1RUH2

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52084
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruh200
2HWC2 4RFT0 1BEV2 1PIV3 1ND2C 1C8M1 1COV1 1VBA2 5DDJ1 1RUD2 4FTBA 5FMOL 1D4M2 1RUC2 5ABJA 3JB4C 1H8TC 4N43B 1V9U1 1ND3A 1A6CA 3VBOC 1RUI2 1ZBE1 1PIV2 2HWD2 4IV1C 2WFF3 4IV1A 2R073 1RUG3 4Q4V2 4Y4YA 1RHI1 1VBD1 1ZBA2 5ABJB 2HWF3 4YVSC 1QJX2 2PLV3 1HQNA 5D8AC 1QQP1 3DPRA 1TME1 2HWB2 4GMP1 1ND3B 1VBB1 3VBOB 4IV1B 2FZ1A 4QPGA 3IDEA 1RUG2 1VRH3 4WM7A 2HWF2 1AYM1 4PDWA 4YVSB 5ACA2 1EAH2 1PGW1 1VBC3 5L7OC 4CDQC 1PGL2 4CDQA 3CJIC 3CJIA 5BNPA 2WZR2 3J8F2 1MEC2 2R061 4GMP0 1B35C 1ASJ3 1MQTA 2R043 3TN92 1HRV3 4RS5C 4RS5A 4CEWC 2WS93 1VBC2 1POV3 5JZGC 4YVWA 5L7OB 2WWSA 2XBO3 4CDQB 1PO22 1GFF2 3CJIB 3JB8A 2X5IC 2X5IA 1NA1A 2DF7A 4GB32 1VAKA 2HWE3 1ASJ2 1B35B 1PVC1 1MQTB 2BFUS 5J96B 1HXS2 2RS52 4Q4X3 4CEYA 1FMD3 4RS5B 2RR13 4CEWB 2WFF1 1IHMA 2R071 2ZTNA 3VBFA 5JZGB 1R082 1AR72 5BNNC 2HWC3 1AYN2 1RUF3 2MEV2 1RUH3 1BEV3 2X5IB 4CDXC 1OPOA 2PLV1 2HWE2 4CDXA 3JBG2 1AR93 5C8CA 1NCRA 1D4M3 1RUC3 4Q4X2 4CEYB 4N53A 2RR12 1RUE2 1TMF2 1VBE2 4CDWC 5BNNB 1VRH1 1F2NA 1RUF2 3M8LA 1RMU2 1RUH2 1RUI3 2HWD3 4CDXB 1PO12 2XPJA 1AR92 2RMU2 1R091 4Q4V3 5ABJC 4IV3A 1ZBA3 3ZFFA 1QJX3 1NOVA 2TBVA 2HWB3 4CDWB 1ND3C 2R041 1RVF2 5J98B 1RUJ3 4CDUC 1BMV1 4CDUA 1HRV1 1W39A 2WS91 2QQPA 4Q4Y3 1FOD3 1FPN2 2XBO1 2RS31 2BFUL 5ACA3 1EAH3 1X36A 1AR61 3DPRC 3ZXAC 4QPIA 1QJY3 2RS11 1CD3G 1RUJ2 1HRI2 5AC92 2WZR3 4CDUB 1FMD1 3J8F3 1MEC3 1BBT3 4QPGC 4RHV3 1AL22 3VBUA 4Q4Y2 1FOD2 4WM7C 1EV12 1AR82 4RQPA 4PDWC 3TN93 2HWC1 1Z7S2 4Q4W2 4EJRA 1BEV1 5FOJB 3DPRB 1QJY2 4QPIB 1VBA1 5BNPC 1RUD1 1PO23 3VBHC 2RM22 1D4M1 1RUC1 3VBHA 1RB8G 1BBT2 4RHV2 2BUKA 4GB33 4QPGB 1MQTC 3JD72 1QJU2 4WM7B 5LK7B 1HXS3 2RS53 4PDWB 5C9AC 5C9AA 1NY72 4NWWA 5A33A 1RUI1 1PIV1 1X33A 2HWD1 4YVWC 3FBMA 1R083 1AR73 5BNPB 3VBHB 4Q4V1 3VDDC 3VDDA 1AYN3 1ZBA1 1CJDA 1NA1C 2MEV3 1R1A2 1QJX1 3JBG3 4FSJA 2HWB1 1OOPA 4AEDA 4CEYC 3VBSA 5C9AB 1C8M2 5A33B 1COV2 5DDJ2 3VBFC 4YVWB 1RUE3 1TMF3 1VBE3 5C4WC 2FZ2A 5C4WA 3NAPC 1RUG1 3NAPA 1VBD3 4NWVA 3VDDB 4WM8C 4WM8A 2HWF1 4JGZA 5A32A 1RMU3 4FTEA 1NA1B 3VBRA 1PO13 5ACA1 4JGYA 1EAH1 1V9U2 5C8CC 2BPA2 2RMU3 1NCRC 2IZWA 1PGL1 1ZBE2 4N53C 2WZR1 2VQ0A 3J8F1 1MEC1 4GH4C 1NCQC 3VBFB 4GH4A 1NCQA 5C4WB 1RHI2 1VBD2 3NAPB 1E57A 1RVF3 4WM8B 3TN91 1QQP2 3VBRB 1TME2 1VBC1 5C8CB 1NCRB 1VBB2 1FPN3 1PO21 4IV3C 1K5MA 3ZFFC 2R063 4N53B 4N43A 4GB31 4GH4B 1NCQB 1ASJ1 1AYM2 1HXS1 2RS51 1AUYA 1HRI3 5AC93 1PGW2 3LOBA 2ZZQA 3HAGA 1ND2A 1POV1 1VB4A 1AL23 1R081 1AR71 1EV13 1K5MB 1AR83 4IV3B 2R062 3ZFFB 1AYN1 1Z7S3 1PVC3 2MEV1 4Q4W3 1H8TA 2HWE1 4QPIC 3JBG1 2RM23 4Q4X1 3VBOA 1ND2B 1SMVA 2RR11 5CFDC 5CFDA 3VBUC 2ZAHA 4Y5Z0 1RUE1 1TMF1 1VBE1 3JD73 1OHFA 1QJU3 4RQPC 4YVSA 1RUF1 1POV0 1PVC2 5D8AA 1RMU1 1RUH1 1H8TB 1PO11 1AR91 2RMU1 1QJZA 3ZFEC 3ZFEA 2WFF2 2R072 1R1A3 5K0UC 5K0UA 5CFDB 3VBUB 3S6PA 1C8NA 2GSYA 4RQPB 1RVF1 2PLV2 1C8M3 5D8AB 1COV3 5DDJ3 5L7OA 1R093 1VB2A 1FPN1 2WLPA 1M06G 3ZFEB 5FMOS 1B35A 5K0UB 4LLFA 1V9U3 1VRH2 1OOPC 1WCDJ 4AEDC 3VBSC 1ZBE3 1RUJ1 1HRI1 1NG0A 5AC91 4CEWA 1DDLA 1R092 5JZGA 5CFCC 5GKAC 1AL21 5CFCA 4Q4Y1 1RHI3 2RS33 1FOD1 3ZFGC 1EV11 3ZFGA 5BNOC 1AR81 5BNOA 4JGZC 3VBRC 1QQP3 1AR63 1Z7S1 1TME3 4JGYC 4BCUA 1HX6A 4GMP3 4Q4W1 2RS13 2R042 1OOPB 1QJY1 1VBB3 4RR3C 4RR3A 4Z92B 4AEDB 1BMV2 3VBSB 2RM21 1HRV2 2GH8A 2WS92 2BBVA 1BBT1 4RHV1 2XBO2 2RS32 5CFCB 5BNNA 3JD71 1QJU1 1AYM3 3ZFGB 5BNOB 4JGZB 5A32B 1F8VA 1AR62 1NY71 1AL0G 2RS12 4JGYB 1VBA3 1RUD3 4RR3B 1K5MC 2Y26A 1FMD2 4FTSA 4SBVA 4N43C 1R1A1 4CDWA
chains in the Genus database with same CATH superfamily
1XPWA 2WFPA 2HWC2 1S0FA 2W1UA 1UCXA 2A70A 3CZJA 3AMMA 1YLLA 2JG8A 5EJ1B 4KGQA 1ND2C 4N9HA 4D7TA 2P1BA 5FY1A 1VBA2 2A71A 1IKQA 2OPWA 1KDMA 5FXWA 3PUIA 5FMOL 4C1XA 2CGNA 5F2SA 1W8OA 4L11A 3BODA 4CCCA 5ABJA 1A34A 1JOPA 4ARYA 4BQ5A 3RVHA 3NNMA 2ZOEB 5BXXA 2ZGNA 5FIXA 5HPOA 4N43B 4UW3A 1BCXA 3HBKA 5C3OA 1ND3A 4XUPA 1SLCA 3M4FA 2CSGA 2LM3A 3LDBA 2VL4A 1UOFA 1D2SA 4K40A 4C1WA 2XLGA 1JZ5A 1H6YA 1L3JA 3RRDA 1DFQA 4IV1C 4A7ZA 4IV1A 3D0SA 1ZNPA 2PYTA 5LA2A 3ASIA 4XEZA 2VZOA 1TQ5A 1SFNA 4AHYA 1RHI1 1ALYA 1ZBA2 5ABJB 4W6XA 1CZSA 2QQVA 5LEJA 3RI9A 1ST8A 2X8KA 3U07A 3DPRA 3MIFA 4NROA 2HWB2 5FAXA 5J1XA 1MS1A 1JYXA 3WNPA 1ND3B 5J48A 3H8RA 5T52A 3VDCA 1VBB1 1DHKB 4QX2A 4KG8A 2ZEZA 5B4NA 2D5HA 1YFUA 2QZ2A 3K3NA 4D69A 1VMJA 5FQ0A 1OQDA 2JDKA 1RJ7A 4MLOA 1S2EA 4IV1B 4UW5A 5F3CA 3RZGA 2DTYA 1OLQA 1E5IA 5A6ZA 1H2KA 3AXEA 2A75A 2O8QA 5JMOA 2H6BA 4YSFA 5C71A 1AYM1 2ETEA 4UI9L 4KQ7A 5FZIA 1CVNA 4HONA 1JOBA 4GAZA 4OI1A 4XFBA 1C5HA 1QJFA 1VBC3 1XXNA 5L7OC 1UU4A 5FZOA 4EWDA 3G6JB 1WW7A 3N9LA 5FPUA 5BNPA 3OD4A 2W0XA 2WZR2 5F3IA 1JOJA 2PHWA 3MF9A 2R061 5JIUA 1ZZ8A 3FFZA 4XOGA 2ZJCA 1ASJ3 3EYPA 2Y6FA 4KNCA 1AF9A 1NYWA 2Z2SB 1HRV3 1RGSA 4PT6A 1UOGA 1VPHA 5T50A 5FZMA 4CEWC 1PM4A 3FC0A 1POV3 3ZDVA 5L7OB 3OF1A 1AXZA 5FZOB 3OJBA 2DCKA 2XBO3 4MGQA 1UMZA 2FDHA 4FP2A 1JXNA 4GXLA 4Y24A 3T1MA 5KXCA 5IK5A 5FPLA 4QGMA 1DQ5A 1UXZA 1WW4A 1NA1A 2DF7A 2E7QA 2QJVA 3IPVB 3P3NA 5GZDA 3WDYA 3IN9A 1TZOA 2DCYA 2QTWB 1OLRA 4LO4B 5FPBA 3ZN4A 4AXOA 1XYOA 4ZS2A 3T08A 2LW8A 3UYJA 2RS52 4Q4X3 4HKWA 4CEYA 2QQUA 2X29A 2K0GA 3ZYFA 5C3RA 1N3OA 5F37A 4DUXA 4KU7A 4XAEA 4CEWB 4FAGA 1UZWA 2EXKA 3KCXA 2R071 2PAMA 1CPNA 1R082 1AR72 1D4VB 2XJRA 2OW4A 4WVVA 4UXAA 4OVEA 1RUF3 2DVGA 2GMEA 2VW1A 1JBCA 2DU1A 5LA9A 4XF9A 4AI0A 2LUWA 2ZZJA 2PLV1 2HWE2 2E6VA 1KXGA 5FY4A 4CDXA 4CDXC 2WDBA 3JBG2 2J22A 3U4XA 3VKLA 4Y4RA 2CU5A 3I2KA 4M0NA 4Y1UA 5E1RA 1DBNA 2ZGTA 1W0PA 4XMAA 3AB0A 4CEYB 2DBNA 1SLTA 1DP0A 2AC1A 2GMMA 4QPWA 5FFOC 4TWTA 5FYTA 2EXJA 1YXWA 4LKFA 4BLJA 1V6LA 4N9IA 4BHPA 3ES1A 1F35A 2EAAA 4D7YA 2E32A 3LA2A 2AUYA 3THPA 4XF4A 1C1FA 3WW2A 1RUH2 1RUI3 2GH2A 1U5XA 3BU0A 5D21A 1WBLA 4XVHA 5EJ3A 3GYDA 5CYYA 4X6RB 4CDXB 1DU3D 3HIFA 4B7EA 4NIIA 1WGPA 1R091 1M4WA 3P3PA 1KDKA 1KS5A 1QWRA 2J1VA 4XF1A 2CTVA 2Y34A 5IFTA 1IOAA 2ET1A 1AJOA 2GNTA 3GBWA 5HCBA 3ZFFA 5JOZA 4ZU4A 2W52A 4AFCA 2XVLA 4QQ2A 4NN0A 4RN5A 1NOVA 2QNKA 2TBVA 5LY2A 3MIBA 4LHNA 3IB3A 4IEWA 1ZM1A 2R041 2GC2A 1SBDA 3E1F1 3OGGA 5FKBA 5DAVA 3U14A 1N1TA 3PMEA 4NIDA 3RPQA 3PIJA 1POQA 4MZUA 2R6QA 2W46A 3R05A 1WUVA 2WS91 4H7LA 2QQPA 4OHYA 2VNRA 1O5LA 4MXVA 1FPN2 4GALA 3CMGA 3ELNA 2Y60A 5JR7B 1BZWA 4L99A 3VD7A 2RS31 1H2LA 2JKXA 1QH7A 2XKPA 1QDCA 4B1LA 3BOWA 3ZSJA 1GOHA 2Q0AA 1T6BX 2E31A 2W92A 5GLTA 3JU9A 4PIXA 1QNWA 1LGBA 3ME2A 4CTEA 4O61A 2YUEA 1OBNA 1S55A 3NNLA 3GBGA 3R4DB 4QQHA 1UZYA 1RYYA 3MUY1 3TRSB 2XWBB 2A7AA 1MEC3 4XIOA 4ZKTB 3H3LA 1AJKA 1SACA 2R1DA 1FOD2 5IVVA 3GXUA 4KWLA 3C7GA 2ZGMA 3PVEA 3LDRA 4RQPA 1F5FA 2HWC1 1HN1A 4YGDA 5HCAA 3W5NA 1LENA 1D0GA 2NLRA 4J6GA 4XBQA 3B9CA 2Q5TA 5GLZA 3SEPA 4XFHA 3J26N 1LESA 3MIHA 1VBA1 1YWKA 1TNFA 1YYNA 5FYUA 2W1SA 1H2MA 4UWDA 1VRBA 3O5SA 3VGIA 4QB2A 4QQPA 3AMHA 2DCTA 4Q0QA 5LCWL 2C1FA 4RHV2 4GB33 1XE7A 2AEZA 4JZRA 4TN7A 5E89A 1U0AA 4B4RA 1CAWB 3HNMA 3JD72 1PNGA 1QJU2 3VDBA 3ST7A 2TUNA 3J7NA 5LA1A 2D40A 3RZKA 4W65A 3RGBA 2E51A 3PDQA 4JRLA 3KWVA 5F2WA 4NWWA 2B46X 4HK8A 3EB7A 2NMOA 3FBMA 1A78A 3GCWA 3HT2A 3FHAA 3N4MA 4IEYA 4I30A 1F15A 1AYN3 4BIFA 4P9IA 1ZBA1 4UFHA 5CKQA 2AH2A 4XFIA 4LHKA 2OX0A 2LROA 1RXFA 1R1A2 4YM1A 2VBDA 2OYZA 4CVUA 2V5DA 5T5OA 1YQ6A 4XACA 2HWB1 2BERA 4AEDA 3VBSA 3WQ0A 2GMPA 2O14A 1LOCA 2WKKA 3I54A 4GWMA 2XOMA 4NRMA 1RUE3 2G4IA 2VE1A 1VBE3 5DZEA 2P4EA 2XQRA 1DG6A 1VBD3 4AFBA 2A6ZA 1Y3TA 4WM8C 4WM8A 3I4IA 1JI6A 5EYXA 1DGWX 4QKFA 4D6SA 2Q8DA 4CE8A 1QIQA 4MGZE 3P6BA 5KHJA 2ADEA 1DGRA 1WMDA 3AZZA 1XQNA 4C8DA 2RMU3 1CAUA 1NCRC 3LEMA 3M3OA 3MIDA 3UGHA 5A70A 4I0AA 2JEMA 5EXOA 2JIGA 4N53C 3QH7A 1I1EA 1DYKA 2WZR1 4AL9A 1VE0A 3GJAA 1HJGA 1WLWA 4RA0A 5JUVA 1QOSA 1NCQC 4OUMA 4GIQA 1NCQA 5FK7A 3WUCA 4CUAA 3OGVA 4XETA 5FP3A 1UXXX 2BNMA 3NO8A 1W99A 1O59A 5A3MA 3UL2A 4UF0B 2Q4SA 4WM8B 1T2XA 1W6MB 4QM8A 2Y6GA 5CB7A 1W28A 5FKCA 2D98A 5L9BA 2NYYA 5FZ3A 1W2AX 2WT0A 1CAUB 1AXYA 1HB2A 1NCRB 3FN9A 5CA6A 1KGYA 4JKMA 4E8CA 1NUKA 1XB9A 1YUDA 4N53B 4OI2A 1SEFA 4K1YA 1GZWA 4KH9A 1HKDA 1LR5A 5FWEA 1NCQB 4E9KA 2XDVA 4LIUA 4YG6A 3BGAA 3IIAA 2RS51 5AC93 4HK9A 5FMCA 5F5QA 3HAGA 4B4QA 2ADDA 3A22A 1QOOA 3R6SA 1W6NA 3LPGA 4NHXA 2JKBA 5C5TA 5IYYA 1WCSA 3VN4A 1R081 1AR71 1XSQA 4CU6A 2Q1ZB 2ZEXA 4NRPA 2FQPA 4QM9A 4PI0A 5HCHA 4G3YC 1H8TA 3VZJA 2HWE1 4XTPA 4QPIC 4Y5SA 3VD9A 3JBG1 5LA0A 3DKQA 2AREA 3PUQA 4LBJA 4HFSA 1UYZA 5C33A 2RM23 2I45A 3ACGA 4P02B 3WP3A 2F17A 3A21A 2CHHA 4LO7A 4UFIA 5FYZA 3GALA 3SCHA 3ZYBA 4FI9A 4BJ0A 1NLSA 1UY0A 2YPJA 2ZGSA 5CFDA 2ZAHA 1W6NB 5CFDC 3SNMA 3U0ZA 5FO9B 2J1UA 1OHFA 3ZYHA 2RJKA 3NL1A 3T0BA 4YVSA 1WLCA 3GJBA 3I2GA 1PVC2 2JG9C 2HEWF 1I9RA 1RUH1 5JCTA 2XG3A 4ZY9A 1H8TB 3L2HA 5L36A 1JU3A 2FBEA 4XMIA 3FHIB 5DG1A 4YZ2A 3GZAA 4AR2A 2JJ6A 3AK0A 1L7RA 3BIEA 3ZFEC 3ZFEA 1UYYA 3LWCA 1JYVA 5FLJA 3NJYA 3PU3A 2R0HA 5DAXA 1U5YA 5CFDB 4LQRA 3S6PA 2GSYA 2DCZA 2ZX2A 3IDCB 1A3KA 4YW5A 3RG0A 4IE0A 2H0VA 4IEPA 1WZXA 4CA9A 1WKYA 2DVBA 5DABA 1C8M3 1KFUL 3S30A 5JXGA 2JG9B 1COV3 2FDFA 2BTVC 3PUHA 4DOUA 1NT0A 4TTGA 5FUNA 2NQYA 3U10A 5C5UA 3D8CA 1XNKA 2ZKLA 4LBMA 1JUHA 2R30A 2YPDA 1FPN1 4HL0A 4OHVA 2HKXA 1PNFA 4PBPA 5FREA 1GKBA 3ZFEB 1W03A 2VOTA 2WZPP 4D8MA 5L9VA 3TEWA 2DDUA 3W58A 4TLGA 1B35A 3UV9A 4FOQA 1K5JA 2ZHNA 4NMIA 1MS5A 4MGSA 4JQRA 1PX3A 4QPYA 5I0TA 4K9SA 3DV8A 1H30A 4CU7A 3T09A 2RHPA 4EYUA 2G9GA 5G04L 1IS3A 4NIAA 2EA7A 5L9RA 2VZPA 3AMPA 2KA3A 5EWSA 1FOD1 2J1RA 4NAMA 4W6YA 3MPBA 3EHKA 4FO9A 4NJ4A 3KQRA 3DYPA 3H0OA 4JGZC 3EO6A 1AVBA 3ZXJA 2G9FA 4AZZA 1QQP3 1XRUA 1AR63 2VNVA 4XE9A 4AHWA 1J3RA 1TME3 2UYBA 4JGYC 3BOPA 1IS5A 2RS13 3AJYA 4RR3C 4BWOA 4RR3A 3TYJA 5FXZA 2Q30A 1S0CA 1HRV2 1OXCA 4RSUA 5FZ1A 2WNVC 3BB6A 4HT1T 2WNVA 2BBVA 3LZZA 2OZ6A 2XUMA 3MIEA 2ZS6B 3RYPA 3WNLA 1W8ZA 5TSWA 5CADA 2VJXA 3FWEA 4RHV1 2XBO2 4FPFA 3I59A 1X8EA 5IVYA 3RZJA 1R64A 3MO4A 3JD71 3WW3A 2PMWB 3ILNA 1QJU1 1UMHA 1FX5A 4A3ZA 2FDGA 4DRVA 4JGZB 1C3HA 1UYXA 2UWAA 4GQ7A 4K1ZA 4B3NA 1F8VA 3KGZA 4JGYB 1O91A 2EIGA 3T4VA 1LOAA 4RR3B 3MYXA 4LBLA 4XJWA 2GDFA 2ZAAA 4AGVA 2PHRA 4AFDA 5JPMB 4ZXEA 1X8MA 4NOTA 2ZGOA 3Q9OA 3B93A 3I2OA 2WNVB 1OVSA 2VOKA 4PF5A 5T5PA 4E2GA 4EQVA 1R1A1 4EWAA 4Y5TA 4LXLA 4CDWA 1AXKA 5FJHA 2V09A 2BGPA 3WDXA 4FPJA 1X7NA 5DN2A 3FMGA 1PIV3 4NO4A 2GNMA 4FQ4A 2OUHA 1CAXB 5FBJA 4F7ZA 4QX3A 5DUWA 3OOXA 4GJZA 1MZ6A 3ENRA 1X9PA 1DGLA 3RNSA 5EZWA 1JZ6A 1SFYA 2RV9A 4X8PA 2YGMA 3H8OA 4DPNA 2FDKA 3D82A 4DUWA 5KC6A 2F6BA 5J09A 3D6EA 1ZZ7A 2EXIA 3T4HB 4DO0A 2W95A 4Z07A 4XUTA 1JHNA 2G9ZA 1RUI2 1YIPA 1SPPA 4XZPA 1WMXA 4DXRA 2AZ5A 4ET7A 2BBAA 1VALA 1OT5A 4YG3A 3GDBA 1RXGA 1ZREA 3OEBA 1CWPA 1RUG3 4QKDA 1ULEA 4E4HA 3TEZA 4HETA 1UY3A 3MV11 3HNBM 3NV3A 4YW1A 3GCXA 3PMSA 5D8AC 4COUA 1G9DA 1S0EA 5DUXA 3ZR5A 4GMP1 2W08A 4BMBA 2WN2A 4ISRA 1F5JA 1UY1A 2QQJA 1DIWA 4IEVA 4MGYE 2VQAA 4NUBA 2B8MA 1SPPB 4XABA 1DLCA 2NM1A 1Q8QA 4QPGA 1K12A 5BNQA 2YY1A 1W8HA 1GNHA 2PFWA 3USUA 4AK3A 1VRH3 4IXLA 4JTNA 4WM7A 4CCKA 2PAKA 5CBLA 5CISA 2HWF2 4Q8LA 4P9JA 2WZEA 2HEVF 1CAVA 3NNJA 1U5ZA 2HYXA 3N7JA 3ZXGA 4CDQC 2P6CA 3H7JA 4CDQA 4OQ9A 3WF4A 3CJIC 3BTZA 1UOJA 3CJIA 2YBKA 3BI3A 5FZFA 1ZRFA 4XJ9A 3U37A 2X10A 4Q0PA 4FXGB 1IKPA 2AR6A 3IDBB 1J59A 1MEC2 4GMP0 3WT3A 5GZFA 2WRAA 5EJZB 3B00A 1MQTA 1W6OA 4XUOA 1MZ5A 4CU8A 4KMQA 4RGKA 1HIXA 3KHCA 5FUIA 1KJRA 3T0AA 1CAVB 2JECA 5KXBA 1W9TA 1X9TA 3FHQA 4CUBA 1SZBA 2J42A 4Y1YA 5JZGC 1W9WA 4LKSA 4XBNA 4X6QB 5FYYA 4CDQB 2WIIB 5BPXA 1TEIA 2P6HA 3TBDA 3CJIB 5JSRA 3JB8A 4XJUA 4AOCA 1DGRN 3WF0A 3RWKX 2VULA 4XTMA 3RDIA 4GB32 1SHWB 3V64A 1JYIA 3MI8A 4Y1XA 1PVC1 5EYYA 1MQTB 3NQHA 4H3WA 1CESA 4QGNA 1G8WA 2QUOA 2X09A 1W6OB 3ACFA 4ITCA 4LR4A 2QKDA 2ERFA 1AHSA 4H7MA 2WNUA 3SHRA 4DINB 1OD5A 1FMD3 4D0QA 4WVZA 1N1YA 1FNYA 2RR13 3JCIA 1J58A 4UW6A 1JYTA 3HNYM 2ZTNA 5JZGB 3MICA 2VY0A 1CZTA 2W2IA 4KU8A 5A7QA 5BNNC 3LEKA 3A23A 2XVKA 4XFCA 1LHUA 1AYN2 2PHXA 2QQIA 3R0RA 3B7MA 4ZXKA 3TAYA 1V6KA 1LOGA 3OGJA 4QHOA 4XJ8A 2WQZC 4V2WA 1AR93 3M2MA 5AFBA 1D4M3 2JD9A 1LODA 2OQ6A 2ZGRA 2D5FA 3M7AA 1PZ8A 3H8XA 2ZPXA 2E33A 2ID4A 3VKFC 3AP7A 1QY4A 2DUPA 4WZFA 1RUE2 4M4PA 2Y6KA 1VBE2 3WDTA 3RSJA 1KS4A 1G9BA 2EALA 2R1BA 1IGOA 1LHVA 4S2HA 5BNNB 1PX4A 3ZXEA 2QQWA 2WQ8A 3P5BA 3VDAA 1GOFA 4FAHA 2JG8C 2VZUA 2ZMLA 4YM0A 1I5PA 3AKSA 2W87A 2O1QA 4I0BA 1M06G 4YW4A 3G7DA 2RMU2 4CCOA 3S0MA 1IPJA 4HKLA 2GNBA 4GZ9A 4B1MA 5ABJC 1CJPA 2CAVA 3C7HA 4HVQA 2P17A 3UKVA 3ROUA 4IGOA 4OUSA 3AVSA 1ZX5A 2CV6A 3AZWA 5JOXA 1D0HA 5EHDA 4PLMA 1J1TA 4NPLA 3KV6A 4P14A 1ND3C 3RMXA 3NKGA 4Y20A 3SMHA 5KC5A 1H9PA 5J98B 2XJPA 3O1UA 1OQ1A 3ZMOA 2Q8CA 2JG8B 4MHRA 1HRV1 3AYDA 4I3GA 5F39A 4E2SA 1UY4A 2C6SA 5FPAA 5C3PA 5FY8A 1O4ZA 3B5LB 3FFQA 2XXZA 3L2YA 4OHZA 4AVCA 3WCRA 5I0RA 4Q4Y3 3HOBA 2XBO1 4K8RB 4RFRB 3AZVA 1V6OA 3OGSA 3U75A 4COZA 3KB5A 1GNZA 4DNYA 1OH3A 2QQLA 4YGEA 3OGRA 2IVJA 1JZ7A 1CQ9A 2VUCA 1EAH3 3DPRC 5I91A 5GZEA 4AEKA 3O1OA 3ZXAC 2R16A 5F3EA 5LY1A 5IJRA 2VR4A 4FPKA 4I0WB 5A3UA 2VECA 4Y20B 4ASKA 2IXHA 3THTA 1RUJ2 5AC92 1QOTA 2WO1A 2YB7A 3E6BA 3GHNA 1HB1A 1LHNA 3NW4A 2DVDA 4FQZA 1G9AA 2JX9A 2VW2A 4H55A 4IGQA 1LNSA 3LSDA 3N7MA 3TN93 5I0DA 5IK4A 3O0VA 3DXUA 3GBFA 2PQQA 3MIGA 5FOBB 4PIYA 4OMDA 5FOJB 2E63A 2ZA9A 3DPRB 4AGGA 1QJY2 3J7LA 1PK6A 3CLPA 2KXLA 1PO23 4HN0A 5BNPC 2RM22 5CIRA 1MS0A 4ES9A 3VHNA 1MVQA 3ZMNA 5FQ0B 3E5QA 4MX3A 1BBT2 2W47A 1W2UA 5C7GA 1PZ9A 1QXJA 3KF3A 4U36A 1CX1A 5HV0A 1UYPA 4I01A 4FPYA 4OQ8A 2DU0A 2D7FA 3NV4A 3LPFA 4BQ4A 2VCBA 1BHGA 5EPAA 5C9AC 5C9AA 2VC9A 5A33A 1LRHA 1RUI1 3PJQA 2ZMKA 1W2NA 3O1PA 3HT1A 1O3QA 1HB4A 4EN8B 4YFWA 1MZEA 5BNPB 5IT6A 1WW6A 3H1YA 5BYNA 2Y6LA 4DRRA 2PN5A 3O1SA 3U1XA 1NA1C 2MEV3 4JAAA 2WLQA 1URXA 1V0AA 1UY2A 3CIHA 4AHXA 3O1MA 1UW8A 4A6OA 1S0DA 5FZGA 3ACIA 2W68A 1E5RA 1OOPA 3WDWA 2WT2A 4CEYC 4GWIA 4QXBA 1W6QA 4NPMA 5C9AB 1Q3EA 1C8M2 3WEZA 5A33B 1COV2 3ZPOA 2WA4A 3M1HA 4NIHA 2B9UA 1RITA 3SC7X 3VD4A 3J7HA 5C4WC 2FZ2A 5C4WA 4EN6B 2OS2A 1NE6A 5DAPA 5DAWA 1SBFA 2HWF1 3U78A 3Q8BA 1W3XA 4FTEA 1RMU3 5FY7A 1NA1B 5FLHA 1US2A 5HCFA 3VBRA 3ZN6A 2JDUA 4JDNA 1H8VA 4J1WA 3I8TA 4UFKA 1ULDA 2NZ9A 1HB3A 3A0NA 2AYHA 3LB9A 1DF0A 5L19A 3ZKUA 5FWJA 4BK4A 3URFA 4C0HA 2VQ0A 2YU2A 4EN7B 1MEC1 3BPSA 4S2DA 3PU8A 4HN1A 2G19A 4FOWA 1MS9A 3AMQA 3POIA 4JRAA 5C4WB 4OI0A 5HXMA 3I3DA 3WNOA 1RVF3 2PA7A 4BA6A 4LHLA 3RI8A 4A7YA 4M00A 4P5YA 1QQP2 2VZRA 3BCWA 3KSCA 3N36A 1IZ3A 3VBRB 1TME2 1NQJA 1O3RA 2Z5WA 1OFSA 1IQAA 1W0NA 4OLLA 1QDOA 4NRQA 3SQOA 4E4DX 1NQDA 5FBZA 5JI7A 5L73A 2ES3A 2J1EA 2JE9A 2VOWA 2R063 2WAAA 4IE4A 2XLFA 3WD5A 3ZFFC 3POFA 4LA2A 1VP6A 4Q2FA 4GB31 2VXRA 3LDKA 3POWA 4XURA 5A6YA 3VZMA 2WAOA 1QH6A 4FXKB 1HRI3 2B9VA 1PGW2 1ULOA 5FJKA 3WF2A 1J3QA 2ZZQA 3W59A 3WG3A 4LO8A 3LOBA 1AX1A 3DGTA 4UYBA 2MHFA 2QQNA 3C3VA 3I3MA 1MPXA 3SCFA 4I3PA 1RUOA 1AR83 1D2QA 1ZVFA 1PMIA 2YYOA 3USSA 2ZHKA 3BYWA 3ZFFB 1AYN1 1H4HA 2VZVA 2XJUA 1Z7S3 3AKPA 1WD3A 3E5XA 5I0UA 3ZYJB 2ARCA 4Q4W3 3NWKA 5DG2A 2B42B 5GLVA 4LKDA 1GQGA 4LTAA 2MPFA 3V0AA 3MFAA 2K46A 2VNGA 4J25A 1GP5A 2JB4A 4AF9A 3KCCA 4CZSA 3T2QA 3VBOA 5FZ6A 4LHSA 4HPKA 5FZHA 1NXD1 3APBA 1SMVA 1TE1B 1V70A 4XFAA 4GWNA 4MH0E 4HVOA 1H1IA 1NZCA 1UAIA 1RUE1 3ABZA 4PQ9A 1VBE1 4COYA 1HN0A 2VPVA 3JQWA 4BPZA 5A6XA 4RQPC 2E26A 3I3QA 1OUSA 3VZNA 5JDBA 4NVPA 4BQ3A 2LS6A 1PMHX 5DUUA 4QX8A 5JSOA 4YNIA 1F9KA 4F8AA 3O1RA 5F5CA 1QNYA 3T2OA 4JDOA 4PBOA 3V0AB 2RMU1 3FZ3A 3FLRA 2RDQA 4ZONA 1WBFA 4ZPIA 5FYMA 4OMCA 1BQPA 1QJZA 1JN2P 1K45A 4LUKA 1Q8VA 1JTZX 1A8MA 4L92A 5A7PA 1ACCA 1OUXA 4DEQA 1V6IA 5K8SA 2DUQA 1V6NA 5J7MA 5KR7A 1C8NA 4LNVA 1Q5OA 3ECQA 4META 4P9WA 1I3HA 5F6KA 5A3WA 1BK1A 5E8AA 4RQPB 2RDSA 1US3A 3POJA 3ZDSA 2DURA 3NJZA 2BGOA 1OURA 5DDJ3 4NE9A 1G9CA 1R093 3M3CA 5KBFA 2UURA 2B39A 1VB2A 4COVA 1ULPA 3PTYA 1GWMA 2HBUA 4LITA 1OMIA 4XIKA 3WX5A 2UWBA 4OULA 4O9EA 1V9U3 3SXWA 1VRH2 4WVWA 2WT1A 3N3HA 2WO7A 2WYSA 4IERA 2GC3A 4AEDC 2A3YA 3VBSC 3KHBA 4TZDA 5DZGA 1ZBE3 1SLIA 3JUUA 4AI9A 1RUJ1 2K9ZA 2B4KA 4YW7A 5JLVA 5AC91 1PVXA 1DDLA 4NIGA 2R32A 2RG4A 3RQ0A 1DYOA 1GU3A 2RS33 3GZTB 3AJZA 3H3UA 3L9JT 3QBQA 4AEMA 4AHZA 4IE7A 1IS4A 1YNAA 4AW7A 1RTVA 4Z8BA 2CAUA 4DUVA 4FPEA 3DKWA 4ATFA 1QJY1 2BNOA 2VM9A 3MEPA 4AEDB 3O7OA 4PLOA 3VBSB 4AI1A 4YARA 2RM21 1Q43A 2WC2A 3POYA 5I0SA 5FZDA 2Q1FA 3THDA 5FPXA 4KWUA 1ULGA 1BBT1 1FV2A 3QLQA 1MR5A 1O4TA 4QXHA 1TG7A 2JICA 3N9QA 1JYNA 5FZ8A 5IVFA 3PUAA 2BZDA 4KG0A 1F4HA 2YFUA 1OQEA 2EF6A 5IATA 2ET7A 3LFIA 2PHDA 3BTYA 1C4RA 2OUJA 1REFA 3WHTA 1VBA3 5APAA 1LULA 3VL8A 4FCAA 4P08A 5F7UA 2QQOA 1MS3A 1FMD2 4JHTA 1OPMA 1CIYA 1YHFA 4UAPA 3ZIXA 2VUJA 2XLAA 3MBWA 4SBVA 4MVTA 1HLCA 1W90A 4OZOA 4D6RA 1XU1A 1V6JA 2XJTA 1WCUA 1S0GA 3RYKA 2JENA 3ZVXA 3EMRA 2YC2A 2RDNA 3NV2A 4Y3OA 1O3TA 5H9RA 2C5DA 1JUIA 5CAZA 4IQPA 5FY9A 3AP5A 2VUDA 3WINE 3M3IA 5JIAA 1C8M1 5HXVA 2VQTA 1COV1 3FE5A 2VXJA 4BQ1A 1RUD2 2NP0A 1GYKA 3CBNA 1D4M2 1DQ1A 5A3OA 2IC1A 3W9AA 1XE0A 5JI9A 3SLIA 4XQWA 3WG1A 1WA4A 5A80A 4XFFA 1S0IA 3WR0A 5JAXA 1F31A 2GU9A 3KM5A 3IT8A 3WQ1A 3LIGA 1H8TC 2ZGLA 1GZWB 1OI6A 3SH4A 5FLIA 5FYSA 4WZCA 1A6CA 1FAYA 2V5YA 1QMJA 1SQ4A 4BISA 3Q8CA 4URAA 4WVMA 3MW2A 4R4ZA 4G4FA 2WFF3 3WG4A 2XL7A 3TB0A 3C2UA 5CG9A 5JPNB 1UWWA 4ISQA 2LRPA 4Y4YA 5LBFA 3UT0A 4YVSC 5EFUA 2IVIB 3FBYA 4BH9A 2VQUA 4QAWA 4QQLA 2JDAA 1QQP1 3POBA 1MS8A 5CZKA 2AACA 1TME1 1RL3A 2Y0OA 4GKXA 4INDA 4D6QA 4P9YA 4D94A 5B2GB 3UNPA 3DYMA 1DZTA 1UD1A 4ZU7A 4IW3A 2YFZA 2D6LX 2P3KA 5I93A 4YRDA 1EP0A 1YCIA 4K3UA 3VZKA 4LEJA 3E6CC 2D3SA 2DBIA 2FZ1A 2LALA 2IUWA 4YYOA 4JX0A 4HBNA 4ONUA 5FK8A 3EXUA 5CU1A 4NHLA 4KBZA 2DYCA 2P3JA 2TNFA 4PDWA 4YVSB 4BLIA 1UX6A 3N9NA 1EAH2 1PGW1 1GQHA 4W50A 3I49A 1W8UA 1XBFA 4WBBA 3WCSA 3E5UA 4YGCA 5IHRA 3F2ZA 4CP1A 1BVP1 3N9OA 2RVAA 3Q8EA 3KZ4C 4P9GA 4QKBA 4FPGA 2WBKA 2XJQA 4Y33A 1H9WA 3AX4A 2BP6A 2YU1A 1VIWB 3CL1A 3WNKA 4GWJA 1B35C 3UGGA 4AVTA 1GZ9A 1SCRA 2I2SA 2X53S 3NMBA 1RINA 1ZYBA 5EQUA 3NKTA 3RFRA 3LSEA 5EV7A 3OBZA 5FMDA 2ZGKA 4M0HA 3TN92 4AVVA 4MGTA 3ZX7A 3UKTA 4RS5C 5SV8A 4RS5A 4CUGA 1VBC2 4L0PA 4YVWA 1L7QA 4PHZA 5KXDA 5DZFA 2WWSA 1PO22 1GFF2 4YGBA 1GQPA 4LBKA 5H9PA 3GGLA 3K4DA 4R9AA 1YIFA 5IW0A 4Z2WA 2A6VA 1W8WA 2X5IC 3D3AA 2X5IA 1I6XA 3AKTA 3UETA 3W5MA 1VAKA 2HWE3 1ASJ2 1B35B 1NLRA 4C90A 1W2OA 5FYBA 4Q26A 3AFGA 1PZ7A 2DFCA 4Q0UA 4Q27A 1GUIA 5LK5A 3IDAA 2ENRA 5J96B 2FMDA 1Y43B 1LOEA 2ZHMA 1JZ8A 3PVNA 3RZZA 4RS5B 2RJ2A 4V1PA 3WF3A 4Q5OA 1IHMA 3VBFA 3N7LA 5K9YA 4B29A 2EIEA 1VR3A 4GKYA 5FP7A 1DCSA 3K48A 2W91A 5FY5A 3N7KA 2C0ZA 2YC4A 3T3YA 2MEV2 4MHUA 3WG2A 1RUH3 1BEV3 1MACA 1YI9A 2X5IB 2ZGUA 4JKKA 4DFSA 1SBEA 2WZ8A 4RYDA 4A3XA 1DYPA 3NSTA 4Z82A 1Q56A 3UGFA 5C8CA 4BK5A 2J1TA 3H8UA 5JOYA 1RUC3 3T30A 4Q4X2 5IVCA 3V65A 3BTXA 4R9BA 3ZOIA 2NPIA 3V0BA 5LRRA 1YQCA 2W39A 1LAJA 2VCCA 2ZKNA 4H2AA 3DCQA 4R9DA 3I59B 4CDWC 1G86A 3JXSA 4IE6A 1VRH1 2R49A 3ZYRA 1AX2A 1RUF2 3JZVA 3I3EA 3M8LA 3B3QE 4ZU5A 4BDVB 1RMU2 3I2IA 3OPZA 5M0TA 5A1LA 5CG8A 2HWD3 2VZ1A 2WQ4A 4FFIA 4NR1A 1W0OA 5FZ0A 1QXPA 1YQ8A 2FCTA 2J1AA 4QB6A 5FO8B 3CKHA 4DB5A 4AEJA 4Q4V3 3C7FA 2YZ4A 4XUNA 3RMYA 1OVPA 1YRZA 1UZZA 4P9LA 5H9QA 4IV3A 3WY6A 2D3PA 3KVBA 4DXZA 2FDIA 3I97A 1UNBA 1QJX3 4YZ3A 3IKWA 4RD7A 4CDWB 1OF3A 1XNCA 4CCDA 4MSVA 3ZYIB 1RVF2 5KHGA 4URTA 4LIVA 1LEDA 4AVBA 2OXBA 3DN7A 2D97A 5E6HA 4AG4A 1YFYA 3MV01 2QBXA 4LJHA 2XONA 3DXTA 3ZYPA 5I8YA 4DY5A 2EXHA 1FOD3 3ITQA 1EPWA 4P5HA 2V73A 1P8JA 3B94A 1PMJX 2JDNA 3N9PA 5A3PA 2A6WA 4HKOA 4PCRA 1SDWA 5ACA3 1S0JA 1X36A 3AZXA 5F5AA 1QJEA 4A4AA 1OA4A 3CZUA 2JXAA 1OA2A 5FP9A 2D3RA 3POGA 4UT5A 1IG0A 5FCCA 1JZ2A 1UKGA 3UK9A 2E7AA 2ZX3A 4AQ2A 4O65A 1HRI2 2UU8A 3T2PA 1FMD1 2JDYA 5FY0A 4BQWA 3J8F3 4QPGC 2VO5A 4RHV3 4N7UA 4XILA 3VBUA 4OYUA 3U11A 3B69A 4WM7C 3VLBB 1AR82 2H6CA 3KV4A 3J7MA 4CYDA 2BQPA 4NAOA 1U12A 1Z7S2 3LF7A 4XF3A 2PHUA 3IMNA 3MFCA 4CP9A 4Q4W2 2W94A 4YM3A 1ZRCA 1ZRRA 1HV1A 1D7PM 1G7YA 4YW3A 1TNRA 1ZZCA 1RUD1 1LJ7A 3O12A 4HSLA 4KL1A 1D4M1 3VBHC 4MUVA 3VBHA 2GN7A 2YGLA 2OQ7A 3WSOA 4D3WA 1RB8G 2WINB 1E5SA 2XL9A 2Y8KA 3DEMA 3Q8FA 1Z78A 4OHWA 4AWDA 2BUKA 4QPGB 5K7PA 3H50A 3K4ZA 1MQTC 1LOFA 3AYCA 4HG6B 3USUB 5AFEA 3LQCA 2ZABA 3VHRA 4WM7B 3TOJA 5LRSA 2QVSB 1HXS3 3MGUA 4FOYA 4HMZA 3INAA 5LWBA 4CP9B 2VUAA 3WV6A 1UMIA 1GZTA 3S7IA 5A7NA 1KD7A 4M01A 4DZGA 4BXFA 2Y6HA 3VBHB 3VDDC 3VDDA 2YC0A 5E88A 4EZHA 3GHMA 1OA3A 3SKVA 1TVGA 2GZWA 1SG3A 2OPKA 3OBRA 4MGIE 1UF2C 3D4KA 2GP5A 4NHKA 4YWAA 1V6MA 4H14A 5I8SA 4QX5A 1YO8A 4Q0SA 4FSJA 3RZHA 1UPIA 4XBLA 2WNUC 1VAMA 4XF0A 2EIDA 1JH5A 2ZX4A 4A41A 3X29B 3CO2A 2VCMA 2V4AA 3GZEA 5DDJ2 3K77A 3O1VA 4BU2A 3SCGA 1TMF3 4A6SA 3OB8A 2PTMA 1W6PA 2QDNA 3NAPC 3NAPA 4PF1A 1UN1A 2WN3A 3VDDB 4CPBD 5JXJA 1QGLA 3QOPA 3T1LA 4DQAA 1W05A 2DWRA 1UO9A 5A32A 2VMHA 3EBRA 3NVCA 2EIBA 1PO13 4YFZA 1EAH1 1V9U2 3WVJA 2BDRA 3C7EA 1UZVA 1SLAA 4JTOA 2WNUB 5FDBA 1ZBE2 2WUHA 2VVFA 3AKRA 3GNEA 5IK7A 4EN9B 3KV9A 2KR2A 4IL7A 2C9AA 4BM8A 3KF5A 1KRIA 4W4ZA 4GH4C 5F32A 4GH4A 4FFFA 2WA3A 1VBD2 3K2OA 1HV0A 3NAPB 1H6XA 1IG3A 2XHKA 5FZCA 2YBPA 3TN91 2YG0A 4LK6A 4FPHA 3WW4A 1LOBA 2VMFA 1WD4A 1CZVA 2GP3A 3I2HA 4LBQD 3T0DA 4OFGA 1ULCA 1VBC1 2KD7A 4AYUA 2IXCA 1H0BA 3AVRA 1OKQA 5A1FA 1S4CA 3IMMA 4E8DA 4XCAA 4FOVA 1PO21 3H1WA 1K5MA 2VW0A 2BU9A 3SEEA 3VL9A 5IVEA 4UFMA 4BIOA 4RGAA 3HBZA 5CKMA 5SV5A 4N43A 5GZCA 4GH4B 1Q8PA 4HANA 1ASJ1 3WNNA 4CXYA 4RL7A 4HSJA 4GD4A 2GC1A 4HZFA 3ILFA 4IUGA 3TNQA 4C0BA 2D43A 1HQLA 1ND2A 3WNMA 3AFKA 1MVEA 1JZ3A 1POV1 3KD4A 3B02A 1AL23 5JSPA 3K3OA 1ENSA 4PJYA 1ZA7A 2AENA 1EV13 1ZRIA 1K5MB 2VMIA 4XYXA 5GLUA 5CVRA 3T2TA 3PVOA 4XXPA 3VZLA 1VLNA 1PVC3 2MEV1 5DQ0A 4W8JA 3BPZA 4QHZA 3H7YA 1FT9A 3OD0A 5A3NA 3H42B 4QX0A 1XYPA 3ETQA 2VZTA 3VB9A 2XVGA 3ATGA 3M3QA 1O6UA 4Q4X1 3OBTA 3OTFA 4AE2A 4EZ4A 2A1XA 4N90A 4BQ2A 4SLIA 2XKOA 2ZACA 5A3LA 1ND2B 3HPNA 2D6MA 2HBTA 2JDPA 4UBHA 3HVDA 2B5HA 4ASLA 5KHIA 2A3XA 2BJSA 2BGCA 2ORZA 2QQMA 3SH5A 4WV8A 2RDRA 4ZS3A 5FO7B 4XFGA 5BV6A 1RUF1 1POV0 1AZDA 1Y7BA 4XHXA 4JCKA 1RMU1 1CONA 3SISA 1T6GC 4QWNA 1PK6C 3OG2A 5A7OA 1LB2A 3PNAA 2B7YA 3H3ZA 5GJ6A 5LASA 2BOIA 2IWGB 5IFPA 3WXPA 1N3QA 2WFF2 3J4UH 5FRAA 1UU5A 1NKGA 2GALA 2JDZA 3LIHA 2D6OX 4L2NA 4Q0VA 3QACA 4IEQA 4L8QA 4CPBA 4QGLA 4IEZA 2UY8A 3AMNA 3MDPA 2CGPA 1RIRA 5IWFA 2CL2A 1UL9A 4BXSV 2W1QA 1XNDA 3AXDA 3DYOA 1RVF1 2RE9A 4Q1RA 1Y9MA 4S2FA 1ZZ9A 4DEVA 1FATA 1JS9A 1UX7A 1GP4A 5L7OA 1G6NA 1GSLA 1OH4A 1PK6B 1XJAA 4P9XA 1O3SA 3HJRA 1IPSA 2VMEA 2XJSA 4QQOA 2B45X 4LE4A 2V72A 2W5FA 1EUUA 3WP6A 4ASMB 5JXHA 4NPRA 1DZQA 1UU6A 1HW5A 4UFLA 4ARXA 1CX4A 2E9QA 3BN6A 5CKNA 3IIIA 3IPVA 2Z42A 1VMFA 2ZCWA 5IAVA 4FPOB 4LLFA 4RGGA 2FD8A 1LCLA 1OOPC 2BW8A 1WCDJ 1ZZBA 3S5AA 4LBQA 4LBOA 4U2AA 2VMGA 2ARAA 5CNAA 5G05L 3A4UA 5ISLA 1NLQA 2IXLA 3PTRB 3ACLA 1HRI1 1CR7A 1BLZA 2FMYA 3WDUA 1KEXA 2C4XA 2BRTA 4CEWA 3IBMA 2NMNA 1VMHA 5LZ6A 5FPVA 4LT5A 2D6PA 4BOWA 1GOGA 5GKAC 5CFCC 5CFCA 1RHI3 5KXEA 4R8HA 1HJFA 4Q1PA 4DXSA 5E16A 5BNOC 2A3WA 1AR81 3VHPA 4EROA 3CF6E 5BNOA 4LO6B 4D7SA 4QD2A 4FPCA 1FNZA 3VBRC 1Z7S1 2ORXA 4YZ4A 4BCUA 4Q4W1 5FYCA 1W9SA 2WSUA 1L7LA 1OOPB 1VBB3 4LBQB 5FPZA 3NNGA 3OSDA 3VD3A 1BMV2 5J36A 3N9MA 4YG0A 1W6QB 2PAEA 3HQUA 2X05A 2GH8A 1HQWA 3O0XA 1WMFA 1O4YA 4YZ1A 2J7MA 4JKLA 4R4XA 1H4GA 2MNGA 1W04A 4FT8A 5F3GA 3BU7A 5CFCB 3UJQA 1AYM3 1BYHA 4R9CA 5FXVA 5BNOB 2CDPA 3H1MA 1SCSA 2WR9A 4AQ6A 1AR62 1OKOA 3ZN6B 1STMA 2OIIA 4QB1A 5B4XA 2H0BA 1AL0G 1O7FA 2RS12 3CHXA 3PVBB 5LATA 3FLPA 3ZSLA 4DMIA 2ARBA 3VKMA 1YEWA 4MO3M 2Y26A 3J9SA 4XDQA 1GMMA 5C6CA 3LCPA 3I2FA 2GN3A 4FTSA 5FZLA 1FXZA 1S0BA 2E53A 3AP6A 3HD8B 5FZ9A 4R52A 3AYAA 2ZBJA 2YMZA 2FCVA 5CEHA 1OSGA 1G9FA 1WA6X 5JOWA 3I2JA 4Y1ZA 2ZGQA 5A7WA 3V56A 2ZEWA 4RFT0 1BEV2 3S57A 1RJ8A 4KWKA 1EUTA 3KT1A 4A42A 4YW6A 3AL6A 5DDJ1 1GLHA 4E4SA 4EN0A 4QDQA 4FTBA 2CWSA 4TLFA 1RUC2 4UFJA 5C3QA 4YLZA 2WNEA 3OUIA 2DV9A 2ZEYA 3H9AA 4QKNA 1JZ4A 1N1VA 3QD6A 1WWYA 3LKJA 4LA3A 3IAQA 4MOAA 3JB4C 3CQOA 2VBPA 4N8MA 3TEXA 5FZEA 3AP9A 4IEUA 3CU7A 3OBAA 2Y6JA 2TEPA 4CRQA 3VUOA 1V9U1 3SKJE 3CJXA 2HLEA 3I2DA 1ODMA 4AVSA 3ACHA 5FZKA 4J1XA 5A7WB 3VBOC 2BWAA 2Y33A 2JE8A 4M4RA 1ZBE1 2WYFA 4LULA 1PIV2 2HWD2 3K4AA 4LKEA 1K42A 4AQTA 2R073 1W8TA 1KITA 3O1TA 4DIQA 3LA3A 2F4PA 1X82A 1R1ZA 1QEXA 2ZX1A 4Q4V2 2A73B 2UYAA 1VBD1 4CCNA 2HWF3 4W6WA 3THCA 1OF4A 1OFNA 2SLIA 4YPJA 1QJX2 2D93A 1DGWA 1HQNA 2PLV3 4FVVA 4QXKA 3PUSA 4I02A 2P3YA 3HMYA 2WO3A 1CIWA 4E27A 4EWEA 1NXMA 1FV3A 3TNPB 3M3EA 3VBOB 1LEMA 4XXAA 2Z79A 4HPKB 3CNAA 2CNAA 1CAWA 3I7DA 3IDEA 3OEAA 1RUG2 5FZ7A 4AQSA 3OCPA 3U4SA 2F4LA 3RWNA 5GALA 2YDEA 4DY3A 4B4PA 2Q1MA 5ACA2 3WZ1A 2BEOA 3PURA 4XJAA 1NAEA 5JXIA 1PGL2 1W9YA 2EVXA 4M3CE 2C26A 4IETA 4XDPA 4QU2A 4N7IA 3MLJA 4IDZA 2VVEA 3FLTA 2PHFA 1N3PA 4EE2A 1SFPA 2PQSA 3ES4A 3J8F2 2GAUA 1H1AA 5EIYB 3OYWA 3RZMA 4PQQA 1W8FA 3FUOA 2I74A 4BMEA 2R043 3C7OA 3HQXA 1FYUA 1REDA 5BY5A 1XNBA 2CDOA 2IXIA 3PHMA 1Q8OA 4JV4A 4O7XA 5H9SA 2WS93 2WL1A 3KS7A 2RJLA 4LOSA 4JDMA 2VVDA 1FI2A 1J83A 2YBSA 3ZPYA 1WMEA 1YQ2A 1F4AA 2WNOA 5LEKA 2BV4A 4ORFA 4CSWA 5JR2A 2W3JA 4K6BA 4QU1A 4DXTA 3OYWB 1Q8SA 2VOVA 2ZMNA 3C8XA 5C8WA 2ZXQA 5FR3A 2WO2A 2BFUS 3ZXFA 1HXS2 1KJLA 3JQXA 1C1LA 4TXWA 4V2VA 2UY9A 3AM2A 3HWJA 1YQ5A 4BB3A 4TYSA 1UIKA 3POEA 1KQRA 2VMDA 2WFF1 2V4VA 1UOBA 3QCWA 4I09A 4L9BA 2BNNA 1W06A 3O0WA 2VGDA 4JQTA 1ENQA 1ULFA 1YJLA 2HWC3 2XB6C 3FX3A 4UF0A 1GV9A 1W6MA 1XNTA 2VMCA 3WQ7A 1OPOA 1W8NA 1JYWA 2I07B 1NCRA 1Y9QA 4GA9A 4XC9A 1S2KA 1GNYA 1OLME 2BVBA 3KMHA 2VAUA 2D6KA 1BJQA 2ILMA 4N53A 2RR12 5F8PA 3QH6A 1LTEA 2R0FA 4XZUG 2VBBA 5IAXA 1TMF2 4UOJA 4CXXA 5A3TA 5A1AA 3ZLIA 1LU1A 4MXWA 5HBAA 5IK8A 2ARXA 1Y9GA 1X50A 1F2NA 4FBFA 1O8PA 5IVJA 1UIJA 3RZLA 1EPZA 4XAAA 3W21A 4Y22A 4QDSA 1PO12 4AFAA 2XPJA 1AR92 3PL0A 2CY6A 2J1SA 1BVVA 4MV2A 4IEOA 2BYVE 2VZ3A 1LU2A 3FUQA 1Z0HA 3NNFA 3KT7A 4M3CF 1ZBA3 5F6LB 1WLDA 2WJSA 2OVUA 2VOXA 4BE3A 4AI3A 4Z1VA 4AAPA 4PI2A 2HWB3 4Z2AA 3WW1A 1GICA 4MXWB 5T54A 2VD7A 1SLBA 5DPNA 4ES8A 1WW5A 1RUJ3 3IAPA 1GBGA 4CDUC 1BXHA 4CDUA 5C3SA 2OZJA 1BMV1 3KVAA 2ATFA 4Y22B 3BKZA 4COWA 1W39A 3E6DA 3HN1A 1E5HA 1APNA 3MPPG 3OUHA 1U5IA 2FDJA 2P34A 2VZSA 4Y26A 3VV1A 3ETPA 2BFUL 2Y0IA 5FMBA 2IFRA 1AR61 2K2SA 1S2BA 3AKQA 2DVAA 1QJY3 4QPIA 2RS11 1CD3G 1NE4A 2ZGPA 1DQ6A 2D44A 3OPWA 4OZXA 1QU0A 4WVMB 2OT7A 2WZR3 4CDUB 1REEA 3MLKA 1YC61 1BBT3 3WP4A 1O5UA 1AL22 4Q4Y2 3P1IA 4ATEA 1QXRA 3ZIWA 4CCMA 1EV12 5ANQA 3PJYA 2PHTA 4PDWC 2VTXJ 3E97A 5T5JA 5A7SA 4GULA 3SITA 2XUEA 4EJRA 2JG9A 1BEV1 4LLOA 5KHKA 4QPIB 3MLLA 1BKZA 4KI5M 2JE7A 1RUC1 3LD8A 4G9SB 3LGRA 1Y4WA 5KHHA 3ZSMA 2DCJA 3ZR6A 4Q8KA 5IUQA 1J1LA 2E7TA 2EICA 4BYYA 3WOGA 5LK7B 2RS53 3MW3A 2VTXA 4PDWB 2BVVA 1NY72 3ZSEA 1PGSA 4C91A 1PIV1 1SLLA 1X33A 2HWD1 4JHZA 4YVWC 4CU9A 1CPMA 4MADA 5FZ4A 4QDRA 5J37A 1R083 1AR73 3ORJA 3B01A 5C70A 4Q4V1 4CXWA 1MS4A 1XOYA 2CWMA 1PHMA 2VCAA 1CJDA 3F95A 3KCYA 5FZAA 1WCQA 5FP8A 2XHNA 1YFWA 1QJX1 4QMAA 3JBG3 2L9LA 3DUIA 3IWZA 4XHBA 2Q8EA 1JU4A 5ERLA 2XQXA 1MZFA 5FYHA 2C24A 2WWJA 4CCEA 1BK0A 1DQ4A 1QHDA 3R4UA 3RJRA 3VKNA 2VH9A 3IZOA 3WQBA 5ANNA 1C57A 1HDKA 2QQKA 4KGGA 4GJYA 1XYNA 3LEGA 3VBFC 4YVWB 4B7KA 5BUVA 3TEYA 3K75B 5FV3A 4OI4A 4LUMA 1N1SA 1RUG1 3BTAA 3UJOA 4NWVA 2VU9A 2VTFA 4LE3A 2JDHA 4A44A 2AEYA 4JGZA 3B9IA 4KWJA 4IE5A 2P37A 4JGYA 5LB6A 3WLUA 1XSRA 5ACA1 5C8CC 2BPA2 2KM2A 1GZCA 4AAXA 3NV1A 2IZWA 1PGL1 2N7GA 4JVAA 2XH6A 2JWPA 1GR3A 5GZGA 2W1WA 2HH9A 2XR4A 1H1MA 4I2OA 3DF0A 3MHZA 3A0KA 4FFGA 3J8F1 4A45A 3VBFB 3ILRA 3PLQA 1RHI2 4K8FA 4K20A 3HR9A 1E57A 3OY8A 2Q8OA 3HEIA 4QXCA 4CUCA 4XQ4A 1CAXA 4UW4A 1YJKA 2ZX0A 5C8CB 5EP9A 3KT4A 1VBB2 4BQYA 1XC6A 1UQXA 1FPN3 4M3CA 5FZBA 3GZUC 1OD3A 4IV3C 4KBBA 5FP4A 4CCJA 4CP2A 3V0BB 5DXDA 5FYVA 2DUOA 1VAVA 1JYCA 2DVFA 3AZYA 2BWCA 3HN3A 4LPLA 2XWJB 3ZSKA 4MG2A 3WDVA 4HLTA 2O8OA 1JHJA 1LECA 1UZ0A 4Y1VA 5JVVA 1SDDB 3ZXLA 1AYM2 2QE3A 2YROA 1QKQA 1HXS1 3OY8B 2WWUA 1AUYA 3Q8AA 4QHBA 2WABA 5D1IA 4NHMA 4XPVA 2NN8A 4IGPA 1J84A 1DLLA 1VB4A 2FCUA 4XJZA 3S5QA 1C5IA 2A5ZA 4PIZA 2P3IA 4HOOA 4K21A 4XQDA 2JB8A 5AVPA 3BUCA 4M3CB 1RC6A 3LFMA 2A6YA 4IV3B 5LBCA 3SH3A 2R062 1WLTA 3ZN5A 5F1RA 5F5IA 3WUDA 1UPSA 4XW3A 4YW2A 3DL3A 3VZOA 1NZIA 4X8NA 2XJVA 5IVBA 1ZRDA 2IXKA 4XDOA 2CGOA 1C28A 4MYEA 3NJVA 4LO5B 4ZZ5A 2JDMA 1DQ2A 1EY2A 3AYEA 5F9TA 3TWIA 1S1AA 1GP6A 2AGSA 4IEXA 5K4LA 2DTWA 2RR11 4JC1A 4OHXA 1JW6A 2OKXA 3VBUC 4Y5Z0 1JODA 2FHRA 2QCSB 1DQ0A 4QT6A 1TMF1 3S7EA 4A7KA 3JD73 3GM8A 5GM0A 5DUVA 1QJU3 3EJKA 4LMFA 2HYKA 3RYRA 3ZXDA 1I5ZA 4FPLA 4CCLA 3LAGA 5HV4A 3POSA 5DMYA 3KV5A 4NHYA 2Z4FA 4F3JA 5D8AA 1KFXL 3ON7A 4K7JA 1PO11 3ZKYA 1RUNA 2JD4A 1AR91 2QDRA 3WF1A 4XUQA 3OUJA 1W3VA 2Y64A 1OC1A 1OLMA 4QX7A 3I3BA 5FUPA 3GF6A 1IPKA 2Z69A 2R072 4F83A 2VZQA 1LHWA 1ENRA 1R1A3 5K0UC 5K0UA 1LOFC 2C9KA 3A7QA 3VBUB 2LTNA 2P2KA 1LGNA 1CN1A 1PM7A 2IXJA 2P5BA 2VNOA 2UWCA 3DECA 4AI8A 4PLNA 3AC0A 1LKNA 2GC0A 3KGLA 4TSVA 5I8TA 4DS0A 3ALQA 3M70A 2PLV2 2A6XA 2PHLA 5D8AB 5LBBA 3OPTA 3O14A 4AGRA 2BOJA 1AX0A 1WCKA 1W9FA 2G1MA 2QFEA 4OUEA 3WHUA 3K46A 1CGPA 2JIJA 4XCBA 2WLPA 3AP4A 4YM2A 3CEWA 5D2AA 3D0JA 1EYBA 5FMOS 4Q29A 4P00B 2OA2A 3R4SA 1VJ2A 4OCTA 5GLWA 4E4ZA 5K0UB 3RJ2X 1IS6A 1LHOA 2PXJA 5JWPA 3MZHA 1ENXA 2SBAA 3BALA 5KWRA 3ZM8A 2YHJA 2PELA 3VD5A 2QZ3A 4S2GA 3RS6A 4YZ5A 5J3UA 4AFMA 2XMLA 3AL5A 3BVCA 3N35A 2HJIA 1NG0A 2EAKA 4ZZ8A 1R092 5FXXA 5JZGA 1K3IA 4MGKE 4AI2A 1H2NA 1AL21 2Y38A 4Q4Y1 5DAQA 3VKOA 4LBNA 1IQDC 3NRUA 3IM0A 2O0OA 1YFXA 3ZFGC 1EV11 3ZFGA 5JMCA 1QF3A 4LOTA 2IFWA 5A6QA 5T55A 5HI0A 4E2QA 3LEIA 1DZRA 2D6NA 1HX6A 4GMP3 1YI7A 4QX1A 5LBEA 1GWLA 2R042 3BIWE 3MF6A 2YXSA 3MW4A 1XE8A 4Z92B 3HQRA 4LORA 5AVAA 4L97A 2DFBA 1A8DA 3KQ4B 3WNXA 4A2UA 2WS92 3D5OA 5FYIA 3CDZB 1J3PA 3ZYGA 1ONAA 5FTTC 4UBGA 3LOIA 3W20A 4LK7A 1XNAA 1ZA4A 4CP0A 4ZHNA 5LW9A 5T5LA 1W6PB 2RS32 5BNNA 2HEYF 4AVAA 3ZFGB 3MUZ1 4BZ4A 3LA7A 1LGCA 4B8EA 2YV8A 2W9XA 5T3NA 1B09A 2VG9A 4IESA 5A32B 2CYFA 1NX9A 3NJXA 1GWKA 2ZHLA 1NY71 3PIGA 3UKNA 3VHOA 4FFHA 1ZZ6A 1N47A 3FL7A 4FP3A 1RUD3 4EV0A 3EQEA 1ODNA 3FJSA 1K5MC 3K51A 1V00A 3LE0A 3ZXKA 3WP5A 3KLSA 2R7EB 1XU2A 3ZO0B 1O8SA 4HVRA 1JMUB 4BQXA 1W2TA 4N43C 4O9GA 2XGXA 3UESA 1UKRA 2WSVA 2GNDA 4HXCA 1GANA
chains in the Genus database with same CATH topology
2WFPA 2HWC2 1S0FA 1UCXA 2A70A 3AMMA 1YLLA 2JG8A 4KGQA 1ND2C 4N9HA 4D7TA 1VBA2 2A71A 1IKQA 1KDMA 4C1XA 5FMOL 2CGNA 4L11A 3BODA 5ABJA 2ZOEB 5BXXA 2ZGNA 4N43B 4UW3A 1BCXA 1ND3A 1SLCA 3M4FA 2LM3A 4K40A 1D2SA 4C1WA 2XLGA 1L3JA 3RRDA 1DFQA 4IV1C 4A7ZA 4IV1A 3D0SA 1ZNPA 2PYTA 3ASIA 4XEZA 1TQ5A 1SFNA 4AHYA 1RHI1 1ALYA 1ZBA2 5ABJB 4W6XA 5LEJA 3RI9A 2X8KA 3U07A 3DPRA 3MIFA 5FAXA 2HWB2 1MS1A 5J48A 1ND3B 5T52A 1VBB1 1DHKB 4KG8A 2D5HA 1YFUA 2QZ2A 4D69A 5FQ0A 1OQDA 1RJ7A 4MLOA 4IV1B 4UW5A 2DTYA 1OLQA 1H2KA 3AXEA 2A75A 2O8QA 2H6BA 4YSFA 1AYM1 2ETEA 4KQ7A 1CVNA 4OI1A 4XFBA 1C5HA 1VBC3 1XXNA 5L7OC 1UU4A 4EWDA 3G6JB 1WW7A 5BNPA 3OD4A 2W0XA 2WZR2 1JOJA 2PHWA 3MF9A 2R061 5JIUA 1ZZ8A 3FFZA 4XOGA 2ZJCA 1ASJ3 4KNCA 1AF9A 1NYWA 2Z2SB 1HRV3 1RGSA 5T50A 4CEWC 3FC0A 1POV3 5L7OB 3OF1A 1AXZA 3OJBA 2DCKA 2XBO3 1UMZA 4FP2A 1JXNA 4GXLA 4Y24A 3T1MA 5KXCA 5IK5A 4QGMA 1DQ5A 5F9TA 1WW4A 1NA1A 2DF7A 2E7QA 2QJVA 3IPVB 3P3NA 5GZDA 3WDYA 3IN9A 4LO4B 2DCYA 3ZN4A 1OLRA 4AXOA 1XYOA 2RS52 4Q4X3 4HKWA 4CEYA 2X29A 2K0GA 1N3OA 4KU7A 4FAGA 4CEWB 3KCXA 2EXKA 2R071 2PAMA 1CPNA 1R082 1AR72 1D4VB 2XJRA 2OW4A 4WVVA 4UXAA 4OVEA 1RUF3 2DVGA 2GMEA 2VW1A 1JBCA 2DU1A 4XF9A 4AI0A 2LUWA 2ZZJA 2PLV1 2HWE2 2E6VA 1KXGA 4CDXA 4CDXC 3JBG2 3U4XA 3VKLA 4M0NA 4Y1UA 5E1RA 1DBNA 2ZGTA 1W0PA 4XMAA 3AB0A 4CEYB 1SLTA 2GMMA 4BLJA 5FFOC 4TWTA 2EXJA 1YXWA 1V6LA 4N9IA 4BHPA 3ES1A 2EAAA 4D7YA 3LA2A 2AUYA 3THPA 4XF4A 1C1FA 3WW2A 1RUH2 1RUI3 2GH2A 1U5XA 1WBLA 5EJ3A 4CDXB 3GYDA 4X6RB 1DU3D 3HIFA 4B7EA 1WGPA 1R091 1M4WA 3P3PA 1KDKA 1KS5A 1QWRA 4XF1A 2CTVA 1IOAA 2ET1A 1AJOA 2GNTA 3GBWA 5HCBA 3ZFFA 5JOZA 4ZU4A 2W52A 4AFCA 2XVLA 4QQ2A 4NN0A 1NOVA 2QNKA 2TBVA 3MIBA 4LHNA 4IEWA 1ZM1A 2R041 2GC2A 1SBDA 3OGGA 1N1TA 3PMEA 3RPQA 4MZUA 2R6QA 3R05A 1WUVA 2WS91 4H7LA 2QQPA 4OHYA 2VNRA 1O5LA 4MXVA 1FPN2 4GALA 3ELNA 5JR7B 1BZWA 4L99A 2RS31 1H2LA 1QH7A 2XKPA 1QDCA 3BOWA 3ZSJA 2Q0AA 5GLTA 3JU9A 4PIXA 1QNWA 1LGBA 3ME2A 4CTEA 2YUEA 1S55A 3GBGA 3R4DB 4QQHA 1UZYA 3TRSB 2XWBB 2A7AA 1MEC3 4XIOA 4ZKTB 1AJKA 1SACA 2R1DA 1FOD2 4KWLA 2ZGMA 3PVEA 4RQPA 1F5FA 2HWC1 4YGDA 5HCAA 1LENA 1D0GA 2NLRA 4J6GA 4XBQA 3B9CA 2Q5TA 5GLZA 4XFHA 3J26N 1LESA 3MIHA 1VBA1 1YWKA 1TNFA 1YYNA 1H2MA 3O5SA 3VGIA 4QQPA 3AMHA 2DCTA 4Q0QA 2C1FA 4RHV2 4GB33 1XE7A 4B4RA 5E89A 1U0AA 1CAWB 3JD72 1PNGA 1QJU2 3ST7A 2TUNA 2D40A 4W65A 2E51A 4JRLA 4NWWA 2B46X 4HK8A 2NMOA 3FBMA 1A78A 3HT2A 3N4MA 4IEYA 4I30A 1AYN3 4BIFA 4P9IA 1ZBA1 2AH2A 4XFIA 4LHKA 4YM1A 1R1A2 2OYZA 5T5OA 2HWB1 4AEDA 3VBSA 3WQ0A 2GMPA 1LOCA 2WKKA 3I54A 4GWMA 1RUE3 2G4IA 5DZEA 1VBE3 1DG6A 1VBD3 4AFBA 2A6ZA 1Y3TA 4WM8C 4WM8A 3I4IA 5EYXA 1DGWX 4MGZE 5KHJA 3AZZA 1DGRA 1WMDA 1XQNA 2RMU3 1CAUA 1NCRC 3M3OA 3MIDA 4I0AA 2JEMA 5EXOA 4N53C 3QH7A 1I1EA 1DYKA 2WZR1 1WLWA 4RA0A 1QOSA 1NCQC 4OUMA 4GIQA 1NCQA 3WUCA 4XETA 2BNMA 3NO8A 5A3MA 3UL2A 2Q4SA 4WM8B 1W6MB 4QM8A 5CB7A 2D98A 2NYYA 2WT0A 1CAUB 1AXYA 1NCRB 5CA6A 1YUDA 4N53B 4OI2A 1SEFA 4K1YA 1GZWA 4KH9A 1HKDA 1LR5A 1NCQB 4E9KA 4YG6A 3IIAA 2RS51 5AC93 4HK9A 5F5QA 3HAGA 4B4QA 3R6SA 1QOOA 1W6NA 2JKBA 1WCSA 3VN4A 1R081 1AR71 2Q1ZB 2FQPA 4QM9A 4G3YC 1H8TA 3VZJA 2HWE1 4XTPA 4QPIC 3JBG1 4LBJA 2AREA 4HFSA 5C33A 2RM23 2I45A 3WP3A 4LO7A 3GALA 3SCHA 2YPJA 1NLSA 2ZGSA 5CFDA 5CFDC 2ZAHA 1W6NB 3SNMA 3U0ZA 5FO9B 1OHFA 2RJKA 3NL1A 4YVSA 1WLCA 1PVC2 2JG9C 2HEWF 1I9RA 1RUH1 5JCTA 2XG3A 5L36A 1H8TB 3L2HA 2FBEA 4XMIA 5DG1A 3FHIB 4YZ2A 3GZAA 2JJ6A 3AK0A 3ZFEC 3ZFEA 3LWCA 5FLJA 2R0HA 1U5YA 5CFDB 3S6PA 2GSYA 2DCZA 2ZX2A 3IDCB 1A3KA 4YW5A 3RG0A 2H0VA 4IEPA 2DVBA 1C8M3 1KFUL 3S30A 2JG9B 1COV3 2BTVC 4DOUA 2NQYA 3U10A 3D8CA 1XNKA 2ZKLA 4LBMA 1JUHA 2R30A 1FPN1 4HL0A 4OHVA 2HKXA 1PNFA 4PBPA 5FREA 1GKBA 3ZFEB 2WZPP 3W58A 1B35A 3UV9A 4FOQA 2ZHNA 1MS5A 4JQRA 4QPYA 5I0TA 4K9SA 3DV8A 1H30A 2RHPA 2G9GA 1IS3A 2EA7A 3AMPA 2KA3A 5EWSA 1FOD1 4W6YA 3MPBA 3EHKA 4FO9A 3KQRA 4JGZC 3H0OA 3EO6A 1AVBA 3ZXJA 2G9FA 1QQP3 1XRUA 1AR63 4AHWA 4XE9A 1J3RA 1TME3 2UYBA 4JGYC 3BOPA 1IS5A 2RS13 3AJYA 4RR3C 4BWOA 4RR3A 3TYJA 2Q30A 1S0CA 1HRV2 4RSUA 2WNVC 3BB6A 4HT1T 2WNVA 2BBVA 3LZZA 2OZ6A 2XUMA 3MIEA 2ZS6B 3RYPA 5TSWA 5CADA 3FWEA 4RHV1 2XBO2 4FPFA 3I59A 1X8EA 3JD71 3WW3A 3ILNA 1QJU1 1FX5A 4DRVA 4JGZB 1C3HA 2UWAA 4GQ7A 4K1ZA 4B3NA 1F8VA 3KGZA 4JGYB 1O91A 2EIGA 1LOAA 4RR3B 3MYXA 4LBLA 4XJWA 2GDFA 2ZAAA 4AGVA 2PHRA 4AFDA 5JPMB 1X8MA 4NOTA 2ZGOA 3Q9OA 3B93A 2WNVB 2VOKA 4PF5A 5T5PA 4E2GA 1R1A1 4EWAA 4CDWA 1AXKA 2V09A 3WDXA 4FPJA 1X7NA 3FMGA 1PIV3 4NO4A 2GNMA 4FQ4A 2OUHA 1CAXB 4F7ZA 5DUWA 1MZ6A 3ENRA 1DGLA 3RNSA 5EZWA 1SFYA 4X8PA 2YGMA 4DPNA 3D82A 5KC6A 2F6BA 5J09A 3D6EA 1ZZ7A 2EXIA 4Z07A 1JHNA 4XZPA 1RUI2 1YIPA 2AZ5A 1VALA 4YG3A 1ZREA 1RUG3 1ULEA 4HETA 3NV3A 4YW1A 3PMSA 5D8AC 4COUA 1G9DA 1S0EA 5DUXA 4GMP1 2W08A 4BMBA 4ISRA 1F5JA 1DIWA 4IEVA 4MGYE 2VQAA 2B8MA 2NM1A 1Q8QA 4QPGA 5BNQA 2YY1A 2PFWA 1GNHA 3USUA 4AK3A 1VRH3 4IXLA 4JTNA 4WM7A 5CBLA 2PAKA 2HWF2 4Q8LA 4P9JA 2HEVF 1CAVA 1U5ZA 3N7JA 3ZXGA 4CDQC 3H7JA 4CDQA 3CJIC 3CJIA 1ZRFA 4XJ9A 4Q0PA 4FXGB 1IKPA 2AR6A 3IDBB 1J59A 1MEC2 4GMP0 3WT3A 5GZFA 3B00A 1MQTA 1W6OA 1MZ5A 1HIXA 1KJRA 1CAVB 2JECA 5KXBA 4Y1YA 5JZGC 4XBNA 4X6QB 4CDQB 2WIIB 5BPXA 1TEIA 3TBDA 3CJIB 5JSRA 3JB8A 4XJUA 1DGRN 2VULA 4XTMA 3RDIA 4GB32 3V64A 1JYIA 3MI8A 4Y1XA 1PVC1 5EYYA 1MQTB 4QGNA 4H3WA 1CESA 1G8WA 2QUOA 4ITCA 1W6OB 4LR4A 2QKDA 2ERFA 1AHSA 4H7MA 2WNUA 3SHRA 4DINB 1OD5A 1FMD3 4WVZA 1N1YA 1FNYA 2RR13 3JCIA 1J58A 4UW6A 2ZTNA 5JZGB 3MICA 2VY0A 4KU8A 5BNNC 2XVKA 4XFCA 1LHUA 1AYN2 2PHXA 3R0RA 3B7MA 4ZXKA 3TAYA 1V6KA 1LOGA 3OGJA 4XJ8A 2WQZC 1AR93 3M2MA 5AFBA 1D4M3 1LODA 2ZGRA 3M7AA 2D5FA 1PZ8A 2ZPXA 3VKFC 3AP7A 1QY4A 2DUPA 4WZFA 1RUE2 1VBE2 3WDTA 3RSJA 1KS4A 1G9BA 2EALA 2R1BA 1IGOA 1LHVA 4S2HA 5BNNB 3ZXEA 4FAHA 2JG8C 2ZMLA 4YM0A 3AKSA 2O1QA 4I0BA 4YW4A 3G7DA 2RMU2 3S0MA 1IPJA 4HKLA 2GNBA 5ABJC 1CJPA 2CAVA 4HVQA 2P17A 3UKVA 3ROUA 4OUSA 1ZX5A 2CV6A 3AZWA 5JOXA 1D0HA 4PLMA 1J1TA 4P14A 1ND3C 3RMXA 3NKGA 4Y20A 3SMHA 5KC5A 1H9PA 5J98B 2XJPA 1OQ1A 3ZMOA 2JG8B 1HRV1 3AYDA 4I3GA 4E2SA 4AVCA 1O4ZA 3B5LB 3FFQA 4OHZA 3L2YA 3WCRA 5I0RA 4Q4Y3 2XBO1 3AZVA 1V6OA 4COZA 4DNYA 3KB5A 1GNZA 4YGEA 1CQ9A 1EAH3 3DPRC 5I91A 5GZEA 4AEKA 3ZXAC 2R16A 4FPKA 4I0WB 2VECA 4Y20B 2IXHA 3THTA 1RUJ2 5AC92 1QOTA 3E6BA 3GHNA 1LHNA 3NW4A 2DVDA 4FQZA 1G9AA 2JX9A 2VW2A 4H55A 3LSDA 3N7MA 3TN93 5IK4A 3O0VA 3GBFA 3MIGA 2PQQA 5FOBB 4PIYA 5FOJB 2E63A 2ZA9A 3DPRB 4AGGA 1QJY2 1PK6A 3CLPA 2KXLA 1PO23 4HN0A 5BNPC 2RM22 5CIRA 1MS0A 4ES9A 3VHNA 1MVQA 3ZMNA 5FQ0B 3E5QA 4MX3A 1BBT2 1W2UA 1PZ9A 1QXJA 4U36A 4I01A 4FPYA 2DU0A 2D7FA 3NV4A 5C9AC 5C9AA 5A33A 1LRHA 1RUI1 3PJQA 2ZMKA 1O3QA 3HT1A 4EN8B 4YFWA 1MZEA 5BNPB 5IT6A 1WW6A 3H1YA 5BYNA 4DRRA 2PN5A 1NA1C 2MEV3 4JAAA 2WLQA 1URXA 4AHXA 1UW8A 1S0DA 2W68A 1OOPA 3WDWA 2WT2A 4CEYC 1W6QA 5C9AB 1Q3EA 1C8M2 5A33B 1COV2 2WA4A 3M1HA 2B9UA 1RITA 5C4WC 2FZ2A 5C4WA 4EN6B 1NE6A 1SBFA 2HWF1 4FTEA 1RMU3 1NA1B 5FLHA 5HCFA 3ZN6A 3VBRA 4JDNA 1H8VA 4J1WA 3I8TA 1ULDA 2NZ9A 3LB9A 3A0NA 2AYHA 5L19A 1DF0A 3URFA 4C0HA 2VQ0A 4EN7B 1MEC1 4S2DA 4HN1A 4FOWA 1MS9A 3AMQA 4JRAA 5C4WB 4OI0A 1RVF3 2PA7A 4BA6A 4LHLA 3RI8A 4A7YA 4M00A 1QQP2 3BCWA 3KSCA 1O3RA 3N36A 1IZ3A 3VBRB 1TME2 1NQJA 2Z5WA 1OFSA 1IQAA 4OLLA 1QDOA 4E4DX 1NQDA 5FBZA 5JI7A 5L73A 2ES3A 2JE9A 2VOWA 3ZFFC 2R063 3WD5A 2XLFA 4LA2A 1VP6A 4Q2FA 4GB31 2VXRA 3POWA 3VZMA 1QH6A 4FXKB 1HRI3 1PGW2 3LOBA 1J3QA 2ZZQA 3W59A 3WG3A 4LO8A 1AX1A 3DGTA 2MHFA 3C3VA 3SCFA 4I3PA 1RUOA 1AR83 1D2QA 1ZVFA 1PMIA 2YYOA 3USSA 2ZHKA 3ZFFB 1AYN1 1H4HA 2XJUA 1Z7S3 3AKPA 1WD3A 3E5XA 5I0UA 3ZYJB 4Q4W3 3NWKA 5DG2A 2B42B 5GLVA 1GQGA 4LTAA 2MPFA 3V0AA 3MFAA 2VNGA 4AF9A 3KCCA 4CZSA 3VBOA 4HPKA 1NXD1 3APBA 1SMVA 1TE1B 1V70A 4XFAA 4GWNA 4MH0E 4HVOA 1H1IA 1NZCA 1UAIA 1RUE1 4PQ9A 1VBE1 4COYA 2VPVA 3JQWA 4BPZA 4RQPC 3VZNA 5JDBA 4NVPA 5DUUA 5JSOA 4YNIA 1F9KA 4F8AA 1QNYA 4JDOA 4PBOA 3V0AB 2RMU1 3FZ3A 3FLRA 1WBFA 1BQPA 1QJZA 1JN2P 4LUKA 1Q8VA 1JTZX 1A8MA 4L92A 1V6IA 5K8SA 2DUQA 1V6NA 5J7MA 1C8NA 4LNVA 1Q5OA 3ECQA 4META 4P9WA 1I3HA 5F6KA 1BK1A 5E8AA 4RQPB 3ZDSA 2DURA 3NJZA 5DDJ3 1G9CA 1R093 3M3CA 5KBFA 2UURA 2B39A 1VB2A 4COVA 3PTYA 4XIKA 1OMIA 3WX5A 2UWBA 4OULA 4O9EA 1V9U3 3SXWA 1VRH2 4WVWA 2WT1A 3N3HA 4IERA 2GC3A 4AEDC 2A3YA 3VBSC 4TZDA 5DZGA 1ZBE3 1SLIA 3JUUA 1RUJ1 2K9ZA 5JLVA 5AC91 1PVXA 1DDLA 2R32A 3RQ0A 2RS33 3GZTB 3AJZA 3H3UA 3L9JT 3QBQA 4AEMA 4AHZA 1IS4A 1YNAA 4AW7A 1RTVA 4Z8BA 2CAUA 4FPEA 3DKWA 4ATFA 1QJY1 2BNOA 3MEPA 4AEDB 3O7OA 4PLOA 3VBSB 4AI1A 4YARA 2RM21 1Q43A 2WC2A 3POYA 5I0SA 5FPXA 1ULGA 1BBT1 1FV2A 3QLQA 1MR5A 1O4TA 2JICA 4KG0A 1OQEA 2EF6A 2ET7A 2PHDA 1C4RA 2OUJA 1REFA 3WHTA 1VBA3 1LULA 3VL8A 4FCAA 1MS3A 1FMD2 1OPMA 1YHFA 3ZIXA 2VUJA 2XLAA 4SBVA 4MVTA 1HLCA 1XU1A 1V6JA 2XJTA 1S0GA 3RYKA 2JENA 3ZVXA 1O3TA 3NV2A 5H9RA 2C5DA 1JUIA 5CAZA 4IQPA 3AP5A 3WINE 3M3IA 5JIAA 1C8M1 5HXVA 1COV1 3FE5A 4BQ1A 1RUD2 2NP0A 1GYKA 1D4M2 1DQ1A 2IC1A 3W9AA 5JI9A 3SLIA 4XQWA 3WG1A 1WA4A 4XFFA 1S0IA 3WR0A 5JAXA 1F31A 2GU9A 3KM5A 3IT8A 3WQ1A 1H8TC 2ZGLA 1GZWB 1OI6A 3SH4A 5FLIA 4WZCA 1A6CA 1FAYA 2V5YA 1QMJA 1SQ4A 4WVMA 3MW2A 4R4ZA 4G4FA 2WFF3 3WG4A 2XL7A 3TB0A 3C2UA 5CG9A 5JPNB 4ISQA 4Y4YA 4YVSC 5EFUA 3FBYA 4BH9A 4QQLA 1QQP1 1MS8A 1TME1 1RL3A 2Y0OA 4GKXA 4INDA 5B2GB 4P9YA 4D94A 1DZTA 1UD1A 4ZU7A 2D6LX 2P3KA 5I93A 4YRDA 1EP0A 1YCIA 4K3UA 3VZKA 4LEJA 3E6CC 2D3SA 2FZ1A 2LALA 4YYOA 4HBNA 4ONUA 3EXUA 5CU1A 4NHLA 2DYCA 2P3JA 2TNFA 4PDWA 4YVSB 4BLIA 1UX6A 1EAH2 1PGW1 1GQHA 4WBBA 3WCSA 3E5UA 4YGCA 4CP1A 1BVP1 3KZ4C 4P9GA 4FPGA 2XJQA 1H9WA 3AX4A 1VIWB 3CL1A 1B35C 4AVTA 1GZ9A 1SCRA 2I2SA 2X53S 1RINA 1ZYBA 3NKTA 3LSEA 5EV7A 2ZGKA 4M0HA 3TN92 4AVVA 3ZX7A 3UKTA 4RS5C 5SV8A 4RS5A 1VBC2 4YVWA 5KXDA 5DZFA 2WWSA 1PO22 1GFF2 4YGBA 4LBKA 5H9PA 4R9AA 1YIFA 4Z2WA 2A6VA 2X5IC 2X5IA 1I6XA 3AKTA 1VAKA 2HWE3 1ASJ2 1B35B 1NLRA 4C90A 4Q26A 3AFGA 1PZ7A 2DFCA 4Q0UA 4Q27A 5LK5A 2ENRA 5J96B 2FMDA 1Y43B 1LOEA 2ZHMA 3PVNA 3RZZA 4RS5B 4V1PA 1IHMA 3VBFA 3N7LA 5K9YA 4B29A 1VR3A 4GKYA 3K48A 3N7KA 2C0ZA 2MEV2 3WG2A 1RUH3 1BEV3 1MACA 1YI9A 2X5IB 2ZGUA 4DFSA 1SBEA 4A3XA 1DYPA 3NSTA 4Z82A 1Q56A 5C8CA 5JOYA 3H8UA 1RUC3 4Q4X2 3V65A 4R9BA 2NPIA 3V0BA 5LRRA 2W39A 4R9DA 2ZKNA 3I59B 4CDWC 1G86A 1VRH1 2R49A 3ZYRA 1AX2A 1RUF2 3JZVA 4ZU5A 3M8LA 3B3QE 1RMU2 3OPZA 5CG8A 2HWD3 2WQ4A 4NR1A 1W0OA 1QXPA 5FO8B 4DB5A 4AEJA 4Q4V3 2YZ4A 3RMYA 4P9LA 1YRZA 1UZZA 5H9QA 4IV3A 3WY6A 2D3PA 4DXZA 1QJX3 4YZ3A 3IKWA 4RD7A 4CDWB 1XNCA 4MSVA 3ZYIB