3WW2A

X-ray structures of cellulomonas parahominis l-ribose isomerase with l-psicose
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
248
structure length
241
Chain Sequence
TRTAISRREYDEWLSEAASLARALRYPVTPEMVNDSAGIVFGDDQYEAFAHGLWSREPYEVMVILESLNEPAVDGLPAAGAAHAEYSGLCDKLMIVHPGKFCPPHFHQRKTESYEVVLGEMEVFYAPEPVTVGDDDVLSFSPMPEGSPWPEGVALPAGREDSYAGLTSYVRLRAGDPKFVMHRKHLHAFRCPADSPVPLVVREVSTYSHEPAAPLPQWRGLHDNTFVAEAANSGRLATAIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Essentiality of tetramer formation of Cellulomonas parahominis L-ribose isomerase involved in novel L-ribose metabolic pathway.
pubmed doi rcsb
source organism Cellulomonas parahominis
molecule tags Isomerase
molecule keywords L-ribose isomerase
total genus 60
structure length 241
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ww2A00
2DCTA 2EA7A 2I45A 4J1XA 1TQ5A 2E9QA 3B02A 3WW4A 3TNPB 1CGPA 4LTAA 2PHDA 1RL3A 4DINB 4XF3A 3WW1A 1YLLA 1CAUA 4OLLA 4YRDA 3CJXA 4XF0A 1RUNA 4QGLA 4XFGA 2VECA 4FAGA 3I59B 4KU8A 3UKNA 4WZCA 3VHRA 4LULA 4O9EA 2GZWA 2GU9A 2IXCA 4IERA 4HZFA 3H7YA 3MZHA 1WA4A 3NL1A 3ES1A 3IIAA 3C3VA 2GC3A 4L2NA 1IPJA 4I3PA 2K0GA 2H6CA 2UYBA 4MUVA 3GBFA 2EAAA 2PHLA 1SQ4A 3H1WA 1XRUA 3PNAA 2H0VA 4L11A 2O1QA 4XETA 1DGRA 2Q30A 2UY8A 3LOIA 1VJ2A 4H7LA 3G7DA 3L2HA 3BCWA 3EQEA 4IETA 3U10A 4EROA 1O4TA 3ROUA 3FX3A 3IWZA 3H1MA 1ZNPA 2IXLA 3PLQA 1SEFA 4XEZA 1RC6A 2PFWA 5J48A 5C6CA 4Q0QA 2Q1ZB 2ET1A 3OCPA 1RGSA 4I01A 4QGNA 5BPXA 3RDIA 1O5LA 3D0JA 2PAEA 1ZRDA 3QOPA 2KXLA 2QCSB 5FLJA 4AXOA 3RPQA 1XE7A 2Z2SB 4LA2A 5LEKA 5FCCA 4RD7A 4XFFA 2QNKA 5CU1A 4Q0SA 2BEOA 4QMAA 3BU7A 2PAMA 4PIZA 5I0UA 1ZRRA 4META 3UKVA 1ZX5A 1QY4A 2WFPA 2Q4SA 4D7TA 4ONUA 3H50A 4HN1A 1G6NA 1DZTA 4D7SA 4QM8A 3I59A 4UBHA 4HBNA 1JUHA 4MZUA 5JR7B 4LUMA 4XF1A 3RYKA 4MGKE 4AVCA 3D82A 3KGZA 3H7JA 4MGZE 2FQPA 3WW2A 2WC2A 2GC1A 4I0AA 3FE5A 1ZZ7A 3FFQA 2FMYA 1IPKA 4FT8A 5JAXA 1J3QA 1LRHA 2Y0OA 1YWKA 3I7DA 3LWCA 5FLIA 5E16A 1VR3A 3LA3A 4HSLA 2IC1A 4FAHA 3NW4A 2PQQA 3N4MA 4OFGA 5EFUA 1ZREA 3H3UA 4KWKA 2BNOA 4JTNA 2K9ZA 4XFBA 5F1RA 1YHFA 1NE4A 4F7ZA 5J3UA 3QACA 3IDBB 1CAWB 1X82A 2D5FA 4BYYA 4Z07A 4JV4A 4YARA 3E6DA 5I8YA 1O5UA 5I93A 1J1LA 3KCCA 3BB6A 2OA2A 3I54A 1WLTA 3D0SA 2OYZA 1CX4A 1O3QA 1LR5A 3LAGA 2VPVA 1SFNA 3UKTA 2C0ZA 3SCHA 4Q0VA 1NXMA 1O3SA 3E5XA 1NE6A 4IEXA 2MHFA 2EVXA 5KHJA 1Y9QA 1ZZ6A 4LUKA 4F8AA 3E6BA 3SXWA 5KHGA 5FPZA 1X8MA 2UY9A 5EZWA 4WVZA 2IXIA 4P9GA 2HJIA 1FI2A 2BGCA 1X7NA 4JTOA 4KU7A 1PM7A 3CEWA 3JZVA 3FZ3A 1XE8A 2B8MA 2BNMA 3E5UA 3M70A 1LB2A 1OMIA 2CGPA 3FHIB 1I6XA 5BUVA 5D1IA 3E6CC 1PMIA 1V70A 2V09A 3MYXA 4EWEA 3CLPA 5KBFA 3DV8A 4ZU4A 4XFHA 4GULA 4XF4A 3S0MA 4LA3A 2OZJA 2ZKLA 5FPXA 5I8TA 5I8SA 4IEUA 1YFUA 3ES4A 4AVBA 3NSTA 3R6SA 2ETEA 4MH0E 2XHKA 2Q0AA 4IEQA 4MGYE 3KGLA 3HT2A 4LEJA 3SCGA 3S7EA 4A2UA 2P17A 3EJKA 1ZZ9A 2O8QA 3DN7A 1J3PA 4B29A 4BHPA 1EYBA 3OF1A 4N9IA 1FXZA 1UPIA 4XFIA 2D5HA 4YNIA 1ZRFA 1ZZBA 5KHIA 3NKTA 3RNSA 1EY2A 1UIKA 4UBGA 2OZ6A 4UXAA 3CF6E 2XLGA 4E2SA 2IXKA 2CAUA 4JVAA 4IESA 4K8FA 5KHHA 4EWDA 5LEJA 4PJYA 3KSCA 2HKXA 3O14A 2N7GA 1UW8A 2VQAA 4KL1A 2B9UA 1ZVFA 4E2QA 5J7MA 4IEOA 3IBMA 1CAXA 4AQ2A 2D40A 1O3RA 4R8HA 4EWAA 1UD1A 3IDCB 2ET7A 2QDRA 3NJZA 5HI0A 1QXRA 3H9AA 4HVRA 2UYAA 3RYRA 1NZCA 4R52A 1U12A 1Q5OA 5I0SA 5BY5A 5JCTA 2QJVA 2XLAA 3RYPA 3WW3A 1EPZA 4IEVA 2H6BA 5BV6A 1QWRA 4I09A 1H1MA 3USSA 5JSOA 2MNGA 4XFCA 1CAXB 4QX5A 4AQ6A 2PYTA 1HW5A 4EV0A 4ORFA 4MX3A 4HLTA 1OI6A 5FDBA 3E5QA 3EO6A 3HIFA 1O3TA 4I02A 3M3IA 3DL3A 2PTMA 4YSFA 4TLFA 3MDPA 1L3JA 1H1IA 4WBBA 1Q3EA 1X8EA 2XLFA 4I2OA 5KHKA 5C8WA 3H1YA 3LZZA 4I0BA 2PA7A 4QXKA 2GAUA 4O9GA 4PIXA 5BXXA 3U0ZA 1GQHA 5LRSA 4HVOA 2BNNA 1RTVA 1OD5A 4HSJA 3RZZA 4N9HA 4NVPA 4Q29A 1YFXA 4QM9A 1ZRCA 2BYVE 5LRRA 4KWJA 1I5ZA 1NYWA 5T3NA 1CAVA 4IEZA 3NVCA 3OGJA 4ZU7A 1CAWA 2GC0A 3SCFA 1UCXA 5I0TA 5E1RA 3TNQA 3SHRA 4HN0A 1OFNA 3U11A 3FJSA 4QGMA 2XKOA 4LLOA 4FBFA 5FQ0A 1YUDA 1Y3TA 3HQXA 4HVQA 2XL7A 3ZDSA 4KWLA 1CAUB 5CVRA 1J58A 3E97A 4XF9A 3H3ZA 4IEWA 2PAKA 2Z69A 4CYDA 1Q43A 1WGPA 3SMHA 1RUOA 3DKWA 2CAVA 4YYOA 2GH2A 2XKPA 4X6QB 4PIYA 4MGIE 5CADA 5JSPA 3CL1A 3HT1A 1VP6A 4MV2A 5FQ0B 2D93A 3ELNA 2ATFA 5I91A 3LA7A 1YFYA 4X6RB 5FLHA 2GC2A 1ZZ8A 3PVBB 1EP0A 1ZZCA 4IEYA 2IXHA 1O7FA 2XGXA 5I0RA 1J3RA 3OTFA 3ETQA 3BPZA 3GYDA 1J59A 3ACLA 4Q0PA 1LKNA 4Z82A 4AVAA 4BIFA 1QXJA 1FT9A 2IXJA 4J1WA 4ZU5A 1GQGA 1YFWA 3BALA 1DGWA 2B5HA 2MPFA 3ST7A 2QVSB 3CO2A 4E2GA 5JSRA 4XFAA 4HMZA 3OD0A 3EBRA 5K8SA 4BH9A 3KMHA 3FWEA 4Q0UA 2XL9A 3H8UA 2F4PA 3LA2A 4IEPA 5AVPA 3S7IA 1UIJA 2CV6A 3MPBA 2OPKA 1CAVB 2ZCWA 1DZRA 3EHKA
chains in the Genus database with same CATH superfamily
3WQ0A 2CDOA 2O14A 1IS5A 2GMEA 3J7LA 4GALA 4MADA 3RGBA 2JWPA 4AGRA 2CDPA 3KS7A 2P2KA 3LOBA 1LEDA 5BNOA 2UU8A 1F2NA 2BJSA 4PBOA 2FZ2A 1AR63 4BQ5A 4LTAA 4B4QA 3JQWA 3MFAA 2PHDA 4IL7A 2X5IB 1U5XA 4A44A 3ME2A 2YHJA 1NCQB 4XJUA 5IFTA 2VZ3A 2W94A 4XF3A 1ZYBA 2G9FA 2BP6A 2X09A 2ZPXA 4LBOA 4YRDA 1WCDJ 4JGYC 3ZYBA 1V0AA 1VPHA 3VKMA 3WNKA 4LHLA 2P3YA 5DZFA 5DAPA 1WLWA 2R30A 2CYFA 4O9EA 1LOEA 5EYXA 3NNGA 1NOVA 1IZ3A 3ITQA 1IKPA 4P08A 2HBTA 1JXNA 4YFZA 1K5JA 4P5YA 4Q1PA 2O0OA 4CDUA 5L7OB 2A7AA 3H7YA 3I3DA 3OY8A 1V6OA 3T0AA 3BIWE 1WA4A 1S0JA 2BGPA 3OEBA 3WXPA 1BMV2 3VLBB 5DAWA 2NN8A 2HH9A 2WT0A 3M7AA 4OUMA 2CWMA 2ZACA 3WP6A 4M01A 3V0AA 5JXJA 1S0IA 2YBPA 5DN2A 5CFCC 4UOJA 3J4UH 3WLUA 4AEDC 2K0GA 2XHNA 3DYPA 3LFMA 4IE4A 3VHNA 4ZS3A 2R16A 1C28A 3AZWA 2XB6C 3H1WA 3J7MA 3I3BA 4LMFA 3ZXKA 4AZZA 1WKYA 3O1VA 4IGQA 1SLLA 2H0VA 1GWKA 4NJ4A 4E4SA 3NNFA 4KG0A 3OGGA 4YVWA 2ZGNA 3LDKA 4NWVA 2ZMKA 1DLCA 2VE1A 2WFF2 1S0EA 3BCWA 3EQEA 3AL6A 4RYDA 1LOGA 1TNFA 1W2NA 1ZBA3 2Q1FA 2VVDA 3FX3A 4P14A 5FY1A 2PQSA 1WZXA 1H2MA 3TEWA 1Q8VA 1US2A 2RR11 1SEFA 1E5HA 3PLQA 1VMHA 3WF0A 1RXFA 1RC6A 4YVWC 3WDUA 3KHCA 1UKRA 3PUQA 3NKGA 1ZBA1 3OCPA 2WS92 4ZXKA 4QGNA 3VBHA 3RZKA 4IV1A 5LASA 2ZS6B 2RM23 1Y4WA 1RUI2 4N53A 4E8CA 2Y6FA 2WWSA 3QOPA 1S2KA 1YNAA 2WQ8A 4Y1UA 4HONA 5FZ0A 1H30A 1YJLA 2Y8KA 4CDXC 4AXOA 3RPQA 3RZLA 1QJEA 4E4DX 4LBQB 4CP9B 3ZO0B 5LBBA 3K75B 1X33A 1GNYA 3B3QE 4QHOA 1QQP1 4Q0SA 3T30A 4NHKA 1W6NA 2HWD2 4XXAA 5IK4A 4QDQA 4META 2W1UA 1W8FA 3OB8A 3KVBA 1SG3A 3UKVA 1QY4A 5J1XA 2WFPA 2Q4SA 1CIYA 2XJVA 5BNQA 1GV9A 3H50A 5FZ4A 2VOXA 3UJOA 1DZTA 5FRAA 1UYXA 1IG3A 3AP7A 2HWC1 3I59A 1PZ8A 4BCUA 2RS33 4NHMA 1HN1A 2WINB 1AYN2 2DBNA 3AYAA 4LUMA 4XF1A 5BNOC 1OLME 4HANA 4FI9A 1EV13 3UGFA 3H7JA 3ZXFA 4MGZE 2FQPA 4PHZA 3WF3A 3VBSB 1JZ8A 1W6QB 1W8NA 1D7PM 4PCRA 4SLIA 2YXSA 1J3QA 1JS9A 3K51A 1UZ0A 5F32A 3T08A 4BK4A 4YVSA 4L97A 5CEHA 3GHNA 5CISA 1HLCA 3MIGA 2JX9A 1SCSA 2V73A 1N3QA 4EZ4A 5AC92 2XJUA 2P6HA 1CN1A 2QQOA 1AYN1 4IDZA 5E16A 1VR3A 5FLIA 2DTWA 1R64A 5GZDA 2IC1A 2D98A 3HNYM 1ONAA 4Q5OA 4XVHA 2WT2A 1WCQA 2PQQA 1NY71 2ENRA 1US3A 4MLOA 3ZMOA 3N4MA 4OFGA 1PX3A 2QBXA 1WLDA 1SFYA 5FBZA 1ZREA 5E8AA 2GP5A 1YHFA 5GLVA 4F7ZA 5FYMA 2JD4A 3W9AA 3A22A 1PZ7A 3HBKA 1MZ6A 3QACA 2Q8CA 5J3UA 1GNZA 2QE3A 4LJHA 1UOJA 1K5MC 1W9YA 4JV4A 2WR9A 3T4HB 2AGSA 3E6DA 5DAQA 4FFGA 4LHSA 1J1LA 3KCCA 3BB6A 1OT5A 4Q4Y2 2GALA 2OUJA 4Y5SA 3UL2A 1L7LA 3SEPA 4ZY9A 5K9YA 4A6SA 1QJU1 1VAKA 2HEVF 2WO3A 3T1MA 1O3QA 1UY0A 4B1LA 5LA0A 3POIA 5GZEA 4A45A 1UU5A 3AFGA 1K5MB 2TNFA 4C8DA 4OUSA 1YJKA 4FPLA 1MS3A 4Q0VA 3HNBM 3JD71 3POEA 4PQQA 1BK1A 4QPGB 2MHFA 1Y9QA 4B7EA 1LAJA 2D6MA 1VBE3 3O5SA 4OQ9A 1NCQA 4L92A 2YPDA 2IXIA 2OXBA 1WMDA 5C3OA 2Y6JA 3M3OA 1UMZA 4JTOA 2VBDA 4KU7A 2VCCA 3VZOA 3CEWA 3JZVA 5FMOL 4UFIA 1IS6A 1F5JA 2VCAA 3E5UA 4QD2A 2DCKA 1LB2A 3KT1A 4FO9A 3VBFB 4AVTA 4ARYA 1JH5A 4WM7A 1W28A 2XBO2 5LY1A 1HV1A 1PMIA 1XBFA 2OPWA 2VNGA 5LA9A 4RS5C 4A3ZA 2IFWA 2CNAA 3K46A 3MYXA 3CLPA 4EWEA 1RUJ3 3KF3A 2TUNA 5CFCB 1YIFA 1SHWB 4GULA 3S0MA 4B4RA 4CDUB 1DP0A 3JBG3 5BNPC 3DCQA 4RN5A 2QQKA 1EUTA 2WNEA 5I8TA 1HRI3 3ZN4A 2RHPA 1EUUA 4CPBA 1FNYA 2D6PA 2KA3A 4Z92B 4GD4A 4RR3A 5ISLA 1RUJ1 5FY9A 1S0CA 4K1ZA 2W87A 3WG2A 4MH0E 2XHKA 4IEQA 5FZ7A 4Y22A 5FZBA 4RGAA 4OHVA 2A6XA 2IZWA 2R0HA 3HT2A 4JAAA 4FTBA 2P17A 3LE0A 5F8PA 5A7PA 3VZJA 5FP7A 4BXSV 4RR3C 3OF1A 3GJBA 1TMF1 2IFRA 1C57A 1Y43B 3J8F3 4N9IA 1COV2 5KXEA 4Q4X1 4YNIA 2IVJA 1ZRFA 4F3JA 2HEYF 4DRRA 3VBSA 4AF9A 4NO4A 4N7IA 4BMBA 3ZKYA 3GBGA 3J8F2 2CWSA 3MHZA 2ARXA 1NCQC 1V9U3 5FZEA 1BBT1 2X5IC 4GMP1 4M00A 5F37A 1IQAA 5LEJA 1PM4A 5FZ9A 3MIEA 3O0WA 5HCBA 2HKXA 3AP4A 4BQ1A 2F17A 2JDNA 1MS4A 2D3RA 3WY6A 3HR9A 4BLJA 2NPIA 3T0DA 1EAH1 5FPVA 1QH6A 5ACA2 4QU1A 4IEOA 1CAXA 1N1TA 1PMHX 4OVEA 1BZWA 1GLHA 5AFEA 2ADEA 1A8MA 3F95A 4QHZA 3VV1A 3IDCB 3NJZA 5FYCA 3FLPA 4RGGA 2VZVA 5FUIA 5CA6A 1W8WA 4COUA 3ZR5A 2D6LX 2WA3A 1B35A 2VNVA 5BNPB 3NV3A 4HVRA 3LB9A 5JIAA 2ADDA 1NZCA 2RMU1 3RYRA 3TEYA 3CJIA 1W99A 5JCTA 4LBQA 4LHKA 1NCRC 3VD4A 3IPVB 3POWA 1MQTA 1EPZA 1RJ7A 5FOBB 4OULA 2B45X 3ZFGC 1GZCA 4FSJA 1W6NB 4QX7A 2MEV2 1REDA 4XFCA 1NT0A 4J6GA 4GZ9A 1R1A1 2WQZC 2V5DA 4HKWA 4AVSA 5IYYA 5FPLA 2AEYA 2ILMA 1HW5A 2B7YA 1AR82 3HQUA 3OUHA 4EV0A 4D3WA 4ZZ8A 3MPPG 5FPAA 4WM8C 4Q4X3 4D94A 5JOWA 1OA3A 2QQLA 3UK9A 3ALQA 4I02A 2HWB2 5CKNA 2ZKNA 4FP3A 3ZFGA 1F8VA 1QOTA 1W9SA 4H3WA 2YZ4A 1A3KA 1MS1A 3LD8A 4YSFA 4TLFA 1OURA 1V9U1 5T5OA 5FBJA 1JZ5A 2J1EA 3M4FA 2C6SA 2WUHA 5ACA1 1JYWA 3MW3A 3SITA 1UOFA 4UFMA 3POFA 4RL7A 1H1IA 2Y34A 2NQYA 1G9BA 4ASLA 2JE7A 1RHI2 1UOGA 2VW0A 5DZGA 5FAXA 5JPNB 4Y26A 3B9CA 3OGSA 2XLFA 1O8SA 3PTRB 2QQVA 3RVHA 3U4SA 5C8WA 2CGOA 4LKFA 4I0BA 3Q8FA 2VCMA 5D8AB 3J26N 5SV8A 1W2OA 2C9AA 4N43B 2AUYA 2F6BA 2E33A 4DXSA 1COV1 2JDUA 3WHTA 4CCJA 5LRSA 3I2OA 4NIHA 1NLQA 1OD5A 4TN7A 4IE7A 3ZSKA 1HRV1 5LA2A 1YFXA 3J7HA 1FOD2 2E51A 4GJYA 2BYVE 4YW7A 4AFDA 4NE9A 5FV3A 1GP4A 2RS51 4A7ZA 1W90A 4N7UA 2AR6A 4MOAA 3NVCA 2W3JA 1CAWA 3WNXA 4BQ2A 1K45A 2W47A 2C24A 5K0UC 4P9YA 1KFUL 3LEIA 3P1IA 1QGLA 4NIGA 3HAGA 5L36A 1VBD2 5KXDA 4YZ1A 2GMMA 3VBUB 1FPN1 2G19A 3U78A 2GH8A 1SLAA 3O1OA 4LLOA 4FBFA 2OS2A 3NAPA 4JDMA 1Y9MA 5FQ0A 5A32A 1Y3TA 1PO13 1WBLA 1DQ1A 2I2SA 3ACFA 1LHUA 3I3EA 4WZFA 4XC9A 4KWLA 1CAUB 1RXGA 2RMU2 4KWUA 3ABZA 5FZ1A 4CTEA 5BNOB 4HPKB 1S0FA 5AVAA 3WSOA 4XF9A 4AEKA 1XC6A 3H3ZA 1FV3A 1D4M2 1FPN2 2VVEA 3HD8B 1B09A 1WGPA 5CYYA 4FOVA 1KS4A 1RVF2 1SPPA 1UZWA 1NA1A 3W59A 3VBHC 4WVVA 4GB31 1PGW1 2GH2A 2XKPA 4X6QB 1H8TA 1VAMA 4LBLA 4YZ3A 1VMJA 3BI3A 4Q4W2 1OF4A 1APNA 1DGLA 1LTEA 2XJPA 3CL1A 3HT1A 5DZEA 3DPRC 1VP6A 2ZHMA 5DDJ3 4CRQA 1BCXA 1BMV1 1OSGA 1W6OB 4HKLA 2WNVB 2D93A 2VZRA 1OQ1A 4W50A 5FUPA 3DXTA 4TSVA 3O1RA 4UAPA 4M3CB 2RS53 3GZUC 2WLPA 1V6KA 2EIBA 5GZCA 4AQTA 1HKDA 1T6BX 2UURA 4Y1VA 2JDHA 2YMZA 1UU4A 1EP0A 2JENA 4NHYA 1QNYA 5L7OA 1DZQA 1HRI2 4IEYA 4BE3A 1JYNA 2PHFA 3P3PA 2JE8A 4H14A 3EMRA 1LOFA 1DF0A 4JKKA 4LORA 1GBGA 3ETQA 4XHBA 2HWF2 5LATA 3BPZA 2RS13 3Q8CA 1BEV2 5C3RA 3FUQA 1J59A 3WF4A 4OUEA 1AR61 5IK7A 1C8M1 4AVAA 4TWTA 3POGA 4INDA 5JOYA 1N1VA 2VQTA 4IQPA 5IW0A 4TZDA 1PO22 1UKGA 1OOPB 4YM0A 3P5BA 4JGZA 2NZ9A 2WT1A 3LDRA 4YG6A 2RR12 4J1WA 4ES8A 3AL5A 1GQGA 2ZEZA 1I3HA 2JECA 3OYWA 4XAEA 1C4RA 2ES3A 1IS4A 1DGWA 2BU9A 2NM1A 1RUH2 2PHUA 3C7HA 3CO2A 5J36A 4LNVA 4QWNA 4BQ3A 4PLOA 4BQ4A 5DABA 3O1PA 4NWWA 1DGRN 4M0NA 1H0BA 3EBRA 3UT0A 5EPAA 1YQ6A 5IFPA 3FWEA 4Q0UA 4PF5A 4CU9A 2C1FA 3T2TA 1H8TC 4FOWA 4AVVA 1RUG1 3K3OA 1ZBE2 4FPOB 5FP4A 1QJY2 2R062 3AM2A 5IVVA 5CNAA 4Q4V2 3KHBA 1F9KA 1DQ5A 4W65A 1ZRIA 3OPZA 5FXVA 3VBHB 1UIJA 5IWFA 3MPBA 2OPKA 3MUY1 4U2AA 4QKDA 1HB3A 1AR73 2QZ3A 1QH7A 1XXNA 2EA7A 1W8HA 1XNKA 3H0OA 4J1XA 1FYUA 5L9VA 3BIEA 4LKSA 5F9TA 5FYIA 1TQ5A 5JOZA 1H1AA 1OVPA 1UL9A 4LK7A 2FDHA 3B02A 4RHV1 1K3IA 2FBEA 3PVEA 2EF6A 3TNPB 1CGPA 4AEDA 4XDPA 3MV01 1AR91 4EN7B 3WDXA 2E6VA 1AF9A 1AR62 3WW1A 2ZGKA 1LOAA 3N36A 1CAUA 5IVBA 3SH3A 1PVC3 5FREA 1EV12 1YI9A 2A6YA 4TXWA 5K0UB 1LGBA 3CJXA 4FPKA 3H42B 4F8AA 3WNNA 1RUNA 4QKBA 1JODA 4P00B 3R05A 1ASJ1 3SKJE 2QQMA 3WG4A 4YVSB 2WQ4A 5LA1A 1GKBA 3GZAA 2ORXA 3VHRA 3PMEA 1PIV3 5FXWA 4NPRA 1QXPA 2IXCA 2DU1A 1ND2C 3MF6A 5FTTC 3I2GA 2RM21 3EB7A 3ZSLA 4CDQC 5A6ZA 4LK6A 3VBFC 1W6QA 2C5DA 1ND3A 1Z7S1 3NL1A 4MXWA 3LQCA 5D8AC 1G8WA 1RITA 1RUJ2 2J1TA 4NPLA 4WM7C 4L2NA 2EIEA 2GSYA 1QU0A 3FUOA 5IATA 3KVAA 1FMD1 2WSVA 4I3PA 4D0QA 1XYNA 2H6CA 2UYBA 3V65A 5FYHA 2VNRA 5HCFA 3WZ1A 2ARCA 2CHHA 4CDXA 1TEIA 1IS3A 3I3QA 2EAAA 1AUYA 1J1TA 5ERLA 3QH6A 4YM2A 5GALA 2W08A 4CEYC 3ILRA 1BVP1 1FATA 5FY4A 4WM8A 2D7FA 3CQOA 2FDGA 4GMP0 4XETA 2G9ZA 2ARAA 2RJKA 3SLIA 3WG3A 1RUE2 4K7JA 4L8QA 5FK7A 4H7LA 1DCSA 4IETA 1AJOA 1CPMA 4EROA 1N47A 3SEEA 2WFF3 3IWZA 3BTZA 4HL0A 1ZNPA 3H3LA 1VB2A 1ASJ3 4NROA 4QKFA 2BW8A 2Q1ZB 4BWOA 5CBLA 2ET1A 1JU4A 1PO12 2ZZQA 3FLTA 3J9SA 4JX0A 1W8OA 1RGSA 2V5YA 5BPXA 5F3GA 3RDIA 1ASJ2 5ABJC 2WZR3 3ON7A 4GXLA 2K2SA 4PF1A 3A21A 1OPMA 3MLJA 4HPKA 4XOGA 1UY3A 3M3QA 4JKMA 3VBFA 4AHXA 4PLNA 5LEKA 5KR7A 1SLTA 4OI1A 1AR92 1NA1B 5FCCA 1XPWA 4XFFA 2VL4A 2QNKA 5DXDA 1NKGA 1VRH3 5CU1A 3WCSA 4Q4W3 4XUNA 1KS5A 2BEOA 3AP9A 4QMAA 4XABA 1DBNA 5FWEA 1FMD3 3CMGA 4Y20A 2VTXA 3VL9A 4V1PA 2WN2A 3D8CA 3L2YA 3SISA 5A3UA 3TBDA 5T5LA 3KD4A 4ONUA 4D7TA 4HN1A 5IK8A 3ATGA 4FTSA 1QQP3 3IMNA 1G6NA 1YC61 2XUEA 3VZLA 4D7SA 1PGW2 2ZGQA 5D2AA 4HBNA 5JR2A 4FQ4A 4MZUA 5HPOA 2LW8A 2PXJA 3D4KA 4UYBA 3RYKA 3PVNA 4ZZ5A 5FO9B 3N3HA 2PLV1 3I2JA 1STMA 2WFF1 2ZGMA 1SMVA 3KGZA 4GAZA 2RDSA 4K3UA 5F6KA 1LGCA 1W6PB 2GC1A 1U5IA 4DMIA 2FDIA 4FFFA 3FFQA 1OFSA 2XJTA 2FMYA 3KCXA 1AR81 3HBZA 2X29A 4QX8A 4XE9A 5CFDA 5FZIA 3HPNA 5GJ6A 1XU1A 3ZSEA 5K7PA 1NQJA 4XIOA 4NIIA 1CZTA 3RJ2X 3OGVA 2J7MA 4LQRA 1POV3 1MZ5A 1JMUB 3K77A 4HSLA 4LKEA 1U5ZA 3VBRC 2VOWA 4FAHA 3RI9A 4P9IA 3N7LA 1IQDC 2DTYA 2DCZA 2DV9A 5LBCA 1SBEA 1UXXX 1QJX2 5L9BA 3R4SA 5EFUA 4KWKA 3GHMA 2BNOA 5ACA3 4XFBA 2D44A 5F1RA 2LM3A 3LFIA 2LALA 5DUUA 3WVJA 4AHZA 1NG0A 3M8LA 2WL1A 1HQNA 2YC0A 3FN9A 2K46A 3DEMA 4FOQA 2BBAA 5IAXA 2IUWA 2JDPA 2XXZA 1QHDA 4YARA 2A3XA 3ZX7A 1VB4A 4AG4A 3CIHA 1YQ2A 3C8XA 2ERFA 1HB1A 4FFIA 1OKOA 3AMMA 2WO2A 1WLTA 1SACA 2VVFA 3GZTB 3MI8A 2OYZA 1JTZX 4YZ2A 2J1UA 4PLMA 1LR5A 1TME3 4QX1A 4QPGC 1LHWA 1NCRA 2C0ZA 1MR5A 3WD5A 1RHI1 1SDWA 1ZBA2 1NXMA 3AKRA 1TMF3 1O3SA 1XB9A 4AFCA 5FO8B 2VULA 4JC1A 5CFDC 4BXFA 2PHXA 1GANA 5KHJA 2P6CA 1H9WA 2QUOA 2LS6A 3CBNA 4MGQA 3ZYFA 4DZGA 4AEDB 4TTGA 4HG6B 5DUXA 1S55A 1WCUA 1RVF1 2RVAA 2PHWA 4H55A 4QQ2A 5EWSA 5EZWA 4B8EA 2FCVA 4P9GA 4UWDA 1FI2A 2BGCA 1X7NA 1KGYA 3OPWA 4XMAA 1VBE1 5FKCA 3SNMA 1H2LA 2BNMA 2Z79A 1MS0A 3M70A 4H2AA 1G9FA 3AZXA 2ZX1A 4LO4B 1I1EA 1BJQA 2CGPA 3ZXLA 2VOVA 4BDVB 3E6CC 3VB9A 1ENRA 1V70A 2V09A 2VTXJ 2X05A 3VDBA 1GOFA 3MEPA 5CZKA 4UW6A 5A1FA 4A42A 4ASKA 4LXLA 4UFKA 3R4UA 1UPSA 5JLVA 4CCKA 1OF3A 2XVKA 3QH7A 5E89A 5FPXA 2YYOA 1WD4A 3JBG2 4JGYB 5I8SA 1C1LA 1ND3B 2D43A 4MXWB 1YFUA 2DUPA 4XJZA 3V0BB 4Y5Z0 3TYJA 3AB0A 3NSTA 5FYTA 3R6SA 1W9TA 2ETEA 4LOTA 5L9RA 5H9PA 1GUIA 1DYPA 5A3MA 1BXHA 1WCKA 3KGLA 5KC6A 1H4GA 2RS32 4A2UA 3KQ4B 2A5ZA 5C8CA 2ZGRA 2VM9A 2O8QA 2WA4A 3DN7A 4BIOA 1J3PA 1PMJX 2RS12 1QNWA 1BVVA 3GM8A 1JZ2A 1Q8PA 4XFIA 2W5FA 1DHKB 2D5HA 4CUAA 2BRTA 4IV3C 5DUVA 5M0TA 4GH4C 1UMIA 1VBC3 5HV0A 3WP5A 2VOKA 3RNSA 1EY2A 1SLCA 2WO1A 3GCWA 3M3CA 5K4LA 2XG3A 3SH4A 2OZ6A 5FMBA 3CF6E 1LOBA 1VALA 3OOXA 5CKMA 2B46X 4EWDA 5JMCA 4EE2A 3APBA 1ND2A 3JB4C 5EQUA 2W46A 4A7KA 4K8RB 1UW8A 4KL1A 5LW9A 1DQ0A 3RG0A 1CESA 4X8PA 2JKBA 1DG6A 2WBKA 5J7MA 3F2ZA 3IBMA 1YQ5A 2XQXA 5D21A 2WS93 1BKZA 1TZOA 2ZGSA 4GWNA 1F4HA 4CSWA 1O3RA 1OHFA 4COWA 2ET7A 2QDRA 3GALA 4CCDA 1GYKA 2OIIA 1M06G 1QXRA 1EAH3 1RMU1 4BA6A 3UJQA 1AL22 3BN6A 2UYAA 1XQNA 2WNVA 1LOCA 2ZZJA 4XACA 1U12A 5IT6A 1Q5OA 1MPXA 2RV9A 1RIRA 2Y26A 2VZOA 2OVUA 3PUHA 4CP9A 4LT5A 5H9SA 4R9CA 1PX4A 4GWIA 2QJVA 3VKNA 3RYPA 2GDFA 4DQAA 4P5HA 5JDBA 1H8TB 4AI8A 4IEVA 1CIWA 2H6BA 1D0GA 5F5AA 5BV6A 2QQNA 4I09A 3PUIA 5JSOA 5F39A 2MNGA 3FL7A 4PDWB 4WVWA 5FYBA 1CAXB 3TEZA 2DDUA 3VDAA 4AQ6A 4Q8KA 4BPZA 4NMIA 1OLQA 3T4VA 1N3OA 2Y6LA 4DIQA 3E5QA 3EO6A 4RA0A 2DUOA 3KV4A 1VBC1 1PK6A 1DYOA 3DECA 1MEC2 2J1VA 3IAPA 2VUAA 4H7MA 4K40A 4LITA 3TOJA 5A3WA 1AX0A 4C1WA 1OOPA 2HWC2 4FOYA 2ZAAA 2AYHA 2YDEA 3MDPA 4FPFA 4YW6A 1AXKA 1V00A 3I2FA 2WN3A 1SLBA 1BK0A 1Q3EA 2HWC3 1W0PA 1X8EA 3KQRA 4D6SA 4RGKA 4CUBA 2XUMA 5FZGA 3JUUA 3MIHA 5GZFA 1EV11 5FZOB 4LKDA 5IVJA 1PVC1 3T3YA 5A7WA 2E53A 3RWKX 1MVEA 4CEWC 1RMU3 4PIXA 3VL8A 3DYOA 4JDNA 1VAVA 4N9HA 4NVPA 5A80A 1R091 4A4AA 5LRRA 4KWJA 1I5ZA 3NJXA 3AMHA 1UO9A 1NZIA 1QEXA 2R1BA 2YY1A 2VD7A 3G6JB 3HOBA 3O1UA 4COVA 1R1ZA 3ZFFC 1DYKA 2BWAA 2JDZA 4U36A 1JU3A 5B4NA 2D3PA 5FYUA 3GXUA 3M1HA 1UU6A 4KI5M 5JUVA 3IKWA 4FQZA 2AZ5A 2GP3A 2A3YA 3TAYA 4BM8A 5C4WC 3UETA 1OFNA 2XMLA 3U11A 4DUWA 3OD4A 2Z5WA 3FJSA 3ZFFB 3FHQA 2A71A 2HWB1 4YW1A 4UFJA 5J09A 4ISRA 3M3EA 3KWVA 3EYPA 1DDLA 1UOBA 4HVQA 1DFQA 2XL7A 3WUDA 3Q9OA 5CKQA 2YBKA 4LLFA 4Q2FA 3VBUC 1YO8A 3E97A 4QPGA 1CD3G 1OD3A 1ULDA 1VBE2 5FP8A 1O8PA 2VQ0A 1BYHA 4ZS2A 2D97A 3K3NA 1Q43A 3WQBA 3FBMA 3AYEA 5LZ6A 1RUOA 4MYEA 5FZDA 4YYOA 3ZOIA 2RM22 4MGSA 1QDOA 5F5QA 2DYCA 1AL0G 4TYSA 1GNHA 4PIYA 1OA4A 2YGMA 5CB7A 1IGOA 5FZMA 2Z4FA 5JMOA 1QOOA 5BNNC 3PU8A 1BLZA 2XDVA 3ZM8A 5FZCA 1RINA 3N9OA 4Y1YA 3ELNA 3WT3A 4YW5A 3ZIXA 1R093 1UZVA 3RFRA 1GWMA 4XILA 2YV8A 4N43C 4R9BA 5FLHA 2GC2A 1ZZ8A 5DDJ1 1U5YA 1PHMA 3TN93 1A78A 4V2VA 1HXS3 3LPGA 4PDWA 4R9AA 3I2KA 5JOXA 1BBT2 2XGXA 3ZXDA 5I0RA 2W52A 3DKQA 3OTFA 3O12A 1LHNA 4DY3A 4QB1A 1AYN3 4DUXA 2ZGPA 2RJ2A 1XJAA 1GFF2 2JIJA 3ACLA 5F5IA 4UFLA 5A7QA 3PURA 1TVGA 4OHWA 5F6LB 5A1LA 1S2EA 1I9RA 4HK9A 4UW4A 1TG7A 2JG9C 1ZA7A 1ENXA 4M4RA 1QXJA 2X10A 4M3CA 2CL2A 2IXJA 2WNUC 1GZWB 4DXZA 2CU5A 3BALA 2R043 4OI2A 4WM8B 2MPFA 2VMDA 5A33A 1GZTA 2QVSB 3ST7A 4E2GA 2WIIB 4XFAA 1CX1A 1R081 2B4KA 3WF2A 3T0BA 3O0VA 2P3IA 1RUC3 2QDNA 3ZFEC 4QPIA 1AHSA 1OA2A 2JG9A 3NJVA 3N9LA 3UGHA 5FZOA 1QF3A 3KMHA 4BH9A 5K8SA 3VD9A 2WZEA 1JYTA 3W5MA 5A7WB 2BUKA 4EN9B 2MEV1 4OMDA 1S0DA 5GLTA 3ZDVA 3KV5A 2F4PA 1RUI3 3IN9A 4OQ8A 4OHXA 1OH3A 4D6QA 1WW6A 5A3PA 2YPJA 2QQWA 4QQLA 2VTFA 4XYXA 5DMYA 2HWD3 2ZGUA 2ZCWA 1ENSA 1LU1A 1G86A 3WOGA 4GH4B 4HT1T 2A6ZA 3DF0A 4WVMA 5B4XA 2JXAA 2I45A 2X53S 3MBWA 1DQ6A 3CJIB 4PQ9A 4N53C 1OQDA 2RS52 5A6QA 4R4XA 1FOD1 1XNAA 4S2DA 4AOCA 5JI9A 2E9QA 1NLRA 5LK7B 3WW4A 4XJ8A 4DUVA 4Y20B 4P9XA 4LBJA 1G9AA 2X8KA 1BQPA 1GSLA 3D5OA 4DINB 2HWF3 3ZSMA 4IXLA 1YEWA 3ZYJB 4I30A 3AXEA 2HYXA 4KH9A 4AI9A 4OMCA 1W8ZA 4CDWB 4XF0A 3POBA 4QGLA 4XFGA 3R4DB 2VECA 4YGBA 4XBQA 5FP3A 3AJYA 3I59B 5T5PA 1D4M3 1XNDA 4XMIA 1HRI1 4KU8A 5E88A 3UKNA 2XJQA 4WZCA 2XVGA 3O1SA 5DG1A 1JHNA 2HBUA 4JQTA 5FZAA 3W5NA 1JHJA 2ZBJA 1WMFA 3NAPC 4IERA 1W0NA 2WZR1 2AREA 3B5LB 4JHTA 4XIKA 5FFOC 3CU7A 3MZHA 2VCBA 3RMXA 1LOFC 5C3QA 3DXUA 2Y6KA 3RSJA 3ES1A 2XR4A 2AC1A 3QD6A 3IIAA 3C3VA 4HFSA 4QX3A 1HV0A 3T2PA 1KD7A 2GC3A 5FY7A 3WQ1A 4A6OA 1O4ZA 1RUE1 3WV6A 1VBB3 5EJ1B 3LSDA 2EIDA 1AYM1 2C4XA 1UYPA 4AHWA 3ZXGA 2DVFA 1H6YA 4RS5B 1VBB2 1W2TA 2ZABA 3IDAA 1V6LA 4MUVA 3KT7A 1SQ4A 1VBB1 1FOD3 3A0KA 4P9JA 3UNPA 1W39A 1XRUA 2DCYA 1UY4A 2Y60A 4GIQA 4UW3A 2O1QA 2WWJA 1OVSA 3OY8B 4AFBA 1YI7A 3Q8AA 1COV3 4XURA 2UY8A 2ORZA 4IE5A 4CEYA 4YG0A 4AI3A 1JUIA 4YGEA 3ROUA 3OBTA 4KMQA 4V2WA 2W1QA 3H1MA 3HJRA 4XBLA 4FVVA 5D8AA 4ASMB 2IXLA 4IV3A 4XEZA 4JQRA 2D6KA 4PDWC 1KQRA 3MLLA 4L99A 1T2XA 3WDWA 2ARBA 2BZDA 4YW2A 2JIGA 3AC0A 2VZTA 5C33A 4AI1A 4CVUA 2PHRA 3HMYA 4QPIB 3CNAA 4CU6A 3WCRA 3C2UA 4XW3A 4DOUA 2EXJA 2PAEA 3GF6A 1MZFA 1ZM1A 2KXLA 5ANQA 4KG8A 2QCSB 3W58A 5FLJA 3QCWA 2A1XA 4DS0A 4Q4Y1 4AWDA 1UN1A 1H4HA 4LA2A 5FYSA 2FDJA 4AFAA 1PO11 2VMGA 4QDRA 1UZYA 1SPPB 3THDA 2GN7A 4AEMA 5LCWL 1SLIA 4RD7A 5C5UA 3LSEA 5GLWA 4ES9A 1XNBA 2G9GA 2WABA 2WAOA 2ZAHA 1SBFA 4I3GA 5I0UA 5JZGA 2BVVA 4Q4Y3 5FMOS 3DPRB 3A4UA 4JGYA 2WS91 1O59A 3THPA 1OQEA 3GZEA 1QOSA 4N53B 4Q4W1 5LK5A 3RZJA 2UWCA 2WDBA 3TWIA 2EICA 4CDWC 5FPBA 5C3PA 4MGTA 1B35C 4X8NA 4L9BA 4XQWA 2A75A 2FD8A 1WLCA 4DXTA 1MZEA 1D2QA 3B93A 5E6HA 1TME1 1Y7BA 5F5CA 5T54A 1FNZA 2VUJA 4E4HA 4RQPC 4CDQA 2P1BA 4QQPA 1S1AA 2WC2A 4OYUA 3GDBA 1RUG2 3FE5A 1OC1A 1ZZ7A 2H0BA 3VN4A 4CDWA 5KWRA 4FFHA 4HXCA 4C90A 1IPKA 1GMMA 2OX0A 4FT8A 5EV7A 5J98B 5JAXA 4LBQD 1A6CA 1LRHA 5EP9A 3H8XA 2BVBA 2DF7A 5HXVA 1C8NA 3VZKA 3B00A 2HYKA 2IWGB 4JCKA 2Y0OA 3V0AB 3I7DA 3MIFA 1LODA 3ENRA 3WUCA 1PGL2 4XCBA 3BODA 3ZIWA 4QQOA 5F3EA 1GU3A 4M4PA 1KFXL 5I93A 2VUDA 5FP9A 2WNUB 2O8OA 1FAYA 2YC2A 3H3UA 4NRQA 2W9XA 2K9ZA 3IZOA 3EXUA 3RRDA 1HIXA 1NE4A 2GNBA 2NP0A 3UYJA 3ORJA 2D6NA 4CA9A 5DUWA 2G4IA 3HN1A 3INAA 2D5FA 5A1AA 4J25A 1EAH2 2G1MA 2D3SA 4RFT0 3MFCA 5FY8A 2V72A 4O61A 3VZNA 3I54A 5C7GA 2OQ7A 1D0HA 3N7JA 3PTYA 2Y0IA 1NUKA 1YRZA 2VR4A 3VD3A 3AMQA 5JXGA 1G9CA 2RDQA 4Q4X2 3THCA 1NE6A 1ULFA 3CDZB 4CCEA 4IEXA 2ZMLA 1XOYA 1TMF2 2ZEWA 3HWJA 1O4YA 4QHBA 1HN0A 1ZZ6A 2DVBA 2WJSA 1AR71 1NAEA 3C7GA 3HQRA 4FP2A 4L0PA 2LRPA 2DVDA 2NMOA 3E6BA 4LUKA 1WW4A 2DUQA 4QX0A 3OUJA 5KHGA 1DQ4A 1URXA 2BOIA 3MO4A 1MQTC 1X8MA 2C9KA 1FV2A 2UY9A 3VBOB 4URAA 3UGGA 1QKQA 4K9SA 4A3XA 5AC91 1XE8A 2VBBA 3HVDA 5ABJA 1FPN3 5FYVA 2ZTNA 1OMIA 4AEJA 4QXCA 4MHRA 3ZFGB 1I6XA 1PK6B 1RVF3 3JXSA 1ENQA 1O6UA 5D1IA 4ZXEA 1JYCA 3UESA 2YFZA 3MIDA 3CZUA 2LTNA 4MO3M 3K4DA 5BNNB 4W4ZA 1CVNA 4W6XA 5KBFA 2PLV2 4AK3A 2ZHKA 4XF4A 1FMD2 4LA3A 2RE9A 4BK5A 2OZJA 1C5HA 2ZKLA 4Y4YA 4IEUA 1KXGA 4CXWA 1GICA 3ES4A 4AVBA 4GB33 1CQ9A 4AI0A 5A6YA 1KJRA 4JKLA 1Z7S2 3I4IA 2F4LA 2Q0AA 1ACCA 2XWJB 1WUVA 3ILFA 4GKYA 1QJZA 2E7AA 1UXZA 4QB2A 4W8JA 4LEJA 5EHDA 3SCGA 5EIYB 1CJPA 2VO5A 3JB8A 5SV5A 3EJKA 1VBA3 2EXIA 4DB5A 2VMIA 1ZZ9A 4NN0A 3SC7X 1XNCA 4EQVA 2ZEYA 3BTYA 4BHPA 1MS8A 1FXZA 2DFBA 2BTVC 1UPIA 3AP5A 3AP6A 4E8DA 5CFCA 2FDKA 3PL0A 4HETA 4TLGA 1UMHA 4B1MA 4FPJA 5C5TA 1VBA1 4CEWB 1XYOA 4EN0A 1UIKA 2XH6A 3ZSJA 4UXAA 4N8MA 5C4WA 4DPNA 1ULEA 2IXKA 4JVAA 5KHHA 4IESA 5AC93 1AXZA 1P8JA 3POJA 4LO8A 3KSCA 3O14A 2N7GA 2A70A 5FWJA 4YZ4A 4AGVA 1KJLA 4RHV2 5EJ3A 1ZVFA 4E2QA 1LHVA 1HX6A 2WZ8A 4AQ2A 1YXWA 4RQPA 1YCIA 2JKXA 1W3VA 3I2HA 1QDCA 4DEVA 3IMMA 5J37A 2J1RA 4GQ7A 1UYZA 4YGCA 2A6WA 4BZ4A 1KITA 2R041 5FOJB 2JB4A 1ZBE3 1ALYA 1H6XA 4LE4A 3H9AA 4LO6B 2C26A 3AXDA 3ZN6A 1R083 4R52A 2FZ1A 5A7NA 5JIUA 3Q8EA 5L19A 1JYIA 4Q1RA 3BTXA 1UZZA 1R1A2 2W1SA 5TSWA 3AKQA 5JXIA 4Q4V1 3ILNA 3WW3A 2WKKA 1ZBE1 4FXKB 4KQ7A 4UFHA 2MEV3 5LBEA 3V64A 1F5FA 5GM0A 3USUB 4ARXA 4D6RA 1H1MA 3VDDB 1GOGA 4QX5A 1ODMA 2BERA 2PYTA 2ZA9A 1HXS2 4Y33A 4MX3A 3MLKA 3I2DA 1OI6A 3BKZA 2IVIB 5F2WA 2QTWB 5FDBA 1OXCA 3ZYRA 1OUSA 2PHTA 3WX5A 4AGGA 2BPA2 2Y33A 1RUH1 2HWB3 2VUCA 1T6GC 5F3IA 2ZJCA 4QPWA 2OW4A 4YW3A 4DY5A 1HB2A 2JG8A 2Q8EA 3K4AA 4K21A 3GNEA 4DNYA 4LE3A 3ZPOA 1L3JA 3MW2A 5CAZA 3THTA 5CG8A 3O1TA 3VUOA 3VZMA 5FKBA 3H8RA 4I2OA 2BFUS 5KHKA 3S57A 1PIV2 1QJU2 2VMEA 3B01A 3LZZA 1VMFA 4XUTA 3AKTA 3DGTA 2DVAA 4E27A 2E63A 1WMEA 3FHAA 4NR1A 2PA7A 4QXKA 3UV9A 3OGRA 3PDQA 1LULA 1MS5A 4O9GA 2CY6A 3IT8A 1QJU3 5BXXA 5KXBA 3U0ZA 4KBBA 4HVOA 3RZZA 3JU9A 4HSJA 3VD5A 3ZLIA 3POSA 2KR2A 4RSUA 3K4ZA 3C7EA 4LOSA 1PIV1 3OG2A 4Q4V3 3PJQA 1VIWB 2HEWF 2VAUA 3VHOA 4IEZA 5F7UA 2JEMA 1AZDA 3NNMA 1JOBA 5FMCA 2Q8DA 3OGJA 4WVMB 4ZU7A 3PIJA 3SCFA 5HBAA 4COZA 2ZEXA 1GP5A 4I0WB 4K1YA 2J42A 2VOTA 2QKDA 2WAAA 2A73B 1RUE3 2WLQA 3NQHA 1GP6A 1WW5A 4JRAA 4N90A 4W6YA 5A3OA 4NIAA 4OHZA 2DVGA 2W95A 2ZGOA 3SHRA 2XWBB 1IOAA 4DEQA 3SH5A 1DLLA 5L73A 4QGMA 2XKOA 3FFZA 4GH4A 4QDSA 1XE0A 5FXXA 5IHRA 4IV1B 3ZDSA 3D6EA 2TBVA 1RB8G 4NRMA 1J58A 4M0HA 3PU3A 1MEC3 1AJKA 4QKNA 1HJGA 3VKOA 3WEZA 3RQ0A 4CYDA 2ZHNA 2CAVA 2WZR2 2ZMNA 3VBOA 3AZVA 1JZ4A 2Q1MA 5EXOA 4OI0A 2ZX4A 1OH4A 3KM5A 2HLEA 4JZRA 3K48A 3D3AA 3OBRA 4B7KA 4CUGA 4MV2A 2RDNA 1CR7A 5FQ0B 1PNFA 3WP4A 5A32B 4XQDA 4AAPA 4AQSA 5A6XA 3CKHA 5GLUA 1GQPA 2ATFA 4GJZA 1VRH2 2QQIA 1UQXA 3J8F1 5FZFA 5BNNA 1YFYA 3WINE 3BTAA 3JCIA 1W2AX 4GA9A 5KC5A 5FZ8A 2W1WA 3PVBB 3WDVA 4IGPA 1ZZCA 3AK0A 3KLSA 1MACA 1O7FA 4FPEA 5I0DA 5APAA 1MVQA 3A23A 1SCRA 1QIQA 1J3RA 3IAQA 1XNTA 5G05L 2ZGLA 3U75A 1N3PA 1POV1 1JBCA 1VRH1 2DWRA 4QB6A 3RZHA 1A8DA 1HB4A 2R6QA 3KV9A 2YU2A 4Q0PA 1PZ9A 1TNRA 4DXRA 4PI0A 2E31A 1LKNA 3W21A 5DG2A 1Q8OA 2VMHA 1K42A 2AENA 4CCOA 4XUOA 3TEXA 3OBAA 4BIFA 4LIVA 3CZJA 3OJBA 1FT9A 1NY72 3ZMNA 1YFWA 4LO5B 4N43A 4YG3A 3S5QA 3URFA 1MEC1 1PGSA 2GNMA 4P9LA 3WDYA 1G9DA 2B5HA 1VBC2 3POYA 1D4M1 4Y4RA 2JDYA 2BOJA 2I74A 2YBSA 4LR4A 3O0XA 1F4AA 3AKPA 4A7YA 2P4EA 1XU2A 4LHNA 4JDOA 1FX5A 2XL9A 3LEMA 3QLQA 5HCAA 2ZX0A 2R073 3H8UA 3KZ4C 4NIDA 5FXZA 5A7SA 5JXHA 1W04A 2AH2A 1W2UA 3NRUA 3LA2A 1V6NA 1J83A 2DU0A 1VBD1 3JD73 2YU1A 1WA6X 3IB3A 1DU3D 3OSDA 4P9WA 1AR72 1S0GA 5DPNA 5A33B 4EN6B 3IIIA 3EHKA 4Z2WA 4QQHA 3ZYIB 3JD72 4YZ5A 5A3TA 2DCTA 4XQ4A 2VQUA 1CONA 1VBD3 3LDBA 3LPFA 1LCLA 5HXMA 1OLMA 4D7YA 2PN5A 5JWPA 2VNOA 2HWD1 4YFWA 5FYZA 3U37A 3IM0A 5JZGB 1RL3A 3NWKA 3CJIC 1NLSA 1UY1A 2NLRA 2ZOEB 1F35A 2JE9A 1PVC2 5C3SA 1YLLA 1XSQA 4OLLA 5G04L 3ZYPA 4BU2A 4XTPA 2DCJA 4FAGA 2VXRA 5HCHA 4KGQA 2RJLA 2GMPA 4LULA 2JDMA 5GKAC 2JG8B 2LUWA 1H2KA 1RHI3 2GZWA 2GU9A 1YQ8A 4O7XA 1AX2A 3PIGA 1SFPA 4LBMA 2EXKA 4DFSA 4HZFA 5FZ3A 2QQJA 1OLRA 5IJRA 1REFA 5DAVA 4BQXA 4ISQA 4QU2A 1OPOA 2W0XA 4FPYA 5IVEA 1JZ7A 5K0UA 3AYDA 5HV4A 2PELA 1YYNA 3B7MA 1ODNA 2SBAA 3GGLA 3N9PA 3WF1A 3OBZA 1C1FA 1IPJA 3K2OA 2JD9A 4YM3A 3RJRA 1PGL1 3GBFA 1JOJA 4EJRA 3CHXA 3X29B 1RUD1 2PHLA 2WNUA 4JGZB 5T55A 4OCTA 3SQOA 3ZFEB 3PNAA 4M3CF 4L11A 4AL9A 1AYM2 2ZHLA 2VZQA 1RUF3 1DGRA 1F31A 3I97A 3OUIA 4YW4A 2WYSA 3I3MA 2Q30A 3LOIA 2XOMA 4G3YC 1VJ2A 3G7DA 1HRV3 2A6VA 3L2HA 3U10A 3VHPA 1O4TA 2YGLA 1TME2 4ZKTB 1W03A 4MXVA 4NHXA 2VZSA 4YM1A 2Z42A 3MW4A 1WCSA 1HRV2 4NUBA 2AACA 1PO21 2PFWA 2RG4A 2VU9A 2FCUA 4RS5A 2RMU3 5LBFA 4Q0QA 5C6CA 1LHOA 5J48A 2NYYA 5C8CC 4FXGB 4I01A 5J96B 1NCRB 4BISA 1O5LA 4LPLA 1OUXA 3D0JA 2VZPA 1E5RA 4XAAA 1ZRDA 3KV6A 4OZOA 1SBDA 5GZGA 1KRIA 2VXJA 2P3JA 4NAMA 3WG1A 1JI6A 1XE7A 2Z2SB 5AFBA 2NMNA 5KXCA 3RZGA 2A3WA 5DDJ2 2BBVA 2DURA 2OQ6A 2RS11 3C7FA 4IV3B 4Q8LA 3VD7A 1JZ6A 2E32A 1X9TA 5IK5A 2QZ2A 3BU7A 2BQPA 2PAMA 4PIZA 1ZRRA 1LJ7A 2P37A 3OPTA 3I49A 2R7EB 2RS31 4LBNA 1OKQA 3V56A 5FR3A 2DBIA 4QPYA 1ZX5A 4GWMA 1NQDA 2E7TA 5FJHA 4GWJA 4IUGA 1O91A 2Q5TA 3FBYA 2B9VA 3VBRB 4B3NA 3IDEA 4GB32 4QM8A 3S30A 5B2GB 4UBHA 5C9AC 3ACHA 2EALA 1E5SA 2X5IA 1JUHA 2VH9A 3ASIA 5JR7B 2B42B 1HDKA 1ND3C 1WBFA 4MGKE 2W2IA 4AVCA 1UY2A 2GNTA 4UF0B 3D82A 4S2HA 2FMDA 3KT4A 2Y64A 5F2SA 4BLIA 1QJFA 1SZBA 5JZGC 4PI2A 3WW2A 4EYUA 1UX6A 4I0AA 4KGGA 4YWAA 2RR13 1IG0A 3WP3A 4XUPA 1RUG3 1PO23 4W6WA 4CEWA 4XTMA 1U0AA 1AL21 3WNLA 1EPWA 1S2BA 1X50A 2R1DA 2L9LA 2R042 2Y6GA 3C7OA 2Q8OA 3ZKUA 4WV8A 4Z1VA 5C4WB 2XBO3 3T2QA 1NX9A 4MVTA 1YWKA 1BHGA 2ZX2A 3LWCA 3MV11 3LA3A 5JI7A 5JPMB 1UNBA 1ZA4A 2XJSA 1W9FA 4CE8A 2FHRA 1GZ9A 4CDXB 2XQRA 3MF9A 1C8M3 3AMNA 1Q8SA 2UWAA 2Y38A 3NW4A 3ZN5A 3BYWA 1RMU2 3AJZA 1K5MA 3PUSA 4JTNA 4QPIC 1OOPC 4QX2A 3RWNA 3SKVA 3VKFC 3ZR6A 1C8M2 3LIHA 4O65A 3KB5A 3MUZ1 4IGOA 4Q27A 3OEAA 5CFDB 4CZSA 2R0FA 3NJYA 3IDBB 4UW5A 4YVWB 1JOPA 3PMSA 1L7QA 1CAWB 1X82A 4BYYA 4Z07A 3U1XA 4CP0A 4D69A 1L7RA 4K20A 5I8YA 1O5UA 1REEA 1LGNA 2JJ6A 1E5IA 1POQA 1RUC1 2OT7A 4FPCA 1JW6A 4BQYA 4MG2A 3ZFEA 3N9NA 4P02B 4AAXA 3P6BA 3T09A 3M2MA 4F83A 1GOHA 2OA2A 3LGRA 1PNGA 3D0SA 2YUEA 1CX4A 4XDQA 1ULPA 5FIXA 3WDTA 1DIWA 1F15A 1RUI1 1OBNA 3LAGA 3U07A 3N9MA 2VPVA 1SFNA 4ITCA 3UKTA 4FCAA 3SCHA 3ACGA 2KM2A 2VMFA 3E5XA 3LF7A 4Y3OA 3WNOA 2EVXA 3KF5A 3N7MA 2WNVC 1G7YA 1CJDA 3USUA 1ULOA 2R49A 3A7QA 1NXD1 1POV0 3E1F1 3SXWA 4HK8A 5FPZA 4Y5TA 4EN8B 3A0NA 4CXXA 2OUHA 4WVZA 2QQUA 2XPJA 2HJIA 4M3CE 3GCXA 1XYPA 4LO7A 1PM7A 3AFKA 3ZXAC 5FZHA 1W6MA 3FZ3A 2B8MA 5DAXA 4C1XA 3TN91 1DGWX 1HXS1 1HQLA 1W6OA 1Q8QA 2Y6HA 4NAOA 3AVSA 3FHIB 3JBG1 4AYUA 5L7OC 4D8MA 3ZYGA 4FTEA 3B94A 5BUVA 5FPUA 4Z8BA 1LEMA 1H9PA 2V4VA 2CSGA 5LWBA 1CPNA 1QJY1 2R061 3DV8A 4ZU4A 4AI2A 4XFHA 5IVCA 3ETPA 3N9QA 2HWE2 2PMWB 2WZPP 4K6BA 4QT6A 4Y1ZA 1V6JA 2W68A 4NPMA 1LESA 4COYA 4CP2A 3AMPA 1KEXA 3L9JT 2P5BA 3TN92 3W20A 2FDFA 4IW3A 5T50A 1VLNA 2HWE3 4PBPA 1W6PA 1Z0HA 1A34A 3DUIA 1WD3A 2B39A 1IPSA 3DYMA 4MGYE 1ND2B 2J1SA 3S7EA 2GN3A 4FPHA 1BEV3 3VBSC 2QFEA 4HKOA 1J84A 1Z7S3 5FZLA 1I5PA 3BVCA 4YVSC 4B29A 1EYBA 1XSRA 5FYYA 5C9AA 2CTVA 4OI4A 5F3CA 3OYWB 1CWPA 4CCLA 3RS6A 1AYM3 1ZZBA 4NHLA 5KHIA 1NA1C 2WYFA 3NKTA 3NV1A 3U4XA 1BEV1 4C0BA 1IKQA 1B35B 4KBZA 4UBGA 3FC0A 3V0BA 2XLGA 2XONA 2JDAA 5LY2A 2FCTA 3BPSA 2CAUA 5FUNA 4K8FA 4E2SA 5A3NA 5A7OA 2ID4A 4PJYA 4XXPA 5FJKA 3IPVA 1RUC2 4ZHNA 3GBWA 3LIGA 2VQAA 2VC9A 1V6MA 2D6OX 3ZFFA 4ATFA 2KD7A 5C8CB 2VZUA 2B9UA 4KNCA 4ATEA 1YIPA 3FLRA 2D40A 1MS9A 4S2GA 1D2SA 2ZGTA 2WWUA 3PUAA 4R8HA 4EWAA 3AZZA 1QJY3 1UD1A 2R063 4XPVA 4RHV3 4HOOA 5ANNA 2SLIA 4NRPA 5FZKA 5HI0A 1W8UA 1CZVA 3NV4A 1AR93 1V6IA 1W3XA 1WW7A 2VY0A 4JHZA 3HN3A 1X9PA 4NOTA 4XJ9A 3LKJA 4CCMA 5BY5A 5IVYA 3MIBA 2PLV3 5I0SA 2HWE1 1JN2P 4QXHA 1LECA 2XLAA 1UF2C 2E7QA 4LBKA 5C70A 3TB0A 1LU2A 2R071 1AR83 3ECQA 1QWRA 2W92A 4AW7A 4RFRB 4CU8A 1JYXA 3USSA 1CZSA 3FMGA 1W0OA 4JGZC 2UWBA 1KDKA 3KCYA 1GWLA 4XUQA 3DPRA 3RZMA 3AZYA 4AFMA 4ORFA 4HLTA 2CGNA 1ULGA 1S0BA 1W06A 3ZXJA 3HIFA 4R9DA 1O3TA 3M3IA 3DL3A 3VBRA 4QXBA 2PTMA 4WM7B 3NNJA 3PVOA 1UWWA 3WQ7A 1Z78A 4BJ0A 2BFUL 3LCPA 4AR2A 3S6PA 4G4FA 4UF0A 4XDOA 3JQXA 1M4WA 4URTA 4CPBD 4CDQB 2DFCA 3B9IA 1Q56A 1W6MB 1W05A 1RUH3 4WBBA 2ZXQA 3VDDA 2JG8C 2BDRA 4SBVA 4CU7A 1WWYA 2J22A 2HWF1 5T52A 3H1YA 1H8VA 1GR3A 1VRBA 3I2IA 4YPJA 1AX1A 3VKLA 1X36A 4Y22B 2AEZA 3I8TA 1GZWA 2GAUA 4Q26A 1QMJA 4CCNA 3AYCA 1GQHA 5BYNA 4PT6A 5IUQA 2BNNA 1RTVA 4YGDA 2JICA 2YFUA 3NAPB 2EXHA 1RJ8A 2VBPA 2EIGA 4Q29A 4QM9A 4RR3B 3BOWA 5FMDA 4C0HA 4OZXA 3NNLA 1ZRCA 1NYWA 5T3NA 4IE0A 4MSVA 1CAVA 5FY5A 4ET7A 1JZ3A 3N35A 4GKXA 3WNMA 3LEKA 2VJXA 4E9KA 5A3LA 3Q8BA 3PJYA 1R1A3 2GC0A 1UCXA 2VZ1A 3MICA 1ULCA 2VW1A 5I0TA 4MHUA 5E1RA 3TNQA 1JYVA 5C9AB 3BGAA 4LIUA 1D4VB 1ST8A 2JDKA 4HN0A 1RUD2 4CCCA 1RUF2 2V4AA 4CDUC 1E57A 4IV1C 2YG0A 4XJAA 1YUDA 3HQXA 1RUD3 3BUCA 2JB8A 2WSUA 2BGOA 1IHMA 5A70A 5CVRA 2QQPA 3NV2A 2VG9A 4IEWA 3H8OA 2WNOA 1RUF1 3J7NA 2PAKA 2Z69A 1KDMA 5CIRA 3SMHA 2XVLA 3HNMA 3P3NA 3N7KA 4YLZA 3DKWA 5DQ0A 5LB6A 4ZONA 2LROA 2YC4A 3B69A 4XHXA 1MQTB 4B4PA 5CADA 4MGIE 1RYYA 2J1AA 4JRLA 5JSPA 5ABJB 2VGDA 5BNPA 2BWCA 2W39A 2YROA 1K12A 3NMBA 1R092 5EYYA 1PK6C 2WO7A 5I91A 1C3HA 4XZUG 3LA7A 1QQP2 4E4ZA 1TE1B 4X6RB 3WHUA 1Y9GA 2P3KA 1N1YA 3WR0A 1HQWA 3QBQA 5H9QA 5IVFA 3VBOC 1LNSA 4Y24A 4OHYA 4C91A 1W8TA 4UT5A 2IXHA 4CUCA 4XZPA 1LENA 1PVXA 3VGIA 1HJFA 2W91A 1BBT3 4GMP3 2JG9B 4R4ZA 1W9WA 2E26A 5FY0A 3O1MA 3O7OA 3R0RA 1VBA2 3GYDA 4XJWA 4AHYA 3ZYHA 5FK8A 3HEIA 3ZPYA 3T2OA 4BMEA 4CP1A 5CG9A 4Z82A 2TEPA 4IE6A 1S4CA 3NO8A 3AVRA 1YQCA 4QAWA 1AXYA 1QJX1 1UX7A 5T5JA 2XJRA 1V9U2 3AKSA 1WMXA 2VMCA 4ZU5A 4CXYA 1N1SA 4ZPIA 1H2NA 2EAKA 3AX4A 4Z2AA 5JVVA 3ZVXA 3S5AA 1AVBA 5JSRA 3PHMA 4HMZA 2P34A 3OD0A 5FZ6A 5IAVA 1C5IA 3LEGA 4BOWA 1QJX3 4FPGA 3ACIA 5H9RA 3U14A 3VDCA 2BV4A 4CEYB 3GJAA 4Y1XA 3WNPA 3VDDC 5FO7B 2R32A 4XCAA 2OKXA 4BQWA 2YB7A 4UI9L 3RI8A 4AE2A 4XBNA 2R072 2I07B 3ZXEA 5GLZA 4EZHA 1AL23 2RDRA 3BU0A 2ZX3A 4G9SB 1DQ2A 4RQPB 4IEPA 5AVPA 3S7IA 4BB3A 4DO0A 2XBO1 2CV6A 1VE0A 3BOPA 2VW2A 1SDDB 3VBUA 3T1LA 4A41A 4DRVA 4S2FA 1CAVB 3TRSB 1DZRA 5EJZB 3RMYA 3MGUA 5C71A 2WRAA 1UAIA 1R082 2GNDA 3ZN6B 1UYYA
chains in the Genus database with same CATH topology
3WQ0A 1IS5A 2GMEA 4GALA 4AGRA 3KS7A 2P2KA 3LOBA 1LEDA 5BNOA 2UU8A 1F2NA 2FZ2A 4PBOA 1AR63 4LTAA 4B4QA 3JQWA 3MFAA 2PHDA 4IL7A 2X5IB 1U5XA 3ME2A 2YHJA 1NCQB 4XJUA 4XF3A 1ZYBA 2G9FA 2ZPXA 4LBOA 4YRDA 1WCDJ 4JGYC 3VKMA 4LHLA 5DZFA 1WLWA 2R30A 2CYFA 4O9EA 1LOEA 5EYXA 1NOVA 1IZ3A 1IKPA 1JXNA 4YFZA 4Q1PA 2O0OA 4CDUA 5L7OB 2A7AA 3H7YA 3OY8A 1V6OA 3BIWE 1WA4A 1S0JA 3WXPA 1BMV2 3VLBB 2NN8A 2WT0A 3M7AA 4OUMA 2CWMA 2ZACA 3WP6A 4M01A 3V0AA 1S0IA 5CFCC 3WLUA 3J4UH 4AEDC 2K0GA 3VHNA 2R16A 1C28A 3AZWA 2XB6C 3H1WA 3ZXKA 1SLLA 2H0VA 4E4SA 4KG0A 3OGGA 4YVWA 2ZGNA 4NWVA 2ZMKA 2WFF2 1S0EA 3BCWA 3EQEA 4EROA 4BMBA 1LOGA 1TNFA 3ZMNA 1ZBA3 2VVDA 3FX3A 4P14A 1H2MA 1Q8VA 2RR11 3PLQA 1SEFA 1RC6A 4YVWC 3WDUA 1UKRA 3NKGA 1ZBA1 3OCPA 2WS92 4ZXKA 4QGNA 3VBHA 4IV1A 2ZS6B 2RM23 1RUI2 4N53A 4Y1UA 2WWSA 3QOPA 1S2KA 1YNAA 1H30A 1YJLA 4CDXC 4AXOA 3RPQA 4E4DX 4LBQB 3ZO0B 1X33A 3B3QE 1QQP1 4Q0SA 4NHKA 1W6NA 2HWD2 4XXAA 5IK4A 4META 3UKVA 1QY4A 2WFPA 2Q4SA 2XJVA 5BNQA 1GV9A 3H50A 2VOXA 3UJOA 1DZTA 5FRAA 3AP7A 2HWC1 3I59A 1PZ8A 4BCUA 2RS33 4NHMA 2WINB 1AYN2 3AYAA 4LUMA 4XF1A 5BNOC 4HANA 1EV13 3H7JA 3ZXFA 4MGZE 2FQPA 3VBSB 1W6QB 4PCRA 4SLIA 2YXSA 1J3QA 3K51A 4YVSA 4L97A 3GHNA 1HLCA 3MIGA 2JX9A 1SCSA 2V73A 1N3QA 5AC92 2XJUA 1CN1A 5FLIA 1AYN1 5E16A 1VR3A 2DTWA 2IC1A 2D98A 1ONAA 2WT2A 2PQQA 1NY71 2ENRA 4MLOA 3ZMOA 3N4MA 4OFGA 1WLDA 1SFYA 5FBZA 1ZREA 5E8AA 1YHFA 5GLVA 4F7ZA 5J3UA 2JD4A 3W9AA 3QACA 1PZ7A 1MZ6A 1GNZA 2QE3A 1K5MC 4JV4A 2AGSA 3E6DA 1J1LA 3KCCA 3BB6A 4Q4Y2 2GALA 2OUJA 3UL2A 5K9YA 1QJU1 1VAKA 2HEVF 3T1MA 1O3QA 5GZEA 1UU5A 3AFGA 1K5MB 2TNFA 4OUSA 1YJKA 4FPLA 1MS3A 4Q0VA 3JD71 1BK1A 4QPGB 2MHFA 1Y9QA 4B7EA 2D6MA 1VBE3 3O5SA 1NCQA 4L92A 2IXIA 1WMDA 3M3OA 1UMZA 4JTOA 4KU7A 3VZOA 3CEWA 3JZVA 5FMOL 1IS6A 1F5JA 3E5UA 4QD2A 2DCKA 1LB2A 3KT1A 4FO9A 3VBFB 4AVTA 1JH5A 4WM7A 2XBO2 1HV1A 1PMIA 2VNGA 4RS5C 2IFWA 2CNAA 3MYXA 4EWEA 3CLPA 1RUJ3 2TUNA 5CFCB 1YIFA 4GULA 3S0MA 4B4RA 4CDUB 3JBG3 5BNPC 2WNEA 5I8TA 1HRI3 3ZN4A 2RHPA 4Z92B 1FNYA 2D6PA 2KA3A 4RR3A 1RUJ1 1S0CA 4K1ZA 3WG2A 4MH0E 2XHKA 4IEQA 4Y22A 4RGAA 4OHVA 2A6XA 2IZWA 2R0HA 3HT2A 4JAAA 4FTBA 2P17A 3VZJA 4RR3C 3OF1A 4N9IA 1TMF1 2IFRA 1C57A 1Y43B 3J8F3 1COV2 4Q4X1 4YNIA 1ZRFA 4F3JA 2HEYF 4DRRA 3VBSA 4AF9A 4NO4A 4N7IA 3GBGA 3J8F2 2CWSA 2ARXA 1NCQC 1V9U3 1BBT1 2X5IC 4GMP1 4M00A 5LEJA 1IQAA 3MIEA 3O0WA 5HCBA 2HKXA 3AP4A 4BQ1A 1MS4A 2D3RA 3WY6A 3HR9A 4BLJA 2NPIA 1EAH1 1QH6A 5ACA2 4IEOA 1CAXA 1N1TA 4OVEA 1BZWA 1GLHA 5AFEA 1A8MA 3VV1A 3IDCB 3NJZA 3FLPA 4RGGA 4COUA 2D6LX 2WA3A 1B35A 5BNPB 3NV3A 4HVRA 3LB9A 5JIAA 3RYRA 1NZCA 2RMU1 3CJIA 5JCTA 4LBQA 4LHKA 1NCRC 3IPVB 3POWA 1MQTA 1EPZA 1RJ7A 5FOBB 4OULA 2B45X 3ZFGC 1GZCA 4FSJA 1W6NB 2MEV2 1REDA 4XFCA 4J6GA 1R1A1 2WQZC 4HKWA 4AVSA 2BBVA 2ILMA 1HW5A 2B7YA 1AR82 4EV0A 4D3WA 3MPPG 4WM8C 4Q4X3 4D94A 5JOWA 1OA3A 3UK9A 3ALQA 4I02A 2HWB2 2ZKNA 4FP3A 3ZFGA 1F8VA 1QOTA 4H3WA 2YZ4A 1A3KA 1MS1A 4YSFA 4TLFA 5T5OA 1V9U1 3M4FA 5ACA1 3MW3A 3SITA 4RL7A 1H1IA 2NQYA 1G9BA 4ASLA 2JE7A 1RHI2 2VW0A 5DZGA 5FAXA 5JPNB 4Y26A 3B9CA 2XLFA 5C8WA 2CGOA 4I0BA 5D8AB 3J26N 5SV8A 2C9AA 4N43B 2AUYA 2F6BA 1COV1 3WHTA 5LRSA 1OD5A 3ZSKA 1HRV1 1YFXA 1FOD2 2E51A 2BYVE 4AFDA 4A7ZA 2RS51 4N7UA 2AR6A 3NVCA 1CAWA 3WNXA 5K0UC 4P9YA 1KFUL 1QGLA 3HAGA 5L36A 1VBD2 5KXDA 4YZ1A 2GMMA 3VBUB 1FPN1 2GH8A 1SLAA 4LLOA 4FBFA 3NAPA 5FQ0A 4JDMA 5A32A 1Y3TA 1PO13 1WBLA 1DQ1A 2I2SA 1LHUA 4WZFA 4KWLA 1CAUB 2RMU2 4CTEA 5BNOB 4HPKB 1S0FA 5AVAA 4XF9A 4AEKA 3H3ZA 1FV3A 1D4M2 1FPN2 2VVEA 3HD8B 1B09A 1WGPA 4FOVA 1KS4A 1RVF2 3W59A 1NA1A 3VBHC 4WVVA 4GB31 1PGW1 2GH2A 2XKPA 4X6QB 1H8TA 1VAMA 4LBLA 4YZ3A 4Q4W2 2XJPA 1APNA 1DGLA 1LTEA 3CL1A 3HT1A 5DZEA 3DPRC 1VP6A 2ZHMA 5DDJ3 4CRQA 1BCXA 1BMV1 1OSGA 1W6OB 4HKLA 2WNVB 2D93A 1OQ1A 4TSVA 4M3CB 2RS53 3GZUC 2WLPA 1V6KA 5GZCA 4AQTA 1HKDA 2UURA 4Y1VA 2YMZA 1UU4A 1EP0A 2JENA 5L7OA 1QNYA 1DZQA 1HRI2 4IEYA 4BE3A 2PHFA 3P3PA 4H14A 1LOFA 1DF0A 1GBGA 3ETQA 4XHBA 2HWF2 3BPZA 2RS13 1BEV2 3FUQA 1J59A 1AR61 5IK7A 1C8M1 4AVAA 4TWTA 4INDA 5JOYA 1N1VA 4IQPA 4TZDA 1PO22 1UKGA 1OOPB 4YM0A 4JGZA 2NZ9A 2WT1A 4YG6A 4ES8A 2RR12 4J1WA 1GQGA 1I3HA 2JECA 3OYWA 1C4RA 2ES3A 1IS4A 1DGWA 2PHUA 2NM1A 1RUH2 3CO2A 5J36A 4LNVA 4PLOA 4NWWA 1DGRN 4M0NA 1H0BA 3EBRA 3FWEA 4Q0UA 4PF5A 2C1FA 3T2TA 1H8TC 4FOWA 4AVVA 1RUG1 1ZBE2 4FPOB 1QJY2 2R062 3AM2A 5CNAA 4Q4V2 1F9KA 1DQ5A 4W65A 3OPZA 3VBHB 1UIJA 3MPBA 2OPKA 4U2AA 1AR73 2QZ3A 1QH7A 1XXNA 2EA7A 1XNKA 4J1XA 3H0OA 1FYUA 5F9TA 1TQ5A 5JOZA 1H1AA 1UL9A 3B02A 4RHV1 2FBEA 3PVEA 2EF6A 3TNPB 1CGPA 4AEDA 1AR91 4EN7B 3WDXA 2E6VA 1AF9A 1AR62 3WW1A 2ZGKA 1LOAA 3N36A 1CAUA 3SH3A 1PVC3 5FREA 1EV12 1YI9A 2A6YA 5K0UB 1LGBA 3CJXA 4FPKA 1RUNA 3R05A 1ASJ1 3WG4A 4YVSB 2WQ4A 1GKBA 3GZAA 3VHRA 3PMEA 1PIV3 4NPRA 1QXPA 2DU1A 2IXCA 1ND2C 3MF6A 5FTTC 2RM21 3ZSLA 4CDQC 3VBFC 1W6QA 2C5DA 1ND3A 1Z7S1 3NL1A 4MXWA 5D8AC 1G8WA 1RITA 1RUJ2 4WM7C 4L2NA 2GSYA 1QU0A 3FUOA 1FMD1 2WSVA 4I3PA 1XYNA 2H6CA 2UYBA 3V65A 5HCFA 2VNRA 3WZ1A 4CDXA 1TEIA 1IS3A 2EAAA 1AUYA 1J1TA 3QH6A 4YM2A 5GALA 2W08A 4CEYC 3ILRA 1BVP1 1FATA 4WM8A 2D7FA 4GMP0 4XETA 3SLIA 2RJKA 3WG3A 1RUE2 4K7JA 4L8QA 4H7LA 4IETA 1AJOA 1CPMA 1N47A 2WFF3 3IWZA 4HL0A 1ZNPA 1VB2A 1ASJ3 5CBLA 2BW8A 2Q1ZB 4BWOA 2ET1A 1PO12 2ZZQA 3FLTA 3J9SA 1RGSA 2V5YA 5BPXA 3RDIA 1ASJ2 5ABJC 2WZR3 4GXLA 2K2SA 1OPMA 3MLJA 4HPKA 4XOGA 3M3QA 3VBFA 4AHXA 4PLNA 5LEKA 1SLTA 4OI1A 1AR92 1NA1B 5FCCA 4XFFA 5DXDA 2QNKA 3WCSA 1VRH3 5CU1A 4Q4W3 1KS5A 2BEOA 3AP9A 4QMAA 1DBNA 1FMD3 4Y20A 3VL9A 4V1PA 3D8CA 3L2YA 3SISA 3TBDA 5T5LA 3KD4A 4ONUA 4D7TA 4HN1A 5IK8A 3ATGA 4FTSA 1QQP3 3IMNA 1G6NA 3VZLA 4D7SA 1PGW2 2ZGQA 4HBNA 4FQ4A 4MZUA 3D4KA 3RYKA 3PVNA 5FO9B 3N3HA 2PLV1 2WFF1 3KGZA 2ZGMA 1SMVA 4K3UA 5F6KA 5GZDA 4DMIA 1LGCA 1W6PB 2GC1A 1U5IA 3FFQA 1OFSA 2XJTA 2FMYA 3KCXA 1AR81 3HBZA 2X29A 4XE9A 5CFDA 5GJ6A 1XU1A 3ZSEA 5K7PA 1NQJA 4XIOA 3RJ2X 1POV3 1MZ5A 4HSLA 3VBRC 1U5ZA 2VOWA 4FAHA 3RI9A 4P9IA 3N7LA 2DTYA 2DCZA 2DV9A 1SBEA 1QJX2 3R4SA 5EFUA 4KWKA 3GHMA 2BNOA 5ACA3 4XFBA 2D44A 5F1RA 2LM3A 2LALA 5DUUA 3WVJA 4AHZA 1NG0A 3M8LA 2WL1A 1HQNA 2YC0A 4FOQA 1QHDA 4YARA 2A3XA 3ZX7A 1VB4A 4AG4A 2ERFA 3AMMA 1WLTA 1SACA 2VVFA 3GZTB 3MI8A 2OYZA 1JTZX 4YZ2A 4PLMA 1LR5A 1TME3 4QPGC 1LHWA 1NCRA 2C0ZA 1MR5A 3WD5A 1RHI1 1SDWA 1ZBA2 1NXMA 3AKRA 1TMF3 1O3SA 5FO8B 4AFCA 2VULA 4JC1A 5CFDC 2PHXA 1GANA 5KHJA 1H9WA 2QUOA 4DZGA 4AEDB 5DUXA 1S55A 1RVF1 4H55A 2PHWA 4QQ2A 5EWSA 5EZWA 4B8EA 4P9GA 1FI2A 2BGCA 1X7NA 4XMAA 1VBE1 3SNMA 1H2LA 2BNMA 2Z79A 1MS0A 3M70A 3AZXA 1G9FA 2ZX1A 4LO4B 1I1EA 1BJQA 2CGPA 3ZXLA 2VOVA 3E6CC 1ENRA 1V70A 2V09A 3MEPA 4UW6A 5JLVA 3R4UA 1UPSA 2XVKA 3QH7A 5E89A 5FPXA 2YYOA 1WD4A 3JBG2 4JGYB 5I8SA 1C1LA 1ND3B 2D43A 4MXWB 1YFUA 2DUPA 4XJZA 3V0BB 4Y5Z0 3TYJA 3AB0A 3NSTA 3R6SA 2ETEA 5H9PA 1DYPA 5A3MA 1BXHA 1WCKA 3KGLA 5KC6A 1H4GA 2RS32 4A2UA 2A5ZA 5C8CA 2ZGRA 2WA4A 2O8QA 4BIOA 3DN7A 1J3PA 2RS12 1QNWA 1BVVA 1Q8PA 4XFIA 1DHKB 2D5HA 4IV3C 5DUVA 4GH4C 1VBC3 3WP5A 2VOKA 3RNSA 1EY2A 1SLCA 3M3CA 2XG3A 3SH4A 2OZ6A 3CF6E 1LOBA 1VALA 2B46X 4EWDA 5JMCA 3APBA 1ND2A 3JB4C 4A7KA 1UW8A 4KL1A 1DQ0A 3RG0A 1CESA 4X8PA 2JKBA 1DG6A 5J7MA 3IBMA 2WS93 1BKZA 2ZGSA 4GWNA 1O3RA 1OHFA 4COWA 2ET7A 2QDRA 3GALA 1GYKA 2OIIA 1M06G 1QXRA 1EAH3 1RMU1 4BA6A 3UJQA 1AL22 2UYAA 1XQNA 2WNVA 1LOCA 2ZZJA 1U12A 5IT6A 1Q5OA 1RIRA 2Y26A 4LT5A 2OVUA 5H9SA 4R9CA 2QJVA 3VKNA 3RYPA 2GDFA 4DQAA 4P5HA 5JDBA 1H8TB 4AI8A 4IEVA 1CIWA 2H6BA 1D0GA 5BV6A 4I09A 5JSOA 2MNGA 4PDWB 4WVWA 1CAXB 4AQ6A 4Q8KA 4BPZA 1OLQA 1N3OA 3E5QA 3EO6A 4RA0A 2DUOA 1VBC1 1PK6A 1MEC2 4H7MA 3TOJA 2VUAA 4K40A 1AX0A 4C1WA 1OOPA 2HWC2 4FOYA 2ZAAA 2AYHA 2YDEA 3MDPA 4FPFA 1AXKA 1V00A 1SLBA 1Q3EA 2HWC3 1W0PA 1X8EA 3KQRA 2XUMA 3JUUA 3MIHA 5GZFA 1EV11 1PVC1 2E53A 1MVEA 4CEWC 1RMU3 4PIXA 3VL8A 4JDNA 1VAVA 4N9HA 4NVPA 1R091 5LRRA 4KWJA 1I5ZA 3AMHA 2R1BA 2YY1A 3G6JB 4COVA 1R1ZA 3ZFFC 1DYKA 2BWAA 2JDZA 4U36A 2D3PA 3M1HA 1UU6A 3IKWA 4FQZA 2AZ5A 2A3YA 3TAYA 4BM8A 5C4WC 1OFNA 3U11A 3OD4A 2Z5WA 3FJSA 3ZFFB 2A71A 2HWB1 4YW1A 5J09A 4ISRA 3M3EA 1DDLA 4HVQA 1DFQA 2XL7A 3WUDA 3Q9OA 4LLFA 4Q2FA 3VBUC 1YO8A 3E97A 4QPGA 1CD3G 1VBE2 1ULDA 2VQ0A 1BYHA 2D97A 1Q43A 3FBMA 3AYEA 1RUOA 4MYEA 4YYOA 2RM22 1QDOA 5F5QA 2DYCA 1AL0G 4TYSA 1GNHA 4PIYA 1OA4A 2YGMA 5CB7A 1IGOA 1QOOA 5BNNC 1RINA 4Y1YA 3ELNA 3WT3A 4YW5A 3ZIXA 1R093 4XILA 2YV8A 4N43C 4R9BA 5FLHA 2GC2A 1ZZ8A 5DDJ1 1U5YA 1PHMA 3TN93 1A78A 1HXS3 4PDWA 4R9AA 5JOXA 1BBT2 2XGXA 3ZXDA 5I0RA 2W52A 3OTFA 3O12A 1LHNA 4DY3A 1AYN3 2ZGPA 1GFF2 3ACLA 4OHWA 5F6LB 1I9RA 4HK9A 4UW4A 2JG9C 1ENXA 1QXJA 4M3CA 2CL2A 2IXJA 2WNUC 1GZWB 4DXZA 3BALA 2R043 4OI2A 4WM8B 2MPFA 5A33A 3ST7A 2QVSB 4E2GA 2WIIB 4XFAA 1R081 3O0VA 2P3IA 1RUC3 2QDNA 3ZFEC 4QPIA 1AHSA 1OA2A 2JG9A 5K8SA 4BH9A 1QF3A 3KMHA 4EN9B 2BUKA 2MEV1 1S0DA 5GLTA 2F4PA 1RUI3 3IN9A 4OHXA 1WW6A 2YPJA 4QQLA 4XYXA 2HWD3 2ZGUA 2ZCWA 1ENSA 1LU1A 1G86A 3WOGA 4GH4B 4HT1T 2A6ZA 3DF0A 4WVMA 2JXAA 2I45A 2X53S 1DQ6A 3CJIB 4PQ9A 4N53C 1OQDA 2RS52 4R4XA 1FOD1 4S2DA 5JI9A 2E9QA 1NLRA 5LK7B 3WW4A 4XJ8A 4Y20B 4P9XA 4LBJA 1G9AA 2X8KA 1BQPA 1GSLA 3D5OA 4DINB 2HWF3 3ZSMA 4IXLA 3ZYJB 4I30A 3AXEA 4KH9A 4CDWB 4XF0A 4QGLA 4XFGA 3R4DB 2VECA 4YGBA 4XBQA 5T5PA 3AJYA 3I59B 1D4M3 1XNDA 4XMIA 1HRI1 4KU8A 5E88A 3UKNA 2XJQA 4WZCA 2XVGA 5DG1A 1JHNA 2ZBJA 1WMFA 3NAPC 4IERA 2WZR1 2AREA 3B5LB 4XIKA 5FFOC 3CU7A 3MZHA 3RMXA 1LOFC 3RSJA 5KXEA 3ES1A 3QD6A 3IIAA 3C3VA 4HFSA 3WQ1A 1HV0A 1KD7A 2GC3A 1O4ZA 1RUE1 3WV6A 1VBB3 3LSDA 1AYM1 4AHWA 3ZXGA 2DVFA 4RS5B 1VBB2 4MUVA 2ZABA 1V6LA 3KT7A 1SQ4A 1VBB1 1FOD3 3A0KA 4P9JA 1W39A 1XRUA 2DCYA 4GIQA 4UW3A 2O1QA 3OY8B 4AFBA 1YI7A 1COV3 2UY8A 4CEYA 4YG0A 4AI3A 1JUIA 4YGEA 3ROUA 3OBTA 3H1MA 4XBLA 4FVVA 4ASMB 2IXLA 4IV3A 4XEZA 4JQRA 2D6KA 4PDWC 1KQRA 3MLLA 4L99A 3WDWA 2ARBA 4YW2A 5C33A 4AI1A 2PHRA 3HMYA 4QPIB 3CNAA 3WCRA 3C2UA 4XW3A 4DOUA 2EXJA 2PAEA 3GF6A 1MZFA 1ZM1A 2KXLA 4KG8A 2QCSB 3W58A 5FLJA 3QCWA 4DS0A 4Q4Y1 4AWDA 1UN1A 1H4HA 4LA2A 4AFAA 1PO11 2VMGA 4AEMA 1UZYA 2GN7A 1SLIA 4RD7A 3LSEA 5GLWA 4ES9A 1XNBA 2G9GA 4I3GA 2ZAHA 5JZGA 1SBFA 5I0UA 2BVVA 4Q4Y3 5FMOS 3DPRB 3A4UA 4JGYA 2WS91 3THPA 1OQEA 1QOSA 4N53B 4Q4W1 5LK5A 2UWCA 3TWIA 4CDWC 1B35C 4X8NA 4L9BA