1YFYA

Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from ralstonia metallidurans complexed with 3-hydroxyanthranilic acid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-hydroxyanthranilate-3,4-dioxygenase
publication title Structural Studies on 3-Hydroxyanthranilate-3,4-dioxygenase: The Catalytic Mechanism of a Complex Oxidation Involved in NAD Biosynthesis.
pubmed doi rcsb
source organism Cupriavidus metallidurans
total genus 29
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2005-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yfyA01
3OTFA 5KHKA 4AQ6A 5I0TA 5J48A 4QGLA 2EAAA 4D7TA 3E5QA 3E5UA 4R8HA 3PNAA 4KU8A 2B8MA 2D40A 4HSLA 4HMZA 4EWEA 3EO6A 2XHKA 1FXZA 4LLOA 4XFCA 4ORFA 5I8SA 3NKTA 1DZTA 5C8WA 2OA2A 2EVXA 5I8YA 3SCFA 2XL7A 1YLLA 2ET7A 4HZFA 2GAUA 1YWKA 1DGRA 4META 2PA7A 2P17A 4IEYA 3C3VA 4UBGA 5KHHA 4ZU4A 3EHKA 4YSFA 2C0ZA 2Q0AA 5J3UA 3E6DA 5JAXA 1RUOA 3LOIA 1LRHA 2FMYA 3U11A 4ONUA 1V70A 5FLJA 1CAXB 2XKPA 2BNNA 3H1MA 5JR7B 2H6BA 2E9QA 2MNGA 3ROUA 4QMAA 4AXOA 2XLGA 2IXLA 2GC2A 2MHFA 2Z2SB 2HJIA 3FZ3A 2CV6A 3CF6E 5FLHA 1YFWA 1CAWA 1UIKA 3B02A 2H0VA 1UPIA 5F1RA 4DINB 2PTMA 1ZNPA 4YRDA 4HVOA 2ZCWA 5E1RA 3IDCB 4KWKA 5JCTA 4Q0VA 2BYVE 2N7GA 4MV2A 3UKNA 5J7MA 4XFFA 3R6SA 3EBRA 4MZUA 3H3ZA 3BALA 1X8MA 1YHFA 2O8QA 2UYAA 4UBHA 1ZRDA 4Q29A 4BH9A 4TLFA 4XFHA 1UCXA 4QGMA 5BXXA 4XEZA 1EP0A 2QNKA 3M70A 2PYTA 3FWEA 1QWRA 4R52A 3E6CC 5KHIA 1U12A 4PIXA 1SEFA 1CAXA 2GC0A 1WLTA 4F8AA 1CAUB 1EY2A 3BPZA 4O9EA 1ZZ6A 1RTVA 1OI6A 4XF3A 4E2QA 4A2UA 1RC6A 3CL1A 4F7ZA 3E5XA 4HVQA 3E97A 3TNQA 4IEVA 1NE4A 2F4PA 4WBBA 1O3TA 5BPXA 5LEKA 4FAGA 5FQ0B 4HSJA 3MZHA 4E2SA 3KSCA 4HVRA 1XRUA 4MGKE 2XLAA 1ZRRA 2BGCA 3CJXA 5FCCA 3CO2A 1YUDA 3EQEA 5KHGA 1RGSA 3I59B 4FBFA 3FJSA 4HN0A 2PAKA 4HN1A 1H1IA 1ZZ9A 2Q30A 4RD7A 3H1YA 4LUKA 2OYZA 1O3SA 3EJKA 4L11A 1I5ZA 4BIFA 2UY9A 3ETQA 3DV8A 4MGYE 2IXIA 1UD1A 5FPXA 2CAVA 5FLIA 1J1LA 2D93A 3ELNA 1ZZ7A 4I02A 4IESA 2H6CA 4EV0A 3D0JA 4K8FA 1LB2A 3TNPB 4KWLA 4LUMA 4I0AA 5HI0A 2PAMA 4O9GA 3LAGA 4Q0PA 2PFWA 1J3PA 3SCGA 4BYYA 3S7IA 4WVZA 1JUHA 1CAUA 1CGPA 1O3QA 5BV6A 1I6XA 1J3RA 4QXKA 4H7LA 2K9ZA 4QGNA 4WZCA 2DCTA 5I91A 3RYRA 4CYDA 3LA2A 4UXAA 4YARA 1VP6A 1SQ4A 4ZU5A 4AQ2A 2XL9A 5EFUA 1DZRA 5FQ0A 2GC1A 4L2NA 1FI2A 4HLTA 1X7NA 1LKNA 3H7YA 4KL1A 4XF0A 1IPKA 2IXJA 4XFAA 3RDIA 1TQ5A 4Q0QA 3QOPA 3RYKA 2XGXA 3I59A 1QXJA 2Z69A 4J1WA 3SHRA 3PVBB 3FE5A 4I09A 3E6BA 4IEPA 4YYOA 1UW8A 3LZZA 2D5FA 2ETEA 2GC3A 4MH0E 4N9IA 5JSPA 3WW1A 4IEQA 3CEWA 3NW4A 1DGWA 2PHDA 4OLLA 3GYDA 1OD5A 1ZZBA 3OCPA 2VPVA 3H3UA 4IEOA 2VECA 2O1QA 2QCSB 3VHRA 3IWZA 3NVCA 1IPJA 2IC1A 4I0BA 3SCHA 2GH2A 3H50A 1NXMA 4I01A 1XE7A 3H7JA 4JV4A 1J59A 4YNIA 1Q3EA 3ZDSA 5I0UA 2IXKA 3HT1A 4LA3A 1ZX5A 2ZKLA 5FDBA 3D82A 2BNMA 2Q4SA 4QX5A 3U10A 3FHIB 2B9UA 2GZWA 4ZU7A 1G6NA 5BY5A 3DKWA 5LRRA 3PLQA 4LA2A 2KXLA 5I0RA 3ES4A 3BU7A 5K8SA 1RL3A 4QM9A 3RNSA 5LEJA 2K0GA 5LRSA 3LA7A 4Q0SA 2GU9A 3OF1A 1CX4A 2BNOA 4XF9A 3LWCA 1FT9A 1J58A 4Z82A 4PIYA 4IEWA 5CADA 1ZRFA 4MUVA 1L3JA 1ZZ8A 3HT2A 5CVRA 3FX3A 1QY4A 2OPKA 5T3NA 3USSA 5JSRA 1RUNA 1WGPA 2MPFA 4I2OA 3ACLA 1CAWB 1J3QA 3H1WA 4KWJA 1VJ2A 3WW3A 4MGIE 3SXWA 3O14A 2WFPA 1OFNA 1PM7A 2XLFA 3CLPA 3NJZA 5FPZA 4P9GA 2HKXA 3HQXA 3OGJA 1ZVFA 2FQPA 3WW2A 5BUVA 3NL1A 4KU7A 3KMHA 3IIAA 1O7FA 4X6QB 4Q0UA 4X6RB 4EWDA 4GULA 3DL3A 3UKTA 2CAUA 4NVPA 2I45A 3RYPA 1CAVB 3BB6A 4E2GA 1GQHA 1Y3TA 3FFQA 3ST7A 1WA4A 3M3IA 4IEXA 4D7SA 1NZCA 4I3PA 3U0ZA 5KBFA 1ZREA 3IBMA 4AVBA 1ZRCA 4XF1A 2WC2A 2ET1A 1UIJA 4N9HA 1O5LA 1O5UA 4EROA 1EYBA 2IXCA 1HW5A 4LULA 3NSTA 4Z07A 3S0MA 2IXHA 4B29A 4OFGA 3WW4A 3LA3A 3BCWA 4JTOA 4MGZE 3MDPA 3GBFA 3QACA 4MX3A 2CGPA 2B5HA 1OMIA 1X8EA 4HBNA 3L2HA 2QJVA 4EWAA 1VR3A 5D1IA 5CU1A 1YFYA 3D0SA 2Q1ZB 3H8UA 4LEJA 5AVPA 1XE8A 3DN7A 3N4MA 1QXRA 2OZ6A 4XF4A 3HIFA 3I7DA 2BEOA 4AVAA 2PAEA 4IERA 2PHLA 1YFXA 4JVAA 2QDRA 2ATFA 3JZVA 3KCCA 1GQGA 5I8TA 3RZZA 2QVSB 5JSOA 5C6CA 1NE6A 2D5HA 1CAVA 4XFGA 1H1MA 3OD0A 3MYXA 5E16A 5I93A 4IETA 2Y0OA 1ZZCA 4XFIA 1SFNA 3ES1A 4J1XA 3MPBA 3UKVA 1X82A 5I0SA 4PIZA 2UY8A 4QM8A 1PMIA 3H9AA 5KHJA 1YFUA 3S7EA 2VQAA 4FT8A 1Q43A 3RPQA 4IEZA 2XKOA 2UYBA 4IEUA 2EA7A 2OZJA 3SMHA 1Y9QA 3I54A 4FAHA 1EPZA 3KGZA 4XFBA 4PJYA 4JTNA 4BHPA 1O3RA 5EZWA 2V09A 3G7DA 3IDBB 4XETA 1LR5A 1O4TA 2PQQA 1Q5OA 4AVCA 3KGLA 1NYWA 4LTAA
chains in the Genus database with same CATH superfamily
5JXIA 3OTFA 4LBQA 4LKSA 1W9YA 2J1AA 2WO7A 5FFOC 3VBRC 5A3PA 1NQDA 2VCCA 1JS9A 2RS52 4YPJA 2HWC3 1TNFA 4YM2A 4E8CA 1SLCA 3UL2A 3K3OA 4R8HA 3J7MA 2XUEA 4FPGA 5FZKA 3AYDA 5BNNB 5HXMA 4PDWB 4HMZA 2DVDA 3FUQA 1GSLA 4NAMA 3EO6A 1RUI1 5FP4A 3BTAA 3ZFEA 3O1OA 1FXZA 4LLOA 1F31A 2JB8A 2X8KA 2ZPXA 4ZXEA 1PO12 1YXWA 1S0GA 1H4GA 1DZTA 2PLV3 2ZX4A 4YGBA 5FZ1A 3VGIA 4PT6A 5KXCA 1KITA 3IIIA 2XL7A 1YLLA 3MBWA 5A3TA 1YQCA 1H8TB 2RV9A 2GAUA 1A8DA 4QX0A 2DDUA 4URAA 2XMLA 3M1HA 4Y22B 2VW1A 3BTXA 5LA9A 3WHUA 2H0BA 1MS3A 3W5NA 1QNYA 5C5UA 5KHHA 5LW9A 4ZU4A 3EHKA 3JD71 1W8TA 5IK8A 2CDOA 3ZIWA 4MG2A 2JEMA 1A78A 2JDZA 1ULEA 1PO22 4GWNA 2EXHA 2XONA 1V70A 3AKRA 1BK0A 1CAXB 1W9TA 5BNPB 2XKPA 5C70A 1POQA 1RUE3 2ZZQA 2EIEA 1IKPA 4K8RB 1LGNA 4QPGB 4GH4A 3VDAA 4D6RA 3C7EA 5A3NA 2UU8A 5A3WA 1JOBA 4QHOA 4AXOA 4QB6A 2K46A 5C4WA 3M8LA 1YI7A 3VD3A 2J22A 4IUGA 1BBT2 1AR91 1OD3A 5A7OA 2W1UA 4XUTA 4BPZA 5BNQA 3ZYHA 1ENSA 1VAVA 3VBSC 3K4ZA 1UY0A 2RS32 5GJ6A 4Y4RA 1QJFA 1WLCA 1YFWA 3VBFC 1UIKA 3ZXLA 1C5IA 4EN7B 4LJHA 1C8M2 1REDA 1HJFA 4AZZA 1YO8A 2NN8A 5JOYA 5AVAA 2PTMA 3O0VA 1W05A 4GWMA 4XUQA 5D8AA 4WVMB 4BQ3A 4HKWA 1LEMA 3TB0A 3ZXKA 1IG3A 4LO5B 5A70A 2OXBA 5JCTA 4JGZA 3AP5A 2Y6HA 5ANNA 2ZKNA 1K45A 2N7GA 4MV2A 5J7MA 5JXJA 4XFFA 3ZFFC 4Y1YA 2R7EB 2JD4A 1COV3 1N1SA 3FN9A 1WLDA 3H3ZA 1X8MA 2VU9A 1S2EA 3ZFGC 5LBEA 1QHDA 1VMHA 4IV1A 3U4SA 1PO21 2BGOA 4BH9A 3FHQA 4H2AA 3M3QA 1IPSA 3ZVXA 5A1FA 1WKYA 4AHYA 1T6GC 2WA3A 5FZEA 3O1RA 4MGSA 1KS5A 4QU1A 3LFIA 3N7MA 5FYHA 4FPEA 4Y20B 5LBCA 4ZHNA 4Z1VA 3THDA 4LO4B 1VE0A 1SEFA 3T0BA 3WF0A 3O1MA 2FDGA 1NCQA 4C0HA 4CDWB 3U07A 1QJU2 1HJGA 3JQWA 2RS31 1KJRA 3ILRA 1NAEA 1I9RA 2BV4A 3VBRB 2VVFA 1O59A 3E97A 4KG0A 3RMYA 1O8SA 1WW6A 2TBVA 3FLPA 3MFAA 3HN3A 4KMQA 3Q8AA 4K20A 2Y34A 2ZA9A 3U78A 3UYJA 1O3TA 4FAGA 5F3EA 4DXRA 1UMZA 5DDJ3 4RA0A 2A6VA 4HSJA 4CCEA 4Y1XA 4E2SA 4HVRA 4NIGA 5F3CA 1DU3D 2B4KA 4DZGA 4NUBA 2CL2A 1MS1A 4R9CA 3T2TA 3BVCA 3CKHA 5C71A 1MS9A 3CO2A 4XMIA 3WR0A 5KHGA 1HQNA 2VNRA 1UPSA 1IG0A 5LK7B 1OOPA 3RJRA 3FJSA 1K5MC 4AEDA 1WMEA 2PAKA 4E4HA 2JX9A 2VVEA 1F5JA 4PLOA 1JYXA 2R042 3NAPC 2HLEA 3MLKA 1D0HA 3IMNA 3VZLA 2WIIB 4JAAA 3THCA 2G9ZA 4YM0A 3ETQA 1FYUA 1W39A 4QXHA 3RZJA 4MGYE 4YGCA 1UD1A 3S6PA 5FZLA 1J1LA 2E53A 2HH9A 3MFCA 3FL7A 2H6CA 3GZTB 3A0NA 1DQ4A 1XOYA 2YXSA 3HNMA 2VVDA 4AHXA 3P3NA 2JE8A 2VQ0A 3OGSA 4FPJA 3TNPB 4CCMA 4KWLA 5FMDA 5DZGA 1OVPA 4O9GA 5FREA 4LBLA 2X10A 4OI1A 3BGAA 1X50A 2QQOA 5A7WB 1QOSA 4WVZA 1JUHA 1LU1A 1WWYA 4XHXA 2WZR2 3WDXA 1OLRA 2Y6JA 4JQTA 3A23A 2VY0A 4QXKA 5EYYA 4KGQA 3VBSB 3WNOA 4KQ7A 4QGNA 4WZCA 2WNVC 4UF0A 1H2MA 4XUPA 2JE9A 1VIWB 1GKBA 3TN91 4E4ZA 3W5MA 4ITCA 1CPNA 4RGAA 5EYXA 3VL9A 3OUIA 3VBFB 1C57A 2Y26A 4YVWC 4COUA 1AR61 4ZU5A 4AQ2A 4XDPA 2W95A 5FYMA 2W47A 4H14A 2JG8A 3MI8A 4DXZA 1PZ7A 3I2KA 1FI2A 1Z7S2 3MUY1 3OY8B 4HLTA 3VZKA 4DIQA 3T0DA 4W6WA 4RHV2 4XUOA 3GDBA 4Q5OA 4YW3A 1H1AA 4BQ4A 1W04A 1PK6C 3MIGA 1HB2A 1CZSA 4AFMA 2KA3A 3ZFFB 4Q0QA 2VMIA 3RYKA 1O4YA 1ZBE2 2CWMA 2E7QA 2Y33A 5FZ0A 1QXJA 1GMMA 5T50A 3ZFGB 1JI6A 4J1WA 4OYUA 3SHRA 1W0NA 1Q8VA 1W99A 2BWCA 5IAXA 2QQKA 2DU1A 1WA6X 3PVBB 1AR71 2EAKA 1GUIA 2ZEZA 2WWJA 5FUNA 3PL0A 1MVQA 2WL1A 3ZSEA 3M3CA 1G9BA 3QH6A 2YFUA 2ZGOA 4P02B 1S4CA 2WYFA 3AZWA 3KV4A 2WT1A 5FZCA 5LBBA 1RB8G 4CDUC 1OF4A 3D6EA 2D5FA 2D3SA 2GC3A 3KQRA 5KXBA 4N9IA 1DQ6A 1R083 1RINA 1CVNA 3CQOA 3WW1A 1EV12 4IEQA 4HK8A 5C3PA 1UX7A 1W9FA 2YC4A 3CEWA 4B7KA 1TMF2 2W3JA 2J42A 4OLLA 1VBE2 1ZA7A 4HPKA 4LOTA 4FO9A 4IE5A 4N7UA 3O5SA 2WS93 1U5ZA 4QX3A 1W2AX 3IWZA 4XIKA 1QOOA 3X29B 1RUG3 4AK3A 2D98A 5GM0A 3O1TA 2DV9A 1O6UA 2DVGA 2WFF3 3VKMA 3VV1A 4CU9A 3IAPA 1NXMA 4QPIA 4MLOA 3H7JA 4JV4A 4LK6A 2VOXA 1Q3EA 3ZDSA 1ZBA2 3Q9OA 2HWB1 2IXKA 2L9LA 4BCUA 3PU8A 1W6MB 2JKBA 3PVNA 4XXAA 3D82A 3WNKA 2BNMA 2HWD3 1YJKA 5EXOA 2JJ6A 1HRV2 4UFHA 1PHMA 5H9SA 3GNEA 2GZWA 1Q8OA 1HX6A 4ZU7A 5LY1A 3ZXFA 1UY2A 1ZBE1 3WF1A 4AI0A 4BM8A 4XXPA 5C33A 5BY5A 3RZGA 3LEIA 1K5MB 1KXGA 4XTPA 5FXWA 5I0RA 1UX6A 1OA3A 1RL3A 4RFT0 4OHVA 1HB3A 4LPLA 2K0GA 1VLNA 5FPBA 3A4UA 2RS13 2BGPA 3NAPB 2W94A 3MIDA 4N53C 5FZOA 4M0HA 1AR81 1OPOA 5FMOS 5FYVA 4Z82A 3VKLA 4CU6A 2ARBA 2BBVA 3JBG3 3N36A 1AJOA 1NY71 1VBA3 3NNJA 1QMJA 4Y24A 1VALA 3FX3A 1VMFA 2ZXQA 2VZUA 5HCHA 1RMU2 3THTA 2P37A 2G4IA 4P9XA 4LO8A 4D3WA 1MEC3 1LOAA 2JIGA 1BKZA 1VJ2A 2GMEA 3Q8EA 4MGIE 4UYBA 3SXWA 5L7OC 2C26A 4H55A 1SACA 5CEHA 5JOWA 1LU2A 4KBBA 5F7UA 4EZ4A 5FPZA 3CHXA 3FBMA 3V0BB 1TME2 2HKXA 2YMZA 4E9KA 3ON7A 5J36A 1BLZA 4UWDA 2HWF2 1XQNA 1E5IA 2WZEA 4N7IA 2JDKA 1ZVFA 5F32A 2BJSA 5AFEA 3VD4A 3KMHA 3AFKA 4AI1A 4RS5C 2X5IA 3MW4A 4QHBA 4URTA 2WNVB 4OUEA 5JVVA 4Q0UA 2ZGUA 4X6RB 1W8HA 1WW5A 4GULA 3VBHA 1CJPA 4PF1A 1HRV1 1POV1 4YVWB 2AREA 1AXKA 1W0PA 4PBOA 3WD5A 4E2GA 1FPN1 2KR2A 1Y3TA 3RZMA 1B35A 2Y6GA 1UZ0A 3RZKA 4QHZA 4YW4A 4A3XA 1BMV2 4JZRA 3ZMOA 4ARXA 4D6SA 1LNSA 1D2SA 3A0KA 3KV9A 4NR1A 2NZ9A 2C5DA 5KBFA 2TUNA 5GALA 1ZREA 1SFPA 2A71A 2QQWA 1FNYA 3MUZ1 5FMBA 3LCPA 5FK7A 1ALYA 1PK6B 1V6MA 3J4UH 3J8F2 2BERA 4EROA 2R071 5T5LA 4AF9A 3KZ4C 1C3HA 4BQ1A 1A3KA 1R64A 3MW2A 4B1LA 4WM7A 5FMOL 1AL0G 4CUGA 4OFGA 2QTWB 3N7LA 3LA3A 3K4DA 1FMD2 5DUVA 1JU4A 5KC5A 4LKFA 4JGYC 3WNPA 3GBFA 3SEEA 3F95A 1RUI3 2B5HA 1OMIA 1AYN3 4L8QA 1RMU1 4HBNA 2D6NA 2MEV1 1XSQA 1G9FA 4M4PA 2QBXA 5GZFA 2Q8CA 1WD3A 4CDUB 1NUKA 2IFRA 4CRQA 4XACA 2CDPA 2WN3A 4FPHA 1UU5A 2WNUA 3DYPA 3MO4A 4NN0A 2VOKA 1GZWB 1YFYA 4LEJA 1QKQA 4AI2A 3L2YA 1V9U2 4WM8C 3RRDA 1PIV1 4AE2A 3W59A 3OD4A 4XF4A 2D44A 3HIFA 3AYAA 5JXHA 4D6QA 4L9BA 3JD73 4OI4A 2RJLA 1GP5A 2PAEA 4IERA 3B9CA 1SPPA 1NLRA 2Q1FA 1S0EA 2PHTA 3WVJA 4J6GA 4QAWA 3KCCA 2D43A 4FFFA 3ZSJA 4DOUA 5IVFA 4TZDA 2Y8KA 2AEZA 1W6OB 2G9GA 2QVSB 1DQ5A 1VBB1 3B3QE 5C8CA 1X36A 3MIHA 5C6CA 4CTEA 2D5HA 4C8DA 3USUA 2RJ2A 3D4KA 1FOD1 3ZYIB 2WLQA 3OD0A 4RSUA 3MYXA 5E16A 5I93A 1QF3A 4BLJA 1ULOA 2RS53 4LBKA 1ZZCA 2PHRA 4QWNA 1BVP1 3ES1A 5FYBA 3UKVA 1X82A 4LK7A 3BPSA 4LE4A 3H8RA 1YYNA 1FMD1 2VW0A 4YWAA 3H9AA 1CQ9A 3Q8BA 4X8PA 5FY9A 2O14A 1GZTA 4N53B 1PO13 4LT5A 1NA1A 3VDDC 1CPMA 4DY5A 2YU2A 1EAH2 4CCDA 4XUNA 4QPYA 1ASJ2 2JB4A 2XKOA 3RGBA 4PQQA 5K0UC 1JYIA 1GLHA 3ZSMA 4BQYA 1X9PA 3OBZA 3LSDA 1PZ9A 4CDXC 1EPZA 4PBPA 2A70A 3KGZA 4YW2A 1V9U1 4FSJA 1NLQA 3VBUA 3B93A 3JQXA 4R4XA 5L7OB 1KRIA 4BHPA 3IDBB 4XETA 3H42B 2PQQA 4WVWA 4AVCA 3OUJA 2VTXA 3DEMA 2P3KA 5KHKA 3NJYA 4AQ6A 1PO23 1VBC2 3DECA 2A5ZA 4RQPC 5J48A 2EAAA 1PMHX 3ABZA 4RS5B 1JYCA 2OS2A 2B8MA 1XNCA 1R092 2A6YA 2W46A 5A7NA 3VZOA 3WCSA 4DS0A 3BIEA 4GB32 1HRI2 3HMYA 4CA9A 5C3OA 4CCNA 1N3OA 1LTEA 2QZ3A 4FFGA 4FPFA 2GP3A 1DQ0A 2GDFA 2OUJA 2JECA 3KCXA 2ZHKA 4OMCA 1UZYA 5I8SA 5IVEA 5JWPA 1BYHA 4Z2WA 1W6NA 1YQ2A 2P3JA 4FOQA 1BBT3 3ZN4A 1N1YA 4TYSA 3IMMA 5AC92 4KI5M 4XOGA 3TEXA 2EVXA 4CP1A 3SCFA 2W0XA 3HQUA 4P9LA 2RS33 1QJX2 2ET7A 3MLJA 5BNOA 3WZ1A 3OYWB 1YWKA 1YIFA 1G9CA 1K42A 4FPCA 2RG4A 4META 4V1PA 5FWEA 1I3HA 2PA7A 5A33A 3ZO0B 3WP3A 3C3VA 1C8M3 4LMFA 4OULA 2Y0IA 4MADA 2XJUA 4OMDA 5FZBA 3JU9A 2Q0AA 4CPBD 4NIHA 5E6HA 2DYCA 5J3UA 3GZUC 3VB9A 4JGYB 5HBAA 3H8XA 1LRHA 2JG9A 2JICA 1H9PA 4CEYC 5LA1A 4CP9A 3VBOB 4ONUA 1MQTA 2W39A 3I49A 3WF3A 3MGUA 2X53S 5FKCA 3I97A 2BNNA 1PGSA 2VMFA 1BEV1 3B69A 2YROA 2Z4FA 2GSYA 3NV1A 1Q56A 2ARAA 3FFZA 5JR7B 2QDNA 2MNGA 4AWDA 1YQ6A 2ORZA 2W87A 4QMAA 1OH4A 1AL21 1RUD2 3K2OA 4COVA 4ES8A 1F9KA 4WM8B 2IFWA 2ZABA 2IXLA 5LY2A 2GC2A 2MHFA 4IV3A 3ZMNA 3LOBA 3WLUA 4JQRA 3QH7A 1XU2A 3RI9A 1JMUB 2UURA 4BMBA 4GB31 3WSOA 4CZSA 1HRI1 2CV6A 4XCBA 4A7ZA 5LWBA 2VAUA 1CAWA 2W08A 1ENRA 5IVCA 4NHMA 2A3YA 4F3JA 1EUTA 4QXCA 2D6OX 4AEJA 4DINB 1RJ8A 2VMHA 2Y64A 5AC91 3O1VA 5BNNA 5CFDA 1F2NA 4N8MA 1Q8SA 5E1RA 1QJU3 3HJRA 5SV5A 3POEA 1SHWB 1QJX1 3CZJA 5HV0A 3OUHA 2UWBA 3HD8B 4XBLA 3SKJE 2BYVE 4OHYA 1MACA 1X33A 3PVOA 1RIRA 4D0QA 1UZZA 3RWNA 5F5CA 2FDFA 4CU8A 2VC9A 1Y9MA 4LBNA 4FTBA 4GALA 1S0BA 3DYOA 1U5XA 1H8TA 1YHFA 2O8QA 2ZX1A 1H8VA 3M7AA 5FZAA 1ZRDA 4C0BA 1IS3A 1MS8A 1R1A2 1HN0A 4Y22A 4TLFA 4XFHA 5FUPA 1AVBA 3LDRA 1WCSA 1GOHA 2LW8A 3T4VA 3WHTA 3ZR5A 3MIBA 3VDDB 3O0WA 3POJA 5EJ1B 3T4HB 2JDYA 4OVEA 5K0UB 1RUC1 3N9LA 3Q8FA 4BXFA 3T2QA 1HB1A 1W3XA 1RHI1 5JPNB 4CDXB 1PVXA 1RUD1 5FZ7A 5J09A 4S2GA 3CNAA 1CAXA 2AC1A 5BNPA 1WLTA 2D3PA 3E1F1 3OBTA 1CAUB 1QQP1 1EY2A 2O0OA 1UXZA 2R043 1OQ1A 2RMU1 2SBAA 1ZA4A 3BPZA 4QPGA 4NPRA 2RR12 5FBJA 5FYTA 1ZZ6A 5FYSA 4XF3A 3KCYA 1NCRC 2BPA2 4JKMA 4K1ZA 4HVQA 4BA6A 3I4IA 1GNHA 4YFZA 5IATA 3TNQA 2NM1A 4RQPB 2XHNA 1RUF1 2VNOA 4R9BA 5ANQA 3OGRA 3V0AB 2YC2A 4OCTA 5H9RA 4D94A 1S0JA 3S57A 4WBBA 2VMEA 4JDOA 4KBZA 4AAPA 5DUXA 5FQ0B 5A32B 3SISA 1GU3A 4XILA 3UJQA 1MS5A 2AACA 3RWKX 1AR92 2J1SA 3KSCA 3CU7A 2QE3A 3C7GA 1CONA 1UO9A 4BWOA 4WVMA 2BGCA 1KD7A 2C4XA 2WZR3 3CJXA 1W8FA 5FCCA 3W20A 4FP3A 5F6KA 1YUDA 4FPYA 1VB2A 3I2IA 1UY4A 1RGSA 2VCMA 2VW2A 3I59B 2R0FA 4FBFA 4X8NA 5IVYA 1R1A1 3RG0A 1JYTA 4XQWA 1BZWA 4Q4X1 4FPOB 4IQPA 1HLCA 1VBD1 3AKSA 1H1IA 2I74A 3GCXA 1ZZ9A 3LQCA 4AHWA 2Q30A 4RD7A 4RN5A 3H1YA 5DN2A 5FIXA 3K51A 3T1MA 2ENRA 2OYZA 4UW4A 3HOBA 3VDCA 1UF2C 2A6WA 2YPJA 4LHSA 4GJZA 5BYNA 3RQ0A 3KWVA 3S5AA 2VMCA 3ACGA 1RUH1 3DV8A 4MXVA 1Z7S3 4A42A 5FUIA 4BK5A 3ZN5A 4CEYB 4RHV3 2D93A 2ZHNA 3ELNA 1DBNA 1F5FA 4TTGA 3D0JA 1LHVA 1S1AA 3GHMA 2VZQA 2RR11 4DNYA 4I0AA 4Y20A 1ZBE3 4CCJA 4FOVA 1HQLA 1LODA 5JOZA 5IWFA 5FZHA 3JUUA 2YV8A 4QQPA 4BQXA 5JZGC 5DABA 3N9QA 4YZ5A 3EXUA 4CDWA 4K40A 4EQVA 4M3CF 5BV6A 1J3RA 1V6LA 3FHAA 2RHPA 3PMEA 2K9ZA 3DUIA 1PGL1 2CGNA 2DCTA 4IL7A 3VBRA 3KF5A 4JRAA 1G8WA 1EV13 1H4HA 3RSJA 3RYRA 1N3PA 4H7MA 5FKBA 1TMF3 3NJVA 4YARA 2G19A 1LGBA 1SQ4A 1VBE3 3AMHA 2Z42A 2XB6C 4AVTA 3V56A 5EFUA 3KD4A 4MYEA 4XJUA 2DWRA 2GC1A 4L2NA 3R4SA 4Y26A 1SBFA 2BOIA 4R9AA 4LBMA 2C9AA 5GZDA 1AX2A 1Z0HA 2JD9A 2WAAA 4NWVA 1LKNA 4QX7A 4COWA 3H7YA 1XNBA 2PQSA 3K48A 2WO1A 5TSWA 1IPKA 2IXJA 4YVSC 3ZDVA 1TQ5A 1ULGA 2NLRA 3V64A 4O65A 5LA0A 1MZEA 4QDQA 1UU4A 1REFA 2XGXA 3ZYGA 2FCVA 5JI7A 1ZBA3 4Y1ZA 1BJQA 1UOJA 3O0XA 1DYKA 1PX4A 1NQJA 2NMNA 1LOGA 1NLSA 2DVFA 3FE5A 4HANA 1HRV3 4NE9A 5I0DA 3BTZA 1VRH2 4Q8LA 5FMCA 4M01A 4LIUA 2WR9A 2Y6KA 5IAVA 1KJLA 4E8DA 1N3QA 1JZ5A 4IW3A 3AXDA 1WCKA 4CCKA 4YM3A 3RJ2X 5FYCA 4IGQA 2PHDA 1GOGA 1H30A 3OCPA 3VLBB 3NNGA 4EN9B 2VPVA 2VNGA 5HXVA 3AFGA 1R1ZA 2O1QA 2FZ1A 4N43C 2YB7A 4AFAA 5DAWA 4Q4Y1 5DXDA 3NVCA 1US3A 1IPJA 1NCRB 1YJLA 2J1VA 5A7WA 2ZGMA 2YUEA 1HXS1 1TEIA 4C1WA 4GAZA 5FZIA 3SCHA 4BISA 3H50A 4I01A 3GGLA 3VBSA 1J59A 1RMU3 4NHXA 3INAA 2QFEA 1XNKA 2YY1A 3RVHA 4OI0A 3AMNA 2Y38A 1GICA 1ODMA 2P3IA 4PI0A 4CUBA 4DUWA 3BI3A 3VBFA 3VHOA 5FP3A 2Q8DA 3B94A 4GWJA 4Z8BA 4Y5SA 3FHIB 4FQ4A 1TME3 2B9UA 5CG8A 3DPRC 2ZEXA 2HWF3 1ULFA 4YLZA 4CCLA 4UW3A 4AFDA 1JTZX 3OY8A 4FOYA 1O91A 5J98B 3ZYBA 3TN92 4YG3A 1ZRIA 4O61A 3PLQA 1JZ3A 4LA2A 5FTTC 3ES4A 3O1SA 3BU7A 5L9VA 3PIGA 5FPVA 4Q1PA 5EJ3A 1AR62 2ZBJA 1OKOA 4XTMA 3ZFFA 2FDIA 1VRH1 4CXXA 2NQYA 2W52A 4ZONA 1CX4A 2BNOA 4XF9A 3ZFGA 4DY3A 3POYA 2FDJA 3LWCA 2EICA 5DAQA 3ZKYA 2CTVA 2R1BA 1UMHA 4IEWA 4PIYA 5CADA 3NMBA 4MUVA 5L36A 1W2NA 5A7PA 1ZZ8A 5C7GA 5B4NA 1QY4A 3JXSA 2QQMA 2BP6A 2WUHA 3CJIC 1ND3C 2BDRA 2MPFA 1CZVA 1QH6A 2AUYA 3PUQA 4HKOA 5FYIA 4I2OA 2XBO1 3J8F3 4NRMA 3WEZA 1XBFA 2WFPA 2Y6LA 3NJXA 2XLFA 1SCSA 1AR72 1U5IA 3CLPA 4FPLA 1WBLA 4P9GA 5JZGB 4UFMA 1AX1A 3HQXA 1FMD3 4OZOA 2XJTA 5BUVA 3NL1A 3UV9A 1MZ6A 3S30A 5JMOA 3GCWA 2PMWB 3T0AA 3UGGA 3P3PA 4HKLA 4G9SB 4EWDA 3ZXAC 2LRPA 3WXPA 4AAXA 1PZ8A 5GLUA 5L9BA 5A7SA 2I07B 4NVPA 3T2OA 3UKTA 1C28A 2CWSA 3MF9A 4OI2A 2ZHLA 4QKBA 3THPA 3O7OA 3RYPA 1CAVB 3BB6A 4DXSA 1GQHA 5EIYB 4AFBA 1V9U3 2XJVA 1URXA 2HEWF 1W6MA 3M3IA 1NZCA 2RDSA 3PU3A 3OBAA 4UAPA 3U0ZA 2WNOA 3U37A 3A21A 1HIXA 3DXUA 1OXCA 3TWIA 1P8JA 4C1XA 4DRRA 1ZRCA 3MLLA 4YVSB 2ET1A 2WSUA 4ISQA 3T30A 3CBNA 4Q26A 4Y3OA 1O5LA 4D7YA 1OVSA 2SLIA 2HWB2 2IXCA 1UKRA 2YGMA 2ARCA 3HR9A 3NSTA 4I3GA 1K5MA 2DBIA 4RYDA 4SLIA 2JDAA 5C3RA 4XBNA 1S2BA 4FP2A 4NHKA 2EF6A 3MDPA 3NAPA 3QBQA 1LAJA 2JXAA 3OPZA 1TZOA 1WMDA 2W1WA 1YRZA 2A3WA 3FC0A 4QQLA 4IGPA 5EJZB 2DVAA 2DUPA 4K3UA 3POBA 1UAIA 1VR3A 1SDWA 4PHZA 3BTYA 5FO7B 1GWLA 4GQ7A 1ODNA 1SLLA 3D0SA 5FP7A 5LCWL 1V6NA 2ID4A 4A3ZA 2E32A 2YU1A 2A6XA 3K77A 2J1RA 3DN7A 5FBZA 3N4MA 1AR82 5A6XA 1UOFA 3CDZB 4N43B 2ZACA 3WP5A 4P9WA 1NY72 1UU6A 1YI9A 3TEYA 2J1UA 1W06A 3V0BA 1LECA 2C6SA 2VZSA 1EAH3 2ZMKA 2X09A 3I7DA 1ASJ3 3K3NA 4QX2A 4AVAA 5IFTA 5IFPA 2PHLA 4TLGA 4LO6B 2EIGA 1YFXA 4JVAA 3WNNA 1YCIA 3I3DA 1CWPA 1S55A 1SBDA 1GQGA 1JW6A 2JENA 2WNVA 5H9QA 5A6YA 5CBLA 1MZFA 3N3HA 2QZ2A 5E8AA 1CIYA 3HAGA 2JKXA 4RGKA 2ZGSA 4YVWA 4G3YC 3TBDA 3WP4A 1LHUA 1NE6A 1SDDB 1UWWA 4HETA 1DGLA 2ERFA 1DLLA 2VMGA 4XFGA 2YFZA 1OA4A 4QX8A 3DPRB 1H1MA 3SH3A 1UNBA 1KDMA 3H0OA 1S0IA 1VBC3 1F15A 1XC6A 4IETA 2Y0OA 2J7MA 1NG0A 4A44A 4LQRA 5T54A 3KV6A 4GMP3 4WZFA 4AEMA 2AEYA 2X29A 4PIZA 1JYNA 1R093 3T3YA 5FJKA 1PK6A 4GB33 4GMP0 1HRI3 2GMPA 4QM8A 5HCBA 3GBWA 1FPN2 2JIJA 2V73A 3C7OA 1L7LA 3I2HA 3ZIXA 1JH5A 2VQAA 3ZN6B 3ETPA 5AC93 4IEZA 2VNVA 5H9PA 3SMHA 3AMPA 3HBKA 5DUWA 3OB8A 1Y9QA 3I54A 4V2WA 2IVIB 1QJX3 5FZ6A 4LBOA 2R072 3L9JT 4UF0B 4EN6B 4CDUA 3CJIB 1ND3B 1JYVA 5CYYA 2V09A 3ILFA 3I3QA 1LR5A 2EIBA 2R32A 1SLIA 4UW5A 4HFSA 5LA2A 1GZWA 3B01A 1JBCA 5KC6A 4NPLA 1FV3A 1F4AA 2MEV2 1OC1A 4QB1A 1DG6A 3QLQA 4Q4W2 4QGLA 5D2AA 4EJRA 1DYOA 3ZOIA 1MVEA 3E5QA 4D7TA 2A6ZA 5ACA2 3AM2A 1RUE1 2IWGB 2VZVA 4XJAA 1SBEA 4MOAA 4HSLA 1DGWX 3HNYM 2W2IA 4ORFA 1C8NA 1PIV2 4JKKA 1RUD3 3NKTA 4R4ZA 3P1IA 1GNZA 1RXFA 5C8WA 5IVJA 1D4M2 2WQ8A 3WQ0A 1U0AA 5I8YA 2NMOA 2V72A 4AHZA 2Q1MA 4CDQC 1EPWA 3J7HA 2D6KA 4K1YA 1KEXA 2JWPA 1V6IA 5KR7A 1KFXL 1NXD1 2ZX0A 4IEYA 2FHRA 5JIUA 4B4RA 4B8EA 2WZPP 3SITA 1VBB2 1A6CA 1W6QB 4K21A 4YSFA 2ZGPA 2C0ZA 2QUOA 4Q4V2 5JAXA 3J26N 3LOIA 1F4HA 1A34A 1FOD2 4JCKA 4N53A 2FMYA 5DG1A 3U11A 2CGOA 2W92A 3VKOA 1UN1A 2X05A 1UZVA 3ACHA 2NYYA 2WWUA 3WV6A 1COV1 3KLSA 2GNMA 2QQJA 4UFKA 2DTYA 1Q8PA 2H6BA 1WD4A 3ROUA 1PMJX 4CEWC 3I2FA 5LK5A 3VBOC 1LULA 1R1A3 2TNFA 3FLTA 3HVDA 2XLGA 4Q4W1 4XJ9A 2P3YA 5L7OA 1JHJA 2GMMA 2QQVA 1ACCA 2Z2SB 4Y5Z0 5ACA1 5IK4A 4FXGB 5DAVA 1ND2C 5FXXA 2ADDA 4DQAA 2XUMA 4BE3A 3I2JA 3FZ3A 5CKQA 3CF6E 5FLHA 3BIWE 2LS6A 3N35A 5FY7A 3I3MA 5F2WA 2H0VA 1UPIA 4RS5A 5F1RA 1JOJA 5F5AA 4CCCA 2W68A 1LOEA 1ZNPA 1D4M1 1W0OA 3ACFA 1O8PA 2WN2A 3MF6A 3AX4A 4JHTA 4XAEA 2RR13 3IDCB 2HBTA 4NOTA 1UZWA 2ADEA 4KWKA 5EPAA 4PLMA 3QD6A 4Q0VA 4V2VA 5C9AC 4W6XA 2D6MA 1K3IA 3UKNA 2W91A 4AI9A 4NWWA 5F37A 3EBRA 5FOJB 1QJY2 4KNCA 5JLVA 3JCIA 2TEPA 1MPXA 5EP9A 2GH8A 3N9MA 2UYAA 4UBHA 1RYYA 1GANA 1Z78A 2VTXJ 3OYWA 4Q4V1 3O12A 3AKPA 1J83A 1NT0A 2ZJCA 5DDJ1 4E27A 4CYDA 3PTRB 3WNXA 1LOFC 2QQIA 1AR93 4QGMA 5BXXA 3SH4A 4XEZA 3PHMA 2JDHA 2ZMNA 2JDMA 4ASLA 1YIPA 5ISLA 1V6OA 4JGYA 3D8CA 2R16A 4OZXA 3VD7A 3E6CC 3DF0A 3WOGA 3T2PA 2YDEA 5KHIA 4COYA 5F8PA 4EZHA 3GALA 4PIXA 2P34A 3GZEA 5GLTA 5FO9B 4F8AA 2Q5TA 4F83A 2OT7A 4RR3C 1K5JA 1C5HA 1DHKB 1W9SA 4O9EA 3WF4A 3FUOA 4BU2A 1OI6A 1DIWA 1Y9GA 4LHKA 3I8TA 4KWUA 4A2UA 4AQTA 4E2QA 1RITA 1VPHA 1RC6A 2D6LX 3CL1A 3E5XA 4WM8A 4F7ZA 4CP0A 2ZGTA 2F4PA 1BEV2 4M4RA 1IKQA 2ZX3A 2VXRA 3WP6A 4INDA 4OQ9A 4EN0A 2VBPA 3UT0A 3WG1A 1AL22 5GLZA 4AFCA 5A7QA 3MZHA 4GWIA 2RDNA 3ZXGA 1OQDA 4QQHA 3POSA 1AYM2 1QJY1 5HCAA 2YBSA 1OHFA 5CB7A 2C1FA 4Y33A 5FZDA 2VR4A 3JB8A 3VZJA 1XNDA 4HN0A 1JOPA 2PXJA 4CDQB 3VHNA 5FY4A 2RVAA 4HN1A 3VZNA 4CSWA 2B42B 3TOJA 4OHWA 4B1MA 2LTNA 3AYEA 2WINB 4LUKA 4HK9A 5CFCC 1O3SA 3AVSA 1O4ZA 4IGOA 4AOCA 4DB5A 1Y43B 1PGW1 1XYNA 2IXIA 2XWBB 1M4WA 4JC1A 2VD7A 5FLIA 1NX9A 3WQ7A 4DEVA 1E5HA 3UGHA 3D5OA 3VDDA 3B7MA 4EV0A 5J96B 1DYPA 2WAOA 2O8OA 4K8FA 5K0UA 4B4PA 1SPPB 3WF2A 1LB2A 4LIVA 4LUMA 5FYUA 2YBKA 4M3CB 5HI0A 2VZTA 3S5QA 3KM5A 3LAGA 3VZMA 4CEWB 4CDXA 2PFWA 3WDUA 2VCAA 5IVVA 3PTYA 2HEYF 4GXLA 4W65A 3SCGA 1QEXA 3BOPA 4JDMA 4Q2FA 3T08A 2P6CA 3EMRA 1CAUA 4IE7A 5ABJC 3KS7A 1I6XA 1VRH3 4AI3A 1ND2B 1TE1B 1GQPA 1MZ5A 1RUC2 2R6QA 1RUJ2 4BXSV 3G6JB 1RHI2 5JDBA 1G9DA 3ITQA 3BU0A 5DZEA 5A80A 4JDNA 4RQPA 4A41A 3N7JA 3A22A 1IS5A 1TNRA 2WSVA 3LA2A 3AXEA 1CESA 4UXAA 3V0AA 1QQP2 3U14A 2RMU2 2R062 4XC9A 1AYM1 1ZYBA 4KH9A 2WS91 3MICA 3C2UA 5FQ0A 1BVVA 2R30A 5A32A 2RM22 4CE8A 4QXBA 3WX5A 1RUG1 2BU9A 4I30A 1X7NA 4LBQD 1NA1B 5A3OA 3K46A 3MW3A 4MVTA 4A7KA 5AFBA 1RUF2 2WFF1 3VN4A 1LOBA 1UYXA 5C9AB 5CA6A 3ECQA 4KL1A 4XF0A 1JZ8A 1W6PB 3AZXA 3RDIA 1D4VB 4QKFA 4YFWA 5F3IA 5LZ6A 1S0DA 4PDWA 4W50A 3I59A 2PHFA 2Z69A 3MIEA 5E89A 1WCUA 2ZGKA 3VKNA 2R49A 4NO4A 3BODA 3SH5A 2HWD1 1N1TA 4ET7A 1HQWA 4I09A 3E6BA 4YYOA 5C3SA 3AZZA 3IT8A 1N47A 1KDKA 4M3CE 3IKWA 4P00B 2ZX2A 4QU2A 5LASA 2VG9A 3IN9A 3IPVB 4LITA 5JSPA 1W03A 2E51A 4WVVA 3ZR6A 1ZM1A 3OPWA 3TN93 4Q4X2 4QB2A 4CEYA 1VBD2 3NW4A 4DRVA 2VBDA 4QQOA 1G86A 1DGWA 3IB3A 4XJWA 4CUAA 1F8VA 5L73A 1D0GA 1W8WA 2RDRA 1UOBA 3J9SA 1ZZBA 2V5DA 1AR63 2WLPA 2RS11 4M00A 3H3UA 4XQDA 5FZ3A 4RR3B 4BQWA 1VB4A 3RFRA 4MXWB 1RUH2 4LORA 4XMAA 5CKNA 1RUJ1 3LDBA 5A6QA 2DTWA 3JBG1 1VBA1 3WNLA 3OSDA 2GH2A 4XBQA 4A4AA 2AENA 2QKDA 3ZFEC 1QIQA 2K2SA 2R061 3KVAA 2QQLA 3C8XA 1DLCA 5FXVA 2A1XA 2VH9A 1XNAA 2RM21 4WV8A 2J1TA 1WCDJ 2P5BA 5FRAA 3WDVA 3R05A 4CPBA 2VO5A 2Q4SA 3U10A 1AR73 1JUIA 4L0PA 2E7AA 4NMIA 4TSVA 1WLWA 3RMXA 5K9YA 3MIFA 1LGCA 1LCLA 4CCOA 1SLAA 2ZEYA 1DF0A 4LNVA 1PGL2 5LBFA 2GNDA 3LIHA 4AGRA 3WNMA 2E26A 2A7AA 2ZOEB 3DKWA 5APAA 2B39A 1W2UA 4NROA 4XQ4A 1XPWA 5LRRA 3TEZA 1M06G 5IJRA 4ZPIA 4UFJA 3LKJA 4QM9A 4XJ8A 3RNSA 4KGGA 4GA9A 1H9WA 4CP2A 2LROA 1T2XA 3NKGA 1AZDA 4Q0SA 5GKAC 2GU9A 3OF1A 1JZ6A 1UMIA 4XAAA 2RDQA 2YYOA 3PUAA 5CFCB 2LUWA 1FT9A 1J58A 2Q8OA 4NIAA 4O7XA 1V00A 1ZRFA 1FAYA 5CVRA 4GH4C 2XVLA 4P5HA 2OPKA 3M3EA 4L99A 3N9OA 5T3NA 3USSA 3ATGA 5JSRA 2OPWA 1RUNA 1WGPA 4B4QA 3ACLA 1CAWB 1J3QA 1KGYA 1LHNA 3H1WA 3J7NA 3WW3A 1OA2A 1QXPA 5C4WC 2HWB3 2ES3A 5K4LA 3I2DA 4FXKB 1DFQA 1GFF2 2WNEA 2DFBA 3HEIA 5DQ0A 1A8MA 5IK7A 5CFDB 3AP4A 1W2OA 3SNMA 1FNZA 4TXWA 3OGJA 5C3QA 5ABJB 1AYN1 3BKZA 1APNA 3OEBA 2FQPA 3WW2A 3N9NA 3IIAA 2VM9A 2ZGNA 4OUMA 2VZ3A 3GXUA 4MO3M 4DUVA 1O7FA 1BCXA 3N9PA 4X6QB 1NCRA 4ASMB 1XB9A 5D8AC 3LPGA 3DL3A 2NP0A 2VBBA 1XXNA 1E5SA 2CAUA 3PUSA 2QQUA 3W58A 2XDVA 4JGZC 4XJZA 5EWSA 4Q4Y2 2C9KA 1AR83 2OVUA 2BVVA 2XJSA 1WUVA 4IEXA 3ZXEA 5KXEA 5F39A 1S2KA 5EV7A 2RJKA 1HXS2 1OKQA 4FFHA 3IBMA 3SLIA 4AVBA 5A6ZA 2XOMA 1STMA 4IV1C 4XF1A 2WC2A 5GLVA 4AG4A 1HDKA 2XJRA 4N9HA 3MHZA 3PUHA 2VUCA 3NO8A 1GBGA 4AQSA 1ULDA 1HW5A 1SZBA 4LULA 2AYHA 4JHZA 4Z07A 5FPUA 4B29A 1OF3A 1WW7A 3WW4A 1VMJA 1GR3A 2WKKA 3NV4A 4JTOA 5F5IA 4MSVA 5T5OA 4RFRB 2KD7A 2XQRA 4C91A 3KT4A 2UWAA 3WINE 4XE9A 1C1LA 1IS6A 2EXKA 1NOVA 2WQZC 2RS51 5T55A 3HN1A 4GD4A 1ONAA 1NCQC 4EWAA 3F2ZA 5D1IA 3ENRA 3LB9A 2G1MA 4BZ4A 4E4DX 5CU1A 1POV3 3H8UA 5SV8A 5EQUA 5AVPA 2UWCA 4LBQB 4XCAA 5DAXA 1XE8A 2E33A 3AZVA 2AZ5A 1FPN3 5HV4A 1PO11 1POV0 1QXRA 3LDKA 3ZX7A 4HG6B 5FY0A 4LO7A 4QQ2A 1AX0A 3AKTA 3LIGA 2ORXA 3BUCA 5M0TA 3O1UA 5JZGA 1H2KA 4YGDA 4TN7A 4YW6A 3VDBA 4P9YA 3POFA 3SC7X 5FR3A 3ZFEB 3M2MA 3PMSA 1QNWA 2XBO2 2QDRA 2ATFA 2R073 4YZ2A 2FMDA 1BK1A 4PCRA 2DUQA 2AR6A 5I8TA 3VD5A 2JDUA 3POWA 3KT7A 5EHDA 2VZPA 1W28A 1F35A 5FZGA 1OOPC 1CAVA 2DURA 3MEPA 3R4UA 4HONA 4K7JA 3VL8A 1OLME 2AGSA 2EIDA 2VULA 2VUAA 4AEDC 3WDYA 2MEV3 5A3UA 5DMYA 4Q4W3 4FTEA 4XFIA 4Y1UA 4UI9L 5CAZA 5IVBA 4J1XA 3MPBA 1OUSA 4P14A 5ACA3 3PURA 5I0SA 1D2QA 3P5BA 2E31A 2VOVA 4RL7A 4YVSA 3BN6A 3FMGA 1PMIA 2AH2A 4BQ2A 5LB6A 4YM1A 3CZUA 2VZOA 4MGTA 1PIV3 4HOOA 1CJDA 1L7RA 4UW6A 3UESA 3TEWA 1BBT1 3H3LA 4FT8A 3NV3A 5IT6A 2XVKA 1XNTA 5B4XA 3RPQA 4FCAA 1D4M3 4NIDA 4IEUA 2EA7A 2OZJA 5JMCA 3GHNA 4YG6A 3IDEA 4GH4B 3KV5A 4FAHA 1I1EA 3AL6A 3LEKA 3ZLIA 4XFBA 4E4SA 2LALA 5C4WB 4JTNA 1C8M1 1ST8A 5G05L 1YQ8A 1O3RA 3G7DA 2NPIA 5JUVA 1O4TA 3ZXJA 4DMIA 3AC0A 1NYWA 1VBB3 2PHXA 4CXYA 3ZYPA 1IQAA 2YHJA 4Q4V3 5CZKA 5FZ4A 1FOD3 1CZTA 2VXJA 5I0TA 3UNPA 4OQ8A 1CN1A 2VQUA 1V6JA 4N43A 1JHNA 1UY3A 2Z5WA 3E5UA 2GN7A 3KF3A 3ASIA 3PNAA 1DZQA 4KU8A 2J1EA 1I5PA 5HPOA 2BWAA 2DCKA 1LEDA 2D40A 2JG8C 5D8AB 4EWEA 1WBFA 5A1LA 1EUUA 3ZSKA 5J1XA 2HWE2 2XHKA 1W8NA 3WQBA 1GNYA 4XFCA 4AVSA 4QD2A 1FX5A 1OPMA 1IHMA 1OLQA 4JGZB 1RVF2 4OHXA 1AF9A 3WG2A 2B46X 2P1BA 3LE0A 2WWSA 4AGGA 1PVC2 2FDHA 5FPAA 3NQHA 5CG9A 2D3RA 1Y7BA 2Y60A 4HT1T 4XZPA 2OA2A 4ARYA 4Y1VA 4DXTA 4TWTA 4FI9A 4HZFA 5FP8A 3DPRA 3WG3A 4DFSA 2PHUA 4IV1B 1DGRA 1JZ4A 1MS0A 1YC61 2P17A 4NRQA 4C90A 4UBGA 3I2OA 3MV11 3TYJA 5KWRA 4UT5A 2ZGRA 2WT2A 1DDLA 1Q8QA 1QJU1 1VRBA 2HYKA 3R4DB 1DGRN 3BOWA 3E6DA 3I3BA 1REEA 4AI8A 2DBNA 2CHHA 4YG0A 1RUOA 4ISRA 3OPTA 3QCWA 2HWC2 4NHLA 3EB7A 1XU1A 2BW8A 5FLJA 3ZN6A 4YW5A 1E5RA 2PELA 2BBAA 1U5YA 3H1MA 1NCQB 2BFUS 2VUJA 1QJY3 3NNFA 4FPKA 2DFCA 2E9QA 3NRUA 4CXWA 2OQ6A 2W1SA 2BTVC 3D3AA 3WUDA 3CJIA 1DQ2A 1ND3A 4Y5TA 2A75A 1VAMA 3IDAA 2PLV2 2ZAHA 4AGVA 5CIRA 2Y6FA 1J1TA 1DCSA 2D6PA 1FATA 2HJIA 2HYXA 4QPIC 2IUWA 3APBA 1PM4A 4GKXA 2PHWA 5FY1A 4D8MA 1S0CA 4NAOA 2HWE1 1B09A 1H6XA 3AP9A 2DU0A 1XSRA 3B02A 3M4FA 1NKGA 1RVF1 4P5YA 1TG7A 1N1VA 1WMXA 4YRDA 1PVC1 2R041 4HVOA 2OIIA 2GN3A 3PDQA 4FOWA 1YNAA 2ZCWA 3ORJA 4I0WB 1AXZA 1L7QA 1HV1A 3ACIA 3AP7A 4XVHA 5FXZA 3WT3A 1OOPB 3DYMA 1UOGA 5IW0A 3JB4C 4AEDB 4UFIA 3NNMA 2D97A 2ZEWA 1RUE2 3R6SA 4MZUA 3WY6A 4IE4A 1BEV3 2CNAA 2VMDA 3BALA 3DGTA 4J25A 2VUDA 2WA4A 5FPLA 5FOBB 4Q29A 3UGFA 1GP6A 4LR4A 1CIWA 1VAKA 1AL23 5JR2A 2HWC1 1IZ3A 4DO0A 1UCXA 1EP0A 2WZR1 1W6QA 2QNKA 2PYTA 3M70A 3TAYA 2YGLA 5A1AA 5CNAA 1AYM3 2BFUL 3FWEA 4W4ZA 1QWRA 5IYYA 5KXDA 2BVBA 4R52A 3TRSB 2ARXA 3Q8CA 2A3XA 1YEWA 2XG3A 1U12A 3WQ1A 2CY6A 4LHNA 1KS4A 3W21A 2PLV1 2GC0A 2HEVF 2V5YA 2BOJA 1HKDA 3GBGA 3IAQA 4JKLA 5G04L 5T5JA 4CUCA 5CISA 1SCRA 3AP6A 1UL9A 1CX1A 1OSGA 1WMFA 4QPWA 4ZKTB 2JE7A 1RTVA 2X5IC 1TVGA 4U36A 1E57A 1Z7S1 3AZYA 4MHUA 2WT0A 4AYUA 5F9TA 2WO2A 4JX0A 3RI8A 4RHV1 3VBHC 4IEVA 4NHYA 1NE4A 2Z79A 1COV2 1GWKA 1FV2A 5FY5A 4IE0A 4BDVB 2JG8B 5BPXA 5LEKA 1B35C 5T5PA 4EE2A 5L9RA 2CU5A 4YW7A 3K4AA 1RJ7A 1BHGA 4Q27A 3UJOA 1H6YA 1XRUA 4MGKE 2XLAA 3ZYFA 1ZRRA 2B45X 2XJPA 3AMMA 2FZ2A 2R1DA 3EQEA 3LEGA 1UXXX 3GZAA 1X9TA 3URFA 1RUC3 3VHPA 1CD3G 4WM7C 1RUJ3 5K7PA 1RHI3 1D7PM 1EV11 4D69A 4JRLA 1W6OA 1TMF1 4SBVA 4YGEA 1QH7A 5FZ9A 2QQPA 2VZ1A 1VBE1 1ULCA 3LD8A 1QQP3 4ZXKA 3SEPA 2RMU3 2R063 3EJKA 4L11A 1KFUL 1I5ZA 4BIFA 1HB4A 2UY9A 3WUCA 3A7QA 2FCUA 1LENA 2RM23 4FQZA 1LESA 3UETA 5FPXA 4NPMA 2CAVA 2WNUC 3KHCA 5FP9A 2ZMLA 4U2AA 1RUF3 1ZZ7A 2XJQA 3HPNA 4I02A 4IESA 5B2GB 1Y4WA 1K12A 2HBUA 2D7FA 4HPKB 4XHBA 5F6LB 2PN5A 4A6OA 3AMQA 3WDTA 5DDJ2 1ZBA1 2PAMA 4ZZ8A 3AL5A 4Q0PA 3WCRA 1J3PA 2WQ4A 4ZS3A 4ZS2A 1WZXA 1OURA 2YG0A 3GF6A 4BJ0A 4BYYA 2YZ4A 3HWJA 3S7IA 1GZ9A 1OUXA 5JIAA 3T09A 3V65A 4AR2A 1O3QA 1CGPA 3HBZA 5DAPA 4QPIB 3ZYJB 3AB0A 4H7LA 5DZFA 2P4EA 1S0FA 3MPPG 5J37A 4BLIA 1C4RA 2BUKA 3I2GA 1IS4A 5FK8A 3KVBA 5I91A 5FWJA 4Q4X3 1VBD3 4ATEA 5C8CC 4NJ4A 1QOTA 1VP6A 1QU0A 5F3GA 2YBPA 2XL9A 5DPNA 3VKFC 3C7FA 3CIHA 1OBNA 4PLNA 5FYYA 1JU3A 3U75A 1DZRA 4ZZ5A 3LFMA 5C5TA 3AJYA 1XYOA 3ZYRA 5FAXA 4AEKA 1RUH3 3PJYA 4PQ9A 4CVUA 3ALQA 4EYUA 1US2A 1WCQA 2EXJA 2DVBA 2R0HA 4NRPA 1W8OA 2XXZA 3WDWA 3RZHA 1LHOA 1W9WA 4XFAA 1BQPA 3POIA 2OUHA 4XZUG 3QOPA 2GP5A 4ASKA 5CKMA 5IUQA 1OH3A 5FZOB 4BB3A 2WO3A 1QJEA 4CDQA 1NA1C 1SLBA 2VL4A 3KQ4B 2XR4A 4FVVA 3DXTA 5F2SA 4IEPA 4W6YA 1TME1 3OG2A 2G9FA 2GNTA 4P9IA 5F5QA 2HWF1 1GWMA 2F6BA 1UW8A 3FBYA 2ETEA 3LZZA 2GNBA 4P08A 3P6BA 3VBUC 4MH0E 4ZY9A 2ILMA 1GP4A 4QT6A 4A7YA 4OHZA 5DUUA 4AW7A 2A73B 3OGVA 5DG2A 2F17A 3GYDA 1OD5A 3ZSLA 4LKEA 1AJKA 4BQ5A 4IEOA 4LE3A 2VECA 2YC0A 1UYZA 2QCSB 4B7EA 1GYKA 4K9SA 4M3CA 5D21A 3VHRA 3B9IA 1PGW2 4CEWA 3MV01 3OJBA 2X5IB 3VBOA 1BMV1 3LF7A 1G9AA 5HCFA 2IC1A 3OEAA 4I0BA 1JZ2A 3ZKUA 1LOCA 1MR5A 1JYWA 3VBHB 4H3WA 4YZ1A 4AL9A 1ND2A 2IVJA 4UOJA 1XE7A 3NWKA 4YNIA 3J8F1 5I0UA 2DCJA 2FD8A 3HT1A 3OBRA 1ZX5A 2F4LA 1B35B 2RE9A 2ZKLA 4LA3A 5FDBA 5JI9A 5JOXA 2I2SA 4BK4A 5FO8B 4GJYA 1AHSA 1QDOA 1UYPA 2DUOA 4GZ9A 4QX5A 1XJAA 4XW3A 1BXHA 1H0BA 2VCBA 2W5FA 1ENXA 5BNOC 1IQDC 2WRAA 2ZGLA 1C1FA 1NZIA 1G6NA 1G7YA 1R082 2ZAAA 1DQ1A 3ZXDA 3GM8A 2KXLA 4WM7B 5C9AA 2B9VA 3AK0A 4DUXA 1LHWA 3PVEA 5K8SA 1W90A 3M3OA 4HL0A 3AJZA 1W6PA 5LEJA 4N90A 2XWJB 5LRSA 3POGA 3LA7A 2JG9C 2WS92 2XQXA 2LM3A 3LGRA 4ES9A 4Z2AA 1UKGA 1UYYA 1MQTC 2E63A 4Q4Y3 1V6KA 1RUG2 4LHLA 3ZPOA 2BZDA 2FBEA 3IM0A 2WFF2 4LLFA 5FZ8A 2P2KA 1L3JA 1LOFA 2WABA 3HT2A 1HXS3 1SLTA 2WNUB 2ZHMA 4GIQA 4QX1A 5GZGA 2ZZJA 4HXCA 1OQEA 4FFIA 1SMVA 3IPVA 4KWJA 4FTSA 4G4FA 1UY1A 2DCZA 3O14A 1HV0A 4IV3C 4S2DA 1GV9A 1IOAA 1OFNA 2HWD2 4LOSA 1PM7A 4CU7A 3NJZA 4XPVA 4EN8B 1J84A 1H2LA 2EALA 2VOTA 4RR3A 5FZMA 2BRTA 1XE0A 2Q8EA 4KU7A 4MXWA 4L92A 5FZFA 3BYWA 4QKNA 4QDSA 5GZCA 4NIIA 2ZTNA 5BNNC 2P6HA 2WZ8A 3CMGA 5CFDC 4PDWC 2XVGA 3FLRA 2FCTA 5A3LA 2RS12 2I45A 3WG4A 3N7KA 4XIOA 5C8CB 3KHBA 1MS4A 3USUB 3LEMA 3FFQA 5GZEA 5E88A 4Q8KA 3ST7A 1R081 1PX3A 1WA4A 3KB5A 4GKYA 1UQXA 1QGLA 3JBG2 4I3PA 4D7SA 3VD9A 1VBA2 5IK5A 2W1QA 1EAH1 2VQTA 1ASJ1 2CYFA 1LJ7A 1H8TC 1JN2P 3HNBM 5IHRA 2VTFA 1MEC2 1UIJA 3DKQA 1O5UA 3VUOA 4LKDA 1EYBA 4XDOA 4AVVA 3DCQA 2XBO3 1ENQA 3S0MA 4ATFA 4BMEA 2IXHA 4B3NA 2BQPA 5JPMB 3HQRA 3C7HA 3BCWA 1GZCA 4MGZE 4XABA 2E7TA 4Q1RA 3QACA 4MX3A 3AKQA 4QKDA 2CGPA 3SKVA 1W3VA 5CFCA 1X8EA 2ZGQA 2B7YA 1VBC1 4UFLA 1ULPA 4A45A 3VBUB 5BNPC 4DPNA 3L2HA 1IGOA 4GMP1 2QJVA 4IE6A 1WW4A 2KM2A 5T52A 4QPGC 3LSEA 1R091 2WJSA 2VE1A 1SG3A 3B5LB 4PI2A 3R0RA 4LXLA 4PF5A 2Q1ZB 3O1PA 3AVRA 4XDQA 3PIJA 1JODA 2IZWA 1OFSA 1V0AA 2OW4A 2OZ6A 2WYSA 3IZOA 5FY8A 4Z92B 4P9JA 4S2HA 1QJZA 1W8UA 2BEOA 2OX0A 5LATA 3AYCA 3ME2A 3OGGA 5ABJA 3J7LA 3OOXA 4S2FA 2OKXA 2XPJA 1PNFA 4YZ4A 3ILNA 1KQRA 1OT5A 3JZVA 2FDKA 3U4XA 5ERLA 4YW1A 1W6NB 3RZZA 3UK9A 1HN1A 4XYXA 1W8ZA 1XYPA 3KT1A 5JSOA 3K75B 2JDPA 3GJBA 4IDZA 1RUI2 3NV2A 3RZLA 1AYN2 2C24A 4IXLA 3PJQA 5BNOB 1MEC1 1AXYA 3ZM8A 4A6SA 1DP0A 4L97A 1W2TA 5A33B 1H2NA 1SFNA 1CR7A 4MGQA 4LBJA 1QDCA 2VZRA 2V4VA 4RGGA 5FJHA 2UY8A 2VOWA 3SQOA 5L19A 3B00A 5FYZA 2JDNA 2VJXA 3W9AA 2HWE3 3I3EA 1AUYA 2DCYA 2JG9B 4BOWA 5KHJA 2CSGA 3LPFA 5GLWA 1YFUA 2EXIA 4CP9B 3S7EA 4Y4YA 4K6BA 1RVF3 1OLMA 2WDBA 1MQTB 2WBKA 3ZPYA 1Q43A 2V4AA 1PVC3 1T6BX 2OQ7A 3JD72 4XURA 3NNLA 2UYBA 1RXGA 5JXGA 2QQNA 3GJAA 1YQ5A 1SFYA 4M0NA 1PNGA 3PUIA 4KG8A 3T1LA 5FV3A 1JZ7A 2GALA 3H8OA 4R9DA 4OUSA 5A3MA 2ZS6B 2XH6A 2E6VA 4W8JA 4PJYA 4DEQA 4MHRA 4CDWC 5EZWA 3EYPA 4IV3B 2YPDA 4BIOA 3RS6A 3U1XA 1Q5OA 1GOFA 1JXNA 2VGDA 2W9XA 3KGLA 4QDRA 2DF7A 4YZ3A 4LTAA 4COZA
chains in the Genus database with same CATH topology
3OTFA 4LBQA 5FFOC 3VBRC 1NQDA 2RS52 2HWC3 1TNFA 4YM2A 1SLCA 3UL2A 4R8HA 5BNNB 4FPGA 3AYDA 4PDWB 4HMZA 2DVDA 3FUQA 1GSLA 3EO6A 1RUI1 3ZFEA 3BTAA 1FXZA 4LLOA 1F31A 2X8KA 2ZPXA 1PO12 1YXWA 1S0GA 1H4GA 1DZTA 2PLV3 2ZX4A 4YGBA 3VGIA 5KXCA 1KITA 2XL7A 1YLLA 1H8TB 2GAUA 1A8DA 3M1HA 4Y22B 2VW1A 3WHUA 2H0BA 1MS3A 1QNYA 5KHHA 4ZU4A 3EHKA 3JD71 5IK8A 3ZIWA 2JEMA 1A78A 2JDZA 1ULEA 1PO22 4GWNA 2EXHA 1V70A 3AKRA 1CAXB 5BNPB 2XKPA 1RUE3 2ZZQA 1IKPA 1LGNA 4QPGB 4GH4A 2UU8A 4AXOA 5C4WA 3M8LA 1YI7A 1BBT2 1AR91 4BPZA 5BNQA 1ENSA 1VAVA 3VBSC 2RS32 5GJ6A 1WLCA 1YFWA 3VBFC 1UIKA 3ZXLA 1C5IA 4EN7B 1C8M2 1REDA 1YO8A 2NN8A 5JOYA 5AVAA 2PTMA 3O0VA 4GWMA 5D8AA 4WVMB 4HKWA 1LEMA 3TB0A 3ZXKA 4LO5B 5JCTA 4JGZA 3AP5A 2ZKNA 2N7GA 4MV2A 5J7MA 4XFFA 3ZFFC 4Y1YA 2JD4A 1COV3 1N1SA 3H3ZA 1WLDA 1X8MA 2VU9A 3ZFGC 1QHDA 4IV1A 1PO21 4BH9A 3M3QA 3ZVXA 4AHYA 1T6GC 2WA3A 1KS5A 3N7MA 4FPEA 4Y20B 4Z1VA 4LO4B 1SEFA 1NCQA 4C0HA 4CDWB 3U07A 1QJU2 3JQWA 2RS31 1KJRA 3ILRA 1I9RA 3VBRB 2VVFA 4KG0A 3E97A 3RMYA 1WW6A 3MFAA 2TBVA 3FLPA 4K20A 2ZA9A 1O3TA 4FAGA 1UMZA 5DDJ3 4RA0A 2A6VA 4HSJA 4Y1XA 4E2SA 4HVRA 1DU3D 4DZGA 2CL2A 1MS1A 4R9CA 3T2TA 1MS9A 3CO2A 4XMIA 3WR0A 5KHGA 1HQNA 2VNRA 1UPSA 5LK7B 1OOPA 3RJRA 3FJSA 1K5MC 4AEDA 1WMEA 2PAKA 2JX9A 2VVEA 1F5JA 4PLOA 2R042 3NAPC 3MLKA 1D0HA 3IMNA 3VZLA 2WIIB 4JAAA 4YM0A 3ETQA 1FYUA 1W39A 4MGYE 4YGCA 1UD1A 3S6PA 1J1LA 2E53A 3MFCA 2H6CA 3GZTB 3A0NA 1DQ4A 2YXSA 2VVDA 4AHXA 3P3NA 2VQ0A 4FPJA 3TNPB 4KWLA 5DZGA 4O9GA 4LBLA 4OI1A 1X50A 1QOSA 4WVZA 1JUHA 1LU1A 4XHXA 3WDXA 2WZR2 1OLRA 4QXKA 2VY0A 5EYYA 4KGQA 3VBSB 4KQ7A 4QGNA 4WZCA 2WNVC 1H2MA 2JE9A 1VIWB 1GKBA 3TN91 4E4ZA 4ITCA 1CPNA 4RGAA 5EYXA 3VL9A 3VBFB 1C57A 2Y26A 4YVWC 4COUA 1AR61 4ZU5A 4AQ2A 4H14A 2JG8A 3MI8A 4DXZA 1PZ7A 1FI2A 1Z7S2 3OY8B 4HLTA 3VZKA 4W6WA 4RHV2 4YW3A 1H1AA 1PK6C 3MIGA 4AFMA 2KA3A 3ZFFB 4Q0QA 2VMIA 3RYKA 1O4YA 1ZBE2 2CWMA 2E7QA 1QXJA 5T50A 3ZFGB 4J1WA 3SHRA 1Q8VA 2BWCA 2DU1A 3PVBB 1AR71 2EAKA 3ZSEA 1G9BA 1MVQA 2WL1A 3M3CA 3QH6A 2ZGOA 3AZWA 2WT1A 1RB8G 4CDUC 3D6EA 2D5FA 2D3SA 2GC3A 3KQRA 5KXBA 4N9IA 1DQ6A 1R083 1RINA 1CVNA 3WW1A 1EV12 4IEQA 4HK8A 3CEWA 4B7KA 1TMF2 4OLLA 1VBE2 4HPKA 4FO9A 4N7UA 3O5SA 2WS93 1U5ZA 3IWZA 4XIKA 1QOOA 3X29B 1RUG3 4AK3A 2D98A 5GM0A 2DV9A 2WFF3 2DVGA 3VKMA 3VV1A 1NXMA 4QPIA 4MLOA 3H7JA 4JV4A 2VOXA 1Q3EA 3ZDSA 1ZBA2 3Q9OA 2HWB1 2IXKA 4BCUA 1W6MB 2JKBA 3PVNA 4XXAA 3D82A 2BNMA 2HWD3 1YJKA 2JJ6A 1HRV2 1PHMA 5H9SA 3GNEA 2GZWA 1Q8OA 1HX6A 4ZU7A 3ZXFA 4AI0A 1ZBE1 4BM8A 4XXPA 5C33A 5BY5A 1K5MB 1KXGA 4XTPA 5I0RA 1UX6A 1OA3A 1RL3A 4RFT0 4OHVA 2K0GA 1VLNA 3A4UA 2RS13 3NAPB 3MIDA 4N53C 4M0HA 1AR81 1OPOA 5FMOS 4Z82A 3VKLA 2ARBA 2BBVA 3JBG3 3N36A 1AJOA 1NY71 1VBA3 1QMJA 4Y24A 1VALA 3FX3A 1RMU2 3THTA 2P37A 2G4IA 4P9XA 4LO8A 4D3WA 1MEC3 1LOAA 5L7OC 1BKZA 1VJ2A 2GMEA 4MGIE 3SXWA 4H55A 1SACA 5JOWA 1LU2A 4KBBA 5FPZA 3FBMA 3V0BB 1TME2 2HKXA 2YMZA 4E9KA 5J36A 2HWF2 1XQNA 4N7IA 1ZVFA 5AFEA 3KMHA 3AFKA 4AI1A 4RS5C 2X5IA 3MW4A 4QHBA 4URTA 2WNVB 5JVVA 4Q0UA 2ZGUA 4X6RB 1WW5A 4GULA 3VBHA 1CJPA 1HRV1 1POV1 4YVWB 2AREA 1AXKA 1W0PA 4PBOA 3WD5A 4E2GA 1FPN1 1Y3TA 1B35A 4YW4A 4A3XA 1BMV2 3ZMOA 1D2SA 3A0KA 4NR1A 2NZ9A 2C5DA 5KBFA 2TUNA 5GALA 1ZREA 2A71A 1FNYA 3LCPA 1ALYA 1PK6B 1V6MA 3J4UH 3J8F2 4EROA 2R071 5T5LA 4AF9A 3KZ4C 1C3HA 4BQ1A 1A3KA 3MW2A 4WM7A 5FMOL 1AL0G 4OFGA 3N7LA 3LA3A 1FMD2 5DUVA 5KC5A 4JGYC 3GBFA 4L8QA 1RUI3 2B5HA 1OMIA 1AYN3 1RMU1 4HBNA 2D6NA 2MEV1 1G9FA 5GZFA 4CDUB 1WD3A 2IFRA 4CRQA 4FPHA 1UU5A 2WNUA 4NN0A 2VOKA 1GZWB 1YFYA 4LEJA 1QKQA 4AI2A 3L2YA 1V9U2 4WM8C 3RRDA 1PIV1 4AE2A 3W59A 3OD4A 4XF4A 2D44A 3HIFA 3AYAA 4L9BA 3JD73 4OI4A 2RJLA 2PAEA 4IERA 3B9CA 1NLRA 1S0EA 2PHTA 3WVJA 4J6GA 3KCCA 2D43A 3ZSJA 4DOUA 4TZDA 1W6OB 2G9GA 2QVSB 1DQ5A 1VBB1 3B3QE 5C8CA 1X36A 3MIHA 5C6CA 4CTEA 2D5HA 3USUA 3D4KA 1FOD1 3ZYIB 2WLQA 3OD0A 4RSUA 3MYXA 5E16A 5I93A 1QF3A 4BLJA 4LBKA 2RS53 1ZZCA 2PHRA 1BVP1 3ES1A 3UKVA 1X82A 4LE4A 1YYNA 1FMD1 2VW0A 3H9AA 1CQ9A 4X8PA 4N53B 1PO13 4LT5A 1NA1A 3VDDC 1CPMA 4DY5A 1EAH2 4QPYA 1ASJ2 1JYIA 2XKOA 5K0UC 1GLHA 3ZSMA 3LSDA 1PZ9A 4CDXC 1EPZA 4PBPA 2A70A 3KGZA 4YW2A 1V9U1 4FSJA 3VBUA 3B93A 3JQXA 4R4XA 5L7OB 1KRIA 4BHPA 3IDBB 4XETA 2PQQA 4WVWA 4AVCA 2P3KA 5KHKA 4AQ6A 1PO23 1VBC2 2A5ZA 4RQPC 5J48A 2EAAA 4RS5B 1JYCA 3WCSA 2B8MA 1XNCA 1R092 2A6YA 3VZOA 4DS0A 4GB32 1HRI2 3HMYA 1N3OA 1LTEA 2QZ3A 4FPFA 2OUJA 1DQ0A 2GDFA 3KCXA 2JECA 2ZHKA 5I8SA 1UZYA 5JWPA 1BYHA 4Z2WA 1W6NA 4FOQA 2P3JA 1BBT3 3ZN4A 1N1YA 4TYSA 5AC92 4XOGA 2EVXA 4CP1A 3SCFA 2W0XA 4P9LA 2RS33 1QJX2 2ET7A 3MLJA 5BNOA 3WZ1A 3OYWB 1YWKA 1YIFA 1G9CA 4FPCA 4META 4V1PA 5A33A 1I3HA 2PA7A 3ZO0B 3WP3A 3C3VA 1C8M3 4OULA 2Y0IA 2XJUA 3JU9A 2Q0AA 2DYCA 5J3UA 3GZUC 4JGYB 5HBAA 1LRHA 2JG9A 2JICA 1H9PA 4CEYC 3VBOB 4ONUA 1MQTA 2W39A 3MGUA 2X53S 2BNNA 1PGSA 1BEV1 3B69A 2YROA 3NV1A 2GSYA 5JR7B 1Q56A 3FFZA 4AWDA 2QDNA 2MNGA 4QMAA 1AL21 1RUD2 4COVA 4ES8A 1F9KA 4WM8B 2IFWA 2ZABA 2IXLA 2GC2A 2MHFA 4IV3A 3ZMNA 3LOBA 3WLUA 4JQRA 3QH7A 1XU2A 3RI9A 2UURA 4BMBA 4GB31 4CZSA 1HRI1 2CV6A 4A7ZA 1CAWA 2W08A 1ENRA 4NHMA 2A3YA 4F3JA 2D6OX 4AEJA 4DINB 1RJ8A 2VMHA 5AC91 5BNNA 5CFDA 1F2NA 5E1RA 1Q8SA 1QJU3 5SV5A 1QJX1 2UWBA 3HD8B 4XBLA 4OHYA 2BYVE 1MACA 1X33A 3PVOA 1RIRA 1UZZA 3RWNA 4LBNA 4FTBA 4GALA 1S0BA 1U5XA 1H8TA 1YHFA 2O8QA 2ZX1A 1H8VA 3M7AA 1ZRDA 4C0BA 1IS3A 1MS8A 1R1A2 4Y22A 4TLFA 4XFHA 1AVBA 1WCSA 3WHTA 3MIBA 3VDDB 3O0WA 4OVEA 5K0UB 1RUC1 1RHI1 5JPNB 4CDXB 1PVXA 1RUD1 5J09A 4S2GA 3CNAA 1CAXA 5BNPA 1WLTA 2D3PA 5FREA 3OBTA 1CAUB 1QQP1 1EY2A 2O0OA 2R043 2SBAA 1OQ1A 2RMU1 3BPZA 1ZA4A 4QPGA 4NPRA 2RR12 1ZZ6A 4XF3A 3KCYA 1NCRC 2BPA2 4K1ZA 4HVQA 4BA6A 3I4IA 1GNHA 4YFZA 3TNQA 2NM1A 4RQPB 1RUF1 2VNOA 4R9BA 3V0AB 5H9RA 4D94A 1S0JA 4WBBA 4JDOA 5DUXA 5FQ0B 5A32B 3SISA 4XILA 3UJQA 1MS5A 1AR92 3KSCA 3CU7A 2QE3A 1CONA 4BWOA 4WVMA 2BGCA 1KD7A 3CJXA 2WZR3 5FCCA 4FP3A 5F6KA 1YUDA 4FPYA 1VB2A 2VW2A 1RGSA 3I59B 2R0FA 4FBFA 4X8NA 1R1A1 3RG0A 4XQWA 1BZWA 4Q4X1 4FPOB 4IQPA 1HLCA 1VBD1 3AKSA 1H1IA 2I74A 1ZZ9A 4AHWA 2Q30A 4RD7A 3H1YA 3K51A 3T1MA 2ENRA 2OYZA 4UW4A 5CG9A 1UF2C 2A6WA 2YPJA 5BYNA 3RQ0A 3DV8A 1RUH1 4MXVA 1Z7S3 3ZN5A 4CEYB 4RHV3 2D93A 2ZHNA 3ELNA 1DBNA 1F5FA 3D0JA 1LHVA 1S1AA 3GHMA 4DNYA 2RR11 4I0AA 4Y20A 1ZBE3 4FOVA 1HQLA 1LODA 5JOZA 3JUUA 2YV8A 4QQPA 5JZGC 3EXUA 4CDWA 4K40A 4M3CF 5BV6A 1J3RA 1V6LA 2RHPA 3PMEA 2K9ZA 3DUIA 1PGL1 2CGNA 2DCTA 4IL7A 3VBRA 4JRAA 1G8WA 1EV13 1H4HA 3RSJA 3RYRA 1N3PA 4H7MA 1TMF3 4YARA 1LGBA 1SQ4A 1VBE3 3AMHA 2Z42A 2XB6C 4AVTA 3V56A 5EFUA 3KD4A 4MYEA 4XJUA 2DWRA 2GC1A 4L2NA 3R4SA 4Y26A 1SBFA 4R9AA 4LBMA 2C9AA 5GZDA 1AX2A 1Z0HA 4NWVA 1LKNA 4COWA 3H7YA 1XNBA 3K48A 5TSWA 1IPKA 2IXJA 4YVSC 1TQ5A 1ULGA 2NLRA 3V64A 1MZEA 1UU4A 1REFA 2XGXA 3ZYGA 5JI7A 1ZBA3 4Y1ZA 1BJQA 3O0XA 1DYKA 1NQJA 2NMNA 1LOGA 1NLSA 2DVFA 3FE5A 4HANA 1HRV3 1VRH2 4Q8LA 4M01A 1KJLA 1N3QA 3AXDA 1WCKA 4YM3A 3RJ2X 2PHDA 1H30A 3OCPA 3VLBB 4EN9B 2VPVA 2VNGA 5HXVA 3AFGA 1R1ZA 2O1QA 2FZ1A 4N43C 4AFAA 4Q4Y1 5DXDA 3NVCA 1IPJA 1NCRB 1YJLA 2ZGMA 2YUEA 1HXS1 1TEIA 4C1WA 3SCHA 3H50A 4I01A 3VBSA 1J59A 1RMU3 3INAA 2QFEA 1XNKA 2YY1A 4OI0A 3AMNA 2Y38A 1GICA 2P3IA 3VBFA 3VHOA 3B94A 4Z8BA 3FHIB 4FQ4A 1TME3 2B9UA 5CG8A 3DPRC 2HWF3 1ULFA 4YLZA 4UW3A 4AFDA 1JTZX 3OY8A 4FOYA 1O91A 5J98B 3TN92 4YG3A 3PLQA 4LA2A 5FTTC 3ES4A 3BU7A 4Q1PA 5EJ3A 1AR62 2ZBJA 4XTMA 3ZFFA 1VRH1 2NQYA 2W52A 1CX4A 2BNOA 4XF9A 3ZFGA 4DY3A 3POYA 3LWCA 2CTVA 2R1BA 4IEWA 4PIYA 5CADA 4MUVA 5L36A 1ZZ8A 1QY4A 3CJIC 1ND3C 4HKOA 2MPFA 1QH6A 4I2OA 2AUYA 2XBO1 3J8F3 2WFPA 2XLFA 1SCSA 1AR72 1U5IA 3CLPA 4FPLA 1WBLA 4P9GA 5JZGB 1AX1A 3HQXA 1FMD3 2XJTA 5BUVA 3NL1A 3UV9A 1MZ6A 3S30A 3P3PA 4HKLA 4G9SB 4EWDA 3ZXAC 3WXPA 1PZ8A 5GLUA 3UKTA 2I07B 4NVPA 1C28A 2CWSA 3MF9A 4OI2A 2ZHLA 3THPA 3O7OA 3RYPA 1CAVB 3BB6A 1GQHA 4AFBA 1V9U3 2XJVA 1URXA 2HEWF 1W6MA 3M3IA 1NZCA 3U0ZA 1HIXA 3TWIA 4DRRA 4C1XA 1ZRCA 3MLLA 4YVSB 2ET1A 2WSUA 4ISQA 4D7YA 4Q26A 1O5LA 2SLIA 2HWB2 2IXCA 1UKRA 2YGMA 3HR9A 3NSTA 4I3GA 1K5MA 4SLIA 4XBNA 1S2BA 4FP2A 4NHKA 2EF6A 3MDPA 3NAPA 3QBQA 2JXAA 3OPZA 1WMDA 1YRZA 2A3WA 3FC0A 4QQLA 2DVAA 2DUPA 4K3UA 1UAIA 1VR3A 1SDWA 5FO7B 4GQ7A 1SLLA 3D0SA 1V6NA 2A6XA 5FBZA 3DN7A 3N4MA 1AR82 4N43B 2ZACA 3WP5A 4P9WA 1NY72 1UU6A 1YI9A 3V0BA 1LECA 2ZMKA 3I7DA 1EAH3 1ASJ3 4AVAA 2PHLA 4LO6B 2EIGA 1YFXA 4JVAA 1YCIA 1S55A 1SBDA 1GQGA 1JW6A 2JENA 2WNVA 5H9QA 5CBLA 1MZFA 3N3HA 2QZ2A 5E8AA 3HAGA 2ZGSA 4YVWA 4G3YC 3TBDA 3WP4A 1LHUA 1NE6A 4HETA 1DGLA 2ERFA 1DLLA 2VMGA 4XFGA 1OA4A 3DPRB 1H1MA 3SH3A 1KDMA 3H0OA 1S0IA 1VBC3 4IETA 2Y0OA 1NG0A 5T54A 4GMP3 4WZFA 4AEMA 2X29A 4PIZA 1R093 1PK6A 4GB33 4GMP0 1HRI3 2GMPA 4QM8A 5HCBA 3GBWA 1FPN2 2V73A 3ZIXA 1JH5A 2VQAA 3ZN6B 5AC93 4IEZA 5H9PA 3SMHA 3AMPA 5DUWA 1Y9QA 3I54A 1QJX3 4LBOA 2R072 3L9JT 4EN6B 4CDUA 3CJIB 1ND3B 2V09A 3ILFA 1LR5A 2R32A 1SLIA 4UW5A 4HFSA 1GZWA 3B01A 1JBCA 5KC6A 1FV3A 2MEV2 4EJRA 1DG6A 3QLQA 4Q4W2 4QGLA 4D7TA 1MVEA 3E5QA 2A6ZA 5ACA2 3AM2A 1RUE1 2IWGB 4XJAA 1SBEA 4HSLA 1DGWX 4ORFA 1C8NA 1PIV2 1RUD3 3NKTA 4R4ZA 1GNZA 5C8WA 1D4M2 3WQ0A 1U0AA 5I8YA 2NMOA 4AHZA 2Q1MA 4CDQC 1EPWA 2D6KA 4K1YA 1V6IA 1KFXL 1NXD1 2ZX0A 4IEYA 2FHRA 5JIUA 4B4RA 4B8EA 2WZPP 3SITA 1VBB2 1A6CA 1W6QB 4K21A 4YSFA 2ZGPA 2C0ZA 2QUOA 4Q4V2 5JAXA 3J26N 3LOIA 1FOD2 4JCKA 4N53A 2FMYA 5DG1A 3U11A 2CGOA 3VKOA 1UN1A 2NYYA 3WV6A 1COV1 3KLSA 2GNMA 2DTYA 1Q8PA 2H6BA 1WD4A 3ROUA 4CEWC 5LK5A 3VBOC 1LULA 1R1A3 2TNFA 3FLTA 4Q4W1 2XLGA 4XJ9A 5L7OA 2GMMA 2Z2SB 4Y5Z0 5ACA1 5IK4A 4FXGB 1ND2C 4DQAA 2XUMA 4BE3A 3FZ3A 3CF6E 5FLHA 3BIWE 3N35A 2H0VA 1UPIA 4RS5A 5F1RA 1JOJA 2W68A 1LOEA 1ZNPA 1D4M1 1W0OA 3MF6A 3AX4A 2RR13 3IDCB 4NOTA 4KWKA 4PLMA 3QD6A 4Q0VA 5C9AC 4W6XA 2D6MA 3UKNA 4NWWA 3EBRA 5FOJB 1QJY2 4KNCA 5JLVA 3JCIA 2TEPA 2GH8A 2UYAA 4UBHA 1GANA 1Z78A 3OYWA 4Q4V1 5DDJ1 3O12A 3AKPA 2ZJCA 4E27A 3WNXA 1LOFC 1AR93 4QGMA 5BXXA 3SH4A 4XEZA 3PHMA 2ZMNA 4ASLA 1YIPA 1V6OA 4JGYA 3D8CA 2R16A 4OZXA 3E6CC 3DF0A 3WOGA 2YDEA 5KHIA 4COYA 3GALA 4PIXA 2P34A 5GLTA 5FO9B 4F8AA 2Q5TA 4F83A 4RR3C 1C5HA 1DHKB 4O9EA 3FUOA 1OI6A 1DIWA 4LHKA 3I8TA 4A2UA 4AQTA 4E2QA 1RITA 4WM8A 1RC6A 2D6LX 3CL1A 3E5XA 4F7ZA 4CP0A 2ZGTA 2F4PA 1BEV2 1IKQA 2ZX3A 2VXRA 3WP6A 4INDA