2D6KA

Crystal structure of mouse galectin-9 n-terminal crd (crystal form 1)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
149
structure length
147
Chain Sequence
ALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords lectin, galactose binding, soluble 9
publication title Crystal Structure of the Galectin-9 N-terminal Carbohydrate Recognition Domain from Mus musculus Reveals the Basic Mechanism of Carbohydrate Recognition
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 147
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d6kA00
1IOAA 1Q8SA 4FPJA 2WKKA 5GZFA 4AGVA 3RRDA 4K20A 3R4UA 4M3CA 3OJBA 2DWRA 1LTEA 4Y1YA 2D6KA 2ZMNA 3PVOA 3GNEA 4R9BA 4GKXA 2R0HA 3AYDA 1D0HA 4LBLA 1QOOA 1UKGA 1DGLA 2GN7A 1LHNA 3M3CA 3VKNA 1W6NB 2DYCA 3V0BB 4I30A 1RIRA 1WLCA 5CBLA 4FP2A 4BLJA 3IPVA 3UJQA 4FOYA 1QMJA 1LGNA 3WCRA 3OY8A 3B00A 1JUIA 1KJLA 2A75A 1G9CA 1W6QA 3O0WA 1MZ5A 1SLBA 1SLAA 1VLNA 2DUPA 1ULDA 4YGBA 5T5LA 4BM8A 4NOTA 1V6KA 2ZACA 1APNA 1LENA 1N3PA 3TAYA 1CESA 3PVNA 4ZKTB 1QOTA 3B69A 4YGDA 1NXD1 3SITA 1N1YA 2DVBA 1IS3A 1DQ5A 1ENRA 4FPCA 1QDOA 4W65A 3AP4A 5SV8A 3WNXA 1GNHA 3I4IA 4PQ9A 3ZVXA 1UMZA 2ZMLA 1F9KA 3VKFC 4TYSA 4WVVA 3ZPYA 4F83A 2RHPA 4FPOB 2A6XA 3AYCA 4BQ1A 1IS4A 4AWDA 4Y26A 3ZSLA 2YROA 4C1XA 3VUOA 3O0VA 4LBQA 2AH2A 4KBBA 1OKQA 3D6EA 3FLRA 3GALA 4UW4A 3D5OA 4XXAA 4YG3A 3WZ1A 2EXIA 1AJKA 4Y1UA 3SH4A 2NN8A 4XXPA 1GYKA 4FOVA 1LOCA 5KXCA 1MVEA 2DV9A 3MW4A 4M3CE 3V0AA 1GZWB 2UU8A 1V6JA 3AXDA 3RMYA 3AZXA 4YW3A 4XIOA 5GZEA 1OFSA 2WT2A 3W58A 1GBGA 4LBQD 4LBNA 1MR5A 1H9PA 5JMCA 1S0CA 2ZHKA 2JE9A 3M1HA 1DZQA 2NM1A 3HMYA 1N1SA 2D6NA 4ZXKA 2E7TA 3WUDA 2PHFA 1DLLA 2GMMA 1WBFA 5DZEA 3N3HA 4Y22A 1KDMA 3ENRA 1SCSA 4Q1RA 3M3OA 1UPSA 2A6WA 2CY6A 2EXKA 4XILA 1S0GA 2ZGNA 2CTVA 3WG2A 1FV3A 4GALA 4BMBA 5KXBA 5GZDA 4GWNA 3AZZA 1LOBA 4JC1A 3CNAA 3HR9A 2GALA 1WW6A 3H0OA 3R4SA 1LOFA 2ZGOA 4Y1VA 4YG6A 1XQNA 4U36A 2W39A 1MS3A 1N1VA 2D3SA 1LHWA 4XJWA 2NMOA 3WHUA 3N35A 2DVDA 2P37A 4Y20A 2DVGA 2ZHNA 1LCLA 3AZVA 2VY0A 2WT1A 4ISQA 5IK5A 1QNYA 4XJ9A 4AYUA 5EYYA 5IT6A 5E88A 1W6MA 2G4IA 3FBYA 3AP7A 1AXKA 5DUWA 4M00A 1FX5A 3AP6A 3QLQA 1LHUA 1MS4A 1W6OA 2ZABA 3M3EA 1QGLA 4YW2A 4XE9A 4YG0A 2VU9A 4FOQA 3WG1A 1O4YA 5GLTA 3ZXKA 1LEMA 3AYEA 5JOXA 3WDUA 3AZYA 3USUB 5JOZA 3MPPG 1V00A 5CA6A 1FV2A 3T2TA 3T1LA 3FLPA 1CVNA 1W6NA 3V0BA 2D6OX 2DVAA 4XJUA 4YLZA 2PHWA 2R16A 2H0BA 3ATGA 1ULCA 1JOJA 1WW4A 3AK0A 3JU9A 4FPLA 4XBNA 1MS9A 2LTNA 3UJOA 4PF5A 2ZBJA 5GJ6A 3VV1A 2JDZA 4UW3A 3L2YA 2VW1A 1ENQA 3AZWA 2AR6A 1R1ZA 1WCSA 1Q56A 1LOAA 1Q8PA 4ASMB 3WDYA 4ATEA 4Q8KA 1SLCA 5T5PA 1ULFA 1MS0A 1WLWA 3T1MA 3NV4A 2DTWA 1HLCA 2NP0A 2R49A 1A8DA 2E51A 2P34A 2VW0A 2ZGKA 3BTAA 1BYHA 4JRAA 4XTMA 4YW4A 5F5QA 4FPFA 2DU0A 1AX1A 1AVBA 1GICA 1UAIA 3D4KA 5CB7A 1URXA 1NLSA 3KQRA 2CWSA 3I8TA 1A3KA 5JLVA 2OUHA 5EYXA 2YMZA 1DQ1A 4CRQA 5IK7A 1YYNA 4Y1ZA 1SLIA 1HQLA 1A78A 1RINA 2WSVA 2JD4A 1IKQA 1CONA 2GMPA 2ENRA 4YGCA 4D69A 1V6MA 2DUQA 1LU1A 4RA0A 5DUVA 4LBMA 2UWCA 1X50A 1VAVA 2UWAA 2XG3A 4Q2FA 1CQ9A 1VAMA 4YZ2A 1SCRA 3UL2A 1GZWA 1MVQA 2W68A 1C1LA 1SBFA 2ZGPA 4H55A 3C2UA 2ZHMA 1HDKA 2D6PA 2DUOA 1Y7BA 3O5SA 2A71A 5IUQA 1ZA4A 3SLIA 3WOGA 1JYIA 1KJRA 1JBCA 1LEDA 4YFZA 1IKPA 4JCKA 1IS6A 4P9XA 3WLUA 4UW5A 4YZ4A 4XYXA 5LK5A 4DRRA 4R9CA 4FPEA 3BIWE 1CR7A 3N7KA 1CPMA 5JVVA 2FHRA 4R9DA 1QOSA 3ILRA 1JN2P 1GANA 1AJOA 5T55A 3U4XA 2ZA9A 2GNMA 1WW5A 5T54A 2ZGQA 1DIWA 2WLQA 1F5FA 2GNBA 5GZGA 4TZDA 3V65A 1HKDA 1V6OA 3AX4A 1WBLA 3NV2A 4M01A 4P9YA 1TEIA 4FVVA 2OW4A 2DVFA 1D2SA 1BZWA 1QNWA 2EAKA 1G8WA 2D6MA 3TB0A 3WHTA 4K1ZA 2UWBA 5DZGA 1J1TA 1W0PA 3NWKA 3ZXFA 3A4UA 4LBKA 1AXZA 1HQWA 3DUIA 1BJQA 1W6PA 3WCSA 1S0FA 4U2AA 4YZ1A 3OPZA 2CNAA 3LSDA 4XJ8A 5CNAA 4XJZA 2AUYA 4Q26A 1PZ9A 2DU1A 1S0BA 3MEPA 4RL7A 1GSLA 3W59A 5EXOA 2WQZC 3APBA 3DGTA 1JYCA 5E89A 1ULGA 1U0AA 2PHRA 4YW1A 3AFKA 3WDXA 1Q8OA 3SH5A 3IKWA 3INAA 1W6PB 1IS5A 3FUQA 2A3YA 4ISRA 5FREA 5EWSA 1SBEA 3RG0A 4DPNA 4XHXA 1UX6A 5HCFA 3ZSMA 2A6VA 1DQ2A 1MS8A 1LHOA 3O0XA 3UK9A 3USUA 2D6LX 2V5YA 1MACA 1FNZA 4CTEA 5DUXA 4DQAA 5FRAA 4BMEA 1EPWA 1DYKA 4ATFA 4YZ5A 3V64A 2GDFA 3NV3A 5DG1A 4OZXA 4GXLA 3RQ0A 5T5JA 1CPNA 2A70A 1YRZA 2PELA 1S0IA 2D3RA 2OUJA 2NZ9A 1DYPA 1S1AA 3M2MA 3SNMA 2ES3A 5HCBA 5JOWA 2WJSA 3OYWB 1WD4A 1YI7A 1WUVA 2ZZJA 4YW5A 1VALA 4Y1XA 1AZDA 2A6YA 3O12A 4GWMA 4XJAA 2ZAAA 4XBLA 1O4ZA 4FPHA 1YO8A 2GNTA 2A3XA 3SISA 3FUOA 1DHKB 2EIGA 2YZ4A 4AGRA 4LBOA 3AP9A 4Q8LA 4YM2A 1N47A 3AXEA 5H9QA 2DTYA 1V6IA 3AJZA 2A6ZA 3OGGA 4SLIA 1QF3A 2P3KA 4FOWA 2AENA 1SLLA 3B9CA 3B01A 5IK4A 4DFSA 2D44A 2EF6A 1GZCA 2ZHLA 1FYUA 1QU0A 4Z8BA 4WV8A 1CIWA 3M3QA 1OQ1A 1LHVA 3AYAA 4XOGA 2KM2A 2TEPA 2SLIA 1SBDA 3JUUA 1S0DA 3VKLA 1V6NA 1LESA 1C1FA 1ENSA 1ONAA 2E7QA 3RS6A 2JE7A 3IMNA 4YZ3A 1DQ6A 4Y24A 2Q5TA 2VXRA 1G9FA 1Q8QA 1SFYA 2P3JA 2CL2A 2ZKNA 1G9AA 2OVUA 2E6VA 4FQZA 1GV9A 5KXEA 3RMXA 1FNYA 1LOFC 2FMDA 2ARXA 2A3WA 2LALA 5GLUA 1PZ7A 1LJ7A 5H9RA 3KM5A 1H9WA 2HYKA 3POSA 3HN1A 1BXHA 1YIFA 2E53A 2AYHA 1LU2A 2ERFA 2Z42A 3MW2A 5E8AA 1SACA 1AXYA 5T5OA 2ZMKA 4M3CB 1UZYA 1GLHA 1Z0HA 2XB6C 5JOYA 2CYFA 2V73A 1V6LA 1KITA 1BQPA 5CAZA 1DQ0A 2NMNA 4YM0A 3VKMA 1N3QA 1SLTA 2A7AA 4FPGA 2ZGSA 5F9TA 1F31A 2D43A 2ZGRA 4C1WA 2ZGMA 4Q27A 3ZXLA 4LBJA 1C4RA 4NO4A 2WNEA 4FPYA 3LCPA 1G9BA 3IPVB 1UZZA 3POYA 1GKBA 5HCAA 2I2SA 5DXDA 3OY8B 1AX2A 4P14A 1Q8VA 3ILNA 3NV1A 1W6QB 4DS0A 2VUAA 1DBNA 1MZ6A 1AF9A 1QKQA 5DZFA 4AVVA 1VIWB 1KQRA 2EXHA 3AJYA 3ILFA 3N7MA 2WSUA 3ZXJA 1DQ4A 1S0EA 3A0NA 3BOPA 1N3OA 4YM1A 4PCRA 2AREA 4YM3A 4YGEA 3SH3A 1Z78A 1BKZA 2JKBA 1LOGA 3IN9A 2ARBA 2P2KA 4XDQA 4UW6A 5GLVA 4WZFA 5GZCA 4AVTA 4PBOA 2PHTA 2PHXA 4WVWA 3WDWA 3FFZA 4XZPA 1C57A 4XTPA 3ZYPA 4XMIA 1WLDA 2YXSA 1KRIA 5IK8A 4PBPA 2ZGLA 3WDVA 1LULA 1MS5A 2ZGTA 2AGSA 3RSJA 2P3IA 3VKOA 2UURA 4GKYA 1G86A 2ZGUA 4XIKA 5GALA 1UL9A 3PVEA 3WG4A 4LBQB 4AVSA 4FQ4A 3WDTA 5GM0A 1FAYA 1LOEA 1UN1A 3BODA 3WG3A 3N36A 4M3CF 3LSEA 1WD3A 1YXWA 3Q9OA 1G9DA 2EALA 2NYYA 3AP5A 4K21A 4DRVA 4HL0A 4XHBA 1N1TA 3IM0A 1I1EA 3V0AB 1S0JA 2BQPA 2R0FA 2VW2A 3OYWA 5L73A 1GZ9A 2GMEA 5H9PA 3FLTA 1LECA 2D3PA 4HANA 4K1YA 2W52A 2CWMA 2YY1A 2B7YA 4BOWA 3OBRA 4MYEA 2GNDA 2YV8A 1B09A 1JXNA 4ITCA 2C5DA 1MS1A 4FP3A 3R05A 2C9AA 4L8QA 4Q1PA 4P9WA 4Y22B 3ZXEA 4CZSA 4BLIA 4XBQA 1CJPA 1JHNA 2JJ6A 4R9AA 2A5ZA 2VH9A 1RITA 3MW3A 5DUUA 2PHUA 5DG2A 3ZSKA 3OBTA 1KDKA 2WT0A 5JDBA 4AGGA 1LGCA 3PMEA 2JECA 2W08A 4IQPA 5AVAA 1AX0A 3QCWA 3B3QE 3ZYRA 2DURA 4XMAA 1W0OA 1ZM1A 3A0KA 3WUCA 4YFWA 1PZ8A 1H30A 3ASIA 3WVJA 1WW7A 1DFQA 3N7LA 5T52A 5BYNA 3WV6A 1LGBA 1G7YA 1FATA 2R1DA 2R1BA 1JW6A 4Y20B 2SBAA 5H9SA 3PJQA 1GNZA 1QDCA 4FPKA 1ULEA 2EXJA 3N7JA 5GLWA 3POWA 4GA9A 3ZSJA 1W6MB 1CN1A 5KXDA 1LODA 2GN3A 1I3HA 2D7FA 5T50A 4BPZA 1W6OB 5GLZA
chains in the Genus database with same CATH superfamily
1Q8SA 2WKKA 2VOWA 4K20A 3W20A 5A3WA 4B1MA 4Y1YA 2BTVC 4F8AA 5FP9A 2Z5WA 1DG6A 3VZMA 3E5UA 2QJVA 5IW0A 1GU3A 1CAVB 2YU2A 2GN7A 1LHNA 1W6NB 3V0BB 1Y9MA 3VZKA 5CBLA 1O5LA 4LO6B 5FXZA 4DUXA 4EZHA 4YW6A 4BZ4A 3KF5A 1VBE3 4LEJA 1LGNA 4QDRA 4NHLA 1GNYA 4QB2A 3K3OA 5LA2A 5L36A 1JUIA 2VMGA 5L9BA 3RZLA 1XNCA 3ZYBA 1ZZBA 1NYWA 4BQYA 3OUIA 1QQP2 5A33A 1SLBA 2DUPA 3IZOA 1GP5A 3WD5A 4BM8A 2HWD1 5CFCC 2QQJA 2ZACA 1TMF2 3WNMA 1N3PA 4WM7A 1CESA 1RUC3 1SPPA 3HWJA 3TWIA 4ZKTB 1QOTA 4RYDA 5EQUA 5EFUA 5C8CC 4N53A 1DF0A 3GYDA 2AEYA 4FPCA 4XUNA 3HVDA 2QQNA 3DCQA 1GNHA 3I4IA 5FPZA 5FXWA 4R4XA 3ZVXA 5FZ4A 1F9KA 4QQLA 3ZPYA 2RHPA 4J1WA 4FPOB 4KQ7A 2Q1MA 2ZX1A 4AWDA 1PGSA 2QQVA 3M7AA 3ZSLA 5JPMB 3VUOA 2RM22 4JQRA 4B8EA 4C1XA 3E6DA 3OEAA 5A3LA 3MFAA 4F7ZA 5FYZA 3GALA 4UW4A 3D5OA 1GQGA 5A3PA 3J7HA 3WZ1A 1W03A 2EXIA 2ORZA 1AJKA 2XMLA 3SH4A 5A70A 2R30A 4FOVA 5KXCA 2E7AA 4LMFA 1Y9QA 3POFA 5FMOL 1GZWB 1RHI1 2UU8A 1RMU2 1MPXA 3AXDA 4LA2A 1XNKA 3KVAA 3OF1A 1J59A 1UYYA 1RB8G 4JRLA 4LBQD 1ZZ8A 2W91A 4KG8A 1MR5A 2ILMA 3ZN4A 5IFPA 5K9YA 4FCAA 2ZHKA 3U1XA 5FYVA 1DZQA 4MGZE 1N1SA 3AC0A 1ZBA3 2PHFA 1PVC1 5I0TA 2JG9A 4NN0A 4RHV1 1EAH3 1H1IA 1BBT2 2W47A 2WWUA 3AB0A 4H7MA 4NWWA 4Q1RA 4AK3A 4K6BA 4AFDA 3DXUA 3DL3A 2XJSA 4QPGC 1VMFA 5JR7B 1YFUA 4EZ4A 3VBSC 3WG2A 4NIGA 3PUAA 5J3UA 3A21A 2J1RA 3N9PA 4J6GA 4B7EA 1JZ8A 2R072 1LRHA 3M4FA 5GZDA 4CUAA 4D7TA 3AZZA 4CU8A 2GU9A 2ID4A 4JC1A 1VBD2 2YUEA 2CV6A 4CCNA 5A7OA 1CD3G 4OI4A 4OHZA 5HV0A 4A7KA 2TBVA 2WFF3 1W06A 1HRI1 4MGYE 2J1TA 2G9FA 4NAMA 1N1VA 1US2A 4AEDB 1LHWA 1AYM2 2DVDA 2P37A 3D0SA 1GFF2 1NCQA 2J1VA 4Y20A 1ODMA 5FZ6A 4CU6A 2C1FA 1GOHA 4NIIA 4B4QA 2VY0A 2EVXA 2MPFA 1UZWA 1DGWX 1VJ2A 4CCEA 5IT6A 1ZZCA 2G4IA 2XWBB 3AP7A 3FBYA 1NA1C 1DZTA 2P4EA 3ZKYA 4FTBA 2A73B 1AXKA 1YNAA 1S2BA 5DUWA 4YVSB 2VZVA 1K45A 5A7PA 4Q4X2 1MS4A 1VRH3 2QTWB 4QB1A 4DOUA 3AMQA 1XYPA 2ZABA 2J1EA 1RUD1 1UO9A 4OHXA 2IXHA 4YW2A 4K8RB 4XE9A 2ETEA 2ARAA 2VU9A 1V9U3 4YG0A 5CG8A 1O4YA 4LLFA 3O1VA 5GLTA 3ZXKA 4AE2A 2HH9A 3FX3A 3AYEA 3UT0A 4TLGA 1DGRA 2AEZA 3THTA 2X10A 5LBBA 2GP3A 3H3UA 4D6QA 4NMIA 2C9KA 1VRBA 1FV2A 4NHKA 1L7QA 4UAPA 3T2TA 3WX5A 4CCLA 5CA6A 2D6OX 2DVAA 4D0QA 5G04L 2ZEYA 2BYVE 3ATGA 1ULCA 1OPOA 2XOMA 3AK0A 3WW4A 2QKDA 3R0RA 5A7NA 3UJOA 2VVFA 3TRSB 2RDQA 3AZWA 1UXXX 5LBFA 1Q56A 1FPN2 1ZZ7A 3PUIA 3O7OA 4Q8KA 2HWB1 1OOPA 1SLCA 2BW8A 3W21A 2B42B 1BVP1 2DCJA 3W5MA 1QJY1 2DTWA 1HLCA 5FDBA 2NP0A 2HWD2 5C3OA 1H8TA 4C90A 1YLLA 1BYHA 4JRAA 4YW4A 5F5QA 2GC2A 2DU0A 1OA4A 1UAIA 5EJZB 5FZLA 5HPOA 4OMDA 4A3ZA 4MOAA 4AZZA 1W2UA 1A3KA 4O7XA 1NZCA 4JGZA 5EYXA 1DQ1A 1JI6A 1U5ZA 3N9QA 1NQDA 4Y1ZA 1IPJA 1SLIA 4K40A 5J7MA 4QPYA 3I3DA 2VNOA 4BU2A 2VZTA 1QJU1 5FZGA 1V6MA 1RUJ3 3NW4A 4RA0A 3WNOA 5IVJA 1WMEA 3Q8AA 2UWCA 3ACIA 2UWAA 3RGBA 4CDXA 5FY5A 3GCXA 3LPGA 1UYZA 3P3PA 3IDBB 2K9ZA 2BGOA 3Q8CA 4FT8A 3ORJA 5BNNA 2ZHMA 2DUOA 5IUQA 3SLIA 4RQPA 3WOGA 3NAPC 1RHI2 1LEDA 4JCKA 5FK7A 3VDDB 3KV9A 2UYAA 3RYKA 1VE0A 4GD4A 5D8AC 1Q43A 2FD8A 4FPEA 3JQXA 1G6NA 1RUF1 3N7KA 4AI9A 5BNPC 1K5MC 2XL9A 3VBSB 2P6CA 2JENA 4RFRB 5BNOA 1GANA 2QZ3A 4QXKA 2WNVC 5T55A 3U4XA 2FDFA 2GNMA 4GH4B 5FZCA 4URAA 2ZGQA 1DIWA 1F5FA 2GNBA 1PVC2 2JDUA 4HT1T 4RHV2 2YGMA 3V65A 3RI9A 1TME1 2WWJA 4IEQA 1V6OA 4XC9A 3EXUA 3HEIA 3AX4A 3I3BA 4DINB 2BOJA 2OPWA 4N43A 4FVVA 1ZRIA 1OKOA 2J1AA 1ZZ9A 1OXCA 5KWRA 1ULOA 3K4AA 4GWIA 4IL7A 1J1TA 1W0PA 3PDQA 4NRMA 1UOJA 1MEC3 4BXFA 4LBKA 1HQWA 4O9GA 2X05A 1S0FA 1AR73 4U2AA 2ZX0A 1HRI2 3E5QA 2E31A 3WQ0A 4YZ1A 1GOGA 1HRV3 5F2SA 4XJZA 1D4VB 2AUYA 4Q26A 1S0BA 2ZAHA 5EXOA 2WQZC 3HQRA 5I91A 2R063 5APAA 4IV1A 1T2XA 3ZFGA 4LUMA 5A1AA 2PHRA 1OA2A 1OC1A 3LIHA 4JAAA 3AMPA 4XAAA 3VZJA 3AMNA 4COUA 1YWKA 4CU9A 1C8M1 2Y6FA 4IW3A 1OFNA 5EJ1B 3D0JA 5JIAA 3T08A 1RUD2 3P1IA 2JB4A 1UU5A 4MGTA 2R043 4V2WA 1VBA3 4QX0A 2MNGA 2HWC1 4Q4Y3 5DPNA 2IUWA 4O65A 4YZ5A 1CX4A 1D4M3 5DG1A 4OZXA 4GXLA 3RQ0A 5JI9A 1NQJA 5CFDB 2D3RA 1IPKA 2WQ8A 3M2MA 2ES3A 5HCBA 5IJRA 1QH7A 1YI7A 4N7UA 4YW5A 4CDWB 2RV9A 2XLAA 1VALA 1AZDA 4GWMA 3AKSA 1O4ZA 3FWEA 4FPHA 5EPAA 5B4NA 5C4WC 4B7KA 4BIFA 1E5IA 2HWB2 3FUOA 4O61A 1RVF3 4LBOA 2QCSB 3OGJA 2VJXA 1QJY2 3AP9A 1N47A 4ET7A 5J48A 4FTSA 4X8PA 5JXHA 3I54A 5FJKA 2A6ZA 4SLIA 2P3KA 4FOWA 4L0PA 1HW5A 4IDZA 2AENA 3MYXA 4HLTA 3B9CA 3D3AA 1V0AA 2EAAA 2XVGA 4CDUA 1GZCA 4OVEA 5I0RA 1CIWA 3POEA 1VAKA 1EUTA 3AYAA 4NRQA 5A7WB 4BA6A 3SQOA 4HONA 3UNPA 1C1FA 1ENSA 3AL5A 4IEPA 4XFFA 3WR0A 2W95A 1UIJA 3ZIWA 4KWKA 3KZ4C 1JZ5A 3HBKA 2E7QA 4P9LA 1JOBA 2BV4A 3IMNA 1U5XA 4Y24A 4XUQA 2VXRA 1G9FA 1Q8QA 1QJU2 2K2SA 4MVTA 1MQTC 1W9YA 2YC4A 5F3GA 2Z69A 2VGDA 4A2UA 3SC7X 1GV9A 1HB1A 3LAGA 2N7GA 2O1QA 4TSVA 3L2HA 1ACCA 3VD7A 3B94A 2WNVB 2XKOA 2FMDA 2LALA 2A3WA 4E4DX 1P8JA 1PZ7A 5H9RA 5J1XA 1L7RA 2OQ7A 2W9XA 3LE0A 2X5IC 3KM5A 3DYPA 1NXMA 3DECA 5FZMA 1BXHA 1OPMA 5FYTA 5FO9B 3B5LB 4PJYA 3ZFEB 1LU2A 1A8MA 4KWUA 1CGPA 3J7MA 2ZMKA 4Y33A 3ZDVA 1UZYA 2P6HA 4YPJA 1NT0A 2YBKA 1V6LA 1KITA 1LNSA 3Q8EA 1ZRDA 1PM4A 4OMCA 3VKMA 2XJRA 2B46X 3HIFA 3OOXA 1H0BA 4I09A 5EHDA 1SLTA 2PA7A 1BEV2 5C8WA 1YIPA 5F9TA 3BTYA 4C1WA 2ZGMA 1EV13 4Q27A 3UV9A 3ZXLA 1C4RA 2ZXQA 3ZOIA 5KR7A 3RZGA 5JZGC 1BMV2 3BN6A 5JPNB 4CDQC 4LULA 2XHKA 4OI2A 3IPVB 4QHOA 5FJHA 2B39A 2C24A 2DFCA 4Y5Z0 4E27A 5JXIA 1NCRC 1XC6A 1QY4A 1COV1 1YFYA 2ATFA 3OY8B 1AX2A 2ZOEB 1R1A1 2RVAA 4QX3A 3RPQA 4EJRA 2VUAA 3T0AA 3WNKA 1MZ6A 1AF9A 4AVVA 4LO5B 3UGHA 3ES1A 4S2GA 3ZXJA 4EWDA 2GSYA 1S0EA 3BOPA 4PCRA 4UFJA 2VTXA 2PQQA 2Y60A 3KCCA 1LOGA 1QJZA 4OQ8A 3GXUA 1X8EA 2PHTA 4WVWA 3KMHA 4IV3C 3K4ZA 3RFRA 3ZYPA 4XMIA 1WLDA 1QXRA 4DXRA 1C8M2 4XABA 5IK8A 2ZGLA 2PMWB 1LULA 2ZGTA 4Z07A 3WDVA 4Q4V3 4XF0A 4AEKA 2FQPA 5I0DA 1E5RA 1G86A 4GKYA 5GKAC 1EP0A 1K5JA 1NZIA 3PVEA 2KR2A 4XW3A 4M3CF 3MLKA 4A41A 2HWC2 2R073 2CGPA 2PHLA 2WABA 1YXWA 3LSEA 3OUHA 3DN7A 2D5FA 5JI7A 5C4WB 2DDUA 1H6XA 3HPNA 1N1TA 1NAEA 2WS91 3VBUA 2R0FA 5K0UA 5L73A 3TOJA 1YUDA 3UKTA 5K4LA 2FDGA 4CCCA 5FYIA 5FYSA 2E32A 3H7JA 2UY9A 4CP9A 5J09A 4KMQA 3RYRA 4HANA 3FJSA 2VMCA 4HKLA 4K1YA 4R4ZA 3MBWA 4XF4A 1IHMA 1B35C 2YY1A 1JYWA 3OBRA 4A7YA 1YHFA 2YV8A 1B09A 2Y0OA 3LEGA 4ITCA 2VECA 1NLQA 1GUIA 2C5DA 1MS1A 2PHDA 3MPBA 1PX3A 3POBA 1X36A 1YQ8A 3DPRB 3E97A 4FP3A 4IETA 4L8QA 4CCJA 4YYOA 2EIEA 5FP7A 1JHNA 5FO8B 1YI9A 2A5ZA 2VH9A 3DV8A 4K7JA 1RITA 4XF3A 5C33A 5FQ0B 3PU8A 4I3PA 4D7SA 1YJLA 1Z7S3 3EQEA 5FY7A 5HBAA 1F5JA 3RWKX 3ZX7A 1IZ3A 1RL3A 3JBG1 4KU8A 4Y5TA 4AI2A 1XNDA 3B3QE 2P5BA 2RS33 2ZX4A 1ND3C 2W3JA 3MV11 5KHHA 2RMU1 4R52A 3WEZA 1TNFA 3NSTA 4A44A 4CCOA 1VBC2 3AFGA 4IE0A 4B1LA 1W9WA 1J3QA 3ASIA 3WUCA 4A6SA 5F37A 4JQTA 3KT7A 2QQPA 1H1AA 3RNSA 1JTZX 5T52A 1ASJ1 2PAMA 4YVWC 4B29A 2WR9A 3R6SA 1FATA 4LA3A 1S55A 2WNUB 4FPKA 5HI0A 5J96B 1H8VA 3OGRA 1UZVA 2EXJA 4GA9A 3ZSJA 1W6MB 4L99A 4COWA 1GMMA 3AKRA 4FXGB 2BGPA 1R093 2D7FA 4QKNA 3N9NA 3DYOA 1POV1 1IOAA 4FPJA 5GZFA 4AGVA 4BB3A 4M3CA 1X8MA 3CKHA 3OJBA 2DWRA 2RS13 3MDPA 4YWAA 3OG2A 3PVOA 2HWE3 3KGZA 3AYDA 2JDPA 4DMIA 2V5DA 4ORFA 1JYXA 4MSVA 5FTTC 3LZZA 3VKNA 2Q1ZB 3NNGA 1OURA 2C4XA 4I30A 1RIRA 1WLCA 1NKGA 4X6QB 4FP2A 4BLJA 4Q0QA 3UJQA 3VBHC 2MEV1 4FOYA 4E4ZA 3KV6A 5HXVA 4CSWA 2B4KA 3B00A 1PX4A 4QKFA 5HXMA 1PO13 1W6QA 3PUSA 1MZ5A 2J1UA 1COV2 4TN7A 1SLAA 1R1A2 1FOD1 3CDZB 4YGBA 2HEWF 4AXOA 3ZLIA 5F5IA 1AR63 2CU5A 3JZVA 1APNA 2BJSA 3VBRA 1OH3A 1ND2A 1U5YA 2HEVF 1PO23 4JGYA 1XPWA 1NXD1 2GC3A 4A4AA 1N1YA 5CYYA 1Y9GA 3BOWA 3I7DA 4MX3A 1ENRA 4XQWA 4W65A 1E5SA 4CEWA 5SV8A 1QQP1 4PQ9A 1XYOA 2QVSB 2ZMLA 4MO3M 2AACA 4EE2A 4JKLA 2VOKA 4XEZA 5IVEA 1IS4A 4LTAA 1RUH1 1W9SA 2YROA 3O0VA 4LBQA 5FPBA 2DCZA 4UF0B 3TEXA 4CXYA 1OKQA 4QPIC 3FLRA 4XXAA 4Y4YA 2B5HA 4XXPA 2LS6A 1GYKA 5FUIA 1B35B 5FZ0A 4HXCA 1V6JA 5DAQA 3IMMA 1CAUA 1PK6A 4XIOA 2XKPA 2VZUA 2WAOA 5IVBA 2WT2A 3U0ZA 2WAAA 3F2ZA 4AVAA 1GBGA 2RDNA 5EV7A 4AQTA 4YSFA 2VCAA 1HXS3 1ZREA 2ET7A 2JE9A 2NM1A 4MH0E 2VL4A 2VR4A 4UYBA 5FY8A 1RMU1 3OBAA 3J8F1 2GMMA 3I3EA 5DZEA 3N3HA 4V2VA 1KDMA 2ZS6B 1CAXB 1VPHA 2BU9A 1YC61 2A6WA 5LZ6A 2FMYA 2OZJA 3VBOC 1CAUB 1QJX1 4XILA 3RWNA 2BUKA 1S0GA 3PUHA 2CTVA 4BISA 1OHFA 2I07B 4J25A 4NPRA 3WNLA 4IE6A 1FV3A 4IESA 2YC0A 3KV4A 4JTOA 3NNLA 5FKCA 5FZIA 4YVWB 1OD3A 4BIOA 3VN4A 2WZR1 2JIGA 3LEMA 4AF9A 5L7OA 1I5ZA 5JXJA 2HJIA 5C3PA 1PMHX 2GALA 4QX7A 5FPXA 4QGLA 5FIXA 4HG6B 1LOFA 2QZ2A 1UNBA 5ABJB 1VB4A 3FE5A 4EN0A 1XQNA 4IGOA 4AI3A 1ZNPA 2RMU2 2VOXA 2W39A 1MS3A 4XFHA 4COYA 4XJWA 1WCUA 3J7NA 4QGNA 3N35A 3WHUA 5DDJ1 3SCFA 1L3JA 2ZHNA 1ASJ2 3RI8A 3AZVA 4WM7C 1VBD1 4RR3B 1QNYA 4XJ9A 1UQXA 4LR4A 4N53C 3I59B 4IGPA 1WGPA 2IXLA 4LHNA 4NJ4A 4UFIA 1DCSA 5FZOB 3ME2A 3AP6A 4LIVA 1PMJX 5LW9A 2PFWA 3AMHA 5IAXA 5C9AA 1CAWA 4SBVA 2LUWA 3M3EA 3NMBA 3VZLA 4KI5M 2WDBA 4CP1A 1QGLA 3ABZA 1SHWB 1WCKA 4FOQA 3CMGA 4COVA 4LE3A 5LWBA 1SDDB 4KL1A 1LEMA 3VBHB 3VHNA 1ALYA 4Q4X1 5FLJA 4LXLA 1CAVA 3C7FA 3HNYM 3ZFFC 1CVNA 1W6NA 3V0BA 2PHWA 4MLOA 1E57A 1TE1B 1JOJA 2XBO3 5JXGA 1Y4WA 3JU9A 1JU4A 2VZ3A 1EY2A 3LD8A 5AC91 5A3TA 5GJ6A 1GOFA 2JDZA 3CJIA 1AR92 2MEV2 3L2YA 1ENQA 1R081 2AR6A 1R1ZA 5L19A 2PAKA 1Q8PA 4RGAA 2VQ0A 3FBMA 1V70A 1W39A 1ULFA 5A7QA 4HKOA 2W1SA 3DF0A 3T1MA 3H8OA 3NV4A 3HAGA 4WM8B 1FOD2 1A8DA 2P34A 2WINB 3JD71 3BTAA 3S7EA 3EO6A 4Q4W1 4FPFA 2QQMA 5HCHA 1FPN1 4HSJA 1URXA 3CJIB 1NLSA 1RUF3 4Q29A 2CWSA 4QX1A 3I8TA 4EQVA 2OUHA 4IERA 2VTFA 5IK7A 1YYNA 1RINA 2XQXA 3ZMOA 1HN0A 1ZBE3 2JD4A 1IKQA 1RUH2 1RUG2 2GMPA 3HT2A 2JX9A 2W87A 4YGCA 5AVPA 1TME3 3PTYA 4XPVA 5DUVA 4LBMA 4W6WA 2XG3A 1VAVA 3TN91 2IXKA 2G19A 4FFHA 2XLFA 3QOPA 1GZWA 4HK9A 3UL2A 2WO1A 4FFIA 3WNNA 1QJEA 2A71A 3OD4A 2I74A 2WN2A 2Y6HA 2YFZA 5T3NA 4AFCA 4YFZA 2IVIB 4P9XA 2HWF3 3T4HB 1QHDA 5IYYA 4JHZA 4YZ4A 1HB4A 2H6CA 3LPFA 3PJYA 2RR11 5LK5A 3UESA 3VBOB 5JVVA 2FHRA 5CKNA 1QOSA 2GC0A 4META 1ZRCA 3ACGA 1JN2P 5C3RA 4QQPA 1WMFA 1WW5A 3C8XA 5T54A 4W8JA 4LNVA 4CEYC 4CUBA 3J8F2 3BI3A 5B4XA 1ODNA 4W4ZA 4Q5OA 4OFGA 4P5HA 1WBLA 3BPZA 1QJX2 1C8M3 1UYXA 3LDKA 4P5YA 2DVFA 2DBNA 2YC2A 3WHTA 4LPLA 2UWBA 2WZR2 4RS5B 5DZGA 5F6LB 3WF2A 2E26A 3L9JT 3A4UA 1KGYA 4AEDA 4OI1A 4LORA 1W6PA 3LWCA 1J3PA 3WCSA 4D94A 4FAHA 2K0GA 3I2GA 3OGSA 1EYBA 4CYDA 3LSDA 1SFNA 4XJ8A 4FBFA 5B2GB 1WA4A 2ZZQA 5DDJ2 1OLRA 2AC1A 5BY5A 3W59A 1WMXA 3GJBA 3APBA 1C8NA 2PLV1 3DGTA 5E89A 4YVSA 1Q5OA 1U0AA 4P9JA 1XXNA 4QDSA 2FDHA 5FPVA 5HV4A 2VQUA 4PDWB 3SH5A 4I0BA 3JXSA 1GWKA 1RUE3 1F8VA 3INAA 4JGZC 1W6PB 4N7IA 3ZFFB 2A3YA 1O6UA 5EWSA 1SBEA 3HQXA 4DPNA 4AFMA 2FDJA 5HCFA 4IEUA 2OIIA 1NUKA 3ZSMA 2A6VA 1DQ2A 1Y3TA 3O0XA 1MZFA 2D6LX 2G9ZA 2V5YA 3LA3A 3F95A 3MFCA 4CDXC 4IE4A 3U75A 1AR81 1DYKA 4DUVA 1F35A 2GDFA 4B4RA 2NPIA 3AKQA 3NQHA 5BNNC 4AL9A 1YRZA 4LKDA 2PELA 4RQPC 3TNPB 5FYMA 1S0IA 2OUJA 4EWEA 1S1AA 4QM8A 2IVJA 5F5CA 1XSRA 4IE7A 4Z2WA 1X9PA 3OYWB 4FAGA 5C8CA 3OSDA 2BVVA 4ZZ5A 2VAUA 5AC92 4XJAA 5FPAA 1UKRA 2ZAAA 4XBLA 1R082 4XFGA 4W50A 5BNOC 3POIA 1DYOA 4LQRA 1YQ5A 2JDMA 2EIGA 5FZ1A 5L9RA 4FFFA 3K2OA 4TTGA 2E33A 3PUQA 3AXEA 4YM2A 1REFA 3DXTA 5CFCB 1UW8A 2D98A 3AJZA 4KWJA 3JD72 4N43C 4QB6A 1SQ4A 5C8CB 2E63A 5C71A 3BKZA 3LB9A 4Q4W2 3B01A 1UOGA 1UY0A 2EF6A 2ZHLA 3H9AA 4C8DA 4DFSA 4I3GA 3BVCA 3GDBA 2TEPA 1XNAA 3JUUA 1S0DA 1V6NA 5FBZA 4KH9A 1ONAA 3VD5A 3THDA 2JE7A 3GBFA 3H42B 2Y0IA 3EMRA 5CVRA 5ACA3 5F3IA 2UY8A 5E6HA 2ZKNA 1RUI3 1W3VA 3QD6A 3TN92 4FQZA 2OZ6A 5FR3A 4IV1C 3WSOA 3ZFGC 3KHCA 2B9VA 2IXIA 3LA7A 3VDDA 1VBB1 2KD7A 4EYUA 4CEYB 2VZQA 3LA2A 4NWVA 3VBSA 2VNGA 3POSA 4H14A 3S30A 3U11A 2BP6A 1YIFA 2RR12 2VMEA 5IHRA 1O3QA 2ERFA 5E8AA 2BGCA 2OX0A 4K3UA 1CZSA 4EN6B 3I3QA 3JQWA 4GH4A 3WXPA 5LEKA 1YQCA 1Z0HA 5JOYA 3ON7A 2XJQA 2NMNA 2YU1A 4P02B 4YM0A 5FBJA 2X8KA 1N3QA 3LEKA 3VZNA 1F31A 3ECQA 4LITA 4RFT0 4QPGB 4UI9L 3E6CC 2FBEA 4LBJA 2YBPA 2WNEA 3LCPA 4E2SA 5LEJA 3RZKA 3CIHA 2BZDA 1UZZA 3POYA 4IEZA 3SEEA 4DY5A 1WZXA 2I2SA 4LKEA 3C7HA 3ZKUA 4GMP0 4P14A 1BEV1 2I45A 2VMIA 3NV1A 3MF9A 3OTFA 4LOTA 4IXLA 3I2IA 1KQRA 2XGXA 4QWNA 1BMV1 2XPJA 2WSUA 1VBE1 3VD9A 4YM3A 2WS93 1N3OA 1W2NA 2AREA 2G9GA 4H3WA 4AHWA 2ARBA 2PLV2 3DKQA 4GB32 4LO7A 4XDQA 4D8MA 4QU1A 2CAVA 1NA1B 3ES4A 2OKXA 3H8RA 3NNMA 1JYVA 4PBOA 2PHXA 5LATA 4AEJA 2ET1A 1AL23 5A80A 1RUC1 2IXCA 2IXJA 1MS5A 3VKOA 2ZGUA 1XSQA 4XIKA 4AVSA 1UL9A 5IVFA 3GBWA 3GHMA 3WDTA 3KCXA 3BODA 4HK8A 3PL0A 5LY2A 3I2KA 5FZFA 3BGAA 2XXZA 1SDWA 1AR82 2BWCA 4GULA 4WVZA 4QX8A 2NYYA 5FXXA 2VMHA 3AP5A 3JBG3 5CFDA 4HL0A 3U37A 3V0AB 3IM0A 2RJ2A 2BQPA 5CADA 4LIUA 4MADA 1QH6A 5AFEA 4X8NA 4CDWA 4UBGA 3LFMA 5F32A 3SH3A 1J84A 2D40A 2WO3A 2D3PA 5CISA 3D8CA 2KXLA 4UFKA 2CWMA 3IDEA 3GZUC 4QHBA 2GNDA 4QM9A 2WZPP 4XUPA 4LJHA 2W2IA 4P9WA 4Y22B 4BLIA 2ZX3A 1CJPA 4BK5A 2JJ6A 2OQ6A 4D7YA 2Q8EA 3RJRA 4QXBA 5I93A 3MW3A 4ZS3A 1UIKA 3ZSKA 2WT0A 4GJZA 3ZN5A 4AGGA 4B3NA 2J42A 3PMEA 2JECA 3KD4A 4P00B 2VQAA 4IQPA 5A7WA 1EAH1 1W8FA 1OD5A 3QCWA 2C26A 3ELNA 3ZYRA 5FMDA 3LDRA 4XMAA 1JUHA 2QE3A 3BB6A 1REEA 3NKTA 2X29A 5J98B 5F39A 1NLRA 4YFWA 3SHRA 1H30A 2X53S 3SKJE 3LFIA 3N7LA 5A6XA 1C5IA 1M06G 3WP3A 5JMOA 5BNPA 2R1BA 4ONUA 4IE5A 1FMD2 5LRSA 5D21A 5H9SA 1GNZA 5A6ZA 1ULEA 2WNVA 4XQDA 1VBC1 1PIV2 5FMBA 4OI0A 1H4GA 3M3IA 3I97A 2EA7A 2JICA 1LODA 3NAPB 1VBB2 4N8MA 4ES9A 1W6OB 3ZFEA 3EYPA 3U14A 4BQ2A 5D8AB 4O9EA 3MHZA 5EZWA 3R4UA 1M4WA 5FWEA 4BHPA 5BNPB 1H2NA 1K5MB 1LTEA 4BQXA 3ITQA 2QQLA 3H50A 5AFBA 3I3MA 3GNEA 4OYUA 4Q0SA 1UCXA 4LHLA 4XFAA 2JG8C 2R0HA 2Q8CA 1D0HA 1QOOA 1QQP3 2ADEA 1RYYA 1UD1A 5FUNA 1HJFA 1S2KA 2Y26A 2D5HA 4YW7A 4DXZA 5E1RA 4GMP3 2EIDA 3VD3A 5JR2A 5K0UC 1MZEA 1TMF3 3IPVA 3HNMA 4JDMA 1UMIA 1H2KA 2XWJB 4QXHA 1OBNA 1QMJA 4AQ6A 3BUCA 1ZA7A 3OY8A 5IFTA 5KBFA 4G3YC 2Q4SA 1KJLA 4ZU4A 3O0WA 2YB7A 1O4TA 2JE8A 3T4VA 2OA2A 3B93A 4RSUA 1ULDA 3UYJA 2XUMA 3N9OA 3TAYA 2CDPA 3TNQA 2RM23 4FO9A 1JHJA 3VDBA 3V56A 1VBE2 3CBNA 4I02A 4XZUG 2DVBA 1OLMA 1IS3A 5FCCA 1QDOA 3AP4A 3M70A 5FZAA 1PGL1 2VNRA 1JYTA 2JB8A 4W6YA 1ENXA 1YQ2A 1CIYA 4TYSA 3MLLA 1RMU3 3UETA 4AI0A 1REDA 3J8F3 3K4DA 4HETA 4NRPA 1QWRA 4BQ1A 3MIGA 4Y26A 4E9KA 1RUC2 4CU7A 2XUEA 3H3LA 2AH2A 2QFEA 1WCQA 4GWJA 5C3SA 1QJX3 3Q8FA 3NRUA 1OUXA 1TG7A 1F4AA 1TNRA 2VUDA 1LKNA 5C4WA 4XETA 3H8XA 1MVEA 2F17A 2JD9A 3PMSA 4M3CE 4NPLA 4OHWA 1UZ0A 3RMYA 3AZXA 2XL7A 1BBT3 1SMVA 4UBHA 5GZEA 3T30A 1OFSA 5BUVA 3W58A 4AHXA 1W8WA 1H9PA 1OT5A 3VBFC 5JMCA 4HFSA 1ZRFA 3HQUA 4QMAA 3S57A 2D6NA 3AL6A 4ZXKA 1H1MA 3HD8B 3KT1A 1O8SA 1VBD3 2J7MA 1DLLA 1JU3A 1WBFA 2WNOA 3DPRA 3H3ZA 3LOIA 4MZUA 3PNAA 3S6PA 3ENRA 3MGUA 4AVBA 1SCSA 2JDNA 4CVUA 4ZY9A 3WW1A 5CKMA 2EXKA 1STMA 2QDRA 1RXFA 4YARA 2FZ2A 1RJ8A 5FQ0A 3BTZA 4JVAA 1AYM3 2XVLA 3NJYA 4GALA 4PI2A 2WO2A 4BMBA 5KXBA 4S2FA 3W9AA 3FL7A 4HPKB 2Y6GA 3C7OA 3SCGA 3CNAA 1WW6A 1JZ3A 1EAH2 3H0OA 4KGGA 1IGOA 3R4SA 2WLPA 2ZGOA 3RZJA 3VLBB 2QQKA 2ZEXA 4A45A 2D3SA 4Q4X3 4RGGA 4E8CA 2NLRA 4KG0A 1H6YA 5DABA 3IDAA 5BV6A 3MUY1 4MGQA 2YFUA 4BCUA 4BXSV 2WNUA 2WT1A 2FDKA 1ND2C 1MQTB 3WW3A 3LOBA 5E88A 1W6MA 1MEC1 5AC93 3NNFA 1W05A 4M4RA 2AZ5A 2W94A 4OQ9A 4CEWC 1AR71 4M00A 1FX5A 1UMHA 3BU7A 1R083 3QLQA 5FOBB 3KF3A 1UPIA 4CCMA 2XJTA 1F4HA 3PLQA 4NIHA 2F4LA 1UXZA 4EV0A 5FP8A 2X5IB 3BPSA 5CIRA 2P1BA 5FY4A 4OHYA 4I0AA 2WYSA 3WDUA 5JOZA 3USUB 1H2LA 4Q4W3 5I0SA 2IFRA 5E16A 2Y64A 3OD0A 5FPLA 4Z92B 4HSLA 1RUNA 1FPN3 3T1LA 1VB2A 1QJFA 2O8OA 3KV5A 4XJUA 4YLZA 2R16A 1AUYA 2H0BA 3IAPA 1PK6C 3MIBA 4WVMB 4YRDA 2RDSA 4XBNA 1MS9A 5FZKA 4INDA 1RC6A 4XQ4A 1VBA1 4XDOA 2HWD3 3MF6A 4EN9B 4BJ0A 4QX5A 1XNBA 3VV1A 4Q4Y1 3S5AA 5JWPA 4AFBA 1BCXA 5JZGB 1YCIA 4UW3A 3LGRA 4CDQB 4PT6A 1D4M1 3B9IA 2WC2A 1LOAA 1NCRB 4LHKA 4ATEA 5IVCA 2QQUA 5LA1A 2FZ1A 4CP2A 3G6JB 4JZRA 5DQ0A 5IATA 3C7EA 2XJUA 4UFMA 4CPBD 1O3SA 2R49A 2VW0A 2ZGKA 3QH6A 1OMIA 1SZBA 1AR91 1SG3A 2Q30A 5C5UA 1UOFA 1HX6A 3GM8A 1AX1A 1GICA 5FLIA 4DO0A 4OHVA 2O8QA 2QQIA 5L7OC 4OUEA 5FWJA 5LB6A 1PGL2 3MO4A 2BDRA 1RVF1 4IEVA 5JLVA 2VBPA 4IV3B 1HQLA 4NVPA 1RHI3 1H2MA 1W8UA 4UF0A 1JMUB 2JDHA 2Z4FA 3KWVA 3CLPA 5A6QA 2VC9A 3CU7A 4D69A 2DUQA 2RS51 1LU1A 3KHBA 1UU6A 1X50A 4YZ2A 1VR3A 1VAMA 1B35A 3VBFB 5EIYB 1MVQA 2W68A 1C1LA 3OEBA 2ZGPA 4P9GA 3PU3A 3C2UA 1H4HA 2D6PA 1JYIA 1Y7BA 3O5SA 1EUUA 2CHHA 3MLJA 1PVC3 3SCHA 3ZXGA 1RUG1 2IZWA 1IKPA 2ZKLA 1IS6A 1AHSA 3PIJA 4OCTA 4RHV3 4OULA 4UW5A 4FXKB 1OVPA 1RUJ2 4QGMA 4XACA 4DRRA 3BIWE 1CR7A 3N4MA 4MUVA 4A3XA 3O1PA 4R9DA 1ST8A 4HMZA 3ILRA 3GHNA 3WQ7A 4MXWB 4MGSA 3ZMNA 4EWAA 1CAXA 2WWSA 1NE4A 2JDKA 4N90A 4AQ2A 2PLV3 3J26N 2WLQA 4D6SA 5FLHA 5GZGA 4TZDA 4AEMA 2WIIB 2V4VA 5JCTA 1HKDA 2QQWA 1HRI3 4YVWA 4M01A 4P9YA 2JIJA 2VPVA 3ZSEA 2OW4A 4JV4A 1D2SA 1BZWA 1X7NA 1G8WA 3ZYJB 4UWDA 4K1ZA 4XF9A 3ST7A 3A23A 1W9FA 5ABJA 3KVBA 2WA3A 1TZOA 1U5IA 4FI9A 3IAQA 5DAPA 3ALQA 2HLEA 1ND3B 3J4UH 1BJQA 3ZM8A 2VULA 1EV11 1UWWA 4L92A 5FFOC 1F2NA 2CNAA 4FFGA 1X33A 5CNAA 4RR3A 1RUD3 1PZ9A 2JWPA 4E2GA 2BPA2 3I59A 4RL7A 3G7DA 1OH4A 4GIQA 4P08A 4HOOA 5FZOA 3ROUA 1ULGA 4FTEA 1MEC2 4YW1A 3AFKA 1AR72 1Q8OA 2XR4A 5ISLA 2W5FA 3IKWA 2ZCWA 1HRV2 4BQ5A 1IS5A 1OVSA 3RG0A 3AM2A 4Z1VA 4XHXA 1UX6A 1T6GC 2LM3A 2WL1A 4AW7A 1YEWA 4URTA 5J37A 4DEQA 1MS8A 3HNBM 3VBHA 1W90A 2DCKA 2VXJA 1YQ6A 2R062 3MUZ1 3RVHA 4UXAA 3CJXA 5FRAA 3PURA 4BMEA 1EPWA 3WQBA 4OZOA 1GP6A 1RTVA 4XUOA 5G05L 3V64A 3VHRA 3NV3A 2O14A 4NPMA 5FZHA 3IBMA 4AI1A 5A3NA 5T5JA 1CPNA 4MG2A 4M0NA 1OLQA 4KGQA 3SXWA 4Z2AA 2HWB3 3GZAA 1DDLA 1GZTA 4Q4V1 1KS5A 2NZ9A 3SNMA 5JOWA 3UKNA 2R042 2WJSA 1QJY3 4H2AA 1ZX5A 1VBA2 1WD4A 1WUVA 2ZZJA 2VO5A 4NIDA 2ZEZA 1UY4A 2WZ8A 4Q4Y2 2A6YA 4Y1XA 4AOCA 4NR1A 1W8OA 3HN3A 3O12A 3UGGA 3IB3A 1YO8A 1D4M2 4OLLA 1W28A 2A3XA 3I2DA 3FFQA 4WM8A 4C91A 1DHKB 2YZ4A 3SKVA 5FP4A 2G1MA 4Q8LA 3QBQA 1UY2A 5ANNA 1W04A 5JSRA 1PHMA 1QJU3 5IK4A 3NNJA 4Z8BA 3ZN6A 2XJVA 4G4FA 1W8ZA 3M3QA 1OQ1A 1LHVA 2KM2A 4DIQA 2SLIA 1SBDA 2JG9C 3KCYA 1NX9A 3VDCA 1LESA 2GH8A 4AEDC 3W5NA 1RVF2 1TQ5A 1AYN1 3RS6A 4L97A 4AHYA 2Q8DA 4AAPA 5KHIA 1SFYA 1Z7S1 2P3JA 2YDEA 3T2OA 5FYYA 5J36A 3E5XA 1G9AA 2RS52 4AR2A 3S0MA 4QPIB 2OVUA 5BPXA 2RS31 4MHUA 3ZN6B 5KXEA 1BK1A 3WQ1A 4YVSC 2C0ZA 2ARXA 1L7LA 2OPKA 2XH6A 3TYJA 4XCAA 1LJ7A 2ZX2A 2D93A 3VBOA 1W2TA 5LCWL 3J9SA 1H9WA 2RG4A 1BEV3 3K75B 1BLZA 3N9LA 4LO8A 1NCQC 4BE3A 3HN1A 2E53A 2AYHA 2V09A 3U07A 3MW2A 2TUNA 1SACA 1AXYA 4JX0A 3T2QA 3C3VA 1GLHA 2GZWA 2XB6C 3DKWA 2CYFA 4P9IA 5LBEA 1YFXA 4BQ3A 4IUGA 3MICA 1BQPA 1R091 3OCPA 4XDPA 5CAZA 1KD7A 2B8MA 3K51A 1J1LA 4QD2A 2A7AA 3VHPA 1WWYA 2ZGRA 1IQDC 1TVGA 2XONA 1HN1A 1XYNA 2RS11 2L9LA 1W8TA 2VUCA 3OUJA 3P6BA 4CCKA 4E8DA 3GZEA 4RS5A 3WF1A 4NHYA 2B45X 2HWE1 5FZ3A 3EB7A 4DXSA 2YGLA 1O59A 4HKWA 5DXDA 1Q8VA 4UT5A 5LRRA 4DS0A 2XQRA 4QXCA 1W2OA 1QKQA 2BVBA 5DZFA 1EV12 5A33B 1VIWB 2EXHA 4MXVA 5I0UA 3AJYA 3ILFA 3N7MA 4DEVA 2W1QA 1DQ4A 3A0NA 2W46A 4WM7B 1SPPB 1A6CA 1UF2C 1Z78A 3I2FA 1BKZA 2JKBA 1PO11 4YGEA 5D1IA 5FZ7A 4A7ZA 4N53B 4A42A 4PDWA 4UW6A 3I49A 1DU3D 2DCYA 1OF4A 2HWC3 2Y34A 3LDBA 5LBCA 1HIXA 1OOPC 3ETQA 3WF4A 3ZFFA 5GZCA 3X29B 2VD7A 3FFZA 1AR61 4XTPA 4XZPA 3PTRB 1KS4A 4CP0A 2YXSA 5KHKA 3FZ3A 1PO21 4PBPA 3RYPA 1H8TC 2AGSA 3KT4A 2UURA 3IIAA 2VG9A 1O7FA 2VVEA 3WG4A 3EBRA 1HB2A 4GB31 4FQ4A 5GM0A 1LOEA 1UN1A 1VMHA 4QQHA 1D7PM 3N36A 4D3WA 2HBTA 1WD3A 1ZRRA 4NHXA 3NJXA 3Q9OA 2HBUA 2ZTNA 4YNIA 2VZOA 2Y6KA 4S2HA 4ZONA 1G9DA 2EALA 4K21A 3IT8A 3BU0A 3R4DB 3TBDA 1XU1A 1OSGA 3VDDC 3VB9A 4BK4A 2VW2A 3OYWA 4BQ4A 2YYOA 1JZ4A 1GZ9A 4PIYA 4Q4V2 5H9PA 5LY1A 2VTXJ 3FLTA 3RZMA 1LECA 3O1UA 3OB8A 3MIHA 3HBZA 3VZOA 4XFIA 3H7YA 5IWFA 1C28A 2ARCA 2B7YA 5IAVA 1U12A 1SFPA 4GH4C 5FYCA 4N9HA 3BCWA 1JXNA 3D82A 4IEYA 3ZXEA 3DYMA 4PHZA 2JG9B 2HYXA 4HN0A 4CZSA 5CFCA 1VBC3 4R9AA 3K77A 1HXS1 4HBNA 1CZVA 2PTMA 5DG2A 5DUUA 3OBTA 3VL9A 5C5TA 5FOJB 1LGCA 1O91A 5A7SA 4KNCA 5FPUA 5AVAA 4MGKE 3NJZA 3WP5A 1ZZ6A 4R8HA 4AFAA 2QQOA 2WBKA 2CGOA 4AQSA 3A0KA 4QX2A 1JZ7A 4PIZA 2A1XA 4XVHA 1WW7A 1AYN2 4Y3OA 2IWGB 4PIXA 1LGBA 2BOIA 3O1MA 2VZ1A 2J1SA 1XE8A 1Z7S2 1NCQB 4Y20B 3ZR5A 2WFPA 1QDCA 1I6XA 4QHZA 2RS32 4MGIE 1NY71 4Z82A 3IWZA 3POWA 5GLWA 4CEYA 1T6BX 3LIGA 1PMIA 3WW2A 1POV0 4GAZA 1FT9A 1O8PA 4BPZA 1BK0A 5DAVA 3T0DA 5GLZA 1FMD1 4JTNA 4MHRA 2VCMA 3RRDA 5A3OA 2VVDA 4KU7A 2BEOA 2D6KA 2VOVA 2ZMNA 1PIV1 5K8SA 5CG9A 2JDAA 1W2AX 4K9SA 4LK6A 4R9BA 4B4PA 4BDVB 4GKXA 1KEXA 3GF6A 3MV01 4LBLA 1UKGA 1DGLA 2ORXA 1R092 1COV3 3H1YA 4QPGA 4L9BA 5A6YA 5CFDC 2RJKA 3M3CA 4NUBA 4XURA 2DYCA 1R1A3 4I0WB 4N9IA 2XJPA 3MIFA 1YJKA 5KHGA 5FZEA 3KGLA 4UOJA 4EN7B 4CDWC 2RS12 2NQYA 3I2JA 1UY3A 3ZYIB 3WCRA 3MIEA 2HWE2 4KBZA 4JDNA 4OUMA 3U4SA 1K3IA 2WQ4A 2A75A 1G9CA 5K7PA 3THPA 1FI2A 2BBAA 4ASKA 1GR3A 2P3YA 1HJGA 1W3XA 4TXWA 2XVKA 2XBO1 1VLNA 3JB8A 1ZYBA 1OOPB 1D0GA 5T5LA 4EN8B 1RGSA 4NOTA 1V6KA 1LENA 2CAUA 2BNNA 3PVNA 4LLOA 4WZCA 4YGDA 3B69A 1H8TB 3EHKA 3PVBB 3SITA 4D6RA 1DQ5A 2WUHA 1NA1A 3WNXA 1PO12 2VUJA 1CZTA 1UMZA 1SEFA 4IEWA 4NROA 5FO7B 4CE8A 4E4SA 3VKFC 4WVVA 4BWOA 4QPWA 2D97A 4F83A 4AVCA 2A6XA 3PIGA 3AYCA 3S5QA 5FZDA 4JGZB 5C7GA 1AR62 4TLFA 5LK7B 2BBVA 3GCWA 1PO22 5ERLA 1J3RA 4KBBA 3D6EA 5LA0A 1DLCA 3CO2A 4XUTA 3AKTA 3FN9A 4L2NA 4YG3A 4CDUC 4Y1UA 1GWLA 4CDXB 2NN8A 1RXGA 5DAXA 4QKDA 1LOCA 2PN5A 2FCTA 2DV9A 3MW4A 3WINE 3V0AA 5C6CA 2VCBA 4YW3A 5BNNB 1ZBE1 2RJLA 3GGLA 3PHMA 4RQPB 1HQNA 3RZZA 1W8NA 1D2QA 3ACLA 2F4PA 4LBNA 3ZFEC 2Z79A 1XBFA 1S0CA 2P17A 5FYHA 3SMHA 3M1HA 3O1OA 3HMYA 5IVVA 4LUKA 2E7TA 3M8LA 5FV3A 3WUDA 4QQOA 5BNOB 4Y22A 2HWF1 2UYBA 1QIQA 3QACA 3WF0A 4DXTA 3M3OA 1UPSA 2CY6A 2GP5A 2RMU3 2W92A 2R32A 3JB4C 2E9QA 2ZGNA 2KA3A 1HXS2 2H0VA 1ASJ3 4N43B 3S7IA 2GH2A 4GWNA 1LOBA 5CU1A 1R64A 4BH9A 2W1UA 3HR9A 3CZUA 4Y1VA 1JOPA 1OLME 2LW8A 4YG6A 4U36A 2VE1A 3TEZA 1E5HA 2NMOA 4QQ2A 5L9VA 1ULPA 2DVGA 1LCLA 2YG0A 4ISQA 4QU2A 1ZBA1 1DZRA 1POV3 4TWTA 5IK5A 4AYUA 1WKYA 3C7GA 5EYYA 4ARXA 4CCDA 5FY9A 3WP6A 1WMDA 3NAPA 4IV1B 1NY72 2XHNA 3ZFGB 2Q0AA 1PNFA 1LHUA 5BNQA 2LROA 4M4PA 1K12A 1W6OA 3ZDSA 5F3CA 5D8AA 4F3JA 1OQDA 4NIAA 1JS9A 1K5MA 2OT7A 3BYWA 5FP3A 3WG1A 1QXJA 3B02A 3CQOA 4LKSA 1IG3A 3UGFA 5JOXA 2WFF1 1AR93 3AZYA 4PLMA 1LAJA 2MEV3 2WO7A 3MPPG 1V00A 2CSGA 1RUE1 4CXXA 3FLPA 3O1SA 5JIUA 4CPBA 1Y43B 4FPLA 1WW4A 2ZEWA 2LTNA 3IDCB 3UKVA 4PF5A 1FOD3 5KC6A 1DGWA 1UOBA 2ZBJA 3CF6E 4H7LA 1X9TA 4HZFA 4JKKA 3FC0A 2VW1A 3HOBA 4RN5A 4V1PA 4C0HA 1VRH1 1WCSA 2RS53 1LB2A 3CZJA 3ZYGA 4ASMB 3WDYA 5T5PA 1Q3EA 1MS0A 1WLWA 3DPRC 1V9U1 4ZPIA 2XBO2 1XE0A 2BNMA 3VBUC 2E51A 2Y6LA 4PF1A 5F7UA 5KC5A 2JXAA 3ZIXA 1XNTA 1XU2A 1HB3A 1RUG3 1RUH3 4XTMA 3AKPA 1AVBA 1VMJA 3D4KA 5CB7A 4EROA 1NE6A 3KQRA 5C3QA 4ZS2A 2JEMA 2TNFA 1NOVA 4CDUB 4HVRA 3VL8A 2HEYF 3WP4A 4RGKA 2YMZA 4CRQA 4AAXA 3NVCA 4I01A 3ACHA 4CA9A 1A78A 2OYZA 3ACFA 3P5BA 5D2AA 2WSVA 1US3A 3BALA 2W1WA 5FZBA 1CONA 2ENRA 1WLTA 2O0OA 5CKQA 3VD4A 4Q2FA 2WNUC 3POGA 1CQ9A 1AL0G 1RUF2 1SCRA 5FMCA 2Q1FA 3WY6A 1SBFA 2WYFA 3URFA 4H55A 1HDKA 4CUCA 2WZEA 1ZA4A 1KJRA 1JBCA 3E1F1 4DY3A 1IG0A 5ACA1 3WLUA 1ZBE2 2X09A 1RUI1 2VMFA 4KWLA 4XYXA 4HVOA 1TME2 2H6BA 4R9CA 5FYBA 4S2DA 3TEWA 1CPMA 1FXZA 4IEXA 4LK7A 4M0HA 1AJOA 2WZR3 3K48A 2Y8KA 2ZA9A 3P3NA 4Y4RA 2VBBA 5JAXA 1J83A 4GJYA 4BYYA 1JYNA 1XB9A 2HWF2 2IC1A 4ARYA 1RUJ1 4C0BA 1KXGA 3TEYA 5A3MA 3RZHA 2IFWA 3NV2A 1TEIA 5F5AA 4OUSA 4HPKA 3I2OA 3TB0A 5DDJ3 1QNWA 2EAKA 4I2OA 2D6MA 4LE4A 5FYUA 4X6RB 2VZRA 3THCA 2QDNA 5FKBA 3O14A 1PVXA 1ZVFA 3ZXFA 3NWKA 4PLOA 1F15A 1C5HA 4QDQA 1JZ6A 2XLGA 2DF7A 1AXZA 3DUIA 5F8PA 5FK8A 3WF3A 1GWMA 3EJKA 2VZPA 3OPZA 2EIBA 2VM9A 4ZZ8A 5JUVA 1KFUL 5F1RA 1MQTA 2DU1A 3MEPA 1GSLA 1ZBA2 4AI8A 1JYCA 1DP0A 2QBXA 5ANQA 1OQEA 3NL1A 4E4HA 2JG8A 1I9RA 3WDXA 2YHJA 4G9SB 2ADDA 2BNOA 5KHJA 2X5IA 3DEMA 3CHXA 3FUQA 4LO4B 4WBBA 4ISRA 2VCCA 3I2HA 5FREA 2C6SA 5CEHA 3A22A 3VBRC 3MIDA 4JKMA 4JGYC 3T2PA 1LHOA 3UK9A 1O5UA 2BFUS 4Y5SA 3USUA 1MACA 1FNZA 4ZXEA 5I8TA 2JKXA 5DUXA 4CTEA 4DQAA 1I5PA 4E2QA 4J1XA 2CDOA 2WFF2 1PGW1 2W0XA 4ZU5A 3ZXDA 4ATFA 3ZYHA 4W6XA 1HRV1 1LR5A 1UY1A 1AL21 2GC1A 2JG8B 1RUE2 3GZTB 2PQSA 2A70A 4WVMA 4DNYA 4CUGA 3H8UA 1DYPA 4K8FA 4Q0PA 4XF1A 3B7MA 5DN2A 2R061 3NO8A 3VBUB 4DZGA 5JZGA 5K0UB 4CDQA 1JODA 1AYN3 2WA4A 2FDIA 3JD73 4IEOA 4CP9B 1NCRA 4RD7A 2Q8OA 2YBSA 4IGQA 3GBGA 1VRH2 2DBIA 3QH7A 1NG0A 2GNTA 1QXPA 3SEPA 3USSA 4Q0VA 4ASLA 3SISA 1WA6X 2VMDA 1CWPA 4AGRA 2R041 5F6KA 3T3YA 1V9U2 2FCUA 4DB5A 3VDAA 5H9QA 2DTYA 1OUSA 1V6IA 2RDRA 3OBZA 3OGGA 1QF3A 1W99A 3T09A 1UU4A 1SLLA 1HV1A 3O1RA 1KFXL 3LEIA 2K46A 2D44A 5FZ9A 1XOYA 1FYUA 1QU0A 3ZYFA 4WV8A 4Q0UA 4L11A 1GQHA 5FAXA 3TN93 4XOGA 5ABJC 4IV3A 2XDVA 3MZHA 3VHOA 3OGVA 3NJVA 3VKLA 3OPWA 2RE9A 4QAWA 3BTXA 5FY0A 4YZ3A 1DQ6A 4XFCA 2Q5TA 2CL2A 5CZKA 3VBFA 4RR3C 2DFBA 1W9TA 2RR13 4NAOA 2VOTA 3WT3A 1C3HA 2E6VA 4PQQA 3BIEA 3ZO0B 1JH5A 4JDOA 1K42A 2HKXA 3RMXA 1FNYA 1LOFC 2R6QA 5BXXA 4ZU7A 5GLUA 2OXBA 3VGIA 1UX7A 3LF7A 4ES8A 3HJRA 3LKJA 5ACA2 2HYKA 3N9MA 3U78A 3E6BA 1RUI2 3MI8A 5F3EA 5JSPA 2LRPA 1JZ2A 4MXWA 5FXVA 2Z42A 3POJA 1CJDA 5EP9A 5T5OA 4M3CB 1S4CA 1A34A 2ZJCA 3ETPA 2V73A 4HVQA 2YPDA 4NHMA 1YFWA 1DQ0A 5C9AC 2BERA 4FPGA 3J7LA 2ZGSA 3OPTA 1GP4A 2D43A 3ZR6A 2EICA 2QUOA 1UYPA 3IIIA 1PM7A 4NO4A 4PLNA 4XCBA 4FPYA 1EPZA 1HV0A 5A3UA 1G9BA 2VQTA 4XFBA 3GJAA 1GKBA 3FHAA 5DAWA 1ND3A 5HCAA 4GB33 2Y33A 2QNKA 1XE7A 1PNGA 1RUOA 2R7EB 3ILNA 3KB5A 1W0NA 4GMP1 1W6QB 1DBNA 1VP6A 1TMF1 1S2EA 4WM8C 5FMOS 5A32A 4A6OA 5LA9A 5I8YA 2Y38A 3CL1A 5I8SA 4GQ7A 4YM1A 3RDIA 4XAEA 1POQA 3VBRB 3CJIC 2PXJA 1ND2B 4HN1A 4JGYB 4LOSA 3IN9A 4BQWA 5JSOA 1XJAA 2P2KA 1XRUA 3FMGA 5GLVA 4WZFA 3KLSA 4CEWB 2WN3A 3WDWA 4AVTA 1AR83 3A7QA 1C57A 1BVVA 5EJ3A 4LKFA 3CEWA 2RM21 1KRIA 5A32B 2WS92 3RSJA 2P3IA 2VNVA 2VZSA 4ZHNA 5GALA 2J22A 1OA3A 3H1WA 4LBQB 1DGRN 1FAYA 3WG3A 1IPSA 1OI6A 2GAUA 2B9UA 4GZ9A 1PGW2 2Y6JA 1BHGA 1OF3A 1IQAA 4LHSA 5FY1A 5DMYA 5SV5A 1AL22 5F2WA 4XHBA 4DRVA 1I1EA 3ZPOA 4UFHA 1S0JA 2FCVA 4UFLA 1WCDJ 1PK6B 2GMEA 2DCTA 3AVSA 3HT1A 1GQPA 5A1FA 2W52A 4DUWA 4LT5A 2OS2A 1W8HA 4BOWA 4MYEA 2PAEA 3RJ2X 2WRAA 3NKGA 5FUPA 1BBT1 5FZ8A 3ZXAC 3JBG2 2MHFA 3H1MA 3AVRA 3R05A 2C9AA 4Q1PA 5IVYA 4JHTA 2PYTA 4XBQA 2BFUL 1X82A 2JDYA 2CGNA 4QKBA 4AHZA 2R071 1RJ7A 3KQ4B 2PHUA 1KDKA 3Q8BA 5JDBA 4AG4A 4RS5C 1CX1A 4QT6A 1FMD3 1J58A 2W08A 2YPJA 3JCIA 2V4AA 4PI0A 3AMMA 3LQCA 4FSJA 1AX0A 5L7OB 2Z2SB 3WNPA 2DURA 1QEXA 1O3RA 1PIV3 1W0OA 1O3TA 5M0TA 2VBDA 1ZM1A 1AYM1 2V72A 3WVJA 1PZ8A 2BWAA 1VBB3 1DFQA 3O1TA 5BYNA 3WV6A 3KS7A 1G7YA 4QPIA 2R1DA 3K46A 1JW6A 4COZA 2SBAA 3PJQA 5LASA 4MV2A 3FHQA 5C70A 4NE9A 3N7JA 5TSWA 3KSCA 4CXWA 4PDWC 1CN1A 5KXDA 2GN3A 1I3HA 2BRTA 3FHIB 2ZPXA 5T50A 3T0BA 3K3NA 5C9AB 2F6BA 1CAWB 5A1LA 3U10A
chains in the Genus database with same CATH topology
1Q8SA 2WKKA 2VOWA 4K20A 4Y1YA 2BTVC 4F8AA 2Z5WA 1DG6A 3VZMA 3E5UA 2QJVA 1CAVB 2GN7A 1LHNA 1W6NB 3V0BB 3VZKA 5CBLA 1O5LA 4LO6B 4BZ4A 1VBE3 4LEJA 1LGNA 4NHLA 5L36A 1JUIA 2VMGA 1XNCA 1ZZBA 1NYWA 5A33A 1QQP2 1SLBA 2DUPA 3WD5A 4BM8A 2HWD1 5CFCC 2ZACA 1TMF2 1N3PA 4WM7A 1CESA 1RUC3 3HWJA 3TWIA 4ZKTB 5C8CC 1QOTA 5EFUA 4N53A 1DF0A 3GYDA 4FPCA 5FPZA 1GNHA 3I4IA 4R4XA 3ZVXA 1F9KA 4QQLA 3ZPYA 2RHPA 4J1WA 4FPOB 4KQ7A 2Q1MA 2ZX1A 4AWDA 1PGSA 3M7AA 3ZSLA 5JPMB 3VUOA 2RM22 4JQRA 4B8EA 4C1XA 3E6DA 5A3LA 3MFAA 4F7ZA 3GALA 4UW4A 3D5OA 1GQGA 3WZ1A 2EXIA 1AJKA 3SH4A 2R30A 4FOVA 5KXCA 2E7AA 1Y9QA 5FMOL 1GZWB 1RHI1 2UU8A 1RMU2 3AXDA 4LA2A 1XNKA 3OF1A 1J59A 1RB8G 4JRLA 4LBQD 1ZZ8A 4KG8A 3ZN4A 1MR5A 2ILMA 5K9YA 4FCAA 2ZHKA 1DZQA 4MGZE 1N1SA 1ZBA3 2PHFA 1PVC1 5I0TA 2JG9A 4NN0A 4RHV1 1EAH3 1H1IA 1BBT2 3AB0A 4NWWA 4H7MA 4Q1RA 4AK3A 4K6BA 4AFDA 3DL3A 2XJSA 4QPGC 5JR7B 1YFUA 3VBSC 3WG2A 5J3UA 4J6GA 4B7EA 2R072 1LRHA 3M4FA 5GZDA 4D7TA 3AZZA 2GU9A 4JC1A 1VBD2 2YUEA 2CV6A 1CD3G 4OI4A 4OHZA 4A7KA 2TBVA 2WFF3 1HRI1 4MGYE 2G9FA 1N1VA 4AEDB 1LHWA 1AYM2 2DVDA 2P37A 3D0SA 1GFF2 1NCQA 4Y20A 2C1FA 4B4QA 2VY0A 2EVXA 2MPFA 1DGWX 1VJ2A 5IT6A 1ZZCA 2G4IA 2XWBB 3AP7A 3FBYA 1NA1C 1DZTA 4FTBA 2A73B 1AXKA 1YNAA 1S2BA 5DUWA 4YVSB 4Q4X2 1MS4A 1VRH3 4DOUA 3AMQA 1XYPA 2ZABA 1RUD1 4OHXA 2IXHA 4YW2A 4XE9A 2ETEA 2VU9A 4YG0A 1V9U3 5CG8A 1O4YA 4LLFA 5GLTA 3ZXKA 4AE2A 3FX3A 3AYEA 1DGRA 3THTA 3H3UA 5CA6A 1FV2A 4NHKA 3T2TA 3WX5A 2D6OX 2DVAA 2BYVE 3ATGA 1ULCA 1OPOA 3WW4A 3AK0A 2QKDA 3R0RA 3UJOA 2VVFA 3TRSB 3AZWA 1Q56A 1FPN2 1ZZ7A 3O7OA 4Q8KA 2HWB1 1OOPA 1SLCA 2BW8A 2B42B 1BVP1 2DCJA 1QJY1 2DTWA 1HLCA 5FDBA 2NP0A 2HWD2 1H8TA 4C90A 1YLLA 1BYHA 4JRAA 4YW4A 5F5QA 2GC2A 2DU0A 1OA4A 1UAIA 1W2UA 1A3KA 1NZCA 4JGZA 5EYXA 1DQ1A 1U5ZA 1NQDA 4Y1ZA 1IPJA 1SLIA 4K40A 5J7MA 4QPYA 2VNOA 1QJU1 1V6MA 1RUJ3 3NW4A 4RA0A 1WMEA 4CDXA 2UWCA 2UWAA 3P3PA 3IDBB 2K9ZA 4FT8A 5BNNA 2ZHMA 2DUOA 5IUQA 3SLIA 4RQPA 3WOGA 3NAPC 1RHI2 1LEDA 4JCKA 3VDDB 2UYAA 3RYKA 5D8AC 1Q43A 4FPEA 3JQXA 1G6NA 1RUF1 3N7KA 5BNPC 1K5MC 2XL9A 3VBSB 2JENA 5BNOA 1GANA 2QZ3A 4QXKA 2WNVC 5T55A 3U4XA 2GNMA 4GH4B 2ZGQA 1DIWA 1F5FA 2GNBA 1PVC2 4HT1T 4RHV2 2YGMA 3V65A 3RI9A 1TME1 4DINB 4IEQA 1V6OA 3EXUA 3AX4A 4N43A 4FVVA 1ZZ9A 5KWRA 4IL7A 1J1TA 1W0PA 1MEC3 4LBKA 1HQWA 4O9GA 1S0FA 1AR73 4U2AA 2ZX0A 1HRI2 3E5QA 3WQ0A 4YZ1A 1HRV3 4XJZA 1D4VB 2AUYA 4Q26A 1S0BA 2ZAHA 5EXOA 2WQZC 5I91A 2R063 4IV1A 3ZFGA 4LUMA 2PHRA 1OA2A 4JAAA 3AMPA 3VZJA 4COUA 3AMNA 1YWKA 1C8M1 1OFNA 3D0JA 5JIAA 1RUD2 1UU5A 2R043 1VBA3 2MNGA 2HWC1 4Q4Y3 4YZ5A 1CX4A 1D4M3 5DG1A 4OZXA 4GXLA 3RQ0A 5JI9A 1NQJA 5CFDB 2D3RA 1IPKA 3M2MA 2ES3A 5HCBA 1QH7A 1YI7A 4N7UA 4YW5A 4CDWB 2XLAA 1VALA 1AZDA 4GWMA 3AKSA 1O4ZA 3FWEA 4FPHA 5C4WC 4B7KA 4BIFA 2HWB2 3FUOA 1RVF3 4LBOA 2QCSB 3OGJA 3AP9A 1QJY2 4FTSA 1N47A 5J48A 4X8PA 3I54A 2A6ZA 4SLIA 2P3KA 4FOWA 1HW5A 2AENA 3MYXA 4HLTA 3B9CA 2EAAA 2XVGA 4CDUA 1GZCA 4OVEA 5I0RA 1CIWA 1VAKA 3AYAA 4BA6A 1C1FA 1ENSA 4XFFA 4IEPA 3WR0A 3ZIWA 1UIJA 4KWKA 3KZ4C 2E7QA 4P9LA 3IMNA 1U5XA 4Y24A 2VXRA 1G9FA 1Q8QA 1QJU2 2K2SA 4MVTA 1MQTC 2Z69A 2VGDA 4A2UA 1GV9A 3LAGA 2N7GA 2O1QA 4TSVA 3L2HA 3B94A 2WNVB 2XKOA 2FMDA 2LALA 2A3WA 4E4DX 1PZ7A 5H9RA 2X5IC 3KM5A 1NXMA 1BXHA 1OPMA 5FO9B 3B5LB 4PJYA 3ZFEB 1LU2A 1A8MA 1CGPA 2ZMKA 1UZYA 1V6LA 1KITA 1ZRDA 3VKMA 2XJRA 2B46X 3HIFA 4I09A 1H0BA 5C8WA 1SLTA 2PA7A 1BEV2 5F9TA 1YIPA 4C1WA 2ZGMA 1EV13 4Q27A 3UV9A 3ZXLA 1C4RA 5JZGC 1BMV2 5JPNB 4CDQC 4LULA 2XHKA 4OI2A 3IPVB 2B39A 4Y5Z0 2DFCA 4E27A 1NCRC 1QY4A 1COV1 1YFYA 2ATFA 3OY8B 1AX2A 2ZOEB 1R1A1 3RPQA 4EJRA 2VUAA 4AVVA 1MZ6A 1AF9A 4LO5B 3ES1A 4S2GA 3ZXJA 4EWDA 2GSYA 1S0EA 3BOPA 4PCRA 2PQQA 3KCCA 1LOGA 1QJZA 1X8EA 2PHTA 4WVWA 3KMHA 4IV3C 3ZYPA 4XMIA 1WLDA 1QXRA 1C8M2 5IK8A 2ZGLA 4Z07A 1LULA 2ZGTA 3WDVA 4Q4V3 4XF0A 2FQPA 4GKYA 1G86A 5GKAC 1EP0A 3PVEA 4XW3A 4M3CF 3MLKA 2HWC2 2R073 2CGPA 2PHLA 3LSEA 1YXWA 3DN7A 2D5FA 5JI7A 5C4WB 1N1TA 2WS91 3VBUA 2R0FA 5K0UA 5L73A 3TOJA 1YUDA 3UKTA 3H7JA 2UY9A 5J09A 3RYRA 4HANA 3FJSA 4HKLA 4K1YA 4XF4A 4R4ZA 1IHMA 1B35C 2YY1A 3OBRA 4A7YA 1YHFA 2YV8A 1B09A 2Y0OA 4ITCA 2VECA 2PHDA 3MPBA 2C5DA 1MS1A 4FP3A 1X36A 3E97A 3DPRB 4L8QA 4IETA 4YYOA 1JHNA 5FO8B 1YI9A 2A5ZA 2VH9A 3DV8A 4K7JA 1RITA 4XF3A 5C33A 5FQ0B 4I3PA 4D7SA 1YJLA 1Z7S3 3EQEA 5HBAA 1F5JA 3ZX7A 1IZ3A 1RL3A 3JBG1 4KU8A 4AI2A 1XNDA 3B3QE 5KHHA 2RS33 2ZX4A 1ND3C 2RMU1 4R52A 1TNFA 3NSTA 1VBC2 3AFGA 3WUCA 1J3QA 3ASIA 3KT7A 2QQPA 1H1AA 3RNSA 1JTZX 5T52A 1ASJ1 2PAMA 4YVWC 4B29A 3R6SA 1FATA 4LA3A 1S55A 2WNUB 4FPKA 5HI0A 5J96B 1H8VA 2EXJA 4GA9A 3ZSJA 1W6MB 4L99A 4COWA 3AKRA 4FXGB 1R093 2D7FA 1POV1 1IOAA 4FPJA 5GZFA 4AGVA 4M3CA 1X8MA 3OJBA 2DWRA 2RS13 3MDPA 3PVOA 2HWE3 3KGZA 3AYDA 4DMIA 4ORFA 4MSVA 5FTTC 3LZZA 3VKNA 2Q1ZB 4I30A 1RIRA 1WLCA 4X6QB 4FP2A 4BLJA 4Q0QA 3UJQA 3VBHC 2MEV1 4FOYA 4E4ZA 5HXVA 3B00A 1PO13 1W6QA 1MZ5A 1COV2 1SLAA 1R1A2 1FOD1 4YGBA 2HEWF 4AXOA 1AR63 3JZVA 1APNA 3VBRA 1ND2A 1U5YA 2HEVF 1PO23 4JGYA 1NXD1 2GC3A 1N1YA 3I7DA 3BOWA 4MX3A 4XQWA 1ENRA 4W65A 4CEWA 5SV8A 1QQP1 4PQ9A 1XYOA 2QVSB 2ZMLA 2VOKA 4XEZA 1IS4A 4LTAA 1RUH1 2YROA 3O0VA 4LBQA 2DCZA 1OKQA 4QPIC 3FLRA 4XXAA 4Y4YA 2B5HA 4XXPA 1GYKA 1B35B 1V6JA 1CAUA 1PK6A 4XIOA 2XKPA 2WT2A 3U0ZA 4AVAA 1GBGA 4AQTA 5EV7A 4YSFA 1HXS3 1ZREA 2ET7A 2JE9A 2NM1A 4MH0E 1RMU1 3J8F1 2GMMA 5DZEA 3N3HA 1KDMA 2ZS6B 1CAXB 2A6WA 2FMYA 2OZJA 3VBOC 1CAUB 1QJX1 4XILA 3RWNA 2BUKA 1S0GA 2CTVA 1OHFA 2I07B 4NPRA 1FV3A 4IESA 2YC0A 4JTOA 4BIOA 4YVWB 3VN4A 2WZR1 4AF9A 5L7OA 1I5ZA 2HJIA 2GALA 5FPXA 4QGLA 1LOFA 2QZ2A 5ABJB 1VB4A 3FE5A 4EN0A 1XQNA 4AI3A 1ZNPA 2RMU2 2VOXA 2W39A 1MS3A 4XFHA 4COYA 4XJWA 3WHUA 4QGNA 3N35A 5DDJ1 3SCFA 1L3JA 2ZHNA 1ASJ2 3RI8A 3AZVA 4WM7C 1VBD1 4RR3B 1QNYA 4XJ9A 4LR4A 4N53C 3I59B 1WGPA 2IXLA 4LHNA 3ME2A 3AP6A 2PFWA 3AMHA 5C9AA 1CAWA 4SBVA 2LUWA 3M3EA 3VZLA 4CP1A 1QGLA 1WCKA 4FOQA 4COVA 4LE3A 4KL1A 1LEMA 3VBHB 3VHNA 1ALYA 4Q4X1 5FLJA 1CAVA 3ZFFC 1CVNA 1W6NA 3V0BA 2PHWA 4MLOA 1E57A 1TE1B 1JOJA 2XBO3 3JU9A 1EY2A 5AC91 5GJ6A 2JDZA 3CJIA 1AR92 2MEV2 3L2YA 1ENQA 1R081 2AR6A 1R1ZA 5L19A 2PAKA 1Q8PA 4RGAA 2VQ0A 3FBMA 1V70A 1W39A 1ULFA 4HKOA 3DF0A 3T1MA 3NV4A 3HAGA 4WM8B 1FOD2 1A8DA 2P34A 2WINB 3JD71 3BTAA 3S7EA 3EO6A 4Q4W1 4FPFA 1FPN1 4HSJA 1URXA 3CJIB 1NLSA 1RUF3 4Q29A 2CWSA 3I8TA 2OUHA 4IERA 5IK7A 1YYNA 1RINA 3ZMOA 1ZBE3 2JD4A 1IKQA 1RUH2 1RUG2 2GMPA 3HT2A 2JX9A 4YGCA 5AVPA 1TME3 3PTYA 4XPVA 5DUVA 4LBMA 4W6WA 2XG3A 1VAVA 3TN91 2IXKA 4HK9A 2XLFA 3QOPA 1GZWA 3UL2A 2A71A 3OD4A 2I74A 5T3NA 4AFCA 4YFZA 4P9XA 2HWF3 1QHDA 4YZ4A 2H6CA 3PJYA 5LK5A 3VBOB 2RR11 5JVVA 2FHRA 1QOSA 2GC0A 4META 1ZRCA 1JN2P 4QQPA 1WMFA 1WW5A 5T54A 4LNVA 4CEYC 3J8F2 4OFGA 4P5HA 1WBLA 3BPZA 1QJX2 1C8M3 2DVFA 3WHTA 2UWBA 2WZR2 4RS5B 5DZGA 5F6LB 3L9JT 3A4UA 4AEDA 4OI1A 1W6PA 3LWCA 1J3PA 3WCSA 4D94A 4FAHA 2K0GA 1EYBA 4CYDA 3LSDA 1SFNA 4XJ8A 4FBFA 5B2GB 1WA4A 2ZZQA 5DDJ2 1OLRA 5BY5A 3W59A 3APBA 1C8NA 2PLV1 3DGTA 5E89A 4YVSA 1Q5OA 1U0AA 4P9JA 1XXNA 4PDWB 3SH5A 4I0BA 1RUE3 1F8VA 3INAA 4JGZC 1W6PB 4N7IA 3ZFFB 2A3YA 5EWSA 1SBEA 3HQXA 4DPNA 4AFMA 5HCFA 4IEUA 2OIIA 3ZSMA 2A6VA 1DQ2A 1Y3TA 3O0XA 1MZFA 2D6LX 2V5YA 3LA3A 3MFCA 4CDXC 1AR81 1DYKA 2GDFA 4B4RA 2NPIA 3AKQA 5BNNC 1YRZA 2PELA 4RQPC 3TNPB 1S0IA 2OUJA 4EWEA 1S1AA 4QM8A 4Z2WA 4FAGA 3OYWB 5C8CA 2BVVA 5AC92 4XJAA 1UKRA 2ZAAA 4XBLA 1R082 4XFGA 5BNOC 2EIGA 4YM2A 3AXEA 1REFA 5CFCB 1UW8A 2D98A 3AJZA 4KWJA 3JD72 4N43C 1SQ4A 5C8CB 2E63A 3LB9A 4Q4W2 3B01A 3H9AA 4DFSA 2EF6A 2ZHLA 4I3GA 2TEPA 3JUUA 1S0DA 1V6NA 5FBZA 4KH9A 1ONAA 2JE7A 3GBFA 2Y0IA 5CVRA 5ACA3 2UY8A 2ZKNA 1RUI3 3QD6A 3TN92 4FQZA 2OZ6A 4IV1C 3ZFGC 2IXIA 3LA7A 3VDDA 1VBB1 4CEYB 3LA2A 4NWVA 3VBSA 2VNGA 3POSA 4H14A 3S30A 3U11A 1YIFA 2RR12 1O3QA