1HRI2

Structure determination of antiviral compound sch 38057 complexed with human rhinovirus 14
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structure determination of antiviral compound SCH 38057 complexed with human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 49
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hri200
1C8NA 2QQPA 1ASJ2 4PDWB 1M06G 5D8AB 5C8CA 5ACA1 1MEC3 1W39A 4IV3C 3ZFGC 2R062 4CDWB 1RUF1 4N43B 2MEV1 1RUE2 1FMD1 4Q4X3 1C8M3 1QJX3 4Q4V3 3VBOB 2HWE3 5GKAC 5BNPC 3CJIC 4GMP3 1ZBA3 4AEDC 5BNNB 1VBB3 1MQTC 1R1A3 2X5IA 5AC91 1RUC2 1RUD3 1RUJ3 3ZFEC 1VBE2 1NCRC 4CEYB 3JBG1 1AYN3 2HWF1 4YVSC 1QJU3 1AR81 1TMF1 5K0UC 2RS53 1RUF2 4JGZA 5JZGC 1FMD2 4Y4YA 2IZWA 3VBUC 4GH4C 1VBA1 5L7OB 4YVWB 3TN92 1RHI2 1QJY2 1VRH2 2WFF2 3LOBA 1D4M3 5C9AA 5AC92 2WWSA 1AL22 4AEDA 4QPIA 1OHFA 1WCDJ 5ABJB 1AR62 1MQTA 3VBFA 3DPRB 2RS13 2WZR2 1Z7S1 3J8F3 1F8VA 2R071 1PVC3 1RUI3 2HWB1 4PDWC 1RUH3 5D8AC 3ZFEA 1NCRA 4Q4W1 2R042 1AR82 4RR3B 2WS93 3JD71 1POV0 3VBHB 4JGYA 1FPN3 5K0UA 1NCQA 3VBRB 5JZGA 1AR91 4N43C 3S6PA 1TME1 4CDUC 1BMV1 4N53A 2RMU2 3VBOC 1V9U2 1QQP2 4NWVA 1RUG3 4RQPC 1ASJ3 4Q4Y3 2HWD1 1BBT1 1VBD1 1R081 1BEV2 2XBO3 5CFCA 5DDJ2 1RMU2 2PLV1 5BNNC 1EAH3 2RR12 1HRV3 2BFUS 4CEYC 4CDXB 4PDWA 1PIV3 5D8AA 3NAPB 1FOD3 4Y5Z0 2R061 1PGW2 1RUE1 1AR72 1PO12 1RVF2 3VBSB 4CDWA 3VDDB 4N43A 5L7OC 1NA1B 2X5IC 4YVWC 1AYM2 3VBOA 5ACA3 4CDQB 4IV1B 1RUC1 1VBC2 5BNNA 5ABJC 2MEV3 1VBE1 3DPRC 1FMD3 4JGZC 4QPGB 1OPOA 1EV12 4CEYA 4FTBA 1HRI2 4RR3C 4BCUA 2XPJA 3VBHC 1H8TB 3ZFFB 4FTEA 5AC93 3VBRC 1COV2 3TN91 1RHI1 5C9AC 1QJY1 1VRH1 2WFF1 4QPIC 5L7OA 3JBG3 3VBFC 2HWF3 4YVWA 1X36A 1R092 1AL21 1AR83 1AR61 2WLPA 1TMF3 4GB32 2WZR1 1PO21 1RB8G 5ABJA 2RS32 1VBA3 4FSJA 3DPRA 2R041 1ND2B 4JGYC 1NCQC 1B35B 4CDXC 3NAPC 2HWC2 4N53C 4RR3A 1K5MB 5FMOS 1VAKA 3VBHA 1F2NA 3VBSC 2RMU1 3VBRA 1V9U1 1QQP1 1ND3B 1Z7S3 5CFCC 2R073 3VDDC 1POV1 2HWB3 1NA1C 1BEV1 5C4WB 4Q4W3 5DDJ1 1RMU1 1RUJ1 4CDQC 2RR11 3JD73 4IV1C 5BNOB 1PO22 4GMP0 4WM7B 5CFDB 1AR93 1TME3 5A33B 3IDEA 4WM8B 1X33A 4Q4X2 1C8M2 1QJX2 4Q4V2 2HWD3 4QPGC 1BBT3 1VBD3 4CDWC 2HWE2 1R083 1HXS1 1PGW1 4CDXA 1AR71 1PO11 3NAPA 2PLV3 1RVF1 2BFUL 1ZBA2 1H8TC 3ZFFC 1VBB2 4IV3B 3ZFGB 1R1A2 1AYM1 2BPA2 3VBSA 3M8LA 3VDDA 1RUJ2 1NA1A 1VBC1 4Z92B 2R063 4CDQA 1AYN2 4CEWB 5BNPB 3CJIB 1RUE3 4IV1A 1QJU2 4EJRA 2RS52 2ZTNA 1EV11 1ND2C 1HRI1 2GH8A 1HXS2 1DDLA 1QJZA 4QPGA 1CD3G 1RUC3 1K5MC 1ZBE1 1COV1 1D4M2 4YVSB 1H8TA 5A32B 3ZFFA 2XBO1 1VBE3 1ND3C 4RS5B 2RS12 1R091 1OOPB 3J8F2 4NWWA 5J98B 5C4WC 5LK7B 4GH4B 1PVC2 2TBVA 4GB31 4SBVA 1RUI2 1RUF3 1RUH2 4RHV1 5BNOC 3ZXAC 2WS92 2RS31 4WM7C 3FBMA 5CFDC 2RM21 1VB4A 3TN93 1RHI3 1QJY3 1VRH3 2WFF3 4WM8C 2HWC1 1ND2A 1AL23 1A6CA 1RUG2 1B35A 1ZBE2 3JB8A 1AR63 4Q4Y2 1CJDA 2XBO2 2WZR3 1PO23 1K5MA 4FTSA 1EAH2 2BUKA 2R043 1ND3A 1HRV2 5FMOL 4RHV2 4CDUB 5C4WA 1VB2A 1MEC1 1NY72 1PIV2 4RQPB 4CEWC 1FOD2 3HAGA 2RM22 5BNOA 2RMU3 1V9U3 2Y26A 1QQP3 4WM7A 5CFDA 4Q4X1 1C8M1 1QJX1 4Q4V1 1SMVA 5C8CB 1POV3 2HWE1 5A33A 1BEV3 1PGL2 4WM8A 5DDJ3 1RMU3 2RR13 4GMP1 1ZBA1 5J96B 5ACA2 1VBB1 2ZZQA 1R1A1 2GSYA 1RUD1 4IV3A 3ZFGA 4RS5C 2MEV2 1OOPC 2BBVA 1MEC2 2FZ2A 1AYN1 1HXS3 1AL0G 1AR73 1QJU1 1PO13 2X5IB 1RVF3 3JB4C 2RS51 4LLFA 4CEWA 5BNPA 3CJIA 1AYM3 1HQNA 1HX6A 1VBC3 3JBG2 1D4M1 4JGZB 2HWF2 1AUYA 1E57A 1RUD2 1TMF2 2RS11 4YVSA 3J8F1 5A32A 1PVC1 1EV13 1RUI1 1HRI3 1GFF2 1RUH1 1VBA2 4RS5A 2VQ0A 1OOPA 5C9AB 2WS91 3VBUA 4GH4A 4AEDB 4QPIB 1MQTB 3VBFB 1NG0A 1ZBE3 1COV3 1FPN1 1IHMA 2DF7A 1B35C 1NOVA 5FOJB 3ZFEB 1NCRB 1R093 5C8CC 1Z7S2 1RUG1 2R072 1ASJ1 4Q4Y1 4GB33 4RFT0 2HWB2 4RHV3 4JGYB 4Q4W2 5K0UB 1NCQB 1EAH1 5JZGB 3JD72 2RS33 2FZ1A 3VBUB 2RM23 4N53B 1HRV1 1AR92 2HWC3 1TME2 1BMV2 1NY71 5CFCB 1PIV1 1FOD1 1FPN2 4CDUA 2ZAHA 2HWD2 1BBT2 1VBD2 1R082 4RQPA 2PLV2 1PGL1
chains in the Genus database with same CATH superfamily
5DUXA 2QQPA 5FZOA 1Y4WA 4BB3A 2V72A 5ACA1 1OUSA 1LOCA 5KHHA 4XYXA 3ZFGC 2WZEA 4QWNA 2VL4A 1SLTA 2WRAA 2CU5A 2ZACA 2W9XA 3PTRB 5EQUA 2YBKA 2ZJCA 4E9KA 4O61A 1FMD1 5JIAA 1TEIA 4A44A 2FD8A 2XB6C 2HJIA 4PQQA 4E4HA 5FJKA 3THTA 3K3NA 4UT5A 2ZS6B 1LHOA 4XFFA 5GKAC 2QZ3A 3ELNA 3CJIC 3OJBA 3N36A 2VY0A 4GMP3 2DFBA 3AYAA 1XBFA 3LIHA 3ITQA 4IE0A 2VZOA 3FHIB 1KJLA 2ZGRA 2X5IA 3E1F1 1Z0HA 3BIWE 4LBLA 1PZ9A 2VOTA 1ULCA 4KBBA 4YM2A 3UL2A 4OFGA 1YFYA 2W52A 3B7MA 5FYHA 2OT7A 5DG1A 4JHZA 1W06A 4C0HA 2EXKA 4FP3A 3TWIA 3WXPA 3ZYBA 2NMOA 4BMEA 3M4FA 3WR0A 4YVSC 1CAVA 1LHVA 3LSEA 1QJU3 1GWLA 1AR81 2XG3A 2CYFA 1TMF1 1LCLA 4LHKA 5K0UC 5GLTA 5JAXA 5JZGC 3VN4A 2GH2A 5LASA 4Q1PA 5I0TA 3VBUC 4GJZA 3HBKA 4OUSA 3VDAA 1OH3A 3UESA 2JDKA 1DBNA 1GWMA 3FMGA 4HKOA 4XQWA 3HVDA 5L7OB 2KXLA 1SLAA 2O8OA 2XJVA 5LEJA 1MS3A 1RHI2 3RQ0A 4HANA 1QJY2 3MDPA 1YCIA 2CAVA 5HI0A 5A3PA 3V0BB 1DGLA 3AMNA 4LIVA 3O12A 4P9IA 3SEPA 4TSVA 2W91A 4FOYA 5C9AA 4AEDA 5A70A 2AREA 3MIEA 4LORA 4QPWA 2OYZA 3T4HB 5ABJB 1YWKA 2WQ8A 3AB0A 3PJQA 1S0FA 3WCRA 2A5ZA 4HN1A 1LB2A 2AGSA 4PLNA 2V5DA 2VQAA 3MF6A 3HOBA 1WA6X 3LPGA 2ILMA 3ZFEA 3ROUA 1NCRA 1YIFA 2R0HA 1KQRA 2DU1A 3B93A 1H6XA 4O9GA 2WS93 1PX4A 2BNMA 2XUEA 2QQLA 3Q9OA 1AX0A 5BV6A 3ES1A 1TNFA 1NCQA 3VBRB 3NV4A 1C5HA 4WZCA 4FOWA 5L19A 2AEZA 3E5QA 1OA4A 3S5QA 3UGHA 4CCLA 1TME1 3O1RA 5A6QA 2ZGLA 1LENA 4PI0A 3VZOA 3VKFC 5FZ4A 1V9U2 3WDTA 2DUQA 4AVVA 4CUGA 5L36A 1GOHA 1NLQA 1VBD1 4M01A 4XF3A 2XBO3 5CFCA 3RG0A 2R30A 2D6MA 4UFKA 2CHHA 4XFGA 5BNNC 1DGRN 5T5OA 4KG0A 1PZ8A 4LK7A 2JDZA 4QGNA 4BDVB 2NLRA 4BA6A 4P9JA 1H1AA 4WVVA 3ZMNA 4WZFA 3RVHA 3M2MA 4XUOA 3U10A 3AKRA 5KHJA 2EXJA 3D0JA 1J59A 2G9ZA 4A7ZA 4PDWA 3TYJA 2VUJA 3HBZA 4QX7A 1GNHA 4YNIA 4CVUA 1IS3A 2ZGUA 4DUVA 2XVKA 1RUE1 4OMDA 1A8DA 3SKVA 4RGGA 1VMFA 4N43A 1BXHA 1ODNA 2QQNA 3BB6A 5APAA 4XBLA 3M70A 2X5IC 3IPVB 1ZYBA 4K8FA 4R4ZA 1I6XA 1W3XA 3VBOA 1JYIA 1GQPA 4BLIA 2QQJA 4IXLA 1RYYA 4K3UA 2D5HA 2WZ8A 2VZ1A 4IV1B 4JDNA 5HCFA 4NJ4A 2FHRA 2O0OA 2UWBA 5FZMA 5HV0A 2UU8A 1W6PA 3CDZB 5LRRA 1UIJA 1LODA 2MEV3 1AXYA 3DPRC 1XOYA 2JB4A 2G1MA 3D0SA 1NE4A 4Q0UA 4FFHA 5CBLA 2MPFA 4KGGA 2KM2A 1OUXA 3ON7A 4CEYA 1NLRA 2ZGTA 3FC0A 1JHJA 5EPAA 1RIRA 3VDBA 4U36A 1ONAA 3SISA 3VBHC 4AYUA 4M00A 3UKTA 4CE8A 2YROA 4OUEA 5FBZA 4DB5A 3TN91 5C9AC 4K21A 5FTTC 4HK9A 4MVTA 4XUTA 4AI3A 2YZ4A 3JBG3 3N9PA 5F32A 2HWF3 4RSUA 4BM8A 2W1QA 1EPZA 1SPPA 3BALA 2GAUA 3MIHA 3DXUA 4S2HA 2JG8C 1F4AA 1JOPA 4IEXA 4UI9L 5I91A 1HB2A 5LK5A 1O91A 1RB8G 1VLNA 3RFRA 3FFZA 4OI1A 1CVNA 3VBOB 5FMBA 1VBA3 1A3KA 2DUOA 4HT1T 4AFBA 2VGDA 4QKDA 4EN8B 4Z07A 5A3UA 1NCQC 1DQ0A 2E33A 3MI8A 4JHTA 5FKBA 5L73A 1O3QA 2YBPA 3I59B 2Q1MA 1MS4A 2W39A 3WLUA 4CDXC 3NAPC 3ABZA 2AUYA 2HWC2 2D6OX 1UYXA 4HBNA 3VGIA 4DS0A 2RDRA 1S2EA 4LKSA 3VKOA 1C5IA 1W99A 3MIFA 4FPHA 4AK3A 2JDAA 2TEPA 3DXTA 4PLMA 3VBSC 5GALA 5JPNB 5CFCC 1ND3B 4JQRA 4AEJA 4AAPA 2R073 5F5IA 1VMHA 2P3KA 5IHRA 3BI3A 2HWB3 5A7SA 5LBEA 2C0ZA 2DVFA 5C4WB 4GXLA 1DGWX 1OA2A 5DDJ1 5H9PA 1WUVA 2WUHA 4CDQC 1QXRA 3WDWA 4UYBA 4C91A 4DQAA 5BNOB 4LBQA 1CZVA 1PO22 4BHPA 2BERA 2A6XA 1H9PA 1SLIA 2R16A 4QPYA 4CCDA 2P3IA 2RDNA 5EWSA 2LALA 2QTWB 4DMIA 1AR93 3NVCA 4ZY9A 5ANNA 1G6NA 2GNBA 1ZZ7A 1NQDA 4LNVA 3IDEA 3MICA 4LEJA 4P9WA 3NNGA 4UW4A 4YARA 4NIHA 5HCHA 1QJX2 1CX1A 2HWD3 4QPGC 1HN0A 1BBT3 1QKQA 3RI9A 4AI2A 3ZVXA 4EYUA 1R083 1HXS1 4CCOA 4E2SA 3WG3A 1UZYA 4LO8A 5LB6A 4UFIA 2ID4A 3W5NA 3R0RA 2ZGKA 2VMEA 5DAPA 4KWLA 1G8WA 1YYNA 3VV1A 3VLBB 4IV3B 4CU6A 4O7XA 4AQTA 1H2KA 1AYM1 1O59A 1ULDA 2B9UA 2J1AA 3IIAA 3LD8A 3M8LA 3V64A 4BISA 3OGSA 3VDDA 4KWJA 5FPBA 1UY4A 5FZ6A 3AMMA 2Z4FA 2Y38A 3IDCB 2P17A 3OYWA 1AYN2 5E6HA 3S30A 4JKKA 3MPBA 5A1AA 5FY5A 5FZIA 3AMPA 3ZXKA 2BGOA 4YW4A 4FQ4A 1MZ5A 4JDOA 1OF4A 2XMLA 4YW2A 4A41A 1F35A 1UYZA 1EV11 5KHIA 1LHWA 5FPVA 1X50A 3WW4A 2XJSA 2ZMNA 4CP2A 3DECA 4ONUA 3IKWA 3RZLA 2NN8A 2WIIB 3CHXA 1RUC3 2RDSA 3AKQA 4E2GA 1JHNA 5D2AA 3SH4A 4XUNA 3H7YA 2A6WA 3PNAA 3ZFFA 4D0QA 2XBO1 4IE4A 2WNUA 1RINA 3IZOA 1W2NA 4Y20A 1UU6A 3ZXEA 1BK0A 5IFTA 1LKNA 4XTPA 2ORXA 5HCBA 1W2AX 3KGZA 4Y1XA 1GZCA 5J98B 2TBVA 4GB31 1DG6A 4N9HA 1RUF3 2P2KA 2O14A 3O7OA 2DURA 1OLME 3WNKA 5J37A 3ZMOA 2PHDA 4OI4A 5FYUA 1O8PA 2RJLA 4I3GA 4S2FA 4ISRA 1UF2C 5CIRA 5FYVA 4ES8A 2QQKA 2R49A 1DGWA 3H42B 1RUNA 4IE5A 1VRH3 1G9AA 1D0HA 2XJPA 2VZQA 1N3QA 2F6BA 1JUHA 4AG4A 1U0AA 1AL23 3SCFA 1TNRA 4HSLA 1B35A 1ZBE2 1PGSA 2ORZA 3T30A 4YFZA 4ZPIA 2WZR3 1QDOA 2P37A 5FIXA 4DINB 3V0AB 1PO23 4LO4B 2R7EB 2AH2A 4ARYA 5C6CA 5CADA 5JMCA 4AAXA 2BUKA 4RGAA 4YZ1A 1NT0A 4R8HA 2PELA 1L3JA 2R043 3ZIXA 4LOTA 4A42A 4DOUA 1HRV2 3I7DA 2WO1A 1JYCA 4Z2AA 4RHV2 4I01A 1LTEA 1O3RA 4V1PA 4YW6A 3T2OA 1NY72 2B5HA 1YQ6A 1PK6B 2VECA 3OEAA 2RM22 2VZPA 1PNGA 3MFAA 4XJAA 4Q8LA 1ACCA 5F8PA 4NOTA 4DZGA 2RMU3 4WM7A 5CFDA 2A6VA 3GBGA 4MHRA 4Q4X1 5T54A 3BOPA 1C8M1 3FLPA 3HNBM 4AF9A 2ZGMA 4XMAA 1POV3 2HWE1 3C8XA 4XHXA 5A33A 2YYOA 5A3NA 3APBA 2GC2A 2WNVB 4LIUA 4EWEA 3MGUA 2ZEWA 3E97A 2RR13 4IDZA 5IWFA 2RDQA 5ACA2 5DZGA 1R1A1 2PHTA 1C28A 3AKSA 1S4CA 2IFWA 3VUOA 3ENRA 4ZXKA 3TEWA 2BDRA 3VDCA 2GSYA 4ZS2A 5FO7B 1NX9A 1NAEA 5FQ0A 5LA9A 3THPA 4LJHA 1OOPC 2BBVA 1MEC2 3SH3A 4AHWA 4K1ZA 1LU2A 1PO13 1ZA7A 3LA2A 4XW3A 5AVAA 2BOIA 3JB4C 2RS51 3RZHA 2K9ZA 5FP4A 4URTA 1WBFA 1WMXA 2GNMA 4XCBA 2W1UA 1JZ4A 1G9FA 1SQ4A 2TUNA 3KVBA 3C7HA 3E5XA 2VH9A 1HX6A 1W8FA 1KFUL 2FDHA 2B8MA 2ZGNA 5JI9A 5LA2A 4E4SA 1UWWA 1R64A 1VBC3 2WNUC 3AMQA 3ILRA 4E8DA 4NO4A 1E5IA 4IEZA 1D4M1 1WA4A 1WZXA 4JGZB 5F6KA 2XQRA 1E5RA 4MGIE 4Y1UA 1QWRA 3P3PA 5J7MA 4EROA 3WSOA 1RUD2 3C7EA 1MZEA 1TMF2 3FLRA 4RGKA 4KH9A 2RS11 5IK5A 1S0BA 3J8F1 5A32A 2JDMA 3AP5A 1GOFA 1I5ZA 1W6OB 5IAVA 4DNYA 4GKYA 1PVC1 3NL1A 1RUI1 4RS5A 2J1VA 1I3HA 1ULFA 3AZYA 1E5HA 3U1XA 4UWDA 4GH4A 5LBCA 5CG8A 4LE4A 4BQ5A 4P5YA 1W8NA 1ZBE3 1COV3 3WF1A 1IQDC 3KQ4B 1UY2A 2Y60A 2DF7A 3PUIA 4L8QA 2EF6A 2XLFA 1B35C 1RTVA 1Y43B 3B02A 2DCJA 3GCXA 3PMEA 5FREA 1X8MA 3HIFA 5K4LA 3U4SA 3ZM8A 1R093 4XF1A 4DFSA 2GMPA 2JECA 3KT7A 1ASJ1 1H6YA 1UYPA 1IPJA 3K77A 3OY8A 2H6BA 4FXKB 4RFT0 5GZDA 1NZIA 4TTGA 1DLCA 2C26A 4FI9A 4RHV3 2JG9C 3GZUC 4QX1A 4R9AA 3ATGA 2GC0A 2R0FA 2ARAA 1EAH1 2W0XA 3HQXA 5A6XA 2RS33 2TNFA 4Z8BA 1UMIA 5F5AA 1H2NA 5FYBA 4KU8A 1GMMA 2RM23 4N53B 1CQ9A 1UY0A 2OQ6A 4XJ8A 2FDIA 3QCWA 4W50A 2P3JA 1XNBA 4LLOA 4D8MA 1W0NA 4GQ7A 1TME2 4R4XA 3WF0A 4HOOA 1PIV1 3J9SA 4AGGA 4P9GA 2DUPA 2P34A 5FYYA 3H1WA 2D6NA 5FAXA 5CKQA 1N1VA 4CDUA 2EIGA 1VBD2 2CL2A 2E26A 2IVIB 4MSVA 4OHVA 5L9BA 1AF9A 2VPVA 3N7KA 3BOWA 1XJAA 2WBKA 1S2KA 4MXWB 5B2GB 3UKNA 1C8NA 1OFSA 4HSJA 5FWEA 3S0MA 1S0IA 5D8AB 2XGXA 3I2OA 5C8CA 4QX5A 2WT2A 4BLJA 5EYXA 2DBNA 1MEC3 4LUMA 4P02B 5EYYA 5CA6A 4WVMA 1W39A 1HKDA 2HEYF 1UKGA 3WNOA 4BJ0A 2YC4A 3IIIA 4R9CA 2XJQA 5DABA 4TN7A 1RUF1 2WWJA 5I8YA 1XQNA 4IGQA 1RUE2 2JDHA 2CSGA 1FYUA 4Q4V3 3J7NA 2IXJA 4DY3A 5K8SA 1W2UA 2BNNA 1WLWA 3K4DA 1J3RA 1H8VA 5L9RA 3I8TA 4LTAA 1ZBA3 1LEMA 1Q8SA 2XUMA 2ZHLA 1JZ2A 1VBB3 3BU0A 1MQTC 4EN0A 2BZDA 4ITCA 5DUWA 4QB2A 4Y5TA 4ET7A 5AC91 1L7LA 5A7NA 1RUD3 1RUJ3 1UY1A 4LULA 4M3CF 3LEIA 4AEMA 4ZHNA 3SNMA 3N9OA 4FPCA 1QOTA 3SCGA 1G7YA 1SBEA 1KRIA 5E89A 1OMIA 3WCSA 2VMGA 5IVYA 5LATA 1OD3A 5JSOA 2Q4SA 4W65A 1CAXB 1SCRA 3VZLA 3ZPYA 4HLTA 3NJVA 2QDRA 1O5LA 2Y0OA 4Y4YA 2XJRA 4CXXA 4F7ZA 2IZWA 4GH4C 5HCAA 4XUPA 4BQ3A 2BU9A 5CISA 4YVWB 3TN92 2VCMA 3NO8A 4K20A 4PBPA 2AZ5A 3HEIA 4XACA 3H3UA 5EIYB 3GJAA 4RN5A 1HLCA 3KZ4C 1GQGA 3NSTA 4IEVA 4I02A 3OPTA 3VL9A 3BGAA 3KV9A 3VBFA 4CDXB 4PIZA 5FUPA 4AL9A 1Z7S1 2MHFA 2XHNA 5IVVA 1BJQA 2WA4A 4XFCA 4L92A 3WQ7A 1VIWB 4S2DA 4YGEA 1QDCA 5AFEA 4MGTA 1RUH3 4ZU4A 1RL3A 2W46A 5J3UA 2QQIA 2Y8KA 1JH5A 3POFA 4OVEA 4LHSA 3JD71 2ES3A 4RR3B 3RZZA 5E8AA 1J1TA 2QJVA 4LKFA 4X8NA 2NQYA 1GLHA 1JXNA 2UWAA 3MPPG 5B4NA 5JSRA 1RXGA 4JGYA 5K0UA 3WD5A 3WX5A 5DXDA 3TEXA 3I3BA 3AKPA 4KU7A 5JZGA 1GV9A 2GMEA 5J36A 3KGLA 4N8MA 3VZNA 4CDUC 2WC2A 2PQSA 1IPKA 1RUG3 1OQ1A 1TQ5A 4Q4Y3 4HK8A 4YW7A 4HVOA 3LEGA 1NXMA 5A7WA 1WLTA 4Y1YA 5DDJ2 5JLVA 4R52A 3OBAA 2FDJA 4UAPA 3H8XA 5LBBA 2JDNA 5LCWL 5JDBA 1ZREA 5B4XA 4QX0A 1ZX5A 3ILFA 2XJTA 2W1SA 4YG3A 2BBAA 3KD4A 3T0DA 1FOD3 3MLLA 4FPEA 1SFNA 2BWAA 2E63A 2R061 3I4IA 4G9SB 2XOMA 4N9IA 4XCAA 5I0RA 4EV0A 4A45A 1FATA 4JCKA 3WF4A 2B4KA 1REDA 3GXUA 1YFWA 2JDPA 3HN3A 5A3WA 1CGPA 4CDWA 1AZDA 5I8TA 1JODA 3USUB 3GGLA 4LQRA 1NA1B 4M3CE 5L7OC 1JYVA 1AYM2 2W68A 1BZWA 1LOFC 1GANA 5IK8A 2WLQA 3NW4A 4L11A 2VO5A 3B9IA 5FZDA 1UYYA 2VE1A 4QB1A 4BOWA 3I3MA 2C1FA 4GAZA 3SQOA 3Q8CA 2IXHA 3R6SA 5I0UA 3D5OA 1REFA 4PI2A 2C9AA 3KQRA 5BNNA 4NIDA 5ABJC 3RSJA 4DPNA 1K42A 1VBE1 2OKXA 4OHWA 1Q8PA 4BQYA 4QX8A 1EP0A 1LU1A 1CWPA 3ZXDA 3WNLA 4NRMA 3O0XA 1H1IA 5GLUA 4AEKA 4QKFA 1QGLA 1O6UA 5JIUA 1EV12 4FTBA 2ZKNA 3WG1A 2B46X 5C5UA 1XU2A 1H8TB 1A34A 2PHUA 5DAVA 1XSQA 3LPFA 3VBRC 2Y6JA 3WQ0A 3KF5A 3I59A 3RJ2X 3TAYA 4CP9B 5IFPA 3B5LB 3TBDA 2WNEA 2WFF1 3I2FA 5KBFA 1CAWB 3MIGA 5F3GA 4ATEA 2JICA 4HVQA 5A7QA 3VBFC 4FO9A 2PHXA 3VKNA 4PIYA 4TXWA 3K51A 1GZ9A 1QJFA 2ZPXA 4QKBA 3VKLA 1AR61 2WLPA 4IESA 4GB32 1JMUB 3OBRA 4N7IA 2QDNA 4AI0A 3AZXA 2B9VA 4L9BA 2PHLA 1DQ1A 3JUUA 3BIEA 3DPRA 4FSJA 5GLVA 5A80A 3PL0A 2R6QA 1ND2B 3A23A 3IT8A 4JGYC 5A3TA 4EZHA 3HNMA 2DVGA 2PTMA 4XQDA 2C6SA 2K2SA 4A3ZA 1XSRA 4AVTA 4UFMA 3HT2A 4MV2A 2HBUA 2JKBA 5SV5A 4IEPA 4YW3A 4CCCA 1K5MB 2YHJA 2FMDA 1WCKA 5FY0A 1ZZ6A 3VBHA 1F2NA 2BRTA 1IGOA 2WINB 3FZ3A 3NV2A 1QQP1 4AHXA 5DUVA 4PCRA 2BP6A 4OHZA 4B29A 1BEV1 1VAMA 2R1DA 4Q4W3 2Q8DA 3T09A 1RMU1 4P9YA 1PM7A 3WF2A 4Z2WA 1RUJ1 1YNAA 2Q0AA 5FPXA 4IE6A 1GZTA 2SLIA 4IV1C 4FT8A 1XNKA 1ZM1A 2JG8A 1YC61 1DYOA 3AJZA 1DYKA 1FI2A 1T6GC 4FFGA 5DQ0A 3ZN6A 5AVPA 3KHBA 3HNYM 3WUCA 5JR2A 3ME2A 1NKGA 4B1MA 1SG3A 2ADDA 1GYKA 2OVUA 3I2HA 4FQZA 2FCVA 4MXVA 3JZVA 4NPRA 4WM8B 1X33A 1OLMA 3OUHA 4JZRA 5FYIA 2P6CA 2DCKA 1ALYA 4Q4X2 3WNXA 1C8M2 2HYKA 2EXHA 5J1XA 1ULGA 4CDWC 2HWE2 5GZCA 1PGW1 5EV7A 4CDXA 1AR71 4QXHA 3NAPA 3H0OA 4ZU5A 2P1BA 2PLV3 1RVF1 1W6NB 4JX0A 1EY2A 1KGYA 3BCWA 4META 2F4LA 4C90A 2VOXA 3OUJA 1UOBA 2NM1A 1R1A2 2ZOEB 3FBYA 3ZFGB 4FPOB 3VBSA 4E4ZA 2ET1A 5AFBA 4CTEA 1OLQA 2XL7A 4LT5A 5FZHA 3OF1A 4G4FA 2W1WA 4WBBA 3G7DA 1D2SA 3OGRA 1DCSA 4Z92B 5D1IA 4CDQA 3UT0A 5GZFA 2RV9A 4CEWB 1QHDA 2DTWA 3CJIB 2DWRA 4IERA 1CAUB 2BEOA 3W58A 1JI6A 3IAPA 3NJZA 3PTYA 3NNMA 2RS52 3DF0A 3PUAA 4UBGA 3WP6A 4CCNA 2ZHMA 3QOPA 1U5XA 2D3SA 4WVWA 2VZ3A 4MH0E 5FCCA 3V56A 1LOBA 1OURA 3ZR6A 1U5ZA 1HRI1 2GH8A 1J3PA 1H2MA 2G9FA 5I0DA 2E32A 2OZ6A 3HD8B 4X8PA 2Y6KA 4QPGA 1LHNA 2VNGA 4XAEA 2VMIA 2ERFA 2QE3A 3M3QA 3LQCA 4OLLA 1LRHA 3CBNA 3LKJA 4RA0A 1DFQA 1GICA 1D4M2 4YVSB 3A22A 3KF3A 1KS4A 3KM5A 3OUIA 5JWPA 2YDEA 1XC6A 3PVNA 4NIGA 1A8MA 1ND3C 3EJKA 4XXAA 1ZRDA 1XNTA 4Q2FA 2RS12 2CY6A 2A7AA 4V2VA 3J8F2 2Y6GA 2ZEZA 3NKTA 5C4WC 5LK7B 2Q30A 1W6QB 1PVC2 3DUIA 5FOBB 1RUI2 1PZ7A 4GKXA 3P1IA 5BNOC 1ST8A 2WO3A 2J1SA 4Q26A 4PF5A 3UJQA 2EALA 3ZSMA 5IW0A 2DYCA 3PHMA 3GDBA 3CO2A 1FAYA 1XPWA 2ZA9A 2D97A 3RI8A 2JD4A 1YFXA 4EN6B 5F3IA 1RHI3 1IKPA 3AC0A 1VMJA 1QJY3 4QHOA 5DAWA 1QY4A 3ACHA 2CNAA 3BODA 1QXJA 3N9NA 1UZWA 2FMYA 5FBJA 1OKQA 4LITA 1JUIA 4MGYE 4IEOA 2DFCA 2PHFA 3KV4A 5A7OA 1WBLA 3GM8A 3NJYA 4JTOA 3JB8A 3H7JA 1W8HA 5F5CA 3AKTA 4TYSA 5KWRA 2XONA 2XXZA 3KHCA 1L7QA 2GP3A 1EAH2 1O4TA 1LGCA 3ZPOA 4COZA 2JIGA 1DZRA 3WP4A 4LKEA 2LRPA 5FXVA 5KHGA 4XE9A 5BYNA 1QF3A 3WG2A 1W9SA 2AACA 3RZMA 2IFRA 3I2DA 5FMOL 5GLZA 5DG2A 4XPVA 2VW1A 4J6GA 4P5HA 1S0JA 1RGSA 3WHTA 3ZDVA 1W28A 4KBZA 2ZXQA 2UWCA 2JENA 4UF0B 5DZEA 4DEQA 1PIV2 4YYOA 1JU4A 4CU8A 2A6YA 3HT1A 4MGKE 1WW5A 5IAXA 3UK9A 1ZVFA 1UCXA 5FZOB 1V9U3 2Y26A 3T08A 3I97A 4F8AA 4AI9A 1UQXA 2A6ZA 3A4UA 5H9SA 4JDMA 5T5LA 1IQAA 1CX4A 2DBIA 2XH6A 3SLIA 4BIOA 4GMP1 3P5BA 1SDWA 2A3XA 4NR1A 2Y34A 5HXVA 1T2XA 3THDA 5JXGA 2AR6A 5EJ3A 4XBNA 5EHDA 3GBWA 1XU1A 3Q8FA 2GALA 5IUQA 3VHPA 4AQ2A 5JXHA 5F7UA 3B01A 1DQ2A 4YWAA 3POGA 4XIOA 5KXCA 3OBZA 5JXIA 1OF3A 4B8EA 5C3PA 4H3WA 3N9QA 4OZOA 5T5PA 3ZYIB 2QQVA 4AHYA 3L9JT 5FXXA 1T6BX 3RPQA 1QJU1 3NQHA 2QKDA 2X5IB 2OXBA 4G3YC 4CRQA 1I1EA 1LOEA 4COYA 4EWAA 3AP6A 1V6OA 5BNPA 2EAKA 3RDIA 3W59A 1F4HA 5KR7A 2Q8OA 1JZ5A 2VXRA 3ST7A 2BJSA 2OPWA 2WN3A 5HBAA 4NE9A 1CIYA 1CAVB 4CUAA 4XFHA 4Q0SA 1YRZA 2B7YA 4ASMB 1H30A 4Y26A 1E57A 1V6MA 1DGRA 2D3PA 2HYXA 1DYPA 4QM9A 5BY5A 3ZKYA 4CA9A 3MFCA 3UETA 3DEMA 4A7KA 5A3MA 4ZKTB 5IVJA 1X82A 5E16A 2HEWF 1ULEA 2Y64A 1F9KA 1JW6A 2W5FA 4L99A 1GFF2 5FLJA 4XBQA 1EPWA 2FQPA 2VQ0A 4QAWA 3BTXA 1OOPA 5C5TA 5C9AB 2WWUA 2WS91 1PMIA 3USSA 4AEDB 5FO9B 1YI9A 3N7MA 2X8KA 4W6XA 4B7EA 1CESA 3P3NA 3RZJA 1NG0A 2D7FA 2XDVA 2ZHNA 1B09A 1IHMA 3OG2A 5IJRA 1GZWA 3CZUA 4QU1A 3L2HA 4H7LA 5A6ZA 1D7PM 2VMDA 4DUWA 4LOSA 4ZU7A 3ZFEB 2DCTA 2XJUA 1NCRB 3OSDA 1XYOA 1Z7S2 3WQ1A 3WT3A 5I0SA 1V6JA 3NV3A 2YG0A 4OUMA 2Z42A 2ZGSA 4JC1A 1WKYA 4IGPA 4FPYA 2VOKA 4MOAA 3DYMA 1ZZ8A 2AEYA 3TRSB 1WD3A 1NCQB 4NROA 4Q27A 3JD72 2X05A 1JOBA 1G9DA 5HV4A 3O1MA 3OD4A 1S1AA 2Y6HA 3U07A 3O0VA 1EYBA 2D43A 2JDUA 4M0NA 5EZWA 1V6NA 2HBTA 3ZXFA 1BQPA 2HWC3 1JZ7A 4J1XA 4RL7A 4NPLA 2RG4A 3M3OA 5CFCB 1JTZX 4OI2A 4QHZA 3AYCA 5FLIA 4BPZA 2G9GA 1FPN2 3FJSA 4DEVA 3B94A 5FY9A 1K12A 3DKWA 3HWJA 3KB5A 4JRLA 2E7AA 3AL5A 1LEDA 4RQPA 1W04A 1W9WA 2IXCA 3ZKUA 2VCCA 1MVQA 3HQRA 2WT1A 2ZX3A 5FDBA 2X09A 1PGL1 3CMGA 1MR5A 5JPMB 3GHMA 4PDWB 3T4VA 1M06G 1US2A 3LIGA 3TNQA 2VZVA 5HXMA 1C57A 1PM4A 1MS1A 1SHWB 2W3JA 1M4WA 4C1WA 3AVSA 3LFMA 3H1YA 1XYPA 1K5JA 2JG9A 2BGPA 2R062 3KCXA 3N7LA 1H4GA 1I9RA 2L9LA 1OKOA 2N7GA 3CZJA 3JU9A 2MEV1 3EBRA 4N43B 2ZGQA 1W8UA 2PHWA 4M4PA 3AYEA 4FCAA 1QJX3 2VZRA 4W8JA 1C1LA 2GP5A 3IN9A 2VTXJ 5CYYA 5FZFA 2DDUA 2Q1FA 4LR4A 5FP7A 5CG9A 5BNPC 2BGCA 2EIEA 5ISLA 3FUQA 3PJYA 1ZNPA 5FWJA 1VP6A 4QQ2A 5FLHA 2C9KA 2A1XA 4AVSA 4UW6A 1W6PB 4P14A 3WNNA 1OD5A 1CONA 1SLCA 4KI5M 4XF9A 3RYRA 2Z69A 1FNYA 3ACFA 3T0AA 1IPSA 3U0ZA 1GU3A 3NMBA 1I5PA 2J1EA 1DLLA 1VBE2 1YEWA 1X7NA 2CWMA 3AFGA 4CEYB 1HJFA 1US3A 3JBG1 1AYN3 2HWF1 2PAEA 2FCTA 3AK0A 2EICA 4INDA 4XDOA 4CCMA 4Q1RA 2Y6LA 3ZLIA 3I2KA 4HPKA 1RJ8A 4O9EA 4AI8A 3T1MA 1FMD2 3ZYFA 4RD7A 4XXPA 5LZ6A 1W6MA 1VBA1 2V5YA 5F3CA 4K8RB 1OT5A 2WDBA 1SPPB 2PXJA 3GZAA 3IAQA 3M1HA 2V4VA 2WFF2 3LOBA 2OUHA 4BIFA 1YI7A 3BUCA 4BQXA 2J1RA 2WO7A 5FPUA 5A7PA 4S2GA 4CP1A 4QMAA 4QPIA 4B1LA 1STMA 3MLKA 4M3CA 4YZ5A 4JVAA 1MQTA 1YO8A 3R05A 4Y22A 3LAGA 1AR62 2QQUA 4DUXA 4UBHA 3CF6E 4D6QA 2R071 3AP7A 4Q0QA 1HN1A 3SMHA 3E5UA 4QX2A 4DXZA 2HWB1 2A71A 5D8AC 1W0OA 2ETEA 2ZHKA 1AVBA 4MGQA 4KMQA 1RXFA 2GDFA 1AR82 3CQOA 4EQVA 1KDMA 3RZKA 3PLQA 5H9QA 4D6SA 2NPIA 1REEA 5FZ0A 5H9RA 3WHUA 1CN1A 4BK5A 1FPN3 2CGNA 2I07B 3UGFA 5GLWA 2IXIA 1AR91 5FZ1A 4DXRA 2HEVF 4GWNA 4UW5A 4R9DA 1H1MA 4GA9A 1UIKA 3RS6A 3UV9A 5GJ6A 4EN9B 3CNAA 4I0AA 2GN3A 1QQP2 3I2JA 4RQPC 3Q8EA 4UOJA 2HWD1 4JQTA 4P00B 1BBT1 5FZ9A 4LBQB 4OI0A 1Q8VA 1R081 1BEV2 1YQ2A 2Z79A 4UW3A 1JN2P 1RMU2 2JDYA 1JZ6A 1SCSA 2D44A 3FN9A 3MBWA 2DV9A 4XJUA 4FPFA 4XVHA 1BKZA 5KXBA 4IGOA 3KT1A 5FZBA 1HRV3 1UAIA 1G9BA 3ACIA 2VG9A 5FR3A 2Y6FA 3VKMA 2B45X 1Q8OA 2WSUA 3U37A 4E27A 4BMBA 1O3TA 3WVJA 1JS9A 3RMXA 1PHMA 2XR4A 3PVOA 4NMIA 1WWYA 4Y5Z0 4BQ2A 3Q8BA 4LBNA 2ZZJA 5LEKA 3KT4A 1PGW2 4QDQA 4DRVA 1AR72 2F4PA 1OC1A 1RVF2 5C8WA 3LDKA 4YGBA 2O1QA 3VDDB 2OQ7A 3T2TA 2LW8A 4IQPA 3OYWB 4YVWC 3HQUA 4QQLA 1HB3A 2WFPA 3PDQA 4L2NA 5FYMA 5ACA3 3EHKA 3PU3A 3LZZA 1BVVA 1KITA 4XILA 4AR2A 3OBTA 4MGZE 3K4AA 3OGVA 1RUC1 2J1UA 1P8JA 1W9TA 2GC3A 2D5FA 2W94A 3WP5A 3A0KA 1FMD3 4JAAA 2CGPA 2GN7A 3INAA 2YMZA 4BK4A 3H50A 3O5SA 1HV0A 3K75B 3M7AA 4PHZA 4Q5OA 5DAXA 3S5AA 4LK6A 3EQEA 4AFMA 1MZ6A 4BU2A 5JOWA 5CB7A 1HRI2 4BXFA 4RR3C 4LBOA 2VTXA 2YGMA 2K46A 2XPJA 3RJRA 1DZTA 2O8QA 1OBNA 3ZFFB 4FTEA 4FPGA 2WNUB 4LBKA 3UGGA 4MG2A 2C5DA 1K3IA 2Y0IA 2VUAA 1WMDA 4Y20B 3FE5A 1WW6A 4A7YA 5BXXA 2JX9A 4HG6B 4D7TA 4DXSA 1VRH1 2D3RA 4QPIC 2R32A 1ZZCA 3ZSLA 1AX1A 1V6IA 5L7OA 3I54A 2VNRA 1UOFA 1X36A 1SDDB 1AL21 1LOFA 5JVVA 4IEQA 2D40A 2AENA 3VZKA 4CXYA 1AR83 4N90A 1TMF3 3V0BA 3LF7A 4DIQA 4GJYA 2WZR1 1SLLA 1PO21 1J3QA 3QBQA 3ZSJA 1Z78A 1Y9MA 1KS5A 2XWBB 4WV8A 4BWOA 1ZA4A 5ABJA 5DPNA 1ZRCA 4XF0A 2DVBA 2R041 1UPSA 4QDRA 4ZXEA 2WYFA 5HPOA 5FK8A 4PJYA 4CP0A 3ACLA 1B35B 2DCYA 2E31A 2A75A 2DU0A 3DN7A 3VL8A 1GR3A 2YXSA 4NHXA 3ILNA 2FDKA 2VUDA 2A3WA 4IUGA 2YPDA 4GIQA 3J26N 5FMOS 1VAKA 4TWTA 3I3QA 1MS0A 1GSLA 2RMU1 2UYAA 3VBRA 3O0WA 2WQ4A 4CSWA 2YBSA 1R1ZA 3KCCA 4LBJA 1SBDA 1POV1 1H0BA 3KLSA 1YQCA 1NA1C 4E8CA 3GZTB 5C3QA 2E7QA 2W87A 1URXA 2RR11 3LEKA 1RUOA 3ZYJB 2GU9A 4XUQA 4H7MA 3SITA 1HDKA 1OA3A 3IBMA 3UJOA 1VJ2A 4Z82A 4GMP0 4WM7B 3RYKA 5CFDB 4QGLA 3PUHA 1UMZA 1SBFA 2WO2A 3IM0A 4XFAA 1XXNA 1TME3 2QQMA 3ZXGA 3T2QA 5A33B 2NYYA 3FL7A 4NHKA 3D82A 5FXWA 3GJBA 5FY4A 1N1YA 2RJKA 4QB6A 1VBD3 2QZ2A 5A3OA 2VCBA 4AQ6A 5BPXA 2BOJA 1PO11 3AYDA 2W2IA 3OPWA 2BFUL 5A6YA 2YV8A 1H8TC 3ZO0B 5G05L 3FWEA 1LNSA 2LS6A 4H14A 3AFKA 4I09A 1N3OA 1APNA 1TE1B 2H6CA 2UURA 4XMIA 5FQ0B 2BPA2 5F2SA 3A0NA 2YFUA 3SHRA 4K7JA 1S0GA 3SH5A 4UFHA 4B3NA 3ZX7A 2H0BA 4LPLA 3IPVA 1OVSA 1AX2A 1VBC1 3UKVA 4ATFA 1UW8A 2J22A 1JZ8A 3WQBA 3R4SA 5DZFA 3V65A 3LDBA 4MYEA 3AVRA 4FP2A 4IV1A 1RUE3 1QJU2 2XHKA 5TSWA 5EJ1B 4EJRA 2YC0A 1X9PA 4BQWA 4PF1A 1NE6A 4FXGB 3POBA 1UZVA 1BCXA 2EA7A 5IYYA 3CJXA 5FZKA 1ND2C 1UPIA 5JCTA 1HXS2 3VD4A 5DAQA 3KWVA 5FK7A 5T55A 3BN6A 2CDOA 2VVEA 2V09A 2SBAA 5FXZA 3LA7A 5IVCA 3NRUA 2F17A 4P9XA 1CD3G 2WA3A 3WDUA 2ENRA 3BTYA 1YQ8A 1K5MC 1ZBE1 1COV1 3CU7A 4NIIA 4J25A 2VMCA 2JIJA 4QXKA 5A32B 1YUDA 3LEMA 2VNVA 5F1RA 5E1RA 2XL9A 5IVFA 2AC1A 2EVXA 5CNAA 4RS5B 2D6PA 1R091 4XQ4A 2G19A 3GALA 3PU8A 4NWWA 2B39A 4GH4B 4F3JA 4XZPA 2WT0A 3B9CA 4SBVA 3H8OA 3DCQA 3CEWA 2ZABA 4U2AA 4RHV1 3N7JA 1UU5A 5JR7B 3ZXAC 1BLZA 1ULOA 2PHRA 2RS31 2WS92 3LWCA 2VOWA 1JYNA 5JMOA 2VVFA 3FBMA 1LOGA 2RM21 1VB4A 1UU4A 2E7TA 2JE9A 4X6QB 3TN93 1GOGA 4I2OA 4WM8C 4ES9A 4E2QA 3OY8B 4W6WA 3W21A 4AVBA 3N9LA 4ZONA 2CV6A 1KDKA 1DQ4A 2V4AA 3B69A 1A6CA 1FX5A 2VBDA 3H3ZA 2J7MA 1UD1A 3N4MA 4W4ZA 3O1PA 1CJDA 4YPJA 2XBO2 1GNZA 1XRUA 4AQSA 4CU9A 5I93A 3J7LA 3W9AA 1ND3A 2OS2A 1XE8A 2GZWA 2H0VA 2C4XA 4CDUB 1Q43A 5C4WA 2YUEA 1MEC1 2WAAA 4CEWC 5D21A 3H9AA 3J7HA 3HAGA 4IEWA 1HB4A 4HN0A 4D3WA 5BNOA 2CWSA 4CPBA 3ZXJA 1UZZA 1DQ6A 4BQ1A 5F5QA 4Q4V1 4COVA 1SMVA 5C8CB 1GP4A 4QQOA 3KMHA 4LA2A 3RNSA 1PGL2 1JOJA 2ZMKA 5DDJ3 5LWBA 4WVMB 3O14A 5LA1A 4A2UA 1W2OA 1ENXA 2NZ9A 1ZBA1 5J96B 1GKBA 1V6KA 4D94A 1VBB1 3ECQA 3K46A 3MW3A 1UZ0A 2ADEA 5C7GA 5IK4A 4XEZA 4YGDA 3WF3A 2QQOA 1QIQA 5CVRA 1RUD1 5FV3A 1W2TA 3K3OA 4IV3A 3PUSA 2MEV2 1AJOA 5EFUA 2BQPA 2PA7A 3OGGA 1XYNA 3DGTA 2NP0A 5EP9A 4Y3OA 1HXS3 4ASLA 4HMZA 4HETA 4QDSA 5JSPA 3ACGA 5I8SA 3NNLA 1W8ZA 3CIHA 4LLFA 2XVGA 4OZXA 5SV8A 2IXLA 1UL9A 2VMFA 4NRQA 3UYJA 1AYM3 1HW5A 4I0BA 3C7GA 1HQNA 2VAUA 4IE7A 2X10A 4RYDA 1RITA 3POSA 2RJ2A 5FKCA 2YC2A 4LBQD 4KWUA 3SC7X 3JBG2 4XHBA 4Y24A 2HWF2 4Q29A 1V00A 1IOAA 3OEBA 5C33A 4TLFA 1SFYA 1MACA 4UFJA 1DU3D 2QVSB 4GALA 4LUKA 1LECA 5C3SA 3N35A 1QEXA 1EV13 4CZSA 1RUH1 1VBA2 1DIWA 3MV11 2EXIA 4QU2A 4AE2A 4DY5A 2D93A 4SLIA 3VBFB 1JZ3A 4FOQA 4XJ9A 3ES4A 1SZBA 4FVVA 4NPMA 4RFRB 3WNPA 1ODMA 3K2OA 2ATFA 1Y9QA 4NHYA 1NOVA 4FPLA 5FOJB 1WD4A 2RVAA 4JKMA 4ORFA 4AOCA 1HQLA 3A21A 2VC9A 1LAJA 1RUG1 1RC6A 2R072 4Q4Y1 3KSCA 2ZX2A 4GB33 2JE8A 2HWB2 4CUBA 1YLLA 4JGYB 5K0UB 5JZGB 3JCIA 1UMHA 3ZYRA 4H55A 4LO7A 2FZ1A 2RE9A 1VALA 5FMDA 1HB1A 5FZ8A 3VBUB 3V0AA 2BYVE 4QD2A 4W6YA 4MX3A 2BV4A 3H8UA 1W9YA 2E53A 3NKGA 1H2LA 3CL1A 1AR92 5C71A 1QU0A 4CCKA 2PAMA 2VZUA 1IS5A 5A7WB 4BE3A 5A3LA 2W47A 2JD9A 5F39A 3VD9A 4OHYA 1FOD1 1AXKA 5FP9A 2EAAA 4IEYA 2HWD2 1BBT2 3DYOA 3AXDA 4IL7A 2VULA 1R082 3AMHA 1GNYA 2R1BA 1IS4A 1Q8QA 1PK6A 1AXZA 4LHNA 5JUVA 3RMYA 5M0TA 4JRAA 4XF4A 1Q3EA 1ASJ2 2ZX1A 4P9LA 4NHLA 2VJXA 1XB9A 1J84A 1C4RA 3EB7A 4XAAA 4Y1ZA 5CKNA 2IXKA 1HQWA 2WNVA 4IV3C 2CGOA 5IT6A 3FUOA 1E5SA 5CAZA 4CDWB 3SXWA 1LGNA 2VU9A 4XDPA 4D6RA 5KXEA 2QCSB 4XFBA 4Q4X3 1C8M3 4JV4A 2A73B 4NAOA 4OMCA 5FY8A 2HWE3 4R9BA 1V0AA 3POWA 1LR5A 4XABA 1W03A 2AYHA 1OH4A 4FFIA 4AEDC 1WMEA 4XTMA 5BNNB 4XZUG 1MPXA 2YY1A 1SLBA 1R1A3 5DN2A 3D4KA 2IC1A 2JEMA 2HLEA 2Y33A 4OCTA 5EXOA 4NUBA 3T3YA 5IVBA 1RUC2 5F3EA 1TG7A 3AZZA 5F6LB 2Q8EA 4A6SA 3O1OA 1YIPA 3ZFEC 4LXLA 1JYWA 1NCRC 4N7UA 4ARXA 3GCWA 1QXPA 4P08A 2OZJA 2GNDA 2GNTA 3BYWA 1FNZA 3WOGA 4COUA 4YRDA 4CU7A 5BNQA 2PN5A 4PBOA 1PNFA 2D6LX 2YB7A 4MO3M 2RS53 3MHZA 1RUF2 4JGZA 4QXBA 4D69A 3DYPA 4ZS3A 1WMFA 2XLGA 1G9CA 3W20A 1JU3A 4HL0A 3OCPA 4AW7A 3POJA 3TNPB 2JJ6A 3ORJA 1XNDA 2Q5TA 2Z5WA 5FYTA 2VQUA 3RWNA 1W6OA 2FBEA 3POYA 2OA2A 4Q0VA 4AFCA 4DO0A 3BTZA 1VRH2 2E6VA 2XKOA 3NNJA 3RYPA 1F15A 3WG4A 1D4M3 4HVRA 5AC92 4AVCA 2WWSA 1AL22 5BUVA 2BNOA 3NNFA 1H4HA 1UXXX 1WCQA 1OHFA 1WCDJ 1TVGA 3OGJA 5JOYA 4K40A 4DXTA 3E6CC 3DPRB 2RS13 2VQTA 4IEUA 1ZZBA 4I3PA 2WZR2 4AVAA 3J8F3 4GWIA 4YM0A 3WV6A 4B4QA 2GMMA 1S55A 1Y9GA 4JKLA 1F8VA 1PVC3 2XLAA 4LE3A 1RUI3 4PDWC 4GD4A 5FY7A 1WGPA 2OPKA 1NZCA 1S2BA 4Q4W1 2R042 1ENRA 2I45A 3ZYGA 1HV1A 1POV0 4QQPA 1VR3A 2VMHA 3ALQA 3HPNA 3NV1A 5K7PA 3VBHB 4J1WA 3WEZA 4GWMA 1WCSA 4IETA 2IVJA 2XQXA 3C2UA 4URAA 4AFDA 4D7SA 4N43C 3S6PA 5ERLA 4ASKA 1BMV1 3B00A 4N53A 4OULA 2RMU2 3VBOC 4NWVA 4HZFA 1ASJ3 1PK6C 2W08A 3U11A 5FPZA 1POQA 3O1VA 2VW2A 2J42A 2JG8B 3FHAA 1CZSA 3DL3A 1OFNA 4YG6A 2PLV1 3BPZA 3WDXA 3ZN6B 1L7RA 4YG0A 3U14A 1EAH3 2RR12 3I2IA 5FZGA 4QT6A 4PLOA 3WUDA 1NYWA 2WL1A 4GWJA 3ZSKA 4K6BA 3ETPA 5IATA 1DZQA 2WNVC 4L0PA 2ZX0A 4YW1A 4LBMA 4UFLA 4A4AA 4MXWA 2BFUS 4A6OA 4CEYC 4PT6A 2KA3A 2G4IA 1H9WA 1OSGA 1PIV3 2VZSA 3ASIA 3NAPB 2DVAA 5D8AA 2EIDA 2DTYA 3BTAA 3HMYA 5T52A 1LJ7A 1IKQA 1MS9A 3MLJA 1WW4A 3PVEA 1LULA 3FX3A 1PO12 2C24A 1QH7A 5GZEA 3VBSB 3EMRA 1KJRA 2P6HA 5L9VA 1FT9A 1ZRFA 5C3OA 2DVDA 3LGRA 3TOJA 2KD7A 3MEPA 4NHMA 5FUNA 3P6BA 4AXOA 5C3RA 1NXD1 3MF9A 5T3NA 1YJLA 1HIXA 1ENSA 1GP5A 4LHLA 2LM3A 3WZ1A 4CDQB 5K9YA 1N1SA 1N47A 2ZX4A 4L97A 3LB9A 3GZEA 5EJZB 5JOZA 1SFPA 3K4ZA 3QD6A 1XE7A 1VBC2 3IDBB 3WDVA 1F31A 2ZBJA 3E6BA 4LO6B 5FYCA 2VZTA 2VD7A 2YU1A 2HH9A 5E88A 2UYBA 1VE0A 1CPMA 1S0CA 2XKPA 3MYXA 4JGZC 4CUCA 4YM3A 1X8EA 4QPGB 4CCJA 1OPOA 3ZDSA 4O65A 3PIGA 5FRAA 1O8SA 3T0BA 1FXZA 2J1TA 2ET7A 1W3VA 3BU7A 3MIDA 5A1LA 1UOJA 2VNOA 3AJYA 3THCA 4BCUA 1WLDA 2YFZA 5LY2A 3IDAA 4AWDA 3IB3A 2BWCA 4BYYA 5AC93 3MZHA 3ETQA 4A3XA 1CAXA 3R4UA 1COV2 1RHI1 4HONA 3EYPA 1QJY1 2X53S 5FZ7A 4AI1A 2YPJA 5FJHA 4Y4RA 3W5MA 1MS8A 4YVWA 1R092 4COWA 3F95A 4YZ2A 2W92A 5GM0A 1OVPA 1MVEA 2CTVA 1C1FA 2WAOA 2VOVA 1XNCA 1RJ7A 3HN1A 1O5UA 4K1YA 2WZPP 3SKJE 2P3YA 2BW8A 4ZZ5A 2FCUA 3N3HA 3WNMA 3ZYPA 2RS32 4XIKA 1ZRIA 3WINE 2X29A 5CEHA 1OI6A 1YJKA 1O7FA 2EIBA 3U75A 4AGRA 1D4VB 3ZOIA 3QACA 1YHFA 5FUIA 3KS7A 4N53C 3WDYA 2QBXA 3I2GA 4RR3A 3PIJA 4YLZA 3SCHA 4TZDA 1EUUA 3I3DA 4I30A 5T5JA 3SEEA 2W95A 3AZWA 3ZIWA 2RHPA 3A7QA 1V9U1 1Z7S3 3IMMA 2ZGPA 3DV8A 4QKNA 1JYXA 3OOXA 3VDDC 2Q8CA 3U4XA 1QOSA 3C7OA 4CXWA 2WYSA 1GP6A 1BVP1 3WP3A 4C0BA 3PURA 4ISQA 1WW7A 4EN7B 2QNKA 4YGCA 2PFWA 1Q5OA 3WW2A 3GHNA 4LO5B 3JD73 4B7KA 3POEA 3C3VA 1F5JA 2YGLA 4I0WB 3TEYA 1QOOA 4LMFA 3VHNA 3VD7A 1ZRRA 5KXDA 3CKHA 3H1MA 3RZGA 4NRPA 1DP0A 1X9TA 1C3HA 4D7YA 2OW4A 2VBPA 3K48A 4KWKA 1AHSA 3J4UH 4Q0PA 1HJGA 4AFAA 4BH9A 3PMSA 4KGQA 2VBBA 4XETA 5CU1A 1OXCA 4Q4V2 1MZFA 5FP3A 3M3EA 1CIWA 4YFWA 1XNAA 1UOGA 3QH6A 1V6LA 5T50A 4FAHA 3NJXA 1ZBA2 1A78A 2ARCA 4Z1VA 3ZFFC 3GNEA 2IUWA 3NWKA 1VBB2 3RGBA 1LOAA 4CCEA 4XFIA 2ZKLA 4QX3A 1W0PA 1KXGA 4QHBA 2UY8A 5FP8A 4B4RA 1RUJ2 3MW2A 2V73A 5KHKA 4PQ9A 5CKMA 3USUA 4YM1A 1NA1A 5LRSA 4LKDA 3FLTA 1J58A 4H2AA 1VAVA 4EZ4A 2R063 5FFOC 2NMNA 3VB9A 4HKWA 5BNPB 4YZ3A 1UO9A 4EWDA 3O1SA 1NQJA 1J83A 5FPAA 3AXEA 4XURA 1WLCA 3AM2A 3F2ZA 3PUQA 4DRRA 4KQ7A 2D6KA 1PMJX 3I49A 2ZTNA 1YXWA 2VR4A 2WR9A 2JE7A 1KD7A 1S0EA 1KFXL 4FAGA 2WJSA 5LY1A 5IK7A 3ZYHA 4YZ4A 4FFFA 1UX7A 1Y7BA 4NIAA 1D2QA 1JYTA 2VVDA 4FOVA 4AHZA 3VZJA 1DDLA 1QJZA 4MUVA 2JKXA 3MO4A 2WABA 1NUKA 4GZ9A 3LFIA 4MADA 3E6DA 3MIBA 3RRDA 3TB0A 3LA3A 1ENQA 2KR2A 4V2WA 4OQ8A 3N9MA 3HJRA 4MHUA 1H8TA 2E51A 1VBE3 5FZLA 5KC5A 2VM9A 5DUUA 4CP9A 4K9SA 4FBFA 1OOPB 3C7FA 4F83A 1CPNA 1S0DA 3IWZA 1CAWA 1RUH2 1KEXA 1YFUA 3JQXA 4IW3A 4XC9A 1GZWB 1QH6A 3U78A 3S7IA 3M3CA 4WM7C 5CFDC 2VXJA 1PX3A 1QNWA 3QH7A 2WFF3 2P4EA 2FDFA 1N1TA 2HWC1 4HFSA 5FZEA 2GC1A 1ND2A 1FV2A 3LSDA 5LW9A 1MS5A 1RUG2 5JI7A 4BZ4A 3Q8AA 1AR63 1GBGA 4Q4Y2 3BPSA 1W05A 1AJKA 1U5IA 3POIA 5ANQA 5DMYA 1DHKB 1K5MA 4FTSA 2WSVA 3G6JB 3KV6A 3ZR5A 2ZMLA 1PMHX 3URFA 3AP4A 3DKQA 1OQDA 1PVXA 1GWKA 4OQ9A 1QNYA 3AX4A 1O3SA 1NLSA 4C8DA 2VCAA 2OIIA 3X29B 2DCZA 1VB2A 2PYTA 4FPKA 4PIXA 5LBFA 1V70A 4BXSV 2ZGOA 3OPZA 1LHUA 4RQPB 1JBCA 1FOD2 3AZVA 3GF6A 4XJWA 2ZCWA 2WNOA 4QXCA 3JXSA 1QQP3 4MLOA 4NN0A 1F5FA 2UY9A 1IG3A 1QJX1 4FPJA 3MW4A 3BKZA 5KC6A 2PAKA 1BEV3 4HKLA 2K0GA 2XVLA 4WM8A 2FDGA 1RMU3 3VZMA 5J48A 4XOGA 4YW5A 2JG9B 2D98A 4AGVA 1ZZ9A 1EUTA 2YU2A 2ZZQA 4Y1VA 1YQ5A 3R4DB 3D8CA 4MGSA 5F9TA 1W6NA 1SEFA 2BVVA 2I74A 4KL1A 4C1XA 1W8TA 5JOXA 1DF0A 1D0GA 5FZAA 1TZOA 3BVCA 2I2SA 4XJZA 1DQ5A 4Y5SA 3L2YA 3ZFGA 1W8WA 4CPBD 4RS5C 4OHXA 2CDPA 4X6RB 2FZ2A 1AYN1 5LA0A 2ZEYA 4CYDA 4Q8KA 1BK1A 3EXUA 1CZTA 1AL0G 1AR73 1QMJA 1RVF3 2IWGB 4HXCA 2MNGA 3D3AA 2P5BA 3WY6A 4B4PA 4CEWA 1O4YA 3KCYA 5C70A 1XE0A 3CJIA 2CAUA 2ARBA 3O1UA 1CAUA 3GBFA 1VRBA 1OQEA 5GZGA 4KG8A 5IVEA 5F37A 4QQHA 4OYUA 1WCUA 4NVPA 1FV3A 1K45A 2ZEXA 1SACA 1U5YA 4HPKB 3ZN5A 1G86A 1IG0A 5JXJA 2QFEA 4XDQA 1AUYA 5FZCA 3LDRA 5A1FA 2XWJB 4QM8A 1W6MB 3PVBB 2LROA 3OB8A 4AZZA 3M3IA 4WVZA 3VHOA 4YVSA 3ZN4A 1IZ3A 1N3PA 2LTNA 3J7MA 3LCPA 1GQHA 3I3EA 1UXZA 1HRI3 4M4RA 3ZSEA 3ZXLA 1Y3TA 3FFQA 4LA3A 5FYZA 5FPLA 3FHQA 3D6EA 5F2WA 3H8RA 2BTVC 3H3LA 3VBUA 3MUY1 3JQWA 1W6QA 4QPIB 4TLGA 2HKXA 2JWPA 4M3CB 2Q1ZB 2ARXA 1MQTB 1UKRA 2LUWA 2Z2SB 3MUZ1 4Y22B 1J1LA 1FPN1 3AL6A 4GULA 1GUIA 1CR7A 2ZAAA 3S7EA 4BQ4A 3IMNA 2WN2A 2WQZC 3WW3A 3LOIA 3OTFA 1LGBA 1UNBA 3HR9A 1W9FA 4MZUA 3UNPA 4UXAA 1O4ZA 2E9QA 1BYHA 3B3QE 4EE2A 1ULPA 3S57A 4Y33A 4NAMA 5C8CC 2BVBA 3MV01 1BHGA 3KV5A 3QLQA 1QJEA 2OUJA 2QUOA 3VD3A 3EO6A 3KVAA 4ZZ8A 1Q56A 4M0HA 4Q4W2 5FMCA 1UX6A 1OLRA 3VHRA 4YSFA 3CLPA 3T1LA 4QGMA 1IS6A 5G04L 2PQQA 1W90A 3GYDA 2VUCA 3T2PA 4JTNA 1HRV1 3OD0A 3VD5A 2B42B 2WKKA 1U12A 4E4DX 3O1TA 3RWKX 2A70A 1VPHA 1UY3A 1BMV2 1NY71 5FO8B 5CZKA 5J09A 5FYSA 1UN1A 2JB8A 2JXAA 1W8OA 2VW0A 1LESA 2ZAHA 3TEZA 1CJPA 4UF0A 5FY1A 2A3YA 2VTFA 2PLV2 3LE0A 3AP9A 2OX0A 2PMWB 2QQWA 4KNCA 3WW1A 5FZ3A 1OPMA
chains in the Genus database with same CATH topology
5DUXA 2QQPA 5ACA1 5KHHA 1LOCA 4XYXA 3ZFGC 1SLTA 2ZACA 2ZJCA 4E9KA 1FMD1 5JIAA 1TEIA 2XB6C 2HJIA 3THTA 2ZS6B 1LHOA 4XFFA 5GKAC 2QZ3A 3ELNA 3CJIC 3OJBA 3N36A 2VY0A 4GMP3 2DFBA 3AYAA 3FHIB 1KJLA 2ZGRA 2X5IA 4LBLA 1Z0HA 3BIWE 1PZ9A 4YM2A 1ULCA 4KBBA 3UL2A 4OFGA 1YFYA 2W52A 3B7MA 5DG1A 4C0HA 2EXKA 4FP3A 3TWIA 3WXPA 2NMOA 4BMEA 3M4FA 3WR0A 4YVSC 1CAVA 1LHVA 3LSEA 1QJU3 1AR81 2XG3A 2CYFA 1TMF1 1LCLA 4LHKA 5K0UC 5GLTA 5JAXA 5JZGC 3VN4A 2GH2A 4Q1PA 5I0TA 3VBUC 4OUSA 1DBNA 3FMGA 4XQWA 4HKOA 5L7OB 2KXLA 1SLAA 2O8OA 2XJVA 5LEJA 1MS3A 1RHI2 3RQ0A 4HANA 1QJY2 3MDPA 1YCIA 2CAVA 5HI0A 3V0BB 1DGLA 3AMNA 4P9IA 3O12A 5C9AA 4TSVA 4FOYA 4AEDA 2AREA 3MIEA 2OYZA 5ABJB 1YWKA 3AB0A 3PJQA 1S0FA 3WCRA 2A5ZA 4HN1A 1LB2A 2AGSA 4PLNA 2VQAA 3MF6A 2ILMA 3ZFEA 3ROUA 1NCRA 1YIFA 2R0HA 1KQRA 2DU1A 3B93A 4O9GA 2WS93 2BNMA 3Q9OA 1AX0A 5BV6A 3ES1A 1TNFA 1NCQA 3VBRB 3NV4A 1C5HA 4WZCA 4FOWA 5L19A 3E5QA 1OA4A 1TME1 2ZGLA 1LENA 3VZOA 3VKFC 1V9U2 3WDTA 2DUQA 4AVVA 5L36A 1VBD1 4M01A 4XF3A 2XBO3 5CFCA 3RG0A 2R30A 2D6MA 4XFGA 5BNNC 1DGRN 5T5OA 4KG0A 1PZ8A 2JDZA 4QGNA 2NLRA 4BA6A 4P9JA 1H1AA 4WVVA 3ZMNA 4WZFA 3M2MA 3U10A 3AKRA 5KHJA 2EXJA 3D0JA 4A7ZA 4PDWA 3TYJA 2VUJA 3HBZA 1GNHA 4YNIA 1IS3A 2ZGUA 2XVKA 1RUE1 1A8DA 4RGGA 4N43A 1BXHA 3BB6A 4XBLA 3M70A 2X5IC 3IPVB 1ZYBA 4K8FA 4R4ZA 1I6XA 3VBOA 1JYIA 4BLIA 4IXLA 4K3UA 2D5HA 4IV1B 4JDNA 5HCFA 2FHRA 2O0OA 2UWBA 2UU8A 1W6PA 5LRRA 1UIJA 1LODA 2MEV3 1AXYA 3DPRC 3D0SA 1NE4A 4Q0UA 5CBLA 2MPFA 4KGGA 2KM2A 4CEYA 1NLRA 2ZGTA 3FC0A 1RIRA 4U36A 1ONAA 3SISA 3VBHC 4AYUA 4M00A 3UKTA 2YROA 5FBZA 4DB5A 3TN91 5C9AC 4K21A 5FTTC 4HK9A 4MVTA 4AI3A 2YZ4A 3JBG3 2HWF3 4RSUA 4BM8A 1EPZA 3BALA 2GAUA 3MIHA 4S2HA 2JG8C 4IEXA 5I91A 5LK5A 1O91A 1RB8G 1VLNA 3FFZA 4OI1A 1CVNA 1VBA3 1A3KA 2DUOA 4HT1T 4AFBA 2VGDA 4EN8B 4Z07A 1NCQC 1DQ0A 3MI8A 5L73A 1O3QA 3I59B 2Q1MA 1MS4A 2W39A 3WLUA 4CDXC 3NAPC 2AUYA 2HWC2 2D6OX 4HBNA 3VGIA 4DS0A 3VKOA 1C5IA 3MIFA 4FPHA 4AK3A 2TEPA 4PLMA 3VBSC 5GALA 5JPNB 5CFCC 1ND3B 4JQRA 4AEJA 2R073 2P3KA 2HWB3 2C0ZA 2DVFA 5C4WB 4GXLA 1DGWX 1OA2A 5DDJ1 5H9PA 1WUVA 4CDQC 1QXRA 3WDWA 4DQAA 4C91A 5BNOB 4LBQA 1PO22 4BHPA 2A6XA 1H9PA 1SLIA 2R16A 4QPYA 2P3IA 5EWSA 2LALA 4DMIA 1AR93 3NVCA 1G6NA 2GNBA 1ZZ7A 1NQDA 4LNVA 3IDEA 3MICA 4LEJA 4P9WA 4UW4A 4YARA 1QJX2 2HWD3 4QPGC 1BBT3 1QKQA 3RI9A 4AI2A 3ZVXA 1R083 1HXS1 4E2SA 3WG3A 1UZYA 4LO8A 3R0RA 2ZGKA 4KWLA 1G8WA 1YYNA 3VV1A 3VLBB 4IV3B 4AQTA 1H2KA 1AYM1 2B9UA 1ULDA 3M8LA 3IIAA 3V64A 3VDDA 4KWJA 3AMMA 3IDCB 2Y38A 3OYWA 2P17A 1AYN2 3S30A 3MPBA 3ZXKA 3AMPA 4YW4A 4FQ4A 1MZ5A 4JDOA 4YW2A 5KHIA 1EV11 1LHWA 3WW4A 1X50A 2XJSA 2ZMNA 4CP2A 4ONUA 3IKWA 2NN8A 2WIIB 1RUC3 3AKQA 4E2GA 1JHNA 3SH4A 3H7YA 2A6WA 3PNAA 3ZFFA 2XBO1 2WNUA 1RINA 4Y20A 3ZXEA 1UU6A 1LKNA 4XTPA 5HCBA 3KGZA 4Y1XA 1GZCA 5J98B 2TBVA 4GB31 1DG6A 4N9HA 1RUF3 2P2KA 3O7OA 2DURA 5J37A 3ZMOA 2PHDA 4OI4A 2RJLA 4I3GA 4S2FA 4ISRA 1UF2C 5CIRA 4ES8A 2R49A 1DGWA 1RUNA 1VRH3 1G9AA 1D0HA 2XJPA 1N3QA 2F6BA 1JUHA 4AG4A 1U0AA 1AL23 3SCFA 1TNRA 4HSLA 1B35A 1ZBE2 1PGSA 4YFZA 2WZR3 1QDOA 2P37A 3V0AB 4DINB 1PO23 4LO4B 5JMCA 2AH2A 5C6CA 5CADA 2BUKA 4RGAA 4YZ1A 4R8HA 2PELA 1L3JA 2R043 3ZIXA 4DOUA 1HRV2 3I7DA 1JYCA 4RHV2 4I01A 1LTEA 1O3RA 4V1PA 1NY72 2B5HA 2VECA 1PK6B 2RM22 1PNGA 3MFAA 4XJAA 4Q8LA 4NOTA 4DZGA 2RMU3 4WM7A 5CFDA 2A6VA 3GBGA 4Q4X1 5T54A 3BOPA 1C8M1 3FLPA 4AF9A 2ZGMA 4XMAA 1POV3 2HWE1 4XHXA 5A33A 2YYOA 3APBA 2GC2A 2WNVB 4EWEA 3MGUA 3E97A 2RR13 5ACA2 5DZGA 1R1A1 2PHTA 1C28A 3AKSA 2IFWA 3VUOA 3ENRA 4ZXKA 2GSYA 5FO7B 5FQ0A 3THPA 1OOPC 2BBVA 1MEC2 3SH3A 4AHWA 4K1ZA 1LU2A 1PO13 3LA2A 4XW3A 5AVAA 3JB4C 2RS51 2K9ZA 4URTA 1WBFA 2GNMA 1G9FA 1SQ4A 2TUNA 3E5XA 2VH9A 1HX6A 1KFUL 2B8MA 2ZGNA 5JI9A 4E4SA 1VBC3 2WNUC 3AMQA 3ILRA 4NO4A 4IEZA 1D4M1 1WA4A 4JGZB 5F6KA 4Y1UA 4MGIE 1QWRA 3P3PA 5J7MA 4EROA 1RUD2 1MZEA 1TMF2 3FLRA 4KH9A 2RS11 5IK5A 1S0BA 3J8F1 5A32A 3AP5A 1I5ZA 1W6OB 4DNYA 4GKYA 1PVC1 3NL1A 1RUI1 4RS5A 1I3HA 1ULFA 3AZYA 5CG8A 4GH4A 4LE4A 1ZBE3 1COV3 2DF7A 4L8QA 2EF6A 2XLFA 1B35C 1RTVA 1Y43B 3B02A 2DCJA 3PMEA 5FREA 1X8MA 3HIFA 1R093 4XF1A 4DFSA 2GMPA 2JECA 3KT7A 1ASJ1 1IPJA 4RFT0 3OY8A 2H6BA 4FXKB 5GZDA 4RHV3 2JG9C 3GZUC 4R9AA 3ATGA 2GC0A 2R0FA 2W0XA 1EAH1 3HQXA 2RS33 2TNFA 4Z8BA 1H2NA 4KU8A 2RM23 4N53B 1CQ9A 4XJ8A 3QCWA 2P3JA 1XNBA 4LLOA 4GQ7A 1TME2 4R4XA 1PIV1 3J9SA 4AGGA 4P9GA 2DUPA 2P34A 3H1WA 2D6NA 5FAXA 4CDUA 1N1VA 2EIGA 1VBD2 2CL2A 4MSVA 4OHVA 1AF9A 2VPVA 3N7KA 3BOWA 1S2KA 4MXWB 5B2GB 3UKNA 1C8NA 1OFSA 4HSJA 3S0MA 1S0IA 5D8AB 2XGXA 5C8CA 4QX5A 2WT2A 4BLJA 5EYXA 1MEC3 4LUMA 5EYYA 5CA6A 4WVMA 1W39A 1HKDA 2HEYF 1UKGA 4R9CA 2XJQA 1RUF1 5I8YA 1XQNA 1RUE2 1FYUA 4Q4V3 2IXJA 4DY3A 5K8SA 1W2UA 2BNNA 1WLWA 1J3RA 1H8VA 3I8TA 4LTAA 1ZBA3 1LEMA 1Q8SA 2XUMA 2ZHLA 1VBB3 1MQTC 4EN0A 5AC91 4ITCA 5DUWA 1RUD3 1RUJ3 4LULA 4M3CF 4AEMA 3SNMA 4FPCA 1QOTA 3SCGA 1G7YA 1SBEA 1KRIA 5E89A 1OMIA 3WCSA 2VMGA 5JSOA 2Q4SA 4W65A 1CAXB 1SCRA 3VZLA 3ZPYA 4HLTA 4Y4YA 2QDRA 1O5LA 2Y0OA 4F7ZA 2XJRA 2IZWA 4GH4C 5HCAA 4YVWB 3TN92 3NO8A 4K20A 4PBPA 2AZ5A 3H3UA 1HLCA 3KZ4C 1GQGA 3NSTA 4IEVA 4I02A 3VL9A 3VBFA 4PIZA 1Z7S1 2MHFA 1BJQA 2WA4A 4XFCA 4L92A 3WQ7A 1VIWB 4S2DA 4YGEA 1QDCA 5AFEA 1RUH3 4ZU4A 1RL3A 5J3UA 1JH5A 4RR3B 4OVEA 3JD71 2ES3A 3RZZA 5E8AA 1J1TA 2QJVA 4X8NA 2NQYA 1GLHA 1JXNA 2UWAA 3MPPG 5JSRA 4JGYA 5K0UA 3WD5A 3WX5A 5DXDA 4KU7A 3AKPA 5JZGA 1GV9A 2GMEA 5J36A 3KGLA 3VZNA 4CDUC 2WC2A 1IPKA 1RUG3 1OQ1A 1TQ5A 4Q4Y3 4HK8A 4HVOA 1NXMA 1WLTA 4Y1YA 5DDJ2 5JLVA 4R52A 5JDBA 1ZREA 1ZX5A 3ILFA 2XJTA 4YG3A 3KD4A 1FOD3 3MLLA 4FPEA 1SFNA 2BWAA 2E63A 2R061 3I4IA 4G9SB 4N9IA 5I0RA 4EV0A 1FATA 4JCKA 1REDA 1YFWA 1CGPA 4CDWA 1AZDA 5I8TA 3USUB 5L7OC 4M3CE 1NA1B 1AYM2 2W68A 1BZWA 1LOFC 1GANA 5IK8A 2WLQA 3NW4A 4L11A 3B9IA 4BOWA 2C1FA 2IXHA 3R6SA 5I0UA 3D5OA 1REFA 5BNNA 2C9AA 3KQRA 5ABJC 3RSJA 4DPNA 1VBE1 4OHWA 1Q8PA 1EP0A 1LU1A 3ZXDA 3O0XA 1H1IA 5GLUA 4AEKA 1QGLA 5JIUA 1EV12 4FTBA 2ZKNA 3WG1A 2B46X 1XU2A 1H8TB 2PHUA 3VBRC 3WQ0A 3I59A 3RJ2X 3TAYA 3B5LB 3TBDA 2WNEA 2WFF1 5KBFA 1CAWB 3MIGA 4ATEA 2JICA 4HVQA 3VBFC 4FO9A 2PHXA 3VKNA 4PIYA 3K51A 1GZ9A 2ZPXA 3VKLA 1AR61 2WLPA 4IESA 4GB32 3OBRA 4N7IA 2QDNA 4AI0A 3AZXA 4L9BA 2PHLA 1DQ1A 3JUUA 4FSJA 3DPRA 5GLVA 2R6QA 1ND2B 4JGYC 3IT8A 2DVGA 2PTMA 4XQDA 2K2SA 4AVTA 3HT2A 4MV2A 2JKBA 5SV5A 4IEPA 4YW3A 1K5MB 2YHJA 2FMDA 1WCKA 1ZZ6A 3VBHA 1F2NA 2WINB 1IGOA 3FZ3A 3NV2A 1QQP1 4AHXA 5DUVA 4PCRA 4OHZA 4B29A 1BEV1 2R1DA 1VAMA 4Q4W3 1RMU1 4P9YA 1PM7A 4Z2WA 1RUJ1 1YNAA 2Q0AA 5FPXA 2SLIA 4IV1C 4FT8A 1XNKA 1ZM1A 2JG8A 3AJZA 1DYKA 1FI2A 1T6GC 3ZN6A 5AVPA 3WUCA 3ME2A 2OVUA 4NPRA 1GYKA 4FQZA 4MXVA 3JZVA 4WM8B 1X33A 2DCKA 1ALYA 4Q4X2 3WNXA 1C8M2 2HYKA 2EXHA 1ULGA 4CDWC 2HWE2 5GZCA 1PGW1 5EV7A 4CDXA 1AR71 3NAPA 3H0OA 4ZU5A 2PLV3 1RVF1 1W6NB 1EY2A 3BCWA 4META 4C90A 2VOXA 2NM1A 1R1A2 2ZOEB 3FBYA 3ZFGB 4FPOB 3VBSA 4E4ZA 2ET1A 5AFBA 4CTEA 1OLQA 2XL7A 4LT5A 3OF1A 4G4FA 4WBBA 3G7DA 1D2SA 4Z92B 5D1IA 4CDQA 5GZFA 4CEWB 1QHDA 2DTWA 3CJIB 2DWRA 4IERA 1CAUB 2BEOA 3W58A 3NJZA 5LRSA 3PTYA 2RS52 3DF0A 4UBGA 3WP6A 2ZHMA 3QOPA 1U5XA 2D3SA 4WVWA 4MH0E 5FCCA 3V56A 1LOBA 1U5ZA 1HRI1 2GH8A 1J3PA 1H2MA 2G9FA 2OZ6A 3HD8B 4X8PA 4QPGA 1LHNA 2VNGA 2VMIA 2ERFA 2QE3A 3M3QA 4OLLA 1LRHA 3LKJA 4RA0A 1DFQA 1GICA 1D4M2 4YVSB 5JWPA 1KS4A 3KM5A 2YDEA 3PVNA 1A8MA 1ND3C 3EJKA 4XXAA 1ZRDA 4Q2FA 2RS12 2CY6A 2A7AA 3J8F2 3NKTA 5C4WC 5LK7B 2Q30A 1W6QB 1PVC2 3DUIA 5FOBB 1RUI2 1PZ7A 4GKXA 5BNOC 4Q26A 4PF5A 3UJQA 2EALA 3ZSMA 2DYCA 3PHMA 3RI8A 3CO2A 1FAYA 2ZA9A 4EN6B 2D97A 2JD4A 1YFXA 1RHI3 1IKPA 1QJY3 1QY4A 3BODA 2CNAA 1QXJA 2FMYA 1OKQA 1JUIA 4MGYE 4IEOA 2DFCA 2PHFA 1WBLA 4JTOA 3JB8A 3H7JA 5KWRA 3AKTA 4TYSA 1EAH2 1O4TA 1LGCA 4COZA 3WP4A 1DZRA 5KHGA 4XE9A 5BYNA 1QF3A 3WG2A 2IFRA 3I2DA 5FMOL 5GLZA 5DG2A 4XPVA 2VW1A 4J6GA 4P5HA 1S0JA 1RGSA 3WHTA 5DZEA 2UWCA 2JENA 1PIV2 4YYOA 2A6YA 3HT1A 4MGKE 1WW5A 3UK9A 1ZVFA 1UCXA 1V9U3 2Y26A 4F8AA 2A6ZA 3A4UA 5H9SA 4JDMA 5T5LA 1IQAA 1CX4A 2XH6A 3SLIA 4BIOA 4GMP1 1SDWA 2A3XA 4NR1A 5HXVA 2AR6A 5EJ3A 4XBNA 3GBWA 1XU1A 2GALA 5IUQA 3VHPA 4AQ2A 3B01A 1DQ2A 4XIOA 5KXCA 4B8EA 4H3WA 5T5PA 3ZYIB 4AHYA 3L9JT 3RPQA 1QJU1 2QKDA 2X5IB 4G3YC 4CRQA 1I1EA 1LOEA 4COYA 4EWAA 3AP6A 1V6OA 5BNPA 2EAKA 3RDIA 3W59A 2Q8OA 2VXRA 3ST7A 5HBAA 1CAVB 4XFHA 4Q0SA 1YRZA 2B7YA 4ASMB 1H30A 4Y26A 1E57A 1V6MA 1DGRA 2D3PA 1DYPA 4QM9A 5BY5A 3MFCA 4A7KA 5A3MA 4ZKTB 1X82A 5E16A 2HEWF 1ULEA 1F9KA 1JW6A 4L99A 1GFF2 5FLJA 4XBQA 1EPWA 2FQPA 2VQ0A 1OOPA 5C9AB 2WS91 1PMIA 3USSA 4AEDB 5FO9B 1YI9A 3N7MA 2X8KA 4W6XA 4B7EA 1CESA 3P3NA 1NG0A 2D7FA 2ZHNA 1B09A 1IHMA 1GZWA 3L2HA 4H7LA 4ZU7A 3ZFEB 2DCTA 2XJUA 1NCRB 1XYOA 1Z7S2 3WQ1A 3WT3A 5I0SA 1V6JA 3NV3A 4OUMA 2Z42A 2ZGSA 4JC1A 4FPYA 2VOKA 1ZZ8A 3TRSB 1WD3A 1NCQB 4Q27A 3JD72 1G9DA 3OD4A 1S1AA 3U07A 3O0VA 1EYBA 2D43A 4M0NA 5EZWA 1V6NA 3ZXFA 1BQPA 2HWC3 4J1XA 4RL7A 5CFCB 3M3OA 1JTZX 4OI2A 3AYCA 5FLIA 4BPZA 2G9GA 1FPN2 3FJSA 3B94A 3KB5A 3DKWA 3HWJA 4JRLA 2E7AA 1LEDA 4RQPA 2IXCA 1MVQA 2WT1A 2ZX3A 5FDBA 1PGL1 1MR5A 5JPMB 3GHMA 4PDWB 1M06G 3TNQA 1C57A 1MS1A 1M4WA 4C1WA 3H1YA 1XYPA 2JG9A 2R062 3KCXA 3N7LA 1H4GA 1I9RA 2N7GA 3JU9A 4N43B 2MEV1 3EBRA 2ZGQA 2PHWA 3AYEA 4FCAA 1QJX3 3VBOB 1C1LA 3IN9A 5CG9A 4LR4A 5BNPC 2BGCA 3FUQA 3PJYA 1ZNPA 1VP6A 4QQ2A 5FLHA 4AVSA 4UW6A 1W6PB 4P14A 1OD5A 1CONA 1SLCA 4XF9A 3RYRA 2Z69A 1FNYA 3U0ZA 1DLLA 1VBE2 1X7NA 2CWMA 3AFGA 4CEYB 3JBG1 1AYN3 2HWF1 2PAEA 3AK0A 4INDA 4Q1RA 4O9EA 4HPKA 1RJ8A 4AI8A 3T1MA 1FMD2 4RD7A 4XXPA 1W6MA 1VBA1 2V5YA 3GZAA 3M1HA 2WFF2 3LOBA 2OUHA 4BIFA 1YI7A 4S2GA 4CP1A 4QMAA 4QPIA 3MLKA 4M3CA 4YZ5A 4JVAA 1MQTA 1YO8A 3R05A 4Y22A 3LAGA 1AR62 4UBHA 3CF6E 2R071 3AP7A 4Q0QA 3SMHA 3E5UA 4DXZA 2HWB1 2A71A 5D8AC 1W0OA 2ETEA 2ZHKA 1AVBA 2GDFA 1AR82 1KDMA 3PLQA 5H9QA 2NPIA 1REEA 3WHUA 5H9RA 1CN1A 1FPN3 2CGNA 2I07B 5GLWA 2IXIA 1AR91 2HEVF 4GWNA 4UW5A 4R9DA 1H1MA 4GA9A 1UIKA 3RS6A 3UV9A 5GJ6A 4EN9B 3CNAA 4I0AA 2GN3A 1QQP2 4RQPC 2HWD1 1BBT1 4LBQB 4OI0A 1Q8VA 1R081 1BEV2 2Z79A 4UW3A 1JN2P 1RMU2 1SCSA 2D44A 2DV9A 4XJUA 4FPFA 1BKZA 5KXBA 3KT1A 1G9BA 1HRV3 1UAIA 2VG9A 3VKMA 2B45X 1Q8OA 2WSUA 4E27A 1O3TA 4BMBA 3WVJA 3RMXA 1PHMA 3PVOA 4Y5Z0 4LBNA 2ZZJA 5LEKA 3KT4A 1PGW2 4DRVA 1AR72 2F4PA 5C8WA 1RVF2 4YGBA 2O1QA 3VDDB 3T2TA 4IQPA 3OYWB 4YVWC 4QQLA 2WFPA 5ACA3 4L2NA 3EHKA 3LZZA 1BVVA 1KITA 4XILA 3OBTA 4MGZE 1RUC1 3WP5A 2GC3A 2D5FA 3A0KA 1FMD3 4JAAA 2CGPA 2GN7A 3INAA 2YMZA 3H50A 3O5SA 1HV0A 3M7AA 3EQEA <