3WW2A

X-ray structures of cellulomonas parahominis l-ribose isomerase with l-psicose
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
248
structure length
241
Chain Sequence
TRTAISRREYDEWLSEAASLARALRYPVTPEMVNDSAGIVFGDDQYEAFAHGLWSREPYEVMVILESLNEPAVDGLPAAGAAHAEYSGLCDKLMIVHPGKFCPPHFHQRKTESYEVVLGEMEVFYAPEPVTVGDDDVLSFSPMPEGSPWPEGVALPAGREDSYAGLTSYVRLRAGDPKFVMHRKHLHAFRCPADSPVPLVVREVSTYSHEPAAPLPQWRGLHDNTFVAEAANSGRLATAIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ribose isomerase
publication title Essentiality of tetramer formation of Cellulomonas parahominis L-ribose isomerase involved in novel L-ribose metabolic pathway.
pubmed doi rcsb
source organism Cellulomonas parahominis
molecule tags Isomerase
total genus 60
structure length 241
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ww2A00
2CV6A 1DZTA 4GULA 5E1RA 5C6CA 1QXRA 1NE6A 3SCHA 5FPXA 2IC1A 4LUMA 1RUOA 2PHLA 1QXJA 1SFNA 1IPKA 3H8UA 3U11A 2PAKA 3CLPA 4LEJA 3EJKA 4J1XA 1WA4A 4ORFA 1RUNA 4MGYE 2C0ZA 5JSPA 3RYKA 4IEPA 3E6BA 5KHGA 4AVAA 2B9UA 3CO2A 1ZNPA 4RD7A 1VJ2A 1CAVA 1J58A 1ZZCA 4HSLA 4UXAA 5CVRA 1J3PA 4LUKA 4ZU4A 3H3UA 3DKWA 2Z2SB 4HSJA 5JSRA 4XFFA 1J3QA 4KL1A 5FCCA 2IXLA 3JZVA 3S7EA 3E5UA 3E6CC 4META 4LA2A 4BHPA 1O7FA 4R8HA 3QOPA 1WGPA 4YRDA 4AQ6A 3H1WA 5FLJA 2PAMA 4MX3A 4XFCA 1J1LA 5KHIA 4QMAA 3QACA 2H0VA 4AVCA 1SEFA 3NSTA 2VPVA 3LA3A 4IESA 3TNQA 1O3SA 1OMIA 1TQ5A 3MZHA 3M3IA 1I6XA 3FX3A 4OLLA 1O5LA 1Q5OA 3EBRA 3H1MA 3HIFA 4O9GA 1NZCA 3KGZA 4X6RB 1CAVB 3U0ZA 1O4TA 1ZZBA 4Q0PA 5CU1A 5FLIA 4XF1A 1Y9QA 2Q4SA 1X82A 4LULA 3WW2A 3NW4A 2EAAA 1QY4A 4J1WA 1LB2A 5I91A 4I09A 4LTAA 4Q0UA 5FPZA 3BPZA 1O3RA 1YWKA 4H7LA 1LRHA 3UKNA 3ES4A 4HVOA 4L11A 1O3QA 5EFUA 3PNAA 3RYPA 3I54A 2XL9A 4EROA 4KWLA 4BIFA 4QGNA 4ONUA 5AVPA 4I2OA 2KXLA 1ZZ6A 5I0SA 1H1IA 4I02A 3PLQA 1GQHA 1NYWA 1UW8A 4QXKA 3CEWA 3RDIA 4IEVA 2WC2A 2XGXA 3L2HA 5I8SA 4QX5A 5LRSA 2GU9A 4WBBA 2PA7A 1UD1A 4O9EA 1PMIA 4IEWA 5D1IA 3FJSA 3VHRA 3RYRA 2ETEA 4N9IA 1ZZ7A 2DCTA 4I0BA 1I5ZA 5CADA 3SMHA 2IXHA 2XKPA 4HN0A 4I0AA 5LEJA 2Y0OA 4JTNA 3ZDSA 3LZZA 1O3TA 1ZRFA 1RC6A 4LA3A 1CX4A 3ES1A 4IEZA 2B5HA 2VQAA 1ZRDA 4E2QA 1YFYA 4FAGA 3NVCA 3UKVA 2QCSB 4HMZA 3IIAA 2PHDA 3NL1A 4F8AA 2Z69A 5JAXA 2UYAA 4K8FA 3I59A 1SQ4A 2P17A 4R52A 3BB6A 4XF9A 1X8EA 3LWCA 3RZZA 1X7NA 2ET7A 2MPFA 3GBFA 2O8QA 2OZ6A 2HJIA 3LA7A 4HN1A 2PYTA 1QWRA 4FAHA 3FZ3A 1CGPA 2GC1A 3E97A 1G6NA 5J7MA 4MV2A 1UIKA 2ZKLA 3KMHA 1YUDA 4UBHA 2IXIA 4Z82A 1CAXB 4HVQA 1LR5A 4JTOA 4BYYA 4I3PA 5I0TA 3WW3A 1DGWA 4L2NA 1CAWA 1EYBA 3LOIA 5T3NA 1Y3TA 5I93A 4XFHA 3UKTA 4QGMA 3BU7A 3C3VA 5HI0A 1O5UA 2PFWA 4PIZA 4AXOA 4NVPA 2BYVE 2IXJA 2Q1ZB 4IEOA 2FQPA 4TLFA 5I8YA 2PQQA 2XHKA 2GC3A 4Q0SA 3KSCA 3GYDA 2B8MA 1IPJA 4HLTA 4PIXA 4X6QB 1JUHA 2BEOA 4FT8A 1ZZ8A 3E5QA 3LAGA 4IEYA 5EZWA 4F7ZA 4XF0A 4XFAA 5JSOA 1L3JA 5KBFA 1U12A 2IXCA 3OD0A 4Q29A 3ETQA 1DZRA 4IEUA 4JVAA 3IDCB 3H9AA 4XFBA 1ZX5A 2FMYA 3H1YA 4D7SA 4E2GA 4EWDA 5I0RA 3ACLA 4CYDA 1ZREA 2H6BA 2V09A 3FE5A 1CAUA 5KHJA 2BGCA 3U10A 2OYZA 1HW5A 3ROUA 3CF6E 4KU8A 3E6DA 4KWKA 1J59A 4KWJA 1XRUA 1XE8A 5J48A 3I7DA 1OD5A 1UPIA 5J3UA 2GAUA 3D0JA 4Z07A 4YSFA 2MNGA 1H1MA 4MUVA 3EHKA 2GZWA 4QM8A 3MPBA 4XFGA 5KHKA 2IXKA 2Q30A 3OGJA 2QDRA 4BH9A 1Q43A 4EWEA 2QJVA 1VR3A 2Q0AA 4XFIA 4EWAA 4FBFA 4Q0QA 5C8WA 4OFGA 1YHFA 1VP6A 3BCWA 1YFWA 3OF1A 4MGIE 3IWZA 2H6CA 2ET1A 1OI6A 4IEXA 2GC2A 1J3RA 3SCGA 5BY5A 4D7TA 3S7IA 1GQGA 3PVBB 2F4PA 3SCFA 5BXXA 5I8TA 1NXMA 4YNIA 2XL7A 2VECA 2CAVA 3NKTA 5FLHA 1OFNA 2QVSB 2OA2A 3RPQA 2K9ZA 3FFQA 1RTVA 2ATFA 3D82A 4IETA 1YLLA 5FQ0A 4QGLA 2UYBA 2PTMA 2EA7A 1ZRCA 4MGKE 5JCTA 5BPXA 1ZRRA 5LEKA 2XLFA 3EO6A 2O1QA 4IEQA 5LRRA 4YYOA 1Q3EA 3CL1A 2BNNA 1EPZA 3DL3A 4AVBA 2CAUA 3I59B 1ZZ9A 4XF4A 2XKOA 3FHIB 1FXZA 4AQ2A 4B29A 2MHFA 3HT2A 4PIYA 3D0SA 2QNKA 2HKXA 1FT9A 4I01A 3IBMA 2ZCWA 2GH2A 3MYXA 4WZCA 5BV6A 4KU7A 1WLTA 3B02A 3H7JA 3OTFA 4LLOA 4N9HA 1LKNA 3SHRA 2E9QA 4E2SA 5FQ0B 5JR7B 4XETA 4YARA 3ST7A 2UY8A 4XEZA 5F1RA 1YFUA 3FWEA 1EY2A 3G7DA 5I0UA 2D93A 3NJZA 3WW4A 3DV8A 1PM7A 1CAWB 4A2UA 3O14A 3S0MA 2K0GA 4QM9A 3LA2A 4ZU5A 2WFPA 5BUVA 3MDPA 3KCCA 1DGRA 3SXWA 3H50A 4IERA 4PJYA 3H3ZA 3H7YA 1ZVFA 2I45A 1V70A 2D5HA 3RNSA 1NE4A 2EVXA 3HQXA 3E5XA 3TNPB 1YFXA 2XLGA 4UBGA 4HBNA 2XLAA 5E16A 4Q0VA 4P9GA 3WW1A 3N4MA 2PAEA 2N7GA 2UY9A 3EQEA 3HT1A 2GC0A 4XF3A 1UCXA 4JV4A 3M70A 1EP0A 4EV0A 1XE7A 3IDBB 2D5FA 4ZU7A 2D40A 3ELNA 2BNOA 3CJXA 4MZUA 3USSA 4HVRA 1FI2A 2OZJA 3KGLA 3BALA 4HZFA 4MH0E 4MGZE 5K8SA 1UIJA 1RGSA 5KHHA 1CAUB 5FDBA 3DN7A 2BNMA 4WVZA 2CGPA 4DINB 1X8MA 2OPKA 1RL3A 3OCPA 1CAXA 3R6SA
chains in the Genus database with same CATH superfamily
1RUD3 2CV6A 3V0BB 3NRUA 3ABZA 3OBTA 1AHSA 1QKQA 1WW4A 4QU2A 2XQRA 3SCHA 3VDCA 3ZFGA 2QUOA 1RUH2 2PHLA 3B01A 4FPHA 1F35A 1NOVA 4D69A 3ECQA 1ENSA 1NLRA 1V6LA 4JGZC 3ZPYA 4JZRA 4AFDA 4LEJA 4CCCA 3MV11 1OVSA 1WA4A 4ORFA 5EYYA 2K2SA 1F4HA 3H0OA 3P6BA 3VBUB 2EIEA 4COVA 1LESA 4BK5A 3E6BA 4LBJA 5KHGA 1EPWA 4UF0B 4CPBD 3VL9A 3GNEA 4AVAA 4Q4X2 1HQNA 2B9UA 2R30A 5GM0A 1MPXA 1DYPA 4RGAA 2BDRA 1WCUA 4NR1A 4AZZA 4E27A 1ZZCA 2LROA 2ZTNA 3J7NA 4LUKA 1UMHA 5CVRA 1OT5A 3OSDA 4UFHA 1GKBA 3L2YA 2ZEWA 5FZHA 3VHPA 5A7OA 2Z2SB 4COYA 5JSRA 3NV3A 4G9SB 2AR6A 2LALA 1W8TA 1J3QA 5K7PA 3BKZA 3B5LB 4CXXA 2VMFA 4RSUA 2HWF3 2IXLA 2X10A 3IM0A 3JZVA 3E5UA 4P08A 3FHQA 5FPUA 4QKNA 4BHPA 1VIWB 1O7FA 2E32A 4LLFA 3QOPA 2W9XA 4AQ6A 1BKZA 1POQA 2GNBA 4CDQA 3MIFA 1L7LA 1PO12 3SH4A 4CDUB 5FZ6A 2FDKA 5EYXA 2R49A 3CJIB 4A41A 1UAIA 2PMWB 3QACA 2L9LA 2WFF1 3M3OA 1SEFA 2ORZA 5FZFA 4AHZA 2W95A 1VBD3 4N43B 4CP2A 4LE3A 3C7FA 5FOJB 4TZDA 1Y4WA 1ND2A 3LA3A 4QB6A 3SC7X 3VDDC 3RZHA 2LTNA 1PNGA 4AOCA 3LFIA 1O3SA 3HVDA 1LODA 4RHV3 2JG9A 3MICA 1VAKA 4LOTA 3MZHA 4BJ0A 4YZ4A 3FX3A 4Q27A 1O5LA 2WSVA 5H9RA 3H1MA 1QJU1 3CDZB 2OVUA 3KGZA 1RUF1 3SISA 3U0ZA 2G4IA 5T55A 2XBO1 5FUNA 3AFKA 3OUIA 1GOFA 2X53S 1AYM1 5T5OA 2JDYA 1Y9QA 1WCQA 4XJAA 3PUAA 3TEYA 4K20A 2HWC3 1D4M1 1W2TA 4JRLA 5KR7A 2R061 3WY6A 1N1SA 1VALA 2RM22 1SBEA 1RUI1 4PBPA 5JOZA 3V56A 1WKYA 4GH4A 4CUCA 2WN2A 1IQAA 5APAA 4DXZA 1QY4A 4FPCA 2WYFA 1SLIA 3C7OA 3C8XA 1LB2A 1UQXA 1ZBE1 4CUAA 2YROA 4LTAA 1UF2C 5AVAA 3BPZA 3VHNA 1O3RA 2MEV1 3PHMA 1ULCA 1G8WA 1YJKA 4ASKA 1VRH2 3ES4A 4TLGA 5L73A 3RI8A 3KB5A 3ZFEC 4A44A 4CA9A 5LA0A 5EFUA 3RYPA 4AEJA 3THPA 4CUGA 2C4XA 5D8AA 2XL9A 5DUUA 5EJZB 4CP9B 4BIFA 4QGNA 4ONUA 2LUWA 5AVPA 2VG9A 2XQXA 4UFMA 3LB9A 5GZEA 5I0SA 1GNZA 1UYZA 2YU1A 4BA6A 1JYCA 2VVFA 5FJKA 5M0TA 1AYN3 1HRV3 1PO22 4IEVA 3SQOA 3FHAA 4Y5SA 1D2SA 5KC6A 5FREA 5DPNA 3MW3A 2Z4FA 4Y22A 5CFDC 4XMIA 5B2GB 1HQLA 4ASLA 1V9U1 3ETPA 4FP3A 1PNFA 4WM7C 3NWKA 4AI9A 1I5ZA 3AC0A 5CADA 2WZ8A 3DXTA 2YDEA 4I0AA 1V6OA 4XAEA 3O1UA 4JTNA 5A70A 3C7HA 1SCSA 1BQPA 3LZZA 1S0EA 5C3OA 4XQWA 1ZRFA 1H9WA 1JW6A 2VZSA 1WMXA 4OHXA 1UOBA 1CX4A 1YI7A 3ES1A 2VQAA 1K5MA 3WQ0A 1ZRDA 3HQRA 4FAGA 3MFCA 1JU4A 2QCSB 2PHDA 4AGVA 4K8FA 5HBAA 4CEYC 4Y24A 1SQ4A 2Z42A 4DMIA 3I3DA 4XF9A 2VOWA 4NAMA 4B4RA 4DY3A 1G9DA 4GD4A 5F5QA 4NROA 5IK5A 2KA3A 3ZN6B 2XVLA 1W04A 5F3IA 1VBA2 3UJOA 1FMD2 2FCTA 3SLIA 3JU9A 2VC9A 2OZ6A 1TME2 3B3QE 1OXCA 3LA7A 5DDJ1 5JZGA 3O1RA 1VLNA 1PIV2 4FXKB 5C3SA 4IGPA 4B7KA 3U14A 1QJZA 4DQAA 2J1AA 1G6NA 4AL9A 1CESA 2ZKLA 2R0FA 2ZGQA 4ZS3A 4FSJA 2IXIA 2DVDA 1W03A 2VNVA 1K12A 2C24A 1CAXB 1DGRN 2A3XA 5CG8A 1R082 1LR5A 2BGPA 5T54A 4BYYA 3CU7A 4I3PA 3ZFFC 5JXHA 1CX1A 3ZXLA 3IZOA 4JDNA 5I0TA 1ZYBA 2QE3A 5EXOA 3ZFGB 1NAEA 1PGSA 1NCRA 1VMHA 1Y3TA 4N90A 2EALA 3I2DA 4QGMA 2HWB2 2OQ6A 3BU7A 2ZHKA 3KF5A 4FPFA 5D2AA 5JXIA 3C3VA 3U07A 4AGRA 1JZ8A 3ZR5A 1NXD1 1O5UA 2IFWA 1RUC3 3BODA 5FIXA 2XB6C 4PIZA 5F2WA 4EN8B 5J09A 2IXJA 5DUXA 3J8F1 2PQQA 3PDQA 2XHKA 1QNWA 2R073 2ZGNA 4NHKA 4Q0SA 3CNAA 1VBC1 3K3OA 3IKWA 2D3SA 2DTYA 2EICA 4PIXA 1K42A 2W5FA 1WD3A 4FT8A 5FP8A 5JVVA 1CJPA 1JUIA 1CIWA 3CZUA 2Q1MA 3RSJA 4F7ZA 4HK9A 4HL0A 4XF0A 2E31A 1BK0A 3MIEA 1W2NA 3VD5A 3NJXA 1U12A 2RDSA 2D6KA 1UZVA 2KR2A 3POFA 1GANA 1WW7A 4RFRB 1T2XA 2G19A 4H55A 4IEUA 1NKGA 1C8M1 1NUKA 3IDCB 4W6YA 2WWSA 4CDQB 1SDDB 4XUTA 4D7SA 2V4VA 1UNBA 2VOXA 4BQ3A 1VBE2 3A7QA 4N53A 5ANNA 4EN9B 3AJYA 4J6GA 1K45A 3SH3A 2WL1A 1S2BA 2VBBA 3FE5A 4EN7B 5A6QA 4LBMA 4RS5A 2W1QA 1OBNA 1DQ4A 1HQWA 3ZYFA 1FOD3 3I2JA 3AZZA 3AYEA 2P6HA 5FK7A 1E5SA 4GQ7A 4HOOA 3JUUA 5A3WA 4KU8A 3BPSA 1OA3A 1LHWA 2OUJA 1STMA 2ZGKA 2OXBA 2D6MA 4NWWA 2D6NA 2JX9A 2ZAAA 3OJBA 4KWJA 4PDWC 5E6HA 4XPVA 3VKOA 2UWBA 1GU3A 2PQSA 2ZA9A 2WLPA 2JG8A 2WFF2 3ACFA 3RG0A 4CU6A 5BNOB 2JDMA 1PK6C 4FI9A 3D0JA 4P5YA 2MNGA 1IKQA 1H1MA 2VH9A 1CZTA 4MUVA 3EB7A 1SFPA 3KHBA 3EHKA 4QB2A 3GJAA 3MPBA 4GWMA 1I9RA 2WZR1 3OGJA 4GH4B 5FZOB 1Q43A 2RV9A 1JYVA 1RUD2 4EWEA 3UGFA 3LIHA 4XJ9A 5LBBA 2QJVA 5A6YA 4OMDA 1QJU2 1VR3A 3AXEA 1E57A 3DPRA 3N9LA 5ANQA 4A7ZA 2I74A 1ZRIA 1SPPA 5FUPA 1REDA 1AYM2 1NQDA 2VU9A 1MR5A 3D5OA 4IL7A 4E4SA 1YFWA 4LNVA 3JBG1 2VJXA 4HPKA 2R062 4Y20A 2XPJA 2ET1A 1RUI2 4X8NA 1HXS3 5D8AB 1J3RA 1WMFA 4LKDA 5E8AA 3T0DA 5ABJB 3S7IA 2JDUA 4AI1A 4ZONA 1GQGA 4XUPA 1KEXA 4YPJA 4Y33A 1ZBE2 3SCFA 4PBOA 2BPA2 5C9AC 1W6NB 3VUOA 3F95A 5FR3A 3NNMA 2CAVA 1B35C 1S55A 1XNCA 5A33A 2RMU2 1GZ9A 4QDQA 5FLHA 3A22A 4CU9A 5FY5A 2ADDA 4O7XA 2VQUA 4CXWA 2F17A 1RUH3 4K6BA 2ERFA 1W3XA 2J1VA 1VBB3 2CY6A 2XWJB 5DUVA 4DY5A 1QJY1 1RTVA 1ZA7A 1MVQA 4PI0A 2ZZJA 4BE3A 4GKYA 1LHUA 1APNA 1GUIA 5A7QA 2UYBA 2ZABA 4HANA 4D94A 2EA7A 3K4DA 3SH5A 3JQXA 2XUMA 4MGKE 1MS8A 2WN3A 4Q4X3 1JYXA 4JKMA 5BPXA 3VBSA 2O1QA 4IEQA 3VBHA 3POSA 4JCKA 5LRRA 3GZUC 5LK5A 1Q3EA 1VB2A 2OIIA 3ACGA 4K1YA 3HEIA 3H8OA 5FZ7A 3WCSA 1NA1C 1W6OA 1QQP1 2ZACA 3N9MA 1V9U2 1DP0A 2YYOA 3WOGA 3ZDVA 2RE9A 2BWCA 2VTFA 4P9IA 1ZZ9A 3M7AA 1ASJ3 4A42A 3FHIB 2B39A 3TAYA 4B29A 1LAJA 5A3NA 2MHFA 2IFRA 1QF3A 4Y1XA 3POJA 4OZOA 4PIYA 4DZGA 4LHNA 4LKFA 5A3TA 5CAZA 1H8TA 2CWMA 5F37A 5FYUA 5KXEA 2HWC2 1PO13 1CVNA 4YGDA 3IBMA 4YFWA 2GH2A 2X29A 3ZR6A 2JD4A 5BV6A 3RMYA 4KU7A 1ULPA 5TSWA 1OC1A 2W94A 1TMF1 4M01A 4RA0A 5C8CA 3QCWA 4LLOA 2XJUA 1Q8PA 3SHRA 5K0UA 2E9QA 3WNPA 5BNNB 2J42A 2JXAA 1DU3D 4YW3A 5JR7B 1GWLA 3TN91 3EMRA 4YGBA 3NMBA 4H14A 1MS0A 1VE0A 5F5AA 3O12A 3UNPA 2ENRA 5LA9A 2DURA 3LQCA 1S0BA 1EY2A 1ND3C 2D93A 2PHWA 4AEDB 1JYTA 4FPOB 1PM7A 1NCRB 1Q8SA 4I30A 4U36A 2R041 4FPJA 3VBFA 1H6XA 4LMFA 4BWOA 1TZOA 2SLIA 1W6MA 4JHZA 4FP2A 4B1MA 4ZY9A 5JMCA 2Y6FA 4Q8LA 1XNAA 5GKAC 2QZ3A 3JCIA 4AFBA 5CKNA 4Q4W1 1NZIA 5J37A 1AYN2 2HH9A 1G86A 2RM23 3KCCA 5FZGA 3SXWA 2Y6KA 3VGIA 5JOXA 5JPNB 4LE4A 2VUJA 2A7AA 2P3JA 1XYOA 4OUMA 2VCAA 3VKFC 3H3ZA 4M3CE 4R4ZA 4XUOA 1FV2A 2RJ2A 1GZTA 2WYSA 4QPIB 2XJPA 3V0BA 1N1YA 3I2FA 3QH7A 4LORA 2EVXA 1WLWA 3HQXA 5FKBA 4KI5M 3WF4A 2QQUA 3M2MA 1QIQA 2ZHMA 1IS3A 2ARAA 1IS4A 1GICA 2XLGA 3VLBB 2DU0A 4UBGA 1WZXA 3T0BA 2XLAA 5E16A 4GB33 3AMNA 3VDBA 3K2OA 1SHWB 1E5HA 2JD9A 4P9GA 1VRH3 1ZBA3 3WW1A 5FWJA 2N7GA 2A3WA 2B7YA 5CKMA 3AX4A 3TOJA 5A1LA 3B7MA 3HT1A 3O0VA 5HCBA 1AL21 5FP3A 4UF0A 5F3GA 3ZIWA 4JV4A 4SLIA 4YG3A 5A7WA 2GP3A 3IDBB 5ACA1 1TEIA 2Y34A 4IQPA 5FPAA 4XAAA 2FD8A 1PO23 1RHI1 3JD73 1H2NA 1KFUL 4HVRA 4LKSA 2OZJA 2W0XA 4QDRA 1EUTA 1W39A 3AKQA 4XZPA 3VD7A 5G04L 5FDBA 2XJSA 5GLTA 1OH3A 1AR73 4GMP1 4CU7A 2QZ2A 1OF3A 2J1EA 1HN0A 1X8MA 3H3LA 4FOVA 4AWDA 2VOKA 4ATEA 3OCPA 5DAPA 2BFUS 1SFYA 1C8M2 2ZHNA 1DGWX 2JDKA 4R4XA 3WDYA 3HN3A 4GULA 3WG4A 1QOSA 5C6CA 5FPXA 2VZ1A 2NM1A 3SEEA 3WDWA 3ENRA 4RQPC 2ZX3A 2VCMA 2PAKA 3CLPA 4N43A 1NQJA 3DCQA 3VBRA 1K3IA 1SBFA 4J1XA 2JE8A 1RUNA 1DQ6A 1RJ7A 2RS31 1DG6A 2DV9A 4M4RA 2A6WA 3AJZA 2WO7A 2C0ZA 3ZXFA 2B9VA 5IVBA 2YC0A 2PN5A 4IEPA 3KCXA 1N1VA 1OQ1A 1W0OA 4ISQA 4AQSA 4YGEA 4IE0A 4HSLA 4JQRA 1TE1B 3FUQA 5C5TA 4LBOA 4CP1A 4ZU4A 4Z92B 1GZCA 4PF5A 1FMD3 4DFSA 1DIWA 4CEWC 1E5RA 4HPKB 1TME3 4AHYA 3ZPOA 4Y20B 2VD7A 1C5IA 3ACHA 1R091 2LM3A 4JGYA 3TEXA 1JN2P 3MGUA 5BNQA 1O91A 3LKJA 5D21A 5LASA 1CN1A 4N7UA 1D2QA 1EAH3 2P3YA 1H8VA 4S2HA 1V6MA 4YRDA 5KC5A 4M3CF 3H1WA 3PIJA 2CGNA 4IV1B 1PGL2 1VPHA 2X5IA 4KG0A 2PAMA 4MX3A 4QX3A 4MLOA 4ZPIA 5KHIA 1AX0A 5DZGA 1R083 3B69A 2H0VA 2NYYA 4AVCA 3JBG2 4CCEA 1NCQC 2EAKA 5LA2A 1BEV1 1URXA 1YI9A 3HJRA 4BK4A 1OPOA 3R4DB 2WAAA 4UI9L 4CP9A 4CDWC 4LR4A 3OBRA 1C28A 1TQ5A 2VOTA 1WUVA 1I6XA 2WINB 3BOPA 4OLLA 2VE1A 1POV3 3SITA 2Y60A 1H6YA 4QKBA 1CAVB 3VBSB 5L19A 1F8VA 4Q0PA 4PF1A 3VV1A 1LGNA 1LNSA 1OOPA 2JE9A 1K5JA 1O4ZA 3SKJE 1Z78A 1X82A 5IVJA 2W92A 2XR4A 1FOD2 4UFJA 4LULA 1W0PA 5FP7A 2VMHA 1W6OB 1OLRA 1QJY2 1SLCA 2VW0A 3BU0A 4K8RB 5J1XA 4CCDA 4NHMA 5F7UA 5KWRA 3K4ZA 1BVP1 3Q8CA 2Z5WA 3NNGA 2H0BA 1H2KA 2R6QA 2YB7A 4Q0UA 3BYWA 4H7MA 3N7LA 1S0DA 1H8TB 2WA3A 4H7LA 3V64A 1LRHA 2EIGA 3UKNA 3WX5A 3KHCA 3V0AB 4L11A 3TYJA 5FO7B 4UWDA 1UMZA 3VKLA 5LBEA 2OUHA 5HCHA 1QQP2 5C8CB 3OBZA 1J83A 4KWLA 4XDQA 5FZMA 2Y6GA 1OPMA 5KXDA 3IT8A 4YWAA 1OUSA 4E4ZA 1POV0 3KCYA 5K0UB 2A71A 3MW4A 1H1IA 4XIOA 5DZFA 3MI8A 1GQHA 1NYWA 3AKRA 4IV3A 4NAOA 4PHZA 4RR3A 5T5LA 1H1AA 4ITCA 3ZX7A 1OURA 3PUQA 2WC2A 2XGXA 2J7MA 3L2HA 5AFBA 2C6SA 3M8LA 4XMAA 4M00A 2PA7A 4XJZA 3VBFB 2VM9A 1OLQA 2JDZA 5D1IA 5DABA 2WFF3 1W6MB 1UU6A 5CYYA 3TBDA 3ZFEB 5F32A 5A1FA 4NHLA 1QJX1 4MVTA 5CFCC 5JPMB 4N9IA 1PMHX 1ZZ7A 5GLZA 3MHZA 5B4XA 4B3NA 5A3UA 2ZS6B 5A3PA 4COUA 5GZDA 4QPGC 3SMHA 2WZEA 1IS5A 2XKPA 2YC4A 5F6KA 4IW3A 4Y1YA 3RRDA 5EPAA 4BQ2A 2GP5A 1QGLA 4OI2A 1I5PA 2GSYA 3W5NA 4B1LA 4WV8A 5BNPC 3RZKA 4WVMA 2P5BA 2DCJA 3FFZA 4MADA 2WNVC 1O3TA 2XVKA 1QJU3 3N9OA 4L0PA 4FOYA 1LOFA 1RUF3 2QQLA 4DUVA 2R042 1VBB2 2XBO3 2BQPA 3ZYIB 1AYM3 3NVCA 4HMZA 4Y1VA 1MS5A 4UW6A 4F83A 3WP4A 1D4M3 2WT1A 1ZA4A 2R063 4Q4W2 4LIVA 2ZGSA 3WNNA 1KJLA 1RUI3 4WM7B 3QD6A 4GZ9A 4XYXA 5A7WB 3KWVA 1JI6A 4XCBA 1H2MA 2MPFA 3LDBA 2WQZC 1ZBE3 5A3OA 3KT7A 4INDA 1QWRA 2MEV3 1CZSA 2OT7A 2RVAA 3FZ3A 2DYCA 1IZ3A 2RMU3 1Q8OA 2GALA 2YUEA 1ASJ2 3PL0A 4CVUA 2WO1A 2VZPA 1MZ6A 1UIKA 3KMHA 1UKGA 1AL22 1YUDA 3FBYA 4WM8C 3PU8A 2DDUA 1ST8A 3FLRA 3NV4A 4CEYB 4P00B 5L7OA 3K77A 2WIIB 3GCXA 3O0WA 2DWRA 1BK1A 3ZXDA 1X36A 3U78A 4XTPA 2DU1A 3I3QA 5J98B 4K3UA 1RHI2 1J84A 1FNYA 4A7YA 1OUXA 3B94A 4XUNA 4BQ1A 1U0AA 4LQRA 3LOIA 5T3NA 4S2FA 3DGTA 1F2NA 1MQTA 3N7MA 4FOWA 3VBRB 4XQ4A 3ZKYA 3FLTA 4GALA 4YM1A 4AXOA 4NVPA 2Y33A 3LE0A 2BYVE 4IEOA 3WD5A 2FQPA 1V9U3 3NO8A 3I2IA 2EXJA 3OBAA 4RN5A 2CDPA 2GC3A 3GALA 3GYDA 3PTYA 4ASMB 5SV8A 2B8MA 1JZ4A 4H3WA 2UWAA 4X6QB 2YMZA 1OF4A 3DEMA 5FZKA 1YJLA 3ZFFB 2A70A 4RGGA 5BNOA 1S4CA 3OEBA 5KHKA 3LAGA 1LGBA 4XFAA 2HBTA 2YPJA 2RS32 1QH7A 5C4WC 4JGYB 3GZTB 2VCBA 4XVHA 2VZQA 5FZOA 4KGGA 5FZEA 1BXHA 1DLCA 1VAVA 4Q29A 5FYBA 3IDEA 4AEKA 2PLV1 1SLBA 4JVAA 4NHXA 4QXCA 5FJHA 1GV9A 4XFBA 3M4FA 3HBKA 1UZYA 1ZX5A 2X5IB 3AZWA 4JAAA 4EWDA 3A0NA 2Q1FA 3NAPA 4GB32 4MHRA 1YXWA 1MVEA 4MXWB 1C1LA 1ZBA2 3IAPA 2QBXA 2BTVC 5DDJ3 3W9AA 5KHJA 3FN9A 4DO0A 2P1BA 2FDGA 1R092 3GM8A 1YQCA 2BGCA 5FZ8A 3PUHA 5ABJA 1KS4A 1PVXA 1Q8VA 2XJRA 4ARXA 2W3JA 1BJQA 2KM2A 1LOGA 4P9WA 3LSEA 4EZHA 2WRAA 2IVIB 5H9PA 1W6NA 3JD72 1BBT1 1MEC1 4UOJA 5JXJA 1XE8A 5J48A 3MLJA 1ACCA 1D0HA 5FZ9A 1X9TA 4DEQA 5A1AA 4NO4A 2RS11 1UPIA 5GLUA 1AR72 1OOPB 4YW5A 3LEGA 1BEV2 2GAUA 2YBSA 3I3MA 4FTBA 1C4RA 4F3JA 4C0HA 3D6EA 2VTXA 4QM8A 2E63A 2GZWA 2QQNA 3ZYHA 2XWBB 2RDNA 2ZEYA 3MPPG 2HYKA 2IVJA 2P34A 2Q30A 3MW2A 4CSWA 2RS51 4LBQD 4E2GA 1HIXA 1RUG2 5F39A 4YVWC 4ZXEA 4COZA 2WS91 3B9IA 5FZDA 3J8F3 5HXMA 4OFGA 4LO8A 1VBC3 3VBOA 4PDWB 1BLZA 5FZBA 2W1UA 1MZ5A 3IWZA 1B09A 1CIYA 1PK6B 3LDKA 4COWA 5A6XA 2BRTA 3VBUC 2BVVA 4IEXA 4XE9A 2XDVA 1CQ9A 3MF9A 3SCGA 5BY5A 2FBEA 4Z1VA 5IJRA 3OGSA 4X8PA 5K4LA 4D7YA 4LBKA 2F4PA 5LCWL 4RR3B 1D0GA 4IV3B 5EQUA 3KM5A 1QHDA 1Y43B 4JKLA 1N3OA 4YNIA 3ZXKA 1C8M3 3HNBM 2A5ZA 4BQYA 2XJVA 2ZBJA 2YXSA 4LIUA 4B8EA 4C8DA 4PCRA 3RPQA 2YGMA 2K9ZA 3HNMA 3FFQA 5IUQA 1EAH2 5HPOA 1YLLA 1YIPA 3MUY1 5BNNA 1ENXA 4KH9A 2B4KA 1SLLA 1LGCA 3PJYA 4OULA 3O7OA 4QGLA 4LBQB 4V2VA 4LK7A 3POBA 2V72A 4CDUC 5C3RA 1JZ3A 3CJIC 4EE2A 5JCTA 4WVMB 1PZ9A 5F6LB 3QLQA 2XLFA 1C3HA 2WUHA 4AEDA 1W8ZA 4YYOA 1B35B 3T1MA 5HV4A 1GR3A 1HLCA 1OKOA 1PMJX 2HWD1 3CL1A 4OQ9A 3BGAA 4CXYA 4N8MA 1QJX2 5CB7A 3RS6A 1Y7BA 4FOQA 3DL3A 5LB6A 2HEYF 5FZ3A 1YCIA 3HBZA 4AFAA 2CAUA 3VD9A 1JOPA 4ZHNA 1RXFA 3BIEA 4XF4A 3GHNA 2VXJA 5JUVA 5CG9A 2BGOA 3J7LA 1FXZA 4IE7A 4AQ2A 4BQ4A 5FOBB 4OHYA 4XIKA 4QPIA 4NJ4A 1WLCA 2QNKA 1XSRA 3D0SA 3QBQA 4YVSA 2HKXA 1S2KA 3K75B 1FT9A 4WVWA 3T1LA 3WHTA 3WNOA 2ZGLA 1AXZA 1CPNA 2ZCWA 4JRAA 1U5XA 4PQQA 1YEWA 3MYXA 4WZCA 2J1UA 1H4HA 5FMBA 4A7KA 4QPYA 1V6JA 1WLTA 3H7JA 3JBG3 4NWVA 2GDFA 5FYHA 4A3XA 3V65A 5C5UA 1FV3A 4GIQA 1X50A 5A7PA 2Y8KA 4E2SA 1DZQA 3K46A 5FQ0B 4YARA 5L7OB 1C5HA 1NLQA 3K4AA 3B9CA 4HXCA 3T2QA 1RUJ1 3U37A 3MIHA 4ZKTB 3ILRA 3FWEA 2VZOA 3LD8A 3G7DA 5I0UA 1XC6A 1LOEA 4IE6A 1MACA 3R0RA 3ZVXA 3NJVA 2VZUA 2JKBA 5FXZA 1H9PA 4ZZ8A 1UY3A 3O14A 3ME2A 4JKKA 1UYXA 4XJ8A 3S0MA 1MQTB 4QM9A 4XTMA 4PLOA 1EV11 1PVC1 2DBIA 2Q8CA 1RVF1 1YRZA 2HEVF 2WFPA 4PQ9A 3SEPA 2BP6A 1VRBA 3NNJA 3ZMOA 1QJY3 2NP0A 3MV01 4IERA 1MS3A 3DKQA 3POWA 4PJYA 5IWFA 4P9YA 3H7YA 4QX1A 1ZVFA 2I45A 4CP0A 2WJSA 1R64A 4Y4RA 3AMQA 3RNSA 2WT2A 1N47A 1H0BA 1ND3B 2I2SA 2J1TA 3O1PA 2DVGA 3E5XA 2YGLA 3WF1A 3I2OA 1YFXA 5DG2A 1NX9A 4L92A 3MIDA 5C7GA 2ILMA 3D3AA 2PAEA 4A45A 2VUCA 3CBNA 2WR9A 3EQEA 3POIA 5FTTC 1MZFA 5FUIA 4HKLA 2QQJA 1QQP3 5HV0A 2WNUC 4EV0A 1SZBA 4Y26A 1G9BA 2CNAA 1W28A 4XUQA 4LJHA 1LEDA 1RUF2 1RUE1 2BNOA 3CJXA 5CIRA 3OPWA 4Q4V1 3B00A 5FPVA 1DDLA 1ULOA 2XBO2 3R4SA 2NMNA 3NAPB 2HWE1 2TBVA 4Y5TA 2DCYA 3W58A 1OH4A 1FI2A 3Q9OA 4XACA 3BALA 2RR11 4MOAA 2QKDA 4KQ7A 1D4M2 5IT6A 2E6VA 1QJFA 2WNOA 2BNMA 4JGZA 4CCNA 5JOWA 5E89A 4YW2A 1RL3A 1TMF3 5FZLA 2BWAA 4G4FA 1X9PA 2GMEA 2PLV2 3ZSLA 2HLEA 2CWSA 2VUDA 2A6ZA 4IV1A 3TN93 3R6SA 1V00A 4RGKA 1FATA 2JWPA 1JU3A 1DZTA 2KD7A 2TNFA 3B93A 2MEV2 2VQ0A 2Y0IA 2ARBA 3N7KA 1NE6A 2DCZA 3N9NA 4XILA 5C70A 2IC1A 2SBAA 3OY8A 5F3EA 4AFCA 5LA1A 5FZAA 1QXJA 3WG1A 1SFNA 1IPKA 1TNRA 1Z7S1 3CHXA 4NN0A 3U11A 3WP5A 1JYWA 1S0GA 3DUIA 1A3KA 2R043 1IQDC 4NOTA 4PLMA 2CGOA 1ODMA 4MGYE 4BQWA 2ZMLA 3RZJA 1XYPA 5JSPA 3RYKA 4V1PA 3DYPA 4CDXC 4OZXA 1R1A1 5IK8A 3CO2A 4Q4W3 2DBNA 1ZNPA 1BBT2 1VJ2A 3N9QA 1MEC2 1CAVA 3ZFGC 1S2EA 2XVGA 3EYPA 3VBOB 1OHFA 4BOWA 1A8DA 2RS12 4XBLA 3FUOA 3DKWA 1U5IA 4QHOA 5FFOC 2NMOA 2BW8A 4FFIA 1NLSA 4H2AA 3PIGA 4RQPB 5GZFA 4DB5A 5A3LA 4XFFA 2CDOA 2EIBA 2VAUA 4IGOA 4BCUA 4KL1A 5FYZA 3VDDA 4BQ5A 2P4EA 2CU5A 3S7EA 2RS52 3S6PA 1JZ2A 4META 3SKVA 3E6CC 4RL7A 1LOCA 2W68A 4R8HA 2WS92 5J36A 3USUA 2A6YA 1AL23 4XCAA 4QPWA 5FLJA 5GLVA 1ENQA 4OUEA 3O1TA 2DCKA 1PZ8A 2J22A 1J1LA 1FNZA 4XFCA 4QMAA 2JJ6A 4D8MA 5ACA3 5JOYA 4FPKA 5L9VA 5ISLA 3S57A 2QQIA 2VMDA 3V0AA 2VZ3A 1RHI3 4HG6B 3NSTA 3KS7A 2G1MA 2VPVA 4QQHA 2GN7A 3WV6A 3TWIA 2FZ1A 3BTAA 4I0WB 3U4XA 1YQ6A 3WXPA 4AI0A 2ZMNA 3T0AA 1N3PA 1TVGA 4GMP3 1AR81 1BCXA 1HRI1 5IFPA 3M3IA 1GP6A 4NHYA 4CDQC 1T6GC 5AC91 3EBRA 1Q5OA 1LHOA 3HIFA 1UX7A 3VZNA 1CWPA 5EWSA 2ES3A 4X6RB 2BBVA 3AYCA 4GWNA 4EN6B 4NPLA 1KITA 1ZZBA 3WG2A 3DF0A 5DDJ2 5FLIA 4XF1A 2PHUA 4E8DA 2Q4SA 2VW2A 4YM2A 4MGQA 1ND2C 2ARXA 4ET7A 3LEMA 3ZFEA 1NCQB 1RITA 1YYNA 5FMCA 5GALA 1AJOA 4K1ZA 4B4QA 4NRQA 3GXUA 2JG9C 2PHTA 2D43A 1V6IA 2XHNA 4BXSV 1F5FA 1RMU1 5LATA 4CDWB 2RS33 2ZGRA 4J1WA 5IATA 2XH6A 4QX2A 1COV1 4D0QA 4AVSA 1DQ0A 2JDAA 5CKQA 5IAXA 3KV6A 1YWKA 1OVPA 4YVSB 5FYVA 5GZGA 1AL0G 4DIQA 4K40A 1QOTA 2VOVA 1JOJA 1F9KA 1LOAA 3QH6A 2HWD2 2ZX4A 4HVOA 4OI4A 5EV7A 3PNAA 4EN0A 5CFDA 3MBWA 2R16A 4L8QA 1UY4A 2V5YA 4GH4C 4P02B 1AJKA 2Y38A 3RZMA 1YNAA 3P3PA 4AVVA 1F31A 1RIRA 3J8F2 1R093 4I02A 4WM7A 2QQOA 1JYIA 3PLQA 2W1WA 3H8RA 3CEWA 1VBC2 1IS6A 4FFGA 2YU2A 3NV2A 3SNMA 4TTGA 2BV4A 2DTWA 3PU3A 2OQ7A 2A3YA 5F5IA 1L7QA 2WO2A 1YIFA 5JDBA 4QX5A 3WDXA 5LRSA 1HB1A 1JYNA 2GU9A 4DRRA 3P3NA 5FP4A 5FYYA 1UD1A 3PVOA 4QQ2A 4AI3A 1PMIA 1QNYA 2VGDA 3MLKA 3FJSA 2WO3A 5D8AC 5JWPA 3VHRA 2DFBA 1D7PM 2V5DA 4FPYA 4KBBA 3A0KA 3JB8A 1BEV3 2BOIA 3OG2A 3KV4A 4DEVA 1H4GA 4JDOA 1GOGA 2VZTA 1US2A 2AZ5A 5FYIA 1OQEA 2IXHA 1FPN1 1OLMA 1ULFA 4OYUA 4CEYA 4Q26A 3IIIA 3HAGA 5LEJA 3M1HA 2Y0OA 1G9AA 3ZDSA 1RUG3 3I2GA 3RJRA 1GNHA 4LA3A 2EF6A 4OHVA 2J1SA 2R32A 2V4AA 1AR61 1W05A 5GJ6A 1AVBA 1UZ0A 1Z0HA 4D3WA 3MIBA 1EV12 1PVC2 2Z69A 4C0BA 1RVF2 2VMEA 5CFCB 3I59A 3LDRA 1BMV1 4D6QA 4R52A 2VVDA 3BB6A 2JENA 3GDBA 1X8EA 3FLPA 2VMGA 4QPGB 1V6NA 2ZGMA 3LWCA 3UETA 3RZZA 3ZSKA 3ZYBA 1X7NA 4DPNA 4XQDA 1SACA 2ZPXA 3GBFA 3PURA 5ERLA 3ZFFA 5BNPB 3ZYGA 3OUJA 2BVBA 2O8QA 2HJIA 2WNVB 2HBUA 1AXYA 2P37A 1K5MC 2PYTA 4QU1A 3R4UA 3RZGA 2D6OX 2R1DA 1CGPA 4XABA 2AUYA 3VZKA 3N35A 3AP4A 4JGZB 5IVYA 3C7EA 2LW8A 2VUAA 3FL7A 1A78A 1DBNA 2P3IA 2WZR2 4MV2A 1W9SA 5FP9A 4UBHA 5J7MA 1JHNA 3WDVA 3VZLA 1W6QA 4BM8A 4HVQA 3M3CA 4JTOA 4AHXA 3H8XA 4NIDA 2E51A 2P3KA 5F3CA 2HWE2 3HMYA 5JZGC 3WW3A 3OY8B 1A8MA 1FAYA 2ID4A 4L2NA 4MXWA 5E88A 2RR12 4URTA 4BDVB 3NKGA 4XFHA 5DUWA 3UGHA 2ZHLA 4GJYA 3AL5A 4Q4Y1 3AFGA 4UFIA 1W2UA 4XJUA 4OHZA 5HI0A 3P5BA 3U75A 2PELA 2PFWA 4QHBA 4YFZA 4FTSA 1QJX3 2WWJA 4RFT0 1VB4A 5I8YA 1YO8A 4MSVA 3KSCA 4YW4A 1Q8QA 2ZAHA 4HLTA 2BJSA 4OHWA 1JUHA 1NCRC 4FCAA 4A3ZA 1VAMA 2ARCA 2BEOA 3BIWE 1X33A 3OPZA 5F9TA 3E5QA 3GJBA 1Z7S2 2AYHA 2WKKA 1AF9A 2JICA 3ZSJA 2B42B 2FDHA 1L3JA 3BI3A 5KBFA 2O0OA 2C5DA 2TEPA 5G05L 2FCVA 3VDDB 4W65A 4NIGA 3GBWA 4HK8A 2A75A 1QEXA 2XMLA 1R1A2 4WZFA 3ETQA 5DAVA 1DZRA 1YQ8A 4QKFA 1SCRA 1C57A 1UYYA 3USUB 4QPIC 4P5HA 3H9AA 4URAA 2VQTA 2F6BA 3ACIA 1VMJA 5JXGA 1PM4A 1S0JA 3IPVA 1LU2A 4XXPA 3BUCA 1SBDA 2TUNA 2FDJA 1YQ2A 2ZX0A 4QQLA 3S30A 3ACLA 3J7MA 4PDWA 3UK9A 5HCAA 2W87A 4CYDA 3OD4A 2XOMA 3WCRA 1ZREA 2H6BA 2V09A 4FO9A 4CCJA 2VCCA 1PK6A 3T2TA 2ZGOA 3ZM8A 3HPNA 3OOXA 1UY0A 3WZ1A 3U10A 3I2KA 5FPLA 4D6SA 1C8NA 4OQ8A 3C2UA 1HW5A 4AE2A 2Q5TA 4LPLA 3CF6E 3ROUA 2RDRA 4FFHA 1IOAA 3O1OA 3E6DA 2NLRA 1J59A 1FX5A 3K3NA 4N53C 4KG8A 3ZSEA 4OUSA 1JTZX 4KNCA 1VBA1 4R9BA 1OD5A 3T09A 5J3UA 5EHDA 1PIV1 4RS5C 2ZX1A 3ZYPA 1OD3A 5AFEA 1TMF2 4Z07A 4YSFA 2VULA 1W8HA 3RQ0A 2OW4A 2Y26A 3Q8AA 3LOBA 4AR2A 2G9GA 5FZIA 1AR82 1IHMA 2BU9A 1HRI2 2JIGA 2G9FA 2R0HA 3PVNA 4LBQA 2Q8EA 3TN92 2D6PA 4ATFA 2Q8OA 4XFIA 2YBKA 3AP6A 5F8PA 2FMDA 2RHPA 2WNEA 4Q0QA 1XJAA 2D97A 2JG8C 1S0IA 1LOBA 2JDNA 3UGGA 2RDQA 5C8WA 4XBQA 1IGOA 1OSGA 1HKDA 3HNYM 4UW4A 1AUYA 3I8TA 1B35A 3OF1A 4MGIE 2DUOA 1QU0A 2Y64A 2Y6LA 5H9QA 5FPBA 2W08A 5A32B 5CFDB 2H6CA 2HWB1 3KLSA 2YBPA 3OPTA 3ZMNA 5C33A 5L36A 3VD3A 2GC2A 3W20A 3BN6A 1JH5A 2G9ZA 4QAWA 4YLZA 3EXUA 3WUDA 3S5AA 1AR91 1PGW1 1W8UA 3PVBB 5A80A 3PJQA 5H9SA 5A7SA 3WQ1A 3DPRC 2UWCA 2W2IA 5BXXA 5I8TA 1W9FA 2PLV3 5FYSA 3HOBA 3JB4C 3WDTA 5FXVA 1V0AA 3LFMA 3A4UA 4JX0A 1DF0A 1F15A 1DQ5A 1LU1A 3CIHA 1OFNA 2QVSB 2DUPA 2OA2A 1REFA 1JHJA 3GBGA 1KRIA 3TB0A 1NA1A 4XDOA 4ES8A 1ENRA 5FQ0A 2ZGPA 4NIIA 4IV1C 3MO4A 5ACA2 4XXAA 4Q1PA 1ZRCA 1XB9A 3HN1A 4HT1T 5BYNA 1BYHA 5FAXA 3EO6A 2EXIA 1VBE1 5IW0A 1BBT3 2F4LA 4P9JA 5LEKA 3BTXA 4NIAA 1MEC3 5DQ0A 4E8CA 1N1TA 5IVCA 3NJYA 2A73B 4QHZA 3RI9A 2BBAA 1W6PA 2RS13 3VB9A 3CKHA 3I59B 4AHWA 1FPN2 2XKOA 4EQVA 4D6RA 1RJ8A 1V6KA 1W8NA 4YG6A 5FY9A 3AZXA 2RS53 2X09A 5FBJA 3VDAA 5K9YA 3Q8FA 3HT2A 3VBSC 1IKPA 5DZEA 2WS93 5IK4A 1XNKA 1JBCA 3RJ2X 3VBHC 4C90A 2I07B 4YM3A 1ND3A 2YV8A 4XOGA 4NPRA 2HYXA 4I01A 1FYUA 3WNKA 1QDCA 1YC61 3JQWA 1AR62 3O1VA 2OS2A 3TRSB 5DMYA 3AP9A 3B02A 3IDAA 1OA4A 3OTFA 2AACA 3ORJA 3PUSA 4N9HA 1U5ZA 1Q56A 1BMV2 5L9RA 4Q8KA 5FO9B 2JIJA 3AMMA 3CZJA 4MGSA 1RUD1 4N7IA 1XNBA 5JI7A 5T52A 1W6QB 3ST7A 3WG3A 3ILFA 2UY8A 4JDMA 2WDBA 5F1RA 2CSGA 1H8TC 1YFUA 2E7QA 5B4NA 2GNDA 2YFZA 4GWIA 5LW9A 5EJ3A 2WA4A 3DYOA 3ON7A 3WW4A 3GZEA 1SLAA 1BHGA 3FBMA 3OGRA 3KT4A 4ISRA 3T2OA 2D44A 4OI1A 4QD2A 3IAQA 1LJ7A 5C8CC 2K0GA 5GLWA 3I97A 4E4HA 2GMPA 1ODNA 1HJGA 5K0UC 5F5CA 3ZN5A 3T2PA 3DXUA 2X8KA 5BUVA 4LITA 4FQ4A 3H50A 3RGBA 4DXTA 4GKXA 1XPWA 4XW3A 3AK0A 3OB8A 2ZOEB 1NT0A 4UYBA 4GA9A 1NE4A 1CPMA 3VBFC 1W0NA 3PMSA 2RMU1 2XJQA 4QB1A 4EZ4A 3M3EA 1W9TA 2HWF1 2ADEA 4HBNA 2VZVA 4Q4Y2 4TN7A 2HWD3 2UY9A 5EJ1B 4AG4A 2VNRA 1PHMA 1PX4A 2GC0A 4DXRA 1UCXA 1TG7A 3AP7A 3M70A 3OGVA 1W2AX 4CCOA 1T6BX 1Y9MA 2FCUA 3AYAA 1XE7A 2D5FA 4EYUA 3VZOA 2D40A 4JC1A 1KDKA 3ELNA 1RB8G 1WCSA 3IPVB 4MZUA 3N9PA 4LO4B 5CEHA 4R9AA 4BQXA 1VBD1 2NZ9A 3RWNA 1LEMA 4J25A 2VVEA 4L9BA 2LRPA 4MH0E 4MGZE 5K8SA 4YG0A 5FMOL 3AZVA 5LZ6A 1RGSA 5KHHA 4RQPA 1OFSA 2VR4A 3DN7A 4RHV1 4WVZA 2ZXQA 2CGPA 3MF6A 4UW5A 4DINB 2WZPP 4Y3OA 2OPKA 3G6JB 1DYKA 1GWMA 5CZKA 2RJKA 3M3QA 3PTRB 4V2WA 3ATGA 1O8PA 1AXKA 2WNUB 3WLUA 4DNYA 2AEYA 3VZMA 3KVAA 5E1RA 5FKCA 2WQ4A 3I49A 1QXRA 3ZIXA 1RUJ3 2XUEA 4RYDA 1G7YA 3I4IA 3U1XA 2B46X 2HWC1 4LUMA 1RUOA 2D98A 1UXZA 3H8UA 4FPEA 5JMOA 2BZDA 5T5PA 2B45X 4KGQA 3EJKA 4S2DA 4CEWA 3MLLA 3N7JA 3ASIA 3BOWA 3T4VA 4XHBA 4MO3M 3AZYA 1EV13 1PVC3 1XBFA 5J96B 5FXWA 1RVF3 2GNMA 4AYUA 3VZJA 2DVAA 3KD4A 1XU1A 4RD7A 2FDFA 5DAWA 4CZSA 5C9AB 1J58A 4UXAA 1J3PA 1F4AA 1IG0A 4KMQA 5FY8A 3I3BA 4N43C 3H3UA 3VBRC 3J4UH 2UURA 3URFA 1NY71 1UYPA 1GOHA 4HSJA 4UFLA 4AEMA 1NCQA 3AKSA 1UOJA 1ULDA 4YW1A 5IYYA 3N3HA 5FCCA 5KXBA 1GZWA 1H2LA 4CDWA 2D6LX 4YGCA 1AYN1 1HRV1 4LA2A 1OKQA 3WR0A 1WGPA 5FY7A 4CDXB 2WZR3 4MXVA 4QX8A 4TXWA 3T30A 4A4AA 4A6SA 3AKPA 1HX6A 1ZM1A 3RWKX 1W99A 4QQOA 1ALYA 5CBLA 1QDOA 5EIYB 1RUE3 4Q4V3 1MS9A 2A1XA 4Y1UA 4DOUA 1UOFA 3NNLA 2HWE3 5GZCA 2ORXA 4JGYC 2FHRA 1G9FA 3IB3A 4LXLA 4S2GA 5DAXA 4FPLA 2RR13 4IESA 5DAQA 2OKXA 3TNQA 4LT5A 2HEWF 5DXDA 3D8CA 1NA1B 4LBNA 4W6WA 1AR92 1PGW2 4BPZA 1OMIA 1HV0A 4W50A 4TWTA 5JR2A 1C1FA 3PVEA 2X5IC 4NRPA 1HB4A 3MEPA 1NZCA 4O9GA 1RINA 3MIGA 4XHXA 5FZ1A 3HWJA 1W3VA 1O4TA 5C3PA 1EUUA 2JEMA 3A21A 4OMCA 3ZXGA 3ZXAC 5CU1A 3MFAA 4PT6A 1LCLA 4P9XA 2Z79A 1QOOA 4K7JA 1GQPA 3KT1A 5FZCA 4LHSA 1W6PB 2RG4A 5FMDA 3WW2A 2IZWA 1Z7S3 1M4WA 1LENA 2ZEXA 4UAPA 3OEAA 3NW4A 5JLVA 2X05A 2EAAA 1XNTA 1XQNA 4GWJA 2FDIA 2YPDA 1ULEA 2DUQA 4IUGA 5I91A 4I09A 2ZGTA 5HXVA 3UV9A 4W6XA 2QQKA 1R1A3 5FPZA 4ES9A 3Q8BA 1LHNA 3DECA 3WF0A 2DVFA 1JZ7A 5HCFA 1F5JA 1OOPC 4ZS2A 3T4HB 2Y6JA 3WHUA 1BZWA 1O3QA 1Y9GA 4MG2A 1KXGA 5A7NA 3I54A 1ND2B 3UYJA 3VN4A 1SMVA 4EROA 3HQUA 3LCPA 2GH8A 4YZ3A 5CFCA 1XXNA 5FO8B 4I2OA 1ZZ6A 2KXLA 1UX6A 3DYMA 1HB2A 1GP5A 2JG9B 5DG1A 5FZ0A 4QPGA 1WLDA 1UW8A 3UT0A 3ZN4A 1LECA 4QXKA 4Z8BA 1JZ6A 3RDIA 3D4KA 2IWGB 2YC2A 3IMNA 1WCDJ 1DLLA 1UU4A 2VBDA 5I8SA 5BNPA 1W06A 1WWYA 4WBBA 2VMCA 2WNVA 4A6OA 1KDMA 2K46A 4LK6A 4O9EA 3E1F1 4I3GA 3F2ZA 5FMOS 3WF3A 4IEWA 1RUC1 3L9JT 1QXPA 4KBZA 3RYRA 1UXXX 2ETEA 1TNFA 4DXSA 2DCTA 4JQTA 3AVSA 2R071 4I0BA 4RR3C 4IV3C 5LBCA 1KFXL 4DUWA 4HN0A 2RJLA 2VO5A 3OUHA 1UOGA 1WD4A 1AR83 4M3CA 4QX7A 1HRI3 5IAVA 3AP5A 3WT3A 4XC9A 4CUBA 5AC93 1PGL1 4IDZA 4Y4YA 3LSDA 1O4YA 1GWKA 4XURA 4KWUA 2YG0A 4Q1RA 1RC6A 1UY1A 2QQVA 5T5JA 4NMIA 4AAPA 1NG0A 4IEZA 2B5HA 3I3EA 2Q8DA 2ZMKA 2AH2A 4NUBA 5F2SA 3RFRA 4E2QA 1YFYA 3UKVA 1XNDA 1XU2A 4XBNA 4XJWA 2WBKA 2D3PA 3IIAA 3NL1A 3ZKUA 4F8AA 2JDPA 2UYAA 4YZ1A 3OYWA 5JAXA 5FY4A 2YFUA 4ZZ5A 4W8JA 3ZLIA 5IVFA 2P17A 4HFSA 3WNMA 3RMXA 1KJRA 4WM8A 3WQBA 3KV5A 4E9KA 2BFUL 1RMU3 1M06G 3WNLA 4O65A 4R9DA 5FBZA 4IE4A 1COV3 2ET7A 2O8OA 2OX0A 1LOFC 2JDHA 3JXSA 4O61A 4Z2AA 4QWNA 1RYYA 3HR9A 5FYCA 1VMFA 4HN1A 1JZ5A 2QTWB 1D4VB 3ZXJA 4Y22B 4AK3A 4FAHA 3HD8B 4B4PA 2HWF2 4IXLA 2JE7A 2PHFA 4LOSA 2W46A 1FOD1 1W2OA 2W91A 5LK7B 4G3YC 1GMMA 2GC1A 4FVVA 1UPSA 3E97A 1MZEA 4E4DX 4MGTA 1DFQA 4FFFA 1IG3A 1W8WA 4BISA 5C71A 1UMIA 2ZZQA 4Z82A 2AEZA 1JXNA 4BLIA 2UU8A 1WA6X 1HB3A 1UU5A 1A6CA 2C1FA 2W52A 3VL8A 1VBD2 1DGWA 2D7FA 3KQRA 4NRMA 4QT6A 4AFMA 3PMEA 4LO6B 1CAWA 1EYBA 4LHKA 4QXHA 5I93A 2EIDA 4WVVA 1K5MB 3UKTA 4Y1ZA 4RHV2 5FY0A 1GLHA 3MUZ1 1US3A 4CEWB 4B7EA 2E53A 2P2KA 3WP3A 3FMGA 2CYFA 5L7OC 2YZ4A 4NPMA 5FZ4A 5C4WA 5CNAA 2Q1ZB 4TLFA 3AL6A 4HKWA 1JODA 2JECA 1AX1A 1FPN3 4QKDA 3VKMA 4YZ2A 1IPJA 2WQ8A 1ONAA 1XSQA 4GXLA 3R05A 4CTEA 4AF9A 1ZZ8A 3ZXEA 1MQTC 1GSLA 5JZGB 4IEYA 2O14A 1HXS1 4MHUA 1DGLA 2R7EB 4C1XA 1JMUB 2ZKNA 3ITQA 5EZWA 1QMJA 5JSOA 2IXCA 2QFEA 1AR63 2JB8A 2XONA 3OD0A 1CD3G 2CL2A 1CONA 1GZWB 3TEWA 4QQPA 2AC1A 4P9LA 4U2AA 3GHMA 3LIGA 2E7AA 2VXRA 2QQPA 2FMYA 1O8SA 3H1YA 3X29B 2VTXJ 3LPGA 5BNOC 5I0RA 4DS0A 1KGYA 3T3YA 4LO7A 4OCTA 4C1WA 3KVBA 1RUH1 4SBVA 1VBB1 2WABA 3KQ4B 1SDWA 2WT0A 1NY72 2PHXA 2Y6HA 5A32A 1CAUA 5CA6A 1W8FA 2VY0A 4GMP0 1IPSA 4YW6A 3K51A 4DUXA 5JI9A 3BTZA 1DQ2A 1SLTA 3NV1A 2AENA 1HRV2 2OYZA 4CU8A 1WW5A 1G9CA 2A6VA 3KV9A 5FXXA 4Q4X1 4YVWA 3RVHA 2DF7A 4KWKA 1W8OA 2GNTA 3NAPC 3GCWA 1XRUA 5KXCA 2DVBA 4CCKA 2YY1A 3WINE 3I7DA 2PHRA 3VD4A 4BXFA 2JKXA 4BIOA 1XYNA 1PZ7A 5SV5A 4AI2A 3WQ7A 1XE0A 4LO5B 3LEKA 2WWUA 2BERA 1QJEA 2ZGUA 5ABJC 3KF3A 1LULA 4AAXA 4XDPA 5CISA 1ASJ1 1I1EA 1GFF2 2E33A 4FXGB 4XFGA 5EP9A 2IXKA 3VBUA 4W4ZA 4EJRA 4Q4Y3 3WEZA 3ZSMA 2FZ2A 1UZZA 1LTEA 2QDRA 3CMGA 3FC0A 4BH9A 5IVVA 3O1SA 3RZLA 1UO9A 2AREA 3NNFA 4Q5OA 1RUJ2 1GYKA 2Q0AA 2ZX2A 1WMEA 2QQWA 1AX2A 1GBGA 1PO11 4EWAA 4FBFA 2OPWA 4FPGA 1YHFA 4Q2FA 4N53B 4BB3A 3THDA 5FYMA 1VP6A 5FK8A 1O6UA 3BCWA 1O59A 4UW3A 3WUCA 3WSOA 4BMBA 1S0FA 2C26A 5DN2A 1DQ1A 3POEA 1OI6A 4RS5B 4OVEA 1ULGA 1CR7A 5T50A 2J1RA 2E26A 3THCA 4D7TA 3AYDA 2WSUA 4L97A 3LEIA 3UJQA 1OQDA 3C7GA 4YM0A 3UESA 2EXKA 4CDUA 2C9AA 4TSVA 1NXMA 3VBOC 3W21A 1BVVA 3CJIA 2XL7A 2VECA 3VKNA 3W5MA 2VBPA 2CHHA 1DHKB 2JG8B 1CZVA 3AVRA 3NKTA 1KS5A 4BLJA 2XXZA 4Z2WA 2QQMA 3LGRA 4LBLA 2E7TA 1MS1A 1U5YA 2WAOA 4FTEA 4AI8A 1HN1A 2RM21 2ATFA 3D82A 4IETA 2DFCA 2VMIA 3LF7A 2IUWA 3O1MA 1HJFA 3J26N 2PTMA 1GP4A 3INAA 4CE8A 4CPBA 4M3CB 4NIHA 1RUE2 3DPRB 4Q4V2 1SPPB 5LY2A 4TYSA 1W90A 1ZRRA 5FWEA 4LKEA 3VHOA 3WDUA 2XG3A 4OI0A 3BVCA 1W9WA 3ILNA 3AKTA 4GB31 1UY2A 4QXBA 1KD7A 5LY1A 4LHLA 1VBA3 1VRH1 1ZBA1 1RUC2 1WMDA 2VZRA 4M0HA 1E5IA 2BNNA 3WNXA 2P6CA 5BNNC 1EPZA 1PIV3 1WBFA 1H30A 1LHVA 4AVTA 2QDNA 2R072 3N36A 3OYWB 1JOBA 4AVBA 1XOYA 3BTYA 2CTVA 4AGGA 1HDKA 4DRVA 3ALQA 2XJTA 2NQYA 4WM8B 3A23A 2EXHA 5FY1A 5JIAA 5C3QA 3IN9A 1PO21 3JD71 1OA2A 2YHJA 3AM2A 4AEDC 4PLNA 4BU2A 4R9CA 2W39A 1I3HA 3AB0A 5FV3A 5A33B 3J7HA 4QDSA 3Q8EA 4XZUG 1AR71 2W1SA 3GZAA 1PX3A 4K21A 4CRQA 5IVEA 3OGGA 5I0DA 2V73A 3P1IA 2GN3A 2ZJCA 1LKNA 3AXDA 2JB4A 3AMHA 1QH6A 3GGLA 4FQZA 2HWB3 3WF2A 4L99A 3AMPA 1UN1A 3I2HA 4XETA 1REEA 1RUG1 4YW7A 2PXJA 3T08A 2BOJA 1AR93 4M0NA 2NN8A 4HKOA 2WLQA 4XEZA 5A3MA 4YVSC 5L9BA 3POYA 1RXGA 3NJZA 3DV8A 3VBHB 4CCLA 3APBA 2VL4A 1CAWB 4A2UA 4AQTA 1R1ZA 5IHRA 3WVJA 2D3RA 3LA2A 3KZ4C 1N3QA 4HONA 4ARYA 3ZO0B 3U4SA 3O5SA 3CQOA 2A6XA 4GJZA 1KQRA 4ZU5A 4GAZA 3MDPA 5C4WB 1JS9A 1DGRA 1CJDA 1OLME 5FRAA 3THTA 2VNOA 2BUKA 3NQHA 1A34A 1SG3A 1UZWA 2WNUA 3ZOIA 4CCMA 4C91A 1HV1A 2VW1A 1V70A 3S5QA 2D5HA 4NE9A 3TEZA 1FMD1 2VNGA 5JIUA 1TME1 1WCKA 4BMEA 3LPFA 5FYTA 3TNPB 3H42B 1VBE3 1P8JA 4JHTA 3UL2A 4PI2A 4AW7A 4BZ4A 1S0CA 4Q0VA 3POGA 5IFTA 2ZEZA 2GMMA 1W9YA 5A6ZA 4P14A 3N4MA 3O0XA 1EAH1 4HETA 4MYEA 4ZXKA 4XF3A 2W47A 1DCSA 1DYOA 1EP0A 5AC92 4IE5A 5IK7A 1J1TA 4UFKA 4ZU7A 1S1AA 3WP6A 1R081 1WW6A 3ZN6A 2C9KA 3ZYRA 5C9AA 1UL9A 2AGSA 2NPIA 3USSA 4K9SA 4YZ5A 1GNYA 3J9SA 3KGLA 1YQ5A 4HZFA 1HXS2 1UIJA 4M4PA 3W59A 1L7RA 1UWWA 1CAUB 3ZYJB 4Y5Z0 1UKRA 4UT5A 1RMU2 1WBLA 3K48A 1POV1 2R1BA 2LS6A 1MS4A 4IGQA 1COV2 3PUIA 4CDXA 1AZDA 3GF6A 5LBFA 1CAXA 4QX0A 4YVWB 3IMMA 5LWBA
chains in the Genus database with same CATH topology
1RUD3 2CV6A 3V0BB 3OBTA 4QU2A 1AHSA 1QKQA 1WW4A 3SCHA 3ZFGA 2QUOA 1RUH2 2PHLA 3B01A 4FPHA 1NOVA 4D69A 3ECQA 1ENSA 1NLRA 1V6LA 4JGZC 3ZPYA 4AFDA 4LEJA 1WA4A 4ORFA 5EYYA 2K2SA 3H0OA 3VBUB 4COVA 1LESA 3E6BA 4LBJA 5KHGA 1EPWA 3VL9A 3GNEA 4AVAA 4Q4X2 1HQNA 2B9UA 2R30A 5GM0A 1DYPA 4RGAA 4NR1A 4E27A 1ZZCA 5CVRA 2ZTNA 4LUKA 3VHPA 1GKBA 3L2YA 2Z2SB 4COYA 5JSRA 3NV3A 4G9SB 2AR6A 2LALA 5K7PA 1J3QA 3B5LB 4RSUA 2HWF3 2IXLA 3IM0A 3JZVA 3E5UA 4BHPA 1VIWB 1O7FA 4LLFA 3QOPA 4AQ6A 1BKZA 2GNBA 4CDQA 3MIFA 1PO12 3SH4A 4CDUB 5EYXA 2R49A 3CJIB 1UAIA 3QACA 2WFF1 3M3OA 1SEFA 4AHZA 1VBD3 4N43B 4CP2A 4LE3A 5FOJB 4TZDA 1ND2A 3LA3A 3VDDC 2LTNA 1PNGA 1O3SA 4RHV3 1LODA 2JG9A 3MICA 1VAKA 3MZHA 4YZ4A 3FX3A 4Q27A 1O5LA 2WSVA 5H9RA 3H1MA 1QJU1 2OVUA 3KGZA 1RUF1 3SISA 3U0ZA 2G4IA 5T55A 2XBO1 3AFKA 2X53S 1AYM1 5T5OA 1Y9QA 4XJAA 4K20A 2HWC3 1D4M1 4JRLA 2R061 3WY6A 1N1SA 1VALA 2RM22 1SBEA 1RUI1 4PBPA 5JOZA 3V56A 4GH4A 1IQAA 4DXZA 1QY4A 4FPCA 1SLIA 1LB2A 1ZBE1 2YROA 4LTAA 1UF2C 5AVAA 3BPZA 3VHNA 1O3RA 2MEV1 3PHMA 1ULCA 1G8WA 1YJKA 1VRH2 3ES4A 3RI8A 5L73A 3ZFEC 3KB5A 5EFUA 3RYPA 4AEJA 3THPA 5D8AA 2XL9A 5DUUA 4BIFA 4QGNA 4ONUA 2LUWA 5AVPA 2VG9A 5GZEA 3LB9A 5I0SA 1GNZA 4BA6A 1JYCA 2VVFA 1AYN3 1HRV3 1PO22 4IEVA 1D2SA 5KC6A 5FREA 3MW3A 4Y22A 5CFDC 4XMIA 5B2GB 1HQLA 4ASLA 1V9U1 4FP3A 1PNFA 4WM7C 3NWKA 1I5ZA 5CADA 2YDEA 4I0AA 1V6OA 4JTNA 1SCSA 1BQPA 3LZZA 1S0EA 1ZRFA 4XQWA 1H9WA 1JW6A 4OHXA 1YI7A 1CX4A 3ES1A 2VQAA 1K5MA 3WQ0A 1ZRDA 4FAGA 3MFCA 2QCSB 2PHDA 4AGVA 4K8FA 5HBAA 4CEYC 4Y24A 1SQ4A 2Z42A 4DMIA 4XF9A 2VOWA 4B4RA 4DY3A 1G9DA 5F5QA 5IK5A 2KA3A 3ZN6B 2XVLA 1VBA2 3UJOA 1FMD2 3SLIA 3JU9A 2OZ6A 1TME2 3B3QE 3LA7A 5DDJ1 5JZGA 1VLNA 1PIV2 4FXKB 4B7KA 1QJZA 4DQAA 1G6NA 1CESA 2ZKLA 2R0FA 2ZGQA 4FSJA 2IXIA 2DVDA 5CG8A 1CAXB 1DGRN 2A3XA 1R082 1LR5A 5T54A 4BYYA 3CU7A 4I3PA 3ZFFC 3ZXLA 4JDNA 5I0TA 1ZYBA 2QE3A 5EXOA 3ZFGB 1PGSA 1NCRA 1Y3TA 4N90A 2EALA 3I2DA 4QGMA 2HWB2 3BU7A 2ZHKA 4FPFA 3C3VA 3U07A 4AGRA 1NXD1 1O5UA 2IFWA 1RUC3 3BODA 2XB6C 4PIZA 4EN8B 5J09A 2IXJA 5DUXA 3J8F1 2PQQA 2XHKA 1QNWA 2R073 2ZGNA 4NHKA 4Q0SA 3CNAA 1VBC1 3IKWA 2D3SA 2DTYA 4PIXA 1WD3A 4FT8A 5JVVA 1CJPA 1JUIA 1CIWA 2Q1MA 3RSJA 4F7ZA 4HK9A 4HL0A 4XF0A 3MIEA 1U12A 2D6KA 1GANA 1WW7A 4H55A 4IEUA 1C8M1 3IDCB 4W6YA 2WWSA 4CDQB 4D7SA 2VOXA 1VBE2 4N53A 4EN9B 3AJYA 4J6GA 3SH3A 2WL1A 1S2BA 3FE5A 4EN7B 4LBMA 4RS5A 1DQ4A 1HQWA 1FOD3 3AZZA 3AYEA 4GQ7A 3JUUA 4KU8A 1OA3A 1LHWA 2OUJA 2ZGKA 2D6MA 4NWWA 2D6NA 2JX9A 2ZAAA 3OJBA 4KWJA 4PDWC 4XPVA 3VKOA 2UWBA 2ZA9A 2WLPA 2JG8A 2WFF2 3RG0A 5BNOB 1PK6C 3D0JA 2MNGA 1IKQA 1H1MA 2VH9A 4MUVA 3EHKA 3MPBA 4GWMA 1I9RA 2WZR1 3OGJA 4GH4B 1Q43A 1RUD2 4EWEA 4XJ9A 2QJVA 1QJU2 1VR3A 3AXEA 1E57A 3DPRA 4A7ZA 2I74A 1REDA 1AYM2 1NQDA 2VU9A 1MR5A 3D5OA 4IL7A 4E4SA 1YFWA 4LNVA 3JBG1 4HPKA 2R062 4Y20A 2XPJA 2ET1A 1RUI2 4X8NA 1HXS3 5D8AB 1J3RA 1WMFA 5E8AA 5ABJB 3S7IA 4AI1A 1GQGA 1ZBE2 3SCFA 4PBOA 2BPA2 5C9AC 1W6NB 3VUOA 2CAVA 1B35C 1S55A 1XNCA 5A33A 2RMU2 1GZ9A 5FLHA 4K6BA 1RUH3 2ERFA 5DUVA 4DY5A 1VBB3 2CY6A 2XWJB 1QJY1 1RTVA 1MVQA 2ZZJA 4BE3A 4GKYA 1LHUA 1APNA 2UYBA 2ZABA 4HANA 4D94A 2EA7A 3SH5A 3JQXA 2XUMA 4MGKE 1MS8A 4Q4X3 5BPXA 3VBSA 2O1QA 4IEQA 3VBHA 3POSA 4JCKA 5LRRA 3GZUC 5LK5A 1Q3EA 1VB2A 2OIIA 4K1YA 3WCSA 1NA1C 1W6OA 1QQP1 2ZACA 3WOGA 1V9U2 2YYOA 2RE9A 2BWCA 4P9IA 1ZZ9A 3M7AA 1ASJ3 3FHIB 2B39A 3TAYA 4B29A 2MHFA 2IFRA 1QF3A 4Y1XA 4PIYA 4DZGA 4LHNA 5CAZA 1H8TA 2CWMA 5KXEA 2HWC2 1PO13 1CVNA 4YGDA 3IBMA 4YFWA 2GH2A 2X29A 2JD4A 5BV6A 3RMYA 4KU7A 5TSWA 1TMF1 4M01A 4RA0A 5C8CA 3QCWA 4LLOA 2XJUA 1Q8PA 3SHRA 5K0UA 2E9QA 5BNNB 2JXAA 1DU3D 5JR7B 3TN91 4YGBA 4H14A 1MS0A 3O12A 2ENRA 2DURA 1S0BA 1EY2A 1ND3C 2D93A 2PHWA 4AEDB 4FPOB 1PM7A 1NCRB 1Q8SA 4I30A 4U36A 2R041 4FPJA 3VBFA 4BWOA 2SLIA 5JMCA 1W6MA 4FP2A 4Q8LA 5GKAC 2QZ3A 3JCIA 4AFBA 4Q4W1 5J37A 1AYN2 2RM23 1G86A 3KCCA 3SXWA 3VGIA 5JOXA 5JPNB 4LE4A 2VUJA 2A7AA 2P3JA 1XYOA 4OUMA 3VKFC 3H3ZA 4M3CE 4R4ZA 1FV2A 3V0BA 4QPIB 2XJPA 1N1YA 3QH7A 2EVXA 1WLWA 3HQXA 3M2MA 2ZHMA 1IS3A 1IS4A 1GICA 2XLGA 3VLBB 2DU0A 4UBGA 2XLAA 5E16A 4GB33 3AMNA 4P9GA 3WW1A 1VRH3 1ZBA3 2N7GA 2A3WA 2B7YA 3AX4A 3TOJA 3B7MA 3HT1A 3O0VA 5HCBA 1AL21 3ZIWA 4JV4A 4SLIA 4YG3A 3IDBB 5ACA1 1TEIA 4IQPA 1PO23 1RHI1 3JD73 1H2NA 1KFUL 4HVRA 4XZPA 2OZJA 2W0XA 1W39A 3AKQA 5FDBA 2XJSA 5GLTA 1AR73 4GMP1 2QZ2A 1X8MA 4FOVA 4AWDA 2VOKA 4ATEA 3OCPA 2BFUS 1SFYA 1C8M2 2ZHNA 1DGWX 4R4XA 3WDYA 3WG4A 4GULA 1QOSA 5C6CA 5FPXA 2NM1A 3WDWA 3ENRA 4RQPC 2ZX3A 2PAKA 3CLPA 4N43A 1NQJA 3VBRA 4J1XA 1SBFA 1RUNA 1DQ6A 1RJ7A 2RS31 1DG6A 2DV9A 2A6WA 3AJZA 2C0ZA 3ZXFA 2YC0A 2PN5A 4IEPA 3KCXA 1N1VA 1OQ1A 1W0OA 4ISQA 4AQSA 4YGEA 4HSLA 4JQRA 1TE1B 3FUQA 4LBOA 4CP1A 4ZU4A 4Z92B 1GZCA 4PF5A 1FMD3 4DFSA 1DIWA 4CEWC 4HPKB 1TME3 4AHYA 4Y20B 1C5IA 4JGYA 1R091 2LM3A 5BNQA 1JN2P 3MGUA 1O91A 3LKJA 1CN1A 4N7UA 1D2QA 1EAH3 1H8VA 4S2HA 1V6MA 4YRDA 5KC5A 4M3CF 3H1WA 2CGNA 4IV1B 1PGL2 2X5IA 4KG0A 2PAMA 4MX3A 4MLOA 5KHIA 1AX0A 5DZGA 1R083 3B69A 2H0VA 2NYYA 4AVCA 3JBG2 1NCQC 2EAKA 1BEV1 1URXA 1YI9A 1OPOA 3R4DB 4CDWC 4LR4A 3OBRA 1C28A 1TQ5A 1WUVA 1I6XA 2WINB 3BOPA 4OLLA 1POV3 3SITA 1CAVB 3VBSB 5L19A 1F8VA 4Q0PA 3VV1A 1LGNA 2JE9A 1OOPA 1O4ZA 1Z78A 1X82A 1FOD2 4LULA 1W0PA 2VMHA 1W6OB 1OLRA 1QJY2 1SLCA 2VW0A 4NHMA 5KWRA 1BVP1 2Z5WA 2H0BA 1H2KA 2R6QA 4Q0UA 4H7MA 3N7LA 1S0DA 1H8TB 2WA3A 4H7LA 3V64A 1LRHA 2EIGA 3UKNA 3WX5A 3V0AB 4L11A 3TYJA 5FO7B 1UMZA 3VKLA 2OUHA 1QQP2 5C8CB 4KWLA 4XDQA 1OPMA 5KXDA 3IT8A 4E4ZA 5K0UB 1POV0 3KCYA 2A71A 3MW4A 1H1IA 4XIOA 5DZFA 3MI8A 1GQHA 1NYWA 3AKRA 4IV3A 4RR3A 5T5LA 1H1AA 4ITCA 3ZX7A 2WC2A 2XGXA 3L2HA 5AFBA 3M8LA 4XMAA 4M00A 2PA7A 4XJZA 3VBFB 1OLQA 2JDZA 5D1IA 2WFF3 1W6MB 1UU6A 3ZFEB 3TBDA 4NHLA 1QJX1 4MVTA 5CFCC 5JPMB 4N9IA 5GLZA 1ZZ7A 4B3NA 2ZS6B 4COUA 5GZDA 4QPGC 3SMHA 2XKPA 1IS5A 5F6KA 4Y1YA 3RRDA 4OI2A 1QGLA 2GSYA 4WV8A 5BNPC 4WVMA 3FFZA 2DCJA 1O3TA 2WNVC 2XVKA 1QJU3 4FOYA 1LOFA 1RUF3 2R042 1VBB2 2XBO3 2BQPA 3ZYIB 1AYM3 3NVCA 4HMZA 4Y1VA 1MS5A 4UW6A 4F83A 3WP4A 1D4M3 2WT1A 1ZA4A 2R063 4Q4W2 2ZGSA 1KJLA 1RUI3 4WM7B 3QD6A 4XYXA 1H2MA 2MPFA 2WQZC 1ZBE3 3KT7A 4INDA 1QWRA 2MEV3 3FZ3A 2DYCA 1IZ3A 2RMU3 1Q8OA 2GALA 2YUEA 1ASJ2 1MZ6A 1UIKA 3KMHA 1UKGA 1AL22 1YUDA 3FBYA 4WM8C 3FLRA 5L7OA 3NV4A 4CEYB 2WIIB 3O0WA 2DWRA 1BK1A 3ZXDA 1X36A 4XTPA 2DU1A 5J98B 4K3UA 1RHI2 1FNYA 4A7YA 3B94A 4BQ1A 1U0AA 3LOIA 5T3NA 4S2FA 3DGTA 1F2NA 1MQTA 3N7MA 4FOWA 3VBRB 4XQ4A 3FLTA 4GALA 4YM1A 4AXOA 4NVPA 2BYVE 4IEOA 3WD5A 2FQPA 1V9U3 3NO8A 2EXJA 2GC3A 3GALA 3GYDA 3PTYA 4ASMB 5SV8A 2B8MA 4H3WA 2UWAA 4X6QB 2YMZA 1YJLA 3ZFFB 2A70A 4RGGA 5BNOA 3LAGA 1LGBA 4XFAA 2YPJA 2RS32 1QH7A 5C4WC 4JGYB 3GZTB 4KGGA 4AEKA 1BXHA 1VAVA 4Q29A 3IDEA 2PLV1 1SLBA 4JVAA 1GV9A 4XFBA 3M4FA 1UZYA 1ZX5A 2X5IB 3AZWA 4JAAA 4EWDA 3A0NA 3NAPA 4GB32 1YXWA 1MVEA 4MXWB 1C1LA 1ZBA2 2BTVC 5DDJ3 3W9AA 5KHJA 1R092 2BGCA 5ABJA 1KS4A 1PVXA 1Q8VA 2XJRA 1BJQA 2KM2A 1LOGA 4P9WA 3LSEA 5H9PA 1W6NA 3JD72 1BBT1 1MEC1 1XE8A 5J48A 3MLJA 1D0HA 4NO4A 2RS11 1UPIA 5GLUA 1AR72 1OOPB 4YW5A 1BEV2 2GAUA 4FTBA 1C4RA 4F3JA 4C0HA 3D6EA 4QM8A 2E63A 2GZWA 2XWBB 3MPPG 5KHKA 2HYKA 2P34A 2Q30A 3MW2A 2RS51 4LBQD 1HIXA 1RUG2 4COZA 4YVWC 2WS91 3B9IA 3J8F3 4OFGA 4LO8A 1VBC3 3VBOA 4PDWB 1MZ5A 3IWZA 1B09A 1PK6B 4COWA 3VBUC 2BVVA 4IEXA 4XE9A 1CQ9A 3MF9A 3SCGA 5BY5A 2FBEA 4Z1VA 4X8PA 4D7YA 4LBKA 2F4PA 4RR3B 1D0GA 4IV3B 3KM5A 1QHDA 1Y43B 1N3OA 4YNIA 3ZXKA 1C8M3 2A5ZA 2XJVA 2ZBJA 2YXSA 4B8EA 4PCRA 3RPQA 2YGMA 2K9ZA 3FFQA 5IUQA 1EAH2 1YLLA 1YIPA 5BNNA 1ENXA 4KH9A 1SLLA 1LGCA 3PJYA 4OULA 3O7OA 4QGLA 4LBQB 4CDUC 3CJIC 5JCTA 4WVMB 1PZ9A 5F6LB 3QLQA 2XLFA 1C3HA 4AEDA 4YYOA 1B35B 3T1MA 1GR3A 1HLCA 2HWD1 3CL1A 1QJX2 5CB7A 3RS6A 1Y7BA 4FOQA 3DL3A 4AFAA 2HEYF 1YCIA 3HBZA 2CAUA 4XF4A 3GHNA 5CG9A 1FXZA 4AQ2A 5FOBB 4OHYA 4XIKA 4QPIA 1WLCA 2QNKA 3D0SA 3QBQA 4YVSA 2HKXA 1S2KA 4WVWA 1FT9A 3T1LA 3WHTA 2ZGLA 1AXZA 1CPNA 2ZCWA 4JRAA 1U5XA 3MYXA 4WZCA 1H4HA 4A7KA 4QPYA 1V6JA 1WLTA 3H7JA 3JBG3 4NWVA 2GDFA 4A3XA 3V65A 1FV3A 4GIQA 1X50A 4E2SA 1DZQA 5FQ0B 4YARA 5L7OB 1C5HA 3B9CA 1RUJ1 3MIHA 4ZKTB 3ILRA 3FWEA 3G7DA 5I0UA 1LOEA 1MACA 3R0RA 3ZVXA 2JKBA 1H9PA 3O14A 3ME2A 4XJ8A 3S0MA 1MQTB 4QM9A 4XTMA 4PLOA 1EV11 1PVC1 1RVF1 1YRZA 2HEVF 2WFPA 4PQ9A 3ZMOA 1QJY3 2NP0A 4IERA 1MS3A 3POWA 4PJYA 4P9YA 3H7YA 1ZVFA 2I45A 4CP0A 2WJSA 3AMQA 3RNSA 2WT2A 1N47A 1H0BA 1ND3B 2I2SA 2DVGA 3E5XA 2YGLA 1YFXA 5DG2A 4L92A 3MIDA 2ILMA 2PAEA 3EQEA 5FTTC 1MZFA 4HKLA 1QQP3 2WNUC 4EV0A 4Y26A 1G9BA 2CNAA 1LEDA 1RUF2 1RUE1 2BNOA 3CJXA 5CIRA 4Q4V1 1DDLA 3B00A 2XBO2 3R4SA 2NMNA 3NAPB 2HWE1 2TBVA 2DCYA 3W58A 1FI2A 3Q9OA 3BALA 2RR11 2QKDA 4KQ7A 1D4M2 5IT6A 2E6VA 5JOWA 2BNMA 4JGZA 5E89A 4YW2A 1RL3A 1TMF3 2BWAA 4G4FA 2GMEA 2PLV2 3ZSLA 2CWSA 2A6ZA 4IV1A 3TN93 3R6SA 1V00A 1FATA 3N7KA 1DZTA 3B93A 2TNFA 4YW3A 2MEV2 2VQ0A 2Y0IA 2ARBA 4XILA 1NE6A 2DCZA 2IC1A 2SBAA 3OY8A 4AFCA 1QXJA 3WG1A 1SFNA 1IPKA 1TNRA 1Z7S1 3U11A 4NN0A 3WP5A 1S0GA 3DUIA 1A3KA 2R043 4NOTA 4PLMA 2CGOA 4MGYE 2ZMLA 1XYPA 5JSPA 3RYKA 4V1PA 4CDXC 4OZXA 1R1A1 5IK8A 3CO2A 4Q4W3 1ZNPA 1BBT2 1VJ2A 1MEC2 1CAVA 3ZFGC 2XVGA 3VBOB 1OHFA 4BOWA 1A8DA 2RS12 4XBLA 3FUOA 3DKWA 1U5IA 5FFOC 2NMOA 2BW8A 5GZFA 1NLSA 4DB5A 4RQPB 5A3LA 4XFFA 4BCUA 4KL1A 3VDDA 3S7EA 2RS52 3S6PA 3E6CC 4META 4RL7A 1LOCA 2W68A 4R8HA 2WS92 5J36A 3USUA 2A6YA 1AL23 5FLJA 5GLVA 1ENQA 2DCKA 1PZ8A 4XFCA 1J1LA 1FNZA 5ACA3 4QMAA 2JJ6A 5JOYA 4FPKA 3V0AA 1RHI3 3NSTA 3KS7A 2VPVA 4QQHA 2GN7A 3WV6A 3TWIA 2FZ1A 3BTAA 4I0WB 3U4XA 4AI0A 3WXPA 2ZMNA 1N3PA 4GMP3 1AR81 1BCXA 1HRI1 3M3IA 5AC91 4CDQC 1T6GC 3EBRA 1Q5OA 1LHOA 3HIFA 3VZNA 5EWSA 2ES3A 4X6RB 2BBVA 3AYCA 4GWNA 4EN6B 1KITA 1ZZBA 3WG2A 3DF0A 5DDJ2 5FLIA 4XF1A 2PHUA 2Q4SA 2VW2A 4YM2A 1ND2C 2ARXA 3ZFEA 1NCQB 1RITA 1YYNA 5GALA 1AJOA 4K1ZA 4B4QA 2JG9C 2PHTA 2D43A 1V6IA 1F5FA 1RMU1 4CDWB 2RS33 2ZGRA 4J1WA 2XH6A 1COV1 4AVSA 1DQ0A 1YWKA 4YVSB 5GZGA 1AL0G 4K40A 1QOTA 2VOVA 1JOJA 1F9KA 1LOAA 3QH6A 2HWD2 2ZX4A 4HVOA 4OI4A 5EV7A 3PNAA 4EN0A 5CFDA 2R16A 4L8QA 2V5YA 4GH4C 1AJKA 2Y38A 1YNAA 3P3PA 4AVVA 1F31A 1RIRA 3J8F2 1R093 4I02A 4WM7A 1JYIA 3PLQA 3CEWA 1VBC2 1IS6A 3SNMA 3NV2A 2DTWA 2A3YA 1YIFA 5JDBA 4QX5A 3WDXA 5LRSA 2GU9A 4DRRA 3P3N<