1HRI2

Structure determination of antiviral compound sch 38057 complexed with human rhinovirus 14
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structure determination of antiviral compound SCH 38057 complexed with human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 49
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hri200
1FPN3 1RVF1 3JD72 2RM23 4JGYA 2Y26A 1V9U1 3DPRC 1MEC3 1FOD1 1RB8G 2RS51 5BNNC 2RR11 4YVWC 1VBD1 3VBRA 3CJIB 1AYN2 3ZFEA 5CFCA 1R081 4GH4A 1BEV1 1RUD2 1B35A 1VBB3 4JGZA 1QJX1 1AR82 1RUJ3 1PO23 5CFDB 4LLFA 2ZAHA 4RQPA 4CDUB 2HWF3 3VBFB 1QJU3 2WWSA 1MEC1 1NCQC 1ZBE3 1FMD2 3J8F2 1RUI1 4CDXB 5D8AB 1C8NA 1HXS3 1OHFA 4CEWB 2WFF1 1ASJ2 1BBT2 3VBHB 2HWC1 1ND2A 4QPGA 3TN93 1R093 2MEV3 1D4M2 1GFF2 2R073 4N43A 1RUJ1 2RMU2 5C4WA 2PLV2 5AC93 1HX6A 1QJU1 4WM7C 1ZBE1 5JZGC 1AR71 1QJY3 1RUF1 2GH8A 1MQTB 1VBE1 1HXS1 1W39A 2GSYA 4Q4Y2 4Q4V2 4N43C 3VDDB 1NA1C 1VRH1 1VAKA 1R091 2MEV1 5C4WC 2WZR3 1PGL1 1AL21 2WS92 2RS32 5BNOB 4CDWB 5K0UA 1RUH2 1OOPC 5AC91 1PO13 3JB8A 5DDJ3 3VBSC 1PIV2 5C8CC 3JD71 4GMP3 3ZFFA 1QJY1 4CEYA 1TMF3 1H8TA 1RMU2 2R042 4Q4X2 1EAH2 3VBOB 1ZBA2 3NAPB 1R1A2 4NWWA 1POV3 4RHV2 1SMVA 1AYN1 1QQP2 1PVC3 4N53A 1K5MA 5C9AA 1RUD1 4IV1A 1AYM2 1AR81 1NCRC 2RMU3 1RVF3 2ZZQA 1COV2 3ZFEB 5CFCB 1RUG2 2RS53 1FMD1 1HQNA 3J8F1 4GH4B 1ND3C 1B35B 1VBD3 3DPRA 1POV1 3VBHC 2HWB2 4GMP0 4YVSC 5BNNA 4JGZB 1R083 2FZ2A 1BMV2 1ASJ1 1BBT1 1BEV3 2IZWA 4IV3B 1HRV2 4Q4Y3 3ZXAC 2X5IC 4Q4W2 1POV0 4RQPB 1QJX3 5A33A 1D4M1 2HWD2 2RMU1 5L7OC 1RUH3 2PLV1 3HAGA 1RUI3 4PDWA 1RHI2 1NCQA 1ND2B 1C8M2 4QPGB 1RMU3 2R043 2BFUL 4Q4X3 2WFF3 1ZBA3 2FZ1A 4Q4Y1 4Q4V1 4RR3C 1AUYA 2HWC3 4CDWC 4WM8C 5FOJB 2WS91 2RS31 1RUH1 1AYM3 4PDWC 2RS12 1AR62 1PIV1 3NAPC 4AEDA 1AR73 1RUF3 1COV3 4WM7A 1VBE3 5JZGA 3VBUC 1RUG3 1RMU1 2R041 4Q4X1 1EAH1 1PGW2 5ABJC 1ZBA1 2QQPA 4RS5C 1R1A1 5A32A 4RHV1 5BNPC 2HWB3 1VRH3 3ZFGC 4EJRA 5K0UB 1QQP1 2XPJA 1NA1A 1AL23 4Q4W3 1AYM1 4AEDC 4CEYB 2HWD3 1H8TB 1OOPA 1TME2 3JD73 4GB32 3VBSA 5ACA2 1COV1 4QPIC 1M06G 5C8CA 1RUG1 4CDQC 4N53B 4IV3C 1VBA2 4RFT0 5C9AB 1E57A 1AYN3 2HWB1 4IV1B 1BMV1 1RUD3 1OPOA 1HRV1 4Q4W1 2HWE2 5CFDA 1AR83 2HWD1 1X36A 1AR92 3VBFA 3DPRB 1NCRA 3IDEA 3CJIC 2RS13 5BNNB 4YVWB 1AR63 1FMD3 1NY72 3J8F3 1RHI1 4Y5Z0 1C8M1 5A33B 1ND3A 1ASJ3 1BBT3 1FPN2 3VBHA 4YVSA 2RM22 5CFDC 5J98B 1Z7S2 4CDUC 3VBFC 1D4M3 4JGYB 2X5IA 4CDXC 2PLV3 5D8AC 3VBRB 1NCQB 1WCDJ 2RS11 4CEWC 2BUKA 1IHMA 1HRI2 5L7OA 1AR61 4GB33 1VBB2 3S6PA 2TBVA 1PO22 1PGW1 1VB4A 4Q4V3 2HWF2 2BPA2 3LOBA 4RR3A 4CDWA 2WS93 4WM8A 2RS33 4WM7B 1MQTC 5JZGB 1RUE2 1PIV3 1TME1 4GB31 3VDDC 3TN92 5ACA1 2R072 3NAPA 2VQ0A 1CD3G 1EAH3 4N43B 1VBA1 1R1A3 4RHV3 5AC92 5BNOC 5GKAC 3VBUA 5LK7B 5C4WB 1QQP3 5ABJA 4RS5A 5BNPA 3ZFGA 1OOPB 1QJY2 1Z7S3 3JBG2 2HWE1 3VBSB 1VB2A 5C8CB 3VBOC 1AR91 4Z92B 4SBVA 1VBC2 2WZR2 1HRI3 1NG0A 1NY71 4QPIA 1PO12 4CDQA 5DDJ2 4IV3A 1RUC2 4JGYC 1FPN1 1QJZA 3JB4C 1HRV3 2R062 1DDLA 2RM21 1Z7S1 1TMF2 3VBRC 1NCRB 3ZFFB 3ZFEC 5CFCC 4GH4C 1B35C 1F8VA 1PVC2 4JGZC 1HRI1 1ND3B 1RUE3 1EV12 4FTBA 1K5MB 1NOVA 3CJIA 4YVSB 1RHI3 1VBB1 2XBO2 4RQPC 1C8M3 4FTEA 1PO21 1RVF2 2X5IB 2HWF1 4BCUA 1V9U2 2ZTNA 1FOD2 2RS52 2RR12 5L7OB 4CDUA 1VBD2 4FTSA 3JBG3 1ND2C 1R082 4QPGC 1BEV2 4CDXA 5D8AA 1RUE1 4FSJA 1X33A 4CEWA 1VBC3 1QJX2 3TN91 2R071 5FMOS 4RR3B 4WM8B 3FBMA 1CJDA 1RUC3 1MEC2 1RUI2 2R063 4PDWB 3JBG1 2WFF2 4Y4YA 1TME3 1A6CA 2HWC2 2WLPA 1MQTA 5ACA3 3VBUB 1VBC1 5K0UC 5ABJB 2WZR1 5FMOL 1RUJ2 4RS5B 1EV13 1VBA3 3VDDA 5BNPB 3ZFGB 2XBO3 1PO11 1QJU2 5DDJ1 3ZFFC 5J96B 1RUC1 4CEYC 5BNOA 1ZBE2 2DF7A 1H8TC 2R061 3M8LA 1AR72 1RUF2 4GMP1 1V9U3 2HWE3 4AEDB 1TMF1 1FOD3 1HXS2 1VBE2 1F2NA 2RR13 1AR93 4N53C 1K5MC 5C9AC 1VRH2 2BFUS 4QPIB 5A32B 4YVWA 1PVC1 1R092 2MEV2 3VBOA 4CDQB 1PGL2 4IV1C 1AL22 1EV11 1AL0G 1NA1B 2BBVA 4NWVA 2XBO1
chains in the Genus database with same CATH superfamily
2WNUA 3SLIA 2VXJA 4YM1A 3HEIA 5HCBA 1IPSA 3JD72 3RZLA 2XJUA 5FR3A 2EAKA 4CCLA 1RGSA 3O1VA 2Y6FA 4UBGA 4L2NA 1MEC3 3DCQA 4CXXA 5GLUA 1C1FA 3AKTA 3PIJA 4K1ZA 1VBD1 2GALA 1KQRA 4BQ5A 1X9TA 1DIWA 2VZSA 2YPJA 3POJA 5BPXA 2LW8A 1LB2A 4OHWA 3U07A 3M3IA 1ALYA 1R081 1JZ3A 1B35A 2EIBA 1H4HA 2WRAA 1QJX1 3S57A 3ZXEA 1V6MA 1UOGA 4OI0A 3TEXA 1O4ZA 2KA3A 3MGUA 3CJXA 3NV1A 3MHZA 4LKDA 2LUWA 4LITA 4LLFA 3BTAA 1L7QA 5FO7B 1DYOA 2HWF3 3PMEA 1DQ6A 5FZ3A 2GNBA 3UKVA 4CDUB 2X09A 3SCFA 3EQEA 4QQOA 5FYYA 1IG3A 5A7PA 3SH3A 4MUVA 2J7MA 1RUI1 3WF4A 5FKCA 5FY8A 4FPHA 4XCAA 4AG4A 1C8NA 5F6LB 1HXS3 1OHFA 4CEWB 3AP6A 3CLPA 3K4ZA 3WSOA 5HCAA 2ET7A 1GQGA 4COYA 5FP3A 2ARAA 2ZKLA 2O1QA 2HWC1 3ES4A 1GSLA 4JHTA 4AEKA 2E7AA 2VZ3A 3LFMA 3TN93 2R073 1D4M2 3BI3A 5A6ZA 3H42B 4CCMA 2XVLA 3TWIA 1NLSA 1RUJ1 1W6PA 1S0GA 3DN7A 2VNGA 4ATEA 4BLJA 5AC93 1SPPB 3I2DA 1G9AA 1DQ0A 1QJU1 3AMHA 3RFRA 1HB4A 1U5ZA 1E5SA 1KITA 1V6NA 2Q1FA 3QH7A 3LPFA 3VZKA 4BQ2A 1AR71 1CPMA 1VBE1 1APNA 3JZVA 2DCJA 3TOJA 1GZWB 2VOWA 4ZU4A 4E2GA 3WNOA 4Q4V2 4E2QA 3VDDB 2ZEZA 3O1OA 1M4WA 4MGZE 2ORZA 5AFBA 1R091 2MEV1 5DUUA 4D6SA 2Q8CA 3ZN5A 5K8SA 1NE6A 2CSGA 2RS32 3I2HA 4G3YC 2YG0A 3OUHA 3ZXDA 4UYBA 1RUH2 3AJZA 1UCXA 1OOPC 3OTFA 4QKDA 1PO13 4EE2A 3RGBA 1JUHA 3JB8A 5JXJA 3V0BA 5DDJ3 3H8XA 2VTXA 5JR7B 3VBSC 2PMWB 1CAVB 2XL7A 3EHKA 3U37A 1GMMA 1PIV2 1YJKA 2VOXA 1N1SA 4Y3OA 3JD71 4OULA 1KD7A 4W4ZA 1UU5A 3IN9A 4LO4B 1H1IA 4XMAA 3T09A 1FI2A 2YFZA 3K46A 4JZRA 1DGWA 3ZFFA 1DYPA 5F3GA 5FZFA 3KM5A 2QQJA 1RMU2 1JMUB 2BNNA 3NV4A 1BHGA 3RZMA 1EAH2 2JDAA 2XVGA 5JUVA 3HBKA 1POV3 3ACFA 1RTVA 3AXDA 2XVKA 2OXBA 4RHV2 5FK8A 3S5QA 1G9DA 2FDKA 1I9RA 3U75A 2JB4A 1PVC3 1W9TA 4XAAA 3UV9A 4M00A 2WNUB 2Y6HA 4E8CA 1FV2A 1VAMA 1KFXL 2GU9A 4L0PA 3NO8A 3RPQA 4XUQA 3FHIB 1AYM2 2P17A 1OT5A 2QFEA 1NCRC 4OYUA 4XIKA 2RMU3 4X6QB 3ILRA 4EN9B 4QB1A 1AXZA 4LE4A 4NHYA 3QLQA 3ILFA 3UJQA 1DGWX 4IEZA 4JHZA 3WD5A 4Z8BA 2WLQA 5J1XA 1ND3C 1B35B 1VBD3 3DPRA 1GWMA 4BLIA 5C71A 1SBDA 2JDHA 4XAEA 3OSDA 2VTFA 4PIZA 4L99A 1MZ5A 1Q8QA 1R083 2DCZA 4QHBA 3WP4A 5FZ9A 5IFPA 2FZ2A 5IVJA 1BMV2 3ZXAC 4MXVA 2JJ6A 3WW2A 4A7KA 4YARA 5AVPA 4LHNA 1JS9A 1QJX3 1S0BA 1IKPA 1D4M1 3MV01 1UD1A 4LOTA 2HWD2 5K7PA 3E5XA 3CU7A 4CRQA 4JKLA 4R9DA 1CONA 2VOVA 4KU8A 3M3EA 1OMIA 1UPSA 3H9AA 3HAGA 2DU0A 4LORA 4CUAA 1EYBA 4FPJA 3URFA 4QMAA 5JOWA 4DB5A 2WT0A 1RUI3 4Z07A 2JKXA 3AKRA 4B1MA 4I3PA 2BGOA 4LA3A 3ZMOA 1NCQA 4ZKTB 1YQ2A 5FY9A 4GALA 2BFUL 3FFZA 4UAPA 4NRPA 4J6GA 3ZOIA 2WO2A 4RGAA 1W2AX 4Q4V1 1RXGA 1HDKA 1AUYA 1HQLA 2HWC3 2VMEA 2XLAA 4WM8C 3NKTA 3ZXLA 2J1RA 3FBYA 3KSCA 3KV4A 5GLWA 3I2GA 3OOXA 4UWDA 4IQPA 2FCUA 2XUEA 4Y1YA 2RS31 2GN3A 1YNAA 5I0DA 4PIYA 2WC2A 1RUH1 3NL1A 1W6OA 4XBQA 4XC9A 2OKXA 4A7ZA 3A4UA 3AYCA 2FDIA 2DTWA 2W95A 1IKQA 2YB7A 2XJTA 3I2JA 4ITCA 1PIV1 1LOAA 3WNNA 1AR73 2CL2A 1MVEA 1RXFA 1COV3 4WM7A 1DQ2A 1OH4A 1VBE3 2G4IA 2FCTA 4AW7A 1PMHX 1RUG3 1RMU1 1W0OA 4QXHA 4CU6A 2DFCA 1EAH1 2QQPA 2DYCA 4AVAA 1TE1B 1SG3A 1VMFA 4RHV1 2ZGUA 2HWB3 1VE0A 4EJRA 4OZXA 4AHZA 2D6OX 4PIXA 1REEA 3V0BB 2GAUA 5LRSA 4TTGA 3M3QA 4B29A 3MV11 4Q29A 2WBKA 4R8HA 1MZEA 1PM4A 4C90A 1IS6A 4D69A 1AX2A 2BZDA 1AYM1 1PMJX 2IUWA 4HKLA 1MS1A 3GZEA 5FY4A 2Q8EA 3TB0A 3POWA 1TME2 3JD73 3CZUA 2NP0A 1JU4A 3VGIA 3WQ1A 5CA6A 5CISA 4XILA 2Z4FA 4KL1A 5FZ1A 1PZ9A 5FZHA 2JEMA 5JI9A 2QBXA 3GZUC 1YO8A 2C9AA 1GNZA 4IV3C 4XJZA 4RFT0 5IVVA 4RFRB 1G6NA 3VZLA 4B4QA 3U14A 1O7FA 3NNFA 3Q8FA 1CN1A 3VLBB 2BRTA 4YM3A 3KS7A 3POEA 1WW6A 1BMV1 2OS2A 1IS4A 1TQ5A 1W8NA 2A6WA 3HQRA 4LBKA 3IAQA 5FZ4A 2VZ1A 4PJYA 3OGJA 2TEPA 4BQ1A 2HWD1 4XF0A 1X36A 1OKOA 3GM8A 5FZEA 4XF1A 1OLQA 1Y9GA 2ZX1A 5FUIA 1ULEA 3DPRB 3QCWA 2CHHA 2RS13 3CEWA 1UPIA 3KLSA 5C3PA 2KR2A 4FBFA 5IYYA 1E5RA 2B8MA 3OUIA 3PTRB 1ZM1A 5DXDA 4Y5Z0 1GV9A 2VBDA 4NPLA 2V09A 3K4AA 4QPWA 3ZYHA 4YM2A 5AVAA 3VBHA 4AL9A 5IVCA 2OQ6A 2BOIA 3LGRA 2RM22 2ZEYA 4HK9A 3HR9A 4TSVA 4XIOA 4MGTA 1Z7S2 3C7EA 3OYWA 3O1PA 2QVSB 4Q1RA 1D4M3 1WGPA 2JXAA 4Y5SA 5LRRA 4INDA 3UGFA 3MF6A 3PVOA 2ES3A 2Q1MA 3OY8A 3KF3A 2ZACA 5D8AC 4KU7A 2K2SA 4AI3A 4A2UA 4ARYA 1ZA4A 1NCQB 1UXXX 4F83A 3I2IA 4OUSA 4CP1A 1HRI2 1ZX5A 1OI6A 1BK1A 1OLMA 3U0ZA 1HB2A 1MS3A 3D82A 2CTVA 2VUJA 1IGOA 3AMPA 4COUA 4Y26A 5A3WA 1US2A 4A6SA 4LQRA 4AHYA 1PO22 4YW4A 2LALA 3FLTA 4NUBA 4AI1A 4P9JA 4Q4V3 1ODNA 3IDCB 4R52A 4RGKA 5J09A 2WKKA 4LTAA 3ZR5A 2PHTA 1W6OB 4YFWA 3ON7A 4S2FA 4LJHA 2P5BA 2RG4A 4ZU5A 4CDWA 1W3VA 3OBZA 1H30A 2RS33 3B00A 3I3MA 4NE9A 4F3JA 1CJPA 2YGMA 4WM7B 1YFYA 4KQ7A 4KNCA 4WVVA 1GP6A 4NHLA 1PIV3 1YQ8A 3S7EA 1OF3A 1TME1 1HW5A 1UYXA 2R30A 3RVHA 5HXVA 5E88A 4OHYA 1A34A 2Y6GA 3DYMA 1GANA 2WYSA 2VOTA 1KS4A 1TNFA 3H1WA 4QM8A 1EAH3 2VTXJ 3Q8CA 2J1AA 5T3NA 2R16A 4BIOA 2CAVA 3C7HA 5A80A 4RHV3 2PHLA 3DUIA 3LPGA 4ORFA 4RD7A 5JVVA 3WW3A 2Z42A 1NQJA 4HMZA 4XDPA 4RS5A 1D7PM 1DHKB 5DMYA 5HI0A 1D0GA 1XXNA 2PN5A 1OBNA 3IM0A 3LOIA 4QM9A 3WT3A 2XL9A 1QJY2 1U12A 1F4HA 1Y9MA 3WZ1A 1CAXA 2R7EB 5CB7A 1Y3TA 3SC7X 1J84A 4XJUA 4XTPA 1VB2A 1O59A 4QHOA 4LHLA 3H3ZA 5GALA 2VMGA 1ZRDA 4N9HA 2XH6A 4SBVA 4XFAA 2BWAA 4LBMA 1YIPA 4NIAA 3ME2A 1WLDA 1NG0A 1A78A 4CCEA 1XE0A 3J7LA 4AFMA 2DCTA 5IK8A 2LTNA 5FK7A 1W0NA 2EIGA 3LQCA 4FP3A 4CDQA 2D6KA 5FYMA 1RUC2 3VHOA 2PHXA 4YW7A 2XDVA 4E4ZA 3IWZA 4KWUA 1QJZA 4META 1WMEA 5IUQA 2RM21 3LEKA 4FPGA 4OLLA 4XBLA 4WBBA 1Z7S1 1TMF2 2D6NA 5A7OA 1X8EA 3WP5A 4D6QA 5J36A 1H2LA 4F8AA 1AX1A 1QJFA 2Y64A 5GZEA 3VDBA 1DFQA 4D7SA 1LU2A 5FXXA 5EJ3A 5JI7A 3TNQA 3UETA 2Y8KA 2PTMA 1XYPA 3T2OA 4JGZC 1HRI1 1RUE3 1HB1A 1ULFA 1EV12 3C7FA 3N9QA 2VC9A 3HWJA 4FPFA 5FAXA 3TBDA 1W6MA 3ZR6A 1JOJA 4COWA 3IZOA 5D2AA 1D4VB 5FKBA 3MIEA 2EA7A 4GA9A 1WLCA 3OEAA 3OYWB 5LATA 2GP3A 1NZCA 1CR7A 1PO21 1LU1A 1CGPA 4E2SA 2E7TA 2DDUA 3PVBB 3E6BA 4MXWB 1V9U2 4OI1A 3F95A 3BN6A 2EF6A 5FP4A 1FOD2 5FV3A 4EN6B 4BK4A 2RS52 2BGPA 4C0BA 2RR12 3MICA 1PVXA 4IE6A 1KS5A 2ZGKA 4IGOA 3P3NA 1H8VA 1XNDA 2VCBA 2GP5A 2WIIB 3USUA 2AH2A 5A3MA 4QPGC 1BEV2 5T5LA 4CDXA 3Q9OA 2CDOA 3WG1A 3GJBA 3ZN6A 4AI8A 4P9GA 3WDXA 2YROA 1QWRA 2ID4A 4NVPA 2XWBB 5DQ0A 5FZOB 2BP6A 2WO3A 4HZFA 1E5IA 3WNKA 1X7NA 4DFSA 4I2OA 3HN1A 5FYIA 3BKZA 1ACCA 4H14A 5A3OA 3CKHA 2VW0A 4URTA 2BV4A 2DUPA 1MEC2 3OB8A 2UU8A 2JG8A 3AYAA 3WDYA 2V5YA 3ZYPA 1RUOA 2D44A 2DU1A 3J4UH 4S2HA 5JIUA 2JENA 3M4FA 5F7UA 5DAQA 1YXWA 2O0OA 4AFBA 5F3CA 2IVJA 4MGSA 4L8QA 3O0XA 4LMFA 5EV7A 1W0PA 2FDJA 1TME3 1QHDA 4O61A 5KR7A 2CDPA 3GGLA 3K51A 1DLCA 4AQ6A 1IQDC 1AHSA 3DXUA 5H9PA 2NZ9A 2XG3A 3H3UA 3SCGA 1S0FA 2UWAA 4RS5B 4X8PA 3ZYGA 2XUMA 3AFGA 4ARXA 4MHUA 4ZONA 1OQDA 2XBO3 1LOBA 3AVSA 5C8CA 3A22A 4OZOA 1WD3A 3QACA 3VZOA 4DXTA 1QXRA 3B02A 5FYZA 1RUC1 4NHXA 4CEYC 4QD2A 1F15A 2FDHA 1RUF2 4GMP1 1X50A 4D8MA 4WZCA 3DEMA 3JUUA 2K0GA 5F37A 3O12A 1TMF1 1HXS2 1S4CA 3N7MA 4XPVA 2YU2A 3WCSA 3APBA 5T5JA 1F4AA 4TN7A 4N53C 3JU9A 4FO9A 3RYRA 2W68A 5A32B 2AEYA 4LUMA 1MACA 4YVWA 3VBOA 4CDQB 4MGYE 2H0BA 2D93A 5FP7A 1EV11 2L9LA 4W65A 5JPMB 1XQNA 2KXLA 1GNHA 5J37A 2UWBA 2BBVA 2MHFA 4B8EA 3WNLA 3RJ2X 4XUPA 4BK5A 2QE3A 1LECA 3SNMA 4AGRA 4LT5A 4QQLA 1UW8A 3BIWE 4KBBA 4XFHA 5L9VA 4RGGA 1JZ6A 2RM23 5FPZA 2XB6C 2PELA 4JGYA 1V9U1 3PUQA 1LHOA 3BODA 2VXRA 1FOD1 3T4HB 4QXKA 5A3LA 3OPTA 2RS51 2FDGA 5BNNC 3SKVA 1O5LA 2RR11 3FLPA 4GZ9A 4YVWC 3SITA 3VBRA 4QHZA 2QKDA 1AYN2 1W6MB 5A6YA 5LWBA 3T2QA 3HT2A 5CKQA 2QNKA 4DY5A 3N9MA 1BEV1 1RUD2 5LASA 5JSPA 4FFHA 1UNBA 3UESA 4AWDA 2NQYA 1I1EA 1XE8A 4L9BA 5DN2A 4ZZ8A 4LXLA 3S30A 4X8NA 1PO23 3HOBA 1TVGA 3SISA 3N4MA 2KM2A 5DAXA 5FY5A 4BPZA 5JCTA 5CYYA 2ZAHA 4BDVB 4CU8A 5FJHA 1Y43B 1YRZA 4HETA 2BEOA 2NMNA 4P9YA 2WAAA 5KBFA 5ANNA 1MEC1 5FZGA 1ZBE3 3USUB 3FMGA 1ENXA 4AVBA 3H50A 4CDXB 1SLAA 2QQNA 3AFKA 1US3A 2VULA 3RRDA 4GWNA 2VZQA 3R05A 3RDIA 1JYWA 4XOGA 4BA6A 1W9YA 4I09A 1PZ8A 1BBT2 2Y34A 3T4VA 4P9WA 4MGIE 1ND2A 5LCWL 4X6RB 1SFPA 2WNEA 2ILMA 1ENRA 1GFF2 3EO6A 2BW8A 2GNMA 3I8TA 4TWTA 3VD9A 4PCRA 3BGAA 2RMU2 2JG8B 2JDNA 3ROUA 4UFMA 2PLV2 1UIKA 3NJYA 4YGBA 1UWWA 5F3EA 1MPXA 5C4WA 3WP3A 5A3NA 2E6VA 3KV9A 5JXIA 3Q8AA 2WWUA 3PURA 4OMDA 1HJGA 4AVSA 1GZTA 1W6NA 1MZ6A 5JZGC 3O1SA 1MS0A 3LD8A 4DINB 1QJY3 1RUF1 4YW1A 3H8OA 3PMSA 2WA3A 4GAZA 1PK6C 1HXS1 4BU2A 4CUBA 2ZGRA 2GSYA 5EWSA 3WHTA 3TEWA 5DAPA 1UX7A 1LJ7A 3A0KA 3H8RA 1NA1C 4QKNA 4UFLA 1BCXA 1XOYA 2ZGTA 3E6DA 3HNMA 1MVQA 5C4WC 2YY1A 4ZS3A 1D0HA 2YC4A 3BTXA 4BQ4A 1QJEA 1SBEA 1UY2A 2XJPA 1ULCA 5AC91 3BU7A 2C9KA 1JUIA 1VAVA 2B42B 4IEQA 4AVTA 1N3QA 3AYDA 1NUKA 1DQ5A 4CTEA 1YCIA 5C8CC 2Y60A 3MFAA 4GMP3 5A70A 1DU3D 1AX0A 1W03A 3LDKA 1QF3A 4HANA 3NV3A 1TMF3 2R0HA 4JTNA 4K8FA 2HKXA 1QIQA 5EPAA 1H8TA 3VBOB 3BTYA 4YM0A 4AOCA 3MYXA 3NAPB 5JOZA 2GMMA 5LZ6A 4LUKA 1SMVA 3JCIA 1AYN1 5GM0A 4E4SA 4HOOA 3BYWA 3M7AA 2V5DA 4AFCA 1PNFA 5FTTC 5IJRA 1K5MA 1RUD1 1H9WA 2WNOA 5BNQA 2HYKA 1K5JA 2IFWA 1CAUB 4XJ9A 4DXZA 5LY1A 4NRMA 3AZXA 4UW5A 3AB0A 4GJYA 4IV1A 2BERA 4XHXA 3ALQA 4Q5OA 4IGPA 1JYXA 3VKMA 2FHRA 2YU1A 1UOFA 4PI0A 3H0OA 3K4DA 1W90A 1MS4A 2DWRA 2Y0OA 3IT8A 2WSUA 1COV2 4IEUA 3AP4A 1RUG2 2RS53 5A7QA 2PAKA 4LPLA 2ZCWA 1POV1 2E53A 3ACLA 2HWB2 4YVSC 3S5AA 3KD4A 1GYKA 4Q0SA 2XWJB 3VD7A 1J3PA 2P34A 3ZX7A 5A3TA 4K3UA 4GKXA 1BBT1 1BEV3 2JE7A 4Q4Y3 2BBAA 1HRV2 3G7DA 1PX4A 4HKOA 5DUWA 2AZ5A 4HONA 3CL1A 4P14A 3LCPA 5A7SA 3VHNA 5A33A 4OUEA 5FZLA 2DCKA 2J1UA 2D3RA 2VUCA 1H4GA 3O1RA 5FYHA 4AE2A 2IFRA 4AQ2A 4ISRA 1JODA 2RMU1 2O8OA 1CVNA 5FYBA 3UT0A 2CGOA 2PLV1 3GXUA 5ERLA 3I59A 5FQ0A 1WWYA 4ZZ5A 5FZBA 2QDNA 2GDFA 3H1MA 3WF1A 2WFPA 2WR9A 4CCDA 3ZYRA 4ASMB 1ND2B 4LA2A 4JC1A 4QX2A 3T0BA 2R043 1W8FA 1XRUA 4TLFA 5F32A 4AXOA 3RSJA 4RR3C 2H6BA 1OSGA 1G7YA 2W87A 1GUIA 4XQ4A 4CU9A 2Y0IA 1FATA 1V70A 3E5QA 4I02A 4XVHA 5FYSA 3ORJA 4Y22B 3ZSJA 3E5UA 4XF4A 2VD7A 5FZDA 4CPBD 2A6YA 3UKTA 4TXWA 3LWCA 3OF1A 1W6NB 5I0UA 3OJBA 5C33A 5F2SA 1W8TA 1W8ZA 2JICA 3CQOA 4N7IA 5I8YA 5C5UA 2RS12 4LOSA 1J3QA 4YWAA 2DV9A 4LBNA 5FREA 5EJ1B 4CUGA 1O3TA 3NV2A 3OEBA 2BWCA 1RUF3 1VMHA 1ZNPA 3VD4A 2WQ4A 5LBFA 2E26A 3NSTA 3VBUC 4LBQD 1ZVFA 5ABJC 1LULA 3P6BA 5LB6A 2OX0A 2V72A 5LBBA 4FAGA 3ZFGC 1O91A 2E9QA 1DF0A 5FDBA 3I54A 2BNOA 1LENA 1WMFA 5H9QA 5B4XA 2JDPA 1O5UA 1LOGA 2TUNA 4WV8A 3TEYA 5G04L 3M70A 4Q4W3 1QH7A 4CZSA 4D3WA 2ZEXA 1VJ2A 2ZS6B 3VL8A 2VVEA 3ZN6B 2PHDA 4QGMA 2BU9A 2XLGA 1H8TB 2XOMA 1OXCA 4OFGA 1OOPA 3VZJA 3P3PA 2WL1A 3RNSA 2P37A 5L19A 1IPJA 3I3DA 3VBSA 2VMFA 1COV1 3MLKA 4ZS2A 1B09A 2V4AA 2X8KA 1RUG1 1LEMA 1JH5A 1ZZ9A 1W6QA 2WQZC 5FPLA 1BYHA 5FYCA 5FPUA 1AYN3 2HWB1 1W04A 4WVWA 1IZ3A 3R6SA 1OUSA 2YGLA 4IV1B 4DXSA 4EN7B 1QY4A 2ZGMA 3DF0A 5A6QA 1RUD3 1OPOA 1HRV1 1DQ1A 4JQRA 4UFHA 2YFUA 2CV6A 3FUQA 4NHKA 2XJSA 5EQUA 3U10A 3ZXKA 3MLJA 2DUOA 3GBWA 2VMHA 5CFDA 3FJSA 2RJ2A 4PLNA 4QXBA 4AHXA 5F8PA 4HLTA 5C8WA 5IHRA 3VBFA 1I6XA 2YMZA 5L7OB 2HEWF 1HV1A 5APAA 4JRLA 5E16A 1NCRA 3CJIC 3FZ3A 3NJVA 4LK7A 4RN5A 4D6RA 4CUCA 3S7IA 1AR63 1LEDA 3RWKX 2JB8A 3RQ0A 1W9SA 1MS5A 4XUOA 4BJ0A 4ES8A 1BKZA 2B46X 4IW3A 5LY2A 2PHWA 5A33B 1ND3A 3B5LB 1BBT3 1FPN2 4P5HA 4ES9A 3ZSLA 5CFDC 5J98B 2QQLA 3OGRA 1Y7BA 4Z82A 4AI2A 5AFEA 4BXSV 3VBFC 3ST7A 1D2SA 3I59B 5FQ0B 3B93A 2P6HA 5D1IA 1YI9A 2W2IA 2PLV3 5HV0A 3GBFA 1R64A 2OIIA 3THDA 4QB2A 2RS11 2DVGA 1WUVA 5DZGA 3LEMA 4DUVA 1MS8A 1PM7A 1R1ZA 4FFIA 4AGVA 2ZHLA 1YFXA 5FWEA 4MYEA 4AVVA 4QDSA 5F1RA 2QZ3A 1VBB2 2VBPA 2ZGPA 5IFTA 1OPMA 4MVTA 4AAXA 1XNAA 4A45A 1W3XA 2W1WA 5T5OA 1F31A 1XJAA 3POSA 3K77A 2UWCA 3IAPA 3G6JB 4XQDA 1OUXA 3PU3A 3AL5A 2JECA 1XNCA 4WM8A 3MW4A 1RITA 4IEYA 4M0HA 3ZYFA 1XPWA 1MQTC 2J1SA 2ZGOA 3INAA 5CZKA 2ZAAA 3ZDVA 1JN2P 1RUE2 3VZNA 4HL0A 1HJFA 4A42A 4FAHA 3GYDA 2UYBA 2PFWA 2Y6LA 3KQRA 2DTYA 2GNDA 1LOFC 2WINB 1W6PB 4Q26A 5BNOC 4L92A 4I0AA 4B1LA 1LR5A 5LK7B 1W06A 2RDQA 2HBUA 4BQXA 1NZIA 5KHJA 5FUPA 4OI4A 1K12A 1YWKA 1JHJA 4QKBA 4CE8A 1OOPB 2P6CA 1UZZA 2ZPXA 3I4IA 4EZHA 3VBSB 2B9UA 4YW2A 1XYNA 1C4RA 5FO9B 1LESA 3AL6A 4LKFA 1P8JA 2XHNA 1BVVA 2I74A 3L2HA 3DYOA 1W6QB 1YJLA 1KDKA 2DFBA 3PDQA 4XCBA 4BOWA 5EXOA 3TNPB 1XBFA 4JV4A 4AFDA 2DCYA 4NRQA 3MFCA 4E27A 3BU0A 2HYXA 2QUOA 4IV3A 2F6BA 4P00B 1UOJA 3C8XA 1S2EA 1FPN1 2GN7A 3KV5A 3JB4C 4RSUA 1HRV3 2P4EA 3W58A 3I2FA 4O65A 4XFIA 4XDQA 4ASLA 5JMCA 5EYYA 1NCRB 3MUZ1 3ZFFB 4Q2FA 1XNBA 5FZCA 3ZFEC 1LCLA 3J7HA 5CFCC 2G19A 2JX9A 3POFA 4GH4C 3ZMNA 1F8VA 3FX3A 5I0SA 4EQVA 2YDEA 1VPHA 3PTYA 4M3CF 1ND3B 4XF3A 2VNVA 1NOVA 5JAXA 1UAIA 2C1FA 1VBB1 2VCAA 2XBO2 3OPZA 4Q0VA 1CX1A 4RQPC 3EB7A 1QXJA 4FTEA 2NLRA 2JDZA 1RVF2 4K1YA 4W6YA 4K7JA 5D21A 4BXFA 3B9CA 2ZXQA 4YW5A 2X53S 4OVEA 2OUJA 2OA2A 1H1MA 4Q0UA 4QDRA 3GHNA 1W8HA 3HNBM 4R4ZA 3ABZA 4BCUA 4EV0A 4AEMA 2W9XA 4LO6B 3VN4A 3M1HA 1JHNA 2GZWA 3I7DA 4PHZA 2AEZA 1YUDA 1URXA 3Q8BA 2C26A 2RVAA 4KWKA 4D7YA 4UW3A 1CWPA 5LA0A 3SHRA 4XEZA 2HEVF 1JZ4A 1KDMA 1WD4A 1PMIA 5D8AA 2W08A 1RUE1 2JG9C 2WNVC 2WWJA 1W2OA 1O3SA 4DS0A 3GNEA 1WBLA 2OUHA 4FSJA 3OBRA 1X33A 4XXAA 4KMQA 4N9IA 5FMOS 4MO3M 2R1BA 3KVAA 3I3EA 3V64A 3K2OA 3LB9A 1KRIA 2RE9A 3IDBB 4WM8B 2PA7A 3KCYA 3FBMA 3J26N 1LRHA 3N7LA 1X82A 1JOBA 3A21A 2J1VA 4HXCA 5FRAA 1OD3A 2GC0A 1TEIA 1MZFA 1TNRA 1UY1A 5EIYB 1STMA 1SEFA 4K20A 1OLME 1SFYA 2D5HA 1XNTA 2VUDA 3OD0A 4J25A 4DZGA 3J7NA 1VLNA 1ZZCA 1A8MA 3KGZA 4NOTA 1S0JA 5FY7A 1A6CA 1RJ7A 2A71A 2H0VA 1XC6A 5CIRA 5K0UC 2P2KA 2ETEA 4XUNA 4OQ8A 2H6CA 3R4SA 3O5SA 3N9PA 4XFFA 2QQOA 1OD5A 1H2KA 3RJRA 3ZXFA 1O8SA 2JWPA 2D6MA 5J96B 1ZBE2 4O7XA 4IE7A 3MUY1 3LZZA 1UU6A 3QOPA 2SLIA 3UGGA 5HBAA 2VW1A 1F2NA 3KGLA 5HCHA 1EPWA 2YC2A 3FLRA 4P5YA 3OUJA 3NNMA 1REFA 1DZRA 5C9AC 1VRH2 2BFUS 1IQAA 4QGLA 4AI9A 1U5XA 4CA9A 1K45A 3M3CA 4AQSA 1AL22 1AL0G 3C7GA 3LDRA 3U4SA 3T0DA 1GP5A 3ZYJB 1UMZA 2XBO1 2QDRA 3DL3A 3N9NA 4YGEA 3VL9A 2EIDA 1IS3A 4CXYA 1F9KA 2FBEA 1FPN3 1RVF1 3WDWA 4HPKA 1YQ6A 3B01A 4XF9A 3GCWA 1CAWA 1ONAA 1SHWB 1WCSA 3OBTA 4Y1UA 1DBNA 1RB8G 3UGHA 2XHKA 4CSWA 2V73A 1JTZX 3CF6E 3AZZA 1FX5A 3DKQA 5FPXA 2VMDA 4IL7A 4IE4A 4DEQA 2MNGA 1W9FA 2QQMA 5IAXA 3HQXA 3E6CC 3POGA 4H2AA 4ZY9A 2WSVA 4LHKA 1V6LA 3LEGA 4HVQA 1YFUA 2E51A 1VBB3 4EYUA 4JGZA 4HVRA 1VR3A 2ZX2A 1AR82 3BOWA 4LE3A 3MF9A 3ZSEA 4GULA 1GR3A 4W8JA 2OVUA 3LE0A 4GJZA 2ZMLA 1UN1A 2VH9A 1IOAA 1Q8VA 2K9ZA 2B45X 2WWSA 4MSVA 3AMMA 2EXHA 5F9TA 2J42A 2YC0A 2ARXA 2R1DA 3ZPOA 4W50A 5L36A 2W5FA 5D8AB 5FYUA 2JD9A 1O3QA 4UT5A 2A6ZA 4V2WA 2PQQA 3OBAA 1QU0A 4PBOA 1ASJ2 4QU2A 4BMEA 4M4RA 3VBHB 3PJQA 2ZHKA 3MW2A 4QPGA 4AVCA 2VZUA 3AP7A 4N43A 4FXGB 3THTA 3PVEA 1GLHA 2WDBA 4KWJA 2GC1A 4MV2A 2CU5A 4HN0A 1J58A 1AF9A 5BUVA 3OY8B 1HX6A 4AI0A 4UXAA 5A1AA 1ULPA 4M4PA 3D0SA 2WZEA 3VD5A 1OQEA 1ZBE1 1UL9A 1UU4A 1DYKA 3QD6A 3PNAA 2GH8A 2OW4A 4M0NA 4JX0A 1F35A 2W92A 4CP0A 5GLZA 4TYSA 5CKMA 1W05A 3VHRA 4Q4Y2 1BXHA 4Q8KA 4N43C 4P9LA 1VRH1 5CAZA 1Y4WA 3MPPG 1WW5A 4HSJA 1UZVA 2WAOA 4UW6A 4AR2A 2HEYF 1H2MA 1AL21 2N7GA 3EMRA 3VDCA 2AACA 4CDWB 3EJKA 4M01A 3UL2A 4Z2WA 3SH5A 2ZOEB 5FXVA 4H7MA 3LIHA 2LS6A 1WBFA 4IUGA 3DGTA 4NIGA 4KWLA 1OA4A 1QNWA 4FQZA 2IXIA 2RJLA 3GHMA 3DV8A 3NJXA 2AYHA 4FOWA 1QJY1 2VBBA 5DZEA 4CEYA 4ZHNA 1OF4A 2ZX3A 2E7QA 2VAUA 2R042 3PUIA 4JDOA 4CCJA 1R1A2 4NWWA 2Q30A 3QH6A 1VP6A 5HCFA 3WNXA 3Q8EA 1OC1A 1QQP2 4DUWA 3OGGA 5JIAA 4PQ9A 1WCQA 4BHPA 4N53A 4Y5TA 3RZHA 3BALA 4BYYA 1C3HA 3NVCA 3ZIXA 5T52A 1C5IA 2QQIA 1RIRA 4K21A 3MIGA 1Q56A 1HV0A 1PNGA 1CAWB 4Q0PA 1CAXB 4I01A 3VUOA 1AR81 1RVF3 4GWIA 1CPNA 4NIIA 3C2UA 3WW4A 1G86A 4P08A 5I91A 5J48A 3WF0A 1HQNA 1JYCA 5IAVA 2I45A 4LEJA 5JPNB 3UNPA 1PHMA 4EN0A 1I5ZA 3T1LA 1X8MA 2D3PA 2D7FA 3B94A 5BNNA 2ADDA 1YI7A 4JGZB 3FHQA 1QMJA 2OT7A 1UZYA 1ASJ1 2A3YA 1DZQA 2YHJA 4XJWA 2ZGLA 2X5IC 3OGSA 4Q4W2 3B9IA 4U36A 4Q8LA 1POV0 4MX3A 1YC61 1KXGA 2Z2SB 4PLMA 3ZSMA 2VOKA 2YXSA 4WVZA 3WDVA 4MADA 1GICA 5GZGA 5L7OC 4PI2A 4XZPA 1FNZA 4XW3A 1UYPA 3FE5A 3KWVA 4OQ9A 2DBNA 3H8UA 5CU1A 2OZ6A 3KZ4C 2AR6A 3KCCA 1FV3A 1JYNA 1I3HA 1LGCA 4NMIA 1OKQA 4PDWA 2W52A 2EXJA 5IVEA 1RHI2 1SLTA 1JYTA 4QPGB 3AXEA 2P3KA 3MIHA 4Q4X3 4UFIA 1ZBA3 2FZ1A 4Q4Y1 3WP6A 3N36A 2AUYA 2BGCA 4OMCA 4B7KA 5FOJB 5IVYA 1REDA 2XJVA 1DG6A 4KGQA 5F3IA 3PU8A 4UOJA 1WLWA 4XJAA 1RUNA 2JIGA 2C5DA 4PDWC 3T2PA 3ZXJA 3PHMA 1AJKA 3EYPA 4A3ZA 4Y20A 4XFGA 1AR62 2Y6KA 4DNYA 1GBGA 3NAPC 4AEDA 4MG2A 1FYUA 3AZVA 1GOGA 3I2KA 2I2SA 3P1IA 2B9VA 5JZGA 2R041 3D0JA 2WJSA 1PGW2 4G4FA 1R1A1 5FIXA 2A1XA 2WUHA 1PK6A 5BNPC 1VRH3 1QQP1 2Q8DA 3RG0A 2VQAA 2BTVC 2XPJA 2WN3A 1DGRA 1H6YA 2DVBA 1NA1A 1VRBA 1AL23 4N8MA 3MW3A 3ZYBA 5JXHA 2GMEA 4OUMA 1KJLA 1T6BX 4QT6A 4AEDC 4CEYB 5B2GB 3TRSB 2VZRA 3RI9A 1NLQA 2R6QA 1LHWA 4JQTA 4QPIC 1M06G 4P9XA 3WF2A 2ZGSA 4PF1A 3LF7A 3VDAA 2IC1A 3R4UA 2XXZA 5H9SA 4CP9A 3AVRA 4N53B 3RMXA 1VBA2 2PHRA 2B5HA 2SBAA 5IK4A 4ZXKA 3EBRA 3VKLA 1E57A 3M3OA 5CNAA 2AREA 2BJSA 3L2YA 3WG4A 1TG7A 4FFFA 3RWNA 4Y1XA 1O4TA 4YG3A 1BLZA 5DAVA 1JZ5A 1N1YA 2F4PA 4LHSA 2G9FA 5DG1A 3D5OA 1HKDA 2G9ZA 4Q4W1 2E31A 5FLIA 3LSDA 2HWE2 5T55A 1ZRFA 2PYTA 4DIQA 1QXPA 4KBZA 4NN0A 1GU3A 4IE5A 3SMHA 1AR83 1LGBA 1YFWA 2YBPA 2QQVA 4BE3A 5FCCA 1AR92 3OGVA 1H6XA 3WNMA 4E9KA 1W8UA 3POBA 1EUTA 1GQHA 3VKNA 2A3WA 3IDEA 4CP2A 5GJ6A 2OPWA 1S2BA 3KT7A 5BNNB 3LKJA 4LR4A 4FCAA 4YVWB 3PIGA 3HIFA 1UF2C 1BK0A 2Q4SA 5CG8A 1RHI1 2WT1A 2ZMKA 2VW2A 3LIGA 1H9PA 2A3XA 3FC0A 3W9AA 3WQ0A 5CBLA 4E8DA 4GQ7A 3ETQA 3GZTB 1XNKA 3O1MA 5K9YA 3AK0A 1ASJ3 2DBIA 3ASIA 4YVSA 4A4AA 4NAOA 1L3JA 3LAGA 1S0DA 4CDUC 2ZHNA 5LBCA 5HV4A 1RYYA 2Z79A 3CIHA 4B3NA 2Q0AA 4JGYB 3K75B 3DXTA 4NJ4A 4NPRA 5GZDA 1SLCA 4LO8A 5EYXA 3I3BA 4HSLA 1UZWA 1S0CA 1XYOA 3IMMA 3VBRB 2ZHMA 3GF6A 4CEWC 5F5AA 1AR61 2W46A 4CCKA 4GB33 4O9EA 3HNYM 1ZYBA 3F2ZA 1ULDA 3S6PA 3B3QE 4Y4RA 2YZ4A 4XUTA 4KGGA 4CXWA 4F7ZA 1PGW1 2VZTA 2ADEA 5LW9A 1GOHA 5A7NA 1JXNA 2C6SA 4G9SB 3VV1A 4DUXA 4QX8A 4LO5B 3LOBA 4XURA 4RR3A 4RL7A 5DABA 1U5IA 4OHZA 3ZYIB 4Y20B 4GWJA 2FQPA 1XB9A 2VCCA 3NNLA 2F17A 4FT8A 4YZ1A 3AKQA 3KQ4B 2ATFA 2VMIA 3LSEA 4C1XA 2VECA 5JZGB 3ZDSA 1EPZA 2Q5TA 4YYOA 1V00A 5JMOA 4RYDA 1V6JA 4Y1VA 1PK6B 3VDDC 1O6UA 1SBFA 3LDBA 3WEZA 4GD4A 5SV8A 1NKGA 4JAAA 2OYZA 3IKWA 4DPNA 1CD3G 1VBA1 1R1A3 2W39A 3HQUA 3VBUA 1QDOA 5C4WB 1QQP3 3IPVA 2VZVA 5ABJA 3ZVXA 3MLLA 4BQ3A 1S2KA 2YYOA 2ZKNA 4QU1A 5LK5A 3ZFGA 3ACGA 5FMDA 4HKWA 3IMNA 3ELNA 5DAWA 2HWE1 2VNOA 4XJ8A 1WW4A 3ZN4A 4PQQA 2WZPP 3T2TA 1UY3A 4CP9B 2AENA 5C8CB 1ZRIA 3RMYA 4UFJA 1AR91 2J1TA 2YBKA 4QXCA 2GC2A 3P5BA 4QX3A 3H1YA 4YGCA 1J59A 2ZEWA 5FZKA 3A0NA 1ENQA 2WZR2 3AMNA 3MO4A 4IETA 1WMDA 4JDNA 3T1MA 5C70A 4LIVA 2WNUC 4H3WA 3AP5A 1C5HA 4D7TA 2CGPA 1QEXA 4O9GA 5FY1A 4QX5A 4XYXA 2VMCA 1OLRA 1G8WA 3W5NA 4NHMA 5KHHA 3ECQA 3OPWA 1OA3A 1HN0A 1DDLA 3JQWA 2DUQA 1GWLA 4URAA 1JZ7A 2FD8A 2WO7A 1GP4A 5FPBA 1DZTA 5F5IA 4LBOA 4BH9A 5LEJA 1Q8SA 4EZ4A 3I2OA 5A7WA 1B35C 3PUAA 1YYNA 2RDRA 2GNTA 4UFKA 1HIXA 1UX6A 2A6VA 1DGRN 5T5PA 2ZX0A 4K9SA 5ANQA 2Z69A 5KWRA 5JSOA 1KFUL 3LA3A 1K5MB 2ZJCA 3CJIA 4XXPA 1RHI3 3MBWA 4YVSB 2FDFA 5KHKA 3PUSA 2ENRA 2FMYA 1LOEA 4BMBA 4C0HA 3O1UA 3MDPA 1CZTA 3HBZA 5C3SA 4YZ3A 3VHPA 5T50A 1NT0A 2E33A 4TLGA 2LM3A 2ZTNA 1IPKA 5CADA 1YQCA 2DVFA 2IXCA 2WYFA 1ENSA 3DKWA 1V6OA 3WDTA 3ZXGA 3JBG3 1HB3A 2E32A 2BOJA 3THPA 4YPJA 3WF3A 4FPCA 3KHBA 2XMLA 3IBMA 2VGDA 4BZ4A 3DYPA 5JOYA 5FMBA 3HN3A 3ITQA 1VBC3 2C24A 4I30A 3K3NA 1NAEA 4QWNA 2FCVA 2Y33A 1Q8OA 1W2UA 5A3PA 4RR3B 2JD4A 4YZ2A 4NIHA 3N9OA 4KG0A 4IGQA 2CAUA 2G9GA 3U11A 1WCUA 1CJDA 1CIYA 2JE8A 3WOGA 2R063 1LGNA 5A1FA 4FPYA 2WN2A 4V2VA 2Z5WA 5DZFA 4OI2A 4DQAA 1PX3A 1JZ2A 2WFF2 5JDBA 2W0XA 5L9RA 1UKGA 3B69A 2A73B 4Y4YA 3VKFC 5FBZA 3KV6A 4CPBA 2UY8A 5DUVA 3AZWA 1AVBA 1MQTA 3V56A 2XJQA 2JKBA 3VBUB 1QNYA 2TNFA 3IPVB 5ABJB 2WZR1 2D40A 5FMOL 2YV8A 2PAEA 3PLQA 3N35A 1VBA3 4XACA 4DRRA 5F6KA 3ZFGB 5M0TA 3A23A 5FZ6A 5FLHA 1LOFA 5C6CA 3ZFFC 2HH9A 2D98A 3AYEA 4LO7A 5BNOA 1CZSA 1UY0A 2DF7A 1HLCA 3PL0A 4LBQA 1W8WA 3M8LA 4MH0E 1LKNA 1OA2A 1JU3A 2HWE3 3V65A 4D0QA 1LHUA 2A5ZA 1YQ5A 2PQSA 5J3UA 2HLEA 2CWSA 4QX7A 5JR2A 1UXZA 1UMIA 4GIQA 3WQBA 1AR93 4H55A 4Z2AA 2VU9A 3AKSA 5JXGA 4HVOA 4BM8A 4PF5A 1NX9A 3RYPA 4R4XA 1PGL2 5FZ7A 3ZKYA 5IK5A 4BQYA 1ST8A 3AZYA 3QBQA 5FYVA 1Y9QA 4NWVA 1ZA7A 3NQHA 4EROA 5KHIA 2C0ZA 1W2NA 4UW4A 3D4KA 4IEPA 4P9IA 4YLZA 3V0AA 2BVBA 1A8DA 1U5YA 4QGNA 2VQTA 5A7WB 1OFSA 4ATFA 2Y26A 3DPRC 1HN1A 1F5FA 2IXLA 3GZAA 3HJRA 4NR1A 3WUDA 4A41A 5C5TA 1HQWA 3TEZA 1VIWB 2CNAA 3CJIB 4GWMA 3ZFEA 4WZFA 1C57A 1XU1A 1OQ1A 1N3PA 3GDBA 4AZZA 5CFCA 2EXKA 1O3RA 1W9WA 4GH4A 3T0AA 5CVRA 2GH2A 4YRDA 1T2XA 3WG2A 2PAMA 3AC0A 4AFAA 4L97A 3GJAA 1RUJ3 1MS9A 5FWJA 1W99A 1UQXA 5CFDB 5KXDA 1QOSA 4RQPA 4BWOA 4HK8A 2W94A 4COZA 3VBFB 3C3VA 3RZGA 1QJU3 2VY0A 4EWEA 3BTZA 5FXZA 1DQ4A 1NCQC 1H0BA 1FMD2 3ZSKA 3J8F2 4FOQA 3RZZA 1WA4A 3ZKUA 4LBJA 4YW6A 1ZZ7A 2DVDA 4CCNA 1LODA 3WCRA 1AXKA 1SLBA 1CIWA 2P1BA 4FVVA 4NO4A 5FOBB 2WFF1 1AZDA 2IXHA 3TYJA 4WVMA 1RC6A 3R4DB 2BDRA 3THCA 4BB3A 4B4RA 4ONUA 3AMQA 3NJZA 4BIFA 1K3IA 1R093 2MEV3 2WNVA 5IT6A 2JG9A 3LA2A 5FY0A 1N1TA 1Q43A 2D97A 2WT2A 4AGGA 3WV6A 1BQPA 1J3RA 3EXUA 3O0VA 4K40A 4LKSA 1QGLA 1WLTA 3SEPA 2O8QA 4WM7C 3R0RA 1XSRA 3GALA 3PJYA 1GKBA 5KHGA 1LHNA 2CWMA 3JXSA 2A7AA 1MQTB 1ODMA 5BXXA 1ZREA 1T6GC 1JI6A 1W39A 2R0FA 5EZWA 1SZBA 2B4KA 2G1MA 3HT1A 4UBHA 2OZJA 2IVIB 4XETA 3GCXA 4FP2A 3RS6A 5FPAA 1H1AA 3WW1A 1VAKA 5FXWA 2WZR3 5GLTA 1YIFA 1PGL1 3POYA 3K3OA 2WS92 5HPOA 5BNOB 5IK7A 4FPLA 5K0UA 4LULA 4LBQB 1L7RA 1ZZBA 2OPKA 4R9BA 3WX5A 4CCOA 5J7MA 1SLLA 1SFNA 3ILNA 5FBJA 2CGNA 1QKQA 3HD8B 1CX4A 5BY5A 3H7JA 3O7OA 2ZZJA 4UI9L 4Q4X2 4DMIA 2ZBJA 1ZBA2 2XJRA 4JTOA 4M3CE 4AQTA 4S2DA 3S0MA 3N7JA 4DY3A 2F4LA 1RL3A 4AHWA 5CEHA 2QQUA 3UJOA 3ZO0B 4M3CA 1C1LA 1O8PA 1QOTA 4H7LA 1G9FA 5KC6A 5EFUA 2VQUA 1YEWA 5FZMA 2Q8OA 3UKNA 5C9AA 3V0AB 3KHCA 4JVAA 5FZIA 1FNYA 5KC5A 4PLOA 2P3YA 1VMJA 4YGDA 5HXMA 2JDYA 4FXKB 3LA7A 4MXWA 4KI5M 1DP0A 2ZX4A 3WNPA 4OHVA 2ZZQA 1I5PA 3TAYA 1TZOA 3BPSA 4U2AA 3ZFEB 5CFCB 4C1WA 1SACA 2J1EA 1FMD1 3NNGA 5LA9A 5LA1A 3J8F1 3O14A 3FWEA 4GH4B 4MGQA 2ORXA 3VBHC 1WW7A 3E1F1 4GMP0 4W6WA 5E8AA 2PHFA 2W1SA 5CKNA 4COVA 1VALA 1BZWA 2IZWA 3BPZA 4IV3B 2VO5A 4JKMA 4RA0A 3HVDA 4SLIA 1UO9A 1Z0HA 3CMGA 5T54A 3OD4A 5FZOA 3L9JT 4LBLA 4RQPB 1LOCA 3KT1A 2QQWA 4XHBA 4GXLA 1SDDB 3W20A 1POQA 1QH6A 2NPIA 2XGXA 2VVDA 3SKJE 2VR4A 1RUH3 3T30A 4FPKA 5A1LA 4YSFA 2X29A 2RHPA 1OH3A 2HJIA 1A3KA 5EHDA 4PT6A 4ET7A 3BIEA 1O4YA 1CZVA 3RI8A 2QTWB 3U78A 4WVMB 4K6BA 3SH4A 4AF9A 3FUOA 3RZKA 1EP0A 2Y6JA 5IW0A 1C8M2 1RMU3 2RDSA 2WFF3 2WNVB 2JG9B 4CVUA 1FXZA 5IVBA 1RJ8A 3ATGA 4CDWC 3VD3A 2X05A 4E4DX 3A7QA 5I0RA 3O0WA 5A6XA 1XE7A 2OQ7A 4ZXEA 2WS91 2W1UA 4FI9A 2ARCA 2IXJA 3J7MA 4QX1A 3VB9A 5FO8B 2NM1A 1AYM3 3IDAA 5I8SA 3M2MA 1GZCA 3T3YA 5IVFA 4XABA 3WG3A 2NYYA 3NNJA 4J1XA 4NROA 4KH9A 1UKRA 4I0WB 1WCKA 4L11A 4B7EA 3FL7A 1NQDA 2X10A 1CQ9A 4XQWA 5DUXA 4Q4X1 4DEVA 2EIEA 1ZBA1 2RJKA 3E97A 2WO1A 4RS5C 3W21A 3ZPYA 1S0IA 4A6OA 5A32A 3CDZB 4HFSA 2MPFA 1KGYA 2CYFA 3VZMA 5K0UB 4I0BA 5I0TA 3KB5A 3POIA 4QAWA 5F2WA 1WA6X 4CCCA 2ERFA 2LROA 2V4VA 2D6PA 1WZXA 2ZGQA 5G05L 3O1TA 4Q27A 2VM9A 4QKFA 1XU2A 2HWD3 5FUNA 5H9RA 3WR0A 5LEKA 4GB32 5EJZB 3MIFA 4IESA 5ACA2 2W91A 4M3CB 2AGSA 3FN9A 4CDQC 4IEOA 1W28A 3U1XA 5DG2A 1C28A 1PZ7A 5L9BA 5C9AB 3OG2A 4XE9A 1QDCA 4QQHA 2JE9A 1SDWA 4CU7A 4FPOB 4HBNA 1G9CA 3AKPA 2C4XA 3KF5A 4YFZA 3AP9A 3D8CA 1SLIA 4PBPA 4QQ2A 1GNYA 1NXD1 4HN1A 4MOAA 1Q8PA 2D43A 1IS5A 3MEPA 4NIDA 2A75A 2W3JA 3CBNA 4BQWA 5F39A 5JSRA 3B7MA 2QZ2A 4DXRA 1W8OA 5I93A 1FMD3 3NKGA 1NY72 1JZ8A 3J8F3 1Q3EA 2VNRA 2VG9A 1V6KA 3IB3A 1GWKA 1OVSA 5KXCA 3BUCA 3C7OA 5FZ0A 5KXBA 4IERA 1C8M1 3CNAA 3MI8A 1S0EA 3RZJA 1H2NA 4KG8A 5ISLA 1UZ0A 2YUEA 4MLOA 4Q0QA 2I07B 3MPBA 3SEEA 2EICA 4NPMA 2B7YA 4LIUA 4HPKB 1J1LA 3NRUA 2K46A 4IXLA 1UOBA 2D6LX 2X5IA 3PVNA 2ZGNA 2WABA 3KMHA 3IIAA 4QB6A 4CDXC 2CY6A 3U4XA 2QCSB 5E6HA 4XTMA 2XONA 1WCDJ 3WUCA 4YG0A 1SCSA 2BUKA 1IHMA 5L7OA 4P02B 3AX4A 4A44A 4HG6B 2VZPA 2VPVA 2Y38A 2GC3A 5BV6A 3JQXA 4Q1PA 2RDNA 1RINA 4DOUA 2IXKA 2TBVA 5FZAA 2YPDA 2BNMA 1SQ4A 1VB4A 1ZZ6A 4UF0A 1JOPA 1AXYA 2HWF2 2JG8C 3KT4A 3ACIA 3MIDA 5DPNA 3T08A 2BPA2 1U0AA 1GOFA 4LNVA 3WQ7A 5LA2A 4YG6A 3SQOA 4LLOA 4AEJA 4QX0A 3K48A 2B39A 2WS93 2D3SA 5F5QA 5FZ8A 3ZM8A 5F5CA 5B4NA 4QQPA 5C3QA 5FLJA 2W47A 5KXEA 1AJOA 3H7YA 2VJXA 2Q1ZB 4XDOA 1LAJA 1ZZ8A 2BVVA 3KVBA 4GB31 2ZABA 5ACA1 3TN92 2R072 3BOPA 1SCRA 4Z1VA 3NAPA 4OCTA 1LNSA 1XSQA 2XQRA 2VQ0A 1UIJA 4R9AA 2EAAA 4N43B 5FP9A 2E63A 5C3RA 5AC92 2ZA9A 5GKAC 2JDMA 3FHAA 4C8DA 4IE0A 4W6XA 2QQKA 1CAUA 2DURA 5BNPA 1UYYA 1LTEA 1UMHA 2JDUA 4FOVA 2XLFA 1Z7S3 2VUAA 3JBG2 2A70A 2IWGB 2XQXA 4YNIA 3UYJA 5BYNA 5I8TA 5FMCA 4OHXA 2VE1A 5FPVA 3VBOC 1KJRA 3MZHA 1E5HA 1S55A 4Z92B 1Q5OA 2BQPA 2EXIA 1VBC2 2HBTA 4AK3A 4XFCA 5L73A 5IWFA 3MIBA 1HRI3 2W1QA 4FQ4A 4IEVA 5FFOC 3ZLIA 2AC1A 1N3OA 1NY71 1JW6A 4CYDA 1DLLA 3WDUA 4QPIA 1DGLA 3DECA 1K42A 1PO12 1F5JA 5DDJ2 4JGYC 4IDZA 5E89A 1UYZA 1EUUA 2R062 3N7KA 4XFBA 5C3OA 2J22A 2ZMNA 1N1VA 2LRPA 2VVFA 4NAMA 3VBRC 1OVPA 3BCWA 4FOYA 3N9LA 4ASKA 4Y24A 3I97A 4D94A 3UK9A 4Y1ZA 3J9SA 3X29B 1KEXA 3CO2A 1PVC2 1WMXA 2D5FA 4JDMA 1OURA 3VKOA 2UY9A 4GKYA 1MR5A 3ZIWA 1JYVA 4FTBA 2A6XA 5FYTA 1ZRCA 2EALA 3WVJA 3I49A 3I3QA 5K4LA 4AYUA 2NMOA 4DRVA 4N7UA 1C8M3 1V0AA 3IIIA 2X5IB 2WZ8A 1YLLA 4MHRA 2DVAA 4ZPIA 1FT9A 3W59A 3D6EA 1LHVA 4IEWA 2HWF1 4JKKA 5SV5A 4Y22A 1PGSA 1FAYA 4A7YA 5FJKA 2GMPA 5GZFA 5JOXA 1ULGA 2VL4A 3H3LA 4K8RB 1J83A 4CDUA 1VBD2 1BJQA 1QOOA 5A3UA 3WLUA 2JDKA 3W5MA 4FTSA 2UURA 3ACHA 3RYKA 4AAPA 4B4PA 5GZCA 1D2QA 2ET1A 1ND2C 1R082 5C7GA 1GZ9A 2ARBA 3CZJA 1Z78A 5JLVA 1UY4A 1YHFA 3FFQA 2XKOA 4UF0B 3USSA 3PUHA 4CEWA 1QJX2 3TN91 3HMYA 2R071 4YW3A 1CESA 4R9CA 3SCHA 2VZOA 2VCMA 1NYWA 1WKYA 1GQPA 1ZRRA 2WA4A 4HT1T 4ISQA 5LBEA 4JCKA 4QDQA 4LKEA 4BISA 2UYAA 3CHXA 2XR4A 4QPYA 4MGKE 2XKPA 1RUC3 5E1RA 3AJYA 2R49A 3NWKA 3OCPA 2WQ8A 4YZ5A 3LEIA 4XBNA 1RUI2 1DCSA 1SPPA 1JBCA 3NW4A 4JRAA 4EN8B 4PDWB 3JBG1 1JYIA 3D3AA 4TZDA 5TSWA 1L7LA 5JWPA 4FFGA 5EP9A 2P3JA 3ENRA 2FMDA 4J1WA 4A3XA 1OFNA 4C91A 4FPEA 2RV9A 1BVP1 1NE4A 2P3IA 2HWC2 3AM2A 3SXWA 2PXJA 2WLPA 5ACA3 1VBC1 1ULOA 3GBGA 1GZWA 4N90A 1RUJ2 1EV13 1G9BA 3VDDA 5BNPB 4ZU7A 5CG9A 4I3GA 1N47A 1X9PA 2EVXA 2QJVA 1PO11 5FP8A 1QJU2 5DDJ1 3ETPA 4EWDA 3LFIA 1J1TA 1NXMA 4EWAA 1W2TA 1H8TC 2R061 1S1AA 2KD7A 4YZ4A 1AR72 4LK6A 4E4HA 4MZUA 3WHUA 2R32A 1IG0A 1V9U3 4AEDB 2BYVE 3KCXA 1VBE2 1FOD3 2O14A 5IATA 1CAVA 3HPNA 4Y33A 2RR13 3NMBA 3WXPA 3WY6A 3ES1A 1NLRA 1K5MC 4V1PA 4S2GA 3WINE 4QPIB 3BB6A 1EY2A 4XZUG 4DO0A 1PVC1 1R092 2MEV2 5GLVA 2PHUA 2YBSA 3BVCA 4IV1C 1V6IA 1NA1B 2JIJA 4XMIA 2NN8A 4IEXA 3N3HA
chains in the Genus database with same CATH topology
2WNUA 3SLIA 4YM1A 5HCBA 3JD72 2XJUA 2EAKA 1RGSA 4UBGA 4L2NA 1MEC3 5GLUA 1C1FA 3AKTA 4K1ZA 1VBD1 2GALA 1KQRA 1DIWA 2YPJA 5BPXA 1LB2A 4OHWA 3U07A 3M3IA 1ALYA 1R081 1B35A 1H4HA 1QJX1 3ZXEA 1V6MA 1O4ZA 2KA3A 3MGUA 3CJXA 3NV1A 5FO7B 2LUWA 4LLFA 3BTAA 4CDUB 2HWF3 3PMEA 1DQ6A 2GNBA 3UKVA 3SCFA 3EQEA 4QQOA 3SH3A 4MUVA 1RUI1 4FPHA 4AG4A 1C8NA 5F6LB 1HXS3 1OHFA 4CEWB 3AP6A 3CLPA 5HCAA 2ET7A 1GQGA 4COYA 2ZKLA 2O1QA 2HWC1 3ES4A 1GSLA 4AEKA 2E7AA 3TN93 2R073 1D4M2 2XVLA 3TWIA 1NLSA 1RUJ1 1W6PA 1S0GA 3DN7A 2VNGA 4ATEA 4BLJA 5AC93 3I2DA 1G9AA 1DQ0A 1QJU1 3AMHA 1U5ZA 3VZKA 1KITA 1V6NA 3QH7A 1AR71 1CPMA 1VBE1 1APNA 3JZVA 2DCJA 3TOJA 1GZWB 2VOWA 4ZU4A 4E2GA 4Q4V2 4E2QA 3VDDB 1M4WA 4MGZE 5AFBA 1R091 2MEV1 5DUUA 3ZN5A 5K8SA 1NE6A 2RS32 4G3YC 3ZXDA 1RUH2 3AJZA 1UCXA 1OOPC 3OTFA 1PO13 3V0BA 1JUHA 3JB8A 5DDJ3 5JR7B 3VBSC 1CAVB 2XL7A 3EHKA 1PIV2 1YJKA 2VOXA 1N1SA 3JD71 4OULA 1KD7A 1UU5A 3IN9A 4LO4B 1H1IA 4XMAA 3ZFFA 1FI2A 1DGWA 1DYPA 3KM5A 1RMU2 2BNNA 3NV4A 1EAH2 2XVGA 1POV3 3AXDA 1RTVA 4RHV2 2XVKA 1G9DA 1I9RA 1PVC3 3UV9A 4M00A 2WNUB 1FV2A 1VAMA 1KFXL 2GU9A 3NO8A 3RPQA 3FHIB 1AYM2 2P17A 2QFEA 1NCRC 4XIKA 2RMU3 4X6QB 3ILRA 4EN9B 1AXZA 4LE4A 3QLQA 3ILFA 3UJQA 1DGWX 4IEZA 3WD5A 4Z8BA 2WLQA 1ND3C 1B35B 1VBD3 3DPRA 4BLIA 1SBDA 4PIZA 4L99A 1MZ5A 1Q8QA 1R083 2DCZA 4QHBA 3WP4A 2FZ2A 1BMV2 3ZXAC 4MXVA 2JJ6A 3WW2A 4A7KA 4YARA 5AVPA 4LHNA 1QJX3 1S0BA 1IKPA 1D4M1 1UD1A 5K7PA 2HWD2 3E5XA 3CU7A 4CRQA 4R9DA 1CONA 2VOVA 4KU8A 3M3EA 1OMIA 1UPSA 3H9AA 3HAGA 2DU0A 1EYBA 4FPJA 3URFA 4QMAA 5JOWA 4DB5A 2WT0A 1RUI3 4Z07A 3AKRA 4I3PA 4LA3A 3ZMOA 1NCQA 4ZKTB 4GALA 2BFUL 3FFZA 4J6GA 4RGAA 4Q4V1 1HDKA 1AUYA 1HQLA 2HWC3 2XLAA 4WM8C 3NKTA 3ZXLA 3KSCA 3FBYA 5GLWA 4IQPA 4Y1YA 2RS31 2GN3A 1YNAA 4PIYA 2WC2A 1RUH1 3NL1A 1W6OA 4XBQA 4A7ZA 3A4UA 3AYCA 2DTWA 1IKQA 2XJTA 4ITCA 1PIV1 1LOAA 1AR73 1MVEA 2CL2A 1COV3 4WM7A 1DQ2A 1VBE3 2G4IA 4AW7A 1W0OA 1RUG3 1RMU1 2DFCA 1EAH1 2QQPA 2DYCA 4AVAA 1TE1B 4RHV1 2ZGUA 2HWB3 4EJRA 4OZXA 4AHZA 2D6OX 4PIXA 1REEA 3V0BB 2GAUA 5LRSA 3M3QA 4B29A 4Q29A 4R8HA 1MZEA 4C90A 1IS6A 4D69A 1AX2A 1AYM1 4HKLA 1MS1A 3TB0A 3POWA 1TME2 3JD73 2NP0A 3VGIA 3WQ1A 5CA6A 4XILA 4KL1A 5JI9A 1PZ9A 2JEMA 3GZUC 1YO8A 2C9AA 1GNZA 4IV3C 4XJZA 4RFT0 1G6NA 3VZLA 4B4QA 1O7FA 3VLBB 1CN1A 4YM3A 3KS7A 1WW6A 1BMV1 1IS4A 1TQ5A 2A6WA 4LBKA 4PJYA 3OGJA 2TEPA 4BQ1A 2HWD1 4XF0A 1X36A 4XF1A 1OLQA 2ZX1A 1ULEA 3DPRB 3QCWA 2RS13 3CEWA 1UPIA 3KLSA 4FBFA 2B8MA 1ZM1A 5DXDA 4Y5Z0 1GV9A 2V09A 4YM2A 5AVAA 3VBHA 3LGRA 2RM22 4HK9A 4TSVA 3HR9A 4XIOA 1Z7S2 3OYWA 2QVSB 4Q1RA 1D4M3 1WGPA 2JXAA 5LRRA 4INDA 3MF6A 3PVOA 2ES3A 2Q1MA 3OY8A 2ZACA 5D8AC 4KU7A 2K2SA 4AI3A 4A2UA 1ZA4A 1NCQB 4F83A 4OUSA 4CP1A 1HRI2 1OI6A 1BK1A 1ZX5A 3U0ZA 1MS3A 3D82A 2CTVA 2VUJA 1IGOA 3AMPA 4COUA 4Y26A 4AHYA 1PO22 4YW4A 2LALA 3FLTA 4AI1A 4P9JA 4Q4V3 5J09A 3IDCB 4R52A 2WKKA 4LTAA 2PHTA 1W6OB 4YFWA 4S2FA 4CDWA 4ZU5A 1H30A 2RS33 3B00A 4F3JA 1CJPA 2YGMA 4WM7B 1YFYA 4KQ7A 4KNCA 4WVVA 3S7EA 4NHLA 1PIV3 1TME1 1HW5A 2R30A 5HXVA 5E88A 4OHYA 1GANA 4QM8A 1KS4A 1TNFA 3H1WA 1EAH3 5T3NA 2R16A 4BIOA 2CAVA 4RHV3 2PHLA 3DUIA 4ORFA 4RD7A 5JVVA 3WW3A 2Z42A 1NQJA 4HMZA 5HI0A 4RS5A 1DHKB 1D0GA 1XXNA 2PN5A 3IM0A 3LOIA 4QM9A 3WT3A 2XL9A 1QJY2 1U12A 3WZ1A 1CAXA 5CB7A 1Y3TA 4XTPA 4XJUA 1VB2A 4LHLA 3H3ZA 5GALA 2VMGA 1ZRDA 4N9HA 2XH6A 4SBVA 4XFAA 2BWAA 4LBMA 1YIPA 3ME2A 1WLDA 1NG0A 1A78A 5IK8A 4AFMA 2DCTA 2LTNA 2EIGA 4FP3A 4CDQA 2D6KA 1RUC2 3VHOA 2PHXA 4E4ZA 3IWZA 1QJZA 4META 1WMEA 5IUQA 2RM21 4FPGA 4OLLA 4XBLA 4WBBA 1Z7S1 1TMF2 2D6NA 1X8EA 3WP5A 5J36A 1H2LA 4F8AA 1AX1A 5GZEA 1DFQA 4D7SA 1LU2A 5EJ3A 5JI7A 3TNQA 2PTMA 1XYPA 4JGZC 1HRI1 1RUE3 1ULFA 1EV12 4FPFA 5FAXA 3HWJA 3TBDA 4COWA 1W6MA 1JOJA 1D4VB 3MIEA 2EA7A 4GA9A 1WLCA 3OYWB 1NZCA 1CR7A 1PO21 1LU1A 1CGPA 4E2SA 2E7TA 3PVBB 3E6BA 4MXWB 1V9U2 4OI1A 2EF6A 1FOD2 4EN6B 2RS52 4C0BA 2RR12 3MICA 1PVXA 1KS5A 2ZGKA 3P3NA 1H8VA 1XNDA 2WIIB 3USUA 2AH2A 5A3MA 4QPGC 1BEV2 5T5LA 4CDXA 3Q9OA 3WG1A 4AI8A 4P9GA 3WDXA 2YROA 1QWRA 4NVPA 2XWBB 4HZFA 1X7NA 4DFSA 4I2OA 3HN1A 4H14A 2VW0A 4URTA 2DUPA 1MEC2 2UU8A 2JG8A 3AYAA 3WDYA 2V5YA 3ZYPA 1RUOA 2D44A 2DU1A 3J4UH 4S2HA 5JIUA 2JENA 3M4FA 1YXWA 2O0OA 4AFBA 4L8QA 3O0XA 5EV7A 1W0PA 1TME3 1QHDA 3K51A 4AQ6A 1AHSA 5H9PA 2XG3A 2NZ9A 3H3UA 3SCGA 1S0FA 2UWAA 4RS5B 4X8PA 3ZYGA 2XUMA 3AFGA 1OQDA 2XBO3 1LOBA 3VZOA 1WD3A 3QACA 1QXRA 3B02A 1RUC1 4CEYC 4QD2A 1RUF2 4GMP1 1X50A 4WZCA 3JUUA 2K0GA 3O12A 1TMF1 1HXS2 3N7MA 4XPVA 3WCSA 3APBA 5T5JA 4N53C 3JU9A 4FO9A 3RYRA 2W68A 5A32B 4LUMA 4YVWA 1MACA 3VBOA 4CDQB 4MGYE 2H0BA 2D93A 1EV11 4W65A 5JPMB 1XQNA 2KXLA 1GNHA 5J37A 2UWBA 2BBVA 2MHFA 4B8EA 3RJ2X 2QE3A 1LECA 3SNMA 4AGRA 4LT5A 4QQLA 1UW8A 3BIWE 4KBBA 4XFHA 4RGGA 2RM23 5FPZA 2XB6C 2PELA 4JGYA 1V9U1 1LHOA 3BODA 2VXRA 1FOD1 4QXKA 5A3LA 2RS51 5BNNC 1O5LA 2RR11 3FLPA 4YVWC 3SITA 3VBRA 2QKDA 1AYN2 1W6MB 3HT2A 2QNKA 4DY5A 5JSPA 1BEV1 1RUD2 4AWDA 2NQYA 1I1EA 1XE8A 4L9BA 3S30A 4X8NA 1PO23 3SISA 3N4MA 2KM2A 4BPZA 5JCTA 2ZAHA 1Y43B 1YRZA 4HETA 2BEOA 2NMNA 4P9YA 5KBFA 1MEC1 1ZBE3 3USUB 3FMGA 1ENXA 4AVBA 3H50A 4CDXB 1SLAA 3AFKA 3RRDA 2VULA 4GWNA 3R05A 3RDIA 4XOGA 4BA6A 4I09A 1PZ8A 1BBT2 4P9WA 4MGIE 1ND2A 4X6RB 2WNEA 2ILMA 1ENRA 1GFF2 3EO6A 2BW8A 2GNMA 3I8TA 4TWTA 4PCRA 2RMU2 2JG8B 3ROUA 4YGBA 2PLV2 1UIKA 5C4WA 3WP3A 2E6VA 4AVSA 1W6NA 1MZ6A 5JZGC 1MS0A 4DINB 1QJY3 1RUF1 4YW1A 3PMSA 2WA3A 1PK6C 1HXS1 2ZGRA 2GSYA 5EWSA 3WHTA 1LJ7A 3A0KA 1NA1C 1BCXA 2ZGTA 3E6DA 1MVQA 5C4WC 2YY1A 1D0HA 1SBEA 2XJPA 1ULCA 5AC91 3BU7A 1JUIA 1VAVA 2B42B 4IEQA 4AVTA 1N3QA 3AYDA 1DQ5A 4CTEA 1YCIA 5C8CC 3MFAA 4GMP3 1DU3D 1AX0A 4XEZA 1QF3A 4HANA 3NV3A 1TMF3 2R0HA 4JTNA 4K8FA 2HKXA 3ZN6A 1H8TA 3VBOB 4YM0A 3MYXA 3NAPB 5JOZA 2GMMA 4LUKA 1SMVA 3JCIA 1AYN1 5GM0A 4E4SA 3M7AA 4AFCA 1PNFA 5FTTC 1K5MA 1RUD1 1H9WA 5BNQA 2HYKA 2IFWA 1CAUB 4XJ9A 4DXZA 3AZXA 4UW5A 3AB0A 4IV1A 4XHXA 3ALQA 3VKMA 2FHRA 3H0OA 1MS4A 2DWRA 2Y0OA 3IT8A 2WSUA 1COV2 4IEUA 3AP4A 1RUG2 2RS53 2PAKA 2ZCWA 1POV1 2E53A 3ACLA 2HWB2 4YVSC 3KD4A 1GYKA 4Q0SA 2XWJB 1J3PA 2P34A 3ZX7A 4K3UA 4GKXA 1BBT1 1BEV3 2JE7A 4Q4Y3 3G7DA 1HRV2 4HKOA 5DUWA 2AZ5A 3CL1A 4P14A 3LCPA 3VHNA 5A33A 2DCKA 2D3RA 1H4GA 4AE2A 2IFRA 4AQ2A 4ISRA 2RMU1 2O8OA 1CVNA 2CGOA 2PLV1 3I59A 5FQ0A 2QDNA 2GDFA 3H1MA 2WFPA 3ZYRA 4ASMB 1ND2B 4LA2A 4JC1A 2R043 1XRUA 4TLFA 4AXOA 3RSJA 4RR3C 2H6BA 1OSGA 1G7YA 4D7TA 4XQ4A 2Y0IA 1FATA 1V70A 3E5QA 4I02A 4Y22B 3ZSJA 3E5UA 4XF4A 2A6YA 3UKTA 3LWCA 3OF1A 1W6NB 5I0UA 3OJBA 5C33A 4N7IA 5I8YA 2JICA 2RS12 1J3QA 2DV9A 4LBNA 5FREA 1O3TA 3NV2A 2BWCA 1RUF3 1ZNPA 2WQ4A 3NSTA 3VBUC 4LBQD 1ZVFA 5ABJC 1LULA 4FAGA 3ZFGC 1O91A 2E9QA 1DF0A 5FDBA 3I54A 2BNOA 1LENA 1WMFA 5H9QA 1O5UA 1LOGA 2TUNA 4WV8A 4CZSA 3M70A 4Q4W3 1QH7A 4D3WA 1VJ2A 2ZS6B 3VL8A 2VVEA 3ZN6B 2PHDA 4QGMA 2XLGA 1H8TB 3VZJA 4OFGA 1OOPA 3P3PA 2WL1A 3RNSA 2P37A 5L19A 1IPJA 3VBSA 1COV1 3MLKA 1B09A 2X8KA 1RUG1 1LEMA 1JH5A 1ZZ9A 1W6QA 2WQZC 1BYHA 1AYN3 2HWB1 4WVWA 1IZ3A 3R6SA 2YGLA 4IV1B 4EN7B 1QY4A 2ZGMA 3DF0A 1RUD3 1OPOA 1HRV1 1DQ1A 4JQRA 2CV6A 3FUQA 4NHKA 2XJSA 3ZXKA 3U10A 3MLJA 2DUOA 3GBWA 2VMHA 5CFDA 3FJSA 4AHXA 4PLNA 5C8WA 4HLTA 3VBFA 1I6XA 2YMZA 2HEWF 1HV1A 4JRLA 5E16A 1NCRA 3CJIC 3FZ3A 3S7IA 1AR63 1LEDA 3RQ0A 1MS5A 4ES8A 1BKZA 2B46X 2PHWA 5A33B 1ND3A 3B5LB 1BBT3 1FPN2 4P5HA 4ES9A 3ZSLA 5CFDC 5J98B 4Z82A 1Y7BA 4AI2A 5AFEA 3VBFC 3ST7A 1D2SA 3I59B 5FQ0B 3B93A 5D1IA 1YI9A 2PLV3 3GBFA 2OIIA 2RS11 2DVGA 1WUVA 5DZGA 1MS8A 1PM7A 1R1ZA 4AGVA 5F1RA 2ZHLA 1YFXA 4MYEA 4AVVA 2QZ3A 1VBB2 2ZGPA 1OPMA 4MVTA 5T5OA 1F31A 3POSA 2UWCA 3G6JB 4XQDA 2JECA 1XNCA 4WM8A 3MW4A 1RITA 4IEYA 4M0HA 1MQTC 2ZGOA 3INAA 2ZAAA 1JN2P 1RUE2 3VZNA 4HL0A 4FAHA 3GYDA 2UYBA 2PFWA 3KQRA 2DTYA 2GNDA 1LOFC 2WINB 1W6PB 4Q26A 5BNOC 4L92A 4I0AA 5LK7B 1LR5A 5KHJA 4OI4A 1YWKA 1OOPB 1UZZA 2ZPXA 3I4IA 3VBSB 2B9UA 4YW2A 1XYNA 1C4RA 5FO9B 1LESA 1BVVA 2I74A 3L2HA 1W6QB 1YJLA 1KDKA 2DFBA 4BOWA 5EXOA 3TNPB 4JV4A 4AFDA 2DCYA 3MFCA 4E27A 2QUOA 4IV3A 2F6BA 1FPN1 2GN7A 4RSUA 3JB4C 1HRV3 3W58A 4XFIA 4XDQA 4ASLA 5JMCA 5EYYA 1NCRB 3ZFFB 4Q2FA 1XNBA 3ZFEC 1LCLA 5CFCC 2JX9A 4GH4C 3ZMNA 1F8VA 3FX3A 5I0SA 2YDEA 3PTYA 4M3CF 1ND3B 4XF3A 1NOVA 5JAXA 1UAIA 2C1FA 1VBB1 2XBO2 4Q0VA 3OPZA 4RQPC 1QXJA 4FTEA 2NLRA 2JDZA 1RVF2 4K1YA 4W6YA 4K7JA 3B9CA 4YW5A 2X53S 4OVEA 2OUJA 2OA2A 1H1MA 4Q0UA 4R4ZA 3GHNA 4BCUA 4EV0A 5J48A 4AEMA 4LO6B 3VN4A 3M1HA 1JHNA 2GZWA 3I7DA 1YUDA 1URXA 4D7YA 4KWKA 4UW3A 3SHRA 2HEVF 1KDMA 1WD4A 1PMIA 5D8AA 2W08A 1RUE1 2JG9C 2WNVC 1O3SA 4DS0A 3GNEA 1WBLA 2OUHA 4FSJA 3OBRA 1X33A 4XXAA 4N9IA 5FMOS 2R1BA 3V64A 3LB9A 1KRIA 2RE9A 3IDBB 4WM8B 2PA7A 3KCYA 3FBMA 3J26N 1LRHA 3N7LA 1X82A 5FRAA 2GC0A 1TEIA 1MZFA 1TNRA 1SEFA 4K20A 1SFYA 2D5HA 3OD0A 4DZGA 3KGZA 1VLNA 1ZZCA 1A8MA 4NOTA 1S0JA 1A6CA 1RJ7A 2A71A 2H0VA 5CIRA 5K0UC 2P2KA 2ETEA 2H6CA 3R4SA 3O5SA 4XFFA 1OD5A 1H2KA 3RJRA 3ZXFA 2D6MA 5J96B 1ZBE2 3LZZA 1UU6A 3QOPA 2SLIA 5HBAA 2VW1A 1F2NA 3KGLA 1EPWA 3FLRA 1REFA 1DZRA 5C9AC 1VRH2 2BFUS 1IQAA 4QGLA 1U5XA 3M3CA 4AQSA 1AL22 1AL0G 3ZYJB 2XBO1 1UMZA 2QDRA 3DL3A 4YGEA 3VL9A 1IS3A 1F9KA 2FBEA 1FPN3 1RVF1 3WDWA 4HPKA 3B01A 4XF9A 1CAWA 1ONAA 1WCSA 3OBTA 4Y1UA 1DBNA 1RB8G 2XHKA 2V73A 1JTZX 3CF6E 3AZZA 1FX5A 5FPXA 4IL7A 2MNGA 3E6CC 3HQXA 2WSVA 4LHKA 1V6LA 4HVQA 1YFUA 2E51A 1VBB3 4JGZA 4HVRA 1VR3A 2ZX2A 1AR82 3BOWA 4LE3A 3MF9A 3ZSEA 4GULA 1GR3A 2OVUA 2ZMLA 1UN1A 2VH9A 1IOAA 1Q8VA 2K9ZA 2B45X 2WWSA 4MSVA 3AMMA 2EXHA 5F9TA 2YC0A 2ARXA 2R1DA 5L36A 5D8AB 1O3QA 2A6ZA 2PQQA 1QU0A 4PBOA 1ASJ2 4QU2A 4BMEA 3VBHB 3PJQA 2ZHKA 3MW2A 4QPGA 4AVCA 3AP7A 4N43A 4FXGB 3THTA 3PVEA 1GLHA 4KWJA 2GC1A 4MV2A 4HN0A 1J58A 1AF9A 5BUVA 3OY8B 1HX6A 4AI0A 4UXAA 3D0SA 1OQEA 1ZBE1 1UL9A 1UU4A 1DYKA 3QD6A 3PNAA 2GH8A 2OW4A 4M0NA 4CP0A 5GLZA 4TYSA 3VHRA 4Q4Y2 1BXHA 4Q8KA 4N43C 4P9LA 1VRH1 5CAZA 3MPPG 1WW5A 4HSJA 4UW6A 2HEYF 1H2MA 1AL21 2N7GA 4CDWB 3EJKA 4M01A 3UL2A 4Z2WA 3SH5A 2ZOEB 4H7MA 1WBFA 3DGTA 4KWLA 1OA4A 1QNWA 4FQZA 2IXIA 2RJLA 3GHMA 3DV8A 4FOWA 2AYHA 1QJY1 5DZEA 4CEYA 2ZX3A 2E7QA 2R042 4JDOA 1R1A2 4NWWA 2Q30A 3QH6A 1VP6A 5HCFA 3WNXA 1QQP2 3OGGA 5JIAA 4PQ9A 4BHPA 4N53A 3BALA 4BYYA 1C3HA 3NVCA 3ZIXA 5T52A 1C5IA 1RIRA 4K21A 3MIGA 1Q56A 1HV0A 1PNGA 1CAWB 4Q0PA 1CAXB 4I01A 3VUOA 1AR81 1RVF3 1CPNA 3C2UA 3WW4A 1G86A 5I91A 1HQNA 1JYCA 2I45A 4LEJA 5JPNB 1PHMA 4EN0A 1I5ZA 3T1LA 1X8MA 2D3PA 2D7FA 3B94A 5BNNA 1YI7A 4JGZB 1QMJA 1UZYA 1ASJ1 2A3YA 1DZQA 2YHJA 4XJWA 2ZGLA 2X5IC 4Q4W2