3E6CC

Cprk ocpa dna complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
225
structure length
225
Chain Sequence
b'DFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSEQTSYYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide-binding protein
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation/dna
total genus 70
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00027 cNMP_binding Cyclic nucleotide-binding domain
C PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e6cC02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e6cC01
2D93A 4M6YA 4IF4A 2Q1ZB 1HXDA 4YG2F 1ZG1A 4XFGA 5JR7B 4IRHA 3BWGA 4XFAA 1OYYA 4ASNA 4HBLA 4GXOA 3KEQA 2QWWA 2ZFWA 1Q1HA 4JBAA 3BPXA 2HWVA 3BROA 3HSEA 2H6BA 4Q0SA 2FNPA 2HKXA 2ZCWA 1XB4A 2O8QA 5J8CA 3ULQB 1KU2A 5JFRA 4YIIA 2K27A 2JPCA 1ZLJA 1ZX5A 3E97A 1NYWA 1DDNA 3GW2A 2HYFA 1T6SA 5J7MA 3J7AO 2Q2EA 2P7VB 1J9IA 2OD5A 1S7OA 3KZYA 1ON2A 1CAUA 2M87A 4EWEA 1E17A 1LNWA 3HHGA 1R22A 5LHGA 3HT1A 1RUNA 5C8WA 1EH8A 2OPKA 4PDKA 3ZMUA 3DXJF 2FU4A 3BP8A 3J80K 3U2RA 3HRUA 2KIUA 1R23A 3BOQA 1DPRA 2P17A 5HS8A 2J5PA 3U0ZA 5L3DA 2QM3A 3CUOA 1ZG5A 4MGRA 3BJ6A 4ZU5A 2HZTA 5LGTA 1UHMA 5K1YA 3FWEA 4PIYA 4YSFA 3G3ZA 1W4MA 4J1XA 4Q47A 1XGOA 5D8LB 4NB5A 5EEGA 3I59A 1UIKA 1BBYA 3U9GA 3OCPA 3VHRA 3E6DA 3L00A 1Y0UA 1ZGJA 3TOAA 1I1SA 2FA5A 3HTUA 2UYAA 1LKNA 4OLLA 3QU6A 3H50A 3V8JA 5C6CA 1HSJA 2HJIA 2P5KA 4UV8A 6PAXA 1L3LA 2RDPA 4L9JA 3LAJA 5J3UA 3WGGA 3ZP5A 1YO5C 4IRGA 1L0OC 1NE6A 1D8JA 1IUYA 4YNIA 1AOYA 2GC0A 4WBBA 1IXCA 2F2EA 5BS6A 4FBFA 5HS9A 4UBHA 1LEBA 1K6OA 1U5TB 4Z2YA 1P6RA 1U8RA 4U0YA 1CAVB 2EFOA 1OI6A 2OA4A 1YW7A 4UHTA 4XLPF 2QZ8A 3NEUA 1R5GA 3F23A 2PAEA 1G3WA 2O03A 1TLHB 3GZ5A 5KHKA 4Q29A 1ZH5A 3OV8A 2VT2A 5ILVA 3J80Z 3NVCA 1O3RA 4LB5A 2DTRA 1G4DA 4XEZA 5FLJA 2VBZA 1O7FA 4MUVA 5FLXK 1ZRRA 4PIZA 3ECOA 5DUIA 2D5HA 2ESNA 2IXLA 2KJCA 4KNYA 4CHUA 1YFXA 2O1QA 3BY6A 4ENNA 3F8MA 4RGRA 1BC7C 5BXXA 1FYMA 2STWA 1U2WA 3WTWC 4HVRA 4MGIE 2XHKA 1XSXA 1K79A 5JSOA 4YYOA 3EBRA 4UUVA 1CX4A 2Y0MA 1S7AA 2WV0A 3IDBB 4QGNA 4ZU4A 3CLOA 2DQRA 4XF4A 4BXUA 1RUOA 3V4GA 4YFNF 5T3NA 5FD5A 4GGGA 5FPZA 3CEWA 3H3ZA 4L9TA 1A04A 3QACA 4YFXF 1EPZA 1B9MA 3H7JA 2DQLA 2G7HA 4AD9A 4LK1F 1QXRA 2XV4S 3QAHA 3CLPA 2A6HF 2IP2A 1STZA 1U5TA 4I0BA 1L3JA 5HLIA 1CAVA 4RGUA 3ZN1A 2QNKA 4HLTA 1WKMA 2IA2A 3F6OA 2RN7A 3ZN0A 4XF3A 3U11A 2FOKA 3ELKA 4M74A 4ORFA 5JCTA 2YX4A 3KP4A 4ZH4F 1FC3A 4BAYA 5HDGA 3E5QA 4IETA 3WE3A 2DO7A 2XRNA 1Z6RA 2W57A 4MH0E 5F64A 3OTFA 3OD0A 3KSCA 2P7CB 2HDCA 1WLTA 3QP5A 4EROA 4YARA 4AVPA 1XSDA 5FLXZ 4META 2MBFA 5KHJA 1FSEA 2PI0A 2HQNA 3O6BB 2P4WA 3T0YA 4OMZA 2V1UA 5AIPA 4QM9A 1IPJA 4HN0A 2HR3A 5I8YA 4EGYA 1EV7A 1REPC 2CGPA 3P7NA 5LHIA 1XMAA 2LDUA 2FBKA 3K1NA 2XLGA 2EV6A 1DP7P 3HSRA 1PP8F 2ZKZA 1Q43A 5HLGA 3GXOA 4ON0A 5BY5A 4L0ZB 4HMZA 4LK0F 1CAXB 3MFKA 4AXOA 5F1RA 2W25A 4JQFA 2FQPA 1U3EM 3EETA 3RDIA 1ZZ7A 1UD1A 1ZLKA 4ZZLA 1VP6A 3LFKA 2MH9A 3QPTA 2KKOA 1G6NA 5CVIA 4ZYDA 4HQMA 1YW8A 4Q0PA 1KQ8A 2DPDA 1OMIA 5I8TA 4XFCA 4LUKA 3FXQA 1B59A 2DT5A 2IC1A 1I6XA 5FFZA 4IEWA 3RI4A 2KJBA 5ICGA 1ZAOA 2HEOA 5D5XB 1J59A 3QP6A 3BDDA 4CZZA 3MAJA 2Q0AA 5L3CA 2EV5A 1NE4A 4KU7A 3M7GA 4PGGA 2JPBA 4JV4A 1Z91A 3K2ZA 4J1WA 3S0MA 2KIFA 2E7WA 3GO5A 2O6GE 4OU0A 2UXXA 3KLOA 3K1MA 1BI0A 1GVJA 1XE7A 2BEOA 2DPUA 2KXLA 1OFNA 5I0TA 5E8GA 2K4JA 3M8EA 1KU3A 3H9AA 2IA0A 2MH2A 1EYBA 4ETSA 1OD5A 2Z2SB 3IC7A 4Y13A 3F8NA 3VOEA 4G6QA 3GYDA 4G9YA 4M9XA 5FFXA 2YX7A 2QBYB 2VBWA 2VC1A 1H0MA 4LJZF 3EDPA 2ZXJA 1P92A 3TGNA 5JHUA 3ISPA 4ZYEA 3GX4X 3TQNA 4KMUX 5LBQA 3QOPA 4OIOF 4OOIA 3FZVA 3F8CA 4EJUA 1FYKA 5LRSA 5FQ0B 3WODF 1CAXA 3RYRA 4M6XA 1H9TA 1TNSA 4EGZA 2VODA 2QQ9A 1IN4A 2GA1A 3SZTA 4D0PA 2A07F 1MZBA 3RYPA 2Z99A 1J0RA 3HT2A 1RL3A 1BOAA 3C3VA 4DNCA 4Z82A 4IRIA 2B8MA 1SD5A 3KEOA 1WI9A 2NYXA 2A3SA 3I54A 5D4SA 4B8XA 3I64A 2ACJA 4WXCA 3B02A 4QGLA 1G3TA 5BV6A 2ZBKA 1SD7A 1R5HA 4QX5A 3TDUC 2OBPA 3MWMA 1ZNPA 1ULYA 4BH9A 2O0YA 3JTGA 4IEVA 2UZKA 5DCFA 5E16A 3M8FA 1EP0A 1C0WA 4HAMA 2YSRA 1MJBA 2LF7A 4G6DA 3ETQA 1SMTA 4QLCU 5JVTA 5JSRA 3R0AA 5H20A 2V79A 2HGCA 1W7PD 2FNAA 4KMFA 4MTDA 2J5OA 3R4KA 1LJ9A 2QBYA 2JSCA 4UNOA 1R58A 2GAUA 4MNUA 2GU9A 3ZQ7A 3ZMSA 1Y9QA 5LHHA 2XVCA 5BOXA 1IW7F 3NSTA 5FGMA 2R7DA 3ABUA 1P4WA 2MPFA 5FQ0A 1R1VA 2QDRA 1J75A 3H1WA 4LA2A 5J8FA 4MGZE 2VQAA 4R8HA 3U1DA 5CU1A 3DF8A 4D7TA 4WCGA 4CDGA 2TDXA 4JTOA 2ELHA 1H9GA 1RIOH 3T5XA 1TW2A 2XIGA 1HW1A 1B9NA 3GZ6A 2MLKA 1SMYF 4G7ZF 3LQRA 3WTVC 2E9QA 3W6JB 3IHUA 2DI3A 2PFBA 3NRVA 2ZNYA 4HA8A 4AIHA 2MNGA 2EAAA 1UPIA 2BE5F 1YTYA 1KQ9A 3IL2A 1KA8A 4G94A 4L18B 3WW3A 1XN7A 1QXJA 3M9AA 2H09A 2FBIA 4AWXB 5ICCA 4I7HA 3I5UA 5K5RA 2B0LA 2IXKA 2GC1A 2GIVA 4A2UA 1GHCA 1ZG3A 4EJVA 4Q0QA 1KU9A 5E18F 3D0SA 1J7KA 1NHAA 1XSVA 2XGXA 4PZJA 1IXSB 2PFWA 1O3TA 3DL3A 4GCVA 5EFUA 4XFHA 2UYBA 1QPMA 5TRDA 2ZJ2A 3BPZA 1IXRC 1GQGA 2AXLA 4QM8A 4A0YA 1J2XA 1ZN2A 2HKOA 4A5NA 3PQKA 4P9UA 1I1GA 1YS7A 5FCCA 2AS5F 3I53A 4O9GA 5K5OA 4IVNA 1DGRA 3H7YA 3HRMA 4FT8A 3EQLF 2FMYA 2QQBA 3F6VA 3H1MA 3ACLA 4RD7A 2A69F 3IRRA 3H3UA 5D5WB 4Y17A 1ZZCA 3DPLC 2VBYA 5DD4A 3F8FA 1FP2A 1HBXG 4PCQA 3ROUA 1UFMA 1IN5A 4XF0A 4MTEA 3RKYA 3PLQA 4HSJA 1UIJA 5CVRA 1BI1A 1RC6A 4XF1A 3EUHA 3KP5A 5JI6A 1LVAA 1Z7UA 3GYHX 4HF2A 2RC4A 2F5DA 4A6EA 4YFKF 3Q9VA 1HW5A 4LEJA 2Y0OA 4I02A 5D4RA 1I27A 2IRFG 3TNQA 4D7SA 1R7JA 3K69A 2MA3A 4XSXF 4QWQA 3SCHA 2A68F 1YG2A 3DKWA 4I3PA 3C3WA 4X6QB 2QJVA 2PA7A 3VEPA 1FWZA 2CAUA 4EVIA 1CGPA 5D6FA 5D8KB 4A0ZA 3DQVC 2MC3A 1RNLA 2C0ZA 3WG9A 2PQ8A 4OINF 3RPQA 3R0JA 4A6DA 4HX8A 5D6EA 2FQ3A 2IJLA 2UY9A 4KN7X 1R1UA 1OPCA 5CVUA 3MZHA 2Y48A 1T0FA 3GEZA 3WTSC 1MKMA 1U12A 1ZRCA 2EVXA 5ED4A 1T98A 3NJZA 4MEXF 2D5FA 2HTJA 4MV2A 3DEUA 5K8SA 3LQQA 2D1HA 3L2HA 1WQ2A 4CXFA 1S8NA 4GYIA 3CO2A 1LQ1A 1D5VA 4IEPA 1Z1DA 2VE8A 4LLGF 1FXZA 5JR3A 1HSTA 5KHGA 3TOBA 2HS5A 1YS6A 1XGSA 2WTEA 2P5LC 4XRFA 2CG4A 2IW5A 4N0BA 3LAGA 3LOIA 2O8XA 1HKSA 4IJAA 1KGSA 4IEYA 5DDGA 3UKVA 3KLNA 1ZHFA 2FXAA 3RZZA 1NXMA 5KVRA 1J1LA 2PHDA 1OKRA 2XROA 5AVPA 3RPUA 1T39A 3FFQA 1LDJA 3F21A 5BPXA 4HVOA 4Q48A 5ILUA 2EWNA 4UXAA 3SCGA 3USSA 1J3PA 4LLLA 3D0JA 3DP7A 4LLNA 2Z69A 2VN2A 1LRHA 5AONA 2K0GA 4XLNF 4HX4A 3E6MA 5LEKA 1O3QA 1H1IA 5KHIA 5K5QA 5HVQC 3JTHA 4E2GA 3RTRA 5I0UA 5L3BA 1YYVA 3IWFA 1RGSA 2QENA 1BN5A 4LFUA 4TLFA 1ZZ6A 1T38A 4ZU7A 2X0LA 2A61A 3KP7A 3EO6A 4RGSA 3WGIA 2XAQA 3PVBB 3H8UA 4AVAA 4OIRF 5H6RA 3D5LA 1DZTA 2QLZA 3EYYA 2M45A 2BYVE 3V8KA 5DCMB 1EH7A 2FF4A 3BPVA 3E3VA 1ZZ8A 3N4MA 3GFLA 5E17F 1YHFA 4IHTA 3CUQC 2V09A 3MYXA 4HW0A 4M73A 4HX7A 4O6JA 3SHFA 1PM7A 1ONVA 3FHZA 5CVVA 3BZ6A 3GBFA 3EHKA 4LA3A 5I93A 4QGMA 3R60A 3KETA 2Z33A 2PG4A 1KYZA 4EM2A 3ZPLA 3BU7A 3TO6A 4KIFA 2BNNA 3IKTA 3ES1A 3EJKA 1BIBA 4MEYF 2BV6A 4WZCA 4KUMA 4IEUA 2ZO4A 3FF5A 1O3SA 4NVPA 3WU1B 3HIFA 3JAMK 4ESJA 3VB2A 4UVCA 2XAHA 3E6CC 2EV0A 2QQAA 3ZDSA 2NNNA 2DCTA 1IZ1A 2EK5A 3KFWX 4I2OA 1XCBA 4I09A 2LKPA 1XGNA 4KN4X 4EV0A 1R1TA 2M30A 4H0EA 1Z6TA 2V1XA 2RQPA 4UV9A 4E2QA 2OYZA 2Z9OA 4OFGA 4NQWA 2L54A 3F8BA 1YIOA 5IT9K 2E1NA 4B09A 4U88A 2HTSA 3V7CA 4B29A 1IN8A 2VT3A 3ABTA 3UKNA 2GZWA 2M8EA 4WXHA 2F5EA 2ISYA 3R6SA 1XE8A 3MPBA 4IEOA 3V7SA 3S7IA 2Y75A 2HQRA 3ERED 4ZYHA 1O7LA 3SXWA 4KIGA 2V9VA 2ETEA 2O3FA 3WTXC 5FPXA 4CO8A 1PMIA 2JZYA 3WE2A 2P8TA 2IXJA 2CQKA 2EFQA 4KWJA 3G7DA 1Z05A 3HSFA 3V7RA 3REOA 2IXIA 2PHLA 4EM0B 3TNPB 1QY4A 2LF8A 3E5UA 3K0LA 1Q5OA 2OZJA 1VR3A 1JGSA 3HQXA 1R00A 2ADUA 1S29A 2XUBA 1FT9A 4M72A 4LULA 4XETA 4JK1X 1LDDA 3HOTA 4Q0UA 5I8SA 2VBXA 4L2NA 1FX7A 4EMSA 2A6EF 4WX9A 4O9EA 3TKYA 3L2CA 2PN6A 4KICA 3JAMZ 1ZRFA 4OIQF 4AVBA 3SCFA 5FB2A 2VXZA 2P6SA 4K8FA 1HKQA 1B1BA 4HYEA 1U6GA 2DK5A 4LTAA 3KP2A 1PP7U 1FBUA 1ZGAA 4I0AA 4L5IA 3JZVA 1ZREA 3CO6C 1FSHA 2IXCA 1QO0D 3HRSA 5IT9Z 3FJSA 1D8KA 1IRFA 3IWZA 1FBQA 5DEQA 4O5VA 1AWCA 1QZYA 5H6QA 1MDMB 3WW1A 1TTYA 3KZZA 4P9GA 4ESBA 2VE9A 3WTUC 2ISZA 2IT0A 3IIAA 5I0SA 4I01A 1BI3A 1ODDA 3Q5FA 4PJYA 1J3RA 2FSWA 3QRFF 1X8MA 4EJTA 5LEJA 3AAFA 2NNYA 1ZVFA 2Z5UA 1ZYRF 1X82A 4KT5C 2IA1A 4IERA 4U7BA 2MHFA 1LEAA 5ICFA 4XF9A 4GYGA 1F1ZA 4XFFA 2GXGA 4ENMA 4KWKA 3SMHA 2PYTA 3VFZA 4P55A 3RKXA 1UW8A 4MX3A 3I0TA 3BJOA 2PTMA 2XKPA 1XDSA 1XCVA 2QUFA 3GFJA 1BM9A 5ILSA 2VONA 4HLYA 3FMQA 4IESA 1CF7B 2GC2A 5I0RA 3CF6E 3U10A 1P4AA 1PUEE 2UWMA 3LZZA 3V8LA 2XKOA 4LMYA 1KU7A 4M71A 2EFPA 1EH6A 5DYMA 5AIQA 4MGKE 1I5ZA 1SFXA 5ERIA 1MDMA 2L4AA 2P6TA 1YFHA 4LD5A 1DPUA 2W85A 3GFMA 2KRFA 2D40A 4R79A 3DN7A 1B4AA 2HYGD 4Q5SF 3IRQA 1WGPA 3FX3A 3I7DA 4E70A 3GUDA 2L4MA 1OYIA 1YWKA 2ETHA 4EWDA 4F7ZA 4M9ZA 3R61A 1ZARA 1ZZBA 3LA2A 4G8XA 2B9UA 4A0XA 3H1YA 1MJAA 3TO9A 1SAXA 5IT3A 2CFXA 2ATFA 2O61A 1F4KA 3OGJA 2EFWA 1TW3A 1IPKA 2A5YB 2F5CA 1USTA 1YUDA 5HS7A 1QNTA 3MEXA 1XMKA 3P9IA 2RNJA 4RB0A 1JUHA 4FHTA 3GFIA 4LGWA 5E1ZB 4TV7A 4GO1A 2LNBA 4LB6B 2K7LA 2COMA 5HDKA 1O4TA 5KHHA 2PMHA 1CF7A 2CYYA 4IEXA 3CJNA 2RV8A 2DU9A 3F72A 4A5MA 1UCXA 4YRDA 3SXYA 4HSLA 5BQTA 3TDZC 4IEQA 1TQMA 3PQJA 2GQQA 2CV6A 2M1BA 2WWYA 3JSOA 2RVCA 5E1XA 4BHCA 2NRAC 2DFIA 4KU8A 1W5SA 3Q9SA 4FAGA 3O2PE 1V70A 1GQHA 1FY7A 1FLIA 2Q4SA 2ESHA 2I45A 1ON1A 2H94A 3IKVA 2XL7A 3IDCB 5CVJA 2FE3A 3M3IA 3MCZA 2P5VA 2ZKLA 2DW4A 2OZUA 3HYIA 3GF2A 3WW2A 3J81K 2ET1A 2XAJA 4EJWA 4RB3C 2VOOA 4WVZA 2GA2A 3L09A 3CDHA 3MDPA 2L3DA 2W24A 4EWAA 2CO5A 1FP1D 3RNSA 5F6FA 2VECA 2WFPA 2IXHA 4N9IA 3D82A 3RKWA 3FHIB 5HLHA 3M1EA 3E6BA 1O5LA 3O14A 4PGHA 2BBYA 2JTVA 3WTZA 2H27A 2PJPA 1GXQA 1NZCA 1VJ2A 1YFWA 2BNMA 1XDUA 2GXBA 5CLSA 3EYIA 3L7WA 4HQEA 2B5HA 3PNAA 2EJRA 4P96A 3QU3A 5BPIA 4BQAA 1RI7A 4ESFA 2GH2A 1Z9CA 5I91A 2Q8KA 3BB6A 2KIMA 5KBFA 3OOPA 1RZ4A 2DK8A 3LWCA 2DAOA 2PBIA 3JW4A 2W84A 3SQNA 1HQCA 3TO7A 3WTYC 4ONUA 1TQIA 1V3FA 4JTNA 1MGTA 2HOEA 3NW4A 1S3JA 1O57A 1JE8A 3CUQB 2CAVA 2OA2A 3KE2A 5CJ9A 1SD4A 4HV5A 4EJOA 4FAHA 1CAWB 2PMUA 1FZPB 2F4PA 3RYKA 4AIKA 1YW9A 1J58A 2F5FA 1SQ4A 3J81Z 4S04A 2FRHA 1UB9A 2PAMA 1FPQA 1OYWA 1ZRDA 2STTA 1LB2A 2PAKA 4RB2C 5L3FA 3ZMZA 1F5TA 4HF1A 4IEZA 2PEXA 3C18A 4H7LA 4M9SA 3W6KB 2OQGA 1OR7A 1QWRA 1HKTA 3P9CA 4BNCA 1QGPA 1X3UA 2RKHA 1X8EA 2FEZA 1DGWA 5J6XA 4NHJA 2V1DA 4FX4A 3FMSA 5JSPA 4RS8A 3T1BA 3CO7C 1WWXA 1FYLA 2JRTA 1MD0A 5E8IA 4XBFA 3BCWA 2FBHA 3M70A 3LAPA 3LA3A 1USSA 3HTSB 3DPTA 4MQ9F 4UVBA 1R36A 3NQOA 4Q0VA 3FM3A 1U5TC 3FE5A 3LWFA 3KGZA 1JXSA 1YQAA 2MLGA 1WA4A 4Y15A 2MD5A 5BPDA 1V4RA 4RAZA 2V6CA 4DINB 2K86A 1TBXA 1IN6A 1DZRA 2GWRA 3RJPA 4MZUA 4XFBA 3MZYA 1P4XA 1T2KA 1EY2A 1SFEA 4AQ6A 1DUXC 2C6YA 4G7HF 3KP6A 1UCRA 3CUQA 3JSPA 4L5JA 4MHGA 4RB1A 2Q30A 4P9FA 4K2EA 4MQVA 4EM1A 4WF2A 1CAWA 4BHPA 1BJAA 2DLLA 3IBMA 4U0VA 1PDNC 1W5TA 5DD8A 4HVQA 4HDVA 1G3SA 4A12A 3ST7A 1FBSA 5ICEA 4AIJA 3RIRA 2DBBA 3DFGA 1JHFA 3FZ3A 3ELNA 3SZPA 1QBJA 4OIPF 1K78B 2XLAA 2EA2A 3VODA 2UXNA 4HV6A 5DUKA 5D1IA 1X7NA 4KWLA 5EZWA 1FI2A 1SEFA 4HBNA 2EA7A 1XD7A 3KP3A 2CSOA 5JAXA 4LG0B 1RTVA 3ZMTA 5EEHA 4R52A 5A2QK 4RAYA 2BGCA 2IPQX 2GC3A 1TNTA 4U7DA 1HW2A 3NKTA 3HUGA 4CICA 1U78A 1Y3TA 1SD6A 3C7JA 5E1WA 5DCMA 5DV5A 5LGNA 4CGZA 5CADA 5FLIA 3QPHA 4X6RB 3MQ0A 3K9TA 1BIAA 4O3MA 3G73A 3SFZA 2G9WA 1KQ0A 4HF0A 2ZMEB 5FLHA 2IVMA 4AQ2A 1BC8C 4XFIA 1J5YA 3ZMDA 4ENJA 3L9FA 4GULA 4BHBA 4LLOA 1P2FA 2WC2A 2OQRA 2Z3YA 1F9NA 5D5VB 4WWCA 3NL1A 2PQQA 2XLFA 4KL1A 4L0YB 4BYYA 1LR5A 2JT1A 5L3GA 3WW4A 1E2XA 5BMZA 5KK1A 1XGMA 3ECHA 3S7EA 3E5XA 3BALA 4IHSA 4L11A 3K1PA 4I98B 3O3KA 1WSUA 2QVOA 2RGVA 2D2WA 1J3QA 4QMAA 4UXNA 1YLLA 3GVAA 4AVCA 4KFCA 1K78A 4WXDA 2H0VA 4G7OF 4P5OA 4DQ2A 1VTNC 1H1MA 2XASA 2L02A 1W7PB 1BI2A 4LUMA 4XSZF 2K02A 5FDBA 2L01A 3P9KA 2E1CA 4YIFA 3LA7A 1IAWA 3CJXA 4LG0A 2ZNZA 1FOKA 4UBGA 4KIBA 2K4BA 4ENKA 3WU0A 5FD6A 3CTAA 3HOSA 2LSOA 5E20A 4HN1A 2OAZA 4JVAA 2VC0A 2NS0A 5LGUA 4HDUA 2CW0F 2YPRA 4RGXA 3C1DA 2HFHA 5A2QZ 5TJJA 3FXRA 4KA4A 2VOPA 3T8TA 3DV8A 1XRUA 4Z07A 2BNOA 4R1HA 1O5UA 3CL1A 5HDNA 5BUVA 2Q0OA 1MJ9A 5J48A 3LSTA 1SFUA 2ZMEA 1ZZ9A 1S6LA 4EQQA 1QZZA 1WRJA 5LLQA 5L3EA 1YFYA 1Q3EA 4BIFA 4PIXA 2EFNA 5FO5A 2EA4A 3I58A 1FNNA 3FM5A 1IF1A 4UVAA 2UY8A 1TQ5A 2QYOA 3KCCA 2YU3A 2XAFA 5HOOA 2K9ZA 2VPVA 1IN7A 4CYDA 4HZFA 4L9VA 5CYVA 2XAGA 1YLFA 2YR2A 3ML6A 3OF1A 2ET7A 2G7UA 3WGHA 3HRTA 1LDKB 4HLXA 4ZYGA 4U0WA 1W7PA 1SFNA 3F3XA 2D1VA 4L9NA 1KYWA 3SHRA 4IXAA 3H92A 2D45A 3ES4A 3I71A 3S2WA 4FX0A 4KYWA 2CWEA 3N97A 4ZZDA 1GXPA 4KDPA 1TQPA 3KGLA 5HI0A 1IRGA 3B73A 5LRRA 3PFIA 4F8AA 1D3YA 3COAC 2N7GA 2M5WA 4S05A 1CAUB 1YFUA 2E7XA 3T8RA 5D5UB 2PLYA 4N9HA 3EQEA 3I4PA 4HOBA 2QCSB 3BJAA 1B6AA 2FMLA 1QQIA 2H6CA 4IPAA 4QXKA 3FXUA 1G3YA 3WTTC 3F22A 4Q4ZF 2QVSB 1UHWA 2OZ6A 2XL9A 2NAZA 3GLXA 2OU2A 3UKTA 3FMRA 1JHHA 4WK8F 5E1RA 2R3SA 3HHHA 3ZMVA 1K7AA 2X4HA 2EB7A 3I59B 3GWZA 4E2SA 2R7FA 4MGYE 3KMHA 4OMYA
chains in the Genus database with same CATH superfamily
3A1YA 3DTIA 4M6YA 1MZFA 5H2FC 1Y43B 2LR8A 3PJRA 5LCWL 4D94A 4XFGA 4N8MA 3OGGA 1U8BA 1QJEA 4HBLA 4FPKA 5FZHA 3KEQA 2QWWA 3BPXA 3PTRB 4Q0SA 1NA1B 5IFPA 4M0HA 1RIRA 5J8CA 2GNDA 2LY2A 1R64A 4Z2AA 2JPCA 1HLCA 1XS9A 1HX6A 5FLMJ 5EG0B 5ACA1 1SLAA 2QUOA 1DDNA 3ZYJB 2HYFA 5IVJA 1UMQA 2Q2EA 3ZQFA 2WNUC 3ASOH 1S4CA 1ON2A 3TL4X 3LSMA 2ZX0A 1LNWA 1BEV2 1R22A 5LHGA 1VBA1 4I76A 4ZZ8A 4YGCA 4GWNA 4PDKA 4HFSA 3DXJF 1WHUA 3BP8A 4OHXA 2LYCA 2WBMA 2P17A 5FY8A 2CYFA 3U0ZA 5L3DA 4LBOA 2CMPA 2QM3A 5EEAA 3KEYA 4MGRA 2W2IA 2A5WA 4PIYA 5CA6A 4YSFA 5IVFA 1K42A 3IUOA 4M4PA 5IPAA 2IAIA 4AFDA 4B4CA 3BR2A 5F8PA 3OCPA 3VHRA 1Y0UA 3T0DA 4QQ2A 2EZLA 1D1CA 3HTUA 3O1RA 4OLLA 2UU8A 1TMF1 3OEAA 3V8JA 3AL0B 3O0WA 5C6CA 2EICA 2HJIA 2P5KA 2ZJQF 1TC3C 6PAXA 1R081 1ENXA 5FZ6A 4RS5A 5J3UA 3WOGA 5J98B 3G2BA 1NE6A 1L0OC 2JICA 5FBZA 1TZLA 4M01A 2F2EA 1LAJA 1POQA 3J9SA 4LIVA 2JXAA 4UBHA 4XUOA 4NIAA 1ZBE3 1LEBA 5F6KA 3JRCA 1NK3P 1GV9A 9ANTA 5A33B 1P6RA 3IAM2 2WAFA 3OG2A 2NOJB 3NV4A 2EFOA 3A0HC 1LENA 1V9U3 1G9DA 4Y1YA 2ZBJA 4D1QA 2O03A 2KIQA 2GSYA 3GZ5A 5KHKA 1ZH5A 3OV8A 1A5JA 5C9AA 1FOD3 2BXYA 4SLIA 1G4DA 1O7FA 4MUVA 1ULPA 4AU7A 5DUIA 5K7FA 2ESNA 4ES8A 3TN91 3J7AY 1XTAA 2LBFB 5FZEA 4CCMA 2LTNA 1FYMA 2STWA 1IZ3A 1U2WA 3WTWC 2XHKA 1XOYA 3PM1A 5JSOA 4YYOA 3TBDA 5FY5A 1A6CA 1CX4A 2Y0MA 2WV0A 3IDBB 3AG4H 2VW2A 4ZU4A 3THCA 4V19K 3ZSKA 4B1MA 2X6WA 2VCMA 4W6WA 2L7KA 2O8OA 4NPLA 5FD5A 4GGGA 3FIWA 3ENRA 1EPZA 1B9MA 3K4NA 4Y20B 3WF4A 4BWOA 3QAHA 2G1MA 1H89C 3ZN6A 1QVTA 3A21A 4XBQA 3KYDB 3D1NI 1U5TA 4I0BA 1W03A 3NV3A 2FDGA 4K8RB 1CAVA 2B42B 4OZOA 2QNKA 1W8UA 4FCAA 1WKMA 5IAVA 3JBG2 2IA2A 1Z3XA 3PIGA 3U11A 4Q4X3 1CVNA 3ELKA 4M74A 4CU6A 5HDGA 4BAYA 3E5QA 4QKDA 3O12A 2XRNA 4AI8A 5FKMA 1MEC3 3E7LA 2W57A 4Z6YA 3CDLA 3OD0A 3KSCA 1H2LA 5F27A 4V1PA 2R6QA 2DCJA 3FHQA 4IHVA 2HQNA 5IVYA 2C26A 3CD6I 4R4XA 5AIPA 4AVTA 1TE1B 1IPJA 5CBLA 2HR3A 3PVNA 5FZOB 5I8YA 5LBBA 5IW0A 2YGLA 2W39A 2ZJCA 3FDYA 3ILNA 1NUKA 4IEJA 1DP7P 2VE1A 3OY9A 1ITYA 5FPAA 2O5RA 5E79C 3TAYA 1CZSA 1XG1A 1FMVA 1RVF3 4IV1B 2J7MA 2VOKA 1V5FA 3JRFA 4JQFA 2FQPA 3U21A 3RDIA 1GNZA 1ZLKA 5EGOA 3LFKA 2FD5A 4GAZA 2MH9A 1GICA 3M7AA 2DT6A 4WVMB 3OYWB 1XX5A 1FNZA 2WWSA 4Q0PA 1EA3A 2DPDA 5CFDB 3VYRB 4LUKA 1B59A 1I6XA 2HEOA 5D5XB 3J7YJ 3WX5A 3MAJA 3OBAA 5L3CA 1W04A 2EV5A 1YRNB 4PI0A 1OQDA 2JRMA 2X8KA 1NE4A 1JI6A 2NM1A 3DPRA 3AKTA 4RFRB 1QF3A 2JPBA 1VQOI 3K2ZA 1HKDA 3L1PA 5F39A 3GO5A 2UXXA 1GVJA 5L9VA 1SPPA 3OIPA 2PQSA 1OFNA 4JZRA 2DU0A 2CTVA 3P5BA 1OD5A 2MSYA 2Z2SB 5TGTA 1S2KA 3RQIA 4URAA 5JHFA 1OJLA 4G6QA 4W6YA 2L9SA 1W3VA 4LJZF 3EDPA 3TGNA 1ND2C 1ULGA 3K4LA 3NARA 4OIOF 1ETYA 4V2WA 4EJUA 3WQ7A 4MXWA 5FQ0B 2PX9A 1CAXA 3ZYPA 3MF6A 4JDOA 4GH4C 5DAXA 2QQ9A 3WG1A 4CUCA 4EN8B 2WZ8A 2RDQA 3ZFEC 1VBC2 4ZTFA 4Z82A 3Q8EA 2G9FA 3T09A 3RZJA 2VIXA 3OYFA 4FOWA 2A3SA 5FZFA 4CDQA 3ZVXA 1VALA 4ZDOA 3I64A 2RR13 3OOXA 2VQTA 2IGNA 1H8TA 1R5HA 1URXA 3TDUC 4BH9A 5L7OC 3I97A 2BJSA 2W1SA 1ASJ3 5FRAA 4FPJA 3JQWA 4HAMA 1GR3A 4XL9A 1MJBA 2YXSA 2WO3A 1SMTA 4QPOA 5JSRA 4R9CA 3KLSA 1X2MA 4XUNA 2HGCA 4A7KA 2FNAA 3AG1H 2J5OA 3S1MJ 2MEV3 5J47A 2W1OA 2DMTA 1R49A 2GU9A 4RAFA 1F15A 3K4JA 3HPHA 1DQ2A 2ES3A 4XK4A 1FIAA 2MPFA 1OFCX 1JJ8C 3H1WA 3ASNH 5F0CA 2FMDA 4MGZE 2WNOA 1OD3A 4QSHA 1W9WA 3U1DA 4B7KA 2W87A 3Q8AA 4CDGA 3J8F2 5T5JA 3T5XA 3PURA 3MN2A 3RJ2X 4K20A 1JZ4A 1G9FA 2MLKA 3GBWA 3CJTB 3WTVC 1ND3A 2EXHA 4UW4A 3NRVA 4XAAA 2CV2A 4HA8A 4NPMA 4Q4Y1 3AP6A 2WN3A 2A6XA 4LKDA 2DA5A 4EZ4A 1HRI3 4G94A 5F08A 4NE9A 5LZ6A 1AL22 1W6QA 2H09A 1PMHX 3VZKA 2IWGB 3PO2J 4AWXB 3DUIA 2UURA 3HGGA 3I5UA 4YPJA 2B0LA 1GANA 2GIVA 4OWRB 2GC1A 5LWBA 4A2UA 4XUPA 2GALA 4XJAA 4EE2A 1Y56A 1CZVA 1ERDA 1NHAA 1XSVA 2XGXA 1GV2A 4PZJA 1Y4WA 4CU7A 3ZXJA 1BK1A 3DL3A 1VAVA 2VZQA 3K4BA 5A80A 4GCVA 4ISRA 4XFHA 2UYBA 5TRDA 3PTYA 3D5SC 3DEWA 1IXRC 2G4IA 4A0YA 3JXSA 3PIPF 1ZN2A 3LDRA 3PQKA 3AXEA 4P9UA 1YS7A 2AS5F 2WWJA 3I53A 3G71I 5K5OA 4AR2A 4CCOA 1VBC1 2KMUA 5CEHA 3EQLF 4FPGA 3F6VA 2WYSA 3H1MA 4Y26A 3ZQHA 2A69F 3WDWA 5A32B 4B43A 2CWSA 4J01A 1ZZCA 3DKXA 4E8CA 4Y7NJ 5DD4A 1HBXG 4PBOA 4GWIA 1AR73 2FX0A 4BDYA 5M3MJ 2BOLA 2K3FA 3FXJA 3I2DA 2L9VA 2EXJA 5LY1A 1R71A 1BI1A 5TISC 1RC6A 1OA3A 4UYBA 3G1MA 4NWVA 2EINH 4BQ3A 2R7TA 2Y0SA 2OS2A 2F5DA 3DLAA 2QKMB 1WLDA 1BA5A 1LNSA 4KT6A 3ZXSA 4AL9A 1BJQA 1R7JA 3LFMA 4I0WB 3VHPA 3KF5A 2A68F 3DKWA 4I3PA 3QLQA 1JYNA 3RRDA 2PA7A 3VEPA 1UX6A 2YS9A 3UESA 1AA7A 5D6FA 5GALA 2RJLA 2HEWF 1VB2A 3J8F1 2Y6HA 5SV8A 3JQXA 4ANJA 2PQ8A 3PU3A 1SLBA 1S0IA 3VKNA 2JB4A 4H2AA 3R0JA 5FJKA 1IV6A 3Q0VA 4Y3OA 5FZ4A 4OULA 2F5VA 2Y9YA 4KN7X 3K4DA 1R1UA 3MZHA 1QZEA 3WQ0A 1T0FA 2L0KA 2HWB3 3KD4A 1JYIA 3VBFA 1U12A 5F3IA 4CE8A 2XB0X 4Q8LA 4GD4A 3H9QA 1XXNA 3NJZA 2V5DA 2HTJA 1IG0A 3LQQA 4JRAA 4CXFA 4ASMB 1S8NA 4GYIA 1AL21 4HL0A 1EAH3 4YG0A 3R0RA 5FZ1A 1U9NA 4TN7A 3IZOA 2P5LC 1OCZH 2E5NA 4NHYA 5LA0A 4G9SB 2GIZA 1O6UA 1F5FA 2HU9A 4BY1J 3CJIC 1KGSA 5CFCC 5DDGA 1ZHFA 3RZZA 1D0ZA 1OKRA 1J83A 2EF6A 3D5OA 5A3TA 5HCAA 3O5SA 5H9RA 1T39A 3FFQA 3F21A 4HVOA 2H1KA 1PX4A 5J1UA 2WY8Q 2GBYA 1C5HA 4LLLA 4BA6A 3RZMA 3DU5A 4XLNF 4HX4A 2K0GA 2VUDA 3HMYA 2DYSH 1U5YA 2QZ2A 4OI2A 4BMEA 3N3HA 1S5LC 1PK6C 3IWFA 3H8XA 4NQWB 1ZBE2 5FRNA 1NG7A 2A61A 1MBGA 2A05A 4RGSA 1OH3A 4WM7C 4AVVA 4KGGA 3MW2A 4Z8BA 1V9U2 3ILRA 1WBFA 2M45A 3V8KA 5EDNA 5LASA 3OPZA 2OV7A 1EH7A 3BPVA 3M3QA 1YXWA 3M4FA 4GMP1 1YHFA 1SVMA 1LHNA 1GU3A 1MACA 4QB6A 3CUQC 3FBNB 3N9OA 2HWF3 2CSGA 1JBCA 4HW0A 5GLWA 1PM7A 3SQOA 1XYNA 4BM8A 3BZ6A 4AWDA 2WO7A 1RUJ1 1XE0A 3R60A 2Z33A 2ME0A 1UG0A 3BU7A 1QHHD 2RJ2A 1BIBA 2BV6A 4TXWA 3AL5A 4KUMA 3ZGKA 3FF5A 1O3SA 3THTA 3WU1B 2RS11 5FAXA 3VB2A 2WAAA 3CIHA 1UG2A 4DPNA 1ENSA 2LH9A 1BBT2 2NNNA 1H2NA 2EK5A 2CJJA 3HOWJ 2LKPA 1R1TA 4AHZA 2M30A 4TZDA 4H0EA 2YY1A 1ULCA 2LROA 4UV9A 5IK5A 4BK5A 3WDTA 1YI2I 1JMUB 4U2AA 3VBHA 4B09A 1A31A 4BQ2A 2BVBA 2L9LA 2F5EA 1P8JA 4IEOA 1BVP1 4ZYHA 2GM4A 3SXWA 2V9VA 5M0TA 2O3FA 3PJQA 4MYEA 1W8HA 4UF0B 2E26A 4CO8A 4ZPIA 1YQCA 2JZYA 2IXJA 3N7JA 3W3CA 3I49A 3SDGA 1K12A 2O7OA 1DQ1A 3V7RA 3OB8A 3K3NA 3TNPB 1F8VA 2VO5A 2LF8A 3E5UA 3K0LA 1NCQB 4Q4W3 2OZJA 1DF0A 2EH3A 1VR3A 3HNYM 3B6CA 4COZA 2A6ZA 2ADUA 5L19A 1ND2A 4BUPA 1WJBA 3FUQA 1HQNA 4JK1X 2VMHA 4R4ZA 1Q8PA 5DAPA 4ASLA 2Y6KA 5I8SA 1BR1A 2VBXA 4Q4V3 1ZA4A 4Y1ZA 4C1XA 4EMSA 1XBFA 4GH4A 2PN6A 4KICA 1ZRFA 5IVBA 4S2FA 1LOFC 5FB2A 3J7HA 2P6SA 1GWMA 2I8DA 2X09A 1UY2A 4K8FA 4LKFA 4MHUA 2R073 2I5UA 3LD8A 5C44J 4TLGA 4AIDA 2W52A 2VULA 4GKYA 2FDKA 1ZREA 2IXCA 2DDAA 1RUI2 3PNYA 2OTLI 5L7OA 2A3YA 3FJSA 1WKYA 4LLFA 2XRLA 3K3OA 4IZZA 3U1KA 5HPOA 3HN1A 1UAIA 4YG6A 3KZZA 1RUF3 1O8SA 1UYZA 4ESBA 3IIAA 2ZMEC 1BI3A 1ODDA 4BJ5C 1TZOA 4JGZB 4AOCA 4PJYA 4EJTA 5HXMA 1VBD1 3C2UA 2IEKA 4H7MA 4KT5C 4IDZA 3ZKUA 3EUKL 3RCOA 3T2PA 3USUB 1X2NA 4ZC3A 1LEAA 3ZMOA 3UT0A 2W82A 1OT5A 1F1ZA 2GXGA 4ENMA 2R7EB 4DGWB 3C2HA 3B7MA 3E0JB 1BBT1 1RYYA 2PTMA 2VUAA 1XDSA 1XCVA 2QUFA 3GFJA 2XHNA 1BM9A 3INAA 3FMQA 1CF7B 3HM5A 2ZGOA 3AZXA 4A3MJ 4JGYC 4AZZA 3A0NA 2IS2A 3LZZA 2Q2EB 4LMYA 4XJ8A 1SVOA 3TP0A 2EFPA 1EH6A 5AC91 2JDMA 2N8GA 1MZ6A 2WFF3 2CQQA 3J7ZI 3R05A 5LD2C 5FZ0A 2ZAHA 3KZ4C 3ZLIA 2EALA 5CQEA 4QKFA 3TRSB 2K40A 5J40A 2RR12 4XC9A 4Y22A 2PMZA 3TYJA 4R79A 3N36A 2VZSA 3DN7A 3ZFFC 4EEFG 1B4AA 1CIYA 3N9LA 4GFBA 4Q5SF 3IRQA 3FX3A 1DYPA 1ASJ2 3GUDA 2L4MA 1OYIA 2JA8J 3R61A 3VL9A 1W2OA 2VQLA 1ZZBA 1PMJX 1XJAA 1NT0A 1MJAA 3TO9A 1K83J 2CFXA 2BW3A 2YUEA 4DIQA 1TW3A 5J1XA 1QPIA 1USTA 1R1A3 5HS7A 1QNTA 3MEXA 4K1YA 1ALYA 1XMKA 2R7OA 3I56I 5BNPB 4RB0A 1W2AX 3HKZA 4IL6C 2DXIA 3OPTA 5FYMA 2EQRA 4A6OA 4UOJA 2LNBA 4LB6B 4XKWA 4B47A 2K7LA 3PNTA 1O4TA 2VXRA 1VRH1 5KHHA 4Y1UA 4YVWB 4IEXA 1K3IA 3CJNA 1DYKA 2DU9A 1UCXA 1D0HA 1QOTA 5BQTA 1R6RA 4KJZA 3CU7A 1RUI1 4GDFA 3I3MA 1RINA 1CQTA 2GQQA 1SFPA 1YQ8A 4LHSA 1DCSA 3H9GA 3JSOA 1W2TA 2YBPA 1O59A 4N53B 5GAHJ 1ZR2A 4KU8A 1W5SA 3Q9SA 2HWC3 3WR0A 3WVJA 2YG0A 3ATGA 3DXTA 3M4OJ 3O2PE 1V70A 2KZGA 3UK9A 2JA5J 3HWJA 3VDBA 2XL7A 2FE3A 3M3IA 2IUWA 3BTYA 1G7YA 4BQ4A 3CMAI 1HXS3 3VUOA 5JXJA 4CUAA 1A8MA 4A44A 1H30A 3U4XA 4Y5SA 1HRI2 3L09A 4YFZA 2WS93 4CYCB 4D69A 3G6EI 3ESWB 4NRMA 2IXHA 3Q0WA 4OZXA 3RKWA 2JWPA 2BY0A 4Z92B 3FUOA 5HLHA 3DKQA 5EYXA 3WNXA 2WLPA 2CY6A 2H27A 4P00B 2PJPA 1UKRA 4A3KJ 1NA1C 3LGRA 1VJ2A 1S0BA 4OUEA 2AUYA 3ZN5A 1XDUA 5K0UC 1S2EA 2KDZA 4B1LA 4HQEA 1H8VA 2ORZA 2D97A 1QVUA 1UYYA 5F5IA 2EJRA 3QU3A 1SC7A 4ESFA 3OYMA 5LY2A 1LFBA 1TWFJ 1Z9CA 2P34A 5I91A 2JSPA 2Q8KA 1ETKA 4AYUA 2GDFA 1N3OA 5KBFA 3QBQA 3WDVA 1RZ4A 3P1IA 1R093 4PSXA 3MV01 3SQNA 1HQCA 4CA9A 4GB32 1MGTA 2JVHA 3POYA 3NW4A 3K48A 3KE2A 1GP4A 3T1LA 1Z78A 1DGWX 4QPIB 4CTEA 4FI9A 5LW9A 2R5YB 1YW9A 3CJIA 5CFCA 1PIV1 3BTXA 4N4OB 3JB8A 4C90A 2STTA 1LB2A 1X19A 5FREA 2R7QA 3AL0C 4H7LA 2LY9A 1A8DA 4PBPA 4B4QA 1W6PA 2A6TA 3HKZN 1X8EA 2X85A 2RKHA 2P3IA 1AKHB 3I55I 5A7QA 3KPHA 4NHJA 4JKMA 5A3LA 1COV3 4A41A 1WWXA 2VZRA 5E8IA 1PK6A 3BCWA 2FBHA 3ZOIA 2YU9J 3LA3A 1USSA 3HTSB 2NS7A 4MQ9F 3OYDA 5FLVA 5FZMA 1RHI3 1JXSA 1JU3A 2MD5A 2CGOA 3HUGB 5FZ3A 4XQFA 3HOZJ 4RAZA 1IN6A 1WZ2A 1J84A 1SZBA 5M5XJ 1DUXC 4M3CB 4G7HF 3W5NA 3KP6A 3V0BA 3CUQA 4BKXA 2HWB2 2PHFA 5IVCA 3CDIA 2PHRA 2R7UA 4V2GA 3L9JT 3ZDVA 4N7UA 2DMPA 5B66C 3CKHA 4I6ZA 4WF2A 3RMYA 1RJ7A 5FYTA 2XONA 3I2GA 3BYWA 1F2NA 4ZONA 4U0VA 5J4VA 4ZXKA 1H2MA 4IUGA 2JA2A 5DD8A 3NNGA 1G3SA 1LHOA 1FBSA 3T4VA 1E5IA 3RIRA 5DS9A 2DBBA 1Z7S1 3IPVB 3FZ3A 3S15J 2Z42A 3OEBA 2D6OX 2PLV3 1QBJA 4LORA 4OIPF 2IBDA 2WAQN 1UU6A 5A3NA 3VODA 2UXNA 4HV6A 2VL8A 5D1IA 3PUBA 4KWLA 1KDKA 4HBNA 4YW5A 3KP3A 1AJKA 5JAXA 5EEHA 1LPQA 5CAZA 1Z3YA 2WLQA 3RSNA 4XHBA 1WFXA 2ZFUA 4CICA 1CWPA 1Y3TA 3C7JA 2JA6J 5DCMA 3G1LA 4UFJA 4JDNA 3QYFA 4YW2A 4GB31 4O3MA 1QNWA 1H8TB 2G9WA 4AHWA 5JI9A 2ZGTA 3W58A 5FLHA 2IVMA 4Y52J 2DFFA 4XFIA 4F93B 1WGXA 4BHBA 4LLOA 1JUIA 1V00A 4YW4A 2DUPA 2Z3YA 3S16J 1GOGA 2PQQA 2K2SA 2XLFA 5FZGA 1X4PA 1NAEA 3ECHA 4I3GA 2HWF2 4QB2A 3BALA 4L11A 2ECBA 1WSUA 3GTKJ 4QMAA 4UXNA 4ATFA 1W0TA 4DQ2A 2IS1A 1LOFA 3FFZA 1W7PB 4LUMA 2ARAA 4YIFA 1IAWA 1O91A 2DF7A 2ZNZA 4UW6A 4KIBA 4IV1C 3A02A 3OYGA 4LJHA 2V7FA 1RUE3 3LEMA 5FD6A 2HDDA 2LSOA 1DQ0A 4E7HA 2VMDA 3CC7I 1N1VA 5HODA 2M7BA 3C7FA 3PDQA 4RGXA 5JZGC 1PO12 2VOPA 3MW4A 4XAEA 3T8TA 1XRUA 2BNOA 2ZJPF 2JG9A 4PI2A 5CFDC 1K6YA 1LKXA 2EZHA 1O5UA 5HDNA 5BUVA 1MJ9A 2CV1A 2ZMEA 2XVGA 4OHWA 1IO2A 2HWB1 2HQAA 3KB5A 3LSIA 5L3EA 1YFYA 3AMQA 3FBMA 1Q3EA 4PIXA 1DZQA 5GZGA 2W9XA 5B4NA 1WW4A 5GZDA 4NOTA 3CCSI 1XB9A 5AVAA 5FO9B 1H8AC 4CXXA 2LREA 4UVAA 1DGRM 4X0GA 3HOYJ 4D7MA 4C9YA 4BQOA 2YU3A 4P9XA 3U4SA 5HOOA 2VPVA 4F3QA 2ADDA 3UGFA 4CYDA 4HZFA 1B35B 3OF1A 2ET7A 3WGHA 1E3PA 2XGEA 2GP3A 4ZYGA 1TVGA 1OC1A 1LU2A 3H0GJ 2D1VA 4L9NA 3G1OA 3BODA 3I71A 2WDBA 1HB3A 1B8IB 5GAGJ 1QMJA 2M34A 4A7YA 1GXPA 4KDPA 4JGYA 1TQPA 2VBDA 4BEHA 3PFIA 2EZKA 1I3AA 1D3YA 3COAC 2DWRA 1GP6A 1I50J 2F4LA 4FFIA 2NQYA 4C2TA 3T8RA 5D5UB 3EQEA 5JXGA 4QX2A 3MD2A 4KITB 4BGDA 3OR2C 4ET7A 3RZLA 4QXKA 3KIOA 1GMMA 2HH9A 3FXUA 2HXIA 4DY3A 3ZFFA 5JUVA 1NCRB 2ZHNA 3PSFA 3W59A 4WK8F 5E1RA 4HANA 4RA2A 5KR7A 3ZMVA 3C8XA 2X4HA 1RUF2 3I59B 1BL0A 1UO9A 2WZR3 1PUFB 5T5OA 4OMYA 2AHQA 2D93A 5ABJB 4MIMA 2VGDA 4AFCA 4GWMA 4FASD 4F52A 1WCDJ 4YG2F 3ZYIB 2IZWA 3MO4A 5JR7B 3ZKYA 3BWGA 3BI3A 2W95A 5LA2A 2ZGSA 3HPGA 2CNAA 2YFUA 4OUSA 1IDZA 3HN3A 2ZCWA 2QE3A 5FYBA 4TYSA 2O8QA 3H1CA 4HNUA 1KU2A 4AYBA 1N77A 1V6OA 4CDUB 1ZLJA 1ZX5A 2W4SA 3L2RA 1NYWA 1R4NB 5J7MA 1UZZA 2OUHA 5G04L 2CV0A 3KZYA 4EWEA 1E17A 3WU2C 1EF4A 1PO11 2OPKA 2FU4A 4INDA 4M3CE 2QQKA 1W9FA 1VI0A 1DPRA 3OYHA 3ZRGA 1E57A 1OVPA 3CUOA 2RMU1 4XLFA 1UHMA 2WFF2 2ADEA 3FWEA 1QU3A 3ZXGA 4Q47A 2VOXA 1XGOA 4NB5A 5EEGA 1YJWI 1AX1A 2Z5WA 1MH3A 4QX7A 3E6DA 3L00A 1POGA 3RI8A 2FA5A 2UYAA 3QU6A 2E31A 1AX2A 2FBEA 4YM2A 1S9HA 2FJ1A 1PO23 4XNFA 1WJEA 2PMWB 2F48A 4LBQD 4L9JA 3RZOJ 3C2GA 1C3HA 5T55A 2SBAA 4B3XA 1D8JA 4YNIA 1AOYA 1R1A2 4WBBA 1IXCA 5FK8A 3MI8A 4FBFA 5HS9A 3IMNA 2QQJA 5CZKA 5A7SA 4B8EA 2DOFA 2K9LA 4Y1VA 1EUTA 4U0YA 2HNHA 1POV0 2IS4A 1YW7A 5IUQA 3OYKA 2XJUA 1MS3A 3EXUA 1QJY3 1AYM3 5IATA 3TB0A 1TLHB 3TEXA 3AMPA 3F2ZA 3NO8A 3A4CA 4HK9A 2YU2A 2DTRA 2V4VA 5FLJA 4RYDA 1SDDB 4AFBA 3GCMA 1S0JA 1G59A 1AR62 2IXLA 2HWC2 4CHUA 3HG9A 3F8MA 3H8OA 4RGRA 4JX5A 4XUTA 4OHZA 3JRAA 5IVVA 1JW6A 1HXS2 5JI7A 3VKFC 1G2HA 4BS9A 3IDAA 5LK7B 2ZAAA 1S7AA 4QGNA 5E88A 2JJ6A 2TBVA 3K4ZA 4K3UA 5T3NA 1UOFA 2VXJA 3H3ZA 4L9TA 4EN6B 2I74A 4AYBN 1DQ6A 2DQLA 2G7HA 4QHOA 4AD9A 3VGIA 3DTEA 4L8QA 3C2BA 4B48A 4P9LA 4TWTA 4UT5A 3CHXA 1STZA 1QHDA 1W1WE 4JX6A 5A33A 3CF5F 3OYAA 1L3JA 4LOSA 5HLIA 5E3MA 3H5AA 2D6LX 4AHXA 1UY3A 1UYXA 3IB3A 4XF3A 1E0EA 4UW3A 4CVUA 1OA4A 2YX4A 2D3PA 3AKPA 1Q56A 4O61A 5FMOL 1TEIA 4B7EA 5GADJ 1T6GC 1R092 2A75A 3LE0A 3HC7A 2YBSA 2LBFA 2HDCA 3QP5A 4YARA 2X05A 1XSDA 5K7HA 1IKPA 1OH4A 1N1YA 1ETWA 5KHJA 2B39A 3IMMA 3WG3A 5CNAA 3NAUA 2C4XA 4E4DX 2Q8DA 2DCKA 2B46X 4OYUA 3OOUA 4OMZA 4QM9A 5BNQA 4HN0A 4GA9A 4EGYA 1DLLA 1HJFA 2WT1A 1REPC 4GWJA 3OL3A 3P7NA 5LHIA 2HEVF 2RS51 3IDEA 1CPMA 3I2OA 1R1A1 1PP8F 2ZKZA 5FO7B 2VJJA 4NNJA 1Q43A 4Y20A 3GXOA 1ST8A 5DM6F 4JC1A 5HNHA 1U5ZA 3QPLA 5ACA3 2Z4FA 2VNRA 2VTXJ 3MMYB 4AXOA 2W25A 3H8RA 3VSLA 1U3EM 3SEQA 4BB3A 2KKOA 1G6NA 5CVIA 1VBA3 4RR3B 1GUIA 1QOSA 2ELKA 2RG4A 2CUJA 2BGPA 5EZHA 1OMIA 2JD9A 4XN0A 1RHI2 5A3WA 4YLZA 2DT5A 2XPVA 2IC1A 5FFZA 1I3QJ 5ICGA 2P0WA 5DZFA 3O1VA 3EYPA 4CZZA 5GLVA 2CUEA 4MXVA 1IC8A 2M7AA 1AR61 3OGSA 2JEMA 2D5VA 3M7GA 1WJFA 1RR7A 2CW7A 2AQEA 4RFT0 5JDBA 3RG0A 3OUJA 4OU0A 2R32A 3H0OA 4FSJA 4IE7A 1XE7A 1VQ4I 3O1UA 2DPUA 2BVVA 1H4GA 5A1FA 2JK3A 1HXS1 1ZGWA 3H9AA 2DCYA 4YGBA 1EYBA 2MH2A 1TMF3 5DG2A 4ETSA 4Y13A 3F8NA 4G9YA 2WA3A 1GLHA 5FZOA 2YX7A 2QBYB 3WCSA 4M3GA 2VBWA 1R083 3PL8A 3VD7A 3OUHA 2FDIA 3D5RC 3TQNA 2P4EA 2H0BA 4OOIA 1HIXA 1NTCA 3F8CA 2E1MB 1L7LA 1FYKA 1APLC 4IV1A 4DB5A 1H9TA 2PLV2 5KC6A 2VODA 4EGZA 2AXTC 1IN4A 1D1BA 1C1FA 2YFZA 2GA1A 3VZOA 2XWBB 3WDYA 1J0RA 3HT2A 1BOAA 4CPBA 4DNCA 3S3NA 4IRIA 1YHQI 2B8MA 1SD5A 4WVMA 1WI9A 2NYXA 3OYWA 1QGLA 3ACIA 3KWVA 3AL6A 3WHBA 1MZ5A 1X1DA 5CFDA 5D4SA 4WXCA 2QZ3A 2RM22 5JOXA 3AZYA 4QX5A 1RMU2 3MWMA 4CP9B 1ULYA 4C1WA 2A6YA 2UZKA 5HBAA 3PVOA 5E16A 1YRNA 2QBXA 1PNFA 2RDRA 1M06G 4S2GA 3JREA 4IKFA 2OVUA 1IV8A 1FMD2 3VBUB 2DURA 3HOXJ 2YSRA 1RUG2 5FZIA 1UYPA 3TN93 3ETQA 4LK7A 1VIWB 1QJX2 4L92A 4F92B 2AREA 2DOAA 5C71A 3OUIA 2QSFX 2V79A 4AEDB 1NCQC 1G9CA 4KMFA 1B09A 4MTDA 5F2SA 1RITA 2CRGA 4KG8A 1LJ9A 2WJSA 2JSCA 2B7EA 4MNUA 2IVIB 2LM3A 3ZMSA 1ENRA 1Y9QA 2XVCA 2X53S 2TUNA 2HPMA 2R7DA 5FGMA 2Y2ZA 4A3DJ 5FQ0A 4N4NB 1AF9A 1VZ0A 4FISA 4P5YA 4II3A 4AGGA 2FCVA 5J8FA 4JKKA 4R8HA 4A3JJ 1CR7A 3DF8A 2VJXA 4D7TA 2ELJA 3VBOB 4WCGA 3K70C 1I1EA 4W97A 2TDXA 4JTOA 1WZXA 1C8NA 4LO6B 3VN4A 1TW2A 2ZZJA 4IX7A 3GZ6A 1RUE2 2GMPA 1SMYF 3C7OA 3LQRA 2Y33A 4JX0A 2E9QA 4DZJA 2X6OA 2DI3A 3S17J 1WWYA 5JVVA 2ZNYA 5JLXA 4OMDA 3L2QA 2EAAA 2JIGA 4BQXA 1UPIA 1ZQ3P 1DIWA 4S2DA 1YTYA 1AZDA 1XYPA 2FCUA 4XORA 1KA8A 4Q26A 3WW3A 3M3EA 4FQZA 2GOMA 4XVHA 3UKGA 3T30A 1WMDA 1GHCA 3JD71 1ZG3A 4EJVA 3CCMI 5E18F 2B45X 2X6YA 1HDDC 4AI1A 3S6PA 1DHKB 2DVDA 1IXSB 2PFWA 4O7XA 1W8TA 1D7PM 1DU3D 3POWA 1D4M1 4CCCA 3P3PA 2ZJ2A 3BPZA 3BZKA 1GQGA 2AXLA 1WMXA 3ZXAC 2C9KA 3T2QA 2JDAA 4ZY9A 2PLV1 3NQHA 3L2WA 1W6NB 4BBRJ 2ZX1A 3FHAA 4Y4YA 3J26N 1SHWB 3K4AA 2JVGA 1DGRA 3HRMA 4FT8A 4QD2A 2FMYA 4IV3B 1AX0A 4RD7A 2NP0A 2VL4A 5F5AA 5D5WB 2PJRB 2ORXA 4KWUA 2RM21 4LR4A 3HVDA 1W06A 1RMU1 3KVBA 1LESA 2TNFA 2LY1A 4XOTA 3ROUA 2VW1A 3CCUI 1UFMA 1RUD3 4RQPB 1FMD1 4XF0A 1RUG1 3RKYA 1OLMA 1UIJA 1UWWA 5FMBA 2Z1DA 3ON7A 1QJX1 4G4FA 1LVAA 4AK3A 4MADA 4QDRA 4PHZA 2K85A 4CRQA 3LSPA 3GYHX 1NY72 4LT5A 2RC4A 1W28A 2VTFA 4CEWB 4A6EA 4G12A 4YFKF 2DFHA 3Q9VA 4LEJA 1NOVA 2V5YA 4QX0A 4DUXA 4I02A 5D4RA 3KT4A 4D7SA 4QWQA 1G8XA 5BNPC 1MZEA 4X6QB 3M8JA 2X5IB 1R9TJ 4OQ8A 3FXMA 3T0BA 1OF4A 2FDJA 1C8M1 4RS5C 2QQ8A 3S1NJ 3OY8B 3DQVC 3BIEA 2C24A 2BZTA 4CCDA 5JIAA 3WG9A 4PJNA 3BR1A 5K4LA 4OINF 1OOPA 4YVWC 1ODNA 4CU8A 5A32A 2D3RA 5JMCA 4A6DA 3I3DA 3LKJA 4HX8A 3MIHA 4AGRA 1OPCA 2QF7A 2L9RA 2Y48A 1LHUA 3APBA 1I39A 4N53C 3WTSC 1MSFC 1MKMA 2EIEA 5ED4A 1US3A 1T98A 1W36D 5DUWA 1ZYBA 3NJXA 2D5FA 4MV2A 3GJAA 3DEUA 2R7RA 2D1HA 3L2HA 5EJ3A 3CO2A 1LQ1A 1LULA 1Z1DA 3DU6A 3DXUA 2VE8A 4LLGF 3VPRA 2WSVA 3JUUA 3V0BB 2VTXA 4BQ1A 1ZRIA 3ONQA 2CG4A 4LHKA 1KJLA 2DA4A 2IW5A 3RPUD 4N0BA 1XNTA 3AFGA 4XMYA 4PCRA 2O8XA 2QFEA 4DZGA 4F83A 3CCEI 5F32A 4Y33A 4A7ZA 3BUCA 5DUXA 3NMBA 4IQJA 2JDNA 3SITA 3ZCOA 5ILUA 4N43B 3CZ6A 2PHTA 4E7LA 1J3PA 2HZDA 3SEZA 1DQ4A 3I8TA 1PO22 5LATA 4GJZA 2Z69A 2VN2A 1KXGA 1RUH2 5LEKA 3OBTA 1H1IA 5F3CA 5HVQC 3AP4A 4E2GA 3RTRA 1S0GA 5I0UA 2JA7J 1YYVA 4BPZA 2LS6A 3FKIJ 2HOAA 2JDPA 1OKQA 4LFUA 3VDXA 3AZVA 1F43A 2XB5A 4PJLA 3SZGA 2X0LA 2VKVA 3KP7A 2XUEA 4HKWA 3ABLH 3H35A 3H8UA 1DDLA 4OIRF 4QX3A 4Q4Y3 5DCMB 3HPNA 1QJY2 1JU4A 3E3VA 1O4ZA 5EJCA 1AL0G 3GFLA 5E17F 4GQ7A 3UL2A 2EXIA 4O6JA 3FK7A 2JE8A 5CVVA 4QPIC 2ZABA 1OQ1A 4QGMA 4FTSA 2W1UA 1QA6A 1G9BA 1KYZA 4EM2A 4HSTA 5DTDA 3TO6A 3RGBA 3ZPYA 5D21A 4D6SA 3ES1A 3EJKA 4YEJA 4D6QA 2HWD2 4XBNA 4NVPA 1YIJI 2YV8A 3JAMK 4ESJA 3WF0A 3ZDSA 3VSKA 2HWE3 3KFWX 3JB4C 1FOWA 4X8PA 4XTMA 1VBC3 4UI9L 1E5RA 4XMIA 2V1XA 2RQPA 4E2QA 2ZGPA 2OYZA 1VF9A 2L54A 4NQWA 1JYVA 5IT9K 4U88A 4MFDA 2VVFA 1CQ9A 2BPA2 5HLTA 3UKNA 4BXXJ 4E7SA 2QSGX 4WXHA 4ZTJA 3BR6A 3R6SA 2J42A 3JCIA 4M4RA 3HEFA 1UMZA 4XLCA 2JIJA 4SBVA 3I4IA 5FPXA 2QQVA 2P8TA 1S55A 4A3LJ 2CQKA 1VBE1 3UV9A 5J37A 3ZYBA 4CU9A 3G7DA 1Z05A 3HSFA 3ZXFA 4PF1A 2PHLA 4DBQA 3GZEA 3RSJA 1Q5OA 1YI9A 2LMDA 2KISA 2D7FA 2ZGLA 2JG8B 3KV6A 1W8WA 2OW4A 2XUBA 1FT9A 4XETA 4Y1XA 3ZXKA 3OIQA 3C7HA 3LMMA 4MSVA 2DJNA 1MIJA 1FPN2 2X48A 4L2NA 1WJDA 1GUUA 5A7NA 5EYRA 2Y6FA 1SFOJ 4FPCA 3JAMZ 1UMIA 1RUH1 2VCBA 2ZHLA 4XIDA 2VXZA 5GKAC 3J8F3 3SDBA 3ZQCA 2HYKA 2QQNA 1CN1A 4RL7A 1B1BA 5KNLA 5ACA2 1YQ2A 1SBDA 1KJRA 1FBUA 2YU1A 1ZGAA 4I0AA 4QQHA 3JZVA 5IOYA 4BEHB 1WCUA 5FPLA 1A34A 5IT9Z 4K40A 4YGDA 4AAXA 1VBA2 1FBQA 4UF0A 1QZYA 3H0DA 1QJY1 4BXFA 4P9GA 2GNBA 1ZK8A 1ODMA 1H8TC 2Y64A 4FE7A 2VPLA 1AL23 5I0SA 4I01A 5J09A 3D3AA 4E8DA 5FYHA 3KVAA 1SCSA 5A3UA 2ZMLA 1NCQA 2FSWA 3NJYA 5FYSA 1XPWA 1ZVFA 1ZYRF 1X82A 2GNTA 4K7JA 2IA1A 4IERA 2HWD1 2UUZA 3TEDA 5ICFA 4J25A 5EF6A 1K45A 2X1DA 4XFFA 4LXLA 3Q9OA 2JE9A 4B4PA 1GZTA 2KL4A 1R082 1OCTC 3RKXA 3JRGA 1XC6A 3M3OA 4GZ9A 3I0TA 2XWJB 2WNUB 3BJOA 2XKPA 4UW5A 3I2KA 4CA0A 4U87A 1MS1A 2VASA 2GC2A 1OQYA 3GZUC 5IP7J 4ZJZA 4FFGA 5I0RA 3H5RA 4L97A 3CF6E 1SAUA 3U10A 1PUEE 2XKOA 5BNGA 2E51A 1OA2A 4NRQA 3A22A 4M71A 5DYMA 4MGKE 3M3YJ 1VQ8I 1I5ZA 2OXBA 4XQDA 2JDUA 2L4AA 3MLKA 3VDDB 1Y0NA 3AMMA 3DWLE 1DPUA 3K75B 5H9PA 1JYXA 2KRFA 5DABA 1S0EA 2D43A 4GMP3 4OUMA 3GNEA 4JGZA 2XJVA 5C3PA 1X3ZB 3FXKA 1LEDA 3K4KA 1RUJ3 4M9ZA 3JRHA 5CYYA 3I2HA 4G8XA 4ZYAA 2B9UA 5EPAA 2ZXQA 3USUA 3MIFA 3UGGA 2ATFA 2LLKA 2EFWA 1IPKA 5EWSA 2F5CA 4HNTA 1W90A 4LBMA 1FPN1 3PFYA 2RS13 3P9IA 1JUHA 1RUC2 3KYLA 5E1ZB 3O8HA 4DRVA 1AYN1 3MVPA 2VOTA 4GO1A 2MC4A 2YHJA 4AE2A 1D2SA 3FXLA 5HDKA 5FJHA 4RGAA 1CF7A 2RV8A 3LEGA 3F72A 4A5MA 3N9PA 4LO4B 3PO3J 3RJRA 2KA3A 4FOVA 3TDZC 1V54H 1ULFA 1TQMA 1V6MA 2E33A 1T33A 2WWYA 3LIGA 4XDPA 5E1XA 4BHCA 4QX8A 3GTOJ 5C7GA 3U14A 2DFIA 2R062 3SKVA 4BE2A 4RA0A 1APNA 2VJ5A 1VQNI 1GQHA 2LOOA 2Q4SA 3LOBA 2ESHA 2VOVA 1NCRC 1SCRA 2ECCA 3IDCB 4XURA 1VQKI 5FXVA 2ZKLA 2DW4A 2VCAA 3WW2A 4LHNA 3J81K 4AF9A 5FXXA 2XAJA 4RB3C 4HSRA 2VOOA 3CDHA 2M3AA 2ZX3A 5ABJC 3RS6A 5FROA 2MD0A 4D7YA 2IXSA 3RNSA 4RM2A 2VECA 3OIOA 3D82A 4N9IA 3R4SA 4II2A 4QT6A 4NO4A 4DW6A 2Q8EA 5BNPA 3M1EA 3E6BA 2BBAA 1HC8A 1SG3A 1GOFA 2YROA 1SBFA 2JTVA 3GDBA 1GXQA 1YFWA 2MYSA 4V2FA 4J00A 5CLSA 3AKQA 3HJEA 4LBJA 3KCYA 4CDUC 1LECA 2WWUA 3AZWA 4YVWA 1S0CA 4XACA 2WT0A 1JS9A 2Y38A 4YM1A 2E34A 3WQ1A 2BHZA 5BPIA 3FC0A 5EXOA 1RI7A 2DMQA 4CCEA 3IM0A 2XB6C 5BYNA 4UUSB 4XDQA 4N53A 1F9KA 3IAPA 5A3OA 2DK8A 4M3CF 3LWCA 2DAOA 3ZM8A 5DZGA 3TO7A 3WTYC 3ZR8X 4ONUA 2Z16A 3K46A 1S3JA 2Y8KA 1O57A 1T0FC 4B3AA 3K77A 2EIGA 3AM2A 3AK0A 3VBFC 4I99C 1MMSA 5E3OA 1RUD2 5CISA 1VBD3 2F4PA 1FZPB 3OYIA 2J1VA 4CYCA 2WYFA 3FMGA 3J81Z 2FRHA 4NAOA 2AENA 1OLQA 1ZRDA 3GGLA 1IG3A 2PAKA 4AFAA 4RB2C 1F31A 2PEXA 5IYCJ 5CG9A 4M9SA 1XYOA 3W6KB 2YZ4A 1RUC1 2A70A 1OHFA 1BBT3 1X3UA 1MSEC 4CEYB 1DGWA 1GZWB 5J6XA 4FX4A 5B1BH 1HRV2 3CO7C 2AO9A 1FYLA 2JRTA 2R92J 3WY6A 2KP6A 4XBFA 1H2KA 1XC5A 1IRZA 4D8MA 3N7MA 3VLBB 4UVBA 1R36A 3FM3A 4QXCA 2AGSA 1Z7LA 1EKEA 2MLGA 5AC93 3PVEA 4BISA 3S2HJ 2R061 1V4RA 2V6CA 5A6QA 2EAKA 3AFKA 2X10A 4AM3A 1TBXA 2XPUA 2GWRA 4XM3A 3RJPA 1CESA 4MO7A 2BDRA 4XFBA 3V65A 4F55A 5LFAA 3LDKA 1SFEA 1AUYA 4AQ6A 5EV7A 5F9TA 3T2TA 2C6YA 3MUY1 2WBKA 4J19A 2VD7A 2J22A 4QPIA 5D8AB 4K2EA 2DU1A 2R5YA 1YJ9I 3WLUA 3LIHA 1BJAA 1MNEA 2DLLA 1KFXL 2BWCA 1LGBA 3I3EA 2W00A 3AG3H 3FKJA 4HDVA 5F3EA 5C70A 1LJ7A 2LTPA 2V6EA 2X6XA 4P9WA 3J4UH 2WNVB 1KEXA 2R7WA 5BNNB 2KLOA 1D5YA 5C3QA 4NC8A 2W5FA 3FBYA 1AKHA 1K78B 4CCJA 4BQWA 2LP0A 4G3YC 3ZFEB 3T2OA 1SEFA 1VRH3 1XD7A 4W1UA 1RTVA 4AUXA 2MFZA 3RZKA 2BGCA 1RUI3 2K5CA 3NKTA 1HW2A 3AKRA 3AG2H 3VYUB 3POSA 3HUGA 2VZPA 2WKKA 1S0FA 1Y1WJ 5E1WA 1JODA 2VZ3A 1OCOH 2JD4A 1MW7A 3VBHC 4C3JJ 1FATA 5FLIA 4X6RB 3MQ0A 4H55A 4M3CA 3SFZA 1KQ0A 3QWLA 2F4OB 3H9JA 4M3BA 2BXZA 4AQ2A 4BLIA 3KCXA 4AVZA 2W08A 4Q4Y2 1RUD1 3L9FA 4GULA 4ZS3A 4A3BJ 5D5VB 3NL1A 4KL1A 2ZGNA 1VBB1 4L0YB 4BYYA 3WW4A 4ZXEA 3MFAA 4MGSA 3THDA 3S7EA 4BK4A 3JR9A 2ZXHA 2R5ZB 1BR4A 3O3KA 2AR6A 2ARBA 3IPVA 1WA6X 1LU1A 2RGVA 2MABA 3CZJA 4KFCA 2K3PA 2H0VA 4JDMA 1VTNC 1H1MA 2L02A 2WT2A 1HRV1 1BI2A 4XSZF 2K02A 3U75A 1JOJA 4BZ4A 4M00A 4ENKA 2GH8A 1GOHA 2XQXA 3B94A 3WU0A 4A93J 2HWE2 4R9DA 2J1SA 4JVAA 4YZ1A 4HDUA 4BU2A 2YPRA 3C1DA 2HFHA 4RR3C 3FXRA 4Z07A 4R1HA 1CD3G 5J1RA 3K10A 4XZUG 5J48A 1SFUA 1A78A 2FDFA 3GJBA 3GZTB 1S6LA 4EQQA 2EIKH 5LLQA 3TEWA 4W4ZA 3OS2A 2HI3A 3IV5A 3GZNB 4AEJA 2LKSA 3I58A 1FNNA 1PIV3 1IF1A 4UFLA 1GFF2 3EB7A 4FTBA 2QYOA 1Y1VJ 1XQNA 5JVGF 2XAFA 2K9ZA 3NWKA 4QPQA 2BP6A 2YR2A 3HRTA 1LDKB 1OUSA 1D0XA 4FPYA 4XILA 4XPVA 3WP4A 1W7PA 2ZGMA 1Y8QB 4D9JA 3UNGC 2RV9A 2E1MC 3MW3A 3BTIA 1HN1A 2CDOA 1GWKA 4FOQA 4B1RA 5LRRA 3JCUC 2JQ7A 1VMHA 2M5WA 1QDCA 4LK6A 2VKEA 1AR81 1CAUB 4WV8A 1YFUA 2ZPXA 4YZ4A 2QKLB 2HBUA 4N9HA 3I4PA 1N1TA 1I5PA 3BJAA 1VQ5I 4ZZ5A 2DYRH 1BHGA 3RVHA 4A3CJ 4XYXA 5C5TA 1G3YA 3WTTC 2Y34A 4AQTA 4QXBA 4Q4ZF 2NAZA 5FZLA 2ERFA 2R4GA 4Y5Z0 2R3SA 4E27A 5F0FA 5HNFA 4XMAA 3VBUC 4HEA2 2YC2A 3DYPA 3R4UA 2R7FA 3KMHA 1NZIA 5J36A 2OJED 1SLCA 4IF4A 2Q1ZB 2KPMA 4AEDC 4IE5A 1ZG1A 1WBLA 4LPLA 2GMEA 4AGVA 1B35A 4XFAA 4ASNA 1Z7S3 5J1YA 3I9V2 5C8CB 4GXOA 1Q1HA 2HWVA 1C57A 3HSEA 1LTEA 2H6BA 4D0QA 2FNPA 2QQIA 2HKXA 1SFYA 4XIKA 1XNCA 2VU9A 2R1DA 5DG1A 2K27A 1UJ8A 3H36A 1B8IA 2L7ZA 3CP2A 2O9LA 3CMGA 3J7AO 2HWE1 2P7VB 2OD5A 3IT8A 2XAUA 3WD5A 2R0QC 4YW3A 4NHKA 3HT1A 1RUNA 1BR2A 3GLLA 5C8WA 1TT0A 1OOPB 3ZMUA 5CPRB 1BMV2 3J80K 3U2RA 3HRUA 2KIUA 1R23A 4FFFA 3Q8CA 5HS8A 5FUPA 4GB33 2J5PA 2XR4A 2KRHA 1DU0A 4ZU5A 3BJ6A 1YIFA 1NCRA 2NVXJ 2W68A 5FR3A 1KRIA 1VAMA 2B9SA 5D8LB 3I59A 4D5CA 1PUFA 5ABJA 1BBYA 2V9PA 3BKZA 3EUHC 4QQPA 3TOAA 1I1SA 1SDWA 4PJJA 3LSJA 2I10A 2WB1A 1ACCA 1LKNA 4D5FA 3H50A 1RUJ2 1STMA 2BU9A 1MR5A 1HSJA 3WSOA 4AW7A 1L3LA 4JRLA 3AC0A 2M8GX 3NV1A 4FO9A 3ZP5A 1YO5C 2V26A 4IRGA 3KZIC 1IUYA 5F37A 3T08A 2GC0A 4CDUA 2RS12 4P1WA 3ZFGB 1ORKA 1SEUA 3NNLA 3KYCB 2KR2A 4MO3M 2XSJC 4Z2YA 4XZPA 2AC1A 4IV3C 3BC8A 1OI6A 4WM7B 3CJRB 2E7TA 2E1OA 4XLPF 3NEUA 3D4KA 1R5GA 3F23A 1OF3A 1FOYA 1G3WA 2P1BA 3DCQA 4G6TB 4Q29A 1AU7A 4YFWA 4JX4A 2CW8A 1EV12 5ILVA 3J80Z 1NX9A 1ZBA1 1QEXA 2A1XA 3B93A 3NVCA 1O3RA 2VBZA 2ZACA 4RQPC 1ZRRA 4PIZA 2D5HA 2KJCA 3QYEA 2QDNA 3BY6A 4ENNA 4W65A 1QH7A 2I2SA 1BC7C 2R0HA 3FLRA 2OTJI 1W36C 4Q27A 2XXZA 3AYCA 1JT6A 4FTHA 3NNMA 1K79A 4PF5A 3I3LA 3EBRA 4UUVA 5IVEA 1RB8G 3ETPA 3V0AB 4CEWC 5JLWA 5JPMB 3DBRB 3CLOA 2DQRA 4NAMA 2R93J 2WQZC 1RUOA 4YG3A 4YFNF 1UU4A 4YW6A 4DEQA 1A04A 5TSWA 4YFXF 1Z0HA 3H7JA 3WG2A 5A7WB 4MFEA 2KDOA 5LBFA 4LK1F 3QD6A 2XV4S 3CLPA 5FYZA 2HYJA 3LEIA 1U9OA 2JWTA 3MZ8A 2FUG2 1YITI 2QQOA 4HLTA 1K61A 3MF9A 1BMV1 2RN7A 3ZN0A 3UJQA 1RR8C 2WRAA 2VI6A 3H5NA 1TNFA 2WQ8A 4HKOA 1FC3A 1MVEA 4OHYA 1W6MB 5F2WA 3WE3A 2DO7A 5KCMA 2HVSA 1BLZA 1Z6RA 2XOMA 4MH0E 3OTFA 2HXOA 1LOAA 3TP3A 2P7CB 2Y30A 3K51A 1IRXA 1REFA 4META 2MBFA 1DGWY 1BXHA 1FSEA 4COVA 3I2JA 1N3PA 2WB1N 2PI0A 4NIDA 2E2HJ 3O6BB 2R7VA 2W47A 2KM2A 1Y9GA 1W99A 1VBD2 2Y0SN 2V1UA 1Y6IA 1JOBA 4PDWB 2Q1FA 3ZSLA 1EV7A 4URTA 3I2FA 4YVSB 2XLGA 3K1NA 5FO8B 4QQOA 4N43C 4QU2A 4ON0A 2D6PA 4HMZA 3FLPA 3J7LA 4E4ZA 2R041 5F1RA 2WZPP 1GNHA 4CUGA 3EETA 2E36A 4ZZLA 3POEA 2RS32 5JPNB 3QPTA 3CMYA 2XJTA 1PO13 5FFOC 3MLJA 4WM8B 1KQ8A 5I8TA 1UN1A 2CS3A 2FDHA 4XFCA 3BVCA 3FXQA 3THPA 1EV11 2KJBA 2RMU3 2VPRA 4XUQA 3BDDA 1VQ7I 4UAPA 5AC92 2Q0AA 3OSFA 2IGMA 2GXAA 3NKGA 4RGGA 3PSIA 2EXKA 1GSLA 4PGGA 2C1FA 3FHNA 5JOWA 4LNVA 2E7WA 1JZ6A 2DA1A 3KLOA 5LA9A 3ABZA 1DFQA 4HPKA 3RQ0A 4DBRA 5E8GA 5I0TA 2DA2A 2K4JA 2IA0A 1VQPI 5KXBA 3P6BA 2WN2A 3O7OA 1RKTA 3VOEA 3HBZA 2RREA 2GMMA 3GYDA 3OJBA 4M9XA 5FFXA 4DUWA 3LFIA 2ZXJA 1P92A 5JHUA 4LHLA 5JR2A 5DN2A 3ISPA 4ZYEA 3W21A 3RFRA 3QOPA 1U0JA 3U1XA 5LRSA 5KHDA 1YRZA 5L73A 4M6XA 2Q8OA 5KC5A 2E71A 3RQ4A 5EJ1B 1TNSA 3HAGA 3I4MJ 1WI3A 2L5QA 2QQWA 1PM4A 5I0DA 2A07F 5GTIC 1MZBA 1T56A 5IP9J 2NPIA 3BQYA 3RYPA 3H3VK 1UY0A 1RL3A 4RR3A 3KEOA 1VRH2 1TWGJ 1POV1 2QEXI 2ACJA 2E35A 2MGQA 1QH6A 1FV2A 4QGLA 5BV6A 1P7JA 4LITA 2ZBKA 1SD7A 2XJPA 1ZNPA 1PZ8A 4AI3A 2VUJA 2DTZA 4JHTA 4BCUA 2ZEZA 2JG9C 1WMEA 1FV3A 1G8WA 2BUKA 1MNDA 5GTHC 1I3HA 3SKJE 1YCIA 4XLEA 4RLQA 4JQTA 5FWJA 4LKEA 3KV9A 5IFTA 5BNOB 4ARXA 3R4KA 3VBRB 2JG8C 1JTXA 2QBYA 2DYCA 2E7AA 5SV5A 4UNOA 2GAUA 2DOEA 1YJKA 3U78A 4FQ4A 5LHHA 5K7PA 4BE0A 5C4WB 1XNBA 3EPZA 1MBEA 1J75A 3BTLA 4LA2A 3L2UA 5CU1A 3A01B 3MIDA 2CUFA 1WH7A 1QQP2 4ZDLA 2ELHA 2RS31 4MG2A 1RIOH 2JJ7A 1S2BA 2XIGA 2DV9A 1A6QA 3MPPG 3WF1A 5EP9A 3L2YA 1MS5A 3W6JB 3IHUA 4CP9A 5IYBJ 2PHWA 5FY9A 2NXNB 4IE6A 2BY3A 2MNGA 4D3WA 1HDKA 1H88C 4QKNA 1YNAA 3HBKA 1LFUP 2XJRA 1N25A 4L99A 4DYQA 3VBUA 4QPGB 4CXYA 3QQAA 1F35A 1XN7A 1LHVA 1KGYA 1QXJA 2FBIA 3HGYA 5ICCA 4I7HA 4WVVA 3WHTA 2XMLA 3OYBA 4AEDA 5K5RA 2IXKA 1T6BX 2ZEWA 2TEPA 1LCLA 1NH3A 1KU9A 2WNEA 3D0SA 1VMFA 3HNMA 2RNGA 1PVC2 3LF7A 5FP3A 2PHXA 1OPOA 1PIV2 3WNNA 1O3TA 2RS53 5E89A 2QKDA 1JUMA 1UL9A 2A6WA 2J1RA 5K0UB 1WMFA 4QM8A 1J2XA 2VW0A 5FK7A 2HKOA 2G0EA 1I1GA 5ERLA 2AACA 5HCBA 3VBOA 5FCCA 1X58A 2WA0A 2WUHA 1P9QC 5IWFA 2CFOA 3ZXEA 1YQ6A 2DUOA 3ACLA 1D2QA 3IRRA 5EHDA 1Q8VA 5C3RA 1N78A 4Y17A 5FMDA 2AH2A 3BTZA 3DPLC 5C3OA 2WV1A 3U07A 3F8FA 3WP5A 2R1BA 3WP3A 2L9NA 4PCQA 3POJA 1OPMA 2A3XA 1IN5A 3OYEA 2B7YA 3VDDC 1AR63 2BOIA 4NIHA 4DQAA 2BBVA 4MTEA 5FKBA 4RGKA 2VMGA 3OGVA 1WJCA 2JDHA 1YJLA 3EUHA 5JI6A 1UX7A 2VQCA 2W0XA 3OS0A 4I30A 4N90A 3SH4A 2FOWA 1Z7UA 1FTZA 5C5UA 2ARCA 4UFHA 1WLWA 4KG0A 3CDZB 1UY1A 3GALA 1HW5A 3ZQLA 4UFKA 1I6HJ 2Y0OA 1I27A 4HKLA 3TNQA 5DUUA 1MS0A 5CKNA 3K69A 3SCHA 4XSXF 2DCZA 1YG2A 1H1AA 3C3WA 3Q8FA 2OIIA 3VYSB 1Z7S2 1ZR4A 2E6VA 1FWZA 4QX1A 1W6NA 4RHV2 2CAUA 1X1CA 1V6KA 1QQP1 5D8KB 2C9AA 1IJWC 4B4RA 4XXAA 2MC3A 1G86A 5K9YA 1MMAA 4IV3A 2E2IJ 2CWMA 3BT9A 5FP9A 4UY8I 3RPQA 5FYIA 3OSGA 2OPWA 4NROA 2PJRA 4XE9A 3MKYB 1H6YA 2DA6A 2UY9A 3MKWB 2BZDA 1K5JA 2R7ZJ 2YPDA 5DAQA 3CCLI 2NN8A 1PYVA 1K4TA 4F3JA 1MQTB 2EVXA 4RQPA 2JB8A 2H8RA 1VFCA 3BQZA 4MEXF 3M07A 2J1EA 5K8SA 2V9KA 2PMZN 1HB2A 1WQ2A 1D5VA 4IEPA 2ZJRF 1HSTA 5KHGA 3S30A 1LFPA 3BTJA 2HS5A 4ZS2A 1YS6A 1OBNA 1SLIA 5FPVA 1V6LA 4E4SA 1ETOA 1PVC1 3LAGA 3LOIA 3B3QE 4CEWA 4IJAA 3GTGJ 4OCTA 3UKVA 3S5QA 4CCLA 4MGTA 3OL4A 4FOYA 1NXMA 1J1LA 3BR0A 4LOCA 1B72B 3NAPB 2ID3A 1AR92 3RPUA 5AVPA 1AJOA 4CDXB 5ANNA 5BPXA 2X5IA 4Q48A 4PLNA 1OR7C 3D0JA 3UETA 3DP7A 4DXZA 3OY8A 4LLNA 5FZKA 5AONA 4BOWA 1O3QA 4JYKA 5KHIA 2L7FP 1BEV1 4NC7A 3MKLA 1XNDA 5L3BA 2BFUL 3PUQA 3ZXDA 4NBQA 3HQUA 2QENA 4TLFA 1ZZ6A 3NWTA 4PFOA 4BY7J 3WGIA 1AXZA 1VQ9I 3PVBB 4AVAA 1AVBA 2VH9A 4QHBA 2NVTJ 3EYYA 4PJ0C 2BYVE 3WDUA 1QRYA 3N4MA 1ZZ8A 3TBIA 5FPBA 2BFUS 4IHTA 5FKOA 1QJU2 3WQBA 3MYXA 3PMEA 3WZ1A 4M73A 4HX7A 3SHFA 1ONVA 3FHZA 3GBFA 3EHKA 3VZLA 4LA3A 3BLYA 5I93A 2A6VA 4R9BA 3JD73 3CBNA 1NG6A 2M4GA 3ZPLA 3KX2A 1PZ9A 5FZAA 4MEYF 1TL8A 3ASIA 2ZO4A 1YX3A 1D4M3 4ZDPA 5IJRA 4N43A 2J1UA 1Q8OA