3WW2A

X-ray structures of cellulomonas parahominis l-ribose isomerase with l-psicose
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
248
structure length
241
Chain Sequence
TRTAISRREYDEWLSEAASLARALRYPVTPEMVNDSAGIVFGDDQYEAFAHGLWSREPYEVMVILESLNEPAVDGLPAAGAAHAEYSGLCDKLMIVHPGKFCPPHFHQRKTESYEVVLGEMEVFYAPEPVTVGDDDVLSFSPMPEGSPWPEGVALPAGREDSYAGLTSYVRLRAGDPKFVMHRKHLHAFRCPADSPVPLVVREVSTYSHEPAAPLPQWRGLHDNTFVAEAANSGRLATAIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Essentiality of tetramer formation of Cellulomonas parahominis L-ribose isomerase involved in novel L-ribose metabolic pathway.
pubmed doi rcsb
source organism Cellulomonas parahominis
molecule tags Isomerase
molecule keywords L-ribose isomerase
total genus 60
structure length 241
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ww2A00
2B9UA 4QM9A 4TLFA 1RUOA 1CAVA 1UIJA 2IXCA 5LRSA 1H1MA 4LUMA 4RD7A 1ZREA 2GC1A 4PIXA 2OYZA 4FT8A 3WW2A 2GZWA 3UKTA 5I8YA 3PNAA 3RNSA 3USSA 5C8WA 1QY4A 3D0SA 4Q0PA 3KSCA 4O9EA 3I59A 4HVOA 1J58A 1YWKA 4WZCA 2PAKA 1I6XA 3OF1A 1CAWB 1X8MA 3OCPA 4Z07A 3RYKA 4D7TA 3BU7A 3WW1A 2WFPA 4JV4A 1SQ4A 1V70A 3PLQA 4HBNA 4XF0A 5BPXA 3DKWA 1DZTA 5T3NA 4EWDA 2PQQA 3CLPA 2OZJA 1J1LA 4LA3A 3S7EA 5LEKA 1HW5A 3IIAA 2QDRA 5BV6A 2PAEA 1ZNPA 1CAUB 3GBFA 4HN0A 4Q29A 5E16A 5FLIA 4HVQA 1YHFA 4ZU5A 2GC3A 3D0JA 2Q30A 3SMHA 4AXOA 2BNNA 1CAVB 4H7LA 4I0BA 1YFXA 1FXZA 4LULA 3E5UA 4MGIE 1WGPA 3TNQA 1O5UA 3EHKA 1LB2A 3BALA 4IEXA 4IEZA 4PIZA 4BHPA 5KHGA 4CYDA 3QOPA 3NL1A 4QGNA 4HVRA 1CAWA 2CAVA 2FMYA 2PA7A 4J1XA 2KXLA 5K8SA 1J3PA 5J7MA 5I0RA 1XE7A 4XEZA 5J3UA 4BH9A 3PVBB 3LOIA 4PIYA 3RYPA 1OI6A 4AVCA 3EBRA 3ELNA 1WLTA 4HLTA 3UKVA 1YFWA 2PYTA 1PMIA 4EWEA 4I09A 4XFIA 3HQXA 2PFWA 3IBMA 1H1IA 1QWRA 4LA2A 5KHJA 1EY2A 3E5XA 2GAUA 3FFQA 4AQ6A 2Q0AA 3DN7A 2C0ZA 5JSPA 2XKOA 5BXXA 4XF3A 4YNIA 3UKNA 1YUDA 5FDBA 3H3UA 4YRDA 2PHDA 4ZU4A 4FBFA 4AVAA 2OZ6A 3BB6A 4JTNA 2ETEA 4IEWA 3C3VA 2UY8A 3WW3A 4X6RB 2BYVE 3L2HA 2BGCA 1EP0A 1O3SA 2ET1A 3ROUA 2GU9A 1YFUA 1J59A 3SXWA 5JR7B 5J48A 3GYDA 2XGXA 4META 5I8TA 2QJVA 3TNPB 3I59B 1GQHA 3H1MA 3FX3A 4MGZE 2D5HA 2IXKA 2ZCWA 4XFBA 3OGJA 5FLJA 1SEFA 5JCTA 3OTFA 5CVRA 1FI2A 1WA4A 3G7DA 1VR3A 4F7ZA 4XF4A 3I54A 1ZRRA 3H8UA 3SHRA 1UW8A 2E9QA 3FZ3A 3H7YA 4R8HA 1NXMA 4A2UA 2FQPA 3H1WA 1JUHA 4WVZA 2O1QA 1NE4A 2IXIA 4AVBA 2MHFA 1LKNA 2OPKA 4BYYA 3SCFA 1Q3EA 4JVAA 5JAXA 4IESA 2P17A 4I2OA 3NSTA 4IEQA 4QGMA 3LA3A 3BCWA 5AVPA 1RTVA 4O9GA 3FHIB 4XF9A 5I8SA 4MV2A 2EAAA 2XL9A 4P9GA 4WBBA 2EA7A 4KWJA 1VP6A 4Z82A 1J3QA 1ZZ9A 4KU8A 2IXLA 1XRUA 2I45A 3CL1A 2MNGA 2B8MA 3NKTA 1VJ2A 2B5HA 3H3ZA 3CO2A 3RYRA 1EYBA 4PJYA 3S7IA 3U11A 2N7GA 3B02A 3CF6E 4FAGA 4KWKA 1QXRA 4IEPA 5E1RA 2XL7A 5LEJA 1DGRA 5FCCA 5KBFA 4IETA 1NE6A 3QACA 3H50A 5HI0A 2D93A 3E6BA 1CAXB 1RGSA 2OA2A 5LRRA 5D1IA 4L2NA 4J1WA 3H1YA 2IXJA 2K0GA 4KU7A 1DGWA 4NVPA 1O4TA 1ZZ8A 1FT9A 1ZX5A 5I0TA 4E2GA 4ONUA 4XF1A 2ZKLA 1ZRCA 4ORFA 5I0SA 2QVSB 5F1RA 3S0MA 4MGKE 4E2SA 4ZU7A 3D82A 1YFYA 4HSLA 2QCSB 2H6CA 3RDIA 3CEWA 4Q0UA 3VHRA 1O5LA 3MPBA 1IPJA 2ET7A 3HT1A 1IPKA 2ATFA 2EVXA 3ACLA 2WC2A 2DCTA 3RZZA 1Y9QA 4MH0E 2IC1A 4MX3A 1UIKA 2UYAA 1PM7A 3MDPA 3NW4A 4DINB 1RC6A 4K8FA 1Y3TA 3LWCA 3U0ZA 2K9ZA 4LLOA 2XHKA 5FQ0A 2VQAA 4E2QA 1XE8A 3NJZA 2F4PA 3DL3A 2H6BA 3M70A 2HKXA 1U12A 4MZUA 3U10A 3KMHA 5FLHA 3EQEA 4UXAA 3R6SA 3HT2A 5I0UA 2UYBA 5BUVA 1GQGA 4XFAA 1LR5A 3IDCB 4LEJA 3BPZA 2D5FA 2PHLA 1ZRDA 2H0VA 3KGZA 2XLGA 2Q4SA 2PTMA 4KWLA 4D7SA 5CU1A 4LTAA 1DZRA 4Q0VA 1OMIA 1NZCA 5EFUA 1LRHA 4LUKA 3E5QA 5FQ0B 2GC0A 1J3RA 1YLLA 4UBHA 1TQ5A 2PAMA 3MYXA 2D40A 1I5ZA 4L11A 5I93A 3FWEA 3ES4A 1NYWA 3H9AA 3FE5A 4MUVA 1X82A 4QMAA 4F8AA 4JTOA 1OD5A 4XFFA 1O7FA 5JSRA 5FPZA 1X8EA 4I01A 5JSOA 1UCXA 4HMZA 4I02A 5CADA 5KHIA 3CJXA 3MZHA 1O3RA 2XLAA 4I3PA 2HJIA 3O14A 1EPZA 5C6CA 5FPXA 3SCHA 1CAUA 2CGPA 4EV0A 4XFGA 1ZZCA 2GH2A 2Y0OA 1ZZ6A 3EJKA 1X7NA 1RUNA 3E6DA 4OFGA 4YARA 4YSFA 3ST7A 4FAHA 4MGYE 4X6QB 1UD1A 2O8QA 3FJSA 4OLLA 1CAXA 2VPVA 3IWZA 3M3IA 4BIFA 4R52A 4IEUA 1Q5OA 4QX5A 4Q0QA 2CV6A 4KL1A 3LZZA 4YYOA 5BY5A 3DV8A 1ZZBA 1ZRFA 5KHHA 4IEOA 3I7DA 3IDBB 4XETA 1QXJA 4QXKA 4XFHA 4Q0SA 5EZWA 3H7JA 1OFNA 1ZZ7A 3E6CC 2XKPA 4EROA 2BNMA 3OD0A 3LA2A 4QM8A 4XFCA 3JZVA 4B29A 1G6NA 4IEYA 4N9HA 1UPIA 5I91A 1CX4A 4HZFA 3RPQA 2Z69A 3LAGA 3ZDSA 1SFNA 1O3QA 2IXHA 4GULA 2GC2A 3WW4A 2Z2SB 2CAUA 5KHKA 1L3JA 3KGLA 1Q43A 3KCCA 2V09A 2XLFA 3ETQA 3N4MA 4IERA 3SCGA 4EWAA 3E97A 4N9IA 4HSJA 3LA7A 1RL3A 4HN1A 3NVCA 4AQ2A 3EO6A 1CGPA 2Q1ZB 4IEVA 2MPFA 2BEOA 1ZVFA 4UBGA 2BNOA 4QGLA 2UY9A 2VECA 3ES1A 3HIFA 2QNKA 4I0AA 1O3TA
chains in the Genus database with same CATH superfamily
1LOBA 1AR81 4BMBA 2ZMNA 4KBBA 5A6YA 3R05A 3ZSMA 4AL9A 1IS6A 1VLNA 1DU3D 2XH6A 2OYZA 1ZREA 3VKLA 1XSRA 1BMV2 2RS33 2VUAA 1GZCA 1KD7A 2ARAA 3PMEA 5J96B 2R1DA 4KI5M 3V56A 4H14A 3GJAA 4DOUA 3KHCA 2JDNA 5I8YA 4OI4A 5KWRA 3ZVXA 1QIQA 3PNAA 1MPXA 5C8WA 2XXZA 3WVJA 3D0SA 4ZHNA 4O9EA 1S4CA 1W9FA 3J9SA 4WZCA 2PAKA 3N9QA 5FBJA 2EXKA 4OHXA 1M4WA 1AR92 2VH9A 2D3PA 3ZPYA 3RYKA 3DUIA 1G9AA 3VD9A 1HIXA 3WNKA 2FCTA 2WKKA 3OY8B 1C1LA 2EXIA 5FK8A 4AFMA 2HBUA 1AL0G 1W9WA 4OUMA 5FYSA 2GSYA 1YRZA 4PF5A 5AVAA 1XOYA 4LBJA 4LBQD 2JWPA 2ZHLA 5JXIA 1DZTA 1U5XA 5JOYA 1UZZA 4CCNA 2PQQA 1S0CA 1RUD2 1XYOA 3WQ7A 1FPN1 1PO22 1ND2A 4I3GA 1PGSA 2QDRA 4Y20A 3N9LA 1KS5A 3ZFEB 1RUOA 1GSLA 5HV0A 4E9KA 3GBFA 1UZ0A 4D94A 1DDLA 2X8KA 1OH4A 2XJPA 4ZU5A 3T09A 2AENA 4Z92B 1AYM3 3D0JA 3POBA 5FXWA 4YW4A 2WYSA 3APBA 3S57A 4PDWC 1CESA 4YVWB 1R64A 5IVBA 4JGYC 3WUDA 4LBMA 3MV01 4LULA 2I2SA 2G4IA 1NLSA 1OPOA 1SBDA 4FPFA 4MGIE 2DVFA 2VC9A 3T30A 3AYCA 4OQ8A 1DBNA 3EHKA 1LB2A 3KV4A 1UPSA 2XJQA 4PT6A 4BHPA 3UGGA 3BI3A 3QOPA 1GU3A 1NY72 5JDBA 4BA6A 3LGRA 2DBNA 3ZFEA 3VBHA 3POIA 5LATA 2ZGOA 1AX1A 2PA7A 2ZTNA 5BNOC 4MSVA 3VBSC 4O7XA 1J3PA 2ZGUA 4BH9A 1L7LA 3WNLA 3RYPA 2V5YA 4Y1VA 2R072 4AVCA 1PGW2 2VZ3A 1D2SA 3M3CA 1VBD3 3FL7A 3IZOA 1O59A 4IV1A 4LE4A 2WFF3 2VMEA 5AFEA 3LPFA 1N1TA 4CDWC 4FTSA 1JZ7A 3ZXJA 1Y9GA 4HL0A 1GQPA 4QB1A 2PFWA 2BBAA 2DCZA 5KHJA 1QJY1 3E5XA 5L7OC 2UWAA 1HJFA 2GAUA 1OUSA 4FQZA 4JDNA 4E4HA 1QQP2 2RE9A 2C0ZA 3J8F1 5KXCA 2YBPA 1FV2A 3IM0A 3KF3A 3NNGA 3ZXLA 3BIEA 1WW7A 2YU1A 5BXXA 2KA3A 3ACGA 2BPA2 1IS4A 4TWTA 3M3OA 1GWKA 5JI7A 4IV3C 3BKZA 2EIBA 3AL5A 4C8DA 1XNCA 3UJOA 3ZXGA 2UWBA 2PHDA 5IVYA 3INAA 1CZTA 1WCUA 1W0PA 1WZXA 5FKCA 3CJIC 1T2XA 4CEYA 1VB4A 3DECA 2ZMLA 4KNCA 4GKXA 4I0WB 4OI0A 4QXBA 1J1TA 4CCEA 1W0OA 4H55A 3Q8FA 5DAWA 5LASA 3RMYA 5J98B 4L92A 1DYOA 1F2NA 1X9TA 3SLIA 2G9GA 1AYN2 3POWA 2D6LX 2JIGA 3WF1A 1AYM2 1J59A 4C91A 3WUCA 5J37A 1EAH3 1PO13 1JZ2A 1WCSA 1TME2 3SXWA 5JR7B 5J48A 2WQ4A 2Q1MA 5K0UB 5FMBA 1PVC2 3GYDA 3ZYHA 5FZOB 3VN4A 4W6WA 3ZYIB 5I8TA 2QJVA 2ZZJA 3I59B 2Y38A 3IAQA 1D4M3 2TEPA 2YZ4A 3KQ4B 3ZXEA 1X9PA 2R30A 5DAVA 1S0BA 4LK6A 3FUOA 3ZFEC 2YC4A 2YC2A 2A3XA 2WT2A 2YPJA 1ASJ3 1FI2A 3OTFA 5CVRA 2E53A 2K46A 3ZSEA 3G7DA 1ZYBA 4JQRA 2O14A 3I3EA 4XCBA 5LA1A 4L97A 3MFCA 1W6NA 2OVUA 1VALA 4PLNA 5A33A 4A2UA 1JU4A 2FQPA 3H1WA 2ZHKA 4KGGA 4DY3A 3TEYA 2GNTA 1NE4A 3MICA 3VD7A 4YM1A 1AVBA 4XTPA 1UY3A 1V6OA 5BNPA 4AVBA 5FZAA 2LW8A 2MHFA 1JMUB 3OJBA 1MQTB 3SCFA 5FJHA 2BFUL 3T0AA 3VDDB 4YW5A 1K45A 3GHNA 3LEIA 3T2PA 2FDKA 5T52A 1ULFA 1IZ3A 1JI6A 1WCKA 2JE7A 4LNVA 1K5JA 5B4NA 3GCXA 4BISA 4ISRA 1QQP3 4HPKB 2LM3A 4LHKA 5C5TA 1WW6A 2QFEA 3SITA 3HPNA 3OOXA 4E4ZA 2ZX4A 4A42A 1GZWB 2Y6LA 4K8RB 2DUPA 3OBRA 4XF9A 3VKFC 1Q8SA 1NZIA 2WFF2 5I8SA 4YZ1A 5AFBA 4WM8B 4MV2A 3VBUA 3CZJA 3JQXA 3L2YA 5T5PA 1J3QA 1PX4A 5FY1A 2VZPA 3KT7A 1TNFA 2DFCA 1KDMA 2WAOA 1MZEA 1W04A 2CSGA 3LEKA 4AFAA 2AACA 2R063 2IXLA 1NY71 2JECA 4XJZA 5F2SA 2WABA 3POEA 4JGZB 1R1A1 1CN1A 1BBT1 1POV1 3A4UA 2VOKA 3H3ZA 3CO2A 4TYSA 1AR61 3RYRA 1LENA 4PJYA 1O4ZA 5EJZB 3U11A 2N7GA 3B02A 1VMFA 5GZGA 2IUWA 3SEPA 4IEPA 5E1RA 1RUC3 1V6KA 1QEXA 5E6HA 4YPJA 1CQ9A 1PVC3 4OHWA 1SMVA 5JPMB 1X33A 5FCCA 1X50A 5C3OA 1NE6A 2WRAA 1NA1A 3B69A 4FPEA 1BCXA 2D93A 4ZKTB 4ASKA 1WWYA 2A1XA 4BQ3A 3C8XA 4AHXA 4DO0A 3E6BA 1UYXA 2NQYA 2OA2A 1RUF3 1W6MA 2V73A 2WNUC 1KJRA 1ZBA3 1PO12 5A3OA 5FYUA 5FZGA 1UWWA 2BUKA 1YQCA 2PXJA 4AZZA 1DYPA 4OHZA 3O1RA 4FPOB 1LGBA 4GH4A 2ZABA 4YM2A 5L73A 4RSUA 1FT9A 5DABA 2ZEWA 2FD8A 1Z7S1 5FZIA 5I0SA 2YFUA 4IV1B 2EIDA 3S0MA 1RUJ3 3N7MA 2X5IB 3NAPB 2VMFA 5FJKA 3VDDC 5FZEA 4HK8A 4X8PA 1PX3A 2FZ2A 3O5SA 3B01A 3LEGA 4IW3A 4JRLA 1ASJ1 4QQPA 2HEYF 4BMEA 1O6UA 3JD72 5CFCB 2FDHA 5JXGA 3ALQA 1HDKA 4TLGA 1IPKA 1RVF2 2PQSA 3KZ4C 4CXXA 1TME1 3ACLA 3F2ZA 2RS32 2WC2A 4Y26A 1V9U2 2CWSA 3HR9A 4KWUA 1J83A 2HEWF 4F3JA 3JUUA 4E8CA 4RFRB 5FZ1A 3RJRA 4MHUA 4YGCA 3ATGA 3ZR5A 1VBA2 1GZWA 2VM9A 1ZA4A 4G9SB 4WM8A 4L9BA 4K6BA 4RHV3 4DINB 1WMXA 3C7GA 4MVTA 1Y3TA 3CIHA 5CNAA 2HH9A 4LMFA 2CY6A 3WNXA 4Q4X1 3IKWA 4RL7A 2F4PA 2QQNA 2D6MA 2IFWA 1N1VA 5CFCA 2QKDA 5FUNA 2XHNA 3VBOC 2JDUA 2A75A 3ITQA 2HKXA 2JICA 1ND3C 1CZSA 2AUYA 2JB4A 3B9IA 4W8JA 3KMHA 1S0EA 3S30A 2ZX3A 1AL23 1QJX3 2VGDA 5FLHA 3THTA 1Y7BA 4IL7A 3ZFFC 1JYIA 3DYOA 5C8CA 4HONA 2D6OX 3R6SA 3HT2A 3KV6A 1M06G 5BUVA 3GZAA 1R092 2SBAA 3VDAA 1UMZA 3T08A 4QHBA 1LR5A 4HKLA 5DAPA 5JZGC 3A22A 3OGSA 4KG8A 1IKPA 2CU5A 1BXHA 2XVLA 2Q4SA 2JDHA 2JEMA 2PTMA 3LDKA 5IJRA 2XWJB 3OG2A 3CZUA 5FXXA 1LODA 4XDPA 2XQXA 1DZRA 1JBCA 4QDRA 4KMQA 4Q0VA 1H2LA 1NZCA 2VMDA 2MEV1 2XBO1 4UF0B 1LOAA 2WFF1 5JIAA 2HWF2 1QKQA 2AEYA 2E7QA 2Z4FA 4KGQA 3ZYRA 1UOJA 5FQ0B 4AEDB 1J3RA 1H8TA 4QX7A 5A1AA 1C4RA 3BN6A 4XBQA 3DGTA 4MXWA 3AKRA 4L11A 2F6BA 1Z0HA 2OQ7A 4KH9A 3WDUA 3AL6A 5CG8A 4CEWC 2X05A 4BQYA 2PMWB 5I93A 4KQ7A 2HYKA 3CHXA 1NYWA 3AYDA 2IVIB 1K42A 4M00A 5FYCA 4QKDA 1WUVA 4F8AA 1CJDA 1OD5A 4XFFA 5FV3A 1PNGA 1H9WA 3SEEA 2W47A 2W52A 4I01A 4RYDA 4DRVA 1VPHA 1DGRN 4RR3C 2HWD1 4I02A 4XIOA 2BZDA 1WMDA 2Y6GA 5F39A 1ULEA 3T1LA 3CJXA 5DZEA 3MZHA 3ZLIA 4CRQA 4IGPA 1QOTA 1VBC2 2GP3A 4DXRA 3TEXA 4A6OA 4CDQA 4Q4V3 4UW4A 1JYWA 1WD4A 4QQ2A 4Y24A 2W3JA 2IZWA 1SPPB 3OUJA 1HKDA 4RHV2 2FHRA 2ZACA 1OQ1A 4XFGA 1W8TA 3A23A 4TN7A 2HWB1 4URTA 4AOCA 2AZ5A 3V65A 1X7NA 3E6DA 4Z2WA 1V9U3 2EIGA 1GNYA 2ZPXA 1IPSA 3MI8A 2VVDA 3IAPA 3I2OA 4OLLA 3VBFC 4B4QA 5L36A 3WG4A 2Z79A 2D44A 3N9NA 4WVVA 4XYXA 1LHOA 3HBZA 2XVKA 4WV8A 1QJZA 1RUC1 5F6LB 1R093 4ZXEA 3EYPA 1Q5OA 3VHPA 1IG0A 2NM1A 4GWIA 4WVMB 3OEBA 4XJWA 3DV8A 1ZRFA 2ZGTA 3PIGA 2W68A 4OMDA 5KHHA 1JUIA 2B9VA 2YC0A 3PU3A 4IEOA 3R4SA 2UWCA 3C7HA 4XETA 4CEYC 4XFHA 3LOBA 5A3MA 1ULGA 1KFXL 3U4SA 3H7JA 1OFNA 1ZZ7A 4QPYA 5C9AA 2ZEZA 2NP0A 4MO3M 4IV3A 1V9U1 3FN9A 5H9QA 1OOPA 1UYPA 2YBKA 5IK8A 3LB9A 5FY4A 4EROA 2BNMA 4P9JA 1E57A 5CG9A 1RUF2 2VOTA 4JX0A 4AWDA 3SQOA 4QX0A 3JZVA 3QD6A 4IEYA 3J7MA 3ENRA 2HYXA 1GWMA 1CX4A 2WL1A 2YYOA 5GZEA 1REEA 1BYHA 5CFDB 3ZDSA 1O3QA 2HLEA 3N35A 5FWEA 3MIEA 2B4KA 4FI9A 4TTGA 2PLV1 2QQVA 3PUQA 2ZBJA 2YFZA 4AGVA 2E51A 1NX9A 1OVSA 4MXVA 5FREA 1JHNA 3P1IA 1OOPC 5L19A 1QJU1 1N3PA 1AR91 1OKQA 2XJTA 2Y6JA 3F95A 2HWC2 4XJAA 4G3YC 3VDDA 2YBSA 1VBC3 1UO9A 3JCIA 4XOGA 4BIOA 2UU8A 4N53A 4N9IA 1L7RA 3I4IA 4AQ2A 4WVWA 4HFSA 5F8PA 3VBRB 2NMOA 3NKGA 2VBDA 3OPTA 4EN8B 2MPFA 2R1BA 3UYJA 4Q26A 3JBG3 5EYYA 1ULCA 1UOFA 3ES1A 4UT5A 4QPGC 3HIFA 3BU0A 2LUWA 4PLOA 4LKSA 3URFA 1JOBA 3WF4A 4D0QA 1O3TA 4YFZA 3SH3A 5LBEA 1CAVA 2IXCA 4N43A 3VBRA 3WR0A 5C8CB 4FQ4A 1YIFA 5LRSA 3KM5A 3O1OA 4WM7B 4FT8A 1MEC2 5JMOA 5FZ9A 3TN92 2BVVA 2GZWA 5A70A 2ZJCA 3RNSA 4WM7C 2QQOA 2ZAAA 4Q0PA 5BNNC 1DHKB 2DFBA 1VBE1 2CGNA 2RS11 3I59A 3JXSA 1YWKA 3HNMA 4AVSA 3MW2A 3WDWA 2A6VA 3OF1A 1MZFA 3KT1A 4Q4Y1 5FY8A 4FPLA 1XE0A 2DUQA 4LBNA 4Z07A 1FMD2 2WWUA 4YVWC 1S2KA 3RWKX 2WO7A 2BU9A 2HWD2 1OF3A 4CCCA 1OLRA 4FFGA 1AX0A 1HV0A 3W20A 5FO7B 5FMOS 1SQ4A 3MIGA 2QTWB 4HBNA 4TXWA 2YPDA 3WX5A 4JKKA 2WDBA 4LHLA 5B2GB 4LE3A 3AM2A 1I5PA 1Z78A 5K9YA 1GWLA 2YMZA 2RS53 2OZJA 4CP9B 3I2FA 2R32A 1LHUA 4AEDC 5IK7A 1GNHA 2JD4A 4AI1A 3IIAA 2AC1A 2ZGNA 4XJUA 3DXTA 1A8DA 4H7MA 1FV3A 2ZEXA 2VBPA 2ZX0A 4E8DA 4CEWB 4HVQA 4NIIA 1YHFA 4ITCA 2DUOA 5JOWA 1F15A 3PVOA 3CKHA 4M3CE 2Q30A 5HCFA 2ID4A 4AXOA 1QXPA 1AXYA 5F7UA 1YC61 4H7LA 4I0BA 4Q8KA 3GF6A 4IGQA 3Q8BA 4EN9B 1W6MB 1UL9A 4RR3B 4YGDA 3E5UA 4Y22A 1HQLA 1HRV3 5L9RA 1RVF3 1UU6A 5LK7B 2VMGA 4IEXA 1N3OA 3BGAA 4AI8A 1QU0A 2RM23 2WZ8A 3NL1A 5CZKA 3UGFA 1WW4A 1POQA 3WDYA 1CAWA 2RDRA 3J7NA 4J1XA 1W3XA 2YHJA 2HWC3 5H9RA 1RUF1 3TAYA 4CDUC 4QB6A 5A80A 1TE1B 1HLCA 1GYKA 1W03A 2VUDA 4A6SA 4AHYA 3I3QA 4QKBA 4YLZA 5J3UA 1MS0A 5FY9A 4AI9A 1AYM1 1CJPA 4XHXA 3FBMA 1XB9A 3UETA 2XG3A 5LCWL 5FZ8A 3UKVA 1WLTA 2WAAA 1W39A 3D6EA 1AR73 2VU9A 1PVC1 5I0DA 4FP3A 1UYZA 2VD7A 3HQXA 3FLRA 4K3UA 1QWRA 1H4GA 4V1PA 1EY2A 1MR5A 3NJXA 4BK4A 4YVWA 2Q0AA 2P5BA 3AX4A 3HOBA 4CEYB 2O0OA 1POV3 1BBT3 1LESA 2HWC1 4BLIA 1IQDC 4PBPA 2HWD3 3RZMA 3VZJA 4Q4W1 1UOBA 2Y0IA 3ZX7A 5ACA1 3L9JT 2D98A 5E89A 1RUI2 4U2AA 4QU1A 5FZHA 4LHNA 3HQUA 3KLSA 1YJLA 2BRTA 2RS52 4FBFA 3O1VA 4JRAA 4PF1A 3BB6A 2P3KA 1WBFA 2XWBB 3H3LA 3C3VA 4IEWA 4JTNA 4MGQA 2UY8A 5GLWA 3VBOB 3WW3A 4ARXA 4CDXB 1K5MB 1NG0A 1RITA 1RINA 2VCCA 2XQRA 1W6QA 3L2HA 4MADA 4P9XA 4UFIA 5FYYA 4BXSV 1H9PA 3H8RA 4OVEA 5CFDC 2I07B 1CONA 3VD4A 4QDSA 4A7YA 5GLVA 1PZ7A 2P3YA 3Q8AA 2VO5A 4AGRA 4DXZA 2CYFA 5JZGA 2WNUB 2WNVB 4Q4W3 3I3DA 5FZCA 4YW2A 5FY0A 2YB7A 5C3RA 2WSUA 2XGXA 4META 4CXWA 5FMOL 1VBB2 5FXVA 1PMJX 5DN2A 1YXWA 2AGSA 3FX3A 1W9SA 5DDJ2 3K3NA 1OURA 1ZRIA 2D5HA 5F5AA 1JZ6A 4YW7A 3UNPA 2VNGA 1K5MA 4XFBA 1DF0A 5JPNB 2R16A 2YY1A 5FLJA 1FMD1 2RM22 3RQ0A 1EAH1 5GZCA 4Y5TA 4Q1PA 4GMP3 2WNOA 4W4ZA 1CWPA 2G19A 5KC6A 1VR3A 1LCLA 4FPKA 4XF4A 1IS5A 2ES3A 2WWSA 1R1A2 2W95A 2J1UA 3H8UA 5LWBA 2VNOA 3SHRA 5GLZA 5T55A 2WZR3 1UW8A 3FZ3A 4COYA 5C4WC 1GOFA 4JAAA 4MHRA 1QF3A 2DWRA 4WVZA 3SKVA 3RZJA 3VBUB 1EV11 2E7AA 1RUH3 4LORA 1MS1A 4PHZA 2OPKA 5A3LA 1XXNA 1X36A 2XPJA 3I2DA 4RFT0 5GKAC 3K51A 4BQ1A 4CP2A 4IESA 4I2OA 3WNPA 3NSTA 5KC5A 2Q1FA 2W08A 4QX2A 1EPWA 4QGMA 3ACFA 1QDCA 4S2HA 4NE9A 1IHMA 1V6IA 3BCWA 4XZPA 1QNYA 4PCRA 4CDQC 3N7KA 5AVPA 4CCLA 4CUAA 4Z8BA 1F8VA 1SBEA 1RUG3 1STMA 3ILRA 4AGGA 3M2MA 3FHIB 1W9YA 5F3EA 2OX0A 5F3IA 3POJA 1Q8OA 4XQ4A 2EAAA 4P9GA 4WBBA 5FYZA 1W2OA 2A6WA 4Z82A 3WDTA 1ZZ9A 1FX5A 4Y4RA 4URAA 3WCSA 5CIRA 3TB0A 2Q8OA 5M0TA 2XVGA 1W6NB 3AFGA 3PURA 5A32B 1W3VA 1XRUA 3WF3A 3GHMA 1G9FA 3GM8A 2B5HA 4YGEA 5CISA 1W6QB 4XMAA 2QQMA 1EYBA 2ZA9A 5D21A 2NN8A 5F32A 3CF6E 1N1SA 3ILNA 2HBTA 4Y1ZA 5F5CA 1LULA 3RSJA 1YIPA 3WP4A 5LEJA 3H42B 4FTEA 1DGRA 2VJXA 4QPIB 4XQDA 2WIIB 1SBFA 1ZBA1 4IGOA 5KBFA 3BOPA 1F5JA 4LITA 3KS7A 4XJ9A 5FZOA 1Q8PA 1XYNA 4LIUA 2DU0A 1LHVA 4AG4A 3VD3A 5HBAA 1TNRA 1DFQA 5C70A 3NV3A 2DCKA 4ZPIA 3C2UA 3ZN5A 1RUE2 3IDAA 3NV1A 5A7WA 1UY4A 4FPCA 4NWWA 4AHWA 5AC93 5D1IA 3S5QA 4TSVA 4J1WA 2AEZA 3H1YA 4Y33A 4IE7A 5EXOA 4Q4W2 5LBCA 4K40A 2K0GA 3UJQA 1ST8A 1PHMA 1XQNA 2DCYA 2ZHNA 4EZ4A 2AYHA 1ZZ8A 1VAKA 3EMRA 4E4DX 1C8M1 1LGCA 3K77A 3SH4A 4NJ4A 4GMP0 3VBUC 4CUCA 3RFRA 3PUHA 3NV4A 2QVSB 4ES9A 5F1RA 1REFA 3LSDA 1FNZA 5LB6A 4E2SA 4ZU7A 3KHBA 1H4HA 1O8PA 2EIEA 3I3BA 3PDQA 2QCSB 5CFCC 1EUUA 2H6CA 4UFMA 5F6KA 4GWJA 1HRI3 5FZ4A 1AZDA 2J42A 1IPJA 2R062 1R091 2ZGLA 2ET7A 3MPBA 4AVTA 3J26N 3ZXAC 1ODNA 1AR71 2DCJA 3AZZA 1UKRA 3QH7A 1QH7A 4R9AA 3B3QE 2WT0A 4YW3A 1MEC3 5A3PA 4QWNA 2ARBA 2OKXA 3VBFB 3RRDA 1D7PM 1UZVA 1FAYA 3GDBA 3AYEA 1Y9QA 1VBB1 4MH0E 4SBVA 2IC1A 4LQRA 4MYEA 2C1FA 4GWMA 1MQTA 4CCKA 1UIKA 2ZGPA 4XUNA 2ZMKA 4DFSA 5A3NA 4CVUA 4NPLA 3WZ1A 3J4UH 1V00A 1A78A 3CQOA 4K8FA 1Q8VA 2RM21 5D2AA 1EAH2 4ZZ5A 4MOAA 4YZ2A 3VZMA 3ILFA 5JXJA 2H6BA 2JKBA 5C5UA 3SC7X 3ZOIA 1K5MC 4BCUA 4CDXC 4MZUA 1UOGA 5IK4A 3RJ2X 1POV0 4BOWA 3ETPA 3K4AA 2ADEA 1LEDA 3ZKYA 4BLJA 1V6NA 5GJ6A 5I0UA 3MLKA 5FZFA 3VZKA 1XJAA 2WQZC 3PVEA 2Y64A 4YZ5A 1DYKA 2GN7A 5A1FA 1H6YA 4XFAA 3KV5A 5JIUA 3IDCB 3N7LA 2P2KA 4XE9A 4XUQA 2RR11 3BPZA 4CA9A 1DLCA 5J1XA 1ENSA 1O91A 2PHLA 2I74A 2H0VA 2XLGA 5SV8A 2TBVA 4ATEA 4QQOA 2X09A 1K3IA 1OHFA 5FPUA 1QJEA 3CBNA 3W59A 1SG3A 3SNMA 1F31A 4HKWA 4LTAA 1NAEA 2HWB2 3WQ0A 2VZQA 4YVSA 2NPIA 1LRHA 2NLRA 3GCWA 3TOJA 1LAJA 3I2HA 3E5QA 2B46X 4NUBA 2GMPA 3I2KA 4Q4V2 4AQSA 2GC0A 2BTVC 2LROA 1AXKA 3JU9A 4S2DA 4N7UA 4Y3OA 5JR2A 1I5ZA 3U4XA 5C4WB 1Q56A 1RUE3 4HK9A 1VE0A 5IAXA 4LBLA 3FWEA 2VCAA 1RUH2 1HRI1 4GH4C 1FOD3 1TMF1 1VBE3 2W39A 3GZEA 2FCVA 3H9AA 5FPAA 3UT0A 5L7OA 2XONA 4MUVA 5LK5A 1GBGA 3N36A 1I9RA 3ZYPA 3K4ZA 5C7GA 2GNDA 5FZ3A 1GP4A 5FPZA 3OYWA 1CIYA 1MVEA 5FZBA 1X8EA 1W2AX 1WA6X 4FOYA 4HMZA 2JG8C 4P14A 1NQDA 1HB1A 1H2NA 3VB9A 2VW0A 2CHHA 4LPLA 5D8AA 3WNMA 1YQ5A 4GZ9A 1UU5A 3MF9A 3O1TA 1GNZA 4I3PA 4NPRA 2E33A 4FPJA 4CDQB 3QH6A 4P9WA 3HNYM 4QKNA 1CAUA 1COV2 4CDUA 5IVJA 2Y33A 3VL9A 4EV0A 1JU3A 4LJHA 3VHOA 3JBG1 3OPZA 1ZZCA 2W46A 5GLTA 1LHNA 3OGVA 2CGOA 2ADDA 1LU1A 1ZZ6A 2Y0OA 4Y1UA 3MW3A 4OFGA 4YSFA 5F3GA 3ST7A 4A3XA 1OXCA 1RUD3 2WJSA 1RHI1 5F37A 1DGLA 1TME3 5FYBA 4ASMB 1GKBA 1Z7S2 2MEV3 2XBO3 1JZ4A 1AXZA 2P6HA 1MS4A 3T1MA 5K0UC 4BM8A 2WS91 4NHXA 1QOOA 2XR4A 5JLVA 3AKPA 5FFOC 4HETA 4QX5A 4Q0QA 2CV6A 2K2SA 3LZZA 4CCDA 3RZHA 1OA3A 4RQPA 3AB0A 1JS9A 1KFUL 1MVQA 4OI1A 1PZ8A 2JENA 3POGA 3QBQA 4QXKA 5FUIA 4Z1VA 2VTFA 3JD71 4BQXA 5EZWA 2JKXA 2JIJA 1KQRA 2VY0A 5CA6A 2G9ZA 4JC1A 3RI9A 4INDA 1UQXA 4XBLA 3AVRA 2JJ6A 2E6VA 3LIGA 1UXXX 3OD0A 2J1VA 4IE4A 5AC92 3LA2A 5K7PA 3PJQA 4XFCA 1HN1A 4N9HA 5HCHA 2NMNA 2DDUA 1S1AA 3AMPA 3O0XA 4BE3A 3HD8B 4FXKB 3OY8A 4HZFA 3RPQA 5BNPB 1UYYA 1WBLA 3ZR6A 4QQHA 3HN1A 4K7JA 1BMV1 5FUPA 3AZWA 3O12A 5FPVA 2GC2A 2FDJA 4J25A 5HXMA 5IW0A 3KGLA 1Q43A 3W9AA 3V0BB 1EV13 3PL0A 4FOWA 1PVXA 3N4MA 2VNRA 1MACA 3VBSA 3CNAA 2DV9A 5C9AC 2YV8A 2D6NA 3K4DA 5FZLA 2GNMA 1E5SA 1W90A 2OQ6A 2ILMA 2F4LA 2A6XA 1SZBA 3ZXDA 1KITA 1WLDA 3MIBA 4CE8A 1JYNA 3NVCA 1CGPA 3HMYA 2FDGA 4RS5C 2W0XA 1OA4A 2Q1ZB 3C7FA 4IEVA 1F4HA 4FXGB 4UYBA 5ABJB 1FOD2 1MS9A 4NIDA 1SLCA 5FYMA 5FO9B 3S6PA 3V0AA 1FMD3 2JDZA 3IT8A 4GJZA 3N9PA 3BTZA 2BNOA 2KD7A 4QGLA 5JI9A 3UK9A 4QPGA 1AL22 1LOCA 1QJX2 3DYPA 3GGLA 3VZOA 4DMIA 4DIQA 1N47A 2JDKA 1PO21 1FPN2 2PHWA 4QM9A 2MEV2 2XBO2 1JOJA 4XURA 1H1MA 5BNPC 4LHSA 4PIXA 5FP4A 1PO23 2BOJA 2WN3A 1MS5A 4EN7B 3OSDA 3M8LA 1K12A 1YQ8A 3R4DB 5FYVA 3UKTA 2E7TA 3UL2A 1U5YA 4HT1T 3USSA 2Z42A 4YM3A 3AMMA 4ZXKA 4P9YA 2NYYA 4MLOA 5IHRA 4A44A 3NV2A 1O4YA 1TMF2 2W87A 1J58A 2Y34A 3N9MA 4HG6B 2GP5A 3N7JA 1CAWB 2RDSA 1X8MA 4BQ5A 5EYXA 2QQWA 4D7TA 3DXUA 5A7SA 4D8MA 3BU7A 3WW1A 4HXCA 4AEKA 2A3YA 2WSVA 2WFPA 4GAZA 4IQPA 4GWNA 3WD5A 3ZFGA 3ZSKA 4JV4A 3VKOA 4BK5A 4YG6A 2XOMA 4WVMA 5DUXA 5FPLA 4D69A 1V70A 3PLQA 3AVSA 3FHQA 3GNEA 1H0BA 1RXFA 4XF0A 3ASIA 5BPXA 4IV1C 4QD2A 3KV9A 4AW7A 1WLWA 2OUHA 1COV1 2A70A 3NQHA 1LGNA 1YYNA 4QHZA 5T3NA 5EP9A 3KCYA 4EWDA 3MGUA 4YGBA 3OD4A 1GMMA 5E88A 1H6XA 4B3NA 1HQNA 3S7EA 3PJYA 2Y60A 4YG0A 1W28A 5BV6A 5FYTA 2PAEA 2QUOA 3THPA 4P9LA 1ZNPA 5FLIA 4NO4A 2R073 1NKGA 4Y4YA 1RXGA 1HX6A 3TEWA 5FP7A 2G1MA 3RZLA 2GC3A 3AFKA 4CTEA 4XVHA 3SMHA 1ZA7A 1JN2P 2WZEA 4ZS2A 1QQP1 3J8F2 4IUGA 3USUA 1XU2A 1YFXA 2IVJA 5JVVA 1FXZA 4RS5B 3PUAA 4NIGA 1ZBE2 5A7WB 1GOHA 5ACA2 4QAWA 1W05A 5A7NA 1ENQA 2VZSA 2ZGKA 1RJ7A 2JDMA 4YWAA 4IEZA 4UWDA 4AE2A 4EYUA 1UY2A 4AF9A 4QGNA 3HVDA 4KG0A 3KF5A 1NCRB 4EN6B 2CAVA 5GM0A 3B9CA 3BPSA 3HAGA 5AC91 1S0GA 3AJZA 2KXLA 5A6XA 5K8SA 3N3HA 5J7MA 4E4SA 1C5HA 5I0RA 1G86A 1XE7A 4XEZA 2YG0A 2Q5TA 2Z5WA 1BVP1 4Z2AA 4HPKA 5IK5A 1W8WA 1RUD1 4PIYA 1OLMA 1OI6A 1G7YA 2OW4A 4R9DA 5C3QA 1ULPA 2FMDA 2EICA 1BK0A 2E63A 2W1UA 3MPPG 2EALA 1U5IA 3ELNA 2PHRA 1YFWA 4HLTA 3WINE 1QH6A 4NROA 2PYTA 1PMIA 2P37A 4GB31 5FZ0A 4I09A 4EWEA 3WG3A 2PLV2 3WNNA 4XFIA 1SDWA 1C1FA 1RUG1 2W5FA 1H1IA 1KGYA 3IBMA 3ZN6A 1FATA 2JG9C 4FP2A 1D0HA 2WA4A 1WMFA 2QNKA 4XTMA 2AR6A 4R4ZA 3BOWA 3MV11 3FFQA 4AQ6A 5IVCA 4GQ7A 1FYUA 2HWE3 5F5IA 1REDA 1W0NA 2XKOA 3U37A 5A33B 1NXD1 3VKMA 4XF3A 2WLQA 4IXLA 4XPVA 4NRQA 3GXUA 4BB3A 3ZSLA 5BNNA 5T5OA 4YRDA 1ZM1A 3VKNA 4FTBA 5L9VA 4D6SA 5G05L 5LY2A 1BLZA 3GZUC 4JHZA 4RQPB 1FOD1 1TMF3 3QCWA 4ZU4A 5L9BA 4FPGA 2ORZA 3BTYA 2LALA 4X6RB 2VZTA 2C26A 2RVAA 2Y8KA 3ZXFA 4AR2A 3VZLA 2BGCA 2ARCA 2ZOEB 1OLQA 3B7MA 5KXDA 1EP0A 2JG9A 4UFKA 4V2VA 1S0JA 1O3SA 2ET1A 3B94A 3ROUA 2GU9A 1YFUA 4XW3A 4ES8A 2R071 2QQUA 5DZFA 4FFHA 4XACA 1OSGA 1MS8A 2E26A 4UFLA 1YCIA 3T2OA 1KS4A 1RMU3 1DG6A 4JZRA 3J8F3 1PIV2 2V72A 2D97A 1NCQC 5FPBA 3RGBA 2HEVF 3T2TA 3TNPB 4C90A 2PELA 1GQHA 4Q27A 5C3PA 1ND2B 2W9XA 1VBE2 4HANA 5DAQA 4WM7A 4CSWA 2RHPA 1R1A3 3ZMOA 1XC6A 2OUJA 2WZR1 2ZCWA 3LF7A 3WQ1A 5F3CA 3VUOA 3OGJA 3O1MA 5TSWA 2J1SA 5ABJC 1HB2A 4FOVA 4RGGA 4LK7A 4XUPA 2VW2A 3AKQA 3VBRC 4UW3A 3PUIA 3I2IA 4F7ZA 3MFAA 3I54A 1W6PB 1ZRRA 1BBT2 2LTNA 2E9QA 2VZOA 4R8HA 1NXMA 1JUHA 2O1QA 2D7FA 4JGYA 4NAMA 2BOIA 4HKOA 4GH4B 3NJYA 2CDPA 2B7YA 4B7KA 2YU2A 5FK7A 4QHOA 4BQ2A 4GIQA 5LBBA 1JXNA 3WV6A 2PLV3 1ZBA2 2X29A 5JAXA 2P17A 5HV4A 4A7ZA 2WO2A 4X8NA 3A21A 2HWE2 3G6JB 3OBZA 4DEQA 1QHDA 5A1LA 3O1PA 3U78A 4CP9A 5C8CC 3LA3A 1D4M2 4NRMA 5DUVA 3WY6A 1RTVA 4YVSC 2DVGA 1LNSA 4O9GA 2RDQA 4P5YA 4RQPC 3V64A 2ERFA 1OKOA 2P34A 2XL9A 3KD4A 5EWSA 4KWJA 2ZXQA 3NMBA 4FSJA 1BHGA 2J1AA 2ZGRA 4Y5Z0 1XNBA 3MF6A 4JKMA 1HB3A 4KU8A 3A7QA 4LXLA 5A7OA 3USUB 1GP6A 3W5MA 2VCBA 4LBQA 5T5JA 2I45A 2WLPA 2JX9A 1DQ2A 3CL1A 4JGZA 2B8MA 5FMDA 3WDVA 1W8HA 2GMMA 3C7EA 2R061 1CX1A 1YI9A 3C7OA 1VRH2 3OBAA 1ASJ2 4KWKA 1H8TC 4UW5A 3VDCA 1A8MA 2XL7A 1PIV3 1RVF1 1R1ZA 3ACIA 1LOGA 1RMU2 1F5FA 1HRV1 2C4XA 3IPVB 1G9CA 1ODMA 2W1WA 1URXA 4I30A 2XUMA 3SISA 4PI0A 2QQJA 3H50A 3K75B 2AREA 4NOTA 2JG8A 2DURA 4N8MA 4QU2A 5DQ0A 1RGSA 4AQTA 5FR3A 1OUXA 1JYXA 2QE3A 1BQPA 3MW4A 5LRRA 2W92A 1YI7A 5A3WA 1UMHA 3WG2A 4ATFA 1DGWA 4FOQA 4NVPA 5EIYB 4Q4X2 2ZGSA 1ZX5A 5I0TA 2W1QA 4E2GA 1ACCA 1UMIA 2JG8B 4ONUA 5FZKA 3WDXA 3DF0A 5A32A 2ZKLA 5CKQA 3VL8A 4K21A 4BQWA 5FZ6A 1QJFA 2RS51 3OGRA 4MGKE 4N53C 3T0DA 1ND3A 1YFYA 2EXJA 1DIWA 3LPGA 2P4EA 3PTRB 5JWPA 2JB8A 4HSLA 4QQLA 3K46A 3RDIA 1QJY3 1DQ0A 3CEWA 1DQ6A 5FRAA 4COUA 4M0NA 1JZ3A 1ENXA 4BXFA 1C8NA 1UX7A 3M1HA 1EUTA 4XAEA 5FP3A 4A4AA 3MBWA 4H3WA 3P5BA 1PNFA 2ZAHA 3HT1A 1NCRA 4GALA 2RR12 4G4FA 3ZMNA 1RUI3 2OS2A 1RIRA 2EVXA 4WZFA 4YVSB 1LEMA 3MLJA 1OFSA 1AUYA 1XNAA 5F5QA 1RHI3 4NN0A 5C33A 2DCTA 3RZZA 1NT0A 4YW6A 5EV7A 3K48A 2JG9B 5A3UA 4MX3A 3OB8A 4P00B 1XU1A 3O0VA 2D6KA 4XXAA 4EN0A 5FXZA 1LECA 5DDJ1 5IATA 3TEZA 2DU1A 3MDPA 4M3CA 4W50A 3S5AA 3NW4A 4L8QA 1RC6A 1ALYA 1PO11 3WXPA 3U0ZA 4CU8A 1HQWA 4DXSA 3KQRA 1HN0A 2XHKA 4L0PA 5FQ0A 1JZ8A 4E2QA 4OULA 3NJZA 5A7PA 3DL3A 1WCQA 2P3JA 3BVCA 4Q5OA 3AP9A 2QZ3A 1F9KA 5FZDA 3M70A 4CDUB 3NNMA 1G9BA 3A0NA 1QNWA 1VIWB 3U10A 1CD3G 5BNOA 2BBVA 1VRH3 4NIHA 2CWMA 3EQEA 4UXAA 4C0HA 1GANA 1NUKA 2W91A 3M3EA 4AFDA 5GLUA 1E5HA 4OCTA 1SLIA 2B42B 1D2QA 2B45X 2R0HA 1GQGA 2VOVA 1QMJA 4CDWB 2RMU3 3AZXA 3BYWA 3B93A 3VBFA 3WP5A 3ZFGB 1ZRDA 1VBC1 3LCPA 1CPMA 5FZMA 2BP6A 1QDOA 2HWE1 2WA3A 4DUWA 1VBA3 4KWLA 4ZONA 3ZXKA 1F35A 4H2AA 4D7SA 4LKDA 1Q8QA 5IVFA 5L7OB 5CU1A 4RHV1 1GR3A 4CP1A 1TZOA 1H2MA 2XJVA 3Q8CA 5APAA 2R042 1SPPA 5IT6A 4CPBD 3JBG2 1OMIA 1VB2A 5BNOB 5EFUA 1N3QA 4LUKA 4AHZA 4OHVA 1VBD1 4CUBA 3GJBA 3AZYA 5C3SA 2YGLA 1SDDB 1YLLA 2XUEA 1TQ5A 2OXBA 4M01A 4O61A 4PQ9A 4CPBA 4DUVA 3MYXA 2D40A 1SCSA 1UY0A 4ASLA 2VBBA 3BTXA 1W6OB 5FOBB 4XC9A 2X53S 4LO4B 2D3RA 3A0KA 4A41A 3POFA 3TBDA 3ZO0B 4IE5A 2BW8A 4PLMA 1DQ4A 3HNBM 1Y4WA 4AVVA 5JSRA 4RA0A 4LBQB 3ON7A 1C57A 5LW9A 1CR7A 1MZ5A 2X5IC 3NAPC 1RJ8A 3MHZA 4GJYA 3LIHA 5CADA 3RZKA 1AHSA 2O8OA 1OLME 3H0OA 1O3RA 2QQIA 3AJYA 3V0BA 3MIDA 4K9SA 3O14A 4JQTA 3I2GA 5C6CA 4YZ4A 4CXYA 5FPXA 2CGPA 5ANQA 3O1SA 1RUE1 4DZGA 2A73B 4LIVA 5DZGA 5LA9A 1PM4A 2GH2A 2W1SA 5JOZA 2RG4A 1GZTA 4F83A 2RJLA 2WO1A 3EJKA 2TNFA 1E5RA 3GBWA 4YARA 2HWF1 2QBXA 3AKTA 4M4RA 4XCAA 4A7KA 4MGYE 1GP5A 1UD1A 2D6PA 3GALA 4X6QB 1C8M2 2FZ1A 4O65A 3IWZA 2HWB3 4B8EA 5E8AA 4BIFA 2RJKA 2WNVA 1G8WA 2WZPP 1DQ1A 1JYTA 2KM2A 2E32A 3U1XA 4NHKA 2Q8CA 1W8ZA 1H1AA 2WWJA 3JB8A 1ZZBA 5DXDA 4YYOA 5BY5A 3FC0A 3WHUA 3WSOA 4NIAA 2VL4A 3I7DA 1NA1C 4NMIA 3IDBB 2QDNA 4Q0SA 2P6CA 3ZDVA 3E6CC 3ZFFB 2XKPA 4Y1YA 5GZFA 4XAAA 4U36A 1GZ9A 1PK6B 3SKJE 1D0GA 4QDQA 3O1UA 3I49A 1LU2A 3TN93 2PHTA 3ZKUA 3I8TA 1YO8A 1G6NA 3TYJA 5BNQA 1U5ZA 2DVAA 2LS6A 2QZ2A 4AK3A 1S55A 1UPIA 5I91A 2CL2A 4CU9A 5ISLA 3R0RA 5H9SA 2ORXA 2C24A 2VOXA 4ZY9A 2Z69A 4UOJA 2F17A 1SFNA 1XPWA 3ZFGC 2IXHA 1AR83 4LR4A 1JH5A 1R081 1DLLA 4R9BA 2R043 4B4RA 4GULA 3POYA 2Z2SB 1QJY2 2V4VA 3AZVA 5KHKA 5ABJA 5JUVA 5LZ6A 2ZZQA 1H30A 3KCCA 2V09A 2XLFA 4Q4Y2 2IWGB 3ETQA 2VXRA 2WS93 4JHTA 4N7IA 4IERA 3SCGA 4EWAA 2DTWA 3E97A 4HSJA 4MGSA 1C28A 2RMU1 3HQRA 3LA7A 5LA2A 5CEHA 4HN1A 1V0AA 4GD4A 2D43A 5CYYA 1N1YA 3K3OA 2GDFA 1W9TA 2BEOA 1ZVFA 2JDYA 3B5LB 5A3TA 1WD3A 5FZ7A 1SFYA 3FFZA 2UY9A 1P8JA 2BQPA 2V5DA 4LO7A 4I0AA 4XJ8A 3THCA 1XBFA 5B4XA 4C1XA 3AP4A 2B9UA 2R49A 4TLFA 1AYN1 2QQLA 1C8M3 1UIJA 3Q9OA 4XDOA 4BQ4A 4OHYA 2A71A 4LUMA 2WO3A 3MUY1 1BJQA 4RD7A 3N9OA 3NWKA 3BUCA 2GC1A 3WW2A 4LKEA 4DQAA 3AMQA 4QPIC 4QX8A 4UI9L 2VTXA 1ULOA 4BDVB 1A3KA 2LRPA 3MEPA 2A7AA 1YJKA 3ORJA 4COZA 5FP8A 5J36A 4Y5SA 1T6BX 1QY4A 4BZ4A 3ZYGA 3KSCA 3Q8EA 3ECQA 1RUH1 1WKYA 5EJ1B 4HVOA 1I6XA 5CB7A 5D8AC 1QJU2 2YROA 3OCPA 4CU6A 3LE0A 3BIWE 5IFPA 3JD73 4N90A 3TRSB 1OVPA 1IG3A 4AAPA 3AK0A 3P6BA 4AFBA 4C0BA 4DB5A 3TWIA 3PUSA 1A6CA 2ZEYA 5IWFA 2B39A 1KEXA 2EF6A 1UNBA 5FYHA 4RS5A 2VXJA 5KXBA 1SHWB 3DKWA 4OZOA 5DPNA 4CCOA 1GLHA 2FBEA 1XYPA 2VE1A 3CLPA 2VQ0A 2WR9A 1NCQB 1J1LA 1HXS2 3EXUA 3T3YA 4LA3A 1AR82 5LEKA 1ND2C 1HW5A 2EXHA 2GMEA 3ME2A 4CCJA 4ET7A 3VZNA 3AMHA 4GB32 1CAUB 4Q29A 4HN0A 5E16A 1SCRA 3WEZA 1ZBE3 5CKMA 3ZIXA 2R7EB 1W06A 1PZ9A 3TN91 4C1WA 1PK6C 1IQAA 1SLAA 2WS92 2WBKA 5KXEA 4GKYA 1OQEA 1OD3A 2BNNA 1HB4A 3HWJA 3DEMA 1CAVB 4N43B 4SLIA 2A6YA 2RS12 1C5IA 3MLLA 4JDOA 2Y6FA 3PTYA 3JQWA 3R4UA 5JZGB 1BEV1 1NOVA 2OIIA 1WGPA 1Z7S3 1Y9MA 1T6GC 2C6SA 3GZTB 4LBKA 3TNQA 1HJGA 1J84A 1O5UA 3BALA 4LLFA 4PIZA 5KHGA 3FBYA 1LJ7A 5DUUA 4CYDA 2GALA 1V6JA 3NRUA 4LO8A 4CP0A 2DBIA 1OQDA 2JD9A 4V2WA 2Q8DA 2A5ZA 1YQ2A 4HVRA 2Q8EA 3KVBA 1IKQA 3X29B 2FMYA 1LTEA 4CDXA 1AR62 5EJ3A 4N53B 2J7MA 1LHWA 2X10A 3D5OA 2OPWA 1VBB3 3AMNA 5IVVA 2JDPA 2VZUA 3PVBB 3LOIA 4JDMA 4DUXA 3KB5A 2DF7A 1TEIA 3EBRA 3ZIWA 1PGL1 5DG1A 2TUNA 2W94A 1ENRA 1FNYA 1YNAA 4FO9A 4QPGB 2G9FA 4CU7A 5JXHA 3IDEA 4QXHA 1PIV1 1JHJA 1MQTC 4LA2A 5FY7A 4XUOA 4AI2A 1BVVA 2L9LA 4OUEA 4OZXA 4XILA 3WLUA 1WLCA 3WF0A 4DEVA 1VMHA 4ZZ8A 4FVVA 3W5NA 2WZR2 3DN7A 3VV1A 3J7LA 5JSPA 2J1EA 4QXCA 4AYUA 3LDRA 3H8XA 1DCSA 4YNIA 4NRPA 3U14A 3VGIA 3UKNA 1KRIA 2RMU2 2RV9A 1OC1A 5BNNB 1YUDA 5FDBA 2DVBA 3H3UA 5JMCA 4XIKA 4Y20B 4RGKA 1SLTA 4AVAA 2OZ6A 1W2NA 1BEV3 1DGWX 2ETEA 3OYWB 4FCAA 4QPIA 3WT3A 2FDFA 4GXLA 3DPRA 2BYVE 4B7EA 1EV12 3UGHA 1XNKA 3B00A 5D8AB 2YDEA 3CMGA 5CBLA 2WQ8A 3CJIB 5FTTC 4AAXA 5IVEA 3M7AA 1I3HA 3IB3A 4FPYA 3W21A 4RGAA 4DPNA 2C5DA 3AYAA 5FY5A 2DTYA 2RS31 1GOGA 1IOAA 2WNUA 4OUSA 5A6ZA 2PHXA 2BGPA 1D4M1 2QQKA 3PVNA 4NAOA 1KXGA 1CVNA 3T4VA 3H8OA 1H2KA 3H1MA 1HXS3 4PI2A 1VBA1 4NHMA 3P3PA 4MGZE 3U75A 1O8SA 4COVA 1U0AA 4W6XA 2IXKA 1QGLA 3KWVA 3WP6A 2FCUA 3MUZ1 1LOEA 1SEFA 2D3SA 1HV1A 4HOOA 5JCTA 1W8NA 1B35B 2JE8A 2W2IA 4PDWB 4Y1XA 1WA4A 2XJRA 3IIIA 3FMGA 4DY5A 3RG0A 3ZYJB 1AX2A 1B35C 1DZQA 2IFRA 3H7YA 4LO6B 5K0UA 5DMYA 1H8VA 3UV9A 2VVEA 4JCKA 1UY1A 3HN3A 4ARYA 4QX3A 5LBFA 2IXIA 4NHYA 1LKNA 4PBOA 4BYYA 3DYMA 1RMU1 1W2UA 1Q3EA 2VVFA 4JVAA 3IN9A 2VUJA 1XSQA 2R6QA 4AEJA 3NNLA 3ZSJA 4IEQA 3I97A 3J7HA 1W2TA 4R9CA 3KVAA 4QPWA 5FIXA 2ARXA 1JTZX 3VBSB 3M3QA 4LKFA 4EZHA 1W8OA 1NQJA 5FOJB 4JKLA 2ENRA 2P1BA 2VTXJ 4B1LA 1US2A 1ZBE1 2XMLA 3BTAA 4MGTA 1BEV2 2VZRA 2EA7A 4DXTA 5T54A 1VP6A 3FLPA 1GFF2 3ZN6B 2VMCA 1LOFC 2RDNA 4OI2A 3AC0A 1Y43B 2ZX2A 3FLTA 5FP9A 4LT5A 2H0BA 2ZGQA 1US3A 2MNGA 3NKTA 1VJ2A 5DG2A 5JOXA 2WINB 3NNFA 3I3MA 1KDKA 1AR93 3S7IA 1SFPA 2JXAA 2AH2A 4FAGA 3QLQA 4YZ3A 1GICA 1QXRA 1UN1A 1PMHX 3RZGA 2XB6C 1AR72 3P3NA 4GB33 4CZSA 1BK1A 4EJRA 1PGL2 3LEMA 3I2JA 5SV5A 5BYNA 5FWJA 5CAZA 5GZDA 4B4PA 4IETA 5FO8B 3E1F1 2PN5A 3QACA 4W6YA 4QT6A 4OYUA 4P9IA 5HI0A 1GV9A 1RUG2 2Y6KA 4N43C 4MG2A 2RS13 2OT7A 4OMCA 4QX1A 3ABZA 3LKJA 1CAXB 3RMXA 4EE2A 2WNEA 4NWVA 2WNVC 2A6ZA 1B09A 5EQUA 4XUTA 1UKGA 3HBKA 2BGOA 3LDBA 3POSA 4L2NA 4L99A 3ZYBA 4AI3A 5IFTA 2IXJA 1RYYA 4KU7A 1UF2C 4XDQA 4D3WA 2VMIA 1O4TA 4FPHA 3AP5A 3AP6A 3O0WA 1C3HA 2PHUA 2VG9A 3BODA 4K20A 3RWNA 2WYFA 2YUEA 4XF1A 3OGGA 4LOSA 2BWCA 1ZRCA 4ORFA 2Y6HA 2P3IA 1AR63 2J1TA 1NCRC 2V4AA 4KBZA 1RUC2 3D82A 4MXWB 3DPRC 1DQ5A 4Q1RA 5IUQA 1OOPB 4Q0UA 3DCQA 3VHRA 1O5LA 2R0FA 2YGMA 3O7OA 1JODA 1RUJ2 3RI8A 1W8UA 4GMP1 4A3ZA 3FHAA 4R4XA 5FMCA 4CCMA 1APNA 1S0FA 4BWOA 3OUHA 2ATFA 4LOTA 4RR3A 2X5IA 3NAPA 4P02B 2QQPA 4XXPA 4Y22B 2ZKNA 4FFIA 2HWF3 2SLIA 2FDIA 1UAIA 2GH8A 5F2WA 5F9TA 3WNOA 1OH3A 2VQTA 2XJSA 3AXEA 2WT1A 1TG7A 4P08A 3PIJA 3WCRA 3WHTA 4J6GA 4XBNA 2UYAA 5C4WA 4CEWA 1PM7A 4P5HA 2VAUA 3MIHA 1VBD2 5G04L 2CTVA 2ZX1A 3OPWA 4Q4V1 3U07A 4BPZA 4D6QA 3LWCA 2K9ZA 3LQCA 4LLOA 4OQ9A 5LY1A 2JDAA 4IDZA 2VQAA 1XE8A 2ZS6B 4AFCA 1CIWA 1UZYA 3VBOA 3WG1A 3RVHA 1SLLA 1U12A 5C71A 3JB4C 1HRI2 4AI0A 1XNDA 3M4FA 4XABA 3VBHC 2VW1A 1RB8G 1MZ6A 5A7QA 2BV4A 2J22A 3HEIA 1QOSA 1VAVA 4WM8C 1WMEA 4QB2A 2UYBA 1WW5A 3LD8A 3OEAA 3D8CA 4JGZC 5ACA3 4YW1A 4LEJA 3WF2A 2E31A 2D5FA 5CKNA 3KGZA 1DP0A 1B35A 1V6LA 3CU7A 5CFDA 3WQBA 2VOWA 1IS3A 5K4LA 1SACA 3OBTA 4UFHA 2DYCA 1GUIA 3ZPOA 1CPNA 1YQ6A 5EHDA 3IMMA 2WN2A 3MO4A 3VHNA 4M3CF 2ZHMA 3ZM8A 1S2BA 4YG3A 3THDA 1MEC1 4UBHA 2PAMA 2BVBA 2VMHA 3EB7A 4LO5B 4NHLA 4A45A 4GA9A 1UXZA 2A3WA 1F4AA 2GNBA 5HCBA 3ZYFA 3SH5A 3ES4A 1VRBA 3VDBA 3VLBB 4Q2FA 4COWA 3FE5A 4S2GA 1X82A 4LBOA 4QMAA 3ACHA 4JTOA 1VRH1 5HCAA 4TZDA 1VMJA 2VQUA 1O7FA 3AKSA 1OT5A 4CDWA 2C9KA 5JSOA 1UCXA 4DS0A 1HRV2 1MS3A 1JW6A 5KHIA 1NA1B 4FFFA 1XNTA 3D3AA 3LFIA 4XZUG 4CUGA 3GBGA 4XQWA 2XLAA 2NZ9A 3NNJA 3UESA 3VD5A 1ULDA 2HJIA 3AP7A 4K1ZA 1AJKA 1EPZA 2VULA 3NJVA 5FYIA 3SCHA 3AXDA 3IPVA 5DDJ3 2ZGMA 4UAPA 4M3CB 4Q8LA 2VZVA 2RJ2A 4QKFA 1TVGA 2VR4A 3MIFA 3HJRA 5EPAA 1S2EA 1RUNA 1NCQA 5FBZA 4XMIA 1IGOA 1UX6A 2KR2A 4FAHA 5FAXA 3VBHB 1SLBA 4EQVA 2O8QA 1R082 2BFUS 1CAXA 2EAKA 2UURA 3FJSA 1E5IA 2VPVA 3K2OA 3LFMA 5HXVA 5A6QA 1BKZA 3FUQA 3M3IA 5T5LA 4D7YA 1JOPA 3NO8A 3PMSA 1W6OA 5IYYA 1LOFA 4K1YA 4R52A 1VAMA 4S2FA 2Y26A 1L7QA 3CDZB 3OUIA 4IEUA 1AJOA 3T0BA 3DKQA 1NLQA 4PDWA 4YM0A 3ZFFA 4KL1A 2CNAA 3V0AB 1H8TB 1PK6A 5DAXA 2PHFA 3RS6A 1RUJ1 1QXJA 1WCDJ 3IMNA 1OBNA 4IE0A 5ERLA 5DUWA 4PQQA 4AEMA 4E27A 1ND3B 1S0IA 4UF0A 5C9AB 3D4KA 2JE9A 4UW6A 4Q4Y3 4IV3B 1W99A 2CDOA 4AEDA 2WUHA 1UZWA 1OF4A 4M4PA 5ANNA 1V6MA 2BERA 1AL21 1QJX1 3LSEA 3WP3A 2VCMA 4QM8A 1BZWA 1JYCA 1G9DA 4B29A 2J1RA 1CZVA 4D6RA 4JGYB 5GALA 2VZ1A 1NLRA 1OA2A 1PGW1 4Q4X3 1S0DA 3LAGA 4YFWA 1FPN3 1UU4A 1AYN3 1W6PA 1ONAA 3T2QA 1RHI2 3ZN4A 2VUCA 2DVDA 3DPRB 5LA0A 1COV3 3W58A 1YEWA 1A34A 4W65A 3WW4A 2BDRA 5T50A 5J09A 1AF9A 2C9AA 2CAUA 3CJIA 3T4HB 1L3JA 4NPMA 3KT4A 1OPMA 2YXSA 3PHMA 1I1EA 1JZ5A 4XHBA 4B1MA 5HPOA 4BJ0A 2RR13 1D4VB 2GN3A 4ZS3A 1RUI1 2XDVA 1RL3A 4BU2A 2BWAA 2VNVA 4DNYA 1W8FA 3EO6A 4ISQA 4M0HA 5FKBA 3PU8A 1QJU3 5KR7A 4DRRA 2BJSA 1JYVA 4IE6A 4UBGA 2VECA 2R041 2XJUA 1KJLA 3KCXA 4RN5A 5IAVA 1R083 5H9PA 4UFJA 1HXS1 3WOGA 4NR1A
chains in the Genus database with same CATH topology
1LOBA 1AR81 4BMBA 2ZMNA 4KBBA 3R05A 3ZSMA 1IS6A 1VLNA 1DU3D 2XH6A 2OYZA 1ZREA 3VKLA 1BMV2 2RS33 2VUAA 1GZCA 1KD7A 3PMEA 5J96B 2R1DA 3V56A 4H14A 4DOUA 5I8YA 4OI4A 5KWRA 3ZVXA 3PNAA 5C8WA 3WVJA 3D0SA 4O9EA 3J9SA 4WZCA 2PAKA 2EXKA 4OHXA 1M4WA 1AR92 2VH9A 2D3PA 3ZPYA 3RYKA 3DUIA 1G9AA 1HIXA 2WKKA 3OY8B 1C1LA 2EXIA 4AFMA 1AL0G 4OUMA 2GSYA 1YRZA 4PF5A 5AVAA 4LBQD 4LBJA 2ZHLA 1DZTA 1U5XA 5JOYA 1UZZA 2PQQA 1S0CA 1RUD2 1XYOA 3WQ7A 1FPN1 1PO22 1ND2A 4I3GA 1R083 1PGSA 2QDRA 4Y20A 1KS5A 3ZFEB 1GSLA 4E9KA 3GBFA 4D94A 1DDLA 2X8KA 2XJPA 4ZU5A 2AENA 4Z92B 1AYM3 3D0JA 4YW4A 3APBA 4PDWC 1CESA 4YVWB 4JGYC 3WUDA 4LBMA 4LULA 2I2SA 2G4IA 1NLSA 1OPOA 1SBDA 4FPFA 4MGIE 2DVFA 3AYCA 1DBNA 3EHKA 1LB2A 1UPSA 2XJQA 4BHPA 3QOPA 1NY72 5JDBA 4BA6A 3LGRA 3ZFEA 3VBHA 2ZGOA 1AX1A 2PA7A 2ZTNA 5BNOC 4MSVA 3VBSC 1J3PA 2ZGUA 4BH9A 3RYPA 2V5YA 4Y1VA 2R072 4AVCA 1PGW2 1D2SA 3M3CA 1VBD3 4LE4A 4IV1A 2WFF3 5AFEA 1N1TA 4CDWC 4FTSA 3ZXJA 4HL0A 2PFWA 5KHJA 2DCZA 1QJY1 3E5XA 5L7OC 2UWAA 2GAUA 4FQZA 4JDNA 1QQP2 2RE9A 2C0ZA 3J8F1 5KXCA 1FV2A 3IM0A 3ZXLA 1WW7A 5BXXA 2KA3A 2BPA2 1IS4A 4TWTA 3M3OA 5JI7A 4IV3C 1XNCA 3UJOA 3ZXGA 2UWBA 2PHDA 3INAA 1W0PA 3CJIC 4CEYA 1VB4A 2ZMLA 4KNCA 4GKXA 4I0WB 4OI0A 1J1TA 1W0OA 4H55A 3RMYA 5J98B 4L92A 3WCSA 1F2NA 3SLIA 2G9GA 1AYN2 3POWA 2D6LX 1AYM2 1J59A 4C91A 3WUCA 5J37A 1EAH3 1PO13 1WCSA 1TME2 3SXWA 5JR7B 5J48A 2WQ4A 2Q1MA 5K0UB 1PVC2 3GYDA 3VN4A 4W6WA 3ZYIB 5I8TA 2QJVA 2ZZJA 3I59B 2Y38A 1D4M3 2TEPA 2YZ4A 3ZXEA 2R30A 1S0BA 3FUOA 3ZFEC 2A3XA 2WT2A 2YPJA 1ASJ3 1FI2A 3OTFA 5CVRA 2E53A 3ZSEA 3G7DA 1ZYBA 4JQRA 4L97A 3MFCA 1W6NA 2OVUA 1VALA 4PLNA 5A33A 4A2UA 2FQPA 3H1WA 2ZHKA 4KGGA 4DY3A 2GNTA 1NE4A 3MICA 4YM1A 1AVBA 4XTPA 1V6OA 5BNPA 4AVBA 2MHFA 3OJBA 1MQTB 3SCFA 2BFUL 3VDDB 4YW5A 3GHNA 5T52A 1ULFA 1IZ3A 1WCKA 2JE7A 4LNVA 4ISRA 1QQP3 4HPKB 2LM3A 4LHKA 1WW6A 2QFEA 3SITA 4E4ZA 2ZX4A 1GZWB 4YZ1A 2DUPA 3OBRA 4XF9A 3VKFC 1Q8SA 2WFF2 5I8SA 5AFBA 4WM8B 4MV2A 3VBUA 3L2YA 3JQXA 5T5PA 1J3QA 3KT7A 1TNFA 2DFCA 1KDMA 4AFAA 1MZEA 2R063 2IXLA 1NY71 2JECA 4XJZA 4JGZB 1R1A1 1CN1A 1BBT1 1POV1 3A4UA 2VOKA 3H3ZA 3CO2A 4TYSA 1AR61 3RYRA 1LENA 4PJYA 1O4ZA 3U11A 2N7GA 3B02A 5GZGA 4IEPA 5E1RA 1RUC3 1V6KA 1CQ9A 1PVC3 4OHWA 1SMVA 5JPMB 1X33A 5FCCA 1X50A 1NE6A 1NA1A 3B69A 4FPEA 1BCXA 2D93A 4ZKTB 3E6BA 2NQYA 2OA2A 1RUF3 1W6MA 2V73A 2WNUC 1KJRA 1ZBA3 1PO12 2BUKA 1DYPA 4OHZA 4FPOB 1LGBA 4GH4A 2ZABA 4YM2A 5L73A 4RSUA 1FT9A 1Z7S1 5I0SA 4IV1B 3S0MA 1RUJ3 3N7MA 2X5IB 3NAPB 3VDDC 4HK8A 4X8PA 2FZ2A 3O5SA 3B01A 4JRLA 1ASJ1 4QQPA 2HEYF 4BMEA 5CFCB 3JD72 3ALQA 1HDKA 1IPKA 1RVF2 3KZ4C 3ACLA 1TME1 4Y26A 2RS32 2WC2A 1V9U2 2CWSA 3HR9A 2HEWF 4F3JA 3JUUA 3RJRA 4YGCA 3ATGA 1VBA2 1GZWA 1ZA4A 4G9SB 4WM8A 4L9BA 4K6BA 4RHV3 4DINB 4MVTA 1Y3TA 5CNAA 2CY6A 3WNXA 4Q4X1 3IKWA 4RL7A 2F4PA 2D6MA 2IFWA 1N1VA 5CFCA 2QKDA 3VBOC 2A75A 2HKXA 2JICA 1ND3C 2AUYA 3S30A 3B9IA 3KMHA 1S0EA 2ZX3A 1AL23 1QJX3 2VGDA 5FLHA 3THTA 1Y7BA 4IL7A 3ZFFC 1JYIA 5C8CA 2D6OX 3R6SA 3HT2A 1M06G 5BUVA 3GZAA 1R092 2SBAA 1UMZA 4QHBA 1LR5A 4HKLA 5JZGC 4KG8A 1IKPA 1BXHA 2XVLA 2Q4SA 2JEMA 2PTMA 2XWJB 1LODA 1DZRA 1JBCA 4Q0VA 1H2LA 1NZCA 2MEV1 2XBO1 1LOAA 2WFF1 5JIAA 2HWF2 1QKQA 2E7QA 4KGQA 3ZYRA 5FQ0B 4AEDB 1J3RA 1H8TA 1C4RA 4XBQA 3DGTA 4MXWA 3AKRA 4L11A 2F6BA 1Z0HA 4KH9A 3WDUA 5CG8A 4CEWC 5I93A 4KQ7A 2HYKA 1NYWA 3AYDA 4M00A 1WUVA 4F8AA 1CJDA 1OD5A 4XFFA 1PNGA 1H9WA 4I01A 2W52A 4DRVA 4RR3C 1DGRN 2HWD1 4I02A 4XIOA 1WMDA 3T1LA 1ULEA 3CJXA 5DZEA 3MZHA 4CRQA 1QOTA 1VBC2 4CDQA 4Q4V3 4UW4A 1WD4A 4QQ2A 4Y24A 2IZWA 1HKDA 4RHV2 2FHRA 2ZACA 1OQ1A 4XFGA 2HWB1 4URTA 2AZ5A 3V65A 1X7NA 3E6DA 4Z2WA 1V9U3 2EIGA 2ZPXA 3MI8A 2VVDA 4OLLA 3VBFC 4B4QA 5L36A 3WG4A 2Z79A 2D44A 4WVVA 4XYXA 1LHOA 3HBZA 2XVKA 4WV8A 1QJZA 1RUC1 5F6LB 1R093 1Q5OA 3VHPA 2NM1A 4WVMB 4XJWA 3DV8A 1ZRFA 2ZGTA 5KHHA 2W68A 1JUIA 2YC0A 4IEOA 3R4SA 2UWCA 4XETA 4CEYC 4XFHA 3LOBA 5A3MA 1ULGA 1KFXL 3H7JA 1OFNA 1ZZ7A 4QPYA 5C9AA 2NP0A 4IV3A 1V9U1 5H9QA 1OOPA 5IK8A 3LB9A 4EROA 2BNMA 4P9JA 1E57A 5CG9A 1RUF2 4AWDA 3JZVA 3QD6A 4IEYA 3ENRA 1CX4A 2WL1A 2YYOA 5GZEA 1REEA 1BYHA 5CFDB 3ZDSA 1O3QA 3N35A 3MIEA 2PLV1 4AGVA 2ZBJA 2E51A 4MXVA 5FREA 1JHNA 1OOPC 5L19A 1QJU1 1N3PA 1AR91 1OKQA 2XJTA 2HWC2 4XJAA 4G3YC 3VDDA 1VBC3 4XOGA 3JCIA 4BIOA 2UU8A 4N53A 4N9IA 3I4IA 4AQ2A 4WVWA 4HFSA 3VBRB 2NMOA 3NKGA 4EN8B 2MPFA 2R1BA 4Q26A 3JBG3 5EYYA 1ULCA 3ES1A 4QPGC 3HIFA 2LUWA 4PLOA 3URFA 1O3TA 4YFZA 3SH3A 3VBRA 1CAVA 2IXCA 4N43A 3WR0A 5LRSA 5C8CB 4FQ4A 1YIFA 1RUOA 3KM5A 4WM7B 4FT8A 1MEC2 3TN92 2BVVA 2GZWA 2ZJCA 3RNSA 4WM7C 2ZAAA 4Q0PA 5BNNC 1DHKB 2DFBA 1VBE1 2CGNA 2RS11 3I59A 1YWKA 4AVSA 3MW2A 3WDWA 2A6VA 3OF1A 1MZFA 3KT1A 4Q4Y1 4FPLA 2DUQA 4LBNA 4Z07A 1FMD2 4YVWC 1S2KA 2HWD2 1OLRA 1AX0A 1HV0A 5FO7B 5FMOS 1SQ4A 3MIGA 4HBNA 3WX5A 4LHLA 5B2GB 4LE3A 3AM2A 5K9YA 1Z78A 2YMZA 2RS53 2OZJA 2R32A 1LHUA 4AEDC 5IK7A 1GNHA 2JD4A 4AI1A 3IIAA 2ZGNA 4XJUA 1A8DA 4H7MA 1FV3A 2ZX0A 4CEWB 4HVQA 1YHFA 4ITCA 2DUOA 5JOWA 3PVOA 4M3CE 2Q30A 5HCFA 4AXOA 1QXPA 1AXYA 4H7LA 4I0BA 4Q8KA 3GF6A 4EN9B 1W6MB 1UL9A 4RR3B 4YGDA 3E5UA 4Y22A 1HQLA 1HRV3 1RVF3 1UU6A 5LK7B 2VMGA 4IEXA 1N3OA 4AI8A 1QU0A 2RM23 3NL1A 1WW4A 3WDYA 1CAWA 3TAYA 5H9RA 4J1XA 2YHJA 2HWC3 1RUF1 4CDUC 1TE1B 1HLCA 1GYKA 4AHYA 4YLZA 5J3UA 1MS0A 1AYM1 1CJPA 4XHXA 3FBMA 2XG3A 3UKVA 1WLTA 3D6EA 1W39A 1AR73 2VU9A 1PVC1 4FP3A 3HQXA 3FLRA 4K3UA 1QWRA 1H4GA 4V1PA 1EY2A 1MR5A 4YVWA 2Q0AA 3AX4A 4CEYB 2O0OA 1POV3 1BBT3 1LESA 2HWC1 4BLIA 4PBPA 2HWD3 3VZJA 4Q4W1 2Y0IA 3ZX7A 5ACA1 3L9JT 2D98A 5E89A 1RUI2 4U2AA 4LHNA 1YJLA 2RS52 4FBFA 4JRAA 3BB6A 2P3KA 1WBFA 2XWBB 4IEWA 3C3VA 4JTNA 5GLWA 4CDXB 2UY8A 3VBOB 3WW3A 4FTBA 1K5MB 1NG0A 1RITA 1RINA 3L2HA 1W6QA 4P9XA 1H9PA 4OVEA 5CFDC 2I07B 1CONA 4A7YA 5GLVA 1PZ7A 4AGRA 4DXZA 2CYFA 5JZGA 2WNUB 2WNVB 4Q4W3 4YW2A 2WSUA 2XGXA 4META 5FMOL 1VBB2 1YXWA 2AGSA 3FX3A 5DDJ2 2D5HA 2VNGA 1K5MA 4XFBA 1DF0A 5JPNB 2R16A 2YY1A 5FLJA 1FMD1 2RM22 3RQ0A 1EAH1 5GZCA 4Q1PA 4GMP3 5KC6A 1VR3A 1LCLA 4FPKA 4XF4A 1IS5A 2ES3A 2WWSA 1R1A2 3H8UA 2VNOA 3SHRA 5GLZA 5T55A 2WZR3 1UW8A 3FZ3A 4COYA 5C4WC 4JAAA 1QF3A 2DWRA 4WVZA 3VBUB 1EV11 2E7AA 1RUH3 1MS1A 2OPKA 5A3LA 1XXNA 1X36A 2XPJA 3I2DA 4RFT0 5GKAC 3K51A 4BQ1A 4CP2A 4IESA 4I2OA 3NSTA 5KC5A 2W08A 1EPWA 4QGMA 1QDCA 4S2HA 1IHMA 1V6IA 3BCWA 4XZPA 1QNYA 4PCRA 4CDQC 3N7KA 5AVPA 4Z8BA 1F8VA 1SBEA 1RUG3 3ILRA 4AGGA 3M2MA 3FHIB 4XQ4A 1Q8OA 2EAAA 4P9GA 4WBBA 2A6WA 4Z82A 3WDTA 1ZZ9A 1FX5A 5CIRA 3TB0A 2Q8OA 2XVGA 1W6NB 3AFGA 5A32B 1XRUA 3GHMA 1G9FA 2B5HA 4YGEA 1W6QB 4XMAA 1EYBA 2ZA9A 2NN8A 3CF6E 1N1SA 3ILNA 4Y1ZA 1LULA 3RSJA 1YIPA 3WP4A 5LEJA 4FTEA 1DGRA 4XQDA 4QPIB 2WIIB 1SBFA 1ZBA1 5KBFA 3BOPA 1F5JA 3KS7A 4XJ9A 1Q8PA 1XYNA 2DU0A 1LHVA 4AG4A 5HBAA 1TNRA 1DFQA 3NV3A 2DCKA 3C2UA 3ZN5A 1RUE2 3NV1A 5AC93 4AHWA 4FPCA 4NWWA 5D1IA 4TSVA 4J1WA 3H1YA 5EXOA 3UJQA 4Q4W2 4K40A 2K0GA 2DCYA 1PHMA 1XQNA 2ZHNA 2AYHA 1ZZ8A 1VAKA 4E4DX 1C8M1 1LGCA 3SH4A 3VBUC 4GMP0 3NV4A 2QVSB 4ES9A 5F1RA 1REFA 3LSDA 1FNZA 4E2SA 4ZU7A 1H4HA 2QCSB 5CFCC 2H6CA 5F6KA 1HRI3 1AZDA 2R062 1IPJA 3MPBA 1R091 2ZGLA 2ET7A 4AVTA 3J26N 3ZXAC 3AZZA 1AR71 2DCJA 1UKRA 3QH7A 1QH7A 4R9AA 3B3QE 2WT0A 4YW3A 1MEC3 2ARBA 3VBFB 3RRDA 1FAYA 3AYEA 1Y9QA 1VBB1 4MH0E 4SBVA 2IC1A 4MYEA 2C1FA 4GWMA 1MQTA 1UIKA 2ZGPA 2ZMKA 4DFSA 3WZ1A 3J4UH 1V00A 1A78A 4K8FA 1Q8VA 2RM21 1EAH2 4YZ2A 3VZMA 3ILFA 2H6BA 2JKBA 1K5MC 4BCUA 4CDXC 4MZUA 5IK4A 3RJ2X 1POV0 4BOWA 1LEDA 4BLJA 1V6NA 5GJ6A 5I0UA 3MLKA 3VZKA 2WQZC 3PVEA 4YZ5A 1DYKA 2GN7A 4XFAA 5JIUA 3IDCB 3N7LA 2P2KA 4XE9A 2RR11 3BPZA 1ENSA 1O91A 2PHLA 2H0VA 2I74A 2XLGA 5SV8A 2TBVA 4ATEA 4QQOA 1OHFA 3W59A 3SNMA 1F31A 4HKWA 4LTAA 2HWB2 3WQ0A 4YVSA 1LRHA 2NPIA 2NLRA 3TOJA 3E5QA 2B46X 4Q4V2 2GMPA 4AQSA 2GC0A 2BTVC 1AXKA 3JU9A 4S2DA 4N7UA 1I5ZA 3U4XA 5C4WB 1Q56A 1RUE3 4HK9A 4LBLA 3FWEA 1RUH2 1HRI1 4GH4C 1FOD3 1TMF1 1VBE3 2W39A 3H9AA 5L7OA 4MUVA 5LK5A 1GBGA 3N36A 1I9RA 3ZYPA 2GNDA 5FPZA 3OYWA 1MVEA 1X8EA 4FOYA 4HMZA 2JG8C 4P14A 1NQDA 1H2NA 2VW0A 5D8AA 1UU5A 3MF9A 1GNZA 4I3PA 4NPRA 4FPJA 4CDQB 3QH6A 4P9WA 1CAUA 1COV2 4CDUA 3VL9A 4EV0A 3VHOA 3JBG1 3OPZA 1ZZCA 5GLTA 1LHNA 2CGOA 2Y0OA 1LU1A 1ZZ6A 4Y1UA 3MW3A 4OFGA 4YSFA 3ST7A 4A3XA 1RUD3 2WJSA 1RHI1 1DGLA 1TME3 4ASMB 1GKBA 1Z7S2 2MEV3 2XBO3 1AXZA 1MS4A 3T1MA 5K0UC 4BM8A 2WS91 5JLVA 1QOOA 3AKPA 5FFOC 4HETA 4QX5A 4Q0QA 2CV6A 2K2SA 3LZZA 1OA3A 4RQPA 3AB0A 1KFUL 1MVQA 4OI1A 1PZ8A 2JENA 3QBQA 4QXKA 4Z1VA 3JD71 5EZWA 1KQRA 2VY0A 5CA6A 4JC1A 3RI9A 4INDA 4XBLA 2JJ6A 2E6VA 3OD0A 5AC92 3LA2A 5K7PA 3PJQA 4XFCA 4N9HA 2NMNA 1S1AA 3AMPA 3O0XA 4BE3A 3HD8B 4FXKB 3OY8A 4HZFA 3RPQA 5BNPB 1WBLA 4QQHA 3HN1A 4K7JA 1BMV1 3AZWA 3O12A 2GC2A 3KGLA 1Q43A 3W9AA 3V0BB 1EV13 4FOWA 1PVXA 3N4MA 2VNRA 1MACA 3VBSA 3CNAA 2DV9A 5C9AC 2YV8A 2D6NA 2GNMA 2ILMA 3ZXDA 2A6XA 1KITA 1WLDA 3MIBA 3NVCA 1CGPA 3HMYA 4RS5C 2W0XA 1OA4A 2Q1ZB 4IEVA 5ABJB 4FXGB 1FOD2 1MS9A 1SLCA 5FO9B 3S6PA 3V0AA 1FMD3 2JDZA 3IT8A 2BNOA 4QGLA 5JI9A 3UK9A 4QPGA 1AL22 1LOCA 1QJX2 3VZOA 4DMIA 1N47A 1PO21 1FPN2 2PHWA 4QM9A 2MEV2 2XBO2 1JOJA 1H1MA 4PIXA 1PO23 1MS5A 4EN7B 3M8LA 3R4DB 3UKTA 2E7TA 3UL2A 1U5YA 4HT1T 3USSA 2Z42A 4YM3A 3AMMA 4ZXKA 4P9YA 2NYYA 4MLOA 3NV2A 1O4YA 1TMF2 1J58A 3N7JA 1CAWB 1X8MA 5EYXA 4D7TA 3BU7A 3WW1A 4AEKA 2A3YA 2WSVA 2WFPA 4IQPA 3ZFGA 4GWNA 3WD5A 3ZSKA 4JV4A 3VKOA 4YG6A 4WVMA 5DUXA 4D69A 1V70A 3PLQA 3GNEA 1H0BA 4XF0A 3ASIA 5BPXA 4IV1C 4QD2A 4AW7A 1WLWA 2OUHA 1COV1 2A70A 5T3NA 1LGNA 1YYNA 4EWDA 3KCYA 3MGUA 4YGBA 3OD4A 5E88A 4B3NA 1HQNA 3S7EA 3PJYA 4YG0A 5BV6A 2PAEA 2QUOA 3THPA 4P9LA 1ZNPA 5FLIA 4NO4A 2R073 4Y4YA 1HX6A 2GC3A 3AFKA 4CTEA 3SMHA 1JN2P 1QQP1 3J8F2 3USUA 1XU2A 1YFXA 5JVVA 1FXZA 4RS5B 1ZBE2 5ACA2 1ENQA 2ZGKA 1RJ7A 4IEZA 4AE2A 4AF9A 4QGNA 4KG0A 4EN6B 1NCRB 2CAVA 5GM0A 3B9CA 3HAGA 5AC91 1S0GA 3AJZA 2KXLA 5K8SA 3N3HA 5J7MA 4E4SA 1C5HA 5I0RA 1G86A 1XE7A 4XEZA 5IK5A 2Q5TA 2Z5WA 1BVP1 4HPKA 4PIYA 1RUD1 1OI6A 1G7YA 2OW4A 4R9DA 2FMDA 3MPPG 2E63A 2EALA 1U5IA 3ELNA 2PHRA 1YFWA 4HLTA 3WINE 1QH6A 2PYTA 1PMIA 2P37A 4GB31 4EWEA 4I09A 3WG3A 2PLV2 4XFIA 1SDWA 1C1FA 1RUG1 1H1IA 3IBMA 3ZN6A 1FATA 2JG9C 4FP2A 1D0HA 2WA4A 1WMFA 4XTMA 2AR6A 4R4ZA 3BOWA 3FFQA 4AQ6A 4GQ7A 1FYUA 2HWE3 1REDA 2XKOA 5A33B