3WW2A

X-ray structures of cellulomonas parahominis l-ribose isomerase with l-psicose
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
248
structure length
241
Chain Sequence
TRTAISRREYDEWLSEAASLARALRYPVTPEMVNDSAGIVFGDDQYEAFAHGLWSREPYEVMVILESLNEPAVDGLPAAGAAHAEYSGLCDKLMIVHPGKFCPPHFHQRKTESYEVVLGEMEVFYAPEPVTVGDDDVLSFSPMPEGSPWPEGVALPAGREDSYAGLTSYVRLRAGDPKFVMHRKHLHAFRCPADSPVPLVVREVSTYSHEPAAPLPQWRGLHDNTFVAEAANSGRLATAIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ribose isomerase
publication title Essentiality of tetramer formation of Cellulomonas parahominis L-ribose isomerase involved in novel L-ribose metabolic pathway.
pubmed doi rcsb
source organism Cellulomonas parahominis
molecule tags Isomerase
total genus 60
structure length 241
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ww2A00
3LWCA 5CU1A 5I91A 1RGSA 5E16A 2IXLA 3MYXA 1G6NA 3OTFA 2IXJA 4O9GA 3H1MA 2ATFA 4D7SA 5I8TA 2WFPA 2PAMA 4HVQA 5JAXA 2P17A 5J3UA 3FFQA 1NXMA 4HN1A 1J59A 1LKNA 3BPZA 2H0VA 1PM7A 1SQ4A 5JSOA 2IXKA 3CEWA 4UBHA 3SXWA 4META 1IPKA 1RL3A 2QJVA 2D40A 3E97A 1GQGA 4TLFA 4I3PA 5FLJA 1ZZBA 3ACLA 3LZZA 3LOIA 3U10A 4GULA 1ZZCA 5KBFA 3M70A 3I7DA 1TQ5A 3LA2A 2B8MA 3IDBB 3KGZA 5C6CA 2GAUA 3EHKA 4B29A 4PJYA 4K8FA 4IEQA 2O8QA 1CX4A 4NVPA 4IEVA 3H8UA 4E2QA 3BB6A 1UIJA 4JV4A 4KU7A 2OYZA 4QGLA 1WGPA 4MGZE 3MDPA 2ET1A 2Q30A 1QY4A 4I0AA 3R6SA 1H1IA 2XHKA 4MGIE 5BPXA 5FCCA 4R52A 4XFCA 2Q1ZB 5CVRA 3FJSA 4HN0A 1NZCA 5J48A 1NE6A 3OD0A 1ZRDA 3C3VA 1O3QA 4PIXA 1NYWA 4YSFA 4HVOA 1XRUA 4QM8A 1QWRA 4WBBA 4WZCA 1J3RA 1GQHA 3H1WA 4F7ZA 1Q43A 2IC1A 3HIFA 3RNSA 1DGWA 3QACA 4DINB 2BNNA 3EQEA 4XF9A 5EZWA 1RUNA 2UYBA 1OMIA 4AVAA 1IPJA 1UW8A 4LULA 3D0JA 2HKXA 4QM9A 2PAKA 3FWEA 3VHRA 1ZRCA 2Q4SA 3S0MA 5BUVA 1EPZA 1O3TA 3FX3A 3SCGA 4PIZA 4YARA 3I59A 3IWZA 1ZZ6A 4LUMA 4MV2A 5BXXA 4IERA 1Y9QA 2ZCWA 4QGNA 5LRRA 1CAVA 2VECA 3H7YA 2Y0OA 5LRSA 1J3QA 3LAGA 5KHKA 4MZUA 2GC2A 1HW5A 1X8EA 4Q0PA 5JSPA 1YFUA 1UIKA 3IBMA 2VQAA 1RUOA 1X82A 2EAAA 2QVSB 4O9EA 4A2UA 2KXLA 2QNKA 4Q0SA 2PFWA 4YRDA 1VR3A 4ZU5A 1J1LA 4FAGA 4L2NA 2IXIA 1EYBA 2H6BA 1YUDA 4Q0VA 4XEZA 4AVBA 4EROA 3HT2A 1LR5A 4Q0QA 4JVAA 4OFGA 2WC2A 1VJ2A 3E5QA 1EY2A 5LEJA 1Y3TA 4IEPA 1J58A 4IEUA 4J1WA 5KHGA 1WLTA 4MGKE 5I0UA 4BH9A 1CAWA 1V70A 3RDIA 5KHIA 1O5LA 4XFBA 5F1RA 4IEZA 3FHIB 3H7JA 3WW4A 3D0SA 3OF1A 3L2HA 4EWDA 3E6BA 1UD1A 1CAXA 2UY9A 3U0ZA 3CF6E 4HMZA 4HSJA 3DL3A 4UBGA 3GYDA 1YWKA 4J1XA 3USSA 4N9IA 4Q29A 1UPIA 1I5ZA 4LUKA 3RZZA 2GU9A 5T3NA 3UKTA 5HI0A 1CAUA 4LLOA 4MUVA 1QXRA 2OA2A 5FPZA 2O1QA 4EV0A 2Q0AA 4Z07A 2K0GA 2XKPA 3N4MA 3SHRA 3I59B 3LA7A 4XFFA 5FLHA 4BHPA 4CYDA 5KHHA 1ZZ7A 4I2OA 4ORFA 1JUHA 5C8WA 3M3IA 3WW3A 4Z82A 2D5HA 1CAVB 2BNMA 1ZNPA 3D82A 4P9GA 5I8YA 3NVCA 4HBNA 4KWKA 2F4PA 1YLLA 3OGJA 3I54A 4IEYA 4QXKA 2MNGA 1DGRA 4LTAA 2UYAA 1LRHA 4YNIA 2XL9A 4PIYA 4QMAA 4XETA 3ROUA 3BALA 1FT9A 2GH2A 2B5HA 2XLAA 4BIFA 5FQ0A 3CO2A 2D93A 4BYYA 1YFXA 3WW2A 2D5FA 4XF3A 1XE7A 1O3RA 2E9QA 4XF1A 1X7NA 1I6XA 4XFHA 2PQQA 4HLTA 2QCSB 3HT1A 5KHJA 4QX5A 4XFAA 2CAVA 5I8SA 2GC0A 5FPXA 2Z2SB 4HZFA 4OLLA 1OD5A 2OZ6A 3S7EA 5JCTA 2PHDA 1EP0A 1YHFA 2IXCA 1PMIA 3ETQA 4WVZA 3MZHA 3RPQA 1CAWB 1ZREA 5EFUA 2GZWA 3HQXA 4F8AA 3E6DA 4Q0UA 1U12A 3H50A 3E5UA 4KWLA 1UCXA 4L11A 4AQ2A 1CAXB 2K9ZA 3EBRA 2H6CA 2FQPA 1O7FA 4EWEA 1X8MA 1ZZ9A 2HJIA 3ES4A 3WW1A 4KU8A 4MGYE 4FBFA 5I0SA 3UKNA 1CAUB 1RC6A 1ZX5A 3NKTA 4D7TA 4XF4A 3NSTA 2CV6A 4JTOA 2IXHA 3G7DA 1L3JA 2BNOA 4E2GA 4E2SA 2XL7A 2BGCA 1O3SA 2XLGA 1FXZA 5AVPA 3CLPA 3ELNA 2Z69A 3ZDSA 1O4TA 2BYVE 4XFGA 4X6RB 5I0RA 4EWAA 5K8SA 5BV6A 3SCHA 4AVCA 3EO6A 4IESA 4H7LA 4FAHA 1ZRRA 2I45A 1ZVFA 3JZVA 2CGPA 4LEJA 3LA3A 3SMHA 3FE5A 3RYRA 1NE4A 3NL1A 3S7IA 3H3ZA 3ST7A 4LA3A 5FQ0B 5I93A 4R8HA 1LB2A 5LEKA 3KMHA 3NW4A 4MX3A 3RYKA 1FI2A 1WA4A 1XE8A 4HVRA 5JSRA 1YFWA 2XKOA 4QGMA 2EA7A 2OZJA 2V09A 2N7GA 4I02A 3CJXA 3PVBB 1OI6A 2OPKA 3MPBA 3DN7A 3CL1A 4AQ6A 1ZRFA 3TNPB 3OCPA 4I01A 2PYTA 5J7MA 3FZ3A 1OFNA 1CGPA 4HSLA 4RD7A 3IIAA 4XFIA 5JR7B 3KCCA 1ZZ8A 2PA7A 3U11A 4ZU7A 3BCWA 1VP6A 3H3UA 2B9UA 3E6CC 3ES1A 1SEFA 2DCTA 1DZRA 3PNAA 3QOPA 1O5UA 1Q5OA 2XLFA 5FDBA 1YFYA 2GC1A 4I0BA 4AXOA 4UXAA 2XGXA 3GBFA 4KL1A 4IEOA 4IEXA 4KWJA 3BU7A 4ZU4A 5BY5A 2BEOA 4LA2A 1QXJA 1H1MA 2CAUA 2QDRA 3E5XA 1DZTA 3B02A 2UY8A 5I0TA 3H1YA 3TNQA 4I09A 2PTMA 4X6QB 2PAEA 3NJZA 4JTNA 3KGLA 2ET7A 1J3PA 5CADA 3DKWA 4MH0E 3UKVA 4IEWA 3SCFA 2ETEA 4XF0A 2FMYA 4YYOA 5FLIA 1RTVA 2VPVA 5E1RA 3RYPA 3PLQA 4IETA 1SFNA 3EJKA 4ONUA 2C0ZA 3H9AA 2ZKLA 4N9HA 5D1IA 1Q3EA 3O14A 2PHLA 3IDCB 4FT8A 2GC3A 3DV8A 2MPFA 2EVXA 3KSCA 2MHFA
chains in the Genus database with same CATH superfamily
1QJX2 4NHYA 5JMOA 4KG8A 5CU1A 1QJY1 2D6KA 1Y9GA 4DXTA 5E16A 2V72A 1GOFA 2PLV2 1G6NA 5DAWA 1QMJA 1AL21 2RMU3 4LE3A 1G9AA 2W1WA 1UKRA 3MBWA 5JIAA 3P5BA 4FPKA 3GGLA 1LHWA 1V9U1 2ATFA 2HWE1 2VOTA 4FO9A 2OXBA 5F39A 5K4LA 4HVQA 3ZSMA 1VB2A 4XZUG 5LA2A 3B69A 3LFIA 1WBFA 4R9AA 2RS33 1QJU3 1RUE1 2FDJA 2XUEA 1AUYA 4Y33A 2F6BA 2JDKA 1O4ZA 1OHFA 4HKOA 1HRI1 1WMDA 1J59A 4YM2A 5DZFA 3BPZA 1WW4A 3C7FA 3RFRA 3A4UA 4ZONA 4P02B 1YQCA 3K46A 1ND3A 3K75B 4OI4A 1RJ7A 4XJZA 5AFEA 2DV9A 3CEWA 3HEIA 3ZFEC 4UBHA 2WZR1 1QKQA 1W8ZA 3VBFB 3U4XA 2VTXJ 3O1OA 4COVA 4MG2A 2ZKNA 5FY0A 2FCUA 2ZMNA 3E97A 4DY3A 1WCUA 1N3QA 1VPHA 4BQ1A 4I3PA 2RMU1 3AFKA 5FY9A 3MI8A 2J1EA 1PHMA 3I2KA 3U10A 4JHZA 5KBFA 3M70A 5HCFA 2YY1A 3RRDA 2UURA 3KLSA 2ZHLA 5F2SA 3HBKA 1C3HA 2ZGMA 4Q4X2 2Y6GA 4B29A 4PJYA 1QJU1 4PI2A 1ST8A 1UU5A 2JENA 4OCTA 1CX4A 5IK5A 3FC0A 4GH4B 3LDKA 2BGPA 1W28A 3H8UA 4UFJA 2ARCA 2BVVA 2VR4A 3PTYA 2XJRA 2RV9A 3CU7A 2VL4A 2TNFA 2P4EA 3OD4A 3AVSA 3BKZA 2HBUA 1A34A 3MO4A 2BFUL 1QY4A 1W2NA 4FP3A 4I0AA 4Q5OA 5GLUA 1ND2A 3MICA 1D4M2 4RHV3 3HN1A 1H1IA 1G86A 5T5PA 4R52A 4S2GA 5L9RA 2JG9B 3GCWA 4CDUA 1UOFA 3OPWA 3K51A 3I3DA 4RSUA 5GLTA 1UX7A 2W87A 3SNMA 3FJSA 3T2TA 4GZ9A 3TEYA 4XQ4A 2ZPXA 5HBAA 5J48A 1G8WA 4B4PA 4IUGA 3BIWE 5FPVA 5KC5A 1O3QA 1NYWA 4CCDA 1POV0 3AC0A 3JD73 1RHI2 5FYYA 2VZOA 1O8PA 1L7RA 5DG1A 1UL9A 1KS5A 1XRUA 4U2AA 4UYBA 3S30A 2AEYA 3N7LA 4WBBA 3P1IA 1RMU2 1XNBA 2R072 1W8HA 4UW6A 4WZCA 1LGNA 3ZXKA 4GB33 2RJKA 3H1WA 2JDHA 2YHJA 2WSVA 2W39A 4YPJA 3RNSA 1VRH3 1XC6A 3RJ2X 2FD8A 2E6VA 4M3CE 2PELA 4RHV1 1PK6C 5CFDA 1CWPA 4AE2A 4NAMA 1APNA 1QNWA 2IFRA 3Q8CA 2YC0A 3LEKA 4B4QA 4BMEA 2YBPA 4ZXKA 3HR9A 4V2WA 3R4SA 4DRRA 1RUNA 3O0WA 1IQAA 2E53A 1PO12 1OMIA 5EJ1B 1IPJA 1P8JA 4NMIA 3KVBA 2JD9A 1EV12 3LPFA 3BOPA 4NR1A 1H2MA 2HWF3 3PUQA 4G3YC 5FO7B 2P6CA 3S0MA 3JD71 1VLNA 4V1PA 3Q8EA 4QXHA 2GP3A 2RR13 4N8MA 5F32A 1K5MC 3ZSEA 2XONA 2BFUS 1UQXA 2I2SA 4CU6A 2BERA 1VBA2 4JGZA 2WKKA 2BU9A 3ACFA 4TLGA 4PBPA 4LUMA 5A3WA 2WT2A 1OUSA 5BXXA 5A1LA 3GNEA 1HB3A 4GB31 4Y22B 5LRRA 3ENRA 3GBWA 4HT1T 4CA9A 1VRH1 2Y34A 4YM0A 1DF0A 4JQRA 3X29B 4YGBA 1NT0A 4DRVA 1RUG3 4XDOA 3VHPA 1AYN3 1IHMA 2BWCA 5IVJA 1XBFA 1CPMA 1V6LA 3LAGA 5C33A 3AFGA 3ZYIB 2GC2A 3SEPA 1XYOA 4M4RA 5FFOC 2KM2A 3OPZA 1ACCA 2WDBA 2XJVA 3NAPA 5IUQA 3WP6A 1HX6A 3LE0A 1GICA 3I2JA 1GOGA 2EAAA 2QVSB 2G1MA 2RR11 4NOTA 4CRQA 2E33A 1RXFA 4YVSB 4I30A 2QNKA 1RJ8A 1FX5A 2PXJA 2JICA 5FK8A 3V64A 2C9KA 2JE9A 3PMEA 3ZXAC 1TG7A 2EXIA 2CSGA 3ZKUA 1YUDA 4XEZA 4BM8A 3WNMA 4CEYC 2Y6FA 1LHNA 4Q2FA 4CP9A 1JZ5A 4K20A 4JVAA 1R082 3AXDA 1LHUA 1RUG1 1QU0A 1LEDA 1MZFA 1OFSA 4B1MA 3E5QA 5BNPC 3F2ZA 4HANA 4JRAA 5A3UA 3J8F2 3TB0A 3RZMA 5LEJA 1R64A 4IEPA 1YC61 1J58A 2BOIA 3VZJA 1U5ZA 1OH3A 3B94A 4Q4W2 3IDAA 3WX5A 1AR83 1FATA 1W99A 2DFBA 4QPIA 1V70A 2AR6A 3AMPA 4IEZA 5A3MA 3ZYRA 1C5IA 2ZAHA 4XILA 1Q8OA 4URTA 5JPNB 3K3OA 4ARYA 1RUC2 2WQ8A 3L2HA 2ILMA 2HYKA 1PK6B 2PQSA 2R6QA 1UD1A 3PMSA 4IE5A 5FBZA 4G4FA 4IGPA 1QJEA 4NAOA 5FUIA 3WZ1A 3AKTA 5T54A 3CF6E 3ZDVA 3WR0A 1F35A 2GNTA 4LOSA 3DL3A 4UBGA 1POV3 1YWKA 3DECA 3Q9OA 1OA2A 4K1ZA 4M3CA 5C8CA 4RN5A 4TWTA 2X53S 3ITQA 1NCQA 4Y26A 3TAYA 1RUI3 5JI7A 4NROA 1XNKA 2JDMA 2G4IA 3IPVB 5FUNA 5JXHA 4AVTA 1K5MB 3ZYFA 3LOBA 1AXKA 1PMJX 1AR81 5KXDA 2X5IC 2AGSA 2W92A 4CDQA 3N4MA 3SHRA 2HWD2 4UOJA 4Q4V2 2ADEA 5FLHA 4CYDA 5DZEA 2NP0A 5KHHA 1ZZ7A 3K48A 4NJ4A 2PMWB 4ORFA 2HEWF 3ZIXA 1HKDA 1AX1A 2YBKA 2WS91 3OEAA 4ISQA 4QPWA 4YW7A 3WF2A 4ZZ8A 1BMV2 2JG8B 1NY72 2V4AA 2D5HA 1B35A 3LF7A 3BI3A 1ZNPA 1ODMA 2WO1A 2WINB 1JHJA 2WQ4A 3NMBA 2WAOA 4WM8A 2XR4A 4GMP3 1YI7A 4CCEA 1AR73 1CZTA 1GV9A 1LNSA 1US2A 3I3QA 4BWOA 1POQA 4F3JA 3ZFGC 4XMIA 3I54A 5LWBA 4CUCA 3VBHA 3BPSA 4XETA 3N36A 5FJHA 4N53C 3BALA 4MGQA 1RUI1 1DQ2A 1S0CA 2SLIA 2XLAA 1A78A 4UF0B 3AM2A 4TZDA 3RZKA 1TNRA 1U5YA 4S2DA 5FPLA 1ODNA 1YIFA 3WEZA 1GWLA 3LFMA 3BUCA 3POIA 4AHWA 3AP9A 2D5FA 2AZ5A 3APBA 2ZMKA 1CONA 5FZEA 2AUYA 5FP7A 3FLTA 4A42A 4CEYB 3GBGA 3C7HA 3ME2A 1WLWA 1WZXA 4XFHA 2QCSB 2JECA 4LO8A 1S0BA 4K3UA 5JZGC 2A75A 2WYFA 2RS52 4GMP1 3OYWA 5IFPA 1MS9A 1AR71 3SH4A 4LE4A 2PHDA 3WF3A 1PX3A 4HONA 2IXCA 3EXUA 3N35A 4WVZA 2HH9A 3GXUA 2CNAA 1V6JA 5C71A 3PDQA 3NWKA 4AI1A 1TME2 1UPSA 1CAWB 2QZ3A 5EFUA 1ZREA 3MEPA 3CMGA 3NV1A 1BEV1 5T5OA 2WNUC 3E6DA 4Q0UA 1GNYA 3MIBA 3GZTB 4C8DA 2R063 2QTWB 3OPTA 4KWLA 4BXSV 1L7QA 1W6OB 3ON7A 1H0BA 4YGEA 1J1TA 4D7YA 4L11A 1RXGA 1NA1C 1COV2 2RDNA 5D2AA 1PO22 1YCIA 3VDDA 4AHZA 4AQ2A 2VBBA 2Y26A 4JGYB 4W6WA 1C4RA 2Q1MA 4E4HA 2AYHA 2PHTA 1AL0G 3VBUA 1F4HA 5AFBA 2HJIA 3WT3A 1NCRA 2VW2A 4KU8A 4FBFA 1JZ6A 3V0AA 2A5ZA 1CAUB 1ZX5A 2C1FA 3LD8A 3NKTA 3POFA 4XHXA 5JMCA 3VV1A 2XOMA 4AR2A 4XF4A 5FWEA 3NSTA 3AP7A 2KD7A 2VY0A 2WAAA 2WBKA 3I2HA 2X5IB 3OBZA 3JB8A 4FOQA 1CN1A 2A3WA 2VQ0A 4AFBA 1SBDA 4XABA 4BK5A 4E2SA 4OMCA 3VZMA 4FI9A 3WQ7A 3A7QA 3CLPA 4CSWA 4AI0A 1OXCA 5FV3A 3AMMA 2L9LA 2JKBA 2PN5A 5IVEA 1YQ5A 2UWAA 2PHXA 5G04L 1O4TA 3VBOC 2R061 4ISRA 3BTZA 3DYOA 3PJQA 4QQLA 2LM3A 4QQOA 5K8SA 3OJBA 3NJXA 1A3KA 2WSUA 3D5OA 4Y24A 1ULFA 2FMDA 4AI2A 5JOWA 2DU0A 2AREA 4H7LA 1UYZA 3D6EA 1ZRRA 2CGPA 2Q5TA 2GNMA 1PGW2 4QB1A 3WHTA 1NLRA 2IVIB 3K4DA 1YIPA 3LA3A 1NE4A 4YWAA 4DUWA 4GWIA 4RS5B 4IV1C 3S7IA 4RQPA 3H3ZA 3A0KA 5LEKA 3RYKA 4XCBA 5T55A 3B93A 2NQYA 5JSRA 2E7QA 1PZ7A 3LIGA 2XJSA 5DAPA 5CEHA 2OZJA 3WUCA 1MZ6A 2JDNA 2BOJA 1ASJ2 4UI9L 2P37A 3PVBB 2V4VA 5H9RA 4LBQA 2EICA 1QOTA 3A0NA 4FSJA 3MPBA 3WOGA 3N7JA 5ABJA 2B4KA 4YZ4A 1MS1A 1MQTA 4I01A 2DCKA 2PYTA 5AC92 4MXWA 1E5SA 3T0BA 3T09A 1LEMA 1ZBA3 4ASKA 3M3EA 4LJHA 3VD4A 5JIUA 5EQUA 3VBSC 3RZLA 4RD7A 4YZ1A 4JKMA 5FO9B 3WV6A 1BJQA 1ZZ8A 1W8TA 1JS9A 3AKPA 2WNUB 2VMGA 2PHFA 2Q1FA 4U36A 2G9ZA 1Q8QA 1OLQA 1S0IA 1SEFA 2VNOA 4AQSA 3NO8A 1DZRA 2B7YA 3QOPA 4OQ8A 1Z7S2 2TBVA 5C9AB 2VMCA 1NA1B 3ZR5A 1XQNA 2XLFA 4CU7A 2OQ7A 2GN3A 1YFYA 3L2YA 1N1VA 4AXOA 4X8NA 1JBCA 2XGXA 2AACA 1VE0A 4XOGA 5A3PA 4IEXA 5HXMA 2XQXA 3G6JB 2ZGKA 1QXJA 3D4KA 1J84A 2VUAA 1VBE2 4BQ5A 3BODA 1N3OA 3PUHA 1KJLA 3E5XA 3KQ4B 4XAAA 4QQPA 3N3HA 1ZBA1 1GUIA 1QJY2 1LODA 4K9SA 2VUCA 3ZN6A 4ET7A 1AL22 3VBRA 1ENSA 2VU9A 2PAEA 3NJZA 3KGLA 2ET7A 5HXVA 3T30A 1YI9A 4A4AA 1RUF3 5LY2A 1V9U2 1J3PA 2HWE2 3LSEA 4MH0E 3T4VA 2GP5A 3R4UA 4NHKA 5A80A 3VBOB 1U5XA 3O1MA 3USUB 1RUE2 3SKJE 3I2OA 5FLIA 1AJKA 1LHVA 3KV6A 2VPVA 5E1RA 1HRI2 2ADDA 1RUH1 4ONUA 1GP5A 3NNMA 5F5IA 2ZGTA 2ZKLA 5FZ9A 4UFIA 5D1IA 1FMD3 5FREA 3U1XA 2LALA 2VOVA 4DOUA 2WZR2 3S5QA 4IV1B 5IJRA 1BK1A 1ZYBA 4QD2A 1S4CA 3O14A 4LBJA 2GH8A 4JGZC 4FXKB 5A3LA 1H9PA 4QDSA 3WDTA 1JHNA 4BDVB 5LK7B 5CG8A 1SPPA 2VOWA 1XNAA 3IDCB 2YZ4A 3LKJA 3WQBA 2RMU2 4I3GA 3EB7A 4DY5A 2VZ1A 1DLCA 4IE7A 2A70A 1RUF1 2BPA2 2A6WA 1VMFA 4AAXA 1IQDC 5JOXA 1DHKB 1W8NA 1DQ0A 1QJU2 2AC1A 4WVWA 5DZGA 4G9SB 4MXVA 2WT1A 4O9GA 1OA3A 5FXXA 2VMHA 5I8TA 3O0VA 3THCA 5DN2A 5A32A 3S6PA 5FP3A 2AEZA 1S0JA 3VBSB 1MVQA 4TSVA 2BW8A 5LASA 1NXMA 2BGOA 1FMD1 1GOHA 4HN1A 4E8CA 4AW7A 3WUDA 1LKNA 3D3AA 1SCRA 1PM7A 1QQP3 3KT4A 1SQ4A 5E6HA 2IXKA 1HN0A 1REFA 1W9FA 2ZACA 1LOFA 3JCIA 3HPNA 3DYPA 5J98B 1F15A 3QH6A 3O1UA 5FZOA 2QQPA 2QJVA 4NUBA 1GQGA 2OW4A 4XAEA 1JN2P 2VCAA 2VVEA 1WW7A 3D8CA 5FLJA 2DCZA 4GULA 1ZZCA 5TSWA 2WWUA 1JYVA 2YGMA 3I7DA 4IV3A 2CU5A 3FLRA 4QPIC 1TQ5A 2OUJA 2R49A 1W03A 5FZ1A 3FUOA 5F3EA 4IEQA 2FDGA 4NVPA 4IEVA 5B4NA 2H0BA 2Y6HA 2WJSA 3CDZB 4AEKA 2Y64A 1UIJA 2VH9A 3BB6A 3H3LA 4JV4A 4RHV2 1QQP1 2OIIA 4MGZE 3ZN4A 5FPUA 4WZFA 3FL7A 2ZGQA 5FY4A 3ZMNA 2Q30A 4ATFA 4EZHA 3I2GA 4COUA 2C9AA 1HV0A 5C8CC 1S0DA 3NQHA 4XFCA 1NCQC 3J7NA 1JYNA 1H9WA 3N9QA 4JDOA 5CVRA 2XVKA 3JD72 4CU8A 1UYYA 4IXLA 5BNNA 2CGOA 4PI0A 2RHPA 3KV9A 5EXOA 4EZ4A 2WA3A 5FZKA 4JGZB 2GMPA 5BYNA 4CDQC 3A23A 1YO8A 2Y8KA 3A22A 5H9QA 2X10A 1WMEA 2JE7A 4YSFA 5C5TA 4XJUA 4GB32 5ISLA 5CFCC 5ANNA 4HVOA 4AHXA 4QM8A 4CCOA 4E4DX 1M06G 4K7JA 1W0PA 1KDMA 1VRH2 1B35C 1QWRA 4R4ZA 2VCCA 3TEXA 2W68A 3MIGA 1RUJ3 4WM8C 1DBNA 5CFCA 2P3KA 3J4UH 1J3RA 4Y4YA 4LKSA 3O1SA 1OT5A 4CUAA 5IK8A 1H30A 2P2KA 2I74A 4NO4A 3AP5A 1V6NA 5FXVA 1G9BA 1SDWA 1VBE3 1DGWA 3RZJA 4NPRA 3JQWA 3VBHC 5DAVA 1WCKA 4AWDA 2J1TA 2BNNA 2RS13 5T5JA 1YNAA 3ZXFA 3H42B 1QJY3 2HWF2 4XF9A 3UJQA 3TYJA 1JZ2A 2Y0IA 4XDPA 5D8AA 3VZLA 4AVAA 3M7AA 3RG0A 1NQDA 2FZ2A 2VZPA 2RR12 3MGUA 2CY6A 5IFTA 2Y6LA 3GJAA 1WWYA 1ZRCA 1V9U3 2XBO3 2Q4SA 4XBLA 4AVVA 2P1BA 1OD3A 2YB7A 1K3IA 1WMFA 2QKDA 4PIZA 3W59A 5J36A 1BQPA 1RYYA 2VOKA 3IWZA 1LECA 3WF0A 4P5HA 1RUG2 1QDCA 1PVC3 3MIEA 4TYSA 1UF2C 3LPGA 1JYXA 2VAUA 2ZCWA 5A33B 1UYXA 5GLWA 1LCLA 1OVPA 1SCSA 1A6CA 1CAVA 1DGWX 2VECA 1IGOA 1FV2A 3H7YA 4D94A 4MADA 2VMEA 4RL7A 4GD4A 3EYPA 4YG0A 2VD7A 2RS11 2XQRA 1IKPA 2W2IA 1V0AA 1VAMA 4KBBA 3MF9A 3NV3A 3RMYA 5JSPA 5K0UB 3AJZA 2VMFA 2FDKA 1UIKA 3IBMA 2V5DA 2EIGA 2P3JA 2WN2A 2XBO1 5E89A 4URAA 5BNOB 1GNZA 5JVVA 3VDDC 2D6LX 1AR63 5E88A 2JB8A 3NJYA 5LBBA 4A2UA 3VBUC 3ZLIA 1VB4A 4XHBA 1NCRC 2PFWA 4INDA 4YRDA 1F8VA 2FBEA 2EF6A 4ZU5A 1PVC1 4L2NA 1C8M3 3V56A 3WF4A 2JDZA 4OYUA 4LO7A 1XSRA 4Q0QA 4AG4A 2VJXA 1MZEA 5FKCA 1AR82 2ZZJA 3BTXA 1W6NB 1VJ2A 2GALA 3OGGA 4S2HA 2OKXA 1BVP1 5FYHA 2VOXA 1Y3TA 3OGSA 5FZAA 4IEUA 3AL5A 2WS92 4DNYA 1B35B 4BH9A 2D3SA 3MHZA 4WVMB 4B7EA 1XOYA 3CJIB 4XFBA 3LSDA 2NMOA 1AR61 1CQ9A 2VW0A 2Z5WA 3INAA 2ZS6B 4MOAA 4NRQA 4XC9A 5FMBA 4ZPIA 5GKAC 1W2TA 3OF1A 1IS4A 3PU3A 4AEDA 4EWDA 4TXWA 4Y1YA 4UFKA 3KD4A 4XYXA 5GZFA 3WQ1A 1HRV1 4XVHA 2NM1A 4YVWC 4YZ5A 4KI5M 1R1ZA 1F2NA 3AZYA 1C8M1 1SHWB 1RUI2 4HKLA 5A6ZA 4O61A 1AJOA 4HSJA 4RQPC 3GYDA 3I4IA 2HLEA 1RVF3 3TN93 3USSA 4A45A 2VXRA 4HKWA 2DVGA 2FDHA 3RZZA 5T3NA 5FZCA 5KXBA 4MUVA 3ZVXA 4XMAA 1QXRA 3W5MA 1QH6A 2X09A 4K1YA 2WO7A 1E5IA 2O1QA 4UFLA 4Z07A 2JKXA 3SQOA 4EV0A 5FJKA 1K45A 2CL2A 1H8TA 1V6KA 3C8XA 3I59B 3UYJA 1TE1B 3CQOA 4XUPA 1QIQA 1MQTC 5CBLA 1AR72 5CYYA 3UETA 1W6PB 4ITCA 1XPWA 3FUQA 5C4WB 2BNMA 4P9GA 3D82A 5I8YA 2QQIA 4LKFA 3NVCA 3OY8A 3VGIA 1SBFA 1KD7A 4KWKA 4Y20A 1PX4A 4GQ7A 5F8PA 2YFUA 4AHYA 1DYKA 1BEV2 1RVF1 3OGJA 4IE6A 2MNGA 2QE3A 5E8AA 5A7WB 3TN91 5FYSA 3ZO0B 4E27A 2BBAA 2GDFA 2UYAA 1O8SA 3M4FA 4YNIA 2XL9A 3ROUA 4QMAA 5JXIA 2XJUA 4FXGB 2D98A 2CWMA 2G19A 2F17A 2GH2A 1LOGA 4BIFA 1ULGA 5FQ0A 3OOXA 2JEMA 4NIDA 2KR2A 1IOAA 2DURA 1YYNA 4UFMA 3VBUB 3WINE 3WW2A 5JUVA 4FOYA 2W91A 4XF3A 2BRTA 3LEMA 4M00A 4PLNA 3V0AB 4RA0A 5M0TA 4GMP0 1O3RA 5CA6A 4DIQA 3ALQA 1CR7A 2IFWA 3WXPA 3ZFEB 5JOYA 5KHJA 3VD3A 3CIHA 1DZQA 2CAVA 3I3EA 5I8SA 2RG4A 2WLPA 1GZCA 1OOPA 2Z2SB 4HZFA 3VBRC 1GMMA 4OLLA 2RJLA 4BZ4A 2DTYA 1EP0A 1HV1A 2ZGUA 1PMIA 2C4XA 1PIV3 2YXSA 3HN3A 4FPYA 4FPCA 2ZX3A 4GWMA 2R062 1B09A 2RDSA 4CP1A 1MS8A 1DQ1A 1RITA 3HQXA 5FYIA 4CDWB 2A7AA 4MGSA 1BYHA 4DQAA 1Z0HA 3H50A 1MEC3 3MLLA 3AK0A 1RINA 1MS5A 4YVWB 5C70A 1CAXB 2HWC3 2K9ZA 2WWJA 2YYOA 4H14A 4K21A 2EIBA 4LMFA 2VE1A 2ZEWA 2FQPA 2R043 3WDXA 4DFSA 3ES4A 4N90A 1UOBA 1WD3A 4HFSA 5I0SA 1WKYA 3VZKA 3O1RA 3UKNA 4D7TA 2CTVA 2IUWA 4KMQA 3LDRA 4A3ZA 2D6PA 3IB3A 2CV6A 1PIV1 2DVDA 3B7MA 4HOOA 4RR3A 3WG3A 1BKZA 2DUQA 1L3JA 4DB5A 4E2GA 3AP6A 4R9BA 1O3SA 2XLGA 1PMHX 1MACA 1W2UA 5JOZA 4ZZ5A 3ELNA 4Y1VA 1BK0A 5ERLA 1BCXA 2K2SA 2Z69A 3DGTA 4GWNA 3ZDSA 1MEC1 4FPJA 2BJSA 4XFGA 1R093 2KA3A 3KT1A 5I0RA 2VGDA 4RGGA 3SCHA 4AVCA 2HWC1 2J1RA 2RE9A 1BHGA 4XIKA 4IESA 3ZFFA 4P9LA 4CDXA 3BIEA 1FPN3 5H9PA 1ZA4A 2R041 1D7PM 1RUD3 3I3MA 2WS93 5J09A 1OKOA 4HXCA 4A3XA 4NE9A 3SMHA 3RYRA 5FUPA 2ENRA 1LOFC 1GBGA 2J22A 3HBZA 3MV11 4WM7C 4NWVA 5FZLA 4F83A 5L7OA 4LK7A 5I93A 3VZOA 1LB2A 3KMHA 3NW4A 2X05A 1WA4A 4CU9A 1FAYA 3VL8A 2BVBA 2JDAA 4DS0A 4HPKA 2VMDA 4MO3M 1QJX1 1W6MB 2EA7A 1AX2A 1LTEA 2EALA 2V09A 2YGLA 2XVLA 5HV0A 1CIWA 1S2BA 4IV3C 4XQWA 1WLCA 4ARXA 3HNBM 4XDQA 1FYUA 1ZBA2 1OI6A 1R091 2B39A 2Y33A 5F5CA 5HV4A 4NWWA 1GU3A 2CGNA 3OCPA 4CCCA 1FPN1 3O1VA 3FZ3A 1RUD1 1OFNA 2YDEA 4Z92B 1FNYA 3KVAA 1CGPA 4R9CA 3IIAA 2FCVA 4XFIA 3DPRA 3VN4A 1NZIA 3U11A 1TZOA 1VBC1 3E6CC 1RUH2 4SLIA 4B4RA 3VBFA 1D4VB 1UMIA 4P9XA 2CDPA 1AXYA 2ARBA 2EIEA 1Q5OA 3FBMA 3H8OA 3VKLA 4OHXA 2C6SA 3VD5A 2BZDA 2GC1A 4I0BA 5FY5A 5EPAA 1BEV3 1IG0A 1OBNA 1HB4A 4KL1A 3ZXEA 2PHWA 4MSVA 1YXWA 4QKDA 4CE8A 4JDMA 1G9FA 3WNLA 5BY5A 3K3NA 2BEOA 3IT8A 4LA2A 3SITA 4NPMA 5FZ3A 4MGTA 3WDWA 2QDRA 4Q4X1 4COZA 3IAPA 3E1F1 1RUF2 3AZVA 1YRZA 3B02A 4WVVA 5FY7A 5I0TA 4XE9A 2OT7A 1ENXA 4XUTA 4B3NA 2O0OA 4GH4A 1PZ9A 4GWJA 2JWPA 5L73A 5BNPB 1DFQA 1NQJA 4JTNA 5SV5A 2G9GA 2CHHA 4Q1PA 1YQ6A 4Z2AA 5CADA 1YEWA 5C7GA 3W9AA 2LS6A 2QUOA 4IE0A 4IEWA 4QDQA 1S0GA 3HQRA 2FMYA 2DDUA 1IS3A 1D4M1 1FMD2 4DPNA 4LQRA 4FQ4A 1RTVA 1SG3A 3PLQA 1JOBA 1XXNA 1SFNA 2JG9A 3EJKA 4GKXA 4XW3A 2C0ZA 4XZPA 5LW9A 4YW3A 5L9BA 4Z2WA 3N9OA 4EE2A 4E8DA 3N9MA 4RGAA 2XPJA 1Q3EA 1AR93 4WM7B 5FYMA 2UWBA 5CB7A 5HPOA 3S5AA 1AXZA 4W6XA 1UNBA 4NRMA 1IKQA 5FRAA 1SFPA 3AXEA 4FP2A 1E5HA 5LK5A 2WNEA 1OQEA 1DGLA 5A7QA 3UJOA 3SLIA 2MPFA 1L7LA 2EVXA 4IV3B 2NMNA 2HEVF 4DXRA 5IVYA 4AK3A 4DMIA 2IXLA 1UU6A 3MYXA 3PIJA 3HVDA 3OTFA 5IWFA 1OVSA 1K12A 3UGFA 4OI0A 3MLJA 4AEMA 3DKQA 3MLKA 4N7UA 2X8KA 5FYCA 5C5UA 4D7SA 1VBD3 4AEJA 1T6BX 2PAMA 4H7MA 3T2QA 3LIHA 5B2GB 2VC9A 5I0DA 3WG1A 5JAXA 1QQP2 2P34A 1SLLA 1TNFA 1SLCA 2ZOEB 1RB8G 4NHLA 3K2OA 4KBZA 4EN0A 1AR91 2PHRA 1ZM1A 2DF7A 1H1AA 4GIQA 2H0VA 3ZFGB 5JSOA 1XYNA 1ND3C 1W8WA 2ZABA 1N1YA 1QEXA 2JIGA 4N53B 2HWB3 1C1LA 3V65A 5A3TA 3J26N 4META 1ALYA 1IPKA 5L36A 1SFYA 2WZPP 4AAPA 3MUZ1 4OQ9A 4CPBD 2D40A 4R9DA 3ILFA 2DU1A 2XXZA 4M0NA 4TLFA 4Y22A 1WMXA 5H9SA 5CG9A 5JR2A 4LO6B 1DDLA 1ZZBA 2ZBJA 3LOIA 3AZWA 3AZXA 2J7MA 3M3CA 1Y9MA 1FOD3 1GZWA 4JAAA 4KGGA 4J25A 1VBD1 1W9WA 4GJZA 2Q8EA 5A7OA 2B8MA 3IDBB 4Y5TA 5CFCB 3KGZA 1OUXA 4Q8LA 1OLME 3PHMA 2AENA 2GAUA 3EHKA 4DUVA 2Z42A 4CXYA 4K8FA 4ATEA 3TBDA 2WNOA 3U07A 5JZGB 1KFUL 3UNPA 1UMHA 1V6IA 2VZSA 1QNYA 3ETPA 4LKEA 5B4XA 4AVSA 4AEDC 2QDNA 4Y3OA 5FMOL 4KU7A 2ZA9A 2ZEZA 3SEEA 3ZX7A 4QGLA 4KGQA 4CCLA 1F4AA 3MDPA 3CHXA 2DTWA 3ILRA 1IS6A 4JDNA 3KHBA 2HWB1 2YG0A 2WFF3 4YVSA 4LBMA 2IWGB 5DABA 3JU9A 2VCBA 1BLZA 4MGIE 1RIRA 5DAXA 1ND2C 5FCCA 2YROA 5DQ0A 5FY1A 3RQ0A 3SISA 3U14A 4A41A 5DPNA 5ACA3 1Y43B 3WNOA 4CDUC 5EV7A 3RMXA 4BLJA 1W04A 1HDKA 2R0HA 4HN0A 3AJYA 1NZCA 2ZX1A 4JKLA 1KGYA 5FYUA 1FOD1 1JODA 3OD0A 3J8F1 2QQVA 1H8TC 2P3YA 1RUH3 4UT5A 1F31A 1RUJ2 3ZPYA 4PIXA 2RVAA 3MW3A 1CZVA 1X50A 2FZ1A 3P6BA 2ORXA 1DU3D 3KZ4C 3N9LA 1CPNA 4OHZA 5APAA 5LZ6A 2W52A 1LOBA 3ZSLA 3WP5A 3PUIA 1O6UA 2ZX4A 4A7YA 2RS12 1GQHA 2VBPA 5IVVA 1W2AX 2ZGSA 5FZHA 4FTEA 1JZ4A 1Q43A 4NHXA 4R4XA 2WFF1 3S57A 4TN7A 1PK6A 4MLOA 3MUY1 1AYM3 3QACA 1LOEA 3ZIWA 5JPMB 1OQ1A 3MIHA 4YM3A 2XBO2 4FPEA 1LHOA 5ACA1 4KQ7A 2ARXA 2VG9A 2JDYA 2Y60A 2LTNA 3AYDA 3N7MA 4YW6A 5FYZA 4LULA 3D0JA 1UKGA 5GM0A 3U37A 1S1AA 3MW4A 4FFHA 2VW1A 4QM9A 1C8NA 3VHRA 4FPHA 3IPVA 5T52A 1DQ4A 2HEYF 1PVC2 4C91A 1ND3B 1O3TA 1MS3A 1K5MA 5A70A 1PM4A 1CESA 1N3PA 2ES3A 2ZMLA 4FCAA 4E9KA 3SCGA 3V0BA 2J1SA 2HWD1 3POJA 4XJ9A 4YARA 5SV8A 4N43A 1ZZ6A 3FHAA 5IYYA 4CEWA 2ZXQA 1LAJA 3RZHA 4MV2A 3J7HA 1OOPC 3VD7A 1BMV1 3POBA 5KWRA 2VZQA 2E7TA 1I5PA 4QGNA 4XBQA 3H8RA 2JG8A 1KJRA 2QZ2A 4OUSA 4XUOA 2Y0OA 1AYM1 3SC7X 2D3RA 4W50A 3T1LA 2ZX0A 1J3QA 2MEV3 2GSYA 4BA6A 4BXFA 4ZY9A 2VQTA 1OC1A 5KHKA 2Z4FA 1AR62 2LROA 1HW5A 4AEDB 4AF9A 1X8EA 1KEXA 3CNAA 1C28A 2ZGRA 4LBLA 1OLMA 4UF0A 1HXS3 3CZJA 5GZEA 4UW3A 1AF9A 1C8M2 3BTAA 2BQPA 4JCKA 3SH5A 1RUOA 3NAPC 3IZOA 4O9EA 4ZS2A 4LOTA 1Y7BA 2KXLA 1NLSA 1UZ0A 5FZIA 1X9TA 4LR4A 3V0BB 4QX0A 2YBSA 4FPFA 1ND2B 4PT6A 3ZXLA 4M3CF 1AVBA 2BWAA 3WHUA 5FO8B 1J1LA 4CEYA 4FAGA 2GN7A 4XTMA 4YZ3A 3KV5A 2H6BA 4CDUB 1XU1A 4Q0VA 4AVBA 4O65A 4DXZA 4HG6B 1LR5A 3BYWA 1UXZA 4YW2A 4XQDA 2RS51 4Q4Y3 5GJ6A 4ZHNA 1OH4A 2W1UA 3JBG3 2WC2A 4X8PA 4DZGA 3AP4A 2MEV1 5C3OA 3MIFA 4P14A 4W8JA 5DUXA 1EY2A 3BOWA 4QX2A 3VKNA 4LHKA 2D7FA 4L92A 2TUNA 4J1WA 2W3JA 4MGKE 3VKOA 4YLZA 5I0UA 3M2MA 3UL2A 1KFXL 1CAWA 1TVGA 3ILNA 3OY8B 2CYFA 5IK4A 1HXS1 4IGQA 1VBB1 3GHMA 4D6SA 3FHIB 3H7JA 3ZFFC 4CDXC 2Y6KA 4FOWA 3WW4A 1TMF1 2AH2A 3IM0A 1RVF2 3D0SA 5F5AA 4OI1A 5F5QA 3TN92 3E6BA 3WP3A 1W6OA 3O1PA 3IKWA 1IZ3A 1H8VA 1E57A 2UY9A 3FMGA 4W4ZA 5CFDB 3U0ZA 5LBFA 4JGYA 2V73A 2VNRA 4J1XA 5L7OC 1NXD1 4Q29A 4LUKA 2EIDA 5FZDA 5A6XA 3I2FA 4Q4Y1 3UGHA 3AL6A 4PDWA 3UKTA 5HI0A 3JBG1 1CAUA 4LLOA 2ARAA 1OF4A 4CCNA 1MVEA 2WA4A 2XVGA 2OA2A 4BK4A 3GALA 1DYPA 2X5IA 2DBNA 5FZMA 2K0GA 1F5FA 4L0PA 1VIWB 4KWUA 2XKPA 1EAH3 4OUMA 5A7PA 1OOPB 1AZDA 3NNLA 2DUOA 3PVOA 3NKGA 1CVNA 4QHZA 2ZGOA 4QQHA 3THPA 3KCYA 3B00A 5CKMA 5J96B 2D6MA 2NZ9A 3OUIA 4EJRA 4YM1A 5C3QA 3DPRC 5FKBA 1W05A 3KV4A 1O4YA 2SBAA 2VZTA 2ZJCA 3IDEA 4QXKA 4LO4B 5EJ3A 3VKFC 1DGRA 2DWRA 3B9IA 4LTAA 4XUNA 1ZBE3 1JU4A 5FK7A 1F9KA 5DDJ3 4XJ8A 2JB4A 3VBFC 3DYMA 5K7PA 2B5HA 4RS5A 2WZEA 3ORJA 4JRLA 2YV8A 1LULA 3CO2A 3NAPB 2D93A 5LA1A 3POYA 5FP9A 1UZWA 4BYYA 5JXGA 3KF3A 4XXAA 4OHVA 5FBJA 4UW5A 1OF3A 4UFHA 1W9SA 2XHNA 3C7GA 4OZOA 5LA9A 1EAH1 2QBXA 3I97A 2E9QA 4KNCA 4XF1A 1UAIA 2J1AA 1X7NA 4QX3A 2NLRA 1GP4A 4M4PA 4HLTA 4L97A 5FZ6A 4LK6A 2ZEYA 1PIV2 4B8EA 4BPZA 4CP9B 1UY0A 3WLUA 4XFAA 5LBEA 3AX4A 4GH4C 4RFT0 3ZXGA 2GC0A 3ASIA 5FPXA 2VTXA 1OD5A 5DUWA 4W6YA 3S7EA 1SBEA 3SH3A 5EIYB 2QFEA 3ETQA 1H2KA 1KRIA 1K42A 1ZBE1 4KH9A 1MEC2 1REDA 1S0EA 2VZUA 3OGRA 5DDJ1 4QPIB 3WD5A 3O0XA 5FZ7A 3ACHA 2ZX2A 2WNUA 4N7IA 3ZFFB 3RVHA 2HWC2 1GWMA 4NIGA 3PIGA 1QXPA 4F8AA 3MFCA 2R042 1UXXX 1Z7S1 1ULEA 5C9AA 1NA1A 3NNJA 1H2LA 3T1MA 2Y38A 5IK7A 5IVFA 4NRPA 2FHRA 3M3QA 3MPPG 3EBRA 4QKFA 2Q8DA 3POSA 4AGRA 2H6CA 5IVCA 1O7FA 4QPGA 4H55A 5A6YA 2WWSA 2HYXA 1ZZ9A 5EYXA 3MFAA 1JZ3A 4M3CB 4RYDA 5C8CB 4MGYE 2RM23 2OPWA 4HPKB 3WF1A 1HRV3 2JD4A 1YQ8A 4YG3A 4OUEA 4BMBA 1R1A1 1NCQB 4LO5B 5A6QA 3FBYA 3RI9A 1HQLA 4P00B 2WL1A 4AGVA 2A73B 2DYCA 2VVDA 4KG0A 4JTOA 2IXHA 1YQ2A 1HJGA 3G7DA 2DFCA 3ZOIA 4UWDA 2JX9A 1R092 2BGCA 3KQRA 4CDQB 1FXZA 3UGGA 3HMYA 1ULCA 2VNGA 3KF5A 2A6YA 4A7ZA 1N47A 3VBOA 3GHNA 3JQXA 4ZS3A 1FPN2 1PGL1 3VD9A 5A3OA 1RUD2 3USUA 3KM5A 4PCRA 2BBVA 1XNCA 4X6RB 3DPRB 1UY3A 1W90A 2VZ3A 4GXLA 4WM8B 3ZYGA 4I0WB 4C1XA 4CCMA 2A3YA 3H8XA 1REEA 2X29A 5FZ0A 4FAHA 2I45A 3CKHA 3PTRB 1QDOA 3ZMOA 1VBC2 1GFF2 4LEJA 4P5YA 5HCAA 2JXAA 4BE3A 3N7KA 2RM21 3VBHB 1QOOA 4IV1A 3WG2A 3GDBA 4GKYA 4YW5A 1K5JA 3ST7A 3H0OA 4LA3A 2DBIA 1FI2A 1XE8A 2RDRA 4HVRA 3T4HB 1UY2A 1YJLA 2QQWA 5A1AA 5CZKA 3RS6A 1YFWA 2XKOA 2TEPA 3AKQA 2OUHA 5FZ4A 4EYUA 1FNZA 3ZR6A 3HAGA 4QHBA 1WW6A 4ASLA 1QGLA 2RS31 3DCQA 4IDZA 4AQ6A 1JYTA 4XURA 3T3YA 1XYPA 1KDKA 3CBNA 3J7MA 4YGCA 3OYWB 5ABJC 1D0GA 5FYVA 5J7MA 3BN6A 1D2QA 4P9JA 2W5FA 4FFFA 4QAWA 4C1WA 1N1TA 3VBSA 4P9YA 4BISA 5F9TA 4C0HA 4UAPA 1Z78A 4FFGA 2FDIA 4YVSC 3JXSA 4PLMA 1WCDJ 2FCTA 3UK9A 1JZ8A 4XBNA 3DXTA 1LOCA 3BCWA 3H3UA 4D6RA 5F3CA 2JE8A 3FLPA 3I3BA 2QQMA 3PUSA 1DP0A 2OS2A 3NRUA 5L19A 3PNAA 4K8RB 5FTTC 3RI8A 4IQPA 4D3WA 4JC1A 2VUDA 3HOBA 1BBT3 3MIDA 3OUJA 3OUHA 3VDDB 4D8MA 4UXAA 5KC6A 1JOPA 2JIJA 1Q8PA 3M1HA 3GBFA 1ENQA 4ZU4A 4QX1A 1QJZA 3GM8A 2J1UA 3M3OA 1NCRB 1XNDA 1ULOA 2QQLA 1UO9A 3WP4A 2ERFA 1H1MA 2DCYA 1WBLA 2CAUA 4A44A 3PJYA 2D6NA 1UZVA 3WNKA 1DZTA 2VUJA 2UY8A 1S0FA 5GZCA 4EN7B 3LEGA 4QB6A 4DXSA 5D21A 5G05L 1O59A 2PTMA 1W3XA 4X6QB 1ZRIA 4AZZA 3K4ZA 3PVEA 2VXJA 3DKWA 3R4DB 3ZN5A 1JYWA 1NAEA 1NG0A 2R32A 2P5BA 4XF0A 3ATGA 3DXUA 2Y6JA 1JYIA 4M01A 5FZBA 4YYOA 4CDWC 4TTGA 3LDBA 1JTZX 2VCMA 1BBT1 5CKQA 1AR92 1UY1A 2QQKA 3PUAA 5A3NA 4IETA 1LGCA 1W9YA 4HK8A 3ZSJA 3H9AA 2QQOA 4N9HA 2Q8CA 3I2IA 3R0RA 5EJZB 5C3RA 3AMNA 2XH6A 4AOCA 4AFAA 5AVAA 2YUEA 2OX0A 4N43C 4RQPB 2ZHMA 4SBVA 3B9CA 4CEWC 5FIXA 4FVVA 3FHQA 3MV01 5F37A 3DV8A 1OSGA 4A6SA 2JG8C 3BU0A 2VULA 1GZWB 2MHFA 2ZTNA 3LWCA 1JU3A 4AFCA 5J1XA 1VBD2 5I91A 3RWKX 5A7NA 1VMHA 1RGSA 4AL9A 5IHRA 3O12A 4LBQB 5EWSA 3OBAA 2WNVA 3HNMA 2IXJA 4H2AA 5DAQA 3THDA 5ABJB 1QJX3 1X36A 4FFIA 3HD8B 1FV3A 1MQTB 1XJAA 3H1MA 2D43A 2DUPA 2WFPA 2R30A 3NV2A 2HWF1 4L9BA 4HL0A 4MXWB 2PLV3 5C3SA 4A7KA 2P17A 5J3UA 3FFQA 2C5DA 5A1FA 2LRPA 3IAQA 2ORZA 5ANQA 1HIXA 2HWB2 3POWA 5T50A 3I49A 4YFZA 4V2VA 1Y4WA 2C26A 3PL0A 1VRBA 4CXXA 3VZNA 1IPSA 1M4WA 2NN8A 1I3HA 1OURA 4CTEA 3SXWA 2BDRA 4K40A 1CZSA 4Q1RA 1W6QA 4LORA 2XG3A 4BU2A 1AYN1 1FOD2 1RL3A 2C24A 1ZA7A 1VBC3 2RJ2A 1H6YA 2JDPA 4Q27A 5A33A 4BCUA 3HWJA 4CXWA 1H4GA 2F4LA 4CUGA 3ACLA 3LZZA 1W8FA 5DUUA 3NNGA 3Q8BA 3ZYHA 5FR3A 1XNTA 2E7AA 1H2NA 1VAKA 1TEIA 2DVBA 1LOAA 3LA2A 3QD6A 4IW3A 4FPLA 2PLV1 1I9RA 3OGVA 3Q8AA 5C6CA 1JW6A 1UY4A 2YU1A 1WCQA 5IATA 1DYOA 3NJVA 2O8QA 1D0HA 3ZN6B 4CCKA 4LHLA 3U75A 5K0UA 4Y5SA 2WFF2 3VBRB 4CP0A 4E2QA 1SACA 4ES8A 3RZGA 3DEMA 5BNOA 4FPGA 5GZDA 4Q4X3 2OYZA 4AI8A 1WGPA 5FXWA 4B1LA 3VHNA 3T0AA 2ET1A 4JGYC 2VZVA 5ACA2 2XWJB 1QH7A 4JX0A 3GCXA 1US3A 3R6SA 1UMZA 3IN9A 4PDWC 5BPXA 2XHKA 3VDCA 4JKKA 2Q1ZB 4LLFA 4O7XA 5IVBA 5JXJA 4HETA 1J83A 2NPIA 4Z8BA 3W58A 3PU8A 1A8MA 1W0NA 2GNBA 3AYCA 1D4M3 3GJBA 4D0QA 5FPBA 1NE6A 1W6NA 2E31A 4N43B 5BNNC 4FTBA 4CEWB 3MW2A 4YGDA 1ZRDA 2LW8A 2WYSA 3C3VA 4DEQA 3KCXA 2EXHA 5F6KA 3Q8FA 1IS5A 3VDBA 2JJ6A 1SPPB 4BQ4A 4XIOA 3NV4A 3W5NA 4WVMA 4Q26A 2VVFA 3HNYM 2ZGLA 3O5SA 3WSOA 1AYM2 2ZHKA 3CJIA 2YU2A 3ACGA 4NPLA 1STMA 1POV1 1RHI3 3ECQA 3ZKYA 3OBTA 5FYBA 1BVVA 4F7ZA 2A71A 2D3PA 3WG4A 1A8DA 2IC1A 3HIFA 3VHOA 1SZBA 4AFMA 1JXNA 4DINB 1OKQA 1RMU3 2R073 3WNPA 1W9TA 1GP6A 4RS5C 5A32B 1GR3A 3EQEA 4QHOA 5EZWA 2G9FA 3ZYJB 1S2EA 2UYBA 4YW4A 2E26A 1JMUB 1UW8A 3RWNA 3I2DA 4S2FA 5D8AC 5F6LB 5LATA 1GYKA 2HKXA 3UT0A 3ZXJA 4COWA 4CCJA 4BQ2A 5KXEA 2PAKA 2Z79A 3FWEA 4LBKA 4K6BA 1OPOA 1W8UA 4OMDA 2B9VA 2XJQA 2EXJA 5BUVA 1EPZA 1PO13 1MZ5A 4E4SA 1CD3G 4RFRB 3KT7A 3FX3A 5F3GA 1T6GC 2P6HA 5DXDA 4OHYA 1EV13 2ID4A 4BLIA 2PHUA 3I59A 4BQXA 1DLLA 2A6XA 3ACIA 1MPXA 3I8TA 5FY8A 5FZOB 1HQWA 2MEV2 4IERA 1RHI1 1W6PA 1Y9QA 4OULA 5C4WA 4Y1ZA 1W39A 2W08A 2ZZQA 1VBA3 1SMVA 5LRSA 4P9IA 1RMU1 2R071 3P3NA 1OLRA 4PBOA 3N9NA 1HXS2 2DCJA 2I07B 4XXPA 1IG3A 1VBB2 3WDYA 4EN9B 2J1VA 5A7WA 2E63A 4MZUA 1QJFA 1UX6A 3N9PA 1TMF2 3PVNA 4Q0PA 4AI3A 1KQRA 2WRAA 3U78A 5C9AC 1YFUA 1NKGA 2XJPA 4PHZA 2VQAA 1S55A 4QPYA 3B5LB 3WVJA 5DMYA 2FDFA 4XACA 1PO11 2BTVC 5CIRA 4D69A 1X82A 1EPWA 3TEWA 5T5LA 3SKVA 3ZYPA 5JLVA 1EV11 2UU8A 4QPGC 1LESA 4PDWB 4Q0SA 1LENA 4Q4Y2 4BQYA 1MS4A 4LIUA 1VR3A 3JBG2 5CAZA 3T0DA 2VNVA 2DVFA 2B46X 4QU1A 2WQZC 2IXIA 1EYBA 4FPOB 4GA9A 3ZFEA 4EROA 4XJAA 4LBNA 1URXA 3HT2A 4XCAA 4A6OA 4QX8A 4XUQA 4AFDA 1VBA1 3AYEA 3OEBA 4OFGA 5BNNB 1XSQA 4OVEA 4QDRA 3RGBA 3J9SA 3BTYA 1LU2A 4WV8A 4CVUA 5JDBA 1VALA 1C1FA 3IIIA 2BP6A 1QOSA 5KHGA 2WLQA 1R083 1NUKA 1WLTA 5LY1A 3GF6A 4QXBA 3TRSB 3WCRA 3RDIA 5KHIA 1GNHA 2XB6C 2XWBB 1O5LA 1EUTA 3J8F3 4CDWA 5F1RA 1VAVA 4JHTA 4LT5A 3W20A 1E5RA 5K9YA 4Q4W3 4IGOA 4LHNA 3QH7A 4LBQD 4YVWA 4ES9A 4L8QA 4CZSA 4Y1XA 5GLVA 2IVJA 3IMNA 3LCPA 2GNDA 2D6OX 1CAXA 1UN1A 5FMDA 3WDVA 4BB3A 4CPBA 1Q8VA 4C0BA 4HMZA 1RUC3 4N9IA 3WQ0A 1OPMA 1UPIA 1I5ZA 1PZ8A 5D8AB 2W9XA 2VM9A 2W47A 2GU9A 1GSLA 4ZKTB 1DGRN 4NHMA 1EAH2 2EXKA 4LPLA 4IL7A 1W3VA 1WLDA 5GLZA 1CJPA 5FAXA 1GZ9A 5FPZA 1V00A 2WR9A 5HCHA 2Q0AA 3WCSA 3DUIA 4YFWA 4YZ2A 3QBQA 1I1EA 2A6VA 3TEZA 1ULDA 1R081 3AKSA 2Q8OA 2J42A 3AVRA 3OSDA 1C5HA 2B42B 1WUVA 3LA7A 4XFFA 4BHPA 1UYPA 2OVUA 3ZSKA 1MS0A 2QQJA 3NNFA 3VLBB 1JUHA 4E4ZA 5C8WA 4I2OA 3M3IA 3AZZA 4Q4W1 3WW3A 4Z82A 3T2OA 4Z1VA 1CAVB 4P9WA 3C7EA 1ZBE2 2HWD3 1H6XA 2K46A 4Q4V3 2ZHNA 4HBNA 5DDJ2 3THTA 1LGBA 2F4PA 1YLLA 2R0FA 2VZRA 3K77A 4QWNA 4AGGA 5CFDC 1RUC1 4IEYA 5EP9A 1XB9A 1V6MA 1GKBA 5F2WA 1ONAA 3C2UA 2WIIB 3LEIA 4NIIA 4B7KA 1S2KA 1PVXA 1LRHA 4Q8KA 2QQNA 4PIYA 2D97A 2YMZA 4Y5Z0 1UOGA 1FT9A 3W21A 1V6OA 3POEA 1HB1A 5FP4A 5A7SA 3WY6A 4XPVA 1YFXA 4QPGB 2VO5A 2HBTA 5FWJA 4LNVA 1XE7A 1W6MA 2D44A 1U0AA 3KS7A 3GZEA 4EQVA 1R1A2 5FMOS 2W0XA 4MHUA 1H4HA 1I6XA 1UZZA 4LBOA 3ABZA 3C7OA 3EMRA 2PQQA 3UV9A 3HT1A 1T2XA 4AQTA 5IT6A 4QX5A 1W2OA 4EN8B 2R7EB 3BGAA 2YC4A 2BV4A 4Q4V1 4Y4RA 1WW5A 1PNFA 1W8OA 3KB5A 5LB6A 3AB0A 3OG2A 1XU2A 1GWKA 2B45X 2ZGPA 4J6GA 2OZ6A 4LIVA 4OI2A 5EHDA 5JCTA 1YHFA 1NY71 1PGSA 4H3WA 4MVTA 1PGL2 2RDQA 1WA6X 3A21A 4LHSA 3MZHA 2RS53 3RPQA 3AKRA 4NIAA 1LJ7A 2YPJA 4AI9A 2GZWA 4ASMB 1JOJA 3LQCA 2W94A 4BQ3A 5FPAA 1WD4A 1U12A 4FTSA 3E5UA 2WN3A 1DQ5A 1TME3 1UCXA 2RM22 4XJWA 1HRV2 1KITA 4BQWA 1VBB3 1SLAA 3TOJA 1NOVA 5IW0A 2P3IA 4HK9A 1HJFA 4FQZA 3ZYBA 1JUIA 4EWEA 1X8MA 1TMF3 3R05A 3GZUC 2WO3A 5LBCA 2WT0A 3WW1A 2EAKA 5CISA 1CX1A 2E32A 1COV3 1PO23 1RC6A 3O1TA 4PQ9A 4LITA 2XDVA 3ZM8A 2XJTA 3VKMA 4C90A 3VDAA 1MR5A 1BXHA 2RS32 4RR3C 4L99A 2BNOA 4CUBA 2XL7A 1G9DA 5BNPA 2WNVC 1H8TB 4IE4A 5DUVA 3P3PA 3AYAA 5AVPA 4EN6B 5L9VA 4JQTA 2V5YA 5FXZA 1GQPA 3RJRA 1QHDA 3FN9A 1OQDA 2A3XA 4QU2A 5F3IA 2NYYA 2BYVE 5FYTA 3L9JT 1TME1 3M8LA 2XMLA 2WO2A 2W1SA 3K4AA 5FP8A 1F5JA 4EWAA 5BV6A 4D6QA 2ZGNA 3EO6A 4OZXA 4Y20B 3WNNA 3TWIA 1GLHA 1CIYA 1G9CA 1ZVFA 2WABA 3JZVA 1XE0A 1VMJA 1NLQA 4OHWA 4QKBA 5FOJB 3HJRA 3ZPOA 5GZGA 3VB9A 1GANA 3FE5A 2R1BA 5BNQA 3VUOA 1COV1 4WM7A 3KHCA 1PO21 1ULPA 1SLIA 1JZ7A 3B3QE 3NL1A 3WDUA 2ZEXA 1PNGA 4YW1A 5FQ0B 4Y1UA 4R8HA 2YFZA 1HLCA 3FFZA 4MX3A 4QT6A 3URFA 2UWCA 2DVAA 5DG2A 1GZTA 2CDOA 3QCWA 4NIHA 1AX0A 4QGMA 1SDDB 5HCBA 3POGA 4LKDA 4PLOA 3ZXDA 4QKNA 4JZRA 1UOJA 1G7YA 4NN0A 5JWPA 2N7GA 3JUUA 4I02A 1W06A 4CP2A 3CJXA 1D2SA 1X33A 1DCSA 5JI9A 4LXLA 2OPKA 3DN7A 3JB4C 3CL1A 5FZ8A 1ZRFA 2W95A 3TNPB 5C3PA 5K0UC 1ASJ3 2W1QA 4BJ0A 5BNOC 5KXCA 5J37A 3DF0A 4HSLA 4ZXEA 4DEVA 5JR7B 4AYUA 5AC93 3KCCA 4QB2A 2GMEA 1JYCA 2PA7A 3ZFGA 4ZU7A 1BBT2 1Q8SA 1VP6A 4QXCA 1PGW1 2B9UA 1LU1A 5GALA 5KR7A 3ES1A 3CZUA 4GALA 1HQNA 2DCTA 3AMQA 4N53A 5LA0A 1O5UA 2LUWA 2QQUA 4MHRA 1Q56A 3RSJA 2O14A 3IMMA 1DG6A 4FOVA 4BOWA 2XUMA 5FDBA 1OA4A 2W46A 4COYA 1W0OA 4QQ2A 3UESA 1UU4A 2O8OA 2WUHA 4MYEA 3T08A 2OQ6A 3BVCA 3OB8A 3BU7A 1Z7S3 4IEOA 4KWJA 4M0HA 5FMCA 2R16A 1AHSA 3OBRA 4XTPA 1ASJ1 3LB9A 4PF5A 1DIWA 1DQ6A 1UWWA 3CJIC 1SLTA 4GAZA 5CKNA 4DUXA 4PF1A 3H1YA 1QF3A 2BUKA 2CWSA 4RR3B 5JZGA 3TNQA 4I09A 2VMIA 2WNVB 1SLBA 5FOBB 1X9PA 5AC91 1R1A3 4GJYA 4UW4A 1NX9A 3GZAA 3WNXA 2A6ZA 1U5IA 1ENRA 4DO0A 2YC2A 3UKVA 4W65A 3SCFA 1AL23 1C57A 2ETEA 2VQUA 3QLQA 2GMMA 2R1DA 3PURA 4P08A 4QX7A 1KXGA 3J7LA 4BIOA 2HWE3 3KWVA 3RYPA 4CDXB 2IZWA 1HB2A 3AMHA 3MF6A 2JDUA 2VTFA 5EYYA 5IAVA 3T2PA 1WCSA 2E51A 2JG9C 4PQQA 1EUUA 1RUE3 1JI6A 2YPDA 5FZFA 1W6QB 2WZ8A 3O7OA 4YG6A 1HRI3 5IAXA 1RUJ1 2A1XA 5FZGA 1AYN2 1JH5A 1YJKA 5CNAA 5F7UA 5L7OB 1CJDA 2ZAAA 3LGRA 2PHLA 1UZYA 4RGKA 5C4WC 4FT8A 2GC3A 5LCWL 1N1SA 2WZR3 3F95A 3HQUA 1HN1A 3VL9A 1BZWA 1VBE1 3U4SA 1KS4A 1O91A 3KSCA 2VBDA 3B01A
chains in the Genus database with same CATH topology
1QJX2 4KG8A 5CU1A 1QJY1 2D6KA 5E16A 2PLV2 1G6NA 1QMJA 1AL21 2RMU3 4LE3A 1G9AA 1UKRA 5JIAA 4FPKA 1LHWA 1V9U1 2ATFA 2HWE1 4FO9A 4HVQA 3ZSMA 1VB2A 3B69A 1WBFA 4R9AA 2RS33 1QJU3 1RUE1 1AUYA 2F6BA 1O4ZA 1OHFA 4HKOA 1HRI1 1WMDA 1J59A 4YM2A 5DZFA 3BPZA 1WW4A 3A4UA 1ND3A 4OI4A 4XJZA 1RJ7A 5AFEA 2DV9A 3CEWA 3ZFEC 3U4XA 4UBHA 2WZR1 1QKQA 3VBFB 4COVA 2ZKNA 2ZMNA 3E97A 4DY3A 1N3QA 4BQ1A 4I3PA 2RMU1 3AFKA 3U10A 3MI8A 1PHMA 5KBFA 3M70A 5HCFA 2YY1A 3RRDA 2UURA 3KLSA 2ZHLA 1C3HA 2ZGMA 4Q4X2 4B29A 4PJYA 1QJU1 1UU5A 5IK5A 2JENA 1CX4A 3FC0A 4GH4B 3H8UA 2BVVA 3PTYA 2XJRA 3CU7A 2TNFA 3OD4A 2BFUL 1QY4A 4FP3A 4I0AA 5GLUA 1ND2A 3MICA 1D4M2 4RHV3 3HN1A 1H1IA 1G86A 5T5PA 4R52A 4S2GA 4CDUA 2JG9B 3K51A 5GLTA 4RSUA 3SNMA 3FJSA 3T2TA 4XQ4A 2ZPXA 5HBAA 5J48A 1G8WA 4B4PA 3BIWE 5KC5A 1O3QA 1NYWA 1POV0 3JD73 1RHI2 5DG1A 1UL9A 1KS5A 1XRUA 4U2AA 3S30A 3N7LA 4WBBA 1RMU2 1XNBA 2R072 4UW6A 4WZCA 3ZXKA 1LGNA 4GB33 2RJKA 3H1WA 2YHJA 2WSVA 2W39A 3RNSA 1VRH3 3RJ2X 2E6VA 4M3CE 2PELA 4RHV1 1PK6C 5CFDA 4AE2A 1APNA 1QNWA 2IFRA 4BMEA 2YC0A 5JOYA 4B4QA 4ZXKA 4DRRA 3HR9A 1RUNA 3R4SA 3O0WA 1IQAA 2E53A 1PO12 1OMIA 1IPJA 1EV12 3BOPA 4NR1A 1H2MA 2HWF3 4G3YC 5FO7B 3S0MA 3JD71 1VLNA 4V1PA 3ZSEA 2RR13 1K5MC 2BFUS 2I2SA 1VBA2 4JGZA 2WKKA 4PBPA 4LUMA 2WT2A 5BXXA 3GNEA 4GB31 4Y22B 5LRRA 3ENRA 3GBWA 4HT1T 1VRH1 4YM0A 3X29B 1DF0A 4JQRA 4YGBA 4DRVA 1RUG3 3VHPA 1AYN3 1IHMA 2BWCA 1CPMA 1V6LA 3LAGA 5C33A 3AFGA 3ZYIB 2GC2A 1XYOA 5FFOC 2KM2A 3OPZA 2XJVA 3NAPA 5IUQA 3WP6A 1HX6A 1GICA 2EAAA 2QVSB 2RR11 4NOTA 4CRQA 4YVSB 4I30A 2QNKA 1RJ8A 1FX5A 2JICA 3V64A 2JE9A 3PMEA 3ZXAC 2EXIA 4CEYC 5JOXA 1YUDA 4XEZA 4BM8A 1LHNA 4Q2FA 4K20A 4JVAA 1R082 3AXDA 1LHUA 1RUG1 1QU0A 1LEDA 1MZFA 1OFSA 3E5QA 5BNPC 4HANA 4JRAA 3J8F2 3TB0A 5LEJA 4IEPA 1J58A 3VZJA 1U5ZA 3B94A 4Q4W2 3WX5A 1AR83 1FATA 2DFBA 4QPIA 1V70A 2AR6A 3AMPA 4IEZA 5A3MA 3ZYRA 1C5IA 2ZAHA 4XILA 1Q8OA 4URTA 5JPNB 1RUC2 3L2HA 2ILMA 2HYKA 1PK6B 2R6QA 3PMSA 1UD1A 5FBZA 4G4FA 3WZ1A 3AKTA 5T54A 3CF6E 3WR0A 2GNTA 3DL3A 4UBGA 1POV3 1YWKA 3Q9OA 1OA2A 4K1ZA 4M3CA 5C8CA 4TWTA 2X53S 1NCQA 4Y26A 3TAYA 1RUI3 5JI7A 1XNKA 2G4IA 3IPVB 4AVTA 1K5MB 3LOBA 1AXKA 1AR81 5KXDA 2X5IC 2AGSA 4CDQA 3N4MA 3SHRA 2HWD2 4Q4V2 5FLHA 4CYDA 5DZEA 2NP0A 5KHHA 1ZZ7A 3K48A 4ORFA 2HEWF 3ZIXA 1HKDA 1AX1A 2WS91 4ISQA 1BMV2 2JG8B 1NY72 2D5HA 1B35A 1ZNPA 2WINB 2WQ4A 4WM8A 4GMP3 1YI7A 1AR73 1GV9A 4F3JA 4BWOA 3ZFGC 4XMIA 3I54A 3VBHA 4XETA 3N36A 4N53C 3BALA 1RUI1 1DQ2A 1S0CA 2SLIA 2XLAA 1A78A 4TZDA 3AM2A 1TNRA 1U5YA 4S2DA 1YIFA 4AHWA 3AP9A 2D5FA 2AZ5A 3APBA 2ZMKA 1CONA 2AUYA 3FLTA 4CEYB 3GBGA 3ME2A 1WLWA 4XFHA 2QCSB 2JECA 4LO8A 1S0BA 4K3UA 5JZGC 2A75A 2RS52 4GMP1 3OYWA 1MS9A 1AR71 3SH4A 4LE4A 2PHDA 2IXCA 3EXUA 3N35A 4WVZA 2CNAA 1V6JA 3NWKA 4AI1A 1TME2 1UPSA 1CAWB 2QZ3A 5EFUA 1ZREA 3MEPA 3NV1A 1BEV1 5T5OA 2WNUC 3E6DA 4Q0UA 3MIBA 3GZTB 2R063 4KWLA 1W6OB 1H0BA 4YGEA 1J1TA 4D7YA 4L11A 1NA1C 1COV2 4AQ2A 1PO22 1YCIA 3VDDA 4AHZA 4JGYB 2Y26A 4W6WA 1C4RA 2Q1MA 2AYHA 2PHTA 1AL0G 3VBUA 5AFBA 2HJIA 3WT3A 1NCRA 2VW2A 4KU8A 4FBFA 3V0AA 2A5ZA 1CAUB 1ZX5A 2C1FA 3NKTA 4XHXA 5JMCA 3VV1A 4XF4A 3NSTA 3AP7A 2VY0A 4FOQA 2X5IB 3JB8A 4AFBA 1CN1A 2A3WA 2VQ0A 1SBDA 4E2SA 3VZMA 3WQ7A 3CLPA 4AI0A 3AMMA 2JKBA 2PN5A 2UWAA 2PHXA 1O4TA 3VBOC 2R061 4ISRA 3PJQA 4QQLA 2LM3A 4QQOA 5K8SA 3OJBA 1A3KA 2WSUA 3D5OA 4Y24A 1ULFA 2FMDA 4AI2A 5JOWA 2DU0A 2AREA 4H7LA 3D6EA 1ZRRA 2CGPA 2Q5TA 2GNMA 1PGW2 3WHTA 1NLRA 1YIPA 3LA3A 1NE4A 4RS5B 4IV1C 3S7IA 4RQPA 3H3ZA 3A0KA 5LEKA 3RYKA 5T55A 3B93A 2NQYA 5JSRA 2E7QA 1PZ7A 2XJSA 2OZJA 3WUCA 1MZ6A 1ASJ2 2P37A 3PVBB 5H9RA 4LBQA 4FSJA 1QOTA 3A0NA 3MPBA 3WOGA 3N7JA 5ABJA 4YZ4A 1MS1A 1MQTA 4I01A 2DCKA 2PYTA 5AC92 4MXWA 1LEMA 1ZBA3 3M3EA 5JIUA 3VBSC 4RD7A 4YZ1A 5FO9B 3WV6A 1BJQA 1ZZ8A 3AKPA 2WNUB 2VMGA 2PHFA 4U36A 1Q8QA 1OLQA 1S0IA 1SEFA 2VNOA 4AQSA 3NO8A 1DZRA 2B7YA 3QOPA 1Z7S2 2TBVA 5C9AB 1NA1B 1XQNA 2XLFA 2GN3A 1YFYA 3L2YA 1N1VA 4AXOA 4X8NA 1JBCA 2XGXA 4XOGA 4IEXA 3G6JB 2ZGKA 1QXJA 3D4KA 2VUAA 1VBE2 3BODA 1N3OA 1KJLA 3E5XA 4QQPA 3N3HA 1ZBA1 1QJY2 1LODA 4K9SA 3ZN6A 1AL22 3VBRA 1ENSA 2VU9A 2PAEA 3NJZA 3KGLA 2ET7A 5HXVA 1YI9A 1RUF3 1V9U2 1J3PA 2HWE2 3LSEA 4MH0E 5CFDC 4NHKA 3R4UA 3VBOB 1U5XA 3USUB 1RUE2 5FLIA 1AJKA 1LHVA 2VPVA 5E1RA 1HRI2 1RUH1 4ONUA 2ZGTA 2ZKLA 5D1IA 1FMD3 5FREA 2LALA 2VOVA 4DOUA 2WZR2 4IV1B 1BK1A 1ZYBA 4QD2A 3O14A 4LBJA 2GH8A 4JGZC 4FXKB 5A3LA 1H9PA 3WDTA 1JHNA 5LK7B 5CG8A 2VOWA 3IDCB 2YZ4A 3LKJA 2RMU2 4I3GA 4DY5A 2A70A 1RUF1 2BPA2 2A6WA 1DHKB 1DQ0A 1QJU2 4WVWA 5DZGA 4G9SB 4MXVA 2WT1A 4O9GA 1OA3A 2VMHA 5I8TA 3O0VA 5A32A 3S6PA 1S0JA 3VBSB 1MVQA 4TSVA 2BW8A 1NXMA 1FMD1 4HN1A 4AW7A 3WUDA 1LKNA 1SCRA 1PM7A 1QQP3 3KT4A 1SQ4A 2IXKA 1REFA 2ZACA 1LOFA 3JCIA 5J98B 3QH6A 2QQPA 2QJVA 1GQGA 2OW4A 1JN2P 2VVEA 1WW7A 3D8CA 5FLJA 2DCZA 4GULA 1ZZCA 5TSWA 2YGMA 3I7DA 4IV3A 3FLRA 4QPIC 1TQ5A 2OUJA 2R49A 3FUOA 4IEQA 4NVPA 4IEVA 2H0BA 2WJSA 4AEKA 3BB6A 1UIJA 2VH9A 4JV4A 4RHV2 1QQP1 2OIIA 4MGZE 3ZN4A 4WZFA 2ZGQA 3ZMNA 2Q30A 4ATFA 4COUA 2C9AA 1HV0A 5C8CC 1S0DA 4XFCA 1NCQC 1H9WA 4JDOA 5CVRA 2XVKA 3JD72 4IXLA 5BNNA 2CGOA 5EXOA 2RHPA 2WA3A 4JGZB 2GMPA 5BYNA 4CDQC 1YO8A 5H9QA 1WMEA 2JE7A 4YSFA 4XJUA 4GB32 4HVOA 4AHXA 4QM8A 4E4DX 1M06G 4K7JA 1W0PA 1KDMA 1VRH2 1B35C 1QWRA 4R4ZA 2W68A 3MIGA 1RUJ3 4WM8C 1DBNA 5CFCA 2P3KA 3J4UH 1J3RA 4Y4YA 5IK8A 1H30A 2P2KA 2I74A 4NO4A 3AP5A 1V6NA 1G9BA 1SDWA 1VBE3 1DGWA 4NPRA 3JQWA 3VBHC 1WCKA 4AWDA 2BNNA 2RS13 5T5JA 1YNAA 3ZXFA 1QJY3 2HWF2 4XF9A 3UJQA 3TYJA 2Y0IA 5D8AA 3VZLA 4AVAA 3M7AA 3RG0A 1NQDA 2FZ2A 2RR12 3MGUA 2CY6A 1ZRCA 1V9U3 2XBO3 2Q4SA 4XBLA 4AVVA 1WMFA 2QKDA 4PIZA 3W59A 5J36A 1BQPA 2VOKA 3IWZA 1LECA 4P5HA 1RUG2 1QDCA 1PVC3 3MIEA 4TYSA 1UF2C 2ZCWA 5A33B 5GLWA 1LCLA 1SCSA 1A6CA 1CAVA 1DGWX 2VECA 1IGOA 1FV2A 3H7YA 4D94A 4RL7A 4YG0A 2RS11 1IKPA 1VAMA 4KBBA 3MF9A 3NV3A 3RMYA 5JSPA 5K0UB 3AJZA 1UIKA 3IBMA 2XBO1 2EIGA 2P3JA 5E89A 5BNOB 1GNZA 5JVVA 3VDDC 2D6LX 1AR63 5E88A 4A2UA 3VBUC 1VB4A 4XHBA 1NCRC 2PFWA 4INDA 4YRDA 1F8VA 2FBEA 2EF6A 4ZU5A 1PVC1 4L2NA 1C8M3 3V56A 2JDZA 4LO7A 4Q0QA 4AG4A 1MZEA 1AR82 2ZZJA 1W6NB 1VJ2A 2GALA 3OGGA 4S2HA 1BVP1 2VOXA 1Y3TA 4IEUA 2WS92 4DNYA 1B35B 4BH9A 2D3SA 4WVMB 4B7EA 3CJIB 4XFBA 3LSDA 2NMOA 1AR61 1CQ9A 2VW0A 2Z5WA 3INAA 2ZS6B 4CDWC 5GKAC 3OF1A 1IS4A 4AEDA 4EWDA 4Y1YA 4XYXA 5GZFA 3KD4A 3WQ1A 1HRV1 2NM1A 4YVWC 4YZ5A 1R1ZA 1F2NA 3AZYA 1C8M1 1RUI2 4HKLA 1AJOA 4HSJA 4RQPC 3GYDA 3I4IA 1RVF3 3TN93 3USSA 2VXRA 4HKWA 2DVGA 3RZZA 5T3NA 5KXBA 4MUVA 3ZVXA 4XMAA 1QXRA 1QH6A 4K1YA 2O1QA 4EV0A 4Z07A 2CL2A 1H8TA 1V6KA 3I59B 1TE1B 1MQTC 5CBLA 1AR72 1W6PB 4ITCA 3FUQA 5C4WB 2BNMA 4P9GA 3D82A 5I8YA 3NVCA 3OY8A 3VGIA 1SBFA 1KD7A 4KWKA 4Y20A 4GQ7A 4AHYA 1DYKA 1BEV2 1RVF1 3OGJA 3TN91 2MNGA 2QE3A 5E8AA 3ZO0B 2GDFA 2UYAA 4YNIA 3M4FA 2XL9A 3ROUA 4QMAA 2XJUA 4FXGB 2D98A 2CWMA 2GH2A 1LOGA 4BIFA 1ULGA 5FQ0A 2JEMA 1IOAA 2DURA 1YYNA 3VBUB 3WW2A 3WINE 4FOYA 4XF3A 4M00A 4PLNA 3V0AB 4RA0A 1O3RA 4GMP0 5CA6A 3ALQA 1CR7A 2IFWA 3WXPA 3ZFEB 5KHJA 1DZQA 2CAVA 5I8SA 2WLPA 1GZCA 1OOPA 2Z2SB 4HZFA 3VBRC 4OLLA 2RJLA 4BZ4A 2DTYA 1EP0A 1HV1A 2ZGUA 1PMIA 1PIV3 2YXSA 4FPYA 4FPCA 2ZX3A 4GWMA 2R062 1B09A 4CP1A 1MS8A 1DQ1A 1RITA 3HQXA 4CDWB 2A7AA 1BYHA 4DQAA 1Z0HA 3H50A 1MEC3 3MLLA 3AK0A 1RINA 1MS5A 4YVWB 1CAXB 2K9ZA 2HWC3 2YYOA 4H14A 4K21A 2FQPA 2R043 3WDXA 4DFSA 3ES4A 4N90A 1WD3A 4HFSA 5I0SA 3VZKA 3UKNA 4D7TA 2CTVA 2D6PA 2CV6A 1PIV1 2DVDA 3B7MA 4RR3A 3WG3A 1BKZA 2DUQA 1L3JA 4DB5A 4E2GA 3AP6A 4R9BA 1O3SA 2XLGA 1MACA 1W2UA 5JOZA 3ELNA 4Y1VA 1BCXA 2K2SA 2Z69A 3DGTA 4GWNA 3ZDSA 1MEC1 4FPJA 4XFGA 1R093 2KA3A 3KT1A 5I0RA 2VGDA 4RGGA 3SCHA 4AVCA 2HWC1 4XIKA 2RE9A 3ZFFA 4CDXA 4IESA 4P9LA 1FPN3 5H9PA 1ZA4A 2R041 1RUD3 2WS93 5J09A 4A3XA 3SMHA 3RYRA 2ENRA 1LOFC 1GBGA 3HBZA 4WM7C 4F83A 4NWVA 5L7OA 5I93A 3VZOA 1LB2A 3KMHA 3NW4A 1WA4A 1FAYA 3VL8A 2BVBA 4DS0A 4HPKA 1QJX1 1W6MB 2EA7A 1AX2A 1LTEA 2EALA 2V09A 2YGLA 2XVLA 1CIWA 1S2BA 4IV3C 4XQWA 1WLCA 4XDQA 1FYUA 1ZBA2 1OI6A 1R091 2B39A 4NWWA 2CGNA 3OCPA 1FPN1 3FZ3A 1RUD1 1OFNA 2YDEA 4Z92B 1FNYA 1CGPA 4R9CA 3IIAA 4XFIA 3DPRA 3VN4A 3U11A 1VBC1 3E6CC 1RUH2 4SLIA 4B4RA 3VBFA 1D4VB 4P9XA 1AXYA 2ARBA 3FBMA 1Q5OA 3VKLA 4OHXA 2GC1A 4I0BA 1BEV3 4KL1A 3ZXEA 2PHWA 4MSVA 1YXWA 4JDMA 1G9FA 5BY5A 2BEOA 3IT8A 4LA2A 3SITA 3WDWA 2QDRA 4Q4X1 4COZA 1JYIA 1RUF2 3AZVA 1YRZA 3B02A 4WVVA 5I0TA 4B3NA 4XE9A 5CFCC 1ENXA 2O0OA 4GH4A 1PZ9A 5L73A 5BNPB 1DFQA 1NQJA 4JTNA 5SV5A 2G9GA 4Q1PA 5CADA 3W9AA 2QUOA 4IEWA 1S0GA 2FMYA 1IS3A 1D4M1 1FMD2 4DPNA 4FQ4A 1RTVA 3PLQA 1XXNA 2JG9A 1SFNA 3EJKA 4GKXA 4XW3A 2C0ZA 4XZPA 4YW3A 4Z2WA 4RGAA 2XPJA 1Q3EA 1AR93 4WM7B 2UWBA 5CB7A 1AXZA 4W6XA 1IKQA 5FRAA 3AXEA 4FP2A 5LK5A 2WNEA 1OQEA 1DGLA 3UJOA 3SLIA 2MPFA 2EVXA 4IV3B 2NMNA 2HEVF 4DMIA 4AK3A 2IXLA 1UU6A 3MYXA 3OTFA 4OI0A 3MLJA 4AEMA 3MLKA 4N7UA 2X8KA 4D7SA 1VBD3 4AEJA 2PAMA 4H7MA 5B2GB 3WG1A 5JAXA 1QQP2 2P34A 1SLLA 1TNFA 1SLCA 2ZOEB 1RB8G 4NHLA 4EN0A 1AR91 2PHRA 1ZM1A 2DF7A 1H1AA 4GIQA 2H0VA 3ZFGB 5JSOA 1XYNA 1ND3C 2ZABA 1N1YA 3V65A 4N53B 2HWB3 1C1LA 3J26N 4META 1ALYA 1IPKA 5L36A 1SFYA 2WZPP 2D40A 4R9DA 3ILFA 2DU1A 4M0NA 4TLFA 4Y22A 5H9SA 5CG9A 4LO6B 1DDLA 1ZZBA 2ZBJA 3LOIA 3AZWA 3AZXA 3M3CA 1FOD3 1GZWA 4JAAA 4KGGA 1VBD1 5CFCB 2B8MA 3IDBB 3KGZA 4Q8LA 3PHMA 2AENA 2GAUA 3EHKA 2Z42A 4K8FA 4ATEA 3TBDA 3U07A 5JZGB 1KFUL 1V6IA 4AVSA 1QNYA 4AEDC 2QDNA 5FMOL 4KU7A 2ZA9A 3ZX7A 4QGLA 4KGQA 3MDPA 2DTWA 3ILRA 1IS6A 4JDNA 2HWB1 4YVSA 2WFF3 4LBMA 2IWGB 3JU9A 3RQ0A 4MGIE 1RIRA 1ND2C 5FCCA 2YROA 3SISA 5ACA3 1Y43B 4CDUC 5EV7A 3RMXA 4BLJA 2R0HA 1HDKA 4HN0A 3AJYA 1NZCA 2ZX1A 1FOD1 3OD0A 3J8F1 1H8TC 1RUH3 1F31A 1RUJ2 3ZPYA 4PIXA 3MW3A 1X50A 2FZ1A 1DU3D 3KZ4C 4OHZA 1CPNA 2W52A 1LOBA 3ZSLA 3WP5A 2ZX4A 4A7YA 2RS12 1GQHA 2ZGSA 4FTEA 1Q43A 4R4XA 2WFF1 1PK6A 4MLOA 1AYM3 3QACA 1LOEA 3ZIWA 5JPMB 1OQ1A 3MIHA 4YM3A 2XBO2 4FPEA 1LHOA 5ACA1 4KQ7A 2ARXA 2VG9A 2LTNA 3AYDA 3N7MA 4LULA 3D0JA 1UKGA 5GM0A 1S1AA 3MW4A 2VW1A 4QM9A 1C8NA 3VHRA 4FPHA 3IPVA 5T52A 1DQ4A 2HEYF 1PVC2 4C91A 1ND3B 1O3TA 1MS3A 1K5MA 1CESA 1N3PA 2ES3A 2ZMLA 4FCAA 4E9KA 3SCGA 3V0BA 2HWD1 4XJ9A 4YARA 5SV8A 4N43A 1ZZ6A 4CEWA 4MV2A 1OOPC 1BMV1 5KWRA 2E7TA 4XBQA 4QGNA 2JG8A 1KJR<