3E6CC

Cprk ocpa dna complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
225
structure length
225
Chain Sequence
DFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSEQTSYYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation/dna
molecule keywords Cyclic nucleotide-binding protein
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
total genus 70
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00027 cNMP_binding Cyclic nucleotide-binding domain
C PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e6cC02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e6cC01
2VE9A 2ATFA 1BBYA 1ODDA 2Z69A 4Q5SF 1BI2A 1HSJA 2JSCA 4OLLA 4JTOA 2VBYA 3PFIA 4U7DA 1G3SA 1U8RA 4G8XA 4OIRF 4WWCA 3I64A 2FU4A 1I6XA 4L9NA 4HDVA 4GULA 3BU7A 3ST7A 2PHDA 2MNGA 3V7CA 4HLYA 2PG4A 3OTFA 4U0VA 3MZHA 2ZCWA 2EFWA 1YFUA 3SZTA 3FZVA 2JTVA 3WTWC 2PAKA 3FHIB 3V8JA 4DNCA 5E16A 3T8RA 5CADA 2PFWA 1TQIA 5FFZA 4BQAA 5FO5A 3TOAA 2PYTA 3ZDSA 4IRIA 4KICA 1YG2A 4HZFA 1C0WA 2NYXA 2BNNA 2D1VA 1J9IA 1ZRRA 3IRQA 3E3VA 4HMZA 4XFFA 4GGGA 1LDDA 4LULA 1YIOA 4ASNA 5HOOA 5ED4A 3RTRA 4WCGA 4IRHA 4FBFA 2BYVE 2IJLA 1T39A 4K8FA 2DQRA 2FMYA 4E2SA 2K02A 2KIMA 4IEWA 4RD7A 4MQ9F 4YSFA 5FLXK 4EJVA 1DUXC 4WXDA 1OPCA 3FM5A 5ILSA 1J2XA 3D0JA 1G3TA 2PEXA 4XF9A 4IETA 1Z91A 2HKXA 3V8KA 3WTYC 1G3WA 4Q29A 1ZGAA 3GXOA 4U7BA 2JZYA 4RB0A 4HSJA 3ZMVA 1D8KA 4ZU7A 1AOYA 5FLIA 2GC0A 2XROA 2IA2A 3C3VA 1YFHA 1IN8A 2H94A 3D0SA 5I0RA 1YS7A 3COAC 1QPMA 4KMFA 2GC1A 1U6GA 2DU9A 2O03A 2DK5A 1JE8A 4IEOA 4G6QA 3FF5A 3JTGA 5FFXA 3IKVA 1PUEE 4ZZDA 2G7HA 4KL1A 3N4MA 4EMSA 1KU2A 4FAGA 1ONVA 3RYKA 5J48A 1FYLA 2ELHA 2CSOA 2UYBA 5LGTA 5A2QK 1B59A 3KP6A 4RGUA 3CL1A 1R23A 1QBJA 3IIAA 3KLOA 3GVAA 2D5HA 1YYVA 3DQVC 4XF4A 3KETA 5D5XB 1K79A 3VB2A 5L3GA 1GXPA 3TNQA 2IA0A 2MHFA 2BV6A 2UWMA 2IXJA 5BUVA 3MZYA 2V09A 1T6SA 4IESA 2HTSA 5CLSA 3DFGA 2OAZA 3WW1A 4HVOA 4P5OA 3I5UA 1LEAA 1QNTA 3ZPLA 4GYIA 4K2EA 3GZ5A 2ET1A 4LLOA 3HHGA 4YFXF 1UPIA 4HLTA 2RDPA 2ISYA 5HDKA 2G7UA 4LUKA 4UXAA 4I7HA 2ZBKA 2HJIA 3CDHA 1OD5A 5DD4A 4CGZA 2HFHA 1FOKA 2DI3A 3OV8A 2LNBA 4AIJA 1IPJA 4HX8A 3LOIA 5JR3A 3TO7A 2H09A 1XDUA 5BV6A 3ZN0A 5KHGA 3RKYA 2A3SA 5DYMA 4WVZA 3FXUA 5J7MA 1RL3A 3CO2A 3RPQA 3CUQA 4RB2C 3JW4A 3FXRA 3WW3A 5J3UA 3AAFA 3RDIA 4HBNA 1UFMA 1NE6A 3GFIA 1YLFA 5H6QA 4GXOA 3GO5A 3H1YA 2GU9A 3OCPA 4ZU5A 4P55A 3CJNA 2W85A 2P7VB 1R5GA 2KJBA 4ENMA 1HKTA 2KXLA 2H27A 3TO6A 2Y0MA 2R3SA 1CGPA 4KN7X 1CF7B 3FHZA 1DPUA 1ZZ6A 4JBAA 3F8BA 1FYKA 4KU8A 3ACLA 4KWKA 4LTAA 2RQPA 3RIRA 3T8TA 4CYDA 3J81Z 4B8XA 3MAJA 3SHFA 3H1MA 2EFNA 1U12A 1ZZ7A 4QWQA 4HN1A 1NZCA 2H6CA 4O9EA 4KMUX 3QPHA 3UKVA 4WK8F 2FEZA 1ZNPA 4QM9A 5BPXA 3UKNA 3I0TA 4A5MA 4KIBA 3GF2A 1OYIA 2O1QA 1P4WA 2XUBA 2M1BA 1MGTA 3V7SA 4XSXF 2IP2A 1FP2A 1ZZ9A 2FMLA 4O9GA 2K86A 4KT5C 1UCXA 1KA8A 3WU0A 2L4AA 3ZP5A 2DLLA 4H0EA 1T98A 1F4KA 1K7AA 3CUOA 2FQ3A 2HYFA 4M6YA 5DUKA 4X6RB 2P5VA 2MH9A 5BXXA 1H9GA 4CHUA 4EJOA 3ERED 3L2HA 1MZBA 3QAHA 4KN4X 1T2KA 1V70A 4RGSA 5TRDA 1KGSA 1XN7A 2QVSB 1B1BA 1BC8C 2A68F 3H50A 1XRUA 2GXBA 1KU9A 3WE3A 2OZUA 3FZ3A 1ZLJA 3QP5A 2V1DA 5DCMA 2XVCA 2ZNZA 2PA7A 3WW2A 4Q0QA 3WW4A 1R5HA 1A04A 3CLPA 5D5UB 2CV6A 4QX5A 5CVVA 3DL3A 5CJ9A 4LG0A 5E8IA 1RTVA 1PP8F 2A07F 2EA4A 4OU0A 4G7OF 2XKPA 1Q3EA 1TQPA 2XV4S 3ZN1A 5HS8A 2XASA 4RS8A 2E1CA 1GQGA 4NB5A 2OA2A 3P9CA 1BOAA 4OIOF 3L7WA 1ZRDA 4BXUA 1UIKA 3G73A 4RGXA 5I0TA 5JFRA 4F8AA 4YNIA 3CJXA 3HQXA 5J8FA 3BP8A 3BCWA 1Q1HA 1Z1DA 3TDZC 4LD5A 5E1XA 4QXKA 2FE3A 3E5UA 3JSOA 3KLNA 3JAMK 1NXMA 3F72A 4L9VA 3HSRA 2QZ8A 5ICEA 1OYYA 3LFKA 3SMHA 2W84A 3RKWA 1ZZCA 4E2GA 3T5XA 1U5TB 3J80K 1BJAA 1UB9A 3RI4A 1J59A 2DPUA 5CU1A 1EV7A 1TW2A 2WV0A 1ZN2A 5L3CA 3NW4A 1IW7F 4HF1A 2F2EA 5LHGA 3WGGA 5KHJA 4OMZA 5FD5A 5HLIA 3P9IA 3M8EA 1IN7A 1TNTA 5HVQC 1SMTA 3U0ZA 1CAVB 3S7EA 4HF2A 4UVCA 1R7JA 2BGCA 3M3IA 4L5JA 3SCGA 1Z05A 3KCCA 3BROA 2L54A 3D82A 3SXWA 2CG4A 1Z7UA 4EM0B 4XEZA 1VTNC 1T38A 1BIAA 1CAXA 5L3FA 1CAWA 2RNJA 4ENKA 1XMAA 1H1IA 3ML6A 1F1ZA 1R36A 3OD0A 1UD1A 3ZMDA 1ON2A 5L3EA 3PNAA 3CUQB 4ONUA 1RGSA 3BJOA 1U5TC 3U2RA 4Y17A 3ULQB 1PDNC 1J3PA 4JTNA 2Z33A 4A0YA 3LAJA 3REOA 2J5OA 4PDKA 1IN5A 3F21A 4GO1A 4AD9A 2QBYB 1X82A 2OBPA 2Z5UA 4BH9A 2X4HA 3O3KA 2XLGA 4AVAA 3EHKA 1ZHFA 4BHCA 1OKRA 1WRJA 2HYGD 4HV5A 2A61A 3GFJA 4HQMA 4J1XA 4XF3A 4N9HA 3HRUA 3ES4A 1TBXA 3WTTC 2VBXA 3S2WA 5J8CA 1LDKB 2XL7A 3I4PA 4QGNA 2B8MA 4RAYA 3V4GA 5D6EA 4PCQA 2HKOA 4IEVA 3KGLA 2VOPA 3SZPA 3FMQA 2VN2A 1SD6A 1FX7A 4HAMA 2EB7A 2IVMA 2YX7A 1QZYA 1J58A 2L3DA 2PHLA 3EO6A 3IRRA 1XE7A 3GFLA 1XDSA 3GYHX 1B4AA 4HBLA 4LB6B 3L09A 4MGKE 4YRDA 1CAUA 1JHHA 5L3DA 3CO7C 3CTAA 4FAHA 2UXXA 5AIPA 2JT1A 4QM8A 2Q0OA 5ICFA 3TGNA 2FSWA 2Q2EA 2ZMEA 3KP3A 2VPVA 3LQQA 2DW4A 4KNYA 2VOOA 4A0XA 3VHRA 4QLCU 3ECOA 4EJWA 3BJAA 3E5XA 3F8CA 2Q30A 4M74A 4ON0A 4Q0SA 3WG9A 1PP7U 1O3SA 6PAXA 3DN7A 1HW5A 4L11A 1LJ9A 2PI0A 2COMA 4M9XA 1DZRA 2YX4A 3BJ6A 5E20A 5H20A 2Y48A 1W5TA 3LAPA 3CO6C 2EV0A 3TOBA 5DCMB 3F6OA 2PQ8A 2FOKA 3M7GA 1JUHA 1TTYA 2FQPA 2O3FA 3LZZA 2VECA 1SD5A 2Z2SB 1W7PA 3F8MA 4ETSA 3MYXA 2PJPA 1I1GA 2NRAC 4BIFA 4LG0B 5I0SA 4M71A 3I54A 4R8HA 3LA7A 1BIBA 2MBFA 1KYWA 4J1WA 4H7LA 2E1NA 2A69F 4QMAA 3R60A 1FC3A 1R22A 5BS6A 2QNKA 4M6XA 5KHHA 5HI0A 5JCTA 1ZARA 5KBFA 3ZMZA 2FA5A 1E17A 4MH0E 5FLXZ 4I09A 2QQBA 3GYDA 3KMHA 3C18A 2K7LA 4L5IA 4QGMA 3NVCA 2VC0A 4LJZF 4G94A 2F5FA 1TW3A 3K1NA 2D45A 3FX3A 2EV6A 4WXCA 2ETHA 3IDCB 3FWEA 5DEQA 1ZH5A 2VE8A 2STWA 5E8GA 2GC2A 4AWXB 2NAZA 1Y9QA 3IC7A 4HX4A 2GQQA 3HYIA 5AVPA 4AQ6A 5I8YA 2CYYA 2P17A 2XAGA 4OINF 4NQWA 2XHKA 2OZJA 5I8TA 3ELKA 1S7OA 5EEHA 2FBKA 1SD4A 2FF4A 1RNLA 2RN7A 4KIFA 5FPZA 1NHAA 4LEJA 1KU7A 4D7TA 1USTA 2GAUA 5FDBA 1GQHA 3KP2A 4MUVA 3IKTA 4G9YA 5A2QZ 2QUFA 1U5TA 4QGLA 4DINB 2MC3A 2P6TA 1HQCA 4KYWA 3ZQ7A 2GH2A 1O5LA 2YR2A 4META 4M9ZA 4GCVA 4JK1X 1SFNA 5I0UA 4MGYE 4M9SA 1XSDA 4R79A 3M1EA 4UNOA 2HZTA 3TQNA 1YHFA 2UXNA 1EH8A 1CAVA 1CAXB 2P5KA 1CAWB 4RAZA 3BOQA 4I0AA 1S3JA 1MKMA 1DGWA 3FM3A 3EBRA 1XGSA 4Q0PA 2QM3A 5JSOA 4JQFA 5J6XA 4AIHA 3H7JA 4EM2A 3ZMUA 2EV5A 3W6JB 1TQMA 4LB5A 2PTMA 1P6RA 3IWZA 4OOIA 5F64A 2IXKA 1DP7P 1F5TA 2M8EA 4S04A 1P4XA 5FLHA 5JR7B 2ZJ2A 2XAQA 4A6EA 3WODF 1RUNA 4IEYA 5I93A 4ENNA 4PIZA 1R58A 2M45A 1XGMA 4MGZE 2ET7A 4AVBA 1ZGJA 4I98B 4L2NA 2W57A 3N97A 5F1RA 3MQ0A 5D1IA 3U10A 4IEXA 5I8SA 1O4TA 2QBYA 5IT9K 4S05A 3TDUC 1V4RA 4MNUA 2B0LA 3DV8A 1SQ4A 5BPIA 2KIUA 4UV9A 4IERA 1JHFA 4EWEA 2VBWA 1QXRA 4I3PA 5LGNA 3GWZA 2GZWA 1FZPB 5HS7A 4EWDA 1IN6A 2BNOA 1X8EA 5KK1A 4UVAA 3RJPA 1FSHA 3OGJA 1ZG5A 1TNSA 2M30A 2OQRA 1YFWA 2TDXA 1CAUB 3L00A 1YFYA 2XAFA 4MGRA 2MPFA 4YARA 1WLTA 2A6EF 2OQGA 2ZMEB 2CW0F 4YFNF 1ZRFA 2R7FA 4A5NA 4YIIA 1BI1A 5ILUA 1IXCA 4N9IA 2CFXA 1NE4A 1XGNA 5FQ0A 1B9MA 1EY2A 1FT9A 4MV2A 2Q1ZB 1HBXG 2BBYA 1GHCA 4A12A 3TNPB 1UIJA 3I7DA 4E2QA 3FE5A 2LF7A 2Z9OA 5JVTA 2FRHA 1Z6RA 3IHUA 5CVJA 4XFIA 5BPDA 4NHJA 4LA2A 2H6BA 2ETEA 4G7HF 1ON1A 1O3RA 3E6BA 4IRGA 3GZ6A 5KVRA 2D93A 3QOPA 3SHRA 1LB2A 4CICA 3S0MA 3HRMA 3HHHA 5D4RA 5HDGA 1DZTA 1W7PB 1USSA 4UVBA 4AXOA 1QWRA 3HRSA 4IJAA 2XAJA 1L3LA 5D8LB 1YWKA 4LA3A 3NKTA 4XLPF 1DPRA 3NQOA 1IAWA 4EJTA 1WKMA 3HRTA 3CEWA 1FSEA 5ICCA 4MX3A 2I45A 3Q5FA 2VODA 4KU7A 4PIYA 2L02A 2D5FA 3U9GA 1EH7A 1NYWA 5LBQA 4Y15A 1Z9CA 4JV4A 3KEQA 3DF8A 4WBBA 4ESJA 3JZVA 5CYVA 1O7LA 2UY9A 1IXRC 1CX4A 1S7AA 4CO8A 3EUHA 2ACJA 2QCSB 4XFAA 5K5OA 4MTDA 1XSVA 3O2PE 2P8TA 1ZAOA 1J1LA 1SD7A 2YU3A 1W5SA 5D5VB 3K2ZA 3KGZA 3QP6A 1H9TA 2O6GE 4BHPA 4HQEA 4KA4A 2MLGA 4P96A 1IXSB 5DD8A 4EWAA 2BEOA 2ZO4A 2W25A 3KZZA 5EFUA 3JAMZ 2EAAA 3SCHA 2WTEA 4Q0UA 3MPBA 5E1RA 1O7FA 5ERIA 1I5ZA 3J80Z 4U0YA 2F5CA 4CDGA 3IDBB 1WI9A 3BZ6A 1HXDA 4KIGA 4GYGA 4HW0A 1FY7A 5FCCA 1XSXA 4XETA 3CLOA 2RV8A 3ABTA 3RKXA 5E17F 5FPXA 3ROUA 1F9NA 1XMKA 2QQ9A 2EA7A 1MD0A 3C1DA 2K27A 4L9JA 2NS0A 1J3QA 2XIGA 2ZFWA 3V7RA 2STTA 2VXZA 2ESHA 4UHTA 4LGWA 2XLAA 4L18B 2RKHA 2HDCA 4NVPA 3V8LA 2DQLA 2KRFA 3KEOA 2V1UA 3LSTA 4BNCA 1R00A 5LLQA 1STZA 2BE5F 2IRFG 5BQTA 5HLHA 2FNAA 3JSPA 4KWLA 1FBQA 4B09A 1R1TA 2QJVA 3F23A 1I27A 3WGIA 2D2WA 2V79A 3PQKA 2ADUA 2DAOA 4IEUA 4KWJA 4Z2YA 3SFZA 3I58A 4LLNA 3RPUA 1D3YA 1KYZA 2OPKA 1SAXA 1S29A 3E6DA 2ZKLA 2RGVA 2YSRA 4Q47A 4XSZF 1ZG3A 4ZH4F 4DQ2A 2VONA 4B29A 3BALA 1REPC 4LMYA 4Q48A 1FP1D 3E5QA 5EEGA 1ZG1A 1X8MA 4AQ2A 2P4WA 3MWMA 4HV6A 4I01A 2CAVA 1P4AA 1Y0UA 4PGHA 4MEXF 2HOEA 2VT3A 3NRVA 1ZVFA 1XD7A 4MQVA 1MJBA 1SFEA 1MJAA 2FBIA 2AXLA 5D5WB 1VJ2A 2B5HA 1Y3TA 1QXJA 3LQRA 1J5YA 2GWRA 5IT3A 2R7DA 4LK0F 4FT8A 3C7JA 2ZNYA 4HX7A 2VBZA 5FQ0B 2HWVA 3K1PA 1WA4A 4IHSA 3FMRA 3K0LA 4I2OA 1UW8A 4IPAA 3HOSA 5HDNA 1R1VA 3G3ZA 2ESNA 2F5EA 4N0BA 4EM1A 1FNNA 3DPTA 1O5UA 3WTXC 3U1DA 3O14A 3Q9VA 2Z3YA 4PGGA 4ZYDA 4MGIE 1G4DA 3K1MA 4ZYHA 1W7PD 2E9QA 2QDRA 2VQAA 2UZKA 2RVCA 4XF0A 4IVNA 3KE2A 4OIQF 3QACA 4KFCA 4O6JA 2RC4A 2K4JA 2A6HF 4MEYF 3JTHA 5DDGA 3E6MA 4ESBA 2IPQX 1YW7A 4WXHA 1LQ1A 1WQ2A 4WX9A 3H9AA 4IHTA 4EGYA 4I0BA 3EDPA 1RC6A 2HR3A 3WTUC 4CXFA 2HTJA 2V1XA 5EZWA 3RYPA 2AS5F 5E18F 2Y75A 1ZREA 4X6QB 4IF4A 2L4MA 1IUYA 3BPVA 1GVJA 3FJSA 3MFKA 3I59A 5DV5A 2WC2A 1P2FA 2EFQA 1QZZA 2QENA 2EK5A 3DP7A 2IXCA 5JSPA 2PBIA 2PQQA 2WFPA 1JXSA 3K69A 5BOXA 1VP6A 3R4KA 4EVIA 3EETA 2M5WA 3W6KB 4P9GA 4F7ZA 3GX4X 2O8XA 2OA4A 3R0AA 3LWCA 3HOTA 5DCFA 3BPXA 2GIVA 3H92A 3IWFA 3QPTA 3HT2A 3WTZA 2GA2A 1OR7A 2VC1A 2Q4SA 2HGCA 2KJCA 4Y13A 4CZZA 1HKQA 1TQ5A 1B9NA 4YYOA 3F8FA 1BI0A 5L3BA 1BN5A 1E2XA 1J75A 3F22A 5AIQA 2ISZA 5LRSA 2DTRA 1BM9A 4HVQA 3KP7A 2LDUA 3QU3A 5LGUA 2F4PA 2XKOA 2IT0A 1SEFA 1LKNA 1L3JA 1B6AA 2EFOA 4Z07A 5HLGA 5H6RA 5CVUA 4UBGA 3WE2A 4ESFA 2IXIA 2QLZA 3QRFF 4O5VA 5K5RA 1EH6A 1YO5C 4ZYEA 2JPBA 4BAYA 1K78A 3GLXA 3FFQA 3B73A 3P9KA 5F6FA 5LHIA 2YPRA 3SCFA 3UKTA 5JAXA 3DKWA 4R1HA 3Q9SA 1FI2A 3MDPA 1FPQA 3ELNA 2Y0OA 4L0ZB 2W24A 1FBUA 2CQKA 1V3FA 2XAHA 4UXNA 4XFBA 2E7XA 1H0MA 5LEKA 1IZ1A 1UHMA 2DT5A 1ZRCA 3WU1B 2OU2A 3F3XA 2Q0AA 2QYOA 2DO7A 3VOEA 3ISPA 2CWEA 1G3YA 1SMYF 4HVRA 1EPZA 1LNWA 2EJRA 3VODA 1J3RA 4AVCA 2GXGA 4EJUA 3E6CC 3J7AO 3I71A 1U2WA 3BWGA 3R61A 2PAMA 3NEUA 2X0LA 1O3TA 4HF0A 1MDMA 4UV8A 2XRNA 3P7NA 1J7KA 4MZUA 4D0PA 1H1MA 3RYRA 3HUGA 3BY6A 1YUDA 5K1YA 1EYBA 2M87A 3VFZA 2G9WA 2B9UA 3F6VA 5E1ZB 4FX0A 1TLHB 2A5YB 4EROA 3HSFA 2MD5A 2LSOA 2PMHA 4PJYA 3D5LA 4IEPA 1YW8A 3HTSB 4Q4ZF 2JRTA 3DEUA 4ORFA 1U78A 5IT9Z 3PQJA 3M9AA 4OIPF 2OD5A 2P5LC 2K9ZA 4P9FA 2KIFA 1OFNA 4YIFA 3FXQA 1YLLA 2D1HA 2OZ6A 4IEZA 1QO0D 1X7NA 3M8FA 1S6LA 2FBHA 1QQIA 2IXLA 4WZCA 2K4BA 3WGHA 4YG2F 2H0VA 3MCZA 2V9VA 2DPDA 2MH2A 1OMIA 1IPKA 3J81K 1EP0A 1ZZBA 2P7CB 1P92A 4FX4A 1O3QA 1IF1A 4E70A 2LF8A 3DPLC 4XLNF 1Q5OA 2C6YA 5LRRA 3T0YA 3MEXA 2O61A 3WTVC 5BMZA 4M73A 4XF1A 3LA3A 4TV7A 2EA2A 1FYMA 2XGXA 4U0WA 4ZZLA 1GXQA 2FNPA 4RGRA 3SQNA 3PVBB 1YQAA 1XCBA 1YW9A 1ZX5A 3HSEA 4UUVA 4Q0VA 4ZYGA 1RZ4A 3GFMA 4A2UA 1X3UA 2PN6A 3WTSC 3KFWX 1ZZ8A 1OYWA 4YFKF 4PZJA 5FD6A 4U88A 1YS6A 1O57A 3I53A 5ILVA 4RB3C 2PFBA 2E7WA 2NNNA 3GW2A 4JVAA 2QWWA 1LEBA 2LKPA 2HS5A 5BY5A 5JI6A 1YTYA 3NSTA 1XGOA 2MLKA 3USSA 1KQ9A 2KKOA 4LLLA 1ZYRF 3HTUA 4LK1F 4LUMA 2ZXJA 3KSCA 3G7DA 1FLIA 1LVAA 3SXYA 2F5DA 3EYYA 1IRFA 1BC7C 4FHTA 3L2CA 1HW1A 1QGPA 3I59B 2JPCA 1IRGA 4PIXA 1KU3A 5C6CA 1S8NA 3IL2A 4A6DA 1XE8A 2XL9A 1I1SA 1R1UA 3TO9A 4IXAA 3BDDA 1UHWA 3ECHA 1KQ8A 4XFCA 3GBFA 3GEZA 3LWFA 1FWZA 2N7GA 4Z82A 2XLFA 3LAGA 3H1WA 2O8QA 2WWYA 2GC3A 2EFPA 3KP4A 1LRHA 2OYZA 1FXZA 5DUIA 4AIKA 4EGZA 3KZYA 1AWCA 4IEQA 5D8KB 1UCRA 4OMYA 5KHIA 1SFUA 1SFXA 4M72A 2O0YA 2K0GA 2CO5A 2UYAA 1WGPA 5E1WA 2Q8KA 1U3EM 1L0OC 3KP5A 5T3NA 3CF6E 4BYYA 3TKYA 3ETQA 1PM7A 4KDPA 3ZMSA 1J0RA 2QVOA 5CVRA 1XCVA 3L9FA 2IA1A 3R6SA 1K78B 5K8SA 5HS9A 4EQQA 3C3WA 2HQRA 2Z99A 1IN4A 5LHHA 1PMIA 1W4MA 1ZLKA 2MA3A 3B02A 3NL1A 1G6NA 3OOPA 2C0ZA 4HOBA 1Q43A 1OI6A 3IBMA 2D40A 3BPZA 2BNMA 4R52A 1HW2A 4ZU4A 3RZZA 2GA1A 3R0JA 2FXAA 1JGSA 4MTEA 1HSTA 1XB4A 2HQNA 1BI3A 4D7SA 3EJKA 5CVIA 2CAUA 3PLQA 4G7ZF 3H8UA 2DK8A 2DCTA 3M70A 4I02A 1RUOA 4G6DA 3S7IA 3ES1A 2UY8A 3QU6A 4P9UA 1MDMB 4UBHA 5ICGA 2DFIA 3H3UA 5FGMA 3GUDA 5TJJA 2PMUA 1LDJA 3RNSA 1DDNA 4HA8A 4L9TA 1D5VA 4BHBA 4ENJA 5I91A 4AVPA 4HDUA 2ZKZA 1WSUA 3EQEA 2NNYA 2V6CA 3O6BB 4MHGA 3VEPA 4EV0A 5KHKA 3ZMTA 1D8JA 2PAEA 4O3MA 2J5PA 5C8WA 4A0ZA 1FBSA 4HN0A 2VT2A 1K6OA 3H7YA 3T1BA 1T0FA 3ABUA 2L01A 2P6SA 3HT1A 1Z6TA 1WWXA 4LFUA 5JHUA 5K5QA 1RI7A 2IC1A 3NJZA 2PLYA 3E97A 1RIOH 3K9TA 2CGPA 2EVXA 3EYIA 2IW5A 2DBBA 3LA2A 1DGRA 5FLJA 5JSRA 1ULYA 5D6FA 4HLXA 4XFGA 2HEOA 5AONA 1HKSA 4XFHA 3FMSA 4HSLA 4KUMA 4TLFA 4RB1A 1YFXA 4L0YB 1VR3A 5FB2A 2EWNA 1KQ0A 3DXJF 3F8NA 5LEJA 4LLGF 4WF2A 5D4SA 3EQLF 1CF7A 3OF1A 3U11A 3BB6A 1LR5A 2IXHA 4HYEA 1QY4A 3HIFA 3H3ZA 4OFGA 2QQAA 4XRFA 1MJ9A 4XBFA 3CUQC
chains in the Genus database with same CATH superfamily
5GKAC 2ATFA 1BBYA 2L9SA 4NN0A 1R4MB 4YZ5A 5LCWL 1BI2A 5JUVA 5EJCA 1G3SA 4MFDA 1K5MB 4ZS3A 2FU4A 1I6XA 4F83A 1F8VA 3BU7A 5A80A 4UB8C 4FPLA 2PHDA 3OJBA 2FZ1A 2P81A 3AG3H 5FPUA 4M3BA 4Y20B 2Q8CA 4XTMA 1JHNA 2DTWA 1MS1A 1EF4A 2PAKA 2LTPA 2WAQA 3OS1A 5F3GA 1UOFA 3LEIA 1BR4A 1JUPA 4IRIA 4HZFA 1TMF2 2NYXA 2BNNA 2XMLA 4PLOA 2GMEA 2RR11 4D3WA 3IRQA 2GSYA 4XFFA 1C8M3 2QA4I 3J7NA 2OUMA 1GYKA 4KG0A 1UOJA 1K42A 4LHNA 4ASNA 1FOWA 3RTRA 4WCGA 4IRHA 2BYVE 1T39A 2DQRA 3ASOH 3ERMA 1ZELA 2KIMA 3MUY1 4YSFA 2ID4A 1S0IA 1MW7A 2DVFA 2XBO1 4WXDA 5KC5A 2UV1A 4HRIA 3FM5A 3AL0C 4Q1RA 4AEDB 3POFA 3V8KA 3WTYC 1BQPA 2IEKA 1G3WA 1X2MA 4AQSA 5FZ6A 1DBNA 1KS4A 3WHBA 1JKOC 4U7BA 3HOVJ 5FLIA 2GC0A 3T3YA 2Y6FA 2ZX1A 2X29A 3K4CA 3COAC 1SACA 2Q1FA 2GC1A 4HK9A 4IGOA 2DU9A 2C4XA 3ZFEC 2DK5A 4ES8A 3BIEA 3PJYA 4QSHA 4CSWA 3JTGA 5FFXA 1IO2A 4E27A 3HOUJ 4ZZDA 2BW3A 2JDAA 2WZEA 4EMSA 4ZDPA 3ZXAC 2UYBA 4KT6A 5LGTA 1Y4WA 3KP6A 1FOD2 3CL1A 5A3MA 1AL23 4HG6B 5JMCA 5FZKA 5FXWA 4YZ1A 4OQ9A 2WS91 2KQRA 4XF4A 5D5XB 5D2AA 1UY2A 1JH5A 5L3GA 1JYIA 1GXPA 3TNQA 2ZSHB 3LFMA 2FJ1A 5BUVA 3PJQA 1V00A 4TTGA 2V09A 1T6SA 5FYMA 5FPAA 1JOBA 1Z3XA 4HVOA 5DPNA 2WT2A 3M8LA 1VQ8I 2W9XA 2I8DA 2R061 2WQ8A 1KQRA 3HHGA 1UPIA 2ISYA 3ZXGA 5HDKA 5FV3A 2G7UA 4UXAA 2HJIA 1T33A 4YZ3A 3CESA 1FOKA 3U75A 4XAAA 1X19A 4AIJA 1MEC1 3VBFC 5JR3A 2BFUS 2H09A 3HGYA 3TW6A 5EP9A 5F08A 4DEVA 1RJ7A 2VQHA 1VRH3 4MHUA 3JW4A 3FXRA 4M3GA 1VIWB 3WW3A 2Y33A 3CJIC 2BXZA 1ETVA 4YM3A 1ND3A 1NE6A 4UF0B 5IJRA 3GO5A 2YU1A 4A3DJ 1OVPA 4IV3C 4LORA 1R5GA 2ZACA 2KJBA 4ENMA 1RUH1 1N78A 2UUZA 4XKCA 1D0ZA 1ND2B 3BR3A 1ZZ6A 4PJNA 5FYUA 3F8BA 2OS2A 4KU8A 3ACLA 2HPMA 4YELA 4EN6B 2W1OA 4OQ8A 2FX0A 3J81Z 3H1MA 4CCCA 1BMV1 1U12A 1ZZ7A 4H4KC 4QWQA 3ZXKA 5LY2A 4KMUX 3QPHA 1LGBA 2NZ9A 2YZ4A 3AYAA 1WMEA 2VCMA 3DYMA 5BPXA 1ZNPA 4C1WA 2W1UA 4M6VA 1FPN1 2TUNA 4A5MA 4KIBA 3BR5A 4HL0A 5IK5A 2XUBA 3S93A 2AUYA 4OUEA 3SH5A 1FP2A 2A6YA 1ZZ9A 2FMLA 3OL4A 4N8MA 4II2A 1AVBA 4QU2A 2WAOA 3UNPA 4H0EA 2JMWA 5IAVA 5M0TA 1T98A 1F4KA 4BL0B 3FXLA 2VUJA 2JICA 3ACHA 3CNAA 4DUXA 3POIA 1QVTA 5F37A 1T2XA 5LZ6A 3L2HA 5C9AA 1MZBA 2BPA2 3QAHA 3GHMA 3E7LA 2LY9A 1XSQA 2X1EA 1VBB2 2IXSA 2A68F 1W9WA 2I74A 2DA5A 3DTIA 3A4CA 1DIWA 4RQPC 1PO12 1POV0 1VAVA 3FZ3A 5EYXA 4V2FA 4XLEA 2YUSA 3VYTB 3BZCA 2VC9A 2XVCA 2W91A 1TL8A 2CU5A 2PA7A 3OS0A 2JB4A 1QOOA 3BCAA 1E5HA 4RS5B 2VQTA 4V2VA 1AR63 5E8IA 4FPJA 1QJFA 3ZXLA 1ZRIA 5IVYA 3HEIA 1KDKA 1MBGA 3EMRA 1IOAA 2RS52 4Q4Y1 3RFRA 3GZEA 2CGNA 5DS9A 1RUG3 4OHVA 5E89A 1IHMA 2OA2A 1BOAA 2ECBA 4QQLA 3TP0A 4F91B 4K21A 5LBFA 1UIKA 2PX9A 2WNVA 4LJHA 3NNLA 1JYTA 4F8AA 4BQ1A 2X05A 5J8FA 4KITB 3GJAA 1G7YA 2CV1A 5E1XA 1FMWA 3E5UA 3JSOA 3PSFA 3KLNA 2JD9A 3JAMK 5ABJC 1NXMA 3F72A 2QZ8A 2LC2A 3RKWA 3SC7X 4IHYA 3T5XA 1BJAA 1MSFC 4PFOA 4ZONA 3C2GA 2OXBA 2WNUC 1JU4A 1DDLA 2YB7A 5CU1A 4PJJA 4BY1J 3KIOA 2JD4A 4FTSA 5JI9A 4G12A 1IW7F 3RVHA 5LHGA 4ZZ5A 4N7UA 4OMZA 1PK6A 3U0ZA 1CAVB 1FOYA 3BG5A 1O8PA 4CH7A 1R7JA 4R4ZA 5IFTA 1W6QA 4L5JA 3LNQA 3SCGA 3ME2A 4XJUA 3HQUA 2BY2A 3B00A 1K6YA 4EM0B 1QH6A 3P5JA 4AIDA 1TVGA 2GNDA 1ETYA 1T38A 1FMVA 4WM7C 3M07A 5L3FA 4QPYA 2VXRA 4B1LA 5EYRA 4M3FA 3OD0A 3LSGA 3VB9A 1RUJ3 4JTNA 3RS6A 4HEA2 4A0YA 5FLMJ 3F21A 3MIBA 2XLGA 5FRNA 2VUMJ 4BHCA 1UWWA 1I9RA 2FZ2A 3AFHA 4BQNA 4HV5A 1O4XA 3Q0VA 4HQMA 5KNLA 3ES4A 2VBXA 5J8CA 2B8MA 4RAYA 5DQ0A 3RZKA 2HPIA 4IEVA 1Z0XA 3GTOJ 2LP0A 3SZPA 3WQ7A 3BTIA 3FMQA 2VN2A 4Y5SA 3WNMA 2ZGMA 2XF7A 2IGOA 3AMPA 4NROA 1KONA 2R7QA 1BR1A 1RR7A 1FYUA 4KGGA 3OBRA 1B4AA 5IPAA 2CS3A 2VI6A 2MABA 2R6QA 3E1SA 4PI2A 2Y6JA 3VPRA 2JDZA 2VPVA 4GMP0 3SYTA 3LQQA 3WY6A 4ANJA 4KNYA 3Q8AA 2DFFA 3ECOA 2FHRA 5FKKA 5GPAA 2Q30A 4M74A 1FMD2 1JJ8C 2HXIA 3OYNA 5EEAA 3DN7A 4GALA 3N36A 3OYEA 4OUMA 2COMA 2ZGRA 4M9XA 2YC4A 3J7LA 2YX4A 2B9SA 3CF2A 1IS4A 2Y48A 1YX5A 2DBNA 2M0CA 2VTXJ 3K3OA 3VBOB 1S0EA 3SQOA 4Q4W1 3AZWA 3QODA 3LDKA 2FQPA 2O3FA 3LMMA 4A3LJ 3LZZA 4JDMA 3CDLA 1CZVA 3T2OA 1W7PA 3F8MA 5F1JA 3N9QA 2Z79A 2YYOA 4AVZA 4AHXA 1Y9MA 1KYWA 4J1WA 4UFJA 2CUFA 5JIAA 1KD7A 3R60A 1EV13 4M6XA 5KHHA 1XNAA 1S72I 5KBFA 1MNDA 1AZDA 4A3FJ 3GYDA 3N9MA 1ZBA1 3WG2A 1AYM1 3N7KA 5BNGA 4MSVA 4LBQA 4CDWA 4LJZF 2JDYA 3K1NA 1U5ZA 3OPTA 4N43B 1AF9A 3MMYB 2HWB3 2QQLA 1N1TA 2V72A 4HX4A 1I3HA 3B69A 2GM4A 2JA5J 1HDDC 3VV1A 3D6EA 4NQWA 4NDLA 3L2UA 2OZJA 1OUXA 1S7OA 3HNBM 3V65A 2OC6A 1RNLA 3C7OA 2PLV3 1NHAA 2TNFA 4GIQA 1KU7A 4D7TA 4RGGA 1GQHA 4G9YA 1QRYA 4Y3OA 1QIQA 1PVC2 4P14A 2ZAAA 2QUFA 3PNVA 2MC3A 3K6GA 3DLAA 4KYWA 3A4UA 3OY8A 1OVSA 2GH2A 2VU9A 5D21A 1O5LA 4WM8B 5A7SA 4JK1X 2D98A 4MGYE 1XSDA 2BBAA 3HBZA 3M1EA 4UNOA 3C7HA 3TQNA 2NOGA 1CAVA 3HC7A 1W2TA 2VO5A 2TCTA 3WG7H 2P5KA 3WF2A 3AP9A 4I0AA 1AXYA 2PMZA 2CRGA 5IVVA 4J25A 3FM3A 1X9PA 2M7BA 3EBRA 1CQ9A 2Y6HA 3H7JA 4B4CA 1QJU2 3EPZA 2VQCA 2IVIB 1TQMA 3S30A 4XMIA 3WP4A 2PTMA 3IWZA 2IZWA 3ZDVA 1DP7P 1F5TA 2E63A 4C0HA 4YVWC 2ZJ2A 1GNHA 3KV4A 3WODF 4JHTA 2YGMA 4IEYA 4L0PA 5I93A 4PIZA 2O0OA 3RZLA 3A0HC 2QKMB 3VKOA 4L2NA 1COV3 2VZPA 5GM0A 4IEXA 5D8AC 4S05A 5FP4A 2Z4FA 3DV8A 1POV3 3MIHA 2KIUA 4UV9A 1NA1A 3MIGA 4IERA 4MOAA 1UZZA 5CA6A 3AXDA 2VUCA 1PX4A 5FBJA 2ZZQA 2JENA 1XPWA 3S1MJ 2BNOA 1OLRA 1X8EA 5KK1A 1DQ1A 5IYCJ 1ZR2A 3UR3C 3AMHA 1YFWA 2UWCA 3ZOIA 3KT7A 3AP5A 4JX6A 4AVSA 2OT7A 2ZMEB 3KF5A 3R4SA 2R7FA 4A5NA 1BI1A 1OCCH 2VLAA 4CEYC 5HV0A 1NAEA 5FQ0A 1B9MA 1DCSA 5LBBA 3PUSA 3ITQA 4MV2A 2Q1ZB 2QBXA 1GHCA 3TNPB 3FE5A 5F2WA 5FXZA 2Z9OA 5CVJA 2V4JC 4GH4C 5KHDA 5CFCB 4LA2A 1M06G 2VE1A 4NOTA 5A1FA 3E6BA 2R0FA 3SHRA 3S0MA 2PHRA 4N4NB 3HHHA 1X3WB 3THDA 3D5SC 5HDGA 1GMMA 1DZTA 4XJWA 5T52A 4RN5A 1RUF2 4JDNA 3BGAA 2TEPA 4IJAA 2XAJA 1V6IA 2B46X 3NKTA 1ZK8A 5FIXA 2O7OA 4LOSA 1PO21 1QJZA 4XLPF 3MW2A 2NVYJ 4YG6A 2RREA 2GN3A 4G3YC 1FSEA 3V0AA 1W06A 1JYXA 5DZGA 3JRBA 1OOPB 2X5IA 3K3NA 5K0UC 1MZ5A 3CHXA 3I3DA 1EH7A 1Y6IA 1NYWA 5F5CA 3SDBA 2XGEA 3RI9A 2ZGPA 3DF8A 4WBBA 5LK7B 4ESJA 5AC93 4M3DA 4CCKA 1NCRB 5GLVA 1V9U1 2K9SA 1RUE3 1S4CA 4BDZA 1S7AA 3WQ1A 4CO8A 1O4YA 3P5BA 4XFAA 3KV9A 1RHI2 4X0GA 2XAUA 1T8IA 3O1VA 2PJRA 2DCJA 2ZGNA 2P8TA 1YJLA 4HXCA 4B1RA 5ACA3 5FZ3A 5IW0A 5EWSA 4AR2A 4ZC3A 1H9TA 2R7SA 4HQEA 4KA4A 2YDEA 4P96A 4ASMB 5DD8A 1R083 4IL7A 2BEOA 2HZDA 3KZZA 5EFUA 3HWJA 3SCHA 3NAPB 2DBIA 3MPBA 3UGHA 4XACA 1O7FA 5ERIA 2FDGA 3J80Z 4U0YA 3GTMJ 1RETA 2WYSA 1JYWA 2QUOA 4V1PA 2VNVA 5ANQA 5J98B 3I4NJ 2ARAA 4XXAA 4Q27A 3VBHA 2COBA 2V5YA 3CCJI 4M3EA 3ABTA 2E32A 3RKXA 5FPXA 3ROUA 3THTA 2CUZA 3HVDA 1GZWB 5A33B 4XJZA 2R5YB 1V0AA 2HWC3 1H2KA 2RR12 1J3QA 3LQCA 2Y60A 4IDZA 3OB8A 2ZJPF 2VXZA 4UHTA 4GMP3 4LGWA 2ZFUA 4L18B 2X48A 2DQLA 1JI6A 1MSEC 2V1UA 2LUWA 4FTBA 4BNCA 5KAIC 3HAGA 4IOAF 2CMPA 5BQTA 1VMHA 1AHSA 1GP5A 3LEKA 4BDVB 1A78A 2XB6C 2ADUA 2DAOA 2ZHNA 3SFZA 2LROA 5FYIA 3RPUA 3A22A 3AKZA 4YGBA 1AU7A 1N1VA 2NMNA 1JYNA 4JKLA 5E3LA 2QCOA 1BR2A 5M5YJ 4DQ2A 1NQJA 3AFKA 1OA4A 3OYBA 1REPC 3E5QA 4EN7B 2WBKA 5GLTA 5C4WA 1XNBA 4I01A 3ZLIA 3U78A 1P4AA 4MEXF 3ECQA 3NRVA 2XQXA 1POQA 4QXHA 3T08A 1H8TA 3O0WA 1J5YA 3WG4A 2E35A 4PCRA 1HXS1 3MF9A 1DGRN 2E7TA 1UXXX 4FT8A 5FUNA 3K2AA 4IW3A 4IHVA 4RR3A 2X6WA 5A7WA 2HWVA 4IHSA 1ULOA 3OYLA 3CJRB 1X58A 4C90A 1AL22 1XYOA 3VSKA 3HOSA 1N3QA 3WOGA 1UL9A 2CDOA 1JXNA 1R1A3 4N0BA 5J4VA 1SBDA 2JUCA 1O5UA 4P5HA 4TYSA 3WTXC 3U1DA 3UL2A 4CRQA 5FYHA 1IV6A 3Q9VA 2ZAHA 3OG2A 2VAUA 2C6SA 4V2WA 3KE2A 3BKZA 5IVCA 4O6JA 2HQ5A 4CP2A 1D4M3 4XJAA 1CX1A 4BK4A 4N90A 1HN0A 2IPQX 1X1PA 5EF6A 4GAZA 2ZMLA 1LQ1A 1WQ2A 1D0GA 1KRIA 2KISA 4IHTA 3H9AA 4EGYA 3OBTA 2E7QA 4URAA 1QJY3 2W39A 2VB6A 1LGNA 3WTUC 1OPMA 4DBQA 2HTJA 1WGXA 1SLBA 5E18F 4BJTA 4XILA 4X6QB 3F9KA 3MHZA 2XJQA 2NMOA 5FJHA 1VRH2 3B94A 2CW8A 3KCYA 3OGRA 2VULA 4YW1A 4Z6YA 1RUH2 3ZXFA 2EK5A 2IXCA 4TWTA 2GN7A 2VKEA 5BOXA 1ZBE3 1C8NA 1U0JA 2GXAA 2JG9A 2BJSA 4P9GA 1QXPA 3OGVA 2OA4A 2O8XA 4LIUA 3TWIA 1BEV3 3FIWA 3BPXA 1VB2A 5K7ZA 1K4SA 3IWFA 3QPTA 4B8EA 1PYVA 4D1QA 4ZJZA 1OR7A 2LK2A 4Y13A 5JOXA 5GLWA 1TQ5A 4IV1C 2HXOA 3G6JB 1AUYA 3F22A 1JODA 3IAM2 2P1BA 1BM9A 3ABMH 3CCMI 4ZDOA 3VBRC 3K70C 4XM3A 2IT0A 3IH4A 4ZKTB 2EINH 5C8CC 4IGPA 2WO3A 4EYUA 1C57A 4JDOA 1MH4A 2H8RA 1F35A 2K40A 2QQKA 1A8DA 4RBOA 4YFZA 3FFQA 3B73A 3ZXEA 3P9KA 5F6FA 5B5EC 4LKEA 1S5LC 4FQGA 5F5AA 3Q9SA 2EZHA 1M1EB 4L0ZB 2W24A 1VBC3 5CYYA 3Q9OA 5GZEA 4DOUA 2CQKA 2XAHA 3T2QA 4UXNA 1LEMA 5C4JJ 3FLTA 5DTDA 4BUPA 4BQ3A 1H0MA 5LEKA 3CCQI 3CC2I 1NCQB 3GBWA 1UHMA 3DU6A 1ZRCA 2JECA 2OU2A 2VJ5A 3CJTB 3VOEA 4CDQC 1NQDA 1GQPA 4YM1A 3DYPA 2E1MB 1LE8A 3WF0A 3E6CC 1U2WA 1WLWA 3H42B 3BWGA 3R61A 4CXYA 3H3VK 2VQGA 4MZUA 4D0PA 4D6SA 1AR62 3QD6A 3WDVA 3HUGA 4M3CF 4XL9A 4Z2AA 2PMZN 2G9WA 4CTEA 5IAXA 2JA7J 5E1ZB 2V4AA 1TLHB 4EROA 1IGNA 2MD5A 2LSOA 3R0RA 3D5LA 1LFBA 4IEPA 1YW8A 4DO0A 1RUG2 1YCIA 1B8IA 1CZSA 3PQJA 3VYSB 4OIPF 3I2KA 4J01A 2P5LC 2ZS6B 4P9FA 5EJ3A 4C2UA 2WUHA 4DQAA 1OFNA 2IBDA 4OULA 1FIAA 1FV2A 2OZ6A 3PUHA 1S6LA 2FBHA 2K4BA 3WGHA 4YG2F 2H0VA 2MH2A 3AP6A 1OMIA 4S2GA 3O1UA 3ZQGA 2P7CB 3HMYA 2P5BA 2ZXIA 1O3QA 4E70A 3DPLC 4XRSA 1FYMA 3VDDA 5JPMB 2ZHLA 1VPHA 4RGRA 1Z7S1 1XCBA 2VCBA 3DU5A 1VQ5I 1OXCA 4ZYGA 4Y1YA 4QPWA 2E36A 3A1YA 2WZR3 1X3UA 3JBG1 1ZZ8A 1OYWA 4AFMA 2LVSA 2NN8A 4JRAA 3EB7A 1YS6A 1RKWA 2Y6GA 1ETXA 5FKNA 3GW2A 4JVAA 2QWWA 4OAYA 2YMZA 3DBRB 1S0GA 3USSA 1KQ9A 3H9JA 4C0BA 4LLLA 1ZYRF 3B6AA 5LY1A 2WINB 4WVMA 4LK1F 1LVAA 1HB1A 2M2EA 4FOYA 2J1EA 1BC7C 2D7FA 1QGPA 5F0HA 4PIXA 1O6UA 1KU3A 1KZHA 4XN3A 2VQ0A 3JRFA 3ZYRA 3FHAA 1ENHA 1XE8A 2XL9A 3BDDA 1OCPA 1UHWA 2C5DA 5IYBJ 1W9FA 3GEZA 1H1AA 2QFEA 1R49A 2JA8J 2N7GA 2Z42A 2Y8KA 4CYCB 1RINA 1W04A 3H1WA 3LPGA 1EKEA 3FXOA 1HB2A 1XE0A 1XX5A 4BXSV 1YC61 3A01A 5GZGA 1JZ5A 3H9GA 4CDXC 4LK6A 1W03A 4EGZA 2SLIA 2VUDA 4KBZA 5FZ4A 3BLYA 1W5CC 2NP0A 1MMGA 3TYJA 3SEQA 2P6HA 2Q8KA 4LBJA 4S2FA 4XBQA 4BYYA 2B7YA 4I99C 4BE1A 1PM7A 3DGTA 3JCUC 4YGEA 2A70A 3I3LA 1K78B 3R6SA 5K8SA 4N53B 4BJ5C 3C3WA 4TXWA 2VOKA 1NG6A 1IN4A 1PMIA 2DMNA 1U9OA 1W4MA 4GWIA 3B02A 3TP3A 2ZGKA 2EIBA 4MLOA 3IBMA 4AZZA 2D40A 1W8OA 2BNMA 2XJTA 1WZXA 4E8DA 3R0JA 3FN9A 4FPCA 3O5SA 2HQNA 5A6ZA 5F0CA 4F3JA 5M3FJ 5FRAA 1CIYA 2CAUA 2PHWA 3CJIA 3H8UA 3ZIXA 3M70A 2DCTA 4I02A 5GTHC 1QZEA 4HOOA 2EQRA 3W59A 1AR93 1B35C 1NCQA 3QU6A 5HXVA 5ICGA 2QGUA 3J8F1 3GUDA 4DZGA 1BW5A 4AI1A 4L9TA 2R7EB 4BHBA 4CU6A 2E5NA 1EV12 4XQDA 3EQEA 2NNYA 3VEPA 2LRPA 5KHKA 5A7NA 2D6LX 3T0AA 2JSPA 1SAUA 3H1CA 3MV11 1Y8QB 4HN0A 2VT2A 4G6TB 1X50A 3TEWA 4LFUA 5K5QA 3NJZA 4IE4A 1GNYA 2CGPA 1MR5A 2HWB2 3ACGA 3EYIA 5FLJA 3DLLF 1W6PB 4HLXA 2LALA 4KH9A 2HEOA 1RUC1 1HKSA 3FMSA 4HSLA 4KUMA 5FY9A 4L0YB 3PVNA 1WCSA 5GLZA 1Y7BA 4YW3A 4F93B 3O1OA 5B1AH 3AL5A 5LEJA 2PLV2 3K4MA 4QHZA 3OF1A 1N3OA 2OKXA 4QPGB 2K9QA 4URTA 3K4KA 2QQ8A 1AR83 1RMU1 1C28A 1D7PM 3HIFA 1W8HA 4OFGA 1ENRA 4XBFA 3MBWA 2ZMKA 4E7IA 3AZZA 3CP2A 1GV5A 3DKQA 1ODDA 3BTJA 2Z69A 3S5QA 4Q5SF 3INAA 4OLLA 4JTOA 4B4PA 4YM0A 4G8XA 1V6OA 3AG2H 4OIRF 4Q4V1 3A0NA 4GB33 4ZHNA 4M01A 4HDVA 3VZKA 2VKVA 5E3OA 1MMDA 4JHZA 3ESWB 5A3UA 4HLYA 1NY72 4AYBA 1OSGA 3OTFA 2YBSA 3CLQA 1YFUA 3DBLB 2EFWA 3FZVA 2VKDA 5FOBB 2Z1DA 3K77A 1E3OC 2JDKA 2JTVA 2BOJA 3WTWC 3FHIB 2X6OA 3TB0A 3K2OA 3V8JA 4DNCA 1WUVA 3SEZA 5FZHA 5E16A 3T8RA 4IZZA 2PFWA 1OFSA 3MEPA 4AW7A 4AFDA 4MXVA 1WH5A 1HF0A 1ZRRA 4QX2A 3I3MA 3JQWA 2K9LA 3E3VA 2QQIA 1COV2 5GTIC 4D8MA 5HOOA 1BBT3 3CCYA 4AAPA 4FBFA 2IJLA 2FMYA 3MUZ1 1JUMA 4MQ9F 5FLXK 2VOTA 4EJVA 2WNUA 1DUXC 1K5MC 1R091 4BWOA 5CFDB 2YV8A 4A3MJ 1SFPA 1X4OA 3D0JA 2PEXA 1ASJ3 3MGUA 3P3NA 2FBEA 2DUPA 1S1AA 1W1WE 4Q29A 2WT1A 2E33A 1UMZA 2JZYA 2HWF3 3ZMVA 1D8KA 1AOYA 1WCUA 2WA4A 2IA2A 3CCVI 2H94A 4C30A 4RM3A 3VD5A 1I1EA 1QPMA 5IFPA 4Z92B 1J84A 4W6XA 2HDDA 4E6KG 3K4AA 1IRXA 4IEOA 4G6QA 4HKWA 3IKVA 1RB8G 2WIIB 5GP9A 4P5YA 4LXLA 1ONVA 3RYKA 4PDWB 1XNTA 1FYLA 2ELHA 2CSOA 1BVVA 2EIEA 1NLRA 1R23A 1LKXA 5DN2A 4A3EJ 3IIAA 4XUQA 4L5EA 5CZKA 3RSJA 4K9SA 2IFRA 1YYVA 3WP3A 2K9NA 2VVEA 1K79A 3VB2A 1W0TA 4AEDC 2IA0A 2ZJQF 5FR3A 2WNVC 3PUIA 1BW6A 1RRJA 4CP9A 2WA3A 3WW1A 3I5UA 2DDBA 2R7WA 3ZPLA 3OOXA 4FVVA 4K2EA 3ZFFA 4LLOA 2LH9A 1ALYA 3FK7A 3GXUA 4Q1PA 1IG7A 2YPJA 2ZBKA 1NG7A 2BVBA 2WO1A 1UHSA 4CGZA 2HFHA 1R5ID 1QF3A 2ADDA 2VCAA 3AKSA 3VBUA 2HEYF 2ICWG 3OEBA 5AC92 3HNYM 1RUD3 2JA2A 2F48A 4A3JJ 3RKYA 4Q8KA 3A02A 3FXUA 3ZN6A 1RUE2 1S9HA 3RPQA 3CUQA 2O8KA 2JG8A 4H55A 5J4YA 5J3UA 3AAFA 3RQ4A 1UFMA 2BWCA 5H6QA 1ETOA 3UV9A 2V7FA 4ZU5A 5ACA2 3LGRA 2W85A 1G9BA 4IL6C 2EAKA 4NRPA 5BNPA 5IK8A 2B42B 3IMMA 2P4EA 1WKYA 4QQPA 2Y0MA 1BVP1 1CF7B 1R082 3PO3J 2XOMA 3CMYA 5CQEA 1FYKA 3DPRB 3O1PA 4QHBA 4YM2A 3RIRA 1RR8C 4UW5A 2QKLB 2I5UA 2WAAA 4B8XA 1OFCX 2GOMA 1IS3A 5DUUA 4O9EA 4OHYA 2E71A 2Q8OA 3UKVA 3OSDA 2BY1A 3I0TA 1WD4A 4QHOA 1LAJA 2QQWA 4NC7A 1H6XA 5F32A 5IATA 2M1BA 4XSXF 2ZPXA 4O9GA 2K86A 4A69C 3RZJA 2HWC2 2L4AA 3GTJJ 3MN2A 3WF4A 2GLOA 4JGYB 2HYFA 4XBNA 1FOD3 2RMU1 1H4HA 2XDVA 5DUKA 1WW7A 4X6RB 1U5IA 2MH9A 3SEEA 1H9GA 1SFKA 2P2KA 2H0BA 1X9TA 5FKLA 4BCUA 4KN4X 1TEIA 1V70A 3BN6A 1ND2C 2QVSB 1B1BA 1BC8C 4QXCA 1KU9A 1REDA 1SBFA 5CG9A 3UYJA 3QP5A 5DCMA 2LOOA 1PVXA 1TT0A 4K1ZA 2XB0X 2ZNZA 1L7LA 4NC6A 1VMFA 4OAZA 4EE2A 1A04A 4J6GA 3CLPA 2CV6A 5EXOA 1ITYA 5CVVA 3DL3A 2VZ3A 5A32A 4TSVA 3I2GA 5CJ9A 2DTYA 5DZEA 4LG0A 2Q1MA 4LT5A 2PELA 3MIEA 3I3EA 4ATEA 1RTVA 2Y2ZA 4AGRA 1UG0A 1G8XA 2WZPP 5EV7A 2XKPA 4QPIB 2DDUA 5BNOB 1TQPA 2XV4S 3ZN1A 4DYQA 5FPLA 4XLCA 1GQGA 3VKMA 2HWE3 4ZYAA 4OIOF 4IE7A 3SKJE 3KLSA 2FDFA 1Z21A 2D6NA 3VYUB 4YNIA 4L9BA 3IB3A 3BCWA 1Q1HA 1RPWA 3PU3A 4LD5A 4QXKA 3OPWA 2FE3A 3WF1A 3GMEA 1R1A2 1TME1 4GWNA 1AR73 2R7OA 2RS33 2KFDA 4DZJA 4L9VA 4UAPA 3WQ0A 3WNLA 1OYYA 3SMHA 5E6HA 2W84A 1GOHA 2RAEA 4BEHA 2ZGTA 5FY4A 3M3OA 1LHUA 1UB9A 5B4NA 3RI4A 1H9PA 3MLKA 5FKOA 1O8SA 4RS5C 4DGWB 3ZN5A 3ZM8A 5A3TA 2OTJI 4YVWA 1D4M2 1QHDA 3ZYGA 4HF1A 4E4DX 3WGGA 3M2MA 4H2AA 4CDWC 1CR7A 1IN7A 5HVQC 1JI8A 1H9WA 1WJAA 2WFF3 1QJY2 2WT0A 4CE8A 4KISA 1AL0G 4UVCA 3N9NA 1CPMA 5D8AA 3CIHA 1UYPA 2VQUA 3BROA 2L54A 5JZGB 2RQQA 3D82A 3SXWA 1Q8SA 4XEZA 3CKHA 4A6SA 4QPQA 3QOEA 1TWAJ 1VTNC 1GU3A 2A6TA 1CAWA 1XMXA 2Y30A 1H1IA 3PVOA 5IUQA 2W48A 4FPYA 3OOUA 3ZMDA 2O5RA 3TN91 1ON2A 2XWBB 1ZBE2 1NLQA 3PIJA 4XJ8A 5FZOB 4MXWA 1BEV2 5GAHJ 4C9YA 2CQQA 3REOA 2P37A 5GZCA 4PDKA 5C3SA 1PO13 4GO1A 4AD9A 2Z5UA 4CEYA 3O3KA 1Y39A 4AVAA 3EHKA 3O1TA 1XG1A 2BZTA 4XQFA 4XYXA 2LY2A 3H35A 3VHOA 1PIV1 3GFJA 4BBSJ 1FAYA 4J1XA 4XF3A 4UYBA 3HRUA 2VZTA 4M3CE 3S2WA 1LDKB 4EN9B 4GH4A 4PCQA 5EGOB 4BQOA 3ON7A 1F31A 1VNDA 2EB7A 3PNYA 1G8WA 1W36C 5F8PA 5JOZA 2IVMA 1C5HA 3LEMA 1TZLA 1DQ2A 3IRRA 2OCCH 2AEYA 3GFLA 4UFHA 4COVA 2CHHA 2M0MA 4MGKE 4YRDA 4DXSA 3K4DA 1L7QA 3Q8EA 1A31A 2JT1A 1VBC2 3TGNA 2V9KA 3L2YA 5KCMA 1V6NA 5ERLA 5LB6A 2DW4A 3IUOA 3JRCA 4LIVA 1NA1C 4MADA 3RQ0A 3BJAA 1MBFA 2RM21 4B4QA 5FZ8A 1DU6A 1LJ7A 1QJX3 1W2AX 3M8JA 4IGQA 1HW5A 2FD8A 4L11A 2HVSA 2OF7A 5GJ6A 1DZRA 2DCEA 3OYWB 3BJ6A 1QQP1 5JDBA 1PGW2 3LAPA 3CO6C 3NWKA 3ZFEB 4KI5M 4L99A 2VNRA 1T6BX 3M7GA 1OCRH 4J19A 3DCFA 1OKQA 1SD5A 4D69A 4BJ0A 1VMJA 1WMXA 4BDYA 2MBFA 2A69F 2RS11 1R22A 5BS6A 1XNKA 4CEWB 3LSHA 2FA5A 4E7SA 2L7FP 4I09A 2QQBA 3KMHA 1R64A 1L7RA 4QGMA 3NVCA 2VC0A 1TW3A 2G19A 2J42A 4NAMA 4XUPA 3FX3A 2EV6A 2ETHA 5HCAA 2R043 3N9PA 5FYZA 2STWA 5E8GA 3S32A 3NWSA 1Y9QA 2GQQA 3HYIA 3VBOC 3HNMA 2CYYA 2JE9A 2XAGA 4CA0A 1FJLA 1OKOA 4QQOA 5IK4A 3VBFB 2K46A 4KWUA 4XN0A 1IG0A 4M3CA 4FP2A 3AFGA 2WZR2 3IPVB 2R32A 1UMIA 4Y5TA 1USTA 2IS2A 2GAUA 2WQ4A 3IKTA 1VAKA 3Q8CA 2AO9A 1PGSA 1HIXA 1DHKB 5A2QZ 4RA2A 2W92A 4QGLA 4DINB 3BG9A 2DU1A 3ZQ7A 3PSIA 1EAH3 1MQTB 5IOZA 5DUXA 4UOJA 1XPXA 2YR2A 4JGZA 4M0HA 4IV3B 4DRRA 5DUWA 5DG1A 4CUGA 1BOBA 1EH8A 1AHDP 3J26N 1CAXB 3AB0A 3ZYPA 4N43C 4MYEA 4RAZA 2XPVA 4HNTA 3BOQA 2DXIA 3ZR8X 1U5XA 1MKMA 1DGWA 4OI1A 2JVGA 1P7JA 2W3JA 5DAVA 4ZS2A 4Q0PA 3USUA 2DURA 4JQFA 2WV1A 1IQAA 1N1SA 2M9HA 4FE4A 1GICA 3J9SA 1P4XA 4YVSA 4CDUB 5FLHA 4S2HA 3LE0A 4PT6A 5FXXA 1VBE3 5DDJ1 1RUNA 3BTZA 3NJXA 3POEA 1NOVA 3VBHC 4AVBA 3DTKA 3LSPA 5ISLA 4I98B 3NNJA 1MPXA 3N97A 5F1RA 2G0EA 2A3YA 4FTHA 4WM8C 4HPQA 2W87A 1V4RA 2ZXHA 5EIYB 1F43A 5FPBA 5LA9A 1SQ4A 4XW3A 1H88C 1DZQA 2VBWA 1TNRA 1QDOA 4CCNA 1E0EA 4Y4YA 2AH2A 4UB6C 1Q8VA 1FZPB 1QHGA 5HS7A 4EWDA 2CSGA 1IN6A 1IDZA 1SC7A 1A35A 5A3PA 1ZG5A 4PJLA 1TNSA 2B39A 4RQPB 1LULA 3GNEA 2VNOA 4FI9A 2EIDA 1CAUB 3L00A 1VBA1 4YARA 5J3LA 4RLQA 2ZX0A 1YRNA 2OQGA 4HT1T 5FTTC 3GTQJ 5EJZB 2CTVA 5F3CA 2JDHA 4ARYA 3CQZJ 1JZ6A 3I3BA 4FISA 1IXCA 2CFXA 4NPLA 4DY5A 1WCQA 2LMDA 3HQRA 1FT9A 1TG7A 3HR9A 1BJQA 4EN8B 5FZ7A 3I7DA 4KQ7A 4JX5A 4YW6A 2FUG2 5K4LA 3J8F2 1VF9A 2KMUA 1JTYA 3S14J 4G7HF 4NRQA 1PVC3 3T30A 3ABLH 3NV3A 5KVRA 2D93A 2VMIA 1H8TC 1AYN3 1DFQA 2QKDA 4OI2A 1UQXA 3POBA 5D4RA 3GZAA 2YC0A 5DXDA 2DUQA 4IV1A 4ET7A 4KG8A 1PUFB 3UT0A 1SLCA 5ABJB 1SCRA 4LA3A 2R5ZB 2XUMA 1WLCA 3LOBA 4Z1VA 2P3YA 4I76A 1DPRA 5APAA 1IAWA 1WMFA 2JJ6A 2ZMEC 1WKMA 3HRTA 4CP0A 1SPPB 2QEXI 5ICCA 4MX3A 1ZYBA 3UGFA 2R92J 1MBEA 3PTYA 1TC3C 1C5IA 1A6QA 3Q5FA 1W8TA 4KU7A 3HN1A 2MD0A 2A3WA 1BK1A 3U9GA 3KEQA 3TEXA 5A1LA 1WJFA 3JZVA 1HRI3 2L7ZA 3TW7A 4M0NA 4DMIA 3U37A 2W0XA 4QD2A 2CQNA 5EQUA 1ACIA 5K5OA 1H30A 1CIWA 1G9CA 4QPOA 1G9AA 1HV0A 1OBNA 2XSJC 3I49A 3Q0WA 2VR4A 4WM7B 1ZAOA 1J1LA 3LD8A 3C7FA 5BNQA 2KP6A 2EIJH 3K2ZA 1T6GC 1WVRA 2O6GE 1AR82 2MLGA 4FO9A 4EWAA 2BHZA 3PVEA 5JWPA 2A7AA 2K9MA 5M3MJ 2IS6A 3UESA 1MBKA 2AXTC 1I5ZA 3OGSA 3BR0A 2DFBA 4CDGA 2RJLA 4GB32 3BZ6A 3SITA 1OOPC 1WFXA 4HW0A 5FO7B 5FCCA 1XSXA 3LKJA 2ZJRF 3S3NA 1OR7C 3CLOA 2RV8A 1NCRC 2JVHA 5JLVA 1LCLA 2K27A 4L9JA 1LHNA 2NS0A 4FXGB 5HCFA 2DA1A 1KEXA 1W3VA 2ZFWA 2VZUA 2STTA 1UAIA 4B3AA 2LKXA 1OH4A 1UYYA 3V8LA 2XXZA 4NVPA 5BNNB 3LSTA 1QH7A 4PBOA 4XUOA 5LLQA 3TEYA 2EICA 3U21A 3JSPA 1U5YA 4B09A 1POGA 1OD3A 2QJVA 1I27A 2MEV1 4YW2A 3BU0A 2D2WA 3ETPA 1W2UA 3QYEA 4IEUA 4LLNA 3UETA 1MBHA 2O9LA 2VZOA 2OTLI 1XS9A 1VQ9I 1ASJ2 3E6DA 1XB9A 2ZKLA 3I97A 2YSRA 1ZA7A 1D0XA 1ZG3A 2WA0A 5AFEA 4LMYA 1H8VA 4OZXA 2PQSA 1W6OB 2HWF2 1X8MA 3DKYA 2NXNB 1HRV1 2P4WA 4HV6A 5L7OA 2CAVA 2GP5A 2J1SA 1DQ4A 1Y0UA 4U87A 2ZJCA 2HOEA 2LBFA 2VT3A 1ZVFA 1MS9A 1MJAA 5HBAA 2B5HA 3IH3A 1WH7A 3ZFGA 2XUEA 4OMCA 3O12A 4EEFG 1IS6A 1YOVB 5FZ9A 3FBMA 2QQNA 4LK0F 1F5JA 2DA6A 2VBZA 3K1PA 3KVBA 2XVKA 4I2OA 4OHZA 4IPAA 5TGTA 1R1VA 4DIQA 3WSOA 5IWFA 1IZ3A 5EJ1B 2F5EA 3NJYA 2ILMA 4EM1A 2KDZA 2ZX4A 1E5SA 4BB3A 3AG1H 2Z3YA 2VMFA 3CU7A 1VQKI 1S0JA 2E9QA 2UZKA 2RVCA 2BW8A 4OIQF 1XTAA 2MW8A 2RC4A 2A6HF 2LTNA 1JKQC 3OEAA 4GD4A 2HYKA 1DYKA 4CDXA 3HOZJ 4RHV1 4FTEA 2YU2A 1LUJB 3EDPA 1RC6A 4CXFA 1APNA 2EZIA 5EZWA 2AS5F 3PO2J 3LSDA 4FE7A 2Y75A 1NKGA 3GF6A 4WVWA 1ZREA 2RR13 3VDDC 1YQCA 4B1MA 1RUD2 4OI4A 5JI7A 4IX7A 5A70A 4ZXEA 1P2FA 2EFQA 2JB8A 2C26A 2DT7B 5JSPA 2PBIA 4Q2FA 2F6BA 4KBBA 2WFPA 5C5UA 3VDXA 1VP6A 4EVIA 4AQTA 4XURA 1LODA 2XBO3 2KR2A 3R0AA 2VZVA 3GZNB 2WNOA 4LO4B 4BQXA 1IRZA 3HM5A 1BLZA 1V6JA 1ACCA 1HKQA 4K6BA 1W6MA 1BI0A 5L3BA 2R4GA 1J75A 5AIQA 2DJIA 1U0AA 3KM5A 5LRSA 3ZMOA 2DTRA 1G2HA 1IQDC 2HYXA 3D5OA 3KHBA 5LK5A 1WW4A 2HWD1 4XJ9A 5LGUA 4JQRA 2F4PA 2XKOA 1L3JA 1B35A 5KWRA 4AF9A 5H6RA 2PMWB 3WE2A 4ESFA 1JOPA 3QRFF 5K5RA 3PUBA 5FY5A 4XKVA 3G1LA 5F7UA 2EXKA 1MIJA 4DJAA 2V73A 2ERFA 4PF5A 3H8XA 3UKTA 2WS93 2YPRA 5JAXA 2JUGA 1QGLA 2VG9A 2ZGOA 1ULFA 3ELNA 4XRSG 4INDA 1LOFA 5K7FA 4DXZA 3T1LA 4XHXA 3PNTA 2RVAA 1YE9A 3AKTA 3WU1B 2XPJA 3F3XA 4P9YA 2QYOA 3W2AA 3GCWA 5FP3A 2VBDA 4CCLA 3ISPA 3C8XA 4II3A 1G3YA 2R063 4HVRA 1EPZA 4TLGA 3VODA 1Y1WJ 1J3RA 1JMUB 3JD71 4EJUA 3ZSEA 3WF3A 3J7AO 3IIIA 1MEC3 1LESA 3BQZA 1K83J 3P7NA 4BISA 4UWDA 1YITI 1Z7LA 3AMQA 2GNBA 3KB5A 3TOJA 3ZYJB 1WI3A 1ORKA 5FFOC 1F9KA 3VFZA 4KMQA 4QKNA 5HNFA 4FX0A 2BZDA 3GGLA 3FMGA 3HSFA 1R9TJ 1TMF1 1JU3A 5T54A 3AL6A 4Q4ZF 2JRTA 5LFAA 3NQHA 2CWSA 3DEUA 2HWE2 4A3GJ 1V55H 3W6VA 3VUOA 1OPOA 5IT9Z 2HOAA 2MC4A 1RUH3 2XWJB 2K9ZA 2KIFA 2D97A 3JRIA 3CC7I 1NCQC 2JEMA 2R1BA 2OX0A 4UUSB 4IEZA 1Z67A 1QKQA 3M8FA 1K3IA 3ILRA 1AR72 2V9VA 2RS32 1WCMJ 1IPKA 4JZRA 2E1MC 3J81K 1ZZBA 5LW9A 4QXBA 1P92A 2X6XA 4LKDA 3GTGJ 4P9IA 1IF1A 3AZYA 2C6YA 2HBTA 3WTVC 3MW4A 4ZY9A 4M73A 1FPN3 3LA3A 4XDOA 2EA2A 1C4RA 1W3XA 3IZOA 4U0WA 5GALA 3KHCA 2FNPA 2TBVA 5K0UB 1YQAA 4H14A 5CB7A 4Q0VA 4XQWA 2C1FA 5T5OA 5B1BH 1RZ4A 3GFMA 2WFF2 5FKMA 4Q8LA 4A2UA 2PN6A 1GUIA 3KFWX 1VQ6I 1URXA 3OR2C 4U88A 1O57A 1VZ0A 3I53A 3S2HJ 3KYLA 3Q8FA 2E7WA 4XOTA 4CCEA 1LEBA 2LKPA 3CCEI 4XUNA 3URFA 5BY5A 4HKLA 1FOD1 1YTYA 2HOSA 3HG9A 3TN92 1XGOA 2MLKA 5IVEA 1K5MA 1BA5A 3TEZA 2ZXJA 1FLIA 3SXYA 1IRFA 4FHTA 2OPWA 3BTYA 1DQ0A 1HW1A 4Y20A 3I59B 2JPCA 1GZTA 1LU2A 4Y4RA 1S8NA 3IL2A 5FZAA 4V2GA 5F6KA 1ZQ3P 3PTRB 1GVDA 1PNGA 3LEGA 3BR6A 2E51A 3ZSMA 4IKFA 1W99A 4IXAA 2KIQA 1KQ8A 2VZQA 4Z82A 3SKVA 3LAGA 4N4OB 4CUCA 2OYZA 5J40A 3TEDA 4ZTFA 3K51A 1G59A 1O4ZA 4Q4Y3 2XJUA 2WSVA 3ZRGA 4RM2A 4IEQA 2JDUA 3T2PA 1UCRA 1HJFA 1SFOJ 3POYA 4LBOA 2JKXA 4BOWA 3PUFA 4NNJA 4AEDA 3ZXJA 2JRMA 1U3EM 5T3NA 4D94A 5C4XJ 3CF6E 5LBCA 3WNKA 3I2IA 3DEEA 4KDPA 3ZMSA 2Q8DA 5CVRA 1XCVA 3D1NI 5HS9A 4XZUG 2XPUA 2RM22 1UZ0A 5LHHA 1E3PA 2DCKA 3JRGA 1PZ7A 2MA3A 4OVEA 2EH3A 3NL1A 3OOPA 1LHOA 1QJX2 2I2SA 1RUI1 4HOBA 1Q43A 1OI6A 4AU7A 2GA1A 3PU8A 4MTEA 1HSTA 4NHMA 3HBLA 2ZGSA 4IO9F 2ELJA 4D7SA 1NX9A 1REEA 1UF2C 3VKNA 3CD6I 1V5FA 4I30A 2DYCA 3PLQA 4BACA 3AZVA 4QDRA 3I2DA 2UY8A 3ZIWA 3GJBA 4E4SA 1MDMB 5FRMA 4UBHA 2DFIA 5FGMA 3WX5A 2PMUA 3RNSA 1DDNA 3VDBA 1C1LA 1EA3A 5IYYA 4AVPA 4HDUA 3CP8A 5H9RA 5GPCA 1WSUA 4MHGA 3BODA 4U2AA 1VBB1 3ZMTA 3NJVA 2DDAA 4BM8A 2J5PA 5C8WA 3VZNA 4A0ZA 1FBSA 1K6OA 3H7YA 2O14A 1VQPI 4XC9A 2VQLA 1ZGWA 4XE9A 1WWXA 3U1KA 2WBMA 3ZO0B 2PLYA 2R042 1W6NB 1FX5A 3AK0A 4DUWA 4ZXKA 3SISA 1DGRA 5JSRA 1ULYA 3O8GA 3VBSB 3EYPA 2A6WA 4WVVA 5D6FA 1AX0A 3KQ4B 1MNEA 3QLQA 4UF0A 4XFHA 2VCCA 3QYBA 1YFXA 2A6ZA 2JIJA 5FB2A 3I4IA 1IC8A 2E2HJ 3ZFFC 4A93J 3F8NA 4Y7NJ 1X3ZB 2RS51 2LKSA 3EQLF 1ND2A 2M4GA 4Q5OA 4IOCF 3U11A 3VBUC 1DGWY 1LR5A 4HYEA 4FPGA 1EAH2 1ENSA 4W6YA 2Y9YA 3H3ZA 4FQZA 1LOGA 4GXLA 1MJ9A 3CUQC 2VE9A 4NHYA 3O1RA 2JG8C 5TSWA 4AUXA 4E7JA 1HSJA 2JSCA 1D5YA 2EBIA 2ORZA 2VBYA 4FETA 2LR8A 3CC4I 4U7DA 2VUAA 5FYVA 3ZYBA 1YX3A 3I64A 4P9LA 4L9NA 2WL1A 3ZYIB 5BNPC 2VOXA 2MNGA 1DQUA 3M1HA 1EPWA 2YFUA 3SZGA 3MZHA 3SZTA 3LSRA 3VBRB 2QF7A 4Q4W3 5FYBA 4F55A 3OY9A 4D6RA 5C8CB 1W9TA 5CADA 4YZ2A 1YYNA 1TQIA 4BQQA 3SLIA 3I2JA 3GCMA 4LK7A 4BKXA 4QU1A 1VBE2 2RG4A 2PYTA 3ZDSA 4KICA 3LF7A 4JYKA 4XNFA 4QPGC 2D1VA 4Z2WA 2VD7A 3UGGA 1TT5B 2F4MB 1IKQA 3MIDA 4HMZA 3F0CA 2LYCA 1ULGA 4LULA 2CJJA 5EG0B 2HVQA 1RVF1 3WLUA 2R071 4OI0A 1JT6A 1B72B 4C8DA 5ED4A 1TWGJ 4E2SA 2K02A 1ZBA3 1YJNI 2Y64A 1BK0A 1AYM3 4RD7A 1OCTC 1OPCA 2DF7A 2E26A 2RDRA 4RS5A 1LOAA 5ILSA 1J2XA 1VBA2 3OR1C 4IETA 4NHKA 4A4AA 1F15A 3S1QJ 4A7ZA 4CDQB 3DF0A 1ZGAA 5E79C 2ID3A 4HSJA 3BOWA 3VLBB 1GP4A 4DYCA 1YFHA 1W0OA 3PURA 1U6GA 2ZZJA 2HEVF 2VBBA 1JE8A 2VJXA 3VN4A 3FF5A 2NS7A 1A36A 1PUEE 4K7JA 5GZFA 3D3AA 3WP5A 3N4MA 2BUKA 1MS0A 1KU2A 2YBPA 2ZGUA 2BHYA 5F5IA 4RGUA 1VBD1 2HNHA 3QH7A 3WDWA 4DB5A 5IVBA 4A41A 3FHQA 2BXYA 2J7MA 1AYN2 2D5HA 5H9PA 3DQVC 3KETA 3BG3A 2DFHA 2MHFA 2BV6A 2UWMA 3AXEA 4QB1A 2IXJA 3MZYA 1RESA 4GWMA 2KD7A 4IXLA 2V4VA 3BZKA 2HTSA 1N3PA 3A21A 1SLTA 2DMTA 4YWAA 3H0OA 3DFGA 4HPKB 4AL9A 3X29B 3CCLI 4P5OA 1ZTRA 1JW6A 1LU1A 5A7QA 1QNTA 1FMD1 3IAQA 1JZ8A 3X2QH 4GYIA 4P1WA 2M8GX 2VTFA 4OMDA 4P00B 3M4OJ 4HLTA 2RDPA 1XSRA 3OUIA 1NXD1 4I7HA 1AKHB 1OD5A 2WZ8A 3Q3SA 2P3IA 4X1EA 2WN2A 1VAMA 1DQ6A 2WAEA 2DI3A 1PMHX 5HV4A 4A3BJ 3LOIA 4PDWC 3ZR5A 2DMPA 1HRI2 1W9YA 3ZN0A 5BV6A 2IGMA 3DECA 4MVTA 5DYMA 2VJIA 4WVZA 1UZVA 1RL3A 4AEMA 3JXSA 3U14A 3NNFA 2VNGA 4LKFA 3WT3A 1YO8A 1SLIA 3RDIA 5C70A 1HQWA 5FWEA 5JXHA 4QKDA 5H2FC 4P55A 4CXXA 2P7VB 1W8WA 2GMPA 2H1KA 4BQ5A 1HKTA 1DYPA 2WADA 4XIDA 2KXLA 3RGBA 1N47A 3VBSA 2IVJA 3TO6A 2R3SA 4KN7X 4RMNA 4JBAA 3AKPA 1UX6A 4LTAA 2WWSA 2RQPA 4GRIA 3T8TA 4CYDA 2JA6J 4JX0A 2ZX3A 2JDNA 4HN1A 4AHYA 2H6CA 1MMAA 4WK8F 2FEZA 1PM4A 4BLJA 3GZUC 2E2IJ 3UKNA 2X9DA 1LOEA 3K4JA 3TRSB 2Q2EB 1E57A 1OYIA 5C5TA 1MGTA 3V7SA 3JRAA 4KT5C 1UCXA 3F95A 1KA8A 4LPLA 3ZP5A 2DLLA 5G05L 2FQ3A 4M6YA 5L9BA 3MKYB 3M7AA 4ZDLA 1D0HA 1QU3A 1QPIA 5BXXA 2OUHA 4CHUA 3ERED 4BE0A 4D0QA 3POJA 4RGSA 5TRDA 4B43A 1XN7A 4X8PA 1HOMA 3DPRC 2DMUA 1PO23 1PVEA 2DUOA 3H50A 5FO9B 1UN1A 4G4FA 1S0BA 1MMSA 3BCBA 2GXBA 3WE3A 3VBOA 3VZLA 1QNWA 1WPKA 4Q0QA 3WW4A 1R5HA 1HKDA 3ZQHA 1X1CA 4GJYA 2W52A 4LBKA 5D5UB 4QX5A 2ZBJA 2QSFX 4UW6A 2YG0A 1QJU1 5FMOL 1H89C 4R9BA 1V9U3 3DTEA 3U4SA 1ZA4A 2EA4A 1KDMA 5E3MA 3FKJA 4Q4X1 4BU2A 3WCRA 3T0DA 5J1YA 2E1CA 4NAOA 5EYYA 1SZBA 4UW3A 3L7WA 5FMBA 4E4HA 1DLCA 5I0TA 4QAWA 3BTXA 3CJXA 2W94A 2F4LA 3JB8A 2DOAA 4FOQA 4N43A 2BW3B 4LE3A 1T95A 1Z1DA 5FZGA 2RDNA 3W3CA 1H8AC 3UNGC 4RGAA 2JXAA 4M4PA 3HSRA 4ZTJA 4FSJA 2UWBA 4E2GA 3NKGA 1U5TB 3J80K 5JXIA 3VL8A 3ZOBA 2NYYA 2CW7A 4CXWA 1J59A 2IWGB 4YZ4A 3R05A 1TW2A 5DAWA 2WV0A 5L3CA 1LOBA 2F2EA 5KHJA 3RJ2X 1VI0A 4XOPA 3WDTA 1D2QA 2B9VA 3OPZA 5FD5A 4W97A 3PMSA 1TNTA 4W4ZA 5DM7F 2A3XA 4QPIC 4SLIA 5BNOC 1CWPA 3KS7A 4HF2A 3KX2A 1W8UA 4UI9L 4WM8A 2ARCA 3M3IA 3FISA 1Z05A 3KCCA 2W7NA 4OYUA 2LRDA 3IDAA 3HOBA 2V6EA 2YU9J 2CWMA 5LATA 3ASIA 4BQ4A 1ERDA 1XMAA 3ML6A 4XQ4A 2Y31A 2AEZA 4XCAA 4A7YA 1MS8A 4LITA 1R36A 3CMEI 4DW6A 1OC1A 4MGSA 1YI9A 2ZC2A 1E5RA 2A6XA 4JAAA 1GP6A 5L3EA 1JOJA 2XBO2 1RUF1 1RGSA 3BJOA 1AKHA 4Y17A 1PDNC 1J3PA 2Z33A 1VRBA 3POWA 1ND3B 3LAJA 1X1AA 2JQ7A 4Y1ZA 5CPRB 1IN5A 3D5RC 2Y38A 4CCDA 4JGZC 1X82A 4BH9A 3U1XA 2X4HA 4NMIA 4XHBA 1YQ5A 1V6LA 1OKRA 3V0BB 4CU9A 1JZ4A 2W5FA 1WRJA 2HYGD 2A61A 3DKXA 3ZPYA 4BQWA 4XLFA 2X09A 1TBXA 3WU2C 3PUAA 4K1YA 2A75A 4QGNA 2EALA 1N75A 1HXS3 1NT0A 3MO4A 2ZHKA 3NMBA 3KGLA 1SD6A 1FX7A 4HAMA 5FZBA 3OBAA 3TBDA 1I3AA 5A3WA 4CPBD 1RHI1 2D44A 4NIDA 2YX7A 1QZYA 1J58A 5F9TA 1OLQA 2ZHMA 4YVSC 3RZMA 5FY0A 2PHLA 3OSGA 3UK9A 2WS92 1XC5A 4LB6B 4HBLA 4B48A 3GZTB 1JHHA 5L3DA 3CTAA 4RFRB 4KNCA 4FAHA 2UXXA 3LDRA 2E60A 5AIPA 1FNZA 1PZ8A 5FJKA 5ICFA 4GQ7A 2Q2EA 2ZMEA 3KP3A 3W2WA 1P7IA 2VOOA 3IP4B 4PJMA 4BGDA 4A0XA 1WJEA 5CKNA 4QQ2A 5C9AB 3JD72 3E5XA 5JPNB 4ON0A 4Q0SA 3OYMA 1J1TA 2ELKA 3FHNA 1YNAA 3WG9A 3BYWA 1O3SA 4DYRA 6PAXA 1O59A 2R062 1X2NA 3AKQA 5K7PA 1LJ9A 1Q8PA 2ZABA 5GAGJ 1ETKA 2JWPA 5E20A 5CFCA 3O0XA 4A3CJ 3I9V2 1UYZA 1MEC2 3TOBA 4A3KJ 2D6KA 4C91A 3F6OA 2OUJA 4W1UA 5CBLA 2PQ8A 4W50A 1TTYA 4FOVA 5E3NA 1R1ZA 2VECA 3A23A 2Z2SB 4ETSA 1AJKA 1I1GA 3OSFA 3VZOA 5A1AA 5I0SA 2ORXA 4M71A 3ACFA 3I54A 3JRHA 4H7LA 5T5LA 1FC3A 3FBIB 1C8M1 4B7KA 2QNKA 5A7OA 4BXFA 2ZEYA 3B01A 5HI0A 4CP1A 3MICA 2WLPA 5JCTA 3T4HB 1ZARA 1W05A 5TISC 3B9IA 3G4SI 4CZSA 1PX3A 3WINE 4MH0E 4B47A 4UUTA 2QE3A 4GKXA 3C18A 2VW2A 2VL4A 3WNXA 2FD5A 2LM3A 1OOPA 2WNVB 3L1PA 3RKQA 2RHPA 2CH0A 2V9PA 4G94A 2F5FA 1BMV2 2YS9A 4PUSA 2D45A 1Y0NA 2L2OA 1EJ9A 1LEDA 3IDCB 1QOTA 3FWEA 3QBQA 1NCRA 3IN9A 2VE8A 4AGVA 3THCA 2AGSA 1Z78A 2R0QC 3FBNB 4PLNA 4IHXA 1JZ2A 1FPN2 1WHUA 3QPLA 5SV5A 1LFUP 1BHGA 3K10A 2X8KA 4A3XA 4XPVA 2VY0A 5I8TA 3ELKA 1MNMC 3T0BA 2AENA 3VDAA 2BGOA 5FKBA 5FPZA 4LEJA 1HX6A 4RDUA 1W8FA 1K12A 2BGPA 2I07B 4FFHA 3AG4H 1U5TA 2XG3A 1PK6B 3NAPA 4NIIA 4CEWC 2P6TA 2KLOA 1HQCA 1NH3A 3SH4A 1FIPA 1N1YA 1AL21 1KITA 1W6QB 4GCVA 2FQ4A 1SFNA 5I0UA 4J00A 3LSIA 2LLKA 3A03A 2WO7A 3POGA 4M9SA 4PBPA 1Y8RB 4R79A 5JLWA 3N05A 3OYDA 3RCOA 3POSA 3HJEA 4LBMA 3WDUA 3MKLA 3S8PA 1DU3D 3VZJA 5A3OA 1S3JA 1GZWA 5A33A 2R5YA 1UY0A 2QM3A 5JSOA 3NO8A 4XBLA 4EM2A 2E19A 3A7QA 3ZMUA 1YJ9I 4QT6A 2EV5A 1WD3A 4LB5A 1P6RA 4OOIA 3M3YJ 3KV5A 3QWLA 3I55I 2FDKA 2DJNA 1X33A 4A6EA 2A73B 4D5CA 1YQ2A 4Q4Y2 4ENNA 4UFLA 2M45A 2ET7A 1ZGJA 2W57A 1MQTC 1IG3A 5D1IA 5I8SA 1O4TA 1VRH1 2ZGLA 1HLCA 3TDUC 1SVLA 1LHVA 2CFOA 3V0BA 1JHFA 2CY6A 1V54H 4EWEA 4LO5B 4I3PA 2NS8A 4FOWA 1IV8A 5LGNA 1RYYA 2GZWA 5JVGF 4YEJA 2H1LA 4UY8I 3I2HA 3OGJA 2M30A 1NK2P 2OQRA 4AI2A 4CZCA 3DXUA 2TDXA 1RUI2 1TE1B 2XAFA 4MGRA 2MPFA 2IAIA 2P6CA 3C7EA 1Z7S3 2CW0F 5FZIA 1ZRFA 2PHFA 4CDUC 2XVGA 4ASLA 5ILUA 4B7EA 1AX2A 3JBG3 3WNPA 3M3CA 1K5JA 1HBXG 3PHMA 4A12A 1GR3A 4E2QA 2LF7A 5C3QA 1S55A 5JVTA 3IHUA 1VQ7I 2WY7Q 5BPDA 5L7OC 2ETEA 1ON1A 4IRGA 3K46A 3O7OA 5F3IA 3QOPA 2NOJB 2E2JJ 4CICA 4ISQA 2OIIA 3ZFGC 3FDYA 5DUVA 1W7PB 1X1DA 4BIOA 3IDEA 2VOWA 1TZOA 3HKZN 4BMEA 1Q8OA 4DUVA 3H8OA 2WY8Q 4O65A 3M1CA 2DVDA 1WLDA 3NQOA 2ZTNA 4O61A 3D8CA 3CEWA 3ZVXA 1H2MA 4Y22B 2HYJA 5IVFA 2K85A 1CJPA 2I45A