2D6KA

Crystal structure of mouse galectin-9 n-terminal crd (crystal form 1)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
149
structure length
147
Chain Sequence
b'ALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin, galactose binding, soluble 9
publication title Crystal Structure of the Galectin-9 N-terminal Carbohydrate Recognition Domain from Mus musculus Reveals the Basic Mechanism of Carbohydrate Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein
total genus 33
structure length 147
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d6kA00
4M3CB 1W6NB 3V0BB 3ATGA 1WW6A 1LOFA 3KQRA 2P2KA 4AGRA 5H9SA 4YZ2A 2D3RA 1LHNA 2DUOA 3JU9A 4FPJA 1C57A 2ZGMA 1W6QB 1ULCA 5FRAA 1LHUA 4XHBA 1KJLA 5GLWA 4CZSA 4FVVA 4YLZA 3WDTA 1IS5A 2ZGQA 3AX4A 1PZ7A 1OFSA 1SCRA 3WVJA 1S0EA 1WLCA 3AYEA 4AGVA 2VUAA 1A8DA 1KDMA 3IKWA 3CNAA 4BMBA 3AXEA 3V0AB 1G9BA 1Q8QA 1OKQA 4ISQA 1RIRA 3TAYA 1HKDA 2VY0A 3MEPA 3AYDA 5GALA 1JBCA 1I1EA 3PVOA 2EXKA 3WDXA 3IN9A 4PBOA 1MS5A 4YGCA 1CR7A 4GA9A 3T1MA 1S0JA 5HCAA 1CN1A 3FUOA 2CL2A 4BLJA 5SV8A 3SLIA 3WNXA 1LHWA 2D3SA 3DGTA 5H9RA 3VKFC 2C9AA 1JOJA 4YG0A 2WT2A 1IKPA 1S0IA 2EXJA 4HL0A 3U4XA 2V73A 3O12A 4C1WA 4F83A 2ARBA 1S1AA 5DZGA 5EWSA 5JOYA 4DFSA 4RA0A 2PHUA 2NN8A 3N35A 4NO4A 1FATA 1OQ1A 5T5OA 4FPCA 5DG2A 1C4RA 4K20A 3WG1A 4AGGA 4ITCA 2PHWA 3N7LA 2ZGRA 1CIWA 3KM5A 4Q8KA 1LOAA 2ZKNA 4M3CF 4PBPA 5DUWA 5HCBA 2B7YA 1LECA 5GLVA 1QNYA 2ZMNA 4LBLA 1HQWA 1N3OA 3OYWB 1QNWA 4XBLA 5T50A 2ZACA 4FQ4A 1UZZA 5GLZA 5GZGA 1WD4A 1PZ9A 1YRZA 1S0GA 2G4IA 5L73A 1DIWA 3IMNA 5GZDA 4GWNA 4YG3A 4GXLA 5BYNA 2D44A 2UWCA 1U0AA 1H30A 3OBTA 1AX0A 5H9QA 1Q56A 2GDFA 2D3PA 2DVFA 2AR6A 1ONAA 1SLIA 3LSEA 3VKLA 3WDYA 1APNA 4XBQA 3JUUA 4YM3A 1ZM1A 2ZGOA 4Q2FA 4Y1UA 5T54A 1G9CA 1N1SA 1QU0A 2DYCA 2ZGKA 3ZXEA 1N1VA 1JN2P 5T55A 1LJ7A 3VKMA 1LHOA 2SLIA 4YW2A 3N7KA 4Q27A 3QLQA 1MR5A 2PHFA 3AP6A 3R05A 1DQ1A 1GANA 3HR9A 5IK7A 2R0HA 1QOTA 4P14A 3PJQA 3M3EA 4K1YA 2R49A 1V6NA 1LTEA 3AP7A 4WV8A 2SBAA 2NMNA 3BOPA 2E53A 1URXA 2PHTA 1FX5A 1LHVA 3RSJA 3WHTA 4D69A 4FPKA 1WD3A 4YW3A 5JDBA 4U2AA 2W68A 4Y22A 4Y1XA 3B3QE 2YY1A 2P37A 1SACA 1GBGA 3NV1A 2DWRA 3AZVA 3B69A 4LBKA 3W58A 3FLRA 3SH5A 3A0KA 2DVAA 3WDVA 2D6LX 2LALA 3ZYPA 1CONA 2ZABA 4GKYA 1C1FA 1Y7BA 2A6YA 4XBNA 1DQ5A 1S0DA 1CJPA 4LBJA 3WG2A 1H9WA 2A3XA 1SBFA 3AZYA 1G86A 2AUYA 5GJ6A 5T52A 5F5QA 2DTYA 2D6MA 2VW1A 1AJKA 1N1TA 2AH2A 1QDCA 5KXDA 3WCSA 4FPOB 4JCKA 1O4ZA 2AREA 1YXWA 1YI7A 1GLHA 2JD4A 4LBOA 2R1BA 4R9DA 5JOWA 1UZYA 4NOTA 4GWMA 1MS9A 1KQRA 1YIFA 1UPSA 4P9WA 3FLPA 3M3CA 4GALA 3M3OA 1A78A 1SLAA 4YZ1A 3ILNA 2YXSA 2E7TA 4UW3A 2EXIA 1ULGA 1AJOA 4ATFA 4AVTA 4DRRA 2A3YA 3NV2A 4FQZA 1HLCA 2A70A 2CWMA 1UMZA 3BODA 2DTWA 2FMDA 2DUPA 4PQ9A 4XXPA 4XDQA 4Y26A 3ZXKA 2Z42A 5JOZA 1MZ5A 1LEMA 3R4UA 1G9DA 3RMYA 1FAYA 3N3HA 1BJQA 3D6EA 3UJOA 3B01A 1CESA 1GNHA 5GZCA 3D5OA 3N7MA 1RITA 4ASMB 1LOGA 4AVVA 1JHNA 1H9PA 3A4UA 4AWDA 1JUIA 3FBYA 5FREA 2A7AA 4MYEA 2CNAA 4YW1A 4Y20B 3A0NA 5JMCA 1BQPA 1WBFA 4K1ZA 3UK9A 2ZGSA 4FOWA 4Y1ZA 3OJBA 2YMZA 3WG4A 3AYAA 2TEPA 2A3WA 1SCSA 1PZ8A 1GSLA 1AF9A 3AYCA 2OUHA 1F9KA 3AP4A 3POYA 5E88A 2WSVA 4H55A 2ZBJA 4W65A 3B9CA 5JVVA 1W6OB 1LU1A 2UURA 3O0XA 4K21A 4CTEA 4DQAA 2R0FA 4YFZA 3POWA 3AK0A 2ES3A 1Q8PA 2E6VA 2ZHNA 4YM1A 2VW2A 3IM0A 3GNEA 3SNMA 4P9XA 4Y1YA 3SITA 4XILA 3V65A 2PHRA 3ZVXA 3FFZA 5DZEA 3LCPA 1Z0HA 5F9TA 1Q8VA 4M3CE 2CYFA 4XIOA 3VKNA 2JE7A 1D0HA 5HCFA 2P3JA 1C1LA 1O4YA 3HN1A 3TB0A 1CVNA 2ZGLA 4WZFA 3ZYRA 1GV9A 1LESA 3PMEA 3ENRA 3ZXJA 2ENRA 2OW4A 4M01A 1XQNA 4XJAA 3SH4A 3USUA 1ENRA 4XMAA 4TZDA 1LULA 3NV4A 1W6PA 2DVDA 2ZGUA 4BM8A 1F5FA 3BIWE 4XOGA 4WVWA 2ZMLA 2WT1A 2CY6A 2ZZJA 3NWKA 3AJZA 4M3CA 5EYXA 3V0BA 1MS3A 1IS4A 5GLTA 4LBQA 3POSA 3OGGA 4GKXA 4JC1A 4RL7A 1GZ9A 2A71A 4ZXKA 3WCRA 1V6KA 1MZ6A 2D6KA 2WQZC 2UU8A 3OPZA 3W59A 1G8WA 1VALA 2NMOA 1BKZA 1KITA 4XE9A 1JW6A 2ZA9A 1DLLA 3M1HA 1MS4A 4XZPA 1FV2A 4Q1PA 5AVAA 1YO8A 4WVVA 2ZHLA 2BQPA 1Q8OA 1QGLA 4XJ9A 4AYUA 1WW5A 1X50A 3GALA 1VAVA 2H0BA 2ZGPA 4L8QA 4XIKA 4XTPA 4YM0A 3WLUA 4Z8BA 3AZWA 4Q8LA 2ZHMA 3Q9OA 2V5YA 5T5LA 4LBQD 1LODA 1GNZA 2UWAA 3WDUA 1AZDA 1IS6A 1KDKA 2A6ZA 2ARXA 3ILFA 1UKGA 3VUOA 5E8AA 2P3KA 4PCRA 1DQ2A 2DVGA 3I8TA 3MW3A 3RG0A 4BQ1A 3WG3A 1FYUA 2GNTA 1G9FA 4FPEA 1WW7A 1BXHA 1NXD1 4FOYA 3T2TA 4XJUA 1UL9A 1WCSA 3VKOA 1WBLA 1LOBA 3AZZA 4XTMA 2WNEA 2LTNA 1I3HA 4SLIA 1BYHA 1GZCA 4TYSA 5KXEA 2GMPA 1DQ0A 1S0BA 4ATEA 1ULEA 2GNBA 3ZXLA 3ZSJA 1ULFA 2JDZA 1GZWA 2YZ4A 1TEIA 2EF6A 4FP3A 2W08A 4YFWA 4ZKTB 5CAZA 3BTAA 3WOGA 1JYCA 3C2UA 4FOVA 1G7YA 2DU1A 3USUB 2PELA 4UW5A 1N3QA 3OYWA 3SH3A 1A3KA 4YM2A 1CPNA 5GLUA 1EPWA 1AVBA 3WDWA 1W6PB 1IOAA 2JJ6A 3FLTA 4XJ8A 5IT6A 1RINA 2UWBA 1MS8A 5IUQA 4FPFA 2PHXA 4FPHA 5IK8A 4R9CA 4XJZA 2A6VA 5DZFA 4Q1RA 4LBQB 2GN3A 2VXRA 2A6WA 4M00A 5CBLA 1DHKB 3PVNA 5JLVA 3WZ1A 2W52A 2D43A 2XB6C 3QCWA 3MW4A 1DQ4A 3T1LA 4YGDA 3ZXFA 5DUXA 3WV6A 1LOCA 1Z78A 3AXDA 1SLBA 1Q8SA 1AX1A 3AZXA 4BMEA 2EALA 1N1YA 4Y22B 2NYYA 4YZ5A 4HANA 5CA6A 4YZ3A 2E51A 3I4IA 2JE9A 2D6PA 2A75A 2W39A 2WSUA 5DXDA 2GALA 1IS3A 1V6OA 3LSDA 3WHUA 3AP5A 4FOQA 2GNDA 1SLTA 2I2SA 4YG6A 1R1ZA 2R1DA 3INAA 1QOOA 5DUVA 1LCLA 2P34A 5GZEA 3RRDA 3ZSLA 3N36A 4UW4A 1LENA 2WT0A 2P3IA 2WLQA 3ASIA 4BOWA 3WUCA 1V00A 1W6MA 2OVUA 1SBEA 2JECA 2JKBA 1V6IA 2VW0A 4YZ4A 2EIGA 5H9PA 2DV9A 1YYNA 5EYYA 2D6OX 1JXNA 3O0VA 1N47A 4Y24A 5IK4A 2A5ZA 4XHXA 1KRIA 4C1XA 2Q5TA 3NV3A 3SISA 2CTVA 3ILRA 4XYXA 1MACA 2OUJA 2YV8A 4Q26A 1DFQA 2R16A 2HYKA 3OY8A 3IPVA 1B09A 1DQ6A 1GZWB 1IKQA 1FV3A 2VH9A 3UL2A 1MVQA 3MW2A 1DBNA 3N7JA 5E89A 4XMIA 2ZGTA 3PVEA 4FP2A 2EXHA 4OZXA 1LGCA 1SLCA 3O0WA 3RMXA 3FUQA 1KJRA 4YW5A 4FPLA 4XJWA 5IK5A 1HQLA 1FNZA 2ZGNA 3O5SA 3AFKA 1VLNA 1CPMA 1UN1A 1DYKA 4ISRA 4YW4A 1W6NA 4DPNA 1AX2A 2CWSA 1SLLA 5JOXA 1GYKA 2RHPA 1QDOA 3RS6A 4YGEA 2C5DA 1S0FA 1QF3A 1W6QA 4R9BA 4YGBA 1ZA4A 4CRQA 1VIWB 5EXOA 4P9YA 1V6LA 4I30A 1WUVA 3B00A 4Y1VA 1LU2A 1DYPA 1LOEA 2ERFA 5GM0A 3UJQA 3RQ0A 1JYIA 3V0AA 5KXCA 2DURA 1MVEA 5LK5A 1ULDA 3MPPG 1S0CA 2ZMKA 5KXBA 1FNYA 3H0OA 1AXKA 1LEDA 4LBNA 2E7QA 1LOFC 1SBDA 2A6XA 1W0PA 1DGLA 4UW6A 4BLIA 1QMJA 2WKKA 3ZSKA 4IQPA 1V6JA 2WJSA 4XXAA 1D2SA 2DVBA 2FHRA 1AXZA 1W0OA 3DUIA 4PF5A 5DG1A 5T5JA 2AYHA 3M3QA 3ZSMA 4DS0A 1J1TA 2D6NA 1QOSA 1BZWA 1UAIA 1DZQA 2DU0A 4LBMA 4BPZA 5CNAA 4Y20A 5T5PA 3R4SA 1GICA 2AGSA 2ZHKA 3D4KA 1W6MB 2GNMA 3AJYA 1F31A 4AVSA 3VV1A 1WLDA 4FPYA 1QKQA 1V6MA 5DUUA 3M2MA 1NLSA 2ZAAA 2GN7A 3AP9A 3OBRA 1LGNA 1WW4A 2NZ9A 1UX6A 2YROA 2D7FA 1W6OA 1VAMA 1MS1A 2GMMA 3IPVB 3OY8B 4KBBA 2XG3A 1AXYA 3APBA 1N3PA 2GMEA 2NM1A 2EAKA 1SFYA 4JRAA 1MS0A 2KM2A 1WLWA 1CQ9A 1GKBA 4FPGA 1HDKA 1ENQA 1ENSA 2NP0A 4R9AA 2VU9A 5CB7A 1G9AA 3V64A 5GZFA 4U36A 1LGBA 2AENA 3ZPYA 4DRVA 3WUDA 3HMYA 2DUQA 3L2YA
chains in the Genus database with same CATH superfamily
3N9OA 2C0ZA 3ATGA 1UO9A 1WW6A 3OGVA 2BUKA 2DFCA 5FQ0A 4AGRA 5H9SA 2WNUC 4KU7A 2RDQA 5CFCA 3NNGA 4KL1A 2IFWA 3K4AA 3IZOA 5A7PA 3UT0A 1KEXA 3ZO0B 3I49A 1ZYBA 3MV11 4QB2A 1HB3A 3CU7A 2ZX4A 3H3ZA 4LMFA 2FCUA 4L9BA 2WO3A 4LK6A 1A34A 1OFSA 1RUF3 1MQTC 5L7OA 2BERA 4DUVA 2VUAA 1UF2C 3LFIA 2I07B 3KB5A 1G9BA 1Q8QA 3GHMA 4COWA 1V9U3 1RUH2 3RI8A 3MEPA 1I1EA 1UY3A 2YU1A 3PVOA 4RGGA 4XCBA 1UIKA 3WXPA 2WFF2 3IN9A 4HN1A 3E6DA 1UZ0A 3EQEA 1CR7A 1NCQA 4GA9A 2Z79A 5HCAA 3UKVA 5JI9A 4LO6B 5SV8A 4S2GA 4YSFA 1NZIA 2XVKA 3NVCA 5LA2A 1H1IA 2WT2A 1IKPA 5AC92 1S0IA 3EO6A 2EXJA 1XNTA 3VBUA 4HL0A 5K8SA 3U4XA 1PGW1 5IAVA 4XZUG 2GC2A 2QQVA 5A1AA 2ARBA 5LRSA 5FIXA 3G6JB 5C9AC 1FATA 5T5OA 4K20A 3C7HA 1VP6A 4ITCA 4GB33 3N7LA 4DINB 4Q8KA 3MV01 4H14A 1E5HA 1EY2A 2PTMA 2B7YA 1YUDA 2X5IB 1I6XA 4HBNA 1HQWA 1N3OA 4UXAA 2DCKA 4XBLA 1PO12 2WL1A 4BK4A 1FXZA 3AC0A 1SFNA 4LHSA 4A4AA 4GMP1 2YBPA 5LB6A 5FPVA 2VBPA 4WBBA 5JR7B 1YEWA 1YFUA 2XWBB 4MV2A 3ZFFC 4YG3A 3LDRA 4GXLA 2LROA 5BYNA 3QBQA 1NUKA 1V9U1 4O61A 4PDWA 3VBSA 4I01A 5EQUA 3SCFA 1PGSA 1OOPB 4QX7A 5H9QA 5F3IA 2AR6A 1ONAA 2XBO2 1OKOA 2ADEA 3K2OA 3WDYA 4N7UA 3VD7A 4YM3A 3I2DA 2AEYA 4D6QA 2ZGOA 1OD3A 2IXKA 4RGAA 4Y1UA 1OLQA 2YBKA 4XCAA 5FP8A 2DYCA 4K7JA 3C7EA 3MBWA 4EN7B 2CDOA 4R4ZA 4UI9L 3I97A 4OZOA 1XSRA 5T55A 3VKMA 2WWSA 2VVDA 1F4HA 1LHOA 2BTVC 2JDYA 3KD4A 4ONUA 1RUH3 3WF4A 3QLQA 3WQ7A 3NSTA 1AL22 4P14A 5FK8A 2WFF3 2BBVA 1XJAA 5CEHA 3BOPA 1TNRA 2JWPA 4AXOA 3WHTA 1FX5A 4BIFA 4NWVA 3RSJA 2RR11 2ZS6B 2GU9A 4Y1XA 2E7AA 2AACA 1SACA 3NV1A 1VBC1 5AC93 4QPGA 1Z7S1 2OIIA 1NQJA 3CKHA 2P17A 4K8FA 3H8RA 3SH5A 5FY5A 2DVAA 4CUAA 4RQPB 2D6LX 5FV3A 5LA9A 2HWE1 2ZABA 5FYBA 4I02A 5JWPA 1OHFA 1YC61 1Y7BA 4XPVA 4NE9A 2VZQA 4BYYA 5FPXA 2VE1A 4LKFA 4LOSA 3AMHA 4A7YA 2ZX3A 2RDRA 1JZ8A 2D5FA 4M4RA 4GWJA 2CSGA 2ZEXA 1OLME 5F5QA 4LQRA 4HG6B 1H8TC 1JH5A 5D21A 2D6MA 5FP3A 3I2KA 4AR2A 2AH2A 1QDCA 2VZPA 5C8CA 4QXKA 2R6QA 1NCRA 2RV9A 1YXWA 1YI7A 1GLHA 2V09A 4RFRB 2J1RA 5LBBA 2JX9A 2R1BA 3VBFA 4R9DA 3ZXAC 5IVYA 4CP1A 5JOWA 2VMIA 1KQRA 1ALYA 1HRV2 1O7FA 1UPSA 3FLPA 4GALA 3M3OA 3DPRC 2XBO3 3P5BA 3N4MA 3WF3A 2EXIA 4AVTA 1AJOA 1D4M1 1OLMA 2LRPA 4JQRA 3IWZA 3CIHA 2DTWA 2FMDA 3POEA 4XDQA 2QQMA 2K0GA 2VOXA 2OZJA 2F4PA 1RTVA 4Q4W3 2Z42A 3S6PA 5JOZA 3R4UA 1I9RA 4NIAA 2OYZA 3TWIA 4PT6A 3I2GA 1XYPA 5LEKA 3D6EA 1VRH3 1US2A 2C6SA 4AI2A 2K9ZA 1AL23 3N7MA 3ZFGC 2VVFA 2AEZA 4EWDA 3P3PA 3FBYA 4OUSA 3NNJA 1X9TA 4MYEA 4YW1A 1HQNA 4AEDC 5FZ6A 5K4LA 1BQPA 2HWB2 5FO9B 1C28A 5F8PA 3ZYJB 1VBA2 3OJBA 1QJY2 4IEPA 3IIAA 4UYBA 3PNAA 1JYXA 4AHWA 4XUNA 1SCSA 3DN7A 3HAGA 3CL1A 3AP4A 1F9KA 1XNDA 3POYA 2IXIA 4WM8B 3SXWA 1UOJA 2WSVA 5B4NA 3B9CA 5FZHA 2I74A 2J22A 4FFFA 3O0XA 1O8PA 3POWA 3OBAA 4AE2A 4Q0UA 5KHGA 1ZNPA 2EIBA 2ZHNA 1FPN2 4P02B 4YM1A 1R091 3KZ4C 2W0XA 5A80A 3WNKA 1B35B 2PHRA 1C8M2 1EUTA 3FFZA 2TNFA 4XABA 4C90A 5FWJA 4LE3A 1F8VA 1PK6B 1E5RA 3GZEA 1Q8VA 5F9TA 4BQ2A 4LXLA 1NXMA 2JE7A 5HCFA 2JDUA 1C1LA 4GMP0 3M4FA 4WVMA 3TB0A 4A7ZA 3SKVA 4MXWB 2UYBA 3IDEA 4Q4W1 4O9EA 2XR4A 2OW4A 1XQNA 4UFLA 3J8F2 2BWCA 5FBJA 2VTXJ 4YW7A 4DEQA 2TUNA 1VRH1 1HJFA 2ZGUA 4BM8A 2JDHA 1HRV3 2MNGA 2B9VA 4OHZA 4WVWA 2ZMLA 1RUC1 4EYUA 2YPJA 4QQLA 3PHMA 2XLGA 3CDZB 4LBQA 4GKXA 1VPHA 4RL7A 4WM8C 1GP4A 1MZ6A 4YVWC 3SQOA 1RUJ2 3CZUA 4RS5B 4A42A 5C9AA 4LT5A 1BKZA 2J1EA 1JW6A 1RB8G 4XDOA 3JCIA 1TQ5A 2HWD1 3N9MA 1BHGA 4KU8A 4WVVA 1ZZ9A 1Q8OA 1QGLA 3GF6A 4XJ9A 1WW5A 2XQRA 4RR3C 4QB6A 1F4AA 4XIKA 4I0WB 4XTPA 2ZHMA 3Q9OA 2V5YA 2RJKA 4LBQD 3J4UH 2JG8B 3CEWA 2BYVE 1QJZA 4B4RA 1K45A 3VN4A 2ARXA 2QJVA 4F7ZA 2HWB3 3VUOA 1QJU2 3LOBA 3MYXA 1VBA3 3I8TA 1QJY3 1REDA 3MW3A 3NAPB 1IG3A 1COV1 5FZBA 5E6HA 4RHV3 1YFWA 3OD4A 1UXXX 4CCMA 3HEIA 1BXHA 4I3PA 3PMSA 4AAPA 1U5IA 1UL9A 4CDXC 5C8WA 3VKOA 4W4ZA 3ETQA 1OPOA 3TEXA 4E2QA 1TME2 5FAXA 4ZU4A 3LFMA 2QQOA 5ABJC 1FPN3 1BYHA 1GZCA 1BBT2 3HWJA 4TYSA 3B7MA 5KXEA 3RZHA 2Y8KA 4L97A 3D0JA 1C8M3 4Z2WA 2GNBA 3DKWA 2JDZA 3ZMOA 4CDWB 4AHZA 2EF6A 2VQTA 3FBMA 1BK0A 3C7GA 3FJSA 3BTAA 3O1SA 4RN5A 3BI3A 4FTSA 3WOGA 5IJRA 1DP0A 2QTWB 1RJ7A 4EWAA 1YHFA 2DU1A 5FO7B 3J8F3 1UY4A 3WW1A 2ORXA 4FXGB 3SH3A 1CPNA 1EPWA 4IV3B 4S2DA 1W6PB 4ZS3A 2FZ2A 2JJ6A 4C8DA 3FLTA 4XJ8A 5F2WA 4XURA 5IT6A 1YWKA 4ZONA 1GP6A 2D93A 1AYN2 3EMRA 5IWFA 1BMV2 2GP3A 3OUHA 3URFA 4AQ2A 4LLFA 4XF1A 1FMD2 4OQ8A 1XSQA 4LO8A 1AUYA 3AMPA 5A33B 4URTA 3VGIA 2VUCA 2Z5WA 3NNLA 5G05L 1HV1A 4N9HA 5CBLA 3PVNA 1OUSA 1RUJ3 4KNCA 2TBVA 3ZM8A 4RHV1 4Z82A 4L92A 3MW4A 1DQ4A 1KS4A 1QJX1 3AKTA 2ZXQA 2KD7A 1TNFA 3ZXFA 4Q4X1 2HBUA 2ZX2A 5FOBB 3AZXA 1Q8SA 4BMEA 4BK5A 4J25A 5CA6A 4CDUB 5C3OA 2L9LA 4QX0A 3VDDB 3ZXJA 3ES4A 5DAQA 4HSLA 1FOD1 2OPWA 4LULA 1QJU3 1R1ZA 2W87A 1BEV1 3HNBM 5APAA 1LCLA 1NY72 4FBFA 1LENA 3K4ZA 1C8NA 2WT0A 4QMAA 3ASIA 4ARYA 5JSPA 3PUAA 3HBKA 1W6MA 2OVUA 4TWTA 4NJ4A 2JKBA 3ZPOA 2EIGA 5H9PA 4ZU7A 2DV9A 1OA2A 5EYYA 1RGSA 1JXNA 5CVRA 2XHNA 1N47A 5I8SA 1WMXA 5FUNA 1H1MA 1HB1A 1PM7A 2VTFA 1BBT3 1IZ3A 2WQ8A 3NV3A 4C1XA 5CFDC 1WGPA 2ETEA 2R16A 3USSA 3WX5A 5AFBA 2B8MA 3IPVA 4XFHA 4OI0A 1SDWA 1DBNA 2E33A 3MW2A 3N7JA 1POV1 1S2BA 4OZXA 1JZ3A 1W2TA 3FUQA 1KJRA 4DUXA 3GHNA 1ZBE1 4WM7B 4CCKA 2H0VA 3WW3A 4MGYE 1HQLA 1CAXB 2ZGNA 2Y6JA 2YFUA 3H7YA 1HXS2 1ENXA 3AFKA 4Q0QA 1CPMA 2VCBA 4NRMA 4BQ5A 4B29A 1W6NA 3GM8A 4KWJA 2DCJA 3NQHA 1RYYA 4GWIA 3RFRA 1QQP2 1AYN3 3KGZA 2C5DA 3HJRA 1FMD3 3GBFA 5LY2A 4GZ9A 5C4WC 4KWKA 2BGPA 5LZ6A 1X36A 4FFIA 5EXOA 4BJ0A 3PDQA 5FMBA 1V6LA 3H1YA 5JZGB 3KMHA 4CP0A 2RS51 4ZPIA 3KCYA 4XFAA 2ERFA 1RXFA 1NOVA 3GDBA 4OI2A 4V2WA 4LA2A 3KGLA 1JYIA 5FPAA 4B7EA 5KXCA 1YI9A 1S0CA 3O1UA 4COUA 2BVVA 2KR2A 1O6UA 1HN0A 2WKKA 4IQPA 1PVC2 1GQPA 1V6JA 5LATA 4XXAA 1OLRA 1OQEA 2Q8DA 2OQ6A 2FHRA 2PQSA 5ACA1 1AXZA 5T5JA 3DXTA 3H1MA 2ZEYA 4QX2A 4DS0A 1J1TA 2D6NA 3GZTB 3I2IA 1BZWA 3ZYHA 1QXPA 4LBMA 3VHOA 1O91A 2EICA 5CNAA 3VBOB 1SHWB 3KF3A 4COYA 3ZYIB 4IESA 2IZWA 1RUI2 4AVSA 1KGYA 2QQWA 1F31A 4K40A 4QU1A 3NW4A 4IV1C 5IFTA 4JDMA 5CFCB 4QKBA 4QX5A 1W8HA 1NLSA 2GN7A 1NA1B 3OBRA 3MO4A 2Y0OA 4P9LA 1LGNA 3AM2A 2YROA 2NZ9A 1UX6A 1TVGA 4YVWA 5A7SA 1RUD2 3D82A 1DGWX 1QJFA 1SPPB 4Q0VA 1AXYA 3APBA 4PIYA 2VJXA 2Q4SA 4UBGA 1PGL2 2Q8EA 4JRAA 3QD6A 5FZIA 1WLWA 1CQ9A 4QKDA 4D94A 2NP0A 4PI2A 1PK6A 2Y6HA 4RR3A 1S4CA 2DBNA 4XUPA 5GZFA 1Q3EA 1HXS3 2AENA 5EPAA 2HWC1 3L2YA 5F2SA 1ZBA1 4LTAA 4MXWA 1LOFA 5F5AA 2WS91 2YU2A 1NAEA 2D3RA 4L99A 3JU9A 1ND2C 2VGDA 2ET1A 5FRAA 1W6QB 1H8VA 1LHUA 4GULA 4NPRA 4ZXEA 4CU8A 3NJZA 3U78A 4Y33A 3ZDSA 4B4QA 1W8OA 3I59B 3RYKA 4CDXA 1BK1A 2Q30A 3TN91 3I2HA 1S0EA 3EXUA 4HMZA 1JHJA 4EE2A 3ITQA 1W2AX 1A8DA 5KBFA 1ZREA 3CNAA 3AXEA 4QHZA 4DY5A 1LR5A 1NA1C 4NHXA 1RUOA 2J1UA 3EJKA 2BGCA 3NNFA 2QCSB 1DZRA 2VY0A 3I3DA 3AYDA 3C7OA 4N43B 3VBSC 1AR91 5A3PA 2EXKA 3OPWA 4AVCA 1QWRA 1PVC3 2W1UA 4PBOA 3J26N 5A32B 1MS5A 2XL7A 2J1AA 4H7MA 3FUOA 2CL2A 3M3IA 3WF2A 4BLJA 4B1MA 3WNXA 4L0PA 4QD2A 4JHTA 3SLIA 3DGTA 4Y3OA 5J1XA 1W99A 2C9AA 2RJ2A 4YG0A 1PHMA 3KQ4B 2JG8A 1ZZ7A 5CKNA 2XVLA 3H3UA 3OF1A 1RUI3 4MVTA 5FLIA 4QGNA 2FD8A 4RA0A 4GH4B 1RUE1 2GZWA 2NN8A 4NO4A 5A1LA 1LB2A 5FP4A 5A3LA 1RJ8A 2Q1MA 1Y3TA 1C4RA 4ZU5A 3WG1A 4JQTA 5F3CA 4QQHA 2J1SA 4D7YA 3T4HB 1T2XA 1RUD3 4M3CF 1JS9A 3ZKUA 4DUWA 1PGW2 5JIAA 4EN6B 1POV0 1LECA 3JD71 4I3GA 1QNWA 3CHXA 4BDVB 2ZACA 4FQ4A 5GZGA 3WY6A 1W28A 1UYPA 1WD4A 4DO0A 4TSVA 1VBB1 4CDWA 2D98A 3ZMNA 4GWNA 1JI6A 1VB4A 2D44A 1VE0A 2UWCA 1GZTA 4NIGA 2X8KA 3ACFA 3VDAA 3OBTA 1AX0A 2LW8A 3KLSA 4GAZA 2CU5A 3VKLA 3LSEA 4ZY9A 3GJBA 4XF9A 2H6BA 3JUUA 3M7AA 1ZM1A 3M8LA 1WA4A 2QQPA 4Q2FA 4BXFA 3ZN6A 2ZKLA 3FX3A 1N1SA 5D8AB 2RDNA 2RM21 4QPIB 1V9U2 5FY4A 1OXCA 3NKTA 2XJVA 1H2KA 5A33A 1EAH1 1N1VA 2C4XA 4QXBA 4A7KA 1W9YA 4XQDA 3UGHA 1JN2P 3ZR6A 2ET7A 2XJUA 3WP6A 1MR5A 2PHFA 3AP6A 4OHWA 1GANA 5D1IA 3S30A 5JXHA 3M3EA 4K1YA 2R49A 4CP9B 1POQA 1V6NA 1LTEA 5FFOC 4WV8A 4BQ3A 2E53A 3ACGA 2PHTA 2WYSA 1XNAA 3RJRA 3ZX7A 4FCAA 5C5TA 1W8WA 2JG9C 3B3QE 3CLPA 4OLLA 2DWRA 3AZVA 4H3WA 1JZ5A 1UOGA 2G19A 4AHYA 1O3SA 5JIUA 1QEXA 4LIUA 1L7LA 2QQJA 1CX1A 2ADDA 3A0KA 3WDVA 1H6XA 1H4HA 1CONA 4IXLA 4M4PA 4OHVA 4GKYA 2BP6A 5C4WA 1JYNA 1SFPA 2A6YA 2RR12 5HXMA 4XF0A 1NG0A 2QKDA 1J58A 1CJPA 4LBJA 2GC1A 2XHKA 5ISLA 1QXJA 1VBC2 4IGPA 1Z7S2 3DF0A 5FYYA 3HPNA 4QQOA 3AKSA 2A3XA 1OURA 2FMYA 2VTXA 2XMLA 3AZYA 4HXCA 1QH7A 2WC2A 2IVJA 2XWJB 2ZTNA 3TNPB 1CZTA 2HWE2 2JDNA 2Q1FA 2YPDA 4CCLA 5C70A 1AJKA 2FDGA 3POBA 5KXDA 5IYYA 3WCSA 1XYOA 3LZZA 4FPOB 5FZ8A 4JCKA 1O4ZA 1W04A 2PHLA 2K2SA 4Q5OA 1LAJA 1BCXA 2JD4A 3MF9A 2OT7A 3VBHC 1O59A 4GWMA 1YIFA 2XJQA 1UMIA 1CAXA 4P08A 1PX4A 2E7TA 2YXSA 5J98B 4A3XA 2VOTA 2N7GA 2BVBA 3ELNA 2KA3A 2VNVA 4MGIE 3RYPA 4ATFA 4DRRA 4GMP3 2A3YA 3D8CA 3NV2A 4LO5B 2WZPP 3RJ2X 4M0HA 4NHYA 4XXPA 1UMZA 4HOOA 1F5JA 2DUPA 4YVSC 3MHZA 3T0BA 4IV1A 1CWPA 5A7NA 3PUIA 3WW2A 1LEMA 1D2QA 4RGKA 3MZHA 2Z2SB 3MIDA 4MUVA 4Y4YA 2VL4A 5FXXA 3HVDA 2AZ5A 3AFGA 3UJOA 1D4M2 3Q8EA 1GNHA 3VD9A 2HJIA 1VRBA 4AVVA 1JUHA 3OGSA 5FKCA 3IDBB 1JUIA 5LCWL 2A7AA 2J42A 4KI5M 4CYDA 3A0NA 3E97A 2ZGSA 2GH8A 4W6YA 3D0SA 4FOWA 2YMZA 5IVJA 1MZEA 5A7WB 4IEVA 4HVOA 3DV8A 4IL7A 4KGGA 5J3UA 4OHXA 1AF9A 2BW8A 3Q8BA 3R6SA 5LEJA 4FTBA 1ND2A 4O65A 4W65A 5LW9A 3GCWA 3MUZ1 4YPJA 1W6OB 1LU1A 2MEV1 2VOWA 3C3VA 3VBOA 3AK0A 2ES3A 1EV11 2RR13 4ORFA 1Q8PA 1ULOA 2AC1A 3K75B 1WMDA 1WCKA 2VW2A 3GNEA 3IM0A 5FJKA 5JI7A 4Y1YA 3LPGA 3QH7A 1VBC3 2WABA 4S2FA 1Z7S3 3SITA 2WINB 3THPA 3ZVXA 5TSWA 2PLV1 5DABA 3MFCA 4COVA 4ZZ8A 5G04L 1W90A 5F6KA 3WNMA 2O8OA 5E1RA 4OHYA 1NA1A 3VKNA 5HV4A 3QOPA 2HWE3 5EHDA 5I0SA 3HN1A 1H2MA 3ZYRA 2ZGLA 4EJRA 3PMEA 3ENRA 1JYWA 5ANQA 2D40A 2ENRA 4M01A 3HQXA 1R092 3ES1A 3T4VA 4AQTA 4Y5TA 2X10A 2QBXA 4KGQA 2FDKA 5A6QA 5FY1A 5FZOA 2WNVB 3BIWE 4A41A 2VNOA 1YQ2A 5AFEA 2CY6A 1VMFA 2ZZJA 2J1TA 3AJZA 5EYXA 1VMJA 1VBD1 4NPLA 4Q4W2 2IWGB 3I2OA 5FXVA 5GLTA 1AHSA 2VMDA 3OGGA 4JC1A 3U75A 5FOJB 1GZ9A 4ZXKA 4UT5A 4JTNA 3VD3A 4A6OA 1ULPA 1VRH2 1G8WA 1X7NA 1VALA 3OGJA 3W59A 4CCCA 5DAWA 2ZA9A 4AG4A 2X5IC 3I3EA 4XZPA 3T2PA 1RUC2 3I59A 4AI9A 4DMIA 2FCTA 3SMHA 5K9YA 1D4M3 3O1PA 2OX0A 3H3LA 1FT9A 5DAXA 1X50A 3GALA 1IPJA 1CAWA 1VAVA 2H0BA 1YNAA 2MHFA 2QNKA 2ZGPA 3ORJA 4Z8BA 3O1MA 1QHDA 3IDAA 3IMMA 4PLMA 4HFSA 4JGYB 1GNZA 3WDUA 2WRAA 2HKXA 2XLAA 2YC4A 1UOBA 3K51A 5FZ0A 1OOPC 3ILFA 3HD8B 2HWD2 2JDPA 2DVGA 3RG0A 5FLJA 2YGLA 2WUHA 3KS7A 3MFAA 5BPXA 1YIPA 4YW6A 2YUEA 1YQCA 1W0NA 5CISA 4FOYA 5A3MA 1CZSA 3ZYGA 4WZCA 5A6XA 1MEC1 4QHOA 1PX3A 1WBLA 3T0DA 3TEYA 4HETA 3AZZA 1UYYA 1GWLA 1UU5A 4Z07A 3MUY1 1XRUA 3POFA 4SLIA 1OF3A 5F7UA 1RUG1 3P3NA 1JZ4A 2GMPA 1DQ0A 2DFBA 2OKXA 1COV2 1S0BA 1STMA 5FYIA 1ULFA 5KR7A 1GZWA 2J1VA 2YZ4A 4JHZA 4YFWA 1W8UA 2W08A 2IXHA 4OYUA 4ZKTB 4KH9A 1WCQA 4Q4V1 5FYTA 3E5QA 4XFIA 3KCCA 4QGMA 1JYCA 2VO5A 3C2UA 2EA7A 1CAUB 1G7YA 2PAMA 2VMFA 1RHI1 3LIGA 2BV4A 2PELA 3I3BA 3USUB 1R093 5DAVA 1N3QA 4C0HA 5JAXA 3S57A 5GLUA 4YM2A 3WDWA 3H7JA 4FAGA 5A3TA 2JE8A 1REEA 2OXBA 2VD7A 1W2UA 3MIEA 4KQ7A 3LGRA 5DDJ1 2UWBA 5FUPA 1MS8A 2JG9A 4W6XA 4K9SA 4RQPC 3RPQA 3T2OA 4LR4A 1UYZA 2C24A 5IVVA 4JTOA 2VXRA 2XVGA 2D5HA 1GR3A 5JLVA 1HB2A 1W03A 2R041 3WZ1A 1PMIA 2XB6C 3MPBA 1RVF1 3FZ3A 4G4FA 3ZLIA 3E6CC 1RUC3 4YGDA 3FHIB 1L7QA 4QPYA 3T08A 3G7DA 1LOCA 1Z78A 1SLBA 1AX1A 2E32A 2EALA 1N1YA 4O9GA 1UW8A 4R8HA 5BNQA 1X33A 2R061 3CO2A 4JDNA 4RHV2 5DXDA 2GALA 3ZR5A 1V6OA 3LQCA 4ET7A 4FOQA 1QJX2 4FFHA 4YG6A 1NKGA 2HWD3 2Y6LA 3BVCA 3E5UA 3INAA 4ZS2A 2FQPA 4Q4X2 3RRDA 2P34A 4RFT0 1ZVFA 4UW4A 3VBHA 2WLQA 1ND3B 1W2NA 4BOWA 1JYTA 3WUCA 1CZVA 4E2SA 1SBEA 2JECA 4MGKE 3LE0A 4QPWA 5L9RA 1YYNA 3FHAA 2D6OX 4CPBA 1WCDJ 1FOD2 2OS2A 1KRIA 1BEV2 4YVSA 1GQHA 2CTVA 4XYXA 2YV8A 1COV3 1DFQA 4Q26A 1OVSA 3KCXA 4FI9A 5FMCA 4OCTA 1B09A 1IKQA 2VH9A 4PF1A 1MVQA 1QJEA 4LUKA 4XMIA 4FP2A 1LGCA 2VXJA 5FP7A 2B46X 4YW5A 3OUIA 5JSOA 5E16A 2P6CA 3ME2A 4XJWA 3S5AA 5FXZA 5BNNB 3A7QA 3AMQA 4CPBD 3O5SA 5JXGA 1HRI1 4ISRA 3IDCB 2CGOA 1AX2A 3ZN5A 4MGSA 4N53B 1GYKA 2RHPA 5JSRA 3RS6A 3OPTA 1QF3A 3FMGA 1ZBE2 4YGBA 1RMU3 4KG0A 2VZ3A 3QH6A 4QQPA 5IVEA 1CD3G 1U12A 4HSJA 2HLEA 1WUVA 4DOUA 2E63A 3OTFA 1B35C 1OA4A 1DYPA 4D6SA 4BQ4A 5LBCA 4DY3A 5HBAA 1LOEA 4CUGA 1MPXA 5FYSA 1PK6C 4IGOA 3VD5A 4RD7A 4B3NA 5DPNA 3RDIA 4B4PA 5BNOB 2VCCA 1MVEA 1AYM1 4A45A 3H0OA 1GOHA 1NT0A 4UFMA 4UW6A 1LOFC 4BLIA 1DGLA 3JQWA 3ZSKA 5J7MA 4BH9A 4NAOA 2WJSA 1PO23 5HXVA 2RS52 2YDEA 4NRPA 3O7OA 4HK8A 1AR81 2XLFA 1W0OA 1QJX3 2AYHA 5FUIA 5FBZA 2BNOA 2Y6GA 4Q4X3 5J96B 2Q0AA 2RMU1 1UCXA 5FYUA 1V70A 4GJYA 4DEVA 4HKOA 5FCCA 3R4SA 2ZPXA 1GICA 2VZVA 2ZHKA 1XNKA 1PMHX 2IVIB 5IATA 4RS5C 1W8NA 1V6MA 4XDPA 5I0UA 5ACA2 5FXWA 4XQ4A 3M2MA 1FOD3 4PIXA 1BEV3 4BISA 5IVCA 4NWWA 3L2HA 4B8EA 4PLNA 5ANNA 2FDJA 1W6OA 2GMMA 3OY8B 4KBBA 3EB7A 4I0AA 4MG2A 1RMU1 1N3PA 4TLGA 2NM1A 4GJZA 2X5IA 1SFYA 2VOVA 5BNOC 2KM2A 4QB1A 3BCWA 1BLZA 1JOPA 1QY4A 3K4DA 4FPGA 4S2HA 2W5FA 2JG8C 4J6GA 5I8TA 1ENSA 5EZWA 1XU1A 2VU9A 2X09A 3LIHA 3H1WA 1G9AA 3V64A 5A3WA 1LGBA 2E26A 2DUQA 1YJKA 1EYBA 3NAPC 4M3CB 5K0UB 3V0BB 4Y5SA 4NIDA 3M70A 1OOPA 5DQ0A 1POV3 1HJGA 4FPJA 2ZGMA 1ULCA 1PO21 2P1BA 5GLWA 4CZSA 1ZBE3 2VQ0A 4FVVA 3DECA 5FZ1A 1I5ZA 5F5IA 2X05A 3WDTA 2WNVA 4QAWA 4KWLA 5DAPA 3LPFA 4CEYB 1R1A1 1HX6A 1PZ7A 3T0AA 3WVJA 3KWVA 4LIVA 2HWC2 3DL3A 1R64A 1WLCA 1ZBA2 3AYEA 4HZFA 4MADA 4AGVA 1ZRCA 1KDMA 3MI8A 2WS92 3IKWA 3THDA 4CDWC 1XOYA 3TEWA 4HK9A 3V0AB 4ISQA 2GH2A 3DCQA 4NHMA 2JXAA 5CG9A 2QQLA 1HKDA 2BWAA 2YB7A 2WA3A 1JBCA 5GALA 3Q8FA 4PQQA 3WDXA 1PIV1 3TN92 2DCYA 2RS53 4JAAA 4IV3C 1S0JA 2PA7A 2BU9A 2RS33 4QU2A 1OUXA 1LHWA 2D3SA 4D7TA 1JOJA 3WNNA 2ZZQA 4JGYA 2BOIA 1AR92 3O12A 5KHHA 4F83A 1O3TA 3NJYA 4NHKA 3UV9A 4CCOA 4AEMA 4RQPA 4DFSA 3KV4A 1CAVB 2PHUA 1R081 3LB9A 2VAUA 2PHDA 1OQ1A 5LRRA 1UY0A 5DG2A 5ACA3 4AGGA 5BNPB 4Z92B 3TOJA 3FFQA 2GC3A 1CIWA 4IW3A 2ZKNA 3DEMA 5IHRA 3F2ZA 4IEOA 4PBPA 1JZ2A 3R0RA 1OSGA 4E4DX 4EN8B 4IDZA 4GIQA 4LBLA 4XFGA 4CE8A 4CDUC 5T50A 1NYWA 2VCMA 2CGPA 1ST8A 1RUE2 1UZZA 4AOCA 4AQSA 2B39A 3JB4C 3PU3A 1Y43B 4JGZB 3VDDC 4AL9A 5A3NA 2G4IA 4HONA 1DIWA 5C3QA 2HEWF 2BNNA 3U0ZA 3IMNA 3ON7A 2VOKA 4PI0A 1NX9A 3K46A 1H30A 3MLLA 5BV6A 5FQ0B 2VMEA 5JUVA 3BTXA 5M0TA 1J3PA 4I2OA 4Y4RA 5K7PA 4DXRA 2GDFA 2D3PA 3JD72 4EROA 2DVFA 4QHBA 1VMHA 5KWRA 1SLIA 1OC1A 3AMMA 4AF9A 1Y9QA 1DF0A 2R30A 2RS31 1Y4WA 3B94A 4NN0A 4D0QA 5HV0A 1G9CA 5T54A 5L7OB 1QU0A 2HWC3 4A3ZA 1ZBA3 2ZGKA 4MGTA 3VZJA 4HVQA 5BNPC 2WS93 1W9FA 3ZXEA 2BRTA 3T09A 4F3JA 3LA3A 4LOTA 4JZRA 3E5XA 4IE5A 4YW2A 5FYCA 4Q27A 2Y6KA 5JXIA 3T30A 3WP5A 1D4VB 1DQ1A 3HR9A 2A1XA 4Q0SA 4WM7C 2R0HA 5C3SA 1QOTA 3QACA 1NLRA 4QKFA 1W06A 5FZGA 1V0AA 5IW0A 5FYMA 2UY8A 3BU0A 3TN93 3AP7A 1GMMA 2SBAA 1NCQB 2NMNA 2RM22 2X29A 2YHJA 2QZ2A 2XUEA 1URXA 1LHVA 2CAUA 5FZAA 1EAH2 4FPKA 4YW3A 2XUMA 3FE5A 5JDBA 3AL5A 4IGQA 2VM9A 2Y26A 2YY1A 5C71A 5EJ1B 1GBGA 4P5HA 2NPIA 3VBUB 1X8EA 1XE0A 2VMHA 3B69A 1F35A 2R071 4V1PA 1AR93 3FLRA 1JU4A 2Q8OA 4IETA 5JZGC 3BKZA 3IAQA 1K5JA 3ZYPA 5I91A 2JEMA 4LEJA 4MZUA 1C1FA 3AKQA 3H9AA 3J7HA 4LE4A 3ZYFA 3LWCA 3POJA 4W8JA 1B35A 1UNBA 1XYNA 2W91A 3J7LA 3PVBB 4QWNA 1H9WA 3VBRB 4Z2AA 4CXXA 1SBFA 5GJ6A 4G9SB 4JX0A 2DTYA 1RUE3 1WA6X 2Y34A 1N1TA 3FN9A 2HEYF 4MSVA 1H2NA 4X8PA 5FMOS 2OQ7A 4LBOA 5KHKA 1OD5A 4PDWB 1MS9A 2BEOA 4IEXA 3VBOC 1Q43A 4AFBA 3WNLA 5JXJA 1SLAA 3JD73 4MXVA 1DYOA 2JDKA 1TZOA 2JDAA 3ILNA 4UW3A 4BIOA 5FPBA 4UFIA 1ULGA 4V2VA 5C33A 1VBB3 2C1FA 3PJYA 2XH6A 4FQZA 1HLCA 2A70A 1WMEA 5CFCC 3BODA 4PQ9A 4Y26A 4JVAA 1UOFA 1DGWA 4J1WA 1XBFA 4RS5A 4R4XA 1LRHA 1KXGA 1MZ5A 1OA3A 3N3HA 1ODNA 1AR61 3BB6A 3A23A 4ES9A 4ZHNA 3B01A 4K3UA 4QT6A 2HWF1 3WNOA 3WF1A 3D5OA 3H8XA 3VBRC 4H2AA 1LOGA 3O1VA 3S0MA 2IUWA 1UMHA 1H9PA 2QQUA 3A4UA 3NNMA 3GZUC 4AWDA 5BNOA 2RM23 5FREA 3GGLA 1EAH3 1MZFA 3NL1A 3SCHA 5JMCA 1HV0A 1QH6A 5EJZB 4LA3A 2XQXA 4QPGB 3GCXA 3NAPA 1O5UA 3WG4A 3AYAA 3UGFA 2TEPA 2WZR1 2A3WA 2XKPA 3PU8A 5FWEA 5J09A 4QX8A 4N90A 5CKQA 1O3RA 3SEPA 4TN7A 5E88A 1W9WA 5F1RA 4GQ7A 4BQWA 4H55A 5FZLA 1K5MB 3KT7A 1NE4A 5JVVA 3K77A 2UURA 2VZ1A 2DF7A 4AI3A 3LEGA 3UYJA 3LAGA 4P9XA 4MOAA 3V65A 4XILA 3W5MA 4JV4A 3KV6A 4N43C 5IFPA 4M3CE 3LOIA 4BXSV 4XIOA 1W2OA 4A44A 1D0HA 3BPSA 1XNBA 1O4YA 1NQDA 4NPMA 2MEV2 4WZFA 1GV9A 1LESA 5C8CB 2P4EA 2W46A 1EV12 3W20A 3VDCA 4LNVA 2UY9A 1NCRB 4XJAA 2NQYA 4XMAA 3VBFB 5J48A 4TZDA 2WR9A 4IV3A 3NV4A 1W6PA 2DVDA 4HKLA 1OF4A 1S2EA 2PLV2 5FZMA 1F5FA 5A7QA 2YYOA 2W95A 3GYDA 4IE7A 4XVHA 3ABZA 4OULA 2VUJA 3OB8A 4GH4C 4M3CA 3V0BA 1MS3A 4UOJA 2XONA 3HNMA 1E5SA 3U11A 3U14A 3A22A 2VZTA 1JU3A 3POSA 1X82A 3WCRA 2E9QA 2QQKA 2D6KA 2WQZC 3VDBA 3ACLA 2RJLA 3OPZA 4YRDA 2BOJA 2NMOA 4QXCA 4XE9A 3TRSB 2YGMA 1DLLA 3M1HA 1MS4A 5CYYA 2QVSB 2YG0A 1JODA 1YO8A 4DNYA 2ZHLA 2BQPA 1VBD2 3JB8A 4AYUA 2LM3A 2WLPA 3OOXA 4N9IA 4L8QA 4BB3A 5FR3A 2OPKA 4JKLA 4BCUA 4AZZA 3I2JA 4MHUA 5T5LA 4CDUA 3OD0A 3LEIA 1LODA 3CJIB 3T3YA 5C5UA 3VDDA 1ODMA 3ZIWA 1PM4A 1KDKA 2VBDA 3SC7X 2A6ZA 2BZDA 1I5PA 2BJSA 1UKGA 4PJYA 5E8AA 2XL9A 1PNFA 4BU2A 1GU3A 3WG3A 1FYUA 2GNTA 1G9FA 3B02A 3I7DA 4LHLA 2VECA 5BXXA 4AFDA 4MH0E 3KHCA 1E5IA 1NXD1 3T2TA 2F17A 2WNUB 2WA4A 4XJUA 1K12A 1JMUB 4E4ZA 5D8AC 1O3QA 4QPIC 2PFWA 1LOBA 4OI4A 3WR0A 3B5LB 2WNEA 4UAPA 2LTNA 4EN0A 5A3UA 1QIQA 5C6CA 1I3HA 1GOFA 2K46A 2W9XA 3EHKA 1MQTB 3SEEA 2XKOA 1X9PA 5BNPA 3ZSJA 4FP3A 1PMJX 4IE6A 5CAZA 5F3EA 1MEC2 5FYZA 3JBG1 3MIFA 4Q4Y1 4WVMB 4YYOA 1Y9GA 2MEV3 3X29B 2F4LA 3H50A 4WM7A 4FOVA 1EV13 2VBBA 2WFPA 2CV6A 1RUG2 4OQ9A 4AI8A 2WDBA 1ZRDA 4AVBA 2VMCA 2PLV3 4X8NA 1UX7A 2HBTA 5KHIA 2IC1A 4NVPA 4NIHA 4E2GA 5FMOL 5IUQA 1HW5A 3CMGA 4Q4V2 4UFKA 4FPFA 4FPHA 4JKMA 3L9JT 1PNGA 3T2QA 5JPMB 4XJZA 2W2IA 1XPWA 1VBE1 2A6VA 3VL9A 2HYXA 2WWUA 4LBQB 1RHI2 3MGUA 2A6WA 2EVXA 2Y6FA 2PXJA 1UU6A 3TBDA 5JZGA 5C9AB 2W52A 3MDPA 1A8MA 2Z69A 5DDJ2 3QCWA 3IB3A 4AK3A 2P3YA 3T1LA 3O1RA 1GFF2 1GOGA 3OEBA 4K6BA 1VBD3 3AXDA 4TXWA 5FYVA 1D0GA 1W8TA 4Y22B 2NYYA 3UKNA 3I3QA 1O5LA 2RS11 2ZAHA 4CUBA 2R042 1AR71 1ASJ1 2G9GA 2JE9A 2W39A 3LA7A 2WSUA 4OI1A 3LSDA 2VMGA 1RVF2 1UXZA 1VB2A 3LKJA 5A7OA 2I2SA 3KVBA 1W9TA 4ASLA 2JENA 3ZFFB 4TLFA 1QOOA 5DUVA 3ZSLA 5C3PA 4UF0B 3VLBB 3N36A 4NR1A 5GKAC 2P3IA 4YWAA 4HN0A 3UNPA 4CEWB 2P5BA 4LITA 2G1MA 4LKEA 4ZZ5A 4CP2A 1V00A 4MLOA 2BFUS 1TMF1 2VW0A 4YZ4A 2R062 4AFCA 5FO8B 2XJPA 2B4KA 3BIEA 3O0VA 4YNIA 5JPNB 1ACCA 5HCHA 5IK4A 4XHXA 3K48A 2Q5TA 3ILRA 5L9VA 2KXLA 2HYKA 2FDFA 1SPPA 3POGA 4OUEA 4QDRA 3RZGA 3KF5A 3PUHA 4DZGA 1M06G 2ZGTA 1DDLA 1MEC3 2EXHA 2ZX0A 4MGQA 5BUVA 5IK5A 1IPSA 3VBRA 4G3YC 1RUG3 1K42A 2O14A 4ES8A 3AVSA 2GAUA 4E9KA 1RUF1 1UN1A 1DYKA 1GQGA 4YW4A 4AHXA 2RG4A 2VQUA 2CWSA 3E6BA 3ALQA 4FFGA 2WN3A 1OBNA 3H42B 3ACIA 4Q4V3 1UPIA 1S0FA 1W6QA 4A6SA 3AMNA 3RGBA 2Y60A 1ZA4A 1YQ6A 1RHI3 2BNMA 3RYRA 3VZLA 4EZ4A 5A6ZA 4CEWC 4LKSA 4I30A 1HRI2 2W3JA 2LS6A 2C26A 3AKPA 4B1LA 5FZCA 3WNPA 3WSOA 5DDJ3 3E1F1 5FY0A 4DXTA 4QQ2A 3VL8A 5FTTC 5JCTA 2DURA 5LK5A 4A2UA 2EIEA 2ZMKA 4KBZA 4NHLA 5KXBA 4PIZA 3CZJA 3SHRA 1AXKA 4W6WA 1SBDA 2A6XA 2PYTA 1W0PA 1W3XA 4N43A 4QXHA 1NZCA 2ZOEB 3OSDA 1H8TB 5CG8A 2R043 3U37A 3W21A 4URAA 3RVHA 5A32A 3BALA 2ARCA 4BHPA 3DUIA 5DG1A 1RVF3 3DKQA 2WNVC 3ETPA 4CU9A 3ZSMA 4GB31 2VULA 1UAIA 1AYM2 4CXYA 2Y64A 5D2AA 4BPZA 4LHKA 5T5PA 5FPLA 5FP9A 4CDQB 3DPRB 3D4KA 5EP9A 1W6MB 2GNMA 4D7SA 4IE4A 4OMCA 4WM8A 2I45A 5FMDA 3VV1A 2DCZA 3PUSA 5A6YA 1YQ5A 4PHZA 2R063 1AR82 1QKQA 4GH4A 5DUUA 4D6RA 3VHPA 5FZ4A 1PVXA 2ZAAA 2XJSA 1WW4A 1K5MA 2RMU2 2D7FA 2ZX1A 1MS1A 2GC0A 3IPVB 3WQBA 5KC5A 4META 2XG3A 1W39A 4AFMA 5I0RA 2GMEA 3RNSA 3WT3A 2EAKA 1YLLA 3N9NA 1X8MA 5HPOA 4AEJA 1LKNA 3AB0A 5LA0A 4JGYC 2PN5A 5LBEA 1JZ7A 4R9AA 3ZFGB 3PTYA 4E4SA 5CB7A 4KG8A 1UQXA 3ZPYA 1PO13 3WUDA 3KHBA 3LCPA 1IHMA 1W6NB 1KD7A 3LF7A 4MX3A 1OMIA 5AVPA 1RC6A 2CHHA 2VZRA 2O8QA 3HN3A 1RMU2 2P2KA 3KQRA 4R52A 4X6RB 4AEDB 3HT2A 4YZ2A 2DUOA 1LHNA 1UZVA 2W92A 1C57A 4XETA 4XHBA 1KJLA 1RUH1 1J3RA 3BGAA 3FWEA 4YLZA 4CDQC 1IS5A 2ZGQA 1IGOA 5SV5A 3DXUA 2WFF1 3AX4A 3WP3A 1HRI3 4CU7A 1JYVA 1SCRA 3IIIA 1G6NA 1WLTA 5D8AA 4AI1A 4QPIA 1HN1A 5FY9A 4BMBA 4XFBA 5HI0A 3HQRA 4RSUA 5B2GB 5F37A 4JDOA 1OKQA 3U4SA 4EQVA 1PO22 1RIRA 3TAYA 5AC91 1UYXA 5A3OA 4QGLA 4XF3A 2CDPA 1F2NA 4JKKA 2BGOA 4I0BA 4CP9A 1R1A2 1OFNA 3IAPA 3KSCA 2PAEA 2YFZA 1WZXA 2XJTA 4YGCA 3J7MA 1J84A 1ZA7A 2R7EB 3T1MA 1CN1A 2BBAA 4LUMA 5H9RA 3VKFC 4BQYA 5LA1A 3SKJE 1AYM3 2W1WA 4NIIA 3CJIA 3B93A 4P00B 1US3A 4Q29A 2V73A 3JQXA 4C1WA 2OA2A 1PIV2 2VZUA 4O7XA 1S1AA 3KVAA 5DZGA 5EWSA 1PO11 3U10A 4CSWA 4E8DA 5JOYA 1AR83 3N35A 3PURA 4FXKB 4FPCA 4AFAA 2Z4FA 3OEAA 1XC6A 1M4WA 2PHWA 2WNUA 3VB9A 2BFUL 2ZGRA 4FO9A 2NLRA 2R32A 3KM5A 4YVWB 1LOAA 2RMU3 2V4VA 4EWEA 3I3MA 1XE8A 2WN2A 5DUWA 5HCBA 4DIQA 3N9LA 5GLVA 3WQ0A 1QNYA 4ARXA 2ZMNA 4CCJA 3OYWB 2XBO1 2JIGA 1MQTA 2QDRA 5GLZA 1IPKA 1R082 1OQDA 2ZEZA 1J83A 2ORZA 2YC0A 1PZ9A 4NMIA 1YRZA 3C7FA 4L2NA 1S0GA 5L73A 4RR3B 1REFA 1JOBA 1TE1B 5GZDA 1U0AA 3IBMA 2PQQA 4SBVA 4ASKA 2IXLA 2GP5A 4K8RB 1Q56A 1T6BX 1ND3C 1ZZBA 3ZSEA 1ZRFA 1XXNA 4IUGA 1H0BA 1APNA 4HLTA 2IFRA 4XBQA 1H6YA 3RZJA 1AL21 4PLOA 3TNQA 3V56A 1GUIA 2JDMA 4CDXB 2EAAA 1OVPA 3P6BA 2JB4A 3HQUA 5LASA 5ABJB 3NJVA 5F5CA 3VHNA 1LJ7A 4XQWA 2V5DA 3LA2A 4XFCA 2SLIA 3O1TA 5EV7A 4YARA 3N7KA 1E57A 5IK7A 3R05A 1ZRRA 1ZZ6A 4Y5Z0 2RS32 5FY8A 1O4TA 3PJQA 4HVRA 5BNNC 1R1A3 4XAAA 2WO2A 3J9SA 4D69A 1C5IA 1WD3A 3WP4A 3ROUA 4U2AA 4P9JA 2W68A 1VAKA 4N53C 4Y22A 4C91A 5FZDA 1OI6A 2QZ3A 4XEZA 2P37A 4AQ6A 4Z1VA 2V4AA 5A7WA 4LBKA 1XNCA 4I09A 2ZCWA 3W58A 1RXGA 2H6CA 2YBSA 1YFXA 1PIV3 3HT1A 3PLQA 3ZFFA 5LBFA 3R4DB 3ZFEB 2LALA 2VG9A 4UF0A 3ZXDA 1UD1A 1S55A 4XBNA 1DQ5A 1S0DA 4CEWA 3KT1A 2ZJCA 4KMQA 3WG2A 2RVAA 3ZYBA 5L9BA 5DMYA 1IG0A 4HKWA 4QDQA 4AEKA 3ZOIA 4E27A 4QX3A 2R072 2CGNA 3U07A 3J7NA 1HRV1 2C9KA 3O1OA 1G86A 3DYPA 2AUYA 4UFJA 5I0DA 3W5NA 5T52A 2P6HA 5FZ9A 2VW1A 1R083 1W05A 5FDBA 2B42B 3HNYM 3WD5A 1SQ4A 2DDUA 4LO4B 2D97A 1ZX5A 3KV5A 2AREA 1U5XA 1P8JA 2JICA 1YCIA 4E4HA 4IEWA 1UZYA 4MHRA 3D3AA 4NOTA 4XUOA 1F15A 3SNMA 3JZVA 4YZ1A 4W50A 4P9WA 3M3CA 5F6LB 1A78A 4CCDA 1JTZX 2F6BA 5FKBA 3O14A 4WVZA 3EYPA 2WZEA 4EN9B 4IEUA 3K3NA 3BTZA 2CWMA 2JB8A 3ZN6B 4QX1A 2ILMA 1IQAA 5F3GA 3W9AA 3ZFEC 3ZXKA 1OPMA 5FY7A 2JIJA 2LUWA 5J37A 4XACA 1G9DA 3DYOA 1FAYA 3RMYA 4CVUA 2HWB1 5I0TA 3ST7A 5CFDB 1VBA1 1BJQA 1QJY1 3BU7A 1CESA 5GZCA 2HH9A 2XDVA 4BA6A 1DG6A 1RITA 4ASMB 5IVBA 1JHNA 3RWNA 5LWBA 5K0UC 2CNAA 3H8UA 4AAXA 1S2KA 4Y20B 5B4XA 4HPKB 2J7MA 1XU2A 4K1ZA 1WBFA 2PMWB 3UK9A 3KV9A 1AR62 1FPN1 4UWDA 4Y1ZA 1H8TA 3CQOA 2HWF2 1C8M1 4LK7A 4CU6A 1BVVA 3P1IA 1PZ8A 1GSLA 3AYCA 3JXSA 4E8CA 2OUHA 1W3VA 5FZ3A 3S7IA 5T3NA 2ZBJA 4CEYC 2Q1ZB 1GWKA 4IERA 5A70A 1SG3A 2VQAA 4K21A 4CTEA 4DQAA 4YFZA 2R0FA 5C4WB 1GNYA 3LD8A 2WAAA 4LO7A 4CDQA 1U5ZA 2E6VA 4AI0A 3DPRA 3J8F1 3OG2A 3FC0A 1UZWA 3NMBA 3BTYA 1TME3 5FLHA 2FDHA 2WZR2 5DZEA 1ZZCA 2R073 3N9PA 1Z0HA 3AL6A 3ACHA 1CGPA 3NJXA 2CYFA 3IT8A 5ERLA 2W94A 2FDIA 2XGXA 2P3JA 3BPZA 3HIFA 3MIHA 5JMOA 1CVNA 1J1LA 3SCGA 1DGRN 3TYJA 4LKDA 1CAUA 1GWMA 3SH4A 1WWYA 3NO8A 3CF6E 3USUA 1UY2A 5J36A 1ENRA 4KWUA 5FZKA 1RL3A 1LULA 2OZ6A 4EZHA 4OVEA 1RUJ1 3RZZA 3ZDVA 2WWJA 3RZMA 1EP0A 1UU4A 1VBB2 4N7IA 3UKTA 3ZFGA 3GXUA 4XOGA 2W1QA 2WT1A 5FZ7A 5FPUA 3MIBA 1L3JA 2B45X 3NWKA 5KHJA 2YC2A 2VNGA 3CBNA 3DYMA 4UBHA 4BWOA 3VD4A 4AEDA 2HEVF 1IS4A 1Q5OA 1DZTA 1UY1A 2A71A 3AKRA 1V6KA 4GD4A 2UU8A 2VPVA 4IV1B 1NLQA 2FZ1A 1KITA 1KS5A 3LDBA 1FV2A 1QJU1 4N8MA 4Q1PA 5AVAA 4HT1T 2XXZA 1CJDA 2G9FA 2XJRA 1K3IA 4OMDA 3RZLA 4JGZC 4YM0A 1WKYA 4LORA 2WYFA 2Y0IA 4L11A 3WLUA 1H2LA 5C7GA 3AZWA 2ATFA 4Q8LA 2WO1A 4FAHA 4FT8A 3OBZA 2FBEA 2UWAA 1TME1 1AZDA 3WQ1A 1IS6A 2WZ8A 1AR63 4CXWA 4DXZA 2P3KA 1SDDB 4XW3A 1IQDC 1BBT1 1DQ2A 4PCRA 4BQ1A 1KFXL 2HWF3 3UETA 4FPEA 1WW7A 1C3HA 2EIDA 4XC9A 3I2FA 5JR2A 2O0OA 5I8YA 1ND3A 3AVRA 1ND2B 4CCEA 1WCSA 3THTA 1SZBA 1ZRIA 3HBZA 4INDA 5L7OC 4AW7A 2O1QA 5FPZA 3WF0A 4XTMA 1DU3D 4XUTA 3MLKA 4DXSA 2MPFA 5EFUA 4D8MA 4NROA 4ATEA 2WZR3 1ULEA 3ZN4A 3ZXLA 4CA9A 3PL0A 1TEIA 3KT4A 5CADA 1OT5A 5KC6A 4IE0A 1AYN1 3WINE 2QQIA 2VC9A 1BMV1 4OUMA 1NCQC 2W47A 1FMD1 4FTEA 4P5YA 4X6QB 3VBSB 2A73B 2BPA2 2RE9A 4UW5A 5A1FA 2QFEA 2VR4A 5BNNA 3OYWA 3RZKA 1A3KA 1EPZA 4MGZE 3S5QA 4NUBA 1AVBA 5I93A 1H1AA 2QQNA 5L19A 3VBUC 1IOAA 2WIIB 5FZOB 3RWKX 2Y33A 4LHNA 1BVP1 1RINA 4N53A 2WQ4A 2PHXA 1CX4A 3JBG2 1CIYA 4Q4Y2 4R9CA 3PTRB 5IK8A 3WEZA 1W8ZA 5DZFA 4Q1RA 2GN3A 2V72A 1QQP3 3Q8AA 2WAOA 4M00A 1DHKB 3BOWA 4UFHA 2E31A 2D43A 3HOBA 3NKGA 3PIGA 2XOMA 3U1XA 3WW4A 1YFYA 1YJLA 4Q0PA 2G9ZA 1YQ8A 3MLJA 3OCPA 5DUXA 3WV6A 1NY71 1VBE2 2B9UA 3H8OA 1CAWB 2ZEWA 1O8SA 5ABJA 1JZ6A 4YZ5A 4HANA 4YZ3A 1OH4A 2E51A 5EJ3A 3VZOA 1TG7A 3I4IA 2D6PA 2A75A 2WNOA 4PDWC 4IEQA 1IS3A 2VZOA 5DN2A 3WHUA 2QUOA 3AP5A 3Q8CA 5CKMA 2GNDA 1SLTA 2WBKA 1FI2A 3ZKYA 4CCNA 2R1DA 4FSJA 4LLOA 4XAEA 1EUUA 5FZFA 2JKXA 4BQXA 5GZEA 1J59A 1GP5A 2WO7A 1XB9A 2ARAA 3BN6A 4B7KA 3B9IA 2BDRA 3VHRA 3LEKA 2RS12 4JRLA 5IVFA 5FZEA 1AR72 1UWWA 1ASJ2 1V6IA 3LEMA 4RYDA 5FYHA 2QDNA 1DCSA 3PUQA 1Y9MA 5IAXA 3GZAA 4Y24A 1ZZ8A 2A5ZA 3FL7A 4IEZA 1HXS1 3SISA 1A6CA 1MACA 2OUJA 3ZFEA 3ECQA 3N9QA 3OY8A 5F32A 1DQ6A 1GZWB 1WMFA 1FV3A 3UL2A 5E89A 1QQP1 2Q8CA 3UESA 2DBIA 2PAKA 3PVEA 2JD9A 3F95A 5F39A 1TMF2 4COZA 1SLCA 4AVAA 3O0WA 3RMXA 1DGRA 2X53S 3VZKA 3PIJA 4FPLA 4QDSA 3THCA 1T6GC 2QE3A 1HIXA 1FNZA 1DLCA 1VLNA 4QM9A 1RUNA 4QKNA 1QXRA 4QPGC 5FJHA 5K0UA 3S7EA 4DPNA 1VJ2A 1H4GA 1VR3A 2CAVA 3MIGA 5LK7B 1SLLA 4IEYA 5JOXA 1UKRA 1QDOA 2JG9B 1SMVA 4YGEA 2IXJA 3TEZA 3JBG3 4Q4Y3 1K5MC 4M0NA 1W8FA 4P9IA 2VNRA 1KFUL 4R9BA 4XFFA 4TTGA 3VZNA 2B5HA 4CRQA 2IXCA 1VIWB 3GJAA 4P9YA 1PVC1 3B00A 4QM8A 4Y1VA 4CEYA 1RUF2 5EIYB 1LU2A 1OH3A 4LJHA 4MO3M 2DCTA 5CU1A 5CZKA 5GM0A 3UJQA 1W9SA 3RQ0A 4P9GA 5L36A 3V0AA 3K3OA 3OUJA 1ULDA 3MPPG 3I54A 1FNYA 1VBE3 1LEDA 4D3WA 4LBNA 2E7QA 5C8CC 4H7LA 4NAMA 4C0BA 1QMJA 1NCRC 1RUI1 4BE3A 3BUCA 1J3QA 3POIA 4XUQA 5CFDA 3VBFC 1NE6A 1D2SA 3MICA 4XF4A 5CIRA 2DVBA 4BZ4A 3BYWA 4J1XA 4PF5A 2Y38A 1AL0G 3M3QA 3RI9A 2W1SA 2VZSA 1QOSA 4OFGA 3ZIXA 1DZQA 2DU0A 2GSYA 5FK7A 3VBHB 4LPLA 1RUD1 1UIJA 1XE7A 4Y20A 3NRUA 3EBRA 4HPKA 3A21A 2AGSA 3OGRA 3AJYA 2RS13 1PGL1 3ZXGA 1WLDA 4FPYA 1AR73 1L7RA 1ASJ3 3C8XA 3GBWA 1CAVA 4CUCA 5BY5A 1WCUA 2FCVA 2VVEA 1LNSA 4YVSB 3AP9A 4GB32 1HB4A 1SEFA 4F8AA 2VUDA 3CJXA 1VAMA 1D7PM 3LDKA 1MS0A 1GKBA 1TMF3 4NRQA 3MF6A 3UGGA 1HDKA 3CJIC 2XPJA 1ENQA 3GBGA 5LY1A 5C3RA 4JGZA 1C5HA 4DB5A 1U5YA 2ID4A 2RDSA 4U36A 4DRVA 3VZMA 2UYAA 3HMYA 4EV0A 3FHQA 2VCAA
chains in the Genus database with same CATH topology
2C0ZA 3ATGA 1WW6A 2BUKA 2DFCA 5FQ0A 4AGRA 5H9SA 2WNUC 4KU7A 4KL1A 2IFWA 3ZO0B 1ZYBA 3CU7A 2ZX4A 3H3ZA 4L9BA 1OFSA 1RUF3 1MQTC 5L7OA 2VUAA 1UF2C 2I07B 3KB5A 1G9BA 1Q8QA 3GHMA 4COWA 1V9U3 1RUH2 3RI8A 3MEPA 1I1EA 4RGGA 3PVOA 3WXPA 1UIKA 2WFF2 3IN9A 4HN1A 3E6DA 3EQEA 1CR7A 1NCQA 4GA9A 2Z79A 5HCAA 3UKVA 5JI9A 4LO6B 5SV8A 4S2GA 4YSFA 2XVKA 3NVCA 1H1IA 2WT2A 1IKPA 5AC92 1S0IA 3EO6A 2EXJA 3VBUA 5K8SA 4HL0A 3U4XA 1PGW1 2GC2A 2ARBA 3G6JB 5C9AC 1FATA 5T5OA 4K20A 1VP6A 4ITCA 4GB33 3N7LA 4DINB 4Q8KA 4H14A 1EY2A 2PTMA 2B7YA 1YUDA 2X5IB 1I6XA 4HBNA 1HQWA 1N3OA 4UXAA 2DCKA 4XBLA 1PO12 2WL1A 1FXZA 1SFNA 4GMP1 4WBBA 5JR7B 4D7SA 1YFUA 2XWBB 4MV2A 3ZFFC 4YG3A 4GXLA 5BYNA 3QBQA 1V9U1 4PDWA 3VBSA 4I01A 3SCFA 1PGSA 1OOPB 5H9QA 2AR6A 1ONAA 2XBO2 3WDYA 4N7UA 4YM3A 3I2DA 2ZGOA 2IXKA 4RGAA 4Y1UA 1OLQA 2DYCA 4K7JA 4EN7B 4R4ZA 5T55A 3VKMA 2WWSA 2VVDA 1LHOA 2BTVC 4ONUA 3KD4A 1RUH3 3QLQA 3WQ7A 3NSTA 1AL22 4P14A 2WFF3 2BBVA 3BOPA 1TNRA 4AXOA 3WHTA 1FX5A 4BIFA 4NWVA 3RSJA 2RR11 2ZS6B 2GU9A 4Y1XA 2E7AA 1SACA 3NV1A 1VBC1 5AC93 4QPGA 1Z7S1 2OIIA 1NQJA 2P17A 4K8FA 3SH5A 2DVAA 4RQPB 2D6LX 2HWE1 2ZABA 4I02A 5JWPA 1OHFA 1Y7BA 4XPVA 4BYYA 5FPXA 4A7YA 3AMHA 2ZX3A 2D5FA 5F5QA 1H8TC 1JH5A 2D6MA 2AH2A 1QDCA 5C8CA 4QXKA 2R6QA 1NCRA 1YXWA 1YI7A 1GLHA 2V09A 3VBFA 2JX9A 2R1BA 4CP1A 4R9DA 3ZXAC 5JOWA 2VMIA 1KQRA 1ALYA 1HRV2 1O7FA 1UPSA 3FLPA 4GALA 3M3OA 3DPRC 2XBO3 3N4MA 2EXIA 4AVTA 1AJOA 1D4M1 4JQRA 3IWZA 2DTWA 2FMDA 4XDQA 2K0GA 2VOXA 2OZJA 2F4PA 1RTVA 4Q4W3 2Z42A 3S6PA 5JOZA 3R4UA 1I9RA 2OYZA 3TWIA 5LEKA 1XYPA 3D6EA 1VRH3 4AI2A 2K9ZA 1AL23 3N7MA 3ZFGC 2VVFA 4EWDA 3P3PA 3FBYA 4OUSA 4MYEA 4YW1A 1HQNA 4AEDC 1BQPA 2HWB2 5FO9B 1C28A 3ZYJB 1VBA2 3OJBA 1QJY2 4IEPA 3IIAA 3PNAA 4AHWA 1SCSA 3DN7A 3HAGA 3CL1A 3AP4A 1F9KA 1XNDA 3POYA 2IXIA 4WM8B 3SXWA 2WSVA 3B9CA 2I74A 3O0XA 4AE2A 3POWA 4Q0UA 5KHGA 1ZNPA 2ZHNA 4YM1A 1FPN2 1R091 3KZ4C 2W0XA 1B35B 2PHRA 1C8M2 4C90A 3FFZA 2TNFA 1F8VA 4LE3A 1PK6B 5F9TA 1Q8VA 1NXMA 2JE7A 5HCFA 1C1LA 4GMP0 3M4FA 4WVMA 3TB0A 4A7ZA 4MXWB 2UYBA 3IDEA 4Q4W1 4O9EA 2OW4A 1XQNA 3J8F2 2BWCA 2TUNA 1VRH1 2ZGUA 4BM8A 1HRV3 2MNGA 4OHZA 4WVWA 2ZMLA 1RUC1 2YPJA 4QQLA 3PHMA 2XLGA 4LBQA 4GKXA 4RL7A 4WM8C 1MZ6A 4YVWC 1RUJ2 4RS5B 5C9AA 4LT5A 1BKZA 1JW6A 1RB8G 3JCIA 1TQ5A 2HWD1 4WVVA 4KU8A 1ZZ9A 1Q8OA 1QGLA 3GF6A 4XJ9A 1WW5A 4RR3C 4XIKA 4XTPA 4I0WB 2ZHMA 3Q9OA 2V5YA 2RJKA 4LBQD 3J4UH 2JG8B 3CEWA 2BYVE 1QJZA 4B4RA 3VN4A 2ARXA 2QJVA 4F7ZA 2HWB3 3VUOA 1QJU2 3LOBA 3MYXA 1VBA3 3I8TA 1QJY3 1REDA 3MW3A 3NAPB 1COV1 4RHV3 1YFWA 3OD4A 1BXHA 4I3PA 3PMSA 1U5IA 1UL9A 4CDXC 5C8WA 3VKOA 3ETQA 1OPOA 4E2QA 1TME2 5FAXA 4ZU4A 5ABJC 1FPN3 1BYHA 1GZCA 1BBT2 3HWJA 4TYSA 3B7MA 5KXEA 4L97A 3D0JA 1C8M3 4Z2WA 2GNBA 3DKWA 2JDZA 3ZMOA 4CDWB 4AHZA 2EF6A 3FBMA 3FJSA 3BTAA 4FTSA 3WOGA 1RJ7A 4EWAA 1YHFA 2DU1A 5FO7B 3J8F3 3WW1A 4FXGB 3SH3A 1CPNA 1EPWA 4IV3B 4S2DA 1W6PB 2FZ2A 2JJ6A 3FLTA 4XJ8A 5IT6A 1YWKA 2D93A 1AYN2 1BMV2 3URFA 4AQ2A 4LLFA 4XF1A 1FMD2 4LO8A 1AUYA 3AMPA 5A33B 4URTA 3VGIA 2Z5WA 1HV1A 4N9HA 5CBLA 3PVNA 1RUJ3 4KNCA 2TBVA 4RHV1 4Z82A 4L92A 3MW4A 1DQ4A 1KS4A 1QJX1 3AKTA 1TNFA 3ZXFA 4Q4X1 2ZX2A 5FOBB 3AZXA 1Q8SA 4BMEA 5CA6A 4CDUB 3VDDB 3ZXJA 3ES4A 4HSLA 1FOD1 4LULA 1QJU3 1R1ZA 1BEV1 1LCLA 1NY72 4FBFA 1LENA 1C8NA 2WT0A 4QMAA 3ASIA 5JSPA 1W6MA 2OVUA 4TWTA 2JKBA 2EIGA 5H9PA 4ZU7A 1OA2A 2DV9A 5EYYA 1RGSA 1JXNA 5CVRA 5I8SA 1N47A 1H1MA 1PM7A 4C1XA 3NV3A 1BBT3 1IZ3A 5CFDC 1WGPA 2ETEA 2R16A 3USSA 3WX5A 5AFBA 2B8MA 3IPVA 4XFHA 4OI0A 1SDWA 1DBNA 3MW2A 3N7JA 1POV1 1S2BA 4OZXA 3FUQA 1KJRA 3GHNA 1ZBE1 4WM7B 2H0VA 3WW3A 4MGYE 1CAXB 1HQLA 2ZGNA 3H7YA 4Q0QA 1HXS2 1ENXA 3AFKA 1CPMA 4B29A 1W6NA 4KWJA 2DCJA 1QQP2 1AYN3 3KGZA 2C5DA 1FMD3 3GBFA 5C4WC 4KWKA 1X36A 5EXOA 1V6LA 3H1YA 5JZGB 3KMHA 4CP0A 2RS51 3KCYA 4XFAA 2ERFA 1NOVA 4OI2A 4LA2A 3KGLA 1JYIA 4B7EA 5KXCA 1YI9A 1S0CA 4COUA 2BVVA 2WKKA 4IQPA 1PVC2 1V6JA 4XXAA 1OLRA 1OQEA 2FHRA 5ACA1 1AXZA 5T5JA 3H1MA 4DS0A 1J1TA 2D6NA 3GZTB 1BZWA 1QXPA 4LBMA 3VHOA 1O91A 5CNAA 3VBOB 4COYA 3ZYIB 4IESA 2IZWA 1RUI2 4AVSA 4K40A 1F31A 3NW4A 4IV1C 4JDMA 5CFCB 4QX5A 1NLSA 2GN7A 1NA1B 3OBRA 4P9LA 2Y0OA 4WM8A 1LGNA 3AM2A 2YROA 2NZ9A 1UX6A 4YVWA 1RUD2 3D82A 1DGWX 4Q0VA 1AXYA 3APBA 4PIYA 2Q4SA 4UBGA 1PGL2 4JRAA 3QD6A 1WLWA 1CQ9A 4D94A 2NP0A 1PK6A 4RR3A 5GZFA 1Q3EA 1HXS3 2AENA 2HWC1 3L2YA 1ZBA1 4LTAA 4MXWA 1LOFA 2WS91 4L99A 2D3RA 3JU9A 1ND2C 2VGDA 2ET1A 5FRAA 1W6QB 1H8VA 1LHUA 4GULA 4NPRA 3NJZA 3ZDSA 4B4QA 3I59B 3RYKA 4CDXA 1BK1A 2Q30A 3TN91 1S0EA 3EXUA 4HMZA 1A8DA 5KBFA 1ZREA 3CNAA 3AXEA 4DY5A 1LR5A 1NA1C 1RUOA 3EJKA 2BGCA 2QCSB 1DZRA 2VY0A 4N43B 3AYDA 3VBSC 1AR91 2EXKA 4AVCA 1QWRA 1PVC3 4PBOA 3J26N 5A32B 1MS5A 2XL7A 4H7MA 3FUOA 2CL2A 3M3IA 4BLJA 3WNXA 4QD2A 3SLIA 3DGTA 2C9AA 4YG0A 1PHMA 2JG8A 1ZZ7A 2XVLA 3H3UA 3OF1A 1RUI3 4MVTA 5FLIA 4QGNA 4RA0A 4GH4B 1RUE1 2GZWA 2NN8A 4NO4A 1LB2A 5A3LA 1RJ8A 2Q1MA 1Y3TA 1C4RA 4ZU5A 3WG1A 4QQHA 4D7YA 1RUD3 4M3CF 1PGW2 5JIAA 4EN6B 1POV0 1LECA 3JD71 4I3GA 1QNWA 2ZACA 4FQ4A 5GZGA 3WY6A 1WD4A 4TSVA 1VBB1 4CDWA 2D98A 3ZMNA 4GWNA 1VB4A 2D44A 2UWCA 2X8KA 3OBTA 1AX0A 3KLSA 3VKLA 3LSEA 4XF9A 2H6BA 3JUUA 3M7AA 1ZM1A 3M8LA 1WA4A 2QQPA 4Q2FA 3ZN6A 2ZKLA 3FX3A 1N1SA 5D8AB 2RM21 4QPIB 1V9U2 3NKTA 2XJVA 1H2KA 5A33A 1EAH1 1N1VA 4A7KA 4XQDA 1JN2P 2ET7A 2XJUA 3WP6A 1MR5A 2PHFA 3AP6A 4OHWA 1GANA 5D1IA 3S30A 3M3EA 4K1YA 2R49A 1V6NA 1LTEA 5FFOC 4WV8A 2E53A 2PHTA 3RJRA 3ZX7A 4FCAA 2JG9C 3B3QE 3CLPA 4OLLA 2DWRA 3AZVA 4H3WA 4AHYA 1O3SA 5JIUA 3A0KA 3WDVA 1H4HA 1CONA 4IXLA 4OHVA 4GKYA 5C4WA 2A6YA 2RR12 4XF0A 1NG0A 2QKDA 1J58A 1CJPA 4LBJA 2GC1A 2XHKA 1QXJA 1VBC2 1Z7S2 3DF0A 4QQOA 3AKSA 2A3XA 2FMYA 3AZYA 1QH7A 2WC2A 2XWJB 2ZTNA 3TNPB 5I0RA 2HWE2 1AJKA 5KXDA 3WCSA 1XYOA 3LZZA 4FPOB 4JCKA 1O4ZA 2PHLA 2K2SA 1BCXA 2JD4A 3MF9A 3VBHC 4GWMA 1YIFA 2XJQA 1CAXA 2YXSA 2E7TA 5J98B 4A3XA 2N7GA 2BVBA 3ELNA 2KA3A 4MGIE 3RYPA 4ATFA 4DRRA 4GMP3 2A3YA 3D8CA 3NV2A 4LO5B 2WZPP 3RJ2X 4M0HA 4XXPA 1UMZA 1F5JA 2DUPA 4YVSC 4IV1A 3WW2A 1LEMA 1D2QA 3MZHA 2Z2SB 3MIDA 4MUVA 4Y4YA 2AZ5A 3AFGA 3UJOA 1D4M2 1GNHA 2HJIA 4AVVA 1JUHA 3IDBB 1JUIA 2A7AA 4CYDA 3A0NA 3E97A 2ZGSA 2GH8A 4W6YA 3D0SA 4FOWA 2YMZA 1MZEA 4IEVA 4HVOA 3DV8A 4IL7A 4KGGA 5J3UA 4OHXA 1AF9A 2BW8A 3R6SA 5LEJA 4FTBA 1ND2A 4W65A 1W6OB 1LU1A 2MEV1 2VOWA 3C3VA 3VBOA 3AK0A 2ES3A 1EV11 2RR13 4ORFA 1Q8PA 1WMDA 1WCKA 2VW2A 3GNEA 3IM0A 5JI7A 3SNMA 4Y1YA 3SITA 3QH7A 1VBC3 3THPA 4S2FA 1Z7S3 3ZVXA 2WINB 5TSWA 2PLV1 4COVA 3MFCA 5CFCA 5F6KA 4OHYA 2O8OA 5E1RA 1NA1A 3VKNA 3QOPA 2HWE3 5I0SA 3HN1A 1H2MA 3ZYRA 2ZGLA 4EJRA 3PMEA 3ENRA 2D40A 2ENRA 4M01A 3HQXA 1R092 3ES1A 4AQTA 4KGQA 2WNVB 3BIWE 2VNOA 5AFEA 2CY6A 2ZZJA 3AJZA 5EYXA 1VBD1 4Q4W2 2IWGB 5GLTA 1AHSA 5FOJB 3OGGA 4JC1A 1GZ9A 4ZXKA 4JTNA 3OGJA 1VRH2 1G8WA 1X7NA 1VALA 3W59A 2ZA9A 4AG4A 2X5IC 4XZPA 1RUC2 3I59A 4DMIA 3SMHA 5K9YA 1D4M3 1FT9A 1X50A 3GALA 1IPJA 1CAWA 1VAVA 2H0BA 1YNAA 2MHFA 2QNKA 2ZGPA 4Z8BA 1QHDA 4PLMA 4HFSA 4JGYB 1GNZA 3WDUA 2HKXA 2XLAA 3K51A 1OOPC 3ILFA 3HD8B 2HWD2 2DVGA 3RG0A 5FLJA 2YGLA 3MFAA 3KS7A 5BPXA 1YIPA 2YUEA 4FOYA 5A3MA 3ZYGA 4WZCA 1MEC1 1WBLA 4HETA 3AZZA 1UU5A 4Z07A 1XRUA 4SLIA 1RUG1 3P3NA 2GMPA 1DQ0A 2DFBA 1COV2 1S0BA 1ULFA 1GZWA 2YZ4A 4YFWA 4ZKTB 2W08A 2IXHA 4KH9A 4Q4V1 3E5QA 4XFIA 3KCCA 4QGMA 1JYCA 3C2UA 2EA7A 1CAUB 1G7YA 2PAMA 1RHI1 3USUB 5JAXA 2PELA 4C0HA 1R093 1N3QA 5GLUA 4YM2A 3WDWA 3H7JA 4FAGA 1REEA 1W2UA 3MIEA 4KQ7A 3LGRA 5DDJ1 2UWBA 1MS8A 2JG9A 4W6XA 4K9SA 4RQPC 3RPQA 4LR4A 4JTOA 2VXRA 2XVGA 2D5HA 1GR3A 5JLVA 2R041 3WZ1A 1PMIA 2XB6C 3MPBA 1RVF1 3FZ3A 4G4FA 3E6CC 1RUC3 4YGDA 3FHIB 4QPYA 3G7DA 1LOCA 1Z78A 1SLBA 1AX1A 2EALA 1N1YA 4O9GA 1UW8A 4R8HA 5BNQA 1X33A 2R061 3CO2A 4JDNA 4RHV2 5DXDA 2GALA 1V6OA 4FOQA 1QJX2 4YG6A 2HWD3