2D6KA

Crystal structure of mouse galectin-9 n-terminal crd (crystal form 1)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
149
structure length
147
Chain Sequence
ALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Galectin-9 N-terminal Carbohydrate Recognition Domain from Mus musculus Reveals the Basic Mechanism of Carbohydrate Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein
molecule keywords lectin, galactose binding, soluble 9
total genus 33
structure length 147
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d6kA00
1DYKA 4FPOB 2WT0A 5DUVA 3RS6A 3WUCA 1QDOA 4LBNA 1AJOA 4FP2A 3T2TA 5IK7A 2GNMA 3AYDA 4K1ZA 4YW2A 1LOFA 1LCLA 3O0WA 3NV3A 3VV1A 3BODA 2ZGRA 1EPWA 3ZXEA 1W6QB 2VU9A 1Q56A 3OGGA 2R0HA 1GNZA 3ZXJA 4YLZA 3AZZA 2GMPA 2W08A 3NWKA 5DUUA 2D3SA 1IKPA 4ISRA 5GZDA 2ZA9A 4GXLA 5L73A 3WHUA 1QOTA 1TEIA 3POSA 2UU8A 2D3RA 2E6VA 1LHOA 4LBQB 4Y1XA 2LTNA 3SH5A 2DUQA 5HCBA 2A3WA 1VIWB 1LHVA 1UMZA 3IKWA 1QGLA 2A7AA 4R9CA 4YG6A 2W68A 2G4IA 5DXDA 1A78A 1CQ9A 2D6NA 5SV8A 3WDTA 3WCSA 3R4SA 2AENA 5HCAA 1AX0A 4C1XA 4YGDA 4AVTA 1MVQA 2WJSA 1JHNA 4FPHA 4ATFA 2PHTA 4FPLA 2WKKA 1SBFA 1MS3A 2GNBA 2WQZC 3FBYA 2CY6A 1BKZA 2D3PA 3JUUA 4FPCA 1AZDA 3LCPA 2AYHA 4YGEA 1RITA 1UPSA 3WDUA 1CONA 2AR6A 2CTVA 3AXEA 1S0FA 2R1BA 3OBRA 4UW4A 3HMYA 4YFZA 2UWAA 3QLQA 4JCKA 3ZSLA 3V0AA 2ZGQA 1YIFA 1PZ9A 4YZ5A 1S0BA 4Q27A 4D69A 4YG3A 1DYPA 3O5SA 4FOWA 2UWBA 4BOWA 1GANA 2YMZA 2A6YA 4FPJA 1DIWA 1ULCA 1V6MA 3ILNA 3AZXA 4DQAA 1W6MA 2V5YA 2ES3A 4L8QA 1FAYA 1V00A 2P34A 3VUOA 3L2YA 1ULGA 3AXDA 1G9CA 3AP4A 2NZ9A 1ONAA 1WLCA 2CYFA 2DVFA 4FVVA 2CWMA 2ZMLA 2OW4A 2A6ZA 4CZSA 3OY8A 3USUB 4W65A 4NOTA 1N1VA 2YXSA 1IKQA 1MS4A 1V6KA 4P9YA 4BPZA 5AVAA 1W6OB 1H30A 2EXIA 4YW1A 2ZHLA 3OYWB 4YW5A 1DGLA 2D6OX 3NV2A 3SH3A 3UJQA 4XOGA 4DPNA 1Z78A 1D0HA 3PJQA 4YZ4A 1GKBA 3MW4A 5JOWA 3PVEA 1UAIA 5IT6A 1V6JA 4XHBA 4SLIA 1ZA4A 2KM2A 1JYIA 3D4KA 1APNA 1LECA 2R0FA 4YGCA 5GJ6A 1AXZA 1ENQA 3D6EA 1HQLA 2VW1A 5EWSA 5T5LA 3NV1A 1LHNA 2DVGA 2DU1A 2UWCA 1MACA 2JD4A 3WV6A 4DS0A 2DUOA 2ZGNA 3N36A 2B7YA 2YZ4A 4XYXA 4R9BA 3WHTA 3ASIA 4XTPA 1NXD1 3WDWA 4GA9A 4PQ9A 1S0DA 1DHKB 3V0BA 4YW3A 2D43A 3ZYRA 1WUVA 5JMCA 2RHPA 5T55A 4HANA 1LEDA 5GZFA 3MEPA 1SLCA 3FFZA 2GMEA 1JXNA 3JU9A 1LJ7A 4FOYA 4WV8A 4WZFA 2W52A 1G86A 3AX4A 4R9AA 4XJ8A 3Q9OA 2EXJA 2P2KA 1Q8QA 1SCSA 2EALA 4I30A 1MR5A 2ZZJA 1LOGA 1V6OA 5T50A 3SISA 3ZYPA 1KDKA 2LALA 1LHWA 2AUYA 1R1ZA 4XJAA 4AWDA 1S1AA 1SCRA 4YZ2A 3ENRA 2OUJA 1LOFC 4K1YA 4BLIA 1QNWA 2P37A 4FPYA 3IPVB 4K21A 2A6WA 2NMNA 3KQRA 5JOYA 1CN1A 1ENRA 1JUIA 3ATGA 4XIOA 4PCRA 4H55A 1DQ0A 5IK5A 1MS1A 2DVBA 3BIWE 5GLUA 2GN7A 1C57A 5GLZA 3AP6A 5GLWA 3AZWA 5E88A 1MS9A 1DQ5A 1SBEA 1FYUA 1MS5A 4UW5A 2DTWA 1PZ8A 5H9PA 5CA6A 3RRDA 1CPMA 4PBPA 2D6LX 1UN1A 1H9PA 2DVAA 1CPNA 1ULFA 5JOZA 1MS0A 5DG2A 1LOAA 1AXYA 5HCFA 1Q8OA 1KJRA 1OKQA 1Q8VA 1W0PA 3M3OA 4DRVA 3DGTA 4CRQA 3WG2A 1HKDA 4ATEA 4AGRA 1S0JA 1W6NA 3N3HA 4BQ1A 1QOSA 2AGSA 1DBNA 3RMXA 3W58A 1Q8SA 1DZQA 5GZGA 5JVVA 1IS3A 1LESA 3V0AB 1Z0HA 3AJYA 1JYCA 1MZ5A 1HQWA 1V6NA 1F5FA 4TYSA 1UZZA 4AGVA 5F9TA 4Q8KA 2ENRA 3ILFA 2ZABA 2VW0A 1VALA 3T1MA 4TZDA 4DFSA 1N3OA 1XQNA 1C1LA 5DUWA 3W59A 1W6MB 3AP9A 3WCRA 1SLIA 2GALA 1FNZA 3AYEA 3UL2A 3IN9A 3FUQA 4M3CA 3BTAA 4XJ9A 3O12A 4AYUA 5CAZA 3POWA 1BYHA 1HDKA 5T5PA 1IS4A 1YI7A 3M3QA 1GLHA 5GM0A 1WD3A 3RSJA 1AX1A 1WW5A 2PHXA 3OY8B 3USUA 1D2SA 5CB7A 4XILA 1RINA 3T1LA 1RIRA 2VXRA 2R1DA 1S0GA 3TAYA 3VKLA 4F83A 2EAKA 2ZHNA 4P9XA 2GNDA 3N35A 1WLDA 1MZ6A 2JE7A 3OYWA 4GWNA 4P14A 4ZKTB 4Y1ZA 3UJOA 2TEPA 1UKGA 2JE9A 4FPKA 3VKFC 1DQ2A 4XJWA 4BM8A 3WDXA 3VKNA 3N7MA 1WD4A 5GZEA 1C1FA 1I3HA 2FMDA 3N7LA 4XBQA 3B69A 1N47A 2OUHA 2GDFA 3FLTA 3GALA 3ZXLA 1KQRA 1URXA 2D7FA 2GN3A 2WSUA 3RG0A 4BMEA 3OJBA 5KXBA 1IOAA 1AX2A 4Q1PA 1Q8PA 1SACA 1QKQA 3AK0A 3GNEA 3N7KA 4M3CF 4Y20A 3WG4A 3V65A 2WT2A 1JN2P 4Y22A 3AYCA 1C4RA 5DUXA 5FREA 3WNXA 3VKMA 4WVWA 3ZXFA 3V0BB 5KXEA 2A71A 1S0CA 1YYNA 4Z8BA 2NMOA 4M00A 1KITA 1YRZA 2E7QA 1N1SA 4XBLA 3AZYA 4XMAA 4ITCA 4U36A 1FNYA 2C5DA 1JW6A 4BLJA 1J1TA 3MW2A 3WDYA 3D5OA 3AFKA 3M3CA 4GKXA 1YO8A 1GZWB 1QOOA 2EF6A 4Q8LA 1GICA 3R05A 4ASMB 4WVVA 2BQPA 1QF3A 2CNAA 3R4UA 4JRAA 1IS6A 1GSLA 1W0OA 2XG3A 1W6PB 3KM5A 4YZ1A 1BJQA 2EXHA 3A4UA 5EXOA 3IPVA 4LBJA 1DQ6A 1G9BA 5T52A 2CWSA 5KXCA 1VLNA 2R16A 5JLVA 5FRAA 2ZACA 4YZ3A 4YM3A 1JOJA 4FQZA 1F9KA 4GKYA 2VY0A 3ZXKA 1LU2A 2ZGTA 2R49A 2JKBA 2CL2A 2YY1A 3WUDA 2V73A 3SNMA 2DWRA 3MW3A 3CNAA 2P3KA 2ZGSA 1B09A 4Y1VA 2NYYA 4XE9A 1KDMA 2NM1A 2PELA 4UW3A 4XTMA 5H9RA 2NP0A 5GALA 1OQ1A 4XBNA 1UL9A 4FPGA 2VUAA 4YM1A 5T54A 1W6NB 4LBQD 4LBOA 4XXAA 4YW4A 2A5ZA 2Q5TA 2WSVA 1A3KA 2WT1A 1H9WA 4XHXA 3B9CA 3V64A 1G9AA 4FOVA 1X50A 5GLTA 1GV9A 1BQPA 1LGCA 1SLLA 2DURA 3ILRA 2ZMNA 2ZKNA 4U2AA 1LOCA 2ZHKA 1GZ9A 5JOXA 3SH4A 4RA0A 5EYYA 4Q1RA 4CTEA 1SLTA 1LU1A 1KRIA 1HLCA 5CBLA 3FLRA 2XB6C 1N3QA 4RL7A 5CNAA 3AP7A 2DV9A 5T5JA 1BZWA 1V6IA 3I4IA 3WG1A 4YGBA 5E89A 1SLBA 2ZBJA 2UURA 1KJLA 4M3CB 4JC1A 4XJZA 2A70A 4YG0A 2YV8A 3VKOA 4FP3A 2ZGKA 1LTEA 4LBKA 2PHUA 2HYKA 3AP5A 1FX5A 2P3IA 4LBLA 4PF5A 2I2SA 3TB0A 5JDBA 3POYA 3WLUA 1BXHA 4AGGA 2JDZA 1WW4A 1CVNA 3I8TA 1G7YA 2E7TA 2SLIA 1AF9A 1IS5A 4K20A 4ZXKA 2D44A 1SBDA 5DZEA 3OPZA 2A3XA 2AREA 2D6KA 1WBFA 2DU0A 3FUOA 2ARXA 1W6QA 3O0VA 2JJ6A 3LSDA 3PVOA 3PVNA 1WW6A 1WBLA 4Y1UA 1ULEA 1QDCA 2E51A 3APBA 1A8DA 1DLLA 3LSEA 1SLAA 3H0OA 2GNTA 3IM0A 4YM2A 2A6VA 1S0IA 2WLQA 5GZCA 2SBAA 5F5QA 1FV3A 2ZGMA 1JBCA 1YXWA 1F31A 2D6MA 4LBQA 1MVEA 5BYNA 3ZPYA 3UK9A 1G8WA 1S0EA 3MPPG 4Y20B 4Y24A 4FPFA 4M3CE 4ISQA 1DFQA 1LHUA 2OVUA 2A3YA 1O4YA 1QU0A 4Y22B 1LODA 5KXDA 4P9WA 3ZSMA 3PMEA 3WOGA 2ZAAA 5H9SA 4BMBA 2GMMA 2VH9A 5IK4A 1G9FA 4DRRA 4XZPA 1GYKA 2W39A 5IK8A 1PZ7A 4Q26A 2ZGOA 2PHFA 3WG3A 1LENA 2EIGA 3HN1A 4OZXA 1CESA 3N7JA 2C9AA 3O0XA 4AVVA 1AVBA 1WCSA 1GZWA 1O4ZA 4YFWA 5DZGA 1G9DA 4IQPA 4YM0A 1GZCA 3B01A 1LGNA 1W6PA 3HR9A 3WDVA 5IUQA 2ZGUA 2FHRA 3AYAA 4MYEA 5H9QA 3ZSKA 4XJUA 1SFYA 1VAMA 2JECA 1GBGA 1I1EA 1MS8A 4Y1YA 2DTYA 3A0NA 1Y7BA 1N1TA 3U4XA 2H0BA 3M2MA 1ULDA 2NN8A 1AXKA 1LGBA 3FLPA 1GNHA 3RMYA 4LBMA 3AJZA 1LOEA 2A75A 3A0KA 4FPEA 1CJPA 5T5OA 4Q2FA 3SITA 1WLWA 5GLVA 4XDQA 2DVDA 2EXKA 2VW2A 1NLSA 4XMIA 1VAVA 1V6LA 2DUPA 4KBBA 1AJKA 1N3PA 1W6OA 1LEMA 2PHWA 4FQ4A 1LOBA 1QMJA 3ZVXA 3ZSJA 5LK5A 3C2UA 2ZMKA 3AZVA 4AVSA 2YROA 2AH2A 2ERFA 2DYCA 4GALA 3SLIA 3RQ0A 3NV4A 1UZYA 2ZGLA 1ZM1A 4XXPA 3IMNA 2P3JA 1FATA 3WZ1A 4Y26A 1QNYA 5E8AA 4M01A 4XIKA 3OBTA 1U0AA 1DQ4A 2A6XA 1ENSA 3DUIA 3M1HA 2ZGPA 4FOQA 4HL0A 5DZFA 1CR7A 4C1WA 3B3QE 2WNEA 4GWMA 5EYXA 4R9DA 1UX6A 2E53A 2Z42A 5DG1A 1DQ1A 3INAA 1WW7A 3B00A 3BOPA 2ARBA 3WVJA 1N1YA 3M3EA 3QCWA 1CIWA 4UW6A 2ZHMA 4NO4A 1LULA 2D6PA 1FV2A 1OFSA 2PHRA 4PBOA
chains in the Genus database with same CATH superfamily
3ZXAC 4MLOA 4Q0QA 1H6XA 2BGCA 2VTFA 2WT0A 4UFHA 3OGJA 5AFEA 4LBNA 4FP2A 4LK6A 5FKBA 3J7LA 2GNMA 3AYDA 3IDCB 4OI4A 4QX3A 2XUEA 5FOBB 2Y8KA 1HQNA 4CA9A 3LA2A 2CGPA 1R64A 3HNYM 1X33A 3A21A 4GH4B 2ZGRA 3WD5A 3ZXEA 4QX0A 3WR0A 2EAAA 1SPPA 2MEV1 1Q56A 4Q0SA 3KGLA 5F39A 2ATFA 4HZFA 2QQWA 4CU7A 5GZDA 4OMCA 1GQHA 5HXVA 3ST7A 5CISA 3SHRA 1LHOA 4LITA 4Y1XA 3X29B 3I3EA 1B35A 2ZTNA 1OLQA 4AVBA 2JENA 3IKWA 5HBAA 4MV2A 3LA3A 4X6RB 4YG6A 2WWJA 2G4IA 5FMOS 5EFUA 2D6NA 1CGPA 5FZ4A 2R32A 4UBGA 3GBFA 5IAVA 3VBFC 3RJ2X 2AENA 1AR82 2RG4A 4SBVA 1MVQA 1AR71 4FPHA 4M0HA 4P08A 2WKKA 1RUF1 4D7YA 2GNBA 3FHAA 2WQZC 2C4XA 2XBO2 3HIFA 2E32A 4N8MA 4CP0A 3P3NA 3WNOA 3CF6E 3RJRA 1UZ0A 5D2AA 5JSPA 2WDBA 2XONA 2Y6KA 3H1YA 3PUAA 3GZEA 2IC1A 3KZ4C 3TBDA 3AXEA 4E8CA 2UWAA 3IIIA 4LTAA 5FYCA 2W3JA 3ZSLA 1K5JA 1Y3TA 3HT2A 1XE7A 2ZX2A 5A6ZA 3ZXGA 3O5SA 1YQ5A 1VE0A 3SQOA 1RHI3 4HN1A 1BVP1 4CP2A 3Q8EA 5FLIA 4PLOA 4CCOA 5A3TA 3POJA 1MQTA 1PX3A 3VHPA 5L19A 1FAYA 1NLRA 4Q4X3 4OZOA 1G9CA 4FTEA 1XPWA 3DECA 5FPBA 5DDJ2 2CYFA 2CAVA 1S2EA 4KGQA 1TQ5A 4XUTA 1VBD1 4CU6A 4QKNA 2A6ZA 2HWB1 2IFRA 5I0UA 4CUBA 3OY8A 2B9UA 1EV12 1POQA 3T3YA 2JDNA 3KCCA 2W1QA 4DZGA 4NPMA 1GP4A 3I2HA 3KMHA 5KHHA 5LBCA 3ZDVA 1DGLA 5LA9A 3SH3A 4OVEA 4XFCA 1OOPC 2D5FA 2RDSA 4UFJA 4HKWA 1AR62 4BQYA 3CO2A 3KV5A 2VNOA 3ORJA 5B4XA 3P5BA 3OBZA 4ZZ5A 4RHV2 3ZIWA 1JYVA 3G7DA 1LR5A 1O59A 4LOTA 3K3NA 4PDWB 4PQQA 5APAA 5F3EA 3D4KA 5FZAA 1APNA 1LECA 3WP6A 5A33A 5K0UB 4YGCA 4EROA 3D6EA 3VLBB 4ZONA 3RPQA 1CAVA 2VW1A 3VBOC 4FCAA 1PHMA 5EWSA 1KEXA 4O61A 5J1XA 1W2NA 2DVGA 3ACGA 2JD4A 1CZVA 2ZCWA 3POGA 5IFPA 3GZTB 3BOWA 4NAOA 2B7YA 1CIYA 1W05A 1GWMA 4BQWA 1J58A 1Y4WA 3ZFGC 3WHTA 4B8EA 4XTPA 3SEEA 3T2QA 1NA1B 5CYYA 1AL23 5JAXA 1DHKB 3O14A 3S7EA 4ASLA 2WZEA 1GOFA 4QD2A 3WX5A 4HN0A 4N7UA 5JMCA 5FJKA 1GU3A 5FXXA 4WVMA 5FZ0A 2UYAA 5C70A 2W87A 5C4WA 3FFZA 2GMEA 2H6BA 1JXNA 2VNGA 1JYNA 1ND2C 4IE6A 4KBZA 1COV3 3Q9OA 3I59B 1GP5A 4L99A 2EXJA 2BP6A 2EALA 5FP3A 2ZZJA 1CAXB 1LOGA 3JZVA 1V6OA 2WO7A 5A3NA 3PUHA 3C7FA 3Q8BA 1H8VA 3I2GA 2Y0IA 2MEV2 1SCRA 2JX9A 2DCKA 2QQNA 4CYDA 4DUXA 4XAAA 4K1YA 1RUJ2 1QNWA 4LKEA 1FXZA 2A6WA 1H1IA 4JZRA 5C9AB 1CN1A 1C28A 3CJXA 1ENRA 3ATGA 3JB8A 4XIOA 3PIJA 4H55A 2E26A 3GZAA 1UYZA 2J7MA 5FP7A 2XL9A 5IK5A 2GN7A 1OSGA 3RZJA 4PDWC 2WNVC 4IV1A 1DQ5A 1MS5A 3DKQA 3OGSA 3VBOB 2DVAA 4NJ4A 5JOZA 2RS13 3A22A 5KBFA 1KJRA 1UCXA 1W0PA 4J6GA 2FDGA 4JV4A 4MGIE 4LIVA 1RXGA 4HG6B 4K7JA 3ZFGB 1QOSA 1W8UA 2PHLA 4BQ1A 4PT6A 5C8WA 1VRBA 1RVF1 1UW8A 2KD7A 1Q8SA 2W92A 3W58A 5KWRA 2IXLA 4DIQA 2ZXQA 2VZRA 4D3WA 2W95A 3AJYA 4LO5B 4MX3A 1I5ZA 4NHKA 1HQWA 2RJ2A 3DXUA 4HMZA 4TYSA 1UZZA 3CEWA 3AB0A 4DY3A 2QTWB 2C6SA 2VOVA 2Z69A 4NIGA 3T1MA 1N3OA 2CGOA 3KWVA 4UOJA 3W59A 3J4UH 3WCRA 5F3CA 1SLIA 3BKZA 2Y6HA 3O1PA 3FUQA 3JD71 4LA2A 2I74A 3GHMA 1OH4A 3PUQA 4KL1A 4MADA 4XJ9A 3WW3A 5CAZA 2VOTA 3H50A 3POWA 2N7GA 1HDKA 3PTYA 1JOPA 5IVEA 5A7OA 1VBD3 1WW5A 2WQ8A 4MG2A 1WWYA 2XKPA 3OY8B 1OURA 1YJKA 1RINA 5FLJA 5A7PA 2VXRA 1W8TA 4F83A 3U0ZA 2EAKA 4E8DA 4P9XA 4IEPA 1REEA 3OYWA 1MZ6A 5ANQA 4ZKTB 1JYTA 5LRSA 2VZOA 4WM7A 3UJOA 5CADA 5F32A 4OUSA 4Q4Y2 4JQTA 4ZZ8A 1UKGA 1W03A 4PDWA 1DQ2A 5DPNA 4BM8A 5D8AB 2HEWF 1SDDB 2V4AA 4RHV1 2QQVA 1OPOA 5ANNA 1I3HA 1ZRIA 2WN2A 3CZJA 2GU9A 1R082 4A3XA 4XQDA 3FLTA 4CEWB 2HWB3 2BNMA 3O1OA 3P3PA 2X5IB 5KXBA 4EV0A 4DQAA 1Q8PA 1YC61 4M3CF 2Q0AA 2F6BA 1QJY2 4QXKA 4AEDC 2NLRA 3WF3A 1HRV2 1YFYA 4Y22A 4TSVA 3WNXA 3WY6A 5C3QA 4GAZA 4AEJA 4AFDA 2XBO3 5FZ8A 1FOD2 2BJSA 4RR3C 1YYNA 1EYBA 2VPVA 3RFRA 1QJX3 4KNCA 4P02B 4FT8A 5C4WB 2JWPA 1JW6A 2YHJA 3VZMA 4RS5B 2D97A 3KV4A 1QHDA 2HWF1 3MW2A 4CP1A 2HH9A 2J1UA 2UY8A 4GMP0 4XACA 3AFKA 4YVSC 1J3RA 4PLNA 1ZNPA 5FUPA 3M3CA 1BMV1 4XF0A 3KV6A 4PIYA 1CAXA 4JQRA 4LHSA 3OCPA 2RS32 1RXFA 4WVVA 4B1MA 2BQPA 4MOAA 3NQHA 4UT5A 1BJQA 1YJLA 2EXHA 3A4UA 4LMFA 5DAXA 5FY9A 3UESA 1O8SA 1CD3G 2R073 3EB7A 2CWSA 3K4DA 4URAA 5KXCA 3CJIA 5FRAA 4NRQA 4A7KA 5J09A 4JDMA 1F9KA 1GFF2 4HSLA 1HRV1 3OGVA 2JXAA 2W0XA 1VBD2 2YY1A 3WUDA 4HKLA 4AI1A 5ACA1 2Y60A 4CDQA 2VD7A 3VBFA 3VZNA 3ZN6A 1ODMA 1DGRN 3WP3A 5FTTC 2NYYA 4XE9A 4LA3A 4XCBA 2ZAHA 4BU2A 1QQP2 4W50A 1PO13 3TN91 1TMF3 1SMVA 3AL6A 1IPSA 4XXAA 5A3PA 2MNGA 2A5ZA 4MGQA 2WN3A 4NPRA 4A4AA 4CVUA 1H9WA 4N9HA 2FDFA 3B9CA 4XUOA 3LIHA 4IL7A 1VBE2 4FOVA 4G9SB 3PJYA 4RR3B 3V64A 1G9AA 1GV9A 1OPMA 1FMD2 1SLLA 2XWBB 2ZX0A 3LA7A 4PIZA 4QU1A 2VNRA 2ZMNA 4DXZA 5JOXA 1VBB3 3CHXA 2RE9A 4RA0A 2BNOA 5IVYA 2GSYA 1RUC2 3MIDA 1OMIA 4ZS3A 3I7DA 3T09A 1N3QA 3KB5A 1NY72 4RL7A 5CNAA 2IXHA 1BZWA 3I4IA 5FQ0B 1R081 3N9MA 2YDEA 3W20A 2YPJA 3WSOA 2AACA 2UURA 4QPWA 4XABA 2CSGA 2QFEA 4AEKA 4AI0A 2A70A 2IXCA 5FO7B 3VKOA 1XNBA 3ZMNA 3O7OA 1DF0A 2ZEZA 2P3IA 5FP9A 1K3IA 4NE9A 3NRUA 5DAPA 3POYA 5F3IA 5I91A 3C3VA 4OFGA 2JDZA 3OUJA 4BB3A 1JZ4A 4CDWA 2SLIA 2CDPA 1OHFA 5FPLA 2D44A 2YYOA 2VE1A 3THPA 4AOCA 3MIFA 4OHZA 2AREA 3B5LB 3C7EA 5TSWA 3NAPC 2D93A 2VXJA 4AXOA 3O0VA 4LO8A 4UFKA 5A6QA 5KC6A 4K3UA 1SPPB 2LROA 4A41A 3ETPA 3PVNA 4META 1QDCA 1BBT3 2G1MA 3APBA 1SLAA 4DB5A 3U4SA 5LA0A 4QB2A 3KV9A 3JCIA 5C7GA 2BEOA 5K7PA 1PGL1 1JBCA 3RZHA 1YXWA 2D6MA 4LBQA 4NRMA 1NCQC 1CX1A 1W2UA 3MPPG 1UZVA 3OOXA 4KWKA 1O6UA 4NUBA 1KFXL 5HPOA 4GJYA 4S2FA 4QDRA 1K42A 1O4YA 2VQ0A 4AK3A 3PMEA 3ZFEC 5H9SA 2B39A 4BMBA 4MH0E 4IEWA 5FZKA 4RQPA 5IK8A 2E7AA 4V2VA 2PHFA 1OVSA 5LBFA 2ZZQA 1DZRA 3E1F1 3WG3A 1LENA 2ZPXA 4OZXA 1FMD3 5F5IA 4LJHA 4OLLA 2QDNA 5KHIA 3PLQA 2ZX1A 4Z82A 2QQKA 1WCSA 5A32B 5CU1A 2G9GA 2VMIA 3D0SA 4WM8A 3WW1A 3ON7A 1PGL2 1UY2A 4JGZB 1W6PA 1J83A 2XJRA 3HR9A 4CXYA 4JTNA 1O3SA 1QIQA 1TME1 2FHRA 4MYEA 4URTA 5F37A 1I6XA 3HOBA 3DYOA 4YVSA 4E4SA 5FJHA 1EY2A 4CUAA 5BNNA 1X9PA 2H0BA 1AXKA 2ADEA 2E63A 3AKRA 3ZIXA 4IV1C 1XB9A 5IYYA 1LB2A 1WLWA 1RUE1 2K2SA 4XDQA 3W5NA 2EXKA 3E5UA 4AHWA 5C3OA 4KBBA 1W6OA 4NHMA 5BNOC 5CVRA 3BI3A 1EV13 1LEMA 2RJKA 3U10A 5G04L 5LK5A 1VP6A 4AVSA 2DCZA 1OF4A 2WFPA 2QQJA 3OGRA 1RVF2 4ARXA 4NIHA 1ST8A 3NV4A 3JB4C 1ZM1A 3AMHA 2HWE3 4Y26A 2OIIA 1GUIA 4NHLA 1JU4A 2O0OA 4FOQA 2HWB2 1QJY1 5LZ6A 1OVPA 1UX6A 5A1LA 1NLQA 2FCTA 1VRH1 2HEVF 2YGMA 5DG1A 1DQ1A 5CFCC 3J7NA 5CFCA 1O8PA 3LEIA 3WVJA 3KD4A 3S30A 3PU3A 1OD5A 2QVSB 4JGZC 1CIWA 1W8ZA 2ZX4A 1FOD3 1RTVA 1LULA 2D6PA 2WO2A 4HKOA 3MLKA 4NO4A 4Q4X2 4XBNA 5FZ1A 2WNOA 3ZFFB 4FPOB 4E4DX 5I0TA 3RS6A 1SDWA 1C8NA 3TOJA 2W1UA 1YQCA 1AJOA 4GB31 1KD7A 1HXS1 2VC9A 3LGRA 4XUPA 1UYYA 3VDAA 4CDWB 1NCRB 2P1BA 3O0WA 5FYVA 3VZLA 1UD1A 5BUVA 1D4VB 1EPWA 1CAWB 1E5IA 1VAKA 2JG9B 5EJ1B 1PIV2 5FO8B 5IVJA 5LK7B 4QPGB 3O1RA 4QQHA 3ZXJA 1COV2 3ETQA 4CDUA 3LQCA 3UKNA 1R091 3LKJA 1UOFA 1SQ4A 2ZA9A 3GGLA 4HPKA 4L97A 5BNOB 1TEIA 4O7XA 3ZLIA 1V9U2 2D3RA 4LBQB 2YU1A 2LTNA 3D82A 3HWJA 1XNTA 1LHVA 2VM9A 1HJFA 4DXSA 2XQXA 1QGLA 2WQ4A 4UFMA 1F2NA 4XFIA 2W68A 2RDRA 1A78A 4Y4RA 2WAAA 4LLFA 4KWLA 1UX7A 3WCSA 5JIAA 5KR7A 2KXLA 3VBOA 1AR73 4AVTA 3E5QA 4ATFA 5E1RA 1VPHA 1ALYA 3RYRA 3E6DA 5I0RA 1UMHA 5LCWL 4FO9A 2R063 3BVCA 1WCUA 2CY6A 4N53A 4RQPB 1AL22 1UOJA 3JUUA 2WZ8A 3O1UA 2NQYA 4WM8C 1AZDA 4AFMA 2FDKA 5C3PA 3IAQA 1RUG2 1UPSA 2XWJB 4LXLA 3TEXA 5FR3A 1O3RA 4HVRA 5KHJA 5BNQA 1POV1 4OI1A 2VUJA 3OBRA 3HMYA 4CEYB 3BTXA 3QLQA 4TWTA 5F5AA 2KA3A 2ZS6B 3GCWA 5IATA 3T0DA 1YIFA 4Y5Z0 4CDXA 1PZ9A 4YZ5A 1PK6C 4Q27A 2RMU1 2ADDA 4H2AA 4YG3A 3UV9A 4D69A 5C5UA 1DYPA 4FTSA 3OPTA 3LEKA 3PUSA 2DF7A 4FPJA 4B7EA 1DIWA 4DINB 1NX9A 1ULCA 2I07B 1FPN3 3ILNA 5BNPA 2V4VA 3AZXA 1B35C 2V5YA 5D1IA 2ES3A 4L8QA 2B5HA 2BNNA 4C0BA 4N43C 4CXXA 3L2YA 2BFUS 3AXDA 3VD5A 4MXWA 4NWVA 4QB1A 4L92A 1WLCA 2IZWA 3B02A 3DPRC 1RUF2 1O4TA 1ZBE2 3M3IA 5F5CA 4X6QB 4AL9A 3S5QA 4LUKA 3USUB 3VBSA 2W91A 4IEZA 1M4WA 2P3YA 4YYOA 3KLSA 1RUG1 2VQTA 2XDVA 3GBWA 4P9YA 2WS92 5C6CA 3MFAA 2EXIA 2LM3A 4YW1A 2ZHLA 1R1A1 1JZ8A 3NV2A 5J98B 4XOGA 4WM7B 1Z78A 2YGLA 1GKBA 2P6HA 4AHYA 5FYBA 3UGGA 1S4CA 2W46A 3BPSA 1UAIA 1DCSA 2YBPA 4S2GA 5IT6A 5LRRA 5FP8A 3UKTA 1ENXA 5JXJA 4SLIA 1ZA4A 5FZOA 2KM2A 4MGYE 3NJZA 4MGZE 4YW6A 1PVC3 4NPLA 3O1SA 3AM2A 4E9KA 2JE8A 5A7QA 4JGYB 4QDSA 1AXZA 1ENQA 3MIGA 4OHXA 1OOPB 2GC0A 2OPKA 2FMYA 3ZXDA 1DG6A 1LHNA 5FYYA 4CP9B 4DMIA 4B3NA 3PHMA 2UWCA 4DS0A 2VMDA 4A44A 2D98A 3Q8CA 2KR2A 4XYXA 1ZVFA 3ASIA 3WDWA 2HYXA 2Y6GA 1S0DA 3V0BA 1IG0A 3B94A 4YW3A 2ZEWA 3ZYRA 1WUVA 4CCKA 4H7LA 3N9OA 3LDRA 3GZUC 3NNGA 4LKFA 1XXNA 1ZYBA 3MF9A 1LEDA 5IJRA 1K45A 3KF3A 3MEPA 5AC92 5FZ6A 4N43B 4F3JA 4AHXA 2HWD3 2B9VA 4FOYA 1NCRA 1AR61 3NW4A 1FT9A 3DPRB 4XUQA 3T4HB 3CBNA 3AX4A 4GH4A 4XJ8A 3IMMA 2R041 3HD8B 3JBG1 4GMP3 3WP4A 1RMU2 5T50A 3ZYPA 4H14A 1TME2 1KDKA 1NE6A 2LALA 1LHWA 2AUYA 1R1ZA 4XJAA 1PIV1 2LUWA 4CE8A 4W8JA 5FXZA 2BOIA 1LOFC 4A6SA 4Q4Y3 3K77A 3IPVB 3UGFA 2NMNA 3THTA 1FOD1 4YNIA 4PI2A 3K4AA 1DQ0A 1F35A 1U5XA 1H4HA 2VMEA 5A1AA 1BEV3 2VVDA 5GLWA 1MS9A 4M0NA 2WZR2 1SBEA 2X8KA 1PZ8A 5FZLA 3AKQA 5HXMA 5CA6A 3RRDA 1CPMA 2XJQA 5LEKA 5L7OA 1PNGA 1H9PA 3OUIA 5FCCA 1ZRFA 2VBDA 1CPNA 1ULFA 4QX2A 1F5JA 2HWE1 4HFSA 2BU9A 2Y26A 1OKQA 1Q8VA 3BTZA 3DGTA 1O91A 3WG2A 1HKDA 1US3A 3AC0A 1S0JA 4CRQA 1W6NA 1HJGA 4NIAA 2JKXA 2K9ZA 2AGSA 3HVDA 2WFF1 1FMD1 4I0BA 3SCGA 2VJXA 2BBVA 1MZFA 3LWCA 1PGW1 5C8CB 5JVVA 3M4FA 3RZZA 4E4HA 1MZ5A 4CDXB 1YFUA 2VG9A 1GZTA 2XOMA 3NSTA 3H7YA 2XBO1 1BK0A 3DKWA 5FZFA 4AGVA 3ILFA 4QDQA 1ASJ1 2EVXA 2ZABA 3OB8A 1VALA 4QGNA 1QJU2 3LB9A 4EN8B 4DFSA 2W1WA 1W6MB 1HV1A 1J1LA 5CIRA 1RUC3 4N90A 4BISA 1R093 4V2WA 1X8EA 3ITQA 2QNKA 3BTAA 4A7ZA 3O12A 4AYUA 5J36A 2ZKLA 1YI7A 3NAPA 1GLHA 3RSJA 4Q0VA 2XKOA 4HVQA 2WWSA 1F4AA 5CB7A 1AR91 2XJVA 4D94A 5IVVA 5FUNA 5EHDA 3TAYA 2R1DA 2G19A 2F4LA 4Q2FA 3SCFA 2GNDA 1PVC1 4Z2AA 1QQP3 1OA4A 5DAVA 2WS91 4BYYA 4L11A 4I09A 1AYN2 4KGGA 1JZ5A 2CU5A 2FDIA 4MZUA 1AHSA 2JE9A 5FAXA 3HBKA 4XJWA 3WDXA 5FV3A 2VMFA 2AEZA 3N7MA 5A33B 2UY9A 3BIEA 5JXIA 3VBUC 2RR11 1CAVB 3HN3A 1GMMA 2VZQA 4ZXEA 1TMF1 2XMLA 4H7MA 4QMAA 1OLRA 2GDFA 4CP9A 3GALA 3I2OA 4KI5M 3K75B 1URXA 3RI9A 4BMEA 1IOAA 1AX2A 2ZEXA 1SACA 3FN9A 1H1MA 1QKQA 1E57A 3AK0A 4Q1PA 4Y20A 3THDA 3ZO0B 2J42A 2VMCA 3V65A 2WT2A 5DUXA 1C4RA 3VKMA 4WVWA 2R042 1NA1C 2R062 2D5HA 2HEYF 1NUKA 3GBGA 4YVWC 4IGPA 5DAQA 3ZXFA 1VBB1 3ZDSA 5KXEA 1S0CA 4XDPA 2PN5A 4M00A 3QBQA 2X5IC 1VBC1 4QAWA 3AZYA 4IDZA 2XHKA 3A7QA 3MZHA 1QXRA 5FXVA 5JXGA 1O3QA 2FQPA 2GH2A 2EIDA 1UY0A 2ID4A 2WNUA 1YO8A 1GZWB 2I45A 2EF6A 1A34A 1ACCA 3FFQA 2FCUA 2B46X 3R4UA 1D4M2 1QF3A 5I8YA 1IS6A 2XG3A 2HWF3 3OD4A 4QB6A 4Q4V2 5EXOA 3IPVA 1CJDA 4V1PA 4YVSB 1VLNA 2R16A 1NE4A 4ZU4A 4RN5A 2ZACA 2BPA2 1QJU1 4GKYA 4WVZA 4IERA 3H1WA 2ZX3A 5FZGA 3ZXKA 4COWA 4FXGB 2JKBA 3H3UA 1RUE2 3KGZA 4D8MA 2DWRA 2ZGSA 3HNMA 1B09A 3SEPA 5F6KA 3FX3A 5HI0A 2P5BA 1KDMA 2QQMA 2RS53 1RC6A 4UW3A 4XTMA 4OI0A 3JBG3 3B9IA 4TXWA 1UL9A 2BYVE 2Q1ZB 1YHFA 1W6NB 1AYN3 4NAMA 5CZKA 3UKVA 3I3MA 1AR63 1HX6A 1S2BA 3B7MA 4IV3C 3VB9A 5CFDB 1AUYA 1OBNA 2ZOEB 4RHV3 4XHXA 5C8CA 2FD8A 2B45X 2MEV3 1X50A 3SMHA 1LGCA 5JI7A 2DBIA 1D2QA 1HB4A 1UYXA 1D0GA 2ZKNA 3ILRA 3WQ7A 5FPVA 3GYDA 3DL3A 1ZBA3 1RVF3 2DCYA 1ASJ3 1WMEA 3KSCA 4Q1RA 3DCQA 2WWUA 5EYYA 5CBLA 4GB33 3O1VA 2DV9A 3GHNA 1V6IA 4HONA 2R6QA 4YGBA 3DYMA 1SLBA 1U5ZA 2Y33A 1JZ2A 4YG0A 5JR2A 4FP3A 1KXGA 1DZTA 2ZGKA 5I8SA 1T6GC 2DBNA 3K4ZA 3KT7A 2EIEA 3AP5A 1FX5A 5T3NA 1RYYA 3RI8A 5FFOC 3TB0A 3J7MA 3VBHC 1MEC2 3BTYA 3SKVA 4AGGA 1WW4A 2BFUL 1W39A 3ROUA 3WF1A 1W8NA 4S2DA 1IS5A 4DEQA 1RUJ1 1JOBA 1VRH2 1SBDA 3LDBA 4NR1A 5DZEA 3OPZA 4DNYA 3TEWA 2E9QA 1AR81 1DU3D 2QQIA 2WUHA 2D6KA 1WBFA 4JRLA 2DU0A 5FY0A 2ARXA 1VMJA 1W6QA 2XLAA 4PIXA 1TME3 1R1A2 4OQ9A 5DABA 3LEGA 1WBLA 2E51A 4Y1UA 4BOWA 4BQ4A 1A8DA 1DLLA 1S55A 1VB2A 2BDRA 2XHNA 3IM0A 3J26N 2QDRA 4MGSA 4TTGA 4Q0UA 2WFF3 5D8AA 4AEDA 1BLZA 1S0IA 2GP3A 3BUCA 3N4MA 1ND3C 1H8TB 2SBAA 1FV3A 2YPDA 2XVKA 2ZGMA 5F5QA 3WF4A 4CU9A 5LY1A 3CKHA 4OULA 4AW7A 3C8XA 1F4HA 5BYNA 1YIPA 4B29A 3CIHA 3HT1A 5BNNC 2WNVA 3KHCA 4AAXA 4I02A 4FFHA 2GC1A 1S0EA 3FWEA 2JG8B 3R0RA 1CWPA 1COV1 2Z79A 1W9WA 2EICA 1XNCA 5LEJA 1LHUA 2A3YA 1I9RA 1QU0A 5LA1A 1VR3A 2Q8EA 5FP4A 4MXVA 4NMIA 4QX8A 5DDJ3 1HV0A 1SG3A 2GMMA 5IK4A 1GWKA 1TVGA 3H3LA 4HK8A 4EWDA 1KFUL 4N53B 2W9XA 2VCBA 4YWAA 1PZ7A 1X9TA 5J7MA 3AFGA 2EIGA 5EJZB 1CESA 2HBTA 3IDBB 3N7JA 2GZWA 4QPIB 3VBHB 5J37A 1V0AA 5JUVA 1K5MC 1Q5OA 4QU2A 1GZWA 4YFWA 1ASJ2 5DZGA 3MUY1 4IQPA 3WW4A 5BPXA 2HWC2 1GZCA 2O1QA 3WDVA 4COUA 1HRI1 5IUQA 1W3XA 3ZSKA 3I2FA 1SFYA 1REFA 1VAMA 1GBGA 2JECA 2O14A 3LPFA 4NVPA 5FPUA 4Y1YA 2DTYA 3J9SA 1OQEA 1PMHX 1NCQA 1U12A 1Y7BA 2Z5WA 1FPN2 3A0NA 3NVCA 3KCYA 4LUMA 5FYSA 1ULDA 1V9U3 2NN8A 2VZ3A 3ZYIB 2ORZA 1WA4A 2RMU2 4LBMA 2G9FA 2LS6A 3VBFB 3ZN6B 3E5XA 1LOEA 2A75A 1H8TC 1V70A 3THCA 3A0KA 2YU2A 1CJPA 1WLTA 1JYXA 3SITA 5KHKA 1KS4A 2BBAA 5A70A 5EJ3A 5EIYB 2PLV2 2ETEA 1RUF3 4A7YA 1S2KA 1ZZ9A 1V6LA 2DUPA 3FBMA 1AJKA 1N3PA 5I0SA 1EV11 4N7IA 2VZVA 2RJLA 4E2GA 1LOBA 2D40A 2BTVC 4CU8A 2YFZA 5FK7A 4HETA 1Y9GA 2DYCA 2RR12 5FZOB 3WQBA 2ZGLA 3VDDA 4JHTA 4M01A 1JTZX 2Q1MA 3OBTA 2YBKA 4Y3OA 1DQ4A 3CMGA 4BWOA 3M1HA 2ZGPA 2YC2A 1CR7A 2YC0A 4C1WA 1O5LA 3ACFA 2ZJCA 4XFHA 4RGAA 5EYXA 3ACLA 2Z42A 3MI8A 2EA7A 3DF0A 3MLJA 2R061 4AG4A 4FAGA 3INAA 1JZ3A 3ZPOA 3B00A 4XEZA 5EV7A 4LO4B 3M3EA 3QCWA 4QX1A 2OXBA 3U78A 2ZHMA 1C8M2 2JD9A 4DXRA 3I97A 3T0BA 4AI9A 4FPFA 5AVPA 4YPJA 1PO12 2GP5A 1DYKA 4Q4Y1 5DUVA 4AFAA 1QDOA 1BHGA 3BPZA 1EP0A 5F1RA 1E5RA 4BQ5A 3MV11 3HQXA 1DDLA 1LOFA 5FMDA 4QQLA 2GC3A 3DPRA 4HOOA 1VBE3 5A3UA 1PM4A 3LAGA 3I3QA 4LKSA 1RHI1 1W6QB 3LZZA 4A6OA 2VU9A 1YQ2A 3MIHA 4FI9A 3OGGA 2R0HA 1GNZA 1YFXA 5ACA2 4I0AA 5I0DA 1L3JA 1AYM3 2XH6A 3IDEA 4YLZA 3JD73 1IPJA 1ZRDA 1Y9QA 4ISRA 5K0UC 2AZ5A 3C7GA 1H8TA 2VO5A 2UU8A 1D4M1 1E5SA 1HN0A 2E6VA 5FY4A 3SH5A 2YFUA 4LPLA 1PGW2 5HCBA 5LWBA 1UMZA 2A7AA 1OI6A 1Q3EA 4R9CA 5DXDA 3D3AA 2JG8A 2E31A 3CL1A 4B4PA 5B2GB 1RL3A 2YC4A 5A7SA 2FBEA 2XL7A 4YGDA 2W47A 4IGQA 4C1XA 2WJSA 3MV01 2BUKA 3AKPA 4Q4W2 4FPLA 3PNAA 2WAOA 1SBFA 3F95A 3FBYA 3A23A 3QACA 3RWKX 3GCXA 4FPCA 2AYHA 1RUC1 2VZTA 4IEXA 5LW9A 1RITA 2JIJA 1Z7S2 2AR6A 2RS11 4BQXA 2IWGB 3F2ZA 3FL7A 4UW4A 4YFZA 3ZYGA 4JCKA 3WQ0A 2IUWA 3DYPA 4XQWA 2C24A 1L7LA 1UF2C 4BQ2A 5JPMB 3M70A 5A32A 3HQUA 1PK6A 1ZBA2 4K9SA 4WM8B 5FZ9A 2JDAA 3M8LA 4FOWA 2UWBA 4JGZA 5FO9B 1GANA 2A6YA 1W06A 4HK9A 4N9IA 1V6MA 4RGKA 1JU3A 4CEYC 2VMGA 1RGSA 1QH7A 1QQP1 4IXLA 3QD6A 2VMHA 1V00A 2OQ6A 3HAGA 3NJVA 3UT0A 3T4VA 1CZSA 1NKGA 3AP4A 1KS5A 2NZ9A 2VOXA 3BGAA 3D0JA 3OF1A 4P5YA 4UAPA 5FY5A 5JZGB 5EPAA 2DVFA 3FHIB 4GQ7A 2P17A 4I2OA 2CWMA 2ZMLA 2WZR1 4AQ2A 1HRV3 2OW4A 1HN1A 3N9PA 4OUMA 3VBSC 4B4QA 5SV5A 4W65A 4GULA 4NOTA 1N1VA 2YXSA 1MS4A 1V6KA 4LE4A 4Z07A 4UWDA 4BPZA 1UNBA 4AF9A 2PXJA 3NL1A 1W6OB 1H30A 4JDNA 3VDDC 1YUDA 4YW5A 3AMQA 1AYN1 4LE3A 2D6OX 4QQOA 4ZU5A 3UJQA 3I2KA 4D7SA 1G6NA 1HRI3 1XJAA 1C3HA 1UPIA 2JICA 3CJIC 4GH4C 4YZ4A 1W3VA 3RNSA 4XHBA 1W2AX 3WXPA 3FC0A 5AC91 3ELNA 2BVBA 1JYIA 1RJ7A 2Z4FA 3HQRA 3WF2A 5GJ6A 2LW8A 1HQLA 4OHWA 3NV1A 1BBT1 3EO6A 3VGIA 3ZX7A 5DN2A 3WV6A 2CV6A 2IXJA 2ET1A 2DUOA 4BXFA 2X5IA 4DEVA 2YZ4A 3MLLA 4ZPIA 1MZEA 5CFCB 4XW3A 3LE0A 4YRDA 4JGYC 3J8F3 5FZHA 4MO3M 1NXD1 4P00B 5B4NA 2VZUA 4GA9A 4PQ9A 5F6LB 5FMOL 2A1XA 2D43A 3PTRB 5A1FA 2B42B 2RHPA 2PMWB 3PDQA 4HANA 3WP5A 2J1RA 3ZFFC 1WMFA 1JHJA 5HCHA 2PTMA 2W5FA 4BXSV 1SLCA 3JU9A 4CDWC 3D8CA 4LEJA 2VQUA 4WV8A 4WZFA 5FZMA 5LATA 2W52A 1TMF2 3MICA 2BWAA 1OQDA 3CQOA 1QJX1 4PHZA 1SCSA 1UOGA 4BIFA 2Y0OA 3ZYJB 2GC2A 4QPGC 2C26A 5FPAA 5FPZA 4R4ZA 1PMJX 4YZ2A 5D8AC 1S1AA 4A2UA 1RUOA 3USSA 2OUJA 4BH9A 2P37A 2RS31 2TBVA 2OZJA 4K21A 3KQRA 5JOYA 1D4M3 5FBJA 1W0NA 1VBB2 4MHRA 1JUIA 4D0QA 4EN0A 3CJIB 5AFBA 1AL0G 5JIUA 4BHPA 3EMRA 1MS1A 3ZM8A 3RZLA 2G9ZA 1C57A 3AP6A 3AZWA 3ZOIA 2OX0A 4IW3A 4UW5A 4I3GA 4Q0PA 2CAUA 4CXWA 1YFWA 2DTWA 3I3DA 1WKYA 5L7OC 4PBPA 1VJ2A 1UN1A 1VBE1 5FDBA 1OT5A 3KVAA 4GJZA 3I3BA 3ZN4A 5DG2A 1LOAA 4EN9B 1Q8OA 3M3OA 3N9LA 4ATEA 5JSOA 4AGRA 1F15A 1ULPA 3N3HA 1PO22 2JDYA 3FHQA 3TN92 3S57A 1DBNA 2PFWA 2VZ1A 4JKMA 3VHRA 1UO9A 1DZQA 3EHKA 2YB7A 4BK4A 5GZGA 1IS3A 1LESA 3V0AB 1Z0HA 1JYCA 2BRTA 4LULA 1XSRA 4XFFA 1PK6B 4Q8KA 4XFAA 3H7JA 1HB1A 4ET7A 3R6SA 2JIGA 1GR3A 1QXPA 4W6WA 5CKMA 5BNPB 2H0VA 4TZDA 1XQNA 5C8CC 1H2KA 4LO6B 2WBKA 4ZHNA 3AP9A 1W9YA 2GALA 1IPKA 4QHZA 4BE3A 3IN9A 1RJ8A 5FQ0A 2VULA 4CSWA 2ZEYA 5LA2A 1UY1A 1WZXA 5FY7A 4B7KA 1BYHA 3U11A 1FI2A 1QWRA 3PUIA 2R30A 1W99A 5T5PA 2Q8DA 4OHVA 1IS4A 1ZZ6A 4XURA 4KH9A 1AX1A 3ABZA 3OSDA 4LIUA 2X05A 1D2SA 4KU8A 4YW7A 2VR4A 1GQGA 4XILA 1RIRA 3GF6A 3W21A 2FZ1A 5A3OA 2ZHNA 3LPGA 4GWNA 4BIOA 1WLDA 2RM22 4H3WA 3HNBM 4EJRA 4P14A 4G4FA 4Y1ZA 1PIV3 3IIAA 2BWCA 1ND2B 4FFIA 4NN0A 4QX7A 5LY2A 2TEPA 5C3RA 3S7IA 1QJFA 2VTXJ 2VL4A 5FYTA 3U07A 1JZ6A 4I0WB 1EUTA 1UU4A 3T2OA 3MO4A 1R1A3 1X36A 3GM8A 3LEMA 4ZY9A 3I49A 1WD4A 4F7ZA 4JGYA 3TEYA 1C1FA 1XC6A 2QQUA 3I2DA 4LORA 1PVXA 5FY8A 5L9RA 3VBUA 1K12A 2FMDA 3N7LA 5JXHA 4HT1T 1H0BA 4LLOA 2OUHA 3P1IA 1UZWA 2VGDA 4EWEA 1KQRA 2ET7A 2GN3A 1SEFA 2WSUA 3RG0A 3OPWA 3GNEA 4XAEA 5M0TA 5FIXA 3N7KA 1LNSA 1JN2P 5E16A 3AYCA 5FREA 3W9AA 5KC5A 3VBRA 1JZ7A 5A3WA 3V0BB 4JDOA 4IESA 4Z8BA 3RYPA 2MPFA 1KITA 1YRZA 2E7QA 1N1SA 4Q5OA 2RM21 3EQEA 4N43A 1XOYA 4O65A 1YLLA 1FNYA 1MEC3 2C5DA 4A45A 2ORXA 4BLJA 5F2SA 4HXCA 4NROA 4QPIA 4YVWB 3D5OA 4RFRB 1JH5A 4XETA 1ZZCA 3I59A 3PIGA 3OG2A 3VZOA 2K46A 1SZBA 3WW2A 4A3ZA 4Q8LA 4L0PA 4S2HA 3ES4A 5DQ0A 3VDCA 4ASMB 4JRAA 1AYM1 2QCSB 2RS51 1GSLA 1U5IA 2WIIB 1UXZA 3AVRA 4EYUA 4D6RA 4LBJA 1DQ6A 4NHXA 1MQTC 2VZSA 5T52A 5C9AA 1G9BA 2DDUA 2OT7A 3VD9A 4YM3A 3KHBA 1NCQB 2VY0A 4IETA 1LU2A 2R49A 3URFA 1HXS3 1ZBE3 3GDBA 1PMIA 3TYJA 1A6CA 1ZZ8A 4LK7A 5A80A 3MW3A 2P3KA 1RUD1 5AC93 4IE5A 4IE4A 4JHZA 4AVAA 5H9RA 5GALA 1OQ1A 2VECA 3CLPA 4HSJA 4CCLA 3BN6A 4W6XA 1FPN1 1WCKA 2VUAA 4FPGA 4YM1A 5T54A 1IHMA 4EE2A 4UI9L 4LBOA 4EZ4A 1XNKA 1C8M1 3NJXA 2WT1A 3WNNA 2J1VA 4RGGA 2QUOA 2EIBA 4CPBA 5GLTA 4AEMA 1BQPA 3BYWA 1XU2A 4OUEA 4CDXC 1LOCA 1POV3 4MGKE 4LQRA 2A73B 1QEXA 3K2OA 2O8QA 4IV3B 1ND3A 2QQPA 1O7FA 4KG8A 1LU1A 3FLRA 5FOJB 1W04A 1RHI2 2XB6C 3AP7A 5T5JA 3AMPA 1H2NA 1D7PM 4IEUA 3WG1A 3WNMA 3MHZA 3U75A 1XRUA 3ZKUA 4LT5A 2ZBJA 4XCAA 3CDZB 4RFT0 4AQ6A 3IB3A 3J8F2 4M3CB 1UQXA 4R8HA 4XJZA 5K9YA 2R7EB 1YCIA 2V09A 5IVCA 2J1AA 2PHUA 2HYKA 3ECQA 4J25A 1TZOA 4D6SA 5J3UA 4PF5A 4IE7A 5JDBA 3ZFFA 1BXHA 3QH7A 4GWIA 1CVNA 4MGTA 1G7YA 1JS9A 1OH3A 1AF9A 3QH6A 4K20A 2C1FA 3I2JA 4Z2WA 5C4WC 5K8SA 2PLV3 2WLPA 1EAH2 3RVHA 2JG9A 3FUOA 1CAWA 4ORFA 1RUG3 2Q4SA 3IBMA 1OFNA 1MEC1 2VOKA 3S6PA 3JQWA 4CDUB 2GNTA 4CCDA 4WBBA 4AI2A 2A6VA 1QJU3 1L7RA 4COZA 2WLQA 3UNPA 4LKDA 5ISLA 1YQ8A 4MHUA 3VBUB 1F31A 1R092 1MVEA 5HV0A 2X29A 1HB2A 3OBAA 3WNPA 4CEWA 2QZ2A 1XBFA 1UY3A 1WCQA 3ZPYA 4ONUA 1UU5A 3UK9A 3JXSA 4CPBD 4Y20B 1JODA 4Y24A 4BK5A 4ISQA 1DFQA 3I2IA 1SHWB 2OVUA 3Q8FA 4Y22B 1LODA 4TLGA 4P9WA 5KXDA 3ZSMA 3WOGA 1VBC2 1UIKA 2ZAAA 5FKCA 3LFIA 3CZUA 3RZKA 1G9FA 4DRRA 1AR72 5A6XA 2W39A 1TE1B 5E6HA 1PO23 4Q26A 1STMA 5JCTA 2Y6FA 4AZZA 2CGNA 2X53S 3HN1A 3JQXA 2PAEA 3HBZA 4TLFA 4AVVA 1ZBA1 3ZR5A 1Z7S3 2BV4A 1O4ZA 2XGXA 4N53C 4B4RA 4YM0A 5EZWA 4JTOA 2HKXA 2Q30A 3ZYBA 1NZIA 3B01A 1LGNA 3TNPB 3U37A 5C5TA 1RUD2 4GIQA 1X7NA 1VB4A 3AYAA 1ZA7A 4R52A 5H9QA 4NIIA 4XJUA 1J3QA 1K5MB 1MS8A 5JSRA 1I1EA 4IEYA 4IEVA 1QJY3 4QPYA 5F8PA 3ZR6A 2WINB 5FZCA 4K6BA 3U4XA 3M2MA 2GH8A 1LGBA 2DFBA 1LAJA 5F3GA 3UYJA 2L9LA 3NNMA 3RMYA 4CDQB 3AJZA 3MIBA 4KWUA 3OEAA 1WMXA 4KU7A 5KHGA 5T5OA 4FPEA 4RYDA 1PNFA 3LD8A 1Y9MA 4NHYA 2DVDA 1RUH3 4RQPC 2VW2A 4Q29A 5IW0A 4C91A 5FWJA 4FTBA 4XMIA 1VAVA 1I5PA 2C9KA 2RM23 2WO3A 3WNLA 5JMOA 5FLHA 2FCVA 4E27A 4FQ4A 1X82A 1QMJA 3MYXA 1UIJA 3ZVXA 1DGWA 2ZMKA 3AZVA 4XZUG 4XF3A 1WMDA 4Z1VA 2VUCA 2AH2A 4GMP1 3LIGA 3RQ0A 1W8OA 1UZYA 1SFPA 4JAAA 5EQUA 3AKSA 4QM9A 4XXPA 3IMNA 1RMU3 5K0UA 1UKRA 1QNYA 2VCCA 3Q8AA 1US2A 5E8AA 1YQ6A 1ZRRA 4ES8A 1U0AA 3MUZ1 1ENSA 3DUIA 5DZFA 4UXAA 4Y5SA 1H4GA 1NZCA 4NWWA 4GWMA 4R9DA 4B1LA 2X10A 1E5HA 2VUDA 5DDJ1 3FMGA 1BEV1 1VBC3 3GJBA 2FDHA 2XQRA 5ABJA 4UFLA 5FZIA 3NNLA 1GOHA 2WZR3 2VZPA 2DFCA 4ASKA 1OFSA 2PHRA 3JBG2 4PBOA 1ZREA 3ZFEB 4AE2A 3WUCA 1HIXA 1ZBE1 1NYWA 3T2TA 4K8FA 4PJYA 3LOIA 3E97A 4K1ZA 4C0HA 5IK7A 4YW2A 1LRHA 1J59A 2BW8A 5IVBA 4CDQC 3RZGA 1LCLA 3VV1A 1YNAA 3NV3A 3BU7A 4WM7C 3BODA 1BBT2 2QJVA 3OD0A 3S0MA 2HWD2 4D7TA 4QKBA 4QHOA 3QOPA 3ZYHA 3KT4A 5JR7B 3WQ1A 4XPVA 3AZZA 1OA2A 2GMPA 2W08A 3NWKA 5DUUA 2D3SA 1IKPA 3RGBA 2X09A 2XVLA 2JDMA 3IWZA 4GXLA 5L73A 1QOTA 3POSA 3WHUA 1EUUA 2FZ2A 2E33A 4P9GA 3T2PA 1CX4A 1NQJA 2DUQA 2OQ7A 3EBRA 1VBA2 1VIWB 2A3WA 2CHHA 4J1XA 5FMCA 5JWPA 2WNVB 2BOJA 3IT8A 5FYIA 4KMQA 1CQ9A 1AR93 3U1XA 5JPNB 5SV8A 3WDTA 4IUGA 4LR4A 3R4SA 5HCAA 1AX0A 5D21A 4EZHA 3PU8A 1JHNA 4OMDA 2PHTA 2ARCA 3RDIA 1MS3A 2XPJA 1VRH3 3OTFA 1BKZA 2D3PA 2R071 2V5DA 1O5UA 2OA2A 4AFBA 3LCPA 4INDA 4YGEA 3RWNA 3ZFGA 1C5HA 3U14A 3WDUA 1CONA 2JB4A 2CTVA 5LB6A 2J1TA 3MDPA 1S0FA 2R1BA 4NIDA 3VBHA 2CDOA 3TWIA 3GXUA 4QPIC 1IQAA 3V0AA 2ZGQA 4R4XA 3K51A 1TNFA 4AI3A 1OUXA 1DYOA 1S0BA 1IG3A 4UBHA 1OF3A 4CUGA 4M4PA 4MVTA 4XFBA 5J48A 4XQ4A 2YMZA 1QH6A 5FYUA 2PAMA 2QZ3A 4IE0A 1M06G 1W6MA 1K5MA 4LO7A 4OCTA 3UETA 4D6QA 2PHDA 2P34A 5FPXA 3VUOA 1Q43A 1ULGA 1XYOA 3T08A 3N9NA 4UF0A 1ONAA 3FZ3A 5A6YA 2WZPP 5CG8A 4FVVA 4AQTA 5L9BA 1UOBA 4CZSA 3K46A 1DGWX 2Y38A 1IKQA 1CZTA 4AVCA 3AL5A 5AVAA 2W1SA 3IZOA 1RUI3 3OYWB 1NCRC 3B93A 5CEHA 3NO8A 1ND2A 3MBWA 1D0HA 2LRPA 2RV9A 3MW4A 3PJQA 4DPNA 2JG9C 5JOWA 1NAEA 2XJTA 3PVEA 4QQPA 5FZ7A 1OXCA 1V6JA 3ZSEA 2WFF2 3KQ4B 2Y6LA 1NT0A 4J1WA 2R0FA 2YG0A 4QXBA 1VBA3 3VDDB 3T0AA 1W9SA 1PX4A 5T5LA 1CAUB 5A3MA 1F8VA 4CCNA 4Q4V3 2DU1A 1MACA 3KS7A 4CCMA 2RMU3 2ZGNA 4O9EA 3N36A 1OUSA 3MFCA 5FZDA 3NMBA 4R9BA 1QJZA 1O3TA 3VZJA 1T2XA 4LHKA 2PAKA 4W6YA 4QKDA 1W8WA 3PL0A 2OKXA 3VBRB 1AL21 4EQVA 3ZFEA 1A8MA 1ODNA 2Y34A 1IZ3A 4CCCA 5FWEA 5GZFA 5A7NA 2Y64A 4L2NA 2Q8CA 1NQDA 4W4ZA 1LJ7A 2YBSA 4RS5C 2QKDA 1J84A 4C90A 4EN6B 3ES1A 3KCXA 3K3OA 1G86A 4R9AA 4YVWA 5BY5A 5C3SA 5C9AC 3CU7A 2P2KA 1Q8QA 4I30A 2HWC3 4QPGA 1MR5A 3ZYFA 2HWE2 3SISA 4QXCA 1XNAA 2JDHA 1XSQA 4AWDA 1RUD3 2Q8OA 3ENRA 2BZDA 4BLIA 2ILMA 4GD4A 1H1AA 1BK1A 1XYPA 4FPYA 4L9BA 3OEBA 2WC2A 3O1MA 3POFA 2VNVA 4PCRA 1B35B 5L9VA 2DVBA 3BIWE 3IDAA 5GLUA 3H3ZA 4GB32 4Y5TA 1GOGA 4QQ2A 5GLZA 3KVBA 5E88A 2XJPA 1C8M3 4JKKA 1FYUA 5FY1A 2DCTA 2FDJA 4UYBA 5H9PA 3OUHA 1PM7A 3DV8A 1NOVA 2D6LX 1DGRA 4Z92B 4FFFA 3FE5A 1V9U1 1W8FA 1MS0A 1RMU1 1AXYA 1Y43B 5HCFA 4DRVA 4DUWA 3TRSB 2Q1FA 3NNJA 4HVOA 4EN7B 4FAHA 2V72A 2WYSA 3RMXA 2XR4A 3VBRC 4XC9A 4DY5A 2BGOA 4MUVA 1W9FA 1W2TA 2VBBA 3JD72 3ZN5A 4AFCA 3VHOA 1V6NA 1F5FA 5F9TA 2YUEA 3NJYA 2ENRA 2VCAA 4K40A 3SC7X 4C8DA 2VW0A 5FUIA 4I01A 2W94A 5C33A 4UFIA 1W2OA 5T55A 1C1LA 2PLV1 2TUNA 3BCWA 5DUWA 4LOSA 3HPNA 4BJ0A 3AYEA 1FNZA 1YI9A 3PURA 3UL2A 2UYBA 4M3CA 4Y33A 3WF0A 4UF0B 3R4DB 1QY4A 3KF5A 2MHFA 3UGHA 4RSUA 5JZGA 5IFTA 3J7HA 1GP6A 1UYPA 5JZGC 3M3QA 5GM0A 1WD3A 2J1SA 5LASA 2PHXA 3GJAA 3USUA 3VBSB 3EYPA 3MIEA 3T30A 4AI8A 3T1LA 4GZ9A 2AC1A 1S0GA 3VKLA 5BV6A 3ACIA 3N35A 2JE7A 4P9LA 2B8MA 2PQSA 1RB8G 3LFMA 5ACA3 2VOWA 5A7WB 1PVC2 4CEWC 1RUJ3 5IWFA 1UU6A 1EAH3 4I3PA 4OYUA 2XJSA 1TG7A 1JMUB 2VTXA 2PA7A 1LKNA 2AEYA 4FPKA 4PI0A 3VKFC 1XU1A 2BGPA 1OD3A 1POV0 1U5YA 3WNKA 4AEDB 3O1TA 3RZMA 3VKNA 1VMFA 3WINE 4E2QA 2PYTA 5GZEA 3LOBA 4O9GA 2TNFA 2HJIA 1OOPA 1MPXA 1CAUA 2JB8A 2XJUA 3B69A 4XBQA 1N47A 2WABA 4F8AA 5F7UA 3ZXLA 2D7FA 1AR92 2B4KA 3OJBA 4IEQA 3WG4A 1Z7S1 2RS12 4QHBA 4KWJA 4OI2A 1NA1A 3H8OA 2PQQA 5HV4A 1ULOA 3EJKA 2A71A 4IGOA 4WVMB 2NMOA 4XBLA 4Q4W1 4JVAA 1JYWA 1GWLA 4XMAA 1OC1A 4ITCA 4U36A 3POEA 3DXTA 4CUCA 2O8OA 5BXXA 4DXTA 1J1TA 3WDYA 3ZKYA 1SFNA 2BVVA 2ARAA 2J22A 3ACHA 3G6JB 4GKXA 4PLMA 3VHNA 1QOOA 3H42B 5A3LA 1GICA 3R05A 3PMSA 4ARYA 2CNAA 2RDNA 3H1MA 5ABJC 1W0OA 3DN7A 1W6PB 1W90A 3KM5A 2IXIA 2RR13 5FMBA 5FXWA 4YZ1A 5G05L 2W2IA 3IAPA 4QM8A 1H6YA 3KT1A 2HLEA 4XDOA 5JLVA 2C0ZA 3FJSA 1DP0A 4YZ3A 1JOJA 4FQZA 5BNNB 2ZGTA 4P9IA 2JG8C 1X8MA 2CL2A 3LDKA 4IV1B 2V73A 3SNMA 2VCMA 3POIA 2QE3A 3CNAA 3AMMA 4FSJA 5L7OB 4Y1VA 1C5IA 1AR83 4FXKB 4YARA 3AMNA 4DO0A 3RYKA 3VDBA 1XYNA 2NM1A 2PELA 5DAWA 2NP0A 2Z2SB 2HWC1 4E4ZA 1GQPA 2OS2A 3WT3A 3VN4A 5FYMA 4LBQD 3POBA 4P9JA 1HRI2 4YW4A 2JDKA 2Q5TA 2VVFA 2WSVA 3PVBB 4DUVA 2QQOA 1JUHA 1A3KA 3E6CC 5FZBA 1J3PA 1UMIA 1ZX5A 3E6BA 5FZ3A 2IFWA 3ZMOA 3M7AA 4BZ4A 2DURA 1ZZBA 1R083 4U2AA 3H8RA 3SKJE 1XE8A 2ZHKA 1GZ9A 1JI6A 2DCJA 3SH4A 4HBNA 3C7HA 3TNQA 5J96B 4CTEA 1SLTA 1KRIA 1HLCA 3MGUA 3TEZA 5BNPC 1BEV2 5FYZA 3S5AA 4XF4A 2F4PA 3W5MA 5E89A 3BU0A 1KJLA 4QKFA 4JC1A 2JDPA 2YV8A 2WR9A 1IQDC 5ABJB 4KG0A 1W8HA 1LTEA 4LBKA 4AHZA 2IVIB 4LBLA 3NAPB 2I2SA 3WLUA 2JDUA 4MSVA 3I8TA 5JI9A 3ME2A 1QXJA 2E7TA 1EAH1 4ZXKA 1HB3A 1YEWA 1RUNA 3AVSA 4QGMA 1OA3A 3WEZA 4BDVB 4CCJA 4OHYA 1RUH2 1RUI1 2XXZA 2A3XA 2XLGA 2RS33 1P8JA 4QGLA 2JJ6A 3LSDA 5A7WA 3NKTA 3PVOA 3NKGA 4PF1A 1WW6A 4BA6A 4GWJA 1BCXA 3P6BA 1ULEA 4OQ8A 3LSEA 4KQ7A 4QXHA 2IXKA 3H0OA 4YM2A 2IVJA 2BERA 3H8UA 3VD3A 3BB6A 1UWWA 4JX0A 4ZS2A 4HPKB 5FYHA 5BNOA 5GZCA 1VBA1 3VD7A 1AYM2 4X8PA 1UXXX 5CKQA 1QJEA 1WGPA 2VQAA 1DLCA 4XFGA 3VL8A 1G8WA 3L9JT 4CDUC 2QQLA 2R043 5F2WA 4M3CE 1EPZA 1IGOA 1QJX2 2HWD1 1ZZ7A 2WA3A 2VH9A 1NXMA 2H6CA 2Y6JA 3MPBA 2F17A 4XZPA 5K4LA 5C71A 1GYKA 1OKOA 4CCEA 5EP9A 4HLTA 3BALA 4Q4W3 1PO11 3TN93 1PGSA 2ZGOA 1H2MA 1WA6X 5IHRA 2OPWA 4RS5A 3VD4A 1T6BX 2OZ6A 2WS93 4XUNA 5FK8A 5CFDC 4CEYA 5IVFA 4LHLA 2WRAA 2C9AA 4LHNA 5CKNA 2WA4A 3O0XA 1AVBA 1VMHA 1H2LA 3MF6A 2WNUB 3HEIA 2HWF2 4G3YC 4IEOA 3N9QA 4XF9A 4COVA 1G9DA 4E2SA 2VAUA 2R072 3ALQA 3DEMA 4ES9A 1OLMA 2ZGUA 5ERLA 2WO1A 1OLME 4UW6A 1XNDA 2NPIA 3H8XA 1MQTB 3K48A 4M4RA 4EWAA 2VVEA 2RVAA 2QBXA 4LNVA 1RUE3 4BQ3A 4AR2A 1TNRA 1W28A 1N1TA 3AKTA 2XUMA 4K8RB 1HW5A 3LF7A 3FLPA 4MXWB 3V56A 1GNHA 4RD7A 2RS52 1WCDJ 3J8F1 5FBZA 1ZRCA 5I93A 1XE0A 4QT6A 5CG9A 4QX5A 5GLVA 1BMV2 4WZCA 1NY71 1YWKA 4Q4X1 5IAXA 1NLSA 5L36A 4FBFA 3NNFA 4QWNA 4BCUA 4XF1A 4COYA 5DMYA 4Q4V1 2GAUA 2PHWA 2J1EA 1BVVA 1KGYA 5CFDA 2XVGA 4X8NA 4Y4YA 4JKLA 3ZSJA 1W9TA 3C2UA 3H9AA 1RUH1 1RUI2 3VZKA 2WYFA 1UY4A 2HBUA 4AQSA 3C7OA 2YROA 4RR3A 3VL9A 2ERFA 3EXUA 3SLIA 4GALA 2WL1A 4P5HA 5LBEA 4DOUA 4TN7A 5LBBA 1L7QA 3SCHA 3WZ1A 2P3JA 1FATA 3L2HA 2VBPA 3HJRA 4IV3A 1ND3B 4XIKA 5I8TA 4A42A 1PO21 2A6XA 2JEMA 2K0GA 2P4EA 4HL0A 4XVHA 5FZEA 4NRPA 3B3QE 4FFGA 2WNEA 1HXS2 3SXWA 2WNUC 3I54A 4AAPA 2OYZA 2E53A 1NG0A 1WW7A 3BOPA 2ARBA 1N1YA 4ZU7A 1REDA 4YSFA 2RDQA 2XLFA 1FV2A 5GKAC 2P6CA 1GNYA
chains in the Genus database with same CATH topology
3ZXAC 4MLOA 4Q0QA 2BGCA 2WT0A 3OGJA 5AFEA 4LBNA 4FP2A 2GNMA 3AYDA 3IDCB 4OI4A 5FOBB 1HQNA 2CGPA 3LA2A 1X33A 4GH4B 2ZGRA 3WD5A 3ZXEA 3WR0A 2EAAA 2MEV1 1Q56A 4Q0SA 3KGLA 2ATFA 4HZFA 5GZDA 1GQHA 5HXVA 3ST7A 3SHRA 1LHOA 3X29B 4Y1XA 1B35A 2ZTNA 1OLQA 4AVBA 2JENA 3IKWA 5HBAA 4MV2A 3LA3A 4X6RB 4YG6A 5FMOS 2G4IA 5EFUA 2D6NA 1CGPA 2R32A 4UBGA 3GBFA 3VBFC 3RJ2X 2AENA 1AR82 4SBVA 1MVQA 1AR71 4FPHA 4M0HA 2WKKA 1RUF1 4D7YA 2GNBA 3HIFA 2WQZC 2XBO2 4CP0A 3P3NA 3CF6E 3RJRA 5JSPA 3H1YA 2IC1A 3KZ4C 3TBDA 3AXEA 2UWAA 4LTAA 3ZSLA 1Y3TA 3HT2A 1XE7A 2ZX2A 3O5SA 1RHI3 4HN1A 1BVP1 4CP2A 5FLIA 4PLOA 1MQTA 3VHPA 5L19A 1FAYA 1NLRA 4Q4X3 4FTEA 1G9CA 5DDJ2 2CYFA 2CAVA 4KGQA 1TQ5A 1VBD1 2A6ZA 2HWB1 2IFRA 5I0UA 3OY8A 2B9UA 1EV12 3KCCA 4DZGA 3KMHA 5KHHA 1DGLA 3SH3A 4OVEA 4XFCA 1OOPC 2D5FA 4HKWA 1AR62 3CO2A 2VNOA 4RHV2 3ZIWA 3G7DA 1LR5A 4PDWB 3D4KA 1APNA 1LECA 3WP6A 5A33A 5K0UB 4YGCA 4EROA 3D6EA 3VLBB 3RPQA 3VBOC 1CAVA 2VW1A 4FCAA 1PHMA 5EWSA 2DVGA 2JD4A 2ZCWA 3GZTB 3BOWA 2B7YA 1J58A 3ZFGC 4B8EA 3WHTA 4XTPA 1NA1B 1AL23 5JAXA 1DHKB 3O14A 3S7EA 4ASLA 5JMCA 4QD2A 3WX5A 4HN0A 4N7UA 4WVMA 2UYAA 5C4WA 3FFZA 2GMEA 2H6BA 1JXNA 2VNGA 1ND2C 1COV3 3Q9OA 3I59B 4L99A 2EXJA 2EALA 2ZZJA 1CAXB 1LOGA 3JZVA 1V6OA 1H8VA 2Y0IA 2MEV2 1SCRA 2JX9A 2DCKA 4CYDA 4K1YA 1RUJ2 1QNWA 1FXZA 2A6WA 1H1IA 5C9AB 1CN1A 1C28A 3CJXA 1ENRA 3ATGA 3JB8A 4XIOA 4H55A 3GZAA 5IK5A 2XL9A 2GN7A 1OSGA 4PDWC 2WNVC 4IV1A 1DQ5A 1MS5A 3VBOB 2DVAA 5JOZA 2RS13 5KBFA 1KJRA 1UCXA 1W0PA 4J6GA 4JV4A 4MGIE 4K7JA 3ZFGB 1QOSA 2PHLA 4BQ1A 5C8WA 1RVF1 1UW8A 3W58A 1Q8SA 5KWRA 2IXLA 4D3WA 3AJYA 4LO5B 4MX3A 1I5ZA 4NHKA 1HQWA 4HMZA 4TYSA 1UZZA 3CEWA 3AB0A 4DY3A 2VOVA 2Z69A 3T1MA 1N3OA 2CGOA 3W59A 3J4UH 3WCRA 1SLIA 3FUQA 3JD71 4LA2A 2I74A 3GHMA 4XJ9A 4KL1A 3WW3A 5CAZA 3POWA 3H50A 2N7GA 1HDKA 3PTYA 1VBD3 1WW5A 2XKPA 3OY8B 1YJKA 1RINA 5FLJA 2VXRA 4F83A 3U0ZA 2EAKA 4P9XA 4IEPA 1REEA 3OYWA 1MZ6A 4ZKTB 5LRSA 4WM7A 5CADA 3UJOA 4OUSA 4Q4Y2 1UKGA 4PDWA 1DQ2A 4BM8A 5D8AB 2HEWF 4RHV1 1OPOA 1I3HA 2GU9A 1R082 4A3XA 4XQDA 3FLTA 4CEWB 2HWB3 2BNMA 3P3PA 2X5IB 5KXBA 4EV0A 4DQAA 1Q8PA 4M3CF 2Q0AA 2F6BA 1QJY2 4QXKA 4AEDC 2NLRA 1HRV2 1YFYA 4Y22A 4TSVA 3WNXA 3WY6A 4AEJA 4AFDA 2XBO3 1FOD2 4RR3C 1YYNA 1EYBA 2VPVA 1QJX3 4KNCA 4FT8A 5C4WB 1JW6A 2YHJA 3VZMA 4RS5B 2D97A 1QHDA 2HWF1 3MW2A 4CP1A 4GMP0 2UY8A 3AFKA 4YVSC 1J3RA 4PLNA 1ZNPA 3M3CA 1BMV1 4XF0A 4PIYA 1CAXA 4JQRA 3OCPA 2RS32 4WVVA 2BQPA 1BJQA 1YJLA 2EXHA 3A4UA 1CD3G 2R073 2CWSA 5KXCA 3CJIA 5FRAA 4A7KA 5J09A 4JDMA 1F9KA 1GFF2 4HSLA 1HRV1 2JXAA 2W0XA 1VBD2 2YY1A 3WUDA 4HKLA 4AI1A 5ACA1 4CDQA 3VBFA 3VZNA 3ZN6A 1DGRN 3WP3A 5FTTC 2NYYA 4XE9A 4LA3A 2ZAHA 1QQP2 1PO13 3TN91 1TMF3 1SMVA 4XXAA 2MNGA 2A5ZA 4NPRA 1H9WA 4N9HA 3B9CA 4IL7A 3V64A 1VBE2 4FOVA 4G9SB 3PJYA 4RR3B 1G9AA 1GV9A 2XWBB 1FMD2 1OPMA 1SLLA 2ZX0A 3LA7A 4PIZA 4DXZA 2VNRA 2ZMNA 5JOXA 1VBB3 2RE9A 4RA0A 2BNOA 2GSYA 1RUC2 3MIDA 1OMIA 3I7DA 1N3QA 3KB5A 1NY72 4RL7A 5CNAA 2IXHA 1BZWA 3I4IA 5FQ0B 1R081 2YDEA 2YPJA 2UURA 4AI0A 2QFEA 4AEKA 2A70A 2IXCA 5FO7B 3VKOA 1XNBA 3ZMNA 3O7OA 1DF0A 2P3IA 5I91A 3POYA 3C3VA 4OFGA 2JDZA 4CDWA 2SLIA 1OHFA 2D44A 2YYOA 3THPA 3MIFA 4OHZA 2AREA 3B5LB 5TSWA 3NAPC 2D93A 4AXOA 5L36A 3O0VA 4LO8A 5KC6A 4K3UA 3PVNA 4META 1QDCA 1BBT3 3APBA 1SLAA 4DB5A 3JCIA 2BEOA 5K7PA 1PGL1 1JBCA 1YXWA 2D6MA 4LBQA 1NCQC 1W2UA 3MPPG 4KWKA 1KFXL 4S2FA 1O4YA 2VQ0A 4AK3A 3PMEA 3ZFEC 5H9SA 2B39A 4BMBA 4MH0E 4IEWA 4RQPA 5IK8A 2E7AA 2PHFA 2ZZQA 1DZRA 3WG3A 1LENA 2ZPXA 4OZXA 1FMD3 4OLLA 2QDNA 5KHIA 3PLQA 2ZX1A 4Z82A 1WCSA 5A32B 5CU1A 2G9GA 2VMIA 3D0SA 4WM8A 3WW1A 1PGL2 4JGZB 1W6PA 2XJRA 3HR9A 1O3SA 4JTNA 1TME1 2FHRA 4MYEA 4URTA 1I6XA 4YVSA 4E4SA 1EY2A 5BNNA 2H0BA 3AKRA 1AXKA 2E63A 3ZIXA 4IV1C 1LB2A 1WLWA 1RUE1 2K2SA 4XDQA 2EXKA 3E5UA 4AHWA 4KBBA 1W6OA 4NHMA 5BNOC 5CVRA 1EV13 1LEMA 2RJKA 3U10A 5LK5A 1VP6A 4AVSA 2DCZA 2WFPA 1RVF2 3NV4A 3JB4C 1ZM1A 3AMHA 2HWE3 4Y26A 2OIIA 4NHLA 2O0OA 4FOQA 2HWB2 1QJY1 1UX6A 2YGMA 1VRH1 2HEVF 5CFCC 5DG1A 1DQ1A 5CFCA 3WVJA 3KD4A 3S30A 1OD5A 2QVSB 4JGZC 1CIWA 2ZX4A 1FOD3 1RTVA 1LULA 2D6PA 4HKOA 4NO4A 3MLKA 4Q4X2 4UW6A 4XBNA 3ZFFB 4FPOB 4E4DX 5I0TA 3RS6A 1SDWA 1C8NA 3TOJA 1AJOA 4GB31 1KD7A 1HXS1 3LGRA 4CDWB 1NCRB 3O0WA 3VZLA 1UD1A 5BUVA 1D4VB 1EPWA 1CAWB 2JG9B 1VAKA 1PIV2 5FO8B 5LK7B 4QPGB 4QQHA 3ZXJA 1COV2 3ETQA 4CDUA 3UKNA 1R091 3LKJA 1SQ4A 2ZA9A 4HPKA 4L97A 5BNOB 1TEIA 1V9U2 2D3RA 4LBQB 2LTNA 3D82A 3HWJA 1LHVA 1QGLA 2WQ4A 4XFIA 1F2NA 2W68A 1A78A 4LLFA 4KWLA 3WCSA 5JIAA 2KXLA 3VBOA 1AR73 4AVTA 3E5QA 4ATFA 5E1RA 3RYRA 1ALYA 3E6DA 5I0RA 4FO9A 2R063 2CY6A 4N53A 4RQPB 1AL22 3JUUA 2NQYA 4WM8C 1AZDA 4AFMA 1RUG2 1UPSA 2XWJB 1O3RA 4HVRA 5KHJA 5BNQA 1POV1 4OI1A 2VUJA 3OBRA 3HMYA 4CEYB 3QLQA 4TWTA 2KA3A 2ZS6B 1YIFA 4Y5Z0 4CDXA 1PZ9A 4YZ5A 1PK6C 4Q27A 2RMU1 4D69A 3UV9A 4YG3A 1DYPA 4FTSA 4B7EA 2DF7A 4FPJA 1DIWA 4DINB 5BNPA 1ULCA 2I07B 1FPN3 3ILNA 3AZXA 1B35C 2V5YA 5D1IA 2ES3A 4L8QA 2B5HA 2BNNA 4C0BA 4N43C 3L2YA 2BFUS 3AXDA 4MXWA 4NWVA 4L92A 1WLCA 2IZWA 3B02A 3DPRC 1RUF2 1O4TA 1ZBE2 3M3IA 4X6QB 4LUKA 3USUB 3VBSA 4IEZA 1M4WA 4YYOA 3KLSA 1RUG1 5C6CA 3GBWA 4P9YA 2WS92 3MFAA 2EXIA 2LM3A 4YW1A 2ZHLA 1R1A1 3NV2A 5J98B 4XOGA 4WM7B 1Z78A 2YGLA 1GKBA 4AHYA 1UAIA 4S2GA 5IT6A 5LRRA 3UKTA 1ENXA 4SLIA 1ZA4A 2KM2A 4MGYE 3NJZA 4MGZE 1PVC3 3AM2A 4E9KA 4JGYB 1AXZA 1ENQA 3MIGA 4OHXA 1OOPB 2GC0A 2OPKA 2FMYA 3ZXDA 1DG6A 1LHNA 4DMIA 4B3NA 3PHMA 2UWCA 4DS0A 2D98A 4XYXA 1ZVFA 3ASIA 3WDWA 1S0DA 3V0BA 3B94A 4YW3A 3ZYRA 1WUVA 4H7LA 3GZUC 5T55A 1XXNA 1ZYBA 3MF9A 1LEDA 3MEPA 5AC92 4N43B 4F3JA 4AHXA 2HWD3 4FOYA 1NCRA 1AR61 3NW4A 1FT9A 3DPRB 4GH4A 3AX4A 4XJ8A 2R041 3HD8B 3JBG1 4GMP3 3WP4A 1RMU2 5T50A 3ZYPA 4H14A 1TME2 1KDKA 1NE6A 2LALA 1LHWA 2AUYA 1R1ZA 4XJAA 1PIV1 2LUWA 1LOFC 4Q4Y3 3IPVB 2NMNA 3THTA 1FOD1 4YNIA 1DQ0A 1U5XA 1H4HA 1BEV3 2VVDA 5GLWA 1MS9A 4M0NA 2WZR2 1SBEA 2X8KA 1PZ8A 3AKQA 5CA6A 3RRDA 1CPMA 2XJQA 5LEKA 5L7OA 1PNGA 1H9PA 1ZRFA 5FCCA 1CPNA 1ULFA 1F5JA 2HWE1 4HFSA 2Y26A 1OKQA 1Q8VA 3DGTA 1O91A 3WG2A 1HKDA 4CRQA 1S0JA 1W6NA 2K9ZA 2AGSA 2WFF1 1FMD1 4I0BA 3SCGA 2BBVA 1MZFA 3LWCA 1PGW1 5C8CB 5JVVA 3M4FA 3RZZA 1MZ5A 4CDXB 1YFUA 2VG9A 3NSTA 3H7YA 2XBO1 3DKWA 4AGVA 3ILFA 1ASJ1 2EVXA 2ZABA 1VALA 4QGNA 1QJU2 3LB9A 4EN8B 4DFSA 1W6MB 1HV1A 1J1LA 5CIRA 1RUC3 4N90A 1R093 1X8EA 2QNKA 3BTAA 4A7ZA 3O12A 4AYUA 5J36A 2ZKLA 1YI7A 3NAPA 1GLHA 3RSJA 4Q0VA 2XKOA 4HVQA 2WWSA 5CB7A 1AR91 2XJVA 4D94A 3TAYA 2R1DA 4Q2FA 3SCFA 2GNDA 1PVC1 1QQP3 1OA4A 2WS91 4BYYA 4L11A 4I09A 1AYN2 4KGGA 4MZUA 1AHSA 2JE9A 5FAXA 4XJWA 3WDXA 3N7MA 5A33B 2UY9A 3VBUC 2RR11 1CAVB 1TMF1 4H7MA 4QMAA 1OLRA 2GDFA 3GALA 1URXA 3RI9A 4BMEA 1IOAA 1AX2A 4Q1PA 1SACA 3ZO0B 1H1MA 1QKQA 1E57A 3AK0A 4Y20A 4BE3A 3V65A 2WT2A 5DUXA 1C4RA 3VKMA 4WVWA 2R042 1NA1C 2R062 2D5HA 2HEYF 3GBGA 4YVWC 3ZXFA 1VBB1 3ZDSA 5KXEA 1S0CA 2PN5A 4M00A 3QBQA 2X5IC 1VBC1 3AZYA 3MZHA 2XHKA 1QXRA 1O3QA 2FQPA 2GH2A 2WNUA 1YO8A 1GZWB 2I45A 2EF6A 3FFQA 2B46X 3R4UA 1D4M2 1QF3A 5I8YA 1IS6A 2XG3A 2HWF3 3OD4A 4Q4V2 5EXOA 3IPVA 1CJDA 4V1PA 4YVSB 1VLNA 2R16A 1NE4A 4ZU4A 2ZACA 2BPA2 1QJU1 4GKYA 4WVZA 4IERA 3H1WA 2ZX3A 3ZXKA 4COWA 4FXGB 2JKBA 3H3UA 1RUE2 3KGZA 2DWRA 2ZGSA 1B09A 5F6KA 3FX3A 5HI0A 1KDMA 2RS53 1RC6A 4UW3A 4XTMA 4OI0A 3JBG3 3B9IA 1UL9A 2BYVE 2Q1ZB 1YHFA 1W6NB 1AYN3 3UKVA 1AR63 1HX6A 1S2BA 3B7MA 4IV3C 5CFDB 1AUYA 2ZOEB 4RHV3 4XHXA 5C8CA 2B45X 2MEV3 1X50A 3SMHA 1LGCA 5JI7A 1D2QA 3ILRA 1D0GA 2ZKNA 3WQ7A 3GYDA 3DL3A 1ZBA3 1RVF3 2DCYA 1ASJ3 1WMEA 3KSCA 4Q1RA 5EYYA 5CBLA 4GB33 2DV9A 3GHNA 1V6IA 2R6QA 4YGBA 1SLBA 1U5ZA 4YG0A 4FP3A 1KXGA 1DZTA 2ZGKA 5I8SA 1T6GC 5T3NA 3KT7A 3VBHC 3AP5A 1FX5A 3RI8A 3TB0A 5FFOC 1MEC2 4AGGA 1WW4A 2BFUL 1W39A 3ROUA 4S2DA 1IS5A 1RUJ1 1VRH2 1SBDA 4NR1A 5DZEA