1YFYA

Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from ralstonia metallidurans complexed with 3-hydroxyanthranilic acid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate-3,4-dioxygenase
publication title Structural Studies on 3-Hydroxyanthranilate-3,4-dioxygenase: The Catalytic Mechanism of a Complex Oxidation Involved in NAD Biosynthesis.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Oxidoreductase
total genus 29
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2005-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yfyA01
4J1XA 1J1LA 4TLFA 2XL7A 2V09A 3LA3A 3JZVA 4UXAA 2XGXA 1DZTA 1YFYA 2GH2A 1PMIA 3FWEA 4E2SA 3ELNA 4KWLA 1ZZ8A 1J58A 4HBNA 3LZZA 3SHRA 4BIFA 3H7YA 4XEZA 1X8EA 1NXMA 2F4PA 3NVCA 2WC2A 1ZRRA 4MGZE 4LEJA 3LA7A 4O9EA 2PAEA 1FXZA 3OD0A 4XF1A 3SCGA 3M3IA 1DZRA 2BNNA 1CAUA 4LULA 1XRUA 2PQQA 4IERA 1Q3EA 3R6SA 5I8SA 1GQGA 3D0JA 4MGKE 2GAUA 2ET7A 2N7GA 1WGPA 1XE8A 2ZCWA 5JCTA 4MX3A 1L3JA 1CAVB 4B29A 1I5ZA 3LOIA 4LTAA 4O9GA 3D0SA 3H1YA 5HI0A 3EBRA 4L11A 4R52A 3GBFA 4KWKA 4KU7A 4BYYA 4LA2A 3FFQA 1YLLA 5FLIA 4MGYE 5F1RA 5C8WA 1EP0A 4Q0VA 5C6CA 3RYRA 4HN1A 5FDBA 3CLPA 5D1IA 2Q4SA 4MZUA 4MV2A 4MH0E 2I45A 3NSTA 1QY4A 5BXXA 2MNGA 3NKTA 2Z2SB 4FT8A 4BHPA 5I0UA 2O8QA 3S7IA 5LRRA 5JSOA 3CO2A 4X6RB 5FPZA 3GYDA 4YSFA 3I59B 3I59A 5KHKA 5E1RA 4GULA 2ETEA 1DGRA 4I0AA 4FAGA 2PHDA 2H6CA 2ZKLA 4AXOA 1CAWA 1CAWB 3RZZA 3DKWA 1RC6A 3MPBA 3PLQA 3LAGA 4XETA 2IC1A 1FI2A 1ZNPA 4X6QB 4JTNA 2FMYA 2OPKA 1J3QA 1V70A 3SCFA 4QXKA 1XE7A 2GC2A 2QNKA 4YNIA 2O1QA 2IXIA 3CEWA 2MPFA 2HKXA 3ACLA 5CVRA 3S7EA 4WVZA 4META 1DGWA 4PJYA 1J59A 4Q0PA 2GZWA 5J3UA 4HSJA 2VPVA 3FE5A 5I0SA 4Q0QA 3RNSA 3EO6A 2BNMA 1IPKA 1OI6A 4JV4A 1CGPA 1SQ4A 2Y0OA 3KCCA 3ROUA 1O3RA 2WFPA 3CL1A 4KL1A 3UKNA 1O3TA 2OYZA 4K8FA 1UW8A 2GC0A 4QGMA 3UKTA 1IPJA 4AVCA 5KHJA 5LRSA 3RDIA 4QGLA 3KGLA 5FPXA 4D7TA 4XFHA 5KHHA 3SXWA 4DINB 4IEQA 4PIXA 1VR3A 1ZREA 1YFWA 3H7JA 2B9UA 4I02A 4E2GA 2UYBA 3CJXA 2KXLA 3L2HA 1ZZ7A 2UYAA 3ZDSA 2PYTA 2QVSB 1LR5A 3DV8A 2PAMA 1Q43A 4ZU4A 2FQPA 3NW4A 5I91A 3QACA 1EY2A 1X7NA 2QJVA 3FHIB 1Y3TA 2ATFA 2OZ6A 1CAXA 1CAXB 4R8HA 3U10A 1NE6A 1CAVA 2PFWA 4IESA 3USSA 1SFNA 2PTMA 3EJKA 4XF9A 4ORFA 4IEYA 4OFGA 4MGIE 4XFFA 3FZ3A 4HVRA 2BGCA 2QCSB 1QXJA 2IXLA 4XFIA 3DN7A 2XLGA 3O14A 2D40A 3MYXA 5I8TA 1O3QA 4LUMA 2IXCA 4JTOA 5JSPA 3H3UA 3H50A 3E5UA 3RPQA 1EPZA 4IEUA 3HQXA 3QOPA 3H3ZA 3D82A 3HIFA 5KHIA 3FX3A 5I8YA 4EROA 1EYBA 1LKNA 4L2NA 3TNPB 3EHKA 3ST7A 1PM7A 4QM9A 2UY8A 1HW5A 4HLTA 3SMHA 2EA7A 1YWKA 5BV6A 4LLOA 1OD5A 2XL9A 2PHLA 2OZJA 3NL1A 4HMZA 4WBBA 4AVAA 5LEJA 1VP6A 3BB6A 4EV0A 4PIZA 1Y9QA 2HJIA 2BEOA 3E6DA 3CF6E 1UIKA 3E6BA 4Q0SA 2PA7A 3IWZA 5K8SA 2Z69A 2D5HA 2VQAA 4HVQA 3N4MA 1NZCA 4KWJA 1OMIA 1Q5OA 4XFBA 4XF0A 3RYKA 2K9ZA 2VECA 4JVAA 3OF1A 4N9IA 5FLHA 1O5UA 2OA2A 1ZZCA 1ZZ9A 2GC1A 3OCPA 1O5LA 4YRDA 1RGSA 1WA4A 2CAUA 4WZCA 1ZRDA 1H1IA 5CADA 2GU9A 1O4TA 3C3VA 4XF3A 5I93A 2CV6A 3HT1A 1J3PA 4LA3A 4Z82A 4LUKA 1ZRCA 1VJ2A 1LB2A 3BPZA 2DCTA 2XKPA 4EWDA 3B02A 4I01A 3M70A 1CX4A 3IDCB 5JR7B 3MDPA 3KSCA 3WW3A 3BCWA 5CU1A 1TQ5A 4IEZA 4A2UA 5JSRA 3U0ZA 4F7ZA 4J1WA 4EWAA 1G6NA 3HT2A 1GQHA 5EZWA 4XFGA 1ZZ6A 4UBGA 2Q1ZB 4AQ2A 3WW2A 2GC3A 1O3SA 1QWRA 4H7LA 2H6BA 2Q30A 3BU7A 3LA2A 4XFAA 3G7DA 5FQ0B 5FQ0A 4HZFA 3H1MA 2EVXA 2IXHA 3RYPA 4BH9A 4FAHA 4HVOA 2ET1A 3ES1A 4P9GA 5BPXA 5J7MA 1JUHA 3FJSA 4FBFA 4RD7A 5BY5A 4EWEA 3E6CC 3KGZA 5KBFA 4CYDA 3NJZA 4XF4A 1CAUB 2C0ZA 4NVPA 1RTVA 4ONUA 1X8MA 4E2QA 3OGJA 3H1WA 3MZHA 2QDRA 1YUDA 1YHFA 3S0MA 3IIAA 2XHKA 2K0GA 4OLLA 3OTFA 2P17A 1UCXA 3I54A 3ES4A 1UPIA 4I09A 4HN0A 2PAKA 4YYOA 4Q29A 2B5HA 3E97A 3E5QA 1H1MA 5J48A 4QM8A 4F8AA 3PVBB 3VHRA 2Q0AA 2UY9A 4AQ6A 4IEWA 1UIJA 2D93A 4KU8A 1FT9A 2H0VA 5E16A 4HSLA 1YFUA 4Q0UA 3WW4A 3BALA 4D7SA 2IXJA 1U12A 1NE4A 2BYVE 1J3RA 4Z07A 3TNQA 3IDBB 2XLAA 4UBHA 1LRHA 1NYWA 4ZU7A 1OFNA 5JAXA 1RUNA 1QXRA 4IEXA 3H9AA 2EAAA 3IBMA 4YARA 2BNOA 5I0RA 4I0BA 2CGPA 4QMAA 4QX5A 4MUVA 5EFUA 1I6XA 4ZU5A 3DL3A 3ETQA 3PNAA 4QGNA 4PIYA 1X82A 4AVBA 3SCHA 4I2OA 1UD1A 4I3PA 1RL3A 1ZZBA 5FCCA 3I7DA 1YFXA 2E9QA 2XKOA 1ZRFA 5I0TA 3WW1A 3LWCA 1RUOA 2XLFA 3E5XA 1SEFA 4XFCA 5KHGA 5T3NA 3U11A 2IXKA 4IEOA 1O7FA 3H8UA 2D5FA 3KMHA 5BUVA 5FLJA 2MHFA 2CAVA 2B8MA 3EQEA 4IEPA 1WLTA 1ZVFA 3UKVA 1ZX5A 5AVPA 4IEVA 4IETA 4N9HA 5LEKA
chains in the Genus database with same CATH superfamily
3UGFA 4J1XA 1J1LA 4Q4Y1 2ORZA 3LA3A 5LA9A 1UU5A 1GWLA 4AFDA 3B9CA 3J8F1 1LAJA 4QDRA 3NNLA 3C7GA 1BK1A 1VBA1 3ZYBA 5IHRA 4D6QA 2J1AA 4QX0A 2YMZA 2B39A 2VUAA 2R041 4OHYA 5E88A 2Q8OA 3H7YA 4RS5B 1W9YA 1NXMA 4CDWA 5DDJ2 4GAZA 3MUZ1 5FP9A 4GA9A 4Y1XA 1O4YA 3JU9A 2WWSA 4JDNA 2DURA 2SLIA 4ZS3A 4ASKA 3PVNA 5F5QA 1QGLA 3M3IA 1H4GA 2VNOA 3CMGA 4Q4W3 1GZCA 5AFBA 1FOD3 4IERA 1Q3EA 3OYWA 1BHGA 4QPIA 4R9DA 5I8SA 1S55A 3O0WA 3VBFA 2W08A 4AI8A 4OI0A 4FPYA 4H3WA 2GAUA 5FYVA 2FCUA 5FZKA 4UYBA 2ZCWA 5FZ7A 1X33A 5JCTA 5C8CC 1PGW2 1RUH3 3IDAA 1BVP1 4MX3A 1L3JA 2BOIA 1EV13 3R4SA 4CUCA 2WFF3 3KZ4C 2XUMA 2R1BA 4LTAA 4CDQC 2JDHA 1OPMA 2HWC2 5FZOB 2Z5WA 3P5BA 4PI2A 2ZX0A 4K1ZA 3GBFA 5FP4A 5LASA 4P9YA 4EN6B 3VN4A 3EB7A 4A3ZA 1B35A 1UXXX 1VIWB 2L9LA 1REDA 2RJKA 1HB2A 1KD7A 1KITA 1R1A3 3AC0A 3OBAA 4A6SA 2QZ3A 3WD5A 1Z7S1 4Q0VA 5C6CA 3RYRA 1WCKA 4C1XA 2RS11 1CPNA 2FBEA 1V6KA 3J26N 1SCRA 1UOGA 4HPKA 1UY1A 3H0OA 1M06G 3M3EA 2E26A 1BBT3 2W39A 3HVDA 4HKLA 1XBFA 2NLRA 5D1IA 5FUIA 5ABJC 5C9AC 2QQNA 4MZUA 4W6YA 2I74A 3P6BA 4CEWC 1VBD2 2BWAA 2DWRA 4RA0A 1DHKB 1XNDA 2X53S 1W03A 5BXXA 1ACCA 3NKTA 4BQ3A 5C5UA 3WP6A 1HN0A 2JDMA 3N7JA 5IVJA 4XIOA 1FV2A 4NJ4A 4BHPA 4DXTA 5BNOC 2FHRA 5LZ6A 1OFSA 2CY6A 4O7XA 2GN3A 1POV3 2DCKA 5JSOA 1K5JA 1HQWA 3CO2A 3B7MA 4WVWA 4CCOA 1LGNA 4C91A 1RHI2 4XDQA 4YSFA 3I59B 4XBNA 1JMUB 3NV3A 1DGRA 4I0AA 1REEA 1N1VA 1WW5A 2B7YA 4TLGA 5FAXA 5GLTA 1XSQA 1OQDA 5C4WB 2VZOA 3CHXA 3QH7A 3WQBA 4AXOA 1MZ5A 3D6EA 4LITA 1JBCA 1LU1A 3LAGA 4XETA 5J36A 2ZAHA 4P9JA 3MIBA 4JQRA 1WUVA 1YEWA 1BEV3 1NXD1 1OT5A 1K42A 3WQ1A 2ZMKA 1JZ2A 2Y26A 2D6OX 1QHDA 5BNNC 1I1EA 4XTPA 2VMIA 4S2FA 2Y64A 1ULEA 4BXFA 5EIYB 2A70A 3VHNA 2EAKA 2ZGPA 1O6UA 4YNIA 1QJY3 4TTGA 2PLV2 1J83A 4BQ2A 5GZEA 1TNFA 4ZKTB 1V6MA 3ACLA 2WAOA 2WLQA 3C7HA 4LNVA 4QXHA 3AYDA 3PU3A 4NHYA 4PJYA 4JAAA 1BYHA 2XJSA 1GP5A 2VZ1A 4HSJA 4JHZA 3NV2A 2VPVA 1RXGA 4OQ9A 3WF4A 3RNSA 1OF3A 5IK7A 2GMEA 3K46A 4XILA 3ZXDA 4LO6B 4JV4A 1YIFA 5FYIA 3TN92 1FOD1 3KCCA 3ROUA 2GMMA 3CL1A 1GMMA 2WWJA 4IXLA 1VAMA 3UKNA 1ULFA 1OBNA 2W52A 5E6HA 5IWFA 3ZSKA 1O3TA 1ODNA 3WHTA 5LWBA 3LEMA 3M1HA 3BKZA 2ZEWA 4LJHA 1ZA7A 5FPXA 3WDVA 4D7TA 2GNMA 5C8CA 5KHHA 5F6LB 2QBXA 1JYVA 3WCSA 4FI9A 2IWGB 4A44A 1A8DA 5FBZA 4LBQA 4RYDA 4MOAA 3V56A 4CDQA 3RI9A 5A6YA 3H7JA 4BK5A 2P37A 2RV9A 2D6PA 2VCMA 5T55A 4E2GA 2F17A 3CJXA 2ORXA 2WINB 2QDNA 1G7YA 3ZDSA 4JGYB 4PBPA 2AH2A 5DAXA 3DV8A 3MLJA 1JYCA 4XJZA 4P9IA 5FY7A 5C3QA 5IVCA 1UYPA 4TWTA 3UNPA 1BBT1 1E5IA 1PO11 4Z2WA 2YBKA 1Y3TA 4A41A 5ABJA 5GJ6A 1DP0A 5C9AA 4DIQA 3AK0A 1W05A 2ATFA 1W8NA 3VBHB 1CAXA 3PTYA 3BU0A 4CEWA 5IYYA 1CAVA 1XYPA 2TBVA 1SFNA 3USSA 5G04L 1HXS3 2ZPXA 3AVSA 4XF9A 5DAVA 4LE4A 2VMHA 2VQUA 2VM9A 3DCQA 2VCBA 5BNOA 1TZOA 1POV1 2ZOEB 1S0BA 4IGQA 5KR7A 3AFGA 3FZ3A 4HVRA 2BGCA 1W2TA 5FZDA 1QXJA 2KR2A 4CPBD 4NIHA 1RMU2 5FZ6A 2LALA 3MEPA 2YPDA 5SV5A 5ANNA 3O14A 2D40A 3KB5A 1KS5A 3KF3A 4LBNA 3MYXA 2W1WA 4M3CA 2HWB2 4RL7A 4LUMA 3J7LA 5H9RA 1S2EA 1UZYA 3K3OA 5L7OC 3IAPA 1QJX2 4D3WA 3VBSC 3E5UA 1NAEA 3RPQA 1YXWA 4AFAA 1BEV1 4Q1RA 5KXCA 3OBZA 2HYKA 2FD8A 4E8CA 2GH8A 4RQPB 1H30A 1JZ3A 4NIIA 4TZDA 3KT1A 4QU1A 1GWKA 4Y3OA 1VBC2 1N1YA 2WA4A 4YG3A 1EYBA 4EROA 3VV1A 1W0NA 3U37A 1QJY1 3GALA 1RUG3 5GKAC 4M0NA 3TNPB 2FDKA 1FMD2 4OULA 3PIGA 1UYYA 1G9AA 1I5PA 4JGZB 2QQKA 1HW5A 5A7OA 3J7NA 4HLTA 3PHMA 3ME2A 1F31A 1RUD3 2EA7A 1HRI3 1SACA 2WT2A 1EAH2 4LLOA 2DFBA 4QB1A 2A3WA 2XL9A 4QAWA 3L9JT 1ULGA 3NL1A 4B7EA 3MICA 3JXSA 1JN2P 3OJBA 4ZONA 5JIUA 2VQTA 3BB6A 1XXNA 1GYKA 1O8SA 1Q8OA 3AP5A 2AYHA 4FQ4A 4YM1A 2HJIA 4DQAA 4OQ8A 2A7AA 1LECA 1DGWX 4Y4YA 4Q0SA 1ND3C 2GP3A 1S0DA 1ENQA 2CGOA 3KT7A 3A0KA 2VCAA 2Z69A 1N3PA 4YG0A 4BQ5A 4HVQA 1BMV1 3VDDB 1V9U2 3N4MA 5IAXA 2YC2A 5JPNB 4OUSA 1XE0A 3R0RA 1CX1A 1PNFA 4AEDC 1Q5OA 4F83A 4XF0A 1VRH3 3MPPG 2JDPA 2VECA 4CEYC 1H4HA 5FLHA 4YVWB 4URAA 5DAWA 1ZZCA 2GNBA 1R093 1T2XA 1ZZ9A 2VULA 2LROA 4OHVA 5FMOS 5HXVA 4PT6A 1TMF3 4YVSB 3O1SA 1RGSA 4BA6A 1MS5A 5A32A 1HJGA 4CDXC 5FUPA 4PHZA 4WZCA 2ZEXA 1VAKA 4C0BA 4B7KA 2WNUC 1XNTA 1MEC3 1O4TA 2JD9A 2JJ6A 1R64A 4XF3A 3HT1A 4E4ZA 4P14A 3RVHA 5KWRA 2WBKA 3EMRA 1AR91 2EIEA 4OVEA 1LB2A 3BPZA 4HXCA 3CKHA 4K8RB 1DQ5A 1V6JA 2BQPA 2XKPA 3MGUA 4OI2A 1GICA 4OMDA 3IPVB 2YGLA 2ZS6B 4CCCA 1GQPA 3IDCB 5LBCA 3MDPA 3AKPA 3JB4C 2G4IA 2BERA 1UYZA 1PHMA 5FYBA 5JXJA 2JDUA 3LD8A 1HXS1 2J22A 5JOZA 1KQRA 2P1BA 2ZX4A 4XQ4A 3LDRA 4MXWB 4F7ZA 1MQTC 2WNOA 1LULA 2JKBA 4FPJA 3PVEA 4PLMA 5EZWA 5TSWA 4TXWA 2YGMA 3HMYA 2ZEYA 1SPPA 5EJ3A 1K5MC 1KDKA 4AQ2A 3WW2A 2GC3A 1C4RA 4JC1A 4A45A 1O3SA 4LO4B 4MGSA 2HWE2 1G9CA 1S2KA 1JZ8A 4QU2A 4A7YA 1AXZA 3DXTA 2GMPA 3H1MA 3OGRA 3T2TA 5LK5A 3ZN6A 3ZR5A 4E9KA 5L7OA 5DDJ3 1NCQC 1AR63 2WO2A 3CBNA 3OPZA 4MXVA 4Q4W2 5GLZA 3J9SA 4DY5A 2E53A 5FZEA 2VMFA 1QJFA 2QZ2A 3VBSA 5E89A 5GZDA 3VD3A 4DUXA 1E5RA 3HD8B 1A6CA 5E8AA 4CDWB 1F5FA 5J7MA 3FJSA 5BY5A 4FBFA 4RFT0 5FY9A 1W3XA 4XJWA 1RUC2 1E57A 2GP5A 1JI6A 2P6HA 4Z2AA 4Q8KA 2VO5A 4L92A 4LXLA 4NIDA 3ILFA 2WZR2 3N35A 4MYEA 1RUH2 4XF4A 1PO22 1LGCA 1RUG1 2RJ2A 4AG4A 4XYXA 4NVPA 4UW6A 1JYNA 2Y6GA 4QPIB 1COV1 2QDRA 2D44A 2OQ7A 5CG9A 4LHSA 1RUD1 2RHPA 4LKSA 1HRI1 1KGYA 5A3NA 3WVJA 3FLRA 4MSVA 4QD2A 3UYJA 1UCXA 3I54A 1LOFC 4AE2A 1JHJA 1UPIA 5FOBB 2JE8A 2HWC3 2WO7A 4LKDA 4GKYA 4YYOA 1R1A2 4CCDA 3LFMA 2VL4A 3K2OA 1Y43B 1H1MA 5EWSA 5IW0A 3A23A 1IG3A 5DZGA 3PVBB 1W2NA 2WABA 2BVBA 1KFUL 1NLRA 1ND3A 4W6XA 5IJRA 4NOTA 3M3QA 4L9BA 1B35B 1OF4A 3WSOA 1QQP1 4NIGA 2XJPA 5ANQA 4CA9A 1W06A 3UESA 4IEWA 3WT3A 4AQ6A 4KU8A 3W59A 2VZSA 4DEVA 1QIQA 4SLIA 5FYMA 1VRH1 3KV6A 5BNPB 1VBD3 1HV0A 4HPKB 4AEDA 2Y60A 4D7SA 4DPNA 4CEYA 4FFIA 1H8TC 2EXHA 1U12A 1UNBA 3OSDA 5FY1A 4GMP1 5KXEA 1AR62 1SG3A 1TMF1 1XYOA 4AI9A 3AP9A 2B46X 5D8AB 2WQZC 1O59A 4CDXA 2HWD3 4AYUA 2BP6A 3ZN4A 4IEXA 3W21A 2WNUA 4MLOA 1UU4A 2IZWA 4WM8C 2EAAA 5FZ8A 1XSRA 3IBMA 4NHMA 2OKXA 4BXSV 2XVLA 4I0BA 3WNOA 1GV9A 1VE0A 1I6XA 3ZLIA 1PGL2 1JOJA 3NAPC 1NG0A 1NLSA 2PHFA 1X82A 4E4HA 5FXZA 3V0AA 2AREA 4YW7A 5KC5A 4AHZA 4I2OA 3OPWA 3MV11 1RL3A 2Y6HA 1LJ7A 2E9QA 1F4AA 2CWSA 2XKOA 4GB32 2A1XA 4RHV2 5EJ1B 1WCUA 3POFA 3LWCA 3H3LA 3O1TA 2BRTA 1K5MA 2PLV3 5CZKA 2OT7A 1S0EA 1X9TA 2V4AA 3JBG2 1NX9A 4O61A 4W65A 4GIQA 4CP0A 2GDFA 3KF5A 2ZA9A 5FUNA 2CTVA 5KHGA 3FFZA 5DDJ1 4COYA 3H8UA 3GZTB 3IDEA 3K4ZA 3KMHA 5FP3A 5BUVA 3THCA 1IKQA 1HV1A 3HPNA 1Y9MA 2A6VA 2B8MA 2PHTA 3NJXA 2IVJA 2VTXJ 3TN93 5LBFA 4AFMA 1D4M1 4IEPA 4ZS2A 4CUGA 1H2LA 4E4DX 3UKVA 3GCWA 5AVPA 3C7FA 1W6MA 4IETA 4IEVA 3I2FA 4AGRA 3O1OA 3HWJA 1ST8A 2ZJCA 1F4HA 1FAYA 4XCBA 5LEKA 3BIEA 2OX0A 1PGW1 1OVPA 2JKXA 5DAPA 3H8OA 2XL7A 1C8M2 4UXAA 5LA0A 4Y1YA 2D3SA 1YFYA 2GH2A 2WAAA 1S0FA 2XQRA 1LOFA 5C8CB 1JU4A 1YI9A 3AYCA 4ARXA 4IV3C 1STMA 1XC6A 3FWEA 4QDSA 4A4AA 4E2SA 2XJTA 4GJZA 4UF0A 3UGGA 4HBNA 4CDQB 1SHWB 3LZZA 4Q4X2 3N9OA 4XEZA 1AYM2 1G8WA 4YFZA 2W92A 3ZSJA 3VD9A 5LY2A 4DRRA 1N1SA 1RUE2 2AR6A 3POGA 4HETA 2PAEA 4BU2A 2CL2A 5IATA 4XF1A 5FYTA 2XJUA 3Q8CA 1X50A 4AI3A 4CCKA 5T5JA 5FO9B 3V0BA 1GOGA 1CAUA 2A5ZA 1RUI2 4BM8A 2PQQA 4Q1PA 1HIXA 2X5IC 1CD3G 3DEMA 1VBD1 4LK7A 1C1LA 3D0JA 3WOGA 4QX3A 1EUUA 3JD72 3RG0A 2YV8A 2ET7A 5ABJB 1H8TA 3LB9A 5C9AB 3HQRA 3LDBA 2VW1A 4Y24A 2DVAA 3VHPA 4CEWB 4Q5OA 4CP2A 1WD4A 4YG6A 1CAVB 5F3EA 4B29A 1I5ZA 1RHI1 2VXJA 4N43C 2RMU2 1OVSA 1WW6A 2CU5A 3D0SA 1BK0A 1RMU3 2QQVA 2W1QA 3NWKA 4M4PA 4PLNA 5BNOB 5FMCA 4WM8A 1Y9GA 5LA1A 3WDYA 3BN6A 2NQYA 2HWB3 4KWKA 1BXHA 1ULDA 1DU3D 1NQDA 3HN1A 1QJX3 3FFQA 3AMHA 5C8WA 3NAPA 4M3CB 3VD7A 1GP6A 3NJYA 4P00B 1CIYA 3HJRA 5FZCA 4ZXEA 1ZBA2 4AVTA 3CLPA 1L7LA 3WNXA 4FO9A 2XWJB 3AP4A 3N9PA 2EXJA 4A7ZA 5LB6A 4MV2A 5C3PA 4XAAA 3VZNA 1VBC3 1LHOA 1W8HA 4D7YA 4G3YC 2PLV1 2MNGA 2RS32 2Z2SB 4FT8A 4NAOA 1FMD3 3S6PA 2EIDA 3I49A 3HR9A 1AR82 2IFRA 2X29A 5IAVA 1SLAA 3AXEA 5LRRA 4RGAA 3KHCA 2YU1A 4C8DA 2JG8C 4LE3A 1SLIA 1EAH3 1W39A 3LSEA 1PIV2 5FYSA 1REFA 3AL5A 2PHDA 2DBIA 3OY8A 2PELA 5T5OA 2E32A 3MI8A 1CN1A 5C70A 2R16A 1CAWA 3DF0A 2ZHLA 4FOQA 2ID4A 4MVTA 1RC6A 2VTXA 3WUDA 4TYSA 2FZ1A 4LO8A 2RDRA 5F6KA 5CFDC 3D8CA 2D7FA 5CNAA 1FI2A 3VUOA 1WW7A 4X6QB 1JZ5A 1V9U3 2ZXQA 4CUAA 3DGTA 1UX7A 2OPKA 1W04A 1H8VA 1A8MA 4QXKA 1R092 2HEYF 1AYN2 4GWIA 1BLZA 1RUJ2 2LRPA 2DUQA 2J1EA 3O0VA 2WUHA 1Q8SA 2QNKA 2A3XA 3RZGA 4I3GA 2IXIA 4YZ4A 4IV1C 4MADA 2MPFA 1AR72 1PZ8A 5K9YA 1MEC2 2VMCA 4IV3A 2K46A 2WRAA 4D94A 5FZ0A 3K48A 4META 3KV5A 5K4LA 4K21A 3SKVA 2GZWA 2XH6A 1Q56A 4OHWA 3ACIA 4QKDA 2DVDA 3FE5A 1GZTA 5A32B 4FXGB 4Q0QA 1QNWA 2ES3A 1OI6A 1CGPA 3ALQA 4QQHA 5CFCC 4LHLA 2R062 1W28A 5FK8A 5DPNA 5CISA 3LFIA 2XBO2 2EICA 2WFPA 1AX0A 4S2GA 5LBBA 3VBOC 2X5IA 1L7QA 2PN5A 1C3HA 4UI9L 1HQNA 3RZJA 5ERLA 5DUWA 4KG0A 2YXSA 2E51A 2W2IA 3UKTA 5KHJA 5LRSA 3DYPA 2C1FA 3RDIA 2AUYA 3T2QA 4UWDA 4FPKA 2BFUS 2OW4A 5J09A 3NMBA 4L8QA 3ZYIB 2EXIA 3SXWA 4DINB 1RMU1 2V73A 1Y7BA 4N43A 4AGGA 1VRBA 1ZREA 2JB4A 3G6JB 4FP3A 4UW4A 3DUIA 1SBDA 5FZIA 2E33A 1PK6C 1OLME 4D6SA 2HWE3 2VNRA 4WVVA 4EN7B 5IVBA 2DCJA 1SPPB 3WNNA 5JZGC 4AVSA 3L2HA 1ZZ7A 1QJX1 3VZLA 2C26A 4RN5A 5GM0A 2PYTA 2JICA 1VALA 4YGCA 2JDAA 2QQOA 3UETA 3WINE 3ZN6B 5L7OB 1ENSA 2JDNA 5I91A 1X7NA 1QEXA 2QJVA 3FHIB 3ZXEA 5F3GA 1H9PA 1PVXA 2DTYA 3OGGA 3VBSB 4BDVB 1W8UA 1RUC3 1VBC1 2JENA 5HBAA 4GD4A 3N9NA 4KNCA 5DG1A 4IQPA 4R8HA 2WZR3 5C3RA 3U10A 1PO23 1QOOA 2ZBJA 3KM5A 4GQ7A 2GNDA 4IESA 1FMD1 1POQA 5ISLA 1SMVA 2IFWA 2JG9B 1DYOA 3EJKA 1GP4A 4AWDA 1GFF2 4CDUC 5JMCA 1CZSA 2VR4A 5H9SA 5IK4A 1AJOA 4MGIE 4XFFA 2C9KA 3SKJE 1W0PA 2JG8A 2ZGSA 4B4QA 5F9TA 4XFIA 1T6GC 2KA3A 3DN7A 2XLGA 1OSGA 2FDHA 1E5SA 4QHOA 2B4KA 2LM3A 3O1PA 1O3QA 2IXCA 4JTOA 3U4SA 2A75A 2LW8A 3ZXJA 2HWF2 5CFDA 3KWVA 4IEUA 5FTTC 2AGSA 1V9U1 2Q5TA 2VQ0A 1XYNA 2BTVC 3WF0A 4A42A 3PU8A 4CCNA 4OI4A 1G9DA 3ZFFC 3BPSA 1AXYA 1Q8PA 1ND3B 3I97A 5DG2A 4L0PA 2WNVC 3B5LB 5FOJB 2CDOA 3I2KA 4HKWA 1Z78A 4V1PA 4XJ9A 1MS3A 2MEV3 3EHKA 3LPGA 2HWD2 4IV1A 1CWPA 1V0AA 4AEDB 4QM9A 3SISA 1OLRA 2UY8A 4NAMA 1ZM1A 4YLZA 1EPWA 3NNMA 4MGQA 4CEYB 2J42A 1YWKA 4QPGB 5LY1A 1KXGA 2VU9A 2Y6FA 2PMWB 2FMDA 1TG7A 3KV9A 4YW3A 3WV6A 4HL0A 3VKLA 2B42B 2C9AA 2D97A 3B94A 4HK9A 4HMZA 2W46A 2WQ4A 2OUJA 4XUOA 3WDUA 5LEJA 4AVAA 1VP6A 5FZAA 5DUVA 2WNUB 5BNNB 4IE4A 4LHNA 5CFCA 1VLNA 1VMJA 4OHXA 3WY6A 5FPAA 3CF6E 3S5QA 1UIKA 3FL7A 2YPJA 2PA7A 3VBOA 1TME2 4COZA 3IWZA 3USUA 1W2OA 3ZFEC 2JIJA 4JQTA 1RITA 3VKMA 4BQ4A 4Z1VA 4AHWA 1JUIA 3PUQA 3V0AB 4GB33 5JDBA 4RHV3 3T4VA 2VMGA 3WP5A 3RYKA 4CU8A 3PURA 2ZGNA 4NE9A 2ZMLA 2OA2A 3ON7A 1MQTB 3JBG3 1QDOA 1OA4A 2HWE1 3OCPA 4PDWC 4NIAA 4AAPA 1PK6A 2QFEA 1JZ7A 2WDBA 2XR4A 1DLCA 4YRDA 4DS0A 2J1VA 1K5MB 5CKNA 5JZGA 2CAUA 5FY0A 3AKRA 1H1IA 2C6SA 3BUCA 2PHWA 4JDMA 4Q4W1 2CV6A 4EE2A 4Z82A 3ZKUA 2WZEA 4DY3A 1VJ2A 1BCXA 4J25A 1YQCA 3CNAA 4CU6A 1NCQB 1QJU3 3RZMA 3AFKA 3VGIA 4I01A 1RUC1 3VDAA 2G9GA 4FPEA 1W8WA 4J6GA 5F5CA 2WZR1 3QH6A 4XVHA 1RUH1 2W3JA 1PO21 2JE7A 5JR7B 3WW3A 3WNPA 1EV11 3VDBA 2BFUL 2O8OA 5CU1A 2WFF1 3MF9A 4IEZA 1O91A 3WF1A 1IQAA 4COVA 4YPJA 4IE5A 1LHVA 5IVYA 4CDUA 3BTYA 2FDIA 4WM7C 1UPSA 1C8M3 3LEIA 2A6YA 2RM22 3D5OA 5L19A 3ZN5A 2VUDA 1UZZA 2WZPP 2YHJA 3POBA 4UBGA 1OURA 3WZ1A 2IUWA 1UOJA 4H7LA 2Q30A 3VD4A 3LA2A 1R1A1 4XFAA 3WNLA 4NHXA 3IT8A 3Q8EA 2Z79A 5FQ0B 4A6OA 3A21A 4BCUA 4DXZA 4Q4X3 3POIA 1AYM3 4KGQA 2V4VA 4N53C 3M2MA 3WQ0A 4UT5A 1RUE3 4UF0B 1XU2A 2GN7A 2W95A 3KHBA 3OPTA 4EN0A 1FX5A 4BZ4A 4QPYA 1OH3A 2ET1A 3AXDA 3I3QA 2J1SA 1G86A 3NNJA 1RUI3 4XBLA 3ZFFA 1WCDJ 1UZ0A 2XMLA 2BBAA 4LR4A 2WNVA 3JD73 5DZFA 3U78A 3V0BB 1CAUB 1CESA 1RTVA 4NWVA 2WT0A 4KMQA 5J98B 3OGJA 1D0HA 3H1WA 2OQ6A 3AYEA 4EQVA 3MZHA 3DECA 1PM4A 5A3TA 1YUDA 4YGDA 4TN7A 3WDXA 2VVFA 3I3BA 2XHKA 1H8TB 4ZHNA 2RMU3 4OLLA 3PUIA 4ZZ8A 3OTFA 2I07B 2P17A 5C3SA 3ES4A 3VLBB 3RZLA 2RS53 4Q4Y2 1UOFA 2PAKA 2VOTA 4KWUA 3VBFC 3E5QA 2ZX2A 5FIXA 3SEPA 4N90A 4WVMB 1IZ3A 5J48A 4LT5A 1PGL1 2R7EB 4WM8B 1UWWA 4Y4RA 4F8AA 2NZ9A 5GLWA 5A3LA 5M0TA 1WMXA 2E7QA 5H9QA 2Q0AA 3T09A 2R042 2GSYA 2VG9A 1DYKA 1ZBA3 2WO3A 5LK7B 4K9SA 3ZFEA 4XDOA 4OZOA 3NAPB 4HSLA 4GB31 4RHV1 4XJUA 2C24A 2Y6KA 3AYAA 3PL0A 1YJLA 2DTWA 3I2IA 2XG3A 2JDYA 2IXJA 3KD4A 3VZOA 4LBLA 2RS33 1SLCA 3CQOA 5GZGA 1NE4A 2BYVE 1TE1B 3JBG1 2G1MA 3FUOA 2Y6JA 1AR83 3VZKA 1S0GA 1W8FA 4PDWA 1S0JA 2XLAA 4UBHA 2Y8KA 3I3DA 3MW3A 5FZ1A 4P9LA 4OCTA 1RUNA 3N7MA 3R05A 3IB3A 3VBUC 3O5SA 3CDZB 4A3XA 1PIV3 4NROA 4YARA 2LTNA 5I0RA 1U5IA 1QF3A 3M4FA 3ZXFA 4AEKA 4QX5A 1ENXA 5FKBA 3ZPOA 4QGNA 4BQ1A 2XJQA 1AJKA 5JWPA 1MS4A 1DLLA 5SV8A 4CU9A 4XQDA 4AVBA 4CP9A 1DYPA 1MZEA 3UJOA 3ZSEA 3SCHA 1JZ6A 1H0BA 1SFPA 2OS2A 1HN1A 1RVF2 2P5BA 2QKDA 2ZABA 1UD1A 1ODMA 1ONAA 2D6KA 3GCXA 4I3PA 3TWIA 3AP6A 1ZZBA 2QQMA 3I7DA 5FREA 5L36A 2BUKA 4WM7A 4EN8B 1ZRFA 1AYN3 1US3A 1RUJ3 5I0TA 5CB7A 4DMIA 3DXUA 3PMSA 1HRV2 4UW3A 1WCQA 3VBRC 3W9AA 4PF1A 2DFCA 4DUVA 1AR73 2XLFA 1WMFA 3IIIA 1NA1C 3JQXA 3ILRA 1KEXA 2JDZA 1JU3A 1MPXA 3SH3A 1XNKA 2XONA 4PQQA 3IN9A 4LKFA 1AYM1 4Q4X1 4QX2A 2IXKA 4AR2A 1NY72 1RUE1 4N53A 4Q4V2 2PQSA 4IGOA 3RGBA 3GZAA 3WNKA 2NP0A 2CAVA 3TAYA 1DBNA 4XJAA 2P3IA 4XMAA 2P3JA 2R063 4PI0A 2NMNA 2XBO3 3RJRA 4CCLA 1RB8G 3Q9OA 1ZX5A 1RINA 1URXA 4K20A 4YM0A 2E63A 3VKFC 5FK7A 1XOYA 3NRUA 3AB0A 1GNZA 2X5IB 2R0FA 3CZUA 4QX8A 4TLFA 3WG3A 4CPBA 1UKRA 2V09A 3JZVA 1LOGA 1SBFA 2RMU1 2ARBA 5CKMA 3WP4A 4BE3A 1PMIA 1LOBA 2VXRA 4MHRA 1JTZX 4ZZ5A 5T52A 4RGKA 4ZY9A 4RFRB 3KVAA 4I0WB 1VBB2 4QB2A 3ELNA 3DYOA 3BGAA 2R49A 5JIAA 3V64A 1ZZ8A 4N43B 1J58A 5A3MA 1YCIA 1RYYA 1DGLA 1RJ7A 4XC9A 1X8EA 4H55A 1W8TA 2F4PA 3IZOA 3ZIWA 3ZXLA 5KC6A 2WC2A 3RZKA 2YBSA 1MS0A 1QOTA 1U5ZA 1ZRRA 3LA7A 5A6XA 4O9EA 1ZBA1 4OZXA 1FXZA 4N7UA 4YW4A 3JQWA 1GUIA 4ET7A 3OOXA 1JYTA 2BNNA 4N7IA 1AF9A 1XRUA 2DU1A 3OYWB 2BPA2 2W1UA 2CYFA 2WYFA 4AI1A 4D6RA 3WF3A 1LEMA 2RS31 5FMDA 1AL0G 2N7GA 2VVDA 1WGPA 3DPRC 5DUUA 1AR81 4XACA 4AW7A 4FTSA 5FZHA 4PCRA 3P1IA 2VOWA 2WKKA 3LDKA 3LOIA 4O9GA 2YROA 4EJRA 4CUBA 3U1XA 3VBUA 1PIV1 1N1TA 3EBRA 3I3EA 5HCHA 4R52A 2JG8B 4Q26A 4KU7A 3ZMNA 4BYYA 1LTEA 1L7RA 1JS9A 5F1RA 3HAGA 1H6XA 2HWF3 4XUQA 3AVRA 3WHUA 2UWBA 1SDWA 2BBVA 2Q4SA 2MEV2 1R091 3B69A 2QTWB 1AYN1 5CFDB 1RUJ1 2I45A 2UWCA 1DQ6A 3NSTA 4GXLA 1JYIA 3B3QE 3T0BA 4XDPA 3ZO0B 3HN3A 1NZIA 1AR71 4DB5A 3VBRA 5F3CA 2YB7A 1MEC1 5I0UA 1NA1A 2VNGA 1ZRIA 1M4WA 3JUUA 5FMBA 3I2GA 4X6RB 1RIRA 5A3OA 2CNAA 5HCBA 4IV1B 1LOAA 4K1YA 3GYDA 4OMCA 3I59A 1QJZA 5FPZA 5KHKA 2JE9A 5E1RA 1WLDA 2ETEA 4XAEA 4CTEA 2O14A 2XVKA 3I3MA 1DGRN 5B4XA 1O8PA 3UJQA 1A34A 2FDFA 4XZUG 4ISQA 3MUY1 2ZKLA 2ARAA 4O65A 2HH9A 3RZZA 3DKWA 3PLQA 3PMEA 4BIOA 2VE1A 5FXVA 4QXCA 4XUPA 4BMEA 3BIWE 1TME3 4CCEA 1AL23 2IC1A 1KFXL 1YJKA 4YM3A 1UYXA 4XE9A 4FPFA 1VAVA 5CFCB 4JTNA 4NN0A 1IS4A 1W6NA 2DVFA 3AM2A 2FMYA 4XXAA 5FV3A 4AQSA 4DNYA 3VBOB 3HEIA 1W2UA 3USUB 4CXYA 1XE7A 1DIWA 1PX4A 1WMEA 1DQ0A 2GC2A 5I0DA 3GDBA 4LO5B 1UMIA 3THDA 2O1QA 1C8NA 3SH5A 3D4KA 1AR61 3GM8A 2JXAA 4JGZC 2HKXA 4TSVA 5FWEA 1CONA 5CVRA 2YFUA 3TEXA 4WVZA 4S2HA 1SFYA 1DGWA 5FYYA 3WDWA 1J59A 4Q0PA 3ZYRA 3WX5A 5IVFA 3O0XA 5J3UA 1QJU2 1IS6A 1C28A 1PK6B 5FXXA 5I0SA 1PMJX 5JZGB 1JH5A 1APNA 1IPKA 4OI1A 3ATGA 1OXCA 1AUYA 1CR7A 1SQ4A 1RXFA 2VW0A 2Y0OA 1O3RA 3AP7A 1QDCA 2PXJA 4KL1A 4GH4C 3RRDA 4DXRA 4GZ9A 2OYZA 4K8FA 1UX6A 3ZR6A 3AKQA 4QGMA 2UU8A 1V6OA 3DPRA 4FOWA 5IFPA 1F8VA 4M0HA 1W9WA 2HWC1 4PQ9A 1PVC2 2BJSA 1WMDA 3TEWA 2GNTA 2RM23 4QX7A 1JXNA 2W47A 3S30A 1GBGA 4BJ0A 4MHUA 3C7EA 3WG4A 3AMPA 3W20A 4PIXA 4LBQB 5HPOA 4CDUB 2VZPA 3A7QA 2OVUA 5F5IA 1CVNA 2B9UA 2RJLA 1RUF2 4I02A 1V6IA 3ZYGA 1VPHA 2ZGQA 3B93A 1UY0A 4NMIA 3ZM8A 4DOUA 2KXLA 4XPVA 2G19A 2UYAA 2WSUA 4EZ4A 3S5AA 3AZVA 3LGRA 3MLKA 1LR5A 2HWF1 1HB3A 2PAMA 1Q43A 3A22A 4XXPA 1PGSA 3NW4A 4JHTA 3X29B 2JECA 4ATFA 1QNYA 1WZXA 4EZHA 1OA3A 4FPCA 4YZ2A 1W6QA 1MACA 3T1MA 4ES8A 1IS5A 4D8MA 4IE0A 3I2HA 4QX1A 5JI9A 1UMHA 4B1MA 1CAXB 2OXBA 4LPLA 2DF7A 2P6CA 3O1RA 4X8NA 2EF6A 2QE3A 3ZIXA 2PTMA 2HWD1 4XIKA 1ZBE2 3ZFFB 5F5AA 4FSJA 3L2YA 4ORFA 4NUBA 2WNVB 2BDRA 4IEYA 4OFGA 3KT4A 2RS52 5T50A 4KGGA 1DQ4A 4C90A 1YYNA 2QQIA 3GJBA 4BMBA 3UV9A 1V6LA 5DABA 2IXLA 4U36A 2VOXA 1F5JA 2WQ8A 4Q4Y3 1D2QA 1KJLA 4P9WA 4JZRA 1WD3A 3BOWA 1O4ZA 3POWA 3APBA 2ILMA 4GKXA 4NWWA 2ADEA 3FHQA 2VUCA 2Q8EA 5I8TA 5KXBA 4AF9A 2P2KA 2E7AA 3MBWA 1KDMA 1HQLA 1FPN2 3RWKX 3H3UA 1TME1 3B01A 3MIDA 5A7WA 5FPUA 1EPZA 2R043 2JD4A 4SBVA 3P3NA 2KD7A 3POEA 1BQPA 2VMDA 4FPLA 2RG4A 1FYUA 5DUXA 4YW6A 1ASJ2 4COUA 1WBLA 2DBNA 1UO9A 3QOPA 3PUAA 1JW6A 1CQ9A 3D82A 5KHIA 4COWA 1DDLA 3ZFEB 4Q8LA 2K2SA 3THPA 2LUWA 5A33A 3RFRA 4FFFA 4W8JA 3VDCA 3ST7A 2D3PA 4JGZA 2DVBA 1PM7A 4CSWA 2CWMA 1YC61 5BYNA 3SMHA 3BTAA 3WEZA 3AMNA 3ZYJB 5A70A 3GGLA 5CEHA 3TN91 3FBMA 4PDWB 1COV2 2OZJA 5JR2A 3RSJA 3M7AA 2YYOA 3ABZA 3ZKYA 4XURA 4WBBA 3SLIA 4EV0A 4ITCA 2XOMA 1Y9QA 2EIBA 2ZGUA 1X36A 2E31A 4FPHA 3T3YA 1HKDA 2QQWA 3E6BA 2DCYA 4GH4A 1HB1A 4IW3A 4QQLA 4A7KA 1N47A 2D5HA 1WLCA 1RVF3 1D0GA 1NT0A 3K4AA 4NPMA 5IVEA 5JLVA 3U07A 4XUNA 1OMIA 4CP9B 5BNPC 2JX9A 2RS13 1QQP2 3GHMA 3A4UA 5APAA 2ERFA 2R6QA 3LKJA 1OLMA 1UMZA 1HRV3 3VB9A 5FPVA 4JVAA 4N9IA 1SLBA 5ACA2 4AFCA 1O5UA 1Q8QA 4Y26A 4Y5SA 4KBZA 3ZOIA 2WNEA 4LORA 3AMMA 2GC1A 4WM7B 2Q8DA 5D8AC 4YVSA 3PJYA 3CIHA 2V72A 3K4DA 5G05L 2VH9A 5A3WA 4KBBA 1W8OA 1WWYA 2VOKA 3GXUA 5CADA 1YRZA 2GU9A 1YNAA 3NNGA 1TEIA 4Q4V3 4ATEA 3BYWA 1J3PA 2NMOA 2Y34A 3ACGA 5AVAA 4AHYA 2VZQA 3NQHA 1VBE2 4QHZA 3U75A 4EWDA 2XQXA 4N53B 3B02A 5F2SA 3ACHA 4HANA 4PF5A 1GZ9A 3M70A 1CX4A 2QQUA 4AEMA 4B1LA 5C3OA 2A6WA 4DEQA 3KSCA 1GWMA 3WP3A 3N9MA 2HYXA 2AEZA 3OBRA 2BGPA 4B4PA 3TYJA 2FDJA 3D3AA 3U0ZA 4MXWA 1SBEA 4UFLA 4WV8A 2AACA 4UFJA 1G6NA 3HT2A 3ZFGC 1GQHA 1E5HA 3OUHA 3O1UA 1MS8A 1W9FA 4XOGA 1DQ1A 2FCTA 4NPLA 1ZZ6A 3LF7A 3RMXA 2HWB1 5L9VA 4XMIA 2WL1A 2XPJA 2P34A 4RR3C 1JODA 4YW1A 2H6BA 3BU7A 3UK9A 2YG0A 3MW4A 5A3PA 5HXMA 1YI7A 5LATA 1VBB3 3O1VA 3G7DA 3U14A 3SNMA 2WN3A 4NPRA 3SC7X 2YBPA 2BGOA 5DAQA 2EVXA 4NR1A 5FYUA 4ISRA 3RYPA 3VBFB 4AFBA 4FAHA 5JOYA 1T6BX 2JWPA 4QKNA 3LOBA 5AC92 1FNZA 1W0OA 2WSVA 2WT1A 4P9GA 5BPXA 4GMP0 5HCFA 2XDVA 1WA6X 4W50A 3NJVA 5JXHA 4EWEA 3KGZA 1CIWA 4Y22A 2J1RA 5KBFA 4CYDA 1UY2A 3NJZA 5JI7A 1XNAA 5GZFA 1EAH1 2C0ZA 3N9QA 4E2QA 1X8MA 1D4M2 3UGHA 1R082 3KCXA 1NCRC 1K45A 1SDDB 1YHFA 5K0UC 3S0MA 4HKOA 3PVOA 2FDGA 3GZEA 4IGPA 4NHLA 1XNBA 4E8DA 3RQ0A 1PZ7A 3AX4A 4I09A 1UU6A 5FP7A 4L99A 5FY5A 1QMJA 3LEGA 4NRMA 4U2AA 4Y1ZA 2R072 5JOXA 4LBQD 4LKEA 5JUVA 4LHKA 5BNQA 2JDKA 3MFCA 4AAXA 5CIRA 4ASLA 3MIEA 4LLFA 3VBUB 3R4UA 3ETPA 4AQTA 1GU3A 1ULPA 2XXZA 1XU1A 4P9XA 1WBFA 3F2ZA 4Y33A 3VHRA 4AOCA 4DUWA 2C5DA 2UY9A 4NRPA 4OUMA 5A7SA 1MVQA 2V5YA 1RVF1 3QLQA 4E27A 2X10A 1UIJA 2A6XA 2D93A 4OUEA 3WDTA 3W58A 5EPAA 2ADDA 1VB2A 3TOJA 2DYCA 3BVCA 5L9BA 1MZFA 2NYYA 1AX2A 3WW4A 4Y5TA 5BNPA 3HBKA 1HRV1 2VBBA 1IS3A 1PO13 5FY8A 3VHOA 1B09A 3ZXKA 1Q8VA 3J7MA 1J3RA 1UL9A 4BQYA 3HNMA 4YZ5A 4P02B 5D8AA 1LRHA 2ZGTA 4RSUA 5GLVA 4CDXB 1NY71 1OFNA 4UFKA 1QXRA 3VBRB 2HEWF 4ZU7A 1P8JA 4CE8A 4Q4V1 1I9RA 2WLPA 2XWBB 3EXUA 4M01A 2TEPA 3NV1A 1NA1B 4FPOB 2BNOA 4M3CF 1W90A 1H2KA 1SCSA 2W87A 4FFGA 3KCYA 3PDQA 2CGPA 4FTBA 1AL22 1NOVA 5EFUA 2NM1A 1LHWA 4ZU5A 1XQNA 1R1ZA 3BI3A 4P5HA 3BTZA 3N36A 5FZFA 4PIYA 2ZGKA 1LENA 2BZDA 2ZGRA 3JCIA 3LQCA 5FFOC 3T30A 1W6OA 1JZ4A 5FCCA 4AZZA 1XB9A 1K12A 1PZ9A 3AKTA 3KV4A 3ZFGA 2WO1A 1W6NB 3J7HA 5LW9A 2D6MA 2WS92 4RR3A 2BU9A 4C1WA 4DO0A 3E5XA 1VBB1 4CZSA 1WLWA 4UOJA 2YC0A 1JOBA 1GNYA 3WG1A 4JKLA 1QH7A 4IEOA 1O7FA 4Z92B 1GZWA 1EUTA 2WJSA 2D6LX 1N3OA 4Q27A 2ZHKA 3AMQA 4V2WA 2MHFA 4Y20A 5H9PA 1S1AA 5EV7A 3WF2A 3EQEA 1HX6A 4HONA 1BVVA 2DU0A 4PBOA 5LCWL 3ACFA 1LESA 2NPIA 2CSGA 2ZX1A 4LIVA 3AJYA 1DQ2A 1W6MB 4BWOA 3ECQA 2Q8CA 3THTA 2AENA 4FQZA 2RR12 3ENRA 2XUEA 3FLTA 5A1AA 1ND2C 2WWUA 3O7OA 2FZ2A 2D98A 3MFAA 3VL8A 4GWJA 1PVC3 2YU2A 1KRIA 2J1UA 1NCRA 2XGXA 3AL6A 1GLHA 2VD7A 5K0UA 4FCAA 4LBJA 1KS4A 3DPRB 1DZTA 3HBZA 5FBJA 3UT0A 1LOEA 2ZEZA 5FZLA 4NO4A 2BV4A 1RUF3 3RI8A 4KWLA 1BKZA 3VD5A 1OOPC 4QKFA 4R9BA 3OB8A 2UURA 3SHRA 4BIFA 4CCMA 1N3QA 5FPLA 3NVCA 4KI5M 1UY4A 1LGBA 4MGZE 4LEJA 1LHNA 5T54A 2Q1FA 3WXPA 1BZWA 2J7MA 3CJIC 5F39A 1VMHA 3OD0A 4X8PA 3SCGA 5L73A 1DZRA 5A7PA 2MEV1 4LULA 5DQ0A 2W94A 2VW2A 4R4ZA 2C4XA 3R6SA 1H2NA 1AR93 1GQGA 3PIJA 3GNEA 4BQXA 4BB3A 2P3YA 5EJZB 4MGKE 1C5HA 1W6QB 1TVGA 2DUPA 4BK4A 1G9BA 1ZBE3 1X9PA 2YY1A 2Z42A 3K51A 3Q8AA 1XE8A 5A1FA 1ULOA 4KG8A 5DXDA 3M3CA 3T2PA 2W5FA 1J1TA 2YDEA 3N9LA 1NLQA 3MIHA 1SLLA 1MS1A 3J8F2 3VKOA 3H1YA 4RS5C 5HI0A 2OUHA 5C71A 1VBA2 3WUCA 1H6YA 4RGGA 4L11A 3DKQA 2ARCA 2EIGA 2XVGA 2PHXA 3GHNA 5JXIA 5KXDA 3T0AA 4YGEA 2WZ8A 1GR3A 3HNYM 1YQ2A 5GALA 4LA2A 1CZVA 2DDUA 4FXKB 3HOBA 1YLLA 5FLIA 1FPN3 2BVVA 2VC9A 2VZVA 4MGYE 5K7PA 3LSDA 1LHUA 1EP0A 3C2UA 2JIGA 3B00A 4B8EA 4HN1A 1DG6A 2ARXA 3J4UH 3OGSA 2ZZQA 4FTEA 4LMFA 2VJXA 3I2DA 4XCAA 5F8PA 5FDBA 1ASJ3 4QWNA 1WKYA 3TRSB 4OYUA 5A7WB 4NRQA 3AZZA 1YIPA 2FCVA 4MH0E 5EYYA 1J84A 4FP2A 1QY4A 2H0BA 2ZHMA 1W3VA 2JG9C 3PJQA 1CJPA 4INDA 3VL9A 3ZSLA 4QHBA 2IVIB 3RJ2X 3AZXA 1UZWA 2CDPA 4BLIA 4K3UA 2O8QA 3S7IA 1W6PA 3LCPA 5A33B 4QPWA 1AVBA 3ZMOA 2Z4FA 3HQUA 2VCCA 1QJU1 2D43A 2VUJA 4YWAA 1WCSA 4GULA 3RWNA 1COV3 3AJZA 1W8ZA 2VBDA 4LO7A 1DCSA 1Z0HA 1A78A 3PUHA 4FAGA 1D4VB 3OY8B 2H6CA 4QQPA 3ZDVA 4ASMB 3W5NA 1OA2A 1OHFA 1CAWB 4JCKA 4UFMA 4BISA 5DZEA 3OBTA 3MPBA 4Y1VA 1D2SA 5FXWA 4DZGA 4M3CE 5IK5A 1QOSA 3O12A 1LNSA 4AI2A 1C8M1 1Z7S2 5F2WA 3B9IA 1FNYA 1RJ8A 2WIIB 1ZNPA 2RS12 2ZMNA 3ZPYA 3TEYA 4XW3A 3W5MA 3K77A 1ND2A 1J3QA 1MVEA 1PVC1 4GH4B 4QQ2A 1V70A 2JB8A 5F32A 3SCFA 1UY3A 4P08A 2W91A 1QQP3 3LPFA 3ZXAC 4AL9A 5ACA3 3CEWA 4G4FA 1RUF1 1JHNA 1MS9A 3FUQA 4GALA 4CU7A 5C5TA 5J37A 4IV3B 3S7EA 5HV0A 1JYXA 4BPZA 4UFHA 1OOPA 4QPGC 5C4WC 3LIHA 4Z8BA 1D7PM 2HLEA 4GMP3 2DUOA 5EQUA 1RUI1 5HV4A 1SLTA 2TUNA 2ZHNA 4AGVA 3GZUC 1ENRA 5GZCA 3POSA 1OPOA 3MIGA 2HBTA 2BNMA 3CZJA 3EO6A 4W4ZA 3CJIA 1FV3A 3JD71 4R9AA 1VBE3 2A6ZA 5D2AA 4JDOA 1OUSA 3LE0A 5HCAA 4LK6A 4DXSA 1GOFA 2W68A 3MLLA 2E6VA 2VZRA 2ZAAA 2ZKNA 4JKKA 5EP9A 1DZQA 2XJRA 3I2OA 4LBOA 1OH4A 3QBQA 2R0HA 4QQOA 4H7MA 2VVEA 1UW8A 1ZBE1 3ILNA 1OKOA 2KM2A 3N7KA 2GC0A 5CG8A 4XUTA 1IPJA 4AVCA 2X8KA 5CKQA 4I30A 4QGLA 4YZ1A 3KGLA 2RS51 1GOHA 1LU2A 4XFHA 2VZTA 1TNRA 2CGNA 4LOTA 3SQOA 1IHMA 1OQ1A 1U5XA 4CCJA 4IEQA 1VR3A 1YFWA 3QCWA 4RS5A 4DRVA 4IE6A 1MZ6A 2QQPA 3ZYFA 1AZDA 3N7LA 3IAQA 2UYBA 5CAZA 3IKWA 1NUKA 3GF6A 5C7GA 5FJKA 3T08A 1MR5A 1CPMA 4NHKA 4XHBA 4YFWA 1FPN1 4D0QA 2QVSB 3H8RA 2Y6LA 5FKCA 5AC93 1K3IA 4UFIA 3OGVA 4GWNA 2FQPA 3KQ4B 4ZU4A 5IUQA 3IMMA 2LS6A 3MO4A 1ASJ1 3QACA 1EY2A 4LOSA 5F7UA 5EHDA 3S57A 4KH9A 3JB8A 2VGDA 1FOD2 3VKNA 2OIIA 2OZ6A 2B9VA 2RDSA 3SH4A 4MGTA 2AEYA 2A73B 3WCRA 1NE6A 2PFWA 4CRQA 5EYXA 2JG9A 1W2AX 1D4M3 1R083 2VZUA 3F95A 3OG2A 4Y22B 3ASIA 4YGBA 4K7JA 4FVVA 5FZOA 1EV12 2F6BA 3KS7A 3QD6A 4LQRA 2WFF2 2QCSB 4AK3A 3GBWA 5JPMB 4N8MA 5C33A 3H8XA 4JGYC 3RS6A 2R073 4QB6A 4QKBA 2W1SA 3MHZA 2EXKA 4AEJA 5T5PA 2CHHA 2DCZA 1WW4A 2OPWA 3P3PA 2WN2A 2B45X 4Q2FA 2DV9A 4URTA 2HBUA 1DFQA 3V65A 3WG2A 5FWJA 5JSPA 5JXGA 3O1MA 3H50A 1W99A 3NNFA 3ZX7A 1ULCA 5FR3A 5IFTA 2PHRA 1H9WA 3SEEA 3VBHC 2BWCA 2YC4A 3HQXA 1NKGA 3MIFA 2YZ4A 3M3OA 1BBT2 1OUXA 3ZYPA 2R30A 1PO12 3CU7A 3OUJA 4XBQA 3H3ZA 3I2JA 1LODA 3KQRA 1HDKA 4CXWA 2VOVA 3RMYA 3HIFA 3FX3A 4XZPA 4Y1UA 5I8YA 3MF6A 2JEMA 3LIGA 5ACA1 1LKNA 4L2NA 4V2VA 5FRAA 4JKMA 5A7QA 2RE9A 1YO8A 1QJEA 1XJAA 3K75B 3ZVXA 1AX1A 4IL7A 3TEZA 4LIUA 4P5YA 4QPGA 5BV6A 1NQJA 5C4WA 3VZJA 1OD5A 3OD4A 4QDQA 2PHLA 2R061 3I4IA 1YQ8A 4FOYA 2XBO1 2QUOA 4HK8A 1LOCA 3NKGA 3NO8A 4EN9B 1W9SA 2E7TA 1VBE1 2A3YA 1RHI3 2BW8A 1HLCA 2ZGOA 4PIZA 5FYHA 2QQJA 5BNNA 3AZWA 3OEBA 4RQPC 2WA3A 2AZ5A 2BEOA 3E6DA 1BJQA 1AHSA 5A6QA 1LEDA 3DYMA 5K8SA 2Y38A 5IK8A 2VQAA 3I8TA 1BEV2 5FZBA 2A71A 1ZYBA 5CA6A 4BQWA 5A1LA 1UAIA 5JVVA 1IOAA 1NZCA 4KWJA 1OC1A 1UOBA 2Y33A 1UF2C 1I3HA 2F4LA 2J1TA 2VNVA 4XFBA 3VZMA 2K9ZA 4AVVA 4HT1T 4YW2A 1GKBA 5FO8B 2G9ZA 1W6OB 3N3HA 3OF1A 4F3JA 1QJY2 3ZSMA 2WS93 4R9CA 1MQTA 1YQ6A 1OD3A 5FMOL 5LA2A 3POYA 5LBEA 3ZFGB 5FPBA 3BOPA 4UW5A 1O5LA 2RDQA 1QU0A 3BTXA 4G9SB 1VB4A 2Y0IA 1F2NA 1WA4A 4RR3B 1ZRDA 3PTRB 3OUIA 2VAUA 5EXOA 4HFSA 5JOWA 3IM0A 3C3VA 5I93A 1C5IA 5CYYA 4LA3A 5AC91 1POV0 5A80A 2QQLA 4MO3M 3U4XA 5CBLA 4LUKA 1ZRCA 4H2AA 5DMYA 2DCTA 3E1F1 1GZWB 5GLUA 5B2GB 1NCQA 5FZGA 3VDDC 1UQXA 5FO7B 2DVGA 2HEVF 1U0AA 4Y20B 4K6BA 1C1FA 1DF0A 4ARYA 1F15A 4FPGA 1F9KA 3BCWA 1FATA 1IG0A 1TQ5A 1UN1A 2ZX3A 5DN2A 5F37A 1GSLA 2RR13 3FN9A 4XJ8A 1R081 4A2UA 1BMV2 2O0OA 4YVWC 3FMGA 4XQWA 1OLQA 1JOPA 4CXXA 4J1WA 5JSRA 3ZXGA 4AI0A 4EWAA 1QH6A 3MV01 3HNBM 2ZTNA 4YVSC 4XFGA 2WYSA 4YZ3A 1ZA4A 2Q1ZB 1W9TA 1IQDC 1QWRA 4FFHA 2R071 1NCRB 1VMFA 4JGYA 5K0UB 3M8LA 3MW2A 2UWAA 3KVBA 3TB0A 5FQ0A 2YFZA 5B4NA 4HZFA 4ZXKA 3TBDA 3T2OA 2VZ3A 3A0NA 2BOJA 1GANA 1XPWA 1S0IA 4EYUA 4L97A 3POJA 2IXHA 4BH9A 2ENRA 2WR9A 4LBMA 4Y5Z0 1UXZA 1S4CA 4CP1A 4H14A 2W0XA 4HVOA 3VBHA 5JMOA 3RZHA 1AR92 3ES1A 1PNGA 3C8XA 4JRLA 1G9FA 3H42B 4JX0A 1JUHA 2G9FA 2SBAA 4RD7A 5J1XA 3WQ7A 2EALA 4D69A 4HG6B 3NV4A 3E6CC 2XB6C 2ZZJA 4GJYA 1IPSA 2D3RA 1H2MA 2YUEA 1S0CA 4XABA 4YM2A 2R32A 5IVVA 4ONUA 1HXS2 1PMHX 3URFA 2X05A 5FZ9A 2P4EA 5FZMA 4AHXA 4QT6A 1CZTA 3IIAA 4M00A 5J96B 3J8F3 3LEKA 4OHZA 4DFSA 2K0GA 3ITQA 3ZYHA 4IDZA 1CJDA 4HOOA 2VMEA 2RVAA 4HN0A 1VBA3 3IMNA 3GJAA 3FBYA 4M4RA 5IT6A 4Q29A 2B5HA 1AL21 3E97A 5FYZA 3ORJA 2I2SA 4WVMA 4PLOA 4CDWC 3T0DA 4WZFA 4RQPA 4ES9A 4QM8A 2VTFA 1A3KA 4GWMA 3AZYA 4R4XA 1HJFA 2AC1A 1U5YA 2XJVA 4QXBA 1FT9A 4BOWA 2H0VA 1V00A 4IE7A 5E16A 5FY4A 1YFUA 4Q0UA 4QPIC 4C0HA 4B4RA 1IKPA 3BALA 1AXKA 4IUGA 5L9RA 5A7NA 1RUG2 2WS91 4YW5A 2ZGMA 4CVUA 5A3UA 3FLPA 2ZGLA 4Z07A 1H1AA 4XTMA 3TNQA 5FYCA 1F35A 3EYPA 3IDBB 3K3NA 1SZBA 2P3KA 2X09A 4KQ7A 1RUD2 3FHAA 1NYWA 1ALYA 1HRI2 5JAXA 2ZACA 2W9XA 4BLJA 2D6NA 1C57A 3H9AA 5T5LA 3WLUA 2VBPA 4UAPA 3T1LA 1W6PB 2V5DA 3WNMA 5A6ZA 1YQ5A 1B35C 4JRAA 4QMAA 1PX3A 4MUVA 3C7OA 3VDDA 3OEAA 3DL3A 3ETQA 3PNAA 4LBKA 2GALA 4XHXA 1LCLA 1UKGA 1OKQA 1QKQA 1Z7S3 2RM21 1V6NA 2RR11 1QXPA 3Q8BA 1JYWA 1HB4A 5FZ4A 4YVWA 5AFEA 1YFXA 5D21A 1XNCA 2RDNA 2VY0A 1VRH2 3WW1A 1OQEA 1RUOA 3UL2A 1ND2B 1IGOA 3GBGA 1SEFA 4XFCA 1TMF2 3BODA 4S2DA 1Y4WA 4K40A 1KJRA 3T4HB 2TNFA 5T3NA 3U11A 1US2A 3FC0A 4E4SA 3R4DB 1GNHA 2D5FA 3Q8FA 5FLJA 5F3IA 3PUSA 2R1DA 1UZVA 1OOPB 3IPVA 4MG2A 3KLSA 2XHNA 3INAA 1WLTA 2NN8A 5FJHA 1ZVFA 3CJIB 3SITA 4B3NA 4W6WA 2Q1MA 3AKSA 4FOVA 1S2BA 2PHUA 5FZ3A 5FP8A 4N9HA 3WR0A 4ZPIA
chains in the Genus database with same CATH topology
4J1XA 1J1LA 4Q4Y1 3LA3A 1UU5A 4AFDA 3B9CA 3J8F1 1BK1A 1VBA1 2YMZA 2B39A 2VUAA 2R041 4OHYA 5E88A 2Q8OA 3H7YA 4RS5B 4CDWA 1NXMA 5DDJ2 4GA9A 4Y1XA 1O4YA 3JU9A 2WWSA 4JDNA 2DURA 2SLIA 3PVNA 5F5QA 1QGLA 3M3IA 1H4GA 2VNOA 4Q4W3 1GZCA 5AFBA 1FOD3 4IERA 1Q3EA 3OYWA 4QPIA 4R9DA 5I8SA 1S55A 3O0WA 2W08A 4AI8A 4OI0A 4FPYA 4H3WA 2GAUA 2ZCWA 1X33A 5JCTA 5C8CC 1PGW2 1RUH3 1BVP1 4MX3A 1L3JA 1EV13 3R4SA 2WFF3 3KZ4C 2XUMA 2R1BA 4LTAA 4CDQC 1OPMA 2HWC2 2Z5WA 2ZX0A 4K1ZA 3GBFA 4EN6B 4P9YA 3VN4A 1B35A 1VIWB 1REDA 2RJKA 1KD7A 1KITA 1R1A3 2QZ3A 3WD5A 1Z7S1 4Q0VA 5C6CA 3RYRA 1WCKA 4C1XA 2RS11 1CPNA 2FBEA 1V6KA 3J26N 1SCRA 4HPKA 1M06G 3H0OA 3M3EA 2W39A 1BBT3 5D1IA 4HKLA 2NLRA 5ABJC 5C9AC 4MZUA 4W6YA 2I74A 4CEWC 1VBD2 2BWAA 2DWRA 4RA0A 1DHKB 1XNDA 2X53S 5BXXA 3NKTA 3WP6A 3N7JA 4XIOA 1FV2A 4BHPA 5BNOC 2FHRA 1OFSA 2CY6A 2GN3A 1POV3 2DCKA 5JSOA 3CO2A 1HQWA 4WVWA 3B7MA 4C91A 1LGNA 1RHI2 4XDQA 4YSFA 3I59B 4XBNA 3NV3A 1DGRA 4I0AA 1REEA 1N1VA 1WW5A 2B7YA 5FAXA 5GLTA 1OQDA 5C4WB 3QH7A 4AXOA 1MZ5A 3D6EA 1JBCA 1LU1A 3LAGA 4XETA 5J36A 2ZAHA 4P9JA 3MIBA 4JQRA 1WUVA 1BEV3 1NXD1 3WQ1A 2ZMKA 2Y26A 2D6OX 1QHDA 1I1EA 4XTPA 2VMIA 4S2FA 1ULEA 2A70A 3VHNA 2EAKA 2ZGPA 4YNIA 1QJY3 2PLV2 5GZEA 1TNFA 4ZKTB 1V6MA 3ACLA 2WLQA 4LNVA 3AYDA 4PJYA 4JAAA 1BYHA 2XJSA 4HSJA 3NV2A 2VPVA 3RNSA 5IK7A 2GMEA 4XILA 3ZXDA 4LO6B 4JV4A 1YIFA 3TN92 1FOD1 3KCCA 3ROUA 2GMMA 3CL1A 4IXLA 1VAMA 3UKNA 1ULFA 2W52A 1O3TA 3ZSKA 3WHTA 3M1HA 5FPXA 3WDVA 4D7TA 2GNMA 5C8CA 5KHHA 5F6LB 3WCSA 2IWGB 1A8DA 5FBZA 4LBQA 3V56A 4CDQA 3RI9A 3H7JA 2P37A 2D6PA 5T55A 4E2GA 3CJXA 2WINB 2QDNA 1G7YA 3ZDSA 4JGYB 4PBPA 2AH2A 3DV8A 3MLJA 1JYCA 4XJZA 4P9IA 4TWTA 1BBT1 1PO11 4Z2WA 1Y3TA 5ABJA 5GJ6A 5C9AA 3AK0A 2ATFA 3VBHB 1CAXA 3PTYA 4CEWA 1CAVA 1XYPA 2TBVA 1SFNA 3USSA 1HXS3 2ZPXA 4XF9A 4LE4A 2VMHA 5BNOA 1POV1 2ZOEB 1S0BA 3AFGA 3FZ3A 4HVRA 2BGCA 1QXJA 1RMU2 2LALA 3MEPA 5SV5A 3O14A 2D40A 3KB5A 1KS5A 4LBNA 4M3CA 3MYXA 4RL7A 2HWB2 4LUMA 5H9RA 1UZYA 5L7OC 1QJX2 4D3WA 3VBSC 3E5UA 3RPQA 1YXWA 4AFAA 1BEV1 4Q1RA 5KXCA 2HYKA 2GH8A 4RQPB 1H30A 4TZDA 3KT1A 1VBC2 1N1YA 2WA4A 4YG3A 1EYBA 4EROA 3VV1A 1QJY1 3GALA 1RUG3 5GKAC 4M0NA 3TNPB 1FMD2 4OULA 1G9AA 4JGZB 1HW5A 4HLTA 3PHMA 3ME2A 1F31A 1RUD3 2EA7A 1HRI3 1SACA 2WT2A 1EAH2 4LLOA 2DFBA 2A3WA 2XL9A 3L9JT 1ULGA 3NL1A 4B7EA 3MICA 1JN2P 3OJBA 5JIUA 3BB6A 1XXNA 1GYKA 4YM1A 1Q8OA 3AP5A 2AYHA 4FQ4A 4DQAA 2HJIA 2A7AA 1LECA 1DGWX 4Y4YA 4Q0SA 1ND3C 1S0DA 1ENQA 2CGOA 3KT7A 3A0KA 2Z69A 4YG0A 1N3PA 4HVQA 1BMV1 3VDDB 1V9U2 3N4MA 5JPNB 4OUSA 3R0RA 1PNFA 4AEDC 1Q5OA 4F83A 4XF0A 1VRH3 3MPPG 2VECA 4CEYC 1H4HA 5FLHA 4YVWB 1ZZCA 2GNBA 1R093 1ZZ9A 2VULA 4OHVA 5FMOS 5HXVA 1TMF3 4YVSB 1RGSA 4BA6A 1MS5A 5A32A 4CDXC 4WZCA 4C0BA 1VAKA 4B7KA 2WNUC 4E4ZA 1MEC3 1O4TA 2JJ6A 4XF3A 5BNNC 3HT1A 4P14A 5KWRA 1AR91 4OVEA 1LB2A 3BPZA 1DQ5A 1V6JA 2BQPA 2XKPA 3MGUA 4OI2A 1GICA 3IPVB 2YGLA 2ZS6B 3IDCB 3MDPA 3AKPA 3JB4C 2G4IA 1PHMA 1HXS1 5JOZA 1KQRA 4XQ4A 2ZX4A 4MXWB 4F7ZA 1MQTC 1LULA 2JKBA 4FPJA 3PVEA 4PLMA 5EZWA 5TSWA 2YGMA 3HMYA 5EJ3A 1K5MC 1KDKA 4AQ2A 3WW2A 2GC3A 1C4RA 4JC1A 1O3SA 4LO4B 2HWE2 1G9CA 1S2KA 4QU2A 4A7YA 1AXZA 3H1MA 2GMPA 3T2TA 3ZN6A 4E9KA 5LK5A 5L7OA 5DDJ3 1NCQC 1AR63 5GLZA 4DY5A 3OPZA 4MXVA 4Q4W2 3J9SA 2E53A 3VBSA 2QZ2A 5E89A 5GZDA 3HD8B 1A6CA 5E8AA 4CDWB 1F5FA 5J7MA 3FJSA 5BY5A 4FBFA 4RFT0 4XJWA 1RUC2 1E57A 4Q8KA 4L92A 3ILFA 2WZR2 3N35A 4MYEA 1RUH2 4XF4A 1PO22 1LGCA 1RUG1 4AG4A 4XYXA 4NVPA 4UW6A 4QPIB 1COV1 2QDRA 2D44A 5CG9A 1RUD1 2RHPA 1HRI1 3WVJA 3FLRA 4MSVA 4QD2A 1UCXA 3I54A 1LOFC 4AE2A 1UPIA 5FOBB 2HWC3 4GKYA 4YYOA 1R1A2 1Y43B 1H1MA 5EWSA 5DZGA 3PVBB 2BVBA 1KFUL 1NLRA 1ND3A 4W6XA 4NOTA 3M3QA 4L9BA 1B35B 1QQP1 2XJPA 3WT3A 4IEWA 4AQ6A 4KU8A 3W59A 4SLIA 1VRH1 5BNPB 1VBD3 1HV0A 4HPKB 4AEDA 4D7SA 4DPNA 4CEYA 1H8TC 2EXHA 1U12A 5KXEA 4GMP1 1TMF1 1XYOA 3AP9A 2B46X 5D8AB 2WQZC 4CDXA 2HWD3 4AYUA 3ZN4A 4IEXA 2WNUA 4MLOA 1UU4A 2IZWA 4WM8C 2EAAA 3IBMA 4NHMA 2XVLA 4I0BA 1GV9A 1I6XA 1PGL2 1JOJA 3NAPC 2PHFA 1NG0A 1NLSA 1X82A 3V0AA 2AREA 5KC5A 4AHZA 4I2OA 1RL3A 1LJ7A 2E9QA 2CWSA 2XKOA 4GB32 4RHV2 3LWCA 1K5MA 2PLV3 1S0EA 3JBG2 4W65A 4CP0A 4GIQA 2GDFA 2ZA9A 5KHGA 2CTVA 3FFZA 5DDJ1 4COYA 3H8UA 3GZTB 3IDEA 3KMHA 5BUVA 1IKQA 1HV1A 2A6VA 2B8MA 2PHTA 3TN93 4AFMA 1D4M1 4IEPA 1H2LA 4E4DX 3UKVA 5AVPA 4IEVA 1W6MA 4IETA 4AGRA 3HWJA 2ZJCA 1FAYA 5LEKA 1PGW1 2XL7A 1C8M2 4UXAA 4Y1YA 2D3SA 1YFYA 2GH2A 1S0FA 1LOFA 5C8CB 3AYCA 1YI9A 4IV3C 3FWEA 4E2SA 2XJTA 4CDQB 4HBNA 3LZZA 4Q4X2 4XEZA 1AYM2 1G8WA 4YFZA 3ZSJA 4DRRA 1N1SA 1RUE2 2AR6A 4HETA 2PAEA 2CL2A 4XF1A 2XJUA 1X50A 4AI3A 5T5JA 5FO9B 3V0BA 1CAUA 2A5ZA 1RUI2 4BM8A 2PQQA 4Q1PA 1HIXA 2X5IC 1CD3G 1VBD1 1C1LA 3D0JA 3WOGA 3JD72 3RG0A 2YV8A 2ET7A 5ABJB 1H8TA 3LB9A 5C9AB 2VW1A 4Y24A 2DVAA 3VHPA 4CEWB 4CP2A 1WD4A 4YG6A 1CAVB 4B29A 1I5ZA 1RHI1 4N43C 2RMU2 3NWKA 1WW6A 3D0SA 4PLNA 1RMU3 5BNOB 4WM8A 3WDYA 2NQYA 2HWB3 4KWKA 1BXHA 1ULDA 1DU3D 1NQDA 3HN1A 1QJX3 3FFQA 3AMHA 5C8WA 3NAPA 4M3CB 4AVTA 1ZBA2 3CLPA 3WNXA 4FO9A 2XWJB 3AP4A 4A7ZA 2EXJA 4MV2A 3VZNA 1VBC3 1LHOA 4D7YA 4G3YC 2PLV1 2MNGA 2RS32 2Z2SB 4FT8A 1FMD3 3S6PA 3HR9A 1AR82 2IFRA 2X29A 1SLAA 3AXEA 5LRRA 4RGAA 2JG8C 4LE3A 1SLIA 1EAH3 1W39A 3LSEA 1PIV2 1REFA 2PHDA 3OY8A 2PELA 5T5OA 3MI8A 1CN1A 2R16A 1CAWA 3DF0A 2ZHLA 4FOQA 4MVTA 1RC6A 3WUDA 4TYSA 2FZ1A 4LO8A 5F6KA 5CFDC 3D8CA 2D7FA 5CNAA 1FI2A 3VUOA 1WW7A 4X6QB 1V9U3 3DGTA 2OPKA 1H8VA 1A8MA 4QXKA 1R092 2HEYF 1AYN2 1RUJ2 2DUQA 3O0VA 1Q8SA 2QNKA 2A3XA 4I3GA 2IXIA 4YZ4A 4IV1C 2MPFA 1AR72 1PZ8A 5K9YA 1MEC2 4IV3A 4D94A 3K48A 4META 4K21A 2GZWA 2XH6A 1Q56A 4OHWA 2DVDA 3FE5A 5A32B 4FXGB 4Q0QA 1QNWA 2ES3A 1OI6A 1CGPA 3ALQA 4QQHA 5CFCC 4LHLA 2R062 2XBO2 4S2GA 2WFPA 1AX0A 3VBOC 2X5IA 2PN5A 1C3HA 1HQNA 5DUWA 4KG0A 2YXSA 2E51A 3UKTA 5LRSA 5KHJA 2C1FA 3RDIA 2AUYA 4FPKA 2BFUS 2OW4A 5J09A 4L8QA 3ZYIB 2EXIA 3SXWA 4DINB 1RMU1 2V73A 1Y7BA 4N43A 4AGGA 1ZREA 3G6JB 4FP3A 4UW4A 3DUIA 1SBDA 1AR62 1PK6C 2HWE3 2VNRA 4WVVA 4EN7B 2DCJA 5JZGC 4AVSA 3L2HA 1ZZ7A 1QJX1 3VZLA 5GM0A 2PYTA 2JICA 1VALA 4YGCA 3WINE 3ZN6B 5L7OB 1ENSA 5I91A 1X7NA 2QJVA 3FHIB 3ZXEA 1H9PA 1PVXA 2DTYA 3OGGA 3VBSB 1RUC3 1VBC1 2JENA 5HBAA 4KNCA 5DG1A 4IQPA 4R8HA 2WZR3 3U10A 1PO23 1QOOA 2ZBJA 3KM5A 4GQ7A 2GNDA 4IESA 1FMD1 1SMVA 2IFWA 2JG9B 3EJKA 4AWDA 1GFF2 4CDUC 5JMCA 5H9SA 5IK4A 1AJOA 4MGIE 4XFFA 1W0PA 2JG8A 2ZGSA 4B4QA 5F9TA 4XFIA 1T6GC 2KA3A 3DN7A 2XLGA 1OSGA 2LM3A 1O3QA 2IXCA 4JTOA 2A75A 3ZXJA 2HWF2 5CFDA 4IEUA 5FTTC 2AGSA 1V9U1 2Q5TA 2VQ0A 1XYNA 2BTVC 4A7KA 4OI4A 1G9DA 3ZFFC 1AXYA 1Q8PA 1ND3B 5DG2A 2WNVC 3B5LB 5FOJB 4XJ9A 4HKWA 1Z78A 4V1PA 1MS3A 2MEV3 3EHKA 2HWD2 4IV1A 4AEDB 4QM9A 3SISA 1OLRA 2UY8A 4YLZA 1ZM1A 1EPWA 4CEYB 1YWKA 4QPGB 1KXGA 2VU9A 2FMDA 3WV6A 4YW3A 4HL0A 3VKLA 2B42B 2C9AA 2D97A 3B94A 4HK9A 4HMZA 2WQ4A 3WDUA 2OUJA 5LEJA 4AVAA 1VP6A 5DUVA 2WNUB 5BNNB 4LHNA 5CFCA 1VLNA 4OHXA 3WY6A 3CF6E 1UIKA 2YPJA 2PA7A 3VBOA 1TME2 4COZA 3IWZA 3USUA 3ZFEC 1RITA 3VKMA 4Z1VA 4AHWA 1JUIA 3V0AB 4GB33 5JDBA 4RHV3 3WP5A 2VMGA 3RYKA 2ZGNA 2ZMLA 2OA2A 1MQTB 3JBG3 1QDOA 1OA4A 2HWE1 3OCPA 4PDWC 1PK6A 2QFEA 4YRDA 4DS0A 1K5MB 5JZGA 2CAUA 3AKRA 1H1IA 2PHWA 4JDMA 4Q4W1 2CV6A 4Z82A 4DY3A 1VJ2A 1BCXA 3CNAA 1NCQB 1QJU3 3AFKA 3VGIA 4I01A 1RUC1 2G9GA 4FPEA 4J6GA 2WZR1 3QH6A 5JR7B 1RUH1 1PO21 2JE7A 3WW3A 1EV11 2BFUL 2O8OA 5CU1A 2WFF1 3MF9A 4IEZA 1O91A 1IQAA 4COVA 1LHVA 4CDUA 4WM7C 1UPSA 1C8M3 2A6YA 2RM22 3D5OA 5L19A 3ZN5A 1UZZA 2WZPP 2YHJA 4UBGA 3WZ1A 4H7LA 2Q30A 3LA2A 1R1A1 4XFAA 3IT8A 5FQ0B 2Z79A 4BCUA 4DXZA 4Q4X3 1AYM3 4KGQA 3WQ0A 4N53C 3M2MA 1RUE3 1XU2A 2GN7A 4EN0A 1FX5A 4BZ4A 4QPYA 2ET1A 3AXDA 1G86A 1RUI3 4XBLA 3ZFFA 1WCDJ 4LR4A 2WNVA 3JD73 5DZFA 3V0BB 1CAUB 1CESA 1RTVA 4NWVA 2WT0A 5J98B 3OGJA 1D0HA 3H1WA 3AYEA 3MZHA 1YUDA 4YGDA 3WDXA 2VVFA 2XHKA 1H8TB 2RMU3 4OLLA 3OTFA 2I07B 2P17A 3ES4A 3VLBB 2RS53 4Q4Y2 2PAKA 3VBFC 3E5QA 2ZX2A 4N90A 4WVMB 1IZ3A 5J48A 4LT5A 1PGL1 4WM8B 4F8AA 2NZ9A 5GLWA 5A3LA 5H9QA 2E7QA 2Q0AA 2R042 2GSYA 2VG9A 1DYKA 1ZBA3 5LK7B 4K9SA 3ZFEA 3NAPB 4HSLA 4GB31 4RHV1 4XJUA 3AYAA 1YJLA 2DTWA 2XG3A 3KD4A 2IXJA 3VZOA 4LBLA 2RS33 1SLCA 5GZGA 1NE4A 2BYVE 1TE1B 3JBG1 3FUOA 3VZKA 1AR83 1S0GA 4PDWA 1S0JA 2XLAA 4UBHA 3MW3A 4P9LA 1RUNA 3N7MA 3R05A 3VBUC 3O5SA 4A3XA 1PIV3 4YARA 2LTNA 5I0RA 1U5IA 1QF3A 3M4FA 3ZXFA 4AEKA 4QX5A 1ENXA 4QGNA 4BQ1A 2XJQA 1AJKA 5JWPA 1MS4A 1DLLA 5SV8A 4XQDA 4AVBA 1DYPA 1MZEA 3UJOA 3ZSEA 3SCHA 1H0BA 2ZABA 1RVF2 2QKDA 3TWIA 1UD1A 1ONAA 2D6KA 4I3PA 3AP6A 1ZZBA 5FREA 3I7DA 5L36A 2BUKA 4WM7A 4EN8B 1ZRFA 1AYN3 1RUJ3 5I0TA 5CB7A 4DMIA 3PMSA 1HRV2 4UW3A 3VBRC 3W9AA 2DFCA 1AR73 2XLFA 1WMFA 1NA1C 3JQXA 3ILRA 2JDZA 3SH3A 1XNKA 4Q4X1 3IN9A 1AYM1 2IXKA 1NY72 1RUE1 4N53A 4Q4V2 3GZAA 2NP0A 2CAVA 3TAYA 1DBNA 4XJAA 2P3IA 4XMAA 2P3JA 2R063 2NMNA 2XBO3 3RJRA 1RB8G 3Q9OA 1ZX5A 1RINA 1URXA 4K20A 4YM0A 2E63A 3VKFC 3AB0A 1GNZA 2X5IB 2R0FA 4TLFA 3WG3A 1UKRA 2V09A 3JZVA 1LOGA 1SBFA 2RMU1 2ARBA 3WP4A 4BE3A 1PMIA 1LOBA 2VXRA 1JTZX 5T52A 3VBFA 4I0WB 5JIAA 1VBB2 3V64A 3ELNA 2R49A 1ZZ8A 4N43B 1J58A 5A3MA 1YCIA 1DGLA 1RJ7A 1X8EA 4H55A 2F4PA 3ZIWA 3ZXLA 5KC6A 2WC2A 1MS0A 1QOTA 1U5ZA 1ZRRA 3LA7A 4O9EA 1ZBA1 4OZXA 1FXZA 4N7UA 4YW4A 3JQWA 2BNNA 4N7IA 1AF9A 1XRUA 2DU1A 3OYWB 2BPA2 2CYFA 4AI1A 1LEMA 2RS31 1AL0G 2N7GA 2VVDA 1WGPA 3DPRC 5DUUA 1AR81 4AW7A 4FTSA 4PCRA 2VOWA 2WKKA 3LOIA 4O9GA 2YROA 4EJRA 3VBUA 1PIV1 1N1TA 3EBRA 4R52A 2JG8B 4Q26A 4KU7A 3ZMNA 4BYYA 1LTEA 5F1RA 3HAGA 2HWF3 3WHUA 2UWBA 1SDWA 2BBVA 2Q4SA 2MEV2 1R091 3B69A 1AYN1 5CFDB 1RUJ1 2I45A 2UWCA 1DQ6A 3NSTA 4GXLA 1JYIA 3B3QE 3ZO0B 1AR71 4DB5A 3VBRA 1MEC1 5I0UA 1NA1A 2VNGA 1M4WA 3JUUA 4X6RB 1RIRA 2CNAA 5HCBA 4IV1B 1LOAA 4K1YA 3GYDA 5FPZA 3I59A 1QJZA 5KHKA 2JE9A 5E1RA 1WLDA 2ETEA 4CTEA 2XVKA 1DGRN 3UJQA 4ISQA 2ZKLA 3RZZA 3DKWA 3PLQA 3PMEA 4BIOA 4BMEA 3BIWE 1TME3 1AL23 2IC1A 1KFXL 1YJKA 4YM3A 4XE9A 4FPFA 1VAVA 5CFCB 4JTNA 4NN0A 1IS4A 1W6NA 2DVFA 3AM2A 2FMYA 4XXAA 4AQSA 4DNYA 3VBOB 1W2UA 3USUB 1XE7A 1DIWA 1WMEA 1DQ0A 2GC2A 4LO5B 2O1QA 1C8NA 3SH5A 3D4KA 1AR61 4JGZC 2JXAA 2HKXA 4TSVA 1CONA 5CVRA 4WVZA 4S2HA 1SFYA 1DGWA 3WDWA 1J59A 4Q0PA 3ZYRA 3WX5A 3O0XA 5J3UA 1QJU2 1IS6A 1C28A 1PK6B 5I0SA 5JZGB 1JH5A 1APNA 1IPKA 4OI1A 3ATGA