1YFYA

Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from ralstonia metallidurans complexed with 3-hydroxyanthranilic acid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies on 3-Hydroxyanthranilate-3,4-dioxygenase: The Catalytic Mechanism of a Complex Oxidation Involved in NAD Biosynthesis.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase
molecule keywords 3-hydroxyanthranilate-3,4-dioxygenase
total genus 29
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2005-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yfyA01
1EYBA 3NL1A 2PYTA 5BUVA 2UY8A 4IEOA 1VP6A 5EFUA 2BYVE 4E2GA 2PHLA 3I54A 2BNOA 2Z2SB 4XF0A 3G7DA 4XFIA 1CX4A 4IESA 5FLJA 2P17A 2FQPA 4BHPA 4QM8A 2GU9A 3QACA 1ZRRA 4YSFA 3SHRA 2XHKA 3OTFA 4HN0A 2IXCA 4Q0VA 5I0TA 5BPXA 4XFAA 4H7LA 3H1WA 1LRHA 2K9ZA 5I0RA 2XLAA 2V09A 4R52A 4XF9A 3ACLA 1J59A 3LAGA 4Q29A 4O9EA 5I8YA 3HT1A 2XLFA 1O5LA 2CV6A 3EBRA 3OF1A 1EY2A 4X6RB 1X82A 5FLIA 3SXWA 4R8HA 5KHHA 5BY5A 3DL3A 3D82A 1RC6A 4WBBA 2ET1A 4ZU4A 1J3QA 1RL3A 3DN7A 3WW3A 2EAAA 4EV0A 3H1YA 1ZRFA 3LA7A 1Y9QA 4Q0QA 4O9GA 4IEZA 3JZVA 4IEXA 2VQAA 5AVPA 3GBFA 3LZZA 5I0SA 4F8AA 1ZREA 2IXHA 1SQ4A 3E5UA 3EHKA 5J3UA 3KGLA 4D7SA 3O14A 3H9AA 4MZUA 4YRDA 3HIFA 5CU1A 1YFUA 1ZX5A 2PHDA 3B02A 2QDRA 4HBNA 1CAXB 4FAGA 3E97A 2ZKLA 2WC2A 2ETEA 4IEPA 2IC1A 3U11A 3IDBB 4Q0PA 4LA2A 1TQ5A 1ZZ7A 1FXZA 5C8WA 1CAWA 1J3PA 3VHRA 2Q0AA 4QGMA 5JSOA 3CO2A 1SEFA 1LR5A 4FT8A 3EQEA 1GQGA 3E6CC 1I5ZA 3NSTA 1ZNPA 2OYZA 2IXJA 5FQ0B 1SFNA 1I6XA 3BPZA 1G6NA 3LA3A 4XETA 1ZZCA 2UYAA 5LEJA 4B29A 2EA7A 4QM9A 4MGYE 3HQXA 4Z07A 5CADA 1J3RA 2QJVA 5LEKA 3FE5A 1YFWA 4LLOA 4WZCA 3MYXA 3M3IA 1CAXA 3EJKA 2PAKA 1O3TA 5KBFA 3L2HA 2D5FA 3H7YA 4Z82A 1J58A 1GQHA 1IPKA 3LWCA 2CAUA 2H6CA 1ZZBA 3I59A 4KL1A 2QCSB 4JTOA 2E9QA 4HVOA 4KWKA 4D7TA 4XFFA 5FCCA 4IEUA 4XEZA 3MPBA 5JAXA 2GC2A 4YYOA 5E16A 4BIFA 3OGJA 3KCCA 1YWKA 4RD7A 1RTVA 3ROUA 2PAMA 4K8FA 4ZU7A 4LEJA 3ELNA 4AVBA 5I93A 2QNKA 1NYWA 3KGZA 4MGKE 1YFYA 3UKNA 3FX3A 2XL9A 1CAVA 1NE4A 5FLHA 1NXMA 2D93A 2PTMA 1PM7A 4WVZA 4PIZA 3HT2A 2GC1A 4X6QB 4HLTA 1YFXA 3E5XA 3E6DA 2ZCWA 5C6CA 1WA4A 4IEVA 3TNQA 2WFPA 4JVAA 2GAUA 4J1WA 2CGPA 4CYDA 1OD5A 4MGIE 1ZRCA 4JV4A 3RPQA 4L2NA 4AQ2A 5KHIA 4ONUA 1VJ2A 3H1MA 4ORFA 1CGPA 4HZFA 4EWAA 1DGWA 3CF6E 3MZHA 2OPKA 1EPZA 3I59B 3WW2A 5J48A 3IIAA 4LUKA 3ST7A 4A2UA 1O3QA 1NE6A 1OFNA 1LKNA 1ZZ8A 3QOPA 3ETQA 1VR3A 2B5HA 1H1IA 4BYYA 3D0JA 3CEWA 3U0ZA 3RYPA 4HVQA 4UXAA 3SCGA 5CVRA 1X8EA 2VPVA 1UCXA 1QXRA 1QWRA 3KSCA 5KHJA 3H8UA 1CAWB 1U12A 2D40A 1O7FA 1YHFA 3FWEA 2BGCA 4MGZE 1O4TA 4I01A 1OI6A 2ATFA 1YUDA 2N7GA 4OFGA 4IERA 5EZWA 3R6SA 3S7EA 3IBMA 1Y3TA 2GH2A 4EWEA 4Q0UA 2MPFA 3FHIB 2GC0A 2DCTA 4HSJA 4J1XA 2KXLA 3E6BA 4L11A 3CL1A 4XFCA 5KHGA 4KU7A 4I0AA 3RZZA 2GZWA 2OZ6A 3DV8A 3BCWA 2B8MA 2Y0OA 1O3SA 2UYBA 3DKWA 4HSLA 5FPXA 1QXJA 2FMYA 4KWJA 3ES1A 1FT9A 3SMHA 4I02A 2D5HA 2XLGA 4PIYA 1DGRA 1WLTA 4E2SA 4XF4A 4QMAA 4HMZA 4IEQA 3IDCB 4I0BA 4Q0SA 2O1QA 4XFHA 1RUOA 4LULA 4LA3A 3FFQA 2CAVA 4I3PA 5JR7B 4QGNA 3FZ3A 4XFBA 2XKPA 4ZU5A 4PIXA 4IEWA 2O8QA 1QY4A 1UPIA 2GC3A 2I45A 1Q5OA 2OZJA 4QX5A 1RUNA 1OMIA 2UY9A 3H7JA 1ZZ9A 3NJZA 1UD1A 2H0VA 1XE7A 1DZTA 2BEOA 3M70A 1RGSA 3N4MA 1PMIA 2PAEA 1ZZ6A 2XGXA 1J1LA 5BXXA 4IEYA 5LRRA 3NW4A 2F4PA 4TLFA 4NVPA 2Q1ZB 4P9GA 2BNMA 3EO6A 2IXIA 1HW5A 3WW1A 4META 4PJYA 4I09A 3H50A 4MV2A 4HVRA 2PQQA 4MUVA 2XL7A 2IXLA 1CAUA 1ZVFA 4JTNA 3TNPB 5LRSA 3PVBB 1UIKA 2VECA 1CAUB 4EWDA 5I8SA 1X7NA 4E2QA 3SCHA 1Q43A 2IXKA 1YLLA 2PFWA 3SCFA 1L3JA 1XE8A 2C0ZA 5FDBA 4MH0E 4HN1A 3USSA 4GULA 1ZRDA 2Q30A 1XRUA 3S7IA 5F1RA 3BB6A 4XFGA 5E1RA 5BV6A 2Q4SA 4AXOA 3LA2A 4OLLA 4AQ6A 3BU7A 3U10A 4AVCA 5I8TA 4UBGA 3PNAA 2HKXA 5J7MA 5I0UA 4KU8A 3OCPA 5JSRA 1O5UA 3D0SA 4FBFA 2H6BA 3H3UA 3S0MA 3C3VA 1UIJA 3BALA 4YNIA 4N9IA 3H3ZA 5KHKA 4EROA 4XF3A 1CAVB 5JCTA 3RNSA 2EVXA 2MNGA 1Q3EA 4KWLA 3ES4A 4BH9A 4AVAA 3RYRA 5T3NA 4DINB 4MX3A 4LTAA 1FI2A 1O3RA 3CLPA 4QXKA 1DZRA 4LUMA 2BNNA 3I7DA 1EP0A 5I91A 3KMHA 5HI0A 3UKTA 2OA2A 3LOIA 4QGLA 3GYDA 2HJIA 3IWZA 1X8MA 2MHFA 2PA7A 2Z69A 4I2OA 4F7ZA 3OD0A 4N9HA 3ZDSA 5JSPA 1IPJA 5FPZA 3MDPA 1JUHA 1UW8A 5K8SA 4IETA 4FAHA 1H1MA 2ET7A 3RDIA 3RYKA 1V70A 3NVCA 3UKVA 2QVSB 1LB2A 3E5QA 3PLQA 4YARA 5FQ0A 3FJSA 3NKTA 4XF1A 1WGPA 5D1IA 2K0GA 3CJXA 4UBHA 1NZCA 3WW4A 2XKOA 2B9UA
chains in the Genus database with same CATH superfamily
4NHKA 1LGCA 1EYBA 1FNYA 1HQNA 2TEPA 3NL1A 1LODA 2PYTA 2E7QA 4NRPA 3SEPA 1VBE1 2EXIA 3ZKUA 1VBA1 1VP6A 4RR3A 5IK8A 1WMXA 5FO7B 1RHI2 1OH4A 4CP1A 2VW2A 2VOXA 4LKFA 4Y1ZA 1V6IA 4PQ9A 3VZKA 2XJPA 3G7DA 4MYEA 4GWIA 1CX4A 3U75A 5FLJA 4DY3A 3M4FA 4G9SB 2FQPA 2XB6C 4YG6A 3WT3A 5JZGB 1MR5A 4QM8A 3IN9A 2GU9A 3MIBA 3JD73 3PIJA 3AKRA 2LRPA 1PX4A 3QACA 1ZRRA 2BPA2 2AYHA 4YSFA 4QKNA 3VZNA 2ZHNA 3FHAA 4GB31 5APAA 1W0OA 2A71A 4ZY9A 2RS33 4OHZA 4WZFA 4ASLA 4PI0A 4Q0VA 1FPN3 1RUD2 3J7LA 1PVC1 2TBVA 4Q5OA 1JYWA 5CZKA 3I2JA 3LEIA 5I0RA 2XLAA 2FZ1A 2V09A 1I9RA 4R52A 5EWSA 4PLOA 1T2XA 5KXCA 1BBT3 3VB9A 1GR3A 3ACLA 1OLRA 3P3NA 1GQPA 1J59A 4Q29A 4M3CF 3GXUA 3I3MA 3O5SA 2EXHA 4HOOA 3ZO0B 5FPVA 4EJRA 4ZKTB 3OF1A 4QPWA 5C7GA 3AVRA 2Q1MA 4N43B 1UU4A 2LALA 5JXJA 1BJQA 3VKNA 4AQSA 1M06G 5BY5A 4PBOA 4BA6A 3D82A 3WQBA 4CE8A 2YBPA 2QQIA 3BVCA 3B69A 3DYPA 5CFCC 3DN7A 1BQPA 1Q8SA 4JZRA 4Y1UA 5AC92 5A7WA 3LSDA 2JENA 1SACA 3ZFEC 1JZ7A 3ZYHA 5F5IA 4LK7A 1OQEA 2Q1FA 1X9TA 1ZRFA 4M01A 1PMJX 1VRH3 1XNCA 3T2QA 5A3LA 5FYIA 4K6BA 3R4UA 4YFWA 4A7YA 3BTXA 3JZVA 1F9KA 4DIQA 5CIRA 5JXIA 2W68A 3HMYA 4NPMA 2Q8EA 1NCQC 1SMVA 5I0SA 2YHJA 1S0CA 1RVF3 4QHBA 3VBSC 1JZ4A 3OPZA 4NIAA 2W94A 5HPOA 5GZFA 2PHFA 3KGLA 3VL8A 3ZXJA 5HXVA 3AMQA 4DXRA 2DUPA 4QPIC 2PHRA 1PK6C 3O14A 3J7NA 4ZPIA 3LF7A 4AE2A 4MZUA 5L7OC 5IVBA 1TG7A 4QU1A 3B02A 3W59A 2QDRA 1TMF1 1QQP1 2ZZQA 4QPYA 5J1XA 4R9CA 5LA2A 4HBNA 2BFUS 2NM1A 5D8AB 4CP2A 1HLCA 4EN6B 5FJHA 4FPJA 4XDOA 1SG3A 3E97A 1W39A 3HBZA 2WC2A 1BKZA 3PDQA 1PX3A 1B35A 1UMZA 4KNCA 2IC1A 4YVWA 3ZYRA 5C5UA 3ILRA 3HD8B 3JUUA 1LESA 5FMDA 5FZKA 1ND2C 1TQ5A 4MGQA 1J3PA 2WNOA 2W47A 3HNMA 1S55A 1GYKA 3PVEA 4QGMA 1A34A 1MS5A 4FP2A 2A6ZA 1NA1C 2WNUA 2VZVA 4QT6A 1GQGA 2RDSA 3GBWA 3VBHA 1SLLA 1XOYA 1WMEA 4XURA 1I5ZA 1CIYA 2RJLA 1UYPA 2EXKA 4RGGA 5JZGA 3E6CC 4JKMA 3AZWA 3JB4C 4UFLA 1RUG2 1U5XA 1W28A 2VU9A 2OKXA 2JDMA 3ZR5A 3V65A 2VNOA 4V1PA 1I6XA 1PGSA 2VCCA 4RQPB 2RM21 3LA3A 1UY4A 2UYAA 3VLBB 5LEJA 4B29A 3KF5A 4QDSA 4Z2WA 4Z92B 2VZQA 5AFEA 3WF2A 4XILA 4RS5A 2OIIA 4LIVA 4Z07A 4BIOA 5A1LA 5LEKA 2XPJA 2WBKA 3TOJA 2DU1A 4LLOA 5GLVA 2BGPA 5ERLA 2WWUA 5E88A 4DB5A 3U4XA 1CX1A 4QQLA 4ARXA 2WWSA 2D5FA 1AR81 2WO3A 3H7YA 4COWA 1IGOA 1AX2A 5BNOB 1H6YA 2WT1A 2DTWA 3ZSEA 2YC0A 2VZ3A 2HEWF 2VMCA 5DPNA 5HCBA 2VC9A 1NA1A 1ZZBA 2WNUC 3I2IA 4N7UA 5H9PA 1HRI2 1AR63 4QXCA 3J8F3 1WKYA 4V2WA 4Z8BA 4D7TA 4TSVA 2P2KA 4XEZA 1GZCA 2FDFA 3MIHA 1NY72 5CFCB 5E8AA 4YYOA 2QE3A 2VOVA 2WQ4A 2Y6JA 4MXWA 5E16A 4BIFA 4P9LA 4CUBA 1FOD1 5D8AA 3OGJA 4QPGA 3ZPOA 4XQWA 2A1XA 1QJU2 2QQVA 5BNNA 5LW9A 2NP0A 5DG2A 2WNVB 4XVHA 3ROUA 4BWOA 4MSVA 3ELNA 2G19A 2J1SA 3ZN5A 5CG9A 4AYUA 4P5YA 1UMHA 3ON7A 5L73A 3SEEA 5IUQA 1MS1A 1PK6A 2WUHA 4GMP0 1IS6A 5C5TA 1W99A 4YW3A 1PK6B 4GH4B 4WVZA 4PI2A 4FTSA 1DGRN 4BCUA 4HLTA 1IOAA 2ZCWA 3N7JA 4JQTA 4CDUB 4IEVA 3TNQA 2ZGMA 4MOAA 4OCTA 3OEBA 2RS32 5FY0A 5FO9B 4LORA 5BNNC 2A75A 4D94A 4QU2A 4GJZA 3OGSA 4MGIE 5IHRA 3JD72 2YY1A 4FPOB 4EN0A 4NUBA 4CDQB 2WS92 2JG9B 4L2NA 5KHIA 1S0JA 2HWB3 3OYWB 2E26A 1SFPA 3RMYA 4K8RB 4ONUA 1RXFA 1VJ2A 3OD4A 1RUH1 3DPRB 4HZFA 1BEV2 3ZMNA 4CCDA 4YM3A 4PDWC 4DEQA 4C1WA 4NHYA 4FPEA 1EPZA 3WW2A 4TZDA 4LUKA 3T08A 5I0DA 4LIUA 1XC6A 1C4RA 5TSWA 3AJYA 5A6ZA 1JW6A 4ZONA 3W9AA 1O3QA 4KH9A 3WZ1A 5CFDB 1OFNA 3JXSA 1ZZ8A 3PHMA 2ZKNA 1RVF2 4FFGA 1QH6A 4B7EA 2IVIB 4GALA 5EP9A 1H1IA 4BYYA 2VUJA 5JDBA 3CEWA 3IB3A 3KV6A 3L2YA 4OVEA 3U0ZA 5FZ3A 4HVQA 3SCGA 3AFGA 2EIBA 3AXEA 2JDHA 3RG0A 1N3QA 2P5BA 3VBRA 5IAVA 3Q8CA 2YYOA 2YBSA 3HN3A 2FZ2A 3O1PA 4FFHA 3INAA 1O7FA 2BUKA 4FPLA 1W6PB 2VMHA 4K20A 1QGLA 2W5FA 5A33B 1GFF2 2IFRA 2BP6A 5EZWA 2ZEYA 2E63A 5JMCA 3ZFGB 1KJLA 2GH2A 1ND3B 4NIGA 1AXYA 3WY6A 4N7IA 4Q0UA 2DWRA 1N1SA 3MIFA 3FHIB 2VVFA 4TN7A 1MS4A 4LOTA 2DV9A 3E6BA 2QBXA 1SBDA 3WP6A 2QZ2A 3MFAA 2RS51 5C8CA 1UZWA 3RZZA 4C0BA 2ARCA 2YV8A 3A7QA 3NV3A 4IUGA 1OURA 2ZHLA 2R061 3HBKA 5A70A 1BXHA 1KFUL 1N1TA 2B8MA 2UYBA 2VXJA 3HNYM 4HSLA 1Q8VA 1WUVA 3BODA 2PLV1 1ACCA 1D4VB 1QXJA 4ZXEA 4CCMA 4GWMA 1SLCA 4KWJA 3ES1A 5FP3A 4JDNA 1BBT2 1FT9A 1U5ZA 2RR12 1RUI3 3SMHA 3WHTA 1ODNA 2X5IA 4XJUA 1S0IA 3AKQA 3DKQA 5LA1A 1R083 2W08A 4JGZA 4OZXA 4PIYA 1DGRA 4YGDA 5FZ8A 3W5MA 1WLDA 1YQCA 4OMDA 1H8VA 4JGYB 1ENRA 4KG8A 4O61A 1IS4A 1DYOA 5H9SA 2QFEA 5EIYB 3KB5A 3K4DA 1UQXA 1GP6A 4XPVA 4CCCA 4BMEA 2D7FA 4LULA 1LECA 3M3EA 5FY9A 4AL9A 1RHI3 4XQDA 1W8UA 4NIIA 1UKRA 2CAVA 4WV8A 1V6OA 5LK7B 2EIEA 1AL0G 1GBGA 1GWMA 1HX6A 3MIEA 1COV1 4IE6A 4TXWA 4BQWA 1IHMA 2LTNA 4P02B 3GCXA 5A80A 5A7PA 4XJZA 4QX2A 1W6PA 1C1FA 1LEDA 1QY4A 1W9WA 2OZJA 3AZVA 3H42B 4Y20B 4WM7B 3TEZA 1DQ5A 3MHZA 2UY9A 3RZGA 2X8KA 4Y20A 5F9TA 1ZZ9A 4CDUA 1DLCA 1C8NA 2V5DA 2YBKA 2H0VA 3KLSA 4U2AA 2RJ2A 3H8XA 3K48A 1NZIA 1ND3A 2JIJA 2WKKA 1DZTA 3ACHA 1JYXA 5IVEA 1PMIA 3OG2A 4K1ZA 1VMHA 4XIKA 4BK5A 5L9BA 3ZYIB 2XGXA 2ZGTA 2HWB2 3ETPA 3P5BA 3WF4A 4LBQD 5AFBA 4CUGA 4IEYA 4JAAA 4AOCA 2JIGA 4N43A 2F4PA 3N3HA 2G9GA 2QZ3A 1W90A 4P9GA 2BNMA 4PF5A 3OBTA 4YLZA 4CDWB 2VMDA 5JOXA 2VXRA 1Z7S2 4CDWA 1DCSA 1MZ6A 4OI4A 4PJYA 3CHXA 5L19A 1YQ2A 2NLRA 3J8F1 2WN2A 3ATGA 4MV2A 3T0BA 4AI3A 4HVRA 2PQQA 5T54A 3TNPB 1ZVFA 5IK5A 5FWJA 5K0UB 4MADA 4C8DA 5HCHA 1HB2A 4JGZC 2C5DA 2ORZA 3AKTA 2WJSA 3AP9A 3POYA 1QEXA 2XMLA 1APNA 3ZFGA 1CESA 5JXGA 2C9AA 2C0ZA 4CCNA 2ZX4A 3B01A 4P14A 3MPPG 4L8QA 5JVVA 1GNHA 3DCQA 1XPWA 5F3CA 4GULA 2YMZA 3VDCA 1DU3D 1H8TC 5F1RA 1CZVA 1ZRDA 1CD3G 1DG6A 3C2UA 4RL7A 4XFGA 3K51A 1VLNA 3NV1A 2Q4SA 5FMBA 5FYMA 1O91A 1XYNA 2G1MA 3GZAA 3I49A 1PO12 3GJAA 3NNJA 3OGVA 4UBGA 1MQTA 3PNAA 5FZ7A 3AK0A 1HRI3 4FOQA 5EYXA 5J09A 3EYPA 3D0SA 3RJRA 4ATFA 5FYTA 4Y5Z0 1AYN3 2A6WA 4YVWB 3VBFB 3NV4A 5B4XA 1UXXX 4Z2AA 1AHSA 5FZAA 1VBE2 1XU2A 1NCQB 4N9IA 1I5PA 1V6JA 1OXCA 5T5PA 1AXZA 1WD3A 2VZPA 2YGLA 1QIQA 4NPRA 4D7YA 1AR71 5FYVA 4AFDA 4YVSA 3FHQA 3LEGA 4BQ4A 4AVTA 4XF3A 5K4LA 3BGAA 3ZN6A 4GA9A 1VAMA 1PNFA 4OUEA 2FMDA 1W8OA 4RYDA 3WP4A 5DQ0A 1Y9MA 4BH9A 1V6KA 1OOPB 5ACA3 1O4ZA 3KS7A 1AZDA 4DS0A 2AENA 3ZOIA 4M3CE 5GJ6A 5JWPA 2VUCA 4W4ZA 1VBB3 3CLPA 2PLV3 4LUMA 2Q5TA 1YJLA 1PVC2 4AG4A 1KGYA 4CTEA 2V72A 1PM4A 1U5YA 4V2VA 2JE9A 4YVSC 2QUOA 2CWMA 5JIUA 3ZR6A 3HWJA 1PHMA 2XH6A 4IQPA 1RMU1 1YO8A 1NOVA 3IAPA 2MHFA 3VKMA 4CCEA 4I2OA 3IT8A 1Z0HA 2W1UA 1QHDA 1W04A 3PVNA 1V9U3 5K8SA 4QB6A 1S2EA 3ZM8A 3ZSJA 4E8DA 1UOJA 3LEKA 1S2KA 3AZXA 5A3OA 4JKKA 4FTEA 4LT5A 4FQZA 1H1MA 1UZVA 2VZUA 1Q56A 3UKVA 1JYNA 1AL23 2QQPA 2R30A 1LB2A 4OZOA 2GP5A 3WDXA 1AR91 3OPWA 5JPMB 3K3OA 3NAPB 4AR2A 4XHBA 5FQ0A 1O59A 2WZR1 3D8CA 3FJSA 3NKTA 3OSDA 2C4XA 4QKDA 3DXTA 4XF1A 5FRAA 3IMMA 3AYEA 3ZXEA 4HETA 1PZ7A 2B9UA 4XZUG 3VKLA 1SHWB 2WNUB 3KHCA 1H8TB 4QWNA 1E5IA 3GJBA 1ASJ3 4X8NA 3KWVA 3TYJA 2BYVE 2J1EA 2VNRA 2IZWA 1YIPA 3AL5A 3DYOA 3I54A 4N8MA 4NHXA 2Z2SB 5ACA2 2JDUA 5L36A 3WV6A 3S6PA 4QPGC 1J1TA 3N9OA 4CU8A 3H3LA 2W2IA 5D8AC 4RFT0 1YEWA 3WUCA 2WSVA 1LOEA 2WWJA 1W8ZA 3PURA 1JZ3A 2A5ZA 3SHRA 3BTYA 2BTVC 4YW2A 2CNAA 2VD7A 3DECA 1CZSA 1VBD2 5LBFA 1CN1A 5I0TA 2ENRA 2XVLA 5FV3A 2FDJA 5BPXA 4ES9A 4I30A 5F6KA 2K9ZA 1AR61 1VB4A 3IM0A 3T4HB 4MO3M 4YG3A 4XF9A 3C7HA 2OX0A 3HN1A 3KV5A 3WLUA 5C3RA 4CDUC 3MICA 3T4VA 4WM7C 1JZ2A 5A32A 2B45X 4MGSA 4AQTA 4CPBA 1SDDB 4QD2A 3Q8FA 4JQRA 3WF3A 1W6OB 1JHNA 2NPIA 1O5LA 2BVBA 1GNZA 2JKXA 2O0OA 4RHV1 2GP3A 1AJOA 2TNFA 3ME2A 1EY2A 4X6RB 2ADEA 5FLIA 4Q4Y2 5JI9A 3VUOA 5KHHA 2DCZA 1W2AX 3WX5A 2Y0IA 2ZXQA 1BVVA 4P9YA 1HXS2 1TE1B 3P3PA 4BQ5A 3FFZA 3U4SA 4BLJA 1D0HA 4FFIA 2RM23 4NHMA 4YWAA 1TNRA 4IV1A 2CU5A 2EALA 2J1AA 4TTGA 1RC6A 2QQWA 4YW7A 1OOPC 1H4GA 1SLTA 2ET1A 1J3QA 1RL3A 2V4AA 3MLKA 4XW3A 1JHJA 2GN7A 3VDDA 3C7GA 4AEMA 2AH2A 4EV0A 1XYOA 4HANA 4RHV3 1W8WA 3U78A 4O9GA 4XTPA 4COUA 1OD3A 1GP4A 3ZXLA 1B35C 3JBG2 1DFQA 1VPHA 5GZCA 3GBFA 3LZZA 4F8AA 2IXHA 1S0DA 4I0WB 1S2BA 3AKSA 3SH3A 4COZA 2ZGLA 2RS12 2R16A 4D7SA 5FIXA 2Z5WA 1RITA 2HWC2 2HWF3 1AL22 3H9AA 4M0NA 5F5CA 1FOD3 3Q8BA 1AR72 4YRDA 3CBNA 2B4KA 3HIFA 5DZGA 4AHWA 5L7OA 2MEV2 1YFUA 1ZX5A 2GMPA 4COYA 3ITQA 3K3NA 1ULFA 2NZ9A 4S2FA 1IG3A 3ZFFB 3TN92 4CP9B 5C8CC 3T0DA 4FPGA 1W8TA 2EIGA 1VB2A 2WINB 2ZEZA 2YB7A 4BM8A 3CZUA 1GOGA 4KWUA 2ZKLA 2JDPA 2ETEA 1X36A 4KG0A 3F95A 3U11A 2WN3A 2Y6KA 3IDBB 4Q0PA 3VKOA 4YGBA 2JG8A 4PF1A 1H2MA 1ZZ7A 1FXZA 3IMNA 4Y5TA 1CAWA 5C8WA 5LBBA 1BEV3 1YQ6A 2Q0AA 2AGSA 3U14A 4CUAA 4QAWA 4P5HA 3J9SA 5F2SA 5JSOA 2VQTA 4YFZA 2VOTA 1QJU1 3VD5A 2JE7A 5CFCA 3EQEA 3BYWA 2CYFA 1S0EA 3FUQA 4QQOA 2ARBA 1VAKA 1HB4A 1CZTA 2ZZJA 1HXS3 1CR7A 3HJRA 3VBRC 3WDUA 2PN5A 5LB6A 2B7YA 2WO7A 3CMGA 1JMUB 1G6NA 3BPZA 1COV2 1ULPA 1VAVA 1JOPA 3ZN4A 2EA7A 3O0WA 4MGYE 4QM9A 3OUIA 3AZZA 3HQXA 2D3SA 5DN2A 5GLZA 2BU9A 4BOWA 5CADA 3KZ4C 4MXVA 3LKJA 1W9SA 1R091 5H9RA 4KBZA 1NQDA 3M3IA 5IK7A 1CAXA 4LPLA 2XBO3 2PAKA 4XMIA 1O6UA 1O3TA 3L2HA 3HNBM 2WS91 3DUIA 3Q8EA 4PDWA 4Y1YA 2WZR2 2VBPA 1W2UA 2YROA 1QJU3 2PELA 3VDAA 3C7FA 4R4XA 1O8SA 4PLNA 3ZN6B 2E9QA 2FBEA 3BOWA 1BEV1 4KWKA 2GDFA 1FV2A 4K1YA 5C9AC 1ENQA 4DNYA 2K46A 4IEUA 4UT5A 3ZSKA 5FKBA 5JAXA 2GC2A 2KM2A 2R063 1YIFA 3CJIB 1RUE1 5T5OA 2VUDA 2RR13 1AR62 2R043 1JYIA 3ZDVA 5SV5A 1ZM1A 1XBFA 1RUE3 4RD7A 4YW1A 2PAMA 4K8FA 4QDQA 1UU6A 1WCSA 3V0BB 4E27A 2RMU2 2VO5A 4AVBA 1VBC3 3I8TA 4GZ9A 3V0BA 3AC0A 1TEIA 1YFYA 2VVDA 4LK6A 3FX3A 5FYUA 3UKNA 2UWAA 4CCKA 4DFSA 2ZMKA 2AACA 1HQLA 2D93A 3QD6A 3KVAA 1VBD1 3POFA 2X09A 3N9QA 5JR2A 2F6BA 1RB8G 5IJRA 1OQ1A 3POIA 5C4WB 1H2KA 2NMOA 3E5XA 5FMOL 2Q8DA 5C6CA 4CEYA 2V5YA 1UZYA 2ZGRA 2DVDA 3WNLA 4FTBA 1KQRA 4J1WA 1Y7BA 1WBFA 1Z7S3 2QQKA 1QNYA 5JIAA 4JRLA 1OD5A 3T2OA 1ZRCA 3VHNA 5FP4A 1DLLA 3RPQA 4A42A 1O8PA 4XCBA 1DQ4A 4CCOA 1OQDA 5K0UC 1P8JA 4EYUA 5JXHA 1ZA7A 4NWVA 3M3CA 2X5IB 5HV4A 4GKYA 1CGPA 1YCIA 4ES8A 3WSOA 2RS52 1V9U1 2JJ6A 2OPKA 1ULOA 5J48A 1CWPA 2LS6A 2UURA 4UW3A 3OY8B 1RUF2 2C1FA 1RUC2 2WFF2 1AF9A 4OUSA 3TB0A 4A2UA 1R1A3 1TZOA 5LBCA 1PVC3 3QOPA 4RS5C 3LDRA 4MXWB 4BQ2A 3D0JA 2EAKA 3S5QA 1CVNA 2YXSA 5JOYA 5A3MA 4DXSA 3LPGA 3N7MA 3O12A 5T50A 2YPDA 2VOKA 1QXRA 4CDXB 3APBA 4CSWA 3VBOA 2JDAA 5JZGC 4RQPA 1KD7A 3GBGA 5KHJA 1CAWB 3AP6A 3AZYA 3N35A 4BE3A 5K0UA 4CXXA 1D4M3 1YHFA 4MGZE 2WABA 2D43A 1GANA 4IGQA 2DVGA 5T5LA 1UY0A 1GZ9A 1VRH2 4LJHA 2KA3A 1YUDA 2O14A 1LENA 5F5AA 2N7GA 4LKDA 5J96B 4UW4A 1TNFA 4KMQA 3RGBA 1DGLA 3NRUA 4RR3B 1WCKA 4WVMA 4Y33A 1FMD1 2MPFA 3LQCA 1OFSA 4UF0B 4Q26A 3OGGA 2GC0A 1R1A1 2DCTA 2BGOA 5ABJA 1BVP1 2OW4A 4J1XA 4D69A 1BZWA 1C8M3 1ULGA 4L11A 3CL1A 3FN9A 1ZYBA 1LCLA 2E31A 3ZXFA 4I0AA 2J1RA 1PO21 2GZWA 1U5IA 3NNGA 3TEXA 2BERA 2OZ6A 3DV8A 2HWF1 5DUVA 1G9DA 4QPIA 5GM0A 4W6YA 3N9NA 1DZQA 1LHWA 1NAEA 1OLMA 3PTRB 5HCAA 2YZ4A 4JHZA 5IWFA 4LO6B 2QQMA 3OUHA 1Y4WA 3M1HA 2D5HA 4XQ4A 4A4AA 2D6NA 2J22A 2D6PA 4FP3A 4G3YC 4QMAA 1QU0A 3BPSA 4NR1A 3WF0A 4HMZA 4IEQA 2ZX3A 3IDCB 3ZFEA 1UO9A 2LUWA 3IAQA 2E7AA 4Q0SA 2O1QA 3J8F2 1F2NA 1RUOA 2VTFA 1H6XA 1BCXA 4LA3A 3WD5A 1AXKA 1W6QA 4LO7A 2XJTA 4Q4W1 3UK9A 1OSGA 1DDLA 2WR9A 3AMNA 4QXBA 1HJGA 2P6CA 1W0PA 3MFCA 3DGTA 3RI9A 4DXZA 4ZU5A 2XKPA 3T30A 1POV0 1RXGA 3OUJA 3LB9A 2Y33A 4C1XA 2VVEA 1PVXA 4B1LA 4OI2A 1Q5OA 1SBEA 3PUSA 5T52A 1RUNA 2CDOA 2JWPA 3NJZA 3WNOA 5FK8A 2FDIA 3NJXA 5L9VA 3B3QE 2V73A 2WA3A 2JICA 4UFKA 1UZZA 4OYUA 2BEOA 1LHUA 1K5JA 1RGSA 4A44A 1BMV1 1MZEA 1ASJ1 4XAAA 3VL9A 3IDAA 5F3EA 5FOJB 3RI8A 3ZVXA 1DIWA 1ZZ6A 4A6OA 4XJWA 3F2ZA 1J1LA 3PTYA 3SISA 4A3ZA 4CU6A 2CGOA 4CCJA 3NW4A 1YI7A 4HT1T 5K9YA 2WS93 3OBAA 4NVPA 2Q1ZB 3JQXA 1DF0A 2ES3A 4GIQA 5DXDA 4ZS3A 2RS53 4XDPA 1PIV1 1ZBE2 4I09A 2YUEA 5FUIA 4E4ZA 1MACA 1EPWA 3H50A 4HKWA 4LO4B 4R9DA 5IVJA 1OLQA 5DAVA 3ZFFC 4D8MA 4MUVA 2XL7A 3KT4A 1CAUA 1GWKA 3VGIA 4EE2A 4W6WA 1W8HA 4E2QA 1AR73 3NNLA 4YM2A 4XUQA 2PFWA 2XVKA 4S2DA 2P6HA 2C24A 1XE8A 3NKGA 5FZOB 4YW6A 1RJ8A 4HL0A 1W06A 4HN1A 4GB32 2Y6LA 4MH0E 3USSA 2Z42A 4C0HA 4DRVA 1F4HA 4HONA 3B5LB 3IZOA 4NROA 5E1RA 1UPSA 1NCRA 1QMJA 1G9FA 3HPNA 3WNMA 5C4WC 2XVGA 1QJEA 2CGNA 2HBUA 3LA2A 3MLJA 1EV12 4NAMA 5FZ6A 4LKEA 2VG9A 4AQ6A 4GMP1 4AVCA 2I07B 3DYMA 1BK0A 1OF3A 3D3AA 3KV9A 1SPPB 4UYBA 3ZFFA 5J7MA 3D5OA 4QXHA 1ZA4A 2I74A 1A6CA 1QJY3 3OB8A 5EV7A 2EF6A 4MHRA 2WLPA 5FZCA 3THTA 1UIJA 3PMSA 1N3OA 2R062 3NAPA 1BBT1 2CL2A 4Q4X1 2AEYA 4LBNA 2P3JA 3H3ZA 4XTMA 1ULDA 5F5QA 5KHKA 1D2SA 2G9ZA 3POGA 2YDEA 5FBJA 3DEMA 1CAVB 5LBEA 2G9FA 4XIOA 5JCTA 2EVXA 4PBPA 5F39A 2GNBA 2MNGA 1R64A 5FXXA 1DQ6A 4K40A 1H1AA 1Q3EA 2BRTA 4KWLA 5BYNA 3BUCA 4BQ1A 4CZSA 2WSUA 2X10A 4NMIA 5HCFA 3RYRA 4BISA 3AP4A 3KT7A 4BDVB 4DINB 4LO8A 2YU1A 3AP7A 4MX3A 1UKGA 5DZEA 3VHPA 3DF0A 4XABA 1X9PA 3GF6A 1O3RA 3K46A 5C71A 3W20A 2BNNA 1T6GC 2HWE3 4ISRA 3KMHA 1UU5A 2FCTA 3AKPA 3A23A 4H14A 2QQOA 3UKTA 1LHOA 1AVBA 1RIRA 2OA2A 1D2QA 2JECA 3LOIA 5BNQA 2Y34A 5CFDC 4FXGB 4S2HA 5FO8B 2WL1A 2D3PA 1TME2 4OHYA 4YM0A 4O65A 3ILFA 5A32B 4CEYB 3RZMA 1H2LA 2VZSA 4F7ZA 1LEMA 5B4NA 3K2OA 3LDBA 3OEAA 5JSPA 2X29A 2ZEWA 4ZXKA 5IT6A 1QH7A 1IKPA 5FY8A 1NCRB 3CU7A 4CU9A 4IETA 4AAPA 5L7OB 3MUZ1 4AI0A 3AVSA 4AF9A 1JS9A 2D3RA 1MS8A 1DQ1A 1QF3A 5DAXA 1V70A 2WZ8A 3AXDA 1OA3A 3ACGA 1W9FA 1JN2P 3E5QA 2W92A 3QH7A 1LTEA 3PLQA 5ANQA 2ZX2A 4N53B 1JTZX 3CJIA 4L92A 3TN93 4Y4YA 4IV3C 1RUC3 2WFF3 5KWRA 2VQ0A 2K0GA 5D1IA 3VV1A 3GZEA 3ACIA 4UBHA 3ABZA 4QKFA 5FYSA 1OPOA 5FY7A 5G04L 3WG2A 2XKOA 4FSJA 1J83A 2W52A 4QX3A 4NIHA 5BUVA 2UY8A 4IEOA 5EFUA 2VUAA 1WCUA 4GKXA 4DO0A 3GNEA 4E2GA 2PHLA 3ZXKA 1JU4A 4DRRA 4KQ7A 2BNOA 1RUI1 1Q8PA 3PIGA 5HV0A 1QDOA 5FYHA 1US2A 3S5AA 1RMU3 4HKOA 1PIV2 3WQ1A 4IESA 1JYCA 1QJX1 4WVVA 1E5SA 2P17A 3MUY1 1NT0A 1GNYA 2WZEA 1RUJ2 1VBC1 4L0PA 2FCVA 4TLGA 5AVAA 4O7XA 1L7QA 3M8LA 1H9WA 1VMFA 1REEA 1SPPA 2R7EB 3RWNA 4F83A 1EV11 1TMF3 2XHKA 2P1BA 2HYXA 4HN0A 5A7WB 2VZRA 4CDQC 4GJYA 2DUOA 4CA9A 4E4SA 3PJYA 1WW4A 5GZEA 3CKHA 5CISA 4XFAA 3AYDA 2FCUA 4UAPA 1MEC1 1XB9A 2Y6FA 3WP5A 4B3NA 2DFBA 4A3XA 3ZKYA 1PGL2 3LD8A 5K7PA 2OS2A 3RVHA 2HWD1 1AUYA 2RMU1 2L9LA 5LWBA 3KQRA 3LAGA 5CAZA 4XZPA 5I8YA 3HT1A 1PZ8A 1STMA 5A6YA 1D0GA 3I3EA 2Q8OA 1E57A 4D6QA 1REFA 4YM1A 4R9BA 2FD8A 2B39A 3VBUC 3SXWA 4CEWC 4E4DX 4UW6A 2XWBB 3DL3A 2Y6HA 3AP5A 1AR93 4K3UA 1UF2C 1OF4A 1X33A 5IFPA 1GP5A 2PHTA 1H9PA 3VD3A 2WYFA 4WBBA 5IVVA 5JLVA 3RZLA 5M0TA 1CONA 3WW3A 5BNPA 1JUIA 4BXSV 4FPCA 3VDDB 2EAAA 2BOJA 3H1YA 4Q4X3 2R6QA 1PO13 1IPSA 3LA7A 1Y9QA 2VMFA 4M0HA 3JCIA 5C4WA 2OT7A 1NCRC 2ZGQA 5FXVA 4IEZA 2ZX0A 5A7SA 3KD4A 1RMU2 1WLWA 2ZTNA 5SV8A 1EAH1 3TRSB 4QHOA 2VMIA 2R1DA 1SQ4A 3BOPA 3E5UA 4LMFA 2A6XA 1R1A2 2VMEA 5DAPA 4B1MA 2VCBA 3W58A 5FZ1A 5HBAA 4H7MA 3VD4A 1OA2A 1ALYA 2JD9A 1FOD2 2J1UA 2YGMA 1W6OA 4AGGA 2PHDA 3AJZA 1VMJA 2RS31 3MIGA 4Q4V2 4ARYA 1IQDC 1QDCA 2ZPXA 2W9XA 4Y5SA 2WQZC 3I4IA 2WO2A 5JOWA 1JZ8A 4HK8A 1NCQA 2XDVA 3JBG3 2GNMA 4OHWA 4CDWC 4Y1XA 2RDNA 3O1UA 3N9PA 4LBJA 1BLZA 1RVF1 1YQ8A 1SZBA 4QDRA 1OC1A 3FLPA 4LA2A 4BJ0A 4DPNA 4BQ3A 2RDRA 5DUWA 2A73B 1RUH2 1NUKA 5AC93 4LQRA 2AC1A 2ZAHA 5EJZB 3THDA 1SEFA 4JDOA 5FZOA 1LR5A 3RWKX 3USUB 3M3OA 4FT8A 4GH4A 2Q8CA 3ZFEB 3ZYJB 3VKFC 4YG0A 3KQ4B 1OHFA 4I3GA 4JDMA 1W6MA 2TUNA 2SLIA 3ACFA 4UW5A 4Y26A 2BBVA 1ZNPA 5GLUA 3WDYA 2DVBA 2XONA 4BU2A 1SFNA 1YNAA 5FMOS 4DUWA 3CZJA 3O1SA 4AI1A 1ZZCA 2ZAAA 3VBRB 1BHGA 1V6MA 4SBVA 2ILMA 5FXZA 1HRV2 1QJX3 1YFWA 4MVTA 2XHNA 3WG4A 3MYXA 2YU2A 2W3JA 1K5MC 5A1FA 1US3A 4KGGA 4GXLA 2DFCA 2XJRA 4RHV2 1ZBA2 2Z79A 4XBNA 4XOGA 4Z82A 1J58A 1GQHA 1N1VA 1IPKA 3LWCA 4CU7A 3T1LA 2QDNA 1BMV2 3W5NA 1W03A 2BJSA 1LOCA 2JG8B 4KL1A 5CKNA 3I2FA 1F15A 2JG9C 4JTOA 3WP3A 1IS5A 4XFFA 4WM8A 1NXD1 4Y1VA 4JKLA 5DDJ3 1Y9GA 4QHZA 2D97A 1AYN2 4EQVA 5A1AA 3MW3A 2W91A 3RSJA 1XE0A 3WCRA 1RUI2 4QQHA 3KCCA 1W2NA 1BK1A 4OULA 1HXS1 1UYYA 1QQP2 1RTVA 4IE0A 1K5MB 4B4QA 4ZU7A 2HWD2 2GH8A 4RR3C 5FZGA 3UGFA 4FPHA 1EUUA 1FYUA 5I93A 1ZBA3 2VCAA 3KGZA 3THCA 2A70A 3B9CA 1CAVA 4IDZA 5FLHA 1NXMA 5FZIA 1KEXA 3RMXA 3WQ0A 2YC2A 1GSLA 3PU8A 2A3WA 5FZMA 1QXPA 3HT2A 4PIZA 1KJRA 2CHHA 2DUQA 4XUPA 4BZ4A 3R05A 5DUUA 5GZDA 2C26A 5AC91 2PQSA 1WA4A 2MEV1 4NHLA 2WFPA 5F3IA 1L7LA 1TMF2 1OA4A 2GAUA 3FC0A 4CYDA 1D4M1 1W8NA 5BNPB 1G9AA 4OQ8A 4JV4A 4QPIB 1IZ3A 1OT5A 3OYWA 4B7KA 4BK4A 1QJY1 2NN8A 5CKMA 4A7ZA 1PIV3 4JRAA 2JG9A 4FI9A 4QQ2A 3TEWA 5FAXA 3H1MA 1CPMA 1ZBE3 3VBOC 2FHRA 3R4DB 5C33A 3A0KA 3S57A 4EWAA 2RG4A 4LE4A 4XBLA 4C91A 2WNVA 1W6NA 3MZHA 2VULA 3WXPA 2Y26A 5FZ4A 3ZYFA 2OUHA 3I59B 2IFWA 1QJFA 4LHSA 4CEWA 4E4HA 3IIAA 4ZHNA 3LDKA 3ST7A 2RS13 4FO9A 5LZ6A 1NE6A 5IATA 2VZ1A 3VN4A 2B5HA 2VH9A 4ZZ8A 3I97A 2B9VA 2IWGB 3HQRA 1LHVA 2BBAA 4GQ7A 2FDGA 3POSA 3AL6A 1I3HA 4SLIA 3T0AA 4B8EA 2VPVA 1UCXA 4ISQA 3GM8A 4JHTA 4Y3OA 4AAXA 5ANNA 3L9JT 4ZZ5A 3VBOB 4CDXA 5BNNB 2ZHKA 3LIGA 3KSCA 1IKQA 1U12A 4KI5M 1PGW2 1WLCA 5A3UA 3FWEA 2BGCA 1PZ9A 4JGZB 5A33A 1O4TA 1M4WA 2UWCA 2ATFA 3HVDA 5EYYA 4CXWA 2VBDA 1OUSA 4GD4A 4L9BA 2BOIA 3LEMA 4IERA 2WZPP 4WVMB 1F5FA 2OQ6A 3R6SA 1V6NA 3EB7A 4FPYA 4L97A 4EWEA 3AMMA 2BZDA 1B09A 5GLWA 4AI2A 1HV1A 2CSGA 2HWE2 3WVJA 1PNGA 4AFAA 2VW0A 5KXDA 4HSJA 4IGOA 1POQA 4LBLA 2KXLA 1VBB2 3WHUA 1R1ZA 1W05A 2WNEA 2CTVA 4YW5A 5C3QA 1Z78A 4KU7A 4UWDA 4RA0A 4W65A 3A22A 2NMNA 4XJAA 4Y24A 4RGKA 3ZLIA 3WCSA 3AYCA 4IV3A 5J37A 1HN0A 3IPVB 1HRI1 3JD71 1XJAA 1GZWB 2NQYA 3DKWA 1LOAA 3K77A 3N9LA 5FPXA 4D0QA 5CYYA 2DVFA 1GICA 3UJOA 2FMYA 5FYZA 4C90A 1ND2B 5GZGA 4DZGA 2HWB1 1B35B 2WA4A 2Y8KA 2W0XA 2ZGSA 4BLIA 5FOBB 4GWNA 3BTZA 3HOBA 4ET7A 3J7MA 2XXZA 2X05A 1O4YA 2XLGA 1XNKA 1LGBA 1ZRIA 4NPLA 4DXTA 4E2SA 3MV11 1S4CA 2O8OA 3ENRA 3FBMA 1LOFC 2J1VA 2W87A 3I2DA 5FJKA 1AYM3 1HRV1 2J1TA 3OY8A 2VY0A 4XFHA 3PUIA 2XWJB 4LITA 3I2HA 2VZTA 1LGNA 5IVYA 3ZMOA 3O1VA 1GMMA 1N47A 1AYN1 4HXCA 4N90A 5A7QA 2HBTA 2JDZA 1RUH3 2ZABA 4I3PA 3V0AB 5JR7B 1EV13 4QGNA 3LSEA 1UWWA 3CIHA 3MI8A 4N53C 2R1BA 4PIXA 5IVCA 1UNBA 3VBUA 4XXAA 5C3PA 5LCWL 3B7MA 3ZIWA 5A6QA 3UGGA 2O8QA 4YZ3A 1F35A 1RINA 2XG3A 5FZ0A 5FZFA 4DUVA 3H8OA 2GC3A 2I45A 1UPIA 1F8VA 1KDKA 2HLEA 5DDJ1 4QX5A 1A8DA 3BIWE 1OMIA 2LROA 4AGRA 3H7JA 5FZBA 3RRDA 1POV1 2D6MA 3POJA 3I2KA 3SC7X 3MO4A 3DPRC 3A4UA 1QKQA 1IS3A 1WZXA 3NO8A 3O1MA 1XXNA 3PUHA 1GZTA 2QQLA 2WLQA 1RUG3 2G4IA 3J7HA 5FTTC 3M70A 2DBNA 3N4MA 2ZACA 1L7RA 1FPN1 1OPMA 1V9U2 1XSQA 1G86A 4CDQA 5JMOA 3GZUC 2JB4A 1G9CA 4RFRB 3P1IA 5BXXA 4Q1RA 3VZOA 3CNAA 1EUTA 5F7UA 1JOJA 3AX4A 3PJQA 3PUAA 4LBKA 4Q4Y1 4DMIA 3HEIA 1ULEA 3IPVA 2R0FA 5FREA 4QB1A 1G7YA 5CA6A 4YVWC 4XYXA 2QTWB 2XUEA 4ASMB 1UN1A 1YC61 2ZGPA 3OPTA 5LY1A 3SH5A 3VZMA 2DVAA 2VQUA 4MGTA 3WEZA 4R4ZA 1UIKA 2VECA 1CAUB 3BKZA 3ECQA 2W39A 1TME3 5I8SA 1X7NA 3E1F1 3HAGA 1VBA2 2PXJA 5GALA 2WDBA 2IXKA 1YLLA 2VOWA 1AYM1 3HR9A 1UYZA 3WDTA 1L3JA 1K42A 1H8TA 1LULA 2ZOEB 2XJQA 4J6GA 3T3YA 5FDBA 1QOTA 2V4VA 4NWWA 3CJIC 2OVUA 3UT0A 3H8RA 4Y4RA 4UFIA 3BB6A 3V56A 2A6VA 3FLTA 3O7OA 4AVVA 1YRZA 2HYKA 4AXOA 1NLSA 1UY3A 2R073 2DCYA 3BU7A 3U10A 1MVEA 1XSRA 3QH6A 4XUOA 3J26N 5I8TA 2HKXA 2XJUA 1SDWA 4FCAA 2VTXA 5FWEA 4KU8A 5T55A 1XNTA 5A3TA 5IVFA 3VHOA 5JSRA 4FBFA 3GDBA 1JYVA 3H3UA 1REDA 4PQQA 4XHXA 5FYCA 5FY4A 5IW0A 3I2OA 3C3VA 5KC5A 3BALA 4IE4A 1W9TA 2VL4A 3BI3A 3O0VA 2QQUA 4NIDA 4XC9A 4EROA 1JYTA 3Q8AA 2BV4A 2JXAA 3N7LA 4K7JA 5CFDA 1E5HA 4D3WA 1N3PA 3IIIA 1HRV3 1QJX2 4QB2A 4W6XA 3RZKA 1KDMA 4YGCA 5A7OA 4H3WA 5FMCA 1C1LA 2R072 3WG1A 1W6QB 1R093 1WA6X 3ZYPA 1UOBA 3WNPA 1GUIA 2A3YA 3K75B 5EPAA 3KCXA 5FUNA 2WRAA 1FI2A 1F5JA 3MW2A 1GOFA 4QKBA 2C9KA 4QXKA 4U36A 5LRSA 3RFRA 4GB33 3KHBA 3X29B 1EP0A 2BWCA 3H0OA 3LFMA 1Z7S1 1KS4A 1JOBA 3EMRA 5HI0A 1OKQA 4YZ5A 5I91A 1LAJA 5FYBA 3MLLA 4AI9A 5A3PA 4QGLA 1LU2A 4XUTA 2QQJA 1A8MA 1E5RA 2GMEA 4EN9B 4D6SA 5EQUA 5F37A 5FPLA 1X8MA 5C3OA 2DURA 2PA7A 2WNVC 1W8FA 1MZ5A 3URFA 3OD0A 1DQ2A 3LOBA 2D6KA 3SQOA 3UETA 1RJ7A 3ZDSA 1S0BA 1IPJA 3KT1A 3MDPA 4Y22B 3UGHA 1MEC2 4ATEA 2BVVA 1V6LA 3LIHA 1OVPA 3A0NA 3LE0A 1GV9A 3FLRA 3VD9A 2EIDA 3JBG1 1NA1B 1UYXA 3OBRA 1JXNA 5FBZA 2ET7A 2FDKA 2WYSA 2A3XA 2R041 1CJPA 2ARAA 3NVCA 4H2AA 2QVSB 2DF7A 4PLMA 1ULCA 2ZGNA 4MLOA 1GZWA 5FPBA 1AL21 5C70A 3LFIA 3KM5A 5FUPA 4YARA 3IKWA 3NWKA 2YG0A 2E51A 2MEV3 3CJXA 3OBZA 1NZCA 2DDUA 3WW4A 1LJ7A 1QJZA 1G9BA 1K3IA 3C8XA 2WAOA 3O1RA 5ABJC 1MEC3 4FXKB 2RV9A 4PHZA 5J36A 1ONAA 4XF0A 1URXA 4XFIA 4CPBD 2OPWA 3AMHA 3OOXA 5FZ9A 3SLIA 4KBBA 2QKDA 4BHPA 4BXFA 4CXYA 2GNDA 3TN91 4IGPA 4WM8C 4RGAA 5F3GA 4OI1A 4YZ2A 2B42B 2YFUA 1DYKA 1H30A 1QJY2 1F4AA 3OTFA 4CP0A 2D6OX 2JDNA 3VDBA 1C3HA 1WCQA 2IXCA 4INDA 2W95A 1AYM2 1HIXA 4H7LA 3H1WA 3M2MA 1Y43B 1LRHA 5FPUA 4HK9A 2CY6A 1S0GA 1JU3A 1X50A 3VBFC 1R092 2DYCA 2W1SA 2ZGKA 3UV9A 1SCRA 3MIDA 1W2OA 5DUXA 3WOGA 1RUC1 2WAAA 2WFF1 1DYPA 4O9EA 3WNKA 5JOZA 2XLFA 1AR82 2CV6A 3EBRA 3GHMA 3T2TA 2WIIB 2XQXA 1WD4A 3HQUA 3SITA 4NO4A 1X82A 2JDKA 4R8HA 4NJ4A 2BWAA 4LHLA 2VBBA 4N53A 3R0RA 1RUJ3 2ORXA 5CNAA 3ZXGA 4NE9A 1RUD3 3VBUB 1PO23 2ADDA 4E9KA 3C7OA 1D4M2 3D4KA 3VZJA 2GNTA 1NY71 4ZU4A 5T5JA 4XBQA 1K12A 4AFBA 2UWBA 2HH9A 4OHVA 5FFOC 4IL7A 4MG2A 4M3CB 1AX1A 1UAIA 2P3IA 2JEMA 2E33A 1W9YA 4Q0QA 5FR3A 5FPAA 5FY5A 4CCLA 2VMGA 2XBO2 2SBAA 4IEXA 5GLTA 4L99A 1TME1 2VQAA 1UXZA 3GGLA 4IE5A 2EICA 2XR4A 3ZYBA 4XAEA 5AVPA 2DCKA 4NAOA 4AEDA 2PMWB 2Z4FA 1ZREA 2DU0A 1IG0A 3EHKA 1WCDJ 5J3UA 1EAH3 2P3YA 4YZ4A 1FV3A 1XU1A 1WBLA 4B4PA 1RUF3 1NLRA 5DG1A 1NG0A 1WWYA 5DABA 5CU1A 3CDZB 1KS5A 3WF1A 1XNBA 3I3QA 5B2GB 1I1EA 3KF3A 1MQTB 2ID4A 2AR6A 1W0NA 4P9WA 5IAXA 3S30A 4GAZA 1CAXB 5D21A 3WINE 4FAGA 1NLQA 2BDRA 4JC1A 4AEDC 1OBNA 1MVQA 4IE7A 4IEPA 2UU8A 1VE0A 2VAUA 2XJSA 4URTA 4A7KA 2VCMA 1C57A 3MBWA 4OUMA 3B93A 3VHRA 3B9IA 4NOTA 2P34A 4HPKA 1POV3 2DTYA 2J42A 3CO2A 1Q8OA 5BNPC 3T1MA 3SKVA 2P3KA 2E32A 3GZTB 1UMIA 1W2TA 2R0HA 5F6LB 1KITA 3NSTA 1W6MB 3PL0A 3RQ0A 4CDXC 2CWSA 4GMP3 2RHPA 2OYZA 3POEA 2IXJA 5FQ0B 4P00B 1DBNA 5A6XA 3I3DA 3N7KA 4LR4A 5DZFA 2R32A 4MHUA 1UOFA 1UY2A 4XETA 5FY1A 1UOGA 1RUJ1 1VBC2 4XJ9A 1U0AA 1KFXL 1J3RA 1JH5A 2JX9A 2QJVA 2GALA 3MV01 3FE5A 3OJBA 1YJKA 3NJVA 5L9RA 4BMBA 2R042 4WZCA 2ZGOA 5A3WA 1LOBA 1XNDA 3EJKA 3ILNA 4Q8KA 4LBMA 4TWTA 2HWC1 1RHI1 4R9AA 3VBFA 4LBQB 5KBFA 2EXJA 1MPXA 1JBCA 3BIEA 4P08A 1C8M2 1FNZA 4HFSA 1PGL1 2F4LA 2PHXA 2HWD3 2B46X 2A7AA 3BN6A 1VRH1 2D98A 1OVSA 2CAUA 2H6CA 3VBHC 1ENXA 2ZMLA 2HEVF 3I59A 5A7NA 1NQJA 4QX1A 2QCSB 4JGYC 3U07A 5ISLA 4HVOA 2WZR3 5FZDA 2ZJCA 3U37A 4BB3A 5FCCA 3RZJA 4OHXA 5DDJ2 3MPBA 2JG8C 2RR11 2WT2A 2X5IC 5DMYA 2BW8A 4AZZA 4F3JA 3W21A 4TYSA 1YWKA 4FPFA 2Y60A 2ZHMA 1YYNA 1GKBA 3TWIA 4DQAA 4CEYC 2PHUA 4LEJA 2GMMA 4M3CA 1MZFA 2QNKA 2K2SA 4UFJA 5LA0A 1NYWA 4MGKE 2P4EA 3GCWA 4IV1B 2ZBJA 1H0BA 2P37A 2XL9A 4AEKA 1NE4A 3WDWA 5ACA1 1HQWA 1UZ0A 5FZEA 3FL7A 2PTMA 1PM7A 2YFZA 1A3KA 1QNWA 4LBQA 2GC1A 2AEZA 4X6QB 4D6RA 1YFXA 3E6DA 2XBO1 1UL9A 3V0AA 1ENSA 5FP7A 4JVAA 3SH4A 5ABJB 2OUJA 2XJVA 2CGPA 2W1WA 1KXGA 4AEDB 1WMFA 2H0BA 3MW4A 1MS0A 3POWA 3POBA 3QCWA 5C9AA 1IQAA 4AQ2A 2VZOA 3ZSLA 4A6SA 1GOHA 4FFFA 3MF6A 4NRQA 2D44A 5IYYA 4ORFA 4IV1C 4BPZA 2ZS6B 3T2PA 5DAQA 1DGWA 3CF6E 3GHNA 2AREA 4RSUA 3ALQA 2R49A 4COVA 4HPKB 2YC4A 5CG8A 1K5MA 2HWC3 4XACA 5FP9A 2XUMA 4W50A 1LKNA 4YVSB 1JZ6A 5KR7A 3ETQA 2OQ7A 5E89A 5FXWA 1VR3A 3AM2A 1CIWA 2LM3A 1FATA 3WQ7A 4DY5A 3VD7A 3WUDA 1XNAA 4BQYA 4LHKA 1LU1A 3RYPA 1UY1A 4S2GA 4FOVA 4UXAA 3DXUA 3VBSB 3ZX7A 5CVRA 3LPFA 4G4FA 4LXLA 1X8EA 5EHDA 2ZEXA 2Y6GA 5J98B 4AHXA 1FAYA 1SLBA 2JE8A 2WO1A 2VTXJ 1QWRA 2ZA9A 5JI7A 4KGQA 3H8UA 2OXBA 1RUE2 3QLQA 4HG6B 2D40A 3P6BA 2VW1A 3MEPA 5CKQA 3UNPA 4AFCA 4GH4C 1XQNA 5DAWA 1A78A 4I01A 1C5IA 2JDYA 1OI6A 4RS5B 1GWLA 4DEVA 1D7PM 4Q4W3 4P9JA 5FKCA 2RDQA 4X8PA 1WMDA 3NAPC 3FBYA 2YPJA 3AB0A 2CDPA 2E6VA 3NMBA 4OFGA 4UFMA 4AVSA 4IW3A 4LKSA 4NN0A 3S7EA 3IBMA 1Y3TA 4WVWA 3AMPA 1RUG1 1XYPA 2A6YA 5LA9A 2HEYF 3G6JB 4DOUA 4LHNA 3Q9OA 4NRMA 1R081 3GALA 3PVOA 2RM22 4A45A 1C28A 3THPA 3UL2A 1PO11 5C8CB 4XFCA 2VE1A 1BYHA 1Q8QA 2AZ5A 3NNMA 5KHGA 1S1AA 4EZHA 2W1QA 4Q4Y3 1HN1A 2Y64A 5EJ3A 5F2WA 3WNXA 1YI9A 4CP9A 5C9AB 4DUXA 3ZSMA 3BCWA 1SBFA 2Y0OA 4XUNA 1O3SA 1H2NA 3RZHA 5H9QA 1FPN2 3MF9A 4PCRA 4CEWB 1VIWB 5LY2A 3WNNA 3LCPA 1QQP3 5A3NA 1DQ0A 2RE9A 1YQ5A 3KVBA 1SCSA 4LE3A 4IXLA 4LNVA 4EN8B 1COV3 2JB8A 1SLIA 4I02A 3KCYA 1VBA3 4XJ8A 3EXUA 1WLTA 4XF4A 5FP8A 1NKGA 1KRIA 4I0BA 1DHKB 1SFYA 4ITCA 3VDDC 4JGYA 3V64A 2VGDA 2W46A 4XDQA 1VBD3 3FFQA 2ZGUA 4PT6A 1LHNA 1OOPA 3NV2A 1VRBA 5BNOC 1ST8A 2ARXA 4FQ4A 3BU0A 4UF0A 3A21A 3VZLA 1K45A 1JI6A 4UOJA 4M4PA 4EN7B 3ASIA 3FZ3A 1QOOA 2QQNA 4LOSA 4XFBA 4AGVA 2GN3A 4Z1VA 4IEWA 3LGRA 4UI9L 5LASA 3M3QA 5E6HA 1FMD2 4H55A 4Q27A 4CVUA 3RS6A 5CBLA 1CJDA 1QOSA 1V0AA 4AW7A 3I3BA 4Q4V3 1HJFA 4XCAA 2FDHA 1F31A 1OUXA 2Y38A 4WM7A 4AK3A 5HXMA 4UFHA 4YW4A 3N36A 4ZS2A 3DPRA 4M00A 1UD1A 4AI8A 1XE7A 2ERFA 2IUWA 1SLAA 4Q8LA 2E7TA 2PAEA 2WQ8A 1S0FA 3PU3A 1W3VA 4EZ4A 3I2GA 5FK7A 3FUOA 1CPNA 1DGWX 1PMHX 1OLME 3C7EA 4WM8B 1DP0A 2VJXA 5LRRA 2C6SA 3WG3A 3VBHB 4JCKA 3ZPYA 4TLFA 1J84A 2JKBA 2XQRA 3FMGA 1ND2A 3TEYA 4Q4X2 4FOWA 3WDVA 3EO6A 3BTAA 4CRQA 3O1OA 2IXIA 4QPGB 1HW5A 5FZLA 3WW1A 4AHYA 4META 3KV4A 3D6EA 4IV3B 1WW7A 4QX0A 4OMCA 5F8PA 1H4HA 5KXEA 4K21A 1MQTC 1JODA 2IXLA 3AFKA 4JTNA 4YPJA 4B4RA 2DCJA 2F17A 3PVBB 2PLV2 4J25A 2R071 3UESA 1MS3A 1AR92 1RYYA 4JX0A 1LOFA 4EWDA 1T6BX 3SCHA 1Q43A 4A41A 3SCFA 2ZMNA 5D2AA 4PDWB 3ZXAC 1PGW1 2KD7A 1GU3A 3ZXDA 2RMU3 2VR4A 1EAH2 3VBSA 2GSYA 1MS9A 2RVAA 3ZIXA 2WT0A 1FMD3 3J4UH 2Q30A 1XRUA 4YGEA 3S7IA 2NYYA 4RN5A 2X53S 5BV6A 3B94A 1UX6A 3ORJA 4OLLA 2JD4A 2E53A 1C5HA 4Y22A 4QX8A 1VBB1 4P9XA 5F32A 3UYJA 3JQWA 2HWE1 3CQOA 2VNVA 4K9SA 3SNMA 1W3XA 3R4SA 3QBQA 1RUD1 2IVJA 5I0UA 3PMEA 4XE9A 1W6NB 4AWDA 5JPNB 1WW6A 3OCPA 4ASKA 1O5UA 3O1TA 4OI0A 2H6BA 1HKDA 1PO22 4BQXA 5EXOA 1WW5A 3S0MA 3AYAA 2XOMA 4AEJA 1ODMA 3O0XA 1VBE3 5KXBA 4YNIA 4N43C 4Q4W2 5IK4A 1HB1A 1R082 1RUF1 5CB7A 3U1XA 1TVGA 1ZBE1 4AFMA 1AR83 3M7AA 3RNSA 4Q1PA 3TAYA 2ZX1A 4RQPC 5JUVA 1ASJ2 1ND3C 5GKAC 5LK5A 3K4AA 3ES4A 1OKOA 3IDEA 4AVAA 2VNGA 1LNSA 5T3NA 4P9IA 4LTAA 5KC6A 3NQHA 4FVVA 4QX7A 2AUYA 1LOGA 1DZRA 2DBIA 3TBDA 2I2SA 1AX0A 3I7DA 2BQPA 3JB8A 5G05L 3T09A 5CEHA 2KR2A 4FOYA 5IFTA 3N9MA 4CUCA 2PHWA 3GYDA 2HJIA 1GLHA 1JZ5A 2BFUL 3SKJE 2RS11 4OQ9A 2LW8A 4LO5B 3IWZA 3OGRA 1ZBA1 4URAA 3MGUA 2Z69A 1HB3A 1FX5A 5BNOA 4N9HA 3ZYGA 1OH3A 1AJKA 3PUQA 5FPZA 1JUHA 1UW8A 1V00A 4Q4V1 2RJKA 3NNFA 2D6LX 5FZHA 3B00A 4M4RA 4QQPA 1UX7A 4FAHA 5LATA 3USUA 3RDIA 5EJ1B 3RYKA 1NX9A 3WR0A 4YZ1A 2HWF2 1N1YA 3RJ2X 2J7MA 4XXPA 1VALA 4GWJA 4HKLA 1C8M1 4LLFA 1YXWA 3JU9A 5FYYA 3UJQA 3NJYA 4FPKA 4XMAA 4E8CA 5C3SA 1CQ9A 1WGPA 1G8WA 1HV0A 1HDKA 4AHZA 4LBOA 4Q2FA 4W8JA 3ZFGC 3K4ZA 2VM9A
chains in the Genus database with same CATH topology
4NHKA 1LGCA 1EYBA 1FNYA 1HQNA 2TEPA 3NL1A 1LODA 2PYTA 2E7QA 5ACA2 1VBE1 2EXIA 1VBA1 1VP6A 4RR3A 5IK8A 5FO7B 1RHI2 4CP1A 2VW2A 2VOXA 4Y1ZA 1V6IA 4PQ9A 3VZKA 2XJPA 3G7DA 4MYEA 1CX4A 5FLJA 4DY3A 3M4FA 4G9SB 2FQPA 2XB6C 4YG6A 3WT3A 5JZGB 1MR5A 4QM8A 3IN9A 2GU9A 3MIBA 3JD73 3AKRA 3QACA 1ZRRA 2BPA2 2AYHA 4YSFA 3VZNA 2ZHNA 4GB31 1W0OA 2A71A 2RS33 4OHZA 4WZFA 4ASLA 4Q0VA 1FPN3 1RUD2 1PVC1 2TBVA 5I0RA 2XLAA 2FZ1A 2V09A 1I9RA 4R52A 5EWSA 4PLOA 5KXCA 1BBT3 1GR3A 3ACLA 1OLRA 3P3NA 1J59A 4Q29A 4M3CF 3O5SA 2EXHA 3ZO0B 4EJRA 4ZKTB 3OF1A 4N43B 2Q1MA 1UU4A 2LALA 1BJQA 3VKNA 4AQSA 1M06G 5BY5A 4PBOA 4BA6A 3D82A 3B69A 5CFCC 3DN7A 1BQPA 1Q8SA 4Y1UA 5AC92 3LSDA 2JENA 1SACA 3ZFEC 1OQEA 1ZRFA 4M01A 1VRH3 1XNCA 4K6BA 3R4UA 4YFWA 4A7YA 3JZVA 1F9KA 5CIRA 2W68A 3HMYA 1NCQC 1SMVA 5I0SA 2YHJA 1S0CA 1RVF3 4QHBA 3VBSC 3OPZA 5GZFA 2PHFA 3KGLA 3VL8A 3ZXJA 5HXVA 3AMQA 2DUPA 4QPIC 2PHRA 1PK6C 3O14A 4AE2A 4MZUA 5L7OC 3B02A 3W59A 2QDRA 1TMF1 1QQP1 2ZZQA 4QPYA 4R9CA 4HBNA 2BFUS 2NM1A 5D8AB 4CP2A 1HLCA 4EN6B 4FPJA 4AI0A 3E97A 1W39A 3HBZA 2WC2A 1BKZA 4KNCA 4RSUA 1B35A 1UMZA 4YVWA 2IC1A 3ZYRA 3ILRA 3HD8B 3JUUA 1LESA 1ND2C 1TQ5A 1J3PA 1S55A 1GYKA 3PVEA 4QGMA 1MS5A 4FP2A 2A6ZA 1NA1C 2WNUA 4QT6A 1GQGA 3GBWA 3VBHA 1SLLA 1WMEA 3E6CC 1I5ZA 2RJLA 4RGGA 2EXKA 5JZGA 3AZWA 3JB4C 1RUG2 1U5XA 2VU9A 3V65A 2VNOA 4V1PA 1I6XA 1PGSA 4RQPB 2RM21 3LA3A 2UYAA 3VLBB 5LEJA 4B29A 4Z2WA 4Z92B 5AFEA 4XILA 4RS5A 2OIIA 4Z07A 4BIOA 5LEKA 2XPJA 3TOJA 2DU1A 4LLOA 5GLVA 5E88A 4DB5A 4QQLA 2WWSA 2D5FA 1AR81 3H7YA 4COWA 1IGOA 1AX2A 5BNOB 2WT1A 2DTWA 3ZSEA 2YC0A 2HEWF 5HCBA 1NA1A 1ZZBA 2WNUC 4N7UA 5H9PA 1HRI2 1AR63 3J8F3 4Z8BA 4D7TA 4TSVA 2P2KA 4XEZA 1GZCA 3MIHA 1NY72 5CFCB 5E8AA 4YYOA 2QE3A 2VOVA 2WQ4A 4MXWA 5E16A 4BIFA 4P9LA 1FOD1 5D8AA 3OGJA 4QPGA 4XQWA 5BNNA 1QJU2 2NP0A 5DG2A 2WNVB 3ROUA 4BWOA 4MSVA 3ELNA 3ZN5A 5CG9A 4AYUA 5L73A 5IUQA 1MS1A 1PK6A 4GMP0 1IS6A 4FTSA 4YW3A 1PK6B 4GH4B 4WVZA 1DGRN 4BCUA 4HLTA 1IOAA 2ZCWA 3N7JA 4CDUB 4IEVA 3TNQA 2ZGMA 5FO9B 2RS32 5BNNC 2A75A 4D94A 4QU2A 4MGIE 3JD72 2YY1A 4FPOB 4EN0A 4CDQB 2WS92 2JG9B 4L2NA 5KHIA 1S0JA 2HWB3 3OYWB 3RMYA 4ONUA 1VJ2A 3OD4A 1RUH1 3DPRB 4HZFA 1BEV2 3ZMNA 4YM3A 4PDWC 4C1WA 4FPEA 1EPZA 3WW2A 4TZDA 4LUKA 5TSWA 1C4RA 3AJYA 1JW6A 3W9AA 1O3QA 4KH9A 3WZ1A 5CFDB 1OFNA 1ZZ8A 3PHMA 2ZKNA 1RVF2 4B7EA 1QH6A 4GALA 1H1IA 4BYYA 2VUJA 5JDBA 3CEWA 3U0ZA 3L2YA 4OVEA 4HVQA 3SCGA 3AFGA 3AXEA 3RG0A 1N3QA 3VBRA 2YYOA 2FZ2A 3INAA 1O7FA 2BUKA 4FPLA 1W6PB 2VMHA 4K20A 1QGLA 5A33B 1GFF2 2IFRA 5EZWA 2E63A 5JMCA 3ZFGB 1KJLA 2GH2A 1ND3B 1AXYA 3WY6A 4N7IA 4Q0UA 2DWRA 1N1SA 3MIFA 3FHIB 2VVFA 1MS4A 2DV9A 3E6BA 1SBDA 3WP6A 2QZ2A 3MFAA 2RS51 5C8CA 3RZZA 4C0BA 2YV8A 3NV3A 2ZHLA 2R061 1N1TA 1BXHA 1KFUL 2B8MA 2UYBA 4HSLA 1Q8VA 1WUVA 3BODA 2PLV1 1D4VB 1QXJA 4GWMA 1SLCA 4KWJA 3ES1A 4JDNA 1BBT2 1FT9A 1U5ZA 2RR12 1RUI3 3SMHA 3WHTA 4XJUA 2X5IA 1S0IA 3AKQA 1R083 2W08A 4JGZA 4OZXA 4PIYA 1DGRA 4YGDA 1WLDA 1H8VA 4JGYB 1ENRA 4KG8A 1IS4A 5H9SA 2QFEA 3KB5A 4XPVA 4BMEA 2D7FA 4LULA 1LECA 3M3EA 1RHI3 4XQDA 1UKRA 2CAVA 4WV8A 1V6OA 5LK7B 1AL0G 1GBGA 1HX6A 3MIEA 1COV1 1IHMA 2LTNA 4XJZA 1W6PA 1C1FA 1LEDA 1QY4A 2OZJA 3AZVA 4Y20B 4WM7B 1DQ5A 2UY9A 2X8KA 4Y20A 5F9TA 1ZZ9A 4CDUA 1C8NA 2H0VA 3KLSA 4U2AA 3K48A 2WKKA 1ND3A 1DZTA 1PMIA 4K1ZA 4XIKA 3ZYIB 2XGXA 2ZGTA 2HWB2 4LBQD 5AFBA 4IEYA 4JAAA 4N43A 2F4PA 3N3HA 2G9GA 2QZ3A 4P9GA 2BNMA 4PF5A 3OBTA 4YLZA 4CDWB 5JOXA 2VXRA 1Z7S2 4CDWA 1MZ6A 5L19A 4OI4A 4PJYA 2NLRA 3J8F1 3ATGA 4MV2A 4AI3A 4HVRA 2PQQA 5T54A 3TNPB 1ZVFA 5IK5A 5K0UB 4JGZC 2C5DA 3AKTA 3AP9A 2WJSA 3POYA 3ZFGA 1APNA 1CESA 2C9AA 2C0ZA 2ZX4A 3B01A 4P14A 3MPPG 4L8QA 5JVVA 1GNHA 4GULA 2YMZA 1ZRDA 1DU3D 1H8TC 5F1RA 1CD3G 1DG6A 3C2UA 4RL7A 4XFGA 3K51A 1VLNA 3NV1A 2Q4SA 1O91A 1XYNA 3GZAA 1PO12 4UBGA 1MQTA 3PNAA 3AK0A 1HRI3 4FOQA 5EYXA 5J09A 3D0SA 3RJRA 4ATFA 4Y5Z0 1AYN3 2A6WA 4YVWB 3VBFB 3NV4A 1AHSA 1VBE2 1XU2A 1NCQB 4N9IA 1V6JA 5T5PA 1AXZA 1WD3A 2YGLA 4NPRA 4D7YA 1AR71 4AFDA 4YVSA 4AVTA 4XF3A 3ZN6A 4GA9A 1VAMA 1PNFA 2FMDA 4BH9A 3WP4A 5ACA3 1V6KA 1OOPB 1O4ZA 3KS7A 1AZDA 4DS0A 2AENA 4M3CE 5GJ6A 5JWPA 1VBB3 3CLPA 2PLV3 4LUMA 2Q5TA 1YJLA 1PVC2 4AG4A 4CTEA 1U5YA 2JE9A 4YVSC 2QUOA 2CWMA 5JIUA 3HWJA 2XH6A 1PHMA 4IQPA 1RMU1 1YO8A 1NOVA 2MHFA 3VKMA 4I2OA 3IT8A 1Z0HA 1QHDA 3PVNA 1V9U3 5K8SA 3ZSJA 1S2KA 3AZXA 4FTEA 4LT5A 4FQZA 1H1MA 1Q56A 3UKVA 1AL23 2QQPA 2R30A 1LB2A 5JPMB 3WDXA 1AR91 3NAPB 4XHBA 5FQ0A 2WZR1 3D8CA 3FJSA 3NKTA 4XF1A 5FRAA 3AYEA 3ZXEA 4HETA 1PZ7A 2B9UA 3VKLA 2WNUB 1H8TB 1ASJ3 4X8NA 3TYJA 2BYVE 2VNRA 3I54A 2IZWA 1YIPA 3WCRA 2Z2SB 5L36A 3WV6A 3S6PA 4QPGC 1J1TA 5D8AC 4RFT0 3WUCA 2WSVA 1LOEA 2A5ZA 3SHRA 2BTVC 4YW2A 2CNAA 1VBD2 1CN1A 5I0TA 2ENRA 2XVLA 5BPXA 4ES9A 4I30A 5F6KA 2K9ZA 1AR61 1VB4A 3IM0A 4YG3A 4XF9A 3HN1A 3WLUA 4CDUC 3MICA 4WM7C 5A32A 2B45X 4AQTA 4QD2A 4JQRA 1W6OB 1JHNA 2NPIA 1O5LA 2BVBA 1GNZA 2O0OA 4RHV1 1AJOA 2TNFA 3ME2A 1EY2A 4X6RB 5FLIA 4Q4Y2 5JI9A 3VUOA 5KHHA 2DCZA 3WX5A 2Y0IA 1BVVA 4P9YA 1HXS2 1TE1B 3P3PA 3FFZA 4BLJA 1D0HA 4NHMA 2RM23 1TNRA 4IV1A 2EALA 1RC6A 1OOPC 1H4GA 1SLTA 2ET1A 1J3QA 1RL3A 3MLKA 4XW3A 2GN7A 3VDDA 4AEMA 2AH2A 4EV0A 1XYOA 4HANA 4RHV3 4O9GA 4XTPA 4COUA 3ZXLA 1B35C 3JBG2 1DFQA 5GZCA 3GBFA 3LZZA 4F8AA 2IXHA 1S0DA 4I0WB 1S2BA 3AKSA 3SH3A 4COZA 2ZGLA 2RS12 2R16A 4D7SA 2Z5WA 1RITA 2HWC2 2HWF3 1AL22 3H9AA 4M0NA 5F5QA 1FOD3 5DZGA 1AR72 4YRDA 5L7OA 3HIFA 4AHWA 2MEV2 1YFUA 1ZX5A 2GMPA 4COYA 4DRRA 5C8CC 1ULFA 2NZ9A 4S2FA 3ZFFB 3TN92 4FPGA 2EIGA 1VB2A 2WINB 4BM8A 2ZKLA 2ETEA 1X36A 4KG0A 3U11A 3VKOA 3IDBB 4Q0PA 4YGBA 2JG8A 1H2MA 1ZZ7A 1FXZA 3IMNA 5C8WA 1CAWA 1BEV3 2Q0AA 2AGSA 4P5HA 3J9SA 5JSOA 4YFZA 1QJU1 2JE7A 5CFCA 3EQEA 2CYFA 1S0EA 3FUQA 4QQOA 2ARBA 1VAKA 2ZZJA 1HXS3 1CR7A 3VBRC 3WDUA 2PN5A 2B7YA 3BPZA 1G6NA 1COV2 1VAVA 3ZN4A 2EA7A 3O0WA 4MGYE 4QM9A 5GLZA 3AZZA 3HQXA 2D3SA 5CADA 4BOWA 3KZ4C 4MXVA 3LKJA 1R091 5H9RA 1NQDA 3M3IA 5IK7A 1CAXA 2XBO3 2PAKA 4XMIA 1O3TA 3L2HA 2WS91 3DUIA 4PDWA 4Y1YA 2WZR2 1W2UA 2YROA 1QJU3 2PELA 4R4XA 4PLNA 3ZN6B 2E9QA 2FBEA 3BOWA 1BEV1 4KWKA 2GDFA 1FV2A 4K1YA 5C9AC 1ENQA 4DNYA 4IEUA 3ZSKA 5JAXA 2GC2A 2KM2A 2R063 1YIFA 3CJIB 1RUE1 5T5OA 2RR13 1AR62 2R043 1JYIA 5SV5A 1ZM1A 1RUE3 4RD7A 4YW1A 2PAMA 4K8FA 1UU6A 1WCSA 3V0BB 4E27A 2RMU2 4AVBA 1VBC3 3I8TA 3V0BA 1TEIA 1YFYA 2VVDA 3UKNA 3FX3A 2UWAA 4DFSA 2ZMKA 1HQLA 2D93A 3QD6A 1VBD1 1RB8G 2F6BA 1OQ1A 5C4WB 1H2KA 2NMOA 3E5XA 5FMOL 5C6CA 4CEYA 2V5YA 1UZYA 2ZGRA 2DVDA 4FTBA 1KQRA 4J1WA 1Y7BA 1WBFA 1Z7S3 1QNYA 5JIAA 4JRLA 1OD5A 1ZRCA 3VHNA 1DLLA 3RPQA 1DQ4A 1OQDA 5K0UC 4NWVA 3M3CA 2X5IB 1CGPA 4GKYA 1YCIA 4ES8A 2RS52 1V9U1 2JJ6A 2OPKA 5J48A 2UURA 4UW3A 3OY8B 1RUF2 2C1FA 1RUC2 2WFF2 1AF9A 4OUSA 3TB0A 4A2UA 1R1A3 1PVC3 3QOPA 4RS5C 4MXWB 3D0JA 2EAKA 1CVNA 2YXSA 5JOYA 5A3MA 3N7MA 3O12A 5T50A 2VOKA 1QXRA 4CDXB 3APBA 3VBOA 5JZGC 4RQPA 1KD7A 3GBGA 5KHJA 1CAWB 3AP6A 3AZYA 3N35A 4BE3A 5K0UA 1D4M3 1YHFA 4MGZE 5T5LA 2D43A 1GANA 2DVGA 1GZ9A 1VRH2 2KA3A 1YUDA 1LENA 2N7GA 5J96B 4UW4A 1TNFA 1DGLA 4RR3B 1WCKA 4WVMA 1FMD1 2MPFA 1OFSA 4Q26A 3OGGA 2GC0A 1R1A1 2DCTA 5ABJA 1BVP1 2OW4A 4J1XA 4D69A 1BZWA 1C8M3 1ULGA 4L11A 3CL1A 1ZYBA 1LCLA 3ZXFA 4I0AA 1PO21 2GZWA 1U5IA 2OZ6A 3DV8A 2HWF1 5DUVA 1G9DA 4QPIA 5GM0A 4W6YA 1DZQA 1LHWA 5HCAA 2YZ4A 4LO6B 3M1HA 2D5HA 4XQ4A 2D6NA 2D6PA 4FP3A 4G3YC 4QMAA 1QU0A 4NR1A 4HMZA 4IEQA 2ZX3A 3IDCB 3ZFEA 2LUWA 2E7AA 4Q0SA 2O1QA 3J8F2 1F2NA 1RUOA 1BCXA 4LA3A 3WD5A 1AXKA 1W6QA 4LO7A 2XJTA 4Q4W1 3UK9A 1OSGA 1DDLA 3AMNA 1W0PA 3MFCA 3DGTA 3RI9A 4DXZA 4ZU5A 2XKPA 1POV0 3LB9A 4C1XA 2VVEA 1PVXA 4OI2A 1Q5OA 1SBEA 5T52A 1RUNA 3NJZA 3B3QE 2V73A 2WA3A 2JICA 1UZZA 2BEOA 1LHUA 1BMV1 1RGSA 1MZEA 1ASJ1 3VL9A 5FOJB 3RI8A 3ZVXA 1DIWA 1ZZ6A 4XJWA 3SISA 1J1LA 3PTYA 2CGOA 3NW4A 1YI7A 4HT1T 5K9YA 2WS93 4NVPA 2Q1ZB 3JQXA 1DF0A 2ES3A 4GIQA 5DXDA 2RS53 1PIV1 1ZBE2 4I09A 2YUEA 4E4ZA 1MACA 1EPWA 3H50A 4HKWA 4LO4B 4R9DA 1OLQA 3ZFFC 4MUVA 2XL7A 3KT4A 1CAUA 3VGIA 4W6WA 4E2QA 1AR73 4YM2A 2PFWA 2XVKA 4S2DA 1XE8A 3NKGA 1RJ8A 4HL0A 4MH0E 4HN1A 4GB32 3USSA 4DRVA 4C0HA 2Z42A 3B5LB 5E1RA 1UPSA 1NCRA 1QMJA 1G9FA 5C4WC 2XVGA 3LA2A 2CGNA 3MLJA 1EV12 2VG9A 4AQ6A 4GMP1 4AVCA 2I07B 3ZFFA 5J7MA 3D5OA 1ZA4A 2I74A 1A6CA 1QJY3 5EV7A 2EF6A 2WLPA 3THTA 1UIJA 3PMSA 1N3OA 2R062 3NAPA 1BBT1 2CL2A 4Q4X1 4LBNA 2P3JA 3H3ZA 4XTMA 1ULDA 5KHKA 1D2SA 2YDEA 1CAVB 5JCTA 2G9FA 4XIOA 2EVXA 4PBPA 2GNBA 2MNGA 1DQ6A 4K40A 1H1AA 1Q3EA 4KWLA 5BYNA 4BQ1A 4CZSA 2WSUA 5HCFA 3RYRA 3AP4A 3KT7A 4DINB 4LO8A 3AP7A 4MX3A 3VHPA 1UKGA 5DZEA 3DF0A 1O3RA 3GF6A 2BNNA 1T6GC 2HWE3 4ISRA 3KMHA 1UU5A 3AKPA 4H14A 3UKTA 1LHOA 1AVBA 1RIRA 2OA2A 1D2QA 2JECA 3LOIA 5BNQA 5CFDC 4FXGB 4S2HA 5FO8B 2WL1A 2D3PA 1TME2 4OHYA 4YM0A 3ILFA 5A32B 4CEYB 1H2LA 4F7ZA 1LEMA 5JSPA 2X29A 4ZXKA 5IT6A 1QH7A 1IKPA 1NCRB 3CU7A 5L7OB 4IETA 4AF9A 2D3RA 1MS8A 1DQ1A 1QF3A 1V70A 3AXDA 1OA3A 3E5QA 1JN2P 3QH7A 1LTEA 3PLQA 2ZX2A 4N53B 1JTZX 3CJIA 4L92A 3TN93 4Y4YA 4IV3C 1RUC3 2WFF3 5KWRA 2VQ0A 2K0GA 5D1IA 3VV1A 4UBHA 1OPOA 3WG2A 2XKOA 4FSJA 2W52A 5BUVA 2UY8A 4IEOA 5EFUA 2VUAA 4GKXA 3GNEA 4E2GA 2PHLA 3ZXKA 4KQ7A 2BNOA 1RUI1 1Q8PA 1QDOA 1RMU3 4HKOA 1PIV2 3WQ1A 4IESA 1JYCA 1QJX1 4WVVA 2P17A 1RUJ2 1VBC1 5AVAA 3M8LA 1H9WA 1REEA 3RWNA 4F83A 1EV11 1TMF3 2XHKA 4HN0A 4CDQC 2DUOA 4E4SA 3PJYA 1WW4A 5GZEA 4XFAA 3AYDA 1MEC1 3WP5A 4B3NA 2DFBA 4A3XA 1PGL2 5K7PA 2HWD1 1AUYA 2RMU1 3KQRA 3LAGA 5CAZA 4XZPA 5I8YA 3HT1A 1PZ8A 1D0GA 2Q8OA 1E57A 1REFA 4YM1A 4R9BA 2B39A 3VBUC 3SXWA 4CEWC 4E4DX 4UW6A 2XWBB 3DL3A 1AR93 4K3UA 1UF2C 1X33A 2PHTA 1H9PA 4WBBA 5JLVA 1CONA 3WW3A 5BNPA 1JUIA 4FPCA 3VDDB 2EAAA 3H1YA 4Q4X3 2R6QA 1PO13 3LA7A 1Y9QA 4M0HA 3JCIA 5C4WA 1NCRC 2ZGQA 4IEZA 2ZX0A 3KD4A 1RMU2 1WLWA 2ZTNA 5SV8A 1EAH1 3TRSB 2VMIA 2R1DA 1SQ4A 3BOPA 3E5UA 2A6XA 1R1A2 5HBAA 3W58A 4H7MA 1OA2A 1ALYA 1FOD2 2YGMA 1W6OA 4AGGA 2PHDA 3AJZA 3MIGA 2RS31 4Q4V2 1QDCA 2ZPXA 2WQZC 3I4IA 5JOWA 4HK8A 1NCQA 3JBG3 2GNMA 4OHWA 4CDWC 4Y1XA 4LBJA 1RVF1 3FLPA 4LA2A 4DPNA 5DUWA 2A73B 1RUH2 5AC93 2ZAHA 1SEFA 4JDOA 3USUB 1LR5A 3ZFEB 3ZYJB 3M3OA 4FT8A 4GH4A 3VKFC 4YG0A 1OHFA 4I3GA 4JDMA 1W6MA 2TUNA 2SLIA 4UW5A 4Y26A 2BBVA 1ZNPA 5GLUA 3WDYA 2DVBA 1SFNA 1YNAA 5FMOS 4AI1A 1ZZCA 2ZAAA 3VBRB