2VZVA

Substrate complex of amycolatopsis orientalis exo-chitosanase csxa e541a with chitosan
Total Genus 280
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
280
sequence length
857
structure length
857
Chain Sequence
LSVGAAAGNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSATSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
total genus 280
structure length 857
sequence length 857
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzvA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzvA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzvA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzvA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzvA03
4PJFF 4PJBF 1CT8A 2P7TA 3BZDA 4NN6C 5CD5D 3IJ7A 3CFKA 4M1GH 1HOCB 5IBLD 4C58B 4ONHA 4ZG1A 5CSUA 5D7JA 3E3QC 4Y19E 4HCRA 2PTTA 4D0BB 3HHRB 4K94H 1SEBB 4PMDA 4BM7A 5DQ9A 4CMMA 4FP8L 4CGTA 5IIEA 1ED3A 4JPIB 4YUEL 1FAIL 5DD0H 3VXQB 5LKNA 3MUAA 1LO2L 2IPKA 1QSEA 4LRNH 4MNHB 3M7SA 3PWJA 3HZKA 5DJAA 3VFTB 2EE2A 5C0CD 4R96B 3U7BA 3CVHL 2IADB 2F54B 3WL1A 1MRCH 4HF5L 5LCVL 3AQUA 1KLFA 5E4EC 4TOYH 3RRQA 1HIML 4APQC 3MRFA 2C3VA 1OP5H 5K9QG 1KR1A 4DCQA 3K77A 4LSQH 4WVRA 1YEDA 4PRHE 1E6QM 4KDWA 2Y6JA 1RK1B 4D6EA 4B5EA 3BAKA 1U8IB 1S5HA 2EH8H 1BJ8A 2WWMD 2XPKA 5GGVY 5FCUH 4Z95H 3GKWL 4I18B 5BRQA 4HGWB 1MRDH 2D7PA 3KPPA 2ZJSL 4HU8A 5DD0L 3KYAA 3PABB 1G84A 4Y4FD 2Q7YB 4HFWA 4AYFA 5T1LB 5E9DE 2BY1A 4O2EB 1CLVA 5DPNA 5SV3A 1EFXB 1MRCL 1A2YA 2IPUG 2FWOB 1TJGH 4QRRA 1BEYL 1V7MH 2AMGA 2G9HA 2JE8A 1U93B 2HMID 3BFOA 4HJJL 1MCWW 5I1EH 1UADC 3UDWA 2AXFA 5DJZA 2EKSB 5I74B 2GUOA 3IDYC 4XCNA 3NIGE 4JDVA 4TUJA 3EFFB 5ALCL 3L3IB 4P08A 4ONFH 2EH8L 3CZEA 3HMCA 5CG0A 1FL5B 1KULA 1GAFL 2CK0H 4M7KL 1V6UA 3QXDA 5D7JD 5TD4A 5C2BH 5JW5B 1CF8H 4QOKE 4Z7UA 1IAMA 2YC1B 5MEPA 4MA7L 1OTUD 3DI3B 4NQXB 1C7TA 1KWKA 1OBAA 4BQ4A 5F9WB 1NLBL 4MJIB 4HK0B 4JFOB 3REWA 3X17A 1TJGL 2XWJA 1RUPL 2GEEA 5AUMA 1FIGL 4Y5VC 1QSED 4H20H 4XXDB 5I1EL 1T89C 2YA1A 4JB9H 4D3CH 4QCIA 3VXPB 3WO3B 3U48A 4PF1A 5EWIL 2NY6C 3VVGA 4ONFL 4PMNA 4MWFB 4NYLA 1QLFB 2D4FA 1HKLH 3CX2A 3DECA 3U7AA 2F8QA 3HZVA 3F5KA 5C0AB 3LD8C 4PP1D 4WTZG 2CK0L 1NDMA 5ISZE 4Z2KA 5JXJA 1DUYA 1RZFL 1BVKA 1JGDA 3STZB 4P8WA 1EZVY 1RHHB 3N9GH 5HNNA 5I24A 5DT1H 4JN1L 4XGZB 1D5XA 1N6UA 4XPFH 2AV1B 4GUPA 4DGVH 3NFNA 5GPRA 4RWHA 2B39A 1GGIH 1OPGH 4D3CL 1F3JB 2X09A 1W1TA 4IRZL 4QTHB 5DA4A 1DEDA 4I77H 1T0MA 2C1OB 3HC4H 4N0CC 4YBQD 4N8CL 3WHE1 4WI2A 4HKBA 4QRRD 5CP7A 1UA7A 3WEOA 5L8JB 5TDNB 5BJTA 1RK0A 3GBMH 3FT4A 5A2FA 3O2DA 1AD9A 1TZ7A 1Q0YL 4GG6A 3A67H 3RGVB 1HKLL 3BGAA 4ZPVB 1FH5H 4KPHL 1QBMH 1G1CA 2AJUH 4GZEA 2IANB 1BLNB 1QVOB 4C56A 4FFVD 3WHXB 1EA9C 3GMOB 3W29A 3N9GL 3VMOA 4B50A 3VM5A 4EI6A 3RUGB 1II4E 4C83B 3ES6A 3CFJB 4QXUL 3AHVA 3PZUA 1MCHA 3WUEA 1YYMH 3WD3A 3H7BA 1UM5L 4GWIA 3ZJ7A 3UTPE 1SMDA 5LWYH 1C08A 3S36X 1CXIA 3FB6A 4I77L 4XC3H 3HC4L 2XNAA 5BXFB 4AEHL 2NXYC 3CDFA 3UYRH 4X6BB 1ZTXH 1JAEA 2D9QB 3A67L 4JQVC 2P8LB 4ISVA 1OWRM 1UXXX 4J4PC 3LV3A 3AIWA 3CSBA 4K23H 1KIRB 3ZE1F 1N59B 4NRYA 3IKCA 2VMFA 3AI0A 1HKJA 4JCLA 4Z8FH 1ZLWH 1ZJBA 2WZ8A 1ZGLA 3MLYL 4P5KA 3SCMA 3O8XC 3PTMA 1AIFA 2W07A 3GRWL 1CZ1A 1U8LA 4PJ8A 3BCFA 5JW4Q 3MNWB 3QIUA 3EYPA 2Q20A 1YYML 4OCSH 1FVDB 3G6AB 3NN8A 1LWHA 2OSLB 4AY0A 2GVYA 2D7TL 5DD1L 5DZNA 4HJ0C 2YPLA 3K2UH 5LWYL 4GRLC 1K9EA 2VZUA 1K12A 5IB5B 2FX7L 2WB5A 1M7XA 2DLFH 4QRTB 3WD0A 3L3KA 4FZEL 3UYRL 1KEXA 1P84K 3QO0B 4PV8B 1OSPL 4OF3A 5AG8A 2WO2A 4M29A 1H0GA 5LQBH 5AD0B 4OCNC 3ULSA 2CH8A 3W6MA 4EJ1C 4PTWA 1UR1A 3ME0A 4NCC2 3HI1A 2XUCA 3KYMA 5DRXA 3IDGA 3TFKC 3QFJE 4RX4A 1ZHLA 5AYUH 4Z8FL 3R06B 4AT6A 2JB5H 2UY3A 2R1WB 2R56L 1JF1A 5E6YA 1ORQB 5TQ0H 1SBBA 3O2VL 5E6IB 4C56D 1ZLSH 4TSCH 1EGJA 3OX8A 4HIEA 3WJLC 2YJQA 1R3JA 4MB1A 3OG6B 4F15B 3PHSA 5IVNA 1IFHH 2B31A 2BVQA 3IAPA 2EH7H 2YA2A 3CSYA 4QHKI 3WQ8A 5KVGL 3DHMA 2XG4A 4HZAA 1GU3A 5D7IB 4PJ9B 4YX2H 1FSKB 5DS8B 4PGDA 1CPUA 3SCUA 4D9QE 5EG6C 3SGJA 3MO1B 5DEFA 4MNLA 3TNNA 1KJ2B 2CIKA 3FOLA 5FDYA 3NCYS 1BPVA 5F6IB 1XYFA 3R0MA 4OZIF 4W8BA 1YNTB 2KPNA 1GJUA 2X70B 3RWCA 2Y5TA 5TQ0L 4MXQD 1OGTA 1I1XA 4V2CB 2EPNA 1ZLSL 4TVUA 3QQ3B 3P73B 1KCVH 3HR5B 3CMOH 3EOAB 3TBSA 2JELH 3HUJF 3GSOA 4QT5B 5CJQL 5BZDB 2Z1SA 3SCMD 4NUJB 1NGXA 2CK2A 4YHGA 4ZXOA 1KJMB 2EH7L 1HDMA 1FZKA 2HVKB 3MRNA 4IHOB 2DSKA 3EIFA 4MHHI 5KVEH 2WK2A 1QHOA 1NCCH 1NGZA 3WSQH 4RWYH 2ZUVA 4E42B 4W7VA 2WMJA 2YPLD 3VXRB 2E7BA 3N1QC 2DSWA 1IAKB 5K9KB 5HGHA 4Y16C 3SCNA 3PUCA 2R9HC 4N0UE 1QSFB 3EYQC 3ZKND 5F96L 1EXPA 3EMZA 4Z78B 3TH4T 4KHXH 3PQYB 4RA3A 4RMRA 2WAOA 5IEHA 1AXIB 4X4YB 3RWJA 2WWCA 1OAQH 4GAJL 5EULV 1R5VA 5K9OA 4RX4D 3TT3H 3I85A 3U0WH 3B8SA 3QPXH 3RVTD 1LNUA 1Q94B 4IIQC 4JHZA 1F6LL 4Z7VA 1OF2A 2KBGA 3B9KB 4X7SL 2NW3B 5HY9A 5ID0A 3QUMB 1KGCD 4M5ZH 1W99A 1NFDA 1PW3A 4MCZB 3CD4A 3OMZA 2Y36H 1GJIA 1K45A 1RJZA 2CUIA 5EOTA 1KEMH 3SGEH 1QFPA 4KKAC 4ENED 5KVFL 1IM3B 4ODWA 3H9HA 3IVKB 3WFHA 4XMPL 2EDBA 1FL3B 3A6CH 5T1KB 4U0RC 3WQVA 1OT1A 1G0XA 5DQJA 5EBMB 4UTAH 1CGWA 4KROD 3F7QA 4YC2C 3BH4A 5A8OA 3MRIA 2B4CC 4KDTC 2DQTH 5KZ6A 1ZLVK 3BZEA 2QQNA 2WO3A 1ZKAA 2I9TA 3DHUA 3I6GB 3OKOA 1T1YA 2WZIA 5IM7A 4GRWF 4XBPB 1JAKA 3QSKB 3U0WL 1MELA 3QPXL 1LF1A 1N8ZB 4I0PA 5HPOA 4L8BB 3NZ8A 3CCHA 3FTGB 1JPSH 4GZJA 3NDYA 1MHPL 1KELH 3M45A 1A1MA 3DRTB 4OD2B 5KS9B 2J3SA 1V3LA 3RL1A 3EDDA 2EDWA 3TBYB 1E4KA 3T2PA 2Y36L 1RZJC 3OR7A 5I0ZA 1XH3B 3IDMA 4WW1A 2A6KA 1KEML 4HIXH 5JXEA 1JCKA 5C71A 3H9YA 4KK5D 5A69A 4JFXA 1PVHA 3B3IB 1RZ8B 3PWLB 4JR9L 2YHGA 1B0RB 1JNLH 1CICB 4XXCA 1TVGA 3OKNA 5FO8A 3G04A 3RQ3A 1U33A 4UTAL 4JREC 1HKIA 5JOPD 3RM4A 4L9LA 3G6LA 2DQTL 4ODBD 1QI0A 5LG1A 2WKGA 2V9TA 2NLJB 3BKCH 5E08L 2VMDA 4PGEB 1TVHA 4LCYA 1TLKA 4IOIA 3UX9B 1FYTB 5I15H 1U3HC 4ZUWB 3OJDB 3RL2B 4LPWA 4AXNA 5D8JH 2ZX5A 5J6GB 4D8PB 4P57A 3QUZA 4PY8J 4NNYB 1OIFA 4JRYB 4G9FB 1E4JA 4Z7OE 4PJCF 2JCCB 2FIKB 4OFYA 4CMHB 1GHFH 4U2ZA 1RJLA 1QFWI 1VGKA 1JNLL 2ADIA 2GCYA 1FN4A 4FS0A 4K3DH 4PQQA 4CADB 2ZUMA 3DV4A 3U0TB 1HHGB 2PXYA 1UR0A 3P30H 1JP5A 3ILPA 2A77H 3QEQB 1IEBA 1CFQA 4WUUB 3U37A 2PI6A 1A64A 3DYOA 5HHNB 3ROLA 3N12A 3VTRA 3GHBH 2R0LH 2X4NA 1RH9A 1OY3B 5I15L 1VENA 1S9VB 5ABGA 2BSSB 2EEBA 2EO7A 3MRBB 5CWSA 1DQDH 2VXUH 4UNUA 5D8JL 3TA3D 3AIVA 4ZFZB 5IJKA 4HWBH 4I0PD 3VW3H 2HJKB 1BZ7A 1NAMB 5GRXG 3V0WH 2X8RA 5DHVH 2NXZC 2E6PA 3HA0A 5DVKA 4E0RB 3AICA 1QQDB 1KTDA 3SKNA 1JN6A 3DRQB 2QQOA 4P9HL 4HUVA 2WKLA 4NRXA 2VMEA 1I7TA 2BHUA 5ITFA 3NH7L 4FRWA 4AH2B 4S1SL 3S88H 2NNAA 1ZVYA 4HUUB 3GTNA 3QNXB 2A77L 1G9MH 1A8JH 5I8EA 2GTWB 1VJSA 5IW3A 5C0CB 3DXAA 2NR6D 4JFWA 4LRIA 2WXDM 5JHDA 2UZIL 2XICA 2Y1VA 4DQOL 4PMXA 1AO7A 3WXWL 4U33A 4AENA 1JZ4A 1V6YA 5C86A 2BOBA 5D2LB 5EU6A 2YMXL 4HOXA 3EYFB 3VW3L 1XF3A 3VGAC 4ZAKA 1EDQA 1TFVA 4PG9B 5JIIA 4OFKA 4X5WA 5HI3C 1ERNA 3U4AA 2VZQA 3MX0A 3I3BA 4OUUB 3QWOB 4N8VB 4NF7A 1MFBL 3DVIA 4RL3A 1J10A 4HZLB 3ESVF 2YZ8A 3SEPA 4ZFOL 1CZVA 3PL6C 5F3HB 4YK4B 1J86A 4DKAA 5EFDA 4OFYD 3S88L 3U1SH 3SCSA 4KJPC 3HZYA 1RFDL 4L8CA 1E4WH 4W4OC 2YC2A 4WU5A 3RX5A 1G9ML 4X80L 2HVJB 3MU7A 5E5RB 4OZ4A 3I2GA 1NCAH 3QHFH 3ULUD 5EIIB 1UYWL 3BQUA 4OZHB 2PXYD 3RJQB 3UG3A 1A1OA 2ZX7A 5CSBA 1MVUB 4F79A 1NGYB 2OS7A 1NBYA 2PN5A 4MNGE 4RISH 2N4IA 2XQYG 3ESUF 4M8QB 4PMYA 4PB0H 5IJRA 5T3XD 4WGVB 3EOTH 1CT8B 1G9NC 2P7TB 1Q9OA 3QUYB 1ZBKA 3F4VA 4PYSA 2BXZA 3VD9A 4TVCA 1I1CA 1KSRA 4JANA 3OHXA 5L0QC 3N04A 1AE6H 5B4MC 4J1UA 2KZWA 4ONHB 1KGXA 2YK1L 3WN6A 5D7JB 3U1SL 1OSEA 1T66D 1ISXA 1UWIA 4LQ1A 4MDJB 3MJ9A 2B8OT 4PJIE 4HAGA 5BWFA 3GGLA 3BP6A 4PJDA 1MJ7H 2RCSH 4XCCH 4CMMB 1TMCB 2J79A 1J1PL 1ED3B 3EW3B 4WFGD 1IC1A 1E1EA 1PYWB 1J12A 1FNLA 1WTGT 5AC4A 1KOAA 1A14L 4I3RL 4GIAA 3PWJB 3HZKB 2LTQB 5DJAB 2XFXA 3EJYC 4OFPA 3V7MA 3DXAD 1B4RA 5SWSA 5IOPB 3ARFA 5JHDD 5EZIH 2XT1B 5A2IH 3VA6A 3G08A 4PV9A 4C7FA 2XFYA 1MI5D 1AO7D 1I1FA 2MCPL 4FFWC 1S7XB 3QULB 5I79A 3A6OA 2C3VB 4ZS6C 2W9EH 2A3EA 4Q7NA 3UEQA 2LU3A 1YEDB 4LCCC 5EU6D 1US3A 1HP4A 2ZOXA 4QX3A 3PUIA 2AK4B 3HG1A 4ZAKD 2F53E 2WMKA 3VXNB 3QUXA 1AJ7L 3QFDA 5DFVD 3NFPA 1A7QH 5JA8B 1XIWC 3OB0K 4P23C 1EERB 1LK3L 1R3HA 1MJ7L 1ZS8A 2RCSL 3GK8H 4XCCL 2P5EE 4Z0BH 2CKBH 4UBDD 1CE1H 3O81A 4NQSB 5CYYA 5C0FA 2VRAA 4MVBC 1KGWA 3PZIA 1WICA 5T3ZD 3ZE2F 3EO0A 1GOIA 3WN5C 4IUGA 3BQUD 3PIQB 4NN7C 1MCSA 4MXVE 4UU9A 2OTWA 1P5UA 1WBXB 3LDBB 1J0YA 4OM0L 5FK9B 1BJ1H 5CSYA 5DJZB 2NPLX 4LLDA 5EUOB 4BFIA 2GUOB 1CE6B 3T0XA 4JDVB 2VWEC 3AIQA 3RZCC 2X1XR 3QNYA 1HSAA 1A9BB 2ZUQC 4XTRC 5I1KH 4E5XA 3H6JA 3U7WH 1KB5H 4MNMA 3BN3B 2ARJA 2VDPL 4CCDA 2V7NA 3GK8L 4Z0BL 3UZQA 3LEKA 4U1IB 3GBEA 2CKBL 4NWTL 3HCVB 4M81A 4Z7UB 5MEPB 4JVPA 3MMUA 3SJVE 5I1IH 1LHZA 1RIHL 3REWB 4XI5D 5DJCA 3H42L 4NKIL 1ZJAA 2CQVA 1CIYA 3LSOB 1MQ8A 3DGCR 5SWSD 3ARFD 1ZVSA 3NCMA 5EN2A 2FH6A 3Q3GA 4YPGB 5DJXB 3MNZB 4NYLB 1WFOA 4OKVB 3U7WL 5I76A 1W0NA 3EUUA 4K3HA 4BQ5A 2NTFB 3HZVB 3HG1D 3QUXD 4HPYL 3ZZ1A 1VPOH 1BVKB 1J7VR 2JJVA 5J13C 3V6BR 5I1IL 2LVCA 2EPLX 4HQQL 1D5XB 2FO4B 3ECQA 4GUPB 3SUSA 3NFNB 4EDXA 2WP3T 4LMQI 4P59H 3QHNA 1QLEH 4JFYB 1K4DB 2VC2L 1WVZA 4NUGH 1LK2A 2ED8A 2VQTA 4KY1L 1NEZA 3O41A 5FYJL 5C6PB 3HMXH 1T0MB 4OQTL 4UAOB 2FJGA 3IGAA 2FO1A 1UACH 4FOMA 5HSFA 5BJTB 3FT4B 4O5LH 1Y18A 3HI5H 1OD8A 3NPSB 3QHMA 1SYVA 2FLBT 4OCRH 4PN2A 1TNNA 2EZ0D 2ZXQA 1AR1C 4UOQA 3VXTA 3ULVL 1VPOL 2Q3ZA 3IU4H 5BOPA 2JD9A 2NX5A 4KKBD 4F3FB 5D9MA 3E8UL 1ODAA 3JV5A 3ES6B 1X6NA 2XV6B 4NO0B 5E03A 5IG7A 2XTKA 3C6LA 1G7HA 1QLEL 3I84A 3H7BB 2VXQL 2F8VA 1JNEA 2HTKD 1NBVH 1FV1B 4KTYA 2ICEA 3KHQA 5IMLA 1C08B 5D5ME 4MQXC 2C3HA 2XNAB 3GI8H 2OZ4A 3G5YA 1G0DA 2XVNA 3GBDA 3FQUA 4XUPA 4PJXA 4KGLA 2R2HB 4OCRL 1FBIL 5IVXA 2G3IA 3OKEB 5GRVK 4CKQA 4M7LT 2DI8A 1FAKT 4ZSOE 4NRYB 1YEIH 5E00A 4ZDHA 4HLZH 3IT8D 4Y4KC 4MO3M 4YFLF 3BHBA 3NJXA 5G04L 1ZGLB 3LQMA 3SCMB 1EQPA 4PRBA 1T22A 4ZTPH 3RP1A 4P2OA 1K4CB 2W1NA 1QI2A 1S9WA 4IRJC 5D1XA 1SJEA 4D1IA 4YEFA 2XSAA 5EJ1B 1NBVL 1NGPL 4G8GA 5F1OB 5CZXD 3OV6A 1CDUA 3KLHC 1H4PA 3RVWD 1H11A 2YC4A 2ZCLL 4HWEL 3GI8L 4HZ6A 1RZ7H 1GQPA 4NFCA 3BKJL 2B1AL 3SE8H 2CNCA 1FRGH 3MRPA 3M8OH 2XKNB 5HI4C 2YFZA 3S37X 4OMCA 2OXGA 3ULSB 1HQRA 4P7LA 3QDGE 2BCKB 1YNKL 5DRXB 1YEIL 1Q9LB 1WTLA 4JFPA 3GMMA 4IRSC 5L2KE 3VI3F 4AT6B 2JF7A 4H25B 1N64L 5GS0L 2W95A 3TF7C 2ERJB 2Z92A 1KENL 3GKZA 4UI9L 3CHFA 4QNPF 3UJJL 4YXKH 3OX8B 1V3JA 1L4IA 4WY7H 4M4RA 3MRQB 5E5MA 5DQDH 2VCAA 1S9YB 2BVQB 1D5MA 3AREA 2EIEA 1BGGA 3LE0A 3C6LD 3CLFL 2VM9A 4NWUH 3S3JA 4DK6A 4NZTH 1SBSL 4KKCD 5T1MB 3S35X 4J6RL 2CRIA 3FO0H 3TO4C 1MSPA 3EDEA 4KROB 4UQ3A 3UBXI 1M71A 4MCYB 2HJFB 4IMLA 4TVPD 1L9MA 2BVEA 1QBLH 4YPJA 5FO9B 2CRZA 4N0YH 4R0LA 5KSAD 2RGMA 2YUXA 3CZGA 4F9LA 3NCYP 4WJXA 3BIKB 3RWCB 2B4CH 2DMKA 1DL7L 4LVEA 1OGTB 1OGBA 2J6EL 3G5ZA 5HI5D 1GOGA 2APVA 1OD3A 4NQDE 3TBSB 4HZ7A 2DL9A 3GSOB 1U8KA 4U1GB 5DQDL 1LD9A 5I16B 1HDMB 3N1PC 5I75B 2QHAA 2FL5A 1QA9A 4P2OD 5J56B 5DK0B 3F5WB 4NWUL 5D1XD 1NP2A 4DUVA 4OCYH 3WFCL 4NQEE 4G8GD 3SKOB 1RZJH 5JMOC 5HHPB 1S9KC 2DQXA 3W6LA 1NH6A 5HHVH 3Q48A 4EUPG 3LB6C 2YB7A 4K3JH 2R4RL 4NN5B 4FQPA 4UDUA 1QBLL 5C09A 3T0EB 4K71C 1FH8A 5IEHB 2QV4A 4WU7A 5DR5L 3ARZA 2DCKA 3BW9B 4EDWH 1Q0XL 2B4CL 43C9A 2NZ9C 5K9OB 2UUDK 4UIKL 4I3SL 5C07A 4KI5F 3RHWK 1LNUB 1AHWC 3KNBA 1G0CA 5JW3L 3PWPE 1CFSB 1ETZB 3W39B 4PJ7A 3W82A 2W94A 4QDRA 1A6ZA 3W9DA 2P1YA 1X6LA 3GMQA 2VDNH 5ID0B 4R8WL 4JDZB 2VZPA 3SGKC 2H32H 1HYRC 3FO1B 1NFDB 2G2RA 4KFZC 3QO1B 1AKJA 3CFDA 4OCYL 4R7NB 1RJZB 1T1XB 1PG7X 1WDSA 3ARED 1ZK9A 4ODWB 1XR8A 3GZKA 4PYGA 5A2LH 3ZO9A 3BGFC 4YHIA 5FUCE 3QEHA 3FFCA 5GHWH 5GS3A 4YHOH 3JTSB 1Z9LA 1IGTA 4RMTA 3ETPA 1MWAA 1O8SA 3LEGA 3GFUA 2XFRA 1T80A 1DE4A 1KCRL 4EDWL 4TXEA 4F9PC 4NBXB 2I9TB 1ES0B 3TA3B 4G8IA 1ZANH 4NNPH 5CD3A 4ATWA 1W9XA 3RM9A 1LQ0A 4I0PB 5I19H 1W9PA 3WF4A 2EDRA 3NZ8B 3CCHB 5HJ3B 2F61A 1RD6A 1V8HA 2ZP0T 3UG5A 1A1MB 2DQFB 2VDNL 4LOUC 2YN5A 5CSGA 1CLCA 2NY3D 3GBLA 3OR7B 4J8RA 1AQMA 2A6KB 4GQPH 1H2JA 1UG9A 1DQTA 3L5IA 2DQGH 1QPKA 2Z93B 4F57L 5D9SB 2OI9B 5KOMC 5GHWL 1XR9A 3MCKB 1IGCH 1A7OH 4J12A 4H1LG 3SO3C 3HE7C 2X1IA 4L9LB 3HNMA 3KXFE 3QI9B 5J6HB 3II1A 3WFLA 4ZY9A 3VIPA 2B1HL 3BC9A 4OCWH 3SKMA 2EDYA 1UWSA 5C09D 4NNPL 3WCYA 4RFNC 1DBBL 4XUTA 1AC6A 4HLZG 4IOIB 4D1JA 4CAGA 4X9IA 1W2KT 4Y4HA 1SJXA 1UC6A 1TCRA 2NY1D 4WNQA 2IG2H 3WF2A 5C07D 4X7TA 1JMXA 1EHXA 3C8HA 5DRNB 4P57B 3AIBA 1G7LB 2X1WL 4DZ8B 2XTJD 4LYQA 1UB5B 2DQGL 2AJYH 2G41A 5EIVA 1RJLB 1RZGB 2EDQA 1XH1A 3WY1A 4NKOA 4NKMA 4QGYA 3VFWB 1AKJD 1MFDL 3WS6A 3L5JA 5M95B 1A7OL 4V1DA 4ELKB 4KRLB 1ZT1A 2P5WE 4YHLH 1ULVA 1JPGB 1HNFA 3K3QA 2N7BA 3P9LB 4TX8A 3FFCD 5IF0B 1CFQB 1QOKA 4NM8L 5TE6H 3ROLB 3FQWA 2X4NB 3D6GA 1CFBA 2X42A 5E9DA 1HJSA 2QPSA 1JGLL 2ICCA 4KRPD 1XAUA 2IG2L 3QCTL 5CWSB 4YXHH 1WZAA 2AXGA 3UTQA 1ZU8A 3ARBA 5DWUH 4GWJA 3STLA 2AJYL 1KTDB 3SKNB 3UTSE 2FDBP 4F7EB 1G9NH 3OAUH 4NRXB 1C5DA 1FZJA 1G6RA 5ITFB 4OTXH 4P46C 1B0WA 3VFGL 2WM0A 1YJDC 4GRMA 4XCYA 3RI5K 1V02A 5JUEH 3L6FB 4DM2A 4D94A 4F9DA 2J7MA 3IDJB 4GBXC 1P1ZA 3FRUA 5JOEA 4Y19D 2WVUA 3MOQA 3QZWA 1M05A 4PY7A 4QOKA 1IQDC 2FJHB 1H1NA 1CR9L 3DXAB 2WVVA 4NFDA 5JHDB 3FY1A 1R8LA 3AMCA 2BNRE 1TETL 3CFEA 1MI5B 5F9JA 3DARA 1R64A 4FFYL 1UD8A 3SDAC 4HGKC 3BSHA 5A8MA 4H1LA 4PG2A 2ITCB 4ORGB 5D1ZB 4ZAKB 3V7AE 3I2IA 2IPUK 5FYKH 4JGMA 4OOZA 3RGHA 3QG7L 4O2FA 2EXWC 1NCBH 3FZUC 1G9NL 3PV7A 1KJ3H 4G7YH 5FYJE 3T04D 4JZJA 1JK8B 4LVOB 1F13A 4PRHD 4ZEPA 5ANME 4HDIA 4JZNA 3HZYB 5JUEL 4BQBA 5DMYA 4L8CB 4WU5B 3FFDA 2VE6B 2CBJA 2Y07H 2O5YH 1CDGA 2N1KA 4ORZC 2FB4L 1BIIB 4R7DA 2Y25A 5MEOA 3BQUB 1D6EB 3A4XA 5F89A 2WP3O 1ZLUK 1F3DH 3RA7H 1HCVA 5AYQA 5I1HH 3ULVE 2EDJA 3QOKA 2Q8BL 2YL8A 4RAVA 2ENSA 4DK3A 4TUOA 5E9DD 3UJIH 5IGXL 3WBDA 1VJZA 2ZUSA 2CR6A 3TJHC 1NCBL 2R23B 3HAEA 1UYQA 1KTRL 3ARBD 1OCWH 1IAIL 1KXVA 3SCWA 2WCSA 1ONQA 3CIVA 4J1UB 4HS8L 4JFEE 2XRAH 2O61B 3BI9X 3ZDYF 1LEIB 5DDHA 4A6YA 3FN3A 3BT2L 5EU4B 2R2BA 5J1XA 1U95B 4UILL 2P46B 1EEYA 4PJDB 4HBCH 2BVUA 1FLRH 4JLRB 1MVFA 3L3DA 5A16B 1TJHL 1MXGA 4HJGA 3EDJA 1JWMB 3WFBL 3DX6A 1GSMA 5I1HL 1KN4H 5I1DA 1KNOB 5JUVA 5I0DA 3CZLA 3WUGA 2VZTA 3FQXA 2XFXB 4QOKD 4RRPA 5SWSB 5KG9A 3G5XA 4P5TD 4YBHA 4ZYKA 3G08B 2WZPD 5HYSG 4M6OH 1XGRB 3RUGF 5J0BA 2VIRB 4W70A 1VACA 3T77A 5B8CC 3B5TA 3HE6A 3K81A 3HG1B 5IFJB 2Q76A 3KPSA 5IBUG 3QUXB 5GGUA 3B9AA 3ALPA 4XNYH 5HVGB 5E24E 1F4WL 4XZUA 1SG3A 1S7VA 1R86A 4QLJA 2ZG3A 4JQXA 3PP4H 2NT1A 3DVFA 3SDXB 2H2SC 5JXAH 1XGUA 4HC1H 1RAMA 1UMHA 1DWFM 1X1NA 3BDYH 32C2A 5E5UB 2FEEL 4DM1A 2V5CA 5C0FB 3VFSA 4Q9RH 1DSFH 2WBJA 5ISZD 1QOXA 1E71M 4HWNA 4AC1X 3EO0B 4QTIH 3HMWH 4PJAE 4YZFF 4GQ9H 4NBYB 4U1KA 4KHTH 4M1CD 3SDYH 3DV6B 4M6OL 5ICXA 1NMAH 4UU9B 1I3GH 2PW2A 3MACH 3PGFH 1D6VH 3QA3B 4KTDL 4AAXA 2CDEA 4UOZA 3IIIA 4M56A 3WUBA 4AISA 2H3NA 1W0WA 3AHYA 1JV5A 1KLUA 3M1BB 3QNYB 4CU9A 4K7PH 4ZOBA 1TVPA 1FO0B 3KYNA 3BN9C 1H15A 4DJMA 3WE6A 4IPNB 3NCCB 4F7MB 5EOCL 1ACYH 4LLWA 2A6DA 2ARJB 1OWWA 3TYFA 1MVYA 2NY4D 4PMVA 5IJVB 5KSUB 3BDYL 4RGMB 5FYLH 1F58H 4GRWH 4YHZL 1V7NH 4XZWA 5C70A 2VQ1A 4U6HB 1DVFA 5KTEH 3B9EA 1Z0MA 4HS6A 4H26A 5DJCB 1A6TB 4ZXBC 3TC9A 3SGEI 1UH3A 2CGRL 4I4WA 1DFBH 1I3GL 3KLSA 4G6FD 3PGFL 1CZ8H 1D6VL 2JDAA 2ZPKH 2W46A 2Q86B 1ZVSB 3UTPD 1AGBA 1UWXK 5EN2B 1OAUH 1JI6A 1CNVA 3T3PF 4CJ0A 1HH6A 5H2BA 4PJBE 4K7PL 2NSXA 3VH8G 3VINA 1WBZA 2PNDA 5JOFA 2ATKA 4BCEA 2J8UA 5I76B 2W5FA 5HHMB 3SQBA 2O5XH 4LLUA 5DK2B 3HE6D 1AGCA 1X4ZA 4X99B 2WW5A 1CZTA 1RUAL 4I2XE 2CBVA 2OR8A 5FGBC 2O5ZL 4KI5C 2X05A 5IT2H 2WC3A 1BPLB 2V5YA 3ZJKA 2ZOKA 1ZS2A 2AJSH 2ZUTA 1H3XA 5BVPH 2OYKA 1Q72H 1KWGA 1XZ0B 5I8OH 1FYHB 3KJ6H 3ALFA 4EDXB 5KTEL 1OAXL 4QCEA 1E6OH 5LYRA 4HHAA 4M93B 2GK0B 4AL8H 1JYNA 5A3ID 3O2WH 2EDDA 1NEZB 3IXTA 3O41B 5H94A 2ZPKL 5HYJE 3IGAB 1CGXA 3GUTA 1UX7A 2QQKA 1OAUL 2VO5A 3MREA 4QHMB 4Z9KB 1WAAF 1Y18B 1AD0A 3LS4H 1FFOB 4GSDH 2IAMA 4LVHC 3TN0A 4N0UA 3HKFA 1UVQA 2CBIA 4JRWA 1MYRA 2NY5C 5CKAA 5TPWL 5A6BD 2X89A 5BXSA 2ZUWA 2J7EA 4DN3L 4P8VA 3MTRA 2DMCA 2BVYA 1UA6H 1FE8L 3PGDA 1BG9A 4D6FA 4LSDA 4Q9QL 3MXWH 2A3CA 3ELAT 3T8XA 4WRLA 1Q72L 3BEVA 1I1AC 2H41A 3KJ6L 4PJHE 5I8OL 3CU1A 2ZEYA 1QNZL 4JO3L 3NIFE 1E6OL 1G7HB 2DKUA 2XWTA 1XGPA 2R4SH 4XVSL 3VXSA 5GIRA 4AL8L 2ICEB 3O2WL 5E1HB 3WO4B 4PREB 1IL1B 2GSJA 4WUKL 1BQUA 1JYVA 3BXWA 3G5YB 1HJWA 1T2JA 1Y6KR 4Y1AA 4FQXA 1JDDA 3ARTA 1MCBA 4NHUB 3A47A 3RJYA 4CD5A 4PJXB 3LS4L 4GSDL 2RBLA 5KSAB 4N90E 4HX1B 1GUIA 3VI4E 2XVGA 3H9SE 5IVXB 4YWGL 1ODUA 1A22B 3RVVC 1OM3L 3BKYH 3CZFB 3FB7A 4ZDHB 4MA3A 4PPTA 1IARB 3BHBB 2B9VA 5AZEL 3UBXA 4X5LA 4PRBB 2VABB 3MUHL 4P2OB 4MA1B 3VFOB 1S9WB 3MV7B 5D7LA 2OCFD 3UR8A 3TBVA 1CG9A 5FA3A 5F6HJ 5JXHA 4G8GB 3U57A 4KDVA 2O93L 1MFEL 3UNPA 1YN6A 3VDAA 4MYWB 1E6NA 1I4FB 3CVHA 1V3IA 3QJFA 4N42A 1UKPA 4QEGA 2PYEE 2N56A 1PSKH 5GZOD 4FMVA 3V4VH 2YKLL 1HQRB 4OV5A 1Q9WA 2A83A 2DM3A 2AJVH 4NP4L 3F7RA 4P2RE 2VR5A 5E0CA 4HWZB 1J0KA 1B3YA 4CU7A 4JFPB 2IAMD 1S7WA 2EO1A 3L3OA 2JK5A 4YGAB 1C8XA 4TX6A 1Q6DA 2X89D 3N17A 5GNYA 4I18C 1FNGA 4G6JL 4M5YH 1JD9A 4W7WA 5KN5A 4X9YA 2WABA 2P8PB 4UQBA 5DZLA 5E5MB 4KKLD 4CN1A 5HYQA 1DR9A 4APQB 1GNXA 1D5MB 3AREB 4GKZA 2DEPA 4OFIA 1JFHA 4M1DL 3N50A 3MR9A 4PLJD 3TO2A 3IAGC 3V4VL 1V6WA 2YUWA 4IMLB 3MRLA 2I60H 4HG4J 1CQYA 2CDGA 1GGTA 2JIWA 1MW1A 3C8KB 4FQXD 3LRSA 1EH9A 3LRHA 4Y2DA 3QQ9C 2WMFA 5BW7A 4J2XA 1INEL 1HKMA 3P9MA 4WI7A 5GRYA 4UNIA 1YDPA 4R90H 4I48A 2GJJA 1JDCA 3AB0B 3SY0A 4WV1A 1B3XA 4M5YL 4MDIB 2MCG1 3P4OA 3PF2A 2OTUA 1V0LA 2EDXA 1A7NH 2VQUA 1LD9B 3ZTNH 5GRJH 3VGHA 4M6ML 2YKKA 1QA9B 4OF7A 4TSBH 3ZM8A 4M3KB 4RIRA 5F3BA 3O6ML 4JGUA 1H3UA 2UVEA 2UWEB 4AQ1B 1F11B 3ECBA 5CSZA 1T20A 5DI8B 3MUGA 4CW1A 3K4ZA 4NRZA 2VDQH 1AH1A 5IVOA 5IB1A 1WT5C 1JWSA 3TBWA 1WDRA 5C09B 4U1LA 3KPRE 5LAXA 1TE1A 4PIRF 2D3LA 1VERA 1YEJL 2AJZA 4TUKL 1MOEA 4OGYH 2NYYC 4R90L 43C9B 3ZE1E 1DQJA 4OCMC 5C07B 3UTTE 2DQIH 3K0WA 1XF2B 3GZAA 3RVUD 4N1HB 3HJRA 4ODSL 3S96A 1A7NL 4PJ7B 4PBVC 1A6ZB 3W9DB 4Z7WA 4HLJA 2XTJB 4TSBL 1MCKA 5ABFA 1QW8A 3GMLA 4QRQA 2R0KH 1AKJB 1SR0A 5LBSH 5FKAA 3ZE0E 1RHFA 2DJSA 2QADC 2K7PA 2XZQL 3OGCA 2AGJH 1ADQL 2QKIB 4YHIB 3FFCB 3NFSH 4HUXB 5GRUH 3S37H 5J9PA 4XWOD 3V9FA 2Y23A 5FL1A 3U2SA 3VFMB 4JIEA 3VWKA 4KZDH 1K42A 1AQKH 1WCBB 3RGVC 4RAUB 1DE4B 4KJWD 4OGYL 2XKUA 2VSCA 1RP9A 2CKNA 4U1SA 2C7UA 4GKSA 2DQIL 2OTPA 5CD3B 1F2QA 5TF1L 4TSAL 1UZ6E 4GJTB 4MNGA 3G6DH 1U92A 1FPTL 1YPZE 4A41A 1CYGA 4D9LL 5DMGC 2BFVH 2OSYA 3O45A 5LBSL 4O00A 2WVSA 1P4LB 3HR6A 1VBRA 3S35H 2AGJL 1MXDA 4UV7H 3TPUA 1DCLA 1MHHA 4KZEL 1XR9B 1R3LA 4Y19B 5JTWA 2BZDA 3VUPA 1BHGA 4Q74A 1AQKL 4WWID 3RHWF 4PJIA 1OB1A 4ODXA 5GGSY 3OKKA 3O3AA 3VO0A 1YJDH 3BXNA 5HDLA 4F33A 2C0HA 3MV9A 1F3DJ 3CUIA 1I1YA 3SKMB 4OZIE 1HILA 3P77B 4FLOA 3G6DL 5LA1A 2R1YB 5D6DC 4ZTOL 1TCRB 2DBLL 1UH4A 3GRWA 4EUPB 5HDOA 4N8PA 2Z4QA 4L8SA 3WKZA 2VXVH 3HUJE 4W4NA 1FFQA 5TDPA 4NOFA 4J3WA 4PRHB 3UEZA 1UR9A 1DBAH 2CDFA 3T2OA 4WENB 2F53A 4HIJA 4UV7L 3RWEA 1OWQA 2Q8XA 2JB6B 4LQFL 3IDNA 2HT2C 3N1GC 4BA0A 5HGAB 4S3KA 2H45A 2P5EA 2J1EA 2VH5L 1Q38A 3NSMA 3M17A 3KLDA 5ICYA 3EJZD 1QRNE 4JVWA 3RVXC 1HYSD 1H41A 4IISA 1HINH 3GJFA 1J0HA 5E6IC 3DPBA 4BQ9A 1KIPA 4I1NB 3QIBD 4XBGB 2HYMA 2OQJB 3WNMA 3ARBB 3I02A 3W2DH 3UJTH 5BMFH 3L2LA 2H1PH 2JJTA 4UTBL 4LSPL 4LEXH 2CKSA 1DBAL 3AZSA 4ZUSB 1PG7H 4PJ9C 3MGOA 1UB6B 1FHLA 1P2CA 4S3JA 4LPXA 4XCYB 2J88L 4M82A 2W1UA 3JVGC 4XBEH 3EOYG 5EUOF 1P1ZB 3MLRH 3NBNA 1WISA 5F6IC 4PY7B 4QOKB 1DN2A 3D9AL 1N82A 1GMMA 4N0RA 3CC5B 5TQ2H 4CCEA 4P4RB 3OIHA 2WVVB 2XKSA 4P5TB 3PWVA 5EZJA 3RBSA 5DVOA 1FC2D 1XEDA 3CFEB 1T1WA 4FQJH 5F9JB 4QLLA 1HINL 3DSNA 1INDL 4M9OA 2V3EA 4OZGB 3IRZA 4K3EH 3CUPA 4H1LB 3W2DL 1RUQL 2PC8A 3IF1A 2WAAA 3LQCA 3WV0A 3TIDA 1BM3H 5K59E 1U3YA 3DSFH 4LEXL 4BSJA 3TOPA 3MLXH 1JRHL 3A21A 2WBWB 3KS0H 4JZJB 4AZBA 3BZFB 4YR6B 1N4XH 4LGRB 1KXHA 1XCQB 2FZ3A 1W3HA 2D20A 4P4KC 5KSBA 2F53D 3FFDB 1FORH 5C0RH 3MLRL 5JPNB 5ISZB 2DM2A 1GYAA 1U8PB 3JTTA 2GJ6A 1JYWA 2C8NA 3JXAA 4PGBA 2XWBA 4R7DB 3TEUA 5MEOB 1ISWA 1LL6A 4KRTA 2I5YH 2CLZA 4GLRH 1ZT4A 2P5ED 3PUHA 5SX4H 3WH9A 1MCNA 2Y6LA 1S8DA 2E0PA 2FCBA 4QB1A 1YY8A 3AS2A 1UM6H 3C5SA 4WWKD 2VVNA 3FN0L 1QP1A 2C26A 4OLZH 1XH2A 3DSFL 1DQMH 4UCFA 3B9KC 3P4MB 3MLXL 5AAWA 3X13A 2FGWH 3HAEB 4Y16B 4AZ5A 25C8H 4L5FH 2NY4B 2Q8AL 3TBTA 4PJCE 4BUGA 4K55A 1N4XL 4HWUA 1VIWA 1MIMH 4ALAH 3NSXA 1P4IL 1FORL 1MRFL 4I5BA 4CUBA 4KUCD 1PX8A 1IGIL 1J1XL 1EEZA 2JIEA 1N5AB 4N68A 1WWWX 2AKRB 4HA4A 2I5YL 4HJGB 5F9OH 2RHEA 4IIQB 4UFHA 3DX6B 3P1IA 1RSFA 5I1DB 1SHWB 2R1XB 4XMKH 1CLOH 4G6FB 1NC2D 5FYJU 3OR6A 3T4YA 1UM6L 4BQ3A 2Z8RA 5JZ7D 5KG9B 3G5XB 5KJRH 4Y5XA 1PBYA 1HE7A 3SHSA 5EORH 3MO4A 3O6FA 1FHDA 3GHEL 1DQML 2HT3C 4NFBA 1VACB 4MQ7B 2ZXAA 2W0KA 3WJJC 1HI6A 3T77B 3HE6B 3LIZH 2IH3B 3CIHA 4Y2OA 3ZL4H 3PN8A 1K8IB 4GO9A 1E6SM 4JFVA 2BGOA 5F8RC 5ECJE 5GGRY 1MIML 4ALAL 4DWSA 3FB8A 3WIHL 1BVLA 2WMIA 4H8UA 1PEZA 2ZOLB 2BY0A 4ZSOA 5CEZE 1CICC 3TTSA 2WINA 3KPMA 1XGQB 3TYGL 4XX1G 2LFGA 3C08H 1DQLH 4JO1H 1H0DB 3OXSB 3KE0A 4XCFL 2GJXA 1E4XL 4QY8B 4GAYA 4JFZH 4XMKL 1Z5LB 4P3WA 3SDDA 1IKNA 1CLOL 1B2WL 2GJ6D 4WFHE 5C0BE 1UWEL 3BEWB 4QX0A 1CWYA 2EJ1A 1RIUH 4GMTL 4U1KB 5KJRL 4PJEF 3L5WA 3QEUB 3V6OA 2OJEB 4LSRH 5EORL 3RWIA 1GOFA 4LLVA 1L6ZA 5ICXB 4AZ8A 1A02N 5DN2A 2PW2B 1DLCA 3W37A 4NT6A 5L9DH 2J1SA 3MBXL 4W6WB 4YE4H 3A6BH 3FT3B 2H3NB 1W3LA 3LIZL 1F97A 4YO0A 1KLUB 3L4XA 1RVFL 1NGWB 3QDGA 1H15B 2GTZB 4CMHC 3WE6B 4L8DA 2XM1A 3QFJB 4PCTA 2GI7A 2NY5H 5L2KA 3NCJL 1K5NB 1RUMH 3OZ9H 4ETQB 5D96B 4LSVH 2WO1A 5F7FA 2XPGA 3ZTJH 3F58H 15C8H 2VZOA 3BIBX 3KPNB 3DLQR 4HPOH 4JZ5A 1PKQE 4QRSB 1GOOA 1ZA3A 2H32B 5CGYD 2DCJA 2CXKA 5F6HI 1YMME 4H26B 4LSRL 2OWXA 1YN7A 1UWTA 3ZYZA 1VADA 4QRRE 1L7RA 1PZ2A 3EZ8A 2G8ZA 3BD5A 2HFTA 1LE5A 4GG8A 5CD5C 1WZKA 3O3DA 1K2DA 3O6FD 5EBWA 1HH6B 4IMKA 5L6YH 2CERA 3QCUL 5IBLC 5JOFB 1PX4A 1NAEA 1NJ9B 3X11A 3PXHA 2DKMA 4LLUB 2RAMA 4JQIH 4DEPB 1RUML 2D31B 1TPXB 2EE3A 4LSVL 2FR4A 4JX0A 5HYSB 4DWSD 2DDQH 3OAYK 3WIIH 3DIFA 3AM8A 3DROB 3EYUH 4X8JA 2NW2A 3DVNA 1QR1A 2R8SL 1HJVA 4Q6IB 1KCUH 1T2XA 4NQDA 4W6YB 5FOBB 5IFPA 1U8QA 3OJ2C 4MZ2A 2X4PA 5IBUB 3UC0H 3VIFA 3SDDD 1W9VA 3WQ4A 1HJXA 2X1QA 4X4ZA 1FHGA 3AY4C 5BXTA 1M7IA 1CS6A 2XZZA 3PDOA 3LKSA 3D1MC 2A9NH 5L8KB 4NQEA 1FJ1A 5I8KH 4JFQA 2ZUNA 5DEGB 1OARH 4Q7DA 5L6YL 1I9IH 1N3NA 2A74A 2IAMB 1ZLVH 4N0UB 1UVQB 5DVMA 2WWMC 2VN7A 5B21A 1Z3GH 2AXHA 4JFHE 5ILTL 3EYOB 4ZFOA 4JQIL 1BOGA 4YK4C 1BGXH 5CKGA 3QDGD 2X4SB 5CZVH 5A6AA 4NQTA 4FN0A 3FQTA 5E09A 3EYUL 5EU7C 4Y4FC 2BSRA 1JGUL 3BEVB 4Z7QF 4CDHA 4R9HA 3IJHA 5L2KD 3X14B 5GSVA 4I9WE 5HVFB 4GFTB 3UC0L 2XWTB 3H2WA 3JZ7A 3VGAB 1B6DA 5GIRB 4MNKA 1MQKH 1JZ6A 4HBQA 5DD3H 3ZE2E 3FB5B 3LN9A 3U46B 2HMIC 5A2CA 3VE0B 1YUHB 3GSXB 4G7VH 3EO1A 4G9DA 1KG0A 2AQ1A 4WW2B 5I8KL 1LP9A 3PL6B 2C4XA 4FQXB 4TQEH 1OARL 3NPZB 1NWRA 2HH0L 2VCBA 4TTDD 1LNSA 5IYYA 3CLWA 2V2TA 4GG6E 1MFNA 3BJLA 3TWCL 5CBAA 1A6UH 4HEME 1BGXL 4QKXB 2ZEZA 3FB7B 4LVNB 3T2NH 5CZVL 1GQJA 4O58H 2VLLB 5D7JC 1OGSA 4GW5B 5INDA 3BH8A 4C56E 3QEGH 1ZB5A 1YEHL 2YD3A 2KDGA 3WELA 1FG2B 1OTUC 4OSUH 1UD5A 1XYZA 4P2QE 3OKDB 4FHBD 2EDEA 6CGTA 3VH8B 1GHSA 1CG9B 2YRPA 3INUH 5FA3B 2XM2A 2QQQA 3SGDH 4NQDD 5GGSA 5SWZE 2LTQC 2XQBH 3BLPX 5DJDA 2WHMA 3CVHB 2Q6WB 5L0QB 3AOFA 4S2SA 4FXGA 4NZDA 4JKPH 2H8PA 1C16B 2GSGB 3H7LA 5CBEA 4OMDA 1NL0H 3Q6FA 1PLGH 4I0CC 3C5ZA 4JPVH 1Q9WB 1JGVH 4NQED 4XRCA 2Y6HA 2W63A 2BSTB 3OL2A 4LL9A 3V7AG 4DTGH 4H8VA 3VD5A 3T0VA 4PP1C 2QQJA 3T2NL 2WV3A 1WBYB 5AYBA 3KXFA 1CGVA 5E8PA 4RMWA 3L95A 3QEGL 3K2MC 4RZCA 5CMAA 1TR1A 5IV2A 3MLTA 4WKAA 1YEEH 3IB3A 3SOBH 3AIEA 2NY2D 1LDPH 5KN5B 1LLOA 5GJSH 2WMPA 3CZJA 3PZVA 4NBZB 2HFGH 3INUL 5EO9B 1IGJB 1JWUA 3PWPD 1A3RH 3VD7A 4LCCB 4D0CA 2JEQA 1EK3A 1OTSD 5IR1A 4YBQC 3DMMA 3DX7B 1XHGA 3TO2B 3GSQA 1O5DT 1MCLA 2PWDA 3LDBC 4JPVL 3MRLB 2NMSA 5JQHC 2EO9A 1T89A 2CDGB 2PW1B 1XIWB 4DTGL 2SEBA 2P5WA 3LRSB 1U2CA 43CAB 1J88A 2R2EA 4FFVC 1EPFA 3MRGA 2JALA 4S10A 4ZOAA 4LHUA 1G5AA 1TTFA 3IU3B 3F12A 2G5RA 4WV1B 5IUSA 3PNWA 3P4OB 2CKBA 2JF6A 2HFGL 3OZPA 4O51A 1QBAA 3WUWG 4E8CA 1KGCE 2PR4L 2WBGA 1BG4A 1N5YH 1UOKA 1IM9B 5FUZL 3V6FB 5JR1H 2ZSWA 2NW0A 2VZ3A 4HZ8A 5FIEA 4DZBA 3UTSA 4PTUB 2DWDB 5J7CC 3FKUS 4CW1B 3LEXB 5DC0A 4KKNA 2G4FA 4V2XA 5IB1B 1JWSB 3TBWB 1MJJA 5JQ6H 1VEPA 2MOVA 3C5ZD 2AJZB 1OT2A 4XMLH 3CFCL 1PJ9A 4BZ2H 1FVCA 3OKMB 3R8BB 1JHJA 1DQJB 1V6VA 3OJMB 2DB8A 3GMRB 4ACZA 3KXFD 5IHUL 5DJYA 1TVBA 4L3AA 4HV8A 4LLAA 3S96B 1B88A 1KFAL 3IETA 2H6PA 4ZPTA 4WHTB 4GKNA 4Q2ZA 3GMLB 5BYWA 5JR1L 1F42A 4QRQB 2R29H 4GXVH 3QDJE 5FOOA 4UQ2A 5FKAB 4PTXA 3HNYM 4LSUH 2R0ZH 5JIKA 4X6CB 4BYHA 1T83A 1E73M 1I9RL 4OQTA 4UAOC 3DMMD 5J9PB 5JOPE 1FDLL 5M94B 1PKOA 3I6KA 1C8QA 2WQ8A 3ARGA 3BCDA 1IGYA 3U6RA 5GSRB 1UQZA 3AXXA 2P5WD 2OYMA 3IDXL 1HQ4A 1TZHB 2NY6D 1VFFA 1WC7A 3QIBB 1I7UB 2YA0A 3VI3E 1AFVL 1MW0A 4MNGB 7FABH 1EIBA 3I2KA 2GJPA 1MLBA 3LH2L 4Z7VE 4S1QL 5ERWA 1E43A 2G75A 2FH8A 1E40A 1N6QH 5EUKA 1RU9H 4N0FA 4HPHA 4OLXH 1C8YA 3KG5A 4LSUL 3IK2A 3BP4A 5JDSB 2BBAA 1WITA 1NOUA 4AQOA 3F5JA 3OB0H 1EOKA 1DUZB 1MHHB 5I30H 1B90A 1KPRA 3PG2A 5FO7A 1R3LB 4BH7A 1TA3A 1MCDA 3H3BC 3M6DA 1CTOA 1EUUA 3UTSD 3OB8A 1NFKA 2FGZA 4MB4A 1VFUA 4PJIB 4ODXB 2D03H 4WKHA 4FQCL 3EGSA 2C4FU 4D9RE 1K9TA 4F33B 7A3HA 1KJ2H 1C8PA 4XCEA 1MH5A 4XC1H 5L2JA 2BY2A 4MXQC 3OXRB 4MPKA 5J12B 3LQZB 2HRPH 3LS5L 3L1OH 1ROWA 1H3TA 1REIA 4X6FB 3VXOA 1IV8A 1LO0H 5F7KC 3NA4A 5GGRA 3SCMC 1MHEA 4XB8A 3FO9B 3KLAA 4GXUM 2O9RA 4EVNA 3AHZA 2Z4QB 1J87A 2BNRD 4HGMA 3WD5H 4L8SB 1RJYB 2G5BB 1N6QL 4YNYB 2DQEH 1J8HA 3WJLA 5KW9L 5IW6A 1KBKA 5DUBA 2OMNA 3HI6H 1ND0B 2AI0H 2DGAA 2CDFB 4TULL 3JV6B 2F53B 4HIJB 4Y0GA 5I30L 5DD6A 4DGYL 3ZKNC 1HWHB 4NJAL 5KSBF 2V5MA 3JWOC 4OKDA 1KIUA 2V5RA 2GJRA 4Y4KB 5FYJD 2DICA 3ARDD 4OCLC 2CETA 4LBEA 5DSCA 2P5EB 4P49A 1KTLA 1KJ2L 3BKML 1CENA 1UWRA 2L7UA 3CH9A 1KYOJ 3ARGD 5ICYB 1CBVL 3BZ4A 3WKMH 4WWKB 4WSJA 3L1OL 3RVTC 4JKLA 4XVTL 3EMQA 2WAHA 1E4MM 3SDXF 1FCCA 3GJFB 4KQ3H 4XPBH 2DYPA 1KIPB 1AGDA 1WEJL 3ULVD 3DJ9A 2FD6L 1MCCA 4OJFH 2DQEL 4WI6A 5EZLB 1UWQA 1HIZA 3WH6A 3P2TA 1ECEA 2BOCA 4ENEC 2NQCA 4N1EA 5I1GL 3G5VB 4W93A 3QUMH 3W24A 1P2CB 3I9GH 4LU5H 1LWJA 3SGJC 3SDCD 5BV7L 5TGBA 4BFEA 4KROC 1AC0A 4LCWA 5IWLA 1P7QA 1YEFH 4ELMF 4ZFMA 3U30C 5DD5L 5F97E 1MCOL 5FKPA 1NC2B 3CXDH 4ODTL 2EE6A 2X5PA 1EJ6A 3MC0A 4Z5RA 3U4EB 2EPKX 4UT6H 3SJVB 5EZJB 2VX6A 3RM8A 3GSVA 2PYFA 5ITBH 2F74B 1A4JA 5ACZA 3V79C 4XPBL 3O2LA 2J6EA 3CUPB 4JHWH 5EOQH 4JFDA 2VITB 1NAKH 4EEEA 5ADPL 3RJDA 1JI1A 1PZUB 2ADGB 3RWDB 3MMWA 4XNXH 4GO6B 3GNMH 5E56A 4FQIL 5MENE 1BGAA 5I75C 2Z91B 4KK5C 4JJ5A 5E8OA 4LAJH 1E15A 4E2OA 2YD6A 4PJFA 4PJBA 4Z77A 1T1ZA 2ZWYA 2D3VA 4P3CH 2J5LB 5C9KA 4KTEL 3HPLB 4IM4A 3KZSA 2DWEA 4V27A 4HXBH 5E8DH 5JW4M 2VDOL 1NBZB 2XWBB 4NN5C 5HDBF 4JN2A 4UT6L 1I3RA 2WUCH 3FT2A 4JM2F 3WEZA 1WIOA 1ZT4B 1E6XM 3CUFA 4OT1H 1HXYA 3GSNH 5H37H 1IC5H 1S8DB 1MIEH 4JHWL 4YHNA 3W0WA 3C5SB 3GSRB 3T0WA 5EFIB 3IFLH 4KV5F 4KMTL 4XNXL 4OAWB 5GS0D 3GNML 4XVHA 4HKXA 4PRIA 5TE7H 4UZUA 2ICWB 1ZWIA 2ICWI 5TE4H 1WCQA 4FZ8L 5D7SL 5ESQA 4G42A 3T1FA 4NC0B 4GXUN 4DKEH 4BSVB 4AIUA 2IFFH 12E8H 4YHPB 4UUJB 1YNLH 5CUSH 4OLYH 4ZFGL 2GDVA 4YXLH 3BD3A 2BVPA 1I3VA 4YAQA 1OVZA 3K4DA 4CDGC 5I71C 2GK1A 1OGAE 5TDOB 3ARWA 2CD0A 3VIGA 2YBRA 2OL3B 5DT5A 2PETA 2CR3A 2X7LB 3T4YB 1IT9L 1MIEL 3J7HA 1P6WA 5JMRA 3TA3C 3IFNH 1L7QA 3MV11 3QNZB 4I0PC 3O6FB 1L8NA 3TGXA 5D5MB 1S7QB 1T3FA 1TQBB 1U3HA 1U6AH 2X4QB 4XURA 5E1AA 4ZODA 4UV4L 3T3MF 4JFDD 4EIZC 1S7TA 2VAAA 1E4KC 1H5BB 3LQAL 1G01A 4AD0A 4CVZB 1JPFB 2X1OA 2ZXDA 2VISA 4DWSB 5CUSL 4LHQB 3FB8B 1DTUA 1HXMB 2I26N 1NAMH 3H9SA 4OLYL 4U1MB 2AABL 1UY4A 4ZSOB 2VNCA 2MQ3A 4N9OB 5CJ5A 2BNUA 2OI9C 4XXCC 3D87B 3IFOA 3VRLF 3WL9A 4DFIA 1T03L 1QFWL 1JUFB 3KPMB 5EPMB 5GNXA 3IRPX 5CJ8A 5MEQB 4S1DD 4BJLA 2AV7B 1E6ZA 4L9LC 2Y06L 2NR6C 4ERSL 1TITA 1DWIM 2GJXB 3MLZH 3I2FA 4GAYB 3SDDB 3O0RH 4OF6A 5DUPL 3S4SA 1OP5K 2YXMA 3F7VA 4X83A 4YDJB 1UQSB 3MRHB 3MYJA 3P0YH 1OB0A 3MJ8B 4YHKH 3BYTA 2HLFD 2A6IB 4BA8A 1GRWA 4P9ML 4NT6B 2E9LA 3W0WD 3OGSA 2PYEA 3UPAA 3VFRB 1LQSR 1YQVH 1NPUA 2P48B 5ESAA 3UCRA 5CEYA 1C7SA 4JO2H 9CGTA 4KAQH 3QDGB 4JHAL 1DBJH 3PZTA 4G6MH 4L8DB 5E2UH 3RU8H 1FFNA 1UM4L 3RNQB 1HXJA 4Q97A 4ZXEA 4OF5A 3D48R 4J28A 5L2KB 2V4VA 5FHAH 3QDMB 3MOBH 3TVMD 2AJXH 1T21A 2XPGB 4JAMA 3ULUC 3RDKA 3LPPA 2W92A 2PXYC 4FXKA 1W2PA 1ZA3B 3O0RL 2WCGA 4PB9H 4MLSA 4OIIL 4RAHA 3EDFA 5FDWA 3P0YL 5D72L 4YHKL 5JW4N 2BHYA 3D18A 1YN7B 4J3VA 2KQMA 1XSJA 4WJ5B 3ZOAA 1YQVL 5IJKC 3O3DB 2QLYA 5EBWB 1CFVL 3LCYA 4G43B 4LPLA 4HUWA 3C8XA 4KAQL 1U3HD 2L0DA 1NOFA 2VAJA 5F71A 1O7VA 5D7KE 5E2UL 1NGQL 5EB9A 5EMYA 2UUDH 1I9JH 1T66C 3DO7A 3BAIA 5IMMB 3FW6A 5IXEA 3SO5A 5CIPB 4RBPK 5HHOE 4U05A 1VFBB 4N90D 2B20A 4OLWH 2FR4B 1ACZA 1ZHNB 3ZDYE 1RQ5A 3UESA 1UJ3A 5GGQH 3BISA 3H9SD 4FNLH 3MUIA 3AHXA 1NLDL 5C0ND 3MCG1 4X8JB 1BSIA 5JBEA 4B16A 4HCRH 4PB9L 5BOZG 4NQDB 4JPWL 5K9JL 4ZZ8A 5HYEA 1Z32X 2LAGB 3B9VA 4LRIC 5FHBH 4DUWA 4CL7A 4MD5B 3N85L 3ARVA 3GH7A 3PDOB 3MRDA 4NZRH 4HU0A 3BH9A 4NQEB 3V4UH 1FJ1B 1M7DB 2HJLA 3CPLA 4DVBA 5FFLA 3LEYL 4ZAKC 3RUGE 1N3NB 2A74B 2CO7B 3UZVB 1HT6A 4N1CA 1GGBL 1FZOB 1C5BH 3VFVA 1HZHL 2PYED 4L4TE 2Z0BA 4JL1A 2UWEF 5DFVC 4ZFOB 5GS2D 2G3NA 2MSPA 4OLWL 4LVOC 2HFEB 5TH2B 2QQLL 1IQDB 4DKFH 2VLKE 3GH4A 2NY2B 2OWWA 4FNLL 2H26A 3TZVA 1DJSA 3VFNA 1OAYH 3FQTB 4LSTH 4P2RD 4UBDC 3WDQA 5GRZA 3UTTA 3VDCA 3OJVC 1OD0A 3IJHB 4K8RD 1R24A 2WIMA 3PWPB 3BVNA 4XP4L 2DQUH 4LCUA 3NCEB 1ZEAH 3BQUC 1WWAX 4QO1A 1JF6A 4CNIA 4L1HA 4R4FH 3B4NA 3K80A 5H37G 4CU6A 4NZRL 2PCPA 4G9DB 2EYTA 4HK3N 4U1JA 1ZL1A 4G80B 2BK8A 3C60D 4BK5A 1NKOA 1A7RL 5EJZB 5GISL 4F8XA 1S7UA 3BPCB 1C5BL 2V2TB 1WWBX 4OGAD 3CSGA 5CBAB 3UCQA 1OF4A 1Q8MA 3V52H 3BPLB 2XHNA 4DKFL 1I1WA 1K6QH 5IQ7H 1H3VA 3B6SA 5INDB 3BH8B 5HI3D 4M62H 1UEYA 2DTMH 3HC0A 1T5XB 2NX5E 1FL6B 1QEWB 4JFTA 3V0VA 1R7OA 5C92A 2DF3A 1ZEAL 2ILLA 4MGQA 2D3NA 2OLDA 3VPLA 3LZFH 4XI5C 4GW1A 1IGMH 3K1DA 1FNSH 4PCSA 4WHYG 4NCC1 2OWCA 3LKNB 5GGSB 5ICZA 3PZNA 1R3IL 5DJDB 1E0XA 3ZO0A 3ARFC 1B30A 3C2AH 4PR5B 2H8PB 3WN5A 2W60A 3Q6FB 4XAKE 1XFPA 3T4AA 1I8KA 3C5ZB 4YFLI 4XRCB 4GOSA 4HT1H 1ZLWK 1Z9SA 2UY4A 3V52L 4XP5H 3GJFK 1P69B 5F7YC 4BZ1H 3QQNA 1EQCA 3QUXC 2ESCA 3WXVH 3DUSA 5IQ7L 3KXFB 4L0PA 1WSST 5E70A 2CKRA 4OZIA 4OGXH 1LEKA 3GXDA 5IV2B 3KPRD 3TONA 2F5BL 3TZVD 1KCSH 4MAZA 1Q1JH 3GGWB 4OI8A 1J5OH 2VXSL 3L3JB 5EC1B 4JVUA 5A6JA 2AK1L 3UTTD 3L9RA 4JPKL 4BSWB 2VDLL 2XACC 3ZYIA 3JV4A 1E0WA 3HUJA 1QFUL 2QQIA 3NZHL 4PP2A 5B8CB 3B9DA 4JFFA 4NHCH 4B53A 3BUYA 5C1MB 2MTPA 3VD4A 4HT1L 2EZ0C 4NKQB 3DUUB 5D4YA 4XAWH 4XP5L 2P5WB 4XNMB 1JFXA 1A6WL 1WAAE 4NCDA 4KK6D 3ZDXE 3MXVH 4ZFFA 3MRGB 4GLRI 2VJXA 3MA7A 1K6AA 3SUVA 4O9HH 4Q22A 4KKBC 5SX4I 3BGMA 2H2PD 1OD9A 3RTQA 3S34H 2VYRE 1KCSL 4PMOA 4CN4A 4J3UA 1G7PB 4RGMC 1J5OL 3ZJ6A 3UO1H 2AEWA 4O51B 2HTKC 5DJ6B 3QOMA 4CU8A 4QXTA 5CCKH 5HD8D 3MRMA 2ZSWB 1EUTA 4NHCL 2Z35A 3MUJA 3UTSB 2ORZA 1SYSA 5DTFB 2WAGA 5I73B 1DN0A 2DQJH 1NCTA 1AR2A 4RDQG 4QYOA 2IMMA 3D0VB 4G3YH 5MP6L 1X4XA 3RBGA 4AZHA 3C5JA 2PWFA 3MXVL 3P40A 1OM0A 3ARRA 4FQ1H 3C8DA 1X5LA 2X4UA 4LLMA 2DDUA 1MF2H 3CJJA 5JPMB 1FFPA 2I9LA 4UR9A 3B2UD 1ZGLM 5B4NA 3AIRA 5JORA 2BNRB 3HZMA 5DJYB 3UO1L 2XGBA 3FO2A 3MANA 4HKZB 3ZT7A 1T04A 3FQRA 4L4PA 2WC4A 4ZPTB 5DJ0A 2CLRA 5CZXC 5E99H 4JG0H 3RVWC 4ZO6A 4PRNA 3O6AA 3MFGB 4M93C 4UQ2B 4AZGA 4DXRA 1QYGH 1NUNB 1A0QL 1CFTA 4AMKL 2J8HA 4OZGF 5ALBL 3FCTA 3ARDB 4MJ5A 3LKPB 1NMCB 2XZCL 5IW1B 1QW9A 1C5CH 2MMXA 5ANMB 3AYSA 3ARGB 1IGYB 1XNAA 3JWOH 3FONB 1MF2L 1HHHA 3DX9A 4Y88A 3SN6N 1E3XA 1FFRA 2CRYA 5D71H 4LASH 3IJYB 4TRPL 2DQDH 4YHML 1F8TH 2VT0A 2M26A 5D8ZA 4MSWA 3FMGL 1D5ZA 5KAQG 3RTQD 1FVEA 2WN3A 4UT7H 5LXGL 1QRND 1HJQA 5E99L 2VXTH 3CVIL 3NABL 4XVJL 5ERWB 2G75B 3C6LC 4N0FB 4KKCC 5JHLH 1IEAB 3QGVA 2PO6A 3BP4B 3SDCB 2VZ1A 4ZD3H 5IEKB 2W65A 1SMOA 1M03A 2J74A 5F88B 3WO4C 1XSIA 3O9NA 1J84A 4YJZL 1ISZA 4PJCA 4JFEB 4FXLA 4A6OA 5C0JA 2WC7A 1IT0A 1G9HA 4DVRL 2ZKHL 4XHJD 1UZ4A 1W72B 1KN2H 4U1HA 3U4BH 5KSAC 3SKJE 2FECI 5IHZA 4TNWF 4V28A 2V7HA 1YMHA 3LN5B 1MH5B 1NCWH 3C9NA 2LVEA 1JYXA 4NZUH 1U2YA 4NSKA 3X3GL 5HI5C 1EBPA 4JZOA 3MLVH 3OPZH 5C08A 4PUDA 3O11A 1BFVH 3D69A 2K7QA 4IRSA 5GGRB 1MHEB 3JUYA 1BX2A 4P2OC 4MA1C 4PGCA 3BWUC 3KJ4B 1E27B 5D1XC 4QB2A 3QEQE 2BNQA 1Y0LA 4ZD3L 3BWAB 3HNVH 3IFPA 2GITA 3D3VA 1BD2A 1GIGH 4HH9B 2DRUA 4J23A 3V5DA 5DJ2B 3RIAF 2X2YA 4KQ4L 5JXGA 2D0HA 3E6FA 3Q1SL 4MAUH 3TO4A 2AEQH 1JHTA 3KYOA 4QGTA 3VDHA 3NSNA 4NZUL 1EO8H 1QI4A 3MLVL 4XHQA 1VESA 3THCA 4YEEA 3O3EA 1GZPB 1DLFL 1LMKA 1XMWA 4ONOA 4ZS7H 1BFVL 5C0BA 4PJAB 3RWHA 1S5IH 4CUCA 1UWXH 5IK3B 1V3HA 1U58A 2CPUA 3VFPA 1KIQB 2J7LA 3O6KH 4MXWH 4XUQA 3AREC 2BOCB 2QL1A 3HNVL 2D4DA 4UOW0 1GIGL 3ILQD 4TPRH 1A4KA 4M1GL 3LRGA 5D6CB 1XD1A 2PO6D 2J4GA 4R4ND 3MROB 4U7KA 1KC5H 2HLAB 1QBBA 4OB5H 4V1DE 4P2YA 3M46A 5I66B 1EVTC 4K94L 5FKPB 1ZT7A 1P6FA 1EO8L 4RNRB 4UIMA 3VGFA 4PJGF 1EJOH 4R0LC 1PKQA 3NCOA 1CD1A 1PEWA 4WCYH 3GSVB 2YRLA 4XPTH 3K1KC 4ZS7L 3BRDA 2V2WB 3BAWA 2VN4A 4HIIA 5ACZB 4LRNL 1YMMA 3AB0C 2G3JA 4RQQA 1LO5A 4C4KT 5C08D 2YL5A 5KZCD 4TOYL 2NY3C 2XWDA 1OOAA 1S7RB 4MXWL 5F7HA 1HX0A 2DJUA 3D0LA 4JJ5B 1CU4H 4LSQL 1V0NA 4EOWH 3KDMB 4PJBB 2UZXB 4TPRL 1T1ZB 1X44A 2X41A 4ZE4A 2BNQD 4D72A 1CGUA 4F7CA 1OW0A 5HHQB 3GSWA 3G6JF 1SJHA 5B22A 5DURD 3D3VD 4M8VA 4OJYA 4I2XB 2DWEB 1V02E 5FCUL 3TNMA 3MBWA 4Z95L 3L7FA 5B39G 1MRDL 4JN2B 5JIHA 1I3RB 5E8NA 5CEZD 4JAWA 5BO1H 2YZ1A 4EQ3A 35C8H 4XPTL 3SGDI 1IAOA 4EN3A 2HN7B 2IALA 2NY1C 3NACH 4F9PA 3CDZB 1G7MB 4NGHH 2EDFA 2PWGA 2YDSA 4HXAH 4WFHD 1TJIH 4EK7A 5C0BD 5IKCA 1V7ML 2WWKO 5HYJB 4HKXB 3HRZA 2XTJC 5D9NA 1L0PA 5HPCA 3T1FB 2DT0A 1UXSA 4R97B 1U8JA 3ZT5A 1US2A 3OA5A 5GGVH 4KWUA 4U3XA 3QXVA 3TVMB 1VFAA 4X4MA 1JFQH 5TJWK 4NPYA 3EBVA 1JJUA 3BP7B 5JLZA 5FECB 1ADQA 2BVPB 2MQCA 5C2UB 4NC2B 1A1NA 4P00B 5C2BL 2MANA 1CF8L 4PJHB 2AK4E 3HE7A 4HOZA 2YBRB 5AWNH 3ULUH 4KRPC 3V8OA 4AEFA 3E6HA 4YBLB 1QACA 4ZUVA 2DIBA 3HPJB 1ZSDA 2QTEA 2X44D 4AM0B 2JTDA 4MA8H 1SYTA 4U6VH 5F9DC 1W8OA 1T3FB 3E1F1 4H20L 2P8MB 1YMMD 4JB9L 4CKVX 1E9LA 2QADB 4HMEA 5DYOB 5IMKA 5T3XH 5CFHA 4HS3B 1N0XH 2MWCA 5JA9A 4W8JA 5C0GB 1AXTH 4BXSV 4QHLA 2DL2A 1OIMA 4MS8D 4D71A 4WW2F 2BNUB 4HUMB 2JIXA 1NMBH 1AGEA 1C90A 2FDMA 3D85A 4Q9BA 5EUOE 2CLVA 2DSUA 5AWNL 3UROR 4P2QA 2WDBA 5DT1L 1RI8A 4XPFL 4DGVL 4LKCA 4ZO8A 5T5NF 1FNHA 4KU1A 5KSVA 4EN3D 1Q6CA 5SWZA 1A21A 3QRGH 1BBJA 5B38A 1B0GB 1GGIL 1OPGL 2YWZA 5C0EA 3EOBA 1MQPA 4M61A 2PYEB 3O9WA 5B39A 4JDTH 4R6UA 5HHXH 5ESAB 5CEYB 1JTOA 2E9JA 3GBML 1BYCA 2P24A 4R26H 3KPSE 2WNGA 4P2RB 4KH2A 1FFNB 2CESA 1CIDA 1FH5L 3W5NA 3DETD 1QBML 3QIWA 2AJUL 3QXAA 2NT0A 1SM3H 2EIBA 1TQCC 4JFHD 1BLIA 4R4BA 2GSIA 1U3JA 2OR9H 1EXUA 4P46A 3PP3K 2LU4A 1XF1A 4X98B 2EPOA 3AAZA 5DHYA 1ZVHA 4GBXA 1LEGB 4XVUD 5HDQH 2Y24A 1VGEH 5T3ZH 2DIJA 2FYYA 3C60B 1QG3A 4L29B 5F7DA 3QRGL 1EHLH 2R0WH 4I9WD 2HKHH 3ACFA 2CHNA 4LLQB 1NFIA 1JPTH 4XC3L 1KYOK 4DAGH 3ARBC 1VFOA 3PBGA 4TYUA 3KWWA 1FZMB 3JWDC 4LIQE 2EYSA 4ARXA 2J7DA 1ZTXL 4FTVA 4LMQE 3DO7B 5JO5A 1O7AA 3IJ9A 5DJ8B 4EBQH 4EI5A 2AAAA 4K23L 1TNMA 3VDBA 5FM4A 3IB4A 1UJ3B 4FQ2H 4LX4A 3MRCA 1YEKH 4MB5A 4YIQB 4X0VA 5HXMA 4U6TA 5FB8A 3TH2T 2JIXD 3MJ9H 2E26A 3D85D 3CNKA 2ZCKH 4OCSL 4P5TC 2QMJA 4P2QD 4FA8A 2HKHL 1EAPA 3GB7A 3K2UL 1IE5A 3KR3H 3DOSA 3QQ4A 3MRDB 4WF7A 2DLFL 3BH9B 4DAGL 1I7ZB 3HB3D 3GIZH 4PG2C 2B0SH 4QDMA 5SWZD 2A0LD 3DC0A 4FQLH 1S9XB 3HNTH 5LQBL 2E7HA 3LN4A 3O9WD 4EBQL 1MCEA 2J8UE 3KPRB 4JZJC 4GKOA 4KUZH 1I85C 4DOHE 2V5DA 4EANA 3TZVB 2H26B 1YEKL 5AYUL 5IQ9A 5MERA 5FM5O 1LJYA 3A22A 3HOBA 4X6EA 2JB5L 3OTTA 4FQHA 3UTTB 4AD3A 3FAXA 5TF0A 3QIWD 4NKDA 2X4RA 3LKRB 5ID1A 4LCUB 4TSCL 3KPLA 2IWGA 3QXTA 5GQBA 2QJDA 1ZXQA 1T7ZA 4M1CC 5DA0B 2GDUA 1HWGB 1AI1H 3KPQA 1IFHL 2ATPB 4LF3B 5IB2A 3V8CA 2YDRA 4PJ8D 5D2NE 3QIUD 4RFOH 3QDJA 4F8TA 2EYTB 3K46A 4PJEE 2HISA 3GIZL 1BOYA 4YX2L 3WLBA 2XOTA 4CJ1A 3JSSA 4FQLL 2A6JA 1S7UB 3HNTL 4IDJH 3NGBC 4P4KB 2GJZB 1U91B 3EB7A 1U2HA 3VWJA 1W0VA 4ZZ5A 1KXVC 5CGTA 2GY5A 3RWGA 1CXKA 2NY4C 2A73B 4KUZL 4X6CF 3BP5A 4FTVD 1ZHBA 3UAJD 3OLDA 3ZJ8A 4POZD 3MMEB 2E7LA 1FO0H 4EI5D 1JD7A 2A1WH 1MWOA 3WH5A 5I1LA 3ZIZA 1YA5A 2DDXA 1KCVL 2J2ZA 3CMOL 2JELL 2IBZX 1YPZB 4GW1B 1AI1L 4JHOA 3RPIA 2YRZA 1NQ6A 5ICZB 3VXSE 5KVEL 2OX5A 4S0SD 1JZ5A 5DO8A 3ZKXB 3MJ7A 1NCCL 1ITBB 3WSQL 3TM6A 4RWYL 1DWAM 2W60B 3OZOA 4U7SA 1R5WA 2ZCHH 3MBEA 4XNUH 4Y1AE 1I8KB 1GORA 1WWCA 1KXTA 4PUBH 1I3UA 3HE6C 4XNQB 4KHXL 2BMKB 4OZFA 5L88H 2QSTA 1UH2A 3DTXA 3FQNB 1A9EB 1AP2A 3WIHA 4JQXC 2BSED 1FO0L 5J3HD 4OZIB 1LEKB 5FM5M 1W3JA 1FNEB 1OAQL 2A1WL 3TT3L 5ENWA 5LGJB 1PZ5A 5SV4A 1JZ2A 3L9RB 4H5SB 4HIHA 5D7LE 3NVQA 5A3IC 4PBWD 3HUJB 2ZX8A 1G7IB 1PAMA 4M5ZL 1J05A 1AGFB 1I8IB 1TZIB 3MPCA 3N0PB 4U6XA 3WNKA 4ZXBA 1BZ9B 2KKQA 1MAJA 3L4UA 3QDJD 5IBTH 1M01A 4PUBL 3A6CL 1QD0A 1T2QH 3TV3H 3B8YA 5I3DA 3VIKA 5L88L 1I5PA 3SKVA 3GSUA 4XP9H 4MQTB 3MA7B 3QG6A 2Y9RT 3GSNB 3R1GH 3VWJD 2WUHA 5DMKA 3VMNA 2E3VA 4BH8A 3RTQB 4F58H 3PHOA 1HHJB 1QRNB 5D96C 4F7PA 2XYCA 5GZND 4XV0A 1PX3A 5FGBA 2FSEB 1URLA 3TLRA 4Z7QE 1JPSL 1KELL 2RJ2A 3WD2A 3WNOA 5EC2A 3T0EE 2DQHH 4IS6B 4CVXB 1ULOA 5CEXB 2HP4A 2EIZA 5JR2A 2Z35B 1RMFH 5AZ2H 4AK1A 4MDOA 5GGTH 1MAMH 4HIXL 1DN0B 3MRJA 5EU5A 4QYOB 3OG4B 4WI4A 1T2QL 3D25A 4UDTB 4TVPH 1MREH 1G7JA 3P4NA 2W0FA 4XP9L 1GQKA 3MBED 4PRAA 4J3TA 1X5YA 2X4UB 1LL4A 4F58L 3N1AA 2IPTH 1FFPB 2I9LB 4DEPC 5DFTA 1TPXC 3BKCL 5JORB 2H9GA 1CI5A 4D9RD 1A3LH 5J1AA 2XI9A 4FK9A 2JJSC 4Q6IC 2APWA 5DJ0B 3V6ZB 2CLRB 4GZIA 3I6LE 4GQQA 4AZCB 4MX7A 1UKSA 4X6DF 4D0DB 1I1AA 1UY0A 2JF1A 2F19H 5MENA 1M4KA 1Q9KB 5GGTL 1MAML 3PJSA 5GZOC 4X7DC 1GHFL 3C6SA 4MJ5B 4DW2H 4Z76B 2DM7A 3CPUA 1JU4A 5I2UA 4JY6A 4K3DL 5JXED 4P48A 1E72M 1DLHA 2IAMC 1HHHB 2X1PA 3DX9B 2VDMH 3P30L 4TNVF 4ZUUB 3RCNA 1A3LL 2F5AH 3GHBL 2R0LL 1HOCA 5EU3B 1D5ZB 4KKLC 1CLZH 1FVEB 1UUQA 2Z31A 2W67A 1EHNA 4D0BA 3S7GA 1QLRB 1DQDL 2VXUL 3PWNB 5IP4A 4Z7WE 1SEBA 2YD7A 4HWBL 1HVQA 4W68A 2NZIA 3RMEA 3BESR 2CPCA 3V0WL 4PLJC 4JPIA 3VXQA 5M5DA 2X6MA 1A6AB 1QNSA 1JNNH 4MNHA 4U3CA 1S7SA 4WW2C 3VFTA 5ESVB 3QUZD 4XP1H 5E7FA 4D8MA 4FQXC 2IADA 4HEPG 4Y4FB 5JBFA 4OF0A 5HDRA 2KQNA 1KJVB 2BHZA 3C9NB 1E4LA 1OGAA 4W86A 2W3JA 4LVNC 5KVDH 1PQZA 4M7JH 1KV3A 4JZOB 4HULB 4UQEA 4F2MA 1RK1A 5A8QA 4NQVB 1CLZL 1GQIA 2HT4D 2NY7H 2X9WA 2EDHA 1BX2B 4PGCB 3L4ZA 3MYZA 5C6TH 1I8LA 2EXOA 2FEDD 2UWFA 1F4YH 1JNNL 3K4AA 3CFKB 5MEND 2VSDA 3WYRA 3VIOA 5D5MF 1EFXA 1PIFA 5CAYB 3KAAA 1CK0H 2FWOA 2B7DT 5AYIA 2PTTB 5BXPA 8CGTA 1U93A 1E4WL 1S78D 1JHTB 1FLTX 1A6VH 4PS4H 1F6FB 5C7XH 1EHAA 1I7RA 3HN3A 1KBGH 5DQ9B 3PZMA 5KVDL 3L3HA 3MV9E 1NCAL 3QHFL 5IIEB 3EFFA 3RVUC 5C0BB 3ISWA 4W85A 2EIDA 2NY7L 4DN4H 2IPKB 1U8HA 1QSEB 1EMTH 4QLRA 3RX7A 1N0LA 4UMGA 4ODVH 1HCFX 4RISL 2WIIA 3AMKA 1BBDH 1EVUA 4PB0L 1E5JA 3GNRA 4HG6B 2Z31D 5C6TL 3EOTL 3IDIA 2FGLA 5JW5A 5FUOH 3DVGA 3MRFB 3OKLA 4DCQB 1F4YL 4XPAH 4AD5A 3DUHA 2XGIA 3CHDA 4XNZB 2DT2A 2X40A 1B4JH 1A4KB 3MOAH 1AE6L 4XWOC 3OAYH 4JFOA 3AMLA 1EEQA 3ORJA 1S5HB 1P8JA 3RZWA 2PF6A 2J7FA 4KJWC 4XXDA 1S3KH 2W87A 1NEZG 4XP6H 5C7XL 3VXPA 1ZT7B 2VURA 4O02H 4W88A 4MMZC 4AIXA 1WT5A 2J77A 3KPPB 1NCDH 1QUNA 3AISA 4HFWB 4MWFA 5DMJB 4LPYA 3F8UB 1OGAD 4RQQB 3QCVH 1YZZA 4Y5YA 4JO4H 4WV1C 5FD0A 4OLVH 3TTOA 1A2YB 4AEEA 1BBDL 5EZIL 3IYLW 3LVEA 4QRRB 2G9HB 5FUOL 3QHZH 3STZA 1RHHA 2W9EL 3NTCH 2AXFB 4XPAL 2N7AA 4XGZA 4XCNB 4TUJB 4U6YA 3GSWB 2DQCH 5HHOA 4G6KH 2OLHA 4AW7A 1S3KL 1A7QL 1WK0A 1OLLA 3VU2A 4BK4A 3MLSH 4MB3A 5F7WC 2C1OA 4O02L 3FRPA 2AOSA 2VX7A 5E8NB 1ESWA 2A38A 3QXDB 3LPGA 4NIKB 1CE1L 2YD5A 4DFHA 1A3HA 1MPAH 1XF5A 5E2JA 3F7YA 2IALB 3H3PH 1C93A 2V3FA 4N5ED 1D7FA 5D93B 4OLVL 5IFHH 3W38A 2XWJB 4LDLB 4U5IA 5AUMB 3DNKA 3WHXA 1RJCA 3HRZB 4K07A 3VGEA 2ORBH 2VDKH 3NTCL 4YDLB 2AS5M 4QCIB 1YEGH 5A6MA 3RUGA 4EUPH 3IDAA 5HBFA 1UXSB 3CFJA 5EH1A 4KK8D 4L4TA 4KMLB 4Z0XA 2DQCL 1OAZH 1L0QA 5I1KL 4NPYB 1CX1A 1UWGH 1KB5L 4YHEA 3ACHA 5CHNA 1TZGH 2VLKA 2BNJA 5KSBE 2HTLD 5GJTH 1NDMB 5BXFA 3EJZC 1DUYB 4HTYA 3W81A 1A47A 2GJ6E 1JGDB 2B5IC 4HUNB 4X6BA 4UFMA 4AYSA 3P9WB 1HYSC 3P3YA 1YECH 4LKXA 5K9QI 3L7EA 3E6HB 1C1EH 3H3PL 1B6UA 1WQVT 4ZUVB 1ZSDB 4WI8A 3QIBC 1UXWA 4S0TD 1KIRA 3SDXE 4DGIH 5BQ7A 5GS1A 2ORBL 4WHCA 4QWWD 5IMKB 4LSSH 4HKBB 5CP7B 3MNWA 3VM7A 3N1FC 1M04A 1RK0B 1AD9B 2VC9A 4OFDA 2FLRT 3G6AA 4GG6B 1OAZL 4P5YA 2QR0A 3VRIA 4BF7A 3JWDH 1UEMA 5T1DH 2J7CA 1TZGL 3ZHDA 5IB5A 2OSWA 5D7KD 4B0MM 4C56B 2ZIDA 2UV3A 4ELME 2DD8H 5HHOD 4RGNE 3W27A 1G6RH 3TH3T 1D9KA 3QO0A 4PV8A 5DVNA 4DEQA 4LPUA 3PTQA 1R5IA 4P2QB 4EI6B 5AD0A 1C1EL 2JKXA 4D6IA 5AG9A 3P11H 2F15A 4P59L 4P8UA 5J12C 2QF8A 4XH2A 4YN5A 5B38B 4A45A 3MODH 3R06A 4NUGL 4M61B 3HMXL 3O9WB 4ACYA 3FB6B 3OAZK 5B39B 2R1WA 1ORQA 1UACL 4RE3A 4L8SC 4MJ4A 1WCGA 3QHTC 5E6IA 5I77A 1MPXA 4H1LH 4O5LL 3HI5L 4GAGH 1IC7H 5DLMH 1W1VA 4ISVB 3U82B 4OZOA 3LV3B 3QIWB 2E27H 3QXAB 3AS1A 4L4TD 2VKWA 1A7PH 2J7GA 3IKCB 4E41E 3IU4L 3BDBA 3O6LH 4WDIA 4R27A 1EXUB 3IDUA 4P5KB 2VLKD 3BO8A 1AIFB 1U8LB 4PJ8B 1KJ2A 4PFEA 5HDBE 3AAZB 5ECUA 3QIUB 3RY6C 4WWKC 2FYYB 3NN8B 3S97C 1B0IA 2YPLB 1YNTA 3V6OE 2Y6GA 1KPUA 3CKHA 2X70A 4FABH 2EDKA 3L3KB 4POUB 2APBA 2J8OA 4KV5E 1NWTA 1B3WA 4HP5A 3U79A 3SURA 1YC8A </