1YFYA

Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from ralstonia metallidurans complexed with 3-hydroxyanthranilic acid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
174
structure length
174
Chain Sequence
b'MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate-3,4-dioxygenase
publication title Structural Studies on 3-Hydroxyanthranilate-3,4-dioxygenase: The Catalytic Mechanism of a Complex Oxidation Involved in NAD Biosynthesis.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase
total genus 29
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2005-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yfyA01
2XL9A 2BNNA 1V70A 3ST7A 4QM8A 2O1QA 1H1MA 1O3RA 2C0ZA 2VECA 3D82A 5J7MA 4MGIE 2UY8A 3CL1A 3CJXA 5KHJA 4XFIA 5KHHA 2Z2SB 4EROA 5KHIA 2EAAA 2B9UA 1Q5OA 4LTAA 4IETA 5I0TA 4XF0A 3HT1A 1RL3A 3EO6A 1YUDA 2VPVA 4EWAA 2CV6A 4ORFA 3G7DA 5FLIA 4ZU5A 4XF9A 4UBGA 1XE7A 3M70A 1O3SA 4EWEA 1UD1A 2QNKA 4D7TA 3I54A 3LAGA 3H50A 4XFBA 1J3RA 1CAWA 1ZZCA 2Q0AA 3HQXA 2Q30A 1X8EA 2PTMA 4JVAA 1UW8A 2UY9A 3DN7A 2GU9A 2VQAA 2MHFA 2QCSB 4QGMA 5F1RA 5I8TA 2OZJA 4QGNA 2GC2A 5I0UA 5I91A 4A2UA 2D5HA 4L2NA 5D1IA 4E2GA 3WW2A 1YFWA 1UPIA 3S0MA 4I3PA 4R52A 5JSPA 3U11A 4MX3A 3H3ZA 1I5ZA 1YWKA 2QJVA 4YARA 4J1WA 3KSCA 4LUKA 1GQHA 1RTVA 5KBFA 3D0JA 3IWZA 4ONUA 4HZFA 4WZCA 4AVAA 1QXJA 5E1RA 2H6BA 3JZVA 2E9QA 4KWLA 2ET7A 3KCCA 2BGCA 1UCXA 2ATFA 3ACLA 1NZCA 3USSA 3WW3A 3S7IA 1NE6A 2CAVA 4E2SA 1LRHA 3CF6E 3H3UA 3IDBB 2GC1A 3M3IA 4MZUA 3GBFA 1Y9QA 1DGRA 5JR7B 1OI6A 3OCPA 4QM9A 4MH0E 3SHRA 3ELNA 3VHRA 1CGPA 3H1WA 3DL3A 1ZRCA 4NVPA 3H9AA 1O3QA 4PIYA 1CX4A 3NW4A 2K9ZA 3E5QA 4IEUA 3EBRA 3RPQA 4PJYA 2IXIA 3H7YA 4IEXA 2PAKA 2GZWA 4F7ZA 4CYDA 1TQ5A 4HSJA 4YNIA 3LWCA 4Q0SA 3BALA 3N4MA 3LA2A 1DZTA 2N7GA 3NKTA 1X8MA 1ZREA 2D93A 2HKXA 2MPFA 4PIZA 3RYRA 5BPXA 1YLLA 3RZZA 2OPKA 1J3QA 3E5UA 3RYKA 1J1LA 2MNGA 4HN1A 4KU7A 2DCTA 4I0AA 3NVCA 2I45A 5BY5A 4B29A 1IPJA 4FAGA 2PQQA 2UYAA 5CU1A 5K8SA 1X7NA 5I8SA 4Q0UA 3FJSA 4XFHA 4KL1A 2IXCA 2PAEA 1DGWA 3EHKA 1SQ4A 3I7DA 5LRRA 1OMIA 1WGPA 1XE8A 5FQ0A 2OZ6A 5I0RA 3LZZA 2WC2A 1FXZA 3H1MA 3I59A 4P9GA 3ETQA 1O5UA 5FLHA 4UBHA 2IC1A 4JTOA 4XFGA 1I6XA 1XRUA 3PVBB 1UIKA 1O4TA 4I2OA 1UIJA 3KGZA 4TLFA 1LR5A 4PIXA 2O8QA 1JUHA 2GC3A 5I8YA 5J48A 3NJZA 2K0GA 3UKNA 4HVOA 5C6CA 5HI0A 2BNMA 4QGLA 3BB6A 3MYXA 3HIFA 3H8UA 4J1XA 2GH2A 4HLTA 3DV8A 2P17A 4XFAA 2XGXA 5I93A 1DZRA 4HN0A 4JV4A 4IESA 3RYPA 4N9HA 2F4PA 4LEJA 2WFPA 2EVXA 1YFXA 3UKTA 1PMIA 1G6NA 3IDCB 2PYTA 5E16A 4MGKE 4FT8A 1NYWA 4I0BA 1CAVA 3SCFA 1RUNA 3RNSA 4HVQA 3SMHA 1WA4A 2CAUA 3MDPA 3D0SA 4HMZA 5JSOA 3C3VA 3TNPB 5CADA 1CAXB 3E5XA 2XLFA 4XF1A 3EJKA 4X6QB 2XKOA 5FPXA 4EV0A 4DINB 5J3UA 2Q4SA 1ZVFA 4IEOA 3H7JA 1YFUA 5EZWA 5LEKA 2OA2A 3OF1A 1ZZ9A 1ZZ8A 2IXJA 4Q0PA 1U12A 4AXOA 4MGZE 4QX5A 3ES4A 1QY4A 1SFNA 2D5FA 2EA7A 1O7FA 1VJ2A 4AQ2A 4MGYE 4BHPA 1EP0A 5C8WA 2Y0OA 4WBBA 3NL1A 1Q43A 4AQ6A 4K8FA 4ZU4A 1IPKA 2KXLA 1PM7A 1GQGA 2Q1ZB 3PNAA 3B02A 4QMAA 2B5HA 1LKNA 2ETEA 3KGLA 4E2QA 3SXWA 4YRDA 2PHLA 5BXXA 3H1YA 4HBNA 1EY2A 3FE5A 4Z82A 1RGSA 1X82A 3BPZA 3BCWA 4H7LA 4XETA 2PAMA 3RDIA 2H0VA 4XFCA 3SCGA 4META 3E6BA 5JAXA 2Z69A 4LUMA 4Q29A 2BNOA 4F8AA 4FAHA 2V09A 2BEOA 1ZX5A 1RC6A 1H1IA 4HVRA 2XL7A 4IERA 4IEZA 2XKPA 4IEVA 1ZNPA 3IBMA 4XF4A 1EYBA 1SEFA 5FPZA 4XFFA 2OYZA 4Q0QA 4XEZA 2GAUA 1QXRA 4RD7A 1ZRDA 4I09A 3NSTA 2IXLA 2QVSB 2UYBA 3CEWA 3QACA 4OFGA 2ET1A 2PHDA 1Q3EA 2PA7A 5LEJA 1NE4A 1J3PA 5FDBA 3LOIA 1J58A 3ES1A 3FFQA 1YFYA 4LULA 3E6CC 1ZRRA 4AVCA 2B8MA 2XLAA 4UXAA 2CGPA 1CAUB 3R6SA 5KHGA 5I0SA 4BH9A 5JSRA 1FT9A 1YHFA 3KMHA 4EWDA 1QWRA 2XHKA 1HW5A 4XF3A 4YSFA 5KHKA 4KU8A 3S7EA 1WLTA 1CAXA 3FWEA 4IEWA 5BUVA 2D40A 3MZHA 4OLLA 3SCHA 4ZU7A 1ZRFA 1OFNA 4IEYA 5BV6A 2QDRA 4MV2A 4Q0VA 5LRSA 2GC0A 3DKWA 4O9EA 1Y3TA 4KWJA 1L3JA 4LA3A 2ZKLA 3WW4A 1FI2A 4N9IA 4IEPA 5EFUA 3TNQA 3MPBA 3OD0A 3QOPA 3CLPA 3PLQA 4LLOA 5FQ0B 2HJIA 4HSLA 3ZDSA 1NXMA 1ZZ7A 3FHIB 3OGJA 5AVPA 2FQPA 1O5LA 1CAWB 4IEQA 3I59B 1ZZBA 1ZZ6A 3CO2A 5CVRA 4D7SA 4QXKA 2XLGA 3HT2A 2IXHA 2PFWA 2FMYA 3UKVA 4BYYA 3FX3A 1OD5A 2IXKA 3GYDA 2H6CA 3E97A 3EQEA 1VP6A 4JTNA 4R8HA 1RUOA 4Z07A 3IIAA 5T3NA 4I01A 4FBFA 3OTFA 3U0ZA 4I02A 4MUVA 4WVZA 4AVBA 3WW1A 1VR3A 2ZCWA 3LA7A 4X6RB 3E6DA 1LB2A 4L11A 2BYVE 3FZ3A 5FLJA 5FCCA 1EPZA 5JCTA 4YYOA 4GULA 3L2HA 1CAVB 3LA3A 1J59A 1O3TA 3BU7A 4LA2A 3U10A 3O14A 3ROUA 4KWKA 4BIFA 1CAUA 4O9GA
chains in the Genus database with same CATH superfamily
3H8RA 2DFBA 1L7RA 1V70A 1HRI2 1D4M2 1SLIA 4OVEA 2Q8OA 1M06G 4LITA 1LGCA 1RJ8A 5FYSA 2C0ZA 2VECA 4R9DA 3NJVA 1OPMA 1AYM2 1W99A 2VZVA 1H8TC 1AR82 3VHPA 1EAH1 4A7ZA 3NKGA 1VBA1 2WUHA 3GZAA 1TG7A 5CYYA 4I30A 5KHHA 1GZWA 2V4AA 2WRAA 2Z2SB 4IE6A 4M4PA 4WZFA 3ZMOA 1NCQA 3M3EA 5A6ZA 3IMNA 1K45A 4LTAA 4XUOA 3IB3A 1GOHA 4AVSA 1TME1 4FPKA 4IV1A 4XXPA 4JGZB 4N8MA 4CCLA 5FPUA 4EWAA 3FFZA 4JC1A 4OHWA 4DS0A 1O4ZA 4OHZA 1WBLA 4KG0A 5GZCA 1YI9A 3S30A 1LHUA 3I2IA 5BNNC 3WNXA 2MEV3 2NN8A 3U1XA 3OUIA 3JUUA 3V0AB 3T4VA 1DQ2A 2EALA 2WNUB 3IMMA 3LDKA 1UD1A 2RR11 4GZ9A 2QNKA 3LAGA 4XUPA 2ZA9A 1J3RA 1CAWA 1DBNA 1H4HA 1ZZCA 2RE9A 3PIGA 5FY7A 1FMD1 1RUJ3 3KVAA 2P2KA 4B1LA 1PO13 2G9ZA 4YVWC 3V56A 2PTMA 5JOXA 2JDMA 1SDDB 5ACA3 4B4RA 1KFUL 3ZR5A 3DGTA 1VBE3 4Q4X1 2CY6A 1BK1A 2P3YA 1XPWA 2VZ1A 4PQ9A 4AVTA 1AR62 5IFTA 4XQDA 2WZR2 3TRSB 1B09A 1IS4A 4TSVA 4A2UA 2GMPA 3FBYA 4QU1A 1PZ8A 5JPNB 1CVNA 5FAXA 4CUAA 1LHWA 1YFWA 4HETA 1QU0A 5D8AB 2JDAA 4LHLA 4R52A 4XQ4A 1YC61 1ND2A 3POFA 3ZYBA 1Q56A 3PJQA 5FZHA 4A41A 3AP7A 4LBQB 4H7MA 4ZS3A 4PDWC 4DFSA 3AZYA 4XACA 3OEBA 1JYVA 1HB2A 3VBRB 3GHMA 2D97A 4M00A 1DQ5A 4AI8A 2WS93 2VMIA 4QHBA 5IVYA 1JZ2A 1PGW1 5T5JA 1HRV2 3WP5A 2WT1A 5ABJB 5FYTA 2E9QA 1C4RA 2RS13 3R0RA 3S57A 3KM5A 2BGCA 1UCXA 2QQLA 2VMDA 4IL7A 4M3CE 3ABZA 1X9PA 1O6UA 1S4CA 3M2MA 2R0FA 5KC6A 2Y6HA 2JG9A 5A3MA 1WA6X 5KXEA 1CESA 4QXBA 1KS4A 4AZZA 5CFCA 3GM8A 3T30A 2CAVA 2K2SA 3H3UA 4MHUA 4UF0B 2C9AA 1I5PA 2VVEA 4XYXA 5C9AA 3WDUA 1Y9QA 4QPIA 2WL1A 5LK5A 3C8XA 4RSUA 5JR7B 3OY8B 3RWNA 1H2NA 4HK8A 1CD3G 1OI6A 2Y0IA 4QM9A 5F2WA 3O1MA 5DZFA 1REFA 2NMOA 4P9WA 4DEVA 2ES3A 5JXJA 1N1VA 2YGMA 5SV8A 1IG0A 1O3QA 4GB33 3LKJA 3NAPB 1CR7A 1EUTA 1SLCA 4IEUA 3VBFC 4AI1A 2AEZA 3RVHA 3VKOA 4AQSA 4FXKB 1W2OA 3H7YA 1YJLA 1AYN1 1NLRA 1SZBA 3O0VA 4XC9A 1TVGA 4Z2WA 3IAPA 2QE3A 3TYJA 2RV9A 1TQ5A 3ATGA 4HSJA 4YNIA 1VBB2 3WDYA 1RMU1 2J1VA 3NV2A 4Q0SA 1H9WA 2OUHA 3CKHA 4EN7B 5JOYA 3BALA 4D6QA 1UO9A 4URAA 1RVF2 1BHGA 5DDJ1 3GGLA 2N7GA 3ZR6A 3NKTA 1X8MA 2YB7A 1ZREA 2WZEA 5C8CA 2HKXA 2RHPA 3DXUA 3BKZA 1OBNA 1H2MA 3GJBA 4PIZA 5BPXA 5C3QA 1NT0A 5LWBA 1U5ZA 5FMBA 4FVVA 2DCTA 1DCSA 4O7XA 4I0AA 4CE8A 3AM2A 1MEC1 1VBC3 1HQLA 1ZBA3 2YROA 5FZ8A 4B29A 5BNPC 3C2UA 4IV3C 5FZMA 4AI3A 3O1RA 5JIAA 2LROA 3LEGA 2VR4A 2W94A 4Q4V1 2UYAA 3VD7A 5J96B 4LBMA 3GHNA 5FUIA 1PNGA 2B9VA 1X7NA 1UYYA 5I8SA 1QHDA 5EJZB 3JD71 2PHWA 2VUJA 1V6JA 3A0KA 4XFHA 2V4VA 5K7PA 1PHMA 3AKRA 4YRDA 2IXCA 3P3NA 4M0HA 1L7LA 4RR3C 4BQ1A 2PAEA 3EXUA 1F5JA 4QQPA 3HPNA 5A33A 1POV0 3KCXA 1H4GA 4MXWB 4UT5A 5LRRA 4W65A 1HDKA 1OMIA 1WGPA 1JYXA 3RWKX 4C90A 1VB4A 4UFMA 5FQ0A 1JN2P 3LZZA 5IVVA 2HBUA 4CUBA 2A1XA 3LGRA 3MBWA 1OA2A 1A78A 4Y4RA 5JZGC 3W5MA 5FPVA 4LHSA 3H3LA 2RDQA 4CEWC 1BEV3 2E31A 2ZMNA 3GCXA 4P9GA 4QX2A 2JDNA 2JEMA 4PI0A 2IC1A 2OVUA 1GNHA 3OPWA 1IS6A 1LULA 2ERFA 2XVKA 1AX2A 3QH7A 4XFGA 5T5PA 3B3QE 2ZAHA 1GSLA 2VNGA 4S2DA 3KCYA 1AL23 3PVBB 4FXGB 1DLCA 4CDQB 5LZ6A 4IE0A 1O4TA 1WCDJ 2WLQA 2XJSA 1PVC1 1OOPA 5E88A 1A8MA 3FLTA 3PUHA 1AJKA 5FMOL 2O8QA 3AVSA 4C91A 5I8YA 4ATEA 3S5AA 4BQXA 2BBVA 2K0GA 2V5DA 3VD3A 3RZHA 1AR71 1QJY2 1ZYBA 5HI0A 1DIWA 2YDEA 4BK4A 4XIKA 3GALA 1I9RA 3HIFA 3NNFA 4R9AA 1AR92 4AK3A 4HLTA 5KR7A 2GNDA 1DYPA 1C1FA 1DQ4A 1MS4A 2P37A 4RQPB 1F8VA 1LOGA 4KGGA 3QD6A 4Q26A 1ASJ2 1ND3C 2DV9A 2XGXA 4XFAA 1DZRA 5A6XA 5IK7A 4IESA 1RHI1 4P9JA 1UAIA 3URFA 4RS5C 3DYMA 4OI1A 3CJIA 2EVXA 2O14A 4GH4B 5GLWA 1PMIA 2VZ3A 1W6MB 3PMSA 3PHMA 4HT1T 3ZX7A 1KD7A 1NYWA 3UESA 1OLME 2VOTA 4QQLA 4Z1VA 3RNSA 1RXFA 2VQUA 4YW6A 4WVMB 1V6MA 4EN8B 5BNOB 3ZXJA 4XVHA 3D0SA 4QDRA 1QDOA 4Y24A 4DY5A 3KS7A 1WD3A 2E53A 2NLRA 4HMZA 1R1A1 2CDOA 1IG3A 3TNPB 1HXS1 4JKKA 4OZXA 4XBLA 3EJKA 5FPXA 5IFPA 3CQOA 5JUVA 3USUB 2YU1A 5A3WA 2OX0A 2WZPP 4TTGA 5J3UA 2FDHA 4AFAA 2VOKA 2FD8A 1YFUA 5LEKA 1GZCA 2OA2A 2PHXA 4CEYC 4IE4A 1W8TA 2VUAA 5JXIA 5H9PA 2VMGA 4BWOA 4PHZA 1RUH3 4JRLA 4XPVA 3OJBA 4MGZE 4JDMA 2XG3A 3AMQA 4BXSV 2VU9A 1SFNA 1W9TA 3WHTA 4CDUA 2D98A 2F17A 4NAOA 4BHPA 5I0DA 4COYA 5BYNA 1RUG2 3KT1A 2QQJA 2Y0OA 3MUZ1 4BA6A 3NL1A 4AWDA 1SG3A 1XU2A 2ZACA 3D4KA 4BQ2A 2WZ8A 2Q1ZB 2XQRA 2HWF3 2E63A 1W2AX 3O1VA 2B5HA 5DUWA 1H6YA 1MZ5A 3D8CA 2CGNA 3KGLA 5BNNA 1W0PA 2HLEA 2J1AA 3A23A 2NQYA 5BXXA 5HPOA 4YVSA 1WW6A 3BTAA 3VHOA 3FE5A 3VBUC 4LMFA 4WM7A 3BPZA 3IAQA 1UYPA 5H9QA 2NYYA 2BWAA 5CB7A 4H7LA 4XETA 2PAMA 3FL7A 4LO8A 2X09A 5J09A 2H0VA 4XFCA 3W59A 4RHV1 5FYVA 1MPXA 3WDVA 4Q29A 2BEOA 3Q8AA 1FMD2 4MXVA 4ASKA 1JOJA 2QQWA 3WP4A 3VD4A 4IERA 5T52A 3RGBA 1H9PA 1X9TA 1SBFA 5T5OA 4TLGA 3AB0A 3MV01 3BI3A 5CG9A 1VRH2 5L7OC 3ZYRA 1YXWA 1ZNPA 3S6PA 3PUQA 3RSJA 2W46A 1EYBA 3MFAA 1HV1A 1ENRA 2Y34A 1RUC3 2NPIA 3GDBA 3LIHA 1PO23 2R32A 4YPJA 5FOBB 2C1FA 4LKSA 2BFUS 1ZRDA 4WVWA 5DZGA 5IVEA 1NQJA 2JB8A 3AC0A 4I09A 4PDWA 2DF7A 3ACHA 1A3KA 2W92A 4K8RB 3UNPA 3CEWA 4OFGA 4E4HA 2ZS6B 4M4RA 5LW9A 1IKQA 2PA7A 4Q4Y1 1AVBA 2BOIA 1J3PA 1UX6A 4LT5A 3LOIA 2SBAA 2VZRA 4BQ5A 1NX9A 4FTBA 3ETPA 1YFYA 3FFQA 3E6CC 1V00A 4PBPA 1HRI1 1D4M1 2HH9A 3ZSKA 2TUNA 3ZKYA 1ENXA 4R9BA 3D3AA 1F31A 1I3HA 1LHOA 2YY1A 1PGW2 5I0SA 1OPOA 2FCTA 4R4ZA 4PLOA 1AYM1 1J84A 2C6SA 5FREA 4XBQA 3WXPA 4EWDA 1AR81 2HWB1 3LD8A 2BW8A 2YC4A 3AMPA 5JMCA 4D6RA 3OGGA 5E8AA 4YW5A 2WQZC 4JQRA 2J42A 1COV3 4DNYA 3ZFEC 3T2QA 5A1AA 1IS5A 4L9BA 3WZ1A 4NHXA 5FMCA 1GZWB 1W8FA 2D3SA 1QEXA 3AP5A 4ZU7A 1NCQB 1OUXA 1YNAA 5A32A 3CDZB 4EQVA 3AVRA 5FP8A 4Z8BA 1M4WA 1RUD3 4COZA 1F2NA 4AHWA 3DKWA 4A7KA 4O9EA 1Y3TA 5K4LA 5C3RA 1L3JA 4IV1B 2CL2A 4LA3A 2DBIA 2VH9A 5J98B 3J9SA 3ZDVA 3B5LB 4G4FA 3I2HA 3TNQA 5F3CA 2YU2A 1VRBA 2JE8A 4M3CA 3OEAA 2PQSA 3PLQA 4XJAA 5G05L 4DEQA 3ZDSA 2XQXA 5IW0A 2WAOA 1CAWB 2XUEA 2WNVB 4N53C 1XYOA 3I59B 2WAAA 2P6HA 4A6SA 4E4SA 1AR61 1WKYA 1D2SA 2JE7A 2HWC3 4QXKA 5FZIA 3N9LA 4OMDA 4N43B 3HT2A 3I2JA 4P00B 3JXSA 4LHNA 3B01A 1IZ3A 1OD5A 2CGOA 2A6WA 3HBKA 4BQ3A 2A5ZA 3GBWA 2H6CA 1DHKB 4OUSA 2Y33A 5FYIA 2DWRA 3J8F3 4QPGC 4A3XA 3ME2A 1W28A 1LECA 1VP6A 2GP3A 2WQ4A 2E33A 2YMZA 4FP3A 4JKLA 4RFT0 4Z07A 5FBJA 1NLSA 1UOBA 4M3CF 3BUCA 1SBDA 1ND2B 1W9SA 2XJVA 3GZUC 1QOTA 4IGQA 4Q4V2 1DLLA 2BTVC 5DAVA 4QPWA 4QD2A 4RR3A 4XE9A 5JOZA 2WNEA 3B00A 1DYOA 4MUVA 1HRV1 2B42B 3M8LA 4MXWA 3UT0A 3WQ0A 4RL7A 2JXAA 1CPNA 1AXKA 1YI7A 4FP2A 5FPLA 5GLTA 4A6OA 4AGVA 1LHVA 2AENA 1ALYA 5JIUA 2HWD2 2WIIB 4NN0A 3LQCA 5CKNA 5F6LB 2J1RA 2QQMA 3RZMA 1GICA 5AC93 2BGOA 3L2HA 4G3YC 5EJ3A 1XNKA 1QKQA 1O3TA 5CFCB 3U10A 1C8M3 3FC0A 1S1AA 3KV5A 3NJYA 5FK7A 1W90A 5IT6A 2JX9A 5HCBA 3N9NA 4XIOA 2CU5A 2R072 3RS6A 4AEKA 4BIFA 1CAUA 5C9AB 1QQP2 4O9GA 4CDQA 1UF2C 2XL9A 5EXOA 2BNNA 4IUGA 3ST7A 4AGRA 5M0TA 1MS3A 1DZQA 3AKTA 4QM8A 2ADDA 5EPAA 2BUKA 1PM4A 3D82A 4KQ7A 4D8MA 1ULCA 3T1MA 2UY8A 2CSGA 3JCIA 3CL1A 4PF1A 5K0UC 4BOWA 5KHJA 4GD4A 4XTPA 1JODA 1VBB1 4XFIA 4MO3M 4XZUG 1Y9MA 3K4DA 4TYSA 5DXDA 4CTEA 3AKPA 3KF3A 1UXXX 1RVF1 2B9UA 2E7TA 4RQPA 3POSA 2X53S 1J83A 4Y5Z0 3ZXKA 1ND3A 3POYA 4AEDA 2NM1A 5FYBA 2WO2A 3EO6A 1YUDA 4XJZA 1O91A 3VBHC 1W0NA 2DUPA 2VPVA 4GH4A 3WUCA 1JHJA 2E7AA 4ORFA 1W6MA 1FATA 2RS31 4CCEA 2B45X 2JKXA 5C8CB 1R083 2XVGA 1IGOA 3AP4A 4XF9A 2RM23 4CP9B 1XE7A 1RUF3 4DUVA 1S2KA 4KGQA 4OMCA 3RQ0A 2BP6A 4IW3A 1PMJX 3T0BA 5C70A 3IT8A 4QU2A 3K3OA 4MGQA 4NHYA 4CDXC 1POV1 2YFUA 4UFHA 2A71A 4JVAA 1CZVA 1DQ0A 3IKWA 1H30A 1R1A2 2PHTA 4ISQA 1KQRA 4NHLA 4QGMA 4L97A 2O8OA 5I8TA 4Y33A 3VGIA 3WDWA 4NWVA 2D5HA 4GKYA 3ZXEA 4YW7A 1GOGA 2JECA 4Y3OA 3ZFFA 4W6XA 2OQ6A 4D0QA 3WW2A 3HN3A 1QJU3 4NO4A 3SLIA 1J1TA 3S0MA 5A33B 4I3PA 3O1SA 4G9SB 3ZFGC 4JDOA 4OUEA 1OLMA 3H3ZA 4CVUA 4DPNA 2RMU3 2YBPA 3LSEA 1DFQA 2LALA 2NZ9A 3T0DA 2KR2A 4YARA 3VBOC 1EV13 2R7EB 2PHFA 4XJ8A 1GQHA 2AUYA 2VOXA 3D0JA 5DG1A 4Q8LA 4XDPA 1JU3A 1XSQA 3K48A 4HZFA 3ZKUA 2C24A 3PU3A 1GBGA 1URXA 2D43A 2Y6FA 1Y43B 3O5SA 4UOJA 4YFWA 4ZHNA 3OYWB 1LCLA 1IKPA 2EXIA 2V5YA 5E1RA 3JB8A 3JQWA 2R063 2E7QA 2XJRA 3JZVA 1G9AA 1NLQA 1X50A 2YPJA 3KCCA 1REDA 2C4XA 1DDLA 1WLWA 2ATFA 4A4AA 1QDCA 1NZCA 3N9PA 4LPLA 3SH4A 3UYJA 2IVIB 1KITA 3USSA 4LOSA 3WW3A 4NMIA 3S7IA 2W1QA 1QJY1 4CCKA 2PELA 2JG8C 3B94A 3VBSC 1F9KA 3CF6E 3GBGA 1V9U3 3ZSLA 1SACA 3DCQA 1RUJ2 3M3IA 5FZ6A 1PO12 3POGA 5IVCA 2YG0A 1UY2A 5ACA2 1FAYA 1ASJ1 3OCPA 3VHRA 4ZS2A 3WNNA 4B4QA 5IVBA 3DL3A 3OG2A 1ZRCA 1VBE2 4JGYC 2BFUL 3T09A 2W95A 4NVPA 1WMFA 3U4XA 3TEWA 3H9AA 1OXCA 3A7QA 3N7KA 3EMRA 5FZKA 4YLZA 4C1XA 3CZUA 1YQCA 2W0XA 4QB6A 2XHNA 1HB1A 1VBD3 2F6BA 5GALA 5FK8A 1IPSA 1NXD1 4LQRA 4UW6A 2GZWA 4AI9A 1JZ5A 4CCOA 3BODA 2CYFA 2FCVA 3ALQA 1H2KA 4NOTA 1JYNA 4JQTA 3WG2A 3TB0A 3PUSA 5KWRA 1LOFA 5F5AA 4V2WA 4QKNA 3IZOA 2A70A 3BGAA 4ZZ5A 2ZGTA 5F6KA 1LNSA 2DTYA 4QDQA 2WS92 2YBSA 4CU8A 1RUE3 2MPFA 5DUXA 3RZZA 1S0IA 2GALA 1UX7A 2Z42A 1J1LA 1TEIA 3R4DB 3SH5A 2RS12 3J26N 4UI9L 4LO6B 4IGOA 4HL0A 4TXWA 3I2OA 1XOYA 1IPJA 4AEJA 4OI2A 2PQQA 1JZ8A 2HWB2 1H8TB 2P3KA 1RUG1 1UKGA 3JBG1 2IZWA 4XUTA 4CDUB 3JQXA 5K8SA 2Y6JA 1OKOA 1ZBE3 2NMNA 2YV8A 3N9MA 3MUY1 3KT7A 2ARBA 3L9JT 5FY9A 5F5QA 1SFYA 3I8TA 2VBDA 4YGBA 4GWMA 3V65A 1VAVA 2GP5A 3IM0A 2ZHNA 4P02B 2OIIA 2H0BA 1SQ4A 4GB32 5IHRA 4Y1UA 3DPRA 3I7DA 2E6VA 2WN2A 4XAAA 3B69A 5BNNB 1LESA 1XJAA 1XE8A 3ENRA 2V72A 3WNOA 3ZXGA 1QOSA 2LS6A 1K5MA 2R1BA 1CONA 2XOMA 2B46X 4YVSB 2ENRA 3NQHA 5A1LA 1FXZA 4WM7B 1AXZA 3H1MA 5F3EA 5CFDC 1C3HA 2BV4A 5IK8A 2WNVA 3ILRA 1GWLA 3I59A 3PVEA 3THPA 4DUXA 1O5UA 3HR9A 4JGZC 1VMJA 2WFF3 1VRH1 3OBAA 4N43A 4JTOA 5FZ3A 5FRAA 4HKOA 4Q4W3 2ZPXA 3IPVA 4C0BA 1PK6C 3IIIA 3UL2A 4CUCA 3VV1A 4AI2A 3WF4A 2WNUC 3SEEA 2PXJA 1LR5A 4QPGA 5C4WA 4S2HA 1MS1A 4CP0A 3W9AA 3MW3A 1VBC2 1ZBA2 1JYCA 2QQNA 4ZONA 3R4SA 3JB4C 3WG4A 2Y38A 2BNMA 4PDWB 3BB6A 3Q8EA 1F5FA 3VZNA 3DV8A 4YM0A 5C33A 5F7UA 2P17A 2ZOEB 4ES9A 1JBCA 2ZGPA 1S0CA 2WA4A 1S0BA 5JXHA 2BBAA 3DF0A 4B8EA 5CA6A 4OI0A 5DAPA 4QDSA 5D8AC 4DUWA 3CMGA 4NPRA 1JOBA 5FYMA 4XOGA 3UKTA 3IDCB 3WF2A 4MGKE 4QKFA 3PURA 4GJZA 1ULFA 5AVAA 2HYKA 4FPHA 3SCFA 4COVA 2Q1MA 1RUNA 1QH7A 1N47A 3TN93 4PQQA 2VZUA 3AYEA 5FO9B 3ZXFA 1KDMA 2QKDA 2VVDA 4V1PA 1G9DA 3POJA 4LBLA 2AEYA 5FYZA 5CADA 3E5XA 4XF1A 1GUIA 2JWPA 1AX1A 4X6QB 3H8XA 4BCUA 4UW5A 3VKLA 2BVBA 2DURA 1NG0A 1RB8G 2Q4SA 2A3XA 4AAPA 3AZXA 2D6KA 4OHVA 1AL22 5A32B 4B4PA 2VD7A 2EICA 2ZHMA 5F37A 3AXEA 2DVBA 3OF1A 1ZZ9A 2IXJA 1OVSA 3HQRA 1U12A 3CHXA 4MG2A 1WUVA 4DXRA 2FBEA 2EA7A 1VJ2A 2R30A 1W8HA 2XXZA 4RFRB 4JHZA 4QX1A 4M3CB 3T3YA 4AE2A 2BPA2 3M3OA 1JS9A 1UY4A 2JDZA 3AFKA 5C8WA 2OPWA 4WBBA 5GKAC 3ZN4A 4AQ6A 1XXNA 3FLPA 2QQPA 2E51A 1HV0A 4ZU4A 4ES8A 1GQGA 5CBLA 3VBHA 4SBVA 1PGSA 1Y9GA 2A6XA 2QQOA 5C7GA 1CX1A 3NAPC 4QMAA 2J1EA 1OUSA 4K3UA 2ETEA 5DAQA 2WDBA 3SXWA 1S2BA 3WQ1A 4CP9A 4KG8A 3HNBM 3ZPYA 4YW1A 4C0HA 4CXYA 3H1YA 1W3VA 3I2KA 2RS32 2RS53 5GZDA 5J1XA 1QGLA 4PLMA 5FYYA 5L19A 1RUI3 2BOJA 5FP9A 4AAXA 4CSWA 1R1ZA 1GQPA 1WLCA 4PBOA 1UOFA 5LY1A 2EIGA 4FAHA 2VMCA 2QFEA 1UXZA 3BTZA 2VNOA 1ZX5A 1PGL2 1O8PA 3DYPA 1MQTA 2PMWB 3B93A 3I49A 1R093 2XL7A 4IEZA 3BIWE 2WZR3 2X05A 2DBNA 2XKPA 3WR0A 1N3PA 2XBO3 4K21A 4IE7A 4RR3B 2AZ5A 2ZEXA 1OHFA 4AW7A 3IBMA 1SEFA 5FPZA 5A7WB 2ARCA 2HWD1 1MZEA 4Y20A 4AFBA 4XEZA 5F3GA 2GAUA 3FHAA 4E9KA 3TEZA 3K4AA 3PMEA 1OURA 2D6MA 1RUH2 3AYAA 4GA9A 2Q1FA 4URTA 5LBEA 1QJX3 2QVSB 4AI0A 1KXGA 2PHDA 1N1TA 5FZ9A 5LEJA 3HWJA 2R071 5FDBA 3V0BA 1QQP1 3OYWA 1NA1A 4DRVA 2V73A 4QB1A 3IDEA 1O8SA 5FZDA 1RINA 2C9KA 2HWF2 2VMFA 3RZGA 4P5YA 2EXKA 3FLRA 4GKXA 2W68A 4LKFA 4X8PA 2BRTA 4BB3A 1IQAA 3SKVA 2OXBA 1PIV1 5FJKA 1E5IA 1CAUB 2CGPA 2FDIA 4L8QA 5L9VA 1SLBA 1FOD3 1TNRA 4LBKA 5JSRA 1FT9A 3KMHA 3WEZA 2Y26A 3WQBA 1C5HA 4B7EA 3WD5A 5A6QA 2XHKA 3ON7A 1HW5A 4OQ8A 5GLVA 3WVJA 4AFDA 2ZEYA 3Q9OA 2P3JA 5KHKA 1MS8A 1WLTA 3FWEA 3U4SA 3LEKA 3WDXA 1T6GC 1VMHA 3I2FA 5BUVA 4ZXEA 1GP4A 2XJQA 2BJSA 1V6NA 5HCFA 2KA3A 1AZDA 3POWA 4A45A 1C5IA 3G6JB 3AL6A 1S55A 4WM8C 5BV6A 2QDRA 4Q0VA 1ND3B 4AEDB 5HV0A 1XB9A 2GC0A 4FTSA 1B35A 1SLLA 2B7YA 5GLZA 1GMMA 4U2AA 1GFF2 3VD5A 4RS5B 3WW4A 4MGSA 1FI2A 4QAWA 4N9IA 5EFUA 1PO22 3MPBA 2IFRA 3QOPA 1UZ0A 1JYIA 1Z7S3 5FXXA 1WW5A 2HJIA 4HSLA 4OQ9A 4CU6A 1BVVA 1NXMA 1RJ7A 4HANA 2Y60A 5AVPA 4YW2A 4NHMA 1AXYA 1FPN3 2D44A 5FUNA 5C5UA 1O5LA 3GZTB 2ZGOA 2WSVA 1LOBA 4FPGA 2ZGRA 2L9LA 1MACA 3THTA 3O12A 3CO2A 2W9XA 4JKMA 1WMEA 4QQHA 5CVRA 3S5QA 2PHUA 4NRPA 4IE5A 2XLGA 2IXHA 3AMMA 1CJDA 3ZXAC 5C3SA 1LU1A 4QHOA 2PN5A 4CP2A 1H8TA 2W2IA 3ZFFB 5FKCA 5BNOC 3W5NA 1ULEA 1GNYA 4ZKTB 5L9RA 1JXNA 4GIQA 3VHNA 2WBKA 1COV2 1PX4A 3NV1A 4NPLA 3LSDA 3JBG2 1UU6A 3WP3A 3PDQA 3PJYA 1U0AA 2CWSA 2VG9A 3PIJA 5T3NA 4CUGA 4KBBA 4I01A 5FY1A 1NOVA 3ZLIA 4FBFA 2FMDA 2JDHA 1YYNA 3EYPA 4Z2AA 5B2GB 3HD8B 4H55A 4LKEA 1NZIA 4RA0A 2ZCWA 1RUD2 3UV9A 4L11A 3VZOA 2MEV1 3WOGA 2AC1A 3PU8A 2ZZJA 2AREA 4K6BA 1G9FA 3VBUB 1W2UA 2PLV3 1ZA7A 1YQ8A 1CAVB 1RUJ1 1S2EA 4YVWA 1PO11 1J59A 2RJLA 3HBZA 1HLCA 3BU7A 4LA2A 5FZ4A 3RI8A 2R043 2VCMA 2ZGKA 4QX3A 5ACA1 1JW6A 1RYYA 5HCHA 4UFKA 5A3UA 1TMF3 2XPJA 3IN9A 1AX0A 1VBE1 4GMP3 5CZKA 5FZOA 3HEIA 2VTXJ 4DQAA 5CAZA 2VBBA 1DGWX 2UWBA 1KEXA 2LTNA 2WYSA 4ISRA 4Y1VA 4OHYA 1S0DA 1O3RA 3OPZA 2BWCA 3INAA 3TWIA 4CRQA 3QCWA 1XNCA 3SISA 4MGIE 5J7MA 3WG1A 4FOVA 4LBNA 3HJRA 5A80A 3CJXA 3MEPA 2QZ2A 4ASMB 3PTRB 3ITQA 4HPKA 4YZ2A 2WINB 2EAAA 1AR93 5LB6A 1NQDA 3O0WA 1DU3D 4P9XA 1Z0HA 3NWKA 2UWCA 1OFSA 2AYHA 3B9IA 5LBBA 2DUOA 4L92A 5I0TA 2WS91 4D94A 1QXPA 4XF0A 3U78A 3HT1A 1RL3A 5A7PA 2WR9A 1UN1A 4LK6A 2VAUA 4CDWC 5J36A 2OS2A 1BBT3 2RS11 3G7DA 4QWNA 5FLIA 4UBGA 2WO1A 1G7YA 1BK0A 3M70A 5FWJA 1UNBA 1O3SA 3HVDA 1UMHA 3AZZA 4LO5B 4EWEA 3I54A 4CU7A 1H1AA 3H50A 3MW2A 2GMEA 4XFBA 2FHRA 5AC92 4ZZ8A 2Q30A 4KNCA 1X8EA 2ZHLA 3OOXA 1JZ3A 1MVEA 2DU1A 3ZFEB 3MIEA 1C8M2 4NWWA 5F39A 1W6QA 4FPEA 1UW8A 2A3YA 2HWE3 2UY9A 4KBZA 2VQAA 5JI9A 2MHFA 2OZJA 4QGNA 2GC2A 5I0UA 4CCCA 3OUHA 1W06A 4GB31 3VBFA 4KI5M 1DQ6A 4ITCA 3ZO0B 3VDBA 1UPIA 1UY1A 2VTXA 5F32A 2ZX1A 4LXLA 3HNYM 3U11A 3DPRB 1HKDA 4MX3A 4INDA 1H2LA 1I5ZA 1EAH3 1YWKA 3J7LA 1VBA3 4J1WA 3KSCA 1K5MB 4LUKA 5FYCA 4AQTA 4K1ZA 5FZAA 5KBFA 3QLQA 5APAA 3KHCA 4ET7A 1SLAA 1F4HA 2VL4A 4AHXA 1N1YA 1TME3 2GN3A 3LF7A 1YCIA 4FOWA 2E26A 3VZJA 4Y26A 4AVAA 1DQ1A 2KD7A 2QQVA 2VOVA 1EUUA 2ZTNA 1QXJA 3Q8CA 1UYZA 3T2OA 1JTZX 4DXTA 4TZDA 4BZ4A 1STMA 2ZX3A 4YZ4A 1R082 4LBOA 2AR6A 2Z5WA 2RM22 2XWBB 1HX6A 1O59A 2D6PA 3IPVB 1RUF2 3ACLA 3SKJE 3OPTA 1VBC1 1ZBA1 2QQKA 4IV3A 5LA9A 2DDUA 3ZYPA 5BNPA 2RR13 4QPGB 4DXSA 5FYHA 3ACGA 2FDFA 5C4WB 1KGYA 5DZEA 3TAYA 3BTYA 4NRMA 5DPNA 3GF6A 4BK5A 2GC1A 2ARAA 3WNLA 1FMD3 5LCWL 4MZUA 4NJ4A 3GBFA 4LJHA 1P8JA 4GALA 1XQNA 4P5HA 3SC7X 3SH3A 5IJRA 4RGKA 4AFMA 1HN1A 1AJOA 1GNZA 4MH0E 1SCRA 1CGPA 1OH4A 4DY3A 3J7NA 3DYOA 4Q4X3 3QBQA 4OULA 5A7WA 1CZSA 4LO7A 5HXMA 1ACCA 2Q8CA 1CX4A 1NCRC 2K9ZA 3RPQA 2IXIA 2VCAA 4IEXA 1APNA 4Q8KA 1CIWA 1LTEA 1YQ2A 4IDZA 1D2QA 2WT0A 1BLZA 2X5IC 1BMV2 2RMU2 1DYKA 1ND2C 4AFCA 4K20A 5IK4A 5JZGA 4FI9A 4CEWA 1BEV1 1JZ6A 3LDRA 1Q8SA 1EV12 1VIWB 1OKQA 2XB6C 4C8DA 1H8VA 2W5FA 5ERLA 5LASA 3LA2A 1DZTA 2ZGUA 2DFCA 2JKBA 3NV4A 3OB8A 1AL21 1OLQA 4YG3A 3RYRA 5KXDA 2FZ2A 1K42A 1J3QA 5DAXA 4DB5A 3UGFA 4HN1A 3KT4A 2R062 1G86A 3BTXA 3VZMA 5IATA 1PIV2 3U14A 1QNYA 2FCUA 1UWWA 3VL9A 5BY5A 2HBTA 4FQZA 3ZN6B 2XMLA 3KHBA 2P4EA 5CG8A 1LGBA 1BVP1 2XWJB 3ASIA 4OYUA 2JG9C 4FAGA 1O4YA 1WW4A 5FZCA 5FR3A 3TEYA 5FZ0A 1GWKA 5CFCC 1CJPA 3O0XA 4QX0A 1MZ6A 1R64A 4BISA 3VB9A 5CKMA 4N90A 4UW4A 1V9U2 4YZ3A 5DUVA 4QKBA 3P6BA 3T0AA 5C9AC 4QPIC 2HEVF 1YJKA 4Q0UA 4MLOA 1MVQA 5FFOC 4W4ZA 5B4NA 2WJSA 4WM8A 1VMFA 5GZGA 2IUWA 3MGUA 5DN2A 1BYHA 4BQYA 1W8OA 3POEA 4RS5A 1DGWA 5KXBA 3VBHB 4ARXA 5A3OA 3P1IA 3EHKA 4CU9A 2W1WA 1ULPA 4NRQA 4P08A 4XMAA 3H8OA 5GM0A 2JD9A 1WD4A 5JI7A 1AYN3 1ULOA 2OZ6A 5A70A 5I0RA 2JENA 5ANNA 4DRRA 1DF0A 1LODA 2QQUA 2WC2A 3KV4A 5LA0A 4NAMA 2Z4FA 3O1PA 1YQ6A 1W6NA 2CTVA 3MIFA 2ZBJA 4CXWA 1RMU3 3VKNA 4UWDA 1PGL1 3ETQA 5CIRA 5FP4A 3GZEA 1QF3A 1ZA4A 4HK9A 2UURA 4UBHA 2QBXA 5DDJ3 5HV4A 2DVGA 1E5SA 2JIGA 2WQ8A 2GNTA 5C8CC 1I6XA 1XNBA 1H6XA 1MQTB 1WCKA 2YXSA 4AGGA 4CEYA 1UIKA 5L36A 2FDKA 1CWPA 1UIJA 4TLFA 2W1SA 3T2TA 2NP0A 1MS5A 2GMMA 4YWAA 1RUH1 5FZFA 5FO8B 1VAMA 3TBDA 4E4ZA 1MEC3 1UOJA 2GC3A 4FO9A 4X8NA 4W8JA 5J48A 3J7HA 3ZFGB 2WABA 4Y20B 3UKNA 4Q4V3 5C6CA 1OLRA 4QGLA 2JDKA 3HN1A 1WLDA 4EN9B 3MYXA 4S2GA 4XDOA 2GNBA 3WP6A 1CQ9A 1ZBE2 3BYWA 3E1F1 3H8UA 3JD73 2GH2A 4J1XA 2D6NA 5L9BA 5IVJA 4TWTA 2HWF1 1PVXA 3PVOA 4FPCA 3PTYA 4PI2A 3W21A 1BKZA 2J7MA 3V0BB 3MF6A 4HN0A 4JV4A 1D4VB 1NA1B 1WCQA 2F4PA 3KV9A 4BQ4A 2WFPA 4MYEA 1YFXA 3KV6A 1UOGA 4U36A 4P9YA 3VBUA 3N7JA 2PYTA 2GNMA 3VL8A 3AMNA 4JRAA 3WX5A 3ZVXA 4XUNA 5A3LA 5C5TA 3M1HA 2MEV2 3AKQA 3K4ZA 2WWUA 4I0BA 1CAVA 3MLLA 3W20A 3WY6A 3B9CA 4AEMA 4BLJA 4HVQA 2AACA 1FX5A 4LIVA 5FXVA 1PZ7A 4R9CA 3MDPA 2JG8B 3KQRA 4MVTA 4BPZA 2P1BA 1W2TA 4H3WA 2YUEA 1RIRA 5T50A 4L99A 3WQ7A 2XLFA 1C8NA 4PCRA 4CZSA 2DCKA 4DINB 2P5BA 3N3HA 4XZPA 5L7OA 2ZGNA 1GWMA 2VBPA 2W3JA 3CIHA 4PF5A 4IEOA 3D6EA 3VDDC 3H7JA 2WA3A 1KRIA 2QZ3A 4Q4W2 2K46A 2VW1A 2VC9A 1PVC3 1RUC1 3NNMA 2VUCA 1OOPC 1PO21 1VPHA 2WYFA 2XDVA 2P6CA 4FCAA 4EZ4A 1XC6A 1ZZ8A 1B35B 4Q0PA 3OGVA 4AXOA 1GU3A 3SNMA 3ES4A 2C5DA 1O7FA 4AQ2A 4K7JA 5FPBA 1EP0A 1HQWA 4OI4A 1AR73 1ODNA 2VMEA 3OSDA 3RJ2X 1VLNA 2X8KA 3BPSA 3TOJA 1Q43A 1W8NA 4XUQA 3LPFA 4MSVA 3C7HA 3O7OA 1UU5A 1PM7A 5D21A 1BXHA 4BQWA 1FNZA 3DECA 3NV3A 5EQUA 5IAVA 4CDWA 3RJRA 5KXCA 1LKNA 4E2QA 1C57A 2FDGA 1RHI3 1MS0A 2LRPA 2VUDA 3HAGA 3HNMA 4XTMA 2I07B 2QTWB 1CZTA 3UJQA 3RZLA 4HBNA 3CJIC 3WLUA 3SITA 3PL0A 5IWFA 1EY2A 4B7KA 4EN6B 3DXTA 5CISA 1RGSA 3A22A 5JPMB 3U37A 3BCWA 4FFHA 3W58A 1HN0A 4HOOA 3RDIA 2R1DA 3SCGA 1RITA 3TN92 1COV1 4FFGA 1JUIA 1H0BA 2R0HA 3ZFEA 2Z69A 4BE3A 3VLBB 1GP6A 4YGCA 2BNOA 5JWPA 4NIHA 1R1A3 1SCSA 2XONA 1LAJA 2E32A 1HXS3 1UZVA 1RC6A 1H1IA 2DCYA 3VZLA 4BJ0A 3WCRA 4DOUA 3ZSMA 1PMHX 5DUUA 2YHJA 1RUD1 1VE0A 4IEVA 3ZOIA 1US2A 3K51A 4LHKA 5TSWA 4XF4A 2D6OX 5DMYA 2OYZA 1W8UA 5FPAA 5JR2A 1SDWA 5FO7B 1JI6A 3F2ZA 1QXRA 2VE1A 4COUA 4XDQA 3UETA 4OCTA 1G8WA 2ZGLA 4Y1ZA 5F5CA 4CDUC 2UU8A 5BNQA 2RDSA 1HB3A 1JOPA 1RXGA 3AP6A 5JMOA 4ARYA 3I2GA 4XXAA 3A4UA 1D0HA 3I3BA 5CFDB 2ET1A 4IGPA 1Q3EA 4AVVA 4IQPA 4N53A 2IVJA 3SEPA 1D7PM 3POIA 4QXHA 4YVWB 1J58A 1VAKA 2ZEZA 1OF4A 2IWGB 1GV9A 4UW3A 5LRSA 4WV8A 2HWC1 2JJ6A 2B8MA 3FMGA 4FFFA 1VALA 4UXAA 5FZOB 3R6SA 4J6GA 1XU1A 1HIXA 1K12A 1PK6B 4FOQA 4BH9A 5FZ1A 2EIDA 4QPIB 1LU2A 1QWRA 2YPDA 3J8F1 4YVSC 2RS52 4B1MA 4BYYA 1PZ9A 4WM7C 3KZ4C 4XF3A 1OVPA 3WV6A 3X29B 1YEWA 4QQOA 1RUI2 4KU8A 1CAXA 2LUWA 4RHV3 3WG3A 4IEWA 1W6OB 4UFIA 1FV2A 3THDA 5EIYB 4CXXA 4B3NA 2WKKA 2ORXA 2DVFA 2D40A 3NNGA 4HPKB 2JB4A 3AKSA 4S2FA 3WHUA 3MZHA 5HBAA 3CBNA 4OLLA 5LY2A 3SCHA 3ZIXA 4EN0A 3BN6A 1ZRFA 4BMBA 1R092 4YGDA 1KS5A 1JYWA 5EHDA 1NCRA 3WF3A 4MV2A 2WSUA 3UK9A 2XBO2 2R49A 4KWJA 2W08A 1V0AA 1SMVA 2C26A 2X5IA 4COWA 3OD0A 2IFWA 4NIDA 1GP5A 1WCUA 4P9LA 5AC91 4PT6A 2Y64A 3LEMA 1S0FA 3ACFA 2TBVA 1QJX2 4LBQD 1QIQA 1ZZ7A 4Y5SA 5FZBA 3AYCA 3AZWA 5LATA 1BZWA 1C8M1 5KC5A 2A6ZA 3VBRC 2VZPA 1BEV2 2G9GA 4IEQA 3OGSA 2EXHA 4Q4Y3 1MR5A 1ZZBA 3AL5A 1LGNA 4H14A 1ZZ6A 1W6QB 3I3DA 1KJRA 1HRI3 1D4M3 1HJFA 5ABJC 3ZN5A 4GWJA 3FUQA 2FMYA 3LDBA 2BU9A 2Y6KA 1W0OA 5H9SA 3ZXLA 1UY3A 1DGRN 2IXKA 3FX3A 3KQ4B 1OD3A 3ZN6A 5C71A 2GH8A 3GYDA 1FOD2 1W2NA 1GYKA 1AYM3 2Y6LA 3VBFB 1IHMA 3E97A 1TNFA 3EQEA 2VW0A 1AR83 5K0UA 2HWB3 4FTEA 3HMYA 4R8HA 4ZPIA 2W52A 2VZQA 2VNRA 5EYXA 2F4LA 2YZ4A 1OQ1A 4RGAA 2WWSA 2G4IA 4XHBA 1KFXL 2O0OA 5FZGA 2VZSA 4C1WA 4LORA 1L7QA 4Q27A 1OC1A 3U0ZA 1C28A 2D7FA 2YFZA 4I02A 4WVZA 3M3CA 2XR4A 1U5XA 5EV7A 5FZLA 3WW1A 1Q8VA 1D0GA 3ILFA 1R081 3AJZA 4X6RB 3MLJA 2JDUA 2RM21 2ILMA 3CZJA 3E6DA 1JHNA 1RUF1 1ZRIA 1SPPA 3FZ3A 4XCAA 1W6PA 5FLJA 5FXWA 4DIQA 5FCCA 1FV3A 2BQPA 1EPZA 4XCBA 3ECQA 1AF9A 5JCTA 5JXGA 2R6QA 1Z7S2 3QH6A 1I1EA 1CN1A 3LA3A 3KWVA 4CDXA 4IV3B 2VM9A 5BNPB 1UKRA 2DTWA 3F95A 4LK7A 5FY5A 3R4UA 3OBTA 2A7AA 1FPN2 1TE1B 2VW2A 4K40A 3AMHA 4SLIA 3ROUA 2J22A 1W8WA 1AR63 4OZOA 2Q8EA 5IUQA 1LENA 3C7FA 2XJPA 5HXVA 4Q5OA 2PHRA 2O1QA 2XUMA 1H1MA 1W9WA 5JOWA 1QJU1 3ILNA 3B7MA 1JU4A 1NY72 2W91A 3M7AA 4QHZA 5A7NA 1GLHA 3ZFGA 4Y22B 2P34A 3VDAA 1U5YA 2EXJA 2WNOA 1BMV1 5ANQA 2RMU1 4Q1PA 4KMQA 4FQ4A 1UZZA 3VBOA 2WO3A 4NIAA 1EV11 2ID4A 2W39A 5EJ1B 1NAEA 3M3QA 4EROA 5FP3A 5KHIA 5JZGB 4HG6B 4MOAA 3AJYA 1Q5OA 4CEWB 3AXDA 3Q8BA 1AUYA 4IETA 1V6OA 2VZTA 1HRV3 3MPPG 3LE0A 1V6IA 3MIGA 2CV6A 1T2XA 2B39A 4E8CA 5FOJB 2R061 3WUDA 2ZHKA 3JU9A 1E57A 4LE4A 4ZU5A 1QJFA 3NRUA 2YBKA 4I0WB 2B4KA 3WDTA 1F35A 5DAWA 2JG8A 4D7TA 3LIGA 1JMUB 3VBSA 5C3PA 4I3GA 2Q0AA 3BIEA 2PLV2 1V9U1 3HQXA 3UGGA 1A34A 2WT2A 4LO4B 4QT6A 3C7OA 4UYBA 3N35A 2R042 4XBNA 2W47A 1AHSA 5FY0A 2R16A 3DN7A 4D69A 5LK7B 2GU9A 3FHQA 1TMF2 1US3A 3VDDA 2QCSB 4JGYA 1YIFA 1GZ9A 5F1RA 4CDQC 5D2AA 4YM1A 2ZX2A 2LM3A 5I91A 4WM8B 2EAKA 4L2NA 5D1IA 4E2GA 1SFPA 1A6CA 1K5JA 4GMP0 3U75A 1RUC2 1VBD1 1E5RA 4MHRA 3PVNA 5JSPA 5LA2A 4A44A 3RI9A 4W6WA 3RMXA 1WMXA 2QJVA 4DO0A 1VBB3 2VVFA 3VKMA 4CPBD 3DUIA 1PX3A 5FUPA 1RTVA 5EWSA 1QMJA 4ZXKA 1RVF3 1W04A 1W6NB 1W05A 3IWZA 4ONUA 1F4AA 4RQPC 3KLSA 5E6HA 4EE2A 4XJUA 4H2AA 5IK5A 3AK0A 5HCAA 4AEDC 3ZPOA 2ZEWA 1RUE1 4WZCA 3POBA 2GN7A 3P5BA 1DGLA 4UFLA 2YYOA 4GH4C 5LBCA 4E4DX 2H6BA 3PUIA 4KWLA 2RS33 4NHKA 4W6YA 3WSOA 3VUOA 2ET7A 5J37A 1BBT2 2OKXA 4CEYB 1OA4A 3THCA 4A7YA 2Y8KA 1OA3A 5F5IA 4Y5TA 1NE6A 3LFIA 5T5LA 4E2SA 1LRHA 5T54A 3IDBB 3RZKA 1XNTA 3I2DA 3N36A 1ZBE1 4FFIA 1POV3 5SV5A 4ASLA 1MZFA 2ZKNA 1DGRA 2CNAA 4AHZA 5H9RA 3NNJA 4QQ2A 3V64A 2HWE2 3RMYA 3SHRA 5A6YA 3ELNA 3H1WA 5FMDA 1WBFA 1XYNA 4PIYA 5IVFA 2D3RA 3NW4A 4MGTA 1V6LA 2A6VA 2WO7A 3E5QA 3EBRA 4RYDA 1X33A 3ZFFC 2ZGQA 4HONA 5FKBA 2ZMLA 4PJYA 3NJXA 5L73A 1LJ7A 3K2OA 4HXCA 2PAKA 1UMIA 5FY8A 3UJOA 4EZHA 4F7ZA 5CFDA 4FOYA 4YG0A 4CYDA 1JZ7A 1EAH2 3M4FA 3LWCA 1VBA2 4KWUA 4F83A 4NIGA 3FUOA 2ZAAA 5A3PA 4ZY9A 3N4MA 4Y4YA 5GZFA 5E89A 5F2SA 4AF9A 4D3WA 4JGZA 1QOOA 1XSRA 1G9BA 3MHZA 2WFF1 4AOCA 2D93A 1TME2 2TNFA 4QKDA 4Q4W1 2HEWF 1EPWA 1PK6A 1YLLA 4QPYA 2OPKA 1ULGA 2X29A 3MIDA 2HWC2 3E5UA 3RYKA 3V0AA 5L7OB 2MNGA 2WNUA 3I97A 3IDAA 4KU7A 3MO4A 3AP9A 4XJWA 4TN7A 3SQOA 3N9OA 1ONAA 2I45A 3NVCA 3T2PA 3ZSJA 1YO8A 2VMHA 1Z78A 1LEDA 3J8F2 2DVAA 1W6OA 2RR12 3DEMA 3ORJA 1QJY3 4XHXA 5DQ0A 3LOBA 3H42B 1YQ5A 2RJ2A 5CU1A 1WMDA 2D6LX 4HFSA 4AG4A 1K3IA 2VQTA 4N7UA 3FJSA 4O61A 3MW4A 3O1UA 1KDKA 5T55A 3P3PA 4KL1A 5DG2A 1ASJ3 2XJTA 3N7LA 2JD4A 3LFMA 4XAEA 5JDBA 2BGPA 2QDNA 3MV11 4Q4X2 4RN5A 2DCZA 5D8AA 4AL9A 5EP9A 4CDWB 1Y7BA 4F3JA 4OHXA 1OSGA 4NUBA 4QX8A 2DU0A 4JAAA 2J1UA 3BOWA 4AR2A 3ZIWA 4LBQA 4J25A 1WCSA 4WVVA 5K9YA 3TN91 1T6BX 2AGSA 1ULDA 3LEIA 4K9SA 1XE0A 3VBRA 2BVVA 2JDPA 2YC2A 2Y6GA 1LOFC 5FLHA 5FYUA 4JDNA 4EYUA 1HB4A 1FYUA 4Q1RA 5ABJA 3ZMNA 3MI8A 1UZWA 1XRUA 1W9FA 4MADA 1A8DA 4I2OA 3KGZA 1Q8QA 1LOCA 1UY0A 2DYCA 2VQ0A 4PIXA 2HEYF 1JUHA 4UF0A 3WT3A 1MS9A 3CNAA 4A42A 4CCMA 3Q8FA 3NJZA 1SLTA 3WNPA 3WF1A 4ATFA 1RUG3 3I4IA 3JBG3 4HKLA 1N3QA 3GXUA 3OY8A 1GKBA 4HVOA 5DABA 2A6YA 2ORZA 1OT5A 1QJZA 4P14A 5JLVA 1NCQC 4D6SA 2HYXA 2ARXA 3D5OA 3NAPA 3ZM8A 4FPLA 4N53B 3KB5A 4LR4A 5LBFA 5I93A 2VCBA 3RYPA 4XQWA 4IV1C 5CNAA 3PUAA 1AL0G 3J4UH 3EB7A 1QNWA 4LEJA 4N9HA 5A7QA 2WLPA 3ZSEA 5AFEA 2X10A 5GZEA 5A1FA 2VGDA 1YRZA 2ZJCA 1G6NA 2RS51 3DPRC 3J7MA 4FPFA 5E16A 4NR1A 4FT8A 5IAXA 1CPMA 1AYN2 4PLNA 1RUI1 1K5MC 1DP0A 3SMHA 1WA4A 2CAUA 1JH5A 1POQA 4DZGA 1RMU2 2G19A 3K46A 2ZABA 1Q8OA 2WNVC 5JSOA 2GDFA 3C3VA 5FV3A 3OD4A 4NE9A 1CAXB 3ZXDA 1UZYA 1V6KA 1BQPA 1R091 2CWMA 2XKOA 2AH2A 4JCKA 5DDJ2 3VN4A 2WZR1 4E27A 1VRH3 4EV0A 2RDRA 1ZVFA 3KF5A 3MFCA 4N43C 1SBEA 2XBO1 4QB2A 4YW4A 5EZWA 4CCDA 4LE3A 2VULA 3KD4A 4LIUA 2A75A 4Y22A 2W87A 3LPGA 1NCRB 2BDRA 1X36A 2DCJA 1QJEA 3T4HB 3R05A 1QJU2 5A7OA 4XMIA 3VD9A 3AYDA 4QX5A 2J1SA 5C4WC 1MEC2 1QY4A 2D5FA 2G9FA 2OW4A 1QJX1 1JYTA 2X5IB 4MGYE 3CU7A 4P9IA 2WN3A 2I74A 2BERA 3C7EA 5JVVA 3DKQA 4K8FA 2I2SA 4GWIA 1UMZA 3JD72 1IPKA 1OH3A 2KXLA 2VY0A 3OUJA 2RVAA 1N3OA 3I3QA 1G9CA 5A7SA 1BCXA 3PNAA 3RFRA 3B02A 4UAPA 4M01A 1QH6A 1W8ZA 2QQIA 1REEA 1FOD1 4O65A 2PHLA 2JE9A 4BXFA 2SLIA 2FDJA 4KH9A 2DUQA 2D3PA 1OQDA 4Y1XA 3FBMA 4FPOB 1X82A 4Z82A 3ZYHA 3K77A 3RRDA 2JG9B 4META 3E6BA 4E8DA 5K0UB 1GZTA 3AX4A 5JAXA 1XNAA 2VOWA 4LUMA 4F8AA 1U5IA 1W39A 2V09A 3T1LA 2Q8DA 4XABA 3APBA 5IYYA 2J1TA 4Y1YA 4AYUA 1Q8PA 1PNFA 2WWJA 4HVRA 1GANA 2G1MA 2QUOA 2A3WA 2W1UA 1LHNA 3HQUA 1NKGA 3NMBA 2ZGMA 4YZ5A 3L2YA 4BLIA 3A0NA 1W3XA 1HJGA 3U07A 2Q5TA 2KM2A 2RJKA 3FN9A 4K1YA 2XVLA 2VZOA 1PVC2 4XFFA 4Q0QA 1VB2A 1W03A 2VCCA 4DMIA 4RD7A 4CPBA 1OQEA 1Z7S1 3NSTA 2JIJA 1SPPB 1VBD2 4JHTA 1W6PB 2XJUA 1S0JA 1XNDA 2ZMKA 4LNVA 1BJQA 2IXLA 1ENQA 1IS3A 2EIEA 4JZRA 3VZKA 3C7GA 3AFGA 2UYBA 1AR72 3N9QA 1FPN1 3QACA 1KJLA 4YZ1A 1NE4A 5FJHA 4CDXB 2LW8A 1LEMA 1UPSA 3RG0A 3BU0A 3ES1A 1OF3A 4LULA 1Y4WA 1ZRRA 3K75B 5G04L 4YW3A 4AVCA 1NUKA 3T08A 2XLAA 4GAZA 4JX0A 4EJRA 4CCNA 3LB9A 5GLUA 4BMEA 1RUE2 1UYXA 3WINE 1W9YA 1RHI2 1NY71 1XYPA 3GCWA 4NPMA 4NROA 4XILA 1HQNA 5KHGA 1YHFA 1S0EA 3VKFC 3K3NA 4WVMA 5BNOA 3WNKA 4LLFA 1E5HA 4CA9A 2ZX0A 3MICA 4YSFA 5LA1A 4FSJA 4AHYA 3ZYJB 5F8PA 3S7EA 5CEHA 5CKQA 5FZ7A 2JICA 1UL9A 3USUA 1XBFA 3H0OA 3VBOB 3N7MA 3RZJA 2ZXQA 5F3IA 1HXS2 1MQTC 1OFNA 1JZ4A 4GWNA 4IEYA 5B4XA 2UWAA 3BOPA 3GNEA 4BU2A 2OT7A 3A21A 4D7YA 3BVCA 3ZYGA 2ZKLA 3ACIA 1IQDC 1WWYA 2HWD3 3AZVA 4IEPA 4BIOA 5FZEA 1ST8A 2GSYA 1IOAA 2ZZQA 3CLPA 4M0NA 4RGGA 3OBZA 3NO8A 3WCSA 3O1TA 2PLV1 4LLOA 5FQ0B 1WW7A 2FZ1A 4GQ7A 2ZGSA 3O1OA 3FHIB 2VO5A 3OGJA 4YFZA 2FQPA 3VBSB 2R041 1ODMA 1SHWB 4V2VA 1TMF1 2VXRA 1TZOA 4XURA 2R073 3MIBA 4GMP1 2JDYA 3NNLA 1QQP3 4XJ9A 1NA1C 2YGLA 2WFF2 5FP7A 3LCPA 4D7SA 4W50A 3OGRA 3I3MA 3VDDB 4Z92B 1PIV3 2PFWA 4JGYB 3UKVA 1N1SA 4LKDA 2ADEA 2P3IA 5AFBA 5F9TA 1UU4A 2VNVA 1OOPB 2YC0A 4OUMA 4XW3A 3ZYIB 1YIPA 4JTNA 1C1LA 4YG6A 3HOBA 5FWEA 2VXJA 1RUOA 3I3EA 3KVBA 2OQ7A 4GXLA 3TEXA 1AR91 4RHV2 5A3NA 2EIBA 2TEPA 4QX7A 1ZM1A 5FMOS 3ZYFA 5A3TA 4GJYA 1GOFA 2Z79A 5EYYA 4A3ZA 1CIYA 3IIAA 1ENSA 4IXLA 1F15A 4Q2FA 4CCJA 4L0PA 4YM2A 3OTFA 4DXZA 4AVBA 4R4XA 4QXCA 2BZDA 4FPJA 4LOTA 4BDVB 1VR3A 4CP1A 1BBT1 3LA7A 1B35C 1LB2A 2VTFA 3MIHA 4HKWA 4UFJA 2CDPA 2BYVE 1LOAA 3MLKA 5FIXA 5C3OA 5ISLA 5FTTC 1LOEA 3CJIB 4YGEA 5GJ6A 2VJXA 2RDNA 2EF6A 4LBJA 4YYOA 3OBRA 3GJAA 3UGHA 2ZX4A 4GULA 4YM3A 3WNMA 3WF0A 4BM8A 2XH6A 1FNYA 2OUJA 4N7IA 1GR3A 2RG4A 3O14A 1WZXA 1UQXA 3MF9A 4NIIA 2A73B 2HWE1 4KWKA 1DG6A 4Q4Y2 1S0GA 5FXZA 2CHHA 2DVDA 5FY4A 5FBZA 3VDCA 4FPYA
chains in the Genus database with same CATH topology
2DFBA 1V70A 1HRI2 1D4M2 1SLIA 4OVEA 2Q8OA 1M06G 1LGCA 1RJ8A 2C0ZA 2VECA 4R9DA 1OPMA 1AYM2 1H8TC 1AR82 3VHPA 1EAH1 4A7ZA 3NKGA 1VBA1 3GZAA 4I30A 5KHHA 1GZWA 2Z2SB 4WZFA 3ZMOA 1NCQA 3M3EA 3IMNA 4LTAA 1TME1 4FPKA 4IV1A 4XXPA 4JGZB 4EWAA 3FFZA 4JC1A 4OHWA 4DS0A 1O4ZA 4OHZA 1WBLA 4KG0A 5GZCA 1YI9A 3S30A 1LHUA 5BNNC 3WNXA 2MEV3 2NN8A 3JUUA 3V0AB 1DQ2A 2EALA 2WNUB 1UD1A 2RR11 2QNKA 3LAGA 2ZA9A 1J3RA 1CAWA 1DBNA 1H4HA 1ZZCA 2RE9A 3RS6A 1FMD1 1RUJ3 2P2KA 1PO13 4YVWC 3V56A 2PTMA 5JOXA 5ACA3 4B4RA 1KFUL 3DGTA 1VBE3 4Q4X1 2CY6A 1BK1A 4PQ9A 1AR62 4AVTA 4XQDA 2WZR2 3TRSB 1B09A 1IS4A 4TSVA 4A2UA 2GMPA 3FBYA 1PZ8A 5JPNB 1CVNA 5FAXA 1LHWA 1YFWA 4HETA 1QU0A 5D8AB 4LHLA 4R52A 4XQ4A 1ND2A 1Q56A 3PJQA 3AP7A 4LBQB 4H7MA 4PDWC 4DFSA 3AZYA 3VBRB 3GHMA 2D97A 4M00A 1DQ5A 4AI8A 2WS93 2VMIA 4QHBA 1PGW1 5T5JA 1HRV2 3WP5A 2WT1A 5ABJB 2E9QA 1C4RA 2RS13 3R0RA 3KM5A 2BGCA 1UCXA 4IL7A 4M3CE 5KC6A 3M2MA 2R0FA 5KXEA 2JG9A 5A3MA 1CESA 1KS4A 5CFCA 2CAVA 2K2SA 3H3UA 2C9AA 2VVEA 4XYXA 5C9AA 3WDUA 1Y9QA 4QPIA 2WL1A 5LK5A 4RSUA 5JR7B 3OY8B 3RWNA 1H2NA 4HK8A 1CD3G 1OI6A 2Y0IA 4QM9A 5DZFA 1REFA 2NMOA 4P9WA 2ES3A 1N1VA 2YGMA 5SV8A 1O3QA 4GB33 3LKJA 3NAPB 1CR7A 1SLCA 3VBFC 4IEUA 4AI1A 3VKOA 4AQSA 4FXKB 3H7YA 1YJLA 1AYN1 1NLRA 3O0VA 4Z2WA 2QE3A 3TYJA 1TQ5A 3ATGA 4HSJA 4YNIA 1VBB2 3WDYA 1RMU1 3NV2A 5JOYA 4Q0SA 1H9WA 2OUHA 4EN7B 3BALA 1RVF2 5DDJ1 2N7GA 3NKTA 1X8MA 1ZREA 5C8CA 2HKXA 2RHPA 1H2MA 4PIZA 5BPXA 1U5ZA 4FVVA 2DCTA 4I0AA 3AM2A 1MEC1 1VBC3 2YROA 1HQLA 1ZBA3 4B29A 5BNPC 3C2UA 4IV3C 4AI3A 5JIAA 4Q4V1 2UYAA 5J96B 4LBMA 3GHNA 1PNGA 1X7NA 5I8SA 1QHDA 3JD71 2PHWA 2VUJA 1V6JA 3A0KA 4XFHA 5K7PA 1PHMA 3AKRA 4BQ1A 2IXCA 3P3NA 4M0HA 4RR3C 2PAEA 3EXUA 1F5JA 4QQPA 5A33A 1POV0 3KCXA 1H4GA 4MXWB 5LRRA 4W65A 1HDKA 1OMIA 1WGPA 4C90A 1VB4A 5FQ0A 1JN2P 3LZZA 3LGRA 1OA2A 1A78A 5JZGC 4CEWC 1BEV3 2ZMNA 4P9GA 2JEMA 2IC1A 2OVUA 1GNHA 1IS6A 1LULA 2ERFA 2XVKA 1AX2A 3QH7A 4XFGA 5T5PA 3B3QE 2ZAHA 1GSLA 2VNGA 4S2DA 3KCYA 1AL23 3PVBB 4FXGB 4CDQB 1O4TA 1WCDJ 2WLQA 2XJSA 1PVC1 1OOPA 5E88A 1A8MA 3FLTA 1AJKA 5FMOL 2O8QA 4C91A 5I8YA 4ATEA 2BBVA 2K0GA 1AR71 1QJY2 1ZYBA 5HI0A 1DIWA 2YDEA 4XIKA 3GALA 1I9RA 3HIFA 4R9AA 4AK3A 1AR92 4HLTA 2GNDA 1DYPA 1C1FA 1DQ4A 1MS4A 2P37A 4RQPB 1F8VA 1LOGA 4KGGA 3QD6A 4Q26A 1ASJ2 1ND3C 2DV9A 2XGXA 4XFAA 1DZRA 5IK7A 4IESA 1RHI1 4P9JA 1UAIA 3URFA 4RS5C 4OI1A 3CJIA 2EVXA 4GH4B 5GLWA 1PMIA 1W6MB 3PMSA 3PHMA 4HT1T 3ZX7A 1KD7A 1NYWA 4QQLA 4Z1VA 3RNSA 4WVMB 1V6MA 4EN8B 5BNOB 3ZXJA 3D0SA 4Y24A 1QDOA 4DY5A 3KS7A 1WD3A 2E53A 2NLRA 4HMZA 1R1A1 3TNPB 1HXS1 4OZXA 4XBLA 3EJKA 5FPXA 3USUB 2WZPP 5J3UA 4AFAA 2VOKA 1YFUA 5LEKA 1GZCA 2OA2A 2PHXA 4CEYC 2VUAA 5H9PA 2VMGA 4BWOA 1RUH3 4JRLA 4XPVA 3OJBA 4MGZE 4JDMA 2XG3A 3AMQA 4CDUA 2VU9A 1SFNA 3WHTA 2D98A 4BHPA 4COYA 5BYNA 1RUG2 3KT1A 2Y0OA 4BA6A 3NL1A 4AWDA 1XU2A 2ZACA 3D4KA 2Q1ZB 2HWF3 2E63A 2B5HA 5DUWA 1MZ5A 3D8CA 2CGNA 3KGLA 5BNNA 1W0PA 2NQYA 5BXXA 4YVSA 1WW6A 3BTAA 3VHOA 3FE5A 3VBUC 4WM7A 5CB7A 3BPZA 5H9QA 2NYYA 2BWAA 4H7LA 4XETA 2PAMA 5J09A 4LO8A 2H0VA 4XFCA 3W59A 4RHV1 3WDVA 4Q29A 2BEOA 1FMD2 4MXVA 1JOJA 3WP4A 4IERA 5T52A 1H9PA 5T5OA 1SBFA 3AB0A 5CG9A 1VRH2 5L7OC 3ZYRA 1YXWA 1ZNPA 3S6PA 3RSJA 1EYBA 3MFAA 1HV1A 1ENRA 1RUC3 2NPIA 1PO23 2R32A 5FOBB 2C1FA 2BFUS 1ZRDA 4WVWA 5DZGA 1NQJA 4I09A 4PDWA 2DF7A 1A3KA 3CEWA 4OFGA 2ZS6B 1IKQA 2PA7A 4Q4Y1 1AVBA 4LT5A 1J3PA 1UX6A 3LOIA 2SBAA 4FTBA 1YFYA 3FFQA 3E6CC 1V00A 4PBPA 1HRI1 1D4M1 3ZSKA 2TUNA 1ENXA 4R9BA 1F31A 2YY1A 1I3HA 1LHOA 1PGW2 5I0SA 1OPOA 4R4ZA 4PLOA 1AYM1 3WXPA 5FREA 4XBQA 4EWDA 1AR81 2HWB1 2BW8A 5JMCA 3AMPA 3OGGA 5E8AA 4YW5A 2WQZC 4JQRA 1COV3 4DNYA 3ZFEC 1IS5A 4L9BA 3WZ1A 1GZWB 2D3SA 3AP5A 4ZU7A 1NCQB 1YNAA 5A32A 4Z8BA 1M4WA 1RUD3 4COZA 1F2NA 4AHWA 3DKWA 4A7KA 4O9EA 1Y3TA 5LRSA 1L3JA 4IV1B 2CL2A 4LA3A 5J98B 2VH9A 3J9SA 3B5LB 4G4FA 3TNQA 4M3CA 3PLQA 4XJAA 3ZDSA 1CAWB 2WNVB 4N53C 1XYOA 3I59B 4E4SA 1AR61 1D2SA 2JE7A 2HWC3 4QXKA 4N43B 3HT2A 4LHNA 3B01A 1IZ3A 1OD5A 2CGOA 2A6WA 2A5ZA 3GBWA 2H6CA 1DHKB 4OUSA 4A3XA 2DWRA 3J8F3 4QPGC 3ME2A 1LECA 1VP6A 2YMZA 2WQ4A 4FP3A 4RFT0 4Z07A 1NLSA 4M3CF 1SBDA 1ND2B 2XJVA 3GZUC 1QOTA 4Q4V2 1DLLA 2BTVC 4QD2A 4RR3A 4XE9A 5JOZA 2WNEA 3B00A 4MUVA 1HRV1 2B42B 3M8LA 4MXWA 3WQ0A 4RL7A 2JXAA 1CPNA 1AXKA 1YI7A 4FP2A 5GLTA 4AGVA 1LHVA 2AENA 1ALYA 5JIUA 2HWD2 2WIIB 4NN0A 5F6LB 1GICA 5AC93 3L2HA 4G3YC 5EJ3A 1XNKA 1QKQA 1O3TA 5CFCB 3U10A 1C8M3 3FC0A 1S1AA 5IT6A 2JX9A 5HCBA 4XIOA 4AEKA 2R072 5C9AB 4BIFA 1CAUA 1QQP2 4O9GA 4CDQA 1UF2C 2XL9A 5EXOA 2BNNA 3ST7A 4AGRA 1MS3A 1DZQA 3AKTA 4QM8A 2BUKA 3D82A 4KQ7A 1ULCA 3T1MA 2UY8A 3JCIA 3CL1A 5K0UC 4BOWA 5KHJA 4XTPA 1VBB1 4XFIA 4TYSA 5DXDA 4CTEA 3AKPA 1RVF1 2B9UA 2E7TA 4RQPA 3POSA 2X53S 4Y5Z0 3ZXKA 1ND3A 3POYA 4AEDA 2NM1A 3EO6A 1YUDA 4XJZA 1O91A 3VBHC 2VPVA 2DUPA 3WUCA 4GH4A 4ORFA 2E7AA 1W6MA 1FATA 2RS31 5C8CB 2B45X 1R083 2XVGA 1IGOA 3AP4A 4XF9A 2RM23 1XE7A 1RUF3 1S2KA 4KGQA 3RQ0A 3IT8A 4QU2A 4CDXC 1POV1 2A71A 4JVAA 1DQ0A 3IKWA 1H30A 1R1A2 2PHTA 4ISQA 1KQRA 4NHLA 4QGMA 4L97A 2O8OA 5I8TA 3VGIA 3WDWA 4NWVA 2D5HA 4GKYA 3ZXEA 2JECA 3ZFFA 4W6XA 3WW2A 4NO4A 1QJU3 3SLIA 1J1TA 3S0MA 5A33B 4I3PA 4G9SB 3ZFGC 4JDOA 3H3ZA 4DPNA 2RMU3 3LSEA 1DFQA 2LALA 2NZ9A 4YARA 3VBOC 1EV13 2PHFA 4XJ8A 1GQHA 2AUYA 2VOXA 3D0JA 5DG1A 4Q8LA 4HZFA 3K48A 1GBGA 1URXA 2D43A 3O5SA 1Y43B 4YFWA 3OYWB 1LCLA 1IKPA 2EXIA 2V5YA 5E1RA 3JB8A 3JQWA 2R063 2E7QA 2XJRA 3JZVA 1G9AA 1X50A 2YPJA 3KCCA 1REDA 1DDLA 1WLWA 2ATFA 1QDCA 1NZCA 3SH4A 1KITA 3USSA 3WW3A 3S7IA 1QJY1 2PELA 2JG8C 3B94A 3VBSC 1F9KA 3CF6E 3GBGA 1V9U3 3ZSLA 1SACA 1RUJ2 3M3IA 1PO12 5ACA2 1FAYA 1ASJ1 3OCPA 3VHRA 4B4QA 1ZRCA 3DL3A 1VBE2 4JGYC 2BFUL 3U4XA 4NVPA 1WMFA 3H9AA 3N7KA 4YLZA 4C1XA 2W0XA 5GALA 1VBD3 2F6BA 4UW6A 1NXD1 2GZWA 3BODA 2CYFA 3ALQA 1H2KA 4NOTA 3WG2A 3TB0A 5KWRA 1LOFA 2A70A 2ZGTA 5F6KA 2DTYA 2WS92 1RUE3 2MPFA 5DUXA 3RZZA 1S0IA 2GALA 2Z42A 1J1LA 1TEIA 3R4DB 3SH5A 2RS12 3J26N 4LO6B 4HL0A 1IPJA 4AEJA 4OI2A 2PQQA 2HWB2 1H8TB 2P3KA 1RUG1 1UKGA 3JBG1 2IZWA 4CDUB 3JQXA 5K8SA 1ZBE3 2NMNA 2YV8A 3KT7A 2ARBA 3L9JT 5F5QA 1SFYA 3I8TA 4YGBA 4GWMA 3V65A 1VAVA 3IM0A 2ZHNA 2OIIA 2H0BA 1SQ4A 4GB32 4Y1UA 3DPRA 3I7DA 2E6VA 3B69A 5BNNB 1LESA 1XE8A 3ENRA 3ZXGA 1QOSA 1K5MA 2R1BA 1CONA 2B46X 4YVSB 2ENRA 1FXZA 4WM7B 1AXZA 3H1MA 5CFDC 5IK8A 1C3HA 2WNVA 3ILRA 3I59A 3PVEA 3THPA 1O5UA 3HR9A 4JGZC 2WFF3 1VRH1 4N43A 4JTOA 5FRAA 4HKOA 4Q4W3 2ZPXA 3IPVA 4C0BA 1PK6C 3UL2A 3VV1A 4AI2A 2WNUC 4QPGA 1LR5A 5C4WA 4S2HA 1MS1A 4CP0A 3W9AA 3MW3A 1VBC2 1ZBA2 1JYCA 3R4SA 3JB4C 3WG4A 2Y38A 2BNMA 4PDWB 3BB6A 1F5FA 3VZNA 3DV8A 4YM0A 5C33A 2P17A 2ZOEB 4ES9A 1JBCA 2ZGPA 1S0CA 2WA4A 1S0BA 3DF0A 4B8EA 5CA6A 4OI0A 5D8AC 4NPRA 4XOGA 3UKTA 3IDCB 4MGKE 1ULFA 5AVAA 2HYKA 4FPHA 3SCFA 4COVA 2Q1MA 1RUNA 1QH7A 1N47A 3TN93 3AYEA 5FO9B 3ZXFA 1KDMA 2QKDA 2VVDA 4V1PA 1G9DA 4LBLA 5CADA 3E5XA 4XF1A 1AX1A 4X6QB 4BCUA 4UW5A 3VKLA 2BVBA 2DURA 1NG0A 1RB8G 2Q4SA 2A3XA 3AZXA 2D6KA 4OHVA 1AL22 5A32B 4B4PA 2ZHMA 3AXEA 2DVBA 3OF1A 1ZZ9A 2IXJA 1U12A 1WUVA 2FBEA 2EA7A 1VJ2A 2R30A 4AE2A 2BPA2 4M3CB 3M3OA 3AFKA 2JDZA 5C8WA 4WBBA 5GKAC 3ZN4A 4AQ6A 1XXNA 3FLPA 2QQPA 2E51A 1HV0A 4ZU4A 4ES8A 1GQGA 5CBLA 3VBHA 4SBVA 1PGSA 2A6XA 3NAPC 4QMAA 4K3UA 2ETEA 3SXWA 1S2BA 3WQ1A 4KG8A 3ZPYA 4YW1A 4C0HA 3H1YA 2RS32 2RS53 5GZDA 1QGLA 4PLMA 5L19A 1RUI3 1R1ZA 1WLCA 4PBOA 2EIGA 4FAHA 2QFEA 2VNOA 1ZX5A 1PGL2 1MQTA 3B93A 1R093 2XL7A 4IEZA 3BIWE 2WZR3 2XKPA 3WR0A 1N3PA 2XBO3 4K21A 4RR3B 2AZ5A 1OHFA 4AW7A 3IBMA 1SEFA 5FPZA 2HWD1 1MZEA 4Y20A 4AFBA 4XEZA 4E9KA 2GAUA 4GA9A 3PMEA 2D6MA 1RUH2 3AYAA 4URTA 1QJX3 2QVSB 4AI0A 1KXGA 2PHDA 1N1TA 5LEJA 3HWJA 2R071 5FDBA 3V0BA 1QQP1 3OYWA 1NA1A 4DRVA 2V73A 3IDEA 1RINA 2HWF2 2EXKA 3FLRA 4GKXA 2W68A 4X8PA 1IQAA 1PIV1 2CGPA 1CAUB 4L8QA 1SLBA 1FOD3 1TNRA 4LBKA 5JSRA 1FT9A 3KMHA 2Y26A 4B7EA 1C5HA 3WD5A 2XHKA 1HW5A 5GLVA 3WVJA 4AFDA 3Q9OA 2P3JA 5KHKA 1MS8A 1WLTA 3FWEA 3WDXA 1T6GC 5BUVA 2XJQA 1V6NA 5HCFA 2KA3A 1AZDA 3POWA 1C5IA 3G6JB 1S55A 4WM8C 5BV6A 2QDRA 4Q0VA 1ND3B 4AEDB 4FTSA 2GC0A 1B35A 1SLLA 2B7YA 5GLZA 4U2AA 1GFF2 3WW4A 4RS5B 1FI2A 4N9IA 5EFUA 1PO22 3MPBA 2IFRA 3QOPA 1JYIA 1Z7S3 1WW5A 2HJIA 4HSLA 1BVVA 1NXMA 1RJ7A 4HANA 5AVPA 4YW2A 4NHMA 1AXYA 1FPN3 2D44A 1O5LA 3GZTB 2ZGOA 2WSVA 1LOBA 4FPGA 2ZGRA 1MACA 3THTA 3O12A 3CO2A 5CVRA 1WMEA 4QQHA 2PHUA 2XLGA 2IXHA 3AMMA 1CJDA 3ZXAC 1LU1A 2PN5A 4CP2A 1H8TA 3ZFFB 5BNOC 1ULEA 4ZKTB 1JXNA 4GIQA 3VHNA 1COV2 3NV1A 3LSDA 3JBG2 1UU6A 3WP3A 3PJYA 1U0AA 2CWSA 2VG9A 5T3NA 4KBBA 4I01A 1NOVA 4FBFA 2FMDA 5B2GB 1YYNA 3HD8B 4H55A 4RA0A 2ZCWA 1RUD2 3UV9A 4L11A 3VZOA 2MEV1 3WOGA 2ZZJA 2AREA 4K6BA 1G9FA 3VBUB 1W2UA 2PLV3 1CAVB 1RUJ1 4YVWA 1PO11 1J59A 2RJLA 3HBZA 1HLCA 3BU7A 4LA2A 3RI8A 2R043 2ZGKA 5ACA1 1JW6A 1TMF3 2XPJA 3IN9A 1AX0A 1VBE1 4GMP3 5CAZA 4DQAA 1DGWX 2UWBA 2LTNA 4ISRA 4Y1VA 4OHYA 1S0DA 1O3RA 3OPZA 2BWCA 3INAA 3TWIA 4CRQA 3QCWA 1XNCA 3SISA 4MGIE 5J7MA 3WG1A 4FOVA 4LBNA 3CJXA 3MEPA 2QZ2A 4ASMB 4HPKA 4YZ2A 2WINB 2EAAA 1AR93 1NQDA 3O0WA 1DU3D 4P9XA 1Z0HA 3NWKA 2UWCA 1OFSA 2AYHA 3B9IA 2DUOA 4L92A 5I0TA 2WS91 4D94A 1QXPA 4XF0A 3HT1A 1RL3A 1UN1A 4CDWC 5J36A 1BBT3 2RS11 3G7DA 5FLIA 4UBGA 1G7YA 3M70A 1O3SA 4EWEA 3AZZA 4LO5B 3I54A 1H1AA 3H50A 3MW2A 2GMEA 4XFBA 2FHRA 5AC92 2Q30A 4KNCA 1X8EA 2ZHLA 1MVEA 2DU1A 3ZFEB 3MIEA 1C8M2 4NWWA 1W6QA 4FPEA 1UW8A 2A3YA 2HWE3 2UY9A 2VQAA 5JI9A 2MHFA 2OZJA 4QGNA 2GC2A 5I0UA 4GB31 3VBFA 1DQ6A 4ITCA 3ZO0B 1UPIA 2ZX1A 3U11A 3DPRB 1HKDA 4MX3A 4INDA 1H2LA 1I5ZA 1EAH3 1YWKA 1VBA3 4J1WA 3KSCA 1K5MB 4LUKA 4AQTA 4K1ZA 5KBFA 3QLQA 1SLAA 4AHXA 1N1YA 1TME3 2GN3A 1YCIA 4FOWA 3VZJA 4Y26A 4AVAA 1DQ1A 2VOVA 2ZTNA 1QXJA 1JTZX 4TZDA 4BZ4A 2ZX3A 4YZ4A 1R082 4LBOA 2AR6A 2Z5WA 2RM22 2XWBB 1HX6A 3IPVB 2D6PA 1RUF2 3ACLA 1VBC1 1ZBA1 3ZYPA 4IV3A 5BNPA 2RR13 4QPGB 5C4WB 5DZEA 3TAYA 3GF6A 2GC1A 1FMD3 4MZUA 3GBFA 4GALA 1XQNA 4P5HA 3SH3A 4AFMA 1AJOA 1GNZA 4MH0E 1SCRA 1CGPA 4DY3A 4Q4X3 3QBQA 4OULA 4LO7A 1CX4A 1NCRC 2K9ZA 3RPQA 2IXIA 4IEXA 1APNA 4Q8KA 1CIWA 1LTEA 1D2QA 2WT0A 2X5IC 1BMV2 2RMU2 1DYKA 1ND2C 4AFCA 4K20A 5IK4A 5JZGA 4CEWA 1BEV1 1Q8SA 1EV12 1VIWB 1OKQA 2XB6C 1H8VA 3LA2A 1DZTA 2ZGUA 2DFCA 2JKBA 3NV4A 1AL21 1OLQA 4YG3A 3RYRA 5KXDA