2D6KA

Crystal structure of mouse galectin-9 n-terminal crd (crystal form 1)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
149
structure length
147
Chain Sequence
ALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin, galactose binding, soluble 9
publication title Crystal Structure of the Galectin-9 N-terminal Carbohydrate Recognition Domain from Mus musculus Reveals the Basic Mechanism of Carbohydrate Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein
total genus 33
structure length 147
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d6kA00
4FOQA 2CWSA 5GZFA 2JE7A 2NZ9A 3PMEA 1WLDA 1WW5A 2D6KA 2DUQA 2VW2A 3TB0A 5JOXA 3V0AA 1JN2P 5DG2A 3IMNA 3OBRA 4WVWA 1MS8A 5CAZA 4TYSA 2CWMA 2DURA 5T55A 1UAIA 4YW4A 2EXJA 4FPGA 4YM0A 1D2SA 3KM5A 2WT0A 4FPKA 3BTAA 3WLUA 4FPLA 2GNTA 4AVSA 2P2KA 3AFKA 4Y22B 4UW3A 1KJLA 4YW2A 2YXSA 3WDXA 1APNA 3CNAA 1Q8PA 5GLZA 5KXBA 1LU1A 3M3OA 5IT6A 4RL7A 3SH4A 3SH5A 2NMOA 4LBLA 2EXHA 5T5OA 4XTMA 2DU1A 1LOFA 4HL0A 3L2YA 2A70A 1FV2A 4TZDA 2CTVA 1ONAA 2FHRA 3DUIA 1UZYA 1CR7A 5F5QA 1W0OA 3N7KA 4FPFA 5GLVA 3AYDA 3USUA 2CNAA 3AX4A 2GMEA 4DRVA 1IOAA 5EYYA 4XJWA 4LBQA 1N1YA 1W6PA 4WV8A 2PHUA 4XJ9A 3ZXEA 4FP2A 1UN1A 1ENRA 1PZ7A 3RMXA 4ATEA 2E6VA 2W08A 3I8TA 1FNZA 4XJAA 1ULFA 1Q56A 2UWCA 5JOWA 2WSUA 2ZHLA 3OJBA 3O0VA 3POSA 4FPEA 2UWBA 1CPNA 1W0PA 4Y20B 1Q8SA 1EPWA 1BXHA 4DRRA 3AP7A 1I1EA 2YY1A 1S0GA 3MW2A 4XJUA 4YLZA 2JKBA 3BIWE 1QU0A 3FLPA 1LENA 1NLSA 2DV9A 3AXDA 2VW0A 3MPPG 4NOTA 1W6MA 1KRIA 1YO8A 2OW4A 2ENRA 3WDVA 2OVUA 1AF9A 4RA0A 2R49A 4UW4A 3AZWA 1N1VA 3VV1A 5SV8A 1N1TA 5JOZA 5DUWA 1AXZA 4XMAA 4XHXA 3C2UA 1DLLA 4XYXA 4CRQA 4LBNA 3FUOA 4FPCA 4M3CF 1V6IA 4C1WA 4YZ4A 3Q9OA 3WDUA 5IK5A 2ZGQA 4FOVA 2G4IA 2ZGNA 1C1FA 4XXAA 1DZQA 1CJPA 1DYPA 1SBEA 1LGNA 1G9AA 1S0EA 1WW7A 1WLCA 2E51A 2HYKA 3VUOA 3MEPA 4YG3A 1GV9A 4DQAA 1MZ5A 2A3YA 1GYKA 1W6QB 2P3KA 4FVVA 3AZXA 4GKXA 1GLHA 4Y1UA 3B3QE 4BPZA 1UMZA 5JDBA 5EYXA 1G9FA 1BYHA 2JD4A 2DUPA 3VKFC 2AENA 1IS6A 4Y1XA 2R0HA 3RQ0A 3BODA 1BJQA 3M3CA 2PHRA 5GZEA 5DG1A 5H9SA 4P14A 3U4XA 1V6KA 4YFZA 1G86A 2P3JA 4PBOA 3N7MA 2GMMA 2VU9A 2D3PA 4XDQA 5GM0A 4YZ1A 3APBA 2A6WA 4PF5A 5GLWA 4U2AA 1WUVA 1UX6A 4ASMB 3WDTA 4GKYA 2NP0A 2VXRA 1A78A 1QF3A 5GJ6A 2ZGMA 1SFYA 1KDMA 2JECA 2AGSA 5GZCA 1LOGA 4CZSA 3WZ1A 1RINA 4WZFA 4GWNA 1LHWA 3UL2A 3ZSJA 2D6PA 5EXOA 1QNWA 4Q1PA 1GNZA 2ZGTA 2DWRA 4M3CE 2A6ZA 4K21A 2ZAAA 4XBLA 1WD4A 4BMEA 3IM0A 2LTNA 2DVFA 3PVEA 4JRAA 4ISQA 4XBQA 3ZXLA 1V6LA 3INAA 3V0AB 1GZCA 1LOBA 3MW3A 2CYFA 1B09A 2PHFA 2A6VA 1JHNA 4XOGA 1LU2A 2Q5TA 1CN1A 2DTYA 3OPZA 4P9WA 3T1LA 4BQ1A 1JYIA 1A3KA 3ZSMA 2SLIA 1S0DA 4JC1A 4XTPA 2D6OX 3PVNA 3ASIA 3MW4A 4IQPA 4PBPA 2EAKA 5LK5A 2ZACA 2GNBA 3ENRA 3KQRA 1WBFA 5GLTA 2YMZA 1NXD1 3N3HA 5KXEA 2GALA 1FYUA 2AREA 3POYA 4YG6A 4ATFA 4R9AA 2ZHNA 3ZPYA 5IUQA 1QNYA 4DS0A 2E7QA 2WNEA 2R1BA 4R9DA 1MS5A 1IKPA 3WV6A 1N47A 3HN1A 1JOJA 3JUUA 2FMDA 3RG0A 2I2SA 1MR5A 1VALA 1LULA 3AYCA 3PVOA 4W65A 4Y22A 4YGEA 5CA6A 3AP9A 1FNYA 5IK8A 1G9DA 2A5ZA 1AJOA 2NM1A 1G9CA 4I30A 1SLCA 1X50A 1ULEA 1CQ9A 3OY8A 3UJOA 3V64A 4AVTA 3A0KA 2ARBA 4R9BA 1AX0A 1ULDA 2ZHKA 4GWMA 4M00A 1Y7BA 3USUB 2D6NA 2DTWA 4AWDA 3SLIA 1W6OA 4FP3A 2ZGSA 5E88A 1F5FA 1IKQA 2UU8A 4DPNA 4Q8KA 1LJ7A 1YXWA 3B9CA 1FATA 4LBQB 4XXPA 1HLCA 1W6PB 2VW1A 1DHKB 4XZPA 3QLQA 4P9YA 2ZGKA 4YGCA 5DZGA 5JVVA 1RITA 1HQLA 2CY6A 5GALA 1LEMA 1SBFA 1GBGA 1MACA 2AUYA 1DYKA 2GNDA 2WKKA 3HMYA 3N35A 4XILA 3ZXJA 5T5PA 3ZSLA 1MS1A 4YZ3A 2ZGLA 1QMJA 3WNXA 1Q8QA 3AP4A 1W6NA 4U36A 1SBDA 5FRAA 2GMPA 1FV3A 4Q1RA 2A3XA 1W6MB 5DZFA 1S0IA 1YYNA 2D6LX 4YM1A 5DXDA 1KJRA 3AYEA 3LSDA 5L73A 4OZXA 4C1XA 4YM3A 1MS3A 3FBYA 2R1DA 1LHOA 2PHWA 1AJKA 1LODA 1R1ZA 3IPVA 2XB6C 1S1AA 3M2MA 3DGTA 4FPHA 3B01A 4AVVA 1LHNA 1V6NA 3V0BA 3NV3A 1HQWA 2AYHA 2P3IA 1U0AA 2OUJA 1A8DA 1QOOA 4LBOA 2DVAA 1IS4A 1O4ZA 5EWSA 3WCSA 2ZA9A 3RMYA 1V6JA 2ZMLA 3WUCA 1SLTA 3JU9A 4FPJA 1S0FA 1V6MA 1MVEA 1I3HA 4ISRA 1GICA 2WSVA 2DVGA 4Y24A 3R4UA 1KQRA 3B69A 3D5OA 3SITA 4YGDA 3NV4A 4K20A 3WDYA 4JCKA 1GANA 3ZXFA 2ARXA 1JUIA 1LOCA 3FLRA 3WVJA 1ULCA 1QOTA 1Z78A 1WLWA 3AP5A 3AK0A 4YW5A 3V65A 2ZABA 3ATGA 2YV8A 1LHUA 2DU0A 2ZGRA 2DUOA 2C5DA 1TEIA 2EALA 3NWKA 5HCAA 1DBNA 2KM2A 4BOWA 1SCSA 3OYWA 3WCRA 1S0CA 1DQ2A 4Q2FA 4FPYA 5HCFA 4GXLA 4SLIA 1G9BA 4ZXKA 5E8AA 4AGVA 4BLJA 1DIWA 2AH2A 5JLVA 3WUDA 2D43A 2W39A 5IK7A 2ZZJA 2W68A 1JW6A 3GNEA 4PCRA 4XIOA 1CPMA 2D3SA 3UJQA 3VKLA 4GALA 3O0XA 2JE9A 4M3CB 3WG3A 2ZBJA 2OUHA 4FPOB 1GZWA 5T52A 3N7JA 2R16A 3ZYRA 2WJSA 2ZMKA 3A0NA 4BM8A 1DQ1A 5H9PA 1G7YA 1VLNA 1LGCA 4ITCA 4NO4A 1RIRA 4WVVA 2LALA 1JBCA 4YGBA 3W58A 2A6XA 4P9XA 1O4YA 3SNMA 1HKDA 3WHUA 1QDCA 4H55A 3N36A 2ZKNA 1LTEA 5GZDA 2WT2A 1CONA 1OKQA 5E89A 1Q8OA 3WG1A 4BMBA 1Z0HA 3ILRA 3WDWA 2PHXA 2ZGUA 4YFWA 1C57A 1Q8VA 2GN3A 2P37A 2BQPA 4FQZA 3SISA 3LSEA 1DQ4A 2NN8A 5CNAA 3A4UA 5F9TA 3M1HA 2A6YA 2YZ4A 1AXYA 2C9AA 5T50A 4FOWA 3W59A 2PHTA 1UL9A 3GALA 4XJZA 1KDKA 1QKQA 1UPSA 1SLBA 2DYCA 2P34A 3OY8B 2RHPA 4L8QA 4MYEA 3D4KA 3NV1A 5DZEA 2D44A 5DUUA 5JOYA 3M3EA 3ILFA 3RSJA 5BYNA 1W6OB 3H0OA 3TAYA 1AVBA 1S0JA 1YIFA 1ZA4A 1AX2A 1MS0A 5IK4A 3AZZA 4YW3A 4AYUA 3AZVA 2EXKA 3HR9A 4UW6A 1DQ0A 1IS5A 5AVAA 1DQ6A 1AXKA 1LOAA 1SLIA 2ERFA 2ZMNA 4FOYA 2DVBA 3RS6A 4GA9A 5H9QA 2ZGPA 1J1TA 1FX5A 3O0WA 3FUQA 2XG3A 2UWAA 3R05A 4ZKTB 5KXDA 4Y26A 1N3OA 4XHBA 1H9WA 2A71A 1DFQA 1ENQA 4Q27A 3OBTA 4XIKA 5KXCA 4LBMA 3OGGA 3VKOA 3NV2A 1VAVA 2D3RA 1CIWA 5GZGA 3FLTA 4F83A 1W6NB 1H9PA 1GSLA 2TEPA 1H30A 1BQPA 1AZDA 1FAYA 2GDFA 1N1SA 1YI7A 4CTEA 1MS4A 4Y20A 1LOEA 3QCWA 4Y1VA 5JMCA 1LEDA 3SH3A 1LOFC 5FREA 2D7FA 1ULGA 1VIWB 4K1YA 4PQ9A 1SLAA 2YROA 1F31A 2B7YA 1G8WA 4Q8LA 4Y1ZA 3O5SA 4KBBA 1WW4A 4AGRA 2E7TA 3AJYA 3I4IA 3IPVB 2AR6A 3WHTA 3ZVXA 1DGLA 4YG0A 4R9CA 3FFZA 5H9RA 1V6OA 1ENSA 3LCPA 4YZ2A 4DFSA 3ZXKA 1S0BA 2R0FA 3ZYPA 2PELA 1LHVA 3V0BB 3R4SA 2GN7A 1MZ6A 3IKWA 3VKMA 1GKBA 2WT1A 1MVQA 2VY0A 2ZHMA 1BZWA 5T5LA 3M3QA 2UURA 1PZ9A 4XBNA 4K1ZA 3AJZA 3WG2A 2CL2A 1ZM1A 2DVDA 4XE9A 5T5JA 1PZ8A 5GLUA 4Q26A 3POWA 1UKGA 1OFSA 2Z42A 1GZ9A 4Y1YA 3WOGA 3D6EA 1W6QA 1N3QA 2A7AA 4M01A 5DUVA 4Z8BA 1JXNA 3AZYA 1IS3A 1D0HA 1HDKA 1URXA 1WD3A 2V73A 1OQ1A 1SACA 1SCRA 2V5YA 3ILNA 4LBJA 5HCBA 4BLIA 1VAMA 1WBLA 1MS9A 2JJ6A 2NYYA 2WQZC 3OYWB 1KITA 1LGBA 4FQ4A 1CVNA 2ZGOA 3T2TA 1AX1A 1QDOA 1QOSA 1WW6A 2D6MA 2EF6A 4XJ8A 1LCLA 2E53A 1QGLA 4HANA 3RRDA 1F9KA 1UZZA 3PJQA 2ES3A 2A75A 1CESA 1V00A 1XQNA 4LBKA 4UW5A 5CBLA 1GNHA 1BKZA 2EIGA 2NMNA 2EXIA 5DUXA 1LECA 1GZWB 3WG4A 3ZSKA 2SBAA 3B00A 3N7LA 4YZ5A 1N3PA 1C1LA 4D69A 2VH9A 5T54A 1SLLA 2W52A 2GNMA 3AYAA 3IN9A 1YRZA 1JYCA 4XMIA 4YM2A 5CB7A 3BOPA 2VUAA 1C4RA 1WCSA 2WLQA 3UK9A 4LBQD 1LESA 3AXEA 4YW1A 3T1MA 3VKNA 2A3WA 2H0BA 4AGGA 2JDZA 4M3CA 3AP6A 3O12A 1DQ5A
chains in the Genus database with same CATH superfamily
1R081 2CDOA 4AI8A 2IFWA 5F3CA 1VJ2A 1WW5A 4P9LA 3IAQA 2D6KA 1OUSA 1WA4A 2HWC1 3BVCA 4EN6B 1YFYA 3QH7A 4WVWA 4CDWC 1MS8A 4JTOA 2CWMA 1MQTB 4IV1B 3T30A 4YM0A 1ENXA 5FBJA 4FPKA 4BQ4A 1GUIA 3N9OA 1QXRA 3OOXA 4J25A 1KJLA 2Y6LA 5CISA 3WDXA 5LA9A 3PL0A 2JENA 1LKNA 2I74A 2IXLA 4XACA 1T2XA 5FJKA 2VC9A 5GLZA 1LU1A 4NWVA 1QXJA 3ACHA 4GZ9A 5IT6A 3E97A 3WINE 4CU6A 3ZFFA 1W2OA 4K8RB 4DIQA 1LOFA 2FDKA 1ACCA 5FYVA 1Z7S2 3N9NA 2CTVA 1ONAA 4TXWA 5FZ6A 5LBEA 5FZGA 1NKGA 1OD3A 2WO7A 4FPFA 2HWD1 3HT1A 3C7GA 5D8AB 2GH8A 3K3OA 3KV6A 3VBHC 4LBQA 1N1YA 2VL4A 3TN91 3VLBB 4XJ9A 2BBAA 4FP2A 1UN1A 2BBVA 2C1FA 1RHI2 4HSLA 4ATEA 4O9GA 4DXRA 4COWA 3ON7A 4IESA 3ZR5A 2VOTA 2VR4A 3JQXA 2W1QA 1RJ8A 4ZZ5A 2PXJA 2WSUA 2ZHLA 3OJBA 4O65A 4JGZC 3POSA 4FPEA 1JTZX 2G9FA 5I8YA 2IXKA 1EPWA 1NG0A 2OQ7A 1TME1 1VBC3 1C3HA 3JCIA 3HEIA 1OLQA 4YLZA 4E8DA 5J1XA 1HXS3 1QU0A 3L9JT 5FKCA 1NLSA 4P08A 1FI2A 1X82A 4NOTA 1W6MA 2BGCA 1AUYA 1ND3A 2OVUA 1IPSA 1C28A 1VBE2 3QOPA 3FWEA 2Y6GA 3D82A 3L2HA 4JGYC 1EAH3 2VZVA 3HNMA 4XHXA 3ZN5A 4CRQA 1W39A 4LBNA 1HQNA 4B29A 3AMMA 2D97A 2OZ6A 2R042 1GP4A 4BU2A 5IK5A 1XU2A 5L9RA 1UOGA 4D6QA 3ZYIB 2GC1A 4IV3B 4KGQA 3UT0A 1OLMA 1SBEA 3AKQA 3HJRA 1F4HA 4LNVA 2W5FA 3LA2A 4EZ4A 1W9TA 4CEWB 1WW7A 2E51A 3VUOA 3MEPA 2IXCA 4RQPB 1GV9A 4YG3A 5EPAA 1MZ5A 5A3OA 3U75A 3WP3A 4DQAA 5DAWA 2D40A 3LPGA 4QX8A 2P3KA 2TUNA 3S7EA 3U37A 1PX4A 3B3QE 3I2KA 1RUG2 2JDKA 3WXPA 5JDBA 2XH6A 2HWE2 1O3RA 4EN9B 2JD4A 2Z79A 3JB8A 5FYMA 2ZCWA 4HN0A 4FXGB 4BB3A 3I59B 4AE2A 5DDJ1 2ZTNA 3ZN6B 1PIV2 3OTFA 1V6KA 2WZPP 2VAUA 3JD71 4PBOA 3GF6A 1B35B 5I93A 2VU9A 4XFGA 4XETA 4OVEA 2VOVA 5FQ0A 4PDWC 3SC7X 4XFHA 4DUWA 4U2AA 1KFUL 1UX6A 2RMU1 3POBA 5K0UC 4Q4W2 2VXRA 2D98A 2WNUC 1R1A2 4PLNA 2ZGMA 2VUCA 5FXZA 5ANNA 2AGSA 4R8HA 1LOGA 1SDWA 2YFUA 4XUPA 3W5MA 1LHWA 5JAXA 4K8FA 5I0TA 1RUE1 5EXOA 1JYWA 1REDA 3WF2A 2ZGTA 4MXWA 2DWRA 3TOJA 3ST7A 1WD4A 1UYXA 4RFRB 4JRAA 4ISQA 3PNAA 5HBAA 1AR63 4XBQA 5EIYB 1V6LA 2I45A 3INAA 1AHSA 4XQWA 1GZCA 2W3JA 5EZWA 5C8CB 3ETQA 1B09A 1NOVA 1JHNA 4XOGA 2Q5TA 1CN1A 5FPZA 3ZM8A 4EQVA 3VBUA 2FCTA 5A1FA 3Q8AA 3I3QA 1S0DA 1ZVFA 4JQTA 3KGLA 3SEEA 5L9BA 1ZZBA 2D6OX 3BPZA 3MW4A 4RS5A 4A45A 4PBPA 5CFCC 2EAKA 2JG8C 5A7QA 1ASJ1 4I0AA 2GNBA 2WIIB 1UOJA 2UY9A 2R7EB 3ENRA 4OUEA 3DKWA 4TLFA 1CX1A 1ZBE3 3OGSA 3R4DB 3W21A 2XPJA 3DYPA 1FYUA 3POYA 4QX1A 4ATFA 1PGL1 2ZHNA 5EJ1B 3ZPYA 4FFHA 4CA9A 4F8AA 1W0NA 2LUWA 3LA3A 3KB5A 3MIFA 4QHBA 1Y9GA 3WV6A 1N47A 3H9AA 3JUUA 2WFPA 4N43C 2I2SA 2DDUA 2P4EA 4W65A 3TYJA 3AP9A 1FNYA 4J6GA 4UBHA 2NM1A 4I30A 2JB8A 1CAUA 4WM8C 4CXXA 4FAHA 1SLCA 3LOIA 3GZUC 1CQ9A 3KCCA 1U5XA 4E9KA 1KGYA 3T4HB 5A6YA 3VDDB 5F5CA 1OMIA 2QUOA 4FXKB 2DTWA 4B3NA 4IDZA 5FP8A 4PI0A 1JYVA 5FO8B 4P9JA 1FATA 3ACIA 3HVDA 1BVP1 3HD8B 4UFJA 1W6PB 1MQTC 4IV1C 2VW1A 3VBRB 3ZFGB 1NA1B 4XZPA 3FHQA 2C6SA 1NQDA 4P9YA 5FK8A 3V56A 1EV13 2RS32 3GHMA 4ET7A 4I2OA 4AQTA 4YNIA 4DMIA 5C7GA 5GALA 3BU0A 1RMU3 4NE9A 1GBGA 4XILA 3KF3A 5JXIA 1VBD1 3N35A 2VZUA 4A4AA 1R092 5L7OB 1EUTA 1IQDC 1YFWA 5ABJA 1E5RA 2ZGLA 5F6KA 3AP4A 3MF9A 2Q8OA 1I5ZA 4MGKE 2DF7A 2HEYF 4U36A 4OZOA 2YC0A 5FPBA 2YFZA 3HOBA 2R061 5FRAA 2G9ZA 3O1VA 4OFGA 3I2IA 1ND2A 1ZRIA 3IT8A 4MSVA 4X8PA 5FP7A 4YM1A 4AQSA 2D5FA 2WC2A 3LSDA 4XPVA 4OZXA 1DGWX 4QGNA 1XYOA 2R1DA 4XFCA 1H8TB 2MEV1 4E4ZA 1O7FA 4HETA 1LODA 5FZFA 4UBGA 4XUTA 1S1AA 5D8AC 3MIHA 3ZIWA 4CSWA 3GM8A 4HMZA 1LHNA 1K5JA 4JZRA 1V6NA 1VBA2 1JHJA 2ORZA 4NPRA 1QOOA 1TNFA 4N9HA 4DXSA 1COV2 3K4ZA 2DVAA 4L99A 1F35A 2IC1A 1H1AA 3I97A 4FFIA 1UF2C 4LK6A 1JZ2A 3WNLA 5DN2A 4JV4A 3JU9A 1S0FA 4NR1A 4QDRA 1I3HA 4X8NA 4G9SB 2WAAA 1C8M2 1EPZA 2WSVA 4RR3B 1TZOA 2WO1A 1KQRA 3D5OA 3VHRA 1OPMA 4S2FA 5JPMB 2WBKA 1FXZA 2X05A 4QAWA 2VVDA 4JCKA 3KV5A 3PTRB 1ZZ9A 1E57A 2BJSA 1AYM2 1AR82 1JUIA 2IXHA 2PLV2 2WZR1 4CYDA 1ZBA3 3ZYFA 3V65A 3RFRA 2DUOA 2C5DA 3ITQA 2Q1ZB 2KM2A 3HNYM 4BOWA 3O14A 2RS13 2GU9A 2JIGA 1SCSA 3VHPA 3OYWA 4AEDB 1DQ2A 2G19A 2WO2A 5F37A 4FPYA 1GZTA 2VE1A 3PIJA 5LRRA 3C3VA 4ZXKA 5E8AA 4MUVA 3HBKA 4TSVA 5KBFA 5JLVA 4OI1A 5AC92 3DPRA 4B7EA 4A44A 4MXVA 3O0XA 4OULA 4M3CB 5CEHA 2BDRA 5DPNA 4QXKA 2ZBJA 1CAVA 1W8HA 2E26A 4IV3C 4DUVA 3VD4A 1NCRA 3N7JA 3ZYRA 4CEWC 2HWB1 5I0RA 2ZMKA 1QQP3 1HB1A 2BEOA 2RM21 4XEZA 1PNGA 4RQPC 2BV4A 4P02B 1GQHA 4LIUA 4XC9A 1DQ1A 4QMAA 5H9PA 5J48A 3H8XA 1G7YA 5A7WB 2VUDA 3BI3A 1REFA 1WMFA 1R64A 1W8FA 3LA7A 2OS2A 2XWBB 5IAVA 5JXGA 1SQ4A 1RVF3 1T6BX 5K8SA 1W99A 2A6XA 1AR91 2CAUA 1HKDA 3LEGA 1QDCA 2XHKA 1TMF1 1UU6A 2YUEA 4H55A 1HJGA 4QKDA 2VBBA 4L9BA 2JG9B 1FMD1 1W04A 4W6WA 5L19A 1W9YA 5E89A 1CZVA 3J7MA 3I2GA 1B35C 4BMBA 3ILRA 5FP3A 2C0ZA 2GH2A 4LO6B 1C57A 2P37A 4GMP1 4AQ2A 2JXAA 1H2MA 5F9TA 4OHYA 4HG6B 1QY4A 3GBFA 4FOWA 4IEUA 4IGQA 2KA3A 4QDQA 4L8QA 1SLBA 2P34A 3Q8FA 2RHPA 4IEWA 5DQ0A 5DUUA 1DGWA 3O1UA 4WBBA 3U11A 3UKNA 3TWIA 5BYNA 1RUF3 2Q4SA 3KMHA 4CP9B 1MS0A 1NT0A 1UW8A 4L11A 4YW3A 5C8CC 1NE4A 3AZVA 4WVMB 2MHFA 3AMPA 4W6YA 5EHDA 5F2SA 5ANQA 2X5IA 1LOAA 1SLIA 1Z7S3 2ERFA 1NCQA 3HN3A 3AVSA 3MIEA 3DYOA 2O14A 4GA9A 2VTFA 3JB4C 3LKJA 1VBC2 4UAPA 2XONA 1OOPA 2DFBA 1NXMA 2UWAA 1CWPA 1HXS2 4Y26A 2G1MA 1CAXA 1XXNA 1DFQA 4N53A 4Q27A 1GQGA 4QDSA 4XIKA 5FY1A 4EE2A 3JBG3 4Z1VA 1VAVA 4GIQA 1D4VB 4F83A 3WP6A 1OQDA 2PA7A 2TEPA 4DNYA 3USSA 1PMJX 4QKBA 2VMGA 1D4M1 1RHI3 3BCWA 3KQ4B 3OBAA 3ZYHA 4CCCA 4Y1VA 3AVRA 2BP6A 1J3QA 1EAH2 3O1PA 2XXZA 5FREA 4DO0A 2D7FA 5BNOA 2WS93 4PQ9A 1SLAA 2YROA 3FL7A 2ID4A 1L7LA 4META 2X53S 3O5SA 4COYA 3AJYA 3VDDC 3I4IA 3HWJA 1VMHA 2WNVA 2Y0OA 5FPUA 4RN5A 4BQXA 2WLPA 1ENSA 3ZXKA 2BPA2 2R0FA 1JUHA 3ES1A 4J1WA 2PELA 1LHVA 3ZYPA 1SHWB 3V0BB 3ZKUA 3K51A 3SEPA 4OQ8A 5JIAA 3VKMA 2YPJA 3FJSA 1GKBA 3P5BA 1OLRA 3VBRC 2VY0A 3ZFGC 3MI8A 4QX5A 5T5LA 4E8CA 2UURA 3E6BA 4XBNA 1UZVA 5C6CA 4A7YA 2BW8A 1RUI1 3SHRA 4UFIA 5F39A 3ZN4A 3K4AA 4QXHA 5IVJA 5L7OC 2CL2A 2TNFA 4FI9A 3NNMA 2DVDA 3LIHA 1ODMA 4IE0A 2R043 3UESA 2FDGA 1S4CA 2R30A 1C5IA 2XVKA 5FYYA 2BNOA 2VCBA 3LOBA 1Y9QA 5LASA 5KHIA 1RUJ2 2QQIA 3WOGA 1L7QA 3LZZA 3C7EA 2A7AA 4GAZA 3HIFA 2KD7A 2WNOA 5DUVA 5CFDA 4Z8BA 1BCXA 1VRH1 1JXNA 4DRRA 2V73A 1WD3A 5F2WA 3MLJA 1SCRA 1D2QA 1W9SA 3VD5A 5IFTA 2HWE3 4FQ4A 3E5XA 1WWYA 1UU5A 4LA2A 3BKZA 1SFPA 1UMIA 1VBB3 1CAWB 3NMBA 3CHXA 4XJ8A 5BNNB 1E5IA 1LCLA 3RRDA 4OQ9A 3PJQA 4UXAA 4ONUA 5LATA 1XQNA 4JHTA 2ET1A 4LR4A 5LY1A 3J8F2 5IW0A 4ARYA 5CBLA 3H7JA 1A6CA 2HLEA 5IYYA 3TEXA 1AR62 1RXGA 3CKHA 1LECA 1GZWB 5F8PA 3ZSKA 3B00A 2E9QA 2ZEWA 1PO21 1N3PA 2VH9A 5T54A 5CIRA 1UO9A 2W52A 2GNMA 4A7KA 3SKVA 2ZX3A 1PMIA 1R1A3 2YHJA 1SZBA 3AMHA 1V9U3 2BOIA 2E33A 2WLQA 3VKNA 1DG6A 2X29A 5I0UA 5IATA 1UXXX 2I07B 1ZBE2 4JVAA 2CWSA 3IBMA 3PMEA 4B7KA 4OCTA 1HV1A 5FOBB 5JOXA 2OZJA 3T08A 3IMNA 1DCSA 1UY3A 4TYSA 3N9PA 2K2SA 4OUSA 5D1IA 1AR72 2EXJA 4FPGA 1K5MA 2B45X 4I02A 4AEDC 2WT0A 3WLUA 4KL1A 4LHLA 4XF9A 5FUPA 2Y0IA 4FPLA 2GNTA 4JGZB 5TSWA 4Y22B 2IWGB 5CKNA 1U5YA 2YXSA 1XNDA 4Z82A 1APNA 4XFAA 2OQ6A 4CDXB 1Q8PA 4BK5A 4Y5Z0 5KXBA 3IIAA 1UY2A 2QDNA 1QJX3 4NHKA 1SPPB 3RZZA 1JZ6A 2NMOA 4CUBA 3ZFEA 1EV12 1NCRC 1XPWA 2DU1A 1PX3A 3L2YA 1FV2A 1RMU2 2RS51 5FCCA 3OG2A 2WN2A 3NJXA 2EICA 1UZYA 5F5QA 2VZ1A 5FFOC 5GLVA 2QQNA 2PHDA 3USUA 1WMXA 2PMWB 5EQUA 1S55A 2GMEA 3P3NA 1OVPA 4FBFA 4DRVA 1PVC2 2JG9C 4UF0B 1LB2A 5FPXA 3ALQA 5A32B 2PHUA 4QX0A 4CDQA 1BBT2 5C3PA 2FDFA 3PLQA 1PZ7A 4NJ4A 3TRSB 2E6VA 2K0GA 2XJSA 1FNZA 1GNYA 1Q56A 5LBBA 2UWCA 5JOWA 3OPWA 3OPTA 4XVHA 4PLMA 3A22A 2FCUA 4BZ4A 1W28A 1H1MA 2OKXA 1R093 3MW2A 3FLPA 3QACA 2ZPXA 4HPKA 3BUCA 2FBEA 3C8XA 2XJPA 2YBKA 3LEIA 1YO8A 5A3TA 2AC1A 5C33A 1UYZA 2XLFA 3WDVA 1KFXL 4NRQA 4RA0A 4PIYA 4PDWB 3ETPA 1N1VA 1IG3A 5FAXA 3WX5A 2NQYA 4IW3A 4AQ6A 2XJUA 5DUWA 1HRV1 5IVFA 3PMSA 2QQUA 3RI8A 1DLLA 1PK6A 1YQCA 2X5IC 4AI0A 3FFQA 5LRSA 4M3CF 3P1IA 3MLLA 4XZUG 5FZMA 3VZOA 1RVF1 2RR11 4C1WA 5JZGA 1BMV1 3ZYGA 4HKOA 1HV0A 4FOVA 2G4IA 3SCFA 3BN6A 1C1FA 4L92A 4QPIA 4ZU5A 4CU9A 1DZQA 4KH9A 1LGNA 3HQUA 4EN7B 4B1LA 4S2GA 5K9YA 2HYKA 2VCAA 3NJZA 3RJRA 3ACLA 1VP6A 2P17A 2RS12 5LA2A 2A3YA 1GYKA 1W6QB 3LFMA 5A33A 5C4WC 3WT3A 3AZXA 4CPBA 1GLHA 4BPZA 4L0PA 2B8MA 2DUPA 5FZBA 3RNSA 3VKFC 5CFCB 4Y1XA 2R0HA 3NNLA 3M3CA 3ZYJB 2QBXA 5ACA3 3HNBM 3K77A 1IHMA 5DG1A 3FBMA 3NAPA 4D3WA 5H9SA 2QQVA 4P14A 3U4XA 5FZOB 5A3WA 5FZ0A 2PLV3 2P3JA 4MH0E 2GMMA 4HXCA 3ZSEA 3U4SA 1W2TA 3QH6A 5FMCA 4BXSV 5FWJA 5IVVA 1WUVA 2MNGA 4ASMB 5HI0A 5JPNB 4OI2A 1A78A 5GJ6A 4I0WB 1G6NA 4BISA 1SFYA 4COUA 4WM8B 1Z7S1 1YC61 3MIGA 1RINA 1OHFA 2C26A 3VZKA 4WZFA 3WSOA 3UL2A 5F1RA 2XVGA 1ODNA 5AC93 1A34A 1DGRA 3I2HA 4Q1PA 1YQ8A 2ORXA 2A6ZA 4K21A 2ZAAA 4QX3A 3RWNA 3SCGA 2VOWA 3IM0A 4QXCA 4C0BA 4IE4A 2EA7A 2V4AA 4O7XA 3UGFA 2BNMA 5C9AA 5KHJA 4IL7A 3ZIXA 4E2GA 1LU2A 5CFDC 2B42B 2ZXQA 3T1LA 4QPYA 4BQ1A 1A3KA 3I3BA 2RVAA 5C5TA 1SEFA 2SLIA 3DV8A 4COVA 4JC1A 5FY7A 4NHMA 1H6XA 3MUY1 1D0GA 5KC6A 2IVIB 1CZSA 1GFF2 2AZ5A 2FZ1A 3OEBA 1NXD1 4I01A 3D3AA 1LNSA 5BNNC 1XE0A 2WWJA 5KXEA 3I2OA 5A7PA 4YG6A 3S30A 3OD4A 1REEA 3IDCB 1RUF2 2HWF3 1BEV3 1QNYA 4I09A 5IUQA 2C24A 2R1BA 4D8MA 1IKPA 1JYTA 3WNPA 3THDA 2L9LA 4QPGA 1S2KA 2FMDA 1OA2A 1VALA 3AMQA 3AYCA 4YGEA 3CLPA 1AYN1 2FDJA 2A5ZA 1AJOA 1G9CA 1VBE1 2FDHA 1X50A 1ULEA 4BDVB 2HKXA 3UJOA 1XNBA 3CJIA 5IVCA 4ASKA 1HN1A 2ARBA 5FYTA 1EUUA 3CMGA 1Y7BA 2Z5WA 4ZZ8A 4R4XA 1W6OA 3JBG2 1AL0G 1QJU2 4WM7A 4DPNA 4Q8KA 4N7UA 3QD6A 1XNTA 3GZAA 4LBQB 2E31A 4CPBD 4DEVA 2BERA 4RSUA 4CCOA 3FHIB 4YGCA 1PNFA 4JTNA 5DZGA 1RITA 3THTA 1YJLA 2PQSA 3RDIA 1PO12 1SBFA 2AUYA 1MACA 2GNDA 2WS92 3H42B 4J1XA 4X6RB 5LB6A 5ISLA 3ZX7A 2Y26A 4I3PA 5AVPA 5C5UA 1RUG1 1MS1A 2QQMA 2HWE1 4AVBA 3EHKA 1QMJA 4CDXC 1Q8QA 1E5HA 5D2AA 1W6NA 2XBO3 5BNPA 2XL9A 2IVJA 1PIV1 4KQ7A 5FZCA 4XABA 1JZ5A 1CGPA 2HJIA 1PHMA 4TN7A 2A3XA 1W6MB 5DZFA 5BNPB 2VOKA 4AHZA 5FR3A 1KJRA 1ND3B 5L73A 5FBZA 4C1XA 3VBOA 4PIXA 5IJRA 2OPWA 2W92A 1W8NA 1LHOA 3MGUA 5JXJA 2DCYA 4Q4W1 3KT1A 3E1F1 4MGIE 5LEKA 1XSRA 4FPHA 4JKLA 4AVVA 5FPLA 1W90A 2ZEXA 3DXUA 1ZZ6A 3NKGA 3NV3A 4QQLA 1HQWA 2P3IA 2O1QA 1A8DA 2G9GA 3PU8A 2YB7A 3BPSA 1IS4A 1K45A 3NJVA 3UNPA 3HQRA 4YWAA 1YFUA 3WCSA 5C3OA 1HIXA 1V6JA 3WUCA 1SLTA 1D7PM 2HWD2 2FD8A 4ISRA 1GICA 2H0VA 4Y24A 3VZJA 5C3RA 1UY4A 2WQ8A 4K9SA 3MO4A 4QQHA 1AL23 3WF0A 1VBB2 1S2EA 4QQOA 5J37A 4SBVA 4URAA 2YDEA 3WDYA 3I49A 3GCXA 3GZTB 1OD5A 1NLRA 3GGLA 3NO8A 1POV3 3IDEA 3Q8EA 5C8WA 1LOCA 2WL1A 3FLRA 3WVJA 1ULCA 4YW5A 1Z78A 1WLWA 2B46X 2ZABA 2YV8A 1LHUA 2DU0A 3NWKA 1RUJ3 1TEIA 1W9FA 3H3LA 3VDCA 2ZEYA 3EYPA 4YVWA 1LAJA 5FQ0B 4NIAA 1RUC3 3VN4A 1TME2 4GXLA 1V9U2 1G9BA 1RUD3 4AFDA 1I5PA 1ZRFA 4AGVA 4BLJA 1ULPA 5EJ3A 3WUDA 5IK7A 1PK6C 4DEQA 2W68A 1BLZA 1JW6A 3VKLA 1VB4A 5K7PA 2D3SA 2VQTA 5BPXA 4GALA 1L3JA 1DYOA 2JE9A 2JDPA 2BRTA 4OI0A 3G7DA 5KHGA 2OUHA 1UWWA 4FPOB 3KLSA 4A7ZA 4FCAA 5K4LA 4MXWB 5I91A 3J8F3 4Q4Y1 4YW7A 1JZ7A 1OXCA 1DU3D 4BM8A 1W3XA 4E2QA 2XUMA 4Z92B 2JDNA 1VLNA 2B4KA 3MIDA 4NO4A 4A3ZA 2RS31 3TBDA 1JBCA 2BNNA 3W58A 3AM2A 4HVRA 4AR2A 1Y3TA 3VBUB 4HN1A 3WQ0A 3WF3A 4BYYA 3OGJA 1GWMA 4DOUA 3LQCA 5FYSA 4K3UA 4KWLA 1FOD1 1CZTA 2VOXA 4KI5M 4GB33 5FTTC 1QJX2 2DCZA 1H2NA 5FLJA 1Z0HA 3WG1A 1NAEA 1PM7A 3WDWA 1Y43B 2ZGUA 4UI9L 4XDPA 4YFWA 1J83A 4LKFA 1AR73 3SISA 1F15A 1DQ4A 5CNAA 3WQBA 4NIGA 4IEXA 4NUBA 3M1HA 1YUDA 3KS7A 1AXYA 1NY72 2C9AA 5T50A 2IZWA 4HFSA 3UGHA 1UKRA 3W59A 4IE7A 1JMUB 1CAUB 2VVEA 3J7LA 4XJZA 1UPSA 2DYCA 4MYEA 3RYKA 4GULA 2Y6HA 4KG8A 2D44A 4XAEA 3B7MA 2OXBA 4AFBA 1L7RA 3NKTA 1Y9MA 3POFA 3WNNA 3Q8BA 5IVBA 1VBA1 2VTXJ 4XFFA 3H1WA 3RPQA 3RGBA 3VHOA 1ZA4A 3LE0A 2VULA 3KSCA 1COV1 1ST8A 2Y34A 5A1AA 4AYUA 2ARAA 4FTSA 4BQ2A 4LK7A 4FOYA 2ZMNA 5FZ1A 5FXWA 3ZXGA 2W87A 4MOAA 4XCAA 4FFFA 3RS6A 2FDIA 2YBPA 4RGAA 1J1TA 1FX5A 1RUE2 2YBSA 2VG9A 1C8M1 2QDRA 2ZX0A 3R05A 4ZKTB 5HCHA 3OUJA 2A71A 4ZS2A 4QB6A 5ABJB 1PVC3 1WGPA 4ARXA 3GDBA 1CIWA 1NA1A 3PDQA 3BGAA 5BXXA 1BBT3 1GSLA 1AYM1 1AR81 5JSOA 5L9VA 4ZXEA 3ZXDA 3UKVA 4YSFA 1N1SA 2RDSA 1ND2B 4Y20A 1LOEA 3ZFFC 4Z2AA 4HVQA 1X9PA 3SH3A 2X8KA 1IG0A 1LOFC 1RJ7A 4EROA 4NIIA 3S0MA 4L97A 2P6HA 3CQOA 1XBFA 3WW1A 2XJVA 5JR7B 4Y1ZA 1RC6A 1WW4A 3VBSA 2YG0A 2AR6A 3WHTA 3ZVXA 1DGLA 4B4QA 3SKJE 3FFZA 2CU5A 5H9RA 2XLGA 5A3LA 1RGSA 3LCPA 5AC91 3BB6A 4M0NA 1O5LA 3FC0A 1HN0A 2VMCA 3VL8A 5B4XA 5JXHA 2HYXA 2XMLA 1MZ6A 1MVQA 1WA6X 4ZY9A 4R52A 1BZWA 2VZQA 1UPIA 5LY2A 5C3QA 2VMEA 3KT7A 4F3JA 1JS9A 3EJKA 2E63A 3I3DA 4PQQA 4D0QA 4LO4B 2VNOA 1ZM1A 5LZ6A 5DABA 1YQ6A 5ACA2 2Y64A 2JICA 1YI9A 5FP9A 2GC2A 2RDRA 1FPN3 4Q26A 4S2DA 3TEZA 5LBCA 4NRPA 4CDUA 2NLRA 3D6EA 4HOOA 1N3QA 1XNAA 1RUOA 1ND3C 3A21A 3K3NA 5E6HA 3T0BA 4XW3A 1GOGA 4RR3A 3VGIA 3N9QA 4AEJA 4BLIA 4D7YA 2WFF3 4A3XA 4Q4X2 2UYBA 3OYWB 1CVNA 2WWUA 1UQXA 4GQ7A 2ZGOA 4FT8A 1AX1A 1QDOA 1QOSA 4UFKA 1JZ8A 1RXFA 2E53A 1UZZA 1I6XA 4MADA 4YVSA 1POV0 2R073 3DPRB 4KU7A 1ZNPA 5FZEA 4LULA 3OGRA 1KEXA 4UW5A 3MZHA 3A7QA 2NMNA 1CAVB 2EXIA 2W1SA 5FOJB 3N7LA 1NCRB 4CCDA 1C1LA 4D69A 1MEC2 3CIHA 3ZR6A 1ZRCA 1SLLA 2OIIA 1W9WA 3H1MA 3KGZA 2AEZA 3IN9A 1YRZA 3JXSA 4YM2A 4NHYA 3BOPA 5JCTA 1VMFA 1C4RA 1UY0A 4LHSA 4URTA 3UK9A 3AXEA 3T1MA 4HK9A 2H0BA 4AI3A 4QU2A 4AGGA 1OVSA 1KXGA 3AP6A 4M3CA 5CU1A 4LIVA 5BV6A 1VBC1 2OA2A 5GZFA 2JE7A 4D7TA 1UMHA 4S2HA 1HXS1 3DN7A 2HWF2 1BEV2 4EV0A 1QJY3 1JN2P 5DG2A 3V0AA 4LKSA 5CAZA 4XAAA 5T55A 3KWVA 2B9UA 1UAIA 4CXYA 4YW4A 1K42A 3T4VA 2C4XA 3KM5A 3BU7A 3BTAA 4LT5A 4IEVA 5F3EA 1OA4A 2P2KA 4AVSA 5B2GB 2A73B 4LHKA 4UW3A 4E4HA 2FZ2A 2W9XA 1EAH1 1O8PA 1WMDA 3J4UH 1RUH3 1QJFA 3AL5A 1VMJA 3CBNA 3RYRA 4AI1A 4FAGA 5CADA 4RHV3 3CNAA 3HT2A 2BYVE 4E4DX 3M3OA 5A3MA 4RL7A 3SH4A 1YCIA 4ES8A 1Q43A 1GOHA 2R6QA 3SH5A 3WQ7A 4LBLA 4NIHA 1MZFA 4QHOA 5CG8A 1JODA 3VL9A 4PIZA 1OH3A 4HL0A 3T3YA 3VD7A 2A70A 4TZDA 1X7NA 2BWCA 1IPJA 4CP1A 2DCKA 1CR7A 4A42A 1GP6A 2LM3A 2VMIA 2X5IB 4IERA 3VBUC 3U0ZA 3AYDA 3VZMA 1EP0A 3AX4A 2VO5A 4DXZA 4QX7A 4RS5C 3M4FA 5EYYA 3KV4A 1OOPB 2XBO2 4Q4V2 5CVRA 2VZTA 3D8CA 2RM22 1CAXB 4WV8A 1QJU3 1X8MA 4N53B 4CP9A 3ZXEA 3T2OA 3RMXA 4P5YA 4UYBA 4BIOA 1JZ4A 3T0DA 5DAQA 2VVFA 4XJAA 2QTWB 1ULFA 2DBNA 2PFWA 5C4WB 4Y4YA 2UWBA 2WO3A 3WP4A 3AKPA 1PO13 3THPA 1BXHA 3I2FA 1UZ0A 4AAPA 2YU2A 1R083 3GHNA 1FMD2 4BWOA 5BNOB 5FLHA 4GH4A 2UY8A 1LENA 3I2JA 2HWC3 3MPPG 2QQJA 3CO2A 2WNVB 2OW4A 1TQ5A 2ENRA 3VDAA 4CUAA 4NAOA 5FZ7A 4AG4A 1AF9A 2R49A 4UW4A 3AZWA 4C8DA 1AR61 1QH6A 3B93A 3KV9A 3VV1A 1LR5A 4MZUA 3HBZA 3R0RA 1N1TA 2WWSA 2JDYA 5C3SA 1W06A 5JR2A 5JOZA 2TBVA 4AHWA 1AXZA 2JDAA 4XMAA 1AL22 3FUOA 2O0OA 2VCCA 3J26N 1V6IA 4FPCA 1JYNA 1NUKA 4YZ4A 3Q9OA 3WDUA 4JRLA 4AZZA 1SG3A 3BALA 4F7ZA 4CEYA 2QZ3A 5ABJC 1IQAA 1ZBE1 1CJPA 4CCMA 5FUIA 1E5SA 1G9AA 5HV0A 2XKOA 4IE5A 2VCMA 1S0EA 3LAGA 4AF9A 1O3SA 2YPDA 5IWFA 3LIGA 3UV9A 5FYBA 2QVSB 2JX9A 1O5UA 3C7HA 1ND2C 1VAKA 1RUC2 1WLTA 4FVVA 1O59A 3M8LA 1PGW1 5CFDB 5CYYA 1YIPA 2HWD3 2ARCA 1RUD2 3NNJA 2R32A 1BYHA 2GZWA 5JUVA 4P5HA 2AENA 1IS6A 3BODA 1BJQA 4MHUA 2BZDA 5FKBA 5FP4A 2RJLA 4JHZA 1O6UA 4HKLA 4Q0SA 4CDWA 3NJYA 2UYAA 1J58A 2J1VA 2P5BA 5IAXA 1G86A 5CKQA 1H0BA 5BY5A 2WRAA 4LLFA 4XDQA 5GM0A 2A6WA 1US2A 4PF5A 2CHHA 3EO6A 4Q5OA 3WDTA 4P9GA 2VGDA 5J96B 4MGQA 1YQ5A 1EV11 2V72A 4M4PA 1KDMA 2JECA 4KU8A 5GZCA 1TME3 5FXXA 1RMU1 4HT1T 5DMYA 2GC3A 4GWNA 3ZSJA 2BGOA 4M0HA 5FZHA 1Q3EA 3EXUA 1UY1A 1OT5A 1QNWA 2PTMA 4AVCA 1GNZA 4M3CE 4GB32 3RI9A 1TVGA 4XBLA 1WCQA 5ERLA 1XYNA 4GD4A 2RDQA 2LTNA 2DVFA 2W91A 3W5NA 2K46A 5LK7B 3ZXLA 1JZ3A 5KC5A 1ZRRA 2BGPA 3EBRA 5FIXA 3SXWA 1LOBA 1RUI2 4IEQA 4W8JA 3H3ZA 3GXUA 3OPZA 1JYIA 4Y33A 5DAXA 1K5MB 2W0XA 4UFHA 1BHGA 3S57A 1W2UA 3NSTA 4H7LA 4XTPA 3PVNA 4IQPA 3ASIA 2XQRA 5J09A 4ZONA 5FYZA 3VBHA 2ZACA 4XF4A 3KQRA 1WBFA 1J3PA 2RV9A 3BIEA 2GP3A 3N3HA 4Y3OA 1HW5A 5JIUA 3DPRC 2PAEA 4R9AA 3MPBA 3ZPOA 4DS0A 5G05L 2Q8DA 3AKTA 1DZTA 1WCUA 1UIJA 2H6CA 3RG0A 4IEYA 5A6ZA 2GP5A 3MLKA 4Y22A 2W47A 3ZFEB 2ZX4A 1DF0A 3OY8A 4RD7A 3V64A 5DDJ3 3AL6A 1PGSA 1XB9A 3A0KA 3RZHA 4KGGA 4R9BA 3RZLA 2ZHKA 4GWMA 3VBFA 3K2OA 4O61A 1FT9A 5J3UA 2ATFA 3JD73 2D6NA 3USUB 3PHMA 2ZGSA 4FP3A 1F5FA 2UU8A 3BTZA 4YYOA 1LJ7A 4HVOA 3U07A 4XXPA 2D93A 4B1MA 2RMU3 1ZBA1 2W1WA 5CG9A 3QLQA 4OLLA 3CZUA 3LEMA 4JGYA 2OYZA 5SV5A 5JVVA 3RVHA 3P6BA 2RS11 2CY6A 2F4PA 2Y6KA 3POIA 4IEZA 3HMYA 1DYKA 3ZXJA 5FPVA 4BQ5A 5T5PA 5J98B 3LGRA 1RUE3 4UF0A 3KVAA 1UOBA 1O4TA 4LTAA 3WNXA 5FY4A 2ILMA 3BYWA 3OCPA 2OT7A 2RG4A 4HPKB 4EWEA 3URFA 2GMPA 4PLOA 2LRPA 4AFCA 4Q1RA 3UYJA 2D6LX 5A3NA 2WZ8A 2J1EA 5CKMA 5DXDA 1QQP1 3AYEA 2OX0A 4LOTA 2Q8CA 2IUWA 1W03A 3CF6E 1QWRA 5FY8A 1MS3A 1VE0A 3NNFA 2VMHA 4HBNA 1YQ2A 1VRBA 2ZOEB 1PVXA 2PHWA 4BQ3A 2WYSA 4N8MA 2CGOA 1ASJ3 3TEWA 1AJKA 1R1ZA 2EIDA 3IPVA 4M4RA 1NCQC 4ES9A 3UGGA 3DGTA 1PK6B 4K40A 2EVXA 3NRUA 5JZGB 1OOPC 4UWDA 1FPN2 2HBUA 4JDMA 2AYHA 5A70A 1P8JA 1U0AA 2OUJA 3NL1A 4LBOA 4N53C 2YC4A 4QPIB 5K0UA 2WNUA 4LITA 2RS52 2ZA9A 3I54A 3JZVA 1BK0A 2WQ4A 1XE8A 2JDHA 3H7YA 2ZMLA 4CCKA 4FPJA 2WFF2 2Y8KA 2LS6A 1YJKA 4LE3A 5F6LB 5BNQA 2DVGA 2J1TA 5A33B 2F17A 1QJZA 4W50A 2B39A 3ZDSA 5BNOC 4D7SA 4YGDA 2HEWF 4K20A 2ETEA 2XJRA 5FDBA 4LMFA 4XURA 5C70A 2R072 2ARXA 4XDOA 1X33A 3AP5A 1QOTA 2WNVC 4CVUA 2LW8A 3AK0A 5FUNA 1C8NA 5JSRA 3ATGA 3K4DA 2ZGRA 3O1RA 4C91A 2EALA 1RUF1 5LBFA 5IHRA 4LOSA 4D6SA 5HXVA 2B9VA 5A7NA 1S0CA 1VBD3 4Q2FA 5HCFA 3AMNA 3KF5A 5CFCA 2JG8A 4SLIA 4Q4X3 4Z2WA 4BXFA 4HZFA 2XJQA 3DCQA 3GCWA 5A3PA 1DIWA 2AH2A 2F6BA 3RZJA 5HV4A 2BFUL 1GWKA 3DECA 5FO7B 5LA1A 1GR3A 3ABZA 4PCRA 1CPMA 5APAA 2XR4A 2R063 4LORA 1A8MA 1HB4A 4RGKA 3WG3A 1QJY2 4IETA 4MO3M 5GKAC 4A6SA 4CCLA 5J36A 4QU1A 5T52A 4D6RA 5IFPA 3H8RA 4N43A 3JBG1 2WJSA 1ZRDA 3DKQA 4DUXA 3A0NA 1JOPA 4LLOA 1RHI1 1MEC3 2MEV3 1DDLA 1LGCA 3B94A 4ITCA 2V09A 3PUSA 1VPHA 5C9AB 5KHHA 3O1SA 2X09A 3KHCA 2LALA 1OF3A 1HRI2 1BMV2 3ZDVA 4QGMA 1XOYA 4LJHA 1RUH2 1JH5A 3J9SA 1O4YA 1PO11 1WKYA 2WS91 3IDBB 4EYUA 4RHV2 3S5QA 1GQPA 1YHFA 3N36A 1CJDA 3T0AA 5GZDA 2VQ0A 1CONA 1MQTA 1Q8OA 3KT4A 4IV1A 3E6CC 2P6CA 1EYBA 3WD5A 4AI9A 2PHXA 1H8VA 4NPLA 2IXJA 3WNKA 3ZO0B 5HXMA 3DXTA 4FQZA 2BQPA 3PVBB 5CZKA 1XC6A 2NN8A 4QPGB 3ZFFB 5A1LA 3DL3A 4HKWA 3LEKA 5LW9A 3PUHA 3ELNA 4Q0UA 4UT5A 2PHTA 1UYPA 1QEXA 3GALA 5E16A 3IDAA 4HLTA 2WZR3 3CJIB 1ALYA 3POJA 3THCA 2KXLA 3NV1A 2DCTA 2B5HA 5JOYA 2PAKA 3J7HA 3M3EA 2R041 2VM9A 2P3YA 2ZEZA 3P3PA 2VZ3A 3GBGA 3K48A 3N9MA 1W6OB 3FMGA 3HQXA 4WM7B 3CDZB 3TAYA 3M70A 1J59A 1AX2A 1KS5A 2Q0AA 3E5QA 3WW2A 5IK4A 4TTGA 4MGZE 4OHZA 3MV01 3SQOA 1HJFA 2Y38A 5AVAA 2XQXA 1DQ6A 1AXKA 2NPIA 1K5MC 5D8AA 4AK3A 5H9QA 2ZGPA 1R082 2C9KA 3O0WA 5F32A 5F3GA 3FUQA 3W20A 5JWPA 2XG3A 2QFEA 5L36A 2HWC2 1ENQA 5KXCA 1WCDJ 3OBTA 1VBB1 4JDOA 2ET7A 3OGGA 4Q4V3 5FMBA 4LKDA 2HWB3 2D3RA 1EY2A 4KBZA 2RM23 2AEYA 2VBDA 4KWJA 5GZGA 4QXBA 3FLTA 4QT6A 1W6NB 1OH4A 1H9PA 2Y6FA 4LPLA 1H30A 3WW3A 1BQPA 1AZDA 2GDFA 1ZYBA 5FLIA 1DLCA 3ZFEC 5JMCA 1LEDA 4LUKA 4QKNA 1TNRA 4JX0A 1AR93 2J7MA 5FZIA 3VBOB 1R1A1 5FZ8A 4BA6A 1TMF3 1GOFA 3DF0A 4ORFA 1H1IA 1V9U1 4Q8LA 4AGRA 1FMD3 2JEMA 2E7TA 3LFIA 4DY5A 3WP5A 3BTYA 1JU4A 1K12A 3VBFC 2KR2A 4DFSA 1YLLA 3FHAA 3R4SA 1AYN2 4GMP3 5I8SA 3M3IA 4CXWA 4CDQC 4LO5B 4LA3A 2HBTA 2PHLA 3M3QA 1PZ9A 2P1BA 2WA4A 1LRHA 1WMEA 2V5DA 3AJZA 5F7UA 1H4HA 1O91A 4MX3A 2W46A 4B4RA 2FQPA 4AHYA 2E7AA 4XE9A 1OI6A 4OHXA 3TN92 4IV3A 3RZKA 3LDBA 1PZ8A 5A7SA 4CEWA 1YEWA 4XF1A 2Y60A 4RYDA 3POWA 4RQPA 4H7MA 3O1MA 2Z42A 1ZZ7A 4EN0A 5F3IA 4Y1YA 5FYIA 1QJX1 4PT6A 5FZ3A 3MFAA 3LB9A 1IS3A 1HDKA 1URXA 5HCBA 1UIKA 1OQ1A 1SACA 2AACA 4YVWB 1X9TA 1VAMA 3IWZA 5G04L 1U5IA 2WQZC 3I59A 3I2DA 1LGBA 3ZN6A 4D94A 2XJTA 2VZSA 4AFAA 1NY71 4AEMA 1WW6A 4Y5SA 5JSPA 3EB7A 4NIDA 5JZGC 1OBNA 1B35A 4BQYA 4YARA 5A6XA 1HX6A 2A75A 4OUMA 1OPOA 3ZLIA 4CP2A 5J7MA 3PURA 4QPIC 1D4M3 4HSJA 3U1XA 1PMHX 1GNHA 4LXLA 5DUXA 1QHDA 4GWIA 3RJ2X 3WG4A 2SBAA 3RWKX 2VXJA 1J1LA 3NVCA 1UZWA 3CU7A 1RUNA 2X10A 1X36A 4W6XA 5CB7A 1CIYA 1KS4A 1ZX5A 3I3EA 1OURA 2VUAA 1WCSA 4LBQD 1LESA 2WN3A 1JU3A 3NQHA 5A3UA 2JDZA 4AL9A 1DQ5A 1U5ZA 4FOQA 4RS5B 1R091 4B8EA 2JIJA 4WVZA 2NZ9A 1WLDA 4AW7A 1SFNA 2DUQA 2VW2A 2WA3A 1JI6A 1NZCA 3NAPC 3QBQA 4I3GA 3OBRA 4KNCA 5C8CA 4XF3A 1NLQA 2N7GA 2YU1A 2DURA 3PUIA 1JOBA 3IB3A 4XQ4A 3TB0A 3C7OA 4IE6A 3VD3A 1RUI3 1D2SA 3PU3A 4DY3A 3H3UA 4GWJA 3ZOIA 2VUJA 5FZLA 5FV3A 3AFKA 3OBZA 3N4MA 5DDJ2 4E2SA 4YW2A 3WEZA 4MG2A 5JMOA 3AB0A 3RZGA 2GC0A 4RFT0 3JD72 4I0BA 5E1RA 3U10A 2V4VA 5FZ9A 4INDA 4OMCA 3MBWA 3FN9A 4V1PA 2QE3A 1ULOA 4COZA 1OF4A 2IFRA 3GJBA 3CEWA 5LA0A 2Q30A 1POQA 2RMU2 3LDRA 1VRH3 4KMQA 2BFUS 2EXHA 2YGLA 2WAOA 4RGGA 5T5OA 4XTMA 4AOCA 4YRDA 2J1RA 4Q0QA 1I9RA 4ZU7A 1WZXA 4XUOA 1GWLA 4MGYE 5C9AC 2WR9A 2FHRA 4JQRA 1ZZCA 3DUIA 2QQPA 3GYDA 3TNQA 1W0OA 3ROUA 3SCHA 3N7KA 2YGMA 2JDUA 3OD0A 5IVYA 3VDDA 1V0AA 2CNAA 4AHXA 2FMYA 1IOAA 3KHBA 5IVEA 4XJWA 4YW6A 3WY6A 5FYCA 5ACA1 4Q4Y2 3K46A 1W6PA 2XDVA 3VBRA 3ZFGA 3IAPA 1ENRA 3IMMA 1PO23 5FZDA 2PLV1 4OI4A 3K75B 2W08A 3ES4A 2Q1FA 3I8TA 1NE6A 1J84A 4QPGC 5KHKA 3O0VA 3PIGA 5L7OA 1CPNA 1ASJ2 1RTVA 1W0PA 2RDNA 4QM9A 1Q8SA 4Y20B 3WQ1A 3AP7A 1FOD2 3O7OA 2YY1A 1Q5OA 3LWCA 1S0GA 4Q4X1 1I1EA 4XJUA 4BIFA 1BK1A 3H50A 5AFBA 1PGL2 2JKBA 3BIWE 3CJIC 2WDBA 3WR0A 5C71A 2DV9A 3AXDA 2XLAA 4CCEA 2VW0A 3F2ZA 4ZPIA 3VBSB 1KRIA 2VTXA 4K6BA 1OKOA 4NVPA 3WF1A 3POGA 4WM7C 2WUHA 4K7JA 4XCBA 4EN8B 2ZX2A 1H8TA 5SV8A 4IXLA 1MEC1 3VHNA 4KWKA 3C2UA 4XYXA 5FO9B 3MFCA 3OUHA 4QB1A 2ADEA 1H2LA 2OPKA 4HK8A 4Y5TA 2ADDA 2ZGQA 2XVLA 2ZGNA 3BOWA 2ZJCA 3ME2A 4IEPA 4XXAA 5LEJA 2EIEA 1NYWA 4UOJA 1DYPA 5BNPC 1WLCA 3W9AA 4GMP0 1OLME 3RYPA 2HWF1 1BEV1 5FY9A 3BTXA 1IPKA 4CDUB 2RS53 3H8UA 2VECA 2A1XA 1VBD2 2LROA 4GKXA 4Y1UA 2QQOA 1UMZA 5EYXA 3D0SA 3VBOC 1G9FA 1RYYA 2CSGA 1K3IA 2RE9A 4LEJA 3RQ0A 5GZEA 2PHRA 4PHZA 5EFUA 2CGNA 2R062 5I8TA 5FMOL 4YFZA 3N7MA 2D3PA 4YVSB 2ZAHA 4AEDA 3APBA 4YZ1A 4C90A 5GLWA 2WABA 5T3NA 2MEV2 3PUQA 4GKYA 3VB9A 2NP0A 1QF3A 2VBPA 3MF6A 3ZXAC 5B4NA 3I3MA 3B02A 3VZNA 4CZSA 3WZ1A 4MHRA 4X6QB 3CZJA 1MPXA 4IGPA 4AEKA 4DINB 2BU9A 4H2AA 2D6PA 4WZCA 5LCWL 2K9ZA 4QPWA 5KWRA 2DCJA 5LK5A 4BMEA 2VZPA 3PTYA 1Y4WA 3NW4A 3T09A 4QX2A 2O8QA 1PM4A 2XBO1 3IIIA 3PVEA 4Q4V1 2VNVA 2XOMA 2JDMA 5A7WA 4BQWA 3V0AB 3MW3A 2CYFA 3N9LA 2PHFA 2A6VA 2BWAA 1HRV3 5FZKA 2HEVF 2DTYA 4P9WA 3DEMA 1ZREA 4YVWC 3ZSMA 1HB2A 3OF1A 4QKFA 2RR13 1HRI3 4XQDA 3OGVA 5F5IA 1TG7A 2JG9A 1W8OA 2QCSB 2WZR2 4ZS3A 5GLTA 2YMZA 4QGLA 1W2AX 1STMA 4OYUA 2BOJA 2AREA 2GALA 1VB2A 1IZ3A 3GZEA 3OB8A 1GP5A 1XNCA 4NWWA 2E7QA 2QQWA 2WNEA 4R9DA 1MS5A 5BUVA 3DYMA 3O1OA 4MVTA 3HN1A 4NROA 4CU8A 1JOJA 4GJZA 3CJXA 1UX7A 3OEAA 1MR5A 3E5UA 1LULA 2EIBA 3PVOA 1CX4A 4H14A 4TWTA 3OSDA 5CA6A 5KR7A 4CCJA 5IK8A 1G9DA 1OA3A 1XYPA 1F5JA 1YFXA 2VNGA 1UCXA 4XUNA 5A80A 3E6DA 2QNKA 1YNAA 4CP0A 2GSYA 1OUXA 3VDBA 2W1UA 3MICA 4AVTA 1NCQB 1AX0A 3MIBA 2RJ2A 1ULDA 2XKPA 3D0JA 1AL21 1V70A 2H6BA 4M00A 4QD2A 4AWDA 1H4GA 4TLGA 5E88A 2HWB2 3SLIA 3T2PA 1IKQA 1QJEA 4N90A 1O3QA 2W95A 4P00B 1YXWA 3B9CA 1POV1 2VNRA 2W2IA 2Y33A 1JYXA 1HLCA 2XUEA 4WVMA 2HH9A 3MV11 1UYYA 1DHKB 2ZS6B 1UNBA 4Z07A 2ZGKA 4P9IA 1RUJ1 1HQLA 2FCVA 4BE3A 1AR92 4XUQA 1LEMA 2WKKA 1RUC1 1TMF2 3ZSLA 4YZ3A 1M06G 1RUD1 4G4FA 3VZLA 1RL3A 3F95A 3Q8CA 1UXZA 4GH4B 5JI7A 2J1SA 3KCYA 1SBDA 2Z69A 1ZZ8A 1YWKA 5F5AA 1FV3A 3S6PA 2BUKA 2ZKLA 1S0IA 5C4WA 1YYNA 3J8F1 3KVBA 1DZRA 4R4ZA 4YM3A 5D21A 3FBYA 4PJYA 2DBIA 5I0DA 2Z4FA 4NPMA 2XL7A 3AFGA 2Z2SB 2XB6C 3M2MA 5JI9A 2EAAA 3PJYA 3B01A 4B4PA 1KD7A 3SMHA 4PF1A 3V0BA 1XSQA 2D5HA 3WNOA 4NHXA 4LQRA 5M0TA 3M7AA 4QHZA 5FWEA 4CEYB 4NAMA 1XJAA 4GB31 2BVVA 1O4ZA 4XF0A 5EWSA 4IEOA 1AYN3 1NA1C 4QM8A 3RMYA 2XWJB 1VBE3 5FK7A 5FMDA 1AR71 2XGXA 1V6MA 1MVEA 5FJHA 3CL1A 4JKMA 1XRUA 2VZOA 3R4UA 4OMDA 1J3RA 3B69A 1S2BA 2ZZQA 1DGRN 1NQJA 3SITA 1H2KA 4AAXA 4CUCA 3NV4A 4LO7A 2VMFA 3I7DA 4GJYA 1GANA 3TN93 4BJ0A 4H3WA 4KWUA 3ZXFA 3VBSC 1OSGA 1QIQA 1D4M2 4XFBA 2J1UA 3GJAA 4CDWB 4G3YC 4AFMA 4YPJA 2VQUA 4LE4A 5HCAA 4ZU4A 1DBNA 4CE8A 1W3VA 2QQKA 3GBWA 3WCRA 2XHNA 3WF4A 3AKRA 1CD3G 2QJVA 1H8TC 2WINB 1RUG3 2F4LA 1CAWA 5BNNA 3B5LB 1RB8G 5FZAA 2D43A 2W39A 1W05A 1C5HA 2ZZJA 3WNMA 3GNEA 4NRMA 4XIOA 3UJQA 3O1TA 4MGSA 3LDKA 1PIV3 3LPFA 4Q0VA 4LUMA 3RZMA 1GZWA 1MZEA 3NNGA 4JDNA 1PVC1 2JD9A 4CU7A 2R16A 4N9IA 2CGPA 1BBT1 3ACFA 4CDUC 2CAVA 4OHVA 4FFGA 5FYUA 1ZA7A 4Q4W3 1RIRA 4WVVA 1UOFA 2GAUA 2VJXA 1GU3A 4RR3C 4QB2A 4YGBA 3MUZ1 4OHWA 4P9XA 3SNMA 4LHNA 3WHUA 1XU1A 5EP9A 1SDDB 4A41A 3TNPB 5FPAA 3B9IA 3VBHB 2ZKNA 1LTEA 2JE8A 2WT2A 4JAAA 3ZMNA 1OKQA 3ZKYA 4AVAA 4DZGA 5AFEA 4MGTA 4YVSC 1VRH2 4AXOA 1PGW2 2GN3A 1Q8VA 4JGZA 2PN5A 4IUGA 3EQEA 3LSEA 4N7IA 3T2QA 1NX9A 5FMOS 5LWBA 4KG0A 3A4UA 5DAPA 5FYHA 2A6YA 1O8SA 2YZ4A 4CDXA 1UL9A 2O8OA 2WZEA 1KDKA 1QKQA 3C7FA 3OY8B 5DAVA 5DZEA 3D4KA 2CV6A 1M4WA 2VMDA 1SPPA 3IZOA 3VBFB 2MPFA 4EWAA 3ILFA 3OUIA 5FY5A 3RSJA 5HPOA 1PO22 1IGOA 3H0OA 1FPN1 1OQEA 1AVBA 1W8TA 1S0JA 1YIFA 3FZ3A 4CDQB 3AZZA 2PYTA 2VZRA 3LF7A 1US3A 2EXKA 2RJKA 1DQ0A 2VD7A 1IS5A 3HR9A 1T6GC 4UW6A 3ZYBA 4JGYB 2JWPA 2DVBA 3HAGA 2WFF1 2VPVA 2YC2A 2IXIA 3ECQA 4AI2A 5KXDA 4MLOA 1N3OA 1W8WA 1X8EA 4XFIA 1H9WA 4XHBA 4BHPA 5A32A 4CCNA 4FTEA 4LBMA 4E4SA 4CUGA 3ZMOA 3VKOA 3NV2A 3KCXA 4Q4Y3 4QQ2A 2R071 4NHLA 3KZ4C 4IGOA 3KD4A 1UD1A 2PQQA 1UU4A 1FAYA 4LKEA 3AKSA 2J22A 2BTVC 1W8ZA 1YI7A 2Q1MA 4CTEA 3VD9A 1MS4A 2RS33 3QCWA 5FXVA 4FTBA 1TE1B 1ULGA 1VIWB 3ORJA 4K1YA 1F31A 2B7YA 5A7OA 1G8WA 4KBBA 1FOD3 3A23A 3FX3A 4UFMA 3IPVB 1O3TA 1NZIA 4C0HA 4BK4A 4YG0A 3G6JB 4QQPA 4QWNA 4R9CA 1V6OA 3X29B 4YZ2A 3TEYA 1U12A 2J42A 2W94A 3UKTA 1S0BA 4A6OA 4PDWA 1WCKA 2GN7A 4PI2A 1QJY1 3FE5A 3IKWA 4EZHA 2WT1A 2E32A 3U78A 3S7IA 5K0UB 2ZHMA 2JB4A 1QH7A 4DXTA 2WNUB 1HB3A 1BVVA 2JKXA 4NN0A 1F4AA 2QQLA 4K1ZA 3WG2A 3MYXA 3MHZA 2CDPA 1F8VA 1HRI1 2PAMA 2VQAA 1RUH1 4LO8A 5T5JA 3H8OA 5GLUA 4JKKA 4UFLA 4GH4C 4RHV1 1SMVA 1VBA3 2WYFA 1ZBA2 4Q29A 4ASLA 1UKGA 3EMRA 3H1YA 1OFSA 1XNKA 3NAPB 3POEA 1COV3 1GZ9A 2DFCA 1W6QA 4EWDA 3JQWA 1F2NA 1GMMA 4M01A 3AZYA 1D0HA 3ILNA 1VR3A 2V5YA 4LBJA 4ZHNA 4MV2A 3S5AA 1WBLA 1MS9A 4W4ZA 1W2NA 2JJ6A 1C8M3 2NYYA 4EJRA 1KITA 4FO9A 2QKDA 4V2WA 1XE7A 3HPNA 2JG8B 3T2TA 5FZ4A 3PUAA 5FZOA 3LD8A 2D6MA 2EF6A 4Y4RA 2J1AA 4HANA 1QGLA 1F9KA 3J7NA 4L2NA 3MDPA 2ES3A 3R6SA 1CESA 1V00A 3AC0A 4O9EA 1AYM3 1AR83 4LBKA 4E27A 4CEYC 1QQP2 3ACGA 3U14A 5A6QA 1BKZA 1QJU1 2BVBA 2EIGA 2Q8EA 5I0SA 4Q0PA 4YZ5A 3WW4A 4N43B 2Y6JA 5EJZB 4HONA 1HRV2 2QZ2A 4DB5A 4WM8A 4BCUA 1H6YA 4FSJA 1QXPA 3AYAA 1JYCA 4XMIA 4A2UA 5EV7A 1RVF2 2RR12 3UETA 1OFNA 2YYOA 2ZX1A 4NMIA 1W8UA 5FY0A 4BH9A 4YW1A 2A3WA 1DP0A 1OC1A 4V2VA 3O12A
chains in the Genus database with same CATH topology
1R081 4AI8A 2IFWA 1VJ2A 1WW5A 4P9LA 2D6KA 1WA4A 2HWC1 4EN6B 1YFYA 3QH7A 4WVWA 4CDWC 1MS8A 4JTOA 2CWMA 1MQTB 4IV1B 4YM0A 1ENXA 4FPKA 1QXRA 1KJLA 3WDXA 2JENA 1LKNA 2I74A 2IXLA 5GLZA 1LU1A 4NWVA 1QXJA 5IT6A 3E97A 3WINE 3ZFFA 1LOFA 1Z7S2 2CTVA 1ONAA 4FPFA 2HWD1 3HT1A 5D8AB 2GH8A 3VBHC 4LBQA 1N1YA 3TN91 3VLBB 4XJ9A 4FP2A 2BBVA 1UN1A 2C1FA 1RHI2 4HSLA 4ATEA 4O9GA 4COWA 4IESA 3JQXA 1RJ8A 2WSUA 2ZHLA 3OJBA 4JGZC 3POSA 4FPEA 1JTZX 2G9FA 5I8YA 2IXKA 1EPWA 1NG0A 1TME1 1VBC3 1C3HA 3JCIA 1OLQA 4YLZA 1HXS3 1QU0A 3L9JT 1NLSA 1FI2A 1X82A 4NOTA 1W6MA 2BGCA 1AUYA 1ND3A 2OVUA 1C28A 1VBE2 3QOPA 3FWEA 3D82A 3L2HA 4JGYC 1EAH3 4XHXA 3ZN5A 4CRQA 1W39A 4LBNA 1HQNA 4B29A 3AMMA 2D97A 2OZ6A 2R042 5IK5A 1XU2A 3ZYIB 2GC1A 4IV3B 4KGQA 1SBEA 3AKQA 4LNVA 3LA2A 4CEWB 1WW7A 2E51A 3VUOA 3MEPA 2IXCA 4RQPB 1GV9A 4YG3A 3WP3A 1MZ5A 4DQAA 2D40A 2P3KA 2TUNA 3S7EA 3B3QE 1RUG2 1O3RA 3WXPA 5JDBA 2XH6A 2HWE2 4EN9B 2JD4A 2Z79A 3JB8A 2ZCWA 4HN0A 4FXGB 3I59B 4AE2A 5DDJ1 2ZTNA 3ZN6B 1PIV2 3OTFA 1V6KA 2WZPP 3JD71 4PBOA 3GF6A 1B35B 5I93A 2VU9A 4XFGA 4XETA 4OVEA 2VOVA 5FQ0A 4PDWC 4XFHA 4U2AA 1KFUL 1UX6A 2RMU1 5K0UC 4Q4W2 2VXRA 2D98A 2WNUC 1R1A2 4PLNA 2ZGMA 2AGSA 4R8HA 1LOGA 1SDWA 1LHWA 5JAXA 4K8FA 5I0TA 1RUE1 5EXOA 1REDA 2ZGTA 4MXWA 2DWRA 3TOJA 3ST7A 1WD4A 4JRAA 4ISQA 3PNAA 5HBAA 1AR63 4XBQA 1V6LA 2I45A 3INAA 1AHSA 4XQWA 1GZCA 5EZWA 5C8CB 3ETQA 1B09A 1NOVA 1JHNA 4XOGA 2Q5TA 1CN1A 5FPZA 3VBUA 1S0DA 1ZVFA 3KGLA 1ZZBA 2D6OX 3BPZA 3MW4A 4RS5A 4PBPA 5CFCC 2EAKA 2JG8C 5LK5A 1ASJ1 4I0AA 2GNBA 2WIIB 2UY9A 3ENRA 4TLFA 3DKWA 1ZBE3 3R4DB 2XPJA 3POYA 1FYUA 4ATFA 1PGL1 2ZHNA 3ZPYA 4F8AA 2LUWA 3LA3A 3KB5A 3MIFA 4QHBA 3WV6A 1N47A 3H9AA 3JUUA 2WFPA 4N43C 2I2SA 4W65A 3TYJA 3AP9A 1FNYA 4J6GA 4UBHA 2NM1A 4I30A 1CAUA 4WM8C 4FAHA 1SLCA 3LOIA 3GZUC 1CQ9A 3KCCA 1U5XA 4E9KA 3VDDB 1OMIA 2QUOA 4FXKB 2DTWA 4B3NA 5FO8B 4P9JA 1FATA 1BVP1 3HD8B 1W6PB 1MQTC 4IV1C 2VW1A 3VBRB 3ZFGB 1NA1B 4XZPA 4P9YA 3V56A 1NQDA 4I2OA 1EV13 2RS32 3GHMA 4AQTA 4YNIA 4DMIA 5GALA 1RMU3 4XILA 1GBGA 1VBD1 3N35A 1R092 5L7OB 1YFWA 5ABJA 2ZGLA 5F6KA 3AP4A 3MF9A 2Q8OA 1I5ZA 4MGKE 2DF7A 2HEYF 4U36A 2YC0A 5FRAA 2R061 4OFGA 1ND2A 3IT8A 4MSVA 4X8PA 4YM1A 4AQSA 2D5FA 2WC2A 3LSDA 4XPVA 4OZXA 1DGWX 4QGNA 1XYOA 2R1DA 4XFCA 1H8TB 2MEV1 4E4ZA 1O7FA 4HETA 1LODA 4UBGA 1S1AA 5D8AC 3MIHA 3ZIWA 4HMZA 1LHNA 1V6NA 1VBA2 4NPRA 1QOOA 1TNFA 4N9HA 1COV2 2DVAA 4L99A 2IC1A 1H1AA 1UF2C 4JV4A 3JU9A 1S0FA 4NR1A 1I3HA 4X8NA 4G9SB 1C8M2 1EPZA 2WSVA 4RR3B 3VHRA 1KQRA 3D5OA 1OPMA 4S2FA 5JPMB 1FXZA 2VVDA 4JCKA 1ZZ9A 2WZR1 1E57A 2PLV2 1JUIA 1AYM2 1AR82 2IXHA 4CYDA 1ZBA3 3V65A 2DUOA 2C5DA 2Q1ZB 2KM2A 4BOWA 3O14A 2RS13 2GU9A 1SCSA 3VHPA 3OYWA 4AEDB 1DQ2A 4FPYA 5LRRA 3C3VA 4ZXKA 5E8AA 4MUVA 4TSVA 5KBFA 5JLVA 4OI1A 5AC92 3DPRA 4B7EA 4MXVA 3O0XA 4OULA 4M3CB 4QXKA 2ZBJA 1CAVA 4IV3C 1NCRA 3N7JA 3ZYRA 4CEWC 2HWB1 5I0RA 2ZMKA 1QQP3 2BEOA 2RM21 4XEZA 1PNGA 4RQPC 1GQHA 5J48A 1DQ1A 4QMAA 5H9PA 1G7YA 1REFA 1WMFA 3LA7A 2XWBB 1SQ4A 1RVF3 5K8SA 2A6XA 1AR91 2CAUA 1HKDA 1QDCA 2XHKA 1TMF1 1UU6A 2YUEA 4H55A 4L9BA 2JG9B 1FMD1 4W6WA 5L19A 5E89A 1B35C 4BMBA 3ILRA 2C0ZA 2GH2A 4LO6B 1C57A 2P37A 4GMP1 4AQ2A 2JXAA 1H2MA 5F9TA 4OHYA 1QY4A 3GBFA 4FOWA 4IEUA 2KA3A 4L8QA 1SLBA 2P34A 2RHPA 4IEWA 5DUUA 1DGWA 4WBBA 3U11A 3UKNA 3TWIA 5BYNA 1RUF3 2Q4SA 3KMHA 1MS0A 1UW8A 4L11A 4YW3A 5C8CC 1NE4A 3AZVA 4WVMB 2MHFA 3AMPA 4W6YA 2X5IA 1LOAA 1SLIA 1Z7S3 2ERFA 1NCQA 3MIEA 4GA9A 3JB4C 3LKJA 1VBC2 1OOPA 2DFBA 1NXMA 2UWAA 1HXS2 4Y26A 1CAXA 1XXNA 1DFQA 4N53A 4Q27A 1GQGA 4XIKA 3JBG3 4Z1VA 1VAVA 4GIQA 1D4VB 4F83A 3WP6A 1OQDA 2PA7A 2TEPA 4DNYA 3USSA 2VMGA 1D4M1 1RHI3 3BCWA 4Y1VA 1J3QA 1EAH2 5FREA 5BNOA 2D7FA 2WS93 4PQ9A 1SLAA 2YROA 4META 2X53S 3O5SA 4COYA 3AJYA 3VDDC 3I4IA 3HWJA 2WNVA 2Y0OA 2WLPA 1ENSA 3ZXKA 2BPA2 2R0FA 1JUHA 3ES1A 4J1WA 2PELA 1LHVA 3ZYPA 3V0BB 3K51A 5JIAA 3VKMA 2YPJA 3FJSA 1GKBA 3VBRC 1OLRA 3ZFGC 2VY0A 3MI8A 4QX5A 5T5LA 2UURA 3E6BA 4XBNA 5C6CA 4A7YA 2BW8A 1RUI1 3SHRA 3ZN4A 5L7OC 2CL2A 2TNFA 2DVDA 2R043 2R30A 1C5IA 2XVKA 2BNOA 3LOBA 1Y9QA 5KHIA 1RUJ2 3WOGA 3LZZA 5CFDA 2A7AA 3HIFA 5DUVA 4Z8BA 1BCXA 1VRH1 1JXNA 4DRRA 2V73A 1WD3A 3MLJA 1SCRA 1D2QA 2HWE3 4FQ4A 3E5XA 1UU5A 4LA2A 1VBB3 1CAWB 4XJ8A 5BNNB 1LCLA 3RRDA 3PJQA 4UXAA 4ONUA 1XQNA 2ET1A 4LR4A 3J8F2 5CBLA 3H7JA 1A6CA 1AR62 1LECA 1GZWB 3ZSKA 3B00A 2E9QA 1PO21 1N3PA 2VH9A 5T54A 5CIRA 4A7KA 2W52A 2GNMA 2ZX3A 1PMIA 1R1A3 2YHJA 3AMHA 1V9U3 2WLQA 3VKNA 1DG6A 2X29A 5I0UA 2I07B 1ZBE2 4JVAA 2CWSA 3IBMA 3PMEA 4B7KA 1HV1A 5FOBB 5JOXA 2OZJA 3IMNA 4TYSA 2K2SA 4OUSA 5D1IA 1AR72 2EXJA 4FPGA 1K5MA 2B45X 4I02A 4AEDC 2WT0A 3WLUA 4KL1A 4LHLA 4XF9A 2Y0IA 4FPLA 2GNTA 4JGZB 5TSWA 4Y22B 2IWGB 1U5YA 2YXSA 1XNDA 4Z82A 1APNA 4XFAA 4CDXB 1Q8PA 4Y5Z0 5KXBA 3IIAA 2QDNA 1QJX3 4NHKA 3RZZA 2NMOA 3ZFEA 1EV12 1NCRC 2DU1A 3L2YA 1FV2A 1RMU2 2RS51 5FCCA 1UZYA 5F5QA 5FFOC 5GLVA 2PHDA 3USUA 1S55A 2GMEA 3P3NA 4FBFA 4DRVA 1PVC2 2JG9C 1LB2A 5FPXA 3ALQA 5A32B 2PHUA 4CDQA 1BBT2 3PLQA 1PZ7A 3TRSB 2E6VA 2K0GA 2XJSA 1FNZA 1Q56A 2UWCA 5JOWA 4PLMA 4BZ4A 1H1MA 1R093 3MW2A 3FLPA 3QACA 2ZPXA 4HPKA 2FBEA 2XJPA 1YO8A 5C33A 2XLFA 3WDVA 1KFXL 4RA0A 4PIYA 4PDWB 1N1VA 5FAXA 3WX5A 2NQYA 4AQ6A 2XJUA 5DUWA 1HRV1 3PMSA 3RI8A 1DLLA 1PK6A 2X5IC 4AI0A 3FFQA 5LRSA 4M3CF 5JZGA 3MLLA 3VZOA 4C1WA 1RVF1 2RR11 1BMV1 3ZYGA 4HKOA 1HV0A 4FOVA 2G4IA 3SCFA 4ZU5A 1C1FA 4L92A 4QPIA 1DZQA 4KH9A 1LGNA 4EN7B 4S2GA 5K9YA 2HYKA 3NJZA 3RJRA 3ACLA 1VP6A 2P17A 2RS12 2A3YA 1GYKA 1W6QB 5A33A 5C4WC 3WT3A 3AZXA 1GLHA 4BPZA 2B8MA 2DUPA 3RNSA 3VKFC 5CFCB 4Y1XA 2R0HA 3M3CA 3ZYJB 5ACA3 1IHMA 5DG1A 3FBMA 3NAPA 4D3WA 5H9SA 4P14A 3U4XA 2PLV3 2P3JA 4MH0E 2GMMA 3ZSEA 3QH6A 1WUVA 2MNGA 4ASMB 5HI0A 5JPNB 4OI2A 1A78A 5GJ6A 4I0WB 1G6NA 1SFYA 4COUA 4WM8B 1Z7S1 3MIGA 1RINA 1OHFA 3VZKA 4WZFA 3UL2A 5F1RA 2XVGA 5AC93 1DGRA 4Q1PA 2A6ZA 4K21A 2ZAAA 3RWNA 3SCGA 2VOWA 3IM0A 4C0BA 2EA7A 2BNMA 5C9AA 5KHJA 4IL7A 3ZIXA 4E2GA 1LU2A 5CFDC 2B42B 3T1LA 4QPYA 4BQ1A 1A3KA 1SEFA 2SLIA 3DV8A 4COVA 4JC1A 4NHMA 1D0GA 5KC6A 1GFF2 2AZ5A 2FZ1A 1NXD1 4I01A 5BNNC 5KXEA 4YG6A 3S30A 3OD4A 1REEA 3IDCB 1RUF2 2HWF3 1BEV3 1QNYA 4I09A 5IUQA 2R1BA 1IKPA 4QPGA 1S2KA 2FMDA 1OA2A 1VALA 3AMQA 3AYCA 4YGEA 3CLPA 1AYN1 2A5ZA 1AJOA 1G9CA 1VBE1 1X50A 1ULEA 2HKXA 3UJOA 1XNBA 3CJIA 2ARBA 1Y7BA 2Z5WA 4R4XA 1W6OA 3JBG2 1AL0G 1QJU2 4WM7A 4DPNA 4Q8KA 4N7UA 3QD6A 3GZAA 4LBQB 4RSUA 3FHIB 4YGCA 1PNFA 4JTNA 5DZGA 1RITA 3THTA 1YJLA 3RDIA 4ZU7A 2WS92 1PO12 1SBFA 1MACA 2AUYA 2GNDA 4J1XA 4X6RB 3ZX7A 2Y26A 4I3PA 5AVPA 1RUG1 1MS1A 2HWE1 4AVBA 3EHKA 1QMJA 4CDXC 1Q8QA 1W6NA 2XBO3 5BNPA 2XL9A 1PIV1 4KQ7A 1CGPA 2HJIA 1PHMA 2A3XA 1W6MB 5DZFA 2VOKA 4AHZA 1KJRA 1ND3B 5L73A 5FBZA 4C1XA 3VBOA 4PIXA 3MGUA 1LHOA 2DCYA 4Q4W1 3KT1A 4MGIE 5LEKA 4FPHA 4AVVA 3NKGA 1ZZ6A 3NV3A 4QQLA 1HQWA 2P3IA 2O1QA 1A8DA 2G9GA 1IS4A 1YFUA 3WCSA 1HIXA 1V6JA 3WUCA 1SLTA 2HWD2 4ISRA 1GICA 2H0VA 4Y24A 3VZJA 4K9SA 4QQHA 1AL23 1VBB2 4QQOA 5J37A 4SBVA 2YDEA 3WDYA 3GZTB 1OD5A 1NLRA 3NO8A 1POV3 3IDEA 5C8WA 1LOCA 2WL1A 3FLRA 3WVJA 1ULCA 4YW5A 1Z78A 1WLWA 2B46X 2ZABA 2YV8A 1LHUA 2DU0A 3NWKA 1RUJ3 1TEIA 4YVWA 5FQ0B 1RUC3 3VN4A 1TME2 4GXLA 1V9U2 1G9BA 1RUD3 4AFDA 1ZRFA 4AGVA 4BLJA 5EJ3A 3WUDA 5IK7A 1PK6C 2W68A 1JW6A 3VKLA 1VB4A 5K7PA 2D3SA 5BPXA 4GALA 1L3JA 2JE9A 4OI0A 3G7DA 5KHGA 2OUHA 4A7ZA 4FPOB 3KLSA 4FCAA 4MXWB 5I91A 3J8F3 4Q4Y1 1DU3D 4BM8A 4E2QA 2XUMA 4Z92B 1VLNA 3MIDA 4NO4A 2RS31 3TBDA 1JBCA 2BNNA 3W58A 3AM2A 4HVRA 1Y3TA 3VBUB 4HN1A 3WQ0A 4BYYA 3OGJA 4DOUA 4K3UA 4KWLA 1FOD1 2VOXA 4GB33 5FTTC 1QJX2 2DCZA 1H2NA 5FLJA 1Z0HA 3WG1A 3WDWA 1PM7A 1Y43B 2ZGUA 4YFWA 1AR73 3SISA 1DQ4A 5CNAA 4IEXA 3M1HA 1YUDA 3KS7A 1AXYA 1NY72 2C9AA 5T50A 2IZWA 4HFSA 1UKRA 3W59A 1CAUB 2VVEA 4XJZA 1UPSA 2DYCA 4MYEA