3E6CC

Cprk ocpa dna complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
225
structure length
225
Chain Sequence
DFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSEQTSYYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation/dna
molecule keywords Cyclic nucleotide-binding protein
total genus 70
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00027 cNMP_binding Cyclic nucleotide-binding domain
C PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e6cC02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e6cC01
1DZRA 1OYYA 1Q3EA 2M45A 2M87A 2K4JA 2PMUA 2QUFA 3GFIA 5F6FA 2B0LA 2L54A 3ECHA 4MQVA 5CVVA 1ZH5A 2GIVA 2XIGA 4LD5A 5J6XA 4OMZA 4XSXF 4EJTA 2H09A 3MDPA 4IEZA 2FA5A 2HQRA 4IF4A 1DUXC 1R00A 4YG2F 3V8LA 4BAYA 3I58A 1VTNC 3OCPA 3T8TA 1U78A 3ECOA 4L2NA 2XAGA 3IBMA 5KHJA 2PG4A 4NVPA 3SFZA 2ZNZA 3O3KA 2DO7A 2ZMEA 5D8KB 2A6EF 4WK8F 2W85A 2LKPA 5TRDA 1JXSA 4MNUA 3V8KA 1RUNA 1G3WA 1SQ4A 3LOIA 2HEOA 1HW5A 4IJAA 3HTUA 3JTGA 3RKXA 1X8MA 2JZYA 1UCRA 2L4AA 4G6DA 4O6JA 1CF7A 1CAUB 2GC1A 1EH8A 2JPCA 1ZG1A 4LG0A 3KP3A 5H6QA 2RNJA 3DP7A 4R52A 4HVQA 3IRQA 1MKMA 3ZN1A 2D5HA 4XF0A 3K9TA 4D7TA 3HUGA 1U3EM 4UBHA 1X8EA 5BXXA 4UVAA 3F22A 4DNCA 2BV6A 1JHHA 2BNNA 1YW9A 4WZCA 4LK0F 1TNSA 3KEQA 1SFUA 5FQ0B 3G3ZA 3F8MA 2PAMA 4FHTA 2A61A 2VE8A 2XROA 1UHWA 2A5YB 1WLTA 4O9EA 3ETQA 3RYKA 3ES4A 2ZFWA 1SD6A 1X82A 1ZARA 5JVTA 4MH0E 4HQEA 1TQIA 1W7PA 1OPCA 3DF8A 2BEOA 5FLIA 1PUEE 5A2QK 5IT9Z 2QDRA 2O0YA 1ULYA 1WQ2A 1DPUA 2OA4A 4XFAA 2OU2A 4XFHA 3E6BA 3MZHA 1T0FA 2ZCWA 1LVAA 3F8FA 1P4XA 1MZBA 1G3SA 5J8CA 1HXDA 4Y13A 5JSOA 3GBFA 4A0YA 4G6QA 3I7DA 4PIZA 2HYFA 4ZU4A 3FF5A 4OLLA 3EYYA 3HOTA 3WU1B 2HS5A 5H6RA 3QRFF 4G9YA 5AONA 1ZGAA 4EM2A 1HQCA 3RIRA 4F8AA 2DAOA 4LB6B 5BOXA 3GZ6A 1C0WA 2HGCA 1QBJA 4RGRA 1YFHA 4LLNA 4L9TA 1P92A 3I64A 3T8RA 1WI9A 1FBUA 2K4BA 1DGWA 2VBZA 1OYIA 4HV6A 1ZLKA 2PTMA 4HOBA 5DEQA 4MGYE 3HT2A 3MWMA 3KGLA 3P9KA 3SXYA 3C1DA 4AQ6A 1FYLA 4EVIA 1J58A 3H50A 1O3QA 1DGRA 2UWMA 3U0ZA 3SCFA 4L0YB 5BPXA 4MV2A 1W5TA 4KMFA 3I0TA 1TW3A 3Q5FA 2PFBA 2UZKA 4AIJA 4PCQA 2VONA 1CAVB 5JSPA 1JGSA 4LULA 4Q5SF 5HVQC 2X4HA 1K6OA 4ZU7A 4ENJA 4KL1A 5CVUA 2K0GA 4XFBA 3CO2A 4UVCA 3L2HA 5I0SA 3KP4A 1T6SA 1HW2A 3GVAA 1H9GA 4D7SA 2IT0A 4LA3A 3WW1A 3C7JA 1XSDA 4LGWA 4YIFA 4KICA 2H94A 4UXAA 3OOPA 3CDHA 1Y0UA 1YS7A 2A68F 1FX7A 4YFXF 2OPKA 1SD4A 3KZZA 4YFKF 4IEVA 4BYYA 1KA8A 1J3QA 4WCGA 3H7YA 1YLLA 2ETEA 1IAWA 1F1ZA 4I3PA 2DLLA 1IRFA 2RQPA 3CJXA 4M71A 2VODA 3O2PE 4IRIA 5J8FA 1S29A 2V1XA 1OMIA 2D2WA 4Q0VA 2WC2A 1J2XA 4HMZA 3ELNA 4PIXA 4G7HF 2QENA 1U5TA 2W57A 5I0RA 4NB5A 4M74A 3MZYA 4JVAA 5DV5A 4DQ2A 2ESHA 3IIAA 2DT5A 4QGMA 1XE8A 2FSWA 4GXOA 1ZZ8A 1IN6A 1J75A 2P7VB 3LAJA 2UXXA 4A5MA 1J3RA 4WXHA 4E2GA 4PGGA 3QU3A 5TJJA 5D6FA 5ERIA 4G94A 4QLCU 2VOOA 5HDGA 2DPDA 2OZ6A 3TDZC 3BU7A 4MHGA 4EM0B 4RS8A 4XF9A 3GW2A 4NHJA 2YSRA 3WE3A 4YYOA 3RPUA 4S04A 1WGPA 2E7XA 1B9NA 1FZPB 4HV5A 3ST7A 3I5UA 4QGLA 4LFUA 2MPFA 4YSFA 4U0WA 2FOKA 4XF1A 2EV6A 3WG9A 4HDUA 3ZMZA 5JR3A 2ADUA 4ON0A 3WGHA 1J59A 2ACJA 4IHSA 1EY2A 3P9IA 3KMHA 1J9IA 3H92A 4IHTA 5LGNA 3SXWA 1FT9A 4ONUA 2J5PA 1EPZA 5AVPA 4YIIA 5DD4A 3WTSC 4A0ZA 4HBLA 3QPTA 4IRGA 5E1WA 1Z9CA 2OA2A 4HVOA 1EH6A 5ILSA 4Y15A 5J7MA 1W7PB 2UY9A 2ZNYA 3J81K 4KN7X 4META 1OI6A 1R5GA 2H6CA 2YX4A 1CAWA 1FP2A 1BI1A 4FBFA 1UW8A 3C3WA 3GFMA 4ASNA 1RUOA 2QJVA 4WVZA 2DI3A 3SHFA 1WSUA 2DTRA 3F3XA 4L0ZB 2RV8A 4LEJA 1AOYA 3IDBB 2DW4A 3JAMK 4ESBA 4X6RB 1ZNPA 4ENKA 2EA4A 1ZZBA 1S6LA 1FSHA 2XL9A 3SZTA 5ED4A 2D40A 2D93A 1HKQA 2E1CA 1QXRA 2K27A 2B5HA 1QQIA 3EETA 2VN2A 1DPRA 1YFUA 4QXKA 1BC7C 2VXZA 2PBIA 4UV8A 4BHCA 2STTA 4GULA 4BHPA 4EM1A 2IRFG 3LWFA 4GO1A 1PP7U 3B02A 2GC2A 4P5OA 4LLGF 2PI0A 1DP7P 2P7CB 2XV4S 4QM8A 2ET1A 4YNIA 2Y0MA 3CO7C 5D1IA 1LEBA 2VT2A 3FZ3A 4LK1F 4GYGA 2IVMA 4IEWA 1S8NA 4HBNA 1T38A 5LEJA 4KIFA 4HF0A 2CSOA 1MJBA 2D5FA 4AIKA 4A6EA 2ZJ2A 1BIBA 1TTYA 3KP5A 2EFNA 4OINF 3F8BA 5EEHA 1UIJA 3OF1A 3MPBA 3E6MA 1WKMA 4XF4A 2PA7A 1UPIA 1RL3A 5C8WA 1CF7B 2X0LA 3I59B 4BH9A 5DDGA 4O3MA 5KK1A 5DCFA 5I91A 2DQLA 5FPXA 1FSEA 1R22A 3O14A 4UBGA 2DK8A 2JSCA 1UFMA 1TQPA 2HYGD 5JCTA 3RJPA 3MFKA 4U0VA 4R8HA 2IP2A 2P4WA 5HS8A 5CADA 3L7WA 3U9GA 1EP0A 4Q0PA 1B1BA 4OFGA 4KUMA 5LHHA 2QVOA 2EV0A 3KLOA 2OZJA 2P6SA 3J80Z 1V70A 3HSRA 1YHFA 3BROA 3NRVA 4Q0UA 5DCMB 1XD7A 4A12A 2Y0OA 5E18F 3ZDSA 1QPMA 1QZZA 2Z99A 1KGSA 1OYWA 3QU6A 4CYDA 4HX4A 3IKVA 4EGZA 2D1VA 1CGPA 1BIAA 2XAHA 2RKHA 2XAFA 4Q4ZF 3ELKA 1MDMB 3HTSB 1O57A 3D0JA 1FBSA 4ZYGA 1UIKA 2HOEA 4JK1X 1YYVA 3LA7A 3TKYA 1R58A 4CZZA 2VBWA 3FM5A 4KYWA 2Q8KA 3W6KB 3H1YA 1KQ8A 4L5IA 3JSOA 1O5LA 1YLFA 2EA7A 4AWXB 1I27A 4I0AA 4M72A 3ZMUA 3E3VA 3FHZA 4EJUA 2KXLA 5E1XA 3FFQA 5AIQA 4OMYA 2VBXA 3RDIA 4N9HA 1YW7A 3R0AA 1ZZ9A 2MD5A 3K1NA 1IW7F 3L09A 3JZVA 3ZQ7A 3RZZA 1SFEA 2V79A 2L01A 3KP6A 2R7DA 3NSTA 3USSA 2FNPA 2GZWA 2MH9A 5BMZA 5CU1A 2QQAA 3UKNA 1F5TA 3EO6A 1NYWA 2KJBA 1WWXA 4I2OA 2P17A 1Q5OA 3SCHA 1P2FA 4J1WA 3B73A 3WTZA 3G7DA 3E6DA 4R79A 4P9UA 5LLQA 3K2ZA 3ZMTA 1SFXA 1IXRC 1L3JA 2VE9A 2EFWA 1ON1A 3TO7A 2C6YA 4M6XA 3TO9A 2Z9OA 3D82A 2Q2EA 2B9UA 3CO6C 2LF7A 5ILUA 1WRJA 3E97A 3WGIA 5L3BA 3HHHA 1O3RA 1QWRA 2NAZA 4IVNA 1GXQA 1J7KA 1FNNA 2PAEA 5DYMA 1NZCA 2QQBA 2VC0A 3WGGA 4FX0A 1XMKA 1D8JA 1Z7UA 3FMQA 1KU7A 5KVRA 1P4AA 1O5UA 2M8EA 5IT3A 1RTVA 2GXBA 3RI4A 5FQ0A 4Y17A 2K02A 3IWFA 2D1HA 1IN4A 2EB7A 1FC3A 4KNYA 4ORFA 3IC7A 1IXSB 4KU7A 3NKTA 2FBHA 4H7LA 1K7AA 3F21A 2XAQA 5ICCA 4IPAA 1NHAA 4IEYA 3DKWA 1FY7A 3HHGA 3ERED 1R23A 2QCSB 2V1UA 2PMHA 5E1RA 5BPDA 1IF1A 1YWKA 3LSTA 4KWLA 1LDJA 3WTTC 1XN7A 3S2WA 2HR3A 4EJWA 1CX4A 2ETHA 2ZXJA 4CXFA 2FBKA 3Q9SA 2E7WA 3H9AA 2F5DA 2OQRA 4QGNA 1G6NA 2DQRA 3QP5A 5D5WB 3WTUC 2TDXA 3EDPA 3F23A 1A04A 4FAHA 4HF2A 2E1NA 2PQQA 3JAMZ 2OYZA 5AIPA 4K8FA 3FHIB 3H1WA 1YW8A 3M3IA 2JRTA 3BJAA 2DCTA 3CUQC 5I0UA 1R5HA 4JTNA 1BBYA 5ILVA 2YX7A 1H9TA 5HOOA 3BWGA 2QNKA 2HTJA 2FNAA 2AXLA 5FO5A 1RIOH 1T39A 5BY5A 1CAUA 2CQKA 1R1VA 1TNTA 4HYEA 5D4SA 2P5VA 4MQ9F 1SFNA 2DBBA 4E2SA 1XGSA 5DUKA 1J0RA 1GQHA 1MDMA 3ZP5A 4Q29A 2FBIA 2ZMEB 3ZPLA 5FLHA 5LGUA 2XKOA 5KHKA 2QQ9A 4BXUA 2L4MA 1Y3TA 2EWNA 2CAUA 1YFYA 2DK5A 1B9MA 3DFGA 1ZZ6A 4KU8A 3LA3A 3T1BA 4E2QA 4CGZA 1HKTA 3U2RA 3T5XA 1E17A 2OQGA 2GU9A 3E5QA 1IPJA 4IEQA 1IRGA 1R36A 4KA4A 1ZHFA 1Z91A 2P5KA 3U10A 4ESJA 2V09A 4UNOA 2F4PA 1FLIA 2CAVA 2GH2A 4RB1A 3OGJA 1L3LA 4PJYA 1XCVA 3I53A 3BPZA 3MQ0A 5FD6A 1BN5A 3ZMVA 1S7OA 2CFXA 3PNAA 2XKPA 5K1YA 1RZ4A 1W7PD 4GCVA 4U7DA 4WXCA 4A0XA 3NJZA 3EQEA 3V7CA 3RYRA 3K0LA 4HLYA 2EA2A 1ZZ7A 4IESA 2R3SA 3WTXC 4YFNF 3ZN0A 1XDUA 1TQMA 5LRSA 1KU3A 2MLGA 2HDCA 3O6BB 1G3YA 3E5XA 2XLGA 1Z6TA 4AVCA 2IXJA 3IWZA 1XB4A 2GC3A 2E9QA 3TOAA 2OBPA 4HX8A 4MZUA 5C6CA 1D5VA 3PQKA 1U5TB 5L3GA 3F6VA 1IUYA 1ZYRF 5HLHA 4ENMA 4A5NA 1TBXA 1FPQA 4GYIA 4RB3C 1JUHA 1TQ5A 3W6JB 4EWDA 3WW3A 1O7LA 2R7FA 5K8SA 3K69A 5CVJA 4LUKA 5LGTA 2YPRA 4ZYEA 4HX7A 3GX4X 2GAUA 2MC3A 2FQPA 4LMYA 4EGYA 1GXPA 5JSRA 1IZ1A 1MGTA 2CO5A 1CAWB 1ZG3A 4I0BA 4KIGA 4JBAA 1RNLA 1B4AA 1ZRFA 4RAYA 4LA2A 1Z6RA 4LLOA 2XUBA 3RYPA 2Q0OA 2IXIA 5E8IA 2W84A 1FWZA 4P96A 4G7OF 4LTAA 2EAAA 1HBXG 3F8NA 1YQAA 2XGXA 5BUVA 1V4RA 3OV8A 2IXHA 2XLFA 5FB2A 4BNCA 2GC0A 4L9NA 5DUIA 2RVCA 5F64A 3MAJA 4XLPF 1ZRRA 5FDBA 1KYWA 2IXKA 3WTVC 4XFFA 4P9FA 1AWCA 2MNGA 1LR5A 1W5SA 2FEZA 3CUQB 3IL2A 2GA2A 4Q0SA 4A2UA 5LEKA 4L9JA 1X3UA 3VEPA 5KHGA 3EUHA 1FYMA 2MH2A 2UYAA 4FAGA 4IEXA 3AAFA 1HSJA 1KQ0A 4KN4X 5LHIA 5FLXK 3MYXA 2NRAC 3S7EA 3C18A 4KFCA 1E2XA 2F2EA 1OD5A 1KU2A 3OD0A 3L9FA 1XRUA 2F5FA 4NQWA 1IPKA 1CAXA 2COMA 1BOAA 2G9WA 5EEGA 3H3ZA 4RGXA 5EZWA 2H27A 4ZZDA 4KMUX 2GWRA 3P9CA 5E8GA 1S3JA 3IRRA 1OFNA 3DPTA 4IEPA 4JQFA 1D8KA 2Q0AA 1VJ2A 1K79A 1Y9QA 5CJ9A 1Q43A 2JPBA 4WX9A 3GLXA 2H0VA 1FYKA 1XMAA 2UY8A 3LAPA 1B6AA 1Q1HA 2MLKA 2MBFA 1KU9A 1H1MA 1QZYA 2VQAA 4LLLA 1XDSA 1ZGJA 3PQJA 1O3SA 2PAKA 2KIFA 1SMYF 2STWA 3HRTA 2WWYA 4ZYHA 4RAZA 4OU0A 4QWQA 1FP1D 1OR7A 5A2QZ 5F1RA 4MTDA 4XBFA 3DL3A 4OOIA 2BE5F 3GYHX 3CEWA 1IN7A 3LWCA 4B29A 1ZN2A 1MJAA 3CUQA 2F5CA 2IJLA 1HSTA 4HZFA 1U12A 1FXZA 3EHKA 2MA3A 4HA8A 3BPXA 3PVBB 5FLXZ 1ZRDA 4AVPA 3R4KA 2IA2A 5D4RA 3DN7A 3LZZA 2Y48A 4LUMA 3K1MA 3FZVA 3EBRA 3I59A 5HI0A 4IERA 3GF2A 1VR3A 4S05A 3ULQB 1B59A 3QACA 4IEUA 5LHGA 2YR2A 4I98B 2FMLA 1YG2A 3NVCA 3D0SA 2NNYA 4XFIA 2K7LA 1T98A 5J48A 4HQMA 3UKTA 5BV6A 4PDKA 2HQNA 2OAZA 3FM3A 5FD5A 3V7RA 1UB9A 1O7FA 2IC1A 3H1MA 2A07F 1DZTA 4RB0A 1XSVA 1VP6A 2FXAA 3S0MA 2BNMA 2VOPA 1IN8A 4HLTA 2EVXA 5FFXA 1QNTA 2NS0A 5KHHA 4ETSA 1ODDA 2FMYA 5HDKA 1RGSA 4P55A 2O1QA 4RB2C 3CF6E 4IEOA 5JAXA 2PYTA 1OKRA 2V6CA 3IKTA 2PN6A 1YIOA 2CWEA 2BYVE 2PHLA 2XL7A 3QP6A 4RD7A 1EH7A 1I1GA 1D3YA 2ET7A 3PFIA 5FCCA 4Z2YA 2PQ8A 1LNWA 1I6XA 4RGSA 5HLGA 4I02A 3SZPA 1ZAOA 1I5ZA 2RDPA 1IN5A 3BCWA 1REPC 3FJSA 4HN1A 3BPVA 4PGHA 4AD9A 1SD7A 2QZ8A 1STZA 4OIRF 3TNQA 4EWEA 4XRFA 1F9NA 2LNBA 3NQOA 3ISPA 1LDKB 2HWVA 5JI6A 2HJIA 3DPLC 1W4MA 1UD1A 2P6TA 1BI3A 4M6YA 4I09A 4UXNA 3L00A 4ESFA 4BIFA 2ESNA 4I01A 4UUVA 3UKVA 2VC1A 1R1UA 2XVCA 4IRHA 1NXMA 4EJOA 4Q48A 2O6GE 3FX3A 1ZZCA 3E5UA 3LAGA 4U0YA 5ICGA 1J1LA 3K1PA 2FF4A 2UYBA 4L18B 3F72A 1EYBA 1USTA 2HKXA 3SMHA 4QMAA 3BDDA 4L11A 3BY6A 2IXLA 5K5QA 3R0JA 2ELHA 3REOA 3ZMDA 4OIPF 2WFPA 3BOQA 4Z07A 3F8CA 4N9IA 4HLXA 4MTEA 2KKOA 2P8TA 1K78A 2F5EA 2HKOA 2DU9A 5FPZA 1PDNC 1U5TC 2PLYA 4D0PA 2EFQA 2PFWA 4ZYDA 1I1SA 3FXRA 2EFOA 2BGCA 1U8RA 3L2CA 1QO0D 2EV5A 3HOSA 1U2WA 2LF8A 4TLFA 2M5WA 1LRHA 1X7NA 5BPIA 3HRUA 1WA4A 2XASA 3CTAA 3TQNA 1T2KA 3TNPB 5CVIA 2O03A 2BBYA 1O4TA 1QGPA 5DCMA 2GQQA 4L5JA 3JTHA 1LB2A 1UHMA 3ABTA 3HRSA 2B8MA 3CL1A 4ENNA 1P6RA 2QBYA 3GFJA 1GQGA 2CYYA 3N97A 3T0YA 4N0BA 3GYDA 4G7ZF 4KDPA 1HKSA 2RN7A 1H1IA 2PJPA 1XSXA 1K78B 4B8XA 1ZG5A 5T3NA 2ZKZA 2ZKLA 4PIYA 3WODF 5CYVA 4BQAA 3V8JA 1IXCA 4MX3A 5L3CA 1ZVFA 2K9ZA 5CVRA 1GHCA 4MEXF 3P7NA 3BJOA 1LQ1A 1LEAA 4RGUA 4P9GA 1J3PA 2KIMA 5I0TA 2OD5A 2VBYA 2GXGA 5BQTA 4EMSA 6PAXA 5L3FA 1FI2A 2CV6A 3F6OA 2IPQX 2ZBKA 3NL1A 4AQ2A 3GWZA 4E70A 2EK5A 3HT1A 1ZX5A 4MGRA 2QYOA 4DINB 3JW4A 1JE8A 5IT9K 3HIFA 3SHRA 4CHUA 2VPVA 5FLJA 4B09A 3HQXA 3WU0A 1RC6A 4QX5A 2FU4A 3FXUA 3VODA 4UV9A 3JSPA 4EV0A 1RI7A 4H0EA 3QOPA 4X6QB 3IDCB 3DXJF 3ES1A 2QWWA 2XAJA 4Q47A 4BHBA 3E6CC 3J7AO 1FOKA 1YUDA 3QAHA 3I71A 3GEZA 5D5VB 2HZTA 2FE3A 2M30A 5L3EA 2Z5UA 1BM9A 3R6SA 2DPUA 5HLIA 2H6BA 4QM9A 3KSCA 4HSJA 4AIHA 4XEZA 3M8EA 3KEOA 3Q9VA 1O3TA 4O9GA 3MCZA 2VT3A 1SAXA 2IA0A 2W24A 2K86A 4EJVA 2I45A 3NW4A 1CAVA 4Q0QA 5JR7B 1LJ9A 3VOEA 3GFLA 4MGKE 3WTYC 2FQ3A 4K2EA 3LA2A 4XFCA 3KFWX 4LG0B 1H0MA 3H3UA 2A69F 3S7IA 3EQLF 1HW1A 3LQQA 2PHDA 1BI0A 5HS7A 4OIQF 2XRNA 3KP7A 2KIUA 3DQVC 5D6EA 3FMRA 5K5RA 3ACLA 1ONVA 3D5LA 3FXQA 4EWAA 2Y75A 1XGOA 2O8XA 4MUVA 5L3DA 5J3UA 1KQ9A 4KWJA 1YFXA 3LQRA 4HW0A 2ISZA 2IW5A 2P5LC 3RKYA 3VB2A 4EROA 3KCCA 4ZH4F 3R61A 3J80K 2N7GA 2C0ZA 4KT5C 3ABUA 4AVBA 2LSOA 2ZO4A 1LKNA 4HSLA 5FGMA 4IETA 4IXAA 3KGZA 3ML6A 3FE5A 5ICFA 4FT8A 4WWCA 5I93A 3COAC 1YO5C 2O8QA 2MHFA 3RKWA 4LJZF 3M70A 4CO8A 3BB6A 3HSFA 3GUDA 5K5OA 3WW4A 3J81Z 2CGPA 3RTRA 4XFGA 4M73A 1SMTA 3H7JA 5JHUA 5DD8A 5E16A 1V3FA 5EFUA 1LDDA 3C3VA 1XGNA 4UVBA 1TW2A 4M9SA 4CICA 2QVSB 2ISYA 3BALA 4U7BA 4WXDA 5E20A 5BS6A 2QM3A 2LDUA 2JTVA 3M8FA 4KIBA 1ZREA 4HF1A 3TOBA 4ZZLA 4HDVA 4GGGA 2W25A 1MJ9A 1ZRCA 3HRMA 3I54A 2VECA 3SCGA 1QY4A 1GVJA 3CLOA 3WTWC 2Z3YA 3TO6A 1YS6A 3TDUC 2J5OA 3M1EA 3KE2A 1JHFA 2HTSA 3DV8A 5HS9A 1KYZA 1G4DA 3EJKA 1J5YA 3FMSA 5I8SA 1R1TA 3GO5A 2A6HF 3GZ5A 1DDNA 4ZU5A 3R60A 4I7HA 3VFZA 1P4WA 3V7SA 3BJ6A 4F7ZA 1U6GA 4AVAA 4JV4A 2XHKA 1CAXB 5LBQA 1UCXA 3QPHA 4YARA 4XETA 3MEXA 1BJAA 1G3TA 4FX4A 1S7AA 4R1HA 3M7GA 4XLNF 1YFWA 1R7JA 1ZLJA 4M9ZA 2YU3A 4WBBA 2IA1A 2QLZA 2XLAA 5FFZA 1XE7A 5D5XB 5E1ZB 4U88A 5LRRA 2G7HA 5JFRA 1NE4A 2JT1A 5I8TA 3ZMSA 2PEXA 1F4KA 1XCBA 5D8LB 3LFKA 2Q4SA 3IHUA 3WW2A 4HAMA 4WF2A 2DFIA 2L3DA 2Z33A 3ROUA 5KBFA 4TV7A 3BP8A 1BC8C 1EV7A 1ON2A 1PM7A 3G73A 2RC4A 2AS5F 5E17F 4MEYF 1Z1DA 4MGIE 4G8XA 2RGVA 1PP8F 2O61A 4PZJA 2CW0F 1BI2A 2IXCA 1PMIA 2KJCA 3CJNA 3KETA 3V4GA 2BNOA 2HFHA 2ATFA 2O3FA 2KRFA 1SEFA 3NEUA 3OTFA 3CLPA 4AXOA 3CUOA 3KP2A 3U1DA 4HVRA 2QBYB 3U11A 2G7UA 3KZYA 2NYXA 2A3SA 5HDNA 4CDGA 3RNSA 4J1XA 2V9VA 1Z05A 2Z69A 1TLHB 3M9AA 3DEUA 5D5UB 1YTYA 4JTOA 2Z2SB 1FBQA 5CLSA 3I4PA 5I8YA 4XSZF 3H8UA 2CG4A 1QXJA 5H20A 4EQQA 2UXNA 1SD5A 4A6DA 4M9XA 3KLNA 2EJRA 1NE6A 2GA1A 2M1BA 4UHTA 3HYIA 1L0OC 1USSA 3RPQA 2L02A 3TGNA 4YRDA 2WTEA 1XGMA 4HN0A 2WV0A 2FRHA 3HSEA 3PLQA 4Z82A 4OIOF 3GXOA 4MGZE 5ICEA 2OZUA 4LB5A 2Q30A 3VHRA 4L9VA 2EFPA 4XF3A 4KWKA 4O5VA 1MD0A 3N4MA 3FWEA 3SQNA 2V1DA 3BZ6A 3WE2A 2Q1ZB 5KHIA 2D45A 3EYIA 2NNNA
chains in the Genus database with same CATH superfamily
1ZK8A 1DZRA 1QRYA 2QUFA 2V1NA 1V5GA 2L54A 3ECHA 5CVVA 2NVXJ 1W6OA 4BACA 4CU6A 2BV4A 4LD5A 2MSYA 4OMZA 4XBQA 4XJ8A 4AEJA 1IDYA 1APLC 3V8LA 4BAYA 3I58A 2R16A 2ADEA 1MSEC 2XRLA 4L2NA 3ZFGB 3IBMA 4NVPA 3SFZA 2WNOA 1JTYA 1AKHB 3O3KA 5CIRA 3POJA 5GZDA 2NLRA 2TRTA 2ZMEA 3ZYPA 1WUVA 2E63A 2WT0A 2W85A 1RMU1 4AOCA 4Y26A 1G3WA 2D3PA 2FDFA 4ATFA 1IS5A 2IFWA 2CNAA 2L0KA 3PDQA 3HTUA 2DMPA 2OQ6A 2JZYA 4D7MA 1CF7A 1TMF2 4Q4V2 2EH3A 1LECA 4XURA 5H6QA 4R52A 4HVQA 4N7UA 4ZY9A 4B47A 3RSJA 4JX5A 3K70C 4B3XA 3VL8A 5GZCA 4DNCA 4AWDA 2R32A 2BNNA 4LK0F 4ASLA 5FR3A 1T33A 2YY1A 1LPQA 3KV5A 4A45A 4RGAA 5FYUA 3G3ZA 2R7WA 2XROA 3HBZA 2D6NA 1AX2A 4K1YA 3M4OJ 3ETQA 3HM5A 4EN7B 1QXPA 4NHMA 1X82A 1H2NA 1ZARA 2NZ9A 1WJEA 3V0AA 5JLXA 3OYMA 1L7QA 3AX4A 2O0YA 2SBAA 4CEYA 4DXRA 1DU0A 2OA4A 5LY1A 3Q8CA 1RB8G 3MZHA 1T0FA 4K1ZA 2ZCWA 1SAUA 1LVAA 2JA2A 2ORZA 2W92A 3LE0A 4QQOA 3SFIA 3CCQI 2YC0A 2XG3A 5F9TA 1G3SA 4KG8A 4IHXA 2ZB9A 4Y13A 3LIGA 2VGDA 3BTLA 4M3GA 4G6QA 4PIZA 3ZKYA 1VALA 4ZU4A 1JZ8A 1VE0A 4JAAA 3VD9A 3WU1B 1D0ZA 2B63J 2HS5A 2BXYA 2XJVA 3DCQA 3QRFF 1I6HJ 5AONA 2BY1A 1ZGAA 2VUCA 4DGWB 4F8AA 2OUHA 5BOXA 3GZ6A 3MZ8A 1HLVA 1C0WA 1QBJA 4RGRA 3RZMA 3LD8A 2W46A 1P92A 2R7ZJ 3DXTA 2K4BA 3TBDA 3NNJA 1ZLKA 5FP9A 4HOBA 1H8TA 3V0AB 3MWMA 2R7TA 4R9CA 3DKQA 1JZ7A 3T2TA 1QEXA 4PLNA 1H9WA 1O3QA 2RJ2A 1DGRA 3VHOA 3A0KA 4AVTA 3U0ZA 3A02A 3KQ4B 4MV2A 1PVC3 3WZ1A 3NAPC 3I0TA 2WWJA 4QPYA 2ZEWA 2UZKA 3PIJA 4AIJA 2WN3A 2HVRA 4AL9A 3BR6A 4AVVA 5HLTA 4B4QA 1NCQA 4ZDLA 3WP4A 2FZ1A 3H8XA 2JUGA 1M06G 3W2VA 5HVQC 1AHDP 4KL1A 3LSDA 3MLJA 4BWOA 1OUXA 3CO2A 5EP9A 4NHXA 3HN3A 2O9LA 2DVGA 2G9GA 3L2HA 3Q3SA 3BG6A 2LY9A 3ZDVA 3KP4A 1T6SA 4WM7C 4B3NA 2VCBA 4LA3A 1WJDA 3I3LA 5HPOA 4KICA 2H94A 1UKGA 4OZXA 1Y0UA 2E1MB 3KQRA 1REEA 1BR4A 1FX7A 1BYHA 1KA8A 2KHMA 3S15J 1ZA7A 3WG7H 1F1ZA 2DLLA 5FXZA 2RQPA 3CJXA 3I2DA 4M71A 2VODA 3BCAA 4M3EA 1Z7LA 4JRAA 1H6YA 5DAXA 3LKJA 1NX9A 4E7KA 2OUMA 4KITB 4PIXA 3ELNA 2G1MA 1OOPB 4DW6A 4J00A 4GWJA 1ENXA 3IDEA 3DPRA 2EZLA 2W57A 5I0RA 4XQFA 4GRIA 2LRPA 2ECBA 5FRAA 5DV5A 1UYZA 1Z21A 1NA1A 4BQ5A 3WINE 2O5RA 1WW6A 2BP6A 2DT5A 3OGSA 2VL8A 2QA4I 2Z79A 4B4PA 1DQ1A 3A1YA 3GZNB 3Q8BA 4AEKA 1BMV1 2VOOA 1PVC1 3CCRI 2WB1N 3BU7A 1DP3A 4NHJA 4RS5B 1RXFA 2YSRA 1D4M3 5LA1A 2H8RA 4Y5Z0 1WW4A 3I5UA 4LFUA 1B35A 4YFZA 2HXOA 3MF9A 1A5JA 1OCOH 3HPNA 3WG9A 2RHPA 4IHSA 3DPUA 3FL7A 3KMHA 3H92A 1U0AA 2Q8DA 1WLCA 5LGNA 2G9ZA 2R5ZB 4UYBA 3WDXA 4ONUA 4PHZA 2J5PA 2WAFA 2KQRA 4HSTA 5AVPA 3URFA 3ZXKA 2ARAA 1Z9CA 1T08B 3CP2A 2OA2A 4HVOA 5ILSA 1JI6A 2Y9ZA 2ZNYA 3PIGA 3J81K 4KN7X 1OI6A 1WZ2A 3MPPG 2L9RA 2ZOEB 2JMWA 1BI1A 1NCQC 1RRJA 4WVZA 2VNVA 1EV13 2FDHA 1WSUA 3IN9A 1YO8A 1IC8A 1X1DA 2KR2A 3IDBB 3JAMK 1GANA 4X6RB 4ENKA 2EA4A 1S6LA 2JB8A 3OS0A 1K4TA 2LREA 2D93A 3V56A 4NC8A 2I5UA 3CCMI 4M01A 1BC7C 5GLWA 5FO9B 3GBGA 3S8PA 3I2JA 5KXDA 1GUUA 4HRIA 2IRFG 4LBNA 3O1UA 4GO1A 4UFIA 3U07A 4XACA 4LKFA 2Y0MA 5D1IA 1WCMJ 2WDBA 5H9SA 4LE3A 4GYGA 2IVMA 3VZLA 2HBTA 5FUNA 3VDDB 2D3SA 1LCLA 5FY8A 5A3MA 1BIBA 4UUTA 1JN2P 1TTYA 2WRAA 1MBEA 2LH9A 2VQGA 2A75A 2FJ1A 4A3BJ 1P7JA 4YW7A 3FBMA 1NCQB 1G8WA 2RDNA 1CZSA 4IW3A 3K4BA 3I59B 5DDGA 1VMFA 4BM8A 5KK1A 4RA0A 3ZN6B 3T30A 1NTCA 5F1JA 1R22A 3O14A 4UBGA 2DK8A 3DBHB 1LESA 2CQNA 1E5RA 2IGMA 4QDRA 1R082 3CJIB 2EZKA 1ZBE1 4RFRB 2CMPA 1K61A 4MSVA 4XDOA 2DYRH 1B1BA 2B9VA 1OFSA 2QVOA 4ISRA 4RR3C 2OZJA 3G1MA 3J80Z 1AR82 4QPOA 1D0XA 1OF3A 1V6OA 1XE0A 1H4GA 3BIEA 1DBNA 2XAFA 2AUYA 3ELKA 3OYKA 1AR62 3H1CA 4NUBA 3Q0UA 5IOZA 3C7FA 2DOFA 4DPNA 5F0CA 5E8AA 1ULFA 3OGVA 5DG2A 1R58A 3DEEA 3PTYA 2VBWA 2QQJA 3N7KA 3JSOA 3VYSB 2EA7A 3OY8B 2ZX1A 1I27A 4M72A 1NXD1 3FHZA 4EJUA 1PIV3 2KXLA 5E1XA 5AIQA 3H5NA 1YJNI 4OMYA 1AU7A 1OA4A 3HJEA 3JRFA 2FBEA 4AEMA 4AAPA 4N9HA 5BNOA 3I8TA 4YM2A 4OWRB 3G6EI 1X2MA 2P4EA 4WVVA 2XPJA 2AR6A 2MC4A 3ZR8X 3KP6A 5HBAA 3USSA 2FNPA 1WD3A 2Z1DA 3NWSA 1FX5A 3FN9A 5BMZA 5IVYA 4HT1T 1F5TA 2QSFX 1VB2A 1WMXA 3VBRA 3DYOA 3SCHA 1OLMA 1VQLI 4J1WA 1FOWA 1SFPA 1TNFA 5FRNA 4D9JA 4MADA 4R79A 3S17J 1S4CA 2VQCA 2HYJA 1CQTA 1L3JA 4FOWA 1GUIA 5F5QA 5FV3A 2C6YA 2BWCA 3PFYA 5FZ7A 2B9UA 2C26A 2WQZC 1W99A 5IFTA 4BXFA 2JD9A 2LVSA 4FOVA 3HHHA 1M1EB 1GICA 1GZWA 2D43A 5JLVA 1HQLA 3BTZA 4TWTA 4IVNA 1GXQA 2DFBA 2PAEA 4LBKA 4N53B 3FMQA 2NN8A 1CONA 5KVRA 2QF7A 1UMZA 1O5UA 1WW7A 4IV3C 4YW6A 2TNFA 3PMSA 5F3CA 5FQ0A 2K02A 3S30A 1PGSA 2SLIA 2E7QA 5FKLA 5TISC 4XQWA 3D5OA 2BU9A 5A3UA 1HRV2 3J4UH 2WKKA 3I3MA 2AQEA 2XAQA 1NHAA 3DKWA 1FY7A 1X36A 1K42A 3JB8A 2QCSB 2FCTA 1AR81 2R0FA 3GDBA 1RUF3 4BMEA 2WNEA 5B1AH 3S2WA 3IPVA 3AK0A 1ZBA2 4CDWC 2XMLA 3Q9SA 4GFBA 3SEQA 2E7WA 5CFCB 3VZOA 3UKGA 4FOYA 4EN6B 2B39A 1W0OA 1HDPA 1POQA 2F5DA 4QGNA 1G6NA 2GNMA 1HV0A 2XF6A 2Y31A 3K75B 5F04A 1UZ0A 2P2KA 4PUSA 3EDPA 5GP9A 2XVKA 1A04A 4Y3OA 4J19A 1UY3A 4LQRA 2QQVA 5GKAC 3JAMZ 2OYZA 2DA2A 4N4OB 4XUTA 2LALA 1KGYA 5K4LA 4A6OA 2CV2A 4C9YA 4JTNA 1RR7A 1TEIA 2VQLA 4QPQA 5IYDJ 5HOOA 2D6KA 5FO5A 4PDWA 1RIOH 2CU7A 2GOXB 4PK4A 1R1VA 3CIHA 3VV1A 1SBDA 4HYEA 4XDPA 1GP5A 1NY71 1UX7A 3GZAA 1UU6A 3GTMJ 1J0RA 3ZXDA 4Q29A 1AR71 5EJZB 1JBCA 2QBXA 5KHKA 5EPAA 3FXMA 2HQ5A 3O1RA 1MNDA 3ETPA 2DOAA 3T1BA 4E2QA 5L19A 1HKTA 3T2PA 3HB9A 3ZVXA 4W6YA 2CH0A 5J40A 1R36A 5CZKA 4ESJA 2KFDA 2V09A 2WUHA 1QNWA 1EV11 2CAVA 3ZM8A 4RB1A 4AUXA 2E31A 3ZMVA 3S5AA 2CFXA 2Q2EB 3PNAA 2XKPA 3P6BA 1W7PD 1LFUP 1XSQA 5FYTA 4WXCA 2LROA 4A0XA 1EJ9A 4LBQD 4HLYA 3N9PA 2R3SA 4BDZA 3T4VA 5LATA 4H3WA 4F3JA 2XLGA 4AVCA 1FJLA 3IWZA 5DAVA 3TOAA 2D98A 4JDOA 4M3CE 4E7SA 2DVFA 2HI3A 1WGXA 1IUYA 1ZYRF 1AR63 5HLHA 2JD4A 4DXSA 3THTA 3KT1A 2AYHA 1MNEA 4GYIA 1N3PA 1JUHA 5FZGA 1KS4A 4JKMA 1YEWA 5JOYA 3VBHB 2DV9A 5L7OC 3TW7A 1W6OB 1V6IA 3DCFA 2YPRA 4ZYEA 2ZZJA 4HX7A 4BJ0A 3WG1A 2L7FP 1OKOA 2Q1FA 3P3NA 1DGRN 2GAUA 1RIRA 2BTVC 2E5NA 2P3JA 4I0BA 1G9BA 4JBAA 4TZDA 5FMDA 1B4AA 1ORKA 3RI9A 3AYDA 3TMOA 4LLOA 3RYPA 5E8IA 2M2EA 1FWZA 1JYCA 4XZPA 1WWYA 1RUE2 1LKXA 3RCOA 3LSEA 2R1BA 3HGYA 2EAAA 1WLWA 5BNNA 5IOYA 2HWF2 4ZTFA 1W28A 2XGXA 3CKHA 2AXTC 2IXHA 5FB2A 4IV1A 4I3GA 5DM7F 4A69C 1I50J 4L9NA 5F64A 4XK4A 4ZKTB 1VRBA 1UKRA 5EGOB 4E4HA 5GLUA 1JOJA 3UJQA 2MNGA 4DEVA 2YFUA 2XPWA 1LR5A 1W5SA 3PNYA 2JDAA 4XUPA 4Q0SA 4AF9A 1VI0A 3C8XA 1X3UA 1FYMA 2MH2A 1HJFA 5FRMA 3HGGA 1VRH3 3IH3A 1KZHA 3M3YJ 4KN4X 5LHIA 3MYXA 2W2IA 3WT3A 2NRAC 3S7EA 2E36A 4LKDA 4BJTA 4S2DA 3FMGA 4UW6A 2F2EA 5GAHJ 5EZHA 3WHCA 1UYXA 3W5NA 1XRUA 1CAXA 3IKWA 2RDRA 1DCSA 2COMA 4OCTA 5FLVA 1BOAA 3LPFA 2QEXI 2VKHA 4XXAA 5C3QA 4KMUX 4W4ZA 3A4CA 1FMVA 3P9CA 4GAZA 1OFNA 3DPTA 2VQUA 1DZQA 4OHWA 3I2KA 5FKOA 1K79A 1Q43A 2JPBA 4CDWB 3ZLIA 4AYBN 3MV01 2H0VA 1MMSA 1FYKA 3LAPA 2R0QC 4YVWA 1H1MA 4NRMA 1XDSA 3PQJA 3RZHA 3OYWB 1Z67A 1SMYF 1TWHJ 4XKVA 4G3YC 1D7PM 1B35B 4ARYA 1FP1D 1RUF2 4QX3A 3WHBA 4N43B 1MBHA 3MHZA 1S55A 2RJKA 1LHNA 9ANTA 3CUQA 4DYCA 1ONAA 5IVVA 3B7MA 1I3QJ 2XB6C 4JKLA 5IP7J 3E1SA 5JI9A 2AZ5A 3LPGA 1D2SA 1BBT3 1FYUA 1LVKA 3PVBB 3U4SA 4AZZA 2XB0X 1KONA 1SANA 5FKKA 3LZZA 3WNMA 2PHXA 3K1MA 1KFUL 3FZVA 1YJLA 4IERA 1K3IA 2B7EA 1CZVA 4K40A 1VR3A 2RMU2 3B9CA 3ULQB 3T0BA 4IE4A 3LDRA 2BPA2 1YG2A 3NVCA 3RPUD 4XFIA 4AQTA 1RUF1 1UZWA 5F6KA 3UKTA 2O8OA 4PDKA 3S93A 2ID3A 4HKWA 4BBSJ 1JJ8C 2E6VA 1MZ6A 3H9GA 2RS52 5M5XJ 3OUJA 4QPIB 5F7UA 2C9KA 1AX0A 4N43A 5ACA3 3ZYFA 4RFT0 4WM7A 1D0YA 5A6YA 2E71A 2OW4A 2NS0A 5HV4A 3UGHA 1ZYBA 4CU7A 2X09A 4RB2C 1HRI2 3CF6E 3OBAA 2PYTA 5JWPA 3IKTA 2R6QA 5T52A 2BYVE 5EGOA 4G6TB 1D3YA 1UO9A 4YM3A 2G19A 3LSMA 5FCCA 3ZKUA 4Z2YA 1TME2 2GOMA 4UWDA 4UB8C 4XLCA 2WNUA 1ZAOA 2EF6A 4UF0A 1W9TA 2QFEA 3BCWA 1JYNA 3FK6A 4GDFA 2YG0A 4JQTA 3TEDA 4CXXA 4DBRA 3ABZA 3FBNB 4CUAA 1X1AA 2IBDA 1OCCH 3TNQA 2JECA 4XRFA 1Y7BA 1F9NA 3NQOA 1LDKB 2DYCA 5JZGB 4MHUA 3QOEA 5T5OA 3QYBA 3UGGA 2VBPA 3N9OA 4BIFA 3VDBA 4I01A 4UUVA 2W95A 3V0BA 2CW7A 1OC1A 5JIAA 4AI1A 5C70A 2WADA 1TT5B 3ZN4A 4Q1RA 3DEWA 1IDZA 3IUOA 1H4HA 3WF2A 2KDOA 3LAGA 4N53C 3K1PA 4GWIA 1UQXA 3AL6A 2LR8A 3VYTB 1COV3 5K5QA 4OIPF 1W2TA 2QCOA 3VDCA 1PO13 4N9IA 2P8TA 4A44A 2R7VA 2W52A 3JBG3 2VMHA 4FE7A 1U5TC 2Y0IA 4COWA 1DIWA 3DTKA 3D8CA 2EFQA 2EZHA 1XNTA 2W08A 2VJ5A 1MEC3 1U8RA 2UWBA 4Y4YA 2VZ3A 4X8PA 2YPDA 5H9PA 2M5WA 1LRHA 3M3OA 1X7NA 4LG3A 5BPIA 2Z42A 3RZKA 2O8KA 2J1SA 4CP2A 4A3GJ 1J09A 2KRCA 2VJJA 3HMYA 2O03A 2W5FA 2LYCA 2W87A 3MW3A 3U14A 2IXSA 2GQQA 4L5JA 3O1VA 4I99C 3CMGA 4LBJA 2B8MA 2IFRA 3ABLH 1GQGA 4CZSA 1OURA 4CP0A 4Q4Y1 4IXLA 2RG4A 1F15A 1VRH2 3T0YA 1IV6A 5SV8A 3JR9A 1ACCA 4CA9A 2OIIA 3GYDA 1GOFA 4G7ZF 5B4XA 2VBBA 1XSXA 3JRDA 4FPKA 3I9V2 3PMEA 2Q8CA 2ZKZA 1JZ5A 2AHQA 3A0BC 5CYVA 3BQZA 3ZOBA 2P5BA 1D1AA 2K9ZA 2ZX3A 4BB3A 5I0TA 3HG9A 2OD5A 3USUB 1Y0NA 3ABKH 4C0BA 5CKNA 3HKZN 1H0BA 5B4NA 4XDQA 4FE4A 3PTRB 5ABJB 2GM4A 3S3NA 4FETA 3F6OA 1COV1 1QJFA 2EK5A 3WP6A 3DU5A 1UZCA 3VBFA 1TG7A 1NLSA 4YFWA 3J8F3 2ARBA 1I39A 1HKDA 4K9SA 2ZX2A 3IMMA 3POSA 3OJBA 3J26N 2I74A 4GMP1 5G04L 4TSVA 1VQ9I 3CJIC 3WF1A 2WO1A 2CRGA 5GJ6A 2DFCA 1EA3A 4EV0A 4H0EA 2BJSA 2EALA 4NIDA 1XXNA 2PELA 3FLTA 2VLAA 2IWGB 3RVHA 3FBYA 1ETXA 1W0NA 3M2MA 3DTEA 4HK9A 5K0UB 1JH5A 1S0DA 2ARCA 4DOUA 2CV0A 4F52A 2Z5UA 1Q8QA 3PVNA 4ES8A 4KWUA 4XEZA 1HRV1 1QOTA 3Q9VA 1PZ8A 2K86A 4Q4W3 2RS31 3OR1C 1CAVA 2WFF3 3OSGA 2A05A 1X1PA 3NNLA 1JS9A 3GFLA 4YZ4A 3WF3A 4Y5TA 3WTYC 4Y1XA 2WB1A 4RLQA 1R1ZA 4J01A 1GNZA 3VBHC 4XFCA 3KFWX 4I6ZA 3QBQA 1Y39A 1D1BA 1POV1 5HS7A 4OIQF 3KP7A 4XQDA 3A0NA 3QYFA 1PNGA 4PDWB 3EYPA 3FMRA 1V00A 1C8NA 1ONVA 3D5LA 1FIPA 2ZXHA 1XGOA 5L3DA 1YFXA 1R093 1SEUA 2ISZA 1Q8PA 2IW5A 2JA8J 2XF7A 5LWBA 2C0ZA 3AKRA 4AE2A 5CG8A 5D8AA 2LSOA 3DYPA 4XJZA 3FE5A 2MHFA 2W00A 2Y38A 3BOWA 3M70A 4CO8A 2VW2A 3WOGA 4LO8A 1HRI1 3INAA 2CGPA 1S0FA 3ENRA 3H7JA 2AEZA 5DD8A 3OB8A 2Z16A 5EFUA 2DYSH 4BS9A 2QUOA 3C3VA 2VJ4A 4UVBA 1TW2A 3QCWA 3RMXA 4PJJA 4LKSA 3OD4A 3UGFA 1JYIA 4RSUA 2ZAAA 2QM3A 4XONA 4KIBA 4AGRA 4MFDA 4BLJA 4NC6A 2YBSA 5E6HA 1NK3P 3HPHA 4BOWA 3B01A 1DQUA 3ZXGA 2GNDA 1W2NA 1AR61 3HRMA 3ALQA 3HQRA 1GVJA 3QYEA 5JI7A 5T50A 3NNMA 5FREA 3DKYA 1JHFA 2CW8A 5HS9A 2V72A 3EJKA 4HANA 4GB32 5BNQA 3GZ5A 3EPZA 4F7ZA 4XMYA 2WNVC 2Y6JA 2RS12 1X9PA 5LBQA 1JKRC 5F37A 4AEDB 4XETA 3MEXA 2NOJB 4QWNA 1G3TA 1PJRA 1S7AA 2ICWG 4R1HA 2EICA 1ZBE2 3CU7A 4M9ZA 3MIHA 3LFMA 5C33A 4RA2A 4WBBA 2QLZA 1GZ9A 4MHRA 5FFZA 1XSRA 1WMDA 3D5RC 4Q4X1 3B3QE 4U88A 5LRRA 2L5QA 1OT5A 1IKPA 3JCUC 1VQOI 2E1MC 5JFRA 1LULA 3I56I 1WJAA 1RETA 2HQAA 2BXZA 2JRMA 3AM2A 4W65A 1F4KA 2HH9A 1YXWA 5D8LB 3WW2A 4HAMA 2L3DA 2YBKA 1EV7A 1ON2A 4LBQB 1ENHA 2ZSIB 5FZAA 1Z1DA 2DBNA 2W68A 2CW0F 2KJCA 3CJNA 3KETA 3KX2A 2DBIA 3H9QA 3H0OA 4PLMA 1HB4A 5CFDB 2W82A 1SEFA 2VMDA 3NEUA 4A4AA 3OTFA 1GV5A 4IOAF 2QQNA 1HXS3 3U1DA 4RAFA 3DUIA 5HDNA 1ZTRA 2V9VA 2Z69A 4D8MA 4AQSA 2Y0SA 4P14A 1JW6A 4KG0A 5D5UB 1XYPA 3P1IA 4JTOA 1HB3A 1FBQA 3CQOA 2LG4A 3VKNA 3VB9A 5I8YA 4C8DA 3ZMOA 2UURA 2BY2A 5FY4A 3N35A 2HOSA 1SD5A 1ODMA 4FQGA 4M9XA 2EJRA 3ZPOA 1NE6A 3HEFA 3A22A 1SPPB 1L0OC 1USSA 3RPQA 3PVOA 4YRDA 3THCA 1XGMA 4XPVA 2WV0A 4OI1A 3DYMA 3HSEA 2WAQN 4OIOF 4DFSA 5ICEA 2XGDA 4NNJA 1POV0 4XF3A 5FY0A 5EEAA 3FWEA 2AC1A 3J7AY 5KHIA 2GXAA 3ZN5A 2GP3A 5FUIA 1Q3EA 4BY7J 1UPSA 4LORA 2WBKA 1RHI3 1YQ6A 5KAFC 5F6FA 2B0LA 2ZGPA 1LODA 4MQVA 3I3QA 3B93A 2BOIA 2XIGA 2QZ3A 4QB2A 2WABA 3MDPA 4IEZA 4QKBA 4V2VA 2HQRA 1RUH2 3KZIC 1SFYA 4FPCA 1AXZA 3I49A 3USUA 3ZQCA 4YG2F 4H2AA 3LGRA 4YZ1A 4JOMA 3L2UA 2GNTA 3WHUA 3CF2A 1QQP1 4M00A 3KF5A 1R49A 4Y7NJ 4A3FJ 4DZGA 2CUJA 2EIBA 1URXA 2A6EF 2WQ8A 5CEHA 2VU9A 2ZGOA 5TRDA 5A3WA 4UW4A 4FCYA 2HEOA 1IS3A 1IG7A 3DBLB 2RR11 1HW5A 3CJRB 1X8MA 3OYHA 1FTZA 4O6JA 1CAUB 4LXLA 2GC1A 2JPCA 1ZG1A 3KP3A 2RNJA 4D6SA 2P0WA 3R4SA 3ZN1A 4XF0A 4ZZ8A 1CQ9A 2LKSA 4Y1YA 1U3EM 1X8EA 5FKNA 5BXXA 4IGPA 1LOBA 3AJYA 2R92J 4QQ2A 1YOVB 2XXZA 4WZCA 1TNSA 3F9KA 5C7GA 2Y64A 2KL4A 1SFUA 5FQ0B 5K0UA 3F8MA 4Y20B 3CBNA 2HOAA 3JB4C 1SBFA 2H1KA 2K5CA 4CUBA 2ZFWA 1SD6A 4XKWA 1TME3 2DOEA 1F5FA 1YQCA 4MH0E 1UL9A 4BEHA 4PFOA 3RFRA 2V9PA 1OPCA 1W7PA 5FLIA 4IHWA 3NV2A 1AJOA 1O4ZA 4DB5A 1F2NA 4OMCA 1IZ3A 2OU2A 3JRIA 1LJ7A 4NRQA 1DQ2A 5FMOL 3L2WA 3SLIA 2M4KA 3BODA 3CP8A 4UOJA 4C30A 5F8PA 3F8FA 1OH4A 5FPAA 2GSYA 5JXHA 5FYCA 5JIUA 2J1UA 2JICA 3SDGA 4NMIA 3IH4A 4A0YA 1CN1A 1R092 4FPGA 2NVQJ 2PHUA 3BZCA 3EYYA 4FXGB 3HPGA 4D6RA 4AAXA 2WT1A 3LL7A 2DA4A 1H2MA 5C4XJ 1YNAA 2BW3A 4E9KA 2HEWF 3WNNA 3VD5A 5EF6A 1OVPA 1YFHA 2D44A 2GIZA 1LE8B 2Y34A 3T8RA 1DGWA 1B8IB 4B1LA 4FPLA 1AL23 1W8ZA 2PTMA 1PO11 3TAYA 1LTEA 3KGLA 3P9KA 3SXYA 1I3HA 1SG3A 2BOLA 1GWMA 5AFEA 1OQ1A 1YQ2A 1BQPA 1G9CA 4AW7A 3NAUA 4XMIA 4L0YB 5IYYA 4GJZA 3IB3A 4CDQA 4RHV3 1W5TA 1YI9A 2PFBA 2Y30A 2E33A 5IATA 1D1CA 4BY1J 1JGSA 4LULA 4U36A 5FZOB 2QZ2A 5DN2A 3NJYA 2X4HA 1K6OA 3K10A 4XFBA 1QH6A 4BJ5C 3IAM2 3UESA 2CQ7A 1N1YA 1W39A 1GZWB 2DUOA 1TWGJ 2ELJA 3CLQA 1HW2A 1H9GA 4N53A 2IT0A 3K6GA 4OZOA 1UOJA 4U2AA 2GMPA 1JUIA 4YIRX 2W39A 4YIFA 4XRMA 3OOPA 2ZMKA 3CDHA 3KWVA 4AFAA 4CSWA 1G2HA 4XRSA 3LSHA 5FK8A 1WCUA 4WCGA 2ETEA 2VNRA 1PX3A 1S0CA 1WJCA 2QQWA 3O2PE 1YIPA 1IV8A 3OBRA 1OMIA 2WC2A 4KISA 2BOJA 2ZGUA 4G7HF 3ITQA 2HWD3 2KPMA 1QJU3 1PX4A 1JUMA 1LAJA 4NB5A 2HYXA 3MKWB 4QPGA 4OI0A 5ABJA 4DQ2A 2BBAA 4GA9A 1VQNI 2EIKH 3K70D 2B4KA 2W48A 5DAWA 1IPSA 1OD3A 4IE0A 2YPJA 1IN6A 3T3YA 3LSIA 1JZ4A 3I55I 1BEV1 5TJJA 4Y4RA 3UK9A 2DPDA 2X5IB 3BTIA 3W9AA 2Y2ZA 2OZ6A 4DO0A 3TDZC 1RUC1 4XF9A 1N25A 4NHYA 5LW9A 2HVSA 3RPUA 1AR93 4B7KA 1B9NA 2KMUA 4QGLA 4U0WA 1GZCA 4XF1A 2EV6A 4AHXA 4JGYC 5JR3A 2ADUA 4ON0A 4EZHA 1EY2A 4FVVA 3ZRGA 4YZ5A 3TN91 4LJHA 5AC93 1GSLA 1AHSA 1PIV1 1EF4A 1PMHX 4OHZA 3ILNA 4IHTA 3Q8FA 3H0GJ 1FT9A 3HJRA 3TWIA 4Z8BA 1EPZA 4YIIA 1VQ7I 5DD4A 2R072 1LOFC 3H35A 3M3QA 4LITA 4YM0A 2NMNA 2J1RA 2EIGA 2VW1A 4UUSB 1JTXA 1CAWA 1RUC2 2V26A 3OYLA 2P3YA 1VBA3 4ASNA 1LU1A 5IVEA 3FXJA 1WJFA 2V7FA 1AYM2 3TN92 1DGWY 2ZGSA 5L36A 4UT5A 2RV8A 1AOYA 4L0PA 5EDNA 2WWUA 2XL9A 5C4JJ 3ZQLA 1W6MB 4CDXC 5ED4A 1K5JA 2DVDA 2ENRA 4ZONA 2E1CA 3ZSMA 2K27A 3W2WA 2B5HA 5B5EC 3AP5A 1QQIA 1YHQI 1VBB3 5J1XA 1W04A 1DPRA 1X4OA 5IFPA 1FAYA 1LOGA 1JU4A 3L2VA 2PBIA 2DUQA 5FZIA 4GULA 1ZM1A 4BUPA 1PP7U 2GC2A 4XZUG 4LLGF 1VQ8I 1DP7P 1GR3A 2JDUA 2XV4S 3OS1A 3S32A 4MLOA 1OLME 1RHI1 4GXLA 1YJ9I 1LEBA 3FZ3A 2VO5A 3ZGKA 4BQWA 3WY6A 1S8NA 3O1MA 1T38A 3IIIA 4HFSA 3NQHA 1BLZA 2CSOA 4A6EA 4YZ2A 4IQJA 3NARA 3KP5A 3GCMA 4OINF 3F8BA 5EEHA 3OF1A 1STMA 2X8KA 3JRHA 4GJYA 3WF4A 1ITYA 1WKMA 3B9IA 3HOBA 4HL0A 1RUE1 3SEPA 2PA7A 1ND2B 1RL3A 2Y0SN 2A5WA 3VBUB 2M4GA 2ZKNA 4O3MA 5DCFA 2VR4A 1Q1VA 5J09A 2A7AA 4QKNA 1TQPA 2HYGD 2NPIA 4P9IA 2LTNA 2BY3A 1T6GC 4R8HA 1GYKA 2IP2A 5CADA 3L7WA 3BTAA 3U75A 4OFGA 2RS13 5JZGC 3POFA 5LHHA 1SLIA 1KITA 2JDPA 1TC3C 2MD0A 3VBHA 3CDLA 4B1MA 1GKBA 3NRVA 4Q0UA 3ZFFC 1XBFA 3ZDSA 5E18F 4CDUB 1W3VA 4P9YA 1KGSA 1OYWA 4HX4A 2W7NA 3IKVA 4L97A 2JG9A 1WJBA 4FTEA 5C5TA 2E32A 1PO23 2XAHA 4Q4ZF 1BK0A 2LBFB 3D1NI 2ZSHB 4ZYGA 5HCBA 2CGOA 1AXKA 3K2OA 4L9BA 1YYVA 1RVF2 3LA7A 3LOCA 1MMGA 3J8F1 3H1YA 1LEMA 1KQ8A 1OOPC 3AMQA 1FMD3 1W8HA 2WAAA 1GV2A 4QPWA 5C8CB 1PVC2 2VBXA 5F5AA 2Q5TA 3RDIA 4FPHA 2CDPA 3TYJA 3O0VA 4YVWB 4Z2AA 4FP3A 2EZIA 1IW7F 1FMWA 2C1FA 4LKEA 2VZPA 4YW4A 1RXGA 4BQQA 2PQSA 1QPIA 4QQPA 4IV1C 4RQPC 2K9SA 3A2KA 5GAGJ 4AEDC 4LO6B 4DXTA 2NP0A 1ETYA 4O7XA 4AI3A 1UOGA 3PURA 3WQ7A 3WU2C 2KJBA 4XKBA 5KC6A 1PVXA 1P2FA 5LCWL 1T56A 4DNYA 3ZX7A 1AYN2 5LLQA 1JMUB 2PHFA 2X29A 5A7QA 2W3JA 1SFXA 2W9XA 4IE6A 1VQPI 1V5FA 5K9YA 1HB1A 1GBGA 4CTEA 4M6XA 2Z9OA 2Q2EA 1R4NB 1POGA 1S0JA 3E97A 4DMIA 5IAXA 3OSDA 1O3RA 1QWRA 5A3TA 4XVHA 1J7KA 3C7HA 2J7MA 3CC7I 1W36D 2V6EA 1NZCA 2XSJC 3JQXA 5FTTC 4NIIA 2VC0A 3KV9A 5JXJA 2HWD2 4HG2A 4TYSA 2M8EA 2OTLI 4QB6A 4CDQC 5DABA 3RI4A 1Y6IA 5KHDA 4Y17A 3IWFA 3OBZA 3VYRB 1LGCA 5FZFA 2PJRA 2EB7A 3GLLA 2RR13 3IC7A 5HXMA 4H7LA 4I30A 3OIOA 1V9U3 4BE0A 2BDRA 2Z5WA 4IPAA 3ERED 1R23A 4ZS3A 4YG0A 4KH9A 1MEC1 2PMHA 4NHKA 1W8NA 4MO3M 3ZFFA 2QQUA 4INDA 3M8JA 1XN7A 1RUC3 2HR3A 2FMDA 1CX4A 2ETHA 4CXFA 2ZAHA 4C0HA 4WM8A 3WG4A 3MF6A 2A6TA 3GZEA 3QP5A 1KXGA 1MW7A 2TDXA 1VAVA 4QU1A 1UMQA 1VMJA 3I2IA 4HF2A 4CUGA 3GGLA 2E1NA 2VNGA 5EYRA 1QGLA 3WLUA 1R4MB 1YW8A 3M3IA 3WNPA 2OCEA 2E2HJ 2DCTA 5I0UA 2LM3A 1K5MB 3CDIA 5JOZA 1V6NA 1H9TA 3A01B 4Q5OA 3BWGA 2QNKA 2HTJA 1MQTC 5DDJ1 3ZSLA 5BY5A 4AFMA 3S6PA 3VBSC 5D4SA 1B72A 1SFNA 3WP5A 1XGSA 3RSNA 5B66C 3CHXA 3ZFEC 1Z3YA 4YWAA 1AKHA 1RUJ2 3UT0A 3ZP5A 3BG7A 2ZMEB 3FHQA 5C3RA 5LGUA 4P9XA 1DU6A 2X6YA 2WT2A 1ZA4A 1AYM3 4JDNA 2CAUA 1YFYA 5FPVA 2NXNB 2EIMH 1B9MA 1ZZ6A 3CMEI 3LA3A 3IH2A 3F2ZA 4Y22B 1E17A 2XVLA 1IPJA 1IRGA 2M0CA 1JOPA 5DUXA 1OPMA 4KA4A 3S1MJ 2P5KA 3U10A 3BTCA 1QMJA 4G4FA 1LHOA 1AX1A 2GH2A 2ES3A 4PJYA 1FATA 1H9PA 4DBQA 1BN5A 3U78A 1H2KA 1VPHA 2PX9A 1CESA 4U7DA 4CUCA 5L9BA 3NJZA 3DGTA 3EQEA 1WA6X 5CFDC 3K0LA 1ZZ7A 1OFCX 4NHLA 1F31A 1XDUA 4XBLA 3R4DB 1KU3A 2MLGA 1G3YA 3E5XA 5FYMA 1Z6TA 1UWWA 1XB4A 2GC3A 2OBPA 4HX8A 2PMZA 1W2UA 5C6CA 1U5TB 5FYIA 2HOTA 3RS6A 1TBXA 1FPQA 1TQ5A 1NAEA 2BZTA 4WM7B 3GMEA 4HK8A 1O7LA 3WW3A 3QPSA 5FZBA 3SQOA 4EJRA 3S3MA 5LGTA 3ASNH 4H14A 5DUUA 1UU5A 2MC3A 1V54H 3H36A 5GPCA 4EGYA 1ASJ2 1ZG3A 5M3MJ 5LY2A 4RAYA 4LA2A 1W90A 2IXIA 2D3RA 3OYNA 4P96A 1BJQA 3KD4A 1UJ8A 4OUMA 2O0OA 2GMMA 3OYFA 3OIPA 1YQAA 1V4RA 2XLFA 2HNHA 3W20A 3CZ6A 4D5FA 5IJRA 1AYN1 2F6CA 1JXNA 2PHTA 3MAJA 1ZRRA 5FDBA 1KYWA 4AFBA 4CZCA 3ZYJB 3CESA 1Y4WA 2WS92 3OSFA 4CP1A 4M3CA 3CUQB 4XCBA 3VSKA 1GDTA 4A2UA 2DMUA 5LBFA 3VEPA 1HC8A 1FMD1 4CP9B 5KHGA 5E3MA 2LOOA 2WSUA 3WNOA 1LFBA 1Y9MA 4IEXA 1S72I 1W8TA 3VD4A 4NAOA 5EJCA 2VVEA 1OD5A 4A7KA 1YIJI 1W9WA 2E7TA 4NJ4A 3AZVA 2F5FA 2JXAA 3S5QA 1C5HA 4OHVA 1QVUA 1YRNB 3H3ZA 2YS9A 2H27A 1CD3G 4ZZDA 2VKVA 4OAZA 2BVMA 4CCOA 5JXGA 5LA2A 4A3XA 2K3PA 4K21A 5BNNB 1CIWA 5CJ9A 3HNMA 3LMMA 4Q4W2 3GLXA 1E5IA 1XMAA 2MLKA 1PZ9A 2XQXA 1KU9A 5FXVA 2BVBA 1QZYA 2VQAA 1DFQA 4LLLA 2YZ4A 5FK7A 2KIFA 1EPWA 2D7FA 2XQRA 5B1BH 3HRTA 3BOPA 4ZYHA 4RAZA 2DJIA 4OU0A 4QWQA 3CJIA 3OR2C 5A2QZ 4JGZC 2TCTA 4Z92B 3FIWA 2BE5F 3GYHX 3CEWA 1NUKA 3N9NA 1GNYA 1DQ6A 4X8NA 1DLLA 4COYA 2A6WA 1ZN2A 1Z7S2 1IUFA 2IJLA 5FY1A 4HZFA 2YGLA 3POGA 3PIPF 1FXZA 3EHKA 2MA3A 1NH3A 4Q4Y3 5T54A 2YYOA 2ZMNA 5FLXZ 2R5ZA 4AVPA 3R4KA 2IA2A 1NKGA 2MFZA 2XJUA 2JKBA 1HIXA 3KVAA 4XTMA 1REDA 3B6CA 3AMNA 4Y52J 4MXWB 1B59A 3QACA 1DYPA 1HDKA 1A34A 2FMLA 3VZMA 4JYKA 4PF5A 3D0SA 1XPWA 4YVWC 5DMYA 3MUZ1 5DAPA 2OAZA 2OVUA 3T2OA 3V7RA 1UB9A 3ZXLA 4LMFA 3ZXAC 2A07F 5FYVA 2EIJH 3RMYA 5LZ6A 5GZEA 4P9LA 3ABMH 1Y8RB 3POWA 4RB0A 5G05L 5ABJC 2M7AA 1XSVA 1VP6A 5FO7B 2C24A 4P02B 3S0MA 5GM0A 2AACA 4HLTA 2EVXA 1QNTA 3BT9A 1MMNA 1JT6A 1VQMI 2F48A 1OKRA 2V6CA 3D5SC 2RREA 2DJNA 4AU7A 1VBC3 4RD7A 1EH7A 5J4VA 4M3BA 4YPJA 3K4MA 3PFIA 2HWE1 3C7OA 2WLPA 3OOXA 4NROA 3MMYB 3HOXJ 2WZ8A 5J96B 4I02A 3RWNA 2ZX0A 2RDPA 1IN5A 3HEIA 1REPC 1ULPA 3GJBA 4IV3B 5FWJA 5KWRA 4ZTJA 4A3ZA 2LMDA 4NPLA 4AD9A 1VQ5I 4E7HA 2LP0A 4CDUC 2L7MP 1T95A 1MZEA 2LNBA 4WM8C 1QDOA 2JKXA 4JP0A 3BUCA 3VZNA 1QIQA 4UXNA 1CVNA 4ESFA 4XW3A 3ZYIB 3WCRA 1YQ5A 2CWSA 4IRHA 1RUH1 4GIQA 4QX7A 2IS4A 4AI0A 1UN1A 2FZ2A 4EJOA 4Q48A 1ZZCA 2C4XA 1H89C 1UY0A 3AMPA 2FF4A 2ZEYA 4L18B 4X6AJ 1USTA 2HKXA 2NVTJ 4QMAA 2CQQA 1SLBA 3NNFA 3REOA 5K7HA 3BOQA 4Z07A 3OYBA 5FPBA 4HLXA 2JWPA 2VUMJ 4E4ZA 4HPKA 3UL2A 2RV9A 1T6BX 4E7ZA 2M8GX 2HKOA 4P5YA 2WNUC 5GLVA 1FPN2 3K2AA 4M3FA 4ZYDA 2GLOA 1I1SA 4QU2A 1IJWC 2BGCA 5HODA 4XLHA 2ARXA 1F36A 3HZJA 3PJQA 2ECCA 3HOUJ 2BGOA 4QHOA 5FZ0A 4JDMA 4Q8LA 1XYOA 2XPVA 2DCJA 4CCKA 3CTAA 4E7JA 2VIXA 5CVIA 1ERDA 1D4VB 3AMMA 4YM1A 4KNCA 3MEPA 3NMBA 2BBYA 1TME1 3JTHA 1JZ6A 3HWJA 1LB2A 4QX8A 2LD5A 3ABTA 1OLRA 4QKFA 1K4SA 3CL1A 1P6RA 5J37A 4CDXA 3HXLA 2YDEA 1BOBA 2WY7Q 2WYSA 5FKMA 3AFHA 1HA8A 3PUFA 3HVDA 1HKSA 1HLCA 2RN7A 2DDAA 4A6SA 2PJPA 1SLAA 1PK6C 3NWKA 1XJAA 2Y6KA 5GZFA 1H6XA 2X85A 1ZG5A 1TL8A 2CU5A 5LASA 3AKZA 2OQ7A 3WODF 1IXCA 1ZVFA 2K40A 4SBVA 2ILMA 3KT4A 3W5MA 1J3PA 2KIMA 5CAZA 5KC5A 4IZZA 2GXGA 5BQTA 4EMSA 3BG9A 4XAAA 1FI2A 4Q4V1 4OI2A 2IPQX 2ZBKA 4CA0A 2V73A 4PCRA 2QYOA 3K4KA 2CJJA 4CCJA 4EEFG 3SHRA 1OQYA 3HIFA 1E5SA 1CJDA 3T09A 4B09A 5IY5H 3WU0A 2X1DA 2BBVA 2HLEA 4QX5A 3DTIA 3JSPA 2DTYA 1Q56A 4IL6C 1ENRA 3QOPA 4X6QB 3ES1A 2R041 4QPIC 4XLAA 4BBRJ 1H30A 2XAJA 3GTPJ 4BHBA 4C2TA 2PLV2 3E6CC 5HCAA 3O5SA 3AP4A 3HN1A 1MS3A 3ZFFB 3OL3A 5EWSA 1R081 3I71A 2WLQA 4DJAA 2HZTA 1GMMA 1JODA 5FMBA 3FC0A 3FK7A 1S0BA 1W6QA 2FQ4A 5JOXA 3KB5A 3S57A 2R071 4O61A 1BM9A 3R6SA 1JKQC 4QM9A 5F3GA 1QKQA 4O9GA 1O3TA 1F8VA 1SAXA 2W24A 1HRV3 1XPXA 2EXJA 4WVMA 4LT5A 5JR7B 3VOEA 4XJAA 1UZZA 2QQLA 1YYNA 2VOTA 5FP3A 3LA2A 4KGQA 5CKTA 5HNHA 2A69F 1MS1A 3GM8A 1LGNA 3LQQA 2D5VA 1BI0A 1IGOA 4XOGA 5EXOA 1QDCA 4MXVA 3DQVC 1SVOA 2LUWA 2JDYA 4WZFA 5K5RA 4B4CA 3ACLA 4CCEA 4ZC3A 3L1PA 4EWAA 2O8XA 4JGYA 1JJ6C 2CUZA 1KQ9A 4KWJA 2XJQA 3LQRA 2A1XA 1X1BA 3I4NJ 4ZH4F 2N7GA 2JE8A 5FBJA 3ABUA 4AVBA 1B09A 5LBBA 4C1XA 1I5PA 4XBNA 5FGMA 4IETA 2PXJA 5A3OA 4FT8A 3FUOA 3COAC 2O8QA 4FSJA 2VL4A 4AI2A 4E27A 3BB6A 4MOAA 3GUDA 3SH5A 1XNDA 3I2OA 4D7NA 2NMOA 4FFHA 3KM5A 2DDBA 2R7EB 4M73A 3VUOA 2YC2A 1A6IA 2OPTA 1R083 2HWB2 1V3FA 1UNBA 5IVBA 4ASKA 2MYSA 3K4LA 2K2SA 3AKSA 2QVSB 1A8DA 3MLLA 2ISYA 4WXDA 2LKXA 2DCKA 2R7OA 1K83J 2JTVA 2JDKA 4HF1A 2FDGA 1N3QA 3TEZA 3TOBA 5JR2A 4ZZLA 1ND2C 4GGGA 2WO2A 5LA0A 1ZRCA 4TTGA 3MIGA 3I54A 2VECA 1QY4A 3CDZB 3HUGB 3CLOA 3JRGA 2G4IA 5BNOC 3TO6A 1YS6A 3TDUC 3NAPB 4DS0A 3H42B 3M1EA 3KE2A 2HTSA 1VBA1 1O91A 3TOJA 3GO5A 2A6HF 1P4WA 3V7SA 3BJ6A 1RUD3 4AVAA 2KP6A 1FPN3 2M0MA 2IS2A 2RS32 3QPHA 5JOWA 3OYCA 2YUEA 5B3SH 4AGGA 4P08A 2HWC1 5FUPA 2VMGA 3M7GA 1YFWA 3GZUC 2ZS6B 2NOGA 2XLAA 4E4DX 1UU4A 3D6EA 5E1ZB 4Q4X3 3AXDA 4YW2A 4LHKA 3MFAA 3RZLA 3LFKA 2Q4SA 3G1OA 2Z33A 3ROUA 1IG0A 2JDNA 4NPMA 4IQPA 3LB9A 1U5ZA 3O1OA 3TL4X 2DURA 2AS5F 4ASMB 3VWBA 4BE3A 2O61A 5JLWA 4K7JA 1LGBA 1PMIA 2GMEA 3LIHA 1RINA 2VASA 3IAS2 2V5YA 4AXOA 3KP2A 1RR8C 2DCYA 2QBYB 2G7UA 3KZYA 3WDTA 2NYXA 2HU9A 4QD2A 1XQNA 1H8TB 4R4ZA 5CBLA 5JVVA 5IK7A 3AB0A 1NY72 5FZ9A 2JG9C 2Z2SB 3PU3A 3I4PA 3AP7A 1HN1A 4XSZF 1MSFC 1SVMA 3ZN6A 4GALA 1LHVA 3POIA 4DY3A 4BL0B 4EQQA 3A4UA 4A6DA 1IG3A 1FOD2 2GA1A 3ESWB 2JG8B 1GP4A 3HYIA 5J3LA 1X2NA 5CG9A 2VUDA 2HPMA 2WTEA 1QH7A 2ZACA 2YU9J 3UNGC 3PLQA 4Z82A 3IM0A 4IDZA 4OUEA 4L9VA 2A71A 4FTHA 4K8RB 2W1QA 1LEDA 3G2BA 1MD0A 1Z7S3 2X05A 1JU3A 4XTPA 3FUQA 1QVTA 4DYQA 3WE2A 2Q1ZB 4S2HA 1N1VA 3S2DJ 2P3IA 4RS5C 1BCXA 3EYIA 2NNNA 5IK8A 1OYYA 3OWTA 1GLNA 2M45A 1V6JA 2M87A 3GFIA 4Y5SA 1AYM1 4YGDA 4LR4A 2BZDA 3DF0A 1IQDC 3NV4A 5J6XA 5FZOA 5DM6F 1C57A 1UYPA 4S2FA 2RS53 1R00A 1MVQA 4B8EA 3VZJA 1MS4A 5JVGF 5GALA 3ECOA 2RVAA 2XAGA 2D6PA 2PG4A 4OI4A 3ZYBA 3G1LA 2DO7A 1E5HA 1GZTA 4WK8F 2ZHMA 5A6XA 2LKPA 4MNUA 1RUNA 1SQ4A 5FZ4A 1JKPC 3WQ0A 1X50A 4FPEA 2E51A 1UHSA 4COVA 1QOSA 4IJAA 4L99A 3JTGA 1C8M3 4A7ZA 4JC1A 1UCRA 2L4AA 4G6DA 5FJKA 3VBUA 1K5MA 1EH8A 1MMAA 1PUFA 2DCEA 3IRQA 1MKMA 2VNOA 4UBHA 5FZEA 3RZGA 4UVAA 3KEQA 5LK5A 5FO8B 2R93J 4GQ7A 2A61A 2VE8A 4NC7A 1OF4A 4JX4A 4DEQA 2WZR2 2BVLA 4HQEA 1A78A 1TQIA 1RUH3 1BXHA 4OHYA 3DF8A 2BEOA 1PUEE 5A2QK 5IP9J 4DUVA 5IT9Z 2QDRA 1ULYA 1WQ2A 1DPUA 2QQPA 4XFAA 1YCIA 5ACA2 5EIYB 4E8DA 4RLFA 3E6BA 1I3AA 3K3NA 2QQKA 3J9SA 2ZX4A 1XNKA 4JGZA 5T5JA 5LBEA 3JRBA 2VD7A 5J8CA 1HXDA 3FXLA 2XC7A 3PHMA 2VZVA 4G12A 5JSOA 1X19A 4XHXA 3PJRA 5F3EA 4AM3A 2HYFA 2ZBJA 3HOTA 4RN5A 4LOSA 5LK7B 2RNGA 4G9YA 2AGSA 5J1YA 3RIRA 2DAOA 4LB6B 2HYKA 4LLNA 3IPVB 5FP4A 3T1MA 3I64A 1WI9A 2QKDA 4TLGA 4HV6A 1F35A 5DEQA 4MGYE 5APAA 2ZABA 2QE3A 5EHDA 3C1DA 4IHYA 4BQXA 3C2UA 1VBB1 3HQUA 3H50A 1W6NA 1AJKA 2UWMA 5BPXA 1RITA 5FY9A 1MS9A 5BYNA 1PZ7A 3ILFA 1W03A 1FIAA 2NQYA 4PCQA 2VONA 1FNZA 5JSPA 4Q5SF 1RVF3 4ZU7A 4ENJA 1XX5A 2K0GA 4MGQA 2XDVA 4NO4A 4AHYA 2X5IA 1RKWA 5I0SA 3AP6A 1RYYA 2Z4FA 5KAIC 2HWD1 2ZXQA 3C7JA 1WCDJ 4LGWA 4UXAA 4IEJA 2AREA 2WV1A 2XJTA 1FEXA 1SCSA 1YS7A 2A68F 4YFXF 4MYEA 4IEVA 1J3QA 4FTBA 3H7YA 3PUQA 4II2A 4D94A 2R1DA 4XC9A 2WA4A 3VBRB 2KDZA 4I3PA 1FV2A 4PBOA 2JSPA 1W8UA 2F4LA 4TN7A 4IRIA 2VVDA 4RQPA 5E88A 4QAWA 4YGCA 2W1OA 2X6XA 2V1XA 4Q0VA 4HMZA 5E89A 2VI6A 1CZTA 1ACIA 4QTRA 2QENA 3B94A 2F4OB 4BXXJ 1X4PA 5FYBA 1ND2A 4M74A 3L2QA 3FXOA 2KZGA 4RM2A 4PQQA 4W50A 1SLCA 3WUCA 3P3PA 3CCLI 5CQGA 1XE8A 2CWMA 3MW4A 2FSWA 3TBIA 1VRH1 2WO7A 2VCCA 1J75A 4A5MA 1G86A 4E2GA 1N47A 3BU0A 3QU3A 5D6FA 5ERIA 4G94A 4QLCU 4IV3A 5HDGA 4XOTA 3VBOA 4MIMA 1UY1A 4L92A 3H8OA 1H2LA 5JMCA 4MHGA 4EM0B 4RS8A 3GW2A 3OY8A 1DU3D 1ZBA1 4U87A 4B44A 4S04A 2E7XA 1FZPB 4HV5A 3ST7A 4YG3A 4YSFA 1A31A 3ZMZA 4HDUA 2ACJA 5J98B 3I3BA 3JQWA 2TEPA 1V9U2 2JG9B 2ZFUA 2YB7A 1EAH3 4P9WA 2V5DA 2YFZA 2WAOA 4CU9A 5FKCA 3WTSC 4A0ZA 2OKXA 3H5AA 2GP5A 3W3CA 3QPTA 4IRGA 1ETWA 5E1WA 1FOD3 4NR1A 3CCYA 2FDIA 5E79C 1W7PB 3CJTB 3FDYA 2KM2A 4BDVB 3ZQIA 4NIHA 5FKBA 4BQYA 1YITI 1UW8A 4D3WA 3O0XA 3C3WA 1RUOA 2QJVA 3SHFA 1ULCA 4S2GA 4FPYA 3VLBB 2L7ZA 2VULA 2XGEA 3F3XA 2HXIA 4QPIA 5JXIA 5FAXA 4ESBA 1U8BA 1ZNPA 1ZZBA 4OMDA 2VPRA 1W36C 3AG2H 4LBQA 3A7QA 3ZQQA 5GZGA 3DLAA 1YFUA 1JYTA 3TRSB 4CDWA 2VXZA 5BNPB 5LFAA 2R7XA 5FY5A 4UV8A 2VQHA 4BHPA 1BW6A 3BN6A 1NZIA 3LWFA 2WR9A 3B02A 3OGRA 3RQ4A 1VAMA 4QM8A 2ET1A 1TWAJ 3CO7C 3NV1A 5FJ8J 4XQ4A 3GXUA 4IEWA 3PUIA 4XIOA 5LEJA 4MG2A 4IL7A 4P5HA 4KIFA 4HF0A 1MJBA 3BPSA 4BCUA 2ZJ2A 3PUSA 1VBD2 1WH5A 2IGOA 1UIJA 1YQ8A 3L2RA 2WZPP 3MPBA 1US3A 4XF4A 2WZEA 1IO2A 1O4YA 2GH8A 1WLDA 3EMRA 2E19A 2X0LA 2CFOA 3N9QA 4ZDPA 1S2KA 1GQPA 3LSJA 2VUJA 2DQLA 2VMEA 5C8CA 5FPXA 1FSEA 2A3WA 4IHVA 2JSCA 1JHJA 5EJ3A 1SDWA 4XM3A 4FO9A 4XUQA 5GADJ 3V42A 5E3NA 3EUHC 4CEWB 1NLQA 2E1OA 3EUKL 3LSGA 2RS33 2J22A 1JYVA 4XUOA 4KUMA 2HWF3 2VCMA 3OEAA 1AXYA 4LK7A 1V70A 3U1KA 2VAUA 3BROA 4R4XA 1VBE1 5DCMB 1XD7A 3ZSEA 2Y0OA 3VBUC 3SDBA 4JX6A 1QPMA 1QZZA 2R49A 4XIDA 1YJWI 2Z99A 3QU6A 5F08A 4CYDA 2D1VA 2W91A 4ZJZA 2WS93 2RKHA 4BQ4A 1ZKGA 3GJAA 1O57A 3D0JA 1FBSA 1GVDA 5FOBB 3LEIA 2ZJQF 4HKOA 4CZZA 3FM5A 3W6KB 3AKTA 1O5LA 1BHGA 1YLFA 4AWXB 4OULA 1OKQA 3E3VA 5JPMB 3PNVA 3VSLA 3FFQA 4PSXA 3VBFC 4FFIA 5ANQA 5CYYA 5DG1A 1LOCA 2WO3A 4NDLA 3R0AA 1Z0HA 4XN0A 1ZZ9A 4UW3A 2Y9YA 3L09A 4XN3A 4OYUA 4A3JJ 2V79A 1UZYA 1C28A 3CZJA 2GZWA 3N05A 4PI2A 2QQAA 1MBJA 2DFFA 3NNGA 3UKNA 2Y8KA 3EO6A 4Y22A 3PM1A 1NYWA 1JGGA 1WWXA 4I2OA 1Q5OA 3B73A 3WTZA 3G7DA 3PU8A 2CV1A 3FHAA 3E6DA 3E0JB 1H88C 3PO2J 4P9UA 3K2ZA 2OCCH 2NM1A 3ZMTA 1IXRC 4F92B 4LHSA 4CEYB 2W94A 2VE9A 1QZEA 3TO7A 1QU0A 2FOWA 3TO9A 3D82A 4UUSA 2LF7A 3U37A 4HPKB 1W5CC 3HC7A 1JKOC 2IS1A 3PIOF 2NAZA 4M4RA 2HDWA 5JMOA 4C91A 2QQBA 4BXSV 3WGGA 4FX0A 1XMKA 1Z7UA 1E3HA 1KU7A 2WSVA 5C8CC 3O1TA 1RTVA 1DYKA 3GTOJ 3AG3H 3VZKA 3BR5A 2Y33A 4L8QA 2D1HA 4KNYA 5EYXA 2PMWB 4JQRA 2WA0A 4YVSA 2FX0A 3NKTA 2FBHA 4PT6A 4IV1B 1RMU2 3MW2A 3F21A 1Y9GA 5ICCA 1HOMA 4IEYA 3HHGA 2AENA 1PVEA 5A7PA 2V1UA 5E1RA 5BPDA 1APNA 1IRXA 3LSTA 1VBA2 3SITA 2VW0A 1LDJA 4IGOA 2Q8EA 4EJWA 2QQMA 1OA3A 1ZBA3 5HNFA 3T0DA 3BKZA 2FBKA 5J47A 1LOAA 4BJ6C 1BKZA 4D5CA 2VOWA 3H9AA 1UG0A 3ME2A 2DQRA 1VBC2 5AVAA 2L9VA 3WTUC 5FZMA 1OLTA 3F23A 4RYDA 5GLTA 2GBYA 1EAH1 4XNFA 1S1AA 3FKIJ 4K8FA 3VHPA 3I2FA 3FHIB 2WNVB 3WQBA 2JRTA 4QSHA 3J7HA 3BJAA 3CUQC 3HBKA 1R5HA 3OOUA 5JDBA 2LY1A 2VOVA 2YX7A 1G7YA 2FNAA 2AXLA 4YZ3A 4BQNA 1CAUA 1F4HA 2E26A 4V1PA 5FPLA 2P5VA 4UY8I 3CD6I 2DBBA 4E2SA 5A32B 5DUKA 3U21A 3IZOA 4EN0A 5FLHA 2DTZA 2MG4A 2C9AA 4FCAA 1SVLA 2QQ9A 4BXUA 2Q8OA 1Y3TA 2EWNA 2VMIA 1XTAA 5C4WC 3CQZJ 4BGDA 2J42A 4KU8A 1U0JA 1ULDA 4JGZB 4XABA 3U2RA 2VJXA 3E7LA 3BGAA 3T5XA 1LOFA 3HR9A 1MBFA 4IEQA 1ZHFA 1Z91A 4XCAA 1CX1A 5DZFA 3AZYA 3AZXA 4UNOA 2K9LA 2VE1A 3OGJA 4IUGA 5IVJA 3QODA 1L3LA 3E1F1 1W0TA 1XCVA 3PSIA 5JZGA 3MQ0A 5FD6A 5IVFA 2V4JC 2HWB3 1NG6A 1JT0A 3M8LA 2YROA 5K1YA 5HXVA 4DRRA 1RZ4A 1HV1A 1RVF1 5C9AB 3OGGA 5DZEA 3V7CA 3RYRA 2EA2A 3KV6A 2HDDA 3EUAA 3K3OA 3ZN0A 1TQMA 4RDUA 4PF1A 2HDCA 4BQ1A 4V19K 1OVSA 1GOGA 2E9QA 4MZUA 4M3CB 1D5VA 2XOMA 3LNQA 3F6VA 3NJXA 3LDKA 1REFA 5FLMJ 5A1AA 3SISA 2OT7A 4A5NA 3KCXA 1UY2A 4FQ4A 4RB3C 3W6JB 5FBZA 3X2QH 3K69A 1CJPA 4K3UA 4LUKA 3HDDA 4IE5A 5D8AB 1C1FA 4EN8B 5L9RA 3ORJA 2HEVF 1QU3A 2FQPA 3A23A 1GXPA 1F9KA 5JSRA 3VKOA 1IZ1A 1CAWB 3CZUA 2JA7J 2K9QA 2ME0A 3RI8A 1Q8VA 3LDBA 2BVVA 4DOZA 3MVPA 5FYHA 1KJRA 1SZBA 5LB6A 4MO7A 2WNUB 1LOEA 1IRZA 3N3HA 1HN0A 2B46X 1QHDA 5EZGA 2F4IA 3KEYA 4LTAA 2QSGX 5CFDA 1RPWA 4AHWA 3M3EA 3SKJE 3F8NA 3S1RJ 4DIQA 2VY0A