3WW2A

X-ray structures of cellulomonas parahominis l-ribose isomerase with l-psicose
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
248
structure length
241
Chain Sequence
TRTAISRREYDEWLSEAASLARALRYPVTPEMVNDSAGIVFGDDQYEAFAHGLWSREPYEVMVILESLNEPAVDGLPAAGAAHAEYSGLCDKLMIVHPGKFCPPHFHQRKTESYEVVLGEMEVFYAPEPVTVGDDDVLSFSPMPEGSPWPEGVALPAGREDSYAGLTSYVRLRAGDPKFVMHRKHLHAFRCPADSPVPLVVREVSTYSHEPAAPLPQWRGLHDNTFVAEAANSGRLATAIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords L-ribose isomerase
publication title Essentiality of tetramer formation of Cellulomonas parahominis L-ribose isomerase involved in novel L-ribose metabolic pathway.
pubmed doi rcsb
source organism Cellulomonas parahominis
total genus 60
structure length 241
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ww2A00
5J48A 4LUKA 4Q0SA 3H1YA 2PAEA 4P9GA 4XFIA 5BUVA 3PLQA 2PHLA 2QVSB 3FZ3A 3U0ZA 1NYWA 1OI6A 1JUHA 4JVAA 2BEOA 4XF3A 2UYBA 3KGLA 4JTNA 4XF4A 1NE4A 2BGCA 5BV6A 4QGNA 5E1RA 3CEWA 2MHFA 4LULA 2GC1A 3MPBA 3SCFA 4Q0VA 4BHPA 3E5UA 1O3TA 1CAUA 5KHGA 1ZVFA 5J7MA 3LWCA 1LB2A 1G6NA 3N4MA 1V70A 4LLOA 1ZRCA 3H3ZA 1LRHA 4KL1A 3BB6A 3SHRA 3H3UA 2CAUA 2XLFA 4KU7A 3OGJA 3ROUA 5C8WA 2WFPA 4O9GA 1QXJA 4YARA 1DGWA 3EBRA 5JAXA 1GQGA 3M3IA 1J3RA 4PIXA 5KBFA 5CU1A 4HLTA 3C3VA 2QNKA 4I3PA 4HVOA 1RL3A 4KWKA 3BPZA 5T3NA 5KHJA 3ZDSA 4XFAA 5FLIA 4IEZA 1NXMA 4MGZE 1HW5A 5LRSA 1YFXA 3RZZA 2HJIA 4H7LA 2F4PA 1WGPA 3FX3A 4FT8A 2VPVA 4QMAA 4HMZA 5BPXA 1CX4A 5FCCA 5FPXA 5HI0A 4EWEA 3FHIB 2ET7A 4LA3A 1O5UA 2BNOA 2UY9A 1QWRA 3M70A 1NE6A 2PTMA 3DL3A 2EA7A 5JCTA 5J3UA 5I8YA 2IC1A 1RC6A 3LA3A 4UXAA 1OFNA 1GQHA 4IEWA 1I5ZA 4HBNA 3H7YA 3OTFA 4KWLA 2D5HA 1J59A 5LRRA 4IEPA 1J1LA 1YFUA 5KHHA 4YYOA 1O3SA 1O5LA 5I0UA 2IXJA 3E5QA 2PQQA 1ZNPA 3L2HA 4HSLA 5AVPA 4QX5A 2Z2SB 1WLTA 3FJSA 5I8SA 5I93A 2XKPA 2PA7A 3PVBB 4QXKA 2FMYA 3H8UA 2Q30A 2DCTA 2B8MA 3H50A 3USSA 1UPIA 4IEQA 4QGLA 3MYXA 3H9AA 2MNGA 5I0TA 4MGYE 2FQPA 1CAVA 1TQ5A 2I45A 4OLLA 2MPFA 3SCHA 3MZHA 1CAWB 3BALA 4QGMA 3DN7A 1ZX5A 4PIYA 4X6RB 4ORFA 3NSTA 5I8TA 3E5XA 4LUMA 3OCPA 3CJXA 5JSPA 1CGPA 3TNQA 3HT2A 1YFYA 4EV0A 4XFGA 3DKWA 1VP6A 3GYDA 4META 2QJVA 1RTVA 2O1QA 4YRDA 4OFGA 3ACLA 1J58A 2K9ZA 1YWKA 1RGSA 2Q0AA 3IIAA 4WVZA 4AVCA 2HKXA 4HZFA 3HQXA 3FWEA 4L11A 2H6CA 5BY5A 1ZRDA 4X6QB 1OD5A 4JV4A 2Y0OA 4XF9A 4MGIE 5FQ0A 5JR7B 4DINB 2EVXA 3H1WA 4FBFA 4R8HA 1X82A 1VR3A 1H1IA 2B9UA 3RNSA 2OZ6A 1X8MA 5LEKA 4HN0A 3LZZA 1ZZCA 4AVAA 4I01A 1J3PA 2IXCA 2XLGA 1YLLA 2XGXA 5KHKA 2Z69A 4I09A 4Z07A 1RUOA 3SMHA 4AQ2A 4I2OA 2D40A 2PYTA 3E6DA 4IEVA 3FE5A 3UKTA 4E2GA 3E6BA 3MDPA 2GU9A 1O3QA 1IPKA 2OA2A 2PHDA 2KXLA 2N7GA 1J3QA 5F1RA 2D5FA 4NVPA 4RD7A 1OMIA 4LTAA 4IEUA 4HVRA 4AQ6A 1ZRRA 3LOIA 1UCXA 1ZZBA 1PM7A 4BYYA 1DGRA 4XFHA 3WW3A 5E16A 2ZKLA 4BIFA 1CAUB 5FDBA 2PAMA 1EP0A 4LA2A 1VJ2A 5K8SA 3SXWA 3PNAA 1CAXA 1ZZ8A 4XF0A 4WBBA 4UBGA 4WZCA 4KU8A 4A2UA 2UYAA 4F7ZA 1Q43A 1SQ4A 2XLAA 3U10A 4YNIA 3ES4A 4JTOA 4HN1A 4AXOA 3E6CC 4D7TA 3EO6A 1XRUA 4BH9A 3WW2A 4ZU5A 2GZWA 2XL9A 3BU7A 4QM9A 1Q5OA 1ZREA 1ZZ6A 3ETQA 3NVCA 1YUDA 3OD0A 5FLJA 3I59A 4XF1A 2GC0A 1LR5A 2Q4SA 3GBFA 3IBMA 5FLHA 3EJKA 3D0JA 1PMIA 1QXRA 5JSOA 4CYDA 4B29A 2BNMA 3FFQA 1UIKA 3S0MA 3D0SA 1ZRFA 3DV8A 4K8FA 1X8EA 4ONUA 5JSRA 5LEJA 1DZTA 1CAXB 4E2QA 4PJYA 4Z82A 3RPQA 3QOPA 3UKNA 4IESA 2C0ZA 3VHRA 1FI2A 4HVQA 4KWJA 2GC2A 4FAHA 4Q0QA 3LA7A 4GULA 5I0SA 5I0RA 1I6XA 3SCGA 3WW4A 4E2SA 2CAVA 1ZZ9A 2XHKA 3O14A 4IEOA 4HSJA 2ET1A 1Y9QA 1ZZ7A 2ATFA 3LA2A 3NL1A 3BCWA 2B5HA 1RUNA 2O8QA 1Q3EA 3S7EA 2Q1ZB 3I59B 4YSFA 2QDRA 2OZJA 2XL7A 1O3RA 2P17A 4XFFA 3CL1A 4ZU7A 4XEZA 1CAVB 4ZU4A 4I0BA 2IXHA 1UIJA 3NKTA 4J1WA 4Q29A 4UBHA 2EAAA 3R6SA 5D1IA 4XFCA 3I54A 4PIZA 3JZVA 4MGKE 5KHIA 1SEFA 3EHKA 2CV6A 3KCCA 3TNPB 1H1MA 3CF6E 1Y3TA 4XFBA 4I0AA 3KGZA 4Q0PA 1EYBA 2IXIA 3B02A 3H1MA 4N9HA 2WC2A 4IETA 1UD1A 5FPZA 3I7DA 4MUVA 5I91A 2H0VA 3IWZA 3RYRA 2D93A 3KSCA 3ES1A 1DZRA 2GC3A 1XE7A 1EPZA 4J1XA 1EY2A 3RYKA 3IDBB 4I02A 1SFNA 5FQ0B 4TLFA 4EWDA 1O7FA 4Q0UA 4EWAA 1YHFA 5EZWA 4EROA 4MX3A 1IPJA 2PFWA 1FT9A 5EFUA 3ST7A 3E97A 4AVBA 4N9IA 3G7DA 4MH0E 2CGPA 4MZUA 3D82A 3NW4A 1CAWA 3WW1A 2VQAA 3RDIA 2XKOA 4L2NA 3KMHA 3RYPA 2PAKA 3UKVA 2ETEA 4O9EA 3HIFA 3S7IA 1YFWA 4MV2A 2IXLA 2QCSB 1FXZA 2E9QA 4IERA 1L3JA 5CVRA 2K0GA 3QACA 2ZCWA 1U12A 4IEXA 3CLPA 2GH2A 2OPKA 3HT1A 5C6CA 4FAGA 1NZCA 3OF1A 1QY4A 2BYVE 4LEJA 2BNNA 3IDCB 4D7SA 2UY8A 4QM8A 5BXXA 4F8AA 3ELNA 2OYZA 3H7JA 1LKNA 2VECA 1O4TA 3LAGA 2V09A 3CO2A 2H6BA 4IEYA 4XETA 1XE8A 3EQEA 2GAUA 1UW8A 5CADA 3NJZA 3U11A 2IXKA 1WA4A 1X7NA 4R52A
chains in the Genus database with same CATH superfamily
5J48A 2Z42A 5KXBA 4GMP0 3PLQA 2PHLA 1DYOA 1JU4A 3FZ3A 2J7MA 3BIWE 1ZM1A 4RQPA 5FY7A 4L97A 3AL5A 3FMGA 3J8F2 1G9FA 1VBE2 5CYYA 3NMBA 1G9DA 1QJU3 4JVAA 5ACA3 4AFCA 2YBSA 1VAKA 4XF3A 4B4PA 1HRV3 2BWAA 2VC9A 1UX7A 4XF4A 2LRPA 2BGCA 5E1RA 4LJHA 3CEWA 3Q9OA 4BQ1A 4LULA 1EV13 3T4HB 2GC1A 2WT2A 3HAGA 4FTBA 1L7QA 3NNJA 2VULA 3TOJA 4GA9A 2DVDA 2BERA 5FBZA 3ZXDA 1EAH2 1H8TC 4I3GA 1RUJ3 3E5UA 3M8LA 5FR3A 2P2KA 1G6NA 4JQRA 2ZEYA 4LQRA 5LBBA 3HN1A 4LBKA 3KT1A 2DDUA 2ADEA 4XTPA 2NP0A 1N3OA 3SHRA 2E6VA 3H3UA 2XQXA 1QQP1 1PVC2 4LR4A 5F5IA 3ZFEC 2LALA 4Y1ZA 5M0TA 3OGJA 4V2VA 5C7GA 5CFCC 4CUBA 5F3EA 2WNVA 1TMF1 5C8CB 3KD4A 1TZOA 3O7OA 4QPIB 4YARA 1LOCA 1F8VA 1H4GA 4YG0A 5GZCA 1POV1 3VDDA 2W5FA 4Z2WA 5GLUA 1ZA4A 1JYWA 5KBFA 4JGYB 5CU1A 4CU6A 2A3YA 1HN0A 2VY0A 3WUDA 4RQPC 1D7PM 4D69A 5DMYA 2UU8A 2C1FA 3M2MA 3BPZA 4YW1A 5LZ6A 4IE4A 4NAOA 5GALA 3WP5A 4NOTA 5JI9A 1WKYA 2D6OX 3LSEA 1REEA 4MGZE 1HW5A 2B4KA 1YRZA 2HEWF 3KHBA 1PX4A 3POBA 1NAEA 1POV3 1YFXA 4P9LA 2JICA 2CL2A 1UYZA 4P9YA 3BTZA 5FYUA 4D8MA 1N3PA 2F17A 5BNNB 4H7LA 1WGPA 2J1VA 4UW6A 4AOCA 1W8NA 3ABZA 2GDFA 1HB3A 5DAQA 5BPXA 1CX4A 2ZX2A 1R1A3 2UWCA 3J7HA 4AFAA 1XNDA 4EWEA 1H4HA 2BVVA 2CY6A 3FHIB 3VD3A 2WAAA 1IGOA 2ZGQA 5A7WB 3HN3A 2RS53 1CD3G 1X9PA 5FY1A 4AHZA 1Z78A 2PHRA 3DL3A 2WNVC 1GWKA 4LMFA 2R0FA 3AYDA 3CHXA 4WM8B 1W6MB 5J3UA 4BE3A 1ZBE3 1DQ1A 1RC6A 2OVUA 4UXAA 1OFNA 4EZHA 1GQHA 4FPKA 1CZSA 2W9XA 1I5ZA 4FP2A 4FOVA 1DGRN 5DDJ2 3VDDC 4HBNA 4YW4A 3H7YA 3D6EA 3DXTA 3MIEA 4HK8A 4YGDA 2QQIA 2RDQA 5LRRA 5E88A 3UNPA 5A7PA 1ZBA3 3OGRA 1APNA 4YYOA 3UT0A 1OQEA 1DG6A 3AP4A 4NHYA 1O5LA 4Q4W3 3V0BB 1O3SA 5F3GA 3P1IA 3C7EA 3HR9A 3K75B 5T5OA 2D6MA 2PQQA 4B4RA 4PCRA 4QKBA 4AHXA 4BMBA 5HCHA 5F3IA 3ZDVA 2DTYA 5FYMA 4QX5A 1WLTA 5LASA 3VL9A 2XKPA 5FPLA 4Z1VA 1DBNA 2CDOA 5KXDA 2FMYA 2DCTA 4EQVA 1KJLA 3OBRA 4LPLA 3USSA 4DS0A 1SACA 5HCAA 1AYN2 1PGSA 3USUB 2WFF1 2HYKA 4N8MA 3EXUA 4CP0A 1Y7BA 2MNGA 2DBIA 5I0TA 4YVWA 4K21A 2I45A 1CAVA 3ZN6A 1LTEA 3SCHA 3MZHA 1QJX3 1SG3A 4NPMA 4RSUA 4ORFA 2WWUA 2WZR3 5SV5A 3WVJA 2P37A 3PIGA 3M3QA 3NO8A 2ZEXA 2YBKA 4UAPA 3CJXA 5JIAA 1Z7S2 5JSPA 1OKOA 5T5LA 1JS9A 2B45X 4JGZA 4FPCA 3W58A 2W68A 4R9AA 5DN2A 3DKWA 5A7NA 2WFF3 4META 4G9SB 4P14A 1F4HA 1RTVA 2VBPA 2XJRA 3LDRA 2O1QA 1BEV1 1FATA 2I07B 4XIKA 1QH6A 1H0BA 1YWKA 1AR63 1QGLA 2KA3A 2Q0AA 3GCXA 3IIAA 4IGPA 1SBDA 4WVZA 1C3HA 2V5YA 4LNVA 1W2NA 3NAPB 1HRV2 1BXHA 3ZPYA 2DVAA 3FWEA 4A7YA 4X6QB 2W52A 4DXRA 1SBFA 5IAXA 1RUC3 2GMMA 4JV4A 4AEJA 5KR7A 1UY3A 2Y0OA 1OOPA 1AVBA 2VGDA 4NE9A 4XBQA 1RUI1 2BWCA 2QE3A 5JZGB 4M4RA 4LIUA 2JG8A 5FQ0A 4LORA 1LCLA 4Y20B 5JR7B 3MF6A 2V73A 1UZWA 1RUJ2 3GZAA 4D7YA 2WO1A 1POV0 4R8HA 2CU5A 2JJ6A 4AHWA 1S4CA 4ASLA 3LSDA 4AEKA 5J37A 3JQXA 2B9UA 1D0GA 4YVWC 3RNSA 1MEC2 4IL7A 1X8MA 5E89A 2ZGLA 5LEKA 1YQ6A 4GB31 4CDXB 2GNBA 3H8OA 1J3PA 1YLLA 2XGXA 4N43A 3WNMA 4CU7A 4I09A 3W9AA 5A1LA 3SMHA 4AQ2A 3Q8BA 5B2GB 4Y24A 1JTZX 5FUNA 2PYTA 4JGZC 4CA9A 1JBCA 2VNGA 4RR3A 3GM8A 1WMFA 4MXVA 3UKTA 3LOBA 1D4VB 2W87A 1MS4A 3RZKA 4GD4A 3E6BA 4LXLA 2G4IA 2GU9A 2C6SA 5GLTA 1W06A 2PHDA 4ZXEA 3ZMOA 2WINB 1JZ6A 1LGCA 4YZ2A 4BPZA 1OKQA 1SZBA 2O0OA 4C0BA 4QHBA 3AYAA 3JBG1 5F1RA 3NQHA 4AFMA 4XUQA 3WF2A 2X05A 1S0DA 4NIDA 2P6HA 3LF7A 4RD7A 1UXXX 4ZPIA 1LHNA 3LPGA 4P9XA 3K46A 1OOPC 4A3XA 1Q8SA 2JE7A 1Q56A 3MLJA 1K5MB 2O8OA 2ZBJA 2JG8C 3LOIA 4MLOA 1PM7A 4AFDA 4LLFA 1DGRA 1W6OA 2Z5WA 2ZKLA 2WZPP 1N47A 4BIFA 1CAUB 3UJOA 2HWB1 1UU6A 1R1A2 1VJ2A 2WT1A 3JD73 5IVVA 5CKQA 3PNAA 2JE9A 3MO4A 4XF0A 4A2UA 4N43C 2UYAA 3FN9A 1UZZA 5FAXA 3MFAA 5FUPA 3TB0A 4QKFA 4F7ZA 1SQ4A 2RS13 2RJKA 1MZ6A 1N1VA 4A45A 3ZMNA 4LT5A 4JTOA 3I3DA 2P3JA 4XCAA 2ORZA 1H2NA 1S0GA 2QZ3A 2WZEA 4RR3C 4AXOA 3F95A 5FZCA 3U4XA 3E6CC 5JLVA 2HWB3 3AKPA 2FDHA 2GMEA 2JEMA 4Q8LA 5IWFA 2WDBA 3RGBA 4AK3A 2GZWA 2XL9A 1SHWB 1SPPB 2VCMA 1ZBA2 4QM9A 2ZX0A 1DZQA 3HD8B 3MUY1 1IG3A 1ZZ6A 3NVCA 5FP9A 3GF6A 1S55A 5K0UA 3MEPA 5FLJA 5GKAC 1I9RA 4W4ZA 1LR5A 3ECQA 5EJ1B 3I2IA 5F6LB 1YEWA 5FLHA 4DMIA 1CQ9A 5F5AA 1AL0G 1PMIA 1PIV3 1QXRA 1YNAA 2VOWA 3D0JA 3GJAA 3MLLA 1DDLA 3JB4C 1QU0A 4KGQA 3CJIB 1CVNA 2JDUA 4UFHA 4YZ1A 4C90A 4YW7A 5ABJA 3DV8A 5FZHA 3BVCA 1C1LA 1V9U1 4H14A 5FXWA 1JW6A 4FTSA 4XACA 1DZTA 1W8OA 1RHI2 3N9NA 3VL8A 4E2QA 2V5DA 2EF6A 3UKNA 1AX0A 3LDKA 2YC0A 4UFMA 3ZFFB 1FI2A 1UMHA 5KXCA 3HQRA 3KLSA 4FQ4A 4QAWA 4ET7A 1LAJA 3WNOA 2ZX1A 4CDQA 3AKSA 3JQWA 2FDGA 3AP9A 2BOJA 1MQTB 4YZ5A 1PK6A 1RUG2 3NJYA 1MS5A 1NA1A 1IQDC 1V9U3 1BBT1 2HWC1 2PQSA 3FLTA 3Q8AA 4C1WA 3I3MA 4OVEA 4XUNA 1NXD1 1ZZ9A 4NHKA 1JYVA 3VN4A 4D3WA 5K0UC 2BBAA 3VHNA 4HSJA 2ET1A 2PXJA 1Y9QA 2WNUB 1BK0A 5A3TA 1RUC2 1XU1A 5FYSA 1S2EA 1OC1A 1OUXA 4CCNA 3RI8A 2B5HA 2O8QA 3ZLIA 3LQCA 2V4AA 2BZDA 3S7EA 3POSA 4H2AA 4E4SA 3MIGA 4BB3A 3POYA 3R05A 2DUOA 2P17A 4LBQB 5FZOB 5CBLA 4BM8A 1DGLA 3CL1A 2FDJA 4XEZA 5A6QA 4QX3A 5IHRA 1XC6A 4GQ7A 1SLAA 1FYUA 5ABJC 2FBEA 2RVAA 2DCZA 1RB8G 5EYYA 2D6PA 2PLV3 4GWMA 2EIDA 2VBDA 3I8TA 3BTYA 5FFOC 3WDXA 4PIZA 2PHTA 3VBOA 2JXAA 5A70A 2L9LA 1SEFA 2CDPA 4UF0B 2EXIA 4QB6A 2VW0A 1MACA 1U5IA 1H1MA 4IE6A 3CF6E 5CIRA 1EUUA 1V6KA 2A6XA 3B9IA 4CDQC 4LOTA 3I2OA 4Q0PA 4XTMA 4B7EA 1NA1C 4CP1A 1NLSA 2WC2A 2R071 1UD1A 5FPZA 3I7DA 1UMZA 2NLRA 4R9BA 5FYIA 4LOSA 5T5JA 1H1AA 1XOYA 2H0VA 4XJ8A 3D3AA 2DCKA 3VV1A 1H6XA 1HXS1 4BXFA 4Y4YA 5C4WA 5J96B 1S0BA 1YCIA 2IFWA 2JX9A 4LK6A 1WD3A 4LKEA 4IE7A 5FTTC 5FZ1A 1N1YA 4J1XA 4OI2A 4D0QA 1HKDA 2TUNA 3IDBB 3OB8A 4MGQA 4MHRA 3WSOA 4TLFA 3DUIA 4NIHA 2XBO3 4Q0UA 2WA3A 4C0HA 1FOD1 2JE8A 1E57A 5T55A 1YHFA 1SCRA 4EWAA 1MS8A 4MX3A 5FBJA 2X09A 4BK5A 4RFT0 1GNYA 4MH0E 1WMEA 1W9WA 5JPNB 1EUTA 2A1XA 4QQLA 1HXS3 1W8HA 1AYM3 3KS7A 3VZJA 4HANA 3NW4A 2Y38A 2ZXQA 4N7UA 4AF9A 2VQAA 1O6UA 3DPRA 3PU3A 2ZMKA 1WD4A 2FHRA 4HXCA 5A1FA 3F2ZA 1VMJA 2RS12 4L2NA 2FD8A 3RYPA 4BIOA 3AP7A 2PAKA 1AHSA 4AI3A 4DOUA 3VBOC 5C70A 2WNOA 4Y22A 4YVSB 1IG0A 1XQNA 1G8WA 5IVEA 4XQDA 4SBVA 1DQ4A 1IHMA 1E5RA 4ZKTB 1XSRA 3VBHB 2QCSB 4WVVA 5IVJA 4XDOA 4JZRA 1AR83 1C57A 3AVRA 1AR91 2R062 1ND3A 3KCYA 3AZYA 1QH7A 1MZEA 1U12A 2XVGA 2FDFA 2Q1MA 3URFA 2D6LX 2I74A 2RM21 4BMEA 5C4WC 1RUH1 1VBB1 2GH2A 2OPKA 1LULA 3WNLA 5C6CA 2CWMA 2CGOA 3OF1A 5FZ6A 3BIEA 4OHVA 2BYVE 5LK5A 1GOGA 4LEJA 4P5YA 4Q4Y3 3T30A 5A32A 2R1DA 4KBBA 4JX0A 2Q8DA 4D7SA 1LODA 5BXXA 1PIV2 1JI6A 1RMU1 4Z2AA 2K46A 5HXMA 1LGNA 5JVVA 4DFSA 3WQ1A 2OYZA 1VMFA 4AVTA 1W2UA 2ZACA 3MIFA 3WZ1A 3LD8A 2VECA 3T4VA 2GH8A 3DPRC 3U78A 2V09A 1N1SA 5CKNA 2H6BA 5CFDB 1H30A 3A7QA 3LEMA 5FZFA 1UW8A 1R1ZA 2VMCA 4CCLA 4E8DA 2QQKA 5CADA 1F31A 3TN92 4CU9A 1RMU3 3NRUA 3IDEA 5BNQA 5JDBA 4Q0SA 5ERLA 3H1YA 4DPNA 4XFIA 4PDWA 3ZN4A 1V6LA 2VCBA 5BUVA 2QQVA 3T2TA 3ILRA 5IVBA 4LO8A 1S2KA 1W03A 2ZMLA 4TWTA 3POWA 2Z79A 4PBPA 2VE1A 3J8F1 1ND3C 4YZ3A 5LY2A 4AGGA 4CSWA 1H9WA 1NYWA 1A34A 1ONAA 3VD4A 4XAAA 4NWWA 4K20A 3WG2A 1QF3A 5FZ3A 1FV2A 3WP6A 4BA6A 2A73B 1R093 4JTNA 2WLPA 1NE4A 5FZGA 3B7MA 4NRQA 2WA4A 1Y43B 1GZWA 3P3PA 5BV6A 1LHUA 1S2BA 3GXUA 3I2JA 1JZ7A 2W2IA 1UZYA 3CKHA 3MPBA 1NLQA 3TYJA 1EAH1 2ARXA 2BV4A 1UU5A 1K5JA 2IWGB 3I2FA 1NOVA 4LO6B 4CP9A 3AXDA 3C7FA 1UYXA 5C9AA 1MZ5A 5KHGA 4LBOA 2RMU2 4NUBA 1LB2A 1WLDA 2QBXA 1FV3A 1V70A 1X36A 4O7XA 3A21A 2Y6GA 1H8TB 1HQWA 1LRHA 1PVC1 4RS5B 5A7OA 3BB6A 1QDCA 1RUD1 1VRH2 2XMLA 5AFBA 1KFUL 2XLFA 1XPWA 4QT6A 1X9TA 1JU3A 5GZEA 3WOGA 4AYUA 1ODNA 5C8WA 2OT7A 4IE5A 2VMIA 5FWEA 1LOFA 1QXJA 2BQPA 3AMQA 4QKDA 3ZFEB 4V2WA 2X5IA 3APBA 4YGBA 5A3PA 5FMCA 5CFCB 1GQGA 3M3IA 4PI2A 4PDWC 4NAMA 3S57A 4FCAA 4URAA 1PO12 4B1LA 3C3VA 2AUYA 4GALA 1O91A 2HWD2 3SKJE 1RUD3 4HVOA 1D4M2 1NCQA 4GH4A 2MEV1 2YB7A 2W92A 3OGSA 1JMUB 2TNFA 3WNPA 5EPAA 4HOOA 1U5XA 2YPJA 4RQPB 5FLIA 1UPSA 2FDIA 3M4FA 1NXMA 2VTXJ 3IMNA 3O0VA 4AI2A 2HH9A 1IQAA 5BNPB 2DU0A 3CDZB 5AC93 5LRSA 3H42B 4BK4A 5FK8A 4Q1RA 3RZZA 3KQ4B 3ME2A 1XNTA 2EAKA 3PVOA 4XOGA 5C71A 5A6YA 2F4PA 2JG9B 3QH6A 1W3XA 2HWE1 3FX3A 2RS32 5FZ0A 3GGLA 2MEV3 3RRDA 5C9AC 3BKZA 1JYIA 2VZSA 4RHV3 5FCCA 1DQ2A 2YG0A 1RVF2 4Q4V2 5LBCA 5GLWA 4H3WA 4CPBD 1O5UA 2BPA2 1IKPA 1ENXA 5A3UA 4QDSA 2PTMA 2Y6FA 5C5UA 1KFXL 4JDOA 3THTA 5JCTA 1LOFC 3LIGA 2VJXA 3PL0A 2E63A 1BVVA 2VNVA 1GKBA 1W6NA 2IC1A 2X5IC 3POGA 2HWE3 4QWNA 5A33B 1GNHA 4IEWA 5DDJ1 1R082 4G4FA 1UKGA 1TEIA 1JN2P 2DUPA 5J09A 1RUF3 2VQ0A 5C5TA 5DAWA 1W8UA 3VZMA 5GLZA 4RN5A 4AW7A 3UESA 2WQZC 2ENRA 4ATFA 3VDDB 4W6XA 4AFBA 1NCQC 4GH4C 3H0OA 4TZDA 5KHHA 3LEKA 4QHOA 2ZMNA 5FK7A 2E33A 1UOFA 1SFYA 4EJRA 3D8CA 2VG9A 3W20A 3ZSJA 5I0UA 2IXJA 3OUJA 4PF5A 5A3WA 3P6BA 3AMNA 1TME3 3U37A 2Z2SB 2EALA 1KXGA 2Y26A 3PVBB 5CKMA 4YFWA 2Q30A 1FMD1 5DZGA 4IEQA 4JDNA 5C3QA 3PMEA 3HVDA 5GM0A 2GN7A 3ZYJB 5F2SA 4X8PA 3FL7A 1HRI3 4MGYE 4P9WA 1ND2B 1BCXA 2WS92 3BALA 5FMBA 3RZHA 3WNXA 2OXBA 5FZEA 1B35B 2VZTA 1VBD2 2VR4A 4LUMA 1ASJ2 1Z7S1 1BVP1 4YW5A 2JDKA 3KQRA 2ZHMA 4M3CF 1KS4A 5DZEA 3MFCA 2QFEA 3T0AA 4Y33A 2WQ4A 4O65A 4UW4A 3TNQA 2VMEA 1FMD3 4ATEA 4EV0A 3ZYIB 3ZKUA 1DU3D 2HWF3 3BTAA 1X50A 3J7MA 4OQ9A 4LBMA 1ODMA 3PUQA 4CU8A 3IMMA 4IGQA 2AH2A 2R49A 1YQCA 2VNRA 3K4DA 4M4PA 3ACLA 4Y1XA 4OMCA 3VDBA 4QX1A 5KC5A 1UY4A 1RGSA 5FZ8A 4DEVA 2RR12 2HKXA 1GYKA 1WBLA 4LE4A 1AJOA 4HZFA 2V4VA 2RG4A 3P3NA 4CUGA 2JDHA 1W8ZA 3MV11 1UX6A 4L11A 1SLTA 1ENSA 1JH5A 1JHNA 1HLCA 1AL22 1OD5A 1W6PA 4JHTA 4BQ3A 4XF9A 2RV9A 4CCKA 1QJY2 3KV9A 3SNMA 4HFSA 4HKWA 3WUCA 4MGIE 4COYA 5GJ6A 3GBGA 4UW3A 2EVXA 1UXZA 5LK7B 4FBFA 1KJRA 1VR3A 1BMV2 2YFUA 1MEC1 4MHUA 4DO0A 1H9PA 3H8RA 3SITA 1UMIA 1O4ZA 2GSYA 2XLGA 5IW0A 4YVWB 3VBFA 2J42A 4PF1A 4CCDA 1JODA 1NCRA 3TBDA 4FI9A 4GJZA 4I2OA 1DLCA 3VD7A 2D40A 1O59A 3E6DA 4IEVA 4INDA 4XDQA 2JECA 4COWA 4BQXA 3FE5A 2XPJA 3M3OA 4FXGB 1QQP3 1OURA 4XABA 4EZ4A 2AC1A 4JGZB 1IPKA 5LA0A 3T2PA 1Y9GA 3T1MA 1YYNA 5HCBA 1TMF3 5SV8A 5C3PA 1JZ4A 5FYCA 1ULOA 2KXLA 2C4XA 2QTWB 2N7GA 1RJ8A 3ZXEA 3T0DA 1J3QA 3OGVA 1COV2 2KR2A 2VZ3A 3K3NA 4KMQA 2OQ6A 5JMOA 4FFFA 5AC92 3VBUA 2AEZA 1O4YA 3VDAA 4DY3A 4XZPA 3VB9A 3CIHA 1FX5A 2FCUA 4GKXA 4BYYA 4Q5OA 2EXJA 3K51A 4S2HA 2J1EA 4XFHA 1OOPB 4AR2A 1V6OA 4RHV2 2PAMA 2BP6A 2JG8B 3PMSA 2XWBB 4X8NA 3NJXA 2JD4A 5A7QA 4BQ4A 1OFSA 4CDUA 4FOYA 4OHZA 1KGYA 2XB6C 5GZDA 4WZCA 4FPEA 3CQOA 4KU8A 5IVCA 5L7OA 3IPVB 2HLEA 3VBFC 3U10A 1NCRC 4FO9A 1H2LA 1DQ5A 2JDZA 3IZOA 3ES4A 1ULEA 1KQRA 1E5HA 4HN1A 4CEYA 1LOAA 1W9TA 3SISA 1RUF2 2A6WA 2XHNA 2LROA 3EO6A 3ZXKA 1XSQA 3ZYRA 2R041 3M1HA 3ZN5A 4AI9A 1VE0A 2VMFA 3PHMA 4YW2A 4Y1YA 1ULFA 2X10A 2GP5A 4Q26A 5EIYB 4QU2A 3ZSLA 5T54A 4ISQA 1KDMA 3WR0A 2ZABA 5FWJA 3PTYA 3SEPA 3VBUC 2GC0A 2A71A 4WZFA 1MVQA 3OOXA 2Q4SA 2WUHA 2W47A 2VOTA 3GBFA 2VVDA 2DU1A 2NZ9A 4C1XA 5C33A 5H9SA 5T5PA 2D7FA 5H9PA 1JYTA 3W5NA 1QOTA 2Y8KA 1V0AA 4M00A 5GLVA 2W1WA 3DYOA 4CDUC 1ZRFA 4CRQA 3ZIWA 1GWMA 4K8FA 5K7PA 4DXTA 2VZQA 5L7OC 5FZIA 1XNKA 3WNKA 2R1BA 4A44A 4XYXA 4Z82A 3RPQA 3L9JT 3QOPA 3T1LA 1W9SA 5A3OA 4UFLA 4AAXA 2YFZA 5C8CA 1VAMA 3B9CA 3ZYFA 4CEYC 4MOAA 4KWJA 2GC2A 1HB2A 1SFPA 2YC4A 1POQA 3KZ4C 4QQPA 5AVAA 1QJU2 1RUG1 1I6XA 4ZS3A 5I0RA 5ACA2 2RDRA 1ULPA 5E8AA 3SCGA 2G9GA 4XJAA 4NO4A 4BQWA 2ZAAA 2CAVA 1GICA 3KV6A 5LA2A 4BISA 2ZGKA 2DV9A 4QPYA 4A6OA 1EV12 1WWYA 4XBLA 5JUVA 3MW3A 4KG0A 5IATA 1DP0A 1WA6X 2DFCA 2ZPXA 1HX6A 4ZS2A 2AEYA 2ATFA 3IKWA 2J1AA 3LA2A 3T2OA 3VBRB 2WAOA 1BEV3 3ZYBA 1K3IA 2D6NA 5FZDA 2WN3A 1Q3EA 2DTWA 3V65A 4EN7B 4YSFA 2Q1ZB 2Y0IA 3AP6A 4Z8BA 2YPDA 5BNNA 3PVNA 4QPGB 4Y3OA 1CESA 1DFQA 2XL7A 2HYXA 3KVAA 5F5CA 1GOFA 3LDBA 2Z4FA 1ULGA 3K77A 5JXJA 5LCWL 2RJLA 4G3YC 3ZPOA 4ZU4A 1RUI3 2IXHA 4J1WA 4Q29A 4CPBA 2HEYF 1VPHA 4B7KA 3VKNA 1LEMA 4UBHA 2EAAA 1OLRA 2QQJA 1IPSA 1UQXA 3OEAA 3R6SA 1CZTA 2D3RA 4LO5B 5A7WA 1UWWA 3CNAA 2A6YA 3NNLA 5ABJB 3LGRA 5CB7A 5C8CC 1WW4A 1W6MA 2CV6A 4Q2FA 1PGW2 1QQP2 4GB33 2E31A 4U36A 1C4RA 1D2SA 2PHFA 2CWSA 2QZ2A 5H9RA 2ARBA 4IW3A 3VZLA 1IKQA 1UKRA 3B94A 3K2OA 4I0AA 1F2NA 2WR9A 4NHXA 3B01A 3KGZA 4XFBA 5ANQA 1TMF2 4XAEA 3UETA 4N9HA 2IXIA 3H1MA 3VKFC 4IETA 1YI9A 3N9PA 1REFA 3SH3A 2YY1A 1T6BX 5FUIA 4CDQB 1KITA 4XBNA 4CEWB 4R4ZA 2XH6A 1L7RA 3KSCA 3ES1A 1DZRA 5FV3A 4P08A 2WWJA 4Y4RA 3CZUA 3INAA 4URTA 3UYJA 1V6MA 4F3JA 1OA4A 4AEMA 1SCSA 2AREA 3HEIA 1SFNA 3K4ZA 3JBG3 1O7FA 2YXSA 4LO7A 4P5HA 5BNNC 1IS5A 4LE3A 4W50A 1W39A 2D43A 4XURA 5EZWA 5JI7A 4EROA 4CUCA 1CJPA 3OD4A 2RS52 4AVBA 3USUA 1WCSA 1L7LA 4NROA 4MZUA 3VHPA 1FPN1 3MIHA 1ZBE2 3WW1A 4JKLA 5L9RA 1PM4A 1PZ7A 3RMXA 4FOQA 1ZRIA 2W1QA 4NWVA 3TEXA 2X53S 3AB0A 3KMHA 3WQ7A 3O1SA 3I2DA 3RWKX 5L19A 1VMHA 3MW2A 2ETEA 1DGWX 4BDVB 2VCAA 4ASKA 2WWSA 4JAAA 1XB9A 3S7IA 2OX0A 5CAZA 4OUEA 3S6PA 4MV2A 2IXLA 5KXEA 4L0PA 2VZRA 4Q4W2 1CIWA 2E53A 1FPN3 3SH5A 2YUEA 5F9TA 1L3JA 2R061 3FLPA 4LKFA 4DZGA 3IDAA 3W5MA 4MGTA 1QJFA 2K0GA 3WF4A 3AP5A 1W9YA 3FHAA 3VDCA 2VXJA 2V72A 2RDSA 3AXEA 1X33A 1TNFA 3HT1A 2D44A 5IVFA 5EWSA 3NNFA 2WKKA 1PMJX 2CGNA 3FUQA 5IYYA 4EN8B 1WW5A 5L36A 1D0HA 2BNNA 5K4LA 5JMCA 5JZGA 2UY8A 2XDVA 3IN9A 4QM8A 4F8AA 5CA6A 4QU1A 4AEDB 1QJX2 5HPOA 3TWIA 1WMXA 2WZR2 3ELNA 4YLZA 5DUUA 4MXWB 1OVPA 3V56A 1NY71 1IS6A 3H7JA 3WDTA 4FP3A 2VL4A 2WRAA 3ZYHA 4COVA 1TNRA 4UT5A 3BTXA 5FYHA 1PZ9A 5G05L 3CO2A 3KB5A 1R64A 2P34A 2AACA 4B8EA 3EQEA 2VZ1A 2EIBA 4YZ4A 2R32A 2WFF2 3G6JB 2GAUA 4WVMB 2BJSA 3TN91 3ILFA 1C8M1 3NJZA 3DPRB 3O0XA 3U11A 4P9IA 1WA4A 4PQQA 4FXKB 1X7NA 3KVBA 2RE9A 1BYHA 1W2TA 2WABA 1V6JA 2BOIA 2PAEA 4P9GA 2IFRA 1AR62 1NKGA 4K9SA 2J1SA 5IFPA 4GIQA 4IV1A 4K1ZA 2AZ5A 5FZMA 2GNDA 2QVSB 2VOVA 1VBC1 2WZ8A 1WCQA 2ID4A 2DURA 3U0ZA 4EN0A 3AKQA 4MSVA 4AVVA 1F5FA 2NYYA 2ERFA 4XJWA 3IT8A 5FXXA 1JUHA 2ADDA 1C8M3 2EICA 3N3HA 3RVHA 4XJ9A 3O12A 2B7YA 1PNGA 3VKOA 4E8CA 3PUHA 1ND3B 4YPJA 2UYBA 2VMDA 1W8FA 5IK7A 4I30A 1BBT3 2HWC3 3ZSMA 1MZFA 5LWBA 1H2KA 2F4LA 1CIYA 2MHFA 1PMHX 3GNEA 3OJBA 5FYVA 5CEHA 1K5MA 5JZGC 4GAZA 3ZFGA 3ILNA 5JOYA 3FLRA 1ZA7A 2XJVA 4B4QA 1G7YA 3PUAA 5CG8A 1O3TA 1CAUA 1ZVFA 3LWCA 1OSGA 2JDNA 1ACCA 4LLOA 1IZ3A 1M4WA 1OF3A 1VRH1 3H3ZA 4OQ8A 4KL1A 2ZGRA 4CCCA 1YJLA 4ZONA 2CAUA 4ITCA 2G1MA 2JKBA 3H3LA 1VBA1 2YYOA 3AZXA 4RGKA 3ROUA 2D3PA 3LB9A 4N7IA 4DUVA 3FFZA 2A70A 4XXPA 1UL9A 2AYHA 1DGWA 1PK6C 1A8MA 5JAXA 1RUE1 4TYSA 3U1XA 1F35A 1J3RA 1G9CA 4M3CB 1G9BA 5I0DA 1ULCA 1GFF2 4IV1C 1KDKA 1PNFA 1VAVA 2HWD1 1UO9A 2W1SA 2RJ2A 2Y60A 4HLTA 1D4M1 4GJYA 4NMIA 2QNKA 4I3PA 4PDWB 1SPPA 3MW4A 1LNSA 4ZZ8A 1RL3A 3ACGA 1FNYA 1V00A 5T3NA 3ENRA 3MIDA 1CN1A 1A78A 4FPOB 5E6HA 4XFAA 3BUCA 5DQ0A 2WBKA 4IEZA 3U14A 1H8VA 4CXYA 3DEMA 2R073 4YW6A 1LEDA 2HJIA 3JBG2 1K5MC 3JD72 3SEEA 3ZFGC 4DUWA 3I49A 2RS31 5D21A 5D8AB 3AMMA 4C8DA 2AGSA 3GZUC 1PO21 2SBAA 5DAPA 5HXVA 4BQ2A 4LBJA 3NNGA 4CDWB 4QMAA 3N9MA 2WNEA 2XG3A 4K3UA 4HMZA 5LB6A 4FPYA 1JZ2A 5FYYA 5FPXA 1RVF1 3AKTA 5HI0A 3I2KA 4Q4V1 3KT7A 1QJZA 4CP9B 1FOD3 2ET7A 3WDWA 3ZIXA 2UY9A 3M70A 2HWB2 1NE6A 5C3RA 3A22A 4CTEA 3GDBA 3Q8FA 2Q8CA 1MS9A 3AMPA 5I8YA 5FMDA 1OPOA 3ZFFA 1R081 1TG7A 1PO23 4OMDA 1BHGA 1LOGA 4J6GA 2XJQA 1YC61 2GALA 4AZZA 1HN1A 2KM2A 1Q8PA 4KWLA 4P9JA 2QDNA 3B69A 5A6ZA 5BNOA 4OHXA 4OI0A 3WCSA 4FFIA 3CBNA 5IAVA 3MIBA 1MQTA 4YGCA 3VBSA 1J59A 3A4UA 1AR71 1AUYA 3WDVA 4IV3A 4K7JA 4Y5SA 1HQNA 5CNAA 3ZR5A 2XVLA 3I97A 2ZEZA 4FOWA 4E9KA 2XVKA 5B4NA 5DAVA 1NX9A 2WNUA 4GH4B 4Q4X1 2YGMA 3THPA 2WIIB 4LHNA 2E7AA 1ZNPA 1YO8A 1AR93 2H0BA 2ZGPA 3L2HA 2FMDA 1LHOA 4HSLA 5EHDA 3VHOA 3J4UH 5I8SA 4D6QA 4CCMA 4DEQA 4PI0A 1CWPA 2DVFA 2RM23 4QXKA 2YHJA 2VXRA 1RUH3 1VBB3 2TEPA 4OULA 4GXLA 4HK9A 4UFKA 3DF0A 5FZOA 4QGLA 2YZ4A 2WS91 3H9AA 3OYWB 4KG8A 4FPFA 4XQ4A 2FQPA 1TQ5A 1YQ8A 1CAWB 4QGMA 5A7SA 3RQ0A 4K6BA 4PIYA 1VBD1 5F6KA 5I8TA 1ASJ1 1W0NA 3ETPA 3DYMA 2IVJA 2OIIA 1UYPA 3LFMA 4M01A 2Q8OA 4AL9A 5FP8A 3OCPA 3WX5A 1DIWA 3ZFFC 3I4IA 3QLQA 4OI1A 4HT1T 4UF0A 1V9U2 1YFYA 3ACHA 3GZTB 3HT2A 1OH3A 4PHZA 4XFGA 1JYNA 3WG1A 3GYDA 1VBE1 1US2A 2QJVA 3I3EA 3W21A 4BQYA 5A3NA 5BNOC 1G9AA 1WLCA 2WLQA 4N53A 1MQTC 4OFGA 1JZ8A 3VBSC 1J58A 4HPKA 2HBUA 1S0FA 4IV3C 4E27A 4HKLA 5FMOL 1PGL2 4AVSA 4NIAA 4A41A 5T52A 3C7GA 3L2YA 2G19A 2XXZA 2W1UA 5BY5A 2WNUC 1AL21 4PLOA 5DABA 1ZRDA 3M3CA 2HWC2 2NPIA 3B3QE 4XMAA 1QJY1 1EPWA 5FJHA 3ORJA 3J8F3 1VBE3 2BBVA 3ZXFA 4ZY9A 3OBZA 4ES9A 4A4AA 3BN6A 3BOWA 2YU2A 1S0IA 5FXVA 4DINB 4YM2A 2XUEA 5JR2A 2PLV2 4UI9L 5FXZA 1H1IA 1XYPA 1PVXA 2OZ6A 4UYBA 3OG2A 3HMYA 4HN0A 3LZZA 1ZZCA 1NZIA 2R30A 2XQRA 4OUMA 1EAH3 2XR4A 4I01A 2IXCA 4AI0A 4KWUA 1AZDA 4Z07A 1VRBA 5EQUA 1OUSA 4QX2A 4LIVA 1DQ0A 5TSWA 4GZ9A 5IFTA 1PVC3 2C9KA 5C3OA 1OLQA 3QD6A 4XDPA 4E2GA 1DCSA 3ZOIA 4DXZA 2A3XA 5FMOS 5FIXA 1K42A 1XNBA 4MO3M 4N53C 5B4XA 3VBHA 4FTEA 5JXIA 2OA2A 2OW4A 4MG2A 3HNMA 1COV1 4LBNA 2OUJA 5FKBA 3RSJA 4A3ZA 3UL2A 2XBO2 4GWNA 1JXNA 1OMIA 1QMJA 4BCUA 4IEUA 4AQ6A 5JXGA 1OA3A 1ZRRA 2P5BA 1UCXA 3N7JA 3V0AA 3WG4A 1W6QA 1HXS2 1AYM2 3WT3A 1NQJA 3POIA 2FCVA 4CCJA 1HV1A 3I3QA 3BGAA 5E16A 1W9FA 3D4KA 2ARCA 4CXWA 2PMWB 3UGFA 5K8SA 3SXWA 3MPPG 4NJ4A 1OH4A 1CAXA 3A23A 1ZZ8A 4RYDA 3TEWA 4D94A 4WM7A 4R4XA 4UBGA 4A42A 1UN1A 5CFDA 1Q43A 2R16A 2XLAA 5IJRA 2WNVB 3CU7A 3BPSA 4UFIA 4J25A 1GP6A 1UY0A 3V64A 4AQTA 1AR82 2JIJA 3VBFB 3WXPA 3VUOA 1NUKA 2EXHA 3PVEA 1T2XA 1AXZA 4RFRB 4UFJA 1XNCA 3SLIA 5LBEA 4AQSA 1XRUA 1QIQA 5T50A 4NRPA 3VBHC 2BDRA 3WW2A 2NMOA 3BU7A 2B46X 3R0RA 2QQLA 1HB4A 5DDJ3 2QQOA 2R6QA 3NJVA 4Q4Y2 3ETQA 1H6YA 3HNYM 4IQPA 3O1OA 1YUDA 3TRSB 2VZOA 2GNTA 3OD0A 3I59A 4XF1A 2QQNA 3OBTA 1QNWA 1W05A 3MBWA 1AYN1 3TEZA 2VO5A 1V6NA 3IBMA 1FNZA 3IAPA 1W2AX 2RM22 3EJKA 1CZVA 1VBB2 3AJYA 1W3VA 4E4HA 1BK1A 5JSOA 1JZ3A 1GP5A 1XXNA 4B29A 2BNMA 1SDWA 3FFQA 1I1EA 3IB3A 5DG2A 5JOXA 1U0AA 1YQ2A 5FZ9A 2B9VA 2W39A 5F5QA 1SBEA 1RMU2 3KT4A 4YM1A 4WM7C 2OS2A 2PHWA 1X8EA 2NQYA 3AYEA 4RS5A 5JSRA 5CFDC 2X8KA 3POJA 5DUXA 4CDUB 4PJYA 3SH4A 1URXA 3AZWA 5JOZA 4IESA 2YU1A 3BYWA 4TLGA 2PN5A 2EXKA 3VHRA 2FDKA 3OPWA 4DXSA 5GZGA 3ACIA 1GZCA 2XJPA 4FAHA 4Q0QA 2DCJA 1S0JA 3LA7A 1QJU1 3ZXJA 4ES8A 5ACA1 1UOBA 3FUOA 4LHSA 1Z7S3 1W8TA 1HRV1 4CEYB 5FJKA 2ZGOA 2J22A 4HKOA 4E2SA 1R092 1TVGA 2VVFA 3WF3A 3J7LA 3WCRA 3GALA 1YJKA 1UNBA 4RGGA 1EV11 1KS5A 3AKRA 4XMIA 3VKLA 3WEZA 3ZXAC 1ULDA 3O14A 5AFEA 3O1UA 3M7AA 4IEOA 4BLIA 1CJDA 2D3SA 4TN7A 1RUJ1 3R4SA 5BNPA 3NL1A 3BCWA 1MS1A 3B5LB 1WBFA 1P8JA 3RJ2X 1RUNA 2JB8A 5FP4A 5FZKA 3N9QA 3I2GA 1YIFA 2FCTA 2QDRA 2W94A 1GMMA 2YROA 3A0KA 1UY2A 2JG9A 4AHYA 4XIOA 2E7QA 4KQ7A 1O3RA 3DECA 1LENA 3K48A 3WNNA 5J1XA 2AR6A 2P3IA 3NV1A 2J1UA 4TXWA 4QD2A 3THDA 3ZN6B 1CAVB 3BODA 4AG4A 1KEXA 2EIGA 3ZSKA 3NKTA 2DFBA 2ZGNA 4ISRA 3RZMA 4RS5C 3ZVXA 3Q8CA 4XZUG 2WSVA 1PZ8A 4DQAA 5LW9A 3GHMA 3NNMA 5D1IA 2VM9A 1MEC3 4JC1A 3Q8EA 4MGKE 5DPNA 5KHIA 3N7LA 1JUIA 1PGW1 3EHKA 3KCCA 2R0HA 3TNPB 1B09A 3JXSA 2J1RA 4QDQA 1RUD2 4C91A 1J83A 5LY1A 5A33A 2LS6A 2VNOA 4FPJA 1UZVA 3N9LA 1AX1A 1I3HA 1VALA 2UURA 2ZHKA 2SLIA 3OY8A 2VZUA 1EYBA 1HIXA 3B02A 4W6YA 1XYOA 3KM5A 3ZYGA 2JDPA 3OGGA 4YGEA 4MUVA 5I91A 1KD7A 1J1TA 3DCQA 1WCUA 3RYRA 4E4ZA 2YV8A 2D93A 2Y33A 4IDZA 3T08A 4OCTA 5BNPC 3KWVA 2GC3A 3O0WA 1JHJA 2MEV2 1QEXA 3B93A 1R1A1 4I02A 4XXAA 5FQ0B 4QXBA 2VW1A 4EWDA 2JG9C 2DWRA 4ASMB 4QHZA 2RS51 2VCCA 1FT9A 1IS4A 5EFUA 3ST7A 5HBAA 4N9IA 1UYYA 1YI7A 1ZBE1 1ND2A 5IUQA 2Q8EA 1HDKA 2JENA 2DF7A 3RDIA 4QKNA 2HWE2 4N43B 1E5SA 4OI4A 4V1PA 4Q8KA 1B35A 2JB4A 2PELA 4HL0A 1AXKA 4QDRA 3UKVA 4Q1PA 2R7EB 1C1FA 2VUCA 4O9EA 1JYXA 3JB8A 4RR3B 2YGLA 1NT0A 4AE2A 1ZBA1 2OUHA 4Y1UA 4CCOA 1CX1A 3WF0A 1MR5A 3NWKA 5FZAA 3MUZ1 3PJQA 2ZAHA 4Q4W1 1YFWA 3AJZA 1S1AA 4B3NA 4DUXA 4IERA 3VKMA 3FBMA 3T09A 1RIRA 2XWJB 2GNMA 4LO4B 5APAA 2LW8A 3TAYA 3UV9A 1DYPA 3S30A 2ZCWA 1TME2 3U07A 4IEXA 3GCWA 3CLPA 1WLWA 2R043 4JRAA 3QH7A 1U5YA 1HB1A 1QDOA 3ZXLA 5IK5A 3HBZA 2TBVA 2D6KA 1CPMA 5DUWA 3IDCB 1HRI2 4XUOA 5FYTA 3KF5A 1W6OB 1QJX1 4PLNA 5DZFA 1RXFA 5L9VA 4WVWA 5ISLA 2WZR1 2VUDA 3IIIA 1LESA 2LTNA 4YWAA 1VLNA 2XUMA 5EJ3A 4H7MA 5FP3A 1RHI1 4AI8A 2WO3A 1YXWA 3T2QA 1LKNA 3HQUA 1ND2C 1E5IA 3AZZA 1MVEA 1O4TA 1ENQA 1US3A 2VMGA 3LAGA 4IEYA 3ZKYA 1FMD2 1XE8A 4QPIA 1B35C 2HWF2 1GSLA 1K45A 1SMVA 4IXLA 1OQDA 4XC9A 1I5PA 3OUIA 3PUSA 1O8PA 2IXKA 4W65A 2Q1FA 4JQTA 2IUWA 5F39A 4JGYA 2IVIB 1AR61 4W6WA 4LUKA 3WHTA 4D6SA 3VLBB 4KH9A 1RHI3 3O1RA 3FHQA 3AK0A 4EN9B 1RUC1 1JOJA 2ZTNA 1T6GC 1YQ5A 3M3EA 5HV0A 1OI6A 2GN3A 5D2AA 4QX7A 4YG3A 5K0UB 2BEOA 4MADA 4XILA 4BQ5A 1RUG3 1BJQA 2W08A 3KGLA 1MS0A 4XPVA 4DNYA 2YC2A 4GWJA 2Y64A 1MPXA 1LOEA 4FPLA 4PBOA 4M0NA 1QOOA 4QGNA 2WYSA 1NQDA 2DVBA 1GU3A 3N36A 4PQ9A 4S2GA 4FVVA 4LBQD 5FO7B 1C5HA 3SCFA 1UY1A 4Q0VA 4BHPA 1XBFA 1OA2A 4ARXA 3KHCA 2JIGA 4JHZA 1GQPA 5FP7A 5J7MA 3DXUA 3UK9A 5F2WA 3RZJA 2PHXA 5IVYA 5DG1A 2JDMA 3GBWA 3N4MA 2OPWA 1ZRCA 2QUOA 4OHYA 1C5IA 4WM8A 1OT5A 4QPIC 3RZLA 1DYKA 4P02B 3CMGA 3IPVA 5HCFA 1VB2A 3HPNA 4KU7A 4AGVA 1W8WA 3LPFA 1OF4A 1WW7A 4CZSA 2ZS6B 2WFPA 4O9GA 4RL7A 1XYNA 2O14A 3POFA 4JGYC 4QPWA 5IK8A 2G9FA 3EBRA 2P3KA 3GHNA 1JOPA 1S0EA 3AL6A 4PIXA 3VZOA 3O5SA 4IGOA 4XW3A 3WP4A 1PX3A 1PK6B 5EJZB 3FC0A 1NA1B 2VOKA 4HETA 4QQOA 4XHBA 1Y4WA 2QKDA 4CUAA 3EB7A 3V0BA 4FSJA 2Q5TA 2DUQA 4IV1B 4KWKA 5FPBA 4MYEA 2ES3A 5KHJA 2B39A 5JWPA 3ZDSA 2XONA 1GZTA 5FO9B 5FYBA 1LOBA 2UWBA 4R9CA 4COUA 4BOWA 2VH9A 3JD71 3ZYPA 3C2UA 1H2MA 4QB2A 3HNBM 3SC7X 4FT8A 1Q8QA 2FZ1A 2ZGSA 4A7ZA 2RS11 2VPVA 2BGPA 3ZFGB 4CP2A 1LU2A 1G86A 1DLLA 3J7NA 3R4DB 3MI8A 1QNYA 1XU2A 2ZA9A 4L92A 4WM8C 5F37A 2F6BA 4LA3A 2EIEA 1VIWB 1WW6A 2BNOA 4ARYA 1SLIA 1BQPA 2YMZA 1QWRA 1SLCA 3IM0A 4QX8A 4A7KA 1OBNA 4QB1A 3MV01 2EA7A 2E7TA 2ZJCA 1ST8A 4QQHA 3VBOB 2LM3A 4NHLA 2ZKNA 2XJTA 3LA3A 3MHZA 1HQLA 3LCPA 4JKKA 5FY8A 2CHHA 3RG0A 1DHKB 2VAUA 4NIGA 2QQWA 3OTFA 5A1AA 3POEA 3ZX7A 5CISA 3WHUA 2D5HA 4K40A 3KV5A 2VD7A 2ZHLA 4XHXA 3NAPA 5JPMB 2DYCA 4IEPA 1J1LA 2I2SA 2QQMA 1YFUA 3W59A 1Y9MA 2R042 5C4WB 2E26A 1PIV1 3TEYA 3E5QA 3KV4A 4DB5A 3CZJA 4Y20A 2OKXA 2R063 4OUSA 5LA9A 3VBRA 5LBFA 5AVPA 3THCA 2ZGUA 4KI5M 3HOBA 5JXHA 3FJSA 2W46A 1UZ0A 5I93A 2QQPA 2PA7A 4XCBA 3H8UA 3PTRB 3PURA 3H50A 2B8MA 4FFHA 4FQZA 4QPGA 2XOMA 1QXPA 1UPIA 4CDXA 5J36A 3MYXA 3OSDA 2Y6HA 4MVTA 1OHFA 3ZM8A 4OLLA 2MPFA 2BU9A 3DN7A 1ZX5A 3OEBA 5A3MA 2VTXA 4X6RB 3NSTA 1XE0A 3J9SA 3E5XA 4N90A 1MS3A 2HBTA 3R4UA 4NRMA 2A6ZA 2E51A 4JCKA 4Y22B 1CGPA 4A6SA 1BZWA 2P6CA 3PU8A 5FZ7A 1GZ9A 1AXYA 1Q8OA 3NV2A 3LIHA 2KD7A 3BU0A 1CPNA 1F4AA 1HJFA 3NKGA 4KGGA 1VP6A 5A80A 4EYUA 4AAPA 1A6CA 3WG3A 5F7UA 3TN93 4LITA 1GR3A 4YRDA 4U2AA 3NAPC 2K9ZA 3K3OA 4D6RA 1PGL1 4AVCA 1BEV2 3D5OA 2DVGA 4R9DA 3RWNA 3UGGA 5BNOB 3T0BA 4BWOA 1WUVA 1ZYBA 2GMPA 1UOGA 2P4EA 3VBSB 3HQXA 4LBLA 4CEWA 1XJAA 2CTVA 2H6CA 4IV3B 4YM3A 1GUIA 4UOJA 1UF2C 3WY6A 2VTFA 1VBC3 2WO7A 4L9BA 5A32B 3VBRC 2XJUA 3O1MA 2RMU1 5FKCA 4RA0A 3J26N 4KNCA 3VZKA 1AJKA 2UWAA 1RUI2 2Y6KA 1REDA 2BW8A 2PLV1 3DYPA 4LHKA 4QPGC 3H1WA 4HONA 2YBPA 4CDXC 2C9AA 1X82A 3HBKA 5BYNA 3QBQA 3LFIA 1V6IA 2JDYA 3BOPA 4RGAA 4XUTA 3UGHA 4SLIA 4AVAA 2ZEWA 4GB32 3U75A 3EYPA 4OZXA 5KHKA 2Z69A 1RUOA 2RMU3 2A7AA 2W3JA 2Y6LA 1KRIA 2BTVC 5KC6A 2PHUA 4BXSV 4YFZA 3WQ0A 1PO11 1WZXA 1U5ZA 5EYXA 2X29A 1OD3A 5LATA 4DY5A 1VRH3 3AMHA 3LEIA 1GLHA 5DAXA 3ZR6A 4NPRA 3X29B 1JZ5A 3MDPA 3N7KA 1VBA3 3JCIA 3P5BA 1O3QA 1N3QA 1JYCA 3C7HA 4Z92B 4YG6A 1RINA 4OYUA 1ALYA 3HJRA 1RUE3 5L73A 4N53B 5F8PA 2VUAA 2BFUL 1WCDJ 2XBO1 4K8RB 2D5FA 3B00A 4CEWC 1PO13 4NVPA 4HPKB 2HWD3 1D4M3 4LTAA 3N9OA 1GZWB 3PUIA 4HVRA 2ZHNA 2RDNA 2WT0A 1AYM1 1D2QA 1OVSA 1ZZBA 4QXCA 3S5QA 4XQWA 3AZVA 3CJIA 3WW3A 3MICA 4OZOA 4AEDA 3E1F1 4EE2A 2D97A 5C9AB 5FDBA 4LA2A 1A8DA 1EP0A 4F83A 4MXWA 3I3BA 5A6XA 4Y5Z0 4P00B 5FZLA 1OLMA 4WBBA 2K2SA 2RS33 2IZWA 2WO2A 2WYFA 3VZNA 5HV4A 4K1YA 1QJEA 4L99A 4FPHA 3OPZA 1ENRA 2ZGMA 4WVMA 4YNIA 1AR81 1FPN2 1NG0A 1RVF3 3ZXGA 4Q4V3 3AX4A 2X5IB 1XNAA 2A5ZA 2ZZJA 5IT6A 4PLMA 4LHLA 4D7TA 2FZ2A 2A3WA 4BH9A 5F3CA 3RZGA 5J98B 1O8SA 1OLME 5FOJB 2BFUS 3WDUA 4ZU5A 2OQ7A 3OUHA 3KCXA 1QKQA 5FRAA 1GOHA 2C5DA 2LUWA 4FFGA 3WD5A 3WP3A 1NCQB 3ATGA 2P1BA 1R083 2VUJA 1Q5OA 3LKJA 4Q4Y1 1A3KA 4QQ2A 1ZREA 3PDQA 4NPLA 4MGSA 5C3SA 1S0CA 3C8XA 2VZPA 1OPMA 3T3YA 5JIUA 1AR73 1W90A 4LBQA 5FREA 3RJRA 4Y5TA 4TTGA 3CJIC 1W28A 4Y1VA 3RS6A 1RXGA 4YM0A 4AEDC 2YDEA 5FPUA 2ZZQA 4GKYA 4CYDA 4Q4X3 3DKQA 3V0AB 1UIKA 1W6QB 3S0MA 3RI9A 3D0SA 3UJQA 1SDDB 3U4SA 1WCKA 3I2HA 3AM2A 4ZHNA 4ONUA 4NHMA 2ZX3A 1UU4A 4NR1A 5LEJA 3A0NA 3PJYA 4JKMA 3O1PA 2ZGTA 1CAXB 2VU9A 3LEGA 1OQ1A 3VD5A 1NY72 2WS93 1LECA 2C0ZA 4WM7B 1W2OA 4WV8A 5FY5A 5FO8B 1W6NB 2BGOA 3SKVA 4O61A 1RITA 1STMA 2JD9A 4COZA 4LK7A 4HVQA 3MGUA 1J84A 1AF9A 1VBD3 2RR11 5FY9A 1ASJ3 3OPTA 4GULA 4H55A 4L8QA 4M3CA 1GANA 5G04L 1C8M2 3IAQA 3WDYA 3WF1A 5I0SA 1NLRA 2RHPA 2WSUA 2C26A 1R091 5GZFA 1DQ6A 1AX2A 2XJSA 1GV9A 2W91A 3QCWA 3WW4A 2WN2A 1GNZA 4CVUA 1W04A 1BBT2 2P3YA 3OBAA 2XHKA 3RMYA 2WJSA 2Y6JA 2ILMA 3ZO0B 3O1VA 1ZZ7A 1VBC2 3MLKA 1LJ7A 4XVHA 2CNAA 3BI3A 2BVBA 3AYCA 3AFKA 4M3CE 1BMV1 2E32A 2RR13 1PHMA 1QHDA 1C8NA 3HWJA 4GMP1 3I59B 2VW2A 1Z0HA 2OZJA 3GZEA 4XE9A 1HJGA 5A3LA 5D8AA 1C28A 1AL23 1JOBA 1LHVA 4TSVA 4UW5A 4XFFA 5EP9A 4ZU7A 4GWIA 1QJY3 4CDWA 3ASIA 5FPVA 2AENA 3O1TA 4S2FA 1VB4A 3KF3A 4I0BA 1UIJA 5EV7A 2A6VA 4OHWA 1UAIA 4BU2A 5FY4A 5FZ4A 4YVSA 5FYZA 5FPAA 1YIPA 4XFCA 3I54A 2WQ8A 3JZVA 2QQUA 4GMP3 4HG6B 2BUKA 2ORXA 1LGBA 3SQOA 4BLJA 2VQTA 4LKSA 2JWPA 4DRVA 1Y3TA 3ITQA 1VBA2 3ALQA 4S2DA 5H9QA 1SLLA 2GP3A 1W99A 2D98A 3H8XA 3FBYA 4UWDA 1N1TA 3C7OA 5DUVA 4BJ0A 4CXXA 4PT6A 5AC91 1RUE2 3AFGA 2WL1A 5CG9A 2R072 4JDMA 1BLZA 2Y34A 4IE0A 4M0HA 5EXOA 3IWZA 4ZZ5A 2ZX4A 2W0XA 1WMDA 1RYYA 1W6PB 1XE7A 2VVEA 1EPZA 1F9KA 2NM1A 4Q27A 1W0PA 2B42B 1EY2A 1COV3 4RHV1 3RYKA 3NV4A 3PIJA 3RFRA 5KWRA 3N7MA 4XJZA 4QX0A 5LA1A 1GP4A 3LE0A 5D8AC 4AI1A 1FOD2 1IPJA 2PFWA 1IOAA 4NIIA 3WV6A 1DF0A 1LU1A 3E97A 4CDWC 3G7DA 5JOWA 2CGPA 2VBBA 3OYWA 3D82A 2VZVA 5FOBB 1RJ7A 1SLBA 1CAWA 4W8JA 1LHWA 2CYFA 1K12A 4YVSC 1PO22 2XKOA 3AC0A 5CZKA 1Q8VA 1NCRB 1RUF1 4I0WB 3EMRA 1GWLA 4YW3A 4LKDA 2NN8A 5F32A 4FPGA 3HIFA 3ACFA 4NN0A 4Y26A 1W0OA 1UOJA 4CE8A 5IK4A 2W95A 3N35A 4CCEA 1CR7A 4IUGA 1FXZA 4DRRA 2E9QA 3NV3A 1IS3A 2HEVF 2VMHA 4AWDA 1F5JA 3ZSEA 3DGTA 4QXHA 3VGIA 5CVRA 4E4DX 3GJBA 1TME1 5K9YA 3S5AA 2G9ZA 2C24A 2NMNA 1AR92 3OY8B 3QACA 4EN6B 3AVSA 4BZ4A 5FZBA 3WINE 4B1MA 1CONA 1RUH2 2VOXA 3VBUB 1TE1B 3MF9A 1AR72 1NZCA 2J1TA 1QY4A 2BRTA 4KBZA 4FAGA 1F15A 5ANNA 1HRI1 2DCYA 5FY0A 3WLUA 3K4AA 2ZOEB 2A75A 5L9BA 2VQUA 1QOSA 4JRLA 1FAYA 2JKXA 1BKZA 1HV0A 4AGRA 4Q4X2 4XJUA 1H8TA 1OXCA 3ON7A 4XUPA 1M06G 4ZXKA 1AYN3 2ARAA 4DIQA 5L7OB 5DXDA 3VD9A 3WQBA 4XETA 2HWF1 2CSGA 3ZFEA 3JU9A 2JDAA 5CFCA 3JUUA 1GBGA 2DBNA 4R52A
chains in the Genus database with same CATH topology
5J48A 2Z42A 5KXBA 4GMP0 3PLQA 2PHLA 3FZ3A 3BIWE 1ZM1A 4RQPA 4L97A 3FMGA 3J8F2 1G9FA 1VBE2 1QJU3 4JVAA 5ACA3 4AFCA 1VAKA 4XF3A 4B4PA 1HRV3 2BWAA 4XF4A 2BGCA 5E1RA 3CEWA 3Q9OA 4BQ1A 4LULA 1EV13 4FTBA 2GC1A 2WT2A 3HAGA 2VULA 3TOJA 4GA9A 2DVDA 5FBZA 3ZXDA 1EAH2 1H8TC 4I3GA 1RUJ3 3E5UA 3M8LA 2P2KA 1G6NA 4JQRA 3HN1A 4LBKA 3KT1A 4XTPA 2NP0A 1N3OA 3SHRA 2E6VA 3H3UA 4LR4A 1QQP1 1PVC2 3ZFEC 2LALA 4Y1ZA 3OGJA 5CFCC 2WNVA 1TMF1 5C8CB 3KD4A 4QPIB 3O7OA 4YARA 1LOCA 1F8VA 1H4GA 4YG0A 5GZCA 1POV1 3VDDA 4Z2WA 5GLUA 1ZA4A 5KBFA 4JGYB 5CU1A 2A3YA 2VY0A 3WUDA 4RQPC 4D69A 2UU8A 2C1FA 3M2MA 3BPZA 4YW1A 3WP5A 5GALA 4NOTA 5JI9A 2D6OX 3LSEA 1REEA 4MGZE 1HW5A 1YRZA 2HEWF 1YFXA 1POV3 4P9LA 2JICA 2CL2A 4P9YA 1N3PA 5BNNB 4H7LA 1WGPA 4UW6A 2GDFA 5BPXA 1CX4A 2ZX2A 1R1A3 2UWCA 4AFAA 4EWEA 1XNDA 1H4HA 2BVVA 2CY6A 3FHIB 1IGOA 2ZGQA 2RS53 1CD3G 4AHZA 1Z78A 2PHRA 3DL3A 2WNVC 2R0FA 3AYDA 4WM8B 1W6MB 5J3UA 4BE3A 1ZBE3 1DQ1A 1RC6A 2OVUA 4UXAA 1OFNA 1GQHA 4FPKA 1I5ZA 4FP2A 4FOVA 1DGRN 5DDJ2 3VDDC 4HBNA 4YW4A 3H7YA 3D6EA 3MIEA 4HK8A 4YGDA 5LRRA 5E88A 1ZBA3 1APNA 4YYOA 1OQEA 1DG6A 3AP4A 3V0BB 1O5LA 4Q4W3 1O3SA 3HR9A 5T5OA 2D6MA 2PQQA 4B4RA 4PCRA 4BMBA 4AHXA 2DTYA 4QX5A 1WLTA 3VL9A 2XKPA 4Z1VA 1DBNA 5KXDA 2FMYA 2DCTA 1KJLA 3OBRA 3USSA 4DS0A 1SACA 5HCAA 1AYN2 1PGSA 3USUB 2WFF1 2HYKA 3EXUA 4CP0A 1Y7BA 2MNGA 5I0TA 3ZN6A 4YVWA 4K21A 2I45A 1CAVA 1LTEA 3SCHA 3MZHA 1QJX3 4RSUA 4ORFA 2WZR3 5SV5A 3WVJA 2P37A 3M3QA 3NO8A 3CJXA 5JIAA 1Z7S2 5JSPA 5T5LA 2B45X 4JGZA 4FPCA 3W58A 2W68A 4R9AA 3DKWA 2WFF3 4META 4G9SB 4P14A 1RTVA 2XJRA 2O1QA 1BEV1 1FATA 2I07B 4XIKA 1QH6A 1H0BA 1YWKA 1AR63 1QGLA 2KA3A 2Q0AA 3IIAA 4WVZA 1SBDA 1C3HA 2V5YA 4LNVA 3NAPB 1HRV2 1BXHA 3ZPYA 2DVAA 3FWEA 4A7YA 4X6QB 2W52A 1SBFA 1RUC3 2GMMA 4JV4A 4AEJA 2Y0OA 1OOPA 1AVBA 2VGDA 4XBQA 1RUI1 2BWCA 2QE3A 5JZGB 2JG8A 5FQ0A 1LCLA 4Y20B 5JR7B 3MF6A 2V73A 1RUJ2 3GZAA 4D7YA 1POV0 4R8HA 2JJ6A 4AHWA 4ASLA 3LSDA 4AEKA 5J37A 3JQXA 2B9UA 1D0GA 4YVWC 3RNSA 1MEC2 4IL7A 1X8MA 5E89A 2ZGLA 5LEKA 4GB31 4CDXB 2GNBA 1J3PA 1YLLA 2XGXA 4N43A 4I09A 3W9AA 3SMHA 4AQ2A 5B2GB 4Y24A 1JTZX 2PYTA 4JGZC 1JBCA 2VNGA 4RR3A 4MXVA 1WMFA 3UKTA 3LOBA 1D4VB 1MS4A 3E6BA 2G4IA 2GU9A 5GLTA 2PHDA 3ZMOA 2WINB 1LGCA 4YZ2A 4BPZA 1OKQA 2O0OA 4C0BA 4QHBA 3AYAA 3JBG1 5F1RA 4AFMA 1S0DA 4RD7A 1LHNA 4P9XA 4A3XA 1OOPC 1Q8SA 2JE7A 1Q56A 3MLJA 1K5MB 2O8OA 2ZBJA 2JG8C 3LOIA 4MLOA 1PM7A 4AFDA 4LLFA 1DGRA 1W6OA 2Z5WA 2ZKLA 2WZPP 1N47A 4BIFA 1CAUB 3UJOA 2HWB1 1UU6A 1R1A2 1VJ2A 2WT1A 3JD73 3PNAA 2JE9A 4XF0A 4A2UA 4N43C 2UYAA 1UZZA 5FAXA 3MFAA 3TB0A 4F7ZA 1SQ4A 2RS13 2RJKA 1MZ6A 1N1VA 3ZMNA 4LT5A 4JTOA 2P3JA 1H2NA 1S0GA 2QZ3A 4RR3C 4AXOA 3U4XA 3E6CC 5JLVA 2HWB3 3AKPA 2GMEA 2JEMA 4Q8LA 4AK3A 2GZWA 2XL9A 1ZBA2 4QM9A 2ZX0A 1DZQA 3HD8B 1ZZ6A 3NVCA 3GF6A 1S55A 5K0UA 3MEPA 5FLJA 5GKAC 1I9RA 1LR5A 3ECQA 5F6LB 5FLHA 1CQ9A 1AL0G 1PMIA 1PIV3 1QXRA 1YNAA 2VOWA 3D0JA 3MLLA 1DDLA 3JB4C 1QU0A 4KGQA 3CJIB 1CVNA 4YZ1A 4C90A 5ABJA 3DV8A 4H14A 1C1LA 1V9U1 1JW6A 4FTSA 1DZTA 1RHI2 4E2QA 3VL8A 2EF6A 3UKNA 1AX0A 3ZFFB 2YC0A 1FI2A 5KXCA 3KLSA 4FQ4A 2ZX1A 4CDQA 3AKSA 3JQWA 3AP9A 1MQTB 4YZ5A 1PK6A 1RUG2 1MS5A 1NA1A 3FLTA 1V9U3 1BBT1 2HWC1 4C1WA 4OVEA 1NXD1 1ZZ9A 4NHKA 3VN4A 4D3WA 5K0UC 3VHNA 4HSJA 2ET1A 1Y9QA 2WNUB 1RUC2 1XU1A 3RI8A 2B5HA 2O8QA 3S7EA 3POSA 4E4SA 3MIGA 3POYA 3R05A 2DUOA 2P17A 4LBQB 5CBLA 4BM8A 1DGLA 3CL1A 4XEZA 4GQ7A 1SLAA 1FYUA 5ABJC 2FBEA 2DCZA 1RB8G 5EYYA 2D6PA 2PLV3 4GWMA 3I8TA 5FFOC 3WDXA 4PIZA 2PHTA 3VBOA 2JXAA 1SEFA 2EXIA 2VW0A 1MACA 1U5IA 1H1MA 3CF6E 5CIRA 1V6KA 2A6XA 3B9IA 4CDQC 4Q0PA 4XTMA 4B7EA 1NA1C 4CP1A 1NLSA 2WC2A 2R071 1UD1A 5FPZA 3I7DA 1UMZA 2NLRA 4R9BA 5T5JA 3VV1A 1H1AA 2H0VA 4XJ8A 2DCKA 1HXS1 5J96B 4Y4YA 5C4WA 1S0BA 1YCIA 2IFWA 2JX9A 1WD3A 5FTTC 1N1YA 4J1XA 4OI2A 1HKDA 2TUNA 3IDBB 4TLFA 3DUIA 2XBO3 4Q0UA 2WA3A 4C0HA 1FOD1 5T55A 1E57A 4EWAA 1YHFA 1SCRA 1MS8A 4MX3A 4RFT0 4MH0E 1WMEA 5JPNB 4QQLA 1HXS3 3KS7A 1AYM3 3VZJA 4HANA 3NW4A 2Y38A 4N7UA 4AF9A 2VQAA 3DPRA 2ZMKA 1WD4A 2FHRA 2RS12 4L2NA 3RYPA 4BIOA 3AP7A 2PAKA 1AHSA 4AI3A 4DOUA 3VBOC 4Y22A 4YVSB 1XQNA 1G8WA 4XQDA 4SBVA 1DQ4A 1IHMA 4ZKTB 3VBHB 2QCSB 4WVVA 1AR83 1C57A 1AR91 2R062 1ND3A 3KCYA 3AZYA 1QH7A 1MZEA 1U12A 2XVGA 2Q1MA 3URFA 2D6LX 2I74A 2RM21 4BMEA 5C4WC 1RUH1 1VBB1 2GH2A 2OPKA 1LULA 5C6CA 2CGOA 2CWMA 3OF1A 4OHVA 2BYVE 5LK5A 4LEJA 4Q4Y3 5A32A 2R1DA 4KBBA 4D7SA 1LODA 5BXXA 1PIV2 1RMU1 1LGNA 5JVVA 4DFSA 3WQ1A 2OYZA 4AVTA 1W2UA 2ZACA 3MIFA 3WZ1A 2VECA 2GH8A 3DPRC 2V09A 1N1SA 2H6BA 5CFDB 1H30A 1UW8A 1R1ZA 5CADA 1F31A 3TN92 1RMU3 3IDEA 5BNQA 5JDBA 4Q0SA 3H1YA 4DPNA 4XFIA 4PDWA 3ZN4A 1V6LA 5BUVA 3T2TA 3ILRA 4LO8A 1S2KA 2ZMLA 4TWTA 3POWA 2Z79A 4PBPA 4YZ3A 3J8F1 1ND3C 4AGGA 1H9WA 1NYWA 1ONAA 4NWWA 4K20A 3WG2A 1QF3A 1FV2A 3WP6A 4BA6A 2A73B 1R093 4JTNA 2WLPA 1NE4A 3B7MA 2WA4A 1Y43B 1GZWA 3P3PA 5BV6A 1LHUA 1S2BA 1UZYA 3MPBA 3TYJA 1EAH1 2ARXA 1UU5A 2IWGB 4LO6B 1NOVA 3AXDA 5C9AA 1MZ5A 5KHGA 4LBOA 2RMU2 1LB2A 1WLDA 1FV3A 1V70A 1X36A 1H8TB 1HQWA 1LRHA 1PVC1 4RS5B 3BB6A 1QDCA 1RUD1 1VRH2 5AFBA 1KFUL 2XLFA 4AYUA 4QT6A 5GZEA 3WOGA 5C8WA 2VMIA 1LOFA 1QXJA 2BQPA 3AMQA 3ZFEB 2X5IA 3APBA 4YGBA 5CFCB 1GQGA 3M3IA 4PDWC 4FCAA 1PO12 3C3VA 2AUYA 4GALA 1O91A 2HWD2 1RUD3 4HVOA 1D4M2 1NCQA 4GH4A 2MEV1 2TNFA 1U5XA 2YPJA 4RQPB 5FLIA 1UPSA 3M4FA 1NXMA 3O0VA 3IMNA 4AI2A 5BNPB 1IQAA 2DU0A 5LRSA 5AC93 4Q1RA 3RZZA 3ME2A 2EAKA 3PVOA 4XOGA 2F4PA 2JG9B 3QH6A 2HWE1 3FX3A 2RS32 3RRDA 2MEV3 5C9AC 1JYIA 4RHV3 5FCCA 1DQ2A 1RVF2 4Q4V2 5GLWA 4H3WA 1O5UA 2BPA2 1IKPA 1ENXA 2PTMA 1KFXL 4JDOA 3THTA 5JCTA 1LOFC 2E63A 1BVVA 1GKBA 1W6NA 2IC1A 2X5IC 2HWE3 5A33B 1GNHA 4IEWA 5DDJ1 1R082 4G4FA 1UKGA 1TEIA 1JN2P 2DUPA 5J09A 1RUF3 2VQ0A 3VZMA 5GLZA 4AW7A 2WQZC 2ENRA 4ATFA 3VDDB 4W6XA 4AFBA 1NCQC 4GH4C 3H0OA 4TZDA 5KHHA 2ZMNA 1SFYA 4EJRA 3D8CA 2VG9A 3ZSJA 5I0UA 2IXJA 4PF5A 3AMNA 1TME3 2Z2SB 2EALA 1KXGA 2Y26A 3PVBB 4YFWA 2Q30A 1FMD1 5DZGA 4IEQA 4JDNA 3PMEA 5GM0A 3ZYJB 2GN7A 4X8PA 1HRI3 4MGYE 4P9WA 1ND2B 1BCXA 2WS92 3BALA 3WNXA 1B35B 1VBD2 4LUMA 1ASJ2 1Z7S1 1BVP1 4YW5A 3KQRA 2ZHMA 4M3CF 1KS4A 5DZEA 3MFCA 2QFEA 3TNQA 2WQ4A 4UW4A 4EV0A 1FMD3 4ATEA 3ZYIB 1DU3D 2HWF3 3BTAA 1X50A 4LBMA 2AH2A 2R49A 2VNRA 3ACLA 4Y1XA 5KC5A 1RGSA 2RR12 2HKXA 1GYKA 1WBLA 4LE4A 1AJOA 4HZFA 3P3NA 4L11A 1UX6A 1SLTA 1ENSA 1JH5A 1JHNA 1HLCA 1AL22 1OD5A 1W6PA 4XF9A 1QJY2 3SNMA 4HFSA 4HKWA 3WUCA 4MGIE 4COYA 5GJ6A 3GBGA 4UW3A 2EVXA 5LK7B 4FBFA 1KJRA 1VR3A 1BMV2 1MEC1 1H9PA 3SITA 1O4ZA 2GSYA 2XLGA 4YVWB 3VBFA 1NCRA 3TBDA 4I2OA 2D40A 3E6DA 4IEVA 4INDA 4XDQA 2JECA 4COWA 2XPJA 3FE5A 3M3OA 4FXGB 1QQP3 4JGZB 1IPKA 3T1MA 1YYNA 5HCBA 1TMF3 5SV8A 2KXLA 2N7GA 1RJ8A 3ZXEA 1J3QA 1COV2 5AC92 3VBUA 1O4YA 4DY3A 4XZPA 1FX5A 4GKXA 4BYYA 2EXJA 3K51A 4S2HA 4XFHA 1OOPB 1V6OA 4RHV2 2PAMA 2JG8B 3PMSA 2XWBB 4X8NA 2JD4A 1OFSA 4CDUA 4FOYA 4OHZA 2XB6C 5GZDA 4WZCA 4FPEA 5L7OA 4KU8A 3IPVB 3VBFC 3U10A 1NCRC 4FO9A 1H2LA 1DQ5A 2JDZA 3ES4A 1ULEA 1KQRA 4HN1A 4CEYA 1LOAA 3SISA 1RUF2 2A6WA 3EO6A 3ZXKA 3ZYRA 2R041 3M1HA 3ZN5A 3PHMA 4YW2A 4Y1YA 1ULFA 4Q26A 4QU2A 3ZSLA 5T54A 4ISQA 1KDMA 3WR0A 2ZABA 3PTYA 3VBUC 2GC0A 2A71A 4WZFA 1MVQA 2Q4SA 3GBFA 2VVDA 2DU1A 2NZ9A 4C1XA 5C33A 5H9SA 5T5PA 2D7FA 5H9PA 1QOTA 4M00A 5GLVA 4CDUC 1ZRFA 4CRQA 3ZIWA 4K8FA 5K7PA 5L7OC 1XNKA 2R1BA 4XYXA 4Z82A 3RPQA 3L9JT 3QOPA 3T1LA 5C8CA 1VAMA 3B9CA 4CEYC 4KWJA 2GC2A 3KZ4C 4QQPA 5AVAA 1QJU2 1RUG1 1I6XA 5I0RA 5ACA2 3SCGA 5E8AA 2G9GA 4XJAA 4NO4A 2ZAAA 2CAVA 1GICA 2ZGKA 2DV9A 4QPYA 1EV12 4XBLA 3MW3A 4KG0A 2DFCA 2ZPXA 1HX6A 2ATFA 3IKWA 3LA2A 3VBRB 1BEV3 2D6NA 1Q3EA 2DTWA 3V65A 4EN7B 4YSFA 2Q1ZB 2Y0IA 3AP6A 4Z8BA 5BNNA 3PVNA 4QPGB 1CESA 1DFQA 2XL7A 1ULGA 2RJLA 4G3YC 4ZU4A 1RUI3 2IXHA 4J1WA 4Q29A 2HEYF 4B7KA 3VKNA 1LEMA 4UBHA 2EAAA 1OLRA 3R6SA 2D3RA 4LO5B 3CNAA 2A6YA 5ABJB 3LGRA 5CB7A 5C8CC 1WW4A 1W6MA 2CV6A 4Q2FA 1PGW2 1QQP2 4GB33 4U36A 1C4RA 1D2SA 2PHFA 2CWSA 2QZ2A 5H9RA 2ARBA 3VZLA 4DMIA 1IKQA 1UKRA 3B94A 4XFBA 4I0AA 1F2NA 3ZVXA 3B01A 3KGZA 1TMF2 4N9HA 2IXIA 3H1MA 3VKFC 4IETA 1YI9A 1REFA 3SH3A 2YY1A 4CDQB 1KITA 4XBNA 4CEWB 4R4ZA 2XH6A 3KSCA 3ES1A 1DZRA 3INAA 4URTA 1V6MA 4F3JA 1OA4A 4AEMA 1SCSA 2AREA 1SFNA 3JBG3 1O7FA 2YXSA 4LO7A 4P5HA 5BNNC 1IS5A 4LE3A 1W39A 2D43A 5EZWA 5JI7A 4EROA 1CJPA 3OD4A 2RS52 4AVBA 3USUA 1WCSA 4MZUA 3VHPA 1FPN1 3MIHA 1ZBE2 3WW1A 1PZ7A 3RMXA 4FOQA 4NWVA 2X53S 3AB0A 3KMHA 3WQ7A 3I2DA 5L19A 3MW2A 2ETEA 1DGWX 2WWSA 4JAAA 3S7IA 5CAZA 3S6PA 4MV2A 2IXLA 5KXEA 4Q4W2 3SH5A 1CIWA 2E53A 1FPN3 2YUEA 5F9TA 1L3JA 2R061 3FLPA 4DZGA 2K0GA 3AP5A 3AXEA 1X33A 1TNFA 3HT1A 2D44A 5EWSA 2WKKA 3FUQA 2CGNA 4EN8B 1WW5A 5L36A 1D0HA 2BNNA 5JMCA 5JZGA 2UY8A 3IN9A 4QM8A 4F8AA 5CA6A 4AEDB 1QJX2 3TWIA 2WZR2 3ELNA 4YLZA 5DUUA 4MXWB 3V56A 1NY71 1IS6A 3H7JA 3WDTA 4FP3A 4COVA 1TNRA 1PZ9A 3CO2A 3KB5A 2P34A 4B8EA 3EQEA 4YZ4A 2R32A 2WFF2 3G6JB 2GAUA 4WVMB 3TN91 3ILFA 1C8M1 3NJZA 3DPRB 3O0XA 3U11A 4P9IA 1WA4A 4FXKB 1X7NA 2RE9A 1BYHA 1V6JA 4P9GA 2PAEA 1AR62 2IFRA 4K9SA 4GIQA 4IV1A 4K1ZA 2AZ5A 2GNDA 2QVSB 2VOVA 1VBC1 2DURA 3U0ZA 4EN0A 3AKQA 4MSVA 4AVVA 1F5FA 2NYYA 2ERFA 4XJWA 3IT8A 1JUHA 1C8M3 3N3HA 4XJ9A 3O12A 2B7YA 1PNGA 3VKOA 1ND3B 2UYBA 5IK7A 4I30A 1BBT3 2HWC3 3ZSMA 1MZFA 1H2KA 3OJBA 2MHFA 3GNEA 5JZGC 1K5MA 3ZFGA 3ILNA 5JOYA 3FLRA 2XJVA 4B4QA 1G7YA 5CG8A 1O3TA 1CAUA 1ZVFA 3LWCA 1OSGA 4LLOA 1IZ3A 1M4WA 1VRH1 3H3ZA 4KL1A 2ZGRA 1YJLA 2CAUA 4ITCA 2JKBA 1VBA1 2YYOA 3AZXA 3ROUA 2D3PA 3LB9A 4N7IA 3FFZA 2A70A 4XXPA 1UL9A 2AYHA 1DGWA 1PK6C 1A8MA 5JAXA 1RUE1 4TYSA 1J3RA 1G9CA 4M3CB 1G9BA 1ULCA 1GFF2 4IV1C 1KDKA 1PNFA 1VAVA 2HWD1 4HLTA 1D4M1 2QNKA 4I3PA 4PDWB 3MW4A 1RL3A 1FNYA 1V00A 5T3NA 3ENRA 3MIDA 1CN1A 1A78A 4FPOB 4XFAA 4IEZA 1H8VA 2R073 1LEDA 2HJIA 3JBG2 1K5MC 3JD72 3ZFGC 2RS31 5D8AB 3AMMA 2AGSA 3GZUC 1PO21 2SBAA 5HXVA 4LBJA 4CDWB 4QMAA 4K3UA 2WNEA 2XG3A 4HMZA 4FPYA 5FPXA 1RVF1 3AKTA 5HI0A 4Q4V1 3KT7A 1QJZA 1FOD3 2ET7A 3WDWA 3ZIXA 2UY9A 3M70A 2HWB2 1NE6A 4CTEA 1MS9A 3AMPA 5I8YA 1OPOA 3ZFFA 1R081 1PO23 1LOGA 4J6GA 2XJQA 2GALA 2KM2A 1Q8PA 4KWLA 4P9JA 2QDNA 3B69A 5BNOA 4OI0A 4OHXA 3WCSA 3MIBA 1MQTA 4YGCA 3VBSA 1J59A 3A4UA 1AR71 1AUYA 3WDVA 4IV3A 4K7JA 1HQNA 5CNAA 2XVLA 4FOWA 4E9KA 2XVKA 4GH4B