1HW5A

The cap/crp variant t127l/s128a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
208
Chain Sequence
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVLAEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATABOLITE GENE ACTIVATOR
publication title The structure of the T127L/S128A mutant of cAMP receptor protein facilitates promoter site binding
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation
total genus 60
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hw5A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hw5A01
1T6SA 3E5XA 4BXUA 2O1QA 4KA4A 3CLPA 1REPC 3R0AA 1D8KA 4PIYA 3MZYA 4IRHA 4J1WA 2Z69A 4MQ9F 3M7GA 1CX4A 3SCFA 2V09A 3BB6A 3ES1A 2F4PA 3HRTA 4KMFA 2PA7A 4QMAA 3DFGA 4L9NA 2ATFA 1YLLA 1OR7A 5DV5A 4RGUA 4IRGA 1CAVA 1FWZA 3H92A 4LLGF 5E1ZB 4XBFA 1G3TA 3K69A 1ZZBA 5HLGA 4MHGA 5A2QK 5HS7A 4H0EA 2A07F 3SZTA 2CG4A 2GIVA 3BDDA 1O5UA 2F5EA 3HHGA 3KETA 3QRFF 2X4HA 5HVQC 1G6NA 1YFHA 1OMIA 3GEZA 1KQ0A 4GO1A 4UVCA 4ZYEA 1D8JA 2CAVA 2YX4A 2HDCA 5DCFA 1QWRA 5LHGA 3OF1A 1O3RA 2RGVA 3HTUA 3RPQA 1ZREA 3H1YA 1W4MA 3VB2A 4HF1A 1FLIA 5FQ0A 3LA7A 4DINB 1G3WA 4KN4X 3L09A 1XCVA 1RI7A 4N9IA 2E9QA 2EA7A 1YFUA 4HDVA 1HW1A 4PIXA 4JV4A 4X6QB 4HW0A 3ETQA 3RYKA 2H09A 5JSPA 3TOBA 5BOXA 5BMZA 4M9SA 4BH9A 3ZMVA 5DD4A 4Q0QA 3CJXA 4OLLA 3F3XA 1G3YA 1J5YA 1ZZ8A 1RNLA 2B8MA 3WE2A 1XGSA 2EB7A 1X7NA 3NW4A 2HTSA 4XF9A 1XDUA 1QY4A 3IKVA 3RKYA 3WG9A 4FAGA 5EZWA 2E1CA 2QJVA 3LFKA 1XN7A 4PIZA 5FD5A 1TQIA 2Y0MA 4QGLA 1HXDA 3WU0A 3ROUA 2K02A 1UHMA 2WFPA 4UUVA 5K5QA 4EGYA 5CADA 4RAZA 3W6JB 4EWDA 4IETA 2CWEA 1LDKB 2WTEA 4HSJA 2XVCA 6PAXA 2EFNA 4Z07A 5D5VB 3IWZA 5L3EA 5FDBA 1ZRCA 3OV8A 4EM1A 1H1MA 3H50A 2VXZA 4L9JA 2Z5UA 5I0TA 4XFHA 4HYEA 2E1NA 1FC3A 4RB0A 2FOKA 3QAHA 1G4DA 5E1RA 1OYIA 4R79A 3FZVA 5CVRA 4AWXB 1UHWA 2DPDA 1T39A 4XEZA 3W6KB 4ZYDA 1BOAA 4R1HA 1ZLKA 3L2CA 4LULA 3VHRA 1MDMA 3T5XA 2F5DA 5EEGA 2IW5A 3FZ3A 4LG0B 4WVZA 2L4MA 3DPLC 1YYVA 4L9VA 2IP2A 2PN6A 2Q0OA 2DCTA 2VQAA 2DW4A 2QQAA 1I1GA 3GYDA 3RKXA 1Q43A 2ESHA 2Y75A 3DPTA 4GGGA 4AVBA 1U5TA 4JBAA 2HKOA 3WTZA 3M70A 2ESNA 1IF1A 3I59B 4HV5A 1OKRA 1FYLA 1QGPA 2HYFA 2DTRA 4AVPA 4LLNA 2KIFA 4I98B 1ZZCA 1FPQA 1W7PB 3D5LA 2JPBA 2L01A 1F4KA 1BI2A 2GA2A 4UBHA 3FHIB 4ZU5A 4HF0A 4WXHA 2ET7A 3WW3A 3J80Z 3L7WA 4EV0A 5I0RA 2V79A 1XRUA 3FFQA 1MKMA 1MGTA 3GZ5A 4EMSA 1J3PA 2M5WA 1OPCA 5HOOA 2XLFA 3FJSA 4QWQA 3DXJF 3UKTA 4M71A 5CJ9A 3LQQA 4MZUA 5BQTA 1MZBA 1ZG5A 5L3GA 3J81K 3SHFA 3HT1A 4KFCA 3WTWC 1YTYA 2XL9A 2HZTA 1Z05A 3QU3A 4AVAA 2QQ9A 2P8TA 3FMRA 4M6XA 3JSPA 1R36A 5TJJA 3CTAA 4KMUX 5HLHA 4PGGA 2ZFWA 1ZRDA 3E97A 2HWVA 3KLOA 4D0PA 2FBHA 2RQPA 5BXXA 2CFXA 1YLFA 3JSOA 4G8XA 2VC1A 2DK8A 2L3DA 1IN6A 2XAHA 2VE9A 4R8HA 3WW4A 3E3VA 5JSRA 2TDXA 3EQEA 2BNNA 1VTNC 5FQ0B 4FBFA 1NHAA 2IXLA 2PMHA 5BY5A 4RB1A 5LHIA 2GC2A 2XAJA 4JTNA 4HV6A 5FLIA 5J48A 1T0FA 4IHSA 1OYWA 5C8WA 5DUIA 2QLZA 1F1ZA 1R22A 2IXJA 1YW7A 4P55A 2ZXJA 2QVOA 4P96A 4CICA 4A6EA 2GC3A 2DT5A 4A5MA 2HQRA 2A5YB 4IJAA 4O5VA 5DUKA 4L11A 5J6XA 2P5KA 2D45A 4PDKA 3SXWA 3QPTA 4LEJA 1A04A 4JQFA 5I8TA 2IPQX 3WU1B 5DEQA 1UIKA 5AONA 3R61A 1E17A 4U88A 2D2WA 3K0LA 5CVJA 1BJAA 2BE5F 2Q30A 3CEWA 1WA4A 3F6OA 5L3BA 3IDCB 1MD0A 4I0AA 2PAKA 2NNNA 3F8NA 1W7PD 3O2PE 4MGZE 3BOQA 5ERIA 3EHKA 3KZZA 2Q2EA 3F8CA 3TKYA 3HRMA 3OTFA 2VT3A 3IWFA 3C1DA 3FXRA 1WI9A 4WXDA 1EH7A 3I53A 2X0LA 3DL3A 4D7TA 1HKQA 2K86A 1Y0UA 5LRSA 1UCXA 1IRGA 3SCGA 3U2RA 2AS5F 1JUHA 5KHHA 4L9TA 4L0ZB 4FAHA 4G94A 1ZZ9A 2OA2A 3BJ6A 3IRRA 4META 1MDMB 3BCWA 2FNPA 3GO5A 1V3FA 2MH2A 3MEXA 2MLKA 1GXPA 4MTEA 1J9IA 4NB5A 4TV7A 2QENA 2PI0A 4LB5A 4AIJA 1XCBA 1FNNA 4CZZA 2ELHA 1IN7A 1PDNC 5DCMA 3ZN0A 4F8AA 1QXRA 3I54A 3M8EA 2UY9A 1R00A 3L2HA 2GAUA 3BWGA 2B9UA 3RKWA 4G7OF 4KT5C 4AIKA 3DEUA 3RI4A 2MHFA 2EV5A 3KGLA 1R1UA 2FQPA 1UIJA 3V8JA 1O7FA 2W85A 4ZZDA 5J3UA 2HS5A 2FSWA 4U0WA 4XF3A 2UY8A 1ON2A 1PMIA 5HS9A 1KQ9A 5TRDA 1SFUA 3ST7A 2I45A 2IA1A 2H94A 1J3RA 2PTMA 4ENJA 1B1BA 1O5LA 2D40A 1QNTA 3JTHA 5I0SA 1FBUA 2VT2A 3U0ZA 2PAEA 2VBYA 2A68F 3OOPA 4B8XA 4ESFA 4Q48A 3SFZA 2MLGA 3O6BB 3TNQA 4XF0A 3CO6C 4M9XA 4UV9A 3WTVC 1W5TA 2FEZA 4HVOA 4CGZA 3R6SA 2IA0A 3H3UA 2MBFA 1G3SA 2J5PA 1S8NA 2BNMA 1ULYA 3P9KA 3TDUC 4XLNF 2G7HA 4WBBA 2MH9A 2A6HF 3G3ZA 1ZRFA 4IEZA 4FX0A 2AXLA 2VE8A 1U78A 4MEYF 4UXNA 4ASNA 1EYBA 2ZMEA 3DP7A 4KWKA 4I3PA 1BIAA 2EFWA 2GA1A 5ILVA 3LWFA 1FSEA 4PGHA 4I09A 2PLYA 3ABUA 3ZMSA 3GW2A 4EJOA 4ENMA 3KLNA 3MYXA 3ZPLA 1F9NA 2IXIA 4YRDA 2MD5A 1BBYA 4M73A 1B59A 1SD4A 3HYIA 2ZNYA 2UXNA 3O14A 3H8UA 1MJBA 3T8RA 3P7NA 1D3YA 1USTA 3UKVA 3FMQA 1BC7C 2MA3A 3WGHA 1RZ4A 4U0VA 3WGGA 2PFWA 2BEOA 5D8KB 3MWMA 2Y0OA 2JPCA 1PM7A 1ZH5A 2XKPA 2E7WA 4ZH4F 3KFWX 2O03A 4HLYA 2RNJA 1E2XA 5DDGA 2OQRA 3IRQA 2QNKA 4EM0B 3CLOA 1CAXA 2CSOA 3QOPA 3I71A 3V4GA 3I5UA 4IEUA 3KEQA 1LNWA 1V70A 2DAOA 1YHFA 2QQBA 3FXUA 4BYYA 2C0ZA 4DNCA 5JR3A 4AD9A 3BALA 4LTAA 1HQCA 1EPZA 2RN7A 1U3EM 1RTVA 4LUKA 5T3NA 3KE2A 1Q1HA 4HDUA 3V8KA 3BZ6A 1KU3A 1CAUA 4HSLA 3ULQB 3FF5A 1ZYRF 1WQ2A 2VN2A 3M9AA 1U12A 2NAZA 3HSEA 1HBXG 1ODDA 1DGRA 3R60A 5DD8A 1RC6A 1F5TA 1H9GA 3D0SA 2V1DA 1FSHA 4J1XA 1IN4A 1TNTA 2VOPA 1Y9QA 3MPBA 1S29A 3N4MA 2D5HA 4Y17A 3RPUA 2XUBA 3NL1A 5I91A 4OU0A 3J80K 2EV0A 4B09A 1BIBA 4RB2C 3LSTA 5FFZA 1ZX5A 3MDPA 3BU7A 3EO6A 2XV4S 4WX9A 4HX8A 3B73A 3CUQA 4HLXA 2N7GA 3IHUA 1WLTA 1QXJA 5J8FA 3KP2A 3GUDA 1QZZA 5K5OA 3HOSA 4IERA 1SEFA 5DCMB 4EJVA 3H7JA 4EM2A 2QVSB 3HHHA 1J59A 4G7ZF 2YU3A 5IT9Z 4Q0VA 1KU7A 5I0UA 1YG2A 2L54A 2YX7A 4MX3A 1JGSA 5KHIA 5ICEA 2VECA 3K9TA 5D6EA 1OFNA 1FT9A 3NQOA 4GYIA 5AIQA 1YS7A 2GC0A 1R7JA 2LF8A 3MZHA 4MGRA 4LLLA 1XGMA 4HMZA 3WTYC 3RYRA 3NRVA 3H3ZA 4AQ2A 4WXCA 3GBFA 1PP7U 5CVIA 3CDHA 4HVQA 4U7DA 4G7HF 1USSA 4OMYA 2O3FA 3M8FA 4XF1A 2FBIA 2G7UA 1WRJA 4OOIA 1J0RA 4KIGA 3LOIA 3JW4A 1SQ4A 2XAQA 5JHUA 1X82A 1O4TA 1K6OA 4XFFA 4AXOA 3CO7C 3GFIA 1IPJA 2P4WA 1YW8A 4LA2A 1ZARA 2O8XA 4S05A 3J7AO 2MPFA 4Q29A 3KEOA 2HJIA 3E5QA 1QZYA 3HRSA 3NVCA 1BC8C 2ZMEB 3ZMDA 4D7SA 2VBZA 2UWMA 1Q5OA 5D4RA 3RNSA 3H7YA 2UZKA 2OA4A 5K5RA 1H9TA 2K0GA 3PNAA 5LEKA 2M30A 1IRFA 3MAJA 1CF7A 3UKNA 4K2EA 4IVNA 2P5LC 3GVAA 4PZJA 1LKNA 1T38A 2V1UA 3GFMA 3S0MA 2OQGA 4HN1A 1TQPA 2DFIA 4P9FA 4RD7A 4KICA 2XKOA 4HLTA 4I02A 4EROA 3ECHA 1YIOA 2QUFA 4LB6B 1I27A 3QU6A 5KHJA 1B9MA 4LFUA 1IPKA 4O9GA 5AVPA 1ZRRA 1CAXB 3WTUC 2XLGA 3NKTA 3EDPA 3WW2A 2FMYA 1B4AA 2FBKA 5FLXZ 5FLHA 4LK1F 3WODF 3G73A 2DK5A 4GCVA 5K1YA 2M87A 2STTA 3BJOA 5KBFA 1O57A 2HEOA 3Q9SA 4Q0PA 4EGZA 2ZJ2A 1CAVB 4XRFA 2V6CA 3ZMUA 2ADUA 1IN5A 5LEJA 3GX4X 3G7DA 3ZQ7A 5D6FA 3KMHA 4IEYA 3F6VA 4XF4A 5HS8A 2VONA 3IKTA 1CAUB 4YIFA 2QBYA 4M72A 1SAXA 1KA8A 3KP3A 4Q0UA 5BPDA 3RIRA 4HOBA 1T2KA 3NEUA 4LD5A 4LLOA 4IEWA 1VP6A 5KK1A 1Y3TA 2HOEA 1W5SA 4JTOA 4FHTA 5FLJA 1RL3A 2Z2SB 1FBSA 3ZP5A 2RDPA 1IAWA 1I1SA 4FT8A 1OI6A 1SMTA 2FU4A 4UXAA 1STZA 2DQLA 3JZVA 2UXXA 4P9GA 2VPVA 1R5HA 4ZU7A 3H1WA 5ICGA 1EY2A 3CUQB 3E5UA 4QX5A 2EFOA 2ZCWA 4Z2YA 2K27A 1EH8A 4YG2F 2GXBA 2LDUA 4EWAA 2IXHA 3F8BA 1P6RA 2ZKZA 2Z33A 3QP6A 4N9HA 1Z6TA 5KVRA 2HKXA 3KZYA 5L3DA 4A6DA 4DQ2A 1QQIA 2LNBA 5FD6A 2GZWA 4MGYE 1TQMA 4CHUA 3TDZC 3REOA 3LAJA 5KHGA 4U7BA 1CAWA 3SZPA 1NXMA 3M1EA 1YO5C 3C18A 2FXAA 2HYGD 4YSFA 1VR3A 1Z7UA 3WTSC 1UCRA 1S6LA 3E6CC 1C0WA 1NZCA 3EQLF 3F23A 5E1WA 3I58A 4JK1X 3OGJA 4IXAA 4KNYA 2L02A 5HLIA 1TW2A 1LQ1A 1K78A 2PAMA 1ZVFA 3U1DA 1CGPA 2FQ3A 4IRIA 4HAMA 3BP8A 2OU2A 3DQVC 2ZKLA 4HA8A 4S04A 2K7LA 1R1VA 4OIQF 4ORFA 3I4PA 4ONUA 2Z99A 4XFBA 1FYMA 1B6AA 4Y15A 3BJAA 4E2SA 4M9ZA 1NE4A 2IJLA 2XRNA 1CF7B 1XB4A 1UW8A 2Z9OA 2PQQA 2P17A 3HRUA 3D82A 3IBMA 1BI1A 4YNIA 4YIIA 2C6YA 4LGWA 3U11A 1ZGAA 4MNUA 4KU8A 1U5TB 5F6FA 1I6XA 5D5WB 2BV6A 4BHCA 1Z9CA 3RTRA 2QYOA 2IA2A 1R58A 2PYTA 2ISZA 2JRTA 4TLFA 1QBJA 2NS0A 1S3JA 4G6QA 4UVBA 5BPIA 4E70A 4MUVA 1ZLJA 4I01A 1OYYA 4M6YA 3KCCA 1FXZA 4QXKA 4NVPA 2BYVE 1YS6A 3JTGA 2B0LA 4AQ6A 1DPRA 2ETHA 4HBNA 3PQJA 2QBYB 4GXOA 4HN0A 1R1TA 5IT9K 3T0YA 3SXYA 3GFJA 1ONVA 1HW5A 4LMYA 2M1BA 4OINF 2KIUA 3JAMK 3F22A 4I7HA 3S2WA 2DI3A 2QZ8A 2NRAC 2IC1A 1DUXC 4KWLA 4L2NA 3LAPA 3F72A 3H1MA 3L9FA 2O8QA 3U10A 1X8EA 3R4KA 3N97A 3TGNA 3IC7A 4IEOA 4QLCU 5I93A 1ZN2A 2D1HA 1J2XA 1Z6RA 2PHLA 4IF4A 2M8EA 5F64A 5H20A 3TQNA 3EYIA 4HX7A 3CUQC 4Z82A 3C3WA 2NNYA 2DBBA 1RUNA 1YQAA 5E1XA 2EVXA 4MH0E 3WTTC 4RS8A 2WC2A 1TW3A 3GLXA 4KU7A 1IXSB 2LSOA 2XAGA 1DGWA 2XLAA 1ZNPA 2ET1A 4LG0A 2LF7A 1ZG3A 4ENKA 2Z3YA 5J8CA 3BY6A 2EK5A 1Z91A 2PFBA 2A3SA 3ISPA 1CAWB 1UD1A 1P4XA 2XHKA 1XDSA 3WGIA 4BIFA 4A0ZA 4ZZLA 4MGKE 4OMZA 4L18B 3DN7A 5LGNA 3K1PA 3VEPA 3I64A 2IRFG 2L4AA 1DDNA 4YFXF 4KL1A 4R52A 1W7PA 2VC0A 5CLSA 1YFYA 1ZHFA 3BROA 1IN8A 2XASA 4A12A 3FE5A 3V7RA 5E18F 1S7AA 1WWXA 1LB2A 1TQ5A 2K9ZA 3Q9VA 2OBPA 1U8RA 1KU9A 3I0TA 1LJ9A 2F5FA 1EV7A 4XSXF 1S7OA 2P6SA 1QPMA 1YWKA 3T8TA 4HF2A 4O3MA 2EAAA 2OZJA 4ENNA 1K78B 3EBRA 1IW7F 1YFXA 3LAGA 2D1VA 3K1MA 3LZZA 4EJUA 4KUMA 5E8IA 3EETA 5D5UB 3K2ZA 3FM5A 3WE3A 1O7LA 5FLXK 4Q5SF 2KJCA 5KHKA 2GXGA 2PQ8A 5FFXA 5E17F 3PVBB 4ZU4A 1K7AA 2F5CA 4ZYGA 2B5HA 4YARA 4CO8A 1PP8F 4A2UA 1ZZ6A 1DPUA 2K4JA 2IT0A 2XGXA 4FX4A 4E2GA 2DQRA 2H6CA 1QO0D 2YPRA 2VOOA 5JFRA 2ZO4A 3MQ0A 4CDGA 1XE7A 1AOYA 4XFAA 4QGNA 4AVCA 5CVUA 3NSTA 3TO6A 4N0BA 3SMHA 2IXCA 2FMLA 1U5TC 1IUYA 4KIFA 4G9YA 4K8FA 5FPZA 1GQHA 2OZUA 1XMAA 3JAMZ 1R5GA 4I0BA 2HGCA 3HTSB 3CO2A 2YR2A 3C7JA 2Q0AA 5L3CA 4UV8A 1ZZ7A 4OIPF 4ETSA 1FOKA 4XSZF 5D8LB 2EWNA 4UVAA 2Q1ZB 5JVTA 1KU2A 3ZDSA 1LRHA 2BNOA 2RV8A 2O0YA 2FE3A 1SD5A 2FNAA 1AWCA 3FHZA 2W24A 3BPVA 4U0YA 4IEVA 3R0JA 3F21A 1J58A 2LKPA 4IEXA 2NYXA 1OD5A 3S7EA 2DO7A 4WZCA 4Q0SA 4IEQA 4L5IA 2OYZA 3V8LA 5LRRA 1H1IA 2CV6A 1EP0A 3P9IA 3FMSA 5LLQA 4IESA 1KYZA 3OCPA 3HSFA 5CYVA 1O3TA 5H6RA 3DKWA 1SD6A 5AIPA 1HSJA 1L3LA 1ZGJA 1J3QA 5DYMA 1UB9A 2JTVA 2JZYA 4KWJA 5FGMA 4CXFA 3VOEA 1JE8A 5BV6A 2ZBKA 2STWA 5C6CA 3L00A 3GZ6A 3FM3A 4YYOA 2CGPA 4LUMA 2D93A 1DP7P 3EJKA 4KIBA 5D1IA 2GC1A 5JSOA 2KKOA 1X8MA 5HI0A 1IXCA 4A0XA 1KGSA 4EWEA 1R23A 1XD7A 4MQVA 3CL1A 2EFPA 1RGSA 4OIOF 1P4WA 1SD7A 1T98A 3CF6E 4E2QA 4UNOA 1FY7A 4I2OA 2R7DA 4Q4ZF 4P5OA 4PCQA 3ZN1A 4X6RB 1GHCA 2ETEA 5ICCA 4G6DA 2P5VA 4WK8F 5A2QZ 3IL2A 2FF4A 4QM8A 1GXQA 2R7FA 4EJTA 4L0YB 2KJBA 5ED4A 3RJPA 3SHRA 4AIHA 2W57A 5FPXA 1SMYF 4BAYA 3IIAA 1FP1D 3LQRA 3T1BA 1DZRA 4XFCA 5LGUA 5FO5A 2VODA 3MCZA 4YFNF 4NHJA 4WF2A 2ACJA 3O3KA 5FCCA 2D5FA 4BQAA 1LEBA 4O9EA 3QPHA 5LGTA 2O61A 5JI6A 4L5JA 2XROA 1HW2A 4B29A 2COMA 3ZMTA 3KGZA 1ZAOA 5D4SA 4KN7X 4M74A 3H9AA 1RUOA 3QP5A 3DF8A 1I5ZA 4HBLA 3VODA 1FBQA 1J75A 1UPIA 3EYYA 2PG4A 3PFIA 5D5XB 3I7DA 4KYWA 2CYYA 2KRFA 2RKHA 4PJYA 3F8MA 1P2FA 3RZZA 2JT1A 1LR5A 2YSRA 2P7VB 4RB3C 4IEPA 2V9VA 4OIRF 2GWRA 4Y13A 1HKSA 1WGPA 2XL7A 3S7IA 4HQEA 3CJNA 1P4AA 2PHDA 2M45A 3RYPA 1ON1A 3TO7A 3GF2A 1WSUA 3GXOA 1ZG1A 3LA2A 3AAFA 4H7LA 4GYGA 3HUGA 2DU9A 3B02A 1J1LA 3QACA 2EA4A 3LA3A 5ILUA 2OPKA 3FXQA 4Q47A 4QM9A 3BPZA 4IHTA 1EH6A 4RAYA 4XFIA 1B9NA 1XSXA 2PEXA 4MV2A 1HSTA 3ABTA 2DPUA 1Z1DA 2R3SA 1U2WA 2XIGA 4LK0F 3OD0A 4MTDA 1FZPB 1FI2A 1YW9A 2KXLA 4HQMA 1XGNA 5F1RA 2FA5A 5LBQA 4MEXF 1NYWA 5HDKA 3COAC 2FRHA 4IPAA 3Q5FA 3NJZA 1NE6A 3FWEA 1O3SA 1U6GA 3RDIA 1TNSA 4P9UA 1BI0A 2Q4SA 3GFLA 3ERED 2EFQA 2P6TA 3ELNA 4XETA 4ESJA 5HDGA 4BHPA 2W25A 2Q8KA 4UBGA 2EJRA 1VJ2A 1K79A 3HSRA 1TTYA 1IZ1A 5BPXA 3K1NA 2H6BA 2K4BA 2CQKA 1WKMA 2CO5A 3V7CA 2W84A 5E20A 3KP7A 1XSVA 2H27A 2Y48A 1UFMA 5IT3A 2BBYA 5EEHA 1TBXA 1JXSA 2A6EF 1L3JA 3F8FA 2J5OA 2HTJA 2OZ6A 1KQ8A 1Q3EA 2GH2A 1HKTA 4RGRA 1XGOA 4A0YA 5L3FA 1P92A 2F2EA 2RVCA 3SQNA 4HVRA 1BI3A 2VBXA 3USSA 2A61A 3KP4A 5ILSA 3ES4A 5E16A 1XMKA 3DV8A 3TO9A 2OAZA 4QGMA 2H0VA 2QDRA 4A5NA 2GU9A 1RIOH 4GULA 2ZNZA 2QM3A 3J81Z 3BPXA 2RC4A 5CU1A 5BS6A 3TNPB 1BN5A 4HX4A 4HZFA 3HOTA 4BHBA 1FP2A 2A69F 5JR7B 1MJ9A 5I8YA 4UHTA 2WV0A 5FB2A 3ACLA 5JAXA 2PBIA 5K8SA 2GQQA 3V7SA 1L0OC 2UYBA 1LDDA 1JHFA 1JHHA 2PJPA 3VFZA 5CVVA 1H0MA 2OD5A 2CW0F 2IVMA 3ECOA 2ISYA 3HIFA 3ZMZA 2V1XA 4JVAA 3PQKA 5J7MA 3PLQA 1DZTA 1D5VA 1MJAA 5ICFA 2KIMA 3WW1A 3D0JA 2BGCA 5LHHA 1BM9A 5EFUA 5E8GA 1SFNA 3KSCA 4RGSA 4YFKF 1GVJA 4ON0A 4BNCA 1YFWA 3WTXC 3HT2A 2EV6A 1YUDA 2MC3A 2IXKA 3HQXA 1LEAA 4O6JA 5HDNA 2HFHA 1LVAA 1V4RA 2G9WA 1XSDA 2HR3A 4F7ZA 4ZYHA 3SCHA 5H6QA 5I8SA 4WWCA 2CAUA 3ML6A 3KP5A 4ESBA 1XE8A 2JSCA 5BUVA 4CYDA 2XAFA 2QCSB 3E6DA 1X3UA 4EQQA 4XFGA 2DLLA 4OFGA 3CUOA 3E6BA 1GQGA 1FYKA 2EA2A 1FX7A 2WWYA 1IXRC 4MGIE 4KDPA 3LWCA 1KYWA 3FX3A 2E7XA 4XLPF 3GYHX 1PUEE 1LDJA 3TOAA 4EJWA 2UYAA 4LJZF 3KP6A 2P7CB 1J7KA 3ELKA 2QWWA 4LA3A 4NQWA 3M3IA 1O3QA 4WCGA 4RGXA 3C3VA 5JCTA 1SFXA 2O6GE 3IDBB 3P9CA 3E6MA 2VBWA 3U9GA 2MNGA 3MFKA 4EVIA 1TLHB 1SFEA 3EUHA 2HQNA 2PMUA 3I59A 3GWZA
chains in the Genus database with same CATH superfamily
1HX6A 3CLPA 3S1NJ 3CKHA 3OIOA 5CPRB 4RHV1 1BBT1 3MZYA 3U07A 2A73B 2M0CA 1CX4A 3ILNA 3CDLA 5F5AA 3BB6A 3S5AA 3LFUA 4KMFA 1AL23 4AGRA 4JKKA 5D2AA 4L9NA 2ATFA 1NAEA 2WO7A 5F9TA 1UOBA 4HOOA 5DV5A 4EN6B 4OAYA 5GLTA 2JDNA 3N7LA 1WI3A 2IVJA 4LLGF 4XBFA 2VZVA 5T5OA 4CE8A 4H0EA 3BDDA 1Z7LA 1O5UA 4LBOA 3ZPYA 3HHGA 3KETA 2CQXA 1YFHA 3GEZA 3PVOA 1HJGA 3VL8A 4ZYEA 2CAVA 3J7LA 1WCQA 1H8TC 2A5ZA 1WVRA 1GZWA 3ZSKA 2HDCA 3RSJA 5B66C 2JE8A 3ORJA 1PK6B 3PNYA 3F2ZA 1SLTA 2NZ9A 2RGVA 3HTUA 5FO8B 5FPVA 1FLIA 4YZ2A 1RUF1 4WM7B 4G6TB 4DINB 1G3WA 4KN4X 1XCVA 2HWC2 4ASMB 4A7ZA 4EJRA 4HDVA 1YRNA 1N78A 1IS3A 2DFHA 2RQQA 4PIXA 5JSPA 3KCXA 4AC0A 2ADEA 3FHQA 4UFIA 5AC91 5BOXA 3OR2C 2FDHA 4BH9A 5DD4A 5F2SA 1TG7A 4Q0QA 1GP4A 1G3YA 2EZKA 1W6PB 2ME0A 2B8MA 4MVTA 3BKZA 1W9TA 5FYMA 1OPOA 4P9WA 4FTBA 4X8NA 2H1LA 2ZHNA 3WE2A 3QBQA 1X7NA 2HTSA 3DBRB 4FAGA 2HWB3 3LFKA 4KITB 1XNBA 1YQ6A 1XN7A 2A7AA 3JCUC 3S1RJ 2RE9A 4PIZA 1OD3A 2M7AA 4NBQA 2Y0MA 3WU0A 3MPPG 1WMXA 3ROUA 1JUMA 4YVWA 4EGYA 1LGCA 3LSMA 2DXIA 2F6BA 2ZEXA 1O4YA 2V9PA 3FK7A 4EWDA 2RHPA 1LDKB 3UV9A 1Z77A 2Q1MA 2XVCA 3IWZA 5L3EA 5FR3A 1IG0A 4Y7NJ 1UAIA 5FDBA 4AEDB 1F5FA 3OV8A 3PJRA 3BQZA 4XFHA 3RWNA 1GUUA 4HYEA 1HXS2 1XNTA 2UWAA 1OYIA 4R79A 1UHWA 3AVRA 2DPDA 3J7NA 1W6MA 4PSXA 3W6KB 1L7QA 2GNMA 3L2CA 2VOXA 1IG3A 3G2BA 3UGHA 1UKGA 2YU2A 2CDPA 1OFSA 1RINA 3GYDA 1JYWA 1ONAA 1Q43A 4BY1J 2WRAA 2DA7A 2MEV3 2ESHA 2WFF1 1U5TA 4JBAA 2EXHA 1S2BA 4CRQA 1OCZH 3I59B 4LBQA 1OOPC 1FYLA 1YHQI 1L7LA 3S1MJ 1UZYA 4Z1VA 3VN4A 1UU4A 1X4OA 3D3AA 5IPAA 1BI2A 4LT5A 3FHIB 4FFFA 4QU1A 3CJIA 2X1CA 1R1ZA 3UJQA 2ET7A 2H0BA 1M4WA 4YW7A 2NMNA 5FKLA 5LW9A 1ETOA 4UW4A 5DAWA 1ZBA2 4DY5A 1OPCA 4W8JA 1SDDB 3DXJF 3QOEA 3MV01 3PMSA 4M71A 5EGOA 1MZBA 3N9OA 1ACCA 2WSUA 2ZGRA 4XRSA 3GGLA 3HT1A 1K5MB 1YTYA 3U4XA 2XL9A 3QU3A 1BZWA 1W05A 1AR93 2ZJQF 3WDTA 5KXDA 3C7HA 3GCWA 2BBVA 1XQNA 1SEUA 1OLQA 5HLHA 1C1LA 1AJOA 1DP3A 3E97A 3KLOA 3ILFA 3HC7A 1YLFA 3JSOA 2CU7A 4AW7A 2KDOA 3C7FA 3SH3A 2VE9A 2GMMA 2JG9C 1QJX1 1D1CA 1VTNC 3IDEA 1EKEA 2NM1A 1QGLA 2IXLA 3CBNA 1LOFA 2GC2A 2Z16A 3MV11 5F2WA 4FFGA 2XAJA 1GR3A 2WV1A 4RN5A 1PIV3 4LO8A 3VYTB 2QA4I 2VW2A 5FZIA 5LA9A 1T0FA 4IHSA 1OYWA 4RBOA 4UI9L 2QLZA 3OY9A 5IP6A 4A3CJ 2GALA 2HYKA 2CU5A 2GC3A 5CIRA 2CH0A 4A5MA 2HQRA 3U1KA 4IJAA 1O6UA 5DUKA 5IK4A 5J6XA 4PDKA 2L2OA 4LE4A 1US3A 4G12A 2LLKA 4CVUA 3WU1B 5FBZA 1MSFC 3U1XA 4U88A 2HWE3 3OYFA 4IO9F 4Y5Z0 5FZOA 1ENRA 2BE5F 5HCHA 3CEWA 1WA4A 3F6OA 1XNDA 2W94A 4I0AA 4JGYC 2XHNA 5DUUA 3O2PE 3HNYM 4MGZE 3BOQA 1A34A 2EZHA 2QKLB 2P3YA 2Q2EA 4Y5SA 2XG3A 3OTFA 1HB1A 3KB5A 1D0GA 2VT3A 5J1UA 4N53B 4QWNA 4ASLA 3VD9A 3KYDB 3DL3A 4HRIA 1LGNA 3C2BA 1Y0UA 1TME3 3S14J 1HC8A 3P5JA 3N7MA 2JX9A 4WVMB 1IRGA 3SCGA 4Z92B 1Q8PA 4BDYA 2AS5F 1RUI1 2ORXA 5KHHA 1LOAA 3LSJA 3W20A 4G4FA 4W4ZA 2PHRA 2OTLI 4META 2DCEA 3BCWA 1MW7A 1V3FA 1WH7A 2AC1A 4CDQC 4MTEA 1J9IA 4NB5A 1VQPI 5K7HA 5FKBA 4AIJA 1FNNA 2M4GA 2VJXA 1H2NA 2DTYA 3HOUJ 2XVGA 1JBCA 1AR83 4KWUA 3Q0VA 1QXRA 1S0CA 3VZJA 3TEYA 2D7FA 3KV5A 3L2HA 2GAUA 4KT5C 1RUG1 2IVIB 4JC1A 1DU0A 3WDXA 2E33A 4HKWA 4NHXA 2EV5A 2E6VA 3KGLA 2QQJA 3C8XA 3L2YA 3E1F1 4ZZDA 4A3LJ 3JU9A 1SFYA 3LL7A 3G71I 2UY8A 1ON2A 1ASJ2 2PMZN 5HS9A 4BACA 2ZX2A 3D8CA 1J3RA 2PTMA 4PJNA 3VBHB 4GALA 5FZFA 3U0ZA 4JX6A 2B39A 1VBA3 1REDA 4AOCA 3SFZA 2KPMA 3CO6C 4I99C 2R7EB 2L0KA 1OVSA 4B4PA 4C2UA 1U0AA 1XPWA 2WNVC 1FIAA 4CGZA 3OOUA 3R6SA 2IA0A 3H9QA 3ZYBA 3H3UA 1DLCA 1OLMA 1S8NA 2AEZA 2BNMA 2G1MA 2R16A 3HBLA 4FX0A 1B09A 5C8CA 2FDJA 2G9FA 4JKLA 4N43A 3AKPA 4RA2A 1E5SA 3F9KA 1GUIA 3LWFA 3RZDJ 4XQFA 4PGHA 3ZMSA 3GW2A 5BNOA 3KLNA 1MIJA 3ZPLA 5FYCA 2MD5A 2WBMA 1SMVA 1W6NA 1D0HA 3LSRA 1FTTA 3O14A 3PIGA 3ZXDA 3JR9A 1MJBA 3O1UA 4BEHA 3A1YA 2R0FA 5GALA 3UKVA 3FMQA 1BC7C 2EIDA 3WGHA 1RZ4A 4U0VA 3H5AA 3AG3H 3J7YJ 5JMCA 3UNPA 3J26N 2XKPA 3OWTA 1XTAA 4NHYA 1MNMC 4GB32 1IDZA 2DF7A 3HGGA 1FJLA 5DDGA 2OQRA 5FAXA 2QNKA 2ZXWH 3CLOA 3LE0A 1GWKA 3QD6A 3E1SA 3O1MA 2CSOA 4MGTA 3JBG2 1VQNI 4F55A 2MD0A 2DAOA 1YHFA 5FKNA 4L8QA 2QQBA 1WJEA 4A7KA 2C0ZA 5CG9A 3ABMH 4BK4A 2ARBA 4AD9A 4LTAA 1EPZA 1GV5A 2EALA 1W06A 2CS3A 1X1DA 3OGSA 3B93A 4LUKA 1Z7S1 4OMDA 1Q1HA 2OUJA 3ULQB 3LD8A 3WQBA 2VN2A 5GZDA 1JYTA 2ID3A 4ES8A 4P9XA 4XBQA 2G19A 1V6OA 1RC6A 4BQXA 5FOJB 4M6VA 1V0AA 2O9LA 2V1DA 1UO9A 3PHMA 3GZTB 1Y9QA 5A6QA 2TBVA 1F5JA 4B09A 3RWKX 1SG3A 2WNOA 2PHUA 4FQZA 2E53A 1RHI1 2JDKA 2WNUB 2FHRA 3K48A 3MDPA 3EO6A 5C3OA 4AL9A 2PLV1 3B73A 5IOZA 2N7GA 3T4VA 2VNVA 5H9PA 3TBIA 1WLTA 2L9NA 2DFCA 3KP2A 2QQLA 3A21A 4EYUA 1WCDJ 4EM2A 2PJRB 1HN1A 2C24A 1BJZA 3THTA 1RRJA 1F9KA 4K9SA 3VBSB 3V0BA 3K9TA 5DM6F 2VBDA 3R0RA 1TWCJ 3WDWA 3OB8A 2OXBA 2XWBB 3M3EA 3QYBA 4NOTA 1EUTA 2OW4A 3M07A 3ZFFA 5CKTA 4XJWA 2XBO2 3WTYC 2I07B 5FZHA 3H3ZA 4DRVA 1Z21A 1EAH2 3AKTA 3HMYA 3K77A 4RGGA 1A8DA 4G7HF 4OMYA 1JOPA 3M8FA 2W39A 4XF1A 3R4SA 2FBIA 3LDKA 4OOIA 4TSVA 2CTVA 3GBGA 1S0FA 2R5YB 1S5LC 4NIDA 2XAQA 3SEEA 1O4TA 4FFHA 4A3FJ 4AUXA 4AXOA 5FMBA 3GFIA 2DA4A 2P4WA 2BOIA 4QXHA 4XJ8A 4LA2A 1ZARA 2ZGOA 4S05A 3J7AO 5E89A 4Q4W1 3OYHA 5FMCA 1ULGA 2YC2A 1JJ6C 1B35C 3HRSA 3NVCA 1LEMA 3U4SA 4XNFA 4D7SA 4XIOA 4UUSA 1JHNA 4XQWA 1OCTC 1NA1A 4NWWA 4PJMA 3PNAA 1FEXA 4LHNA 1QJU2 1AR92 5I0DA 3DYOA 2P5LC 4BM8A 3N36A 1LKNA 1CZVA 2Y60A 1RC9A 4YW5A 3CMAI 4CXYA 2OQGA 4BE1A 4XN0A 1F4HA 4P9FA 5H9QA 2XKOA 2L5QA 1YJWI 4LB6B 2QSHX 1LOCA 3IDAA 3BIEA 1VQOI 1IPKA 3CZUA 5AVPA 3WTUC 1LKXA 3NKTA 3DTEA 2FMYA 3JCIA 3KIOA 2FBKA 1GNHA 5FLHA 4LK1F 3I4IA 1BBT3 2DYRH 3G73A 2DK5A 1WW4A 1Y56A 4GCVA 5A3WA 4C30A 2VZOA 4EZHA 3Q9SA 2JDAA 4Q0PA 4EGZA 4RR3B 1NLQA 2Y6LA 3ZYHA 2KA3A 1PIV2 2VR4A 4BJTA 3OD4A 1MZ6A 1V6IA 2V6CA 4Q4X2 3ZMUA 1D2SA 1T33A 2ADUA 1IN5A 2LS6A 1CX1A 3G7DA 3KMHA 3F6VA 2OX0A 1VQ5I 1YYNA 4IV1B 2QBYA 5JIAA 1SAXA 2LVSA 1TC3C 4CXWA 3WF1A 1T2KA 2GP3A 3DU5A 5KK1A 2MGQA 1Y3TA 1W5SA 4JTOA 3ACIA 4K1YA 1W2OA 5FLJA 2RDPA 1FAYA 4Y24A 4FT8A 2B4KA 3N7JA 1OI6A 2ECCA 1SMTA 5T52A 3VBRB 4XZPA 1MVEA 4Q4V2 5J36A 1D0YA 2LC2A 2XH6A 3O1RA 3U75A 3CUQB 4QX5A 1RUF3 1WCKA 3POIA 2DA1A 1EH8A 3O1PA 4NUBA 5CBLA 4EWAA 4KH9A 3VDDC 1CR7A 1Z6TA 5AC93 1DQ1A 4M4RA 3KZYA 4NPMA 4A6DA 1QQIA 2HI3A 1IKPA 4CHUA 4MFEA 1WCUA 1RR8C 2ECBA 3REOA 2MABA 3LAJA 3SZPA 1SAUA 2VJ4A 3LFIA 3C18A 4YSFA 3HGYA 1UU6A 4K1ZA 2QQVA 1C0WA 4B48A 5KXBA 1MVQA 3EQLF 5IJRA 4I6ZA 1W2AX 1QQP2 4YVWB 5BYNA 5E1WA 2EXIA 4JK1X 3VD4A 4NWVA 3W2VA 1DBNA 2BOJA 5GKAC 1IS6A 5HLIA 1GVDA 4XK4A 5IUQA 2QCOA 4CDUA 1LE8B 3LEMA 4Z2AA 1ZVFA 3U1DA 3GNEA 5BNPA 1CGPA 4MLOA 4Q4Y1 3BP8A 3RRDA 2DV9A 1SFPA 4DRRA 2D6MA 3G6JB 3BCAA 4AQTA 3J8F2 1R1VA 1AYM1 2LD5A 1S72I 2VUMJ 4XFBA 3F95A 3HAGA 4Y15A 1K45A 4M9ZA 1NE4A 1QOSA 3HPGA 5FUNA 2IJLA 4LHKA 3WNKA 3LFMA 4A44A 2NYYA 4C3JJ 4CCCA 2AXTC 2DJIA 1ETWA 5A7PA 2WDBA 4XM3A 3WG7H 1ENQA 2Z5WA 4FCYA 1ZGAA 1H89C 2R92J 2VVFA 4BQ1A 1AYN1 4HG6B 1BMV1 3NV4A 1U5TB 4D7NA 2WFF3 3CD6I 1IPSA 1NLRA 5D5WB 1N3OA 1VQLI 4BHCA 4X6AJ 1Z9CA 1R082 5IVBA 4KGQA 3TMOA 2IA2A 2PYTA 2JRTA 3KV6A 2KP6A 3LPGA 2AYHA 2DN0A 1WBFA 3WSOA 4GH4C 1VLNA 4E70A 4MUVA 2R0QC 4I01A 3MW2A 1VQ7I 4M3BA 1FXZA 3VYSB 3PDQA 5FPAA 5CFDA 2WZR1 3JTGA 4QDQA 1PMHX 2RDRA 1VQ8I 4AQ6A 1DPRA 5CB7A 5IHRA 4HBNA 2H8RA 1VB2A 2GBYA 4AAXA 3GTJJ 2IBDA 3TOJA 4RYDA 4I3GA 2VZRA 5IT9K 2R5ZA 1HW5A 3RGBA 2QQOA 1RUC3 3JAMK 1Z0XA 3S2WA 2DU1A 4NIIA 2DI3A 3DBLB 2IC1A 3PJQA 4UW3A 4HPKA 4XL9A 4IGQA 2W1UA 3EUAA 2E34A 5I93A 4A4AA 2NN8A 4GWMA 3S8PA 3WHUA 1Z6RA 5E6HA 4IF4A 3EYIA 4HX7A 4XUOA 1T6BX 3C3WA 1UMHA 1D7PM 1A3KA 1JUIA 2AGSA 2BZTA 1J1TA 3S1QJ 2PHFA 4MH0E 3BTAA 1IV8A 3WOGA 1AZDA 3ZSJA 1OA3A 2HWD2 1VRH3 2RS11 1SHWB 3LOCA 2LSOA 4DEQA 1S55A 4LG0A 2LF7A 1ZG3A 1Z91A 1OA2A 2A3SA 1CAWB 3WGIA 3RI9A 4LO4B 1OOPB 4ZZLA 4AYUA 4JX4A 4L18B 3K1PA 1GYKA 2OPTA 2OS2A 1WMDA 5GZCA 3VZOA 2K9MA 4R52A 3RCOA 1YFYA 1G9CA 2RM22 3BR6A 1ND2C 5JR2A 1ZHFA 3FE5A 4E6KG 1S7AA 3MO4A 4ISQA 3OIPA 1VPHA 2YGLA 5FY0A 1CESA 5CFCC 1S7OA 2P6SA 1OISA 1B8IA 4FOWA 3VBUA 4HF2A 1K78B 5F3CA 3LIGA 5FZ0A 2ID4A 1IW7F 3OY8B 1YFXA 3K1MA 1GWLA 3MUY1 2WLPA 3ENRA 3EETA 4DNYA 5FLXK 4Q5SF 2HVRA 2KJCA 4CPBA 3ZYGA 5FFXA 2QDNA 4ZU4A 4IE0A 1RUI3 4RL7A 2B5HA 4YARA 3ZFGC 5DN2A 4A2UA 2TRTA 3BR2A 2DDUA 1DPUA 4QPYA 1UF2C 5DZFA 2FJ1A 5F1JA 2XWJB 2PELA 4L9BA 4FX4A 2CW7A 4QPOA 5JFRA 2Z42A 4KJZA 4CDGA 4UW6A 2J22A 1S2EA 2BFUS 2WO2A 1AKHA 3KV9A 4CEYB 3GALA 4NRMA 4K8FA 2W1QA 4URTA 3H0OA 5FPZA 3P1IA 4HEA2 1RUG3 3JAMZ 2FCTA 2Q8EA 4GJZA 2BXZA 4I0BA 5LASA 1LHWA 3HTSB 3MFCA 4QU2A 4UFLA 4GZ9A 2ICWG 1FPN2 3W21A 3VL9A 4BQWA 4ETSA 2EH3A 4PK4A 2JA6J 5JVTA 2BTVC 2VKEA 3VZMA 2FE3A 4DUWA 4CEWC 2FNAA 4BBRJ 4D7MA 2P2KA 5FY9A 2BGOA 1J58A 4QPGC 1OD5A 5JI7A 1AF9A 4RHV2 4Q0SA 4JGYB 2CV6A 1V55H 3P9IA 4KISA 4IESA 3FKIJ 3S30A 3OBZA 2VQGA 3BTLA 2BU9A 1UZVA 1IRZA 1YXWA 5BNOB 2Y26A 3TYJA 1I50J 5DYMA 5FGMA 3GTMJ 1H8TA 4DYCA 1LFBA 4XPVA 5C6CA 5FOBB 3L00A 5JZGC 4P9YA 5A6XA 3EJKA 1YQ2A 1LUJB 3A23A 1X8MA 1DQ6A 3CL1A 5FY5A 3ZOBA 5KAIC 5GADJ 1T98A 3CF6E 2JVGA 4UNOA 5B1BH 1LECA 3DPRA 3VZKA 4X6RB 1S4CA 1GHCA 4OUEA 2ETEA 5ICCA 1XYPA 2P5VA 2R7ZJ 2HPIA 1LAJA 1LTEA 4WK8F 2R072 4QM8A 1GXQA 1SPPB 5LA1A 1RUF2 4EJTA 1LPQA 2CWSA 5ED4A 5FPXA 4OI2A 3I2IA 3IIAA 1JYXA 5EG0B 1IQAA 1LJ7A 2WNEA 2QQ8A 4JZRA 5FMOS 3AXEA 1AR63 3POBA 4GA9A 5FO5A 4XMIA 1HA8A 4YFNF 4NHJA 2ACJA 4YM3A 1I6HJ 5FCCA 4AHYA 5FKOA 2WZPP 1AL0G 2YUEA 5F3IA 2RMU1 1X2MA 2X10A 2O61A 5HCBA 1EJ9A 4L5JA 3VKNA 5F37A 2UWCA 4IGOA 2E63A 1WWYA 1V9U2 4KN7X 5FY7A 2WO3A 4M74A 2E5NA 3H9AA 3QP5A 5LBEA 3A0KA 4QDRA 2ZB9A 2PG4A 2AREA 2RKHA 5DZGA 4AK3A 3RZZA 1RHI3 1MPXA 1NTCA 4XICA 1A35A 1WD4A 3VD7A 2WT2A 4OIRF 2PLV3 2GWRA 3M1HA 2XL7A 1CQ9A 1WJCA 3WDYA 3CJNA 3WUDA 2DOEA 4NHLA 5T54A 1ON1A 5IYYA 2QF7A 1ZG1A 2D44A 3HUGA 1U5YA 1GV9A 1ZBE1 4YPJA 2DU9A 1J1LA 1E5RA 3V0BB 3ZOIA 2X1EA 2OPKA 4KG0A 2V5YA 2RAEA 5FLMJ 1BEV1 3AZXA 3VB9A 2RV9A 1QU0A 1KGYA 2HOSA 2J1UA 2GDFA 4XFIA 3U21A 2QTWB 3NV1A 4MV2A 2DPUA 1Z1DA 1BYHA 1ULOA 3LSHA 1PVC1 3OD0A 1FZPB 3VUOA 1FI2A 2A6WA 2VCMA 1WZXA 5LBQA 4MEXF 4B4QA 3COAC 2X8KA 4XUNA 3PO2J 2EPFA 1K5JA 1O8PA 3KYLA 1O3SA 1PZ7A 1U6GA 3RDIA 1NY71 5FMOL 2Q4SA 3MIHA 3GFLA 1UN1A 3ERED 2P6TA 3ZQHA 1RUJ1 4XETA 1KS4A 3R4DB 4IHYA 2W25A 1TZOA 1LHVA 1VJ2A 4TTGA 2R061 2DUPA 1TTYA 3G1MA 4YM2A 4Q4W3 5L9VA 2WB1N 4RMNA 1OC1A 4CCLA 4NIGA 1RKTA 4A93J 2H27A 2Y48A 1CIYA 2R7WA 4V2GA 3I3LA 3MHZA 3FBNB 2O7OA 2A6EF 1Y1WJ 1JYNA 3HJRA 2HWF1 4BBSJ 5FYTA 2J5OA 1YI7A 5A3OA 1UQXA 2VMFA 4CP9A 2KD7A 2GH2A 1HKTA 2LP0A 3TEXA 2JG9A 3KLSA 3VD3A 3P5BA 1P92A 1PO11 1Y6IA 2W92A 5K0UC 3ZQFA 3SQNA 3KQ4B 4MO7A 2YDEA 1XMKA 1JTZX 3DV8A 2OAZA 4PI0A 2DU0A 3HVDA 2QM3A 3J81Z 3QLQA 5FYZA 1C4RA 1QJX2 4DOUA 4ET7A 2BVMA 5JR7B 1DQUA 3PVEA 5F5QA 2GQQA 3GCMA 3V7SA 1NCQC 4N7IA 4FTHA 3KHCA 1T2XA 2JA5J 3BQYA 3ECOA 4J01A 5FFOC 2GXAA 3GTGJ 4FPLA 1OURA 5J7MA 2KIMA 3ERMA 5A1LA 2VOTA 3KSCA 2VCAA 5IVVA 4XRSG 2K46A 2J1EA 3PUBA 2DFEA 2DOAA 3L2QA 2D6KA 1URXA 4J25A 5IATA 1HRV1 1LEAA 3UR3C 5HDNA 1GP6A 1LVAA 1XSDA 2HR3A 5FXXA 1FOWA 4GDFA 1DGWX 2XGDA 4XKCA 4BQ4A 3MLLA 1TWHJ 2EIGA 3KP5A 4ESBA 3C7OA 2L7ZA 2VTXJ 2VGDA 2WY8Q 3VDAA 2CGNA 4XFGA 2DLLA 3VBOA 5IY5H 3HOZJ 3M7AA 1GQGA 1V5EA 3VBFC 2BDRA 3KF3A 1N25A 2E26A 1IXRC 2CY6A 4MGIE 3LWCA 4XLPF 1TMF2 1PUEE 3WQ7A 1JZ2A 1LDJA 4P9LA 3ELKA 3W9AA 3S16J 5C71A 4A3MJ 3M3IA 1WJDA 4XDPA 5F3EA 3PU3A 4V19K 1DU6A 1NT0A 3HOBA 3Q9OA 1XNKA 3WY6A 1EUUA 4C0HA 1H6YA 1FIPA 1SFEA 2PMUA 5DUWA 1KD7A 4M3DA 4M3CB 1VBB1 2D6NA 2XPJA 1T6SA 4BXUA 1S0GA 4HK8A 1REPC 4W6WA 1O59A 4C2TA 2Z69A 4MQ9F 3NNFA 4HK9A 3SCFA 2V09A 4PHZA 4ZKTB 3O8HA 2PA7A 4PT6A 4ATEA 3WP3A 3DFGA 2I74A 4CDUB 4RGUA 2X05A 4AAPA 3GZEA 1CAVA 2XB6C 4D9JA 1DCSA 5BNPB 1ZA7A 4AVVA 5KCMA 3I4MJ 4L5EA 3MKLA 2WAAA 4Q4Y3 4QX7A 4OUSA 5HLGA 1W6OB 3T0BA 2A07F 1AYM3 5KWRA 3SZTA 1YJKA 3J4UH 2DVFA 4JGZC 2XJRA 2F5EA 2GSYA 1H4HA 3AZYA 3WD5A 3IM0A 2WQ4A 1T95A 1KQ0A 3S5QA 3D6EA 1D8JA 1Y7BA 1WHUA 1WD3A 1QWRA 3LDRA 3AYEA 4OI0A 1COV1 5C9AC 1W4MA 1AYN3 3VB2A 3OPWA 2YUSA 3OG2A 3J7HA 5FQ0A 5JLWA 2R041 3HN1A 2D98A 1R71A 1RI7A 1QA6A 4MG2A 1XMXA 1REEA 3PUSA 2EA7A 1YFUA 1GT0C 4FOQA 3CZ6A 4HW0A 1A8MA 2H09A 4YVSB 1UY0A 4YW2A 1BCXA 3ZMVA 4E7HA 1HLCA 2P6CA 4TZDA 2VZTA 4JDMA 3CCSI 2WZR3 2WYSA 1PM4A 2VQTA 1XGSA 3NW4A 2CFOA 1K12A 3MVPA 4RS5B 3WG9A 1GMMA 4OCTA 5EYYA 2EXJA 2R5ZB 1TQIA 3BTJA 1HXDA 3I9V2 5HPOA 2KZVA 5IK5A 2WFPA 4UUVA 2A05A 3IKWA 4B43A 1RUH2 3IMMA 1NZIA 5FKCA 2VLAA 4HPKB 2WTEA 4DIQA 4DXZA 1F2NA 3POJA 2XF5A 4PBPA 3W6VA 4HSJA 4DS0A 1FNYA 6PAXA 2EFNA 2V73A 4Z07A 1HB3A 1RUD2 4FTSA 4EM1A 1H1MA 3H50A 5A3NA 4L9JA 5I0TA 5M5WJ 2VMIA 1S0EA 5DG2A 1Z7S2 1H88C 4RB0A 3QAHA 4QHOA 1OFCX 1RXFA 3FZVA 2GLOA 3PUHA 5CVRA 2W48A 2W82A 2EXKA 1UY4A 1T39A 2LFBA 4P08A 4XEZA 1BOAA 2LR8A 5J40A 1JUSA 2FD8A 4LULA 2NS8A 1MDMA 5L9RA 3W5NA 1F35A 2F5DA 4YFWA 2RS13 2GOXB 3AG2H 4LG0B 2XJTA 4WVZA 5L7OC 4L9VA 5FTTC 2DCTA 2DDAA 4S0HB 2ZMKA 3ON7A 1RHI2 3DPTA 3T2OA 3NARA 4II3A 4B3AA 3CMEI 2HKOA 5EJ1B 3IAQA 2ESNA 4RGKA 5EP9A 2X48A 4HV5A 4CDWC 1QGPA 2HYFA 2DTRA 4I98B 3B3QE 3H8RA 1ZZCA 1W0OA 1FPQA 5JPMB 2YBKA 3QQAA 2GA2A 5FZBA 2K2SA 1XC6A 4ZU5A 4GH4B 3WW3A 3J80Z 3J9SA 5ACA1 5J96B 3L7WA 3FFQA 1MKMA 3M3OA 3A4CA 5IVEA 4EMSA 4W97A 3FN9A 3ZXEA 4UF0A 2FX0A 4D69A 5EDNA 3LQQA 3SHFA 4KFCA 2VKHA 4AVAA 1PX4A 4RSUA 3H5NA 1MS1A 1W03A 5A3TA 4FE7A 3FMRA 4BLJA 3DCQA 1VBD1 1M06G 1R36A 3WNLA 3CTAA 4WVVA 2B9VA 1ZRDA 2FBHA 2BVVA 5BXXA 2CFXA 3WHBA 4G8XA 4AZZA 5D8AC 2X53S 5EIYB 1ZR2A 5C5TA 1PK6C 4EQVA 1AU7A 4R8HA 3GBWA 3WW4A 3E3VA 1SVOA 5FZLA 4ES9A 2JKXA 4Q4W2 4MGQA 2PMHA 4RB1A 2BY0A 2PHTA 4M3FA 4JTNA 5EHDA 5FLIA 1UY3A 2L7KA 2YBSA 5J48A 1DHKB 2VPLA 2UURA 3W59A 5TSWA 4A3DJ 5DUIA 3A4UA 1AXZA 2AEYA 2VL4A 3T08A 1AXKA 3AP9A 1VZ0A 4A6EA 1U0JA 2ZAAA 4O5VA 1F4AA 2C26A 1MQTC 3N9LA 2P5KA 4XIDA 3SXWA 1VBC2 1A04A 1KFXL 3UKGA 4LBLA 5AONA 3R61A 2D6OX 5KXEA 1OUSA 4LIVA 4XONA 5F0CA 4W1UA 4PJ0C 3I3QA 2CWMA 5CVJA 5K7ZA 1BJAA 2Q30A 4M3CF 3CP2A 2PAKA 4JAAA 5HLTA 4XMYA 3F8NA 1W7PD 3HKZA 3S2DJ 1TNFA 3RVHA 4CUCA 1N1SA 3EHKA 3ACFA 5F0FA 1O4ZA 3KZZA 4OQ9A 2ID6A 1HRI1 3HRMA 1A36A 1OCCH 3IWFA 3C1DA 4AEDC 4WXDA 3E7LA 4A3EJ 2EZIA 2JG8C 4LG3A 5A3PA 3CDIA 1VBE1 2IFRA 3S3OA 4YZ4A 1W99A 4QT6A 5C3RA 1UCXA 3U2RA 3VZLA 3MMYB 3KVBA 1JUHA 4QPIA 3OPZA 4L0ZB 5FJHA 4G94A 1RVF2 5FZ9A 4FAHA 1X3WB 1JKRC 2WYFA 3IRRA 2WKKA 3ZYRA 1A6IA 5CISA 3GO5A 4KQ7A 3IT8A 4TV7A 3S32A 2XJQA 2ZHLA 4LB5A 3V0AA 4PUSA 3N9NA 1UYPA 3J7MA 4XIKA 3VDDA 2X5IA 2OUHA 3KCYA 1HJFA 5C3QA 2A6TA 3BODA 1QHGA 4AGGA 2BW3A 2UY9A 2CQQA 1R00A 2R4GA 2B9UA 3BWGA 3RKWA 3DEUA 1X9TA 4NN0A 3RI4A 3IV5A 4M0NA 4IQJA 2MHFA 3JD71 1UIJA 4AR2A 1R5ID 2W85A 2ZMLA 1RUE3 5J3UA 4BKXA 2HS5A 3AX4A 2Y33A 4XF3A 1KQ9A 2I45A 4DYQA 4ENJA 5IVFA 1OH4A 3JTHA 1FBUA 2VT2A 1SANA 1F36A 1PUFB 4JKMA 2PAEA 3ESWB 5C4WB 4B8XA 4IKFA 3X2QH 4CP2A 4E27A 3QWLA 2VUAA 4UV9A 4QSHA 4QPGB 1W5TA 1K5MC 3T30A 3GZAA 2J5PA 3WG4A 3HG9A 1ZQ3P 4WBBA 2MH9A 1ZRFA 5M0TA 2VE8A 5L9BA 1DG6A 5B5EC 4MEYF 1H8VA 3A0HC 4W50A 1UELB 2ZMEA 4KWKA 4I3PA 2NOGA 4CCEA 1HV1A 4AI2A 1FSEA 2ZXIA 1X19A 4Q4Y2 5DPNA 5F39A 1ENHA 1Y9MA 1Z0HA 1ZBE3 2DA6A 5A7NA 2UXNA 3I2DA 1LENA 1R4NB 5GP9A 2TEPA 1BEV3 3QPSA 5H9SA 4D5CA 2WL1A 2NVXJ 1OLME 2VU9A 4IX7A 3WGGA 2ELKA 5D8KB 2JPCA 3AL0C 2E7WA 2CV1A 1BW5A 1PVC3 3KFWX 1IG7A 5IFTA 2BJSA 2JIGA 2RNJA 3VWBA 1CAXA 4XUPA 2MEV1 3QOPA 3RSNA 1BMV2 3UT0A 3KEQA 1LNWA 2H8WA 1OQDA 3PUQA 4YG3A 5KC5A 5CEHA 3B9IA 1RUJ3 4DNCA 3DXUA 1GNZA 4RM3A 3WNPA 3EMRA 4IZZA 4XOTA 2R063 1RTVA 5T3NA 3V8KA 2VXDA 1CAUA 4HSLA 2DMQA 1ZYRF 3M9AA 1U12A 1EV11 1ODDA 2XB0X 2PHXA 1H9GA 2KT0A 3AJYA 1QVUA 1DLLA 1IN4A 4N53C 1D4M3 1TNTA 4RAFA 2VOPA 2HWF3 1S29A 1R1A1 5DXDA 4Y17A 1E3PA 2W2IA 1GV2A 2EV0A 1JTYA 1PGL1 4E4SA 5LA0A 4RB2C 4K20A 2A70A 1Q8VA 4EN8B 2XV4S 3CF2A 1PO13 2JJ6A 4RQPA 4ZJZA 5K7PA 4HLXA 2ENRA 5TGTA 3GDBA 1QXJA 5J8FA 3NO8A 3FL7A 4ZXKA 5K5OA 5DCMB 4EJVA 3S3NA 3GHMA 1QH7A 3HHHA 1J59A 4G7ZF 3IAS2 4Q0VA 2QKDA 1JGSA 3DU6A 1FT9A 4IE6A 2CGOA 5FZCA 1TP4A 2YYOA 4ZDPA 3URFA 2GC0A 2LF8A 4MGRA 4LLLA 4YW6A 4BS9A 4B8EA 1PP7U 4PLNA 4AFAA 4HVQA 3VBHC 2Q5TA 2QZ3A 2LRDA 1ND2A 2ZXQA 2RS31 1HN0A 2DODA 1YO8A 4I76A 2LH9A 1N3PA 1ENSA 2HWE1 2YGMA 4KIGA 4QAWA 3JW4A 1TWGJ 1SQ4A 4TLGA 2CV0A 1IPJA 2LRPA 3CCLI 3BZCA 1I1EA 1BR4A 4NHKA 2MPFA 1XNAA 4Q29A 1YIFA 2K3FA 1OT5A 3VBOB 4YEJA 3CP8A 4CCJA 2VBZA 3ZFGA 5LBBA 2Y8KA 4BMEA 1Q1VA 2UZKA 4NIHA 1NXD1 1H9TA 1TME1 2K0GA 3K4ZA 2OPWA 3BTCA 3ASIA 3SDGA 2VZ3A 1UX7A 4IVNA 1Z3XA 3GVAA 4PZJA 2RS51 1XXNA 2DVGA 2V1UA 1YNAA 3OYCA 1TQPA 1C8NA 1H8AC 1LFUP 4KICA 3CJQB 4I02A 4EROA 2W91A 1YIOA 2QUFA 4BK5A 3QU6A 1A5JA 4IV3B 2UU8A 4O9GA 1JYVA 3K4LA 3B69A 3GTOJ 1TWFJ 1JUPA 3TW6A 5FREA 3WODF 4BLIA 2STTA 3BJOA 2HEYF 1O57A 2HEOA 1NCQB 2W87A 1ND3A 1G9FA 1MEC1 1CAVB 5F3GA 5F27A 4CEWA 3FBMA 1PO21 5A33A 3UNGC 2K5CA 1Q8SA 4WVWA 3ZQ7A 5D6FA 2NOJB 1QPIA 3WG2A 1IQDC 3NV3A 3WG1A 2HYJA 2VNGA 4HONA 5BPDA 1VBA1 5JOZA 3RIRA 3SQOA 5T5LA 3PNTA 4LD5A 4LKFA 4HT1T 1VP6A 3H35A 3ZMOA 3ZDVA 1CVNA 1GQPA 3HOWJ 1FBSA 3RG0A 4XW3A 3CMMA 1TWAJ 3NAPC 3USUA 1HDDC 4UXAA 1STZA 2DQLA 3JZVA 4P9GA 1COV3 2VPVA 2K9SA 3ZN5A 1JH5A 4M3EA 5ICGA 4XR6A 1P7IA 2WNUC 3E5UA 3ZKUA 3VBFB 4UT5A 4Z2YA 1XJAA 3LSPA 1QDOA 3PIJA 4YG2F 2LDUA 3HQRA 4I30A 1P6RA 2RJ2A 4Y22A 2Z33A 3RQ0A 2R7SA 4N9HA 5KVRA 1AR71 2HKXA 5L3DA 2QQKA 1JZ4A 4DQ2A 5FIXA 3D1NI 1DP0A 3VBSC 2YU1A 3JRFA 2ZMNA 2M0MA 2FDFA 2HNHA 4AFDA 4D0QA 1JZ7A 2F5VA 2CMPA 3FXOA 2XGEA 1W1WE 3PSFA 1YO5C 5JHFA 2D97A 3CC4I 1Z7UA 3WTSC 4Y1YA 3E6CC 3WP6A 1DQ5A 4RGAA 1MSEC 2KISA 3HN3A 3F23A 3OSDA 2Y31A 2JDHA 2Y6GA 1Y9GA 2B7YA 4LOCA 2L9RA 4PFOA 4KNYA 1HKDA 1TW2A 1U9OA 3PTYA 2FQ3A 2OU2A 3DQVC 1AXYA 2FQ4A 1M1EB 1RR7A 3A01B 2VXRA 4JGZB 4DBQA 4AYBA 3W58A 4OIQF 4ORFA 2RMU2 5AFEA 2BVBA 3I4PA 1OVPA 4ONUA 2QQPA 2Z99A 1GKBA 1FYMA 4PLOA 1WMFA 5EPAA 3K4NA 1G7YA 2DDBA 1Y4WA 1AA7A 1UZCA 1WLWA 2XRNA 1CF7B 4XJUA 4HNVA 2PQQA 3UL2A 2R7OA 2Y9YA 1KS5A 4YIIA 3U11A 4KBBA 5C9AB 1ENXA 2WA0A 4MNUA 3WZ1A 5BNNA 4KU8A 3FIWA 5F6FA 2XSDC 3D5OA 1HLVA 3ZPOA 1W8OA 3T2PA 2UWBA 3V65A 3RZKA 4AF9A 4W6XA 4OWRB 1R58A 5FYHA 1NCRA 3TEWA 2ISZA 1QBJA 2W46A 2NS0A 4N8MA 5BPIA 5ACA3 2BV4A 4A41A 3NNGA 5JXGA 3NWTA 2VL8A 4M6YA 4NVPA 4RR3C 2BYVE 4FPJA 1YIPA 1YS6A 2WINB 2B0LA 1RMU2 4NPLA 3VHPA 2CL2A 2HLEA 2WWJA 4CYCA 4DUVA 4CDXA 5KXCA 2LTPA 1R1TA 4IV1C 3WNOA 4D3WA 1UMZA 2VTFA 1POV1 2XJPA 3GFJA 4LMYA 5A3LA 1IHMA 2X6YA 3B01A 1FATA 4BPZA 1VBD3 4ZTFA 4BISA 4ISRA 2LBFA 1ODNA 2QZ8A 1NY72 1E3OC 4KWLA 4DJAA 1JZ5A 4L2NA 1GNYA 2HWC1 1RUJ2 2O8QA 3BU0A 4C90A 1X8EA 4PJLA 3R4KA 3N97A 1GBGA 1RITA 3VBRC 4LE3A 2IUWA 2D1HA 4N4NB 3P3NA 1RKWA 5F64A 5H20A 3TQNA 4EATA 3ITQA 5FZ1A 3BTZA 3CUQC 5ABJA 2NNYA 3LIHA 4QB1A 4V2FA 4U36A 5KNLA 4S2FA 5A80A 3RZJA 4LO7A 2WC2A 1TW3A 2HWF2 4KU7A 2ZGUA 2WB1A 1X33A 2XAGA 3I2JA 2XLAA 2ET1A 2WAOA 1QVTA 2XRLA 4AHZA 5J8CA 5J37A 5G04L 1R49A 2PFBA 4AI8A 3HM5A 2PQSA 1P4XA 2XHKA 1XDSA 4A0ZA 3P6BA 1I3QJ 4CDWB 1IUFA 3VEPA 4FPYA 3T2QA 2VE1A 3I64A 3AKQA 1G9BA 5FP8A 1MH4A 1QJFA 5CLSA 2F48A 2XASA 4K3UA 4YVWC 5IP9J 3HNBM 3V7RA 5E18F 4YELA 2YC4A 2C5DA 1WW7A 1LB2A 1HXS1 2K9ZA 4YW4A 2Q8DA 3K4AA 3I0TA 2DMUA 3BPSA 2F5FA 5FZKA 4XSXF 4I0WB 3WF4A 1KRIA 2DBIA 3T8TA 2OZJA 1HRI3 1Y0NA 1FOD2 2VUDA 3HR9A 4F93B 2WS92 4EJUA 1KJRA 5KAFC 3CCUI 2Y0SA 1VBE3 5D5UB 3WE3A 4XAEA 2KFDA 5FUIA 5FZ8A 2V72A 4QPIB 5IK7A 3B94A 3BG3A 1K7AA 2F5CA 4ZYGA 5F7UA 3M3QA 1H9WA 4A7YA 2Y9ZA 1HB4A 5M3MJ 1KFUL 5FMDA 2IT0A 1OCRH 1HRV2 3NV2A 5D8AB 1TT0A 1HCRA 3V0AB 3KYCB 2X5IB 3ZIXA 3ZSEA 4XFAA 2BW3B 2RREA 4KBZA 3NSTA 3TO6A 5CKMA 2IXCA 2ZGSA 1D0ZA 1U5TC 3OOXA 4BJ0A 2EAKA 2JWPA 1RXGA 2R0HA 2ZGQA 5DZEA 5F6KA 3JD73 2VG9A 2HGCA 1SFOJ 4RLQA 2ZBJA 2J42A 4JRAA 1H4GA 5IW0A 1CWPA 1ZZ7A 2Y69H 5D8LB 1MQTB 1HV0A 1KU2A 2MC4A 3ZDSA 2ZX0A 1LRHA 2BNOA 3K51A 5B1AH 4IXLA 3V64A 3TN92 4IEVA 4GMP1 2O0OA 3HOXJ 1PHMA 2YG0A 3F21A 3FMGA 1VBB2 2P81A 3AG4H 3Q8BA 3TP3A 4YGEA 4IEQA 4L5IA 2OC6A 3V8LA 2V6EA 3SEZA 5LRRA 1DGRM 1H1IA 1VNDA 2YS9A 4ZYAA 1FV2A 5LLQA 5ANQA 2BERA 3OCPA 4BCUA 5CYVA 1O3TA 1O8SA 3DKWA 2XSJC 4ZHNA 1HSJA 1L3LA 1ZGJA 4QQ2A 5B2GB 2JG8B 1UB9A 2ZX4A 2JZYA 2FDGA 5FZ4A 1GLHA 5BV6A 3HOYJ 5FWJA 1C8M2 4AQSA 3CCMI 3FM3A 1LOFC 2CGPA 3ZN6B 3AFKA 3I3DA 2F4LA 1DP7P 1MBFA 5JSOA 2KKOA 3ZX7A 2RNGA 3BG9A 1MBHA 2W52A 3MN2A 2CUEA 2WAQA 1T0FC 4GWJA 1MH3A 4OIOF 1SD7A 1NG0A 1FY7A 5GJ6A 3O5SA 2R7DA 4Q4ZF 4G6DA 3WU2C 4WM8B 2QQMA 2FF4A 4L0YB 2R042 3CCRI 3HDDA 1MS9A 3UGGA 4JHZA 1SMYF 1Y1VJ 3T1BA 4A3IJ 1RESA 1JT6A 1DZRA 2YY1A 4XFCA 3NWKA 5FPBA 3KPHA 3MIGA 2IAIA 2VODA 3H0GJ 3KQRA 4ATFA 4WF2A 2D5FA 1UHSA 3I97A 3PL8A 4BQAA 4O9EA 5LGTA 2VUJA 5A1FA 4BDVB 1EV13 4A6SA 4N4OB 4MHUA 4PQQA 2COMA 4NRPA 1ZAOA 1W8WA 2X09A 3ABLH 4FP2A 1CQTA 3CJRB 1XU1A 3ZN4A 2R7RA 1R1A3 3DF8A 1QEXA 5JWPA 1FBQA 3B9CA 3FISA 5B4XA 3EYYA 3PFIA 4LOSA 1RUC1 3I7DA 4WZFA 4DOZA 4RQPB 1MS5A 2YSRA 5CYYA 1SC7A 1ZYBA 4IEPA 4Y13A 1CONA 5BNQA 1HKSA 3OIQA 5JXIA 4HQEA 4QQHA 2NS7A 2A6VA 2M45A 2HXOA 4PF1A 4LKEA 3GF2A 3G4SI 3GXOA 1JYCA 3AP7A 1JZ6A 4MXWA 1Y8QB 3RQ4A 3BGAA 4CEYC 1Q56A 1OLTA 2M4KA 4O65A 3H3LA 3O12A 5J09A 1WKYA 3FXQA 5JOWA 4IHTA 5IVCA 2QSGX 3DTKA 4XN3A 5GTHC 1D2QA 3X29B 1XSXA 2RDSA 1VRH1 3AL0B 2PEXA 1HSTA 3ABTA 1U2WA 3BG5A 1HF0A 2L7MP 4LR4A 2DA2A 1XGNA 4HQMA 2OIIA 2VO5A 2FA5A 1NYWA 2WR9A 3ZCOA 1GOGA 2RS33 3T4HB 2P4EA 4IE7A 1W6QB 1E5IA 3MF6A 4P9UA 3AL5A 3FFZA 2EFQA 3ZKYA 2O14A 4ITVA 1WJ5A 4BIOA 4BHPA 3SFIA 2VW1A 1A6QA 1QU3A 1W2TA 4MYEA 2ORZA 3ZSMA 5GAGJ 1K79A 3ZMNA 3FBYA 4Q2FA 2H6BA 5C8CC 1QH6A 4MIMA 1WKMA 1C28A 4X1EA 4N43C 3KP7A 4BE2A 1XSVA 4SBVA 4DZGA 4E7JA 2GMPA 2QQUA 2BBYA 3OSGA 5BNOC 1KZHA 1E57A 1L3JA 1MNEA 3F8FA 2HTJA 4GB31 2HU9A 2F17A 2QQIA 3G6EI 1YRZA 2JECA 2RS53 1VBD2 4D6QA 1TE1B 1D5YA 3RPUD 2FDKA 3JBG1 4HVRA 3JXSA 5ILSA 4WM7A 4Y20A 4QGMA 1T08B 1LOBA 4A5NA 1YQCA 2B9SA 4GULA 4QB6A 1QJEA 1VE0A 3BPXA 2RC4A 3JRBA 2RDQA 4HZFA 3MFAA 4IQPA 3HOTA 2XJSA 1FP2A 3HPHA 1MMSA 2L9LA 5I8YA 1ETXA 1OCOH 4B47A 1ND3B 5JAXA 5DDJ2 2PBIA 4DPNA 3SITA 4JCKA 2OQ7A 2XJVA 1JHFA 1MEC3 1UOGA 3GTLJ 4FPEA 3VFZA 1H0MA 1W6PA 2UV1A 2CW0F 4XJ9A 1PO23 3OYIA 3ZMZA 3MKYB 3OSFA 4NNJA 2YROA 2K40A 3PLQA 2IGKA 1W0TA 4FPFA 2VTXA 1MJAA 2E2HJ 1SCSA 5LHHA 1QJY3 2Y6FA 5GM0A 3WF0A 2CNAA 3L9JT 5E8GA 4XABA 1R4MB 3ZFEB 3WCRA 4YFKF 3H5RA 2EF6A 4BNCA 3HT2A 3WTXC 4L99A 1U5XA 1MMAA 2IXKA 2QKMB 3OBTA 1V4RA 4YW1A 3USUB 5H6QA 1W8NA 5EWSA 4AEDA 3W5MA 4GXLA 2VZUA 4HKOA 1XE8A 2JSCA 2M2EA 4CYDA 1W9FA 1OPMA 2XAFA 5JVVA 2QCSB 1AL22 2GN7A 2R1BA 3MW4A 3IPVB 2FCUA 1FYKA 4PFPA 4R9DA 1HRI2 1B72B 3T0DA 1YC61 3CC7I 4A3BJ 4KDPA 2A75A 2QZ2A 1APNA 4IL7A 1POQA 3U14A 2XBO1 3TOAA 5F32A 2UYAA 4LJZF 3KP6A 4ZC3A 2P7CB 5FKKA 1AR73 1EAH1 2VCBA 2QWWA 4LA3A 2M8GX 3GF6A 4RGXA 4YRVA 1W8FA 3TB0A 5JCTA 2XGCA 3TRSB 3IDBB 3ZFFC 3ZM8A 2VBWA 2R7VA 3EUHA 1FNZA 3I59A 3VDXA 5EXOA 4PDWA 4KA4A 2E60A 3ZR8X 3R0AA 1D8KA 1LU1A 1G8XA 4J1WA 1T6GC 1UOJA 5DTDA 2VASA 4D6SA 3DGTA 3VSKA 3JB8A 3HRTA 5L73A 2Z4FA 3ZYIB 4G3YC 3JD72 1OR7A 1MR5A 4IRGA 1WCSA 1AR61 3CF5F 1FWZA 3IH4A 5IOYA 3LEGA 3SH5A 3PURA 2J1AA 5FK7A 2VJJA 4MADA 1G3TA 3VKMA 1ZZBA 1QJU1 4MHGA 2WWUA 5A2QK 1JKOC 4ZXEA 2EILH 1ZRIA 4FP3A 2ZZJA 2JVHA 4LPLA 4OULA 5A7WB 1JU4A 3M8LA 3SJMA 2X4HA 2WA3A 4JP0A 3CMYA 4NPRA 1G6NA 3K3OA 1OMIA 1HQWA 2HWB2 4UVCA 4XLFA 4RAGA 4XKBA 3NAPB 5F6LB 3SKJE 1WJBA 2F4MB 4D6RA 1UY1A 1SACA 3ZXKA 5BNNB 1OQYA 3K10A 1DYPA 2QQNA 4QX1A 5A32A 3H8XA 3L09A 3GTQJ 3N35A 2IGNA 1NCRB 1K61A 4Q4X1 4C3IJ 1U5IA 2DVBA 2E35A 4JX5A 2GH8A 3NNJA 2KIQA 5APAA 2EIJH 4JV4A 4X6QB 3ETQA 3VYRB 5BMZA 4M9SA 3LSIA 3I56I 3CJXA 2ZC2A 3WINE 1QJZA 3F3XA 4II2A 1QZEA 4XF9A 1XDUA 4CSWA 4CYCB 5HXVA 1UX6A 2BZDA 5EZWA 2E1CA 2ZABA 5FV3A 4P9IA 4A3KJ 4LBMA 2GM4A 1US2A 4QGLA 1IS4A 3POYA 1POV3 2K02A 4Q4V1 1WJFA 2ZJCA 2MEV2 4U2AA 5K5QA 4OHXA 4M00A 2LBFB 2DA5A 3I2HA 3W6JB 4IETA 5DS9A 4MGSA 5FXVA 1GICA 1DGLA 1ALYA 4QX0A 1D0XA 2J1SA 3TEDA 2HWC3 2LY2A 4P1WA 3F0CA 4OI1A 2W0XA 4K7JA 5JDBA 3IIIA 1IO2A 3T09A 1WBLA 1NKGA 2Y6HA 2ZSIB 2E1NA 3O1SA 2HPMA 1FC3A 5LATA 3BVCA 2FOKA 1G4DA 5E1RA 4WVMA 1NLSA 4DZJA 4AWXB 4AVTA 1F15A 3OS2A 1W36C 2O8OA 2CUJA 5T55A 3GJAA 4ZYDA 1WH5A 1S1AA 3GLLA 1PMJX 3VHRA 3T5XA 1W9WA 5SV5A 1GANA 5EEGA 4DGWB 1R1A2 3POWA 3C7GA 4NQWB 3PUAA 2Q0OA 3UYJA 1ORKA 2VQAA 2QQAA 4NHMA 1I1GA 3OS1A 3N9QA 1VB4A 3RKXA 1PGL2 3DEEA 3IH3A 5IYCJ 2Y75A 4AVBA 2RG4A 1PX3A 2LKSA 1IF1A 1OKRA 5IAVA 4LLNA 1EF4A 2KIFA 1ZA4A 3GZNB 5JI9A 3HEFA 4QIWN 3C7EA 4BA6A 3D5LA 2JPBA 2L01A 2DTZA 4UBHA 5LZ6A 2F4OB 4HF0A 4WXHA 1OQEA 1H2KA 2IS6A 1HXS3 4EV0A 2HYXA 4D1QA 3J8F1 1XRUA 1SZBA 1GZCA 1MGTA 3I3MA 2JIJA 2XMLA 3GZ5A 1J3PA 1YOVB 2M5WA 4V2VA 1X3ZB 4E9KA 4CDUC 5HOOA 2XLFA 4QWQA 2FDIA 3B00A 2ZGNA 5BNPC 3SH4A 5CJ9A 5BQTA 2D6LX 4PF5A 1GLNA 4D8MA 4A3JJ 2B42B 2HZTA 5E79C 2QQ9A 3HL2A 2P8TA 4S2GA 4NMIA 1JS9A 4M6XA 2VM9A 4R9CA 1EPWA 5TJJA 3DF0A 5DAVA 1UYYA 3CCYA 4KMUX 3DXTA 4HG2A 2ZFWA 2HWVA 4D0PA 4YGBA 3OJBA 1GZWB 2HWE2 2RQPA 3ZR5A 3ZO0B 1R081 2VC1A 5FZ6A 3I49A 2L3DA 4EE2A 1IN6A 4LJHA 1OQ1A 2XAHA 4O61A 5JSRA 2TDXA 2WN3A 3VHOA 4CTEA 2BNNA 4E8DA 2E32A 2B45X 4OHYA 1XB9A 1LOGA 3O1OA 1NHAA 5BY5A 4HXCA 1H2LA 2AR6A 4HV6A 1Y39A 2HBTA 3AXDA 2Y30A 2TNFA 5EQUA 1ZBA3 3OUHA 4V1PA 1YRNB 2E1OA 1E3HA 1D1BA 4K21A 1LNSA 1F1ZA 1YE9A 4CU7A 3N3HA 1TME2 2ZXJA 2QVOA 3S15J 4YVSC 4CICA 2DT5A 4S2DA 3MIEA 2W47A 1JMUB 4L11A 2D45A 1C1FA 5ISLA 1XSRA 4BOWA 1XOYA 1WFXA 5HNHA 3SLIA 2IPQX 1PGW1 3H3VK 2W00A 3U37A 1GWMA 4GMP3 1E17A 2HEWF 4RS5C 4BU2A 5D21A 3VGIA 4DMIA 3K0LA 3GCXA 3E0JB 1AR82 1UZZA 2VZSA 3IDCB 5L3BA 2ILMA 4QX3A 4FI9A 2QE3A 3SNMA 4C8DA 4KI5M 5ERIA 3OYAA 5F8PA 1FMVA 5CQGA 4K40A 1T8IA 3F8CA 2OKXA 4B7KA 5CKQA 2DYSH 1PO22 3FXRA 3MIBA 4QPWA 4Y1VA 3IH2A 1WI9A 4CH7A 2VNRA 3I53A 2X0LA 2HWD1 3WF3A 2V4AA 2K86A 5LRSA 1QOTA 3GTKJ 3I3BA 1J84A 4XZUG 1VBA2 1W6MB 2JD4A 1P8JA 4L9TA 2DCZA 5FYSA 3VSLA 1LEDA 1ZZ9A 4XBNA 2OA2A 3BJ6A 4UYBA 2WNUA 1ZGWA 3IB3A 2FNPA 3HBZA 2MLKA 1GXPA 1JTXA 2QENA 2PI0A 2Q1FA 4CZZA 1IN7A 2RM21 2A3XA 5DAXA 4F8AA 1QF3A 3GZUC 3M8EA 3UGFA 2FMDA 4OZOA 4A3GJ 4LBQB 2J1VA 1W0NA 3VBSA 5J1RA 2FQPA 2YV8A 3V8JA 3VV1A 2FSWA 5TISC 3CJIB 4U0WA 4L92A 1PNGA 2ZX1A 2DMTA 2IA1A 3T1MA 2H94A 3LKJA 1B1BA 5A3UA 2D40A 1QNTA 1L7RA 2TCTA 2VBYA 2A68F 2DCKA 3OOPA 2TUNA 4ESFA 3SYTA 3IAM2 4Q48A 1XU2A 3VBUC 3K4MA 3O6BB 1LOEA 3WHTA 2EZLA 5EGOB 2P3IA 4XF0A 1LVKA 2DOFA 4UWDA 2ARXA 3WTVC 1QDCA 3ZQIA 5FY1A 1GU3A 1MZFA 5LFAA 1G3SA 3S93A 3O7OA 1ULYA 1DU3D 4HKLA 1SLIA 4SLIA 5FZAA 2HQ5A 3TDUC 4XLNF 1XYNA 1MBKA 2KLOA 3ZQQA 3MBWA 4C91A 4ASNA 5A6YA 1ZELA 1BIAA 2BVLA 2EFWA 2IS4A 1BK0A 4X0GA 1BR1A 3J7ZI 4ENMA 1OUXA 3OBAA 1ASJ3 2YZ4A 4YRDA 3CCVI 5HV4A 2ME6A 1SD4A 3HYIA 2ZNYA 3SEQA 1IZ3A 1BVP1 2Y2ZA 2XUEA 1W0UA 3JB4C 2DJNA 3T8RA 1CIWA 3LSEA 4XDQA 3P7NA 1USTA 1VQMI 2MA3A 2PFWA 4GWIA 2BEOA 5LK7B 3THPA 3EUKL 4COZA 4ZH4F 4Q1RA 1ULCA 2IS1A 4HLYA 5C4JJ 3UESA 1N3QA 3HQUA 2OV7A 1VMFA 3WUCA 4JRLA 3MKWB 4BQ3A 1LFPA 3I71A 3V4GA 1V6JA 2P5BA 4IEUA 1XPXA 3ASNH 3MZ8A 1V70A 1I5PA 2LROA 3OGRA 2ADDA 4AFCA 3BLYA 3FXUA 4QX8A 3ZGKA 3INAA 4RR3A 2GNDA 2NVQJ 3VHNA 5FZOB 3BALA 4YG0A 5GZFA 5LA2A 5JXJA 1KU3A 5A7SA 4IV1A 2V26A 2LYCA 2Q2EB 2NAZA 3MIFA 1HBXG 3R60A 1F5TA 3AZVA 3AVSA 2K3PA 5JPNB 3D0SA 1FSHA 3RS6A 4QX2A 5JLVA 3ETPA 4Q1PA 4NC6A 1WLDA 4GB33 5I91A 4UFJA 1BIBA 3VBRA 2JWTA 1BLZA 5FY8A 3LSTA 5J4VA 3OEBA 5FFZA 2R071 1ZX5A 2ZGKA 3CU7A 2X9DA 3JRCA 3JBG3 5FLVA 3CUQA 4Y20B 1FMWA 1W9YA 3KZ4C 1HQNA 3GUDA 1QZZA 2HVQA 3CJTB 3HOSA 4BDZA 3DPRC 2I2SA 4YGDA 2QVSB 4LK6A 3ILRA 5IT9Z 4BL0B 3K46A 1KU7A 5JVGF 3QODA 4F91B 5I0UA 4MX3A 2YX7A 3ECQA 3NQOA 3AL6A 1QNWA 4GYIA 5AIQA 5C7GA 4DW6A 1LODA 2NQYA 1YS7A 3MZHA 1SCRA 4E4ZA 2ZKNA 1XGMA 1V9U1 2JA7J 4IEJA 4XJAA 3RYRA 4FE4A 2R6QA 4WXCA 4BQQA 5A6ZA 1F43A 4OQ8A 1X1BA 1HIXA 4U7DA 1USSA 3MKZA 5FRNA 2XR4A 5C4WC 5FYYA 2G7UA 1WRJA 4CXXA 2VIXA 1J0RA 4QKDA 1UAAA 4JDNA 5DUVA 1I39A 3LOIA 3AB0A 4QQPA 5JHUA 1X9PA 1X82A 2D43A 4XFFA 3HJEA 4ZS2A 4E7SA 3AMHA 1YW8A 1LE8A 2O8XA 2YPJA 1BBT2 5LBFA 1OA4A 1SLAA 5C8CB 4BXXJ 4BQ2A 3KEOA 2HJIA 3E5QA 1NK2P 1W2UA 4N43B 5IAXA 3BOWA 3M4OJ 3C2GA 1S0BA 2UWMA 2DMNA 2NMOA 5A70A 4XQ4A 1PYVA 4CA0A 4HSTA 4CU6A 4Q8LA 5FZGA 3NQHA 4NRQA 3FC0A 4XCAA 2XBO3 3S6PA 2OA4A 3ZQCA 5K5RA 2VAUA 2M30A 1IRFA 1W6NB 5FKMA 3UKNA 2Y0IA 4YWAA 1EAH3 5J98B 4ZPIA 3RJRA 4LNVA 4BEHB 3GFMA 1V00A 4FCAA 1UNBA 4FFIA 5JXHA 2VJ5A 3A02A 2JEMA 4RD7A 2JE7A 2CRGA 2IGMA 4ZDOA 2LKXA 4PDWB