1RUH2

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52084
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruh200
1R1A1 2VQ0A 4JGZB 2HWD3 2WZR3 1EAH2 2WS91 3VBHC 1FOD2 3ZFGA 5D8AC 1HRI2 4YVWB 2RS11 4Q4Y2 1FMD2 3S6PA 4RQPC 5K0UC 3VBRA 4WM7A 1RUJ1 1TME2 4QPIA 4Q4W3 2R061 5FOJB 2WZR2 5CFDA 4GH4C 4Y5Z0 1RUD1 2HWF1 4JGYC 4CEYA 1QJY3 5C8CA 1NCRA 1HX6A 5BNPA 1K5MC 1RUI3 2DF7A 1PGL2 1NA1C 3VBSB 1FPN3 1ZBA1 1VBB1 2FZ1A 4Z92B 1ZBE2 1H8TB 1CD3G 5CFCB 4RR3C 5ABJC 1VBD1 4CDXC 4N53B 2MEV1 1AR61 1RUC2 3TN91 1AR73 1AR83 1POV0 1VRH1 3CJIB 3JBG3 5C4WB 4YVSA 1NCQC 3VBOB 1ND2B 5A32B 3VDDC 3DPRA 1R083 4Q4X3 1VBC1 2RR11 5DDJ3 1PIV2 1BMV2 4EJRA 2R041 1AL21 4Q4V3 3VBUC 3NAPA 1PGW2 1BEV1 1AR82 1NOVA 4WM8B 1VB4A 2HWB2 4PDWC 2X5IB 4N43C 3ZFEB 5FMOL 2RMU1 5L7OA 1AR93 5AC91 1BBT3 1AYM1 4FTSA 1COV3 1MEC3 1QJU1 3JD73 4Q4V2 2GSYA 5ACA3 1HRV2 1NG0A 4LLFA 4RHV1 3J8F3 4NWWA 1RHI1 1ND3C 1RVF3 1AR92 1SMVA 1FOD1 4RS5C 1BBT2 5JZGC 4FSJA 1COV2 1AYN3 5BNOB 1B35B 1OOPA 1TME1 2RS53 2RS32 2HWD1 1ASJ3 2WZR1 1RVF2 1GFF2 4CDUC 1M06G 3ZFFB 1QQP3 4CDWA 1R092 4IV1B 1EAH3 4QPGA 5C9AB 1HRI3 1AYN2 1PGL1 4FTEA 4Q4Y3 1FMD3 5BNNB 2RS52 3VBFB 2TBVA 4JGZA 4AEDC 4Q4W1 2XBO2 1QJX2 1ASJ2 4CDQB 1NY72 4CEWB 1QQP2 4YVWA 1MQTC 1QJY1 1Z7S2 1DDLA 1RUI1 3ZXAC 2PLV2 2HWC3 3FBMA 1QJZA 1FPN1 1C8NA 1RUH2 3ZFGC 5A33B 1RMU2 1HXS3 3VBHB 1V9U2 1TMF2 3VBRC 1ZBE3 5D8AB 4WM7C 1AR71 3VBSA 4RQPB 1PGW1 5K0UB 1AR81 4QPIC 3JBG1 1RUC3 2HWC2 2WFF1 2BFUL 5FMOS 5CFDC 1H8TA 1R081 4Q4X1 5CFCA 2R072 2Y26A 3M8LA 4CEYC 5DDJ1 1HXS2 4N53A 4GH4B 5C8CC 1NCRC 1PO21 5BNPC 4JGYB 1PIV3 4Q4V1 2RM22 3CJIA 2QQPA 5C4WA 3VBOA 1ND2A 1K5MB 5A32A 4GB32 1NA1B 1PO11 2RS13 2HWB3 1RUG2 1BBT1 1D4M2 1VBE2 1MEC1 3JD71 4GMP3 4RR3B 5ABJB 4CDXB 4WM8A 5ACA1 1C8M1 4YVSC 2X5IA 2WS92 3ZFEA 1AUYA 3DPRC 3J8F1 1RUF3 1VBA1 2HWF3 1HRV3 1NCQB 3JB4C 1RVF1 2RS12 3VDDB 2HWE1 3NAPC 2R062 1AYN1 1ZBA3 2RS51 1OPOA 1VB2A 3VBUB 1RUF2 1RUD2 2HWF2 5L7OC 2RS33 4PDWB 4N43B 2WWSA 1QQP1 1RUE3 1EAH1 3JB8A 5BNOA 1B35A 1R093 4RFT0 1HRI1 4Q4Y1 1FMD1 1ZBA2 3IDEA 1VBC3 3ZFFA 1VBD2 2XBO3 2XPJA 1A6CA 4IV1A 1QJX3 1RUE2 1ND3B 1AR62 5C9AA 1VRH2 4RS5B 4IV3C 5JZGB 5BNNA 2BPA2 3VBFA 1OOPC 1Z7S3 2BUKA 5GKAC 2BFUS 2HWC1 1VBC2 4CDQA 2WLPA 4CEWA 2PLV3 4GMP0 2BBVA 1HQNA 4CDWC 2ZAHA 2R042 4CDUB 1HXS1 1RUH3 4QPGC 1BEV2 4IV3B 1ZBE1 4NWVA 1PVC3 1RMU3 1V9U3 1TMF3 4JGZC 2RMU2 1RUC1 1POV3 1AYM2 5A33A 4AEDB 4YVWC 3VBHA 4Y4YA 5D8AA 2R073 1PVC2 1MQTB 1PIV1 4RQPA 5K0UA 1BMV1 4RHV2 1RHI2 1OHFA 2RM23 4GB33 2HWB1 1EV13 4GH4A 5J96B 4JGYA 3ZFGB 4GMP1 1RUG3 1D4M3 3VBSC 1E57A 1K5MA 3VBRB 1VBE3 1WCDJ 1NA1A 2HWD2 4WM7B 1VAKA 1R1A3 4QPIB 1H8TC 1RUF1 5CFCC 1HRV1 1X33A 1IHMA 2WS93 1EV12 4N53C 5CFDB 3HAGA 4RR3A 5ABJA 1AR91 4CEYB 4CDXA 3CJIC 4Q4W2 5C4WC 2ZTNA 5C8CB 1NCRB 3VBOC 1ND2C 1RUJ3 1COV1 5BNPB 1F2NA 1R1A2 2R063 1NCQA 1QJY2 2RS31 3VDDA 1RUD3 1RUE1 1RUI2 2FZ2A 5LK7B 1R091 2WFF3 4WM8C 1FPN2 1RUJ2 3VBUA 2X5IC 3ZFEC 4YVSB 4PDWA 4N43A 1VBB3 1PO23 3DPRB 2XBO1 1QJX1 1ASJ1 1NY71 1AR72 1VBD3 2MEV3 1AR63 3JBG2 3TN93 2WFF2 1Z7S1 1VRH3 1R082 1X36A 4Q4X2 1PO13 3NAPB 1W39A 5DDJ2 1VBB2 2PLV1 1ND3A 1PO22 2RR13 3LOBA 5L7OB 4RS5A 1RUH1 5JZGA 5BNOC 4SBVA 1B35C 1C8M3 2MEV2 2R043 1PVC1 1AL23 3TN92 1RMU1 1AL0G 1BEV3 1V9U1 1VBA3 1TMF1 1PO12 1POV1 4BCUA 3ZFFC 2RMU3 4CDUA 2RR12 1MEC2 2HWE3 3JD72 4IV1C 5AC93 4IV3A 1AYM3 5C9AC 2R071 5J98B 1C8M2 1QJU3 5ACA2 5BNNC 1AL22 3VBFC 3J8F2 2IZWA 1VBA2 2ZZQA 4CDQC 1OOPB 2RM21 4RHV3 4AEDA 1CJDA 1RHI3 4CEWC 1F8VA 4GB31 2HWE2 5AC92 1FOD3 1EV11 1MQTA 4CDWB 1QJU2 4FTBA 2GH8A 1RUG1 1D4M1 4QPGB 1VBE1 1TME3 1RB8G
chains in the Genus database with same CATH superfamily
3AKQA 5FV3A 1NQDA 3R4SA 2BW8A 4JAAA 4WVMB 5KHHA 3Q8AA 1DFQA 2YY1A 5KWRA 1Q43A 1HRI2 4LBQA 3BPSA 2JDNA 1FMD2 2TEPA 2W1WA 4QX2A 4RQPC 5K0UC 4BWOA 1ZYBA 4WM7A 1Q8SA 4BXFA 5C5TA 2XHNA 2E26A 4KWJA 2RJKA 3B9IA 1WCSA 2WN3A 4D94A 4Q4W3 3O1PA 2VNGA 4PIXA 2Q8EA 3WDUA 1JU4A 2I74A 1QOTA 2K46A 2WZR2 3I59A 3I4IA 5CFDA 1VR3A 4DRRA 1LHVA 3K51A 2ZEZA 3NKTA 2UWCA 3SQOA 3T30A 1AX1A 3T4VA 3M3CA 1VP6A 1SBFA 3WEZA 3NJVA 4BLIA 2VZ3A 4QM8A 3V0AA 1SLTA 2ATFA 1JYNA 4LHKA 3PVOA 5FOBB 4ASMB 2WKKA 4IQPA 1RITA 1D0HA 4Q29A 1BCXA 5F7UA 1ZBA1 1AX0A 2QQNA 5EHDA 4C0BA 2FZ1A 4X8NA 4BLJA 5JSOA 1O4YA 5D2AA 1VMJA 1J83A 3R05A 3THDA 4XFBA 1WGPA 4RR3C 4MGQA 2ZX2A 4URTA 3SH3A 5ABJC 4DUWA 3U78A 4CDXC 1H4HA 1JS9A 1SBEA 4N53B 2MEV1 4PQQA 1AXYA 3PURA 4XETA 2EIGA 1AR73 3N36A 4BA6A 1X7NA 4N7IA 5LZ6A 2WNVC 2YFZA 3MYXA 2XL7A 5C4WB 3OEAA 1NCQC 3WNPA 1ND2B 3IAQA 4MHUA 3VDDC 2RE9A 4Q4X3 1XSRA 2W08A 2VCAA 1VBC1 3PJYA 2RR11 5H9RA 2X10A 2JD4A 1UMZA 1A3KA 3H0OA 4IEPA 5KR7A 4PF1A 3T1MA 1O6UA 2R041 4IEUA 1NZCA 1AL21 3O1OA 4MXVA 3VD4A 2HEWF 4UAPA 5HXMA 3NAPA 2VUCA 2VCBA 2Q0AA 2R1BA 1S0BA 5EXOA 3AMPA 1VB4A 1FATA 4LBLA 4PDWC 2DVDA 4NRQA 2GMEA 3UGHA 4F7ZA 3WW3A 3N7KA 4Q27A 4R9DA 2MNGA 4GALA 2WABA 3S5AA 2IXHA 5L7OA 4R9CA 5FQ0B 4EN6B 3WG2A 2A70A 1AZDA 1FV2A 2JICA 1IPSA 4M3CE 1MEC3 2PAKA 3T1LA 3T3YA 3CEWA 3OGSA 4O61A 3OB8A 1POQA 4LLOA 1O3RA 3BTZA 2SBAA 3B01A 1D2QA 4X6QB 2BWAA 3OGVA 3LA7A 4COZA 5GALA 3W58A 3J8F3 1RHI1 2P5BA 5APAA 1ND3C 2HLEA 2ORXA 4K40A 2A5ZA 1AJOA 2ARCA 1DGWX 1BBT2 5GLUA 4ET7A 5JZGC 4M3CA 1JU3A 1Q8OA 4GQ7A 1PM4A 4OI2A 3VDAA 1OD5A 3AMMA 3MUY1 4HT1T 1B35B 5DUWA 4B4PA 4KL1A 5FTTC 4E8CA 4Y26A 3I3DA 1D2SA 4XJ8A 4YM1A 4YLZA 3V64A 3LB9A 3V0AB 1CZTA 2ZMLA 2SLIA 4AEKA 1DYOA 4CDUC 1RVF2 4H7LA 1CJPA 2F4LA 3SCHA 1M4WA 1DGRN 2D97A 3LDBA 4DXRA 4XJUA 2WO3A 5I0RA 2J1SA 2BNOA 2ZAAA 4QPGA 4YGCA 3SITA 3VZMA 4AFMA 3USUB 2W1UA 2CV6A 4Y3OA 1HV0A 1ZX5A 2N7GA 3WF2A 4K20A 5BNNB 4QX5A 2WC2A 4HL0A 4Q1RA 3K77A 3VBFB 1QJX2 1URXA 2H6CA 3WP4A 3BVCA 3OD0A 1KQRA 2JE8A 3O1SA 4YVWA 4AAPA 3THTA 4MXWB 3CKHA 2VOKA 1QJY1 2VOVA 4LK7A 4QXBA 3SEEA 2VZQA 1Z7S2 2VZOA 1QXJA 1ZA7A 3ZSEA 3B00A 4UW3A 4LO4B 1NE6A 4ZY9A 4XFCA 3UKVA 2ZMKA 2CGNA 3D4KA 1JYWA 2OZ6A 5HV0A 3SLIA 2BU9A 1G9BA 3KS7A 4DY3A 1CPMA 1C8NA 5EZWA 3ZOIA 2VXRA 2XONA 1RUH2 2OYZA 1SFPA 1OF4A 2Q4SA 3ZFGC 4KNCA 3OUIA 3MW4A 1GBGA 5FMDA 5FJHA 4YZ1A 3S7EA 3ZYRA 5A7NA 3ZKYA 1ZBE3 4XUTA 5D8AB 3LF7A 5FPZA 2ARAA 5GLWA 5I0DA 2F4PA 2B4KA 3VBSA 2HKXA 4ATEA 5FZOB 1AR81 2WUHA 2OS2A 3JBG1 4K6BA 1RUC3 1F4AA 5F3GA 3WR0A 5FMOS 1W8WA 4HBNA 3RJ2X 2QQUA 1R081 4YGDA 5CFCA 4QPYA 2R072 3J9SA 3VZNA 1NAEA 5C7GA 1LU1A 1UL9A 3GM8A 4RD7A 5C8CC 2A7AA 3KZ4C 4YRDA 3VDBA 4BK5A 4XOGA 3LIHA 5BNPC 1KRIA 4LBKA 4Q4V1 3CJIA 1KGYA 5CB7A 2G1MA 1W6MA 3SH5A 3I49A 1KJRA 1TG7A 4CU8A 4FP2A 4FPKA 3KVAA 3LA2A 5LASA 4EE2A 1REFA 3AK0A 2JG9B 2RS13 2JIGA 2BZDA 3DYMA 3FL7A 3HNYM 3OCPA 3IDBB 4XF3A 4XDQA 2Y0IA 1I3HA 5DG1A 3ZPOA 1KEXA 1RGSA 1APNA 2W68A 2RV9A 4DXTA 1CAUA 2K0GA 2GC1A 5FFOC 2YPDA 3O14A 1YUDA 1YXWA 3DL3A 2GDFA 3CZUA 3GHNA 4WM8A 1TQ5A 3BN6A 1H2MA 3KCXA 3AC0A 3AXEA 4YVSC 1WMXA 3GGLA 5ACA1 4OZOA 3ZFEA 3JCIA 4JQTA 2CAVA 4PIZA 3DPRC 1RUF3 1PK6A 2D6OX 3RZZA 1OSGA 2HWF3 2R0HA 3JB4C 3PTRB 5JXHA 1OLME 1V00A 3B9CA 2VOTA 4Q0UA 4DS0A 2JDYA 3FMGA 3N7MA 4M3CF 3Q8FA 3KT1A 1AYN1 3WF0A 1LRHA 2D5FA 4XFFA 5KXDA 4YM3A 1W03A 5EIYB 2HYKA 2BBAA 4XC9A 2RS51 5BUVA 2J22A 3VBUB 3EJKA 4NPRA 1X50A 4Y1YA 1LR5A 2RS33 3PTYA 3GNEA 3M2MA 1OLMA 1LGCA 1V6MA 4QKFA 2EAAA 1QQP1 2GU9A 2VVFA 4CP9B 1DGRA 2WZ8A 4PBOA 4QQOA 1UOFA 4FPFA 5DABA 3JB8A 5BNOA 3HNBM 1S0DA 4RFT0 3H50A 2TUNA 3FBYA 3RSJA 1DZTA 1KD7A 1ZBA2 2QCSB 2XKOA 4AXOA 1OFSA 3O7OA 1LOCA 3MF6A 1YLLA 4EV0A 1MPXA 3CJXA 4IEVA 5DXDA 1GANA 2VGDA 4HPKA 4C1XA 4XACA 3VHOA 1GICA 2Y6GA 2VMIA 5FZEA 5GLZA 4RS5B 2Q1FA 2B9VA 2ZABA 3B3QE 2A73B 4MADA 4Q8LA 5FIXA 4D8MA 2BPA2 1K12A 1N1TA 1QF3A 5KXCA 1UY2A 3O1RA 5SV5A 1LKNA 2YU1A 5GKAC 1VBC2 4TZDA 4HFSA 5CIRA 3TEXA 1IG3A 3N7JA 4YZ3A 3IT8A 2ZCWA 3RQ0A 1J59A 5KHIA 2P4EA 1LHWA 2BBVA 2IVIB 5FYYA 1HW5A 1OA3A 2R042 1OKOA 1BKZA 3T0AA 5HCFA 1Q56A 4LJHA 1CAXB 3OTFA 2X09A 5JCTA 2P6HA 4I01A 4GWNA 4XUPA 4IEZA 2FBEA 4H7MA 5A1LA 5K8SA 3N9OA 4NAMA 1YYNA 2CU5A 4QGLA 1GZCA 2WZEA 1JOPA 3S5QA 2AZ5A 2W47A 3HOBA 2B9UA 4Y4YA 4ZU4A 4ZHNA 3TEZA 3PJQA 4EN0A 3I54A 2EXIA 5CG9A 4LUMA 4RGGA 1QH7A 1MQTB 1WLCA 1PIV1 2BVVA 1LOFC 5J48A 1YFUA 2Q30A 1RHI2 1E5HA 3O1VA 3L2YA 4AI1A 5BY5A 3PVNA 2VMEA 5FK7A 5F3EA 1LODA 2VVEA 3PMSA 3WHTA 4CE8A 3VDCA 2GMMA 1PGSA 2HWB1 4PBPA 5FYBA 1ULFA 2VC9A 1O59A 1IS3A 2JJ6A 4RGAA 1UZWA 2P3IA 1IQAA 4XJAA 3I3MA 2AEZA 2J7MA 5EWSA 3LAGA 1D4M3 1XU1A 3GF6A 1UY1A 3NW4A 1K5MA 2E7QA 1MACA 1OLQA 5BXXA 2GMPA 4UBGA 1NA1A 1LGNA 3CU7A 2VZTA 3KVBA 5AFEA 3TOJA 1R1A3 2Z42A 5F3IA 3WW2A 3ECQA 2XDVA 3HT2A 3ETPA 1HRV1 1PNGA 1ZVFA 2WS93 3DCQA 2XJTA 3NNLA 2ADDA 3KD4A 1N1VA 2XOMA 4Q1PA 1DBNA 4DUXA 4CEYB 3I2GA 5M0TA 3DEMA 5A7WA 3WVJA 4HSJA 1F15A 1F5FA 3UKNA 5JOXA 1DQ1A 1RUJ3 1COV1 1CZVA 3BCWA 1QWRA 4LIVA 1H1AA 3GCXA 1VIWB 2R063 1W0OA 3E6CC 2WL1A 3PLQA 5A3MA 3X29B 4MGTA 1QJY2 5IT6A 3GCWA 2O1QA 1N47A 1H9PA 3K4ZA 5FP3A 3HBZA 5KHJA 4EZ4A 4ZU7A 1XE8A 2WNUB 4GWJA 4MGIE 2UWAA 2RDRA 3BB6A 5LK7B 1R091 3VD5A 5FO9B 5LWBA 1ULGA 4NIDA 4IESA 2X5IC 4CCOA 2XWBB 1IGOA 2WT1A 2VH9A 1B09A 3AYDA 3ACHA 2DUQA 1TVGA 4AI0A 2V4VA 2ZGOA 4N43A 2YYOA 1S2KA 5JWPA 2WAAA 4AOCA 2XBO1 3S57A 3R4UA 3BOPA 4K21A 2Y38A 1ZZ8A 3ACIA 3MIEA 3NQHA 3W5NA 1VBD3 5I8YA 1OUXA 3OEBA 3THPA 3JBG2 3N9NA 4OUSA 1VPHA 4Y20B 4I3GA 1R082 1PO13 3I2KA 5FXZA 1JOJA 4ONUA 2GP3A 5HPOA 2ADEA 2UYAA 1VBB2 2NQYA 2PLV1 4L97A 2J1VA 1N3OA 3K2OA 4M0HA 4DXZA 4JQRA 2W91A 4WV8A 4ZU5A 1Y9MA 2XJPA 4XE9A 3WG4A 4E4DX 1ULPA 1QH6A 3SC7X 2VECA 4IE7A 1IOAA 5A80A 2JE7A 3TN92 1RMU1 3ZYJB 1V9U1 5FUIA 1VBA3 3TB0A 4META 2E6VA 4WZFA 1W8FA 1C5IA 1POV1 3PIGA 1S0EA 4R4XA 3BIWE 4UFHA 5F6LB 4IGPA 3N9QA 2HWE3 4IV1C 5DG2A 4NR1A 1FNZA 4CUGA 2BOJA 4QXCA 5FYZA 2WNOA 3CQOA 5ACA2 1KS4A 2VZ1A 1L3JA 2CGOA 3AYEA 4P14A 4B4RA 3J4UH 3I3EA 1SLAA 4QAWA 1V0AA 1UYXA 3O12A 4O9GA 4CDQC 4AW7A 1OOPB 4OFGA 4AEDA 5E6HA 4OYUA 4CEWC 1GMMA 2Y0OA 1TNFA 5AFBA 4GB31 1QU0A 2AGSA 2UY8A 3OGRA 1MVEA 1OVSA 2XUMA 4LOSA 1OA4A 3WCSA 3NNGA 1H2LA 5FZDA 1UXXX 1REEA 4Q0QA 1QJU2 4BQWA 1QGLA 5D1IA 1RUG1 4AHXA 1WCKA 1CIYA 1XE7A 3DXTA 2YGLA 3PU3A 1IS5A 5T5OA 5A3LA 4MHRA 5JUVA 5JOZA 4J6GA 2AR6A 2VW1A 4JGZB 2BEOA 1UQXA 2HWD3 2WZR3 3RRDA 3ZIXA 2Y6LA 4BJ0A 5KHKA 1NUKA 1AVBA 3VBHC 4HZFA 5B4NA 2VD7A 2GC3A 2OA2A 2VNRA 2DV9A 4UFJA 4XVHA 3RPQA 3W20A 1AXKA 1YQ6A 3VBRA 4JTNA 4QX1A 4XURA 2DBNA 2VTXA 1Z78A 1YQ5A 1N3PA 4KWLA 5LA9A 1GKBA 3IPVB 4QPIA 3N3HA 1T6BX 3ZSJA 1ZRRA 4Z07A 3OY8A 3SHRA 3GBGA 4QDRA 1RTVA 4OQ8A 3AM2A 4GH4C 2HYXA 5JXGA 1RYYA 3FHIB 1YQCA 4LBQD 4CSWA 1RUD1 4JGYC 1SFNA 4XAEA 1QDOA 3H3ZA 1CIWA 1W6OA 4JDOA 4L11A 1NCRA 1HX6A 5F6KA 2ZXQA 1RUI3 3O1UA 2FDGA 1PGL2 4E4SA 3UK9A 1SPPB 4DOUA 3VKNA 4S2DA 4XQDA 2KA3A 4Q5OA 3EQEA 3ZYHA 2Z5WA 3N4MA 2I45A 1PZ8A 2R7EB 2DVAA 4Z92B 1KDMA 1J58A 1H8TB 1UAIA 1ZZBA 1GZWB 4HXCA 3A7QA 5JPNB 3KV5A 2FD8A 1CGPA 1HQLA 2BYVE 4CCCA 2QQKA 3AMQA 5GJ6A 3DKWA 2J1UA 3FHQA 1AR61 4PLNA 1WWYA 3VKFC 4QXKA 3N35A 1YO8A 3WNMA 1IPKA 2ORZA 2VZPA 4UFIA 1POV0 1VRH1 4DUVA 1S55A 5GLTA 1U5IA 3J7NA 2WWUA 5I8SA 3VBOB 3LWCA 4BQYA 4Y1VA 2VUAA 1VJ2A 3WF4A 5CYYA 1Q5OA 2CDPA 1V6NA 2JG8C 3U11A 4ES9A 5JR2A 5FO7B 4Q2FA 4YW6A 1JYIA 1FT9A 3KT7A 1ZZ6A 4XCBA 5DDJ3 1PIV2 4MGYE 5I93A 1QJEA 2WSVA 3C2UA 4AI2A 4EJRA 3OJBA 1UXZA 4YNIA 3KGZA 3JQWA 3KF5A 2QKDA 2YUEA 1DQ2A 3WP5A 1PGW2 1BEV1 4DZGA 3NJXA 2QUOA 3BTYA 1NOVA 1UIJA 3HNMA 4LNVA 3E5UA 3PUSA 2HWB2 5IHRA 3A23A 4BQXA 5FMOL 4GIQA 1UN1A 2RMU1 4O65A 3FZ3A 3M70A 3K48A 5J37A 5AC91 1XQNA 4LR4A 1BBT3 3ORJA 1XOYA 1DYPA 5FLJA 1UD1A 3C7FA 3JD73 4XW3A 3ZXDA 3S0MA 1X9TA 5KXEA 1NLQA 1VLNA 2IWGB 5JDBA 3N9LA 1CAWA 4H14A 2EALA 2PHXA 3NRUA 1HRV2 4LLFA 4K1ZA 3JUUA 2ETEA 1DG6A 5FMBA 2VTFA 3POEA 3M4FA 4NWWA 4AI8A 3H1MA 5JOYA 2EIDA 2B5HA 1RVF3 3P3NA 3AB0A 2YMZA 1FOD1 3AX4A 3H3UA 4OHWA 4LKEA 1IKPA 3AKSA 1W6QB 3TYJA 4CXXA 1COV2 3THCA 1HJFA 4EWEA 3MLJA 2XLGA 4BM8A 5DAWA 5I0SA 1AHSA 4FT8A 4UW4A 4JCKA 3NMBA 1TME1 2P37A 3FN9A 4D6RA 1WCUA 4CVUA 1IG0A 3AFKA 4FQZA 1W9YA 2WQZC 3NWKA 4FAGA 5FZHA 1GFF2 2WWJA 3TAYA 2WO7A 3ZFFB 3U4SA 4CDWA 2VCCA 1R092 1H1IA 1XNDA 3K3NA 2XR4A 4XF0A 1EAH3 5G05L 3WW4A 5F37A 1CVNA 4KGGA 1WZXA 2RDQA 3EMRA 4AWDA 4Q8KA 3HMYA 5C9AB 1JZ5A 3MDPA 4Q4Y3 1OKQA 1XRUA 1T6GC 1UPSA 4K9SA 1LOEA 3M3IA 2Y60A 4FPLA 4LHNA 4Q4W1 2XBO2 5K7PA 4WVMA 1H9WA 3KV4A 4A45A 1W04A 2V72A 2VBPA 3FLRA 3J26N 3FUQA 4RA0A 3RNSA 1ZNPA 2DCKA 1JYXA 2PHRA 3WOGA 2JECA 4AFAA 1A8DA 1QY4A 5LRRA 1UX6A 1V6KA 5LK5A 2QQOA 5F32A 2EVXA 1ST8A 2FMYA 2CYFA 5IWFA 1WMEA 1BK1A 2ZHKA 3HQXA 3INAA 3VD3A 1G6NA 2PLV2 3CO2A 3ZXAC 5I91A 4EN8B 5C71A 2ZA9A 4GA9A 4CXYA 3ZXJA 5GZEA 5A33B 1D7PM 1RMU2 1LOGA 1OD3A 2FCUA 2NPIA 3KB5A 1HKDA 1V9U2 4UF0B 4WM7C 4KU8A 3P3PA 4JTOA 4JKKA 4TLGA 1AR71 3D0SA 4RQPB 1FX5A 5K0UB 2WNEA 4N90A 3GDBA 2WO1A 1C28A 2PQSA 3TBDA 2HWC2 5EPAA 1LU2A 2WFF1 3I8TA 3KCYA 4ZZ8A 1BHGA 5L19A 5CFDC 1GLHA 1NZIA 2ENRA 4Q4X1 1JN2P 3KF3A 5FZFA 5F39A 3M8LA 4YZ5A 4IXLA 2H6BA 1ODMA 2QZ3A 5DZEA 3WSOA 1O8PA 1HXS2 4M00A 4N53A 1WA4A 4I0BA 5FY8A 4DXSA 3BALA 1LAJA 3KV6A 1W90A 2VXJA 2QQPA 4RFRB 5C4WA 3UNPA 2QQWA 2VM9A 1ND2A 1V6IA 1HB1A 3L2HA 5EYXA 4GB32 4LO5B 4TYSA 3WDVA 1HN1A 1VAVA 1EUTA 3EO6A 4N7UA 3AP9A 5A3OA 1H6YA 2GN7A 3RMXA 1ZA4A 3N9PA 1UZZA 2JDUA 1SDWA 1RUG2 3H8UA 3DKQA 3NO8A 2EIEA 2RDNA 3RDIA 4I3PA 2YFUA 1JMUB 1SLCA 1MEC1 2XQRA 2VMGA 2QDRA 2ZX0A 4GMP3 1C5HA 4IUGA 4FO9A 4RR3B 5G04L 5ABJB 5IFPA 4IW3A 4COWA 4CDXB 3POGA 2VQAA 1C8M1 3DYPA 3WF3A 4Y24A 2JX9A 4Z2AA 5JOWA 1Y4WA 4IE4A 3OPWA 3FC0A 1XNBA 2E32A 2WNVB 3J8F1 4UBHA 5DUXA 5CKNA 1IKQA 4K8RB 5FQ0A 1NCQB 4Y5TA 1H2NA 4PLOA 3O5SA 3B69A 3VDDB 3ETQA 3PVEA 4G3YC 2R0FA 1YFYA 1YI7A 2CL2A 4UOJA 3VHNA 4HETA 4I02A 1SZBA 4BMEA 3NAPC 3WDXA 2JDMA 5F3CA 4UFKA 5DAVA 3WQBA 2XB6C 1ZBA3 1MZFA 4HVRA 2XQXA 1LHNA 1WLTA 1VB2A 4IEQA 4QHBA 1NYWA 5FZ8A 5FWJA 2PHUA 1RUD2 1YIPA 1ZRIA 2E51A 5L7OC 3IMNA 5A6YA 4XHXA 4PDWB 2PELA 1ZZ9A 2WN2A 1A34A 4FPCA 2ZOEB 4HSLA 3VB9A 1UU4A 1B35A 4QT6A 2C6SA 5I0TA 3BTXA 5FR3A 2O0OA 3ZIWA 4YARA 1ENQA 1LCLA 1Q3EA 1UY0A 1YCIA 3SNMA 1YQ2A 3IWZA 4NIAA 4AQ6A 3AP5A 5HBAA 2VCMA 1O3TA 2CAUA 1VBC3 3QH6A 4TN7A 2PHDA 3I2IA 2BNMA 4YGEA 1LHOA 4QQPA 4C91A 1OLRA 1MS4A 1X8EA 3HR9A 3PIJA 1MZEA 4YW4A 4TLFA 3GHMA 2W94A 1AR62 1RUE2 1ND3B 1ACCA 3Q8BA 1UCXA 1Y9GA 2VE1A 1WLWA 3BYWA 2Z4FA 1VRH2 1GP5A 3B5LB 4IV3C 1UMHA 3USUA 4C90A 2A3YA 1W2TA 5JZGB 5BNNA 1EY2A 2UY9A 3GJBA 3VBFA 4LBJA 3VKLA 1GU3A 3GJAA 2OUJA 2BFUS 1CPNA 3LGRA 1OQEA 4JRAA 3WP6A 5JSRA 1PZ7A 5JPMB 4NAOA 4GMP0 2QBXA 4MXWA 2ERFA 5C3SA 5C8WA 4ZS2A 3MFCA 4FOVA 3MV11 3KGLA 4BYYA 4CDUB 1JZ6A 1HJGA 4PF5A 4QPGC 1BEV2 2W9XA 4IV3B 1PMIA 3MUZ1 4YZ4A 1ZBE1 4NWVA 4LBOA 1NKGA 3ZSLA 1TMF3 1MS0A 2A6VA 2RMU2 4IL7A 1FYUA 1RUC1 1BJQA 1NQJA 5FBJA 2FCTA 4B8EA 5FPBA 4E2QA 2J1TA 3B02A 5H9PA 3J7HA 5FY9A 3SKJE 3WG1A 5C3RA 3U75A 4YVWC 2GNDA 1PNFA 4EROA 3LFIA 5CISA 2D43A 5K4LA 3RZLA 1WMFA 4MGKE 5FZBA 5D8AA 2QQMA 3MI8A 2VQUA 1PVC2 2P34A 3FLPA 4AVBA 4CCKA 5FZOA 1ZM1A 2FDJA 1QNYA 2DYCA 3CNAA 3FLTA 1ZRFA 2PXJA 2RM23 3AP6A 4P9YA 5AVAA 4B4QA 4IGOA 4R4ZA 3AZXA 3KSCA 4OCTA 1UF2C 2IXLA 4OMDA 2ZEWA 5C3PA 2OT7A 3ILNA 3ZFGB 4AGGA 2X8KA 1W8ZA 1WCQA 3N9MA 2JDKA 1UO9A 3NNMA 1JZ8A 3MIGA 1WBFA 3VBSC 2LUWA 3H8XA 2WO2A 1E57A 4GKXA 1VBE3 4YW5A 2J1RA 5FPXA 4AZZA 1VAKA 2ZGMA 3MFAA 4FCAA 1F35A 5FJKA 5L73A 3H9AA 2D7FA 3T2PA 4AF9A 3AZWA 3ZYIB 1JYVA 2JG9A 1RUF1 2LW8A 2VMFA 4WZCA 4XFAA 5E1RA 5CFCC 3BOWA 3OUJA 1IHMA 3MIBA 3U1XA 1EV12 4LORA 2FDFA 1WW7A 2GAUA 2O8QA 1CX1A 2X05A 3WD5A 1GR3A 1AR91 2D3SA 4AE2A 4DRVA 3RZJA 1JBCA 2JDAA 2ZHNA 3CJIC 2EAKA 4Q4W2 2GNMA 2ZTNA 4A7YA 5C8CB 5DAPA 2MHFA 5F5AA 3T2OA 5BNPB 1F2NA 2ZGLA 4ISRA 1WA6X 5LEJA 5ANQA 4UXAA 3GZUC 1D0GA 2HBUA 2ZPXA 1GP6A 1YQ8A 3KMHA 2RS31 2AC1A 2JENA 4HONA 2BDRA 1XU2A 2EXJA 2GN3A 4ZXEA 4COVA 1ONAA 2R49A 5E88A 1VAMA 2XG3A 1S4CA 1J1TA 4OULA 4EN7B 1G9DA 1PMHX 1IS4A 1Q8VA 4WM8C 1WUVA 4I0AA 3VBUA 3A22A 4HVOA 3ZFEC 5J36A 4DEQA 2VBDA 1PK6C 5GM0A 1CX4A 4AAXA 2CTVA 4YVSB 4HMZA 1SG3A 2B7YA 1VBB3 3MIHA 4JKLA 4XBLA 3UETA 4UT5A 4CP9A 2YBKA 3DPRB 3POWA 5BYNA 1UOGA 1ZRDA 1IPJA 1ASJ1 3SH4A 4A3ZA 1NY71 1AR72 4BZ4A 3RJRA 4D7SA 5IK4A 4Y33A 5FYCA 3LZZA 1U5YA 3C7EA 4P9GA 2E9QA 5DZGA 1HN0A 1W6NB 3CDZB 3ITQA 5A7SA 2WFF2 4PIYA 3TN93 4Z1VA 3LSEA 1OQ1A 2Y8KA 4Q4X2 2R30A 5F9TA 2W87A 4I2OA 4CTEA 5DMYA 1XC6A 3ATGA 3LKJA 4HVQA 2CHHA 5H9SA 3AMNA 4CCEA 3LOBA 3MLLA 1H30A 4XFGA 3AZYA 3OBAA 1DYKA 2P6CA 4RS5A 4LKFA 4OVEA 4YW1A 3ZVXA 4SBVA 3R6SA 5BNOC 5C33A 5LA1A 2MEV2 1CONA 1OH4A 5I8TA 3ES4A 3PU8A 5IFTA 3A21A 4B29A 5FPUA 1U5XA 3ENRA 5T50A 2VPVA 2ZZJA 3GYDA 2JWPA 5FMCA 1GQGA 3J7LA 4O9EA 1GWLA 2Y6KA 1EYBA 3PUHA 1LNSA 2JDPA 2KXLA 1MEC2 2RG4A 2RR12 4ZXKA 3VD9A 2QVSB 1QXRA 4OLLA 1AYM3 1KS5A 1CAXA 4GAZA 3NV3A 2BWCA 4FFFA 1MR5A 3VL8A 4EN9B 1C8M2 1QJU3 1AL22 3MGUA 3IB3A 3UJOA 1A78A 3PUQA 4HK8A 1MVQA 1Y7BA 3J8F2 4CP1A 1S0CA 5F1RA 1NXD1 1W6PB 4QQ2A 3TRSB 4DB5A 2ZEXA 1BZWA 4RHV3 5IAXA 1PVXA 2E7TA 5BNQA 3IBMA 3L9JT 2QQVA 2ZGKA 4CU6A 3FFZA 5J1XA 4NRPA 4IDZA 1MQTA 5FZIA 4FTBA 3RYRA 1CZSA 1XNTA 1ZZ7A 1D4M1 4W8JA 3B94A 4JRLA 3MPPG 4FI9A 4HKWA 3J7MA 2WYFA 4LITA 2IUWA 4K1YA 2Z69A 1R1A1 1N1YA 2KD7A 2VQ0A 3I3QA 3LA3A 2VG9A 5A7OA 1N3QA 2XLAA 4LPLA 4XJZA 2WS91 1JW6A 1SEFA 3H7YA 1HB4A 1TZOA 2YZ4A 3AZZA 1DP0A 2VZSA 3E6DA 1MZ6A 2JDZA 5CU1A 1LOFA 2WA4A 5FKBA 4PQ9A 1GQHA 4LULA 1Y9QA 4TWTA 3PHMA 1YJKA 1RUJ1 2AYHA 2A6YA 5EJZB 2JD9A 1WKYA 2OX0A 2R061 3D0JA 3ZYPA 2C9AA 3HT1A 4W50A 2NMOA 2ZGSA 3HD8B 4FVVA 1UMIA 3D82A 3TNPB 4P02B 3T0DA 4LTAA 5JIAA 5FLIA 2WZPP 3RI9A 4CEYA 4CPBA 1FAYA 5A1FA 1X8MA 2PN5A 1K5MC 2DF7A 3AFGA 4JDNA 5A7QA 1NA1C 1LEDA 1UYYA 4LE4A 4LA3A 4BISA 3M7AA 4UW6A 2DVFA 1UZ0A 2H0VA 5DN2A 3IIIA 5CKQA 4NRMA 1FPN3 1RXFA 1W9FA 4FFHA 4C8DA 5H9QA 4RYDA 1XNCA 1ZBE2 1HDKA 5K9YA 1CD3G 2YGMA 2WNUA 5FP9A 4PJYA 3RZHA 3WP3A 4QU1A 4XZPA 1KITA 3ZYBA 3LCPA 1VBD1 4FOQA 5EYYA 3RG0A 2A1XA 1RUC2 3JXSA 2G19A 1GQPA 2FQPA 2W46A 3QLQA 2D44A 4JVAA 3SISA 4QHZA 4A6SA 4D7TA 5A6XA 4FOWA 4Q26A 5FY7A 5IVBA 4EZHA 5A32B 2VL4A 2OPKA 1O5LA 1WLDA 1CWPA 1CQ9A 4CYDA 2A75A 2KM2A 3OUHA 2VTXJ 1GNHA 2O8OA 3BU7A 4XAAA 1RUNA 4Y20A 3ZDSA 3ZPYA 1JODA 3BU0A 4BHPA 4BIFA 1AR82 5CBLA 2BJSA 5FYMA 1GNZA 3WNOA 2X5IB 4N43C 2ZHMA 1X82A 2GZWA 3QCWA 5LCWL 1KDKA 3AKPA 5J09A 2W5FA 1QIQA 1E5RA 3RYKA 4FAHA 3P1IA 4KH9A 4FTSA 5FDBA 1COV3 1GSLA 1ULEA 1UY4A 1J3RA 4NHXA 4ATFA 4Q4V2 1UKGA 2DDUA 2NMNA 3WQ7A 1ALYA 4N9HA 2WT2A 5DZFA 3CZJA 3HEIA 1CN1A 1NG0A 2UURA 3RWKX 4YPJA 3ZMOA 1DGWA 3LDKA 4FFGA 4V1PA 3ALQA 1VALA 4B3NA 2E7AA 2V73A 4M4PA 1DIWA 4JV4A 1AR92 1LOAA 4QM9A 4XUOA 5FXVA 4AFCA 5B2GB 1XYPA 3TEWA 3KHCA 2ARBA 2GC2A 3OD4A 4JDMA 3CHXA 4Z2WA 3O0WA 1LTEA 3I7DA 4XDPA 3WHUA 2VUJA 3SKVA 2P3YA 4NN0A 1GUIA 3URFA 1JHNA 1UPIA 4AGVA 3EBRA 4ZONA 3H8RA 1OOPA 4KI5M 3WUDA 2LALA 2RS32 1ULCA 2IXJA 3AXDA 5JMCA 1YWKA 5HCBA 4FBFA 3C3VA 2HWD1 2WZR1 1QKQA 3FHAA 4QXHA 5E8AA 3OBTA 1M06G 1LHUA 5JAXA 4PCRA 1NT0A 3OBRA 4IV1B 3ME2A 4R8HA 1G86A 2ZX1A 2F17A 4MX3A 2Q5TA 1HRI3 3T4HB 1AYN2 1H8VA 2D93A 4A3XA 4E4ZA 2RJ2A 4FTEA 5BV6A 1FMD3 3PVBB 1Q8PA 2RS52 3NKGA 1CAVB 3KWVA 2JDHA 5FRAA 4JGZA 4ZZ5A 4AEDC 3FJSA 1OMIA 1O3QA 2BOIA 3KM5A 1EPZA 4LKSA 4XILA 5CVRA 5FYTA 5JXIA 1ASJ2 4CDQB 1NY72 2GP5A 4XTMA 2BGCA 4Y1XA 1XYNA 3ZN6B 4CEWB 1QQP2 3AZVA 4QU2A 2CDOA 3GXUA 2VO5A 1R1ZA 5GZFA 1R64A 4RL7A 1OURA 2Y64A 3P5BA 1OT5A 1DDLA 1RUI1 4L92A 3A0NA 4NJ4A 2DU0A 2JB4A 3IPVA 3P6BA 1IZ3A 1LESA 1XJAA 2EXKA 4UFMA 3MF9A 3ZXKA 1MS9A 4QX0A 4P9IA 4HOOA 2HWC3 2WINB 2WR9A 5FZCA 3B93A 2XH6A 3NNFA 4KU7A 1Y43B 4YM0A 4D0QA 4YW2A 4E4HA 1S0JA 1DHKB 1RXGA 2JKXA 1HXS3 3F95A 3VBHB 2ZGNA 1W2OA 3VBRC 3RYPA 5T3NA 5KBFA 2WSUA 3QACA 1SPPA 2OQ7A 3RVHA 2HBTA 1RJ8A 2YXSA 4QPIC 5IYYA 3E1F1 4AVTA 2J1EA 2BFUL 2OW4A 2PYTA 2Y6HA 4HLTA 1WW6A 1H8TA 1OH3A 3KQ4B 4AEMA 1GZWA 3O1TA 2C26A 4ORFA 2Y26A 3LPFA 5T52A 5DDJ1 3V0BB 3V65A 3OPZA 4GH4B 5FZ0A 1QXPA 4LO8A 4XUQA 1NCRC 1PO21 3HWJA 3RFRA 3H1WA 4JGYB 2DFCA 3JZVA 1OC1A 5GLVA 4A4AA 4NHYA 3QOPA 5FZ6A 3VBOA 1MS5A 3SXWA 3FFQA 2K2SA 4XXAA 1O4ZA 5IVJA 1JZ3A 4AQTA 2GNTA 1KFXL 3OBZA 1JYCA 1BVP1 3DECA 3GBFA 4H3WA 3S7IA 4CU7A 1BBT1 2J42A 1D4M2 2XL9A 2P3KA 3LEIA 3JD71 1ENRA 1L7RA 4QD2A 1UNBA 1RUOA 4AHYA 3UJQA 4ASLA 2WBKA 4ZPIA 5FZ9A 1OUSA 1W8TA 4LEJA 5KC6A 1PM7A 5DUVA 4D7YA 4XPVA 2WS92 1AUYA 5JXJA 4CA9A 4KQ7A 2B39A 3G6JB 4EYUA 2NP0A 2D5HA 1RVF1 4QPWA 3ILRA 3APBA 4KWUA 4FFIA 2JG8B 3JQXA 1CESA 5IJRA 5IVEA 5T5JA 2DVGA 3ZX7A 4A7KA 2CY6A 4M4RA 4CUCA 4H55A 2YC0A 4H2AA 4HN1A 2R062 4YSFA 4P5YA 4NIGA 1V6LA 2IXKA 1C3HA 1OPOA 1YRZA 4FPJA 4BIOA 3ZN4A 1BXHA 1ZREA 1UKRA 2V5YA 3HBKA 4KBZA 3UL2A 3EXUA 4GXLA 4MG2A 3LEMA 4JHZA 4IERA 4BQ4A 3PDQA 4ES8A 1J1LA 1W6QA 2WWSA 2YHJA 2YU2A 3OYWB 2RDSA 1RUE3 4Y22B 4NOTA 4FPEA 1JZ7A 2ID4A 2FHRA 1VMFA 3TNQA 1EAH1 2G9FA 2P2KA 2B46X 2LROA 4Q4Y1 1MS1A 2D6LX 4HKLA 1H2KA 2PHTA 5CA6A 1C4RA 4JZRA 5F8PA 5LY1A 4NHMA 4BK4A 3ZFFA 5KC5A 3KLSA 4QGMA 1VBD2 4Q0SA 3O0XA 4IEWA 2ET1A 3VD7A 4K3UA 4Y5SA 1QJX3 5FPLA 4AEJA 3O1MA 4IE5A 3LEGA 5C9AA 4YFWA 4M01A 4R9AA 2Z79A 4FPOB 4A2UA 5FXXA 1Z7S3 5IW0A 4R9BA 4OHVA 2Q8OA 3T2TA 4A7ZA 4MV2A 5A3WA 1REDA 2D98A 2WLPA 4XBNA 1EP0A 2GALA 2W52A 4LK6A 1W9SA 4CDWC 2ZAHA 1J84A 2WLQA 2W2IA 1BLZA 1S1AA 5B4XA 3ST7A 5C3QA 2VMHA 2VOWA 4WVZA 1RUH3 1DU3D 3GBWA 3LSDA 5EFUA 2ARXA 1PVC3 1S2BA 3AP4A 3VZLA 4LE3A 5FYHA 1FNYA 4DIQA 3IIAA 4HKOA 1J3QA 4MUVA 4WVVA 2XJQA 3BKZA 4LOTA 3UYJA 3VKOA 1S0IA 5A33A 1MZ5A 1YI9A 4QB6A 3WDTA 3H8OA 3G7DA 2DBIA 4OQ9A 2OPWA 2ZEYA 4UF0A 4CU9A 2R073 4LMFA 3RGBA 4XQWA 4RQPA 5GZCA 5K0UA 5HCAA 1BMV1 4L2NA 4U2AA 5F5QA 3CBNA 1F31A 2QZ2A 2DCZA 1OHFA 3MIDA 4M0NA 4BQ5A 2BQPA 2ZGPA 4BMBA 4QHOA 1XXNA 3BGAA 1LULA 1GOFA 3C8XA 2B8MA 4RGKA 3RZKA 1EV13 3IDCB 5CAZA 1HV1A 3IZOA 1E5IA 4LBQB 4GMP1 3HIFA 1F9KA 1LEMA 4FXKB 1OI6A 1WCDJ 2Y6FA 4IETA 2HWD2 4WM7B 3W21A 4BXSV 3CF6E 5FZ7A 1V6OA 1G9AA 2R32A 1GZTA 1JH5A 1X33A 1KJLA 1V6JA 4E2GA 3I59B 2ZKNA 4N53C 1NE4A 3IKWA 5CFDB 3HAGA 3LEKA 4RR3A 5ABJA 2UWBA 2D6NA 4XF1A 4W6YA 1DLLA 4V2VA 1UWWA 4W6XA 3NJZA 4GKYA 4CDXA 3WXPA 1S2EA 5C4WC 4P5HA 2ZGRA 1O91A 2B45X 1ND2C 4QX8A 1JI6A 1PMJX 2WIIB 1PX3A 4A41A 4OUEA 1H4GA 5C5UA 2WNVA 1HQWA 2CWSA 3OGGA 3TEYA 2G9GA 1GWKA 1NCQA 3POSA 2XHKA 3PUIA 4U36A 2DURA 2XGXA 3VDDA 1RC6A 2VMCA 1QEXA 4CCDA 4TSVA 2BVBA 4YFZA 2ZGTA 1RUI2 4YZ2A 1WMDA 4DPNA 4XFIA 3LDRA 3IM0A 2G9ZA 5L9RA 5FREA 1US3A 2WFF3 4HANA 2WT0A 3HVDA 1LENA 4C1WA 4LT5A 5DUUA 3U0ZA 3PUAA 3AYCA 4W6WA 2PA7A 4G9SB 5CADA 1UU5A 4PDWA 1NLSA 1Z0HA 4OI1A 4Z8BA 2QE3A 3HJRA 4MH0E 3U07A 4NPMA 3ACGA 3VLBB 3BTAA 4MLOA 2NN8A 5CZKA 3MBWA 4KG8A 2MEV3 4V2WA 5EV7A 4FPYA 2E63A 5LA2A 5JI9A 4R52A 2LM3A 2HEYF 4NIIA 1X36A 4HK9A 3NAPB 1DGLA 1HIXA 1YHFA 1C1LA 1W39A 2NLRA 5DDJ2 5JI7A 1ND3A 1PO22 2RR13 4XABA 1XB9A 4A44A 1AXZA 1PZ9A 3ZXEA 5L7OB 2WA3A 2DTYA 3I2JA 1U12A 3K3OA 4A6OA 5JZGA 1B35C 1C8M3 2R043 2RJLA 1AL23 3BI3A 3MO4A 1DQ5A 1W9TA 3W9AA 3VHRA 2GH2A 1TMF1 3IDAA 3LQCA 4UYBA 3OGJA 1BYHA 3KCCA 3ASIA 4BCUA 2NYYA 4Q0VA 1XNKA 2RVAA 4XMAA 3AP7A 3ROUA 4CDUA 3JD72 2XJVA 1SQ4A 3DV8A 3POYA 4IV3A 2V09A 3LE0A 3QD6A 1ULOA 3Q8EA 5J98B 5BNNC 3M3OA 1JXNA 2KR2A 2VMDA 3S30A 2UYBA 4M3CB 4XXPA 5IAVA 3VBFC 2IZWA 1XNAA 4LKDA 2ZZQA 5IK7A 1AX2A 2R1DA 2ZX3A 4BDVB 1UYPA 5FWEA 2RM21 1CJDA 1RHI3 5FXWA 3VKMA 1ENSA 4FPHA 2OUHA 4L0PA 5AC92 2W39A 4QKDA 5A6QA 5LEKA 3RWNA 4URAA 2PAEA 4HN0A 1GOGA 2YROA 5F5IA 2GH8A 3E5XA 3WDYA 4QMAA 4QPGB 4XIKA 5FZGA 1VBE1 2ILMA 3POFA 3QH7A 1KFUL 1W8OA 5FZ4A 1SHWB 1RB8G 3NNJA 4DINB 2YB7A 3DYOA 3K75B 5FUPA 5ISLA 4MSVA 2P3JA 1EAH2 1AF9A 3OPTA 1N1SA 1FOD2 4FPGA 4LBMA 1SLLA 3ZFGA 4Z82A 5D8AC 5FY0A 3W59A 4YVWB 5FP8A 3VN4A 2RS11 4Q4Y2 3S6PA 1OQDA 4W4ZA 4MVTA 2J1AA 2I07B 2XXZA 3U14A 3ZXGA 3HQUA 1TE1B 1TME2 3I97A 5FY1A 5FYIA 4AVAA 5F2SA 1I5ZA 5GZDA 2JB8A 3A4UA 3KHBA 5FOJB 2DCJA 4MOAA 2OQ6A 5IVCA 1QDCA 4GWMA 1XPWA 1QOOA 4KWKA 3U10A 3VGIA 3VZOA 3GZAA 4BQ2A 4Y5Z0 4MGSA 2HWF1 4OI0A 1QJY3 4N8MA 5FZ1A 3AJYA 3M1HA 2O14A 4WVWA 1ZZCA 2IVJA 5C8CA 4QX3A 5BNPA 1VMHA 2V4AA 2PHFA 2W92A 5IUQA 3FWEA 4L99A 1V70A 4AVSA 3VBSB 3VZKA 1DQ4A 1TNRA 2JG9C 2EA7A 3A0KA 5SV8A 5HI0A 5HV4A 2Q1MA 3FUOA 1SCRA 3FE5A 1VBB1 2WRAA 1ODNA 2YC4A 5DAXA 3WLUA 3RZMA 3POJA 2E33A 4ITCA 4NHKA 2IXIA 2P17A 3K4DA 1WD4A 3ZYFA 4CPBD 4DNYA 4W65A 5CFCB 1OPMA 3I2HA 4KG0A 5TSWA 2I2SA 1XBFA 4LUKA 3DF0A 4P9LA 3TN91 4A42A 2IC1A 1GV9A 4AHZA 1AR83 3CJIB 3JBG3 1W6MB 4YVSA 1W0NA 4XMIA 4XDOA 1UW8A 3DPRA 1R083 2ET7A 4LA2A 3ZDVA 1JUHA 2QNKA 2YV8A 3MW2A 3WCRA 5T55A 5FYUA 1BMV2 3LOIA 1W6NA 3C7OA 4NE9A 4Q4V3 5JVVA 1CAUB 3VBUC 3I2DA 4NIHA 2LS6A 1E5SA 3MLKA 5ERLA 5FP4A 2XVGA 4JC1A 2JXAA 4LQRA 4WM8B 3MICA 2YBPA 3D3AA 2ZJCA 4IEYA 3ZFEB 2HJIA 2BRTA 3EHKA 2R16A 4IEOA 4XUNA 1PK6B 1AR93 3ZLIA 5L9VA 1AYM1 1CR7A 1W2UA 4D69A 1G7YA 2ZGUA 4X6RB 1C1FA 5DAQA 3GZEA 1QJU1 3ABZA 1IS6A 4XJWA 5E16A 2GSYA 3NV4A 5I0UA 1LECA 4DEVA 3MV01 5EJ3A 5ACA3 3PL0A 5FY4A 2NZ9A 3AKRA 4XIOA 4RHV1 4XBQA 5LBBA 1JYTA 4S2GA 4LXLA 1NXMA 2HEVF 4J1XA 4B1LA 1SMVA 1K42A 2PHLA 4ISQA 4RS5C 2VQTA 1W2AX 3DXUA 2DWRA 2WQ8A 4XEZA 2BGPA 4AI9A 4FSJA 1ULDA 2QQLA 4L8QA 2A6WA 1DQ6A 3NL1A 3U4XA 2IFRA 2TNFA 1W6PA 1AYN3 4COYA 5BNOB 1G9CA 3ACFA 2WDBA 3LPGA 2L9LA 4OMCA 5FPVA 1LB2A 2RS53 2PMWB 3MW3A 4IGQA 1O5UA 2EIBA 4PHZA 2Y33A 3NVCA 1JOBA 4NMIA 4TXWA 4DQAA 4ASKA 1ASJ3 1G8WA 2OVUA 3DGTA 4FP3A 1QQP3 4AHWA 2D6KA 4ZKTB 4HPKB 1GOHA 4QGNA 4UI9L 3UT0A 4AFBA 4D6QA 1FV3A 2OXBA 1YFWA 3ILFA 3ES1A 2WJSA 2C4XA 3HQRA 5A7PA 4QDSA 1DF0A 5LRSA 1PGL1 4C0HA 4JX0A 3CIHA 2TBVA 3BPZA 5IVYA 3PMEA 2BNNA 2NM1A 4P9WA 4BB3A 2DCYA 2AEYA 3ACLA 4FQ4A 1MQTC 1SBDA 1ZRCA 2Y34A 1YNAA 2Q1ZB 3R4DB 2VNOA 4QDQA 5FP7A 2ES3A 1DLCA 3OF1A 1UZVA 3D6EA 1MS8A 3KT4A 3HN3A 4AG4A 4AI3A 4COUA 4PI0A 2VW0A 1DQ0A 1QJZA 3FBMA 1FPN1 1W2NA 1S0GA 2BP6A 1H0BA 2A71A 2VVDA 3WV6A 1SACA 4CZSA 5E89A 4XF4A 5JR7B 3HN1A 2G4IA 2VOXA 4QB1A 2JKBA 2ZX4A 3WNXA 5J3UA 5KHGA 3AVSA 1TMF2 1W3XA 3E97A 1LJ7A 2DVBA 4IE0A 3DUIA 3WNNA 1PGW1 4PLMA 2QQIA 3O0VA 3GALA 4BOWA 1J3PA 4E27A 4NUBA 2C0ZA 4LHLA 3EB7A 4ARYA 3ZXLA 3ELNA 4CP2A 4L9BA 1F5JA 4J25A 4QKBA 4EWAA 4F8AA 3AMHA 2JE9A 4AYUA 3RZGA 2D6MA 2YBSA 4CEYC 2XLFA 1C57A 3WZ1A 3LIGA 4MYEA 3WDWA 5CEHA 5FO8B 1QJFA 5GZGA 1PIV3 3H3LA 5A3TA 2RM22 5LBCA 2BV4A 3ZMNA 4KMQA 1K5MB 1PHMA 2ZGQA 5A32A 4E2SA 1JZ2A 5HCHA 1NA1B 2XUEA 2QDNA 4GJZA 4LHSA 1W06A 1YFXA 4OUMA 4F3JA 3PNAA 1PO11 4AFDA 5A3NA 3H7JA 4QX7A 4XHBA 2WNUC 3IMMA 2HWB3 4NROA 1DZQA 2A6XA 3IN9A 3TWIA 1OA2A 1VBE2 2C1FA 2E53A 2VU9A 5EJ1B 3SMHA 1UOBA 3ZN5A 2VZRA 2V5DA 2FCVA 2JIJA 5FZAA 1OBNA 1W8UA 4JHTA 1QNWA 2DUPA 5A7WB 3N7LA 4RN5A 1IQDC 2X5IA 3WINE 1O8SA 5T5LA 3WNLA 3I2OA 2WFPA 3H42B 3OSDA 1VBA1 3WG3A 3WF1A 1HRV3 3OOXA 1H1MA 2RS12 1JTZX 3VHPA 4Y1UA 1DZRA 5IVFA 1LOBA 1XYOA 3Q8CA 2AENA 2VW2A 4CUBA 3T2QA 1QHDA 2K9ZA 4EWDA 5HXVA 3D5OA 5L9BA 3C7GA 2HWE1 2XWJB 3BUCA 3KQRA 4BPZA 4PT6A 5FYVA 3D8CA 3I2FA 2GC0A 5A70A 4Q0PA 4XFHA 4PI2A 1RL3A 1DCSA 5IK8A 1RUF2 4K8FA 2A3WA 1VRBA 2HWF2 4NO4A 1YEWA 4N43B 3MHZA 3WQ0A 3K4AA 3RI8A 3ZO0B 1W99A 1A8MA 1O3SA 1BK0A 1EPWA 1BVVA 1K3IA 4QKNA 3ZR6A 1L7LA 1I1EA 1WD3A 5CKMA 3SCGA 1XE0A 4QQHA 2GNBA 2H0BA 1R093 1W8HA 1HRI1 3VZJA 5LA0A 2BGOA 2IXCA 1FMD1 4AVCA 2W3JA 4GJYA 2DU1A 1FI2A 4YG3A 3IDEA 2OKXA 2D3PA 2D40A 2YPJA 3EYPA 4LO7A 2C9KA 4AGRA 5FLHA 4K7JA 2YG0A 1F4HA 4NHLA 4MGZE 4YW7A 3DN7A 4Y1ZA 2XBO3 3C7HA 1A6CA 4HG6B 3M3EA 2VUDA 4IV1A 5LB6A 2XPJA 2VY0A 1EUUA 2W95A 4O7XA 5FZMA 5A6ZA 4P9JA 4I09A 4AK3A 5CNAA 1CAVA 3VL9A 1OOPC 1U0AA 2PHWA 1O4TA 1QMJA 2BUKA 2HWC1 2WYSA 3POBA 3GZTB 4CDQA 3MIFA 1SFYA 4J1WA 5IATA 3NSTA 2ZACA 2PQQA 3ZN6A 1UIKA 4CEWA 2PLV3 2R6QA 3HPNA 2MPFA 1HQNA 4AVVA 4AQ2A 5FUNA 1GP4A 4YW3A 1HXS1 2IFWA 2D3RA 4CXWA 4DFSA 4GZ9A 1YIFA 2VZVA 1W8NA 4LIUA 2AUYA 2BTVC 4YGBA 1RMU3 1HB3A 4DY5A 3WW1A 1V9U3 3MZHA 2LTNA 3AL5A 4JGZC 2WAOA 5EP9A 4NPLA 5FPAA 1POV3 4D6SA 1NX9A 5FKCA 3CL1A 2P1BA 1AYM2 4GULA 4LO6B 2PFWA 2VBBA 1RINA 4AEDB 1GYKA 1GWMA 1YJLA 3VV1A 1SLIA 3WY6A 4I30A 5L36A 3VUOA 1RIRA 3VBHA 1SCSA 4F83A 1YC61 1K45A 1GZ9A 3SCFA 4XJ9A 3Q9OA 5JIUA 5EQUA 4FXGB 4XYXA 4SLIA 4RHV2 5T54A 1O7FA 4RSUA 4MO3M 3WNKA 4D3WA 4XQ4A 5JSPA 1OXCA 2XJSA 2QTWB 5F2WA 3ZSKA 5ANNA 2ZS6B 3RMYA 4BE3A 4GB33 3V0BA 3QBQA 4OI4A 4QQLA 4YWAA 4GH4A 3T0BA 3ZKUA 1BQPA 1US2A 3UGGA 5J96B 3LD8A 4EQVA 1SDDB 4JGYA 1UZYA 2ZHLA 3NV1A 4IE6A 2VJXA 4P9XA 1FXZA 1RUG3 1VE0A 1XSQA 3NV2A 4E8DA 4I0WB 1UU6A 3VBRB 5LY2A 1G9FA 3USSA 5FBZA 4GD4A 1I5PA 4CUAA 2C24A 1U5ZA 4UW5A 4QPIB 4CCLA 1H8TC 4OHYA 4Y4RA 2AH2A 4CCMA 2FDHA 3OY8B 1Q8QA 2EXHA 4AL9A 5C6CA 5JMOA 3MEPA 1T2XA 5FY5A 4BQ1A 3ON7A 1KXGA 3V56A 3BODA 3WQ1A 3AL6A 5FAXA 2C5DA 4INDA 1I6XA 1W6OB 4QB2A 5D21A 2UU8A 5IK5A 1NCRB 1S0FA 3M3QA 3VBOC 5AVPA 4XCAA 4S2FA 5KXBA 5BPXA 2CNAA 3E6BA 1R1A2 5F5CA 3WX5A 5IVVA 5LBFA 5DQ0A 3T08A 1ENXA 3T09A 2JG8A 4CCJA 3WUCA 1W9WA 2ZBJA 3E5QA 2X53S 1RUD3 1RUE1 4GWIA 4XTPA 5T5PA 4OHZA 2FDKA 1W05A 4CRQA 2VAUA 3AJZA 5A1AA 2OZJA 2W1SA 2FZ2A 1PX4A 4XF9A 2LRPA 1X9PA 4B7KA 1QOSA 2QQJA 1FPN2 1RUJ2 2RHPA 4ZS3A 2D6PA 4N9IA 3ZR5A 5CG8A 3KV9A 3FX3A 2BERA 3ZXFA 1WW5A 2XVKA 4OZXA 3UV9A 4BQ3A 2PTMA 3U37A 3UESA 4E9KA 2E31A 2EF6A 5DPNA 4AQSA 3POIA 1WBLA 2YC2A 2HH9A 3OYWA 4UWDA 4Y22A 1PO23 3WT3A 2FDIA 1QJX1 1OFNA 1RJ7A 1W3VA 4NVPA 5FZ3A 4QWNA 5LBEA 2F6BA 5C3OA 2YDEA 4B7EA 3LFMA 1AR63 4G4FA 2XMLA 3K46A 5A3UA 2QJVA 4FOYA 3RS6A 1D4VB 3NJYA 1Z7S1 1VRH3 1UYZA 1NLRA 5FK8A 2ZMNA 2VULA 1UY3A 3F2ZA 3UKTA 2CSGA 1LGBA 3R0RA 4B1MA 2CWMA 3BIEA 1WW4A 2B42B 3ZSMA 1JZ4A 2AACA 2XVLA 5LATA 1JUIA 4OHXA 2Q8DA 1MS3A 2PAMA 3CLPA 3ZM8A 3W5MA 1SLBA 4UFLA 1RUH1 4YG0A 2W0XA 4P08A 2VNVA 4DO0A 4CCNA 1PVC1 4KBBA 5C70A 1H6XA 4TTGA 1AL0G 1OF3A 1BEV3 1I9RA 2X29A 2Y6JA 2EICA 2ZKLA 4ARXA 1PO12 1CAWB 1W0PA 2XKPA 2WQ4A 3ZFFC 4MZUA 1HB2A 3AVRA 3UGFA 2JEMA 1UX7A 2RMU3 1Y3TA 3AKTA 3AYAA 3CMGA 5AC93 3OG2A 4YM2A 2DTWA 5FZLA 2W1QA 5C9AC 1STMA 2XJRA 2R071 1JHJA 4JKMA 3I3BA 1AJKA 5FCCA 5FYSA 2CGPA 1VBA2 2AREA 2FMDA 3B7MA 3IAPA 2OIIA 1TEIA 3SEPA 5A3PA 4P00B 4S2HA 4YG6A 2DFBA 1UOJA 2VR4A 5FZKA 3ZYGA 4CP0A 1F8VA 1HLCA 1GNYA 1K5JA 3JU9A 5LW9A 5J7MA 2HWE2 1FOD3 1EV11 3H1YA 4CDWB 1L7QA 2XJUA 2Q8CA 4BU2A 4LBNA 4WBBA 4YYOA 2Z2SB 2DCTA 4DMIA 5JLVA 1W28A 2DUOA 2QFEA 4KGQA 4IEXA 1TME3 3MPBA 4XZUG 1P8JA 2A3XA 4X8PA 2A6ZA 2VZUA 4AR2A 1OVPA 4BH9A
chains in the Genus database with same CATH topology
3AKQA 1NQDA 3R4SA 2BW8A 4JAAA 4WVMB 5KHHA 1DFQA 2YY1A 5KWRA 1Q43A 1HRI2 4LBQA 1FMD2 2TEPA 4RQPC 5K0UC 4BWOA 1ZYBA 4WM7A 1Q8SA 4KWJA 2RJKA 3B9IA 1WCSA 4D94A 4Q4W3 2VNGA 4PIXA 3WDUA 2I74A 1QOTA 2WZR2 3I59A 3I4IA 5CFDA 1VR3A 4DRRA 1LHVA 3K51A 3NKTA 2UWCA 1AX1A 3M3CA 1VP6A 1SBFA 4BLIA 4QM8A 1SLTA 2ATFA 4LHKA 3PVOA 5FOBB 4ASMB 2WKKA 4IQPA 1RITA 1D0HA 4Q29A 1BCXA 1ZBA1 1AX0A 4C0BA 2FZ1A 4X8NA 4BLJA 5JSOA 1O4YA 3R05A 4XFBA 1WGPA 4RR3C 3SH3A 2ZX2A 4URTA 5ABJC 4CDXC 1H4HA 1SBEA 4N53B 2MEV1 1AXYA 4XETA 2EIGA 1AR73 3N36A 4BA6A 1X7NA 4N7IA 2WNVC 3MYXA 2XL7A 5C4WB 1NCQC 1ND2B 3VDDC 2RE9A 4Q4X3 2W08A 1VBC1 3PJYA 2RR11 5H9RA 2JD4A 1UMZA 1A3KA 3H0OA 4IEPA 3T1MA 2R041 4IEUA 1NZCA 1AL21 4MXVA 2HEWF 3NAPA 2Q0AA 2R1BA 1S0BA 5EXOA 3AMPA 1VB4A 1FATA 4LBLA 4PDWC 2DVDA 4F7ZA 2GMEA 5C33A 3WW3A 3N7KA 4Q27A 4R9DA 2MNGA 4GALA 2IXHA 5L7OA 4R9CA 5FQ0B 4EN6B 3WG2A 2A70A 1AZDA 1FV2A 2JICA 4M3CE 1MEC3 2PAKA 3T1LA 3CEWA 4LLOA 1O3RA 2SBAA 3B01A 1D2QA 4X6QB 2BWAA 3LA7A 4COZA 5GALA 3W58A 3J8F3 1RHI1 1ND3C 4K40A 2A5ZA 1AJOA 1DGWX 1BBT2 5GLUA 5JZGC 4M3CA 1Q8OA 4GQ7A 4OI2A 1OD5A 3AMMA 4HT1T 1B35B 5DUWA 4B4PA 4KL1A 5FTTC 4Y26A 4YM1A 1D2SA 4XJ8A 3V0AB 4YLZA 3V64A 3LB9A 2ZMLA 2SLIA 4AEKA 4CDUC 1RVF2 4H7LA 1CJPA 3SCHA 1M4WA 1DGRN 2D97A 4XJUA 5I0RA 2BNOA 2ZAAA 4QPGA 4YGCA 3SITA 3VZMA 4AFMA 3USUB 2CV6A 1HV0A 1ZX5A 2N7GA 5BNNB 4K20A 4QX5A 2WC2A 4HL0A 4Q1RA 3VBFB 1QJX2 1URXA 2H6CA 3WP4A 3OD0A 1KQRA 4YVWA 3THTA 4MXWB 2VOKA 1QJY1 2VOVA 1Z7S2 1QXJA 3ZSEA 3B00A 4UW3A 4LO4B 1NE6A 4XFCA 3UKVA 2ZMKA 2CGNA 3D4KA 2OZ6A 3SLIA 1G9BA 3KS7A 4DY3A 1CPMA 1C8NA 5EZWA 2VXRA 1RUH2 2OYZA 2Q4SA 3ZFGC 4KNCA 3MW4A 1GBGA 4YZ1A 3S7EA 3ZYRA 1ZBE3 5D8AB 5FPZA 5GLWA 2F4PA 3VBSA 2HKXA 4ATEA 1AR81 3JBG1 4K6BA 1RUC3 3WR0A 5FMOS 4HBNA 3RJ2X 1R081 4YGDA 5CFCA 4QPYA 2R072 3J9SA 3VZNA 1LU1A 1UL9A 4RD7A 5C8CC 2A7AA 3KZ4C 4YRDA 4XOGA 5BNPC 1KRIA 4LBKA 4Q4V1 3CJIA 5CB7A 1W6MA 3SH5A 1KJRA 4FP2A 4FPKA 3LA2A 1REFA 3AK0A 2JG9B 2RS13 3OCPA 4XF3A 4XDQA 5DG1A 3IDBB 2Y0IA 1I3HA 2W68A 1RGSA 1APNA 1CAUA 2K0GA 2GC1A 5FFOC 3O14A 1YUDA 1YXWA 3DL3A 2GDFA 3GHNA 4WM8A 1TQ5A 5ACA1 1H2MA 3KCXA 4YVSC 3AXEA 3ZFEA 3JCIA 4PIZA 2CAVA 3DPRC 1RUF3 1PK6A 2D6OX 3RZZA 1OSGA 2HWF3 2R0HA 3JB4C 1V00A 3B9CA 4Q0UA 4DS0A 3FMGA 3N7MA 4M3CF 3KT1A 1AYN1 1LRHA 2D5FA 4XFFA 5KXDA 4YM3A 2HYKA 2RS51 5BUVA 3VBUB 3EJKA 4NPRA 1X50A 4Y1YA 1LR5A 2RS33 3PTYA 3GNEA 3M2MA 1LGCA 1V6MA 2EAAA 1QQP1 2GU9A 2VVFA 1DGRA 4PBOA 4QQOA 4FPFA 3JB8A 5BNOA 1S0DA 4RFT0 3H50A 2TUNA 3FBYA 3RSJA 1DZTA 1KD7A 1ZBA2 2QCSB 2XKOA 4AXOA 1OFSA 3O7OA 1LOCA 3MF6A 1YLLA 4EV0A 3CJXA 4IEVA 5DXDA 1GANA 2VGDA 4HPKA 4C1XA 3VHOA 1GICA 2VMIA 5GLZA 4RS5B 2ZABA 3B3QE 4Q8LA 2A73B 2BPA2 1N1TA 1QF3A 5KXCA 5SV5A 1LKNA 5GKAC 1VBC2 4TZDA 4HFSA 5CIRA 3N7JA 4YZ3A 3RQ0A 3IT8A 2ZCWA 1J59A 5KHIA 1LHWA 2BBVA 1HW5A 1OA3A 2R042 1BKZA 5HCFA 1Q56A 5JCTA 1CAXB 3OTFA 4I01A 4GWNA 4IEZA 2FBEA 4H7MA 5K8SA 1YYNA 4QGLA 1GZCA 2AZ5A 2B9UA 4Y4YA 4ZU4A 3PJQA 4EN0A 3I54A 2EXIA 5CG9A 4LUMA 4RGGA 1QH7A 1MQTB 1WLCA 1PIV1 2BVVA 1LOFC 5J48A 1YFUA 2Q30A 1RHI2 3L2YA 4AI1A 5BY5A 3PVNA 1LODA 2VVEA 3PMSA 3WHTA 2GMMA 1PGSA 2HWB1 4PBPA 1ULFA 1IS3A 2JJ6A 4RGAA 2P3IA 1IQAA 4XJAA 5EWSA 3LAGA 1D4M3 1XU1A 3GF6A 3NW4A 1K5MA 2E7QA 1MACA 1OLQA 2GMPA 4UBGA 1NA1A 1LGNA 3CU7A 5AFEA 3TOJA 1R1A3 2Z42A 3WW2A 3ECQA 3HT2A 1HRV1 1PNGA 1ZVFA 2WS93 2XJTA 3KD4A 1N1VA 4Q1PA 1DBNA 4CEYB 3WVJA 4HSJA 3UKNA 1F5FA 5JOXA 1DQ1A 1RUJ3 1COV1 3BCWA 1QWRA 1H1AA 1VIWB 2R063 1W0OA 3E6CC 2WL1A 3PLQA 5A3MA 3X29B 1QJY2 5IT6A 2O1QA 1N47A 1H9PA 3HBZA 5KHJA 4ZU7A 1XE8A 2WNUB 4MGIE 2UWAA 3BB6A 5LK7B 1R091 5FO9B 1ULGA 4IESA 2X5IC 2XWBB 1IGOA 2WT1A 2VH9A 1B09A 3AYDA 2DUQA 4AI0A 2ZGOA 4N43A 2YYOA 1S2KA 5JWPA 2XBO1 3R4UA 3BOPA 4K21A 2Y38A 1ZZ8A 3MIEA 1VBD3 5I8YA 3THPA 3JBG2 4OUSA 4Y20B 4I3GA 1R082 1PO13 1JOJA 4ONUA 2UYAA 1VBB2 2NQYA 2PLV1 4L97A 1N3OA 4M0HA 4DXZA 4JQRA 4WV8A 4ZU5A 4E4DX 4XE9A 2XJPA 3WG4A 1QH6A 2VECA 1IOAA 2JE7A 3TN92 1RMU1 3ZYJB 1V9U1 1VBA3 3TB0A 4META 2E6VA 4WZFA 1C5IA 1POV1 1S0EA 4R4XA 3BIWE 5F6LB 4IV1C 2HWE3 5DG2A 4NR1A 1FNZA 5ACA2 1KS4A 1L3JA 2CGOA 3AYEA 4P14A 4B4RA 3J4UH 1SLAA 3O12A 4O9GA 4CDQC 4AW7A 1OOPB 4OFGA 4AEDA 4CEWC 2Y0OA 1TNFA 5AFBA 4GB31 1QU0A 2AGSA 2UY8A 1MVEA 2XUMA 3WCSA 1OA4A 1H2LA 4Q0QA 1REEA 1QJU2 1QGLA 5D1IA 1RUG1 4AHXA 1WCKA 1XE7A 2YGLA 1IS5A 5T5OA 5A3LA 5JOZA 4J6GA 2AR6A 2VW1A 4JGZB 2BEOA 2HWD3 3ZIXA 2WZR3 3RRDA 5KHKA 1AVBA 3VBHC 4HZFA 2GC3A 2OA2A 2VNRA 2DV9A 3RPQA 1AXKA 3VBRA 4JTNA 1Z78A 4KWLA 1N3PA 1GKBA 3IPVB 4QPIA 3N3HA 3ZSJA 1ZRRA 4Z07A 3OY8A 3SHRA 3GBGA 1RTVA 3AM2A 4GH4C 3FHIB 4LBQD 1RUD1 4JGYC 1SFNA 1QDOA 3H3ZA 1CIWA 1W6OA 4JDOA 4L11A 1NCRA 1HX6A 5F6KA 1RUI3 1PGL2 4E4SA 3UK9A 4DOUA 3VKNA 4S2DA 4XQDA 2KA3A 3EQEA 2Z5WA 3N4MA 2I45A 1PZ8A 2DVAA 4Z92B 1KDMA 1J58A 1H8TB 1UAIA 1ZZBA 1GZWB 5JPNB 1CGPA 1HQLA 2BYVE 3AMQA 5GJ6A 3DKWA 1AR61 4PLNA 3VKFC 4QXKA 3N35A 1YO8A 1IPKA 1POV0 1VRH1 1S55A 5GLTA 1U5IA 5I8SA 3VBOB 3LWCA 4Y1VA 2VUAA 1VJ2A 1Q5OA 2JG8C 1V6NA 3U11A 4ES9A 1JYIA 5FO7B 4Q2FA 1FT9A 3KT7A 1ZZ6A 5DDJ3 1PIV2 4MGYE 5I93A 2WSVA 3C2UA 4AI2A 4EJRA 3OJBA 4YNIA 3KGZA 3JQWA 2QKDA 2YUEA 1DQ2A 3WP5A 1PGW2 1BEV1 4DZGA 2QUOA 1NOVA 1UIJA 4LNVA 3E5UA 2HWB2 5FMOL 4GIQA 1UN1A 2RMU1 3FZ3A 3M70A 3K48A 5J37A 5AC91 1XQNA 4LR4A 1BBT3 1DYPA 5FLJA 1UD1A 3JD73 4XW3A 3ZXDA 3S0MA 5KXEA 1VLNA 2IWGB 5JDBA 4H14A 1CAWA 2EALA 2PHXA 1HRV2 4LLFA 4K1ZA 3JUUA 2ETEA 1DG6A 3M4FA 4NWWA 4AI8A 3H1MA 5JOYA 2B5HA 1RVF3 3P3NA 3AB0A 2YMZA 1FOD1 3AX4A 3H3UA 4OHWA 1IKPA 3AKSA 1W6QB 3TYJA 4EWEA 1COV2 5I0SA 3MLJA 2XLGA 4BM8A 1AHSA 4FT8A 4UW4A 4JCKA 1TME1 2P37A 3AFKA 4FQZA 2WQZC 3NWKA 4FAGA 1GFF2 3TAYA 3ZFFB 4CDWA 1R092 1H1IA 1XNDA 4XF0A 1EAH3 3WW4A 1CVNA 4KGGA 4AWDA 4Q8KA 3HMYA 5C9AB 3MDPA 4Q4Y3 1OKQA 1XRUA 1T6GC 1UPSA 4K9SA 1LOEA 3M3IA 4FPLA 4LHNA 4Q4W1 2XBO2 5K7PA 4WVMA 1H9WA 3J26N 3FLRA 4RA0A 3RNSA 3FUQA 1ZNPA 2DCKA 2PHRA 3WOGA 2JECA 4AFAA 1A8DA 1QY4A 5LRRA 1UX6A 1V6KA 5LK5A 2EVXA 2CYFA 2FMYA 1WMEA 1BK1A 2ZHKA 3HQXA 3INAA 3ZXAC 1G6NA 2PLV2 3CO2A 5I91A 4EN8B 2ZA9A 4GA9A 3ZXJA 5GZEA 5A33B 1RMU2 1LOGA 3KB5A 2NPIA 1HKDA 1V9U2 4WM7C 4KU8A 3P3PA 4JTOA 1AR71 3D0SA 4RQPB 1FX5A 5K0UB 2WNEA 4N90A 1C28A 3TBDA 2HWC2 1LU2A 2WFF1 3I8TA 3KCYA 5L19A 5CFDC 1GLHA 2ENRA 4Q4X1 1JN2P 3M8LA 4YZ5A 4IXLA 2H6BA 2QZ3A 5DZEA 4M00A 1HXS2 4N53A 1WA4A 4I0BA 3BALA 2QQPA 5C4WA 1ND2A 1V6IA 3L2HA 5EYXA 4GB32 4LO5B 4TYSA 3WDVA 1VAVA 3EO6A 4N7UA 3AP9A 2GN7A 3RMXA 1ZA4A 1UZZA 1SDWA 1RUG2 3H8UA 3NO8A 3RDIA 4I3PA 1SLCA 1MEC1 2ZX0A 2VMGA 2QDRA 4GMP3 4RR3B 1C5HA 5ABJB 4FO9A 4COWA 4CDXB 2VQAA 1C8M1 5JOWA 4Y24A 2JX9A 3FC0A 2WNVB 1XNBA 3J8F1 4UBHA 5DUXA 5FQ0A 1IKQA 1NCQB 1H2NA 4PLOA 3O5SA 3B69A 3VDDB 3ETQA 3PVEA 4G3YC 2R0FA 1YFYA 1YI7A 2CL2A 3VHNA 4HETA 4I02A 4BMEA 3NAPC 3WDXA 2XB6C 1ZBA3 1MZFA 4HVRA 1LHNA 1WLTA 1VB2A 4IEQA 4QHBA 1NYWA 2PHUA 1RUD2 1YIPA 2E51A 5L7OC 3IMNA 4XHXA 4PDWB 2PELA 1ZZ9A 4FPCA 2ZOEB 4HSLA 1UU4A 1B35A 4QT6A 5I0TA 2O0OA 3ZIWA 4YARA 1ENQA 1LCLA 1Q3EA 1YCIA 3V0AA 3SNMA 3IWZA 1O3TA 4AQ6A 3AP5A 5HBAA 2CAUA 1VBC3 3QH6A 2PHDA 2BNMA 4YGEA 1LHOA 4QQPA 4C91A 1OLRA 1MS4A 1X8EA 3HR9A 1MZEA 4YW4A 4TLFA 3GHMA 1AR62 1RUE2 1ND3B 1UCXA 1WLWA 3USUA 4C90A 1VRH2 3B5LB 4IV3C 2A3YA 5JZGB 5BNNA 1EY2A 2UY9A 3VBFA 4LBJA 3VKLA 2OUJA 2BFUS 1CPNA 3LGRA 1OQEA 4JRAA 3WP6A 5JSRA 1PZ7A 5JPMB 4GMP0 4MXWA 2ERFA 5C8WA 3MFCA 4FOVA 4CDUB 3KGLA 4BYYA 4PF5A 4QPGC 1BEV2 4IV3B 1PMIA 4YZ4A 1ZBE1 4NWVA 4LBOA 3ZSLA 1TMF3 1MS0A 2A6VA 2RMU2 4IL7A 1FYUA 1RUC1 1BJQA 1NQJA 4B8EA 4E2QA 3B02A 3WG1A 5H9PA 4YVWC 2GNDA 1PNFA 4EROA 2D43A 1WMFA 4MGKE 5D8AA 3MI8A 1PVC2 2P34A 3FLPA 4AVBA 1ZM1A 1QNYA 2DYCA 3CNAA 3FLTA 1ZRFA 2RM23 3AP6A 4P9YA 5AVAA 4B4QA 4R4ZA 3AZXA 3KSCA 1UF2C 2IXLA 3ILNA 3ZFGB 4AGGA 2X8KA 3MIGA 1WBFA 3VBSC 2LUWA 1E57A 4GKXA 1VBE3 4YW5A 5FPXA 1VAKA 2ZGMA 3MFAA 4FCAA 5L73A 4AF9A 3H9AA 2D7FA 3AZWA 3ZYIB 2JG9A 1RUF1 4XFAA 4WZCA 5E1RA 5CFCC 3BOWA 1IHMA 3MIBA 1EV12 1WW7A 2GAUA 2O8QA 3WD5A 4DRVA 1GR3A 1AR91 2D3SA 4AE2A 1JBCA 2ZHNA 3CJIC 2EAKA 4Q4W2 2GNMA 2ZTNA 4A7YA 5C8CB 2MHFA 5BNPB 1F2NA 2ZGLA 4ISRA 5LEJA 4UXAA 3GZUC 1D0GA 2ZPXA 3KMHA 2RS31 2JENA 1XU2A 2EXJA 2GN3A 4COVA 1ONAA 2R49A 5E88A 1VAMA 2XG3A 1J1TA 4OULA 4EN7B 1G9DA 1IS4A 1Q8VA 4WM8C 1WUVA 4I0AA 3VBUA 4HVOA 3ZFEC 5J36A 1PK6C 5GM0A 1CX4A 2CTVA 4YVSB 4HMZA 2B7YA 4XBLA 1VBB3 3MIHA 3DPRB 3POWA 5BYNA 1ZRDA 1IPJA 1ASJ1 3SH4A 4D7SA 1NY71 1AR72 4BZ4A 3RJRA 5IK4A 3LZZA 1U5YA 4P9GA 2E9QA 5DZGA 1W6NB 3TN93 2WFF2 4PIYA 4Z1VA 3LSEA 1OQ1A 4Q4X2 2R30A 5F9TA 4I2OA 4CTEA 3ATGA 3LKJA 4HVQA 5H9SA 3AMNA 3LOBA 3MLLA 1H30A 4XFGA 3AZYA 1DYKA 4RS5A 4OVEA 4YW1A 3ZVXA 5BNOC 4SBVA 3R6SA 2MEV2 1CONA 5I8TA 3ES4A 4B29A 1U5XA 3ENRA 5T50A 2VPVA 2ZZJA 3GYDA 1GQGA 4O9EA 1EYBA 2KXLA 4ZXKA 2RR12 1MEC2 2QVSB 1QXRA 4OLLA 1AYM3 1KS5A 1CAXA 3NV3A 2BWCA 3VL8A 1MR5A 4EN9B 1C8M2 1QJU3 1AL22 3MGUA 3UJOA 1A78A 4HK8A 1MVQA 1Y7BA 3J8F2 4CP1A 1S0CA 5F1RA 1NXD1 1W6PB 4QQ2A 3TRSB 4DB5A 1BZWA 4RHV3 1PVXA 2E7TA 5BNQA 3IBMA 3L9JT 2ZGKA 3FFZA 1MQTA 4FTBA 3RYRA 1ZZ7A 1D4M1 3B94A 4JRLA 3MPPG 4HKWA 4K1YA 2Z69A 1R1A1 1N1YA 2VQ0A 3LA3A 2VG9A 1N3QA 2XLAA 4XJZA 2WS91 1JW6A 1SEFA 3H7YA 2YZ4A 3AZZA 3E6DA 1MZ6A 2JDZA 5CU1A 1LOFA 2WA4A 4PQ9A 1GQHA 4LULA 1Y9QA 4TWTA 3PHMA 1YJKA 1RUJ1 2AYHA 2A6YA 2R061 3D0JA 3ZYPA 2C9AA 3HT1A 2NMOA 2ZGSA 3HD8B 4FVVA 3D82A 3TNPB 4LTAA 5JIAA 5FLIA 2WZPP 3RI9A 4CEYA 1FAYA 1X8MA 2PN5A 1K5MC 2DF7A 3AFGA 4JDNA 1NA1C 1LEDA 4LE4A 4LA3A 3M7AA 4UW6A 2DVFA 2H0VA 1FPN3 5H9QA 1XNCA 1ZBE2 1HDKA 5K9YA 1CD3G 2YGMA 2WNUA 4PJYA 3WP3A 4XZPA 1KITA 3LCPA 1VBD1 4FOQA 5EYYA 3RG0A 1RUC2 3QLQA 4AHWA 3SISA 2FQPA 2D44A 4JVAA 4D7TA 4FOWA 4Q26A 5A32B 2OPKA 1O5LA 1WLDA 1CQ9A 4CYDA 2A75A 2KM2A 1GNHA 2O8OA 3BU7A 1RUNA 4Y20A 3ZDSA 3ZPYA 4BHPA 4BIFA 1AR82 5CBLA 1GNZA 2X5IB 4N43C 2ZHMA 1X82A 2GZWA 3QCWA 1KDKA 3AKPA 5J09A 3RYKA 4FAHA 4KH9A 4FTSA 5FDBA 1COV3 1GSLA 1ULEA 1J3RA 4ATFA 4Q4V2 1UKGA 2NMNA 3WQ7A 1ALYA 4N9HA 2WT2A 5DZFA 1CN1A 1NG0A 2UURA 3ZMOA 1DGWA 4V1PA 3ALQA 1VALA 4B3NA 2E7AA 2V73A 1DIWA 4JV4A 1AR92 1LOAA 4QM9A 4AFCA 5B2GB 1XYPA 2ARBA 2GC2A 3OD4A 4JDMA 4Z2WA 3O0WA 1LTEA 3I7DA 3WHUA 2VUJA 4NN0A 3URFA 1JHNA 1UPIA 4AGVA 3EBRA 1OOPA 3WUDA 2LALA 2RS32 1ULCA 2IXJA 3AXDA 5JMCA 1YWKA 5HCBA 4FBFA 3C3VA 2HWD1 2WZR1 1QKQA 5E8AA 3OBTA 1M06G 1LHUA 5JAXA 4PCRA 3OBRA 4IV1B 3ME2A 4R8HA 1G86A 2ZX1A 4MX3A 2Q5TA 1HRI3 4A3XA 1AYN2 1H8VA 2D93A 4E4ZA 4FTEA 5BV6A 1FMD3 3PVBB 1Q8PA 2RS52 3NKGA 1CAVB