2VZVA

Substrate complex of amycolatopsis orientalis exo-chitosanase csxa e541a with chitosan
Total Genus 280
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
280
sequence length
857
structure length
857
Chain Sequence
LSVGAAAGNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSATSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 280
structure length 857
sequence length 857
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzvA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzvA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzvA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzvA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzvA03
1YN6A 1GQLA 1QR1B 4OAWB 5FO8A 4NRZB 4JVWA 5FB8B 3QQ9C 3LN4B 5DJAA 5EUKA 2DI8A 4YEEA 3CDGA 1WAWA 4RE4A 2Y8VA 1JWUA 1HEZA 2OZ4L 1QPXA 1Q72L 3P4OB 4Y16B 1W9UA 4P3DB 3FY1A 3ROOB 1JDDA 2ZUVA 3L95B 4GQRA 4FQHA 4LQFH 1JGEB 1NMBH 4BQ9A 1C8QA 4AL8H 3VXSA 3P11L 1EUUA 4ACZB 2O61B 4QTIL 1F13A 3BP4B 1ZHNA 1XGTA 1AGEB 1P7QA 2DI9A 5HDRA 4LARH 1H8OA 1P4BH 3W0WE 1YNKL 2Q76A 3SN6N 2XKNB 5HYQB 4PJAF 5HOSA 4KKAC 4P2RA 1C16A 2D9QB 3B3IA 1SR0A 3BLPX 3TNNB 1H6YA 4WTWA 5DURD 4FQCL 3MMEB 1A21A 3WO4B 3DHJA 3UDWA 4F9PA 3IJ8A 2VX5A 3R1GL 4WFGD 2VCAA 4ODTH 5C9JB 1HHGA 2HRPL 4KQ4H 3MSDA 3PDOA 4R6UA 4MJIE 5JPMA 1R5IA 2FX7H 3C8HA 3MLSL 3WQBA 4RAHA 4X5WB 2OSXA 3DTXB 3FQNA 1WFUA 1D5IL 3H3PL 4DKFH 2VLKB 3NCMA 1U8PB 1NBZB 3WV0A 2B5IB 1P69B 2W60B 3KJ4C 4G43B 3BIKB 2OI9C 3VDCA 2XPGB 2W92A 4TVPD 3SURA 1HXMB 4PG9A 5DQJB 5BXFA 2FZ3B 3BP6A 4K8RL 3F7VA 5HXMA 2WZ8A 5MP6H 1FFOA 1B30A 5DMGD 4W7WA 3VXNB 2IADA 3VI4F 1QNOA 4GI9A 3MRGA 4MDIB 1U33A 2Y2WA 3VVGA 4NBXB 2EDEA 4ODSL 1HE7A 1DVFC 2EBNA 1FV1A 1YEGL 4R97C 1R3JB 1EA9C 1FGNH 2AXHA 4X6FA 2R29H 4PJEA 4HUMB 1EGJL 4ZTOH 5IV2A 2BY0A 2YD5A 1T1XA 4NZRH 4D1IA 5DRZB 4JKMA 4QO1A 1MVFA 1A9EA 4TTDD 2RFXA 2VSCA 4K94H 4AZBA 3HR6A 1CLYH 3MCKA 1H3GA 3D5HA 2HTLC 3I6GA 4LEOA 4PUBL 5CPSA 1BQUA 5GGRY 4R5EA 3GSOA 3IFNL 3O45B 4XC3H 5BVPH 3BZEB 2R1YA 2X0HA 4OFPA 2GYSA 1G84A 3SEPA 2PXYA 5H37H 1ITXA 2Z4QA 4L9DA 2GAZB 4OV5A 4GG8A 4JFZL 5DD5L 2CHOA 5C3TA 4J28A 5IM7A 1FZOB 3FW6A 3LHPH 4U6VH 1QA9B 2ADIB 2EECA 4I3SL 1MHPH 3P1IA 1HDMA 1YY9D 1WDQA 3ZE2F 2ITDA 3RUGB 3G5VB 1IEBB 3ECBB 4H1LH 2DMCA 2ZOLB 4DWSB 2MTPA 4JRXE 4LEXL 4PRBB 3SCQA 1X5HA 3QQ9D 1AO7D 1IC4L 5L2JA 5JLZA 2ID4A 2WWKO 1IMHC 5C0JA 1K6QH 5TF1H 1OAYH 3QHMA 4WNQB 2D24A 1WT5C 1QFPA 3HPJB 2E6QA 2VLJD 3HUJB 5AZ2L 2EXOA 4N8CL 1FP8A 2DS4A 2UWEF 4PJHF 5F7EL 4P5MA 2C4XA 2EPKX 3BVNB 3VXUB 2Z92B 1FG2A 1SYVA 4ZZ8A 2E8YA 1NAML 1QI2A 4CD4A 1UJ3B 3AB0B 4QDQA 4KKAD 4P9MH 4F9DA 4FQXA 4M02A 4OLWH 1TJHL 4HH8A 3D39D 3CUGA 4U1SB 3I75A 4OIFA 3LV3A 4RCAA 1IEAA 1OPGL 4V28A 4OGYH 5I1KL 4ZSOE 3RWIA 5T1KD 3TPUA 3CFJA 3PF2A 4G8FB 3AZTA 4JLRB 4CVZA 5H35B 4M61B 4LQFL 5E99H 1BD2A 2WO3A 1U8OA 1NMBL 2C0HA 5BYWA 4H26A 4AL8L 3SCOA 3P30H 5C0BB 3C87A 4E41A 3KYNA 4Y19D 1OIFA 1F3RB 3MRNB 1I8KB 3RIFK 4ZAKA 5L2KD 3V6ZA 3M07A 1P4BL 4UQBA 2F8OA 4PGEA 5FD0A 1A1NB 5JDSB 1OSZB 1BQHG 5E8NA 3TBSA 5FYKH 2CDEA 4FFZL 2BVPA 3SUTA 1R0AL 4QOKB 1XH1A 3SJVD 3MC0A 1FNEA 1NFIB 2A0LC 1QOXA 2OYMA 1T83C 1DVFD 2BHZA 3AMGA 2P42B 4AH2B 3BPCB 3FN9A 4ODTL 1IGTB 4G9FE 1VFBB 2FX7L 1KENL 5A6MA 5FDWB 1FL3A 5FFLA 4GO8A 1YJDH 3MRPB 4DKFL 2AJUH 3A6CL 1UXSB 2IANA 3NPSC 1R3IH 2DEPA 3ISWA 2DTMH 3FO0L 2UY6A 4HGKC 2PW2B 3KVQA 4NYLB 5HHNB 3R8QA 2F61A 2AKRB 2AJVH 1OCQA 4KPHH 2HTLD 2CPCA 5I19L 1ORSA 1X1NA 4P7QA 2G75B 2XA3A 5HI3C 5BV7C 2WO2A 5IVNA 1UM5H 5MP6L 4E5XA 2HVKA 1R24B 2QHLA 2A73B 3UTTB 2MQ3A 1NJ9B 2XZCL 4KVCH 1MW3A 1LE5A 4N8VA 2V72A 3OQ3B 3GJFA 4M6OH 1I8MB 2ZXDA 3BAIA 4DQOH 3VNYA 1KCUH 3P9WB 2W1WA 1U3HB 1FGNL 3WIFB 5EU6E 1M6OA 2YSSB 1YYML 2F5BL 1DWJM 5HYFA 4ZTOL 2XOMA 4OZOA 1V6XA 4F33B 4Y0GA 4NZRL 3G6AA 1P7HL 3GMRB 2BMKA 1ISZA 3NZHH 2NTFA 4K94L 1CLYL 1ZVSB 3QDME 3I9GH 3PUCA 3QG6A 3T0EE 4U1GB 1G7HB 2HJKA 1F6AA 3ZM8A 3MV9E 4N5UA 1NEZB 4PJXE 2EPLX 1S7UB 3N15A 1AKJB 4X4MA 4XC3L 5BVPL 3MREB 2W0FA 3WJJA 5I6SA 4KFZC 5JOEA 1IM3A 2XIBA 1Q0XH 3DHMA 3KYKL 1ECEA 1KYOJ 3LHPL 4U6VL 2QMKA 2CO6B 5I76A 1MHPL 1EO5A 2C9KA 2PB1A 3POCA 1I4FA 2XXMB 4PJ7F 1RQ5A 3EDEA 3CGTA 3BAEL 5DHVH 4NP4H 1MJUL 3RPIA 2QSVA 4MQXC 4ACYA 3GSNA 5AYBA 4XHJC 1K6QL 1I3RA 2PKDA 2W9XA 2O9TA 3RPMA 5TF1L 3ACGA 5C08D 3MLXH 1OAYL 4Y89A 1WTLA 5MEPA 4MAVA 4X7CC 4ARYA 4OUOA 3D3VB 4GS7C 3V0WH 5H94B 5ABHA 1FNHA 2EH7H 1S9XA 4S1RH 3HS0A 5ISZD 3AIUA 2CR6A 3T04D 1BP3B 2WZHA 1JNNH 4QRRE 1MQQA 3ALXA 5DQ9B 5DMKB 3EYOA 2DQEL 1G7QA 3FT2B 4GSDH 4F7EB 1UH3A 2WDBA 1FA2A 5DF0A 3DGGB 4Q6IB 4OLWL 3RVTC 2R7EB 1JAKA 1LDPH 2FSEB 3TA3C 2A0LD 3F6IA 2XG5A 4JFED 5IUSA 1GGTA 2QQQA 3RGVB 5CEZD 3X13A 3QNYA 4IRSB 5I66A 2AXJA 3WL9A 4OGYL 4OIIL 1ZS8A 3DVNB 1FPTH 4HS6B 2Q8XA 4ZD3H 4HAGA 4A42A 5E99L 4PJBB 5I1IH 2ZUYA 1BVNP 3P30L 2M2DA 1VEMA 3EW3B 1K8IB 4U1JA 5GS2D 4H1LB 1ERNA 4U4BA 3ZT7A 1H15A 3MV7E 1GOWA 2DQFB 4GRLB 3OAUH 3I2FA 3W4RA 3HPLB 4QHNA 3C6LA 4WSJA 5FYKL 1Q9WB 5CXPA 3DYMA 4B3LA 4QY8B 3BHBA 2H6PB 4X0VA 4JFWA 1QHOA 5MHSE 2VMFA 1QI0A 1WZLA 1JPGA 5IEKB 4KKNA 4U1KA 3M1BB 4D6GA 1XH3B 2H8PB 2YK1H 4OI9A 2Y1VA 4DFIA 3PL6C 3SDAB 5IT2H 5IK3A 1PYWA 2OSYA 1NP0A 5J11B 4XNQB 1ZL1A 1Z0NA 5CJXC 2J7MA 1CFNB 1DUZB 2XSAA 1H5BB 4H8VA 2AJUL 2XN9B 4X6DA 1CFSB 4D2NA 1R3IL 2X4NA 3AU1B 3C8XA 4ZOAA 1LEIB 5EBLB 1FNFA 1UA3A 1UEYA 2AJVL 5MENB 4KPHL 1EBAA 3NIGE 4AZHA 4OF3A 1PW3A 1AHWC 1QI5A 2XACC 5I0ZA 4PR5B 5HVHB 1RUAL 4H20H 2FJFA 2C7UA 1R3KB 3CBWA 1UM5L 3AI0A 2DT3A 3CHFA 3CIQA 1HXYB 5EOCH 2HRLA 5E95B 1KN2H 2X4QA 1ED3B 2CCRA 5DO2C 5C8JB 1CLZL 4KVCL 4NWUH 3OGVA 4M6OL 1EV2E 1KCUL 5E56A 4MSWB 1W72H 1C7SA 1EAPA 1IGCH 1DLFL 1AP2A 1XGUB 3U2SA 2ZUSA 4QXTB 4MQ7B 1JYXA 1VRXA 5FUCE 5A2KH 1HH6B 2PO6D 1OB0A 2QPSA 2A74B 2IF7A 3NCJH 4I8DA 5E4IA 3QQ4A 4XZUG 2QLYA 5A8QA 3U30C 1EO8H 1EFXD 3WXVL 2NXZB 4MQXD 4X5LA 4ZPVB 3NZHL 1UY4A 4XHJD 5CPTA 4AMKH 3I9GL 4PY8I 4JQXC 4LSQH 2G2RB 2QQOA 4QYOA 1XGZA 2O9RA 5D7IB 2Z91A 5FIPA 1WZ1H 2FDBP 1UXZA 4LLMB 3BUYA 4LIQH 3VGBA 3OJ2C 4P2QA 3W27A 4M9PA 4AIXA 3I2GA 4J2XA 3K0WA 3QUZB 3SO3C 3NDZA 5DJZB 1Q0XL 4UR9A 3WFLA 4ZFZA 3WD5H 1BFSA 5FUIA 2D20A 3S6TA 4LSDA 1B0RA 2FIRT 4RFOH 1LP9B 3RPKA 1BAFH 1CPUA 4P46B 5C0IB 3K4ZA 3SPVB 3T4YB 4C57C 1AXSB 3RVTD 1I7RB 2PBOA 1R6VA 2YUZA 2P47B 3TA3D 5EBMB 1U8HA 3TZVA 5GJSL 2LVEA 3I97A 3IF1A 4RMWA 4YHZL 4NP4L 2ZX7A 1UC6A 4LYQA 4AC1X 1J18A 3BMVA 2RJMA 4Z7NE 3O2DH 1RIUH 5D8ZA 4JZJA 4L4TA 3H3KA 5C0FB 3MLXL 1IBGH 3U6RA 1UWWA 5DD1L 2EXYC 4YUEH 3V0WL 3BX7C 1R8LA 1NQBA 1F3DH 2ESVA 3Q5YA 4NPYA 1E72M 3NFPB 5AC4A 2EH7L 4S1RL 1WBXB 4M7ZB 3DV4A 2DKSA 3MRLA 1JNNL 4G6FD 4XTRC 4PB9H 3VXRE 6TAAA 5CKGA 4AZCB 4GSDL 3UZQA 1PPIA 2P8PA 2W87A 1EHLH 4KRTA 4ODHL 1TVPA 3QUKB 5EZJA 1I3UA 4HWBH 4ZXBC 5HHOD 3L3HA 3JV5A 2GJ6D 5IMKA 4PRWA 4W7UA 4Z78B 3MRIA 1G7MB 4JIEA 3SQOH 1ITBB 1DQQB 1IQDB 4AT6A 4PJDF 3LQZA 4M6ML 1L7TL 1JF1B 3PL6D 1MW0A 1DN2A 3O3AB 3LE0A 1U8NB 2E3ZA 1PMHX 1FPTL 3IDGB 4MAZA 4F9LC 4ZD3L 3DECA 4MD4A 4RE3A 5I1IL 5E5RB 2I07A 3JTTB 5LJYH 3AGVA 1JNJA 1UXWB 3PGDB 4NQEA 3TCLA 1X7QA 4EKJA 3FQWA 5DHVB 1KBGH 3OIHA 5DRWB 3OAUL 1J0ZA 1A6AB 4YDKH 1X6LA 2F53E 2JB6B 3IIIA 2NY7H 1QLRA 1N59A 5DS8B 5DO2D 1OM0A 4DZBB 5CGMA 1CF8H 5SX5K 5F3HA 1OWWA 3CVHH 3IFLH 2YK1L 1MUJB 4DK3A 5GNYA 1LWRA 4OZGF 2O5XH 1UWTA 4F7CB 4ZQKA 3WS6A 2WCGA 1D5XA 4JZOB 4OMDA 3GNMH 2V2XA 3B2UD 3QI9A 3DNKA 1X5IA 4R3SA 1L0PA 3U46A 4R0LA 1CLXA 1JNDA 1XF4A 4NO5A 2NCMA 1UZ6F 4JO1L 2YHGA 3PIQA 1F4WH 2ARWA 3MBWA 2NZIA 2V7NB 2P7TA 4NRXB 1S7RB 1HHJA 1S7TA 2FL5A 3LRSB 4DGYH 1F02I 4H20L 1T20A 3VH8A 3L3JA 4QRPE 2PQSA 4HKXA 4S0TD 4KTYA 2YC1B 2I24N 5CEXB 1KN2L 2GSGB 4TULH 5CZKA 2V6HA 1QZ1A 1INEL 3QI9C 4NWUL 1QFUH 4HT1H 4PJ8A 2AVGA 4PGCA 1JZ4A 2C8NA 1EFQA 1KB5H 2R2HA 4Z0XB 1ZV5A 3C7FA 1W72L 3MU7A 4DGVH 2GJRA 1G7IB 3DURB 1MI5A 4JEGB 1LF1A 3S7GA 4EI5B 4W89A 4IBLT 2OS7A 4D0CB 3D1MC 3NCJL 1QNSA 2C3GA 1A6TB 1NFDF 4Q9RH 5DK0B 2QR0B 1LQSR 2FH8A 2WHKA 1NGQL 5TPWH 4WKAA 3WMBA 5CPQA 1BLNA 4S1SH 3CQOA 1JJUA 4PJ8C 5EZLB 1JXJA 4LSQL 1S78C 1KIQA 3MUIA 3WS3B 4UBDD 2CK0L 2EXYD 4ODVH 5CGYD 4IRJC 2I5YH 5IF0B 4QHLB 1RI8A 4X9GA 1G9NL 1U8JB 1E6JH 3JWNC 2EYSB 3QEHA 1FYTD 4ORGB 5GSRA 2G5BA 4XTRD 5CIPH 2CSPA 5LVEA 3WUFA 1MLCA 1ZT1B 1CDJA 3CHDA 1FO0B 3R8BB 2Y6GA 3EOAB 4RFOL 2Q6WA 4PG2C 4QXWA 1BAFL 4Z2GA 3VXMB 2PUQT 4ZXBD 5A6BD 4NUGH 1CBVH 5KOVC 1Q9LA 2PW1B 1BG4A 4NRYA 4OLXH 2JF6A 3FHQA 4D6HA 3WQVA 3O4LE 2OMNA 5TDOB 3O2DL 1RIUL 4Y5YB 5GRUL 3LPOA 4HXBL 1YEEH 3RY5A 5BXSA 1JUFA 2FWOB 5JUVA 4X0NA 3VE0A 3VILA 3WLWD 3GMMA 5ABDE 5KEZA 5C6PB 1MXGA 4YUEL 3VCLA 2EICA 4MCZA 3PZTA 2VZQA 4YBLC 4NKDA 4A2LA 4PJCF 2EDTA 1OT1A 1Z9SA 3T4AB 5L7XH 1GJIA 1LE9B 1Q9KB 2OWXA 3JTSB 4YHGA 4E0RB 2YBRA 1CR9H 3HFMH 3CZFB 4PLOB 3BFOA 5HTSA 4OI7A 2W1QA 1EHLL 3DBXB 1MCSA 4HWBL 4U5IA 2EQDA 2PWEA 5EUOF 1YEHH 1YMME 4PRAB 4TTUA 3UERA 4I48B 3P4NA 3SQOL 2O5ZL 1CS6A 1JN6B 1NP2A 5BS0E 1KTLB 3OKLA 3MTRA 4P2OB 2WINA 4PY7B 1UG6A 4JFYB 2RV9A 3VFSB 3VW3L 2XWDA 3I50H 4J3TA 1EPFA 4UU9B 1GC1L 3QXDB 2DBJA 1A1OB 3V4UL 3WD2A 2GY5A 2ZOKA 5H8DA 3KPRA 2CBUA 3WQ8A 2F15A 2YR3A 1F6LL 1CE6B 3G5YB 4OJFH 3L2LA 2YRZA 4Z7WF 4RNRA 5LBSH 1EXUB 4MGQA 1B4RA 1NGWA 2BCKB 1WZAA 1PKQB 1QW9A 1KBGL 3SBWC 2ATKA 4JY5H 4OCXH 4PP2A 5HVGB 2Y7QB 3GB7A 3VJ6A 4YDKL 2NY7L 4Z7UA 1D6EB 3PP4H 3DRTA 5FO7B 5CS7A 3ALFA 1S7QA 2WZPD 2WBJA 1CF8L 4JCLA 1OT5A 3IFLL 1A7QL 1F6FB 5KANI 3CMOH 2GDVA 3STBA 4LKXB 3EHBC 2W9LA 2GCYA 4G42A 2V5SA 3JBG7 1G7JA 2ZUWA 2VX4A 4OIAA 3GNML 4R7NB 1BM3H 1HKLH 1OP5K 3VINA 4JDTH 4X99A 4X7DC 1J10A 4U1MB 2XICA 1DBMH 3MR9A 3L7EB 1OGAD 1AGBB 2IEPA 3PWPE 4WI3A 3W0WA 1G7LB 5CP7B 3VXRB 2DIEA 4U6HA 2QEJA 1F4WL 3I2HA 3AROA 1Y6MR 3AICA 2BNRB 3MRMB 3VDHA 2VDOH 3H7BB 4DGYL 4RQQA 1S78D 1JFXA 4H5SB 4LP5A 4LPWA 4L1DA 1XV8A 1TNNA 2Q7NA 2H1PL 4IRJD 5A6LA 4TQEL 1IAIM 1SEBB 3MO4A 4TULL 1AFVH 1QFUL 4HT1L 2DSKA 3PZUA 5DA4A 4MJIA 1KB5L 3MLRH 5FUZL 1N0XL 4ARXA 3AXIA 4DGVL 2XY1A 2P5EE 1GYAA 4PF1A 3U0TA 2JEQA 3HU7A 3OR6A 1NBYB 5L0QC 4BQ4A 3FONA 1JRHH 3FO9B 2FHBA 2JK5B 5EO0A 4HW6A 2V17H 3CFKB 3LKOB 4CNIB 5I1EL 1ZLUK 4Q9RL 1F3JA 4CUCA 5ICYA 3B9AA 3I2KA 5TPWL 2F5AH 1MWAA 5C0DB 3U0PA 5KZ6A 5EFIB 3WMCA 3CVHB 4LLUA 3LKSA 4H0IA 4KQ3H 2ZUXA 4FQIH 5EC1A 1OD7A 4ODVL 4IPNB 2I5YL 3NCBB 4D6FA 5AUMB 4TYUA 1E6JL 1G7PB 2EZ0C 1WPCA 4ZS6C 2BFGA 2AJ3B 5FECB 1MFDH 4F3FB 1KXTA 1OINA 2BNUB 5AYIA 2J1VA 1V0LA 3VMOA 4UB0H 4XBPB 5SWZA 3BDBA 4A44A 3VRLF 5B3JE 1N4XH 3DSFH 4BH7B 5GGRB 4NUGL 1CBVL 3QP3A 4Y4KC 5ILTH 4P8WA 5HHVL 3CU1A 3MKKA 2LU4A 2XTLA 1YQVH 4XUOA 3BEWB 2JJUA 2Z31C 3MO1B 1GJUA 1YEEL 3C8KB 4WI6A 2ZG1A 3WQ4A 5C8BB 2EYTB 4OD3H 4YAQA 1W8NA 4RRPG 3ARWA 5L7XL 1O7AA 1F2XK 5D6DC 2J8UE 4NUJB 4KJYB 1IAKB 2XV6B 1BZ7B 1CR9L 3HFML 4QRQB 1KFWA 4HCRA 4JY6B 3KPLA 4P9HH 1JU4A 3HNTH 5IKCB 5CAYB 3OAYK 2GJZA 1T0PB 5EG6C 2UY3A 2ZWLT 5C7XH 3MMDA 2JF1A 1HILB 1A8JH 2WBWB 2YEZB 4W5ZA 2AK4E 4A45A 5I79A 1VGKB 3EHBD 3RMEA 4OCYH 2KPNA 1A9BB 1BBJB 2J6EH 1VFAA 3AXLA 5CIPB 2W94A 1VADA 3T2NL 3NH7H 1HHIA 5E00B 3NN8A 1RZIA 3K8LA 4AIEA 4NZTH 4O9HH 4OJFL 5D5MF 5TDPB 2AJZA 4D8PB 5LBSL 5E7BA 1J8HE 3SIMA 4K71C 5IQ7H 4YIQB 4FQPA 4MJ2A 5BRZE 4OCXL 3KL5A 2J88H 3VGAC 4RFEA 1G1YA 4NN6C 4OI8A 4U5KA 5D2NE 1KBKA 4WO4B 3V5KB 3PP4L 3WKNA 2QQKH 5DR5H 2DT2A 4C58B 4LAQH 5IW6B 3PP3K 3HE7B 4WFHE 4KTDH 4ZSOA 3L4XA 2EPNA 5HGAA 2D9CA 2D7QA 3CMOL 3SDCB 4QHMB 4D9QE 2OL3H 3X11A 1PDKA 1F2QA 3VUPA 2ATPA 2WBKA 1CD1B 4PJAB 2ADJA 3NCFB 5E4EB 1HKLL 2PWFA 4JDTL 4AEIL 4FLSA 2OYLA 4BQBA 1DBML 2DQGH 3WQ5A 2QL1A 4W93A 1MCLA 2OXGA 1FN4B 5F6IC 4HKJB 4XAKE 4FLOA 2LS6A 3E6HB 3QR3A 2J8FA 4LCIH 1FZJA 5HYSA 3QJFB 1KTKE 3LSOB 4JPKH 4GG6A 5DJ2A 1O7VA 5GS1C 2XWJB 2BNQB 2EZ0D 1K42A 1AFVL 1OTSD 4MJ5A 2FO4A 3BQUD 3O9WC 4JGJA 3QHZL 4OBSA 1E15A 2W3JA 4O58L 1H3XA 1HKIA 5D7LB 3MLRL 4L9LA 1KCKA 3GIVA 2WKGA 2DWDB 3BESR 2J78A 1P9MC 3SGEH 1BQHB 2GT9A 2WLZA 3B6SB 3H9HA 3VFTB 1JRHL 3WJLA 4Y4KD 1WLHA 2YD7A 3TCXA 4N0UE 3B5HA 1ZHBA 4NKMB 2F5AL 1D2KA 2LU3A 1BJ8A 4BZ2L 1K3IA 2Z31D 4ISVB 1T22A 2L9LA 5HHPA 3U9UA 3L5WA 2C3HA 2ZSVA 4KQ3L 5EB9A 2OTWB 2X1PA 1EVUA 3MACL 4XBGB 2EXWD 4GINA 3SQBA 3WJLC 3GMNB 4EEEA 1J1OH 5JNYB 1XEDA 1MFDL 4KC3B 2ORXA 1JRHI 1WEJH 2YL5A 4ODXB 3S3JA 4FQLL 2APFA 1QSEE 1RJYA 1T89A 5ICXB 4UDUB 1J7VR 2D2OA 2HKHH 1K5NB 4G8GD 5A8PA 3DSFL 4UDTB 4WHCA 4P7OA 5ILTL 4DJMA 5B8CB 2E9JA 4L5FH 1ISYA 4BA0A 1N6QH 5E2VH 1LK2A 5EU7C 2D0GA 3ZT5A 3T0EA 4HBCL 3U7WH 2X8RA 4X98B 1OLLA 4QDSA 2JIWA 3S96B 4PJXA 4P4KA 3O81A 2C26A 3P9MB 2WVUA 1VACB 5IB2A 4J23A 4EJ1C 4ZMAT 4K3JL 3GXIA 5AY7A 4ZS7L 4HS8H 1T89C 2E9MA 2CIIA 2KH2B 5F9DC 1XAUA 4MD5B 3M7SA 4PBVC 4R90H 3S34H 4C83B 5GZNC 4LCWD 3QIUD 3AZSA 4CRPA 2P49B 3LEIA 1MFAH 4GKSB 4JHBA 1XF3B 2L7JA 3HMXA 4BK4A 1BVZA 5C3LD 3KPSD 3IFPA 3LKQB 1C91A 1Y0LB 4P9HL 3AOFA 3HNTL 1XGRA 4YDLC 1TCMA 5DUPH 1QHPA 5J13B 4M6NH 4RGND 5C7XL 1TCRA 5DURB 2X40A 3BP7A 5DRNA 1JMXA 2XUCA 3FO1B 4KU1A 4PMDA 5CHNA 5CJQH 4OCYL 1CFTA 2UWEB 4PJHB 2J6EL 4LHUG 1MELA 4NJAH 5ID0A 3RTQA 4N1CA 5HBFA 1R5WB 4H8WC 4PJ9A 3TNMB 5BO1H 2YRPA 4GXVH 1TQBB 5ESAB 2XQXA 4O9HL 3B9VA 1FFRA 3L3IB 5D1XA 4QRRA 3GH5A 4BSWB 5ESVA 5BW7C 3SCMA 1NCBH 2CKNA 5IQ7L 4M24A 3WHE0 1DLHB 3ARBA 2J88L 3HTLX 1ZWIB 4MCYA 4Z7QE 2OJZL 4LRNH 2QQKL 2GJPA 3RWHB 1GZQB 4LVHC 4LAQL 5E5UB 3O9WD 4KTDL 5CWSA 1ETZA 4PREA 3V5DA 4D9RD 3OJMB 2WUBH 2MHAA 3VWKA 1BX2A 4PJ5E 3ZYOA 4EUPG 4P8XA 3I02A 4JM2D 2OL3L 1LO2H 1NCAH 1T2XA 4HPYH 3MJ9A 3BKMH 3T0XA 5IEHB 3OPZL 1JWSB 1I1AC 2IG2H 3ARDA 3OJVC 1RUPH 3W39B 3FB6B 4MA3B 3MV7A 3WH6A 2ICWJ 3Q3GB 4AWEA 3P4LA 5C09D 3QQ3A 2UY2A 4AZGA 2BVUA 4FFYH 3CIHA 2ZUQC 4LCIL 4FTVA 5T3XE 4NQDB 3FFCD 4S3JA 1B9ZA 5BVJB 1P8JA 3FB7A 1MJ8H 3BSGA 4JPKL 4WW2A 1H09A 3T3PF 3PQYE 3EO1A 3P73A 5DJ6B 3CUIA 1UADC 3JSSA 5DZOA 2HT4C 3ARDC 1S9WA 1TITA 4Y1AD 2X4OB 1RIHH 1XNAA 3L4YA 3L4UA 1DE4A 1PGRB 4XZWA 4PV9B 5DJCB 3CX5K 1WIOA 1HQ4A 4XXDA 5D96B 1EDGA 5JHDD 4WK9A 4YHIA 5F1NA 1A64A 1CICA 5HYJD 4JHOA 1GOFA 5B38G 4CCDA 3PWLB 3CLWA 4PSRA 1AO7B 3IXAA 3VFMB 1BIIA 1I9JH 3C09B 5GJTH 1J0YA 2ADFH 1E0WA 4F7MA 2EDWA 5FF6B 4XC1L 5HGBB 2IXUA 2ICEB 3WL0A 3K75B 2DB8A 1FCGA 3QUXC 3ZKQD 3OG6B 5F44A 1A1MB 3SGEI 1J1OL 5GZND 2VLJB 3ALWA 1WEJL 4HMCA 2ZXBA 3RIAK 2WVVA 4GJTB 4RA0C 2Z35A 2X1WL 4YX2H 3GI8H 2HKHL 5G05L 5M94B 4IRZH 1XF2B 5D1ZC 4K7PL 4PYSA 5L88H 4WU7B 5E94B 4Z5RA 5T3ZE 1A7PH 1RH9A 2Z4FA 3ZE1E 4L5FL 3D39B 1VPOH 4FP8H 1N6QL 1QVBA 1NMAL 3HI5H 3MA9L 1K45A 3GSWB 1K4CB 1U2HA 3U7WL 3UESA 2HG5A 5T1KB 1KJVA 1K3ZA 1XSJA 4Z77B 2DQJH 4CMMB 5BRPA 1NC4A 4URTB 4F7TB 4HS8L 5ACZA 5I30H 2R1XB 4EIZC 4BQ3A 4XZUB 1R64A 4PJ7B 2ITCB 5EBWB 5JOPE 1V0MA 3DPBA 4DKAA 3KPNB 4GIAA 1MFAL 4JM2F 3NJVA 3QUYC 3FQUB 1V6YA 2QKIB 2R0WH 2Y36H 3ARFC 5DUPL 1LWJA 4N0UB 4PRIE 1ISXA 4EDWL 3AY4C 4GOSA 4R9HA 5GXBB 3KPPB 3U1SL 3AAZA 4M6NL 2IAMA 1QBAA 2FGZA 4NM8L 3CZEA 2VLLA 2P5WE 2B4CC 1XGPA 2CXGA 2PETA 1K6AA 4XCEA 3TC9A 4V1DD 1DWAM 4NJAL 4PJFE 4JAMB 1I1AD 2D31B 5BO1L 5SWSA 4B0MM 2W67A 4GXVL 4XVJH 4GFTB 3RWEB 4KUCD 1XF5B 4NO2B 3VX0A 2C1PA 5DDHB 1KPRB 1WITA 3T1FB 2UY5A 2VLRB 1E28B 2MFNA 5I74C 2CLZB 1NBVH 4S3KA 4OFYD 8A3HA 4LRNL 5EU3B 3CH1B 4D0QA 2COQA 2DOCA 5IMLA 4WW1A 3EYUH 1FE8H 3MBXH 3NPZB 1TZGH 1UKPA 5GSVA 3HAEG 2WUBL 2PTTA 1ES0B 1IC5L 2MPAH 2VUYA 4FABL 1KNOA 1LO2L 1NCAL 2PNDA 4HPYL 4A4AA 3ZDZE 3BT2H 3BKML 1OWQA 4P5TB 2VTFA 2W07A 1DUYB 4HK0A 1FP5A 1RUPL 4HUXA 1G6RH 5I17B 2Q87A 1QRNB 3SKNA 3MUGA 1AD9A 4KI5M 3ETPA 3EOBA 4PRPD 4YHYC 3OEAA 5JMOC 1H9VA 2ED8A 4X0KA 4B50A 2F53A 4FFYL 3GBEA 3QHFL 4NNXB 2GUYA 1AD0A 3G04B 5JBEA 5DEFA 3BJ91 3N1AA 1MJ8L 5EO1B 4PJIE 2IPKA 4R96A 3B43A 3QUXD 1I1RA 2DBLH 5EORH 1HWGB 3BPLB 5T3XL 2IH1B 4RMVA 1N64H 1RIHL 2VMDA 3ZJKA 1S8DA 4DKDC 3I2CH 4M80A 4K3DH 1L0YA 3LEXB 2AQ1A 2H32H 5D1ZD 4AM0A 3ARRA 5DYOB 3MRQA 2JCCF 4G6AC 3I2IA 4OKDA 1YDPA 4FRWA 2KL6A 5BZDB 3IVKB 1ZBWA 4UOW0 5JA8B 4AY0A 4W4OA 3IANA 3JWOC 3HRZB 1JD9A 1Y6NR 1I9JL 3NIFE 5GJTL 5DSCB 4HA4A 1MCBA 5A40E 3WUWG 5IVZA 3HI1B 2ADFL 4AAXA 4KRNA 4HIIA 5C08B 3MNWA 4MXQD 3UO1H 2GK1B 2CMRH 4JANA 1P7KA 5CBAB 2QQLH 3F8UB 5DGRA 5ACMA 3FMGH 5I24A 5C0AB 1S46A 2XZZA 5HGGS 2F54D 2A1WH 1EHNA 5JIKA 4PCTA 5ISZB 2VDMH 2NY4C 3B5TA 1UB5A 3QBTB 1U9KA 1SM3L 3QUYD 3TTOA 4MOAA 4HDIA 4ZUTB 3WH7A 5F9WB 3ARFD 3GI8L 4IRZL 4NF7A 3MV01 1K9TA 4KMQA 1C92A 1BOGB 3WFEH 5L88L 1A6WH 1A7PL 5D1QC 5E9DE 3CHCA 5I23A 4LLWA 3GMOA 3MFFB 4RWYH 3CVIH 4KUCF 3KR3H 3HI5L 3EYFA 5DQDH 2DYPA 1TZIB 3AHYA 1XGQA 3VIKA 1KIRA 1JTOA 5D6CA 4NZCA 2OSLB 4YN5A 5LA0A 4UFMA 2OJEB 3IDJA 5DHYB 3V4PH 3X12B 3TBTA 2DQJL 3VFWA 2YA2A 3RL1A 2HFFA 5A1AA 4KV5F 3QJHB 3IKCB 4PGZA 5I30L 1MQPA 2PYFA 5HHQA 1NWUA 4NNYB 1MQ8A 4P4RB 3K8KA 4Z76B 3BAJA 2HN7B 4WEUD 1KACB 1A2YA 4DGIH 3U7BA 2X4PB 4BQ6A 3QWOA 3T2OA 1LO5B 1CX1A 4WSKA 2Y36L 4XNXH 3RX8A 4MNQD 2R0ZH 1M01A 4YHOH 4MXVE 1FHLA 3GNPA 3O4LA 4I3GA 5E1HB 2J7EA 1HHKA 4PQQA 3SKMA 4XP9H 2D3VA 4HEME 3G5XB 1V3LA 2ZICA 3U7YH 1K12A 5FUOH 1GOHA 5I2IA 1OGTB 2YWZA 3D85B 1B3YA 1ISWA 4XVJL 3ME0A 4W70A 2G5RA 1J1PH 2AOSA 1UENA 4GXPA 5J1AA 3IB4A 5DZNA 1VEPA 4NFDA 5F7WC 2O9PA 3PBGA 4NSKB 4L8SA 1O0VA 1FL5A 2VR5A 5F7KC 4PJDB 4BFIB 3AMKA 1ZLSL 1BD2D 4W68A 3FTGB 1CT8B 1FFQA 3CUPB 2FEDC 1Z0MA 3O2VH 2BHUA 1E6SM 1V0NA 2ED9A 5BS0A 4I18B 3WEZA 1PG7H 3MBXL 4J3UA 1TZGL 4RX4A 1BGXH 4PJEF 3R06B 3ECQA 4YDIH 1QVOA 2MPAL 4WHDA 4A3YA 3C2AH 1X44A 3BT2L 3LN5B 3GSQB 4HMEA 3MBED 1S9YB 1S7WA 4WKHA 5CMAA 4GZIA 2ZEXA 2PO6B 3AYSA 1Z2KA 4WUUE 1FAIL 1JGDB 2BOBB 5C07E 1EFXB 2DTSA 2WCAA 5DD6B 2Q7YA 1DEEB 4ZYKA 5FA3B 1IV8A 3W24A 1E4LA 4OZGB 3HR5A 4ODWA 2VX7A 4WI2A 2GFBB 3ZDXE 3EDDA 2DBLL 5DD0H 3EMQA 3VFOA 1DWFM 2NY4D 1N64L 3LPPA 4ZFOL 5KSBE 3NCCB 1X6NA 3BD3A 4K3DL 5CG0A 4NHCH 1E4IA 1Z9MA 3MNZB 4DTGH 1INQB 4IHOA 2OR9H 2WHMA 5D1QD 4BYHA 1FJ1A 1J0HA 1FFPA 2YPKB 4AD4A 2H3NB 4CUBA 2RB8A 5JIIA 4OLZH 5C0CA 5E70A 5EIIA 3L3OA 2GFTA 1HNYA 3IK2A 5TGBA 2K3TA 4KK9D 2VISA 2BZDA 5FGBA 4Y2DA 5JPNB 2W9DL 3RNKA 3U4BH 3UO1L 2QQLL 4HZLB 4BFBD 3FMGL 3GBDA 5J9PA 2K9UA 4UFKA 1ADQA 4FXGA 4MZ2A 2A1WL 4LDLB 2GTZB 1NFDB 3DRQA 4XBEH 4Y4FB 1G6RB 3GSXB 3GDBA 3OJDA 2P5EA 1SVCP 4L3EE 2FR4A 5EIYB 1A6ZB 1R3LB 4ZNEE 3IJ9A 1FNAA 1PEWA 2ICWA 3BKCH 3CC5B 5KN5B 4R4BA 3TJHC 4MD0A 2E9IA 3L3KB 4O02L 3NYDA 1SJEB 3WFEL 5HHOB 1A6WL 3SGJC 3AIBA 4RWYL 2GJ6B 5FGBC 4I2XE 3CVIL 1J8KA 3IKKA 3KR3L 3WHE1 5DQDL 5FA4B 1DTUA 4MDJA 3DVGB 2RJ2A 4BM7A 2H45A 3CX5J 4CW1B 3PL6B 3HZKB 4XP1L 3V4PL 4WU5A 1RHHA 2BXYA 4ZFOB 5BQ7A 5E24E 4HFUL 4JFHE 4P0DA 3UTSB 2H32B 5KS9E 1EMTH 2JD9A 3R4DA 2J77A 2A6JB 4Q97A 4DGIL 2NW2B 3EO0B 2YLAA 1ZEAH 3JV4B 3FFDB 3DGCR 1J83A 5FB8A 4JREB 1FLTX 2JIEA 3FHAA 3RWJB 2FEDD 2A83B 4ACPA 4QNPE 4XUQA 2GSJA 3BW9B 2JB5L 4YHOL 1CDHA 4JHAH 1KLUB 3ROOA 1QACA 1YEIH 1QG3A 2YPLD 1Q0YH 1JGEA 4OSUH 4PJCB 2KQNA 4HIHA 4CL7A 4ACZA 2O61A 1KLFA 4XP9L 3BAXA 4C56B 1NANH 3BP4A 2YDRA 1AGEA 4EN3D 3U7YL 5FUOL 4MHHG 2XKNA 2IFFH 5HYQA 1I8LC 1J1PL 3V8CA 2J8UA 4GQ9H 5EUOB 1XR8B 2R4RH 3U30B 5IIEB 4ATDA 1CDIA 4E2OA 4X9BA 4HD9A 2BXZA 4Y16C 4OGZA 5D9SA 1NCTA 3HZVB 1CGWA 4U6XB 3BH9B 3MMEA 1H0GA 1FIGH 4OF0A 3SHSA 5C9JA 3O2VL 2EKJA 3W5NA 4LBEB 3CK0H 3VXTB 1UHVA 2EPMX 1KUMA 4EUPH 3FL7A 2EDHA 3S98A 1V5JA 3DTXA 4NKOA 5AAWA 1BGXL 3SO3B 5DJ8A 4Z7WB 4YDIL 2QQJA 4OZFH 2VLKA 1NBZA 1YEFH 3C2AL 4HEPG 4Q74A 2QBXA 4EDXB 3OKEB 4AK1A 5E1AA 4C4KT 2W60A 3BIKA 4G7VH 4JZ5A 3L7FB 3D6GA 3WIHH 1E4KC 1HXMA 5DQJA 3N1PC 3G6MA 4L4VE 2FZ3A 1J8HA 2NMSA 5DPNA 4XUTA 3WF4A 2V7HB 4J4PC 3VXNA 3X3FH 5BRZA 4YHLL 4KRPB 4PTUA 3RI5F 4X6BA 4MDIA 1WZMA 5HGHB 4GAYB 2PYEB 3G5ZA 4DKEH 3EAKA 3LQMA 2XXCB 2APXA 2B5IC 1O5DT 1AC6A 2AP2A 5DD0L 1RK0B 4NO0D 5CSYA 1FYTB 4AD5A 4YZFF 5GS0H 4ZE5A 3OZOA 1F42A 5DRZA 3RM9A 5DT5A 4RL3A 2VDPH 1QPKA 3TJHD 1ND0B 3IDXH 1MYRA 3WN5A 3VIMA 3WUEA 3QAZB 4ZXBB 3ZHDA 2OR9L 1HCVA 3QRGH 4G80B 1ZLWH 2MJWA 4M43H 3CH9A 3LEYH 5JMRA 3FRPA 1I9IH 3IJSB 1HYRC 4OLZL 2W61A 5JHLL 3D0LA 4N0RA 1J87A 2BC4B 3GRWH 1XCXA 1JNHB 3MRDB 3TLRA 7FABH 1TVBA 4U3XA 1XHGA 1N0LA 3WEXB 2GAZA 4GH7B 5FYJD 1T2QH 1FZOA 4KHXH 2G9HA 3S36X 1G01A 1QA9A 1KV3A 2ADIA 3IU3B 4I4WA 1JHLH 3BWAB 2XTJB 4XBEL 1MPAH 3RUGA 1HIMH 1H3PH 4KUZH 3ECBA 2APWA 4I0PA 5TE7H 4ENED 1KBBA 3DO7B 4PRBA 3BKCL 4PBGA 4XGZB 3DHUA 1GGBH 2D3LA 4LLYB 3H8NA 1ORQA 3QEQE 2B2XH 1HWHB 3AHTA 3LZFH 5EU5B 4MA8H 1CGUA 3V6OC 2HP4A 3DX8B 1JHKH 4AYFA 1IKNA 3HPJA 4Q22A 3N50A 1FZMB 4M93B 2YDSA 3TTSA 3UTQA 4DWSC 3L4WA 1P4LB 4K8RC 1W9WA 1XPWA 5EC2B 2Z92A 4CDGC 3MOAH 4K2UH 5E09A 1EMTL 1HINH 4WV1A 4HOXA 1YC7A 3DROA 3KHOA 4XMPH 5KG9A 1UR2A 4Y16D 3PWVA 1QSEA 7CGTA 3W25A 1D7FA 1ZEAL 1YA5A 1F4XH 2DLEA 4UZGA 1OAQH 5E2WH 2X70B 3UBXG 3MRCB 2EEDA 1JI1A 3IXTB 1MFNA 3ARGB 3QDGB 2DCJA 4JHAL 1YEIL 3UJIH 5FK9B 4NIKB 1Q0YL 5JW4N 4YK4B 3RWDA 1UJ3C 3AB0C 1HSAB 3O2WL 5KSAC 1NFKA 3ALGA 4AG4H 1C12A 4OTXH 1XD0A 2IFFL 1OP3H 2WANA 1OSZA 3MJ7B 4GQ9L 2VITB 1YPZE 2R4RL 3N06B 4J4PD 3OEBA 2IWGA 3RWFB 2B4KA 1A5FH 5I6XC 1WDSA 3C7HA 1NFIA 4MNHB 4NRSA 1JHTB 4MTVA 3WF3A 3II1A 4OCRH 3AS3A 4AH2A 4D9LH 1A4JB 3BPCA 1FIGL 2ARJQ 4JX0A 1IGTA 4UOW1 1UYXA 2JLLA 3IFOB 2AV1A 3RY6C 3CK0L 1NANI 1OTTD 3HAEH 3RZCC 4JGMA 4HUWA 5FDWA 2L7UA 5D5MB 3ALPA 2X89A 2CKBB 4UAOC 4X7FC 4HG4J 1YEFL 1ZBKA 3RIKA 4YNYA 3IJHB 1WKYA 2PW2A 1CVRA 2QSCH 4NYLA 4RZCB 1CU4H 4UOJA 1L0QA 2AKRA 4G7VL 3WIHL 1TJGL 2G75A 1I1YB 1LEGB 3PV6A 5TE4H 5IB3A 1Z5LA 2YD6A 4HU0A 3QDHA 4FXKA 3X3FL 4L0PA 1TR1A 2A73A 1QSZA 3UTTA 4PB0H 1NJ9A 3QFJE 4LHUB 1WJ3A 1IM9A 2IQ9L 1I8MA 4DKEL 5MEOB 1FVEA 1NKRA 3WIFA 3KXFE 2WMFA 3RCNA 3U4EB 4PJ5A 2F19L 4JFFD 3TBWB 1UYYA 5GS0L 1DFBH 1AXTH 3WNOA 2PN5A 4TRPH 1T7ZA 2VDPL 5I1CH 3GMRA 3QFDB 3TVMA 3IDXL 1PD6A 2A3BA 1BAGA 1CDCA 1JK8A 5K59F 2H9GB 3QRGL 5FO9A 2P8LA 3WFDH 1UY1A 4M43L 5DMYA 1H41A 2DL2A 3CSPA 1I9IL 1W3HA 5FCSH 2J7CA 1U3HC 3LRGA 5JXHA 1LWHA 4EZMA 1S7UA 1AKJA 2VZPA 3GRWL 4JZNB 3ZYZA 4EUPB 3O3UN 7FABL 4S0SD 3W29A 1BFNA 1W9XA 4OUEA 4DWSD 2LAAA 3PQYA 5B21A 1D3CA 1T2QL 1B0GA 4JRYE 4LLDA 4PGJA 2C3XA 3S35X 5LGKA 3WY1A 3MZTA 1JHLL 3HB3C 3CFEB 3MV8D 2X4SA 4D6JA 5F9JB 1MPAL 4U1GC 4PMZA 1H3PL 4KUZL 5TE7L 4PJGE 2AW2A 5KOMC 3HJEA 4QPWA 4JG1H 1U8LA 3MRHA 2UWFA 4IS6B 3WUGA 3H6JA 3UAJD 4D6CA 1P5VA 2UUDH 2CGRL 3KNBA 1SEQL 2WC4A 3MQIA 2B2XL 4JFDE 3LN9A 4J8RB 1S3KH 5GPRA 2ADGB 1I5PA 3LZFL 3H9SB 3VXUD 2OTUA 4MA8L 5INCA 2JIXD 4HV8B 4KJQD 3ULSA 1KXHA 5BWFA 1KXQA 4N9GB 1HT6A 3D3VA 3OF6D 3FT3A 5FGCB 3SDXE 4QP0A 5KSAD 1UZ4A 2FATH 2OMBA 5H94A 4W8LA 1JHKL 4K9EH 2Y5TB 2JF7A 1MEXH 4JFXB 1PQZA 3SCRA 4DXSA 4CVUA 5D7JC 3PWUB 5DMKA 3OKOB 3MOAL 4K2UL 2QBWA 1HINL 3G6JB 12E8L 4XMPL 5CD5C 4HUVB 5B38B 2RAMA 1QR4A 2WC3A 3RWCB 3WUBA 1JNEA 1UWSA 3RGHA 43CAA 4R2GC 1F4XL 1XT5A 3ZL4L 1MCWM 1XNTA 2BERA 1OAQL 2W9EH 5E2WL 5C0BD 3O6MH 3BIBX 3RGVA 4IRSA 4H7VA 3BAYA 3MYZA 1BYBA 4NWTH 3NABH 2NNAA 4Y5VB 3O3DB 1MVUA 4HS6A 4GRWE 3RZCD 1E56A 3MLYH 2DQTH 1VIWA 1A6UH 1KEGH 3UJIL 2EO1A 1NKGA 2RR3A 4PJBA 1BZ9B 1ZSDA 2Z8RA 3PHOA 4OD2B 4HPHA 5A8NA 3HG1E 4K94C 3OMZA 1ZANH 1K8IA 3D9AH 1ONQA 1KEML 4QOKD 3P0VH 4Q6IC 4CMHC 3EO9H 3VFUA 4GW4B 3QNXB 4AG4L 4OTXL 1EVTC 4NQCD 1NCDH 2DQFA 4GRLA 2DQXA 3HPLA 1ZB5A 3VFGH 3ZJ6A 2D7TH 4ETQA 4QTHB 4Y4HA 3C60D 5KTEH 1I7UA 5IEKA 4MYWB 4OCRL 1DWIM 3TT1L 3VGDA 3M1BA 2OWCA 4D9LL 3VGHA 1W0YT 1MXDA 5INDA 4XNQA 1FH8A 1BYAA 1FGVH 3JV0A 2OSWA 1X4YA 1FC2D 1CFNA 3BQUB 4X83A 4Z2JA 2XN9A 1GGCH 4LASH 3RZWA 4H8WH 4CGTA 5FOBA 3WD1A 4W87A 4Q9CA 4LPYA 2QSCL 3MGTB 1CU4L 1MRFH 1RU9H 1JV5B 3PG2A 3RDTC 5MENA 4HH9A 1SYSB 4JHWH 2A6IA 1U3HD 3SDAC 1R3KA 2NX5B 3T0DA 4MA7H 3C08H 4NQSB 1T1WB 3IT8D 3ZZ1A 4XX1E 3P9LB 1ED3A 4PB0L 2Z31B 5C8JA 1J05A 3N1MC 3SDDB 1H5BC 4HULB 3VXOB 4APQA 4MSWA 1L6ZA 1E27B 3O11A 1UACH 1XGUA 3HB3D 4HJJH 4QXTA 4MQ7A 2LAGB 1HH6A 2A74A 1DFBL 1AXTL 1D9KB 4TRPL 4HHAB 1H3TA 3G6DL 4KJPC 5I1CL 4MAYB 4ZPVA 1UB6B 1WWCA 1OY3B 1K4DB 5M17A 4D71A 3S5LA 3VIHA 3VMNA 5IJRA 3VXSE 3WFDL 1CWVA 5D7IA 4XUNA 1TIUA 1EEZB 5FM8A 1U8IB 3HAEB 4ZUSB 4XB8A 2AAVA 3NVQA 2AJXH 2UZIH 2MCG1 4URIA 2R9HC 3VD5A 3QUZA 4PJIA 5DJZA 3BKYH 5D7JD 3HZMA 5TQ2L 1JZ6A 2N7BA 4LCCA 4Y19E 3TT3L 4LLVB 1N5YH 3V7AG 2NXZC 5L2KE 2G3JA 5DGQA 5CD5D 4P46A 3TO4A 5C0IA 1QNRA 5JIPA 5IHLB 4H2CA 4PN2A 4LCWB 3QIUB 4HUUB 4K71B 4R2GD 4F58H 3P4MB 3KPSB 3B9KA 5IW1B 4JG1L 4FFVC 3SJVE 1MH5B 4PSPA 1YJDC 2WWCA 1RZ8B 3VWJA 1VAHA 3MRJA 1JPFA 3O6FB 1S3KL 5IFJB 1LGVA 5FYLE 3T3ME 4RGNB 1DLCA 2BVYA 1KEXA 1SDDB 1IGYB 1GH7A 1MHCB 1GVYA 2FATL 3NFPA 4J3SA 4K9EL 4HIEB 4Z6AT 1MEXL 2N1KA 4RBPH 4UFJA 1BF8A 1T21B 4GW5B 4QAWA 5CJ5A 4QRSA 3DX6A 1YNLL 1QLFA 2GSIB 2R8SL 4JAWA 3RU8L 2WP3O 3H2WA 1U36A 3U82B 5EO9B 4FA8A 2NXYC 3TIEA 1E6NA 1KELH 2NY2B 4O51A 4D0DB 2R2EB 4A41A 3CFIC 1G7MA 1QSFB 3PHAA 4CVXB 2CJUH 2W9EL 4W7VA 3WUWB 5FV2A 3O6ML 3SCNA 1IZJA 2SEBB 3SE4C 3MLTB 5E9DA 2VM9A 1JF1A 2BRQA 1CQKA 2VLMD 3ULVE 3O3AA 3NABL 4JPIA 1QFOA 4M7ZC 1H8SA 3IDGA 4UINH 1E1EA 3BCFA 3AIRA 2DH3A 3WN6A 2DD8H 3MLYL 1Y18B 1EZVX 1A6UL 1E4WL 2D0FA 5GGTH 5I8KH 4YO0B 1Q6FA 3MGAA 3JTTA 3ULVH 3O8XB 4PT6A 4BFEA 1ZANL 1BECA 3D9AL 4JRXD 4HU8A 4JM2B 2X4TB 4G9DB 3P0VL 4AZ6A 1M7XA 1A47A 3EO9L 1MCPH 3RDTD 1U8QB 2UY4A 4YHMH 2PWHA 4YXLH 5HY9B 1NCDL 2NW3A 1IQDC 2QQNL 2EIDA 1JP5A 2VDKH 5DRWA 3V4VH 3GXUA 5FKPB 4GMTH 3SDAD 1A6AA 4IIQA 3L4VA 2D7TL 3MLZH 1DR9A 2ZEWA 4NQXB 5KTEL 5C09B 1A14H 3PZVA 1UY2A 1B31A 1BGAA 5FGRA 5BJTA 5KW9H 4HZ6A 5IMMA 1MUJA 1CXIA 4YHNB 4OCWH 4O2CB 3HZYB 4F7CA 1GOQA 1FGVL 4JZOA 2VXTL 1KCVH 3VD4A 1N26A 1OAXH 1OF3A 3IDNB 3ZR5A 4Y1AB 5TH2B 3WFBH 1GGCL 5DVOA 3N04A 1IT0A 4KJPD 3WH5A 4CD8A 1VDGA 2OYKA 4CD6A 1JDAA 3SCVA 5J6GA 1MRFL 1RU9L 1S7XB 1W0WA 4UCFA 2R15A 1JZ3A 4NM4H 3IETB 5JORA 3GHBH 25C8H 1MCRA 1FH5H 2GK0B 3UXFA 4PGDA 4MA7L 3C08L 3HN3A 3NZ8A 4PRDB 3ULUH 5M03A 1P1ZB 2GSGA 3PWNB 5CSGA 1MJJB 2X1XR 1QNZH 4ZOBA 4E42B 1SY6A 3M8OH 2W65B 2HFEA 1D5ZB 1T0NA 5FYKD 4GLRH 4NC1C 2MANA 4Z0XA 4MA1B 2NXZD 3UJTL 1ACYH 1G7IA 3DURA 3GKWH 3EZJB 2AQ3A 1UACL 1UH4A 4EI5A 2YA0A 4HJJL 1IL1A 1UVQB 1NSNH 4Y5XA 4BZYA 4Z2KA 3OX8B 1A6TA 2BVEA 3MUY1 5DK0A 3HC0A 5BMFH 1ITCA 4HLZG 4FFVD 4X9HA 3E6FB 2V5CA 4JFEE 3AMLA 1XIWC 4WUUA 4PLJC 5D93B 5CEZE 4G9FD 1DSFH 1UOKA 2P45B 4E41E 4RAUB 3WS3A 1S7VA 5I1JH 1YEDB 4XRCB 4PGBA 3M17A 5IF0A 3KLHC 1KXVA 5A6KA 3BEVA 3GHEH 1XGYH 2UZIL 1KJ2B 1AGFB 4LCUB 4ORGA 1CXHA 3BKYL 1ZT1A 1N5YL 5F1OB 4F8XA 1FO0A 4PRHE 4NNPH 1OTUC 2JCCB 3GMLB 3K1KC 3OZ9H 2NXYD 1N82A 5KSBA 4M8UA 2BSRA 1B2YA 1HIZA 1M4KA 5K9OB 2NZ9D 3DJ9A 3I84A 4F58L 3ZYIA 5IYYA 3A67H 1HOCB 1QQDB 4P5KB 4LYRA 4Y5YA 4CU7A 4BFGA 1UQZA 4HS3B 5E2UH 4DUWA 1GOIA 2IANE 1U58A 3HHRB 3QDJB 4LVHB 1A7RH 5EU6D 3OGOE 1HX0A 3B83A 1CDGA 2B20A 1K85A 3JZ7A 3MLPA 3P0GB 2XT1B 2XHNA 4V1DB 5FYLL 1UKTA 1DBJH 3T4AA 4QLKA 3NACH 1VFOA 1FVCB 1Q9KA 1LE9A 1YN6B 1Z9OA 4NZUH 4E0RA 1I1AB 5FO8B 4ZFGH 5I2UA 3DMMA 3CZFA 4JFPA 3QDMD 2W95A 5DJAB 5EUKB 3CDGB 1MRCH 3DBXA 4L3EA 4Y5YC 3GBNH 2DM7A 4ZNEA 3MV9D 1KELL 3PZQA 5CJOH 4PRAA 4MNLA 4CADA 4I48A 4OM1H 4FQ1H 2CJUL 4FQHB 1GRWA 1JN6A 1C5BH 2ZUQB 1EDQA 3AXXA 4PY7A 4U3CA 1ZT4B 3BH4A 2OWWA 4JFYA 4UINL 2MKLC 5ALBH 3VFSA 1ZHNB 2Y06H 1P7QB 2DD8L 1E70M 4Z2AA 4UU9A 1EOMA 1SMDA 4IOFC 3QXDA 1A1OA 5FUCC 5I8KL 2V3GA 3ULVL 4OGAC 3C2SA 3GUTB 5IB5B 2IBZX 4RMSA 4XURA 1A3RH 4GO9A 3O4OC 3VGGA 4P2RB 5KAQG 1EXUA 1MCPL 1GSMA 2IQAA 2O5YL 3FQXA 5FV1L 4YHML 2X41A 4YXLL 3E3QC 4X4ME 2VDKL 3V4VL 3F5WA 3LPFA 1G9NC 1Z3GL 4GMTL 2XA8H 4P2OC 3RJXA 2N7AA 4EAMA 1D6EA 1HHGB 3PHQA 5FO7A 1IAMA 1R5IB 1L9MA 1A14L 4PRPB 1B90A 4EKXA 1UM6H 4TUJA 3HJRA 1B3JA 4UIMB 4Z8FH 2CDGB 2E4TA 3FQNB 3N18A 5KW9L 1HKFA 3QIWD 3A6BH 4LKXA 1UKSA 4OCWL 2BS9A 3KDMB 1MFEL 1JTTA 4MHHI 5CKAA 2P43B 3QUXB 2IPUG 1KCVL 4R7NA 2A6KB 1HXJA 4LSSH 1OAXL 4B9YA 1LP9F 3MCLH 4N90E 3RNQB 3WFBL 4U1MA 4J6RL 1AGBA 3BP6B 3BGMA 3F7VB 4ZODA 1TXKA 1E55A 3S4SA 2VI0A 3QXUA 1UWQA 1I7ZA 1XIWD 5I1AB 3MRGB 3JUZA 4PLJD 2BNRA 3MRMA 4NM4L 4U2ZA 3H7BA 25C8L 5E08H 2WNWA 2Z0BA 3LKPA 1FH5L 2O26U 2VT0A 4JHZA 4Z9KB 1OD8A 1A0QH 5BXPA 2JJSA 1BVKB 2XRAH 3ULUL 5EPMB 3L3DA 3PJSB 4X6FB 4PJEB 1VFUA 1US2A 4PRNB 1MIMH 5IV2B 3M8OL 3WNMA 1T1XB 1UWXK 3KLSA 2X09A 1JPST 5EULV 4DVBA 5DEGB 5CP3H 3GKWL 1A9EB 2HJLA 4QHKJ 2RFXB 1NBYA 3EMZA 3BRDA 1ZTXL 3MCKB 1NSNL 2EIZB 4CNIA 3I6GB 5MHSD 4P00B 1UKOA 4K3EH 1YEJH 4OLYL 3BSHA 1NCWL 3NFNB 2C4FT 1OH4A 4L4VA 2YKLH 2R1YB 5EFIA 1EDTA 3CVHA 3N85H 2PXYB 1Q8MA 2Z4QB 4OZHE 5I1JL 5LQBH 4PJXF 4GG8B 2CBIA 4GLRI 1KIPA 3U36A 1A6VH 1RUKH 2WO1A 4XH2B 5CYYA 1QO3B 3VXMD 1G7PA 2VVSA 3GHEL 1HDMB 3JXSA 4JGUA 4HC1H 5FECA 5HDQH 4WI4A 5JW5B 4ZZ5A 1ZVHA 5LCVL 2BNUA 1E6OH 4NNPL 4NN5B 4DCQB 2GJJA 3OZ9L 3X14A 4K3GA 4JKPH 3KYAA 4BH7A 1FP9A 2VDNH 3DO3A 3C8DA 3HE6C 2JJTC 3WH8A 3EFDH 3A67L 2AEIT 3SO5A 1JGVL 2D3NA 3OLIA 2DDQH 3E8UL 1O7SA 4O2FA 1FBIH 5IQ9B 3PTMA 3SCSA 3C8KA 4X6DE 5E2UL 4GKNA 1A7RL 5SV4A 4IOFD 4M48H 1FG2B 1SYVB 2EYTA 4OGAD 1Q6DA 2AXFA 1JI6A 4MJ6A 1MNUH 4GPNA 4FQXB 5E6IA 1DBJL 3NACL 1H3UA 4WCYH 1JBJA 5JO5B 1IAKA 4GRMA 1MCIA 5JIWA 3Q48A 4QRQA 4IEFB 1IEAB 3K4DA 3ZQ9A 4JY6A 4IDLA 1Y6KR 4P2OD 5FAAA 1MRCL 3GBNL 5FM5O 4K23H 5IKCA 3TPUB 4DEPB 3CFJB 4ZNCD 4UILH 1UQYA 5HYSG 3PV7A 3VDAA 4CVZB 4BQ2A 4FQ1L 5I1LB 1YY8A 3QEQA 4GWIA 1BD2B 4CUAA 1FVDB 2GKIA 5A16A 1HILA 1C5BL 2YEZA 3V7MA 1VGKA 4AZ5A 1TETH 1KCSL 3W82A 4X4XA 1A9BA 1BBJA 2BY1A 4KROD 4L3CA 3TESA 1NC2A 1UWGH 2Y06L 4UAPA 1V02A 4HMDA 1GU3A 4ZAKB 2B8OT 4TVDA 4L29B 4PGEB 1NUDA 3TBSB 1A3RL 5TDPA 2CDEB 2XVLA 2BVPB 4D8PA 4WHTB 5I78A 5HGDB 1U3JA 4YIQA 3GMPA 4KI1A 3WO3B 3MBEB 2BSTA 3CLEL 5ICZA 4TSCH 5EA0L 3QGVA 3QULA 2XA8L 5IHUH 4ONGH 3WXWL 4WO4A 4Y8DC 3V5KA 1WTGT 1CFQA 1FL3B 3L4ZA 2QSTA 4Z8FL 2ICCA 4E4PA 3SDCA 4QHMA 1PX4A 1S5IL 3S2CA 3VXRD 1CD1A 1B0IA 2XGIA 2VUOA 3MRKA 4FQQA 4PJAA 4IJ3B 5JQ6H 4PTMA 1ORSB 3MCLL 4HWUA 3TYGH 2DCKA 2R0KH 3QOMA 4C54A 1ISVA 4NBYB 4WO4C 4YHPB 4L4TE 5IFPA 2ERJB 4E5XB 1BYCA 4ATWA 1FN4A 4UTAH 4JL2A 2APBA 3UBXB 3GSNL 3NIGF 1YPZA 3CCHB 3HE7C 3DYOA 4D1JA 5E08L 1SJVA 3KHQA 4KKBC 4NQVA 4Q0XH 4TOYL 1RP9A 2EE9A 3QJFA 2XRAL 3T08A 2E5EA 2EDJA 5DT7A 2E27H 2BNQA 1QYGH 4BQ8A 1W3KA 4FMKA 4HGWB 1NCUA 4U1NA 2X10A 4HOZA 5FYJU 2CLVB 5DUBA 4MWFA 3G6AB 5HHME 2NW0A 2CO7B 2BMKB 5L8LB 4U33A 4BSJA 4JG0H 1BQHA 1NX9A 2NTFB 3B6SA 3MPCA 3NFSH 2HTKC 3QWRA 4GBXA 1D7PM 5LA2A 2GK2A 4LL9A 3HE6D 1R5VB 1F6AB 4K3EL 4YDJB 5D2LE 2NLJB 1YEJL 4HOWA 4ZPTB 3F7YA 2W0FB 2YKLL 4RDQF 1KCLA 1IM3B 3VGEA 4MLSA 3N85L 1QI4A 5F70A 3BGFB 5LQBL 2OR8A 2OTWA 1A6VL 2J25A 1RUKL 3ARUA 3QFJA 2EDKA 4YEFA 5I1DB 3GMNA 1B4JH 1BJ1J 1I4FB 3KG5A 3NMEA 5HDQL 3QR2A 4YHKH 2FIKA 5EH1A 3KXFA 1WIUA 4ZDHB 1E6OL 3SGKA 4QX3A 3RPIB 4UDUA 2DSWA 2ZJSH 2ZNWA 4UDTA 4QRPD 4JKPL 2CD0A 5B8CA 1W9PA 3S88L 1I9EA 5TDNB 4AD3A 3HMWH 5MI0B 2DDQL 4LVOB 2H2PC 4Z7NF 1Q9OA 1FBIL 1X5GA 3U79A 1S9XB 1F45A 3HS0B 5I75C 3DIFA 1YNKH 4M48L 3KGRA 1Q1JL 2YPLB 3EYOB 2I25N 1G7QB 2V3FA 4KDTA 4MD5A 1TVHB 1ODUA 1MNUL 1EK3A 4C83A 2BGPA 2E31A 3PZ9A 5FOJA 3HCVA 4EN3B 1OGAE 1UH2A 1HP5A 4FQCH 3PABA 1T5WB 1P6AB 3R1GH 5I66B 2P4AB 2GQHA 4HAFA 2C4FU 4YH6A 1ZS8B 4K23L 4N42A 4UILL 1HL9A 4LMQE 1HSBB 3HRPA 3QXAA 2C9AA 2YFUA 2E6JA 1DCLA 5A43C 3A22A 2XZAL 3CAFA 4KHTL 2MKWA 4X8JB 3H3PH 1OT2A 4LKSA 1TETL 1HI6B 1ZXQA 1UWGL 3F12B 2ZX8A 3SDXA 1R5WA 3UG4A 5IWLC 1H15B 1UCTA 4O5LH 1CGVA 1CECA 4WGWB 3RQ3A 2DICA 3C6LB 1L8NA 4BSWA 1WK0A 3Q1SH 5J13C 1VKXB 1GHRA 3BHBB 3HE7D 1JPGB 3LH2H 2J7HA 1DLHA 4KKBD 5I15H 4U1KB 2J8GA 1DQJB 3FXYA 3WENA 2J75A 5LXGL 1CIDA 3RWHA 4MXWH 1GZQA 1P6WA 1U42A 3VNZA 1ZLWK 5ID1A 5IGXL 1TQBC 3IDAA 4LFHD 2VVNA 2PI6A 1MFBH 2M1KA 2X4NB 3KS0J 4HA1A 5IEHA 2G41A 2YB7A 2HA1A 3WUZA 2HTKD 4NO0B 1M71B 4I3RH 4P57B 4F8TA 4ZXEA 3W39A 3FB6A 2R0KL 3QZWA 1YMMD 2C7UB 3QIBD 4UTAL 3AXHA 4G8EA 4LPXA 5GRXG 4EI6A 5CSZA 3CZLA 2UZYB 3CXHK 4I0CC 4RX4D 4RDQG 3VI3E 2V2TA 1VF8A 2Y6SD 3T2QA 4UFHA 4Q0XL 4RISH 1CK0L 5D7LD 4UZUA 1WAAE 5BVJA 4H25A 1QRKA 1EAPB 3BN6A 5K9KA 2E33A 2E27L 1AP2B 4AEHH 1QYGL 5KVFH 4MPKA 3U2SB 4N9OB 1CWYA 3A47A 4GXUN 5HJ3A 2X4OA 4LRIA 4P9HC 1NWRA 2A3AA 3QQ4B 1ZLVH 4LEXH 4F57L 5I71B 5I18L 2EE3A 5DJCA 3WIIH 3P6BA 1KJMB 1OAUH 1AH1A 1C8XA 5J57B 3NFSL 3GKZA 2Z93B 2EH8H 4RGMB 4QYOB 2Z91B 4WJXA 3KPQA 4PP1D 1AO7A 1CBGA 2H2PD 4H88H 2E7MA 4P8UA 2DMBA 4WI9A 4P2QB 4N8CH 3SE3C 4ZFZB 5HGBA 2ICEA 1NAMH 5IR1A 5D96C 3PWPD 4QFUA 1B4JL 1A1MA 1EBPA 4D0BA 9CGTA 2VLJA 3VX1A 4YHKL 1TJHH 1ZMYA 5DN2A 4Z7UE 3A3HA 3TZVB 1BPVA 1OPGH 5D7SL 4JQVC 2DAVA 3J7HA 1UXXX 5J1XA 3VFVA 3O41B 2ZJSL 3OGCB 4JJHA 3C09C 5I1KH 2WM0A 4WU7A 5E94A 4JZJB 4BJ0A 4JFOB 3D39A 3U6RB 3E1F1 3HMWL 1OP3K 2ESVB 1K4CA 5KANG 3H7LA 4M1CD 5MEQA 4JPVH 1BBDH 2XTKA 5T1KA 5F7UA 2DT0A 4L8BA 4M3KB 3WSUA 4Z77A 3MRLB 1DDHB 5F7YC 1FORH 1WFNA 2DDXA 4WKFA 3DETC 2B1AH 4QGTA 2A9NH 2R1XA 2P8PB 1RD6A 4PJ7A 4FFZH 4E9LA 1ULOA 1R0AH 4Y19A 2DIBA 1P2CB 3VIIA 5L2KA 2HT3C 2X4UB 4M4PA 3MRIB 3FJTA 4GW1A 3IDIB 3LQZB 3MRFB 1RPQA 5IJVA 2ZWYA 1MHHB 1RJLA 5AWNH 1M05A 2DPEA 1KENH 3SJVA 5IP4A 4D6EA 5J7CC 4PMXA 1DVFA 2I07B 4L3AA 2NY5L 3A6CH 3KPOA 5JXAL 3ROLA 1UA7A 1JU3A 1HVQA 3FO0H 5EDXA 4NQEB 4W6WB 3TBVA 1IAIH 4OKVB 4OQ1A 2IC2A 4ZO9A 1K2DB 2C3VA 4N68A 3FQWB 5I19H 4O5LL 1NLDH 3TN0C 3RWEA 1NAKH 3PXHA 3SOBH 1XF5A 3Q1SL 3LKNA 5DDHA 4RWHA 5DQ0A 3OAZH 1MWAH 1UYWH 3LH2L 4U1LA 2XZCH 2NPLX 1E28A 5I15L 2BFVH 1OGBA 2E26A 1EEYB 2P44B 5EU3A 1DBAL 4MXWL 3CH1A 4B3KA 2A6DA 4JN2A 3CJJA 1YYMH 1C08B 1EJOL 2F5BH 2V2XB 5SWZE 4R3SB 4D8MA 1XZ0A 1MFBL 1XF4B 3KE0A 1ROWA 2V5DA 1F4YH 3GO1H 3LPGA 3BN9C 3PIQB 4E8CA 1GOOA 4UI2A 3BZ4B 2DLFH 2P7TB 3LQAL 4I3RL 4AQOA 3WDPP 4JFFB 4NQDD 4G8GE 3DUUA 3L3JB 4X80H 3L9RB 5E9AA 3JUYA 2ZCKH 5CEYA 4ZUWB 2AK4D 5J3HC 4WWKC 4KGJA 4YR6A 4Q7NA 2V9TA 1CFBA 4RISL 1ZGLB 3G04A 2R2HB 1OARH 3KYKH 4QGYA 3MANA 1JVKA 5EO1A 1MI5B 2UUDK 4AEHL 2J2ZA 5KVFL 4M7LT 3QCTH 1WT5A 3ORJA 4P5TC 5AYQA 1LEKA 3UPAA 2J1UA 2IH1A 4Z0BL 2OKXA 2KUTA 1J8HD 3BAEH 2Y07H 3RX7A 2VRJA 1MJUH 3WIIL 1BTCA 3T77A 4HCRH 1HKJA 1OAUL 5DYOA 3QH3A 3CZGA 2WCSA 3MV8B 1CIYA 2EH8L 4JN1H 1KIQB 1WNOA 3IVKA 3UTPD 1OCWL 4WFHD 2HVJA 4Z7VE 1W0VB 1LO0H 4H88L 4D9QD 3BPLC 3QEHB 4EQ3A 3DUSB 5SV3A 1U0QA 3MOQA 5GSRB 5ACLA 5C08A 1VCAA 1XCTB 1JGLH 5F1IA 2JIXB 1J0JA 3DETD 5DFVC 4DK6A 2DQEH 4HXAL 3F58H 3QHTC 5KSAB 1IGJA 1N5AA 5ISZA 4LFHG 2C1OA 1Q9LB 2HT3D 1ODAA 3NBNA 2VERN 4NRYB 2VAAB 4XAKD 4DOHB 4ZUTA 2GITA 4OV6F 3U48A 5LWYH 2VZVA 3D48R 4OIIH 5B3JF 2EDYA 4U7KA 2GIYA 5I6XB 4KJWC 1VERA 3VE0B 2QQMA 4JFEA 1FAKT 1T83A 4F15B 1S5HA 4QXGH 5HI5C 3FCTB 4MCZB 1YUHA 1TENA 3SKUD 3NRUA 4JPVL 5GGVL 1BBDL 5DHYA 5DHXB 3X12A 4QCEA 1W9DM 1J88A 1MREL 3RZCB 4CN6A 1W3LA 1FORL 2YBRB 3QJHA 3IKCA 2B1AL 2A9NL 4UAOB 5F9WC 2YD9A 3TN0D 4QX2A 4I0KA 1OLZA 4P4RA 3ACHA 4Z76A 3C6SA 1T1YA 2J8UF 4JKLA 4PRHA 1P53A 3IDMB 3L1OH 4HWNA 4OFVA 2WPGA 1JDCA 1UD6A 3CNKA 4GG6E 4NQCB 1LO5A 3PGCB 4DM2A 2KZWA 3ARPA 2CDFA 2WINB 5M7QA 1B0WA 3FB5A 1JWMA 2D1ZA 1NEUA 4JVUA 5AWNL 4BUHA 1NWSA 5BCAA 2GI7A 3B2VH 3C60B 3RJQB 2WIIB 3FFCE 2ZOKB 1RJZB 1NAMB 3KPRB 4MNGE 2X5PA 1F11B 3Q5OA 5HYIA 4ERSL 1KULA 1IAIL 3PHSA 3BN9D 4UNUA 1NGWB 2ORBH 2VLRD 5DVNA 3P77B 1NLDL 2XWTA 2ATKB 2YD1A 1RUAH 1NAKL 3SOBL 3JXAA 1A3LH 5JHDE 5IHRA 1J5OH 1T6VN 3DVIA 1ZA3B 5HYJE 1HKMA 1MWAL 5J3HD 1S7QB 4WWKD 1UYWL 4BFIA 4GI6A 1EJ6A 1CLZH 2WBJB 3MOBH 3RO8A 3WLBB 2BFVL 1T03H 2C5DC 3FQRA 4AEFA 2GCYB 1JNLH 3CPUA 1DLFH 1G7JB 4I18A 4P5TD 1IAII 2ZUMA 3O6LL 1XR9A 1AR2A 5FYKU 4W8BA 2HJFA 2RVAA 1FZKB 1QRND 4LKCA 3FB8A 4ZXOA 1KT2B 3EJZC 3W0WB 3WXVH 5IJKA 1W9SA 3LN5A 1F4YL 3GO1L 4HP5A 3GSQA 4U6HB 4HUNB 1S9YA 4B41A 3VIGA 1U93A 2DLFL 4X6EA 3WEMA 3ARSA 2VZ3A 4ELME 3EGSA 4BKLA 4X80L 3V79C 1EFXA 1NDGB 4OGXL 2ZCKL 3UG3A 1T04A 5DD6A 1GAFH 2RIKA 4FQJH 8FABA 1DEEA 4I18C 4TX8A 2FLRT 1MSPA 1W3JA 3GEWB 2PBGA 1IC1A 4OZGA 2ZCLH 4MJIB 4W8AA 1OARL 5DFVD 1J1XH 1P84K 5IJKC 3RDKA 1S9VB 4KZEH 5HVFB 4P8VA 3U0TB 3ARXA 3QCTL 3NGBB 3OR6B 2VRQA 3RVWC 2PO6C 5EO0B 4NSBA 1E0OB 4M7LH 5DUMH 3TF7C 5D7JB 3T2PA 5ICYB 5GJSH 2Y07L 5L9DH 2XVPA 3HMXH 4YHZH 4Y7EA 5M5DA 2Q20A 5DJYA 2BSED 4HCRL 1MWAB 1J86A 4KWUA 1INQA 2KQMA 4YWGL 2FECL 3MFGB 4KJWD 4JN1L 1IM9D 3SUSA 4LX4A 3TA3A 4R2GB 2H3NA 3DOSA 5DD1H 3ZKMC 1GOKA 2NR6D 5FCUH 5HI5D 5C0AD 2DDUA 2YA1A 1LO0L 3VD7A 1II4E 3TYFA 4L8DA 3CDFA 4XVTH 3PDGA 1FH7A 2W4XA 1BEYH 4M5ZH 1KXTB 3LDBB 4KAQH 1JGLL 4MDPA 1NMCC 3ES6A 4ZTPH 4M4RA 2J3SA 1KLGA 3F58L 3OKMB 4WTZG 4ODHH 3WKMH 4CMHB 4U0QB 1G6RA 4HX1A 1J12A 1VFMA 2FECI 1A6ZA 3N9KA 4HKZB 3LS5H 3RKPA 3CC5A 1QSVA 2NYYC 3TP4A 3HLAB 3WFHA 5LWYL 3QO0A 4M6MH 4QLRA 1L7TH 3L3KA 1PAMA 5T3XD 1FHGA 3FT4A 3IS0X 3F2ZA 4F66A 3SY0A 3T1WA 5HHOA 4ZXLA 2GJ6A 1Z6JT 1NDMB 1PIFA 2WK2A 3LVEA 3QXVA 3DVGA 5J1SC 4QXGL 4XPHL 1V6VA 4YAQB 4CW1A 1U92A 3PL6A 3VFNA 4OZHA 5EU4A 1L7QA 4Y4FC 3MJ9H 3N17A 2YBUA 5CJXA 1V08A 2E6PA 2ZXAA 4H04A 3ZTNH 1DHKA 2Q8BH 3KPLB 1QFHA 1JFQH 2A6JA 1GHSA 3DSNA 4JRXB 3CFCH 1L7IH 1E4JA 2NW2A 3EO0A 4FTVE 3L1OL 3F65A 3EYPA 3AS0A 2RQ8A 4V2XA 1WF5A 3RDTB 1AHWA 3TV3L 2J7BA 3RWJA 3IGAA 1V05A 2PCPB 3J8F7 5GGUA 2EEBA 3U5YA 5A2LH 3BW9A 5LGJB 3K4AA 3B2VL 5AG8A 5CQ1A 1KLUA 2IGFH 2E0PA 3D85D 4TOQA 3WDQA 3NN8B 4ZUVB 1RZIB 4DZ8B 1CGTA 3EJZD 5ITFA 3NNGA 4CCCA 2AJZB 4OQTA 3V52H 2CK2A 2CLRA 4JO1H 1XFPA 3U5UA 4OFDA 2ORBL 6FABH 4JREC 4KK8C 3EBVA 1JZ2A 2YIHA 1XR8A 1A3LL 5EOTA 1LILA 1J5OL 2YD4A 3W9DB 3QUMA 4GZEA 2DQDH 2R23A 2DJUA 4TXEA 4GI8A 1H0DB 3BH9A 1INEH 3LY6A 4JDZB 3MOBL 4ZSOB 4H8UA 1JF6A 4TUOA 4JQXA 3W9EB 4Z7QF 1SHMA 3WHXB 4JO3L 1T03L 4OT1L 4RFNB 2Z8SA 1JNLL 2ATPB 3C5ZD 5B4NA 4ONHB 5EBAA 2ADJB 3RVWD 4RRPA 3B2UC 4Q6YA 5JOPD 3MYJB 4U31A 4Z7WA 4NFBA 2CUMA 2F54E 4QB2A 3GH7A 1NGQH 4EDXA 1HN1A 3OKEA 2DT1A 1ZBCA 4LPVA 2WMPA 3NAAH 3BE1L 3L7FA 4PRID 3B4NA 1I7TB 1KIUA 3P2TA 4P3CH 2IALB 1FZJB 3CSBA 3ZKMD 2CK0H 1IE5A 5HYSB 1WBZB 5A95A 5CINL 2P5WD 1GAFL 4FQJL 5DJ2B 4GG6B 1G9NH 3DWTA 1V3JA 2CRMA 3OSKA 4JQIH 4MJ5B 2EPOA 2FO4B 4LCYA 1UYZA 4OLVH 5LA1A 4G9FB 3VMPA 1AR1C 2APTA 2ZCLL 4Q7DA 4A3ZA 3N12A 1J1XL 4MMXC 4L9LB 3GIVB 1AIFA 4KZEL 4XAWH 4IPLA 3QPXH 2GT9B 1RK0A 3UETA 2WZIA 4W86A 1Q6CA 5DUML 4M7LL 5F6HI 4U6YB 2VXUL 4J3OC 5L9DL 3HMXL 4Y7MA 2NYYD 4GKZA 1MHEA 1ZHBB 1FYHB 1PZ3A 4KRPC 5KVMC 5GRUH 2NXYB 4HXBH 3ESUF 5DWUH 4ZXBA 5HHPB 2AABH 5A6BA 2HYMA 4XB7A 3S6CA 3CO4A 2ZSVB 4N1HB 5GISH 4MNQE 1GNXA 4UBDC 5FCUL 5CGYC 2WMIA 2YKKA 4QHUA 5M3WA 2XVGA 2AI0L 2BC4A 1BPLB 5F7MC 5SWSE 1H6XA 1LG2A 5FHBH 4P99A 4XVTL 3P0YH 4Y4FD 1BEYL 4F9LA 3GXMA 4M5ZL 2UYLA 1SYTA 2UZXB 5EU6B 4BCEA 4KAQL 5GRJH 4OZIE 4C7FA 3GSRB 4ZTPL 1V3IA 3EFFB 1RJYB 4LVEA 3THCA 3IU3A 3WF1A 3QAZC 3WKML 3KPMB 1KQYA 1HJXA 3FRUB 1ZBVA 5DK2A 1PZ5B 2AEQH 2FHFA 3DO7A 4K7PY 1H49A 2O5ZH 3LS5L 1PY9A 1LK2B 1GIGL 3QDMB 4LLYA 3T0EB 3TTQA 2WAAA 1X9QA 3GJEA 3MV9B 5D2LA 3VW3H 1CENA 4PJXB 3ZE1F 3WLWC 5EU5A 1GC1H 4OF5A 3V4UH 3UTSD 1A3QA 3DX8A 4PBWD 5JXGA 4X6CE 3RI5K 4PPTA 1AGDB 1BFOB 1FZMA 2XTJC 4P59H 3INUH 3MJ9L 3I2JA 1P4LA 4QDMA 4F80A 5I8CA 3HNVH 3SUWA 5EC2A 3ZTNL 2FX8H 3B9KD 2DI7A 4GXUM 4KK8D 4JFSA 2DLGA 2Q8BL 3I3EA 3ILQC 1JFQL 1UR1A 2FJHA 4YBHA 3CFCL 2YLLA 4Z2HA 1L7IL 1SJXA 1CLCA 5G04L 4KI5E 4UTBH 1VGEH 3BP7B 3BZFA 2X70A 1A7QH 2J8HA 4C56D 3SCUA 3IXTA 4M93C 4UT9L 3WE6A 1GORA 2IGFL 4G7YH 4PJ9B 2WMGA 5FK9A 2W0PA 1ZA6B 4ODUA 1NGZB 1DN0A 1HSAA 3E2HB 1GOMA 3RBGA 3QIWB 5D1XB 4QRRB 2XKUA 3V52L 5ESVB 1RVFL 4PJFF 2BNJA 4OLUH 2ED7A 3SCMB 4ELKA 6FABL 2W62A 3CUJA 1TVNA 2DQIH 1PEZA 2F74A 1H5VA 2VITA 4PYHA 4JFUA 5ABEA 3X3GL 1OGAA 3AREC 3WF2A 2H1PH 5TJWK 2DQDL 4TQEH 1UGNA 5A2BA 3ARGC 1E4NA 5ERWA 3Q2CA 4HLJA 1XIWB 5CLTA 3DX9B 5HPCA 5CWSB 1ETZB 5KSUA 2WQRA 3PZNA 1AR1D 4PREB 4YK4C 1A4JA 3V5DB 2MHAB 3VWKB 5FUZH 1N0XH 4A3HA 1A6PA 4RMUA 3I02B 1MCHA 1UY3A 4IRJA 4J1UA 1X5LA 1CNVA 1E4XH 4EXPX 4OF7A 4PLKC 4GUPA 2AQ2A 5D5MA 2CKBA 5I1EH 2BVOA 2NY1B 1A7NH 3MV7B 5IVXE 3ZDZF 4KRPD 3VRJA 4RZCA 3ZT6A 4PG2A 1AI1L 5E8EA 4FLRA 1UEMA 2GUOB 1RZGA 2XNAA 3NAAL 3ZSSA 2PYED 5JBFA 3ZE0E 5T1LD 5JOFB 4RAVB 1I1YA 3JV6A 4JDVA 4P3CL 3FB7B 4WW2B 3BD5A 2B0SH 4WDIA 3EO1B 1YMHB 2LQRA 2VCCA 5CCKH 3VIFA 1MPXA 4JQIL 3QEUB 4NJ9H 2DIJA 4OLVL 1GMMA 3V9FA 3NA4A 3ZYJA 2CKRA 3OLDA 4BZ1L 4H8HA 5IROC 4XWOC 1DE4B 3D25A 4R7DB 4PJIF 3MA7B 3GZKA 3OHXB 4XAWL 4M1GH 3QPXL 4XXDB 3IDUA 4PTWA 2EDXA 5ABGA 3U4EA 2DKUA 2AEPL 1FLRH 3W38A 2EIBA 5HHVH 2EDOA 3GSVA 3IXAB 3CU7A 1BIIB 5I77A 3ARTA 4YGAB 5DWUL 5IESH 1RURL 2BY2A 2AABL 2H9GA 2A3HA 5GISL 1W72B 1JAEA 3D87B 3PXJA 1QOKA 1KPUB 2QQIA 5F8RC 3NIFF 1WP6A 2KDGA 5FHBL 3IJYA 2XTJD 3P0YL 1WAAA 4ONOA 2HMIC 4P5YA 3CSYA 3T65A 4HFWB 3APGA 3DXAE 4WFFE 1RK1B 5TE6H 2WVVB 2DSVA 2BVQB 5GRJL 4F9JA 1L7RA 1EQCA 3JVGC 3ILQD 1MOEA 4NDMA 1OOAA 3O4OB 3CFEA 4LPUA 4NN7C 3VFRA 4Z5RB 5C07D 4UI9L 2AEQL 3FO2A 3SBWA 4YDVB 2YMXH 1RFDH 4IS6A 2APVA 3VA2C 1X5ZA 2HG5B 2VWEC 1KJVB 3WSQL 1GZPA 2ADGA 1KJ3H 4KRLB 1NC4B 5J1TC 4HV8A 1WCQA 5E5MA 3T2NH 4N9GA 1W2PA 4HIJA 4UQ3B 3QXWA 5JDJA 2Y5TA 4GZ9A 1LLOA 4P59L 3INUL 4KROB 4JFXA 4J7RA 1SG3A 5C0RH 1H11A 1X5FA 2F8XC 5B39A 1KPVB 3HNVL 2H41A 4M29A 2FX8L 3BO8A 4HKBA 3D18A 2F8VA 4I5BA 1UD4A 1FNSL 1YQ2A 4LNVA 3ZR6A 3ARED 5K33A 2DSZA 4DEVA 4PUDA 3ARGD 3QDGD 3EYQD 2J1AA 3RWCA 1CGYA 4UTBL 2I60H 2IAMB 2WUHA 3VDBA 1VGEL 2VLLB 2FBOJ 1XGPB 3SUUA 5HDLA 4GT7A 5C0EA 2CH8A 4MGSA 1U30A 2EO7A 1KGUA 3PN8A 3O3DA 4YXKH 4MXVF 5GS0C 4PLKD 4G7YL 2J5LB 3DMMD 2WW8A 1T7WA 4OD2A 3PUHA 4AEIH 1BQSA 5AZEL 4X4YB 5ANME 2BP3A 3HA0A 4GW4A 2C3WA 4OLUL 3NJXA</