2VZVA

Substrate complex of amycolatopsis orientalis exo-chitosanase csxa e541a with chitosan
Total Genus 280
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
280
sequence length
857
structure length
857
Chain Sequence
LSVGAAAGNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSATSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 280
structure length 857
sequence length 857
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzvA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzvA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzvA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzvA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzvA03
3LQAH 3LSOA 1WCQA 1E6ZA 4FQXD 2DI8A 3PZQA 3LIZL 3JTSB 1K8IB 5HGAA 1WIUA 1V0NA 1QO3B 3CVHA 5DEZA 1I4FA 1XF3B 2R9HC 1T2XA 2G75A 2P7TA 4PMRA 4PB0H 4XBPA 4OCSH 1FNSH 4FABH 4JQVC 1UY2A 4NQEB 4M1DH 3QHOA 3TBSA 1JV5B 4HMEA 1C5CL 1DBKL 4LFHG 4XVSH 1MFEL 2YEZB 4PV9A 5D7LA 1FP8A 2AQ1A 5AZEL 1FZOB 4YZFE 2J8UB 5DJZB 3CFEA 1X4ZA 2UY7A 3F7QA 4XAWL 2Y6KA 3L4ZA 1D6VL 1T20B 1WZLA 5T33H 5EUKB 4H5SA 2PB1A 4QFUA 1MAKA 4PJXA 1OGTA 3AU1B 1YMMB 4N5EC 3P2TA 2N1KA 3TA3D 4QLJA 4NI3A 4X7TB 1RUQL 1XR9A 2NY6C 2Q1EA 3X3FH 2EEAA 4MB1A 4L3ED 4DGYL 1FAKT 4IIQA 3V4VL 5CSBA 4JG1L 4LPYA 4OUOA 3BAEL 1U8KA 2HKHL 3EYFA 5MEOB 1B90A 1H9VA 4K9EL 4GFTB 2P46B 3ULUC 4P2QE 3B9EA 4W86A 3FFCB 3ALFA 3MRQA 3WIHA 2YK1H 2WMPA 3BAWA 2HFEB 5DJAB 5IK3A 3OQ3B 4UOQA 4OM0H 1S7UB 2J1KA 4GKLA 1HINH 3BIAX 3GK8L 3MMDA 4A6YA 4L8DB 4JFZL 3O4LA 4N0UE 3U4BL 5HYQA 4BJ0A 3GEWB 1JZ7A 4HU0A 2W9EH 4QXUH 2GITA 5E4EB 4JGUA 2BV9A 4OGXL 4QLLA 1G7HA 4M1RA 3PBGA 4LQRA 4GW5A 4XNMB 4YHML 4XTRC 5IT2H 2HP4A 5E99H 4PJ8A 5B8CC 3TEUA 5TDNB 5C3LD 4CCEA 4V1DD 1MVUA 3F7YB 3GHBL 4PRHB 5J11C 5IHBA 1FIEA 3C60D 4H25A 3IETB 4EI5D 2D0HA 4MJ6A 1WTLA 1LE5B 4F7EA 4P49A 3OB8A 3PWUA 4Y5XA 2EKSA 4PJFE 3SKJE 4U6HB 1DBAL 1SJHA 5EZOH 5JXIA 4HKBB 1ZVYA 1MCWM 4PRHE 4UIKL 3TIDA 2AOSA 3X12B 2CUIA 3SCTA 2IADB 3EZ8A 5I1AB 2VZUA 2GK1B 4LVNC 5D6CB 4XHQA 1L7TH 4QP0A 2ZG1A 4DKDC 2QQNA 2H32B 1KXQE 3LN4B 3I2IA 3T08A 3BT2L 1FH5L 1NCBH 1M7IA 4YPGA 3A4AA 5E6ZA 1GGCL 4BQ8A 3QNXA 2DSVA 5E09A 1WIOA 4XVTH 3HU7A 5CG0A 5F9JB 4DUXA 2DT1A 5IB3B 1FE8L 4PGDA 4HKXA 2H45A 5I79A 3LB6D 4U7MA 2VR5A 2EDTA 3VG0L 2X4SB 3WNOA 2QV2A 3VGAB 2DEPA 2JE8A 2RAMA 3GRWA 4ODBD 2CJUL 2GY5A 3GSOB 3U7YL 2GJ6B 4DGVL 3C09C 4HPOH 4U3AA 5ITBH 4NO2A 4W7VA 3SO3B 1A6ZA 1P9MC 3G6DH 1SY6L 5DEFA 4N8VG 4OV5B 4UT9H 4ODXB 4UFHA 2G60L 3SDAC 3HNSL 4L8CA 1H8NA 1DQDL 2D2OA 3S96A 5L2KE 1A3HA 1MW3A 2BK8A 1JNHB 1MCJA 1ES0A 3L3HA 3AXLA 5FUOH 1IC7H 5IW6A 5DK3A 2K7QA 4YHNB 3ULSB 4LCCB 1QSFE 5TQ0H 4HG4K 3AROA 1J8HA 1QLFB 3GKZA 5I9QC 2CK0H 3WFHB 4DKAA 4Q6IC 1YYMH 3QFDA 3KLSA 5LGKA 1JPFA 1JRHI 4YPJA 1KB5L 4RIRA 3PP4L 4Y4HA 3D0LA 5EU3B 1QZ1A 5DO2D 1U8JA 3IB3A 1OINA 3MLRL 4JANB 2ENYA 4N0CC 2VQ1A 3VDBA 2R69H 1I3RA 4OZIE 3CPUA 5ABEA 4UFKA 2BDNH 3CTTA 3RM8A 1E4WH 1S7VB 3S37X 3ECQA 2LVCA 1C1EL 3B9KC 3ZHKA 1AXTL 3G08B 3LKNA 4R6UA 4MGXA 4WEMB 2P5WA 4J3UA 4PY7B 5EIVA 2VCBA 1XYFA 3MNZA 3MBEB 1LO3H 1CL7H 2GJJA 5FECA 4UQEA 2XJ7A 1UM4H 4ZZ5A 1JHKL 3NCEB 1JYXA 3BEVB 2L0DA 3G5ZA 1EO8H 1XEDA 2IH3B 4AD3A 1QFHA 1VPOL 3PZNA 3NFNA 1B88A 3BP7A 2V5CA 4UILH 1H3GA 4M29A 2WWMC 3DYMA 4GZJA 3QDJB 5D1QB 1NL0L 2X1XR 2DMKA 2NYYC 1MRFL 5I8KH 3MMEB 4R2GD 4P48A 5FO7B 3UTZA 2XN9E 3CZJA 4HUNB 3QDMD 3S35H 3JWDH 1HDMA 3KPOB 5J56B 3L2MA 3QPQC 5D72H 3WH6A 4OCWL 1MI5E 1TVHB 4X5WA 3QG6B 4KK6D 4U1GB 4ZTPL 4D0BB 4MAYD 4HC1A 1OOAA 5BVPL 5MEQB 1IGYA 4BXSV 4M7JL 3VFVB 5L0QB 5T5NG 4FMVA 2IF7A 2RR3A 3MLTB 1TZGH 1TETH 4YK4B 1INEH 3HPLA 1ZGLA 4OFYA 3OKKB 5DSCB 1MIEH 1UCBH 1RHHA 2VDLL 3WH5A 5HBBA 3U4EB 1JYNA 5E0FA 5A3HA 1O7SA 4M7ZB 3HLAA 3KPRB 1OTSD 5FA3B 1AR1C 1OT2A 5LWYL 1Y0LB 3FQWA 4F8TA 4YDIL 1NCWL 1UYZA 1OLZA 1BYDA 1T2QL 1MH5B 2G3IA 5KW9L 5A8NA 2BSSB 1AI1H 2FGWL 1UJ3C 1D5MB 1UQSB 1WJ3A 4QXGH 4ZSOE 3QHFL 3UJIH 4E0RA 1HT6A 5D7KD 2CLZA 4W6WB 5DQDH 1NC4D 3KPMA 3I75B 2Z91A 2F54B 3NA9L 2JKXA 3L7FB 1RP8A 3AISA 4EKJA 1LLOA 3SCNA 2DQJH 4M7KH 1P4IH 4PJDA 2W1SA 4OKDA 3PJSA 1C12A 4ZY9A 4XPAL 3IVKA 2BC4B 2JIXA 1EHXA 1UYQA 2KQNA 3OAZK 3RJXA 5HGDA 1H2JA 2E6QA 3MCG1 4POZC 1MAML 1W0VA 2HVJB 4IM4A 1HXJA 3MRNA 2VDNH 3V7AE 4O5LL 4G6MH 3D3VE 5HI3D 1MJ7L 4WO4C 4PRPE 3D69B 3QCUL 1CDUA 4MQTB 3VG9C 1FPTL 1MREL 4NM4H 4QRSA 3RZCC 5IFJB 1NDMA 2DJSA 3MJGX 2A6DA 4S2SB 4W4ZA 3VIFA 4MNGB 3NZ8B 3V0VB 1WTGT 3AMLA 2W4XA 3SHSA 3RPIA 1IAIH 3IDMB 2APXA 1TJHH 4K8RH 1XF1A 5C0BA 43CAB 1I3GL 3MBXL 3B5GA 1WNOA 3FONB 3G5VB 1NARA 4K68A 4CCDA 3VH8A 3PGFH 5T1KA 5FO9B 3B9VA 5B38A 2WMHA 3QNZA 1FVDB 2DCJA 4QHKI 2DQHH 4YHOH 3V5HB 1IM9D 5L6YL 2VMCA 4MAVA 1RUPH 4YBQD 4P3WA 3FQXB 2PTTB 1GVIA 5JW5A 4Z2HA 2W9LA 3O2LA 4C59B 4QRPB 4ZDHB 4DTGL 1G0CA 2G9HB 4Z7NF 1FVCB 2KUTA 2CDGB 4JO2L 4N0FA 4U1NB 1Z32X 2IMNA 4BFIB 3O4OC 4HIXH 2W95A 3P1IA 1J9CT 3VIIA 2NY3C 4PUBL 1WAWA 3A4XA 2GW5A 2Y6SC 1LE9B 3R06B 1XIWB 3ZKNC 1M04A 2VR9A 3SDYL 4PTTB 5DRWB 4CU6A 3SE4A 2ADFL 4OGYL 4Y4FC 4ZPVB 3MLZL 4YZFF 4BKLB 3BWAA 1BVKB 1XGYH 1GH7A 1M71B 3M6DA 1PG7H 3B3IB 4ZPTB 4K7FA 5KSVA 1IT0A 4LLVA 4UB0L 1DBJL 4FQLH 1P1ZA 1KGXA 3SCMD 3DIFA 1DE4B 3CUJA 1JAKA 3LKSB 4NUGH 4M5YH 1MHHA 3A4WA 5I23A 1K12A 2L7UA 1P53A 1SJEB 1JHLH 4LSUH 3BQUD 1BWMA 5F93C 4P3CH 1TFHA 1JNEA 3TBVB 3WLWC 2QPSA 2D7PA 3QAZB 2JK5B 4LLUA 5FUZH 2EXOA 2X1IA 3MRPA 4XP4L 3WNNA 3C5ZA 5CKGA 2F8XC 5F8QC 2VMDA 4G6JH 3WF1A 4LEXL 3S3JA 1Q1JH 1ED3B 1SBSL 4WFGD 1T22A 1UM5L 1PPIA 1E4XL 3JTSA 1K8IA 4F57L 5IROA 1QO3A 4MZ2A 1XF3A 3D85B 4JKPL 1JGLH 4P4KB 4MNQE 4XXDB 3HE7B 4XP6L 3AMDA 1G7QB 2DPEA 2HH0L 2EDEA 2VDRH 2FEDD 4NQEA 1DFBH 1JV5A 1DEEB 2W66A 3L4TA 5IIEB 4CL7A 4D1JA 3KHQA 1C7TA 5CP7B 2WMIB 1NAKL 4R4NC 1FZOA 3RIFF 5J3HD 5DJZA 3AIVA 4UFJA 4IJ3B 1HQRB 1A7OH 4AEHH 2WMJA 1WT5A 5HGBB 4GAYA 5EUKA 4D9RD 3N11A 1DUYB 3WENA 1KCRL 1MCHA 2VAAB 12E8H 3AU1A 2VABB 1YMMA 2Y07L 2VZRA 3L3DB 1R3LB 4X7TA 5GS3A 5J1XA 4W4OC 4PJFF 1FRGH 4B0MM 4HP5A 1MIML 3SDCD 5IFAH 5EOTB 2XKSA 5IBUG 4DGIL 4BELD 3ACGA 2GDUA 1L7IH 1V05A 5C0CB 1XGZA 5ADPH 3FQUB 3VIHA 3HB3C 2E9JA 5MEOA 2EH7H 2ERJC 1MCOH 3HMXH 3A6BL 4ZQKB 2Z0BA 3H3PL 2EYRB 4GXUN 5ESVB 1FYTB 2ZJSL 2CBIA 1A7NH 2VXUH 3FFCA 3OAUH 2AW2A 5LA2A 2I27N 2W59A 3MV7D 4WHTB 3TJEL 1KLUB 4L4TE 1IGIL 2HFEA 5DJAA 1RZ8B 4W8BA 2WBJB 4GKSA 5F7LB 3O6MH 1R3KB 3DJ9A 2ADGA 5ISZB 1V3LA 1MYRA 3P4MA 1IQDB 4NRYA 2VX4A 4P23D 4PN2A 4JDZB 3K4AA 4AM0B 15C8L 4BFBD 3SE9L 5C2BH 4YXKL 5JHDD 4XNMA 4PJFA 4DK6A 4Z0BL 3NDZA 1EMTH 5TDNA 3O0RL 4PRHA 4WF7A 2QQLH 3G6AB 4NSKB 1JGUH 2I24N 5HHME 3CX2A 5DMJB 1F00I 3IETA 2H1PH 5DWUH 5BCAA 1Z9OA 4R26H 1LE5A 5B4MC 1KPUB 3E2HB 4FMFA 4OD3H 4Y8DC 4GAJL 1KXQA 4LIQL 1AGEB 1NOUA 3A7QA 3WH7A 3BUTA 4U6HA 1EDGA 4HKBA 5C71A 3CSBA 3U6RB 3S88L 2KDGA 3Q0HA 5CJXA 1DVFD 5D9MA 4CD5A 3K8MA 2PWEA 5A8PA 1B9ZA 2IADA 4Y89A 5I1AA 2GK1A 1MCKA 3ZYIA 2W61A 5D6CA 3UYRL 3ULUL 1J1OH 5GRJL 2XTJD 2PF0A 5GZOD 5IOPB 2H32A 3LN4A 1Z3GL 3SKUD 2GFTA 2UYLA 3RVWD 1F4XH 1H0IA 2XRAH 4XWOC 4YEFA 2XTKA 1E6RA 4OZIF 3U0PA 2AJUL 5F9JA 1G0YR 3NCJH 2FIRT 5IB3A 2RVAA 3SY0B 1UWXH 3TP4A 1JCKA 4FQXB 1KEGH 3QR2A 2A77H 2FO4B 2B2XH 3G6LA 4HS8H 4RGMB 4W84A 5F7UA 1ECEA 4QF1B 5DS8B 4HKZB 3U36B 1OD0A 2X4SA 2QQKL 3QULB 5L2KA 2VQUA 3CFCH 4UU9B 4QX2A 2GY7B 5EU5A 1W2KT 3GSOA 1JGVH 3L1OH 3ARQA 1ZLUK 5CILL 1HZHL 2MCPL 1TPXB 1A22B 3IGAA 4KHTH 4J6RL 5DFVD 3LEKA 3BCFA 2E8ZA 4OV5A 1ZMYA 2EDYA 2YOCA 3WY1A 3TT3L 4FTVB 5EU6D 1GJUA 2IQ9L 4JRYB 5EZIH 3AYRA 1JNHA 5DVOA 1I85C 3SE8L 5BS0B 2HMID 3ARFA 4TRPH 4OZIA 1F6LL 4YHNA 3ULSA 4LCCA 4Y5XC 2GSGA 4D0QA 5DN2A 1QLFA 4OKVA 1KIRB 1U3HB 3BHBB 3WFHA 5IMKB 5LXGH 4E8DA 3RDKA 3BIKB 3GM0A 2G5BB 3EFDH 4DZ8B 3V9FA 3GBEA 2DSUA 2VURA 5EU3A 4ORGB 1MWAH 5K9JL 1I1AC 4QEGA 4JANA 1I8MB 4CVZB 5HPMB 5ABFB 3UTPD 2FDMA 1CLCA 1YEDB 4HMDA 3D2UB 4JDTL 1S7VA 3S37H 4NUJB 1YN6B 2FD6L 3J8F7 4PJCE 1G6RL 3BW9A 1V0MA 1HF6A 4M5ZL 4QWWD 4PD4K 4L3EE 4KTEH 4PY7A 4C7DA 5H8DA 5HJ3B 4KTYA 4P9HH 5H35B 3MBEA 2ATKB 2CDEA 4IRSD 3L3GA 3ZE2E 4UTBL 1ZOXA 3KDMB 4Q0XL 3OF6A 2NY2D 2IH3A 4JFEB 3TA9A 1T66C 2NXZD 3VD4A 1XF4B 1GOFA 5F3HB 5IUSA 1YEIL 4XURA 3MV8E 5ELIA 1MI5A 3CHEA 2AXJA 3NGBB 5I1KL 3TN0B 4EI5B 4QLKA 5JHLL 4D0DA 1OAYL 1HKLL 1G6VK 1UM6H 4KJPD 1S7SB 5JQHC 3THCA 3MMEA 2FL5B 1ISZA 2F53D 5FO7A 1N0XH 35C8L 4BYHA 1UY1A 3WF2A 3KPOA 4KHXL 3PZOA 1WAAF 4GI6A 2HLAB 1ZE3C 4NWTL 3HNTH 3CFKB 4V1DE 3TNMB 2ZKHL 3QG6A 3KNBB 3LPGA 4D0BA 3OJDB 2E9MA 4M6OH 5MEQA 1CBGA 1SQ2N 3AM8A 1HIML 4JRXD 3Q5OA 3VFVA 5T3ZL 3WS3B 1RUMH 4Z2IA 1GHFH 3QA3B 3RP1A 3C7FA 2I5YL 4LPWA 3WFCL 1R3JB 5DR5H 3W9EB 2W1QA 3OKKA 5KSAC 4J3VA 5DSCA 3ZOAA 3BMWA 3SPVB 4UV7L 1UG9A 4EE9A 3U4EA 1C5BL 5E7FA 4EDXB 3KPRA 4HA4A 2X42A 3DHPA 2PW2B 1HHKA 1A64A 1RMFH 2AJYH 2MMXA 3FZUD 1J8KA 2BSSA 4JPWL 4TN9A 2IQAB 4YFEA 1D5MA 2E27L 1UQSA 4PGZA 1WAAA 1K9EA 2AP2A 5A95A 1GGYA 2YL8A 3VW3H 4TUFA 4LF3B 1G9HA 1X4YA 4HKJB 4CVXB 3BH9B 3I75A 4GO9A 3VXUD 5F1OB 1S7WB 1CLZH 3L7FA 1TCMA 4E9LA 4NHUB 1NLDH 1JWSB 4F7CB 2DTMH 3D3VA 3WUFA 4FFWC 5C08B 2BVUA 1E0XA 1FLRL 2CETA 1D9KD 1K9FA 3JWNC 4ZXEA 2BC4A 1CNVA 4H1LH 2IFFH 2VLRD 2VVSA 2EXWD 4JHWH 1U3ZA 5IXEA 3Q3GB 5AZ2L 2HVJA 1F3DJ 3F6LA 5A8QA 1EZVY 3LDBC 3SQOH 5HVFB 2DJUA 4U4BA 3IKCB 3W0WD 1JXKA 4BQBA 2DLHA 4M43L 1ITXA 3C2AH 2DQTL 2JIWA 1DLFH 4JY6B 3ZR5A 4CKQA 2DBLL 4S2SA 2X5PA 3BD3A 3NZ8A 5F8RC 2VTFA 3V0VA 5CEZH 1VESA 3O41B 4MDPA 3EYPA 4HFWB 5LBSL 4R9HA 3TV3L 2YA2A 1ZHNB 4O58H 3NBNA 2B9VA 2IXUA 43CAA 6FABH 1UD2A 5A2BA 3FONA 2OI9B 5E4IA 5I74B 5FO9A 4NQCB 1PMJX 4UCFA 3W28A 2IUZA 2B1HH 2WNWA 3JUZA 4IMKA 4MD0A 3V5HA 1JI6A 3F6IA 2WZHA 1NGWB 2XWEA 2Z9TA 3DVGB 2XZZA 1MEXH 3FQXA 4LRNH 4LSTL 3EYSH 1HH9B 4ODTH 1YN7B 1G94A 2D20A 1RURH 3O2DL 1RZGA 4X4XB 3VMOA 1TDQA 2J3SA 4JY5H 4QRPA 3WXVH 4XHJD 4EN3D 4ZDHA 3LY6A 1VIWA 2D7TH 3BGMB 5KS9B 1CGTA 1MFBL 1LQ0A 4M24A 4I4WB 1FO0L 2G9HA 5D2NE 1FVCA 3QUMH 2CDGA 5D71H 4U1NA 5TFSL 2J1SA 1YEHH 1YECH 3VUPA 4BFIA 4BZ1L 5JXED 5HYSG 2DQCH 1J5OL 1RZKH 1T7YA 2QJDA 1D5ZB 1LE9A 3R06A 1XIWA 4GSDH 3I84A 1J0YA 5KS9E 1ZVHA 3GMPB 4PTTA 1WBZB 3W25A 4ZPVA 5ECJE 5BZDB 1R86A 1QPXA 5CSZB 4BKLA 1BVKA 3SDDD 5L7XH 1M71A 1OT1A 3B3IA 4LPXA 2ORBL 3QDME 4X6DB 2BJML 1H0GA 4QGYA 1S8DA 5HHNA 4PJIB 3QCTH 3GO1L 2QSCL 3WFBL 1Z9LA 1GOHA 1DE4A 3MJ8B 1UR8A 2I07B 2E7BA 4JFDD 4LGPB 1ZK9A 3AHTA 1NGQL 3DRTB 3AIWA 2E7LC 4Q9QH 1SJEA 4MOAA 1UVQA 2DBJA 3ZYJA 3TBVA 4X6DE 3CZFB 3MTRA 1U58B 2D9QB 2JK5A 4JVPA 4MNHB 4XXCA 1E5JA 2FGZA 1S3KH 2NX5B 1U36A 2O5ZL 3BZDA 4R3SB 4XC3H 1FDLL 5C6TL 4UINL 5DURB 1T0MA 4QRRD 1ED3A 4BQ5A 5DUBB 4V2CB 1X7QB 3RFZC 3GZAA 4JRWA 1W2VA 2YHGA 4J8RB 4AIZA 3D85A 5DHYB 1BM3L 4P4KA 3TO4C 4HJ0C 4XXDA 3HE7A 2CBUA 3KVQA 1Z5LA 2CKSA 4KUCF 1G7QA 2OTWB 2OWCA 1UZ0A 3VGEA 5D7KE 4KMTL 2VLKD 4FQCL 2R2CA 4N42A 4PLKD 2AK4D 3BKML 4PJ5B 1B0GB 1DEEA 4P2CG 1N5YH 4AZ7A 5IIEA 4FFYL 3WKNA 5CP7A 2WMIA 4KKNA 3DI2B 4HUWB 4LNVA 1H3PH 2XIDA 2IALB 1HQRA 4TX8A 2XG9A 5IYYA 5DGRA 2WANA 1U2HA 3WMBA 4Y16B 4LGSB 3KYNB 3TH4T 1DUYA 5KOMC 2VAAA 5F89B 5EFFA 5IESL 3CO4A 2VABA 4Q58C 1HKJA 2G3NA 1H3VA 3KPSB 4PLJD 2R29H 3RJDA 1HJSA 1R3LA 1NWSA 4YDKL 3G9AB 5E5MB 4L1DA 5KVMC 3WELA 4XNXH 2FRGP 2H41A 3SKVA 5GGTL 3VIJA 5EOTA 3H2WA 4M6NL 2WNGA 1N4XL 5C0CA 4ZAKD 5EORL 3FQUA 2FEEL 3PTMA 3VFGL 1BEYH 2D3NA 1J0JA 1QHPA 1FHLA 4NN6B 3CQOA 1GQKA 2EYRA 5ESVA 2YA1A 3CLWA 4PJGB 4UAOC 4TUOB 5FCUL 3IFOB 3RVUC 1EDTA 4UV4H 3M07A 4WHTA 1KLUA 3BPLC 5CGMA 2WVSA 4XT1C 3APGA 1RZ8A 1NMBH 5KSBB 4P3DA 3C5ZC 2WBJA 2WVUA 1R3KA 4XMLL 3HE6C 3T65B 5T1DH 1HYSC 1H0DB 2ICWI 1B2YA 1JFXA 4UQBA 4MA3A 5BZWA 2VXTL 3OKDA 3HEIA 1E56A 4FLQA 4JDZA 4AM0A 3R0NA 3T0AA 4PGBA 1RP9A 5TE7H 2HRPL 5KVDL 5ICYB 1B0IA 4MA7L 2VZQA 1ZHBB 3G6AA 4OCRH 3LEYL 3DV4B 5BW7A 3ARDC 4I9WE 2YC4A 3BDYH 1KPUA 1UWEH 4JFHD 4D0CB 3GBML 3WXWH 3V4PH 1WT5C 2CIKB 4LHSA 3RWCB 1X1NA 4JREB 4KZDH 1AGEA 4Z0XB 3CLEL 4H1LB 4KKBC 2HLEA 5HI4C 2V17L 4PTUB 3FO9B 1MHPH 3HAEG 3QXUA 3RA7L 4M3JA 2IBGA 3SCMB 4M03A 1D5XB 4K7PY 2EXYC 5C0NC 3S2CA 1AXSB 2WHKA 4M93C 4XVJH 5IOPA 4OJYA 3U1SL 1OGAD 3GGWB 2I9TB 5E8OB 2E31A 4M81A 4N68A 6A3HA 1UKTA 3GIZH 3AS2A 2GQHA 3HUJE 2EPOA 3SY0A 4TSBL 3MPCA 2B0SH 4FQXA 5FHAH 4HLZG 4NSBA 2FO4A 4MLSA 3VOCA 1MWOA 1SEBB 4QF1A 5DS8A 4P5TD 4HKZA 3U36A 1HXYA 1AGFB 1OPGL 3QULA 4FFZL 1J9YA 5HHVH 1JTOA 2A9NH 4UU9A 3KPLA 2YPVL 4U6VH 3EO0B 3ZE2F 3NYDA 1AGCB 3U57A 1KIPA 5EBLB 2E4TA 3UETA 4WFGE 3MA9H 1QNRA 4AG4H 4XZUA 1XNTA 3SCWA 2DWDB 1F3JB 4W89A 4FTVA 5D96B 4ONOA 4WEUD 1PYWB 4AL8L 1DWAM 3VJ6A 1U95B 1UKPA 3VXSD 4WU5B 5J8OA 3FB8B 2B20A 4KMQA 4KI5D 5DFWH 3UBXB 4R97B 5JUEH 2FATL 1HJVA 1KIRA 2YUXA 3CX5J 3BHBA 2V3EA 4UFMA 1T21B 1MQKL 5IMKA 4HH8A 1BQCA 4OLXH 3NH7L 4TSAL 3BIKA 5JOPE 2G5BA 2XVPA 3VINA 25C8H 2N7AA 4ORGA 4HBQA 5ID0B 3PABB 3L5IA 4U6TA 1I8MA 5BO1L 4CVZA 4OJFL 4JG0H 4D9RE 5HPMA 5I8CB 5JQ6L 3PN8A 1J10A 3BZFB 4BA0A 1YEDA 1VEMA 3D2UA 1BQLL 5AYUH 1YN6A 2YUZA 2VDML 4Y7MA 4OLYL 5TE6H 4CAGA 1IKNC 3HN3A 2DWEB 5F7EL 2HTKC 4B41A 4WW1B 5H35A 5A6BD 2ATKA 2IPTH 3VDHA 2MQCA 4N8CH 5E6IC 4P57B 3KDMA 1TVBB 4P23B 4JFEA 1NM9A 3VXRB 1XF4A 3MV7E 5F3HA 5AYBA 4YC2B 2OL3H 3ABZA 2AV7B 3WSUA 3GI9H 1KSRA 4U5KA 3SO3C 1PDKA 4V1DA 4M8QB 1I8KB 4OI8A 3CJJA 1IC4L 1MCRA 3TN0A 4EI5A 3QUXD 3DHMA 5FEBA 2QQJA 1J87A 1FNGB 2QHAA 5GGSB 1S7SA 1UWQA 2ZWZA 3SKMB 1CICD 2P48B 3ARED 2FR4B 2SEBB 1DQML 2VXQL 5E2UL 4TVCA 3LIZH 4U2ZA 1R3HB 1X5HA 4OFKA 4UOW0 3TM6A 3OG2A 2ZUMA 5JHDE 3NZHL 3ARFC 4PJ9D 3CFIC 2HLAA 2EDQA 1YY8A 3PUCA 4PJHB 3KNBA 1FC2D 3WUWA 5JA8B 3OJDA 3HZYB 1NQ6A 5J7CC 4M7LT 1AHWB 1S7QB 1QP1A 3QISA 3WS3A 1C5CH 1DBKH 1MFEH 3CDFA 3QA3A 4UDUA 3IJYB 3BGAA 1R3JA 3W9EA 1IKFL 1AE6L 3GMMB 4JZOB 3SPVA 3CH1B 1D6VH 2YWZA 4EDXA 4MD5B 3IDJB 1QEWB 5C9KA 2PF6A 2PW2A 4DEVA 2LAGB 1PFCA 4Y88A 2XTJE 3MBEC 3VX0A 5GRUL 5E24E 1RUQH 4GRLC 1S46A 5T3XD 4LSRH 1KIQB 4HW6A 4DGYH 4JHOA 4FQ2H 5A94A 4JO3H 5ANMB 4JG1H 3UPCA 3VE0B 4LF3A 1AJ7L 3BAEH 2HKHH 4KQ3L 3W24A 5CZXC 4P2OD 4HKJA 3F7RA 4K9EH 3V6OE 4EUPH 3LOWA 1FNAA 4WU7B 3TO2B 2NR6D 1QSED 2CBJA 3ETBF 5F70A 4NHUA 1S7TA 3OX8A 2HFFB 4F7CA 1S7XB 3ESUF 3GSWB 2NXYB 1G7LB 4LKCB 4BQ6A 4OUUB 5C08A 3GK8H 3OKEB 5ANME 4LCIL 1T89A 4JFZH 1U8HB 4M82A 3U4BH 1MVYA 4RAUA 5DHXB 4ZTOL 3QI9B 4F3FB 2UWFA 4NKDA 3OAYK 4P08A 3ALXA 4FZEL 4GI9A 3BN9D 1LWRA 5EU6E 4K94C 4N5UA 4YHMH 3T0VA 3NSMA 2EQDA 5FOBB 3IKCA 3RKPA 2BVOB 4LFHD 4GMSL 1QKZH 3GHBH 1REIA 5KS9F 5I76B 2H2SC 4JY6A 4RFEA 4K55A 1LNSA 2AI0L 3IFPB 3WHE0 3O41A 5H37G 4HFWA 1ZHNA 1E73M 3ARSA 5D1ZD 1V8HA 3P6BA 3RVXC 1C08A 1DBAH 1IAII 5G05L 2Y5TB 4AISA 2KH2B 4UIKH 3UTPE 4LU5H 1QFPA 2YXFA 2Y36H 2XG4A 5D2NA 1NGWA 2GTZB 2NXZB 3WV0A 2VR4A 4QHLB 4X6DF 1NMCC 5IQ7L 2ZEYA 3DVGA 1CK0L 4PV8B 1YN7A 3BT2H 1FH5H 1FL3A 5DJCA 4X4XA 2UY5A 1GGCH 2V4VA 3HRZB 3BGMA 5KS9A 3GNML 5F7HA 4F8XA 4I4WA 1FE8H 2MTPA 4KRPD 2YD1A 1N7ML 2F53B 3L6FB 1KPVA 3MOAL 3VG0H 4XPGL 4OQTL 4A6OA 2Q8BL 2LU7A 1M7DB 4ODUB 4ZOAA 3QCVH 1ZLVH 2FDBP 3U7YH 2LFGA 4L5FH 5I1HL 2Y8KA 1CR9L 1D5ZA 4YR6B 2DSKA 2CHOA 4YJZL 5JIWA 5IFTA 1WBZA 1DUZA 5BZDA 3BCDA 5CSZA 1SY6H 4HHAB 3MJ9A 4ZENA 2F53E 5DD6A 4X6DA 2ICCA 4A4AA 2G60H 5C0AD 3HNSH 1KB3A 3V5DB 1DQDH 4DW2L 4GIAA 4PJIA 3T3ME 5LA1A 4R96B 1ZVSB 1SMOA 2I07A 4GKZA 4A2MA 3DRTA 4JRXE 1CFNB 3BSHA 5DJXB 4MJIB 5J12B 3WKML 3CZFA 3C7OA 1KB5H 3MO1B 1U58A 4MNHA 3PP4H 1CWYA 1QBLL 4WW2B 2ORXA 4R3SA 4N5ED 4AD5A 4H04A 1EEYB 2YJQA 3O9WB 1BPLB 4F33B 1IMHC 1FCGA 1L0XA 2HT3D 3O81A 1U42A 5DUBA 1X7QA 2Z31C 1A7PL 1BQHG 3RIFK 2YL9A 4JAWA 4GBXB 4Z78B 5GS0D 5IKCB 4NQDD 4B53A 1T80A 1C1EH 3VM7A 5DHYA 2P24B 1DZBA 1AXTH 3VFUB 2OTUB 5FGBC 4G43B 3VU2A 5C8JB 3P9LA 2OTWA 1U3YA 4K7PL 4M00A 4AZ8A 2XPGA 4PRNB 2OL3B 4IEFB 5DMGC 4W7UA 4PJ5A 1B0GA 1JHKH 5D9SB 4OFPA 3VXUE 2J4WL 1ZTXL 3QNYB 1OCQA 5SX5K 1WWBX 4HUWA 1JTTA 3RWIB 1VPOH 2IALA 4S3KA 1SYSB 4FXGB 4MDJB 1ZJBA 1V3KA 2X4UB 2PTVA 4Y16A 3KYNA 5BRZD 5F89A 2BMKB 1TJIL 5E2WL 3LKOB 1NL0H 3KPSA 1DQLL 1CGVA 2VLRE 4XTRD 1AIFB 5SWSE 2EDHA 3S4SB 3RO8A 4ML4A 5FYLL 3MGOA 3W0WE 4OCWH 2LS6A 4NJ9L 3CU7A 4ZTPH 3MRIB 4TUOA 1EHNA 3IFOA 2GYSA 3DC0A 3VD9A 5BVPH 3AMGA 1BFNA 2XIIA 4M7JH 3V7MA 2J88H 1WDSA 4GRMB 3BPCB 5KZCD 5AWNH 4XUTA 1F45A 3HUJF 5JXAH 4RZCB 1H8SA 2YWYA 3JBG7 1OP3K 1VJSA 4APQC 1C90A 1H0DA 3HG1B 1SMDA 2VDLH 1JF1B 5E8PB 3P4LA 4S1SL 2DQIH 2EPMX 1AKJD 1HVQA 4OD1L 1M6OB 5LWYH 4QY8B 5KAQG 4YDIH 1NFDE 1NCWH 1T2QH 5ICYA 5TF1L 1YC7A 5KW9H 2HJFB 4KJQD 2UY3A 2WXDM 3AZRA 1YNTB 2NLJB 4EUPB 3CCHA 4JFUA 2NT1A 4C7FA 3T0EB 3DV4A 3QHFH 1NUGA 3H9SD 1LO5A 4ZUVB 5A6JA 5FYKL 4D0CA 2WN2A 2XXMB 3AMKA 2GJZB 4Z7QE 2CIKA 3RWCA 4OM1L 3S34L 3SDDB 4Z0XA 3NA9H 4IRZL 3FY1A 3LEXA 4H1LA 4B7LA 1CIUA 1BBJA 4NO0D 2W91A 5T1MB 3VFWB 2WMKA 3FO9A 4NZUL 1NCAL 3SCMA 4LVHC 2R4RL 1D5XA 3F7VB 4MNKA 4W70A 3BESR 4XPAH 2BVDA 4MNJA 1CD0A 1AXSA 4LLQB 3KLHD 4L3AA 4G6KL 2DH2A 4MYWB 3C8HA 3DECA 3OGRA 1MAMH 2FHCA 3GGWA 5EIIB 2I9TA 1BIIB 4HZLB 4O5LH 2W65A 2ZSVB 3N04A 2R2BB 3QCUH 2Y23A 4FXKB 2R56H 3LHPL 1FPTH 1MREH 5EZJB 3ACHA 5DDHB 3EKCA 1MCWW 2PO6D 4PREB 4JFDE 2Y72A 3HS0B 1ISYA 3SUUA 1SEBA 2ICEA 2VAJA 1HJWA 3BPOB 1AGFA 3I6GB 3QHZL 4A41A 4KK8D 5D8ZA 1P4BL 2D03H 1PAMA 5I6XB 2M2DA 3EO0A 32C2B 2EYTB 2UWEB 3IDIB 3RGHA 1UZ1A 5T3ZD 1I3GH 3MBXH 1AGCA 5D8WA 4ARYA 1NDGA 4QRRE 2AK4B 5I1EL 1U9KA 1NCTA 4IPLA 1T1XB 2BOBB 3NA4A 2VOTA 4YGVA 3UJJL 4JFYB 1YNKL 4R0LC 3MLSL 5L6YH 1T0NB 1PYWA 3HNYM 1U95A 2DI7A 3X14B 1I9JH 3HC4L 3FB8A 3D9AL 1DWGM 2IG2L 3UAJC 1DBML 5G04L 1PMHX 3BKJL 4U1KB 2VLKE 4GG8B 3CSGA 1A9BB 3JSSA 4X6CB 5AYQA 1BTCA 3PXHA 1T21A 4DTGH 1JI1A 4R27A 5LCWL 1ZXQA 1M1SA 1CZSA 5E9DD 1T6VN 1CZVA 2J7GA 4DZBB 2BNUA 5GISL 3T0DA 3PABA 4NJAH 4QTIL 3DOSA 5I8CA 1HHGB 1PLGL 3BZFA 5D1XB 4NO5B 2VB5A 3B6SB 3PWLB 2Q7NA 2D3VA 4JZNB 1S9YB 3ZKXB 3EHBC 5E08L 5KANG 2YFZA 3BP4B 3MV7A 4UQ2A 2ADFH 4OGYH 2ZCKL 3MLZH 3PV6B 1E6NA 3WQVA 4JQXA 4LAJH 1E43A 3O6FB 3WUBA 1HHJB 4WW1A 4U1JA 2EO9A 4XMKH 1R64A 4UB0H 1SVCP 3ZR6A 4OLZH 5A2AA 4HQQL 1TVBA 4P23A 1KB5B 3NDYA 4YH6A 1V7ML 3VXRA 5HPCA 2DI9A 4O00A 2EPLX 1CT8B 5JHDA 2ZCHL 1KG0B 4AT6B 2AV7A 5I6SA 4OTXL 2FSEB 4M8QA 1DHKA 3GJFB 1I8KA 4CD7A 1KJVA 5I77A 1HHHB 1U8MB 3UNPA 4TOYL 4XP4H 1FNGA 2E9LA 5GGSA 1F2XK 5I8EA 1K4DB 3HC0B 4QYOB 3SKMA 4LEXH 3L9RB 4NZCA 5DFTA 2FR4A 2SEBA 1SBSH 3OBAA 4NP4L 1O7AA 1UM5H 1E4XH 1N59B 2FYYB 1R3HA 4CRPA 4Y5VA 4JM2D 3KYKL 3L3KA 4F57H 3V5KB 4JKPH 3JVGA 4HOZA 1N5AA 4PJHA 3QUZB 2X9WA 1DVFA 2J12B 3TA3C 1U8NB 2XFRA 4P46B 4ZS7L 2J7EA 4HWEL 3SCVA 2HH0H 5FXCH 1AHWA 4JFHE 1S7QA 1QBAA 1F6AB 1YY9C 4HWBL 2ZUTA 3OLIA 5CP3H 3IJYA 2GFBB 4XNZB 2VLMD 1NAKH 4RBPK 3VX1A 5A6LA 4ACPA 2OM5A 3QJFB 1T7XA 4JZOA 3CH1A 1O7VA 4UT7L 1FSKC 3EYVB 3RZWA 1H3TA 3WH8A 4MD5A 3IDJA 1QEWA 2EDXA 3SN6N 1V3HA 3V6OA 1KCRH 3VNYA 1VGEL 4MB4A 4M02A 1OB1B 2Y07H 3LEVL 5JDSB 4XB7A 4P5TB 2G2RB 2ZSWB 3RNKA 1SJXA 4KROB 1XT5A 4ERSL 1WCBB 5HHQA 4WO4D 2AK1L 3GMOA 1MIMH 1KIQA 1OGAE 3SGJC 5IGXL 4DGIH 2FJGB 1BP3B 5HHOD 5ANMA 3VE0A 3X17A 4HWNA 5F71A 4RGOL 4Z2JA 3A6BH 2DLFL 3AB0C 4WU7A 3TO2A 3H3PH 5L8LB 2XY1A 4HZAA 2ZJSH 4NQTA 3C60C 2HFFA 3K8LA 4M6AA 1S7XA 1OTTC 3KL3A 1VSCA 3GSWA 4EI5C 1G7LA 3MYZA 4LKCA 4OUUA 2ESVB 3OKEA 5C0FA 1HWGB 1JL8A 2XI9A 3QI9A 3PL6B 2BNQB 5CUSL 4F3FA 2I60H 2VSDA 4U1MB 4YDLB 3NNGA 1UD3A 3QIBC 3AGVA 3I2JA 1TNNA 3OAZH 3SE9H 1ZBVA 3N1QC 4IPNB 4YXKH 2P5EB 3JWOC 5A2CA 5FOBA 2FCBA 3O0RH 3VXSE 1BFSA 1ISVA 2AEPL 2A0LD 4KI5E 2WWCA 4IRJD 3MLUL 2YC2A 3IFPA 5D2LE 5I0DA 4GRWH 3IU4L 2WDBA 1A6WL 4RRPG 3DX6B 3RHWF 2OSXA 4Z2GA 4GAJH 2X44D 5F44A 4LIQH 4U1SA 3HMWL 2NY3D 4J28A 4AIXA 3PHAA 2X10A 2Y24A 3S88H 2Y5TA 3LB6C 3ZKND 2G3JA 4A45A 4LCWD 3I3DA 4NKQB 3PF2A 4XCCL 3KPNB 1ZWIA 2C3WA 3UYRH 3WO4B 3K46A 3HC3L 3ULUH 2GTZA 4HEME 5GRJH 1CPUA 3STBA 3NCCB 1LL7A 4RMWA 4PV8A 1Z3GH 3IU3B 1O8SA 4L8SA 4UDTB 1IC1A 1GVYA 2AJUH 3HRZA 3V79C 1MLCB 3ZM8A 1CICB 2WSKA 4MXWL 2XUCA 3KXFB 5MEND 4HCRL 3MACH 3IDNB 2F53A 5GRVK 3L6FA 1FP5A 1T89C 1U92B 1MFNA 1G9MC 4PJ9B 2AXFB 2QQKH 4WW2F 1M7DA 4S0SD 3MRCB 3WKZA 4K94L 4MDOA 1MRDL 3VWJD 3ZDXE 4YR6A 3TYGL 3NVQA 1YUHB 5CILH 5FD0A 1MCDA 5FA4A 1HZHH 2ZCLL 2CRIA 2MCPH 3ARUA 2A1WH 4EDWH 2VDKL 4J6RH 4HHAA 1XGTB 1KTRL 5DO2C 1I9EA 1OAQL 2NPLX 5A6SA 3CFBB 1I3UA 3T1WA 4A42A 1FFOB 3TT3H 4DQOL 1K85A 3SKOB 2IQ9H 4X99B 4R96A 1V08A 5GRZA 3SE8H 1OSZB 5F3BB 2XNAB 4HUMB 4HIJB 4EIGB 2DYPD 4R4ND 1CD1B 1CFNA 4X4YB 3F5LA 2WC7A 2ITDB 5DJXA 1E1EA 2NY0D 3STZB 3ZT6A 1EAPB 3PQYD 3SBWC 1TTUA 3MO1A 1NKRA 3NACL 2WABA 5E00B 4WW2A 5FGRA 2GHWB 3DYOA 5K9JH 1TVGA 1UA3A 3UC0L 1EEYA 1FHGA 3O9WA 5D2NC 5ENWB 4F33A 5INDB 5HVWA 1A4JB 2QMJA 1V6XA 2ZZUT 2QADD 4X0NA 3OJVC 4JDTH 3WQ4A 2DQGL 4GBXA 5IKCA 3IFLL 1Q9OB 1G6RH 2PC8A 1A14L 3WMCA 3M45A 2P24A 3C6SA 3IRPX 4M5ZH 5GGVH 3VFUA 2XQYK 5T3XE 2OTUA 3WYRA 4KQ4L 3N17A 4G43A 4RWYL 5C8JA 4K3HA 1D9KA 2GAZB 4YXLL 4KRUA 5KVEH 3LRGA 4R2GC 4OF6A 1ZV5A 3DVNB 5I8OL 4ATLA 1NFDF 4X4ME 1QSEE 4UTBH 5EBWA 4PMOA 3GNPA 1E6XM 4ONHB 5FM5M 3RWIA 5FB8B 1SYSA 1YEIH 5A2LH 4MAYC 1EZVX 5HD8D 2X4UA 4QDRA 4GZ9A 3AMCA 2H2PD 4WHDA 1FZMB 2MHAA 2X09A 3LKOA 4NWUL 4Z7QF 1ESWA 5JHLH 1OAYH 1HKLH 5B4XA 3WJLA 5BXRA 4KGJA 1FOBA 4F9PC 3SGDH 1AIFA 4QCIB 3C08L 3FMGL 35C8H 5T5FL 1OTSC 4KHXH 4E41B 4NWTH 1HOCB 2ZKHH 2V5DA 3MRIA 4B16A 3O2WL 3RY4A 5K9OB 2BFVL 1JG9A 5D4QA 4Y8AA 3W6MA 4KUZL 1NFDA 4I13B 3MV9D 1HIMH 1GONA 4H8VA 5F6IB 4GXUM 3S8WA 1OWQA 4GRMA 1WEJL 1KFAL 3BPCA 2I5YH 3BAXA 3WFCH 4RZCA 1EGZA 4NZDA 5BV7C 4WJ5B 4DOHE 3HG1A 5HYJD 4MMXC 1JF1A 4Z7UB 2YN3A 4H8WC 5E8PA 4XUOA 1RY7B 3VFMB 3QFJB 4RA3A 1A2YA 4AY0A 1M6OA 1UFUA 3BKCL 1RZIB 4M4PA 4QY8A 4DAGL 2ICWA 4KRPB 4WIWA 4HX1A 5K9QG 4EIZC 2E5EA 2HJFA 3IDUA 4JPWH 5FOJA 5IFHL 2NLJA 1CZ1A 3CHCA 4EUPA 5JXEA 1BFOB 1BVNP 2E27H 1HL8A 1ZHLB 4Z5RB 3V0AC 2UVFA 2E6JA 2YRLA 4IDLA 3KJ6L 4Z7UE 1UYWL 4PCTA 1SR0A 5I19L 5H94A 3IJSB 2GJZA 3RJYA 2IPUG 5HI3C 3EOAA 5DK0A 3SDDA 5CJ5A 4PMQA 2WUHA 5HXMA 4M62L 4G42B 4TYUA 3VFWA 4AENB 3T4YB 1FYHB 1AD0B 1QA9B 5I0ZA 1FLRH 3F7VA 4JFDA 5IVXE 4LLQA 3QEQD 4U1LB 4JB9H 2DLTA 1W9WA 3C7GA 1RIHH 3IXAB 5AZ2H 1MFUA 4NN6C 2VH5L 5EIIA 5EOCL 1BIIA 4HZLA 5J06A 5C0AE 4OMDA 1Q6DA 1V03A 1XV8A 4GRWB 2XV6B 4FXKA 3IDGB 5EZJA 2AVGA 2NZIA 4QRRA 1KJ3L 4X6CF 4YBQC 5DDHA 2CKBA 3U7AA 2DQTH 4PREA 2NY6B 2J22A 5D7JD 2DBLH 2WIIA 4XBEL 3HS0A 4GQ9L 4ZO7A 2VKXA 3I6GA 1AXIB 2VC2H 4IOSD 2J1VA 3NIFE 5LBSH 1WZMA 32C2A 5FM4A 3TV3H 2EYTA 2UWEA 3SCSA 3IDIA 5IHLB 1V5JA 3K2MC 5TDPA 2AK4A 1QSVA 1ZLUH 1T1XA 2BOBA 3TT1L 5TH2A 4JFYA 3RDTC 3ZDZE 3JXSA 1LMKA 3CZUA 4LKXB 3W9DB 4NQDE 2H8PB 2BVEA 3VDAA 4LSTH 3X14A 2V2XB 5ICZB 4I3GA 1PKOA 2ADJB 3Q5YA 4QXTB 3O2DH 4JN2A 4U1KA 1YEFL 1RIUL 4GG8A 3WSQL 4AEFA 1A9BA 1E4JA 4X6CA 5JW4Q 2VITB 1MFBH 5EH1A 1CECA 4WHYH 1FO0H 5B8CB 4MB3A 5TFSH 2CD0A 5J11B 4DZBA 4OZ4B 4ZAKA 1S78D 5BRQA 4L29B 3MOQA 4GZEA 3PWJB 1EDQA 3V52H 3K75B 1HHGA 1SY6A 1CCZA 5BRZE 4NO5A 1J5OH 2J1AA 3B6SA 3PWLA 3BQUC 3ACIA 4AEIL 3BP4A 1LO0H 3RWJA 4JCLA 5BROA 4R4FH 3Q5TA 3GGLA 4WGVB 3T2PA 1MCBA 1HHJA 1J0HA 2E3VA 2ORBH 2BJMH 4X7FC 1OSPH 1VA9A 2IAMD 4G8IB 3C6LD 1AO7B 3IDXH 4HUVB 4LVNB 2VCCA 2QSCH 3WFBH 4XCFL 4PMNA 4JFQB 1NGQH 1CT8A 2Y25A 4G80B 3MS8A 1KG0A 3UTTB 5CBEB 4AZ5A 1VADB 2FEDC 1JMXA 3GJFA 3VD5A 4FQ1L 1W72L 2RFXB 2X0YA 1G6RB 1HHHA 1U8MA 2O5ZH 2Q8AL 5C6TH 1FDLH 3H9SB 4UINH 1K4DA 1UT9A 3L9RA 3MRKB 4U7KA 1C92A 2EDWA 1CLOL 4PBXA 1N59A 3KJ4B 2FYYA 2NY5C 4U3HA 4WUKL 3V5KA 1GOWA 1QOXA 3C09B 1BM3H 4MMZC 3QUZA 1TQCC 1U8NA 1KCVL 4D71A 1UZ8A 4DN3L 4P46A 4CD6A 3SDCC 1D5BB 1Z9MA 4MJ2A 4K7PX 1ZAGA 3OKOB 1FAIL 1F6AA 4LDOB 5TE4L 4AY1A 3SDAB 2GFBA 4FFYH 1D7FA 1OGAA 1E4NA 3OL2A 5HY9A 3QJFA 4C57C 4KI5F 4M80A 4FQIL 2WC4A 1MXGA 3GMNB 3NFSL 5D2LF 5I9QB 1ZT4B 1UHVA 4WKHA 1OB1A 3UJTL 5JDSA 3MGTB 3C5JB 4YDKH 4P5TA 2G2RA 2ZSWA 4HPYH 1BAFL 1M53A 3ZIZA 1WCBA 1KN2L 5GGTH 1KCUL 2FJGA 4WFED 4M6NH 1SVZA 1N4XH 2HYMA 1BLIA 2G3MA 3EMQA 5EORH 1X5AA 2XM1A 3FNDA 3RUGE 3VFGH 2UY4A 3GH7A 5JO5B 4LYRA 3BYYA 4PMDA 3VFNB 1TIUA 5CPQA 3VH8G 4BSWA 1SYTA 4J7RA 4LMQI 1EHLL 4IBLT 5FCUH 3TNNB 2B31A 4S1RL 1BWWA 2XA8H 3FN9A 1EPFA 4YDVB 3L3JA 3EFFB 5EO0B 4ONGL 1S9XB 1EVUA 2UZXB 3RY5A 3MQIA 3L4YA 3SKNB 1JFQL 3CMOL 1QBML 1XH2A 5I1JL 1HWHB 4XMLH 5T3ZE 2X7LB 4XI5D 3PL6A 4Y5VC 5HHPA 1VFUA 2VXTH 4U1MA 5INCB 1I1RA 1NEUA 4E2OA 1K6QL 5I1GL 5FDWB 1UYYA 3CVIL 2C4XA 4FXLA 3MRDB 3S5LB 3D87B 1DVFC 3UZEA 4UOJA 2HRPH 3BIBX 2P5EA 2YPLD 3GKWL 1FGVL 3QOMA 2J8OA 4HIIB 1JRHL 3LQZA 4MA7H 3ZDXF 4ORZC 1S5HB 2AJXL 2OK0L 3LEYH 2XTJC 5GZOC 2VRAA 3G6JE 2CDFA 1XHGA 1KV3A 2D0FA 1WZ1L 3GBMH 5IMLB 4HJGB 1R7AA 2W63A 3DX6A 5E9DE 5D7SL 4Z2KA 3QDGD 1RSFA 3V6OC 1K8DB 3CLEH 1WB0A 1IQWL 2J5LC 3O3EB 5GNYA 1II4E 4CU7A 4KVCL 4ZMAT 3VIOA 2V17H 5JORB 1NJ9B 3RA7H 2W87A 2ZOLA 2BRQA 3UMTA 1PEWA 3KPNA 3CK0L 4FG6D 1UYXA 1ZANL 4MA8L 1Q6FA 2EZ0D 4NO3B 1WVZA 4O02L 2ZXAA 3IU3A 3CFDA 3U1SH 2CLRB 4UDTA 4X9GA 1MW1A 5DFVC 3WUEA 1MPXA 3ZTNL 3TONA 3VXTB 2F5BL 1MLCA 1CICA 4TSBH 5JPNA 3AREA 2Y9RT 3KXFA 3IDNA 2J1EA 5SV4A 1UJ3B 1L6XA 2HMIC 3QWOB 3QXDB 3O45A 4PJ9A 4D8MA 1OPGH 1TZ7A 3MRCA 4CW1B 2YPVH 4GW1A 2YPKB 2GT9B 2WVVB 3WQWA 1YUHA 1QFUL 2CXKA 1JU4A 1V3JA 1Z0MA 1XGTA 4O2FB 4L8BB 3BSGA 5IVOA 4KKAD 1FFOA 3AVEA 1KT2B 1X44A 3O6LL 1A7RL 1V6UA 4AL8H 2F8OA 3SKOA 4X99A 4WGWB 4X8JB 5FK9B 2MQ0A 2F2HA 1WISA 1FO0B 1CLYH 3FRUA 5F3BA 2E9WA 4HIJA 2EKJA 2FATH 1A7BA 1VFFA 2ITDA 4IRSC 1MQKH 3I6KA 3NH7H 4PPTA 4WO4B 4TSAH 1EAPA 2VLME 3VG9B 3RZCB 1KGWA 3BEWB 2NY2C 5DXWA 1MCEA 4N1CA 3P4NB 5ENWA 4P2OA 5INDA 5FIPA 4OJFH 1A4JA 5JQ6H 1SMAA 3QO0B 1G1YA 1T3FB 3E6FB 3SJVB 5F9DC 4L8SC 3AY4C 1SHMA 4P2YA 2VDMH 4OLYH 3VXQB 1W3HA 2IFGA 3PP3K 1JUFB 3L5HA 5HDBE 4P5MA 3OR6B 4AW7A 2LU4A 5F7EH 1G9ML 1MPAL 5HHOE 2GAZA 3GMQA 2UY6A 3DVNA 1FVEB 5FF6B 4G8GD 4Y0GA 3VI3E 5BWFA 5EPMA 2XOMA 4QOKB 4ONHA 4LK4A 5JW4M 5FB8A 5I75C 4L3CB 3HE6D 1ITBB 1NH6A 4WIQA 3OKMB 3ZMRA 3M8OL 4GG6E 5HPOA 4Z7UF 3WQ5A 1Q6CA 2H3NA 1FZMA 3W11C 5HDQL 4YFLF 1IC4H 1FV1A 5I1IL 4J4PD 1KELL 5DRXA 4U5IA 1GC1C 1DN0B 1DQMH 2VXQH 1IBGL 2EDNA 3O4OB 5E2UH 3BOVA 2D4DA 3HPJA 1X5LA 3U7WL 4XCEA 3NZHH 4W7WA 2NY3B 4H20L 4AYFA 4JO4L 4XX6A 1N82A 1HOCA 2CUHA 2LE9A 5CP3A 3FZUC 1XCXA 4KAQL 2VM9A 4LCWB 5K9OA 1T5XB 2C3GA 5BJTB 4Y4FB 1Q94B 3GBNL 4P7QA 4N1EA 1A1MB 5SWZD 4WW2C 5DZLA 4WCYL 1HCVA 2CRMA 1YEGL 3OZ9L 1FG9C 3KLAB 2GSIB 1NGYB 3RPKA 1IKFH 4WJ5A 1AE6H 5K9KB 3H3KA 4Z7UA 1WPCA 5ERWB 4OCXL 1RZIA 4R5EA 2E32A 4PRIB 3IF1B 3NJ3A 4NRSA 4K23L 5MENB 1TTGA 5AAMA 1CEOA 1IJ9A 3NIFF 1D9KC 2X70A 1WC7B 5GRUH 2XVLA 1F58H 3GRWH 1BFOA 2YD3A 3EJYD 3PDOB 4Z5RA 4ZXLA 2Y64A 2EXWC 3BRGC 4ZFFA 3CZLA 5B22A 4KQ3H 1Q72L 3IJSA 5MENE 3UCQA 5BYWA 1K45A 1A6TA 4FOMA 3L4UA 3O6KL 5EUOE 4G42A 2X4PB 4AENA 4PTVA 2J8FA 3QO1B 3T4YA 5AC5A 1CXIA 1RUAL 1AD0A 5DFAA 4Q7DA 1EOKA 5FYJH 4YHIB 3MRJB 4ZTOH 4RMRA 4U1LA 1QHOA 4LX4A 1XYZA 3KS0H 4WI9A 3ELAT 3IXAA 2FGLA 3D39B 1L7QA 1F02I 1DANU 4FZEH 3VWKD 3CXDL 4UNVA 2RCSL 1YDPB 5DLMH 3IDGA 4LAQL 4D6IA 1AQKL 1YZZA 4GMSH 4K2UL 5BV7L 1TUXA 4LLDA 1A02N 1PZ3A 4JFXA 1LEGB 1FNEB 4H8WL 2JF7A 2AI0H 2N56A 3E3QE 4MXQD 1XSJA 2IANB 4X7SL 3O3DB 2JB6A 4X8XA 4CUAA 5EWIL 4XHJC 3PQYE 4EN3C 1GQJA 2ERJB 1LEIB 1TFVA 2YBTA 5L9DL 1ULPA 4HS6B 3GNOA 4JFOB 4L9LC 1NANH 1ODUA 3DETD 5JXEC 2YBRB 1G7PB 3CC5B 3MFFB 4KK5C 4P2RD 4LKXA 2RGSA 3HZKB 2Q76B 2H8PA 3CAFA 2Q3AA 1EIBA 5IQ7H 3U37A 1CK0H 3OXRB 1A47A 1W0WB 2V2XA 4OGZA 1QG3A 2A6IA 5HGAB 2ADJA 4QXTA 5LGJB 4JVUA 3L5XL 3SDDC 3JV0A 1BX2B 3JV6B 4FP8L 2ITCB 3WEMA 2VITA 4XBPB 2XGIA 4UQ3A 2IBZY 1HJUA 1N7MH 4NBYB 4OZ4A 1BG9A 4XPGH 4OQTH 2Q8BH 5CD3A 2CR6A 4LPTA 4FK9A 4W87A 2OYPA 3F2ZA 1NEZB 5I1HH 1D3CA 1CR9H 4GLRH 1RD6A 4PGJA 3WDHA 2GUOB 1KB9K 3SEEA 4I1NB 5DK2B 3MV9B 1NCUA 4H5SB 4DM1A 3NAAL 2L4OA 4HH9A 1OGTB 3N1MC 1ZT1B 5D9OA 4XVHA 5ADOH 2CIPA 1A1NA 2J7BA 1PJ9A 5A8OA 4IM8A 3H42H 4C56B 1L7RA 3CMJA 4G8IA 1N6QL 1AO7A 4DW2H 5GSVB 5HYJB 2PYEB 4HUVA 1ISWA 2J25A 3LZFL 3ZT5A 1GOKA 2DTSA 4OZFH 1AD9B 1W9XA 1U8KB 3VVGA 1WGOA 3EYFB 1AY1L 2R0WL 4JFQA 2AEWA 5I6XC 4DEQA 1H3UA 3MV9E 4CGTA 2IEPA 5C0IB 3UTTA 2E9BA 5CBEA 1XR8B 4HIHA 1VADA 2BSTB 5JR1L 3OEAA 3WKMH 4PLKC 1CGSL 2JB5L 2RFXA 4KI5M 2JCCE 1QBLH 1G6RA 3NIDE 2R2EB 5IK3B 2R1YB 5HYJE 2ZXBA 3H9SA 4KJYA 4H26B 3MRKA 4PJ7E 4M8VA 2DS4A 4GRLD 2F8QA 3O4LB 5D6DA 4PD4J 1A7PH 4XUPA 3IS1X 2OR9H 3VXPB 1ADQL 2W0PA 2GITB 3KEHA 2W60B 1H5VA 3V6ZB 1IGCL 1AQHA 1P9MA 4QAWA 1G7HB 3QZWB 5GGUB 5M3WA 1QNZL 1D5BA 3PGCB 4K7PH 1QPPA 3OKOA 4OD2B 5E70A 3QEQB 4ZAKC 4W68A 3DI3B 2J4WH 1ZTXH 4KV5F 1OCWH 2Z8SA 3WJJC 1V7NL 1CFTA 3ZKXC 3BUYB 3BD5A 3PWUB 4Y5XB 2EC8A 3GMNA 1F4YL 1ZT4A 1TJIH 5ID1B 1IAIM 1C93A 5JXHA 2Y6LA 2BSED 2JD9A 4WKFA 5CFHA 1CTNA 1IGTB 3TIDB 1DQLH 3C5JA 2O5XL 4I3RL 4NQVB 2PYFA 3GBLA 3HRPA 3WF3A 3DTXA 5AC4A 2D7MA 5GGQL 1I1AB 2HKFL 3R1GL 2FIKB 4PTWA 2V5YA 5BVJB 5I73B 1KFWA 1WCGA 3V95A 4OF3A 5FYLH 5JO5A 5JOFB 4CVUA 4GINA 4AZ6A 3VFNA 4NJ9H 1BVLB 3C9NB 3VPLA 3GSRB 3RKDD 4YDVA 3EFFA 5EO0A 4GAGL 1RJCA 2NY5L 3RVXD 4EZMA 2W46A 1WWCA 3SKNA 3LVEA 4FFVD 5IJRA 4ZXBC 4FNLL 2VX7A 2V7HB 5INCA 4S1SH 4NGHH 3RHWK 4N8PA 5FDWA 3OZOA 1ULVA 3MRDA 3NCBB 4BK4A 3SGEH 3G5YB 4DK3A 5E9DA 3ULVD 1AC0A 1A6ZB 3U2SB 1RZFL 5GS2H 5FFLA 5TF1H 3BPNC 3OAYH 1PSKL 4HIIA 4LMQE 1R3IL 4AMKL 5DEFB 3U82B 1S5HA 1OQXA 2WW8A 3AHYA 4L8CB 3S96B 4PRPD 3BAIA 3CMGA 5FYKH 5IMLA 2ZUNA 1ES0B 4TULL 4JM2F 4HJGA 4OAWB 4GH7B 3U48A 4UFIA 3RTQD 3D3AA 4OM1H 1JIBA 3S34H 2IJ0C 4IRZH 1AGDB 1K8DA 2IC2A 3MUZ1 3O3EA 2VT0A 2VDPL 1UMIA 2V2WB 3U9PL 4D6JA 3T1FB 2R2HB 4NZUH 1NJ9A 1NCAH 4P5TC 4X7EC 2OZ4A 3D0LB 2R4RH 3CUFA 4PMUA 2O61B 1U8JB 2GJPA 4TSCL 2EDJA 4BQ3A 4FQPA 4GOSA 2V5MA 4LRIC 3WEXA 1L6ZA 5IJVA 5KSAB 1R5WA 4NO3A 1RAMA 4LSVL 2YIHA 4MD4A 2CLRA 3LH2L 5JBEA 1EERB 3WNPA 3LHPH 1FL6B 2AV1B 3F58L 2BVYA 1M7XA 1UH3A 4Y1AD 4MA1C 5C6WH 1UJ3A 2E0PA 5CD5D 4Q97A 4I0PD 3QWOA 5HDBF 2Z4FA 5JUVA 1EO7A 3MNWB 4KI5C 2CR3A 3QHZH 4N90D 1P4BH 3W6LA 2PR4L 1FFNB 2YPKA 2GT9A 4YDLC 4Q9RL 4F37F 3JUGA 3BP7B 3VI3F 1OQOA 4G6FB 4KRTA 5I1EH 4O2FA 2EEBA 1B3YA 3O2DA 4L8BA 2WCAA 3UJJH 5IG7B 1YNKH 5JTWA 1KT2A 2OJZL 3PHQB 4GG6F 2HLFD 3WDRA 2X40A 3VXMB 2EE3A 1IAMA 4KXZI 3K77A 4G9FE 4X8JA 5FK9A 3TWCL 3HC4H 1XZ0B 1FO0A 3D9AH 2IG2H 1H41A 5JR2A 3JV5A 4BUHA 3BKJH 3LD8C 1FLTX 4LLYA 2A3BA 4PEEA 1XFPA 2MPAL 1A8JH 4QX3A 1Q0XL 3LDBB 1EGJL 4WO4A 5IW3A 1IGYB 4Y2DC 4FQQB 1WLHA 3OWEA 5GISH 2BCKB 1CDBA 3P4NA 2YD5A 4QTIH 1MCSA 1PBGA 4W6XB 1PLGH 3TBYA 3S3SA 4X80L 4OZHE 3ZLQC 3VXNA 1IC5L 3E6FA 3SJVA 3IIIA 5E08H 1JF6A 2VCAA 2LTQC 1MJ8L 4Y2OA 3W0KA 1GU3A 3VXQA 4YN5A 4M6ML 3BAKA 2ZCKH 3QJHA 4OZFB 3QUXC 1SFSA 3FQWB 1TR1A 3I3EA 4XNQA 4HSQA 4GG6A 3RM9A 3N9GL 3TFKD 1VJZA 1L0QA 4WFEE 3AREC 1EJOL 1HH6B 5E56A 3VA6A 5J13C 1UX7A 4NQXB 3ZDYE 1DR9A 2E7HA 2Y7QB 4MNQD 2W62A 1FVEA 1Q6EA 4POUB 2DD8L 4PJ9C 3WQ8A 5DD3L 1JYVA 1V7MH 3PWPD 4EOWL 3IJ7A 3SKJH 1DQQB 4JVWA 4XV0A 1ODZA 2YPLB 2ZCHH 4L3CA 5GJSL 2Z91B 4ZFOA 4URTB 3OKMA 5SX5H 3OKLB 5CPTA 4YFDB 4OTXH 3H3BC 2J62A 3U0TA 1F8TL 1F90L 1YNLL 2FX9H 3ES6B 4F7PB 4HUUA 4TPRL 4TOYH 1JXJA 1W3JA 4PP1D 4LYQA 4AEEA 1Q9KB 4M48L 5I71C 4A44A 4PBVC 4X9YA 2XWBB 4WUUD 2F19H 1C12B 2X89D 1HNFA 4NP4H 1JMZA 5EUOF 1WE5A 4D6HA 3IVKB 4KVNL 3RI5F 2O26U 2YPLE 3KYKH 1J18A 4OBRA 5CZVL 1C91A 3WFLA 2P43B 2J75A 3SGDI 3CZGA 1W0VB 5AG8A 2A83A 1MFAL 4LCWA 1BYBA 1T5XA 3QUYD 1V6VA 2W67A 1QNPA 4LSSL 4Y4FA 5BJTA 1Q94A 4ZS7H 5EB9A 4HWEH 1KGUA 1X5GA 1A1MA 3G9VA 3U79A 2VRKA 4Y4KD 2RB8A 4HWBH 3KLAA 4P2OC 2GSIA 3FRPA 3QDGE 2QEJA 1KTKE 2NR6C 3EOBB 1BZ7A 4UT7H 5ERWA 5GGTA 4IMLB 1NLBL 2W5FA 3UXFA 1MHEA 1VGEH 1GQIA 4PRIA 2AS5M 5MENA 3LEVH 1WC7A 3FKUS 5EUOA 5B38B 4ERSH 1P7KB 3QNZB 3RWGB 1LO2L 2AK1H 2Y6GA 3WBAA 3PDOA 1QQDB 5IGXH 1RK0A 5JW3L 1LP9E 4ZOCA 3CUIA 3FQNB 1J01A 4RGOH 1I9IH 3BN9C 2DLFH 5HHMD 5BMFL 3VFRB 2KD7A 2ADIB 3I6LD 4PUDA 4KZEL 3TO4B 4OSUL 3GSVB 1GC1L 4TTDD 1ISXA 4V27A 3RIKA 4MGQA 3QO1A 1IZKA 3WIJA 3CHFA 1MY5A 3KPQB 3H7LA 1R24B 4HEPG 1E6QM 4YHIA 3MRJA 2WO1A 3KR3H 4HK0A 5D1ZC 1EV2E 5CUSH 5I1CL 5ACZB 4NN5C 4KY1L 3D39A 4BDVB 3CDGB 3K2UL 4OOUA 1GGBL 3FTGB 3JV4B 3UAJD 1RU9L 1JN6B 1U8OB 3BWAB 2IPKB 2J1TA 3OGVA 3RVTD 4I2XB 1IV8A 2AEPH 3DMMD 2CUMA 4PRDB 4YE4L 1LEGA 5KSVB 4LLVB 3MLUH 5J6GA 4YXHL 3LEGA 3WD3A 1YJDC 4NBXB 2IANA 3IU4H 1MAJA 3P40A 3S7GA 4RQQB 3O8XD 2HTLD 1LEIA 3HMWH 3BP6B 5BRPA 3QXWA 5IB2B 4JKKA 4LLMA 4UAOB 4RMQA 4DWHA 1I1XA 4JFOA 4AWEA 4YHLL 2GSJA 4J3XA 2XPKA 3CC5A 1G7PA 3MFFA 4KDTA 4M8UA 5FL0A 4XCCH 3GJFK 3C5ZB 1YEEL 3QWQB 2Q76A 1NWRA 4HA1A 4GXVL 2J47A 1T22B 1DBBL 3HE6B 3OXRA 1W0WA 1J1XL 4HDIB 4NN7C 2CESA 2DSWA 1I8LA 4HD9A 3RX7A 5LGJA 3LS5L 3ZJ6A 1BX2A 4JKWA 3JV6A 2WBWB 2ITCA 1MFDH 4AIUA 4G8GE 3QIUD 4RN5A 4K71B 3VFTB 4MXWH 3WIFB 5C09E 1IGJB 2WLYA 5DQ9B 5A1AA 5L88L 1HNGA 4OFVA 1FH9A 3ARDB 1CI5A 2C3VA 1QI4A 4ZODA 4K94H 2A3CA 3MXWL 1MRDH 2O9OA 1NEZA 3TYGH 1KWGA 3VRJB 3VGHA 3X13B 5KVFL 1BOGB 4GAYB 4JFSA 2GUOA 4OI9A 5D8JL 2ZCLH 5DK2A 3MV9A 4WJXA 5KANI 4BH7A 5SWZB 4P2QB 2VDKH 1KYOJ 4L4VE 1ZT1A 1OAQH 1XH3B 1VFOA 2HT3C 3FO1A 4C56A 1WWAX 3ME0A 4DQOH 2BNRD 5GSVA 5HYJA 2PYEA 1WO2A 1CFQB 3TVMD 3U7BA 5GS0C 1OWWA 1YY9D 4M93B 1AD9A 2VLLB 1NUFA 3C8XA 5C0GB 1HINL 4N0UB 4XVUD 5C0IA 3NRUA 5SWZE 1JNNL 1XR8A 2BSTA 5CGYD 3NACH 4CKVX 4J27A 2R2EA 3MV8D 1I8IB 2R1YA 1F6FB 3UC0H 1ONQB 4H26A 3B43A 4GKSB 5EO9B 2W07A 2ADGB 1BREA 3ECBA 3D6GA 3P4MB 1UR0A 2DQGH 4NRYB 5F9WC 4BJLA 3IFLH 3VXPA 1B2WL 2NNAB 2X1WL 1A14H 4PJEB 5GGRY 2W60A 3V6ZA 3N06B 4KQ4H 1AMYA 3MCKB 3F5JA 3QZWA 4PJFB 5GGUA 3PGCA 4YXLH 1OF4A 4OD2A 1SYVA 5I8OH 4OI7A 3QEQA 1OTTD 4NT6B 1CXKA 1CGWA 3NFPB 1B30A 2DDQL 3DPBA 1I85A 4RMUA 4PJEE 1GGIL 3IAQA 2VDOL 3BUYA 1ZBKA 1PZ2A 4UR9A 4RBPH 3DURB 1EQCA 2CKBL 2XG5A 4CUBA 3BZ4B 5ID1A 3BXNA 3QIBD 5D7LD 3VA2C 5D7JA 4NWUH 5CBAB 3LMYA 3WD1A 1IGTA 4NQVA 2ED7A 3QG7L 3C7HA 2AJZA 3F8UB 4U6YB 1I1AA 2FIKA 1WV7T 3C08H 4JHZA 2WINB 3FMGH 1FH7A 5T5FH 1IT9L 5BVJA 1NWTA 4N1HB 1WWWX 1W1PA 2A3HA 1VB9A 1R6VA 4PR5B 5JOFA 5FAAA 2DQXA 2ZUYA 1G9NC 4X6BB 2UYLB 2NSXA 1P7HL 3EW3B 4KJQC 3O2WH 3IXTB 4B5EA 1BVLA 1NFIA 3C9NA 5DA0B 1CWVA 3U0PB 4P2RB 3GSRA 5DT1L 4KUZH 4HFUH 2QQOA 3AIQA 1XGQB 2JF6A 3PTQA 3ARPA 5I1LA 1WEJH 1KFAH 3F65A 3U9UB 1CDHA 1F4WL 5E6IB 4D9LL 4AD4A 3KJ4C 1U8LB 5D6DC 1QW8A 2ZIDA 5L2KB 1VRXA 4MHHG 2V7HA 1MCNA 5EU5B 4ZUUB 3BKCH 2ZP0T 5E7BA 4P2RE 3G5YA 4DAGH 1QSFB 2LU3A 1V0LA 5AYIA 3U2SA 2VZOA 1FP9A 3IGAB 4KRNA 5IFHH 5TQ0L 3S36L 3INUL 3TGXA 3KLHC 2CK0L 4QKXB 3KJ6H 4WWID 4P7OA 1BD2D 1UYWH 2V5RA 4TVPD 4AZHA 5I19H 1FZJB 4OLWL 2WC3A 4OAWA 3ARFB 4PJ8D 3SGKC 4OZIB 1R85A 2GSGB 3FFDB 1AGDA 3B2UD 4OKVB 4M62H 2PO6C 3RILA 3GBDA 2V2WA 3T1FA 2R2HA 3WNMA 4UQ9A 2EIEA 4KK8C 4D3CL 2O61A 1KN4L 1VFMA 3UTSD 1JPTL 1OH4A 4UTFA 4YHYC 4DXTA 1JJUA 4D9QD 2I25N 5KSAA 4F79A 5D9PA 3CXHJ 2EEXA 5GJTL 3MKKA 1JZ4A 5EOCH 5LQBH 3BW9B 5FHBH 4LBEB 4YX2H 2DH3A 3DUSB 3ARGC 1GXEA 1FH8A 3TZVC 2V5TA 4OZHF 4BQCA 2UZIL 1FL6A 4EBQL 2AV1A 3HNVH 3AFLA 1KJ3H 2XIBA 2CDEB 4GRLB 3L3GB 2Q6WB 4XBEH 2FECI 2PI6A 1S5IL 4GQ9H 1ZKAA 3MNWA 3RNQB 2YG0A 1XF2A 1CIDA 1H3WM 3E1F1 3B8YA 1PBYA 2X4OB 1P84J 1FFNA 3N1PC 2QHRH 2XN9B 4DWSD 1LEKA 4IS6B 4S1DD 5FM5O 1LD9A 4D8PA 1DSFL 5DZNA 5I78A 1MI5B 5IHZB 1OF3A 4YWGL 1E55A 5HYSA 5AG9A 4H0HB 3SEPA 3ZKSD 4YGAB 3TT1H 4BS0A 4ZS6C 5IG7A 4D0DB 5DMYA 1KEML 4P59L 5F96L 2AAAA 2FBJL 3PHQA 3FN0H 5J1TC 3VXMA 4CVWA 2A73B 3CFJB 1XZ0A 2DQUH 2ED9A 1Q0YL 1MRCL 4OZHA 4WVRA 1TZGL 1YEFH 1RIUH 1ZLSL 4BSVB 4DFHA 4OQTA 3WSQH 4HJJL 2FB4L 3QEUB 3QQ4B 1JAEA 3PHOA 1UR4A 1RHFA 3N1FC 4MS8D 4FRWA 4FQQA 4WI2A 4GWJA 2BCKA 2B1AL 4JQIL 1U30A 3AIUA 5HDLA 4HOWA 1FJ1A 3WIIL 1JPST 4ZSOB 1GIGL 1IRAY 3LN9A 1GOOA 2VLJE 3BH8A 2RJMA 4Y4HD 3UJIL 2J79A 1UA6L 2H6PA 3HHRB 4ZNEA 2VX6A 1HHKB 4OZFA 5GRYA 5A6KA 2WPGA 3BRDA 4XBGB 1HH6A 2UUDK 1ZHKB 4MQ7B 4NQXA 2Y7QA 4JM2C 2P8PB 4M7KL 1B3ZA 1NMCB 2P5WD 3MRRB 3BDXA 1DQQA 4WI3A 1NCCH 2YPLA 2Y1VA 3OKLA 3CU1A 3WL9B 1OBAA 2F8VA 4FQ1H 2CCRA 3ES6A 1X9QA 3D3VB 5SV3A 4F7PA 4P9ML 4PRPB 5DEGA 3AS1A 2Q8AH 1VEPA 1Q9KA 1EFXD 2Z4QB 3ILPA 2XWBA 1CLOH 1C8QA 4NM4L 3ULVE 3QDGA 4WUKH 3AZTA 4F2MB 4H1LG 4NCC2 4X7DC 2WLZA 2C7UB 1IAIL 1KCVH 1X3DA 2VIRB 2Z35B 4DN3H 1SM3L 3EZJB 2V38A 2C5DC 2W0LA 1FAIH 4EI6B 5TE4H 3RX5A 4G5ZL 4YBLC 3FOMB 1JBJA 2VC9A 3WUZA 4LQFL 3EOBA 4PJBE 4PSRA 4W93A 3RBSA 1MUJA 3GSNA 2R0KL 4LPUA 2ZX9A 1GPOL 4FQIH 1RUPL 2YB7A 4IMLA 2AABL 5D5ME 3NFSH 2E7LA 3DARA 3R8BB 3VXOA 3UJTH 3L5WB 4HA3A 1QFWH 4OFYD 1BAFH 1P7KA 3RWGA 5K9QI 1QQDA 2X6MA 1WFOA 2EH8L 4MD0B 1UQZA 2ZG3A 2PXYD 1WBYA 3FQNA 2XFFA 1L9MA 2Z31B 3GH4A 3CX5K 4GQRA 1RZGB 4EEEA 3VFRA 2ADIA 4I9WD 1EHLH 2DLEA 5E5UB 1VFAB 3TO4A 1P7QB 4Y1AE 4LOUD 4S1RH 3GSVA 4MVBC 2A0LC 1CZ8H 4IRJC 4ONGH 4N90E 1P5UA 1IL1B 1JFQH 1I7RA 3CMOH 1QBMH 1J0ZA 5I1JH 3KPQA 1R24A 5DPNA 1PG7L 3RDTD 3GXIA 3UBXG 2W9XA 5IW1B 4URIA 5ACZA 2DQDL 1K6QH 5T3XL 3CVIH 4HF5H 1GGUA 3CDGA 1TVNA 3HNMA 3FTGA 3JV4A 3IANA 3L4WA 1A6UL 4OZGE 1FGVH 3Q48A 1JN6A 4G7YL 3TTOA 1JRHH 1U8OA 2BSRB 4ETYA 1KQZA 2QV4A 2IPKA 1BYAA 2VUYA 1JFHA 2C1OB 4I2XA 4PRDA 2AJXH 2OK0H 4ISVA 1TENA 4PCSA 1S8DB 4P3CL 2BXZA 5HHNB 4C83A 4PBWD 1A1OA 1JNLL 1WZ1H 5FOOA 5ABDE 5HVGB 3UPRB 4U1HB 1LGVA 3M46A 4NZRL 4RQQA 1XGPB 5D7SH 4M56A 4G3YL 3BP6A 2NY1C 5BOPA 2J1UA 5IB2A 1IQWH 3OXSB 3A47A 3ZT7A 1UVQB 5CS7A 1QVBA 4KVCH 4MNQB 4I18C 5EA0L 2OR8A 2GK0B 1JGLL 3LKPB 4G8GA 1LJYA 5I18L 2VRJA 1LK2B 3CK0H 3UZVB 5I30L 1JHTB 3O11A 2FH6A 2LV4A 1T0MB 3VWJC 2BHUA 5C0BD 1YEKH 1NANI 1ZANH 4MA8H 3HE6A 5GPRA 4HDIA 4APQB 4DKEH 4O02H 1OAUL 4L9DA 3I2HA 2VDQL 3L4XA 4KDWA 4AIZB 5A2IH 2N7BA 3CIHA 3ZTNH 2F5BH 4X9FA 4AEHL 3PNWB 1Z5LB 3VFTA 1OGGA 3DXAD 3WIFA 2HG5B 1P8JA 1OM0A 1IGJA 3PWPE 4RGND 5DQ9A 4JFWA 1J86A 4MAZA 2Y2WA 3KWXA 3ARDA 2AEIT 1D2KA 1JZ8A 3VCLB 4ODWB 5JOPD 3JWOH 5HGHB 1OTUD 3E3QC 3P4OB 3VRJA 4XB3A 3X13A 1BOGA 2NY0C 1QFUH 4XUQA 1KGCD 5JW4R 1KXTB 4P2QA 4WUUE 5SWZA 3OEBA 4PJEF 1XH3A 1H8OA 3HMXL 1YJDL 4BQ4A 2PETA 3MYJB 2QADC 3O6LH 3UP1A 1D5IL 2Z93A 3OAUL 4L4TB 4QRUB 4LVHB 1CFQA 1KQYA 4ACZB 3X11B 1B6UA 2VLLA 4EVNB 1CLXA 3C2SA 5C0GA 5GHWL 1XSKA 4DFIA 4N0UA 1X6LA 5EU7E 3WO3B 2YKLL 5FCZA 4CJ0A 5HSFA 5C0JB 1EQPA 1A6VL 4KDTC 1I8IA 4MX7B 4P3DB 5C2BL 1ONQA 3MRBB 5EO9A 2DSZA 1OD9A 4JFVA 4YAQA 5HD8C 5HHMB 1UMHA 1NAEA 1PX8A 4PMZA 5EO1B 1RYYA 2H2PC 1G1CA 1I8LC 4MA3B 5BZWB 3OKDB 2NNAA 3SUWA 3MX0A 4PJEA 5C9JB 4AJ0A 1W3LA 3MUGA 2J7DA 1C7SA 4PGBB 2VXSL 4OD3L 1WDQA 5ABHA 1G9MH 3MCKA 1MPAH 2ZEWA 3BKYL 2R1XA 4ZFZB 4NT6A 4R0LB 4MXVE 5IVZB 3NFPA 1CVSC 3I6LE 1W72B 4HGKC 3M7SA 4G9DA 4X0VA 3I85A 1UR2A 4QB6A 4GT7A 1J1OL 4OCLC 3L7EB 2ZUVA 3DURA 3M8OH 2Y5EA 5GZND 3MRMA 3BZ4A 1NMAL 4J1UB 5IB5B 1VDGA 5KVGL 3MR9B 5HDQH 4BQ2A 1F4XL 4WTZA 5CBAA 5GS0L 4TTGA 3VKKA 4C54A 1WFTA 5I1IH 3L3OB 2VXVL 5JNYB 4LHUD 1IBGH 4JN1L 4U6YA 5DJ6A 2WINA 2DQFB 2HJLB 5M95B 4H20H 4PR5A 4JO4H 2FO1A 4HWBA 4X6BA 4KAQH 3VIKA 4WENB 3IXTA 1IGFL 3LPOA 3CFCL 5J4MA 1IKNA 2MFNA 4P2RA 2FHFA 3GBNH 5EC1A 5DJ2B 3L1OL 4BCEA 2BY3A 5TPWH 1UY3A 4DVBB 3MSGA 1XGQA 3B8SA 3OV6A 4WCYH 3EDDA 1Q9LB 1YEGH 3OZ9H 3LS4L 5F7FA 3ZO0A 3U9UA 1VKXB 4JZ5A 4XAKD 3MMWA 5E6IA 3FFCD 1HXYB 1U8LA 2Q3ZA 4AYSA 5CCKL 4F66A 1B6DA 2EE2A 3AAZB 3KPLB 4HUKB 1UXWB 4ZUUA 4UNUA 2CLVB 2XOTA 1QSFA 5C1MB 1KIPB 1U93B 3ZHLA 3GHEL 5DGQA 2B7DT 4TNWF 1H49A 3GSQB 4XZUB 1MQRA 4Q6YA 2WMGA 1JP5A 5B39B 5EN2B 1U8PB 3VJ6B 5B4NA 3KL5A 1Q72H 1FZJA 4OFDA 1MWAL 3MJ9H 1UQYA 3MO4A 1HKIA 3FFDA 5E6YA 3O6KH 3TA3B 4PJCB 5K59E 3A23A 3CSYB 5D7JC 1ORSB 2BNRB 4ZFGL 1WF5A 4L3EB 2DKSA 3TVMB 1JNDA 1N6UA 3L4VA 1KCSL 1G9NL 1D7PM 3FQTB 2OBGA 5I73C 4UIMB 4EK7A 1ETZA 2HVKB 3BISA 1FNLA 4BSJA 4ACYA 3FCTA 3MCLH 1FSKB 4F37K 2AERT 3CXDH 4LBEA 4M3KB 3DUSA 1H5BC 2BNRE 4LCUA 3MV8B 2WP3T 4LAQH 5IVNA 4PUEA 1AQKH 5BV7H 4K2UH 2RGMA 1QW9A 1XRVA 1QRKA 1RZ7L 4GRLA 4PP2B 4XPTH 4H8WH 2EDBA 2Q6WA 3OA5A 5A69A 3IKKA 2BY1A 3RNQA 5IP4A 3F5WB 5HBFA 4X7SH 1FFRA 2X4OA 2J8GA 1OGBA 3D5HA 5K33A 1FN4B 1OGSA 2Z1KA 4H0IA 3FT2B 2C0HA 1AP2A 2XN9A 3AB0B 3HCVB 4IS6A 5IBLD 2NW0A 4V1DB 5E2TH 5IHZA 5L9DH 3C60B 1C8PA 2FNBA 1S78C 1H1NA 1HIZA 3D18B 2GJ6D 3WDJA 2A73A 2QQIA 1RFDL 1RVFL 3CFJA 4PTMA 4QCFA 2W92A 1RUML 4HCRA 1GHFL 1VAHA 1CFVL 4CMHC 3L5XH 4BSVA 4QNPE 2F15A 1YY8B 3QIBB 3B4NA 4FP8H 3P0VL 5IR1B 3QEUA 3WUWB 3ULVF 3QQ4A 5C92A 2RV9A 5HGGS 2IAMC 5EOQL 3THDA 3C6LC 1E0VA 2LAAA 1UWSA 4LVOC 3FHQA 3LKRB 4LHJB 3S4SG 1L0PA 1TMQA 3AXXA 3W11D 1RMFL 4UDUB 4K3EL 5JA9A 3BLPX 2JIEA 4JEGB 4UMGA 4PRBA 4ZSOA 1Q9WB 5D7LE 3SCRA 3ARXA 3ETPA 5JBFA 2PN5A 3IRZA 2AKRB 1W9TA 1UWRA 3NAAH 2W3JA 3HNBM 3QHNA 2HFGL 4X4ZA 1RJZB 5KSUB 4PJXE 4XBGA 1I5PA 1G0DA 4QO1A 1ZBWA 1BQHA 1ZHKA 4MQ7A 1OWRM 3PP3H 5D5MF 1N6QH 1AGBB 3BN3B 5IMOB 3MUAA 1MCQA 2P8PA 1E72M 1CDJA 5EFDA 3K4ZA 2CYGA 3RI5K 3MRRA 5DC4B 2R0WH 3MV01 2YBUA 3QQ9C 3WL9A 4EUPG 1A5FL 1KLFA 1S7TB 3OX8B 2JB5H 1G5AA 2WZIA 2G41A 4XUYA 4PRPA 3TCLB 4MQXD 1BD2B 3BE1L 1CFBA 2Z4QA 3SQOL 4RX4D 1OL0A 3VMPA 3RTQA 3GFUA 3QDJD 4RAUB 3II1A 5IJKA 1DLFL 3NMEA 4F2MA 5D1QD 4NKDB 3C87A 5KAQF 1YPZE 5I1DB 2OZ4L 4P8UA 1IGCH 4D94A 2C7UA 5SWSD 4NC1E 5FKYA 3NCYS 2VIRA 2Z35A 5ABGA 3TJHD 3OIHA 1UADC 4JLRA 4ZD3H 1QNZH 4CMMB 4O58L 3A22A 1BD2E 2OQJB 3VNZA 4TVPE 1HL9A 4EI6A 5IHUH 4NKIL 3FOMA 4RFEB 5C6PB 1R8LA 3UTQB 2XSBA 1DLCA 5JOEA 2NY4C 1U3JA 2APTA 3M17A 2PTUA 1V7NH 4KWUA 5FL1A 3ARRA 4NFDA 1EX0A 2Y06L 1E4LA 2WM0A 1F4YH 1C08B 3UTSE 3L5WA 4JHAL 4LARL 4Y1AA 1QNQA 4I0PA</