2VZVA

Substrate complex of amycolatopsis orientalis exo-chitosanase csxa e541a with chitosan
Total Genus 280
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
280
sequence length
857
structure length
857
Chain Sequence
LSVGAAAGNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSATSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
total genus 280
structure length 857
sequence length 857
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzvA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzvA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzvA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzvA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzvA03
1MFUA 2DI7A 3HMWH 1PG7L 1NGQL 4HV8B 2B31A 1A3RH 1X9QA 5BJTA 3GMOA 1CLOL 4GUPA 1NBVL 3QYCA 3BVNA 3BO8A 5FM5O 5JW4M 2CKBH 1QNZL 3CHCA 4GKSB 1UZ4A 1PQZB 2WO1A 4GI6A 2QADB 2QHRH 4AMKH 4N8CL 4KJYB 5FDWA 4ZENA 3FNDA 3QUXA 4CN6A 1CK0L 1Q6FA 3PWPB 4LGXA 4KRMB 4BUGA 3L4TA 5DO8A 4WFHE 2XPGB 2NXZC 3OKLA 3UYPA 1ZLWH 1QEWB 3FQUA 3BW9B 4F8TA 2ED8A 2BVDA 1E4WL 5ECJE 4N9GB 4NCDA 1H15A 4LLQB 4UINH 5DYOB 2Y6LA 4MLSA 5ABGA 2C1OB 1JGVL 4JFEE 1KN4L 5JHDD 2OMBA 3TIDA 4PB0L 1MHEA 4X7FC 2XTLA 2WZPD 3OX8A 3FN3A 5FO9A 1RMFH 3QO1A 3T8XB 4DVRH 2CDGB 3BT2H 2VISB 2A6KB 4Z6AT 1M6OA 3MZTA 5E8DH 4PV9A 4HU8A 3QXDA 1A1NB 1RZ7L 2F58H 3HI6H 5E95B 5TGBB 4PG2A 5J9PB 2BC4A 1TXKA 3GIZL 1QACA 4YC2C 3S96A 4BZ1H 4C55A 1UMHA 4MNKA 5GS3A 2OYPA 4BH7B 4TSAL 1Q9OB 3W9DB 3RVXC 3IDGA 3UAJC 4P57A 4L3EB 5KANG 1A5FH 3X13B 5I23A 4PBXA 3IFNH 5E9DE 5A2LH 3OKOB 4CVUA 3PBGA 3WNPA 3LMYA 3MTRA 3NPZB 4XX6A 4XT1C 4AD4A 5AC4A 3TONA 1RUAH 3TO2B 3FCTB 1HEZA 4NZCA 1B0IA 1HZHH 1FH5L 1MCCA 1TZIA 5JBEA 1BD2A 3WD0A 4MSWA 4PMZA 1F90L 3ZO9A 3ACGA 1W3KA 1PDKA 2W9EH 4NZUL 3OXRA 5ID1B 3L2MA 5JXHA 5EBWB 5HY9B 4XZUB 1DQDH 4WI2A 2XJ7A 1CFTA 1UY3A 2YR3A 3BKYH 1C8PA 3HPLB 4KXZI 5DMKA 2P5EA 2PO6A 2A74B 2FECI 3QQ3A 1FDLL 3L5JA 1XIWD 2HTLD 3BP5A 4V27A 4HZ7A 4WV1A 5A8MA 3S98A 1U92A 4QHNB 1WLHA 2J75A 4M7JH 2HLAB 3NFSL 2CBJA 2BFVH 2JDAA 43C9B 3PIQB 2NY2C 5LBSL 4ODHH 5HHVH 1B9ZA 1OGAE 3RAJL 3D69B 1YNKH 3IJYA 1OM3L 1IM9A 2NY1B 4K3EH 4U1JB 1Z3GH 2ZOKB 4P2OB 3T2NL 4LRIC 2J7EA 4XP1L 4YHOH 4OLZH 4QF1A 4YDIL 4P23D 3NA9L 1C5BL 3KJ4B 4FQHB 5T1DL 2CLZB 3FTGA 1U41A 3QXTA 3OKDB 1FJ1A 3OZPA 2LTQB 1YEDA 4F9PA 1WKYA 2D3NA 1M53A 1GGUA 1W2KT 3QHFH 4HKZB 3DXAA 5DHXB 4WIWA 4BQ2A 3AU1B 4HWBH 2D24A 4ORZC 2XNAB 1W1TA 5CEXA 2V5YA 3FY1A 4M4PA 4Z2AA 2YZ8A 3O6LL 4X7SL 1OSZA 4OIFA 1N3NB 5E5RB 2YD8A 3P30H 5DD5L 4K8RH 3WH8A 3HNVL 1X5GA 1BFNA 3VXQB 3NIDF 5A6BA 4LLMA 4X5LA 1S7TB 1KCVH 4EIZC 5ABHA 3WL9B 3N13A 1S7UA 3SCWA 4Z7WA 2XRAH 4KMQA 3UYRL 2V5DA 5DFWH 4ODXB 3S88H 4AM0A 4V2XA 5F7HA 1KPRB 3VRLF 4O58L 2ARJB 1E4KA 1JGDB 2ARJA 4L4PA 3THML 4XNUL 4X4YB 3NIGE 2GKIA 2CDEB 3QDGD 1H5BC 3OG4B 3SDAD 1AVAA 4UOQA 2DQJH 3MA7B 3PWUB 3WL9A 1W0WB 3TF7C 3N9GH 3EW3B 1P5VA 3FT3B 5BV7C 2N1KA 4QRQA 1TTFA 4R96A 2V9QA 3KPRA 4TQEL 1FH7A 2LW8A 2XVGA 3QJFB 2KZ1B 5I8EB 1W3LA 2AVGA 3QUZB 4DOHE 5IHZA 4NO2A 2YK1H 4PJXE 4HA4A 3C6LB 3HS0A 2XA8H 5E2TL 3TH3T 4CMHB 4JM4H 2J1SA 3I3BA 1KBKA 1H3WM 4N68A 1M71A 4OCSL 4XMPH 2DQIL 4GAYA 4HFUL 3DGGA 4OF0A 3TT1L 3RTQD 5EOTB 4JFEB 4PJFB 3PZNA 5H94B 3WQ8A 3CFKB 2FATH 1CZ1A 4WUKL 5B39B 2CLZA 1C8QA 3DGGB 1A7NL 1KJVA 4RQQB 3HC4H 1KB3A 4MOAA 4XVHA 3S34H 4R4NC 3KPSB 2AABL 3C6LA 3HS0B 4ZXEA 3I3EA 4NO2B 4AIZA 2OP4H 2W0KA 4DTGH 1B30A 1Y6NR 4FTVA 1H41A 3DMMA 3QAZB 4TOYL 5T1LD 1PG7H 4XP5L 1INQB 1A3RL 4GAJL 4DAGH 1LE9A 1M7IB 3PIQA 3VDHA 2CKBL 1NGWA 1QOKA 2HLAA 4GG6F 3CC5B 1U92B 1D6EA 1HH6A 1A4JB 3L3IA 1LEGA 3BP5B 1HXYB 5HGDB 3PP4H 4N8CH 1KCUL 4XX1G 3OAZK 1UXSA 1WZ1L 3BKJL 3GTNA 3ZLQC 2H2SD 1ONQA 4W8LA 2X4RB 4K8RC 1KPRA 1MFEL 1XC6A 1CFNA 2J6EH 5HI3D 1E1EA 3NIGF 1S7UB 2YB7A 3WF3A 1CXEA 1E4WH 1MJ7H 1AO7D 4Y5VC 2FHCA 3C08L 2IAMA 1W9VA 3W5MA 2EPNA 1F02I 4MCZA 3RNQB 3TCXA 1H4PA 5IOPB 3QUKB 2Q6WB 1EVUA 1F42A 43CAA 2RCSL 3HMCA 1I1FA 4Q2ZA 3TO2A 4DZBB 1RMFL 1F58L 4HKZA 5DJ8A 5C0FB 4J1UB 3BT2L 4NO5A 4HQQL 3BJLA 4WWKD 3QWRD 3QPXL 2CDPA 4JHBA 4L29A 4XNYL 3W9DA 2DDQH 2DQHL 4KKNA 3KL3A 1AHWC 2OM5A 3S35L 1GPOL 1DWFM 3OKDA 5CBAA 4L4JA 5FGBA 5I1AB 3FMGH 4L4VA 4U3XA 4OFKA 3BEVB 1PZ2A 1EZVY 1MCBA 5EUOE 1W0NA 4W7VA 1OAQL 3ZSTA 5MHSE 1T20B 3L9RA 3MGTA 4M6AA 2A6KA 3JBG7 5FGBC 3BUYA 2PWGA 2YD4A 1ND0A 3PUHA 2DM3A 2C4FT 1J87A 5KSUA 3KGRA 3MUZ1 2C3HA 4M8VA 3IJSB 4F7TA 3SDDC 2WLYA 3IJYB 4WTZG 3RVUC 5I17B 1FH5H 1QSFD 3RJDA 1UWSA 3D85D 1WUNT 1INDL 4Q22A 2W9EL 4XBGB 1P6FA 5LG1A 4LVNB 4YHLH 2PO6B 3ZHLA 3SBWA 2ITCB 3DXAE 5I1HH 3RKDD 4G6JH 3BKYL 3MYZA 3PWPA 4JFDB 4MA3B 1NCCH 1UQSB 2X7LA 1IKFL 1RD6A 4DOHB 5E9DD 3T0EC 3ARED 3WFCH 4CU8A 3T0WA 2HT3D 5HY9A 3IDXL 4WSJA 1OGTB 4GXUN 3GSWA 5C0AB 4X6BB 1PQZA 5JA8B 4M7JL 3O41B 2BFVL 5IB2A 1BD2B 1AQ0A 3GSXA 2AS5M 5LBSH 4U1SA 1TZIB 5HHVL 3VU2A 1HEZB 1YNKL 4RYDA 1EX0A 5IIEB 4TXEA 5I1LA 1E6SM 1HKLH 1Z3GL 2IQ9L 1KSRA 5HD8C 4GW1A 2W66A 2PETA 4XP1H 1OB1A 3MLZH 4YDIH 4U6YB 4P57B 3IDGB 1BF2A 4PTUA 3SKMB 1XT5A 4LLYA 4F58L 2UY4A 2BMKB 2XFRA 1JF6A 1ZLSL 5JNYB 3N04A 2JLLA 3MGAA 2F54E 4U49A 4S0TD 3UBXA 1EUTA 3BZDA 5J9PA 3U4EB 3AIVA 3QXDB 4PJXA 5B22A 2X41A 4K7FB 4I3SH 2CDGA 1FVEB 1NAEA 5FIPA 4ELMA 5HGAB 1I9IH 1GONA 4QHKJ 5F9JA 1V3IA 2EYTA 4M1CC 1A6AA 1BQHB 1H3PL 2JELL 1E3ZA 4WI5A 3D9AL 4LHUB 1FBIH 5JLZB 1F8TH 1CE6B 1BIIB 1TTGA 1ZKAA 1HXMA 4K7PH 5F88B 4K8RL 3H7BA 4LLQA 1H15B 2VAJA 5E8NA 4KI1A 4WCYH 3MV7A 4OUOA 2CIIB 4ODUB 1KPVB 3VXSD 1PPIA 4QFUA 1A7RL 3UYRH 1X1NA 3S88L 1S7WA 1XFPA 3TO4A 1US2A 1XF2A 5E08H 5HYJA 3PJSA 5FYJL 3P73A 3K46A 4OLVH 3MOAH 4AZ7A 1OAYH 3T04D 1PLGL 2R23A 1E4KC 1HI6A 3WEZA 2EDNA 1KTDB 4YXHH 4JY6A 5MEPB 3FFCD 3G5VB 2PW1B 3BVNB 4TQEH 1KXVC 3EZ8A 2V7HA 4GUPB 3HR5B 4YC2B 1P1ZB 1O6IA 3TBVA 4J4PC 4EOWL 2GITB 4FQ1H 1S9YA 2PYEE 1P7QB 4X6CE 1XHGA 2YK1L 3EO9L 3ECBB 3GJFH 1KQYA 2W9LA 4JM4L 5TDOB 5FAAA 3HZMB 5ACMA 2DQIH 5D2LB 1DJSA 1H5BA 1KENL 3LKRB 3U9PH 4TSCL 4KAQL 7TAAA 5CBEB 2VUOA 1PW3A 2IANE 5DEGA 4IJ3C 3IF1B 4S10A 2R0ZL 5DDHB 5AC5A 3WUFA 4F7PA 3EHBC 4UU9A 1RFDH 2R2HB 3D39D 3DUSB 1KNOB 2AABH 1IMHC 3PQYB 1M04A 5GRYA 4PJAB 1S9XB 4JHZA 3CZKA 2NY6B 2VIRA 4DTGL 1WAAA 4L4VD 1ORSA 2CMRL 3DECA 4GAJH 2DQGH 4EDXA 2GT9A 5C0AE 4Y4FA 2R69L 1E4MM 1BGAA 1NMBH 3WXVL 4J6RH 4E42B 4FLRA 3SDAA 4NRXA 4F9PC 2CBUA 2Z91A 35C8L 4YX2L 1TENA 1MFVA 3PP4L 5KZ6A 1KCUH 3BP6A 3BKJH 3SDDA 3GUTB 2BCKB 3DSNA 5CUSL 4PJBB 1DR9A 5AZEL 4XNQA 2J6EL 1IBGH 1JDDA 4ACZB 4CD7A 5HSFA 5A6BD 1PEZA 2V3EA 3HE7A 3TA3D 4D0DB 4U0RB 3BN9D 1A7BA 3OTTA 4U1MA 4L8BB 3FB5A 5EO1B 3GUTA 1YN7A 2VLJA 1I85C 3O3AB 5C0CB 2LTQC 2VKWA 4ZAKB 3DX9A 4MAZA 3ALPA 1F58H 5E6YA 2M1KA 5C70A 1I3UA 3IKKA 5DR5H 4QO1A 5F7EL 5GS2H 1QFWM 2OSWA 1KC5L 3STZB 4ZUUA 1ZHLA 4Y4FB 4XNYH 2GT9B 2DQHH 5C0BE 3O6KL 5EMYA 2V2XA 3BAKA 1GPOH 1RZGA 3RM8A 2XQYK 3ARBD 3IFOB 3EYVA 5ESAA 3IK2A 2VIRB 1Y6KR 4DEQA 3TNMA 4JRWA 1ZHKB 3VIFA 3DUSA 1OAQH 1D2KA 1WTLA 1EGZA 3L5IA 5AYUL 1AR1D 3VXSE 3I9GL 2QL1A 3UJJH 1CYGA 2KQNA 3P4NB 1QNRA 3D1MC 1D7PM 2QQNA 2A9ML 4HWNA 4QB2A 1J0HA 4P9MH 1INEH 2YEZB 4Q9QH 2F54A 4V28A 1QBLL 3K1KC 4W6WB 5SX4H 1LGVA 1CGUA 3ABZA 4F7MB 5J6HB 4ZXBA 1MW0A 4P4KD 1OL0A 4ELME 3KPOB 4X9GA 1VGEL 2DQFB 5I1HL 3BH8A 4G7VH 4G6JL 3ETBF 5IBLD 2HLEA 1UXXX 5CGYD 1T04A 3CDYA 1ZS8A 3LKSB 4S0SD 2YRPA 4YAQA 1NCWL 3RO8A 1BLNB 1MCWM 2K9UA 2ZUVA 4XWOD 1O0VA 3IFLH 4NUJB 3HI5L 4WEUD 1TVDA 1GOGA 3MV7E 5D1QC 4OM1L 5HYJB 4WI3A 2NY5H 5GGSY 5DQDL 4NHUB 2VLJD 4MMZC 5EZLA 2EDRA 4X6FB 3OPZL 4R26L 2WV3A 4X8JA 4PEEA 4QDMA 4ODWB 5C07D 2W1UA 3DHJA 3LQAL 4HCRL 2NLJA 2J7DA 3MLZL 5M17A 4CCEA 1AGDA 2JIXB 1CE6A 1AR2A 5JLZA 1CLVA 1QSFE 5E56A 3MJ9L 1CR9L 3PDDA 4PJFE 1CWYA 4P2RE 5SWZA 3VWKA 1A6AB 4LNRA 4GQRA 4LDEB 3BCDA 3WLWD 3OQ3B 4NC2B 1ZGLP 2FJHA 4TUKL 2PYEA 5E2JA 2BY3A 4D6HA 1K5NA 3M45A 1YMMB 3DXAD 4K7FA 4JPWL 3B9DA 2X4NA 3BWAA 4X6DA 4PJXB 5TF1H 1BBDL 4AL8H 3G5XB 2VLMD 1VAHA 1T1WB 1I9EA 3HNYM 5EBLA 1I9IL 3OAUL 4GRMB 2ICWI 1T0MA 2VDMH 5ID0A 3WDQA 1L6XA 2IBBA 3GM0A 4N90E 4UDTB 4NKDA 5JNYA 3FAXA 1SHMA 2WMPA 1LHZA 2G2RA 3INUL 4WWID 1NAKL 4P5TD 1F8TL 4H0HB 2GJRA 5KSBE 2WVVB 3SURA 2AI0H 1W9WA 4ONHA 3PABA 4Y8DC 1PIFA 2Z8SA 3ZDYE 1J86A 5E1AB 3L5WA 1MPAH 5T1LB 3W81A 2AV1B 4LF3B 3GSXB 3TZVD 5IVXA 5JUEL 1K45A 4EN3D 5E08L 2XTJE 3WF1A 4U1LA 3MOAL 1OAYL 2D7TH 5D1XA 1OW0C 1CBVH 2GSGA 3WHXA 4YXHL 2NZIA 2HP4A 4UNVA 4I0KA 2X7LB 1PY9A 2OSLA 4M82A 3MJ9A 1YPZE 2MANA 5BYWA 3PNWB 5IB3B 4GRWF 1F5WA 3MRKB 2J62A 1AGBB 4LK4A 3WLWC 1ZSDB 3L3DA 2MFNA 4FABH 2CYGA 3ZSSA 1HCVA 1N64L 4W68A 2VDOL 1MCHA 4OV6F 2VL5A 1EGJH 2XFXA 3MRJA 4KAQH 3W2DL 5I66A 4QY8B 3TO4D 5M5DA 4PJ8D 4K68A 3MRGA 1EHNA 2Q7YA 4QRTA 3KLDA 1FHGA 3GNOA 2L7JA 1NDGB 1MEXH 4XP6H 3SKNA 1DCLA 4CAGA 5LGKA 1IQWH 4J3XA 1CGXA 3FQWA 1HP5A 5I1AA 2RBLA 4AH2A 2AV7B 1ITBB 2CMRH 4WWKC 1HJVA 1FFOB 1CLOH 4L29B 3DO7A 2DH2A 1NBVH 2ESVB 1EBAA 4NO5B 3I2JA 4D0QA 4J6RL 3CUIA 2E9WA 1P4IL 3C5SA 5DC9B 3L7FB 1QR1A 1PY4A 2XT1B 3N0PB 4CDGC 3VW3L 4DZBA 3VFPB 35C8H 5MENB 2JEPA 3GYCA 3P4MA 4Y1AB 5IOPA 3DWTA 1U8IB 2HVJA 1UB5A 3KLAA 4LCIL 4DN3H 1T7WA 1IBGL 4YHKL 1CIDA 2UYLB 3QWRA 4L3ED 3RU8H 3WQBA 2OZ4L 3CZLA 2YWZA 4K7PX 3VRLE 4P8VA 1S7VB 4HUMB 2NT1A 1CFNB 4DM2A 1UMIA 3FT2B 4BSWA 2VCAA 2D31A 1FG9C 1DFBH 2X4RA 1G0DA 3EDJA 3HMXL 3MLRL 4XTRD 5B8CA 4N5EC 2X4SB 4PGBB 5EULV 4HZ6A 5HGDA 2EXWC 1HXYA 1ACZA 3V6OC 1E40A 5BOZG 4J28A 3DO3A 1GIGL 4HC1A 5BS0D 2MTPA 1HH6B 1D6EB 1CI5A 2A3EA 3GBNL 3DPBA 4GQ9H 1I7ZB 4QT5A 5DR5L 4B41A 4XUQA 1FV1A 1KC5H 2ZUQC 5GGTA 2D0GA 1CD1A 2J7BA 3MRRA 1AKJA 3CFJA 2F58L 3HI6L 5CIPB 1BVZA 2H1PH 2Y1VA 3K8MA 1DBKH 4BZ1L 4AXNA 3LKQA 1ODUA 1UD6A 2RGLA 1KXHA 5BO1H 4GI9A 2YFZA 1DYOA 1IGYA 4F7CB 4GG6A 3ECQA 1LO4H 3DV6B 1A5FL 3HZKA 3OF6A 3I9GH 3UJJL 2VM9A 5I2IA 4YHEA 1CD8A 1QSFA 4JVWA 2E6QA 2I07B 4ODBD 5L8KB 5HHOD 2WN3A 4GBXB 5EC1A 1FORL 4P9ML 1HZHL 1FA2A 1M03A 4IS6A 3S3JA 1NEZB 1M71B 1QBLH 4OV5B 3SE3C 1FYTB 3VG9C 1JGEB 2ENYA 1B0GB 2DQUL 3SY0B 2QPUA 1TZHB 3OGOE 5DO2C 4LLWA 3AAZB 4NZUH 1EMTL 4M7ZB 2IH3A 5FL1A 4Q9RL 4UQ3B 1S9WA 4ZYKA 4PBGA 1R3JB 5CJBA 1VGEH 4XWGH 5IB5B 2BHYA 3KPRB 2XWJB 3QAZC 4I13B 1XIWC 5IEKB 4R96B 2LABA 5DVMA 2V2TB 5DF0A 5IW6A 2ZX5A 1D5BA 5C0DA 5DJAA 2GCYA 2WBKA 4OGXL 3IFLL 5ETUB 1F13A 2X4TA 5BW7A 2XN9E 4KK8C 5D7IE 2GAZA 2FO4B 2W87A 4FQXC 1VEPA 2L9LA 2VX6A 3EDDA 1DQJA 3U0TA 4ODHL 4RMVA 4PJHB 4IJ3B 4ARXA 3V6FA 4R26H 4K3EL 1E6JL 1QNSA 1RV6X 2XIBA 1FL3B 2F8QA 4IMKA 1S7TA 1U42A 3T2NH 4PS4H 3TO4C 3C87A 4LLMB 4MD0B 1V0MA 2YDRA 1RZKH 5I9QB 1ZBVA 4X80L 3JV4A 4C56D 2Y36L 3U0PB 3IGAB 4MQTB 1C5BH 3QDGA 2DH3A 4XGZA 3STLA 4B7IA 3I97A 4K94C 2Y6GA 4OZFG 4UQAA 5A8QA 1CPUA 1J0IA 1RK0B 2DYPA 2QJDA 3WKML 3AU1A 4HS8L 1KB5B 4U33A 3OKKB 5GJTH 3IS1X 1YEDB 5IP4A 5TF1L 5JHDB 1BBDH 4AL8L 2I25N 2J5LC 3QHFL 5IVOA 1I1CA 4PY7A 5ESVA 5AD0B 5K9KB 4HWBL 4KK8D 4X4MA 3IJ7A 4P59L 3UDWA 3Q3GA 1AHWB 3C7HA 2V72A 2ZWLT 3OGCB 4URIA 1NAKH 2WSKA 3IS0X 1AE6H 2HFFA 1IRAY 4WI7A 4AIOA 4ETQA 3WD2A 4YZFF 4UR9A 2NW3B 1KCVL 2F53A 1KLUB 3VINA 4A44A 4X98B 3GZKA 4JFED 4O2EB 4RX4A 5DRWB 4XV0A 2ITDA 1OW0A 3LDBC 1QBBA 1BG9A 2IALB 4XNUH 1T3FA 1T5WB 1GVYA 1LO0L 5F6HJ 1AC6A 4LPLA 2C7FA 5B39G 2DQJL 4QYOA 3PZIA 3WF2A 2IQAB 1CBVL 3FOLB 5I1DA 1Z6JT 3KPTA 1VF8A 3EKCA 1YJDL 2J7HA 3TH4T 1IZJA 1FP9A 2VRKA 4L9LB 3DUHA 1KJ2H 1CFTB 3RWJB 4GT7A 4POZD 5DJXA 5IDIA 4P3WA 1LK2A 2VLLA 1WFTA 2YRLA 5ILTL 3ZDXF 1H3UA 2XA8L 5E2TH 2HMIC 4NQCB 1UYQA 2UWEE 3BPNC 5KOVC 4JANA 1N64H 2BP3A 3K2MC 4QXGH 4OCSH 1UWIA 2QQQA 3QQ9D 3ZQ9A 1TA3B 4OM0L 4PCTA 5I74B 4JZOA 1J8HA 4W6XB 4U6TA 3U36B 1ADQA 4GJTB 4WUKH 4ZNEA 1LLOA 3Q6FB 1CICB 3QIWD 2X70A 4LP4A 4YFDB 3HC4L 1MEXL 2L4OA 1F3JA 4XHQA 4E8DA 2GW5A 5CYYA 2WCGA 2FGWL 3W39A 2CETA 1XF1A 5JXEA 5TD4A 4PJHE 5DD1H 5KVGH 2G75A 2O5XH 2OP4L 1AH1A 3D3VE 3ZL4L 4EI6B 4TOYH 3VXME 3N9KA 4XP5H 4UB0L 4P23B 5TGBA 2E6JA 2VDNH 1DQML 2UUDK 5IMOB 5ANMB 2E9MA 5B3JE 1T1XA 3HRPA 4U5IA 4MZ2A 2VISA 2YJQA 3CU1A 5F1SA 3U7AA 1XCXA 3L4YA 1P4IH 4WWKB 1IT0A 1GGBL 1QHZA 2IADA 3Q1SH 2WPGA 2GSIA 2HRLA 4LXFA 2BNQB 3KZSA 3CPLB 3L3HB 3QEHB 2BSTA 4HF5L 3P77B 4PRHD 4J8RA 2BDNH 4Z2IA 5D2NC 1FPTL 1GZQA 4DN3L 1AP2B 2FHBA 1TCRA 2CQVA 3KL0A 3K4DA 1QFOA 4XCYA 1PMHX 3RU8L 2OZ4H 3PV7A 5EO9A 4YE4H 1KYOK 4EQ2A 1WIOA 2PYFA 3OKLB 4M8QA 2XPGA 3CD4A 2VLRB 4NKOA 1DFBL 4Z76B 8FABA 3DC0A 4WU7A 1AGEB 4JPKH 4J3SA 5D72H 3MV8D 4KJYA 1JCKA 4F57H 1MW3A 2YZ1A 3CCHB 1GIGH 1BG4A 4M9PA 1OGGA 1XZ0B 4NQUA 1J10A 3CJJA 3FO0L 4GQ9L 4HQQH 4O2FA 1B1YA 5J7CC 1R8LA 3ARDC 1IV8A 4NIKB 3QPXH 3ZO0A 4CDHA 2DDQL 3OGRA 4LSDA 5T33L 4X4ZA 1PSKH 4JFDD 2ADGB 4LCWB 1SMAA 1DBKL 1UKQA 4I18B 3IKCA 5MI0C 2X4QA 1KEXA 5DFVD 3C60B 2PBOA 5FF6A 2GDVA 3LPFA 1LO4L 1IT9H 2YD5A 1EVTC 5GSRA 3QUZD 4FQQB 1FZJB 1T5XB 4XXDB 2IXVA 1ACYH 1BFVH 4QXUL 1CG9A 3MGOB 1U8JB 4NSKA 1FORH 3PN8A 5DJYA 4HZAA 4W4OA 5FYJD 3KL5A 3RDTC 1QNPA 2D7NA 2DQUH 7CGTA 2VITA 4HDIB 5L88H 5D2LE 1B0WA 4ZUVB 5BRZA 4QHLA 3ULUD 4Q9RH 4NN5C 2APWA 4QRRA 3HZVB 2VMEA 3IXTA 3C8HA 5ICYA 3CXHJ 2EPOA 3RMEA 4HKXB 3ESUF 2LS6A 1IKFH 3WFCL 3C2AL 3DETC 5ERWB 4JM2B 4QNPF 3IDXH 4XWOC 2R2EA 5M03A 4OGXH 3UCQA 4I3RL 4P2QD 2PQSA 1ZWIB 3WN5C 2D9CA 2YXMA 4L0PA 2F53E 3SDCA 1YC7A 4XZBA 3OKMA 1E6JH 3TTYA 1HKLL 2IQ9H 4M62H 4PJ5B 1UYXA 5CZXD 2DKMA 4QX0A 5M95B 5E2VL 5JXAH 2WHLA 3NTCL 2WUHA 4JDZB 4MQ7B 1HH9A 4X80H 4Y4KA 1VRXA 3ARGD 4PJGA 4LFHG 3HE6C 3MUHL 4F58H 3VD5A 1DHKA 5IKCA 4NC1E 4CRPA 5L2JB 3KWWB 1W99A 2V5RA 1ZLSH 4N8VG 4UT9H 2DPEA 3MV9A 3O3DA 4U0RC 3SPVA 2E8YA 1WBZB 3WKMH 4HS8H 2V7NA 4XPTH 4HK0A 3WQ4A 4NI3A 5GJTL 4PTTB 4ET7A 3IAPA 3F5WA 4U1HA 5FYLL 5JIPA 4GAGH 2JB6B 2UWEA 5KSBF 3CUGA 3PP3K 4LCCA 5I8OL 5CEYB 4P9HL 5D6CA 1OF4A 2XYLA 3IYLW 3T4YB 4P59H 5KS9E 1UA3A 4Z78A 2WINB 4JHWH 2JELH 3CUJA 3D9AH 3S8WA 3WD1A 5DVOA 1ES0B 1AE6L 4PRHA 1BAGA 1S9KC 4X6EB 1VGKB 1HQ4B 4WCYL 1D5ZB 5C2UB 1LP9A 2D7PA 5LKNA 3AXLA 3BKCL 1ZVYA 1BYDA 1EQCA 1TZGH 1G6VK 1A7RH 1IM3B 1ZLVH 3HOBA 4BSVA 2W0FA 3V5KA 4ZSOB 1ETZA 4TVDA 3C5JB 4OKVB 1L0YA 2HT2D 2GK1A 3S37H 2WMKA 1LO0H 1T22B 5IEHB 4HUKB 3WSQL 5JORB 1PLGH 4NGHL 3QI9C 3D3VD 4YHYB 4XCEA 1PX3A 1C7TA 3RL2B 1NEUA 3QQ9C 1YJDH 4FXKA 2NY6D 1NFDA 4OGAD 4Y1AD 1UR9A 5HI4D 3Q5TA 4JRXA 4FQ1L 4YHMH 3WCYA 5A43C 3M46A 2H45A 1G7PB 3GXMA 3EO9H 3GEWB 1YMME 5MEOB 2GTZB 3NPSB 1J8HD 4H26A 1W9UA 4FZEH 4LEXH 1CZSA 4QXTB 3VFOA 2GFBA 2P42B 4NUGH 2F8OA 3WJLA 4DN4L 3D0LA 5C0GB 4XUNA 1CXKA 4M61A 1CDCA 1Z0NA 1KENH 3U9PL 5D1QB 2MPAH 4JAMB 4B0MM 4MNHA 3N85H 1JD9A 4RBPH 4W88A 2P46B 1TVGA 5CSYA 2DSWA 4G8FA 1A9EA 4PQQA 2EYRA 3VRIB 1P69B 1WICA 4HIHB 2HT2C 3GXIA 5IBUB 3EHBD 5EIIB 4WO4D 4RFEB 1HKMA 1RFDL 1D6VH 3MRFA 2ZJSH 5JR1H 2FGWH 1UY1A 2FSEB 2AXGB 1JZ8A 4QB1A 1ED3A 2EXOA 3RTQC 5KVGL 1CX1A 1CICC 1E27A 1E43A 1BIHA 3ZL4H 1J7VR 1UA6L 1XIWB 1GJIA 1BJMA 1HINH 2DQGL 4MDOA 2VDNL 4X0NA 4H8WL 2Y9RT 4WIQA 5FV2A 3RCNA 2R69H 2ZUUA 2I9LB 1NMBL 2EIZB 3WXVH 4OCXL 4JB9L 4CUCA 1EERB 2J1VA 1XYZA 4P3DB 3WL1A 5J6GB 1F6AB 1QRND 3Q1SL 4IDLA 2J1TA 5ADPL 5DMJB 1I3RA 3TBYB 5C8JA 4YBLB 2XZZA 2CGRL 3O3EB 5CUSH 1EAJA 1CU4H 2BDNL 4MXVE 2Y7QA 1IC4H 2FL5A 3MUGB 3KLSA 2WW8A 3RWGB 3T0EA 3VXNB 2OXGA 1C5DA 4PJ7B 4YE4L 3RM9A 4R90L 5D2NB 5C7GA 3GNMH 4AC1X 5GS2D 3UTZA 1GOWA 1FNGB 3ROOA 5BRZE 2AK4E 3HC0A 4PGDA 3UPRB 5FIEA 1OPGH 4NKMA 3V6ZB 2OKXA 2H2PD 1AR1C 5D72L 5CINH 1JZ7A 4F57L 5C07A 3VXSB 1KCSH 3MNVA 4HK3N 1MJJA 3EGSB 3FQTB 2RVAA 2J5LB 5IB4B 2P5EE 5LA1A 2E7CA 1MQRA 1MJ8L 3O6KH 1ADQH 2YBRB 1U91A 1PSKL 2E7LC 1QRNE 1YMHB 1RVFH 1GOQA 1MY5A 3MV11 4HG6B 3N15A 5D8ZA 1GJUA 3ZMRA 1LL6A 3QO0A 1QOXA 3DX6B 5C0CE 2HTKC 5B4NA 1ZBWA 3BEWA 4LCUA 1P7QD 1KJMB 1JFXA 4N8PA 1T7ZA 1OD0A 1ACYL 1BFVL 1F45A 4QXUH 5ICZB 1F2XK 2DD8L 4N0UE 3PG2A 3HRZB 3JTTB 5FOOA 4NM8H 3U57A 4D6JA 3WD4A 3BPOB 5L88L 5D4QA 3F58H 1D7FA 4MD4A 4WHCA 4UV7L 4LHJB 3MRHA 4X0KB 4ZFZB 4L9LC 3EJJX 3FO9A 5C0RL 3QDMA 4Z7VB 3RIFF 1FNSH 3VI3E 4G7VL 1KCRL 3LHPH 1HKKA 1PX8A 3VXUA 2G8ZA 5E1HB 5KS9A 1QPKA 1ECEA 3GSUB 3C2AH 1NCWH 3HUJB 1WBXA 5I30H 1EHXA 3K77A 4I3RH 2YOCA 4G8GB 1LP9E 1KIPA 3C5ZC 4OM1H 3BAYA 4JIEA 4JPVL 2NY5L 2X44D 4L3CB 3LPOA 4X6CF 3HRZA 1SJXA 3OPZH 4JQXC 1MCQA 1G7LA 1E5NA 2GJ6A 3GJEA 4M62L 1I4FA 1FQ9C 5JXAL 4HCRH 2IPUK 3NTCH 5I5RA 2PTTA 3BEWB 4LCUB 3EO1B 1RIVH 3DX6A 2IBZY 5E94A 1CR9H 3WFDH 1VADA 3ARFB 3SCQA 4Y19B 4EN3B 5A1AA 4FZ8H 3CVHB 4WW2B 4D3CH 5A3IC 2A6IA 3UDWC 2VC2L 4JPWH 4QKXB 3V0AC 3G5YB 3UTTD 2H26A 4GAGL 2EQDA 5IB4A 1AQKL 4Z7WF 4P9HH 2VDML 2V17H 3PZTA 1HF6A 2WBJD 3WD3A 2VB5A 4NDMB 5C1MB 4DWSC 1LWHA 4ZNCD 1OTUC 1Q6GA 3LKPB 2RJ2A 4KVCL 3UO1L 4Z7UE 1JGLL 4YHNA 2AJUH 4U6XA 1FNGA 3DETD 1I7RA 1PMJX 4QDRA 3FQRB 5JDSB 1E4XL 5KSVA 1VFUA 1AD0A 3D39A 2WANA 1MPAL 2EDWA 4W87A 5J89A 3MUGA 4P99A 1K4DB 5JUEH 4FTVE 2XY1A 5LCVL 1ZBCA 2EYSA 4DGVH 3O3EA 1WNOA 1U2HA 1OGAB 1GVIA 2P43B 4NGHH 2D7TL 2ZEXA 2DTSA 4PD4K 4UT7L 2V9RA 4U2YA 1DE4A 1DVFB 4PJIB 1UWXH 1MCSA 2DBJA 2E7MA 4RA0C 5F97E 4PY8I 4I18C 5LA0A 2I9LA 1K2DA 1SYSA 5ENWA 2QBXA 2CPUA 1E6RA 1G7QB 4OCRL 1BPVA 2WMIB 1PG7W 4YHML 4HS6A 3AYRA 1SQ2N 1UD8A 4I9WE 5CAYB 2D2OA 4M1GL 3LN5B 5EU4A 3T2QA 1FP8A 3IDMB 2C4XA 1KGXA 4FZEL 4LEXL 3JUGA 4DN4H 2P44B 2B4CC 4LYRA 3L3OA 2VLRD 4HHAB 4OZFA 4CMHC 2BGOA 3V5HB 2MPAL 2VDKH 3N85L 4FQXB 4MLIA 2W92A 4OIAA 3VIGA 3DI3B 1NCBH 1RJCA 2DMCA 4JRYB 3TZVC 3FQXB 2FYYA 3GZAA 2QQKH 5E2UH 4XP6L 5C9KA 3B83A 4MCYA 3AIRA 1D6VL 1IQWL 5TF0A 3MRBB 2ZEZA 3B9KD 2I26N 4JCLA 4KJWC 1LWRA 1KIRA 1KPUA 1UA6H 4CADB 3W82A 1HINL 5DRNB 4H8WH 1H0IA 1CVRA 3C60D 3NGBC 4X6DF 4L4VE 3AREC 1R5VB 3D87B 4YH6A 3HAEB 4Y19E 2MOVA 4DJMA 4IHOA 4JB9H 3FL7A 5JPMB 1JPFA 1MWAH 4IM4A 4QRPD 4KRPC 3I6LD 3VW3H 4PY8J 5JQ6L 4JFDE 2XVNA 5ADPH 5FA4B 2CGRH 1JNJA 1LD9B 3QR3A 1CU4L 4ZEPA 3C5JA 4OKVA 3GH5A 4LCIH 2B8OT 2IGFH 4WEMB 1JG9A 4HUUB 2HJLB 4NO0B 4B53A 1RPKA 1JRHI 2JB5H 4GRLD 1E0XA 4YHKH 5HHQA 2C5DC 3RUGF 1XRVA 1IM3A 2BVPA 3AHXA 1WWAX 2CXGA 4LLDB 1EO8H 4MZ3A 1JYVA 1Q6DA 2VZSA 4N90D 4R90H 3UTSE 2IG2L 3GNML 1JFHA 3HE6D 2CHNA 1JK8A 4ZFOA 4HUUA 1HKJA 1BZQK 1D5ZA 1AGCB 1N59A 2Y25A 1QPPA 1OPGL 3HMXH 5CINL 3MLRH 4N1HB 4DKAA 5DN2A 4U4BA 4ZQKA 4LCCB 3GBNH 2WMFA 3FFCE 4P2QB 4Q6IB 1QLRA 4RAUB 5EBMA 2J12B 3M7SA 1OD7A 4RGOH 4H41A 4QOKE 1MJ8H 4L8SA 2YN3A 5EPMA 1I85A 2H1PL 1K3ZA 1KIRB 1RU9H 3T1FA 1RK1B 3SDXB 3BH9A 5EFFA 3RWCB 1EAPA 1UY4A 3AIEA 5BO1L 3MV9B 4PJCB 2O9RA 4V1DA 4MCYB 4LYQA 4FQPA 4HUWB 4Z18A 2GJ6E 4LAQL 1FLTX 5IKCB 1XMWA 4PJGB 3QT2A 5DI8A 3LKNB 1HDMA 1MCEA 3MV7D 3NVQA 3UBXG 4X9HA 4PJ5A 1UWWA 4E2OA 3V5HA 2DD8H 1QQDA 4K3GA 4ZUTB 3KYOB 4PJ7E 2W91A 3VFTA 3H3BC 4NM8L 2E9IA 1EMTH 2K7QA 2ADJA 4UV7H 5HI5D 3KE0A 4OZHB 5C0RH 1ZB5A 2WHJA 2EDOA 2AXFA 3EOBB 1FNSL 3CXDL 1KCRH 3LHPL 4XWGL 4EUPB 3MR9B 4M43L 3TVMA 4F33B 4HIJB 3SEPA 4UUJA 3V7MA 3SCOA 2WWMD 5DMGC 1F6FB 1ZA3B 3VM7A 4HBCL 3EJYC 4ZOAA 2FIRT 4QHLB 5BRZB 1OGAA 1NARA 5LWYL 3RGHA 4ZUVA 3GBEA 2EIBA 4BFBD 1U3HD 3E6FA 2UZYB 1V6VA 3U5UA 3W26A 1AXIB 3G6JE 3ES6B 3HZYB 1HP4A 1EK3A 3IRZA 4D0BB 4UIMA 2ZXAA 3TNNA 4N0RA 3D39B 5DJYB 4MD5B 2QLYA 1W3JA 4NSKB 4KI5D 3PQYD 1BZ9A 3RWDB 2ZWYA 4PS4L 4PRID 1T5XA 2OLHA 1RZKL 2P5WD 1JGIA 5SWZD 4KUZL 3CSYA 3RJXA 4HIXH 5GSRB 5I1GH 1R7OA 1RIVL 2Y36H 1H3XA 3RX5A 5HI5C 3ZKMD 4AD2A 3MJ7B 3WFDL 4OZGB 3QFJA 3DROA 4ZXLA 3IKCB 4I18A 2VDQH 4LOUC 4UI2A 4DVBA 1B3ZA 4D3CL 4LCWA 1U95B 5F89A 2VC2H 1I5PA 4OGZA 4J2XA 4M5ZH 4LVOC 3CFCL 3ZDZE 1HSAB 2YPLB 2W95A 3NIDE 4YBLC 5BROA 1UZ8B 4NFBA 1XZ0A 1GORA 4TX6A 3PGDA 5D1QD 2V17L 1E6XM 1JE6A 3SGEI 3O4LE 3DVFA 3C6SB 2O61B 3W6MA 5E94B 2IANA 4L8DA 2VR9A 4WU7B 5C0ND 3MBED 3MQIA 2AJUL 2EKSB 3BAWA 3F12A 5FCZA 2CKNA 1E4XH 3WKZA 4OUEA 1JU3A 1X3DA 2P7TB 3ACIA 1BMGA 4HZLA 4PRBB 2A9NH 2Q1EA 1KIQB 5LCVH 2H8PA 3P77A 3IANA 4TUFA 1UR8A 1N2RB 5ALCL 2RFXA 4UT7H 2AMGA 1XF4A 3B9VA 4WWKA 3BZEA 5KS9B 3WDHA 1A6ZA 1FN4B 2ZCLH 4ERSH 4F15C 4DXTA 3QJHA 1KJ2L 3OHXA 2HMID 1XNAA 2E26A 3QDMB 2WM0A 4HWZA 3FO9B 2BVQA 4U1IA 4M1GH 1K4CA 5B38B 1B6DA 4PLJD 5ILTH 4NNXB 5MEQA 4EI6A 1JHKH 1S78C 4AG4A 5F1NA 5F44A 4XPAL 2VRAA 4YHZH 4Z2KA 4KDTA 4H8VA 1M05B 4ZZ5A 4QXGL 4XUPA 3RVTD 1B31A 4OM0H 2E7BA 3WN5B 2NY0D 1T7XA 3OB0K 2ORXA 2R4SL 2DLFL 3U36A 5DMYA 4BFIA 4R7DB 5C0IB 1HCFX 3O2WL 3KPLB 4WRLA 4KXZH 1ZS2A 4L8CA 2HN7B 2PWEA 3H9ZA 4E9LA 1YYML 2EO9A 3FFCA 1TLKA 3BYYA 1I9RH 4I3GA 5DD1L 2O5XL 4A41A 4QOKA 5DTFA 2VLLB 1DWHM 4UB0H 1V7MH 3ZKNC 3QUMA 1DQMH 4HX1A 5E70A 2A3AA 5HYJD 3BSZL 2C3WA 2X1WL 3K3QA 1FIGH 2EDQA 4V1DE 3FQNA 1MWAL 1GGBH 1HN1A 4N42A 5GZND 5C07B 5LAXA 3AS2A 3EJZC 4QYOB 3VXSA 5E0QA 4ACPA 4NKMB 4HF5H 1XR8B 5DHVH 5EU7E 1D9KB 4KRPB 5DWUL 5I1KH 2XOMA 2IALA 2GI7A 3UTZB 2HTKD 1FPTH 3HKFA 2ITDB 4CMMA 3N18A 2AEIT 2JB5L 5T3ZE 1JNDA 2X4UB 4X98A 1C5DB 4PJ7A 3IFPB 1EO8L 3F7YA 2IG2H 2C7UB 2NW3A 5BVPH 3U37A 4PIRF 2BZDA 3KPMB 1TCMA 3T0AA 1UOKA 1ZV5A 1QFWL 2D4FA 4JPKL 1FL5B 4EI5D 3ARRA 3Q3GB 4UQCA 2G41A 1RZIB 1JPGB 2BNRA 3JXSA 3MV01 3QUYD 4LEOA 2E40A 1H1NA 3EDKA 5AD0A 3FO0H 1E28B 1YUHA 3S6TA 1QBAA 5T33H 2LAGB 1XIWA 3JTSA 4Q6IC 4MGSA 2EC8A 3G6JA 5C71A 2QPSA 4IRJB 4KZDL 2AXGA 3B5GA 1QG3A 1SBSH 4M02A 4A42A 1QLFA 3K4ZA 2J4WL 4JZNB 5AAWA 4LAQH 2F74A 3LD8C 5ECUA 1IT9L 3IGAA 3U0PA 3WS6A 4GLRH 3OKEB 1A4KB 4UNUA 5SX4I 4MD0A 3IJHA 4N0YH 2YD2A 3VWJB 2UUDH 4JAMA 1F3DH 1PBYA 4PJ9A 1FL3A 1GC1H 3MA9L 4PJCF 2ADIB 4X7TA 3QFJE 4KKBD 4G6FD 2WVSA 3ZE2E 5C0GA 1JWMB 32C2A 3U0TB 2JJSA 1UH2A 1GL4B 4LCWE 2A83A 2FO4A 4P7LA 3ARGB 1UC6A 5ETUA 3TVMC 4K71C 1G7PA 3CHEA 4GO9A 1NH6A 1CICD 3QIWB 2JJTC 3CXDH 3NFNA 1EZVX 1S7XB 3DMMC 4M43H 1FHLA 1E4IA 3O4LA 3IB4A 4AK1A 1ZHNB 4ML4A 1J84A 4X99A 4MJIB 4LL9A 1RUKL 4M03A 1WP6A 4X8XA 1NC4B 5F1IA 5IBTH 4X9YA 1NWRA 2Y5EA 1L7IH 4PTVA 5DJ2B 3EJYD 4S1DD 3QHMA 1B0GA 3DIFA 3OZ9H 3V5KB 2CERA 4E0RA 5CMAB 5FL0A 1R3HB 5DLML 3L2LA 1JF1A 1A47A 1WCGA 2PWDA 5MHSD 5AAMA 4JKWA 4KY1H 2OJEB 5FM5M 3QGVA 5E2VH 1H9VA 4XPHH 1G84A 2DSKA 4WUUB 4PLJC 4PRHB 1W0YT 1OSEA 2YUWA 1U30A 4PTWA 4B3KA 4XHJD 5I1GL 3HZKB 2AW2A 2YD9A 3WQ5A 3F8UB 5A8NA 4H1LB 1IGYB 4ZDHB 4UT9L 1TVHA 2BX5A 3NGBB 5GZOD 1HE7A 1H49A 3BGFB 1QNQA 2ZOXA 4XPTL 4LMQI 3D3AA 3C09B 3CFJB 1AKJB 3D3VB 3MRRB 3QZWA 3MRPB 5FYLH 3TIEB 3KLHC 1JNEA 1UWTA 1S9VB 4WNQB 1DUYA 1BVKB 5I8OH 3LQCA 3WD5L 1AO7E 3ULVC 3MO4A 3AB0C 4JHWL 3WXWH 2VLME 4P8WA 4PGBA 5AZ2L 1LEIA 1KB5L 3OAYH 4RGMC 1UD3A 1KXQA 4HGWA 3DBXB 2X2YA 5DEFA 3T3MF 3BKCH 3MJ8A 3KXFB 1TZGL 2OQJA 3IETA 4MDJA 4X0VA 1XCQA 4G6KH 3ALXA 3VGAB 3I02B 4KJQC 2A9NL 3PXJA 3R1GH 1U8IA 1MFCL 3JWOC 1ZWIA 3S37L 3FRUA 2XICA 4PRIE 3WSQH 4EI5C 1BQUA 4BELD 3G6JF 5CPTA 3SDDD 1GQLA 3SQBA 1CIUA 4IRSA 3SIMA 3BISA 1MVUB 1ODAA 3C5SB 1HQRA 5FGCB 4JG1H 4ERSL 1WFNA 2R4RL 4MDIA 3O0RH 1H11A 2ZE0A 1M7DA 4Z77B 1NMCB 4PCSA 4AH2B 5JHDE 1DANU 1JHKL 1JP5A 4F3FB 1B3VA 4XPAH 4YHZL 4YJZL 3ALFA 5GGSB 4YK4B 3A7QA 4NUGL 4YWGH 5FGRA 2VMCA 3JSSA 5F7DB 3V2AR 1YJDC 3V8OA 3MRDA 2EKJA 1NDGA 2E3VA 3CTTA 3OAYK 2RB8A 3C5ZB 3WUEA 5EUKA 5ADOH 2H32H 2HWZH 3IU4H 3SDCC 4D6EA 2AJ3B 1FZJA 1RH9A 2LU3A 5I66B 1CFQA 4TVUA 1OF2B 3B9KC 3RWHA 3UROR 4PYSA 2ZJSL 2IAMD 5JR1L 5H37G 2X4QB 4G6ML 4N5ED 4JFPB 4KJWD 4JJHA 5D9SB 4NJ9H 5ESQB 1V7ML 3VOCA 1QHPA 2PTUA 3BQUB 2OR8A 3VMOA 1G6RB 3CK0H 3BSZH 5C08A 4P7QA 2OSLB 5DSCA 3U79A 4OCXH 3AIWA 1L8NA 1HK6A 3CCHA 2KH2B 1QHOA 2HG5B 2DWDA 2HYXA 4WDIB 2FD6L 4XUOA 4WUUE 2H2SC 1AGEA 2LVEA 4QOKD 4QDQA 2EXYD 4M8UA 4Z76A 8FABB 3BHBA 5DWUH 5I1KL 4HP5A 4RMTA 1IC4L 5DQ9A 5J1AB 2ERJB 1V0LA 1MPXA 4HA1A 3EBAA 4UDUA 4A3ZA 4MAYA 4NRZA 3VXRD 3LS5L 4CD4A 6TAAA 1UGNA 3RVVD 1T83C 1RIUL 4OCWH 1TCRB 1YY9D 3QNZA 1EV2E 4JVPA 4MNGB 2FDMA 4R4ND 5D5MF 4JFXB 4U1GC 3HCVA 1LNSA 2XSAA 4QDSA 2GSIB 4PG2C 1J8KA 1KCSL 1M01A 1HILB 4TYUA 3RILA 5C0BA 5ID0B 2WAOA 4KTDL 1PAMA 3PL6A 1ZU8A 4AENA 3L3KA 4KMTL 4XH2A 1KQZA 2AAVA 3CDFA 2LQRA 2EO1A 2LU4A 4HCRA 1ADQL 1HWGB 2YD3A 2XN9A 1K5NB 5D7IA 3MMEB 1YEIH 1RVFL 4FFWD 2WP3T 1SBSL 2Z1KA 3GH4A 5IV2B 5SWZB 3WIHA 4ZXBC 2VZRA 3LEXA 2JIXA 3RKDC 3CSBA 2ENSA 3LQZA 2QKIB 1FFRA 1JNNH 4N0YL 4B16A 1J8HB 1KYOJ 3TBTB 1GC1L 2BK8A 3ETPA 2FB4H 1N5YH 4Y2OA 3ZJ8A 4LKSA 3MX0A 4MGQA 1QBMH 4GSDL 5FUIA 3S5LB 3F58L 4F15B 1BX2A 3D48R 1MRDH 4NUJA 5F7KC 5BVJB 3BAXA 4AZIA 2J78A 4KRNA 4G80A 3RWJA 5GGTL 5M3WA 1XF5B 4X4ME 1BZ7A 3MCKB 1TDQA 2FR4B 5DMIL 3VFSB 5KVFL 4K71B 1HNGA 5CWSB 3NJ3A 3QCTH 1FGVL 3FOLA 3QIWC 3N1GC 5I30L 2VABB 3CFEB 5IBTL 1KXQE 1B90A 1U3HC 1L7IL 4R5EA 4KJPD 1KV3A 3QXAB 2QV2A 4JPVH 4KVNH 5DGQA 3DI2B 4PN2A 3CLEL 4O2EA 2IEPA 5DLMH 2R56H 1VERA 4KY1L 2Z8RA 3DYPA 4GXVL 4ZO6A 3MUIA 3DMMD 2VQUA 3P0YH 5HI4C 4U2ZA 1DBBL 4JHAL 3WNMA 1BWMA 4OGYH 5DFTA 2NR6C 4XZWA 1NLBL 3CZFB 3IU3A 3MREA 2AKRA 2DT2A 5INCB 4FZ8L 5K9KA 4WO4A 3O8XB 4KDVA 3EDEA 5FHAH 3CXHK 4CVWA 3BGFC 2DLEA 5DJDB 3OKKA 1L7TH 3GRWA 4QX3A 1AQKH 3ZHDA 4D8MA 5IFAL 3WD5H 1IAKA 5GGRY 2WCSA 2NY2D 5L2KB 3O4OC 1W9PA 1Q0YH 3O3AA 2IAMC 3WEXA 1KB5H 4KVCH 3UO1H 3CMOH 1N6QL 1LDSA 4GO8A 1AGFB 1JGLH 3TYFA 1JYNA 3P9MA 3C8KB 4DK3A 1FC2D 5I75B 4Z2GA 3C7OA 4ENEC 5IVXE 4CNIA 5HTSA 3SDCD 4FQ2H 3VFMA 1Q38A 4G6KL 1NBQA 2X4PA 4YHIB 3IVKA 1E5JA 4PJHA 2WMGA 3EYQD 1JPST 3R1GL 4PJBA 1X5YA 4DGVL 1AC0A 1DSFL 5C0DB 4ONGH 3WUWA 4ALAL 4XNMA 3MBXH 3SDAB 4GI8A 5EFIA 4QRSA 4JG1L 4ODSH 1JTTA 1QO3B 2R4RH 3O0RL 4OCRH 4JO3L 1IJ9A 1WWBX 4FQIH 4OUUB 5DJ6B 3PZGA 3VUPA 1ZLVK 1O7VA 1WK0A 4LLWB 3CX5K 4PREB 1HX0A 4DGYH 2CNCA 3PZMA 3DRQB 3PQYA 1JGEA 4YWGL 1DQQB 3OJDA 4MQXD 1MQ8A 1QSVA 5DVNA 3RWEA 2YPKB 2VDKL 1GOFA 1OP9A 1NCBL 4KKLC 2CDFA 2YHGA 1YEEH 1R3IH 4P7RA 5IFJB 4HJGA 2QQKL 3GMNB 5E2UL 4EKJA 2OLDA 3HZMA 4OI8A 1L7QA 2YLAA 4G6MH 2YLLA 5HXMA 5I2UA 4XB3A 4OLXH 4TUOB 5FGCE 5CIPA 1NKRA 3OR7B 3ARZA 3IDJA 1CD1B 1A22B 1H0DB 1FV1B 1KF9B 3CK0L 4M3KB 3TBVB 3VFUB 1N26A 1WZKA 4Z9KB 4M48H 2PW1A 4Y19D 5B21A 5CQ1A 4P2RB 5FA3B 3P6BA 2JJSC 4WJ5A 5JQ6H 5GISL 3DURB 5GRVK 5JMRA 1AQMA 2GTWA 2R23B 2Z8VC 4PJ5D 5JW5A 5B8CB 2XV6B 3VXTA 2YL6A 3HPNA 2O92A 2DLTA 1NC2B 3M17A 3PJSB 3Q6GH 1WBYB 2IGFL 4D2NA 3IXAB 3UCRA 1XF2B 1E3XA 5KOMC 4YPGA 2A0LC 3C7EA 1WDPA 3AHVA 4OT1H 3VFVA 2YA2A 4OCWL 3ARBC 1U33A 4JG0L 3O6FC 3H7BB 5E8NB 5F88A 1AO7B 4JZJA 4LHUA 2BXZA 1VFBB 4KROC 2COQA 4MXVF 4BXSV 1HSBB 4DEVA 2XQYG 4P7OA 1MJUL 1DQLH 4ELMB 1TFVA 1EXUA 1N7ML 4RGOL 2PBGA 1FFOA 4I9WD 2MQ3A 4C56E 2NNAB 5AUMB 1FNEB 3U7WH 5IF0A 2KQMA 5KTEL 1G5AA 1RU9L 3CFBB 3AY4A 1DVFD 3WIHH 2VRQA 2EDTA 1NANH 5I16A 3I2GA 1YEHL 3N06B 3SKMA 5IBLC 3H9SB 4MNQD 5D96C 4UILL 4PJGE 2CKRA 4RGNE 1FVCA 1YNTA 4QY8A 4AIEA 5F1OB 4Z7QF 1R3LA 5IIEA 1N5YL 1J01A 4WV1C 3RWIB 3ZT7A 3N12A 3PZUA 4P2OC 2FHFA 5H2BB 1BOGA 1ZSDA 4GSDH 3L3DB 5CZKA 1ZLUH 4HWBA 1HHGB 3AXHA 4RFOL 5F8QC 2VVSA 3PNWA 5IB3A 1IGTA 4I48A 4NSBA 5GGTH 2NY3D 3BJ91 4M6ML 5KVFH 4GW4B 1GGTA 1FZMB 5C2BH 3QCTL 3WENA 3PZOA 3I2FA 3CUFA 3WHXB 2CRZA 3UTTE 4UTFA 4X4XB 4MNQA 4HBCH 2FECL 5GGUB 3H0TA 5LWYH 2PC8A 1UEMA 4YHPB 1Q9LA 4JM2C 3IDNA 4RWYL 5FGSA 5H2BA 4KVNL 2DDXA 4KPHL 3II1A 4TVSa 1UFUA 1BD2D 3MBEB 4ONHB 2GUOA 3QDGE 1NUFA 4GXVH 1ZHBA 4Z7VF 5E4EC 2KDGA 3PZ9A 4KUZH 3VGDA 1YA5A 4HIXL 4WTWA 2E9LA 3BUYB 1DBBH 4JHAH 4UQEA 1GQKA 1LE5B 2DF3A 2G2RB 4IOIB 4AG4H 4UNTA 4YXLL 3U46B 4BSJA 1NLBH 4Q9CA 4LAJH 5SWSA 5DK3A 3PHQA 5EZJA 3BEVA 5D5ME 1OHQA 3HE6B 4M81A 2VDQL 3PGFH 3AMKA 1T1WA 1NUKA 1GMMA 4JL1A 5E09A 3QZWG 4KZEL 3QIUD 4M5ZL 1VACA 3PHAA 3VH8B 3CFCH 3F62A 2DSVA 5KAQF 3T0DA 1BGGA 1OARH 4J1UA 3U6RA 5IFAH 1D5XA 5JMOA 4LNRB 1JNHA 4P5YA 4UOW0 3EYFA 1Q0YL 43CAB 1G0XA 1T4KB 3CMOL 4JZJB 5A2CA 2DQTH 3A67L 3MUJA 4MQSB 2OJZL 1OM0A 4C7FA 2OI9B 2IAMB 3KNBB 1I7TB 3H9HA 3B2VL 1YN6A 4FQ2L 2YD1A 3QCVL 2CLVB 1OWWA 1IVLA 4HKJB 5CJ5A 2V6HA 3GBMH 5DUBA 1I1AA 4Y4KD 4HWEL 1DSFH 5E4IA 2VDPH 5JW5B 4N5UA 3MLSH 5ALCH 4LPYA 4WJ5B 1WDRA 3L3IB 5BW7C 1ZS8B 4GKLA 3MBXL 4D6CA 4LBEA 2ZCLL 3VD4A 2YG0A 4JO3H 2NCMA 4PRPB 4CUAA 4OF5A 3IDJB 4FQIL 5DZLA 2QV4A 2WBGA 1CT8A 4MJ6B 3REVB 4ZXBB 5K9OB 5G04L 3OA5A 4PJEE 3VXRB 1U3ZA 2GJJA 1J0KA 5F7NC 3OBAA 4Z7QE 3KPSA 4JFVA 4WKFA 3QIUA 4HJGB 4ZNEE 4XMKH 1FFPB 1BLIA 2A3HA 2P8LA 4KRPD 5HVWA 5J11B 2DLFH 2R4SH 4XPFH 1Q4NX 1WEJH 5F9WC 3GXUA 3P4NA 1PGRB 3CFKA 1R0AH 2KPNA 3O2WH 5EOTA 4PJ9C 3RWEB 1R3IL 3AIUA 2VDLH 2Z35B 2CBVA 1ISWA 1TPXB 1YYMH 1AQHA 1WITA 1ZHKA 2Q8BL 5E6ID 5FYKU 1I9RL 2F5AL 5GS0H 2VOTA 2XHYA 4PD4J 4OFYD 4OLXL 3Q48A 5IHZB 5IG7B 2R2BB 5GRVL 1WE5A 1QRNA 3E6HA 3E0GA 1UT9A 3STZA 5C09E 1GW1A 1FIGL 5BS0A 1OCQA 2YUVA 1NJ9B 1J11A 3SE4C 3QBTB 3MA7A 3PWUA 5FHBL 3GSOA 4W81A 1Z9LA 3IDYC 3TTSA 3FB5B 1FC1A 4X4YA 1QI0A 3BZ4A 4U1MB 1GAFH 2ZZUT 3GMLA 1H09A 4M3JA 4BF7A 4ODXA 4X5WB 5EOCJ 1G7JB 4LPTA 3WELA 1Z2KA 4OT1L 2XKNA 1NGZA 5BVPL 1KFAH 3AXIA 4IMLA 3P9MB 4JG0H 1JDAA 1K6QH 3W28A 4WFFE 2FLRT 1NCAL 1N3NA 1QFWH 3QI9D 2HVKB 3NSXA 5DJ0A 2JKXA 2PCPB 3QPQD 1W1PA 3WUBA 2VZOA 2O9TA 1TIUA 4OFIA 3ZKND 1V5JA 1NM9A 2WBJB 1IL1A 5IMMB 3CIHA 1F3DJ 5F7YC 4FK9A 1DQLL 3MLTA 1TG7A 2FJFB 4Q7NA 1MWAB 4NFDA 5IR1A 1E6NA 3WFHB 3MBWA 1FJ1B 3O8XA 2WO3A 4KZDH 2QMKA 4ATLA 3WIHL 4M1CD 5IB1B 1OGSA 3L1OL 4NCC2 2J4WH 3CZFA 3T0ED 4AEHH 4TVCA 5CKGA 1BJ8A 1FAKT 2X09A 1U8MB 4GKNA 5HOSA 4UILH 2Q8XA 1R5WB 4JM2F 4QF1B 2OK0L 1UZ0A 1T89C 2XKUA 3QG7L 4L8SC 3TJHD 2Y5TA 4BH8B 4FFYL 4HLJA 4ZODA 4ZO9A 3RDTA 2ZOKA 4P2OA 2WVTA 3AIBA 5JXED 2WLZA 3MA9H 2B7DT 4U1JA 5D2LA 2W67A 1AXSB 1JV5A 3UTPE 3D2UB 1SR0A 4QRRE 5DS8A 43C9A 1AI1H 3DUUB 4TUJB 4JY4B 3SDAC 4QHUA 5I8KH 4TXWA 1UWUA 2ZUNA 1U8HB 4NBYB 4GZIA 4WV1B 2BOCA 5IESH 4AT6B 1XH1A 4W4NA 4W5UA 1KTLA 1P1ZA 4P4KB 3ZDXE 1UWQA 1P84K 4L4TE 3G5VA 4Y88A 5C2BL 5MEPA 2VMDA 1HI6B 1RUKH 3ARDA 4FQXD 4Z7UA 3O3UN 4QTHB 3S5LA 3ARVA 3T1WA 3KHOA 1G9ML 1XAUA 3OZ9L 1FOBA 1ZT4A 4RIRB 4KI5F 4U7SA 4KPHH 3PWVB 2VJXA 2B2XH 1NKGA 1IQDB 1S7QB 3PDOA 4K3HA 5LXGL 2ICCA 1JTPA 4ODUA 2P8PA 4XPHL 1CTOA 1GGCL 5JO5A 3V9FA 1FNAA 2EPLX 3MV9E 2XHNA 3OLIA 1SMOA 5IMLA 5C0BD 3X13A 2MHAA 4UQ2B 2OZ4A 5E4EB 1NCNA 3TJHC 2YIHA 3O2DH 5HGBA 2WUBL 1X7QB 3FHAA 1YEGL 4KZEH 3M07A 3NIFF 4EN3C 5GSVB 1QLEH 1REIA 4PV9B 3E3QC 1IAIH 1PKQB 3L3KB 2DT1A 3RP1A 5IM7B 3OX8B 2FGLA 3WXWL 3VVGA 3JUZA 4LLYB 5AZ2H 5HBFA 4D0CB 5KVMC 4PTUB 2G3IA 4HH8A 2MHAB 4MNGA 1J9CT 4DKEH 3CUPA 4ZO8A 5JIKA 3RKPA 4NQXA 4GW1B 3GMQA 4H0IA 4D6FA 1Y0LA 1EEZB 2BFGA 3QCVH 4MAYB 3SGKA 4HZ8A 3PDOB 1S7QA 1EEYB 5FYKL 5JIIA 3GBML 4CJ0A 4NHCH 5BXFA 5HYSA 3BHBB 1MFCH 2M26A 4X6BA 4AEFA 4Z5RA 4UAPA 2UY5A 2VDPL 3GSWB 3GHBH 2YRZA 5C09A 1XGYH 5C09B 3GGWB 4OKDA 5KG9B 5D7IF 1EFQA 3MV9D 4LKXB 5HYSB 2OTUA 4JFDA 3BO8B 3JXAA 3ZR6A 1MREH 4P4KA 5DPNA 2PTVA 5BJTB 1C12B 2B4KA 1A8JH 2C1PB 4J3WA 1Y0LB 3GSNL 3GMQB 4XBGA 1U8HA 3CUPB 1EOKA 2QQNL 2EBNA 3DUUA 5DHYB 1I8IA 5DS8B 4D0CA 1W2VA 1FL6B 4N0CC 5C3LD 5I17A 4XMKL 2QQLA 3IJSA 5ADOL 4X7CC 3TGXA 2HWZL 3IU4L 3VIPA 1WWCA 3VMNA 3FT4B 1I8MB 3QRGL 1FCGA 3PL6C 4Q0XH 3VXRE 3DJ9A 1OAUH 2ATKA 3W0WB 4UZSA 2Q8BH 5J3HD 2Q3AA 4JFHD 3VCLA 4FOMA 4J12A 5EH1A 5GS0L 4JFTA 4H1LH 5CBAB 4WUUD 4NJ9L 4QPWA 1TPXC 3P40A 3EYOB 5T1MA 4MTVA 3AZRA 2FRGP 1SYVB 3ARYA 1MWAA 5KW9H 2ARJQ 2G5BA 3HI1A 2FJFA 3WH6A 4NWUL 1W9DM 4FLOA 2G5RA 3H9SD 4OB5H 1A6PA 2ESVD 4HKBB 4KHTH 3VFNB 1I1FB 2FD6H 5FHBH 1MLBB 1P4LA 5DVLA 5KSAD 4PRNB 1RYYA 1X5ZA 3T0EE 2O93L 4UQBA 2EICA 4TTDC 3WSUA 4NT6B 5MEND 1PZ5B 4MXWL 1A14L 4P2CG 1SJEA 3IDYB 4OSUL 4OMCA 1RHHB 2AK4A 3LS5H 2XKNB 3MLXH 4OOZA 1VFFA 1JL8A 3P11L 4NNPH 5DEFB 1RIUH 1ZT1B 3FB6B 4BA8A 4HGWB 2E0PA 1K6QL 5IK3A 3LRHA 1NCAH 2YL5A 5KZCD 1UXSB 1DZBA 2CDOA 4L3EE 2BOCB 1CL7L 1L6ZA 4HMEA 1WFOA 2R1YB 4KTDH 1MH5B 1DUYB 4KMTH 5M94B 2W4XA 1IAOB 3FKUS 3TIEA 3D2UA 4ONOA 2ZUSA 1AXSA 1JV5B 1I7UA 4NFCA 4Z2HA 1LE9B 1INQA 1LNUA 3GH7A 3POHA 1LL4A 4Z0XB 1YEIL 2FX8H 3ULSA 5I8CB 4BA0A 3WMBA 3FJTA 5I18H 3BMWA 1RUQL 3O6FA 2V5MA 1TVHB 3L1OH 1G9EA 3RIAF 1WDQA 1G7IA 4CGTA 5EC2B 2CKBA 1A02N 1GYAA 3MLVL 2DT3A 1HVXA 3GMMA 4FFYH 4CVZB 1JNNL 5H94A 3CBWA 3W11D 2Q3ZA 1SJHA 5JQHC 2WHKA 3WFHA 4HLZG 4Y4HC 3MNZA 2FB4L 4IRSC 4GAYB 5CMAA 2DL9A 4TTDD 3QIUB 2DQCL 3FB7B 1AI1L 1QBML 2JD9A 5IW1A 5IMMA 5DJ2A 1IL1B 1UQZA 1F4XL 5I8KL 3PWPE 3QULB 1FYTD 1MRDL 3WS3B 3BSHA 2J4GA 5JZ7C 4APQA 2E7HA 5DJ0B 4FFZL 4JFYB 2HVKA 1B4RA 2Q8AL 5DMIH 1ZJBA 1FGVH 3WN6A 3B8SA 4CCCA 1NGZB 4CUBA 3WL0A 1H6YA 3RY6C 3FB8A 3H9YA 1XH2A 1G9NC 4FF5A 1G7JA 1KFWA 5IQ7H 1PYWB 12E8H 3GMLB 1G9MH 3QIBC 1I1AB 4AM0B 5DUBB 3CLEH 2B0SL 3T3ME 5EWIL 3P9WB 3GSOB 4Z7WB 2ZXQA 2R56L 4KKBC 5LXGH 3VWJA 1K6AA 3K74B 5CPSA 3VXQA 1GGCH 1I7TA 3G6AA 2XUCA 2NXZB 2X10A 4YGVA 3P0YL 2NQCA 4GG8B 1QA9B 4OGYL 1VFAB 3BAJA 2R2BA 4PGZA 5CEXB 4URTB 1JNHB 1GHSA 3O2DL 3J7HA 4ZXBD 4LDOB 2FEDC 1YEGH 5FHAL 1Q1JH 3DRTB 3TWCH 2EDFA 1L7TL 2W47A 3V6BR 1K9FA 4AMCA 3WHE1 4LEOB 2WABA 1OGBA 1RZIA 2FX7L 4TVPL 1OAZH 4EXKA 4J7RA 3PHQB 5EZJB 1FL5A 1N6QH 3A23A 1S8DB 1SVCP 4J3TA 4IOIA 1FFQA 3KPMA 5CSZA 4DKEL 1K9EA 3VXRA 3MLWL 2FLBT 2JF1A 2Q7NA 4JEGB 3MBEA 1IM9B 3CH9A 4LPWA 1UG6A 4APQC 2ZUXA 1O8PA 4F66A 1EA9C 5IHRA 3IDUA 1XR8A 4HT1H 2QADD 3IDNB 2HFEB 3NABL 4YHPA 3GHBL 2WAHA 2BGPA 3QQ3B 5CSUA 3AREA 4OAWB 5BZWA 4DWHA 4ONGL 2BVEA 4ALAH 3VX0A 4X6CA 3UTOA 4JY5L 4ODSL 4GWJA 4XUYA 3KHQA 3RY5A 3GRWL 1O7SA 4JO1H 1MREL 5GRWA 3QWQB 3RY4A 1T2XA 1YN6B 2MQCA 7A3HA 3GSNH 2OWWA 1HJXA 4K8RD 3VTRA 4HXBL 4DGYL 1HOCA 5DT7A 4LFHD 1RZFL 2OTPA 4JN1H 4MA8H 5TE4L 5TE7L 2QQNH 3WUWG 1TQCB 3N17A 3JV6A 4YQXH 1EGJA 4LRIA 2J77A 1FIEA 2HN7A 4NO3B 1GNXA 1ZA6A 1CDIA 1UKSA 1VPOH 3FCTA 1OP5K 3KPLA 4R4FH 5C6WH 5IWLA 3MROB 1Q9WB 4O2CA 4R7DA 1HL8A 1U8LA 5DT1L 2LU7A 2RR3A 4UBDD 1XSKA 4AZ6A 4U3AA 3QRGH 4LPVA 1YEEL 4HPYH 2PUQT 4L3EA 7FABH 2DM7A 2N7AA 5IQ9A 3MBEC 5D9NA 2BNRE 3U9UA 1JFQH 1NFDF 4QX2A 1VACB 1OAUL 3GMRA 3T0XA 5I16B 3GSNB 5TH2A 4RN5A 3G9AB 3DSFL 1NC4D 3AMLA 5HBBA 5B38A 1JD7A 2W1QA 4QAWA 5DQJB 1A1NA 2BBAA 3AM8C 1B4JH 2W3JA 5KW9L 1EXUB 1V7NH 3QO1B 4P9HC 4M48L 3T8XA 4A3YA 2GUOB 5GISH 4Y2DD 1HSBA 1L9NA 3D25B 1MHEB 1E4NA 2UY3A 3SCVA 4XAWL 4CKQA 1W72A 2H8PB 3OF6D 1W0VA 4MXWH 2J8HA 3Q6GL 3UTSA 2VNCA 5DYOA 4YXKL 4N9GA 3OR6A 3QWOA 1D9KC 5F7UA 4LCYB 3MLXL 4LQFH 4MNQB 3CIQA 1U36A 3W11C 4NNPL 3H8NA 2W0LA 1ZVHA 4PBWD 1FZMA 2WMJA 5DVKA 4PJEB 4YIQB 3F7VB 4OCLC 4PJDF 1NC2A 2WWDA 5D7JD 2O61A 5IHSA 3VIHA 3VXTB 1A2YA 3FOMB 1X6NA 1U9KA 1V6XA 4JL2A 3PGDB 2J74A 4GKSA 5FA3A 1MJUH 4J3VA 4U1KA 4KUCF 1UZ8A 1BOGB 3CUHA 3JZ7A 2NY1D 4M7ZC 4OCNC 1N7MH 3BUTA 3FN0H 3GMOB 3R4DA 3VFUA 5T5FL 2W94A 2J7FA 4W85A 1H0DA 3U7WL 5KTEH 4FG6D 4ZXOA 1D5IH 2FX8L 2HT4D 3OR7A 5A2JH 5CD3B 4ZD3H 3DROB 1UR4A 2XFYA 3KXFD 5JOPE 2OL3L 1YEHH 4MNJA 4BK4A 5D7LD 4PG9A 2G60H 5IROC 4D8PB 1MFNA 2AQ2A 3G04B 5DRZA 3RVVC 3U30B 2XTJD 4B9ZA 4RDQG 2CESA 4NWTH 3CFBA 2WKLA 4MWFA 4HUVB 4XBEL 3SCMD 3KYAA 3RIAK 2WWKT 1FNEA 5IF0B 4MB3A 1FSKB 2CUMA 2EXYC 3P4OB 3OJDB 2DQCH 3SCRA 2QADC 1UY2A 1FVDA 2W63A 4OJFL 2W61A 1F4XH 4NPYB 4MDPA 1OAKL 4RFOH 1ZAGA 1B3JA 1JRHH 1JHJA 1EEQA 2V2WB 3CDGB 4FFZH 2JFEX 1KLGB 3EFDL 4HIJA 1AO7A 4M6MH 2Q8AH 3I85A 4NRYA 2P49B 3WV0A 3EOBA 4F7EB 4G5ZL 3WQWA 4KDWA 4FQCH 2KD7A 4WENB 4OZHA 3HR6A 1HHJA 3OSKA 4FLSA 5FUCE 4U3HA 2YXFA 1NWSA 3A0OA 1BFTA 4MAYD 5IQ7L 2ESCA 4RWYH 3VA2C 1WBYA 1NGYA 2EJ1A 5IVXF 1M7XA 2HJKA 4PJ9D 1EFXB 3P1IA 1G6RH 3BGMA 1QQDB 4NQVA 4P2RD 3UNPA 4GXPA 2ID4A 2BSSB 2NTFB 2WZEA 3ME0A 1JZ6A 3QHZL 3QH3A 4P2RA 5SWZE 4CNIB 2ORZA 2ILLA 2WSPA 4JDVB 1B2WH 4L1DA 4O9HL 3BQUD 4AG4L 4YXLH 1K8IB 4IPNB 2XIIA 4HK3J 3WEXB 5BXSA 5I1EL 5L2KA 1OY3B 2P45B 2R39A 3GBDA 3PGFL 1MNUL 3AS3A 3NCMA 4V2BA 4W8JA 4NNYA 2H3NB 3MLPA 1WO2A 2I27N 3RWFB 3TWCL 1TQBC 3BAEL 4MA7L 1OOAA 1F4AA 1OARL 1MUJA 3NZ8A 1IGJA 3TT3H 2FX7H 5EN2A 1OAZL 5AG9A 5KSBA 3SGEH 2AKRB 1MF2L 2YPKA 2X1OA 4OYUA 3ARTA 1QFHA 1QZ1A 3NACH 1DQQA 1MHPL 5E8EA 2CRYA 4ATWA 3AB0B 2DQTL 3A67H 3KDMB 2OJZH 5C6PB 4PJ8C 2BRRH 3J8F7 4PREA 3MLWH 1CS6A 3E8UL 3B2VH 1RJLB 4R0LA 4J27A 3V4UL 3SO5A 4AYSA 3EAKA 3R06B 4NO0A 5H8DA 4C4KT 1U3JA 3G9VA 3BZFB 4AZGA 1LD9A 2YWYA 3HNSH 4HWEH 4Y5XC 3ZHKA 4HT1L 3NABH 2OYMA 3WUWB 2EXWD 2WIIA 1FE8H 5C08E 1J0JA 1Y6MR 1BSIA 3MLSL 4PMVA 3FO1B 1UEYA 1LL7A 1DDHA 1GQPA 4OIIL 5JPMA 4PRWA 4AZ8A 3HAEA 4JVUA 2Y6SC 4RCAA 1BZ7B 3MCKA 1XF5A 3UTPD 2FR4A 5LGJA 3IVKB 3DNKA 3SO3B 1CLZH 4PJ7F 4KTEL 2JJWA 3C8KA 3JWDH 4MA8L 1H8OA 4RISL 1C8YA 2J8UB 3AVEA 2UV3A 5FUOH 2F8VA 2QQOA 4NCC1 2CCRA 3ZT6A 2GJ6D 2FDBP 3CZUA 3GHEL 4XPFL 4G42A 5DT1H 1WEJL 1R0AL 1ZANL 2BERA 3WJLC 2FZ3A 5GNXA 1XGRB 3LQZB 3WY1A 3R8BB 4ZUSA 3WFEH 7FABL 5DJDA 2VDLL 3DVNA 2W1SA 1W91A 3TA3B 1HJWA 3QXUA 3NCYS 3PE9A 2F5AH 1E6PA 4WO4B 1IEAB 3DSFH 4PLNC 3WUGA 1SEBB 3PHSA 2C9AA 3GI8L 2NYYD 4FFVD 3MMEA 2BHZA 4FMVA 1K2DB 1SYSB 1A21A 4QCEA 1V7NL 3O2DA 4WFFD 1UWRA 3VFWA 2E31A 1F97A 4GZEA 1I1YA 4KV5F 4Y4FD 2EE6A 1CN4A 1Q0XL 3CX5J 4TPRL 2X1IA 3TLRA 3MOQA 2PWFA 2FEDD 1GAFL 3WIJA 2X9WA 4JFUA 2B4CH 2PO6D 5EOQL 5IMKB 3MNWA 5FO8A 3THDA 3BIAX 3CFEA 5KSVB 2VABA 4LQFL 5SWQB 3O11A 1Y18A 1MCRA 4EZMA 1KFAL 3I6LE 5E8PA 5J4MA 1ZGLM 15C8L 2OTWB 4U6XB 5J1AA 5FO7A 4PTXA 3LKPA 2Z1SA 3KPRD 5LA2A 4G80B 4F2MB 4NDMA 1XH3A 1ZL1A 3SE3A 2MQ0A 4U1GB 2XQBL 2WC4A 2DWDB 5C9JA 3TBSA 2DI9A 2W60A 4G9DA 4GKZB 4M6OL 4MGXA 4GZJA 3PV6A 1WV7T 2HVMA 1ORQA 4KKAD 1WF5A 2ZUYA 5T5FH 5A94A 1G6RA 5C08B 1IGCH 3ULUC 2XFFA 1BF8A 1D5IL 3BX7C 4GG6E 4XC1H 6A3HA 3PF2A 3EB7A 3VM5A 1GNYA 1NFIA 1KXTB 2Z4QA 3QPQC 4AEHL 3VPLA 3RWHB 4HG4K 2AEWA 2ZSWA 1EHAA 5IV2A 4QNPE 4GLRI 1JZ3A 3I2KA 2OK0H 1XSIA 1OT1A 3QG7H 1MI5B 3LN4B 4FTVD 1XGUA 2DQDL 2ICEB 1B3YA 3SDXF 3WDRA 4ZS7H 1I4FB 1NGPL 3C8DA 5DJCA 4XBEH 3GKWL 3MACL 4U05A 4ELMF 2PXYA 3BRDA 3O2VH 4JFFA 5BRPA 1R3KB 5DK2A 2VCCA 1OTSD 3P0VL 4AD0A 2BV9A 3B5HA 4GKOA 4DCQB 4ZPTA 4OQTA 5IESL 2DOCA 1BBJA 3QUYA 4D94A 3HJEA 1JRHL 2DKUA 5CXPA 3TA9A 2MNUA 4HIIB 1F00I 3EFFA 3EFDH 4OIBA 4MDIB 4PP1C 3WH7A 4HLZH 4LHQB 4MX7B 4G5ZH 4EAMA 1AXTL 4G8EB 1D5MA 3OKNA 1MYRA 3F5KA 3VD3A 2A6DA 2GEEA 2XZCL 4EJ1C 4R9HA 5DD6B 5DQ9B 5EBAA 1A6TB 2NY3C 1TITA 3JTTA 1YEFH 5HHPA 4G8GD 1G9MC 1G6RL 2B2XL 4U1NA 3FZUD 1BVLB 5GGQL 2K1MA 3ULVE 3QHZH 3CFIC 4ETYA 2QTEA 3IETB 3KXFA 3T65B 3O9NA 4YPJA 3L3GA 4JQIH 3ZKQD 3VIMA 5AYBA 4QEGA 3E2HB 3AGVA 1B2WL 1X6LA 2XZAH 4O9HH 5DSCB 3RM4A 3SEEA 4GH7B 5HDOA 5ESQA 3SE9L 4HGKC 3WFLA 3THCA 3C9NB 1MY7A 3ARPA 5FKAB 1LMKA 1SM3H 2WUBH 5F9AC 1U91B 4YDJA 4M1DL 3E1F1 3QI9B 1QLEL 3BN6A 4JR9L 1JNLH 1U8PA 3BXNA 3R0NA 1XCTB 1IAIL 1YYLL 4LMQE 5TDPA 2A2QT 5AY7A 1G9NL 4EIGB 2GHWB 3TPUB 2GJXB 5J13C 2AJ3A 3TT3L 1S7RA 3BMVA 3C5ZA 4CN1A 3HPJB 2ICWJ 3NACL 5C3TA 1MHPH 5F7DA 1UQYA 1T2QH 4NZTH 4ZG1A 4UZUA 5DGRA 1T80A 3E8UH 5D2NA 4S3JA 4D6GA 2OJEA 5HGHA 3KPQA 3RPMA 1K8DA 3T0EB 4JJ5A 4PRIA 4PJ8B 1EDGA 1JF1B 5FYKH 5JPNB 1R3HA 1Z9OA 4NHCL 4E0RB 3ZE1E 1VSCA 3HNSL 5I3DA 1X5IA 4M93C 3W37A 4HS3B 1ZE3C 4RA3A 4IRSB 5DHVA 1HHKA 1FE8L 2Q86B 1XGYL 1OD8A 1R24A 4JKKA 4JGJA 2BNUA 5J6GA 4OIIH 4P3DA 4MA1C 3V5DB 3N1AA 3G6MA 1OLLA 1ZHNA 2WW5A 3ZYJA 2EIZA 1JAKA 1DTUA 4TNWF 2DI8A 1CDHA 1UH4A 3BESR 1J05B 2OR9L 4MDJB 2OQJB 5EO0B 2CUHA 1U8QB 2P5ED 3FAWA 4KTEH 3DBXA 4TNVF 3JWDL 3CU7A 1CNVA 1N8ZB 4RISH 2OS7A 5CD5C 3W5NA 5BZDA 4ZPVA 4ONFL 5GRJL 3UZVB 1LEIB 1JWMA 4W4ZA 4ZAKD 4HOZA 1OT5A 5JA9A 2A73A 3VRIA 3MV8B 3GHEH 4KI5C 1CDYA 1I1AC 1WIPA 2J47A 4Q0XL 1A4KA 3WFEL 1DP0A 3MRPA 2AP2A 3D3VA 3QZWB 4HTYA 5D7JC 1PKOA 4IBLT 4LP5A 1F11B 2C3XA 5KZCB 4LCWD 4A3HA 3ESVF 2R29H 4ORGB 1MELA 2FNBA 4BFGA 2EC9T 3JTSB 1OWRM 1UXWB 4JQVA 4NWUH 4WUUA 1E1FA 2BSED 5D7LB 4OB5L 2WDBA 4KHTL 1A1OA 2ZNXA 1EUUA 5A2KH 5ACZB 2PN5A 2P5WA 2XTJB 3LV3B 3LKOA 1JPGA 2BNRB 2VZTA 4IEFB 2ZX7A 2GJZA 1X5AA 4IUGA 1T22A 5EG6C 1QSZA 1IE5A 4JX0A 1A14H 1VESA 2W0FB 2B4CL 4BSVB 4OSUH 3VFGL 4C57C 5CZXC 2P8MA 3P11H 2CBIA 4NO0D 2XWEA 4KK6C 4E4PA 1V3KA 4PMUA 4JDTL 1I8LA 3O4LB 3HNMA 3BP4A 5EOCH 4CMMB 5SV3A 3RTQA 3HUJE 1D9KA 1FO0B 4HIEA 1DEEA 3T77B 5CZVL 1CL7H 4KKLD 1UM4H 3ARGA 1A9BA 2NT0A 2XQBH 3FZUC 4WFHD 3UTTA 3NBNA 4YEEA 3U4BH 4I0PB 4FI9A 5MERA 2DIBA 1NAMB 32C2B 4Q9BA 3QUXD 2VVNA 4NOFA 1OH4A 1OCWH 2ADIA 1IGCL 3BIKA 1KB9K 1YDPA 4JGMA 1LK3L 2YDQA 4XC1L 2J3SA 3DV4A 5I18L 1RUQH 3L5HA 2EE9A 2MKWA 1JHTA 2DMBA 2G3JA 1VDGA 3MRMA 4A4AA 3BN3B 3ISWA 3NN8B 3QRFM 4XP9L 4Y4KB 1H3VA 1QP1A 3MLVH 2I60L 4XVJL 4ESKA 4UV4H 3QQNA 1UZ6F 3TN0D 1NGPH 4Q74A 5EU6B 2BVYA 5EDXA 4IIQA 5SWSE 3X11B 3MACH 2H32A 2QSCH 3CSGA 1E28A 1Z9MA 4LGRB 5C0EA 3FFDA 4PRPD 1C90A 3SKOA 4C56B 1J12A 5EA0L 4JFQB 4RMWA 3C7FA 4P5TB 1NCDH 3MFGB 4KTYA 1IZKA 3QEGH 1E6QM 4PJDA 4UOZA 5CSBA 4R8WL 1FN4A 4KFZC 1CXFA 1QKZH 2WVUA 1AXTH 3EOAA 3QNYA 4FG6C 3HZVA 4Z7OE 4RGNC 3W53A 2JK5A 1N2RA 3PGCA 2X4UA 1AJ7H 1KBGH 1OVZA 2XZCH 4M5YH 4FXLA 3HG1D 1Z5LA 4WW1B 12E8L 2R1WB 4M00A 5D2NE 1C93A 4FP8H 4ZAKC 1KIQA 4JFHE 1YEFL 2B0SH 4PRBA 1N5AA 5CEZL 5EWIH 4HW6A 1G7HA 4HZLB 5GGQH 4KI5M 1U8JA 5LAXB 3QG6A 3QHTC 3SCTA 5KSAB 1SEQH 4F9JA 4ZS6D 3FQNB 3BP7B 4JREB 3UG3A 4RSVA 2QSQA 2EKSA 4O00A 1F4WL 3F2ZA 1J1PH 2EDJA 5L7XL 4MXQC 3RI5F 3NAAL 4K7PY 5IVNA 2B39A 4G9FE 3SE9H 4P08A 3ZDZF 4DM1A 1WQVT 2V38A 3KEHA 2ADGA 5DJZA 1P9MC 1Q1JL 2YSSB 4W70A 4CKVX 4JR9H 5KJRL 3ULVF 1P84J 1JNLL 4Z95H 1G9NH 5HVHB 5C0IA 5A2BA 5BQ7B 3BD3A 4TVPH 3QR2A 1DANT 2DCJA 2WWKO 1P7HL 4HC1L 3RGVB 2A3CA 4JRXD 4P46C 3R0MA 4EE9A 4OQTH 3CGTA 4W93A 1T2QL 4NZTL 1UJ3A 4ZFOL 1M05A 3T0BA 4UTAL 1M4KA 2D1ZA 5F1NB 4G43A 2NW2A 3W9EA 1RP9A 4WI4A 1K4CB 1KXVA 2CHOA 3U7YH 3QG6B 4HWZB 3L3JA 2ZOLA 1U58B 1JI1A 4QLLA 4QLRA 2YC2A 1MVFA 3VX1A 5IJVA 2BSTB 3PTQA 2BNQA 2VWEE 5J56B 5GGVH 4Z8FH 5HDRA 4ZUWB 3MJ6A 4JRXE 1V8HA 2VZUA 3KR3L 3STBA 3VG9B