1HW5A

The cap/crp variant t127l/s128a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
208
Chain Sequence
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVLAEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the T127L/S128A mutant of cAMP receptor protein facilitates promoter site binding
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation
molecule keywords CATABOLITE GENE ACTIVATOR
total genus 60
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hw5A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hw5A01
3MQ0A 3LA7A 4G6DA 2ZMEB 1SQ4A 3N4MA 1QXRA 1KQ8A 4TV7A 4BQAA 3S7IA 3U1DA 2CAUA 4HVOA 4P9UA 1PP8F 4BNCA 1O3TA 3P9IA 5ICGA 1CAUB 1ZRRA 1J3RA 1D8KA 1NXMA 3CUQA 4YIFA 3ZN0A 4O6JA 2IP2A 3RKWA 3GWZA 3NVCA 3ZDSA 2HGCA 3FHZA 3LWFA 1TQ5A 1IXCA 3WTWC 2L01A 1O57A 2YPRA 3CEWA 3HT2A 1FZPB 2IJLA 1XN7A 1FSHA 4FX0A 2FNAA 1F5TA 1J1LA 3IWZA 4XFIA 1YTYA 1S3JA 4KIBA 5FLXZ 3KP3A 3IKVA 2ZNYA 5HS9A 4G7ZF 3QRFF 3V7CA 3V8LA 5J48A 1D5VA 3OV8A 4XF1A 4IETA 1IRFA 2D2WA 1JXSA 5KHJA 1DPRA 1O5LA 2KKOA 1JGSA 3I7DA 3FX3A 4B09A 4ASNA 4KMFA 2DT5A 3NQOA 4ZZLA 1JUHA 1H0MA 4L9JA 3RPUA 2NS0A 4MGIE 1XB4A 3WTVC 2ZMEA 4EM0B 1QZYA 2Y75A 3DN7A 2PAEA 3E5XA 4ENNA 5FLIA 2K9ZA 5FB2A 1G3WA 1YW7A 4HLTA 4AIHA 4O3MA 1NHAA 3SXYA 2DPUA 1RGSA 3H92A 2FBIA 4ZZDA 5E1WA 2GWRA 4KFCA 1PUEE 2CYYA 2ZBKA 1XMAA 4Z07A 1J9IA 3D0JA 1MDMA 3QOPA 1KGSA 1Q43A 1XD7A 1J75A 1ZZ6A 2EFPA 3CTAA 4I09A 4ENJA 2IW5A 1KA8A 4HF0A 4F8AA 3GF2A 3DF8A 2M8EA 4OU0A 4OIQF 2GZWA 1WI9A 5FLHA 5JR7B 4G8XA 2IT0A 2ETHA 1DUXC 3HSRA 3QACA 2DI3A 2VT2A 3WGIA 1I5ZA 5HDKA 3L9FA 2GH2A 1PP7U 2M87A 1G3YA 2EA7A 1BI3A 4UV9A 2QVOA 3H3UA 3CDHA 2P6SA 3ELNA 2EV5A 1TNSA 5EEHA 1R22A 2PQQA 4EWDA 3EYYA 2DK8A 4GXOA 2MHFA 4HLYA 3SZPA 1H9TA 2X4HA 5BXXA 4FHTA 3IHUA 1CAXB 5K8SA 5AVPA 4O9EA 3KGLA 1I6XA 2CGPA 4XSXF 1YS6A 3FE5A 3OD0A 5C6CA 1ZG1A 2ZO4A 1P4WA 5HOOA 3HT1A 3KP2A 3T8TA 2GC1A 3ZMSA 4UVAA 1OYYA 2K02A 2Q30A 1XDUA 5LGUA 4YYOA 1VR3A 4QLCU 1IW7F 3O14A 2PQ8A 4F7ZA 4K2EA 5D4SA 4EWEA 1VJ2A 3V8KA 4UXAA 3MZHA 3LZZA 1OFNA 4A0YA 4I01A 4G7OF 2NNNA 1XSVA 2EV6A 3KLOA 2CG4A 5CU1A 2XLAA 2K0GA 3O6BB 3PLQA 4EJOA 4D7SA 4A5NA 2WC2A 3ZP5A 5FPZA 2HTSA 4AIKA 1O5UA 1XE8A 1R1TA 2J5OA 1S29A 2XL9A 3I64A 3R60A 3M3IA 2DQRA 5TJJA 4I98B 4WXHA 1W7PA 3EO6A 4PIYA 1FX7A 3TO7A 4RAZA 4KYWA 2V09A 1DGWA 4EM2A 4EJTA 2PJPA 4MGZE 4IHSA 4EJVA 4G94A 2IVMA 1R58A 1JHFA 5DUIA 4BIFA 3DXJF 4RB1A 1XSXA 3GLXA 3IC7A 2I45A 5LHHA 2P6TA 2CO5A 2YU3A 2V1XA 5BY5A 3LA3A 4ESJA 2H6BA 2YR2A 2HQNA 3B73A 5KK1A 1IN7A 3SHFA 2BNNA 3F8NA 3TOBA 1BIAA 5DCFA 1DGRA 4IRIA 2AXLA 1HW5A 1YLFA 4HSLA 5LRSA 1FBUA 3ZPLA 4HW0A 4L9VA 1T6SA 2BEOA 1UIKA 3KCCA 2FQPA 1ZAOA 3ZMTA 2FMLA 4CXFA 1D8JA 2KRFA 3BALA 4LLGF 4IJAA 2GU9A 1YIOA 2A07F 2VBWA 2YSRA 4HX4A 3K9TA 3GEZA 4IEXA 3VODA 3WODF 3K0LA 1UFMA 3TDZC 1FPQA 1R5GA 4RGXA 3CJNA 3MWMA 1U5TB 1SFEA 3WW4A 4RGRA 4WBBA 5A2QZ 5F64A 5I0SA 2W84A 2EFQA 2PYTA 4KT5C 1O3RA 3HYIA 1R00A 1QO0D 1UCRA 5DCMA 1HQCA 5K5OA 1QWRA 5J3UA 1FOKA 5D5UB 1R1VA 5CYVA 3LQRA 2EAAA 1ZRDA 2RVCA 4M74A 5ERIA 3ROUA 5ED4A 3HRSA 2IXHA 5D6FA 3BJOA 4UXNA 2PI0A 1R36A 2H27A 3QPHA 3HQXA 1S8NA 2CQKA 2VQAA 5BPXA 1Q1HA 4P9FA 2QWWA 2VBXA 4YG2F 2RN7A 4D0PA 4HAMA 4IEPA 5D5VB 2IXLA 2H94A 3I0TA 4BXUA 2OYZA 3GUDA 4R1HA 1EP0A 4FAGA 4LMYA 1X82A 4KN7X 1YO5C 2XL7A 5ILSA 2RGVA 1PDNC 3N97A 1FYLA 2W57A 1TLHB 3RYRA 3PQKA 3OGJA 1BI0A 2MH9A 3BJAA 2ISZA 2VOOA 3I53A 2EFNA 4ORFA 3BU7A 2LNBA 3I4PA 3CO2A 1IF1A 4QM8A 1Y0UA 4AVPA 4U0VA 2AS5F 3MEXA 5ICFA 3VB2A 3ES4A 2IRFG 4KDPA 2XAHA 2A3SA 1TNTA 2P5KA 5LGNA 2UY9A 1ZGJA 2H09A 2HYFA 4B8XA 3GBFA 2NNYA 1Y3TA 5HS8A 3QAHA 4XFCA 2L4MA 1QQIA 4OMZA 2XLFA 1UB9A 4J1XA 4Y13A 2UXXA 2UXNA 4L9TA 1Y9QA 5JHUA 1MZBA 1EYBA 1QY4A 4YFKF 4MQ9F 4XRFA 5D5XB 2IXKA 4RB2C 2EFOA 1V70A 5LGTA 3GX4X 1U12A 4IEZA 5K1YA 3HSFA 5CVVA 4IEVA 5LEJA 5JSRA 1ZVFA 3JTHA 1UHWA 5L3BA 5LHIA 1H1MA 1EH8A 1J0RA 2QQ9A 3H7JA 4LUMA 3EDPA 1ZREA 1E17A 3MDPA 2A68F 1L0OC 2VT3A 2EA4A 2OQGA 5IT3A 5JSPA 3R6SA 3C1DA 4ZU5A 3CJXA 4M9XA 2IXJA 3P7NA 4AXOA 4QGLA 3DEUA 4Q5SF 2CV6A 5KVRA 2IPQX 4HQEA 2O8QA 5FGMA 3ST7A 3OOPA 2VONA 1ZLJA 2QUFA 4EJUA 5F6FA 1BM9A 5D8KB 2GQQA 2B9UA 1SFNA 1W4MA 1HKTA 2L02A 4DINB 4L18B 3FHIB 2OA2A 3CF6E 1G6NA 5I0UA 1LR5A 2C0ZA 3GW2A 1EV7A 1BC7C 2OD5A 3HUGA 1W5TA 2PEXA 1D3YA 1KQ0A 3FFQA 3T1BA 4S04A 3GO5A 1PM7A 1T39A 1S7AA 4R8HA 2WFPA 5D4RA 5LLQA 2IA2A 3WTUC 4META 5FCCA 3ULQB 1Z1DA 1YWKA 4GO1A 1FBSA 1IPJA 3L2HA 3BOQA 1WA4A 3RZZA 1I27A 2KIFA 4IEUA 3BP8A 2R3SA 1GHCA 1C0WA 4JK1X 4E2QA 3SCFA 1K78B 3NJZA 1YHFA 3VOEA 4LLNA 1T38A 2V79A 4YIIA 4AIJA 3IL2A 1XCBA 4HQMA 1FNNA 3RTRA 2PHDA 3EBRA 4AVAA 4HF2A 3RIRA 3WTZA 3H9AA 5CVIA 5IT9K 3H1WA 2DFIA 3SQNA 2F5EA 2M1BA 4LEJA 1CAUA 4AVCA 4XLNF 2OU2A 3WG9A 5ICCA 2XV4S 3MZYA 1SEFA 1SMYF 3FZ3A 3KZZA 3WU0A 1YUDA 2QENA 3TO6A 4MV2A 3WTXC 2P7CB 4MEYF 3DP7A 3WTSC 2JPBA 4MHGA 1DP7P 4WVZA 2OZ6A 4LUKA 3FZVA 1DZTA 1PMIA 4OIRF 1MD0A 3NL1A 3GVAA 2ZXJA 3BWGA 3TNQA 2M5WA 2Q8KA 4QGMA 5DV5A 1KYZA 1NE4A 4CICA 2EB7A 3DL3A 3T5XA 4L5IA 4N9IA 1CX4A 3JSOA 4LK1F 2C6YA 3SCHA 2A61A 5DUKA 1WRJA 1WQ2A 3Q9SA 4YSFA 1IXRC 2GA1A 1HKQA 2Q0OA 2Q0AA 3RYKA 3LA2A 4E70A 2W85A 4ZYEA 1FP1D 2MNGA 1YG2A 1T0FA 2RV8A 4RB3C 3WU1B 5I93A 5DCMB 4ON0A 4XF4A 3BJ6A 1UPIA 1WWXA 3H50A 2O03A 3KEOA 2WWYA 4LA3A 1W7PD 4ENMA 2DLLA 4KN4X 4P9GA 2K4BA 2YX4A 1J59A 4EVIA 5BV6A 2HJIA 2NAZA 5L3DA 2Y48A 1B6AA 3ZN1A 4MEXF 4HBNA 3FXQA 2P5LC 3F21A 1GXQA 2Q4SA 2J5PA 4BH9A 2BNOA 2LDUA 4QMAA 5E16A 1LDKB 4IVNA 2F4PA 2GC0A 2VODA 1RZ4A 2ZJ2A 3CUOA 4QGNA 1J58A 2BE5F 1UW8A 4XFFA 4Q0UA 5J6XA 3COAC 4HV5A 1UCXA 3PQJA 2PA7A 2DW4A 3QU3A 2UYBA 1EY2A 5E18F 2PAKA 2FRHA 1T98A 2E7XA 1QPMA 2ZCWA 1X7NA 2FF4A 2PMUA 1LEBA 1SFUA 3JZVA 2OA4A 1YW8A 4PGGA 1EPZA 4BYYA 3KP5A 2EVXA 2TDXA 1RUNA 2STTA 1Z6RA 4EWAA 4HN0A 3L2CA 4GYIA 2L54A 2LF8A 4UVCA 1SD5A 4QWQA 5HDNA 4KMUX 5D1IA 1FI2A 4NQWA 1X8MA 2HS5A 3K2ZA 4IHTA 2IXIA 2O1QA 1ZZCA 1TTYA 3R61A 3RJPA 1STZA 2HDCA 1TQIA 1S7OA 1O4TA 4HDVA 3TNPB 2GIVA 3JAMK 1O3QA 5I0TA 3KFWX 5H20A 3KZYA 2ESNA 2CAVA 2O6GE 4R79A 2D5FA 3FMRA 3IKTA 1FYKA 2HKXA 1KU3A 5KHHA 3LFKA 2XKOA 4Y17A 2WV0A 4I2OA 1O7LA 4OIPF 1H9GA 4MQVA 1ZARA 1FC3A 5FD6A 1U5TA 2DAOA 5FDBA 2XRNA 1FP2A 3CUQC 1ZX5A 1LDDA 3EYIA 1OR7A 2UZKA 3ZMVA 3FXRA 3E6MA 3GXOA 2EK5A 1LKNA 1XMKA 4IERA 5C8WA 4Z2YA 1YFYA 3KSCA 4KUMA 3W6JB 1L3LA 3NEUA 3IBMA 3J81K 4CHUA 3R0JA 4L0YB 1USTA 3ECOA 4IPAA 1LRHA 5JCTA 1P4XA 2FMYA 1IRGA 5H6QA 5CVUA 4WX9A 3LAPA 4MTDA 4WCGA 1ZRCA 4ZU4A 3P9KA 3BDDA 3RKYA 3S2WA 5JI6A 2A6HF 4PIXA 5AIPA 4HDUA 1KYWA 1EH7A 1O7FA 3M8FA 3L09A 4NVPA 3USSA 1F1ZA 4IEYA 2P17A 1U6GA 1P92A 1MKMA 1Z91A 3M9AA 4FAHA 4AWXB 3E6DA 4YARA 4LGWA 4LG0A 2CSOA 3FMSA 4M71A 4BAYA 2FA5A 2JSCA 2QM3A 4M72A 3L7WA 1SD6A 4P96A 2WTEA 2HFHA 3JAMZ 2P4WA 2PFWA 4XF0A 1W7PB 1F4KA 1UIJA 1YFUA 2BYVE 4G7HF 2PAMA 1R7JA 4LLOA 1ZZ7A 2FBKA 4U88A 4NB5A 5FO5A 1ZHFA 2BGCA 3BPXA 1IN5A 2D5HA 3MCZA 5LHGA 4WXDA 3K1MA 3KMHA 3FXUA 4YNIA 2Z69A 4PIZA 2KXLA 2XIGA 4WK8F 1S6LA 4IXAA 3BB6A 4MGYE 2QVSB 3FMQA 2QDRA 5DDGA 3F3XA 3ABUA 3CL1A 2JTVA 3U9GA 3IWFA 3V8JA 4KA4A 3TGNA 2QQAA 4MGRA 1ZGAA 5LBQA 3M1EA 3DQVC 4JTOA 4EGYA 3ZQ7A 4I7HA 2Y0OA 4NHJA 3ELKA 4EGZA 2GXGA 3ZMUA 3GFIA 2VBYA 1QNTA 3NKTA 1G3TA 1U8RA 4FBFA 3BPZA 4EJWA 1G3SA 4LK0F 4XEZA 3ISPA 3R0AA 4E2SA 2XAGA 4WWCA 3ZMZA 4ESFA 3T8RA 3L00A 3MPBA 5ILVA 3G73A 3NSTA 3T0YA 1ULYA 3PFIA 1UD1A 4KWJA 1HKSA 4BHPA 3V7SA 1SD7A 3TQNA 1XGMA 5BMZA 3WGHA 1IN4A 1R1UA 3CO6C 2MC3A 2KIUA 2IXCA 3ACLA 3B02A 4I0BA 2IA1A 3HOSA 4Q29A 3F8BA 1TW2A 1USSA 1BOAA 4MGKE 2VE8A 2XGXA 1AWCA 1WKMA 5D6EA 2G7HA 4HLXA 3BY6A 4L2NA 4RB0A 2BNMA 1JHHA 1V3FA 2V1UA 2OQRA 3E5QA 3FJSA 5E8IA 1I1GA 2EA2A 3S0MA 3W6KB 2B5HA 3BCWA 4L0ZB 3U2RA 2GAUA 1YFHA 2PMHA 1RL3A 5FQ0B 2RQPA 1BIBA 4RGUA 5I0RA 4GGGA 3KE2A 4EQQA 5KBFA 3K1PA 1V4RA 2ZKZA 2RNJA 4QX5A 1TQMA 2FXAA 2EV0A 3REOA 1XSDA 1ZZ8A 4HSJA 5DEQA 3TOAA 2L3DA 4LJZF 2PG4A 1Z9CA 1XDSA 2EWNA 2PFBA 3OF1A 4ZU7A 2V6CA 3QPTA 4WF2A 3U10A 5E17F 1QGPA 2OBPA 4R52A 3D0SA 1I1SA 4OLLA 2XAJA 3DFGA 1BBYA 4FX4A 3SCGA 2MLKA 4RGSA 5BQTA 4XFAA 1U3EM 2QJVA 3IRQA 5BPDA 2GC3A 4PGHA 3GZ5A 2V9VA 3DPTA 1XCVA 2D45A 2XLGA 3AAFA 2DU9A 2DPDA 5AIQA 3D82A 1FBQA 2F5DA 4UBHA 3E6BA 1BN5A 1IN8A 3MYXA 2XHKA 4A6DA 2BBYA 5J8FA 4RS8A 2VBZA 1KU2A 2B8MA 2QNKA 2Z3YA 3LWCA 3NW4A 2JZYA 4KU8A 1X3UA 3KP7A 3V7RA 1B4AA 4KIGA 4MZUA 2VECA 2STWA 4ZH4F 1YFXA 3GFLA 4HOBA 4MNUA 5FFZA 4Q0PA 3I54A 2KIMA 5D5WB 4UV8A 2FU4A 3KETA 2XVCA 3ERED 1U5TC 3GFJA 4LB6B 4M9SA 5KHKA 2LSOA 3QP5A 3S7EA 3K1NA 1QXJA 5CVJA 1F9NA 4LG0B 2HZTA 3H8UA 4XLPF 3F6OA 4G6QA 4U7DA 1RIOH 1HXDA 1FXZA 4HF1A 5D8LB 4LB5A 4OIOF 4LA2A 3IDCB 4G9YA 1QBJA 3CLPA 2Z2SB 5DD8A 1LEAA 2IC1A 3UKTA 2Q2EA 1WSUA 2F5CA 4A12A 3RI4A 1U78A 3C3VA 3J80Z 3F23A 3QU6A 2MBFA 5FFXA 1IAWA 3C18A 4H7LA 4JBAA 2IA0A 4JVAA 5JAXA 2D93A 4KICA 1X8EA 1O3SA 2JT1A 1JE8A 5HVQC 2F2EA 1FT9A 2LKPA 3JSPA 1UHMA 2HQRA 1LB2A 4YRDA 2PTMA 3E6CC 3WW2A 1FSEA 5FLXK 1ZNPA 1LQ1A 4XBFA 6PAXA 4DNCA 1BI1A 1CAWA 4Q0SA 5CADA 4JQFA 4UNOA 3FWEA 5DYMA 1J5YA 1ON1A 3KP6A 3ES1A 4AQ2A 3FM5A 2QBYA 4WZCA 1XGSA 1OPCA 2O0YA 3LQQA 1OD5A 3DV8A 2O8XA 2VPVA 1XE7A 4HX7A 5BPIA 4FT8A 1IZ1A 2PHLA 5E8GA 4ZYGA 3VFZA 3BZ6A 4S05A 3ZMDA 3HIFA 4MUVA 3I59B 2H0VA 1MDMB 5HLGA 1B1BA 4HVRA 1GQGA 3WTYC 1OYWA 2K86A 5IT9Z 1BI2A 4P5OA 4L11A 3O2PE 1K78A 1L3JA 5L3FA 2G7UA 2FNPA 1XRUA 1SAXA 1J2XA 1HBXG 4XFHA 4RD7A 1ZLKA 5JSOA 5J8CA 5KHIA 1FWZA 1CF7A 1LNWA 2PBIA 3TDUC 3Q5FA 2MPFA 2EFWA 4PJYA 4ONUA 3TKYA 2LF7A 4IEOA 5I8YA 4BHBA 1XGOA 1RNLA 4Q4ZF 3PNAA 4X6QB 1VTNC 1ODDA 4ESBA 2ZNZA 4K8FA 3EQEA 2JPCA 3WTTC 2Z99A 3R4KA 1CF7B 2KJCA 1GXPA 2FQ3A 5JVTA 4HA8A 2JRTA 3E3VA 3J7AO 1DPUA 2K7LA 5FPXA 4A0XA 1FYMA 4LULA 2XROA 3MAJA 2DO7A 5KHGA 5A2QK 1YW9A 4H0EA 2HWVA 4QXKA 2MLGA 4UBGA 4HZFA 4HX8A 5ILUA 4L9NA 2P5VA 1CAVA 1Q5OA 3DKWA 3H1MA 5JFRA 3I59A 2V1DA 4KWLA 4M6YA 1DZRA 4M9ZA 3F6VA 3SZTA 3LOIA 2A5YB 3FF5A 5HLHA 2DK5A 4HMZA 3U0ZA 2FE3A 2G9WA 4UUVA 1REPC 4OMYA 1OKRA 2VC1A 5FLJA 5L3EA 4U0YA 4TLFA 4UVBA 4ETSA 5BS6A 4WXCA 5HLIA 3D5LA 3RYPA 5E1RA 4U7BA 3G7DA 3H3ZA 4KIFA 4EMSA 1AOYA 3LAGA 1CAVB 2MA3A 1GQHA 5E20A 3F8CA 1HW1A 2XAQA 1YQAA 4HBLA 1ZYRF 2W24A 3F72A 1W5SA 1IXSB 2VXZA 3KP4A 3EHKA 3OCPA 5I8TA 1GVJA 1QZZA 1P2FA 4HN1A 1MGTA 2HOEA 1YFWA 2MD5A 3E5UA 4O9GA 5H6RA 2YX7A 2VE9A 1MJAA 2OAZA 2P8TA 4CDGA 3RDIA 3FM3A 3M7GA 2HEOA 3U11A 3ECHA 2ZKLA 2OZJA 5LRRA 1RI7A 4ZYHA 4ENKA 1TW3A 2NRAC 3IIAA 4JV4A 3IDBB 2R7DA 3K69A 2Z9OA 1KU9A 3EJKA 1WGPA 1IN6A 1ONVA 1J3PA 4MX3A 2E1CA 2RKHA 5BUVA 1ZH5A 5JR3A 3KGZA 5E1XA 2DTRA 4I3PA 2ATFA 4LTAA 3VHRA 4KU7A 4AVBA 3I5UA 2H6CA 3PVBB 3GFMA 2D1VA 1LJ9A 1R23A 4I0AA 2EJRA 1ZN2A 1WLTA 3KEQA 4QM9A 2X0LA 1K6OA 2BV6A 1U2WA 2XAFA 4CO8A 2ADUA 1NYWA 4P55A 2GA2A 4OFGA 1P6RA 3EQLF 3CUQB 4M6XA 4KL1A 4HYEA 4BHCA 4GCVA 5FD5A 3F22A 4HV6A 2PLYA 5CVRA 3C3WA 2UY8A 2O3FA 4O5VA 2ISYA 3HSEA 4Q48A 5T3NA 3IRRA 4EROA 1CGPA 1MJBA 4EM1A 2HTJA 3ETQA 1E2XA 4LD5A 3UKVA 1FY7A 3NRVA 1Z7UA 4MH0E 5EZWA 1G4DA 3EETA 5E1ZB 1J7KA 3HRUA 3MFKA 2QZ8A 1B59A 3H1YA 5AONA 2HR3A 2GXBA 4A0ZA 1DDNA 2F5FA 4Q0VA 1K79A 4XETA 1CAXA 1MJ9A 1OYIA 5EEGA 2Q1ZB 2KJBA 4CZZA 3HOTA 3I71A 4N9HA 2ET7A 2ESHA 4XFBA 1B9MA 3CLOA 1ZZBA 1HSJA 4CYDA 2QCSB 4IF4A 4Y15A 2VN2A 3HHGA 3G3ZA 3HTUA 3J80K 2E1NA 3CO7C 1NE6A 1HSTA 4A2UA 5K5QA 1BJAA 1Q3EA 1CAWB 2CWEA 3HHHA 1SD4A 4GULA 5K5RA 1ON2A 4OINF 4XSZF 1TQPA 2FOKA 4HVQA 2A69F 3RPQA 3OTFA 2A6EF 2RDPA 1TBXA 3JW4A 3F8FA 4YFNF 2M45A 3BROA 4Q0QA 2FBHA 2Y0MA 1ZZ9A 1ZG3A 3WW3A 2B0LA 2E7WA 1FLIA 2Z5UA 2K4JA 2D40A 1R5HA 2OPKA 2CFXA 4N0BA 3DPLC 1Z05A 2K27A 4AQ6A 4Z82A 3WE3A 4IEWA 4XF9A 1SMTA 1HW2A 3ABTA 2OZUA 1LDJA 4KNYA 2R7FA 2ETEA 2DBBA 5HDGA 2ELHA 4I02A 2O61A 4L5JA 3UKNA 2Z33A 4A6EA 5F1RA 4IEQA 1KU7A 4B29A 4OOIA 2ACJA 3VEPA 3H7YA 5L3GA 2CW0F 1LVAA 2VOPA 2FEZA 3GYDA 4UHTA 1T2KA 1YLLA 4LFUA 1P4AA 1YYVA 3RNSA 5EFUA 1IPKA 4PDKA 3HRMA 4IRHA 2M30A 4ZYDA 5I8SA 5CLSA 4J1WA 2DQLA 3HRTA 1H1IA 3JTGA 5HS7A 3SHRA 2HYGD 4DQ2A 2XASA 3V4GA 2N7GA 4M73A 2VC0A 3SXWA 1J3QA 4E2GA 5BOXA 3WE2A 2L4AA 1VP6A 5HI0A 1OMIA 4LLLA 4KWKA 1YS7A 3EUHA 4Q47A 4U0WA 1RUOA 4XF3A 3WGGA 5FQ0A 3QP6A 2MH2A 2NYXA 4JTNA 3WW1A 3SMHA 2D1HA 3E97A 5I91A 3M8EA 2QBYB 4YFXF 3TO9A 3GZ6A 4IESA 4X6RB 4A5MA 4EV0A 5J7MA 4CGZA 2HKOA 3C7JA 2RC4A 2FSWA 1BC8C 2COMA 1A04A 5ICEA 1XGNA 2QYOA 3O3KA 1Z6TA 2UYAA 2W25A 2E9QA 2QLZA 4RAYA 2XUBA 3GYHX 1OI6A 3Q9VA 4MTEA 2GC2A 1SFXA 3KLNA 1RTVA 4D7TA 1ZG5A 2UWMA 1NZCA 1EH6A 4XFGA 3P9CA 2PN6A 2P7VB 3RKXA 3M70A 3SFZA 3LSTA 2QQBA 2ZFWA 3LAJA 1K7AA 2XKPA 4PCQA 3F8MA 5TRDA 2DCTA 2ET1A 3J81Z 1IUYA 1ZRFA 4IRGA 4PZJA 1KQ9A 5CJ9A 1RC6A 3BPVA 3ML6A 3HTSB 1B9NA 3I58A 5LEKA 5DD4A 4AD9A 5L3CA 4GYGA
chains in the Genus database with same CATH superfamily
4C8DA 2DCYA 1SQ4A 2B9SA 2XUEA 3RQ4A 1GZTA 4BQAA 2JG9C 1RR7A 3KV5A 2JENA 1WWYA 5ICGA 2R7SA 2NVYJ 3ILNA 3FUOA 4NHYA 3H0GJ 1W5CC 2A6TA 3NNGA 3WDXA 2W4SA 1JZ4A 2HGCA 4N53C 1IXCA 3WTWC 5C9AA 1AR73 3CEWA 2K9SA 1CWPA 3A0HC 3A0BC 4O61A 1FSHA 1N78A 3OYEA 1JN2P 2BY3A 2JRMA 1J1LA 4CCCA 4XFIA 4DY5A 2WYSA 1OLTA 4M3BA 1PVXA 1YIPA 3WNLA 5B4XA 2ZGSA 3IKVA 2ZNYA 4N7UA 4G7ZF 1ZBE3 3WUDA 5FZCA 4XOTA 3OUIA 4XF1A 1IRFA 2D2WA 2AUYA 3OEBA 1JJ8C 3MUZ1 1JYVA 3LMMA 4EN7B 4QXBA 3HB9A 2DT5A 1RUD2 1H0MA 5J96B 3RPUA 2YFZA 1XB4A 3W59A 2ZMEA 1S2BA 3U1XA 1X4OA 4HKOA 1POQA 3DN7A 3M07A 5CZKA 4L0PA 5FB2A 4HLTA 2WNVA 5LFAA 2FBIA 3PUQA 5CKQA 1PUEE 1JKRC 3HJEA 4BQ4A 2XUMA 2Y2ZA 3HQRA 2X6XA 2R30A 3AL0C 1V54H 1MDMA 4DJAA 1XD7A 3BR6A 5FP9A 2W95A 4KG8A 2BTVC 4I09A 4RR3B 3K7AJ 2FCVA 2NQYA 1QVUA 3WP4A 4YFZA 4FTBA 2M8EA 1J09A 3AMQA 1HV1A 2NVUB 1NH3A 1CQ9A 2MFZA 3NMBA 3JD73 2E71A 4CDUB 2RHPA 5EWSA 3IV5A 5HDKA 2YGMA 3VWBA 1PP7U 4ASLA 5EGOB 2EA7A 1GOGA 2PELA 4B3XA 2GNDA 3H3UA 2WAQN 2EV5A 3BI3A 4P5YA 2PQQA 4EWDA 5F04A 4NAMA 4GXOA 2DK8A 5DM6F 4HLYA 2LY9A 4FHTA 2JSPA 5K8SA 1N47A 3N9NA 1I6XA 2CGPA 4DEVA 2HVSA 1YS6A 4II3A 3FE5A 3OD0A 4HNTA 1U5YA 4XKBA 2GN3A 4NIDA 3FIWA 2ZGUA 2QQJA 4IHXA 2N8GA 1HDKA 2K02A 1KXGA 1VR3A 4QLCU 3O14A 2A6XA 5D4SA 4BUPA 2XQRA 4A3MJ 5LBBA 3V8KA 5CQGA 4A3BJ 1ULOA 3KD4A 1XSVA 4N43C 4UY8I 2JDAA 2FMDA 1DCSA 3J8F1 4UUSA 1HA8A 3EUHC 3HNMA 1QJY2 2BV4A 5FPZA 4YVSB 1W06A 1O5UA 4IQ4A 1XE8A 2J5OA 3MICA 2ZMEC 2MW8A 1W9TA 2B42B 4P9JA 2DQRA 2CQXA 5TJJA 2WSUA 4KQ7A 3H8OA 1AL23 3EO6A 1UY0A 1NUKA 4D8MA 3OBTA 3GCXA 2QZ3A 2G1MA 3AP6A 1W8TA 4G94A 5A3PA 5HV4A 3QYEA 4NOTA 3ZXGA 2I45A 5LHHA 1F8VA 5EHDA 1NCRC 3S57A 5BY5A 3LA3A 1MSFC 4Q4V1 1ETWA 1HN0A 1B72A 3G1OA 2VKEA 2W08A 3T08A 2HEYF 4LE4A 5DCFA 5ACA2 2D6OX 2DN0A 2WLPA 4PQQA 5LRSA 4FFFA 3FBMA 3ZPLA 4HW0A 3PNYA 1BEV2 3KCCA 4XLFA 4FISA 1ZAOA 2ECBA 5K7FA 2W68A 1VAKA 2EZHA 2XR4A 4HX4A 3ZFGA 4IEXA 3WODF 3ACGA 4OI4A 3T2OA 2GXAA 4AEKA 1AKHB 3GF6A 4RGXA 5EYRA 3PIOF 1NLRA 2VMEA 1QJX1 2OX0A 5C3QA 1W05A 4FPCA 2DCEA 1C1LA 1DQ0A 1LJ7A 5A2QZ 2OQ6A 5F64A 2W84A 2EFQA 4M3CF 4Q1PA 2GN7A 2P3KA 3RJRA 1DQUA 1FOKA 2VTFA 3GZUC 1ULFA 2CFOA 4BQNA 3BR5A 2JDKA 4IEJA 3HNYM 1MS1A 1S2EA 5EV7A 4M74A 1GWLA 3C2HA 3HRSA 2EZLA 1D4M3 4BISA 1QPIA 1BVP1 3AKRA 3QPHA 3B93A 3HQXA 1HDPA 2VQAA 5BPXA 4E4ZA 5IP6A 1X1DA 4IEPA 4HAMA 2IVJA 3B9IA 3I0TA 4IE5A 4BXUA 4A3FJ 2OYZA 2BWAA 4FAGA 4LMYA 3TEZA 3RCOA 2E63A 2W1OA 2ZMKA 3MN2A 3OYHA 1VBD3 3ZQGA 1SFKA 2SBAA 3PQKA 1OF3A 5H2FC 1WJDA 2MH9A 3BJAA 5CAZA 2QSFX 2D6PA 2RJLA 3WQBA 2LNBA 2OCEA 4GALA 4IV1B 4XVHA 2WYFA 2W3JA 4U0VA 4BK4A 3MEXA 3O1MA 3B00A 4C3HJ 3VB2A 3ES4A 2IRFG 1NG7A 2P5KA 5B5EC 3I8TA 2H09A 1W6OA 3NWSA 1VAMA 1LHVA 1Y3TA 3TN93 5HS8A 3QAHA 2XJQA 3MGUA 2WNVC 4XFCA 2L4MA 5JMOA 3PURA 5FKMA 4CCMA 3C2UA 2UXNA 5F32A 2CH0A 1QQP2 1W2OA 1RPWA 4YFKF 3Q3SA 4DOUA 3O12A 2EFOA 1V70A 3KM5A 5DDJ2 5K1YA 4M3CB 4FTEA 5CVVA 4JQTA 4IEVA 5LEJA 1G9AA 3I2IA 1ZVFA 1UHWA 2ZGTA 3H7JA 3VUOA 4PF5A 3B9CA 4C0HA 1X1BA 2VW2A 2VT3A 3DPRB 2HYXA 4AHYA 3R6SA 3RWKX 3ZQHA 1D4M1 3SH4A 2H8WA 3ZQQA 1LHUA 4M9XA 2IXJA 3VZOA 4AXOA 3POGA 5FREA 3AL6A 4S2HA 4GJZA 3CCYA 4LBJA 1I9RA 3RGBA 1U0AA 1ZLJA 4YG6A 1HOMA 1VBB2 1RMU1 5D8KB 2HBUA 2L02A 2OA2A 2LK2A 3W58A 4RLFA 5IK7A 1W5TA 4PDWB 1Q8SA 1AX1A 4M3CA 2B7EA 2VUCA 5FWEA 4R8HA 5D4RA 3O0WA 4AC0A 1RUF1 1IQAA 2OTLI 2XF6A 3ULQB 5FZ8A 5JPMB 5FJKA 2YGLA 4QPOA 1RUJ1 3KQ4B 1I27A 2KIFA 3BP8A 4YW2A 1Y7BA 3M4OJ 2WNUA 2JDHA 3I2GA 5DUXA 1BK0A 3WF2A 1S0FA 3K51A 2JMWA 3N9MA 4AIJA 4Q2FA 4KBBA 3IMMA 2J42A 1FNNA 2R041 3WLUA 2QKLB 2PHDA 2ZKNA 4AVAA 2WFF2 2A6VA 3VBRC 3H1WA 2DFIA 2M1BA 1CAUA 2BFUS 3AB0A 3CD6I 2BY0A 3WG9A 3MZYA 1H8TC 3CJIA 1VF9A 1YUDA 2QENA 3N3HA 4MV2A 5BNPA 4AVVA 2P7CB 3DP7A 2A3WA 4WM8C 2LKSA 2WAAA 4WVZA 3NKGA 1WH5A 3FZVA 1PMIA 4EQVA 3CMGA 1MS3A 2YROA 3VD9A 2BVVA 1CD3G 2F6BA 1D2SA 2CS3A 1MS8A 3J7ZI 3VBSA 3QYBA 4A44A 2L9VA 3B7MA 3ZSMA 5JLVA 1N75A 5KAFC 1VMJA 3O1SA 2JDMA 4DZJA 2J1SA 4QPYA 2Q0OA 2Q0AA 3LA2A 2K5CA 1CPNA 4FQGA 4XLCA 1FP1D 5GZGA 2MNGA 3SLIA 1QEXA 1JOPA 5T5OA 2W52A 3RFRA 1AR93 1TWGJ 2DYSH 1UPIA 1ACCA 3H50A 4NHMA 3VDDC 3NJVA 1IRZA 2M4GA 4LA3A 5BNPB 4CH7A 4JAAA 1W7PD 1SANA 3OGRA 5ISLA 4FVVA 2LUWA 2DLLA 4QDQA 2HWC1 1QXPA 4P9GA 1U5ZA 1JXNA 1RITA 2ADEA 4CU7A 2NAZA 5L3DA 1LOEA 1B6AA 3ZN1A 2VZ1A 4KT6A 2MC4A 2OT7A 4YPJA 4AWDA 5E16A 1H8VA 1YJNI 3ECQA 3KEYA 3DU5A 3COAC 1A31A 4HV5A 1UCXA 1RINA 3K70D 4HANA 2AHQA 2DW4A 3QU3A 1H2MA 1LGBA 3POBA 4URAA 4D5FA 1EY2A 2ADDA 2LFBA 2KISA 2PAKA 1LULA 5GAGJ 4WM7B 2RDSA 3OYFA 2E7XA 4AE2A 3G6EI 1QPMA 2ZCWA 1XYOA 3ORJA 1LEBA 2QGUA 2JQ7A 4LO8A 3JZVA 1YW8A 4BYYA 4GD4A 1VQ7I 4LKSA 1Z6RA 1N77A 2OPTA 3LGRA 1QJU2 5FKNA 4PFOA 4GYIA 3DYPA 5T50A 4RYDA 4UVCA 1SD5A 2AO9A 4KMUX 1TME2 5D8AC 1X8MA 1F35A 1QDOA 4WM8A 2R92J 1OOPC 1W8ZA 2CV0A 1SLTA 2PHRA 2IXIA 2O1QA 4DEQA 1YJLA 1ETXA 3R61A 1OHFA 3RJPA 5AC93 3WCSA 3DTIA 4HDVA 4C90A 3TNPB 2GIVA 3JAMK 2RS11 3K4ZA 3BU0A 4XKVA 5H20A 2X6WA 4FXGB 4R79A 2IS2A 2D5FA 1BZWA 2GP3A 3B6CA 4OCTA 2OUJA 2XF7A 1W36C 2B46X 4Y5SA 3LOBA 1O7LA 1YQ8A 3OR1C 2EIBA 5F1JA 3FFZA 1FPN1 1GV2A 2VCMA 4QDSA 5T5LA 5FDBA 1FP2A 5FRMA 2DBIA 4BQ2A 4NRQA 3EXUA 4CEYB 3I56I 3KS7A 3GXOA 3DPUA 4Q4W3 1NK3P 4IERA 5C8WA 3ZN6B 5GLVA 4XUQA 3A02A 4MO3M 1L3LA 1UOBA 3IBMA 1QKQA 3J81K 1LGNA 3R0JA 1AF9A 2W87A 5LK7B 2ICWG 1LRHA 4CUAA 1A5JA 4DMIA 1P4XA 1IRGA 5CVUA 3LAPA 1ZRCA 4Y24A 2QQPA 3BDDA 2BZDA 5AIPA 4NJ4A 1AR92 4HDUA 1VBE2 1ETKA 3L09A 1CONA 4LXLA 3PTRB 5JMCA 5FP3A 1M4WA 4OI0A 3M9AA 4FAHA 4EYUA 1RJ7A 2EINH 4AWXB 3X2QH 1QH6A 1REFA 4V2GA 2AQFA 2FA5A 5E6HA 4TYSA 4M72A 1MMGA 4P96A 1XU2A 5H9QA 1W7PB 4N90A 1YFUA 4G7HF 1E5RA 2EIGA 2PAMA 4XN0A 3T09A 1W6MA 4XDOA 1ZZ7A 4CP2A 3SYTA 5FO5A 3BPXA 3H5AA 1ZBA2 1IN5A 4QHZA 3CJIC 3MCZA 5LHGA 4QTRA 1UMZA 2RM23 1ENQA 1JKOC 3FXUA 4YNIA 1F31A 1F43A 4X8PA 4G3YC 4XQDA 4RS5C 4IXAA 5JHFA 4MGYE 4XAEA 2QVSB 3FMQA 5LY2A 2LLKA 2QDRA 2YPDA 5KXEA 1EJ9A 3U14A 3F3XA 1W0PA 2ZGOA 2JTVA 1YI2I 3U9GA 3V8JA 1JS9A 1V00A 3TGNA 2QQAA 2KA3A 4MGRA 5C3SA 2L5QA 3ZKYA 3HNBM 3ZQ7A 4I7HA 3T0DA 2BOJA 3ZMUA 2X53S 5GZCA 2VBYA 5CFCC 1YIFA 1R1A1 1OSGA 3POFA 5LK5A 1O4ZA 3MPBA 4B1MA 5ILVA 3G73A 1URXA 4PJ0C 3NSTA 3TBDA 3HN3A 3PFIA 5FZ3A 4KWJA 4BHPA 1I3QJ 1JOJA 3V7SA 1UYXA 4YW6A 5BMZA 2WQ4A 3BTLA 5FY1A 3GZTB 3ZXAC 3NAUA 3VDDA 3CF5F 4DPNA 1MMAA 2RMU1 4I76A 2GMEA 3B02A 2IA1A 4G6TB 2HWF2 3MW2A 2XGXA 5D6EA 2R7WA 5CISA 4HLXA 1V3FA 3HKZA 1AR81 3CMAI 5L36A 3OYLA 3P6BA 2VM9A 3S0MA 2XGEA 1DYOA 3QYFA 1MH4A 1RUG2 1VQKI 3BCWA 2DURA 2GAUA 1GQPA 1RL3A 4OWRB 5FQ0B 2BXYA 4R9BA 3AG1H 2VOKA 4RGUA 2HH9A 2I07B 4GGGA 1DYPA 4QSHA 3K48A 3ZRGA 3KE2A 1WZXA 5KBFA 4F52A 1T95A 5FZBA 2DMTA 1W28A 1PNGA 1TQMA 1V5EA 2EV0A 3REOA 2LBFB 2WFF3 5DEQA 5FZKA 3EUAA 1DBNA 3TOAA 4ITVA 1BHGA 5IUQA 5IATA 1S0BA 2PG4A 4ARYA 3ZSJA 4C2TA 2NOJB 3OF1A 1OQYA 1K5MB 2V6CA 4WF2A 4C0BA 2A5WA 5JDBA 3OYGA 2K9NA 5JOYA 4OZXA 3D0SA 5F2SA 4M3GA 4YVSC 4FX4A 3C2BA 3SCGA 4CXWA 1OOPA 3WNKA 4RGSA 2P1BA 1G2HA 1OQEA 3TN91 4LO5B 1PJRA 2E19A 2IXSA 2W9XA 1OUSA 3NV1A 2XLGA 3EUKL 5AIQA 2C4XA 3D82A 1FBQA 1EAH2 1BQPA 4UBHA 1BN5A 4A6DA 2VBZA 2R073 4CDWA 3LWCA 2Z3YA 5IT6A 4FI9A 4KIGA 2VECA 2XJRA 2KIMA 3KETA 3W2VA 2JVHA 2ZBJA 5IVVA 2LSOA 3UGGA 4ZONA 3OUJA 4D7MA 2IS6A 2WS91 1QOTA 5FBJA 2HZTA 4FXKB 3F6OA 2Y0SA 5FO9B 5M0TA 4DZGA 4QQHA 5FO8B 1FXZA 2VCBA 4HF1A 5D8LB 2E26A 4OIOF 1AR63 3VV1A 2PN5A 4G9YA 1QBJA 4RN5A 3CLPA 3UNPA 1LEAA 3KIOA 4C3JJ 4BEHB 4P9IA 2JWTA 1R71A 3RI4A 3DKQA 2XB0X 2IZWA 4ISRA 3CJQB 1BA5A 3F23A 5E79C 5FLVA 4WVMA 5FFXA 4XCAA 1QHDA 5FYZA 4HG2A 4QXCA 3SDBA 2VXRA 2D93A 1M1EB 3RZDJ 2HNHA 1GOHA 1JE8A 2JT1A 2R6QA 1Z7S1 4PI2A 2F2EA 1FT9A 2LKPA 2NMOA 3RZLA 2LTPA 4XTPA 3AC0A 1QGLA 2QSHX 1RUC1 4CDXA 2X1DA 1WMEA 5FLXK 1UNBA 3AYCA 1LQ1A 1VMHA 1RUF2 1LHNA 4DNCA 1MMDA 1CN1A 1R5ID 4W4ZA 4JQFA 1I5PA 3FBIB 3FXJA 1UELB 2NLRA 3WNXA 3KP6A 2PJRB 3FUQA 4AGVA 5A7SA 4AQ2A 3FM5A 1SACA 4UWDA 4LOSA 1JU4A 4BMBA 1BEV1 4RHV1 2VZQA 4FT8A 2R93J 2PHLA 5E8GA 2ZGPA 3BR1A 4LK6A 4OUSA 4RHV3 1LESA 3ZMDA 2VY0A 1LEDA 1JZ5A 1NZIA 1RHI1 3K77A 3ETPA 3PHMA 4OYUA 2XXZA 1ND2A 1OYWA 1C8M2 1PO22 1JUMA 4L11A 1TL8A 1Q8QA 5L3FA 2WNUB 3MIEA 2YUEA 2PHXA 2G7UA 1SAXA 4XFHA 3LE0A 3JUUA 3M3YJ 1CF7A 4D69A 1LNWA 2PBIA 1N3OA 5FXWA 2P81A 3AZZA 1NX9A 2XBO3 4FPEA 4PJYA 4MXWB 2VQTA 4XXAA 4ONUA 2LF7A 1AL21 1FATA 4BHBA 5FIXA 3PNAA 3RJ2X 3WTTC 1X2MA 3CZUA 3CCUI 2ZGQA 5JVTA 1T6GC 4ISQA 3S93A 2JRTA 3E3VA 4A0XA 3O0XA 2ZX2A 3PO2J 3BTYA 4LT5A 2ZHMA 4LBMA 4CDQB 2HWVA 1LECA 1ULPA 4HX8A 3AZWA 4COYA 4IHVA 5FYTA 2YG0A 1VBA1 5A3UA 5FKLA 3ZLIA 3JRDA 3HOWJ 1US3A 4XJAA 2FDKA 2UU8A 1DLCA 3F6VA 2Y6LA 4DO0A 4RS5B 3LOIA 3PL0A 1G9FA 5FYUA 3FF5A 5HLHA 2JG8C 2HDWA 4HMZA 5FR3A 3IH2A 3IH4A 4OHYA 1KJRA 4HPQA 3G71I 1XJAA 2M7BA 4IQPA 4OMYA 1NKGA 3FBYA 3G1MA 1YCIA 5CQEA 1PNFA 2R7EB 1X1AA 3D5LA 3RYPA 5E1RA 2ME6A 3A0KA 3A2KA 1X2NA 3KYCB 4EMSA 1AOYA 1CAVB 3I3QA 2MA3A 5BNNA 4YM0A 1ZYRF 3E0JB 5FYHA 3OPTA 3OCPA 5I8TA 3ABKH 4WVVA 4Q5OA 1P2FA 4HN1A 1YFWA 4O9GA 1ETOA 2TNFA 2P4EA 2VE9A 1LVKA 4CDGA 1S1AA 2B39A 3M7GA 1WLDA 1DHKB 3DUIA 3U11A 1L7QA 3WF1A 2Y9YA 5C4JJ 5LRRA 4UW6A 1HXS2 1H8TA 2L7ZA 1ZBE2 3ZXSA 3EJKA 2L7MP 4W6WA 3VZMA 1ONVA 3MW3A 2VOXA 2ARAA 1VQ9I 4MX3A 2CTVA 2ZZQA 2O8OA 3KHCA 2RKHA 5JR3A 3KGZA 2VCCA 2VXDA 3VHOA 1SFYA 1D0XA 3PUSA 4KU7A 2CY6A 1I50J 4KGQA 2TCTA 2D1VA 2XPWA 4XJWA 1AR82 5JPNB 4I0AA 2FQ4A 5GM0A 1ZN2A 5DAPA 1IV8A 4OQ8A 4XJUA 1AU7A 1VQPI 2DT7B 1VBA3 2VU9A 3HPHA 4GH4A 2ADUA 3NARA 2JA8J 1VFCA 2PHFA 2H0BA 1HRI2 4K6BA 1SEUA 5CVRA 1ZQ3P 1GV5A 1E5SA 2E5ZA 4Y4RA 4M0HA 4Q48A 5T3NA 2GNMA 5F3GA 3DEMA 2UWBA 1ALYA 3CP2A 4RLQA 1MJBA 3CQOA 1WW5A 1HC8A 2VH9A 2FX0A 1Z7UA 4CDXC 2X10A 3AYAA 1QQP1 3AP7A 5GLUA 4A3IJ 3BPSA 2C26A 3MF6A 2VIXA 5D2AA 5EYYA 2ORXA 4ANJA 2CWMA 2ZJPF 1CAXA 1ULGA 4AVSA 4OUMA 4CEYA 3ZXKA 3H3LA 4UF0B 2Q1ZB 5FKOA 4CZZA 4A3KJ 4BE3A 2KZGA 3I71A 2ET7A 2RM21 2ESHA 1AX2A 1STMA 3C8XA 3CJRB 2K85A 4PLNA 2HWB3 3HHGA 4A3LJ 1UPSA 3HTUA 2MEV2 4YELA 1AYN3 4UI9L 1JH5A 9ANTA 3PJYA 1MBGA 1Q3EA 2C6SA 1LPQA 2OV7A 3HHHA 2GMPA 1POV1 5JWPA 1ON2A 3DTKA 4FFHA 2G0EA 1TC3C 2GOMA 4AI2A 3MZ8A 1TQPA 4YW7A 2VBBA 2DMUA 4HVQA 5J98B 3LKJA 1FMD3 2M45A 5FZ4A 2HWD3 4Q0QA 4LOTA 2Y0MA 1RVF2 3KF5A 3BIEA 3ZIXA 2B0LA 2V1NA 2B4KA 1FLIA 4EZ4A 4YW5A 2VQUA 2Z5UA 2K4JA 4XN3A 4N0BA 1NAEA 5F08A 1UY4A 2K27A 1GVDA 3Q8BA 4XMYA 4XAAA 1RMU3 4P9WA 2EIJH 1HW2A 4XIDA 1MH3A 2R7FA 2ETEA 5F5IA 2ELHA 5ABJB 2VMGA 2LC2A 5IAXA 4TXWA 4LO6B 3I55I 1A6IA 1XYNA 3H7YA 3OEAA 5C4WC 4JGYC 2CW0F 2OVUA 1YLLA 1G8XA 4YIRX 1CJDA 1MQTC 4PDKA 4XQFA 4LR4A 2WFF1 3V0AA 3J7YJ 2DQLA 3HRTA 4MYEA 3BUCA 1W8FA 3ZQCA 2XASA 2N7GA 4M73A 4CP0A 3O5SA 1C5HA 4E9KA 4YVWB 5A7PA 2L4AA 1OMIA 4LLLA 2XB5A 4KWKA 1YS7A 3PMEA 4U0WA 3KLSA 1RUOA 1LOCA 4XF3A 5GJ6A 3WDUA 3QP6A 2M8GX 3LOCA 1TMF1 3SMHA 4CEYC 1WLWA 2R042 1B09A 4QB2A 1KONA 4MHRA 4QHBA 1V5GA 4X6RB 4EV0A 1V6NA 2WAOA 3C7JA 2FSWA 2NVXJ 1FX5A 3RZJA 1BLZA 3POYA 4E7ZA 4DRVA 4RMNA 5EG0B 5F0FA 1OI6A 4NHXA 4MTEA 1ZG5A 1NZCA 1EH6A 2ZX0A 3P9CA 4RGKA 1DU3D 3M70A 3TP0A 3ZFFC 5C44J 3LSTA 2QQBA 3WG4A 2ZFWA 1JTXA 1W8NA 1K7AA 3D5RC 1Y8QB 2XPVA 3Q8CA 3VBSB 4QX1A 3TL4X 4IE6A 4OULA 3BPVA 3SISA 3NWKA 5EG0A 4UB8C 5L3CA 1HJFA 2AZ5A 2QE3A 2K9QA 4CDUA 2VQ0A 2DOAA 1FIAA 1PP8F 1OQ1A 2XJSA 4B4PA 3ZYRA 1O3TA 2DXIA 4FCAA 3P9IA 1ZRRA 4OZOA 5EXOA 4K7JA 1J3RA 1D8KA 1NXMA 3CUQA 3ZN0A 1ACIA 1OR7C 4BKXA 4O6JA 5KAIC 3RKWA 3ZDSA 1TQ5A 2LR8A 4CCOA 3WNPA 3HJRA 3HT2A 1FZPB 4OMCA 1FOD2 4E4SA 4FX0A 3VL9A 2ZOEB 4XIOA 4QWNA 3V0AB 2BOIA 2R1BA 5AFBA 3KP3A 4J00A 5HS9A 5FZGA 3QRFF 3V8LA 3WDWA 1A78A 1ASJ3 3OV8A 1XNTA 4Z6YA 5ANQA 4RM3A 2WO2A 5KHJA 1O5LA 1S9HA 1AVBA 2KKOA 1JGSA 3MO4A 1MMSA 3I7DA 3FX3A 1QMJA 5ABJA 5IVJA 1MVQA 4PDWA 3BZKA 3H0DA 4BJ5C 2VULA 1LOFC 2RJ2A 2HOSA 4B44A 2FDHA 2Y75A 5T5PA 2PAEA 3PUAA 5LASA 3E5XA 4ENNA 5KC5A 1V9U1 2MEV3 5FLIA 5A6QA 4G4FA 4O3MA 3HR9A 3C7FA 1R083 2DPUA 4ZZDA 5FY9A 5E1WA 3S3OA 2CYYA 2ZBKA 1XMAA 5C70A 2NOGA 4K8RB 4E4DX 3ZXFA 1ND3A 1PX3A 1PO12 3QOPA 1KGSA 1Q43A 2ZXIA 4L9BA 3QBQA 2OQ7A 1ZZ6A 1X33A 4BQWA 1LNSA 1UU5A 1FIPA 1UG2A 2OKXA 4TZDA 3NNMA 2BDRA 2AH2A 4J6GA 1WJ5A 5C8CA 4F8AA 3WSOA 2ZXHA 1VNDA 4OU0A 3MEPA 4CPBA 1Y8RB 5JR7B 2NP0A 2YC4A 2UWCA 5FY0A 3R4UA 2ETHA 3U1KA 1DUXC 2KRCA 1IC8A 1QOSA 2DI3A 3WGIA 3VB9A 3MD2A 3Q0UA 2ZEXA 4NIHA 4K9SA 3L9FA 4OAZA 3ZQLA 4AG4A 4Y3OA 1REDA 3VYRB 2DFHA 3V42A 2P6SA 1TNSA 2DA6A 3K3NA 1NCQA 2MHFA 1X19A 1I1EA 5FY7A 2ZSIB 4U87A 3LNQA 4NWWA 5AVPA 1YYNA 1WH7A 1YJKA 2EBIA 5IVBA 1O8PA 4XSXF 2AACA 3MV01 3J26N 5C6CA 3OY9A 1ZG1A 1F36A 1EV11 1W8HA 1BR1A 2J7MA 2VE1A 1BOBA 1VB4A 2EXKA 1TG7A 1P4WA 3OGSA 5HOOA 3HT1A 1SMVA 3KP2A 5HLTA 4UVAA 3T0AA 2XJVA 1BR4A 1O91A 2Q30A 4YYOA 1WI3A 1X36A 4F7ZA 4K2EA 4EWEA 1VJ2A 3QOEA 1IRXA 4G7OF 1JYIA 2NNNA 4C1XA 3CCLI 3WZ1A 1WJCA 5CU1A 3DBRB 4M0NA 3ABZA 1HXS3 2VW0A 5FZLA 5L73A 2WC2A 3ZP5A 2VC9A 3HGYA 2VTXA 1S29A 2XL9A 3M3IA 1HIXA 1Z0HA 4I98B 2R061 4WXHA 3ZN4A 1W7PA 4M6VA 5DDJ1 2ZX3A 4PIYA 3WG3A 2GIZA 3A21A 4F55A 4EJTA 4O7XA 2PJPA 1VQMI 2Q8OA 4ZDLA 2R4GA 2H8RA 5EZGA 1VBD2 4EJVA 2IVMA 2OW4A 1R58A 1YX5A 4BIFA 3DXJF 4RB1A 5F0CA 1Z78A 3IC7A 5IOZA 2P6TA 2LS6A 1LFPA 2V1XA 3QCWA 2H6BA 2HQNA 5GADJ 4LBOA 5C8CC 3LSEA 2JA2A 4YLZA 5C5UA 3F8NA 4BIOA 5DXDA 5HBAA 4GMP1 1HW5A 1YLFA 1XYPA 4HSLA 5JI7A 1FBUA 1YQ5A 3GMEA 4XLEA 2FQPA 3ZMTA 2ZABA 2VI6A 1Z0XA 4YEJA 4LLGF 2ZX1A 4IJAA 2EXJA 2V73A 3OS0A 2A07F 5IP9J 3GEZA 4E7LA 3VODA 4XKCA 1UZWA 1F5JA 4BK5A 1FPQA 1PIV2 3ATGA 2TBVA 1R5GA 2VMHA 3OYBA 1U5TB 4DUWA 2KM2A 4B43A 1YIJI 4JDOA 1HLVA 1HKDA 1XMXA 4KT5C 4FASD 1O3RA 3VBHC 3RPUD 3OGGA 1R00A 1QO0D 2FD8A 1UCRA 2LY1A 1HQCA 5FK7A 1PGSA 4UFKA 3I49A 5D5UB 3W9AA 2HWC3 2X5IB 4FOYA 5FUNA 4CE8A 1R1VA 3S3MA 3LQRA 4XLAA 1ZRDA 2J22A 2RVCA 3HMYA 4GQ7A 3ROUA 2ZAAA 5G04L 1JOBA 3MKYB 1TVGA 1FTTA 3KT7A 4XURA 1ND3B 5D6FA 2LROA 3P5BA 1AYN1 2WT2A 1S4CA 1WJEA 4YVWA 2PI0A 3AP9A 1R36A 3EPZA 1WVRA 1S8NA 2E33A 4XUOA 5JXIA 1RUE1 2QWWA 2VOWA 3LSKA 1VIWB 1PO13 3AG3H 1WCUA 2K46A 2H94A 3GHMA 3GUDA 3HOXJ 1EP0A 2DTWA 3JU9A 2BW3A 5KNLA 3THTA 2D6MA 1YO5C 2XL7A 1D4VB 1PDNC 3N97A 2ME0A 4UAPA 1FYLA 1C5IA 3WNOA 1TLHB 3RYRA 1LE8B 4NC8A 3OGJA 3ZFEB 4QB6A 4KISA 2QZ2A 3I53A 5IYDJ 1AZDA 2WV1A 3I4PA 1N3QA 4QM8A 3MKWB 2AS5F 3WHUA 5A6ZA 5GP9A 5ICFA 2J1EA 1S2KA 4KDPA 4IV3C 2A3SA 5LGNA 1UZVA 2O8KA 4B8XA 1KGYA 4C30A 1DFQA 3S1NJ 1JZ7A 2RR12 2BGOA 5TGTA 1UB9A 4PJMA 3VBOB 4Y13A 3WDVA 4L9TA 5T55A 1AJOA 1XXNA 2LM3A 3G6JB 2R0QC 4MQ9F 5D5XB 3CCSI 4BL0B 1E3OC 4A3EJ 1EUUA 1U12A 2WA4A 3HSFA 3B5LB 3H35A 2QQUA 1QJZA 1PVC1 3POJA 5JR2A 5IPAA 3OR2C 1RMU2 5LHIA 1H1MA 3ZSLA 1J0RA 3H3VK 2PMZA 2V7FA 4XNFA 2YU9J 3EDPA 4LUMA 2JXAA 4Y52J 2A68F 1L0OC 5A3TA 5C3EJ 4K1ZA 3N9PA 3C1DA 3VBHA 2G4IA 4ZU5A 3CJXA 4BM8A 1W3XA 4LITA 4XJ8A 4C2UA 1S0JA 1H89C 4Q8LA 1A3KA 5C7GA 1CJPA 3TWIA 2WINB 2K3FA 1U9NA 3HWJA 5LBCA 3ST7A 1I3AA 2CQ7A 5F6FA 4KI5M 1E57A 2B9UA 4IXLA 1W4MA 3DEWA 5CFDC 4DGWB 4L18B 3FHIB 5F7UA 2EILH 2J1TA 2OD5A 4YRVA 4KWUA 3FFQA 4S04A 1IO2A 4N4NB 2BXZA 1PM7A 2XDVA 2WLQA 1OVPA 2IA2A 3WTUC 4META 5FCCA 4JHZA 3VYSB 1YWKA 1UMHA 3VHNA 3BOQA 1Z77A 4IEUA 4ARXA 1GHCA 4E2QA 3BCBA 4QXHA 2QDNA 1MQTB 2RS13 1MW7A 3NJZA 2FZ2A 4ZY9A 4LLNA 1ODMA 1UYYA 1PZ9A 2V79A 4MG2A 2L2OA 1WCSA 4HQMA 1ZR2A 4FOWA 2WN3A 3N7JA 3QH6A 4J19A 4Y22B 1BVVA 3EBRA 1GOFA 3RIRA 3H9AA 1ETVA 2X5IA 5HXVA 3WDTA 3SQNA 2YZ4A 4V2WA 1S55A 2HBTA 3ZM8A 3ZOBA 2DA7A 2WWJA 1N1VA 1SEFA 1LE8A 2JG9A 3KZZA 3WU0A 3BG9A 4MEYF 3WTSC 1DP7P 2QQIA 1MR5A 1DGWX 2C24A 1QJU3 2TRTA 5LA9A 4OIRF 1MD0A 4RM2A 3NL1A 2F5VA 2M5WA 4TSVA 2JWPA 2V4JC 5A1AA 4CYCB 4AFDA 5DV5A 3VD7A 3EYPA 2RV9A 2EH3A 2AXTC 4M01A 3UT0A 2W00A 4N9IA 5ACA3 5IVCA 4LK1F 2C6YA 2VBDA 1IG0A 5DUKA 4W97A 3Q9SA 4YSFA 2JDZA 4I30A 2ARCA 3RYKA 1VBE1 4LHNA 2JEMA 2Z16A 3GZEA 5E88A 1RXGA 1IJWC 1F15A 3HOBA 1QJY1 1IG7A 4ON0A 4I3GA 3MIGA 2O03A 3O1RA 2CUEA 1IGOA 3RS6A 4GJYA 2JG9B 1UU4A 3OBRA 4Y33A 2ILMA 2DBNA 4CZSA 1D0YA 2YX4A 3IB3A 5BV6A 3AKTA 2JUCA 3R4SA 3HL2A 2HJIA 5C8CB 2Y48A 3V0BA 4C91A 1B35A 2LRPA 3FXQA 5JLXA 5J1UA 3WX5A 2LDUA 3H9JA 4QMAA 4AR2A 1NG6A 2VODA 1A8DA 2VXJA 1G9BA 3CUOA 3INAA 1QJX3 2DVDA 5J6XA 2AQEA 4LBQA 3PQJA 1F2NA 1AL0G 5K7HA 2UYBA 4NRMA 3FLPA 3AYDA 4XILA 2FRHA 1S7EA 4XABA 3THDA 1MSEC 1X7NA 2CU7A 2PMUA 3VDXA 2M2EA 5FK8A 2A6WA 1OA3A 4IL7A 4PGGA 1BCXA 4COVA 2KLOA 2TDXA 1RUNA 3OBZA 4EWAA 1A36A 1DU0A 1RVF1 2F4LA 4KBZA 5K4LA 4YZ4A 2QCOA 1MMNA 1QH7A 3K3OA 5D1IA 4NQWA 4MGSA 4MHUA 4IHTA 2X09A 3PMSA 3JREA 1VBC3 1WCMJ 2D7FA 2HDCA 2HVQA 4HXCA 4XACA 1XPWA 1PMHX 3JRGA 5I0TA 2ESNA 2ZTNA 3BR3A 3VPRA 1ZTRA 2EZKA 2EZIA 4CDUC 3LFKA 4XPVA 3R0RA 4Y17A 3FLTA 4I2OA 3W2AA 1H9GA 4D94A 5JIUA 4DOZA 2Y30A 1ZARA 3IUOA 5FD6A 1UXZA 2X6YA 5FY8A 4UYBA 3CUQC 3EYIA 1OR7A 2UZKA 5FYBA 3I2HA 3AG2H 3FXRA 1WD4A 3E6MA 4B1RA 2EK5A 3MW4A 5T5JA 4NMIA 5A1FA 4BS9A 1YFYA 3KSCA 2UUZA 4DW6A 1B8IB 1TMF3 4KUMA 1JYCA 3NEUA 3THPA 1NOVA 1R6RA 4CHUA 2W91A 3ECOA 4IPAA 2DJNA 5DMYA 5JCTA 1IS3A 2FMYA 3PO3J 3PU3A 3AXEA 4ZU4A 3OIOA 2FOWA 3P9KA 1RUH2 3S2WA 5FMDA 1EH7A 1O7FA 1TT0A 3M8FA 3USSA 1F1ZA 3J9SA 3TRSB 1GZWB 3TEDA 1Z91A 4NIAA 3FN9A 1UMIA 2ZGMA 3E6DA 5CEHA 4LGWA 2RS32 2V26A 1S0IA 2CSOA 3FMSA 4BAYA 1BKZA 2JSCA 5EIYB 3DLAA 1SD6A 3SFIA 2VZOA 4IOCF 2ZA9A 5KR7A 2M34A 2PFWA 4XF0A 4PJNA 2Q1MA 2BY1A 4D5CA 2BYVE 2ZJQF 4BE2A 4YG0A 3ZOIA 4A6SA 4XMAA 4L92A 3USUB 4XLHA 4NB5A 2E60A 3DCFA 3VDBA 2VZVA 4G9SB 2CMPA 2IGMA 1HRV2 5T52A 3KMHA 4XOGA 3GGLA 4TTGA 1APNA 2KXLA 3L2YA 3MLLA 1S6LA 1OKQA 3ZXEA 3T2TA 4B47A 3A23A 1OF4A 1ZGAA 5IYYA 3DQVC 3BG6A 2Y0OA 2OUHA 4YZ5A 4NHJA 2Y9ZA 4EGZA 3GFIA 2D43A 2HPMA 3H9GA 4EJWA 1ZYBA 2QQVA 4Y4YA 2JA6J 4LK0F 4Q4W2 3POEA 3ZMZA 4ESFA 4UOJA 4YGDA 2JN6A 3WD5A 4ZKTB 3T0YA 2VD7A 3HZJA 1SVOA 1HKSA 2YFUA 3OYKA 1HXS1 1XGMA 3N05A 2RAEA 3I2FA 3URFA 3CO6C 3ZIWA 2TUNA 2MC3A 2IXCA 2ECCA 3CDIA 1MBJA 3ACLA 5K0UB 3PSFA 4I0BA 4BLJA 4Q29A 5A70A 2ZEZA 2GMMA 4MGKE 3Q0WA 1AWCA 1WKMA 4B8EA 3WF3A 4PUSA 3BY6A 4JHTA 2ZMLA 2BNMA 1LHOA 2A75A 3S14J 5FYVA 4ET7A 3E5QA 4LHKA 4M4PA 3ZYPA 5E8IA 2EA2A 3FHNA 1JZ2A 1DIWA 3M3CA 1WJFA 2B7YA 3KT1A 4AHZA 1JODA 5A3NA 4BDZA 2VZSA 3SZGA 1V4RA 3K4CA 4QX5A 1XNKA 4BXSV 2RDNA 4HFSA 1VQ6I 1ZZ8A 3SQOA 4ASMB 1NTCA 1PVC3 1TNRA 5HXMA 3O1TA 3W3CA 4IHYA 4IE7A 3KZ4C 4DY3A 4F92B 2CDPA 4QPGC 2LYCA 5DN2A 2GH8A 2HZDA 2MLKA 5FJHA 2WA0A 2QJVA 4BQOA 3OL4A 3ZYFA 3IRQA 1FYUA 2V4AA 2GC3A 4PGHA 1QNYA 4WZFA 4NWVA 1KD7A 3AAFA 2DPDA 4AFAA 3C7EA 4N53B 3A22A 4JKMA 2XHKA 5J8FA 2MEV1 1K83J 1V9U3 4LBQB 2P37A 1GYKA 1A8MA 1C28A 1Q56A 1X3UA 3OYJA 3KP7A 1B4AA 4JGYB 4W65A 3UESA 4Y5Z0 2K2SA 3GFLA 4MNUA 4Q0PA 4DS0A 2KZVA 4UV8A 2FU4A 4CRQA 1RUI3 1W8UA 2XVCA 1NT0A 2Y6KA 4A3JJ 5KHKA 2VKVA 3BODA 4Q4X3 4DRRA 4XQ4A 3NNLA 4XZPA 2R1DA 3POIA 3MUY1 2AC1A 4L99A 4BCUA 1AHSA 4CU8A 1UG0A 5DG2A 3KF3A 2DUQA 4XLPF 2R7QA 5CKMA 2E35A 1RUC2 3N9OA 1HXDA 3IDCB 4Z2WA 1PYVA 2D3PA 1VRBA 2F5CA 4PK4A 5GPCA 4O65A 5FZOB 4K20A 1B8IA 4RHV2 1O59A 4AAXA 2IA0A 2VQLA 5LWBA 1YRNA 1W8OA 1O3SA 3ZN6A 5HVQC 1DGRM 2WL1A 1UHMA 4YGCA 2DUOA 4XE9A 2R0FA 4YRDA 2PTMA 3PUFA 3E6CC 3WW2A 1FSEA 2CW8A 2IGNA 3JRHA 6PAXA 3O1PA 2IVIB 3I4IA 5CADA 1W0OA 4U2AA 3FWEA 3IAM2 1CESA 1AXKA 5DYMA 1ON1A 2HYKA 1G7YA 3HOVJ 1XGSA 5CB7A 4UFLA 4TWTA 3DTEA 2NZ9A 3CZJA 4CSWA 1XE7A 4HX7A 5BPIA 2F4IA 2BPA2 3AKQA 1IZ1A 4ZYGA 3BG5A 3VFZA 1I3HA 1AR71 4S05A 2LREA 5CG9A 1LOAA 1DQ5A 3FXOA 3MMYB 3HM5A 2H0VA 1UOJA 5HLGA 2VPRA 3RKQA 1LODA 3GTGJ 1W0NA 3HOYJ 2YBSA 5A32B 3B6AA 1L3JA 4AI1A 1XRUA 1J2XA 1WFXA 2CUZA 3AVSA 5JSOA 2JE7A 1A35A 5KHIA 4W50A 2L0KA 3TDUC 1JGGA 3BZCA 1YI9A 2L7KA 2V4VA 1W9WA 1JKPC 3ENRA 1HV0A 4S2GA 2KIQA 1MEC3 1H8TB 3TKYA 1D7PM 4ZPIA 1XGOA 4GA9A 3CMYA 1UWWA 4XK4A 4XR6A 1ODDA 2E2IJ 4ESBA 3SH3A 2ZNZA 4K8FA 1ZK8A 2LKXA 2ZEWA 2Z99A 3R4KA 1CF7B 5SV8A 5F5AA 1GXPA 2FQ3A 3B69A 4QU1A 3DF0A 1NK2P 1IZ3A 2XVLA 1FYMA 4LULA 4KJZA 3AFGA 4Q4Y3 3H1CA 3KHBA 3MAJA 5KHGA 4HEA2 4QXKA 4R9DA 1AXZA 4HZFA 5ILUA 4L9NA 2K9MA 2RJKA 4CP1A 4P9XA 1JUIA 2V1DA 3GTQJ 2X1EA 5LD2C 4OHWA 1DZRA 1ZBA3 2D98A 1SCRA 2XQXA 2DVFA 3S15J 4AEDB 3SKVA 5KXBA 4E8DA 1AYM2 4UUVA 2QSGX 5CPRB 3Q0VA 1PHMA 2QUOA 4U0YA 3GXUA 4H3WA 5FKCA 1OISA 4WXCA 4FETA 4F83A 1XC5A 5HLIA 5FYIA 2MG4A 1UN1A 4QD2A 2L9SA 3H3ZA 2DODA 3K4LA 3LAGA 4NN0A 2CL2A 3SEPA 1GQHA 3CC7I 1HW1A 4ABZA 3IT8A 4HBLA 2W24A 3F72A 5FXVA 1W5SA 2A6ZA 1IXSB 2XJPA 2VXZA 1WCQA 3EHKA 4AGGA 1QZZA 4AUXA 2JE8A 5GZFA 2MD5A 1BEV3 1PK6B 2JD9A 3JBG1 5GTIC 2OAZA 3FM3A 1UHSA 2DA2A 2J1UA 4QPIB 1RI7A 1APLC 4YWAA 2NRAC 3IIAA 3OBAA 3IDBB 4QPGA 1WGPA 1IN6A 2YBKA 1RUC3 4OQ9A 3AKPA 2HI3A 1JI8A 1C1FA 4LTAA 1T56A 5M5XJ 1T08B 3S2DJ 3VBFC 1MNDA 3GALA 1COV2 1R23A 3AX4A 3M1CA 2HOTA 3W6VA 1ND2B 1EKEA 3BTXA 4QM9A 3ZN5A 1SDWA 2BBVA 2G9GA 2WSVA 2XAFA 2E51A 2KDZA 5TSWA 1GLHA 3EQLF 4Y20B 4HYEA 4HV6A 2PLYA 5IFPA 5IVYA 4QPGB 4RQPA 1NA1C 3AMNA 2LP0A 1JT0A 1VBE3 3C7HA 3ZYGA 2O3FA 4O5VA 3WCRA 4AK3A 3HSEA 3CDLA 3HC7A 2O14A 5JXJA 4EROA 5IVFA 1EV12 4QDRA 3LIGA 2E1MB 1GNHA 4PT6A 2HTJA 4BMEA 3KVAA 5K7ZA 1FY7A 4R4ZA 1JYWA 3LFUA 2CQNA 2HOAA 1G4DA 3ZQIA 5E1ZB 4EE2A 1B59A 2WZR2 3H1YA 2W1SA 1UY1A 4D9JA 2KDOA 5AONA 4FPOB 5J4VA 1H0BA 1J1TA 2F5FA 2KP6A 5A3WA 1K79A 4AM3A 3PVOA 4G12A 1PVC2 1MJ9A 1OYIA 2Q5TA 5JOZA 3ZXDA 1RR8C 5EEGA 3H9QA 3KCXA 5LA0A 3HOTA 4BEHA 3CLOA 1HSJA 5FP8A 2A3XA 4IV3B 2E32A 5J09A 4IF4A 3KV9A 3LSHA 4JZRA 3G4SI 2D6LX 3OIPA 3J80K 3F95A 1NE6A 1HSTA 1S0CA 2VR4A 4A2UA 4IHWA 5K5QA 1BJAA 1RUI1 5K9YA 1ULEA 4AEDA 1FEXA 4BDYA 5BNOA 4KGGA 1GWMA 2EPFA 3I2JA 1GNYA 2A69F 2HWB2 1IS4A 4YFNF 5FY5A 1V6JA 3BROA 3RVHA 3J7HA 2YS9A 2HWF3 2G19A 3VKLA 4FP3A 3ZO0B 2WNOA 2GSYA 4FCYA 2OPKA 4COZA 2ZEYA 3DPLC 5FOJB 1VMFA 3D8CA 5DTDA 4Y1VA 3LSRA 1EA3A 3LPGA 3T3YA 3MIBA 2DBBA 1R64A 4CP9A 1W2AX 2BQPA 3OOXA 4PI0A 3L1PA 3ONQA 2O61A 1ZA4A 3BR2A 3UKNA 1BL0A 4IEQA 3VEPA 5CFCB 2XMLA 2FEZA 3GYDA 5FYYA 3OGVA 1P4AA 1UQXA 5L9RA 5I8SA 3DKXA 1WCDJ 5CLSA 4J1WA 1N3PA 3ZYIB 2V9PA 3ZFEC 3JTGA 3OYNA 2VC0A 5LA1A 3ESWB 3ZX7A 1LUJB 5JI9A 5HI0A 1MBKA 4Z1VA 4F3QA 5FQ0A 2VVDA 2Y69H 4WM7C 4JTNA 3WW1A 2D1HA 5I91A 1AJKA 5DZGA 5L9BA 4YFXF 4W6XA 1ODNA 1LKXA 4IUGA 3GZ6A 4IESA 1CVNA 1D1BA 5ICEA 3S3NA 1HB2A 2VASA 1REEA 1XGNA 1ASJ1 2VW1A 3O3KA 2UYAA 2W25A 4A3GJ 2QLZA 4RAYA 1RHI3 2XUBA 2P3YA 4BY1J 1RTVA 1JZ3A 1M06G 1FNYA 4XFGA 2PN6A 4E4HA 3RKXA 2R5YA 2WZR3 3WOGA 4CDWC 4JX5A 3C7OA 3LAJA 2XKPA 3AMPA 2DT6A 5TRDA 2DCTA 1VQ4I 4QKFA 2Q8DA 4PZJA 3OYAA 4NPMA 3A0NA 1SBEA 5AC92 2RVAA 1QVTA 1B9NA 5DD4A 4AD9A 2E6VA 4DZPA 4G6DA 5M3FJ 4DQAA 1QXRA 1KQ8A 4Y26A 3S7IA 3AVRA 3OYCA 3U1DA 2BUKA 4HVOA 4B4RA 4P9UA 1AHDP 2DTZA 1DQ2A 2WT1A 5C9AC 4Y5TA 1Z7S3 4Y1YA 1BMV1 5HPOA 3G1LA 2CV1A 4MADA 5J36A 3MLKA 4YIFA 1UZYA 3OOUA 3GTOJ 1LEMA 1OPMA 3NVCA 1RUD1 3FHZA 2EIKH 3ZR5A 2R7UA 2QQMA 4Z8BA 1O57A 2YPRA 5F5QA 2VVFA 1XN7A 4UT5A 2WO3A 1H88C 3V56A 4N53A 1W03A 4KIBA 4A3DJ 2X1CA 1T0FC 3AKSA 5J48A 4FSJA 1D5VA 4A93J 1W3VA 4IETA 5CNAA 5F27A 1DPRA 2YPJA 2R062 5ACA1 4B09A 4ASNA 4KMFA 3NQOA 4ZZLA 4L9JA 1K3IA 3D4KA 4MGIE 3LPFA 4MXWA 3WTVC 2X9DA 1QHHD 3KYDB 4DXTA 3QODA 1QZYA 4WM7A 2PLV2 1LHWA 1VQLI 5IP7J 1HRV1 1U5XA 1Y9MA 4Y1ZA 5GZDA 2GWRA 3TMOA 3RI8A 5IOYA 1J9IA 4AAPA 1ND2C 4HK9A 5DZFA 4MGQA 2E2HJ 1R093 1J75A 5HNFA 3LF7A 3LEKA 3CTAA 4ENJA 2IW5A 2CU5A 2YXSA 2NXNB 3GCMA 1YI7A 3GF2A 1JMUB 4OIQF 3U78A 1YE9A 5A7QA 4Q4X1 4G8XA 1GMMA 3HSRA 2V5YA 3QACA 2DVAA 1FJLA 2VT2A 1W99A 3QPSA 1Y1WJ 1W9SA 4YW1A 3K4KA 1I5ZA 3MI8A 1AYN2 3ZMNA 5DZEA 2QVOA 1EUTA 4ZTFA 4BLIA 3CDHA 1UX7A 3ELNA 3KPHA 2VUJA 5EEHA 3MF9A 1R22A 2XWBB 3EYYA 1H9TA 3LDBA 2VJXA 2WDBA 2R0HA 2I2SA 5BXXA 4HNUA 3U07A 3IHUA 5FLMJ 4FPKA 2LRDA 1F4HA 4O9EA 3KGLA 4LG3A 2DCKA 1W1WE 4XDPA 4AI3A 3J8F2 1G59A 1VQOI 2UV1A 3K10A 2HYJA 3ZR6A 2ZO4A 4OI2A 3JQXA 4OUEA 5EJ3A 2GC1A 3OUHA 3ZMSA 3I4NJ 1OYYA 1AR83 3TP3A 4QQ2A 1E0EA 4ZDPA 1IW7F 4RFRB 2PQ8A 2RS52 3ZFEA 2CGNA 4XMIA 3POSA 2JUGA 2Y38A 1OFNA 4A0YA 3PU8A 2EV6A 3KLOA 2CG4A 1OCTC 2XLAA 3NV3A 2K0GA 4K3UA 1LFUP 3PLQA 3O1VA 4DYQA 4D7SA 1UX6A 4A5NA 4QX3A 3O1UA 4XBNA 4CDQC 4XDQA 3K4DA 3R60A 3VBUB 4QT6A 5BNNC 3BC8A 1JTZX 1D0GA 2VG9A 4BWOA 2C1FA 1FX7A 4RAZA 2ZB9A 4MLOA 3N7LA 4HT1T 4KYWA 5ANNA 4EM2A 1H2NA 4Q4W1 5AVAA 3B01A 4GMP0 2XB6C 2WWUA 4GWNA 1JZ6A 3MHZA 1JHFA 3LEIA 1UAIA 1LENA 3K2OA 5JVVA 1XSXA 3NRUA 2YU3A 4M3EA 3DBHB 2FUG2 4ZS3A 1GP4A 1AA7A 4P9YA 4ESJA 4ES9A 1QNWA 2YR2A 2YMZA 3B73A 1H30A 3HOUJ 5KK1A 2R043 1IN7A 3SHFA 5DUUA 3CCJI 1BIAA 2DJIA 1DGRA 4IRIA 3B94A 3ZFGC 2HU9A 1T6SA 1UIKA 2BEOA 2BY2A 3ACFA 2BHZA 1NY71 2W1UA 2RDRA 2FMLA 1D8JA 1BBT1 4J25A 3CU7A 4ATFA 1ZELA 2HWE2 2BZTA 1YIOA 2NN8A 2VBWA 1LOBA 3LFIA 4YZ1A 4QKDA 3K9TA 3DKYA 3J8F3 3K0LA 1UFMA 3DPRA 3TDZC 3HEFA 4GH4C 3U75A 2AGSA 1TWCJ 2LMDA 5M5WJ 1YX3A 3CJNA 3MWMA 1DP3A 5F8PA 3APBA 4BDVB 5J40A 2VTXJ 4NR1A 1TME1 1RUJ2 3NAPC 4QX8A 5I0SA 3I2KA 2PYTA 3LDRA 4QPIC 4BJ0A 2YU2A 3WF4A 5F3CA 3GLLA 2D44A 3V65A 5K5OA 1COV1 4NE9A 5CYVA 4PHZA 3AP5A 3TYJA 2RS12 5ERIA 5H9PA 3BTIA 5GPAA 1CZSA 3UGHA 1DQ4A 1IS5A 1CPMA 1QJY3 1MNMC 3I9V2 1XBFA 5J3LA 4Q1RA 2G9FA 5IYBJ 1SLAA 1C8NA 4NQWB 3IZOA 2JIGA 2CQKA 3GJBA 2HXOA 4QX2A 2QQKA 3TW6A 4YG2F 2RN7A 3VKNA 5GLWA 4CCKA 3NO8A 5D5VB 4R9AA 5IVEA 1OBNA 4IDZA 5FYMA 3ASIA 3OSFA 3GJAA 5ILSA 2RGVA 5B1AH 1XNDA 3FC0A 4GKXA 2W57A 2RE9A 1BI0A 5GALA 3D5SC 2ISZA 3ZYHA 1NA1B 4OVEA 2JB4A 2VOOA 2VPLA 4ORFA 3Q8EA 2Y33A 4KMQA 4AVPA 3GTMJ 5E8AA 2IUWA 4W8JA 4NPRA 1WMDA 5FBZA 3RSJA 3IP4B 2XAHA 4FPFA 1TNTA 3U4SA 1DF0A 4QB1A 4KH9A 3MKLA 1ZGJA 4B3AA 5A32A 4SLIA 1NQDA 3Q8AA 3GBFA 4OMDA 2NNYA 3S16J 2WADA 4XJ9A 2WY8Q 1PIV3 1TME3 2F4MB 3UKGA 2V5DA 3I97A 1RC9A 3KYLA 2O7OA 1QQIA 1ZR4A 4OMZA 4FPHA 2XLFA 3ZR8X 4Q4V2 2UXXA 2E36A 5JHUA 1B35B 1MZBA 4CPBD 2WR9A 5F5CA 1QY4A 5DDJ3 1V6OA 4XRFA 4TLGA 2F48A 2ES3A 1KFUL 1LU1A 2R49A 4RB2C 3BTJA 2YHJA 3GBWA 5FZ6A 3CCEI 4C1WA 3O1OA 3GX4X 1WJBA 4GDFA 3MIHA 4CEWB 1FV3A 1XSQA 4YGBA 3JTHA 3CCQI 5L3BA 1W9YA 5C71A 1EH8A 1H9PA 1Z7S2 5HCHA 1ZREA 2IS1A 3MDPA 5C4WA 5J37A 2JVGA 4BXFA 2OQGA 3OS2A 5IJRA 1XOYA 4BZ4A 3PVNA 4II2A 1QJX2 3QWLA 4A7KA 3FK7A 4JGZA 2D3SA 3FKJA 4IX7A 1H1AA 5KVRA 2O8QA 5FGMA 4AU7A 1DDLA 4FPGA 5FRAA 1SAUA 3CJTB 2GQQA 1Q8VA 1S0EA 5KWRA 3A03A 1SFNA 2B45X 4AEJA 4DINB 3NV4A 2XJUA 1DGLA 1SFPA 1G6NA 4AW7A 1LR5A 2XBO2 2DDAA 3GW2A 1EV7A 1BC7C 2VZTA 3A01B 2PEXA 1KQ0A 2K9LA 3T1BA 1OLMA 2VNGA 4LBLA 1NA1A 4K1YA 2DWRA 2D6NA 3MLJA 3GO5A 1S7AA 2WFPA 5LLQA 3POWA 4RQPB 1UY3A 1IPJA 3L2HA 3JXSA 1WA4A 2M4KA 4QPWA 1LAJA 3OJBA 1SBFA 4FPLA 1PZ8A 1FOXA 1K78B 5IWFA 1YHFA 2A71A 4NIGA 4SBVA 1T38A 1JBCA 1MACA 4IE4A 3IL2A 2WO1A 1WD3A 1XCBA 3GTLJ 4DB5A 3RTRA 1I39A 2WNUC 2YB7A 1DLLA 1ZGWA 5FRNA 1W9FA 3WTZA 5CVIA 4LEJA 4I99C 4CCNA 4E7KA 3S2HJ 5FP4A 4AVCA 4CCJA 2VUMJ 2OF7A 4FP2A 4B7EA 4KNCA 2XV4S 2VQGA 2W94A 1W04A 1SMYF 3FZ3A 4NPLA 1GSLA 4KG0A 2JPBA 4MHGA 3S32A 4LUKA 1DZTA 1JUSA 2CRGA 3GVAA 2JD4A 2ZXJA 3L2VA 3TNQA 5BNQA 1Y1VJ 4QGMA 4AFBA 3QD6A 1ENHA 1T8IA 1KYZA 1NE4A 2EB7A 1Y4WA 4AEMA 4L5IA 1CX4A 1GP6A 3SCHA 1WRJA 1WQ2A 3AK0A 2AREA 3I3MA 1IXRC 3NAPA 1HKQA 3WEZA 4Z2AA 4X0GA 2D97A 4E70A 2FJ1A 3VBSC 1R1ZA 2CNAA 3QPLA 3NWTA 1DU6A 2RV8A 5I93A 2VBPA 3BJ6A 3LSGA 2IBDA 3K4AA 3W5MA 3KEOA 3VLBB 4ENMA 5LA2A 4BJ6C 5IW0A 4H4KC 4KN4X 4XCBA 2K4BA 3O8HA 5JUVA 4EVIA 4XBLA 2VMDA 1AKHA 1LOFA 3X29B 2P5LC 5F6LB 3F21A 1GXQA 2Q4SA 2J5PA 1W6QB 2OC6A 4JP0A 2Q8EA 3DGTA 4LLFA 4IVNA 3VL8A 2GC0A 1RZ4A 2ZJ2A 4JQRA 4QGNA 1J58A 2BE5F 2WAQA 1UW8A 4Q0UA 4WVMB 3IMNA 3E1SA 3DXUA 3BN6A 3S1MJ 3WDYA 1ZBE1 4DBRA 4RBOA 3R05A 3N9QA 1TWAJ 4HPKB 3FHQA 5E18F 4DBQA 1WJAA 2UWAA 1XTAA 3AP4A 3EMRA 5C3PA 4DIQA 2FZ1A 3UNGC 3AL5A 2JICA 1POV0 4ZYAA 2RREA 1SFUA 2OA4A 1VBB1 1EPZA 2CUFA 3DWLE 5D8AA 3KP5A 2VNVA 2EVXA 2RS33 5FTTC 2JDYA 5J4YA 4HN0A 3CP8A 1PIV1 3L2CA 1PGW1 2DUPA 1K5MA 4QWQA 3HBLA 1FI2A 2HS5A 3K2ZA 3ILFA 1KDMA 1GICA 3VBUA 4E27A 1ZZCA 2FCUA 4BQXA 1TTYA 2WAEA 1YEWA 1FPN2 3ASOH 4E7SA 1TQIA 3K46A 1O4TA 2X85A 1OC1A 3SC7X 2JJ6A 3HXLA 2VJ5A 3JD72 2AENA 5DAQA 3KZYA 2KD7A 3LSDA 4QQLA 2O6GE 2DMPA 3FMRA 5E3NA 2VCAA 3IKTA 2E53A 2WZR1 2HKXA 1KU3A 2W2IA 2DOEA 4OI1A 4XQWA 4AF9A 2XKOA 1IGNA 2WV0A 1UOGA 3AMMA 1SLIA 3WG2A 4HK8A 5FPLA 1U5TA 3S17J 3PFYA 2DAOA 3SNMA 4CDXB 3OPZA 4NC6A 1LDDA 3ILRA 2ZHKA 3ZMVA 1ENXA 2ZGNA 1LKNA 1XMKA 4Z2YA 4YZ2A 3HQUA 3W6JB 3RRDA 2ZZJA 4CCLA 3OL3A 1ULDA 4HL0A 2G9ZA 4BE0A 1XX5A 2RS51 1WCKA 4N43A 5H9RA 3M3EA 5H6QA 5FO7B 2X48A 3GDBA 3QH7A 4WCG