3WW2A

X-ray structures of cellulomonas parahominis l-ribose isomerase with l-psicose
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
248
structure length
241
Chain Sequence
b'TRTAISRREYDEWLSEAASLARALRYPVTPEMVNDSAGIVFGDDQYEAFAHGLWSREPYEVMVILESLNEPAVDGLPAAGAAHAEYSGLCDKLMIVHPGKFCPPHFHQRKTESYEVVLGEMEVFYAPEPVTVGDDDVLSFSPMPEGSPWPEGVALPAGREDSYAGLTSYVRLRAGDPKFVMHRKHLHAFRCPADSPVPLVVREVSTYSHEPAAPLPQWRGLHDNTFVAEAANSGRLATAIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ribose isomerase
publication title Essentiality of tetramer formation of Cellulomonas parahominis L-ribose isomerase involved in novel L-ribose metabolic pathway.
pubmed doi rcsb
source organism Cellulomonas parahominis
molecule tags Isomerase
total genus 60
structure length 241
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ww2A00
3RNSA 4EWAA 4XETA 2C0ZA 1QWRA 2PFWA 3D82A 5E16A 1RUNA 2D40A 2VQAA 4IEZA 3HT2A 4XFFA 1CAWB 4IEVA 3I7DA 2GAUA 1DGWA 1RTVA 1V70A 5JSOA 1ZREA 3IDCB 1LKNA 1J3QA 4QGMA 4J1XA 2Z2SB 5J48A 3DV8A 3NVCA 2GU9A 5FCCA 1UIKA 1UIJA 4FT8A 2EA7A 2GC3A 3TNQA 3H9AA 3TNPB 2O8QA 4HN0A 4HSJA 2CGPA 4HN1A 2UY9A 3D0SA 4B29A 2IXLA 4ORFA 5FQ0B 4XFCA 2Q30A 4XFIA 4TLFA 4KL1A 4FBFA 2N7GA 2Q0AA 2Q4SA 3WW2A 4R52A 3G7DA 3BPZA 4QM9A 1O4TA 2BNNA 3BB6A 3RYPA 4F8AA 4HVOA 1EPZA 1DZRA 4OLLA 4XF1A 4IEOA 1XE7A 4AVBA 1FT9A 4MZUA 5LRSA 1G6NA 4HBNA 3VHRA 2B9UA 3KGZA 2MHFA 1OFNA 4R8HA 3MDPA 4H7LA 1SFNA 4P9GA 1CGPA 5LEKA 5E1RA 4WZCA 4L11A 4JTNA 3U0ZA 4KU7A 4PIXA 1YFWA 4XFBA 2OA2A 4IETA 5AVPA 4Q0QA 2D5HA 3CLPA 5C8WA 1XE8A 1RL3A 2UY8A 2WC2A 3EHKA 1SEFA 1ZZCA 3OD0A 2ETEA 4OFGA 1U12A 2OPKA 3SMHA 4HVRA 4LUKA 2IXKA 3M70A 4WVZA 1O5UA 3S7EA 1Q3EA 4ZU5A 2IXHA 1IPJA 4QGNA 5LRRA 5BPXA 1QXJA 4MX3A 3UKTA 4UBHA 4D7SA 3KGLA 3KCCA 3R6SA 3DN7A 1LR5A 4META 3RPQA 2D5FA 2B8MA 5FLJA 3EO6A 4MGYE 4IERA 5HI0A 4LULA 1ZNPA 3LWCA 5FPXA 4J1WA 4QX5A 2K0GA 3BCWA 2PAEA 3OF1A 3KSCA 2XLAA 1VP6A 5KHKA 4XFHA 2V09A 3E6BA 4EWEA 2QNKA 2QDRA 1WA4A 3CEWA 4XF3A 3UKVA 4IEUA 2PAKA 1JUHA 3FZ3A 4A2UA 4N9IA 3U11A 1GQGA 4IESA 3WW3A 3E5UA 4WBBA 1ZZ8A 2H0VA 2PQQA 3H7JA 3LZZA 3FHIB 4YYOA 4XF9A 1ZRDA 2OZJA 4XEZA 1O7FA 5FLIA 2CAVA 3FX3A 3H1WA 4LEJA 3IDBB 3NL1A 1IPKA 3H7YA 5C6CA 4O9EA 1J1LA 4FAHA 1OI6A 1YHFA 2Y0OA 3NSTA 2XKOA 4YNIA 1O3TA 4I09A 5BUVA 1PM7A 2ET7A 2BNOA 4IEQA 1TQ5A 1CAXA 2D93A 2BEOA 3SCFA 1ZZ7A 2QCSB 3IWZA 2Q1ZB 4JTOA 1ZRCA 5I91A 4K8FA 3BU7A 1NZCA 3ELNA 4QGLA 1NXMA 2XKPA 2HJIA 3HT1A 4KWLA 2H6BA 4I3PA 2GC1A 4HLTA 1ZX5A 3EQEA 3N4MA 5I0RA 3ST7A 1I6XA 2ATFA 1ZZ6A 4Q0VA 5F1RA 4D7TA 3GBFA 1VR3A 1YUDA 2CAUA 4FAGA 3WW1A 4KWKA 3M3IA 3MYXA 3D0JA 4XF0A 3FE5A 1VJ2A 4MGKE 5I8TA 2PHDA 4I02A 2FMYA 1ZVFA 4AQ6A 4I0BA 3UKNA 3C3VA 2ET1A 2XGXA 4XF4A 4LTAA 2BNMA 1CAVA 3EBRA 1PMIA 3E6DA 2XL9A 4BHPA 3PVBB 4Q0UA 1GQHA 4E2QA 4UXAA 1CAXB 1NE6A 1ZRFA 3CL1A 4DINB 4BYYA 4LUMA 2GZWA 4JV4A 3SCGA 3CO2A 1ZRRA 5FLHA 5I0SA 1QXRA 4YARA 1EY2A 2IXCA 3H8UA 3OTFA 3SCHA 4BH9A 1Y3TA 1UW8A 2XHKA 3KMHA 3E5XA 2PYTA 5BV6A 3RDIA 1X82A 3B02A 1H1MA 2EVXA 1SQ4A 1WLTA 3H3UA 3QOPA 5JSPA 3H1MA 4LA2A 1X7NA 4MGZE 3GYDA 5BXXA 3HIFA 5EFUA 2ZCWA 3LA7A 1YWKA 2GH2A 2WFPA 1FXZA 5FPZA 1NE4A 3I59A 3ZDSA 2IXIA 3NW4A 4XFGA 1WGPA 2GC0A 5LEJA 2K9ZA 3JZVA 3O14A 4AVCA 2KXLA 3OGJA 4BIFA 1YFYA 3LA2A 4Q0SA 3IBMA 1YFUA 3ETQA 4YSFA 1CX4A 4JVAA 2E9QA 1I5ZA 2PAMA 3BALA 4MUVA 4ZU4A 2ZKLA 4I0AA 1CAVB 4HSLA 4YRDA 1O3SA 3WW4A 3U10A 4PIYA 1LRHA 2VPVA 5I93A 3MPBA 4IEYA 5CADA 4ZU7A 4AVAA 4QM8A 5D1IA 1CAUA 4F7ZA 1OD5A 3S7IA 3ROUA 4AQ2A 2UYBA 3E5QA 3H3ZA 1J3PA 3USSA 4QMAA 3ES1A 3LA3A 5J7MA 3LAGA 3DL3A 3PLQA 5JAXA 1ZZBA 3SXWA 2CV6A 3RYRA 5KHGA 5I0TA 4I01A 2Z69A 3I59B 4Z82A 1DZTA 3HQXA 3S0MA 3IIAA 3MZHA 2H6CA 4EROA 2UYAA 2EAAA 1L3JA 3FJSA 3I54A 1X8MA 2HKXA 3EJKA 5I0UA 1O3RA 2VECA 4AXOA 2FQPA 1J58A 2BYVE 3NJZA 3ES4A 4NVPA 4PIZA 2IC1A 3ACLA 4HZFA 4IEPA 4X6QB 1O5LA 1H1IA 5FDBA 1X8EA 1Q5OA 1NYWA 1UCXA 5CU1A 4MGIE 1DGRA 5I8YA 4Q29A 1UD1A 4UBGA 4XFAA 3RZZA 2MNGA 1QY4A 3NKTA 2PTMA 4RD7A 1RUOA 4EV0A 4O9GA 2BGCA 2PA7A 4KU8A 4Z07A 4HVQA 5BY5A 5KHIA 5KHJA 2F4PA 2O1QA 4KWJA 1O3QA 4E2GA 1CAUB 1Q43A 1YLLA 1XRUA 4EWDA 1J59A 5JR7B 1YFXA 5I8SA 2QVSB 1EYBA 3OCPA 4LLOA 2P17A 4ONUA 4GULA 4N9HA 2MPFA 5K8SA 1CAWA 4QXKA 3E6CC 5KHHA 1RC6A 2XL7A 4Q0PA 3H50A 4IEWA 1Y9QA 4LA3A 5T3NA 4MV2A 1RGSA 4E2SA 3H1YA 3E97A 4CYDA 2QJVA 2DCTA 1OMIA 2I45A 2XLFA 1UPIA 4L2NA 4PJYA 5J3UA 1LB2A 1EP0A 2GC2A 4X6RB 5JSRA 2OZ6A 2B5HA 2PHLA 3FFQA 5FQ0A 5JCTA 2IXJA 3LOIA 2XLGA 3CJXA 5KBFA 4MH0E 1HW5A 3CF6E 3SHRA 1ZZ9A 3RYKA 5CVRA 4IEXA 3L2HA 4HMZA 3DKWA 2OYZA 3FWEA 1FI2A 1J3RA 5EZWA 4I2OA 3PNAA 3QACA
chains in the Genus database with same CATH superfamily
5A7QA 3NMBA 3N7MA 5FOBB 4EWAA 5A3UA 4RS5A 2IUWA 1K5MB 2W52A 5LBBA 4XETA 3X29B 2ORXA 4FPOB 2JENA 1MS5A 2RR12 5DAQA 2ARCA 5JMCA 3I2FA 2VQAA 2WLQA 5FYCA 4NE9A 4QWNA 4A4AA 1CAWB 2WQ4A 4C91A 4NHXA 1RTVA 4D3WA 1S0CA 2XONA 4CEWA 3ZX7A 1GOFA 2KR2A 1ZRIA 4V2VA 2FCTA 3L2YA 1J3QA 3WUCA 3H8XA 1DQ1A 1BK0A 1O91A 2JG9C 2Z2SB 4Q4W1 4YZ5A 1PGL1 3NVCA 4MADA 1W3VA 3ZSJA 1R1A3 4FT8A 1GANA 4QX2A 1RUI1 2DCZA 1PMHX 2GMMA 4XJUA 2GC3A 1JHNA 3TNQA 3WHUA 3WQ0A 1PNFA 1TEIA 4LO8A 2W46A 2O8QA 2QQIA 2WT0A 4HN0A 5K0UA 4BQ2A 2DU0A 2OQ6A 5BNPB 1Z7S2 4HN1A 5CNAA 3MW4A 5A80A 5GJ6A 3WR0A 4UAPA 4JGYC 1ND3C 1WWYA 2VZQA 4KL1A 1VLNA 4FBFA 2JIGA 1HKDA 2N7GA 2OUJA 3AMMA 2Q0AA 4LXLA 4QB2A 2DCJA 2XWJB 5EJ3A 3WW2A 1IS6A 4Y5SA 4ZS3A 2HWC3 1QHDA 3ITQA 1K42A 1XPWA 1FV2A 2DTWA 2JEMA 3AMHA 2PHTA 2BNNA 5JLVA 2WZR1 4S2FA 2B4KA 3RVHA 1V0AA 1UKRA 2GNBA 3SISA 3TRSB 4IEOA 2OW4A 3C7FA 3UT0A 1FT9A 2RM21 4MZUA 4GWNA 4AEDA 1G9AA 4GH4A 5LRSA 5LW9A 1JOBA 2LS6A 3HOBA 4FFGA 3ZVXA 1UX7A 2RJ2A 4XCBA 1JMUB 1UOJA 1MEC3 3WNPA 4QPWA 3M2MA 1SFNA 1W8WA 1ONAA 4LK7A 3AFGA 1R64A 1RUD1 1AR82 3KVAA 5E1RA 1V6KA 3BIWE 4L11A 4FOVA 5C9AA 3U0ZA 4PIXA 1IG0A 2Q8DA 3FHQA 1QQP1 4DQAA 1W03A 5CFCB 1UY4A 2RS11 2OA2A 4IETA 2NMNA 1B35A 4M4RA 5D2AA 3BN6A 1K45A 4TSVA 4Q0QA 5C8WA 2ARXA 2XB6C 4GMP0 2WC2A 3EHKA 4BQ3A 3AXDA 1SEFA 1ZZCA 3ZYHA 1AL22 1U12A 5D8AC 3SMHA 3WG4A 2XVKA 4K21A 5CISA 2WR9A 3W59A 1NCQA 4L92A 2NYYA 2IXKA 3JB8A 1W06A 2C6SA 3RJ2X 5FYHA 4DS0A 1FOD3 3I2GA 4MVTA 3S7EA 1UY2A 4ZU5A 2XJSA 3POFA 4BLIA 1S0IA 1ODMA 5EIYB 4Z1VA 1PO22 1LTEA 1EUUA 2HWF1 1QXJA 3RSJA 1QJU3 3POWA 3P3NA 4LLFA 1PK6A 1E5IA 2Y34A 2VBDA 5T5OA 4BA6A 5L36A 4W4ZA 4BIOA 1FMD3 3KGLA 3ZFFA 4U36A 1ND2C 1W9FA 4L0PA 4R4ZA 2QQVA 1DGLA 5FYYA 3DN7A 4META 3GXUA 2D5FA 3I2JA 4LOTA 5CB7A 3RPQA 5GLVA 1KITA 1W0OA 5FPBA 1VIWB 3A22A 2P3YA 3MW3A 5HI0A 3DKQA 4ZPIA 1W6OA 2BWCA 1W2UA 3T2PA 1VRBA 4GH4B 4EN8B 1QJX1 2R1DA 1YQ2A 2HYXA 4LO5B 1C5HA 2RS31 4D0QA 3ACFA 3IMNA 1JH5A 1SBEA 1E5RA 1VP6A 1WLCA 2VUCA 2W47A 3N35A 4XFHA 5FXVA 2D6NA 2V09A 2VQUA 3NV4A 4AFBA 3H8OA 2EIGA 2QNKA 2Q1FA 2ZEXA 2Q8CA 3VBFA 2A5ZA 2E7QA 2QDRA 3I3MA 4Q1PA 2ZAHA 5GZGA 1HRI3 1BLZA 1NXD1 1SPPB 3ACGA 4XF3A 2HWE3 3UKVA 4D6SA 1D4M3 1BBT1 1DLLA 1R1A2 3NNMA 4FPYA 4N9IA 5C9AB 4Y1ZA 4IESA 1FATA 5F2SA 2P4EA 5IYYA 1GLHA 2RHPA 1B35B 4L9BA 1VAKA 3OB8A 4YYOA 4OMCA 4AHWA 3RZLA 2NP0A 2QQJA 1TME2 5FLIA 3VD5A 4HOOA 1S0GA 1RUJ3 1H2LA 1ZBA2 2YYOA 3BODA 3GZUC 3IDBB 3OY8A 4LEJA 5IJRA 4PLNA 5CBLA 1JYCA 5IFTA 2J7MA 3OG2A 3PVOA 4TYSA 5C6CA 4YG3A 5FZ1A 5ABJA 2I07B 1NCQB 1GZ9A 5IATA 2BOJA 2HWC2 1TMF1 2A1XA 3AP7A 4LBJA 3VL9A 4YNIA 1X9TA 2C24A 2MEV3 1XNDA 5JOZA 2QQUA 5KC5A 2W9XA 3VZJA 1PZ7A 4U2AA 2BNOA 3THPA 4E8DA 3PMSA 3VBSB 4EZ4A 2G4IA 1PK6B 2CDOA 2R041 2VZUA 3BTAA 4QKBA 1WCKA 3M3CA 1S0DA 4M0HA 2YFZA 3B3QE 1NKGA 2QCSB 4FFHA 3HN3A 5CIRA 3OYWA 3GHMA 2YGLA 4OUSA 2AZ5A 1SMVA 3DECA 1ZRCA 4C1WA 4IDZA 4RR3A 3WDUA 3GALA 5DAPA 2AGSA 2WNVC 1F4HA 3ELNA 2UURA 3NNFA 1OOPA 2ZX3A 3AP4A 4YW6A 4YVSC 1JYNA 2PN5A 1Y43B 3WUDA 4P5HA 4KWLA 1W6OB 2YC4A 4JKLA 1EAH1 2B46X 1VRH1 5FZ9A 4AHZA 4D8MA 1LOCA 1BMV2 4DIQA 2GC1A 1ZX5A 2A75A 5FMCA 1H9PA 3WD5A 4XXAA 3N4MA 1KFXL 1UYXA 3RG0A 1BZWA 2HWB3 4QKNA 4XTMA 2ATFA 1LGNA 5JUVA 2BBVA 3VHNA 5FYSA 4OZOA 1RXGA 3H0OA 4ZXEA 3GBFA 5F37A 1YUDA 4RHV3 3T0BA 4AHYA 5LA2A 4J25A 5L19A 4Y1VA 3PDQA 2QQPA 1UOBA 4TXWA 5FYVA 4XF0A 1VJ2A 4PDWC 2RJLA 1ND3B 4JGYB 4MGKE 5CYYA 3OY8B 4A41A 4I02A 3JBG3 2FMYA 1LHOA 4B4QA 1ZVFA 4BXSV 4BQ4A 3K2OA 1QJU2 1KDMA 3C7GA 3WZ1A 1N3OA 1PIV3 3C3VA 4YWAA 1ASJ2 2ZACA 3WNLA 1BEV1 3CBNA 5KXEA 1OPOA 1W8FA 4COZA 1OKOA 2DURA 1UY0A 3E6DA 4YM2A 1ALYA 5KR7A 3GZAA 3PVNA 5GLTA 3FC0A 4IGOA 3Q8AA 5FXXA 4AI3A 1RUE1 1AR63 2WYSA 3KT7A 4UXAA 5H9SA 1OC1A 2J1TA 3DEMA 2HYKA 1S2BA 2ZEWA 3CZUA 3WF1A 2HBTA 3V0BA 4JC1A 4A3XA 1W8TA 1DU3D 2R063 3VL8A 2RV9A 3OYWB 2VG9A 2W2IA 4HL0A 4AFDA 4RR3B 1ZRRA 5FLHA 5I0SA 3BIEA 1RUF2 4YARA 3H8UA 3N7KA 3TN91 3VDCA 4BH9A 3OJBA 1I3HA 2SLIA 1OOPB 1OVSA 2C5DA 4QPGA 2J1UA 3GGLA 4IE4A 4ASKA 2ZGKA 1EV13 1ENRA 2BUKA 2ZBJA 4Y26A 1DQ5A 3ACIA 1X82A 2A6XA 2VUAA 2WN3A 4G4FA 4LHSA 4OZXA 3ZIXA 5F5AA 4CCJA 2FD8A 1LGBA 4LA2A 1HXS1 1X7NA 1AR93 1H9WA 1RUJ2 2Q8OA 1AZDA 1D7PM 2LALA 3PIGA 1LOGA 1M06G 4WM7C 1C8NA 1DP0A 4CCDA 2ZCWA 3MV01 5DAXA 4BQ5A 5BNOA 4YLZA 4XJZA 1UF2C 3BOWA 2RR11 5FPZA 2DVGA 3UL2A 1WMEA 2JB4A 2XQXA 1O8PA 5A32A 2BWAA 1RUG3 1VPHA 3JZVA 3R4DB 4FTSA 2R0HA 4R9CA 2QE3A 5FZ3A 3NQHA 3TBDA 1N47A 1YFYA 5FZMA 3LA2A 2BFUS 4Q0SA 1FPN3 3HNMA 3SC7X 3OEBA 5B4NA 3NAPA 3GZEA 4YSFA 2G19A 2ZHMA 4GD4A 3BALA 1I5ZA 2PAMA 3OD4A 4RFRB 3WG1A 1XNTA 2Z5WA 4YGCA 1ND2B 4UF0A 3I2IA 4A44A 1TG7A 4QQLA 1Q8VA 3SLIA 4AFAA 5CFDC 2WL1A 3BU0A 2W08A 2XHNA 3DXTA 3SH4A 2LM3A 2WWUA 3KQ4B 1K5JA 5FZIA 5A3WA 3WW4A 3U10A 1Z7S1 3WOGA 4LBNA 3V0BB 4IEYA 4GJYA 1WLWA 1Y9GA 5CADA 4NAOA 1US2A 2DWRA 2C9KA 5DDJ3 1XC6A 3T0AA 1X9PA 2VTXJ 1AYM3 3S7IA 3ROUA 3EMRA 1N1VA 1WMFA 3E5QA 3POEA 3J26N 4LKDA 4FVVA 4E4HA 4QPGB 5DZGA 4TZDA 4OHYA 3SH3A 3K3OA 1H2MA 1OKQA 3USSA 3V64A 4QMAA 2X5IC 2VOWA 1HRV3 4A45A 3M3EA 2VBBA 2A71A 2GDFA 2XJRA 1RUC3 2WZ8A 2XUEA 2Y6JA 3HAGA 1W8UA 3ABZA 1FV3A 2A73B 2C1FA 2BERA 1ZZBA 2FDFA 2ID4A 1IKPA 2RMU3 5FR3A 1W6MA 4L99A 1PZ9A 5I0TA 5FYZA 4Q1RA 2VMFA 4I01A 1CZSA 3IN9A 4Z82A 3TEYA 4V2WA 3S0MA 2VW0A 3IIAA 1S0BA 3MZHA 5HCBA 1RUI2 4LKEA 2VZ1A 5A32B 5CKMA 2EAAA 4N53A 1AR81 2WT2A 4AR2A 1L3JA 4EJRA 1X8MA 1UMZA 3EJKA 5L9VA 1NT0A 1O3RA 4AXOA 2FQPA 1WW4A 4HG6B 3NJZA 4L97A 2Y6GA 4N8MA 2QZ3A 4NVPA 4HZFA 5J96B 4CDQC 4TLGA 1X8EA 4CU8A 1Q5OA 3W5NA 1W04A 4UF0B 2Z42A 1TNRA 2R062 1UCXA 3AMPA 4JX0A 4DXRA 1AL21 1DGRA 3TEZA 4ISRA 1CWPA 2FCUA 1ZA4A 5FZ0A 1QY4A 3OBZA 3NKTA 1HDKA 3D8CA 1H8TA 3N9PA 2DUQA 3QBQA 4YVSB 4BM8A 2YUEA 4D94A 4P9YA 3J9SA 4NUBA 3ME2A 3OBRA 1PO21 2PA7A 1EV12 5DUUA 4LOSA 1GNHA 4Q8KA 2RM22 4OUEA 4ET7A 5KWRA 3RJRA 3USUA 4KWJA 4QKDA 3IAQA 4E2GA 5F3CA 4NRMA 3V56A 4ZHNA 3WDVA 4WM7A 2DDUA 2YZ4A 4JDMA 1YFXA 5I8SA 4MGQA 1EYBA 3LF7A 3PTRB 4F3JA 2P17A 5K8SA 2NZ9A 4LBQD 4OQ9A 3FLTA 3Q9OA 4OI4A 3Q8EA 4Q4V3 2XL7A 4UFKA 1RUG2 2B9VA 1U0AA 1Y9QA 4PDWB 5FZEA 3R4UA 3T0DA 4MLOA 5IVVA 1XB9A 3P3PA 1BJQA 3LEKA 3NWKA 4E2SA 5JDBA 3I2KA 1V9U2 1F31A 5GLWA 4IV1A 5CAZA 1OMIA 4DMIA 2B7YA 1UZZA 4CDUC 5JZGC 1UPIA 1GWMA 4SBVA 2ZX1A 1V00A 2CL2A 4N53B 3H3LA 1R1A1 1GP5A 3ZMNA 1G8WA 4QX8A 1KRIA 4CUAA 1AR73 1W90A 2R30A 1XU1A 4C8DA 5EWSA 2B5HA 2PHLA 3FFQA 1TME1 1L7RA 3PU3A 1GMMA 1OA3A 3BOPA 1YQCA 2DBIA 3SEEA 2VNVA 1ZBA1 3LOIA 4XIOA 4PI2A 3CJXA 4CCOA 5FY1A 1HW5A 1D4VB 5FV3A 5IFPA 1OQEA 3VLBB 4XHBA 2ZZJA 4IW3A 2VOXA 2ADEA 1PX4A 2HWC1 1Z0HA 2XDVA 3MIEA 1H8TB 2V73A 1YQ6A 3DKWA 3MLJA 4FFFA 3WNOA 2FDHA 4CCEA 3B01A 5B4XA 5FZDA 1WZXA 4P02B 2YY1A 1FI2A 1NLQA 3K48A 3TWIA 2QDNA 5F8PA 4DY3A 4LO4B 3POGA 1HRV2 3QACA 3USUB 2ZX4A 1JOPA 1RUC2 2XR4A 2LRPA 4NPLA 4AVTA 3B9IA 4B8EA 2E51A 3D82A 1QWRA 1CIWA 4WM7B 5FUNA 2PQSA 4YW7A 4DEQA 4ZS2A 3W5MA 3BTYA 1MR5A 3KB5A 1QMJA 3N9LA 1GICA 5AVAA 1GQPA 3A0KA 3ZSKA 1V70A 3HVDA 2CHHA 4NIIA 1ZREA 1BMV1 3B9CA 4ISQA 2QZ2A 3C7OA 2J1RA 5J48A 5FP3A 3TEXA 1H30A 3DV8A 3VBUC 1UIKA 1ZBE2 1H8VA 5FY9A 4CXYA 4FPHA 4NROA 4CDWC 1WMXA 4RGAA 2W68A 1J1TA 4ZKTB 3H9AA 1VBE2 4Q27A 4JGZC 1P8JA 4IL7A 2ZGOA 4HSJA 4CSWA 3PJYA 3HQUA 2UY9A 2X29A 3D0SA 2Z79A 3RZHA 4AVSA 2VUJA 4OMDA 2ERFA 4XDPA 4B29A 3VBOC 4IE7A 2Q30A 5C70A 2VNOA 5FXZA 4B7KA 1OT5A 3TOJA 4OQ8A 4AWDA 1QJU1 3AB0A 3G7DA 5DUVA 1IHMA 1ASJ1 2WYFA 1O4TA 2WBKA 4Q4X2 4Y5TA 3BB6A 2W92A 2X10A 4TN7A 3RYPA 5IK8A 1EUTA 4YW1A 4IGPA 2Z4FA 3IPVA 1DZRA 1OSGA 3T08A 4BDVB 4ES9A 1WD4A 3ORJA 4PQ9A 2P34A 1JU4A 3LOBA 1LOAA 3N9OA 1JOJA 2PLV3 4NRQA 4HBNA 4M00A 3U07A 4B7EA 1AYN3 1VRH2 3PU8A 3KQRA 1WCDJ 4PBPA 3VHRA 3WCRA 3OGSA 2FCVA 5EYYA 4JAAA 5ACA2 1X36A 1UYPA 3KGZA 5H9QA 1PNGA 2MHFA 3CZJA 4FOWA 3KHBA 2BV4A 2W1SA 5APAA 5C4WA 3ZFGA 4H7LA 2LW8A 2GP3A 1RUF1 4P9GA 1CGPA 2P1BA 2WO3A 5LEKA 4JTNA 4DFSA 3JD72 4PF1A 3K51A 4BQWA 1F5JA 1D4M1 4YZ1A 3MUY1 1RYYA 3ZXAC 1SCRA 5D21A 4OHZA 4OCTA 1IOAA 2WNUC 5C8CC 5J1XA 1RL3A 3WG3A 1YIFA 1ULCA 4CDQB 1JI6A 2LUWA 1VBC3 4GXLA 1RUJ1 4HVRA 4XPVA 2GH8A 4LUKA 5FPUA 4M01A 3M70A 4WVZA 3ZYJB 3NJYA 3U1XA 3BTXA 1W8ZA 4P9XA 5LA1A 2OX0A 3AYAA 4BMEA 1S1AA 1OHFA 2NLRA 2Y6LA 1IPJA 2VW2A 3K3NA 4FOQA 4XUPA 1GZTA 4AAXA 5JR2A 3BI3A 2ORZA 4W8JA 2D97A 4LHNA 2VJXA 5BPXA 3AL6A 3JCIA 5T54A 1FX5A 2XH6A 2W3JA 2YG0A 5BNPA 2A6VA 2QQLA 4COUA 3ON7A 3UKTA 4NIHA 1SLCA 4N90A 1TNFA 1OLRA 4AQTA 3U78A 1UXXX 3I2DA 5JIUA 1OVPA 3IPVB 4CU7A 4YW3A 2XOMA 3PL0A 1CIYA 4LULA 3LWCA 5FPXA 1A34A 2YB7A 5F3IA 5T55A 5FBJA 1D0GA 5BNNC 5LATA 3KSCA 2XLAA 2HWD2 3LGRA 1ZA7A 1SBFA 5FYIA 3WDWA 4HT1T 5CKQA 4XQ4A 3THCA 1VBD3 2XPJA 2JDUA 4CDUB 4IEUA 2PAKA 4YZ4A 3T30A 5FZCA 4A2UA 3ATGA 5JZGB 1HLCA 5LWBA 3POIA 1G7YA 4GAZA 5FP8A 2VZSA 4LKFA 3VDBA 3J8F3 2VAUA 4FPKA 2PQQA 4Q4Y3 3M7AA 2P3JA 3FHIB 4RHV1 4XEZA 5T5PA 1O7FA 3FX3A 2AR6A 2CTVA 3ACHA 3H1WA 4CUGA 5J37A 1JZ8A 3AKPA 3NL1A 1S4CA 5CFCA 1IPKA 3H7YA 3RZJA 1QOSA 2QBXA 4BQXA 1E5HA 3T09A 1J1LA 1OA4A 2ZGRA 1OI6A 1BCXA 2Y0OA 1ENSA 4OHWA 4S2HA 2XKOA 3K75B 4Y20A 2EAKA 4HONA 4P00B 4XMIA 5JPMB 4I09A 4BPZA 3RRDA 4NJ4A 1O3TA 1PM7A 1Y9MA 2JG8A 3JQXA 2XXZA 3K4AA 5FP9A 1TQ5A 1CAXA 1Q8OA 4FXGB 3IAPA 3ZMOA 3ILFA 5C3SA 1LENA 5C3QA 1UAIA 1YQ8A 4QXBA 3OPTA 5JI7A 3VDDA 1RJ8A 3ZFEA 3SCFA 1PGSA 5JVVA 5CKNA 3UJQA 4M3CA 5IWFA 5HXMA 1GZWA 4QKFA 4JTOA 5LBEA 4DOUA 2R061 5LK7B 3VKLA 3NKGA 1RXFA 1SLLA 3KVBA 4CXXA 3N7JA 2XKPA 2HJIA 1VE0A 3H42B 4Q26A 4JKMA 3R0RA 2I74A 1CN1A 1MS9A 5F32A 5BYNA 5M0TA 1S2EA 1XSQA 2HBUA 3EQEA 3PUHA 3UK9A 1YCIA 1EV11 5I0RA 2FHRA 1I6XA 2UWAA 1ZZ6A 3JUUA 4CPBD 5FRAA 4PF5A 1QJFA 1JZ4A 3VD4A 1MQTC 1A78A 2QKDA 3HN1A 4Q0VA 4AF9A 2J42A 4CDWB 2BJSA 5F1RA 1VR3A 2VULA 2YBKA 3S57A 5FMBA 4GB33 4EN7B 3DPRA 4IV3A 3WW1A 4JGZB 3OUHA 1FAYA 4XQWA 3M3IA 4K9SA 1PM4A 5DPNA 3MYXA 1SPPA 3D0JA 1XJAA 4KH9A 5I8TA 4CRQA 1RUG1 3SKJE 3MPPG 4I0BA 1OPMA 4KMQA 4O61A 3UKNA 3R4SA 3WVJA 4GWMA 2ET1A 3N9NA 5J09A 2GSYA 2XGXA 5HBAA 1HJFA 1V9U1 2JDMA 1UL9A 5AC92 4HK9A 1XYPA 4Y20B 2P2KA 1PMIA 1VBB3 2AH2A 2XL9A 3LIHA 3ZPOA 4AGGA 1COV2 2BTVC 2JG8B 4RGKA 3AVSA 2XVGA 2G9GA 4MYEA 1CAXB 2ZGLA 4UI9L 2D6OX 2OKXA 1AX0A 1NE6A 5FPVA 3KD4A 1ZRFA 3O12A 3CL1A 4AI1A 1VB2A 4BYYA 4LUMA 3VDDB 3ZFEB 5IHRA 2X53S 4OI0A 4M3CB 1H0BA 1G9BA 2SBAA 2V5YA 2ZX2A 1GZWB 2R0FA 4NN0A 3VBSA 4EE2A 4UWDA 3WCSA 1QXRA 3VN4A 1EY2A 3MIFA 2ZHKA 3P5BA 2VMHA 2KM2A 4UFJA 5FO8B 1C4RA 1UW8A 1VBD2 5IAVA 4GKXA 1O8SA 3TYJA 1IZ3A 5EYXA 1ODNA 3FFZA 1AJKA 2BDRA 5FUIA 2JICA 4AHXA 3D6EA 3B02A 4Q4Y2 1DCSA 4EZHA 5A3OA 3VKMA 3ZSMA 3UV9A 4HFSA 1WD3A 3GYDA 5F2WA 1HRV1 1OQ1A 2LROA 1H2KA 1RUC1 4XDQA 3AKQA 4P9IA 5JXJA 3LA7A 1XXNA 3BUCA 3T1LA 2WFF3 2WFPA 2YGMA 2JG9A 3IZOA 3DPRB 4IV3B 3PUIA 1BQPA 3AYDA 4FPGA 5FY4A 5I0DA 2EF6A 2VC9A 2WAOA 1W6QA 4QX1A 1W8OA 4RFT0 4URAA 4IXLA 4BIFA 1Y7BA 4PHZA 3MF6A 4IE0A 4UW5A 3T2QA 4AI8A 2YMZA 1QXPA 2FZ1A 3PURA 4MHUA 2NMOA 4WM8C 1R093 4LK6A 3UJOA 3IBMA 5DAWA 3KV9A 1HQLA 4JVAA 1SG3A 2E9QA 2CSGA 2AENA 3A4UA 3NJVA 1ND3A 2ZKLA 4JGYA 4MUVA 1ZBE1 2WNOA 5DUXA 3URFA 3LD8A 4DY5A 1XNCA 1O3SA 1NA1C 1DDLA 1VBE1 4H55A 3IDEA 4PIYA 2AEZA 3GZTB 4N43C 1YI9A 4AFMA 1IPSA 1RVF3 4PI0A 1RHI3 5I93A 3WG2A 3B5LB 3MEPA 1N1YA 4KBZA 1UMIA 1YJKA 4GWIA 4Y1XA 5LA9A 5A7SA 5D1IA 3VKOA 1DYKA 1WCUA 2HEVF 4NPMA 5DZEA 4QQHA 3U37A 3N36A 4XHXA 4AQ2A 2BVBA 4JQTA 4CE8A 4Q4X1 4QQ2A 4CEYC 4XDOA 5EPAA 1WBLA 2D6PA 3IT8A 3I2OA 5FYBA 4GWJA 4QHOA 3ES1A 3LA3A 1MEC2 3T1MA 1DG6A 2WQ8A 2VUDA 4J6GA 4QU2A 3O1VA 5T5LA 1QOTA 4Q4V1 1LHUA 3PLQA 2D3PA 5JAXA 1MVEA 1OH3A 1AXZA 1V6NA 3SXWA 3JQWA 5DQ0A 5ACA1 3ZPYA 3WQ7A 2JG9B 4WVMB 1IQAA 4XC9A 1SACA 2H6CA 3EB7A 5FK7A 4EROA 5IT6A 1VBB2 1UY3A 1W6QB 2X8KA 5D8AA 5KXBA 2ZGNA 4XJ8A 1CD3G 4XBNA 3JD71 1AL0G 3WNKA 3FUQA 1S2KA 3GNEA 1DF0A 1J58A 1MZ6A 1XNBA 2BYVE 1POQA 2DYCA 1FOD2 2VM9A 3IIIA 2JDKA 4X6QB 4Y24A 2JWPA 4XE9A 3O1TA 2VO5A 1XYNA 5FDBA 2J22A 2VXRA 2RS53 1GFF2 1LOBA 3V0AA 1UD1A 2E63A 2P6HA 1QIQA 3K4ZA 2BQPA 1R083 5FBZA 3RZZA 4YZ2A 2GALA 3Q8FA 4H2AA 1FMD2 3VZNA 3WQ1A 2PTMA 1ND2A 4UW4A 4RD7A 1RUOA 5SV8A 2A3YA 1YEWA 3ENRA 4O9GA 1VB4A 1MZFA 2VCBA 5KHJA 2IVJA 1KS4A 1J83A 1DQ2A 3O7OA 3SQOA 4QQOA 4RQPC 5F5IA 4EWDA 1YLLA 1Q56A 2XJTA 2WJSA 4PCRA 1X33A 4R9AA 3VZOA 3OCPA 4LO6B 4LLOA 2AACA 3HNBM 4YZ3A 4ONUA 4GULA 2WFF2 4I0WB 1UXZA 2E53A 3IMMA 5KHHA 3OOXA 5G04L 4Q0PA 3AP9A 4AGRA 1HRI2 3H50A 5L9RA 4LA3A 2HWE2 4Y1YA 5T3NA 1D4M2 2WNEA 4NHLA 3ZYGA 3ZR5A 1OF4A 2GMEA 2HWD1 3E97A 3WXPA 1YC61 4CDXC 4CYDA 3WT3A 5A3NA 2I45A 4XMAA 5IVFA 4A42A 3DYMA 3ZN4A 2O14A 3UESA 3PUSA 4K1ZA 4AI0A 5J3UA 2IWGB 3NNJA 1C1FA 1LU1A 5FZ8A 1QDCA 4MOAA 5D8AB 5FMOS 4AEJA 1LB2A 5F6LB 4XW3A 2ZGSA 5HV4A 3VBHC 1BVVA 1QH6A 4BK4A 1REEA 5J36A 2WZR3 5B2GB 4NRPA 1U5XA 2JJ6A 4C0HA 3IM0A 2UU8A 3LSDA 4JHZA 1HJGA 2MEV2 1RVF2 3ZN6A 1RHI2 3ZYIB 4RGGA 2QFEA 3HJRA 3O1RA 5KBFA 3V0AB 2ZTNA 3CF6E 2XBO3 3D3AA 1PVC3 2QQMA 2R49A 2NQYA 3CJIC 4CCKA 2VCAA 5A70A 2CGNA 3I3BA 1W6NA 1OLMA 5CEHA 2WO7A 4MXWA 2OYZA 4CUBA 4QPIC 1N3QA 2JDZA 2JE8A 1CZVA 1MACA 1QJZA 1BK1A 1UPSA 3FL7A 3ZXDA 1G9CA 4COVA 2CY6A 2R7EB 1J3RA 4KG0A 1YO8A 4YW5A 2WNVA 3QD6A 4I2OA 1OQDA 2C26A 5FZ7A 2WDBA 1QQP3 4YVSA 3RNSA 1RJ7A 2RS13 1SLBA 3MHZA 5K9YA 4FFIA 1QKQA 3PTYA 2C0ZA 1F15A 3BYWA 5DN2A 3EYPA 1NCRC 5E16A 3RWNA 4QHZA 4FXKB 4FP2A 5E89A 4FPCA 2D40A 3S6PA 3HT2A 3ZXEA 1HQNA 1QEXA 2HWB2 2NN8A 4IEVA 1SFPA 3I7DA 1C5IA 1GSLA 4OHXA 2Y64A 1DGWA 2HEYF 1D2SA 3ETPA 5JSOA 2JECA 3BGAA 2VZOA 3FLPA 1LKNA 4J1XA 1POV3 4AFCA 4RHV2 4LBMA 1REDA 4W6XA 2GU9A 5FCCA 1IQDC 2HWF3 2ZZQA 3LFMA 3POSA 5AFBA 2ZABA 1UIJA 4PDWA 3LB9A 1VALA 2EA7A 2RS52 2YBPA 3JBG2 2TNFA 5FFOC 2Q5TA 3RZMA 3ZKUA 1XYOA 1NA1B 1PIV2 4QQPA 4QDQA 1H6YA 1NAEA 2IXLA 4JZRA 4N43B 1E5SA 4LJHA 3D5OA 2NPIA 2D6MA 4TLFA 3ZN6B 2W87A 2YU2A 1X50A 5HCHA 2GNTA 1LAJA 2BGPA 1QJY3 2VZVA 3JXSA 4R52A 1AR62 3AL5A 1V6LA 3CQOA 1DQ0A 2CU5A 2RS33 4K3UA 3WP3A 4XQDA 5FYUA 2BVVA 4BCUA 3L9JT 1W6NB 3VD3A 5AC91 5FOJB 4CEYB 4MXWB 3M3QA 5FZFA 1COV1 3GM8A 4OLLA 4XF1A 3LE0A 1AUYA 1XE7A 4AVBA 2WNVB 3Q8BA 4R9BA 2W5FA 1GUIA 5L7OC 2E32A 2Q8EA 2A6WA 4YFZA 3W20A 3QLQA 2WN2A 4DUVA 3GCWA 4D6QA 1W9YA 1VAMA 3MDPA 5E88A 1OUSA 1WCQA 2AREA 2C4XA 3LEMA 2CDPA 4XAAA 3LPFA 1AR92 1JODA 1OH4A 1CONA 1VBD1 3T2TA 1YFWA 2FDJA 2W95A 4JCKA 3BPSA 3SNMA 4K6BA 1TMF3 1YYNA 3NJXA 3C2UA 1NLRA 1QNYA 5ERLA 4YG6A 4C1XA 1C3HA 2WA3A 2D5HA 4UFMA 5A3PA 4Q4Y1 5C3OA 1NY72 1SBDA 2BGOA 2HEWF 2D6LX 2ETEA 5C71A 3VB9A 1OBNA 3WHTA 2R043 1GNZA 4KBBA 3VBRC 5A1FA 4A7KA 1O5UA 2VVFA 2XBO2 3LDBA 1FPN2 2WLPA 3H8RA 1Q3EA 3WNNA 4XXPA 1ENXA 4QGNA 1QDOA 1LOFC 2VMEA 1WW7A 3KCYA 4AW7A 2W91A 5CFDA 4MX3A 1A3KA 1O59A 3BVCA 4BQ1A 4UBHA 1EAH3 4D7SA 3AC0A 5EHDA 2ZOEB 1U5YA 3THDA 4AEKA 5C33A 3O1MA 4M3CE 4QX3A 1WLDA 2NM1A 4I3GA 2E6VA 3AM2A 3EO6A 5FLJA 1XOYA 4G9SB 4EYUA 3ILRA 4IERA 5DDJ2 4A7ZA 5KC6A 4Z2WA 2X09A 2IFRA 3J7NA 1AYM2 4OYUA 1K5MC 2K0GA 3BCWA 2PAEA 1URXA 1XQNA 3OF1A 4LBLA 4PT6A 4XABA 1CJDA 1OURA 2WS93 5FZLA 1JHJA 4BZ4A 5KHKA 3N9MA 1HN1A 1MS1A 1GP4A 1LU2A 1H4GA 4EWEA 1JW6A 1Z78A 4Z2AA 1RMU3 2X5IA 1GWKA 5F3EA 2D44A 5DMYA 5L73A 1WA4A 3CEWA 3TEWA 3E1F1 1JUHA 1ULGA 4YM3A 1CPNA 2ZGTA 3RGBA 4XCAA 1GQGA 3WW3A 1YI7A 4XAEA 2WRAA 5FZGA 4NO4A 2H0VA 4WBBA 3H7JA 5IW0A 4LBOA 3S5QA 2EXJA 5LBCA 2RMU2 4XF9A 3HD8B 3MUZ1 3RQ0A 2QUOA 3KF3A 1ZRDA 3N9QA 4YVWC 5FP7A 4XACA 3KHCA 2CAVA 2VMIA 3C8XA 1MEC1 2ZPXA 2TEPA 5F5QA 5A6QA 1RUE3 4LKSA 4W65A 3T2OA 1HB4A 5IK5A 3KV4A 4O9EA 4QD2A 4LIVA 5FZBA 3TB0A 3B94A 1QJY2 4XYXA 3NSTA 4DRVA 4S2DA 1Q8PA 3WF3A 1CQ9A 1OXCA 2Y33A 1UZWA 4NAMA 4EQVA 4CDQA 5BUVA 3I49A 2WINB 2ET7A 3WEZA 1AXYA 4W50A 1RINA 4QPIB 1VBB1 3UGFA 4IEQA 1QF3A 1ULFA 2D93A 4KWUA 5CFDB 5A3LA 1KEXA 2O8OA 4DNYA 2DUOA 3UGHA 1VAVA 4XURA 1F8VA 4D6RA 1OF3A 1FOD1 4XIKA 4DPNA 4M3CF 3MIBA 3IWZA 5JXGA 4CU6A 2ZEZA 2RVAA 1HXS3 3MI8A 4K8FA 2OXBA 3U4SA 2Y38A 4R9DA 3BU7A 1NZCA 4QGLA 1A8MA 1L7LA 3HT1A 1S0EA 4HKOA 4ITCA 1NQDA 2H6BA 5FKCA 4KI5M 1FMD1 4RS5C 4HKLA 2Y0IA 4PBOA 1XE0A 4HLTA 2ZAAA 4X8PA 2Y6KA 3KS7A 2BZDA 2GP5A 2PHRA 4A3ZA 3UNPA 3ST7A 4DB5A 1UZVA 2X5IB 3DGTA 3NV1A 1AJOA 2A3WA 5IK7A 2D3RA 3CHXA 4Q4V2 2EIEA 3D4KA 4CEWC 1V6JA 4NMIA 2R16A 2WT1A 4FOYA 3WDTA 3WNMA 3KV5A 2W0XA 4KWKA 4EN6B 4MG2A 1ENQA 3VZKA 2WFF1 3GJAA 1HB1A 3FBMA 3FE5A 3VD7A 4CDUA 5JZGA 4NWVA 2ZS6B 4ARYA 5LASA 1HRI1 1W39A 4AQ6A 2HWE1 5K0UC 4AI2A 3I3DA 2XJPA 2JDPA 3OUIA 2TBVA 1W28A 1AXKA 1AR72 1R091 1VMJA 1Q8QA 4LQRA 4LTAA 2BNMA 4XF4A 2W1UA 4EN0A 4UT5A 5JIAA 4BHPA 4E4SA 4Q0UA 2FDGA 5FO9B 1T6GC 2BU9A 3J7MA 1GQHA 2DFCA 2DBNA 1SLAA 4QDRA 5LA0A 1UNBA 3AZZA 1MS3A 3VGIA 2P3KA 4Z92B 5HV0A 2YPJA 4X8NA 2VOKA 1LHVA 5GLUA 5IUQA 3C7HA 2VMDA 4LORA 5EJ1B 4LPLA 2DU1A 2GZWA 2JDYA 3FBYA 4JV4A 1SZBA 2MEV1 1RVF1 3AKSA 3LFIA 1RHI1 2CWSA 2P6CA 2VCCA 2WS92 4QX7A 5F6KA 3SITA 1WW5A 2IXCA 3OTFA 1RMU2 2ZGQA 1PO13 3KT4A 3SCHA 4GH4C 4YGBA 4AEDC 3O1PA 1V6IA 2XHKA 3E5XA 2PYTA 2VOTA 1SHWB 2X05A 4MSVA 4IE6A 1N1TA 5BV6A 5CG9A 3RDIA 2WIIB 3K46A 4LO7A 5A3TA 5FY7A 2EVXA 1SQ4A 1WLTA 2CWMA 3H3UA 3QOPA 2WA4A 4HXCA 5JSPA 1AR83 5IK4A 3OBAA 4MGZE 3PVEA 4DXSA 5C9AC 5BXXA 3KZ4C 3HIFA 2QTWB 3HQRA 4GKYA 2ZA9A 4XJWA 5EFUA 1B35C 1W2OA 1YJLA 3VBRB 3ZXLA 1LCLA 2GH2A 4GMP3 1L7QA 3ZDSA 2IXIA 5FMOL 1UU6A 3NW4A 1WGPA 4GQ7A 3SKVA 3VBUA 5LEJA 2A3XA 2HWB1 2YPDA 1KGYA 3O14A 4FTBA 4CDWA 2KXLA 1MZ5A 4O7XA 1DLCA 2EICA 1MS4A 1NCQC 1UMHA 3ALQA 4JGZA 4LBQA 4NWWA 1UU5A 2GN3A 4HANA 1HV1A 1YFUA 3ETQA 3B7MA 2HH9A 2J1SA 2BFUL 4ZU4A 4I0AA 3RI9A 3VBOA 1VBA3 3EXUA 1H4HA 2D43A 2YU1A 1AX1A 4YRDA 5HPOA 5FWEA 2QQKA 4BOWA 1PK6C 2RS51 4D69A 3JBG1 3KF5A 4R4XA 2FDIA 3ZFFC 3M1HA 2VPVA 1PIV1 4JDNA 4Y4YA 1N3PA 2DFBA 2VCMA 3PIJA 5GALA 4MGTA 1REFA 2EXKA 1D2QA 4AE2A 1A6CA 2D6KA 2YV8A 5JXHA 3WF2A 4AK3A 2GMPA 5GZFA 4AVAA 3MLLA 3RZGA 3GBWA 1H1AA 1OD5A 1AR61 1LECA 1NX9A 2PLV2 2ZX0A 2UYBA 4KG8A 5JOWA 3BKZA 2FBEA 1AYN2 3A0NA 4E4ZA 5A7WA 1J3PA 2FZ2A 4FQ4A 4YW4A 3OGGA 1DYPA 3VBFC 1KJLA 2PHXA 3HNYM 3LPGA 3O0XA 3VKFC 5DUWA 4BLJA 4UYBA 3OBTA 4YVWB 4QPYA 4CTEA 2E7TA 3LAGA 3ECQA 1RIRA 2WSVA 3LKJA 3DL3A 4AYUA 2RG4A 3AZWA 1B09A 3LEIA 4DUXA 1TME3 3U75A 2WNUA 2VTFA 1MS8A 2Z69A 3ZXGA 5C8CA 1ZBA3 3HQXA 2J1EA 3VBUB 5A33A 3ZSLA 2DF7A 1QJEA 2UYAA 3ZOIA 1HB2A 3FJSA 1AR91 4K8RB 1VBC2 4QXCA 4BMBA 2ES3A 4CCLA 5ABJC 5I0UA 2VNRA 1IS5A 2VECA 3NRUA 2ARAA 1GR3A 4LBQB 3I97A 3U14A 1FYUA 1XNAA 3ES4A 5KXCA 2IC1A 3ACLA 4IEPA 2ZMNA 1C8M3 1O5LA 4XBLA 3A7QA 1H1IA 1GOHA 3CU7A 5A6XA 4OUMA 1NY71 1YXWA 3NV3A 1SDWA 4N7IA 2ADDA 3VBOB 1Q8SA 1XNKA 1DZQA 1UN1A 3AZXA 4YM1A 5I8YA 5LB6A 2MNGA 2OT7A 4FTEA 2E31A 4JQRA 4E9KA 2VE1A 5E8AA 4COWA 1PO12 2XBO1 2FMDA 1JZ3A 1FPN1 1PVC1 5H9PA 5A3MA 4CUCA 4F83A 1RB8G 4MHRA 2YFUA 1GP6A 1HIXA 3OSDA 3LDKA 1OLME 4RS5B 4KU8A 4RR3C 3DXUA 2VY0A 2XQRA 3OUJA 3J7HA 5L9BA 1CJPA 4W6YA 4AZZA 4HVQA 5BY5A 4LHKA 5HCAA 3NV2A 2O1QA 5FYTA 1OOPC 5IVCA 3T3YA 1O3QA 3B00A 1GOGA 1R1ZA 1Q43A 1XRUA 4L8QA 1C28A 1J59A 1JYVA 1EPWA 3Q8CA 3SH5A 4CEWB 4DXZA 3VD9A 1RITA 5BNNA 1LOEA 5GZCA 2QVSB 4JHTA 5A7WB 5JMOA 2WO2A 3LIGA 2MPFA 3E6CC 4QXKA 3A23A 5C5TA 1JZ7A 3WP5A 4YM0A 1I9RA 1AHSA 1DBNA 3KCXA 4I30A 4IUGA 5DDJ1 4ZZ5A 1PVXA 5IVJA 1U5IA 1CZTA 5FJHA 1AYM1 1LNSA 2DVAA 4QB1A 2EIBA 3I4IA 4UW6A 5HXVA 2XJUA 1S0JA 5H9RA 3H1YA 5FY5A 5FREA 3J8F2 1CR7A 1GZCA 3VZLA 5K0UB 2DVFA 2DCTA 2F6BA 4MO3M 1UX6A 1POV1 3WX5A 3MFAA 2XLFA 5FK8A 1CVNA 2VZRA 2WNUB 5C8CB 3POYA 1J84A 1F4AA 2YC2A 4WV8A 4DRRA 5A33B 1VBA2 4L2NA 3O0WA 4FPEA 4N7UA 4OHVA 5FZKA 1EP0A 4CCMA 2JX9A 1ASJ3 1HQWA 4LBKA 1QGLA 3KLSA 2JKBA 4QB6A 1ACCA 4X6RB 2VZTA 4WVMA 1LEDA 4DZGA 5JSRA 2RMU1 1KJRA 4XZPA 3IKWA 5FQ0A 5TSWA 5JCTA 3AMQA 1BYHA 2IXJA 2Y8KA 1SDDB 3DCQA 4MH0E 3ZSEA 1W0PA 3GBGA 3O0VA 1XSRA 4P9LA 3SHRA 3RYKA 4AEDB 1QJY1 4CCNA 3L2HA 3WNXA 2UWCA 4XUTA 5F5CA 1ST8A 2XG3A 3LCPA 4MXVA 5LZ6A 2YXSA 3MW2A 1W8NA 2OVUA 3DYOA 2AYHA 2C9AA 2ZKNA 1RUF3 2I2SA 3WF0A 4BXFA 4CZSA 4XUQA 2J1AA 1UKGA 3NNGA 3ZYRA 2W94A 4BJ0A 3WV6A 4QPGC 2JB8A 2ZGPA 3HR9A 1US3A 4FSJA 2CYFA 2B39A 2PFWA 5BNNB 2ZMLA 4Y1UA 2OPWA 1RUNA 4IEZA 3AX4A 4XFFA 1PHMA 4A6OA 2YC0A 1QH7A 2GAUA 1MQTA 1H2NA 2J1VA 4Z8BA 2XJQA 2VBPA 3IDCB 4UFLA 4AAPA 5BNOC 1LHWA 1QNWA 1N1SA 3IB3A 3IDAA 3PUQA 4QGMA 4GB32 1RUH3 1F2NA 2JE9A 4BISA 1W0NA 2HLEA 2RDQA 2A6ZA 1C8M2 1JBCA 1HN0A 3TNPB 5C7GA 4NR1A 1YQ5A 1C57A 2R073 1KQRA 3ZXFA 2CGPA 4C0BA 5ANNA 2ZGUA 3NAPC 1GKBA 1GWLA 4NOTA 1UWWA 4OULA 5LK5A 3ZFFB 4ORFA 4QDSA 4FPFA 4XFCA 4XFIA 4Y22A 5DABA 5FQ0B 2Q1MA 5FZHA 1JU3A 5LCWL 3I3EA 3AFKA 1E57A 4XTPA 3OGVA 5EJZB 2Q4SA 2ZHLA 4LITA 2WKKA 3FUOA 2D98A 4QX0A 4Y5Z0 2B45X 2JDHA 3AZYA 1LGCA 3BPZA 2VXJA 4LR4A 4QM9A 5C3PA 4LE4A 1PGW2 1AR71 4XUOA 3QCWA 4F8AA 3AYEA 4HVOA 1EPZA 3RMYA 1KXGA 1W9TA 4E27A 3AK0A 3CNAA 1NOVA 5K4LA 2QQWA 2V4VA 1W6PA 1WUVA 3AJYA 3VBFB 4XBQA 1G6NA 1W9SA 2YBSA 1NG0A 3F95A 2JD4A 3T4VA 4B4RA 4Q5OA 4GALA 2B9UA 5FZ6A 2EALA 1TZOA 1OFNA 2WS91 4XUNA 5G05L 2DVBA 4R8HA 3MBWA 4ZXKA 3WP4A 4K20A 3P1IA 2BRTA 3AP6A 1AVBA 1RMU1 3KV6A 3VZMA 4WZCA 2OS2A 5ISLA 1S55A 4KU7A 1MQTB 1V6OA 3FN9A 4XFBA 5CZKA 4Q4W3 2B42B 5AVPA 2WAAA 2VTXA 3GF6A 5ABJB 2DCYA 1CPMA 2A7AA 1KDKA 1XE8A 3CLPA 3FMGA 1O6UA 3WDYA 5GZEA 1RUI3 2UY8A 3OD0A 4N53C 4OFGA 5AFEA 2LTNA 2OPKA 4XJAA 4ZONA 2G9ZA 1OFSA 4WM8A 5FY8A 4A6SA 2L9LA 3NO8A 3KM5A 3AYCA 1R092 3MO4A 3HPNA 2ARBA 4BB3A 3R05A 4CPBA 4D7YA 1JYWA 4C90A 3HBKA 2IXHA 4URTA 5A7PA 2V4AA 3RMXA 2Y6FA 4CXWA 1QU0A 4A7YA 3ZR6A 5DXDA 5LY2A 4H14A 5LRRA 1CESA 2Y6HA 4HETA 4Y22B 2ZEYA 5EP9A 2PMWB 3WP6A 1UU4A 2XMLA 4YG0A 1WKYA 1JS9A 1NA1A 1WBFA 5IVEA 1I1EA 1W2TA 3AMNA 1H8TC 2WABA 4N43A 4MGSA 1PZ8A 4B4PA 4AVVA 2GNDA 3KCCA 3MV11 1SLIA 3R6SA 4AQSA 1LR5A 4BU2A 1WMDA 2PHWA 5FZOA 2D3SA 2B8MA 2RM23 2Y60A 1LHNA 3AJZA 3JB4C 4MGYE 1UOFA 1W6PB 4P5YA 4PQQA 3APBA 1ZNPA 4Y33A 5JI9A 1ULPA 3RI8A 4ZY9A 1IG3A 1UOGA 3M8LA 4J1WA 1HX6A 4QX5A 4AEMA 1Y4WA 4WVWA 3CKHA 5F39A 4CEYA 1KFUL 1KS5A 2EXIA 2CNAA 3J7LA 3SEPA 4EN9B 2RDNA 3O1SA 4KGQA 5CG8A 3E6BA 1RUD3 1RUH2 1UY1A 2BP6A 3OPWA 4UW3A 3LEGA 1AF9A 3I2HA 4GJZA 4DO0A 3OGRA 2AEYA 4NIDA 1MZEA 2BW8A 2PLV1 3FZ3A 4G3YC 4NHYA 4YGEA 2V5DA 5ANQA 1GBGA 1O4ZA 5FPLA 1AYN1 3U11A 3UGGA 2RDRA 1GYKA 3W21A 1MVQA 3E5UA 4CP2A 1ZZ8A 1V9U3 1ZM1A 3LZZA 2R072 4B1LA 3VHPA 3ZIWA 2OZJA 4IV1C 3HMYA 2VQTA 3LSEA 2FDKA 2RDSA 5FTTC 1DFQA 1IS3A 4S2GA 3AP5A 3WINE 3ZFGB 3ZKYA 5LBFA 5HCFA 3POBA 5JWPA 4FAHA 1YHFA 3W9AA 4WM8B 1WA6X 2CGOA 2WZEA 4QXHA 4CP0A 1K3IA 1NUKA 1U5ZA 3JU9A 3MIGA 1JYIA 5GLZA 3ZN5A 1JYTA 1JN2P 4H3WA 4AI9A 3VUOA 4RL7A 1DIWA 1VBC1 1R082 5FXWA 2XVLA 2BEOA 3THTA 3OEAA 2OUHA 4YPJA 1XU2A 3U4XA 1ZZ7A 4CA9A 2W39A 2WWJA 1HV0A 2Q1ZB 4NPRA 5I91A 4XVHA 3POJA 4FCAA 5FZOB 1G9DA 5BNQA 4ATFA 4JRLA 3WSOA 1QJX3 1NXMA 4HK8A 2PHUA 5GKAC 1GV9A 4RQPA 4LT5A 2TUNA 1PO11 4O65A 4XZUG 4I3PA 4RSUA 5FIXA 3MGUA 2VD7A 4Q4W2 4WVVA 5BNOB 2G1MA 1PGL2 5T52A 5F9TA 1M4WA 4ASLA 2ZJCA 3HBZA 1BBT3 2P37A 1TVGA 1F35A 1T2XA 1STMA 1UYZA 4QHBA 3HEIA 5FMDA 4AGVA 4D7TA 5A6ZA 1UYYA 2CAUA 3VKNA 3VHOA 4HPKA 4FAGA 4TTGA 1W05A 4CDXA 3M4FA 5SV5A 1ZBE3 1LESA 1NLSA 2VZPA 3NAPB 4GMP1 4E4DX 2ILMA 3B93A 4ARXA 2JKXA 2O0OA 2WZPP 1MS0A 2PHDA 3S30A 1VBE3 5DG2A 1DYOA 2WQZC 4BWOA 3VBHA 3C7EA 5IAXA 2QQNA 3J8F1 2JE7A 2P5BA 1YIPA 2WZR2 4LNVA 4RYDA 4NIGA 4GIQA 1CAVA 3EBRA 1IKQA 3MIDA 2YDEA 3RFRA 3PVBB 4P9JA 2KD7A 1VBA1 2F17A 3I8TA 4E2QA 1ULOA 2IFWA 2K46A 2IZWA 3F2ZA 4Q4X3 1PVC2 3O1OA 3CJIA 4LIUA 4XOGA 2AC1A 4INDA 4DINB 4ZU7A 5EXOA 2ZMKA 2VZ3A 5A1LA 3WLUA 4Q2FA 3ILNA 4QPIA 2W1QA 5FY0A 5A7NA 3SCGA 1DQ6A 4ES8A 3CO2A 3GDBA 2JIJA 3PMEA 1BKZA 3AXEA 4B3NA 1RUD2 4BE3A 3WF4A 2XJVA 5A6YA 1VRH3 4V1PA 2WUHA 5KXDA 1Y3TA 1W2AX 2DCKA 1QQP2 3KMHA 4FI9A 4RQPB 4KGGA 2BBAA 2RS12 5GM0A 5ACA3 1XBFA 3M3OA 1UZ0A 5DAVA 1NCRA 2AUYA 2KA3A 3MIHA 4XILA 4LMFA 4OI2A 4B1MA 1H1MA 4FO9A 1W6MB 3WDXA 3ZFGC 5FKBA 5C4WC 2E26A 3FHAA 3H1MA 4CCCA 1UQXA 1ULEA 5EQUA 1NZIA 3JD73 2JXAA 4YFWA 1UZYA 4Y3OA 5EV7A 4BQYA 2RE9A 1O4YA 4NIAA 4W6WA 2K2SA 3S5AA 4XJ9A 1YWKA 1JTZX 2V72A 3N3HA 4FPJA 4HPKB 1FXZA 4P9WA 1NE4A 3I59A 4QAWA 4CDXB 5FYMA 5T5JA 1POV0 1S0FA 3NNLA 1JXNA 4XFGA 4FQZA 2GC0A 2K9ZA 5T50A 2HWF2 5CA6A 5DG1A 4AVCA 4DEVA 3OGJA 4NHMA 1WW6A 1MPXA 2VMCA 1W99A 1ZYBA 1JZ2A 4LE3A 3ZXKA 1DQ4A 1BEV3 4GA9A 3ZDVA 5A1AA 3ZO0B 4GB31 4JRAA 3VBHB 2VVDA 1CX4A 3QH7A 4IE5A 5FZAA 5LY1A 2UWBA 2VW1A 1BXHA 3INAA 1CAVB 1DGWX 4HSLA 3WY6A 1C8M1 3GCXA 1FNYA 4DXTA 3A21A 4E8CA 5DZFA 4CP9A 5BNPC 3WQBA 4UFIA 2PHFA 3I3QA 3FLRA 1ULDA 1QJX2 4ATEA 1LRHA 3N7LA 5E6HA 2RS32 2E33A 3VDAA 3CJIB 1C1LA 2EXHA 1PX3A 3MPBA 1G86A 1SFYA 2ZGMA 3TN93 4QM8A 3ASIA 1JYXA 4KNCA 1V6MA 1W8HA 4LHLA 1SCSA 1CAUA 2H0BA 5K7PA 4QT6A 4F7ZA 1YRZA 1BBT2 5JOXA 2ENRA 5L7OA 3K77A 2OQ7A 2HWD3 1WCSA 1PGW1 3PHMA 2G9FA 4COYA 3H3ZA 1GU3A 3P6BA 1OD3A 1NCRB 3W58A 5A7OA 1DHKB 2VGDA 5J7MA 4IV1B 1YNAA 2VQ0A 2E7AA 2JDNA 3MICA 5FO7B 4OI1A 2RR13 4Y4RA 3CIHA 2CV6A 3RYRA 1TMF2 4M4PA 5FWJA 2OIIA 2JD9A 5KHGA 3HWJA 3ZYPA 3I59B 1LJ7A 1DZTA 1W9WA 4NHKA 3UYJA 5JPNB 5CFCC 2DTYA 1A8DA 3OPZA 3GJBA 1JZ5A 3I54A 2HKXA 2VR4A 1BHGA 3VBRA 4QU1A 2R042 2QQOA 2YROA 3DYPA 2Y26A 1APNA 2A6YA 1F5FA 1OA2A 2WSUA 3ZYFA 3O5SA 4IQPA 2WWSA 3MFCA 4PIZA 3ZXJA 3T4HB 2BPA2 5FUPA 3KT1A 1CX1A 3MLKA 3KWVA 1IGOA 1TE1B 1SLTA 3AKRA 5FPAA 2W1WA 2XWBB 1LOFA 2JG8C 3QH6A 1H6XA 4PLMA 1NYWA 3K4DA 5CU1A 4MGIE 4Q29A 1DGRN 4UBGA 4XFAA 4TWTA 2D7FA 1Z7S3 4CP9B 3AZVA 2DUPA 3LQCA 3ZYBA 1EAH2 2BOIA 3G6JB 3VDDC 2PXJA 3ZFEC 5IVBA 3PUAA 3DUIA 4AG4A 4CP1A 4EV0A 2BGCA 4DUWA 1AX2A 4Z07A 3BTZA 1VMFA 2WO1A 5KHIA 4K40A 2GN7A 2F4PA 1K12A 1T6BX 3GHNA 4WZFA 1FNZA 1CAUB 5C3RA 4IGQA 3J4UH 4SLIA 4M0NA 1K5MA 5L7OB 2RJKA 2XUMA 3MF9A 4RA0A 5JR7B 1KD7A 2YHJA 1BVP1 1PMJX 4UOJA 1VMHA 1W3XA 5JOYA 4N9HA 1OUXA 3RZKA 1CAWA 2PELA 3UETA 4UFHA 1IS4A 1RC6A 4PLOA 4FPLA 2VMGA 4BK5A 4CVUA 4FP3A 4RN5A 5FP4A 3CMGA 4IEWA 1LEMA 2VNGA 4K7JA 4YGDA 2R32A 4MV2A 1HB3A 3AVRA 1JUIA 1RGSA 1W2NA 4AOCA 1GNYA 3DPRC 4IV3C 1OLQA 1BEV2 5F3GA 1G9FA 2VL4A 2EIDA 2QJVA 2VOVA 4HKWA 2R1BA 1RUH1 4YVWA 5F7UA 2ZXQA 4CU9A 4JDOA 4PJYA 3B69A 2P3IA 4H7MA 1RUE2 2IVIB 3O1UA 1JZ6A 4YW2A 2GC2A 3CDZB 2VU9A 4K1YA 4P08A 1UO9A 5AC93 2OZ6A 2R071 1F9KA 2A70A 2ZHNA 2VH9A 2JDAA 5FZ4A 4JKKA 1AL23 1I5PA 1COV3 2VVEA 3ZLIA 3TAYA 3AKTA 5FAXA 2XLGA 3TN92 5C5UA 3LDRA 3RS6A 5IVYA 1ZZ9A 1NQJA 2GNMA 3DF0A 4GZ9A 5J98B 3VV1A 4OVEA 4AL9A 5CVRA 4IEXA 4P14A 1D0HA 4HMZA 3RWKX 4KQ7A 1PO23 5GZDA 3ZM8A 2DVDA 3V65A 5FJKA 4ASMB 3FWEA 2DV9A 1QOOA 3PJQA 4ZZ8A 3VBSC 5JXIA 2F4LA 1LODA 1HXS2 2R6QA 5EZWA 3PNAA 4Q8LA 5C4WB 1LULA 1R081
chains in the Genus database with same CATH topology
3N7MA 5FOBB 4EWAA 4RS5A 1K5MB 2W52A 3X29B 4XETA 4FPOB 2JENA 1MS5A 2RR12 5JMCA 2VQAA 2WLQA 1CAWB 2WQ4A 4C91A 1RTVA 4D3WA 1S0CA 4CEWA 3ZX7A 3L2YA 1J3QA 3WUCA 1DQ1A 1O91A 2JG9C 2Z2SB 4Q4W1 4YZ5A 1PGL1 3NVCA 3ZSJA 1R1A3 4FT8A 1GANA 1RUI1 2DCZA 2GMMA 4XJUA 3WHUA 2GC3A 1JHNA 3TNQA 3WQ0A 1PNFA 1TEIA 4LO8A 2O8QA 4HN0A 2WT0A 5K0UA 2DU0A 5BNPB 1Z7S2 4HN1A 5CNAA 3MW4A 5GJ6A 3WR0A 4JGYC 1ND3C 4KL1A 1VLNA 4FBFA 2OUJA 1HKDA 2N7GA 3AMMA 2Q0AA 2DCJA 2XWJB 5EJ3A 3WW2A 1IS6A 2HWC3 1QHDA 1FV2A 2DTWA 2JEMA 3AMHA 2PHTA 2BNNA 5JLVA 2WZR1 4S2FA 1UKRA 2GNBA 3SISA 3TRSB 4IEOA 2OW4A 1G9AA 1FT9A 2RM21 4MZUA 4GWNA 4AEDA 5LRSA 4GH4A 3ZVXA 1MEC3 3M2MA 1SFNA 1ONAA 3AFGA 1RUD1 1AR82 5E1RA 1V6KA 3BIWE 4L11A 4FOVA 5C9AA 3U0ZA 4PIXA 1QQP1 4DQAA 5CFCB 2RS11 2OA2A 4IETA 2NMNA 1B35A 4TSVA 4Q0QA 5C8WA 2ARXA 2XB6C 4GMP0 2WC2A 3EHKA 3AXDA 1SEFA 1ZZCA 1AL22 1U12A 5D8AC 3SMHA 3WG4A 2XVKA 4K21A 3W59A 1NCQA 4L92A 2NYYA 2IXKA 3JB8A 3RJ2X 4DS0A 1FOD3 4MVTA 3S7EA 4ZU5A 2XJSA 4BLIA 1S0IA 4Z1VA 1PO22 1LTEA 2HWF1 1QXJA 3RSJA 1QJU3 3POWA 3P3NA 4LLFA 1PK6A 5T5OA 4BA6A 5L36A 4BIOA 1FMD3 3KGLA 3ZFFA 4U36A 1ND2C 4R4ZA 1DGLA 3DN7A 4META 3RPQA 2D5FA 5CB7A 5GLVA 1KITA 1W0OA 1VIWB 3MW3A 5HI0A 1W6OA 2BWCA 1W2UA 4EN8B 4GH4B 1QJX1 2R1DA 4LO5B 1C5HA 2RS31 3IMNA 1JH5A 1SBEA 3N35A 1VP6A 1WLCA 4XFHA 4AFBA 4CP0A 2D6NA 2V09A 3NV4A 2EIGA 2QNKA 3VBFA 2A5ZA 2E7QA 2QDRA 4Q1PA 2ZAHA 5GZGA 1HRI3 1NXD1 4XF3A 3UKVA 2HWE3 1D4M3 1BBT1 1DLLA 1R1A2 4FPYA 4N9IA 5C9AB 4Y1ZA 4IESA 1FATA 1GLHA 2RHPA 1B35B 4L9BA 1VAKA 4AHWA 4YYOA 2NP0A 1TME2 5FLIA 1S0GA 1RUJ3 1H2LA 1ZBA2 2YYOA 3BODA 3GZUC 3IDBB 3OY8A 4LEJA 5CBLA 4PLNA 1JYCA 3PVOA 4TYSA 5C6CA 4YG3A 5ABJA 2I07B 1NCQB 1GZ9A 2HWC2 1TMF1 3VL9A 3AP7A 4LBJA 4YNIA 2MEV3 1XNDA 5JOZA 5KC5A 3VZJA 1PZ7A 4U2AA 2BNOA 3THPA 3PMSA 3VBSB 2G4IA 1PK6B 2R041 3BTAA 1WCKA 3M3CA 1S0DA 4M0HA 3B3QE 2QCSB 5CIRA 3OYWA 3GHMA 2YGLA 4OUSA 2AZ5A 1SMVA 1ZRCA 4C1WA 4RR3A 3WDUA 3GALA 2AGSA 2WNVC 3ELNA 2UURA 1OOPA 2ZX3A 3AP4A 4YVSC 2PN5A 1Y43B 3WUDA 4P5HA 4KWLA 1W6OB 1EAH1 2B46X 1VRH1 4AHZA 1BMV2 1LOCA 2GC1A 1ZX5A 2A75A 3WD5A 1H9PA 4XXAA 3N4MA 1KFXL 3RG0A 1BZWA 2HWB3 4XTMA 2ATFA 1LGNA 2BBVA 3VHNA 3H0OA 3GBFA 1YUDA 4RHV3 4AHYA 5L19A 4Y1VA 2QQPA 4XF0A 1VJ2A 4PDWC 2RJLA 1ND3B 4JGYB 4MGKE 3OY8B 4I02A 3JBG3 2FMYA 1LHOA 4B4QA 1ZVFA 1QJU2 1KDMA 3WZ1A 1N3OA 1PIV3 3C3VA 1ASJ2 2ZACA 5KXEA 1BEV1 1OPOA 4COZA 2DURA 4YM2A 3E6DA 1ALYA 3GZAA 3PVNA 5GLTA 3FC0A 4AI3A 1RUE1 1AR63 4UXAA 3KT7A 5H9SA 2HYKA 1S2BA 3V0BA 4JC1A 4A3XA 1DU3D 2R063 3VL8A 3OYWB 2VG9A 4HL0A 4AFDA 4RR3B 1ZRRA 5FLHA 5I0SA 1RUF2 4YARA 3H8UA 3N7KA 3TN91 4BH9A 3OJBA 1I3HA 2SLIA 1OOPB 2C5DA 4QPGA 2ZGKA 1EV13 1ENRA 2BUKA 2ZBJA 4Y26A 1DQ5A 1X82A 2A6XA 2VUAA 4G4FA 4OZXA 3ZIXA 1LGBA 4LA2A 1HXS1 1X7NA 1AR93 1H9WA 1RUJ2 2Q8OA 1AZDA 1M06G 2LALA 1LOGA 4WM7C 1C8NA 2ZCWA 5BNOA 4YLZA 4XJZA 1UF2C 3BOWA 2RR11 5FPZA 2DVGA 3UL2A 1WMEA 5A32A 2BWAA 1RUG3 3JZVA 3R4DB 4FTSA 2R0HA 4R9CA 2QE3A 3TBDA 1N47A 1YFYA 3LA2A 2BFUS 4Q0SA 1FPN3 3NAPA 4YSFA 2ZHMA 3BALA 1I5ZA 2PAMA 3OD4A 3WG1A 2Z5WA 4YGCA 1ND2B 4QQLA 1Q8VA 3SLIA 4AFAA 5CFDC 2WL1A 2W08A 3SH4A 2LM3A 3WW4A 3U10A 1Z7S1 3WOGA 4LBNA 3V0BB 4IEYA 1WLWA 5CADA 2DWRA 5DDJ3 1AYM3 3S7IA 3ROUA 1N1VA 1WMFA 3E5QA 3J26N 4FVVA 4QPGB 5DZGA 4TZDA 4OHYA 3SH3A 1H2MA 1OKQA 3USSA 3V64A 4QMAA 2X5IC 2VOWA 1HRV3 3M3EA 2A71A 2GDFA 2XJRA 1RUC3 3HAGA 1FV3A 2A73B 2C1FA 1ZZBA 1IKPA 2RMU3 1W6MA 4L99A 1PZ9A 5I0TA 4Q1RA 4I01A 3IN9A 4Z82A 3MZHA 3S0MA 2VW0A 3IIAA 1S0BA 5HCBA 1RUI2 5A32B 2EAAA 4N53A 1AR81 2WT2A 1L3JA 4EJRA 1X8MA 1UMZA 3EJKA 1O3RA 4AXOA 2FQPA 1WW4A 3NJZA 4L97A 4NVPA 2QZ3A 4HZFA 5J96B 4CDQC 1X8EA 1Q5OA 2Z42A 1TNRA 2R062 1UCXA 3AMPA 1AL21 1DGRA 4ISRA 1ZA4A 1QY4A 3NKTA 1HDKA 3D8CA 1H8TA 3QBQA 2DUQA 4YVSB 4D94A 4BM8A 2YUEA 4P9YA 3J9SA 3ME2A 3OBRA 1PO21 2PA7A 1EV12 5DUUA 1GNHA 4Q8KA 2RM22 5KWRA 3RJRA 3USUA 4KWJA 4E2GA 3V56A 3WDVA 4WM7A 2YZ4A 4JDMA 1YFXA 5I8SA 1EYBA 4F3JA 2P17A 5K8SA 2NZ9A 4LBQD 3FLTA 3Q9OA 4OI4A 4Q4V3 2XL7A 1RUG2 1U0AA 1Y9QA 4PDWB 3R4UA 4MLOA 3P3PA 1BJQA 3NWKA 4E2SA 5JDBA 1V9U2 1F31A 5GLWA 4IV1A 5CAZA 1OMIA 4DMIA 2B7YA 1UZZA 4CDUC 5JZGC 1UPIA 4SBVA 2ZX1A 1V00A 2CL2A 4N53B 1R1A1 3ZMNA 1G8WA 1AR73 2R30A 1XU1A 5EWSA 2B5HA 2PHLA 3FFQA 1TME1 1OA3A 3BOPA 1ZBA1 3LOIA 4XIOA 3CJXA 1HW5A 1D4VB 1OQEA 3VLBB 4XHBA 2ZZJA 2VOXA 2HWC1 1Z0HA 3MIEA 1H8TB 2V73A 3DKWA 3MLJA 3B01A 2YY1A 1FI2A 3K48A 3TWIA 2QDNA 4DY3A 4LO4B 1HRV2 3QACA 3USUB 2ZX4A 1RUC2 4B8EA 4AVTA 3B9IA 2E51A 3D82A 1QWRA 1CIWA 4WM7B 1MR5A 3KB5A 1QMJA 1GICA 5AVAA 3A0KA 3ZSKA 1V70A 1ZREA 1BMV1 3B9CA 4ISQA 2QZ2A 5J48A 1H30A 3DV8A 3VBUC 1UIKA 1ZBE2 1H8VA 4FPHA 4CDWC 4RGAA 2W68A 1J1TA 4ZKTB 3H9AA 1VBE2 4Q27A 4JGZC 4IL7A 2ZGOA 4HSJA 3PJYA 2UY9A 2X29A 3D0SA 2Z79A 4AVSA 2VUJA 4B29A 2ERFA 3VBOC 2Q30A 2VNOA 4B7KA 3TOJA 4AWDA 1QJU1 3AB0A 3G7DA 5DUVA 1IHMA 1ASJ1 4Q4X2 1O4TA 3BB6A 3RYPA 5IK8A 4YW1A 4ES9A 3IPVA 1DZRA 1OSGA 1WD4A 4PQ9A 2P34A 3LOBA 1LOAA 1JOJA 2PLV3 4HBNA 4M00A 3U07A 4B7EA 1AYN3 1VRH2 4PBPA 3KQRA 1WCDJ 3VHRA 3WCRA 5EYYA 4JAAA 5ACA2 1X36A 3KGZA 5H9QA 1PNGA 2MHFA 4FOWA 5C4WA 3ZFGA 4H7LA 4P9GA 1RUF1 1CGPA 5LEKA 4JTNA 4DFSA 3JD72 3K51A 1F5JA 1D4M1 4YZ1A 3ZXAC 1SCRA 4OHZA 1IOAA 2WNUC 5C8CC 1RL3A 3WG3A 1YIFA 1ULCA 4CDQB 2LUWA 1VBC3 4GXLA 1RUJ1 4HVRA 4XPVA 2GH8A 4LUKA 4M01A 3M70A 4WVZA 3ZYJB 4P9XA 3AYAA 4BMEA 1S1AA 1OHFA 2NLRA 1IPJA 2VW2A 1KRIA 4FOQA 2D97A 4LHNA 5BPXA 5T54A 3JCIA 1FX5A 2XH6A 5BNPA 2A6VA 4COUA 3UKTA 1SLCA 4N90A 1TNFA 1OLRA 4AQTA 3I2DA 5JIUA 3IPVB 4YW3A 4LULA 3LWCA 5FPXA 5T55A 1D0GA 5BNNC 3KSCA 2XLAA 2HWD2 3LGRA 1SBFA 3WDWA 4HT1T 4XQ4A 2XPJA 1VBD3 4CDUB 4IEUA 2PAKA 4YZ4A 5JZGB 4A2UA 3ATGA 1HLCA 1G7YA 3J8F3 4FPKA 2PQQA 4Q4Y3 3M7AA 2P3JA 3FHIB 4RHV1 4XEZA 5T5PA 1O7FA 3FX3A 2AR6A 2CTVA 3H1WA 5J37A 3AKPA 3NL1A 5CFCA 1IPKA 3H7YA 1QOSA 1J1LA 1OA4A 2ZGRA 1OI6A 1BCXA 2Y0OA 1ENSA 4OHWA 4S2HA 2XKOA 4Y20A 2EAKA 1O3TA 5JPMB 4XMIA 4I09A 4BPZA 3RRDA 1PM7A 2JG8A 3JQXA 1TQ5A 1CAXA 1Q8OA 4FXGB 3ZMOA 3ILFA 1LENA 1UAIA 3VDDA 5JI7A 3ZFEA 1RJ8A 3SCFA 1PGSA 5JVVA 3UJQA 4M3CA 1GZWA 4JTOA 2R061 5LK7B 3VKLA 3NKGA 1SLLA 3N7JA 2XKPA 2HJIA 4Q26A 3R0RA 2I74A 1CN1A 1MS9A 5BYNA 3EQEA 3UK9A 1YCIA 1EV11 5I0RA 2FHRA 1I6XA 2UWAA 1ZZ6A 3JUUA 5FRAA 4PF5A 1MQTC 1A78A 2QKDA 3HN1A 4Q0VA 4AF9A 4CDWB 5F1RA 1VR3A 2VULA 4GB33 4EN7B 3DPRA 4IV3A 3WW1A 4JGZB 1FAYA 4XQWA 3M3IA 4K9SA 3MYXA 3D0JA 4KH9A 5I8TA 4CRQA 1RUG1 3MPPG 4I0BA 1OPMA 3UKNA 3R4SA 3WVJA 4GWMA 2ET1A 5J09A 2GSYA 2XGXA 5HBAA 1V9U1 5AC92 1UL9A 4HK9A 1XYPA 4Y20B 2P2KA 1PMIA 1VBB3 2AH2A 2XL9A 4AGGA 1COV2 2BTVC 2JG8B 2XVGA 2G9GA 4MYEA 1CAXB 2ZGLA 2D6OX 1AX0A 1NE6A 3KD4A 1ZRFA 3O12A 3CL1A 4AI1A 1VB2A 4BYYA 4LUMA 3VDDB 3ZFEB 2X53S 4OI0A 4M3CB 1H0BA 1G9BA 2SBAA 2V5YA 2ZX2A 1GZWB 2R0FA 4NN0A 3VBSA 3WCSA 1QXRA 3VN4A 1EY2A 3MIFA 2ZHKA 2VMHA 2KM2A 5FO8B 1C4RA 1UW8A 1VBD2 4GKXA 3TYJA 1IZ3A 5EYXA 3FFZA 1AJKA 2JICA 4AHXA 3D6EA 3B02A 4Q4Y2 3VKMA 3ZSMA 3UV9A 4HFSA 1WD3A 3GYDA 1HRV1 1OQ1A 1H2KA 1RUC1 4XDQA 3AKQA 4P9IA 3LA7A 1XXNA 3T1LA 2WFF3 2YGMA 2WFPA 2JG9A 3DPRB 4IV3B 1BQPA 3AYDA 4FPGA 2EF6A 1W6QA 4RFT0 4IXLA 4BIFA 1Y7BA 3MF6A 4UW5A 4AI8A 2YMZA 1QXPA 2FZ1A 4WM8C 2NMOA 1R093 3UJOA 3IBMA 1HQLA 4JVAA 2E9QA 4MUVA 3A4UA 2AENA 4JGYA 1ND3A 2ZKLA 1ZBE1 5DUXA 3URFA 4DY5A 1XNCA 1O3SA 1NA1C 1DDLA 1VBE1 4H55A 3IDEA 4PIYA 3GZTB 4N43C 1YI9A 4AFMA 1RVF3 1RHI3 5I93A 3WG2A 3B5LB 3MEPA 1N1YA 4ZU7A 1YJKA 3VKOA 4Y1XA 5D1IA 1DYKA 2HEVF 5DZEA 4QQHA 3N36A 4XHXA 4AQ2A 2BVBA 4Q4X1 4QQ2A 4CEYC 1WBLA 2D6PA 3IT8A 3ES1A 3LA3A 1MEC2 3T1MA 1DG6A 4J6GA 4QU2A 5T5LA 1QOTA 4Q4V1 1LHUA 3PLQA 2D3PA 5JAXA 1MVEA 1AXZA 1V6NA 3SXWA 3JQWA 5ACA1 3ZPYA 3WQ7A 2JG9B 4WVMB 1IQAA 1SACA 2H6CA 4EROA 5IT6A 1VBB2 1W6QB 2X8KA 5D8AA 5KXBA 2ZGNA 4XJ8A 1CD3G 4XBNA 3JD71 1AL0G 3FUQA 1S2KA 3GNEA 1DF0A 1J58A 1MZ6A 1XNBA 2BYVE 2DYCA 4Y24A 1FOD2 4DOUA 4X6QB 5KC6A 4XE9A 1XYNA 5FDBA 2VXRA 2RS53 1GFF2 1LOBA 3V0AA 1UD1A 2E63A 5FBZA 2BQPA 1R083 3RZZA 4YZ2A 2GALA 1FMD2 3VZNA 3WQ1A 2PTMA 1ND2A 4UW4A 4RD7A 1RUOA 5SV8A 2A3YA 3ENRA 4O9GA 1VB4A 1MZFA 5KHJA 1KS4A 1DQ2A 3O7OA 4QQOA 4RQPC 4EWDA 1YLLA 1Q56A 2XJTA 2WJSA 4PCRA 1X33A 4R9AA 3VZOA 3OCPA 4LO6B 4LLOA 4YZ3A 4ONUA 4GULA 2WFF2 4I0WB 2E53A 5KHHA 4Q0PA 3AP9A 4AGRA 1HRI2 3H50A 4LA3A 2HWE2 4Y1YA 5T3NA 1D4M2 2WNEA 4NHLA 3ZYGA 2GMEA 2HWD1 3E97A 3WXPA 4CYDA 4CDXC 3WT3A 2I45A 4XMAA 3ZN4A 4K1ZA 4AI0A 5J3UA 2IWGB 1C1FA 1LU1A 4AEJA 1QDCA 5D8AB 5FMOS 1LB2A 5F6LB 4XW3A 2ZGSA 3VBHC 1BVVA 1QH6A 5J36A 1REEA 2WZR3 5B2GB 1U5XA 2JJ6A 4C0HA 3IM0A 2UU8A 3LSDA 2MEV2 1RVF2 3ZN6A 1RHI2 3ZYIB 4RGGA 2QFEA 5KBFA 3V0AB 2ZTNA 3CF6E 2XBO3 1PVC3 2R49A 2NQYA 3CJIC 2CGNA 1W6NA 2OYZA 4MXWA 4QPIC 1N3QA 2JDZA 1UPSA 1MACA 1QJZA 1BK1A 3ZXDA 1G9CA 4COVA 2CY6A 1J3RA 4KG0A 1YO8A 4YW5A 2WNVA 3QD6A 4I2OA 1OQDA 4YVSA 1QQP3 3RNSA 1RJ7A 2RS13 1SLBA 5K9YA 1QKQA 3PTYA 2C0ZA 5E16A 3RWNA 1NCRC 4FXKB 4FP2A 5E89A 4FPCA 2D40A 3S6PA 3HT2A 3ZXEA 1HQNA 2NN8A 2HWB2 4IEVA 3I7DA 1C5IA 1GSLA 4OHXA 5JSOA 1DGWA 2HEYF 1D2SA 2JECA 3FLPA 1LKNA 4J1XA 1POV3 4AFCA 4RHV2 4LBMA 1REDA 4W6XA 2GU9A 5FCCA 2HWF3 2ZZQA 3POSA 5AFBA 2ZABA 1UIJA 4PDWA 3LB9A 1VALA 2EA7A 2RS52 3JBG2 2TNFA 5FFOC 2Q5TA 1XYOA 1NA1B 1PIV2 4QQPA 2IXLA 4N43B 3D5OA 2NPIA 2D6MA 4TLFA 3ZN6B 1X50A 2GNTA 1QJY3 4R52A 1AR62 1V6LA 1DQ0A 2RS33 4K3UA 3WP3A 4XQDA 2BVVA 4BCUA 3L9JT 1W6NB 5AC91 5FOJB 4CEYB 4MXWB 3M3QA 1COV1 4OLLA 4XF1A 1AUYA 1XE7A 4AVBA 2WNVB 4R9BA 5L7OC 2A6WA 4YFZA 3QLQA 1VAMA 3MDPA 5E88A 2AREA 1AR92 1CONA 1VBD1 3T2TA 1YFWA 4JCKA 3SNMA 4K6BA 1TMF3 1YYNA 3C2UA 1NLRA 1QNYA 4YG6A 4C1XA 1C3HA 2WA3A 2D5HA 4Q4Y1 1NY72 1SBDA 2HEWF 2D6LX 2ETEA 3WHTA 2R043 1GNZA 4KBBA 3VBRC 4A7KA 1O5UA 2VVFA 2XBO2 1FPN2 2WLPA 1Q3EA 4XXPA 1ENXA 4QGNA 1QDOA 1LOFC 1WW7A 3KCYA 4AW7A 5CFDA 4MX3A 1A3KA 4BQ1A 4UBHA 1EAH3 4D7SA 2ZOEB 1U5YA 4AEKA 5C33A 4M3CE 1WLDA 2NM1A 4I3GA 2E6VA 3AM2A 3EO6A 5FLJA 4G9SB 3ILRA 4IERA 5DDJ2 4A7ZA 4Z2WA 2IFRA 1AYM2 1K5MC 2K0GA 3BCWA 2PAEA 1URXA 1XQNA 3OF1A 4LBLA 1CJDA 2WS93 4BZ4A 5KHKA 1MS1A 1LU2A 1H4GA 4EWEA 1JW6A 1Z78A 1RMU3 2X5IA 2D44A 5L73A 1WA4A 3CEWA 1JUHA 1ULGA 4YM3A 1CPNA 2ZGTA 1GQGA 3WW3A 1YI7A 4NO4A 2H0VA 4WBBA 3H7JA 4LBOA 2EXJA 2RMU2 4XF9A 3HD8B 3RQ0A 1ZRDA 2QUOA 4YVWC