1HW5A

The cap/crp variant t127l/s128a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
208
Chain Sequence
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVLAEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords CATABOLITE GENE ACTIVATOR
publication title The structure of the T127L/S128A mutant of cAMP receptor protein facilitates promoter site binding
pubmed doi rcsb
source organism Escherichia coli
total genus 60
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hw5A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hw5A01
4F7ZA 2VXZA 1QPMA 5HLHA 1U6GA 1OMIA 2FQ3A 3CDHA 1CAWB 1XE7A 2ZKZA 3J80K 1CAWA 3BPXA 4XFBA 4IJAA 2L01A 3MCZA 2D5HA 1O4TA 2HEOA 2ET1A 2OU2A 1UIKA 2RV8A 2EFNA 1XGNA 2YR2A 4KN7X 1USSA 3F22A 4HDUA 5JR7B 4EWDA 2E7WA 1HSJA 2A07F 3OGJA 4L9VA 5CVUA 1B9NA 3T8RA 1EY2A 2G7HA 1U12A 1U78A 1IXRC 1LEAA 5FQ0B 3CL1A 4MV2A 1LR5A 4A5MA 4E2GA 4LG0A 5FQ0A 4WX9A 1GQHA 2Q8KA 3SCHA 5IT9Z 5CVJA 2RC4A 3DXJF 1QXJA 1J2XA 1T39A 2I45A 5ICGA 2IC1A 2Z9OA 5DDGA 4S04A 1XMAA 4TLFA 2LDUA 1YW9A 2FF4A 3HUGA 4RGXA 3M3IA 2DLLA 4ZYHA 1TW2A 1H1IA 4EWAA 2F5FA 2V1XA 4LUKA 2Q0OA 1HW2A 1LVAA 3CJXA 4IESA 2G7UA 4YFNF 3VODA 3I0TA 4L9JA 1MJBA 4HSLA 1O7FA 5BV6A 2F5CA 2XAQA 2D5FA 2GZWA 1W4MA 3P9IA 4KICA 5D4SA 1CAXB 2D93A 1ZZBA 2P5VA 5ED4A 2V09A 2IW5A 3DEUA 3F6OA 5DUKA 2IXCA 4YRDA 4RGRA 5CLSA 4BIFA 5LHHA 1KU7A 3LAPA 2E1NA 4MX3A 1Q1HA 3CUQC 4L9NA 5FPZA 1BOAA 2A61A 3D0JA 4OIQF 2M5WA 4TV7A 5E17F 3JSPA 2VE8A 3REOA 5AIQA 3E6BA 1YW7A 4DNCA 2M87A 4XLPF 4KDPA 3BROA 3FXQA 1QZZA 1SFXA 4E2SA 4M74A 3KCCA 4Y15A 4P9GA 4LMYA 2LNBA 1SEFA 2Z2SB 1CAVB 4U0VA 4IPAA 4IRHA 5LRRA 3CO2A 2GC0A 3PQJA 5D6FA 4P96A 3I7DA 1J75A 2IP2A 2QCSB 1WA4A 1DUXC 2HKOA 4P9UA 4D7SA 1K78A 1DGRA 4Q4ZF 1Z05A 1EP0A 2FBIA 5E1RA 1ZGJA 3D82A 2NAZA 1XN7A 3G7DA 3VFZA 4LFUA 4I0BA 3N97A 5D8LB 2G9WA 1FBQA 5F1RA 3KZZA 1T0FA 3LA3A 3FJSA 4HYEA 2B0LA 4GULA 4XFGA 1NE4A 4CDGA 1ZZ9A 3VB2A 4WZCA 1WWXA 1AOYA 1P2FA 4QM9A 2XIGA 5FFXA 4KWLA 2GQQA 2P17A 3WTUC 1S7OA 3WODF 2QYOA 4UV9A 1S6LA 1KQ9A 5K8SA 1J9IA 5FGMA 5D5UB 3DKWA 2HQRA 2UXXA 3T8TA 2E1CA 2ZFWA 1FYMA 5I8SA 4QWQA 4G9YA 2VBXA 2P5LC 1LJ9A 1SD4A 2VBZA 3LAJA 4ON0A 1KU2A 4FX4A 3E5XA 2ZMEB 3O14A 2OZ6A 2C0ZA 1J3QA 2DK5A 2DPDA 4AIJA 2O1QA 3PQKA 2CAUA 3CF6E 2OQGA 3ELKA 2O8QA 2XLAA 2MHFA 2HQNA 2L02A 2Q30A 3HSEA 4RB1A 4R1HA 3U9GA 3TOAA 1XDSA 5BOXA 5EZWA 1T38A 3K1PA 4LLOA 3HIFA 3GFJA 1RI7A 3WTYC 2IXIA 2XGXA 1X82A 1JE8A 4MZUA 3SXYA 1IF1A 1TBXA 1G3YA 2PEXA 5AONA 4WVZA 2DQRA 4J1WA 3HRUA 5HS7A 1T98A 3ML6A 2Y0MA 2WTEA 3SCGA 2GAUA 5K5QA 3TNPB 3ISPA 3V7CA 3RIRA 3D5LA 3ZMUA 3FMQA 4Z2YA 2K4JA 2XL7A 1XGOA 2DPUA 3SHFA 2JTVA 2QENA 3VHRA 4FHTA 1PP7U 2RKHA 5D6EA 2QZ8A 1JHFA 4JV4A 2X0LA 3IRQA 4BQAA 1FBUA 3LFKA 5ICFA 5IT3A 3MYXA 5KHHA 4E70A 3ULQB 3GFMA 1U5TA 1EH6A 2H94A 3DF8A 4IF4A 1DPUA 2JSCA 1IZ1A 3D0SA 3HRMA 3R4KA 4J1XA 1Q5OA 3GFIA 2Q2EA 3ROUA 4L0ZB 3C3VA 4KN4X 2NNYA 4F8AA 1IXSB 5TJJA 4H7LA 1OKRA 4XF0A 1WSUA 3EJKA 4KIFA 4XFHA 4PGHA 5DD8A 5KHGA 5D5XB 3SMHA 3S7EA 5LGUA 5D4RA 3WTVC 3RKXA 4O9GA 3FX3A 4L9TA 5K5RA 3V4GA 3ABUA 4CHUA 4LK0F 2KIUA 1O3RA 3QU3A 4B09A 4A2UA 3ZMVA 3WTWC 3LQQA 1R22A 1GXPA 2M45A 3E97A 1QGPA 2IPQX 4GO1A 5E8IA 2Z99A 3GZ6A 4I98B 2V79A 3TNQA 4ASNA 1B1BA 5C8WA 4ONUA 4JK1X 2ET7A 5DUIA 4IRIA 5A2QZ 2FMYA 4OIRF 1FT9A 4EJWA 3RI4A 4UHTA 4BXUA 1XSDA 5KK1A 2ZKLA 3C7JA 3FXRA 5LHGA 4U7DA 3KMHA 3GWZA 4ENKA 3E5QA 4Z82A 5HI0A 3BU7A 4XF4A 2IA1A 1DGWA 1PUEE 4PIZA 5JSPA 3HOSA 5HDNA 2M8EA 1YWKA 3T1BA 2R7DA 1NHAA 4MGKE 1O3SA 1HKSA 2Y75A 1XD7A 1RGSA 2DAOA 5J8FA 3H3UA 2HYFA 5DYMA 1PP8F 1TQPA 2PHLA 4MH0E 4PJYA 3FZ3A 1BI0A 3VEPA 2EAAA 2E7XA 2A68F 4I0AA 3GO5A 1OYYA 2FBHA 4LB5A 1TQ5A 3MZHA 3CTAA 3MAJA 4I09A 5JR3A 4HOBA 1J59A 3PNAA 5HDGA 3JAMK 3HT2A 3UKVA 2YX7A 3WGHA 1IAWA 4HQEA 2VN2A 4O3MA 3HQXA 5FDBA 5FLXZ 1XGMA 1Z6RA 1G3TA 3KP7A 4HF0A 1WI9A 4MTEA 1ZG1A 1R1UA 2K0GA 4OFGA 1I27A 4L2NA 4UV8A 3DL3A 3H8UA 3M8EA 1F1ZA 2P7VB 4ENMA 5I0TA 5F6FA 1YFUA 2V6CA 3RKWA 5JFRA 3DN7A 5KHKA 1BI3A 3FE5A 1BC8C 1YQAA 2WFPA 3MEXA 3TDUC 3KP6A 4L11A 3MFKA 1I6XA 4U0YA 4KL1A 3IKVA 5BQTA 5E16A 2W84A 2R3SA 2OBPA 4EM2A 2XKPA 4NHJA 2OA4A 5DCMB 3ZMZA 1FLIA 1J3PA 5EFUA 4HQMA 2Y48A 2EFQA 4IEQA 2IXLA 3ES4A 1EH7A 1MGTA 2ADUA 3K9TA 1VP6A 2DCTA 1BI1A 3ST7A 4HN0A 4D0PA 2VONA 3WE2A 3ZMTA 3V8LA 2LKPA 2H09A 2IA2A 2YX4A 3C1DA 2D2WA 1UB9A 1ZZ8A 5JHUA 3CUQB 1X8EA 4EROA 2BGCA 4LULA 1H1MA 2K02A 3GLXA 2PFBA 3GUDA 1D5VA 1FYLA 5E20A 2F5DA 4HF2A 3S0MA 1IUYA 2CWEA 5DEQA 4MUVA 4WXCA 2CYYA 2XV4S 5I0SA 1R36A 2PJPA 1YUDA 4LGWA 3H50A 2O3FA 3F23A 2EJRA 1STZA 2ZNZA 2FNPA 3IWZA 2VECA 3FF5A 1ZG5A 3I58A 4PDKA 2XAFA 4CO8A 2K9ZA 1FPQA 4HW0A 2R7FA 1KQ0A 4IEVA 4OLLA 1LKNA 5BPIA 4IEXA 3IHUA 2WV0A 1T6SA 1OR7A 2OYZA 3WTXC 1WRJA 1V70A 4XF1A 2FMLA 3UKNA 4UXNA 3BALA 2EV0A 2BV6A 2A3SA 1F4KA 1O57A 1QBJA 1IN7A 5L3EA 3EETA 1MDMB 2MPFA 2AS5F 1IW7F 1MDMA 4EQQA 1YFWA 1ON1A 3GBFA 1LDDA 4Q0VA 3FFQA 1Z7UA 1RZ4A 4S05A 1AWCA 2PQQA 1QO0D 5HDKA 4ZYGA 3E6MA 5JVTA 5CVRA 4HBLA 2CGPA 3DQVC 3I54A 1RUNA 4EV0A 4G8XA 1W7PB 3ELNA 2XAGA 1W7PA 4QLCU 3BPVA 3G3ZA 4KIGA 4A12A 5J7MA 1XDUA 4G7ZF 3DV8A 3NKTA 2F4PA 1P4XA 1JHHA 2PBIA 1YO5C 2XHKA 3HSRA 1LQ1A 1ZLKA 2BNMA 2UY8A 4Q5SF 3VOEA 3FHZA 3BJOA 1PM7A 5I8YA 4JQFA 2ZXJA 2Z69A 1ZAOA 3DPTA 4IETA 2O8XA 2D1VA 2IXJA 1CAXA 4L18B 3NJZA 3U1DA 2KIFA 1L3JA 1LDJA 3SFZA 3V7RA 1B9MA 5LGTA 3QPTA 4IEUA 2DK8A 1Y9QA 1BI2A 5FFZA 3R60A 4Y17A 5L3BA 1OYIA 1FNNA 1FSEA 3GXOA 3P7NA 1W7PD 2EA2A 3SQNA 1UHMA 4I3PA 5HS9A 4K8FA 1ZG3A 3C3WA 4MGZE 1W5SA 4AVCA 2RDPA 4HVOA 3EQEA 4N9IA 1PMIA 4JTOA 2OA2A 1KYZA 2JRTA 4IEWA 1NYWA 5I8TA 3FM3A 4G6QA 4N0BA 4A0XA 2CSOA 3KP2A 4GYIA 3H1MA 3NQOA 4XFAA 2Z5UA 2VOPA 4Q48A 4O6JA 4LJZF 1CAVA 3R0AA 1ZHFA 1F5TA 3IDBB 2KJBA 2VPVA 4CGZA 1NE6A 2CAVA 5FLJA 5LEKA 2OZJA 1YS7A 5FPXA 2IJLA 4R8HA 3EQLF 4WK8F 1S8NA 3HSFA 1LEBA 2IRFG 4M73A 4KWKA 4P5OA 2VT2A 1KU9A 5LHIA 2FE3A 3EUHA 3IKTA 1VTNC 4I2OA 1OI6A 3JTGA 1LNWA 2RGVA 3GF2A 2Q4SA 3RYRA 4HLTA 3M7GA 2V9VA 4BNCA 4I7HA 3RYPA 3H9AA 3NVCA 3CO7C 2STWA 2QUFA 1H9TA 4UXAA 1GVJA 4ETSA 3R61A 2H6BA 2TDXA 2FU4A 2P7CB 2COMA 4WXDA 2WC2A 3NL1A 3LSTA 4FAGA 1ON2A 1MD0A 3KP5A 3ZN0A 1NXMA 1HBXG 5EEGA 4X6RB 3BP8A 3M9AA 3CLOA 1R1VA 4IVNA 1P92A 2ESHA 3LAGA 1XSXA 2EFPA 2ZMEA 1ZN2A 1E17A 4QGNA 4NB5A 5H6QA 2ACJA 4GYGA 3BCWA 1BBYA 4UVAA 4YARA 2D1HA 1Z9CA 2M30A 1Q43A 4AXOA 2GH2A 3KFWX 1ZYRF 2CQKA 1FP2A 4KU7A 4YIFA 1KGSA 4A5NA 4XFCA 4DINB 3F6VA 1TNSA 3MWMA 4L5IA 1IPJA 1L3LA 2QBYB 2PTMA 4YIIA 2DI3A 5L3DA 3SZTA 1CGPA 4YYOA 3J81K 1B6AA 3BWGA 3F21A 4D7TA 3WW3A 2X4HA 3J80Z 1XRUA 4Q0SA 3WU0A 2PAMA 2KRFA 2XRNA 4FX0A 1CAUB 4LLGF 1SD5A 2VE9A 3C18A 3LA2A 1GXQA 2A6EF 1U3EM 3LOIA 2J5OA 3O3KA 3EO6A 1IRFA 2A6HF 1WLTA 4A0YA 4DQ2A 3T5XA 1R5GA 3TDZC 1A04A 5I0UA 2BNOA 3M1EA 3FHIB 4LD5A 3GYHX 3L9FA 5I93A 2HFHA 1ZARA 1BN5A 2MC3A 1DP7P 3PLQA 2XLGA 4UBHA 4AVAA 4A6EA 3KP3A 4NVPA 3BY6A 1WGPA 5BPXA 2JPBA 2Q1ZB 4CXFA 1MKMA 3W6KB 2B8MA 3BJ6A 3K69A 4KUMA 5D5WB 3ACLA 5BUVA 4EJOA 3JZVA 3ZDSA 3IL2A 5E8GA 3USSA 2QWWA 1ZZ7A 2ETHA 4HX7A 3V8KA 5AIPA 2RVCA 1D3YA 1NZCA 2EA7A 4HV5A 2Z3YA 4RS8A 3DPLC 2ZCWA 3G73A 4BHPA 4QM8A 4L5JA 4HV6A 4IHTA 1RUOA 2FOKA 3GYDA 1OD5A 3RPQA 2DQLA 2XAHA 3E6DA 3KGLA 4HA8A 4U88A 2ZBKA 3K1MA 4EJTA 5IT9K 3I59B 4P9FA 1YYVA 3I59A 3M8FA 1K6OA 3IBMA 4UVCA 5BMZA 5CVIA 3L7WA 5AVPA 2OQRA 3BJAA 2UYBA 1YHFA 3E5UA 2ZO4A 1ZRRA 4AIKA 1Q3EA 1KYWA 1SMYF 1OYWA 4O5VA 2UYAA 2STTA 5ICCA 4EJUA 3QP5A 1YW8A 4META 4RD7A 1OPCA 4PCQA 2ISYA 4XSXF 3FXUA 3WE3A 3RPUA 3GVAA 3H3ZA 5FB2A 2IXHA 4UNOA 2VC0A 2QM3A 2D40A 1S29A 3F8NA 4KFCA 4O9EA 2DT5A 2AXLA 2L54A 4OU0A 4XEZA 2O0YA 1RNLA 3EYYA 2NYXA 2B5HA 2PYTA 1J0RA 5ILVA 4EJVA 4OIPF 1FZPB 2QVOA 3RDIA 3V7SA 1ZRDA 4ORFA 4EGZA 4M71A 3U0ZA 4ZU4A 2VOOA 1MZBA 2OAZA 3GX4X 4IEOA 2IVMA 4OINF 3L09A 4QXKA 1J7KA 1CF7B 5I91A 4FAHA 4Q0UA 4QX5A 3H1YA 5E1XA 3HT1A 3IWFA 4IEZA 4GGGA 3I64A 2HYGD 1LB2A 4X6QB 5I0RA 2MH2A 2UXNA 4E2QA 3CEWA 1U5TC 4PIYA 4HZFA 1G4DA 3OD0A 2LSOA 5L3CA 1UCRA 3NRVA 3O2PE 4KMUX 1IPKA 1DDNA 1XE8A 3FMRA 4Y13A 5L3FA 5L3GA 3WU1B 1K7AA 2QNKA 3KLOA 2NRAC 4YFXF 4MGRA 1SMTA 2KKOA 3B73A 3WW1A 3I71A 1FSHA 4HVRA 1UW8A 5E1ZB 2GIVA 1F9NA 1V3FA 1V4RA 2O03A 4ZZDA 4G7HF 3SZPA 1SFUA 3ZN1A 2FQPA 2P6TA 4HBNA 2DW4A 5E18F 5ILUA 2ETEA 2FNAA 2UWMA 4RGSA 5EEHA 4RGUA 4BHBA 3NSTA 3LWCA 1D8JA 2P6SA 4ZYDA 2DO7A 4OMZA 2GXBA 2B9UA 3QRFF 5KHIA 1XSVA 3TO7A 4MEYF 3WGIA 5DCMA 2FRHA 2QVSB 1ZREA 1QQIA 1MJ9A 3R0JA 4IXAA 4WF2A 3QAHA 1DZTA 3F8MA 5BS6A 2RQPA 1ZRCA 5LLQA 3ES1A 4EM0B 2L3DA 2XROA 2W25A 1JXSA 1UHWA 5HOOA 2JZYA 5ICEA 4G6DA 3KSCA 5KHJA 3CUQA 1T2KA 3QU6A 3TGNA 2VT3A 2EA4A 1O7LA 1XMKA 4CYDA 4LB6B 2FXAA 1QNTA 3LQRA 3L2HA 3ZMDA 2HGCA 2GC2A 1IN5A 4XF3A 4EWEA 2NNNA 5JAXA 6PAXA 1I5ZA 5J8CA 2YPRA 2PHDA 4LA2A 3HTSB 2PFWA 4A6DA 2VC1A 2HTJA 1D8KA 4LTAA 1FBSA 2DTRA 1UIJA 2HDCA 2K4BA 4HF1A 1C0WA 1EV7A 1Y0UA 4XRFA 1R1TA 1O5UA 1ZZ6A 4OMYA 5DD4A 2C6YA 3LWFA 5LEJA 4KIBA 5FO5A 4EMSA 1QZYA 2RNJA 3HYIA 2VQAA 1L0OC 2PAEA 1SFEA 1RL3A 1ODDA 2BYVE 4JBAA 3BPZA 2KXLA 2P5KA 3KGZA 3F8BA 4OOIA 2LF8A 4BYYA 2GWRA 1RTVA 4LLNA 3H7JA 5HVQC 4LG0B 3SXWA 3V8JA 2DBBA 4UBGA 3F72A 3K1NA 4XFFA 1TNTA 4PIXA 3H92A 2HWVA 1UPIA 1SD6A 2OZUA 1S7AA 1E2XA 1ZZCA 1XCBA 1SAXA 1ZLJA 4R52A 3IDCB 2JT1A 2QQBA 1K79A 2MD5A 4YFKF 2ZJ2A 3F3XA 1O3QA 5KBFA 2CO5A 2HS5A 4L0YB 2A5YB 2QDRA 2M1BA 2GC1A 2BEOA 4XBFA 1H9GA 2VBWA 2LF7A 4Q47A 3TQNA 2H27A 2K86A 1J58A 4HVQA 1BIBA 1O5LA 3KEOA 2MLGA 2QLZA 2YU3A 1YTYA 1J1LA 2EK5A 4QMAA 1KU3A 1DZRA 4GCVA 2JPCA 3IRRA 1ZVFA 1HKQA 3ZQ7A 4HX8A 2PMHA 2H0VA 1HW5A 4U7BA 1UFMA 4M6XA 1R00A 4ESFA 3R6SA 3FMSA 4HLYA 5JSOA 3RKYA 4BAYA 4YNIA 2XAJA 5LBQA 3COAC 5A2QK 3ETQA 5H20A 3JAMZ 5J6XA 1ZGAA 2PMUA 4LUMA 4BHCA 1R58A 1BIAA 1YLFA 1FI2A 5D1IA 4KT5C 4B8XA 4ZU7A 3EBRA 3EYIA 3N4MA 1R7JA 2FA5A 1BC7C 3LA7A 3ZMSA 2XL9A 1FYKA 2P8TA 3H7YA 1K78B 3NW4A 2P4WA 1I1SA 3T0YA 4Z07A 3K2ZA 3Q9VA 4RB0A 1J5YA 3O6BB 2EVXA 3WTTC 4I02A 3E6CC 3CLPA 4CZZA 2IXKA 3BB6A 1YFXA 1TW3A 1QXRA 4H0EA 1FWZA 3L00A 4XETA 2BBYA 2MLKA 1Z6TA 3EDPA 2ESNA 3L2CA 4AD9A 4MTDA 4Q29A 1HKTA 2EFOA 3ECOA 4ESBA 4HDVA 4HAMA 1ZRFA 5CJ9A 4XF9A 2KJCA 4G94A 1ONVA 2WWYA 4IEYA 3WTSC 3U10A 3K0LA 5FLXK 4PZJA 5LGNA 5KVRA 3Q9SA 3SCFA 1ZX5A 5CVVA 1YS6A 4WBBA 3WW2A 4WCGA 5FLHA 1S3JA 2HKXA 2RN7A 4AVPA 2UY9A 1TTYA 3ABTA 2QQ9A 1SQ4A 3WTZA 3BOQA 3TKYA 5JI6A 5BY5A 3GZ5A 3TO6A 3EHKA 5E1WA 2W24A 4N9HA 1EPZA 1UD1A 3WW4A 2CV6A 2GA2A 4MNUA 1XGSA 4CICA 3CUOA 1FY7A 4XLNF 2OPKA 1RIOH 1R23A 2CFXA 2MNGA 5JCTA 3QP6A 4BH9A 3TOBA 5BPDA 2PN6A 2XKOA 3Q5FA 2HJIA 3ZP5A 4MGIE 4KWJA 1O3TA 2GXGA 2HTSA 4OIOF 3QACA 2QBYA 4ZYEA 2Z33A 2D45A 3P9KA 1IN4A 2PG4A 1GQGA 1IN6A 2IA0A 1MJAA 5HS8A 4KYWA 3KZYA 1CAUA 4YG2F 4KMFA 4AIHA 2ELHA 3BDDA 3FZVA 3BZ6A 3U2RA 1P4WA 3HOTA 1HSTA 2CG4A 2FBKA 1YLLA 3OCPA 4ZZLA 1Z1DA 3KE2A 2VODA 2J5PA 2L4AA 5ERIA 3I5UA 4MEXF 5T3NA 5JSRA 1UCXA 2F5EA 3MPBA 3IIAA 4HMZA 1I1GA 1TQIA 3JSOA 1CX4A 3U11A 5CYVA 1U5TB 2V1DA 3FWEA 4HN1A 2HOEA 2GC3A 4UUVA 3MDPA 4P55A 4ZH4F 3B02A 2PA7A 4FT8A 4G7OF 3OV8A 4IERA 2Y0OA 1OFNA 2EFWA 4KA4A 4NQWA 2O6GE 1TQMA 1HQCA 2L4MA 4JTNA 1YIOA 3RYKA 4HX4A 5FD5A 4AVBA 3RZZA 1XB4A 4U0WA 1PDNC 3IC7A 1JGSA 1P4AA 5J3UA 3LZZA 1FP1D 3CO6C 2K7LA 5ILSA 4M72A 1VJ2A 1USTA 4RAYA 4MQVA 3ZPLA 4M9ZA 3WG9A 1X8MA 4I01A 1YFHA 3DP7A 5LRSA 3JTHA 1YG2A 5HLIA 4KNYA 2IT0A 4LK1F 1X3UA 2E9QA 3PVBB 4LEJA 2EB7A 2PQ8A 1TLHB 2CW0F 1FXZA 4QGMA 4ZU5A 2XASA 4RAZA 1XCVA 4AWXB 1BJAA 3KETA 3GFLA 1LRHA 1FC3A 3J7AO 3HTUA 2XVCA 1IRGA 4Q0QA 4M9SA 4GXOA 1J3RA 5K5OA 4EGYA 4XFIA 5K1YA 3H1WA 2H6CA 3KEQA 5F64A 1WKMA 3PFIA 3RNSA 4IEPA 4K2EA 4EM1A 1BM9A 1VR3A 1G6NA 1Z91A 1HW1A 2EV6A 3MQ0A 2XLFA 3JW4A 2PAKA 2Q0AA 1IN8A 1P6RA 2XUBA 1QY4A 2W85A 5CU1A 1LDKB 4LA3A 3M70A 3WGGA 1W5TA 3QOPA 2V1UA 3DFGA 1RC6A 1B59A 4M6YA 1IXCA 3OOPA 4Q0PA 2HR3A 4PGGA 5HLGA 2PLYA 4MQ9F 2PI0A 5J48A 3S2WA 2MBFA 3GW2A 1SD7A 1CF7A 1U2WA 2EV5A 3HRTA 4QGLA 4ENNA 3OF1A 4YSFA 1U8RA 3HRSA 5C6CA 3FM5A 1KA8A 3HHHA 2F2EA 3TO9A 5D5VB 4A0ZA 4LLLA 3RTRA 4RB2C 3SHRA 2DFIA 2K27A 1G3WA 2ZNYA 3MZYA 3CJNA 3F8FA 3UKTA 3ECHA 2HZTA 4ESJA 3I53A 4EVIA 1KQ8A 4IRGA 5DV5A 2KIMA 4MGYE 3W6JB 1SFNA 1FX7A 3HHGA 2BE5F 4MHGA 2EWNA 4ENJA 2VBYA 3QPHA 2BNNA 1X7NA 2UZKA 5FLIA 4AQ6A 1ULYA 3KLNA 3AAFA 5D8KB 2NS0A 4HLXA 4KU8A 2DU9A 2MH9A 2GA1A 1JUHA 5FD6A 1ZNPA 2FSWA 3OTFA 4WXHA 1Y3TA 3S7IA 2ATFA 3F8CA 5TRDA 1DPRA 1EYBA 3NEUA 3ERED 3J81Z 2OD5A 1G3SA 3P9CA 4B29A 4AQ2A 1HXDA 3KP4A 2YSRA 1WQ2A 2A69F 5H6RA 4HSJA 5BXXA 4FBFA 4JVAA 2ISZA 1R5HA 5CADA 4IHSA 5DCFA 5FCCA 4R79A 4RB3C 1REPC 1B4AA 2FEZA 1EH8A 3GEZA 1ZH5A 4XSZF 2O61A 4WWCA 4UVBA 3E3VA 1H0MA 3I4PA 2QJVA 1YFYA 4M9XA 1QWRA 2GU9A 2W57A 2QQAA 2N7GA 3RJPA 1GHCA 1FOKA 2MA3A
chains in the Genus database with same CATH superfamily
1SBEA 4BDYA 2VXZA 4IQJA 3TYJA 3DBHB 3EYPA 4GWIA 4QPOA 1XE7A 2Q5TA 2ZKZA 3J80K 1W8HA 4BCUA 3THCA 4QX3A 4NIDA 2OIIA 1LTEA 2M4KA 1FATA 3K4NA 2D5HA 1LCLA 5E79C 2E5ZA 3E7LA 5DXDA 2EFNA 4K21A 1XGNA 2YR2A 4HDUA 1HSJA 2A07F 2HWC2 1C1FA 2QBXA 4IQPA 1B9NA 2C1FA 2G7HA 4L5EA 3VBOB 4Y4YA 2A6WA 4E2GA 1PO13 3VBOA 4WX9A 1D4M3 3SCHA 3PL8A 4V2FA 1QXJA 3MMYB 5T50A 2WLQA 2R7QA 5H9QA 2IC1A 2WNVC 3HUGB 2P81A 3JQWA 1LGNA 2LDUA 2JK3A 2C5DA 3DU6A 3HUGA 2HWF3 5CFCB 2E1MB 3RQ4A 4JGYB 4A3ZA 1QJY3 2ARBA 2FDJA 2G7UA 3F95A 1U5IA 4CCDA 3CDLA 3Q0VA 3ZCOA 5BV6A 3OEBA 2D5FA 4AC0A 4ISRA 3TL4X 1CAXB 2D93A 4BQNA 3OYAA 2CV2A 1U9NA 5ED4A 4QPIC 2IW5A 1JMUB 5DAXA 3AL0B 2ZEWA 5FYZA 4N43B 1JZ8A 5CLSA 2VQLA 1RINA 5LHHA 4FPEA 3QPSA 1KU7A 3LAPA 1WW7A 4ITCA 2AENA 2V4AA 3OIPA 1UN1A 4IL7A 1GP4A 4OIQF 1PMJX 4TV7A 3MUZ1 3SEZA 3VBFC 5LK5A 2ZBJA 3JBG2 3SFIA 4ZKTB 5AIQA 3E6BA 3B69A 4A45A 1YW7A 2YC2A 3CQZJ 3BROA 1SFXA 1UX6A 2YFZA 5K7HA 3S93A 4A3FJ 1SEFA 4YW5A 5FPUA 1DQ0A 2GC0A 2V72A 1RVF3 2W46A 1VFCA 4NWVA 4P96A 3I7DA 2VCBA 1DUXC 2JDUA 4UF0B 2HKOA 4D7SA 1DGRA 1AUYA 2NAZA 1XN7A 5GALA 3QOEA 4I0BA 2F17A 4Z2AA 4J6GA 2G9WA 5F1RA 4YM3A 2F4MB 3FKJA 3KZZA 3FJSA 2VXRA 1WJ5A 3N05A 1NE4A 1EJ9A 3BR3A 4CDGA 1QGLA 1KITA 2XIGA 1EF4A 2R073 2GQQA 1CPNA 3PVNA 2K9QA 3VD5A 2ZJCA 4CUGA 1S7OA 4YFZA 1JKPC 1H4HA 5FGMA 5AC92 1UY2A 2JDPA 2HQRA 1ACIA 3WF3A 3POWA 4NHXA 3IP4B 2P5LC 4CYCA 1LOFC 4FX4A 3E5XA 2DK5A 2DPDA 1SFPA 4QHOA 4HNVA 4B1MA 4BK5A 3NNGA 3BTCA 3ELKA 2NYYA 2XLAA 2MHFA 2E6VA 3LPGA 4DUVA 5FYCA 1VQNI 2VAUA 4LLOA 4XOTA 1X82A 1IF1A 2R92J 4W65A 2X6WA 2WTEA 3SCGA 5K5QA 4RSUA 3AJZA 3ISPA 3V7CA 3A4UA 1W0TA 4Z2YA 1XPXA 3LSDA 2Z42A 4JRLA 4OHWA 2WQZC 5FUNA 3NWKA 2JTVA 2UURA 3I97A 5C5TA 3AXEA 2O14A 5D6EA 1JHFA 2V5YA 1MQTC 2ZHMA 1X4OA 3EUAA 2ZS6B 4A3MJ 4EJRA 3IRQA 3OGVA 4AYBA 2CGOA 2ENRA 4E70A 3GFMA 4COUA 1EH6A 1YCIA 2Q2EB 3HRMA 4J1XA 3FXJA 2Q2EA 3ROUA 3GTPJ 3K10A 1WMEA 1SG3A 1IXSB 5JLXA 2F4IA 4LHNA 3WQBA 4D69A 4JGZA 3AKTA 3EJKA 4YW2A 1LUJB 3WG1A 3KIOA 4M0HA 2Y33A 4BE1A 3KV4A 4BQYA 3FX3A 4L9TA 4QPGC 4JX6A 2XBO1 2NP0A 4X6AJ 1RUF2 3R4UA 4CHUA 4D5FA 3WNNA 3ZN4A 3QU3A 1JTYA 1D0XA 2AC1A 4N90A 4XDPA 1PVXA 3MKLA 3VYUB 3LQQA 1R22A 1GXPA 4XLEA 1X4PA 4I98B 2V79A 2EF6A 2VU9A 2R6QA 2A71A 1B1BA 3VYTB 1D2QA 2ZX2A 5JVVA 1O91A 2ZMLA 5DUIA 4GKYA 2WBKA 5A2QZ 1FT9A 4UHTA 4HANA 3UNGC 1UL9A 1N75A 3PJQA 3KMHA 3BR6A 4ZDLA 4ENKA 5IP6A 3CBNA 3Q0UA 3I2OA 2IA1A 3AP6A 2ZTNA 3J8F1 1SLTA 1AL0G 1G8XA 3HOSA 1WHUA 4B3AA 2WO7A 1Z0HA 4MGKE 5JUVA 1TWCJ 3QYBA 4QB2A 4IHWA 2VZSA 5DYMA 3HOBA 1TQPA 5EJ1B 2PHLA 1PZ8A 3HQUA 1YI7A 1NLRA 2ZKNA 1JOBA 2DA2A 1UYXA 4C30A 5GLWA 2HEYF 5HCBA 3DF0A 2W1OA 3VEPA 3DPRC 5LATA 1OYYA 4FPGA 2VQTA 3ZOBA 3NJVA 3NMBA 1DU6A 3ACGA 3PNAA 1O4YA 2VNOA 1EV13 3UR3C 2I8DA 5IYDJ 3WGHA 3PO3J 4Y1UA 5J47A 4RAFA 4HQEA 1IAWA 4XDQA 3HQXA 2XPJA 5FLXZ 1B09A 2CQQA 5FPBA 1H2KA 4HF0A 1UU4A 1WI9A 1TE1B 4II3A 4CDUB 1D0YA 1MS0A 4OFGA 3THTA 3MLJA 4UV8A 5DDJ3 1QQP1 2WADA 3H8UA 3M8EA 4DBRA 1WCSA 4YRVA 4BQ2A 3DN7A 1W0UA 4P9WA 3N35A 1AYM2 1IGNA 3TDUC 1CIWA 4D6RA 3TWIA 4DXZA 3JBG3 4KL1A 1FMWA 3IKVA 5E16A 4YZ5A 1PX3A 2OBPA 2AACA 4NHJA 3QYFA 3ZMZA 4BUPA 4XUTA 4HQMA 2Y48A 2EFQA 1FOD3 3ES4A 2VJIA 4K3UA 2ADUA 1BQPA 2DCTA 2JXAA 3S2DJ 3ST7A 4C2MJ 2EIGA 3F2ZA 2PHRA 3WE2A 3PUSA 4FPYA 4Q4W2 2NLRA 1JUIA 4WM8B 3H35A 3C1DA 2WB1A 2D2WA 3ZQIA 2P4EA 1FIPA 1RUE3 3CUQB 4HONA 2K02A 1D5VA 5E20A 1WJDA 2F5DA 4J00A 4MUVA 2CYYA 2HWE2 1NLSA 2ZA9A 5C9AC 4ZXEA 1MBFA 2V26A 1VMHA 1XNKA 4LGWA 4S0HB 3F23A 2ZNZA 1STZA 1HQLA 3LE0A 2DMNA 1PIV1 2Z16A 4YZ4A 4L97A 1FPQA 3OMYA 1OVPA 2Q8DA 2W2IA 5CISA 1XNDA 3FFZA 3P5JA 3NKGA 1LKNA 5FZ9A 1YJKA 5BPIA 3I2IA 1Z0XA 2YHJA 2JDMA 4D94A 2OYZA 3VUOA 4PJ0C 4P08A 4L8QA 4OWRB 3HNBM 4DIQA 3I8TA 4BQ1A 1MS9A 3ZDVA 1RUJ2 5FXXA 1LENA 2J1SA 2WJSA 3MGUA 5L3EA 5M3FJ 5ABJC 2LYCA 3EETA 3CJIB 2WR9A 1W6QB 4EQQA 4D7MA 1VRH1 4YGEA 4OUSA 2L9VA 4Z1VA 4XZPA 3FXKA 3HN1A 5FPLA 4M3EA 4S05A 5HDKA 3E6MA 2DT7B 4HBLA 1FMVA 2VZPA 3I54A 5E3NA 1RUNA 5F2SA 4G8XA 4DYRA 1W7PB 3ELNA 1W7PA 5J7MA 2R041 3HGYA 3DV8A 5K0UC 2P3IA 4DO0A 3OYDA 1P4XA 3LSJA 1LQ1A 1ZLKA 2BNMA 2J7MA 3FHZA 4AW7A 4BQ4A 3NNMA 2Z69A 2O8XA 2D1VA 2NOJB 3TMOA 4UOJA 3GBGA 2NM1A 1VBA2 1B9MA 4CCKA 3QPTA 5KXCA 5FFZA 3R60A 4YW1A 4JQRA 4XCBA 5C7GA 1OYIA 1FSEA 3GXOA 1YIFA 4BGDA 1UHMA 2MW8A 1RUH1 1MPXA 5EP9A 4LLFA 1W5SA 4AVCA 4R9CA 2JA5J 4LBKA 4N9IA 1PMIA 1W9SA 1XE0A 2JB8A 5FZ8A 1KYZA 1O4XA 2R1BA 5I8TA 2W4SA 5KAFC 1MMDA 4YGCA 3N7KA 2Y0SA 4EEFG 3T30A 5HV4A 2Z5UA 2DFEA 3KQRA 2VOPA 4URAA 4XJUA 3H8XA 4LKDA 3ENRA 4LJZF 1CAVA 2RJ2A 4XQFA 3N3HA 1Y1WJ 3IDBB 2H0BA 4IXLA 1NE6A 5FLJA 3ZM8A 1YS7A 1A31A 2R1DA 3BKZA 2JSPA 5E3OA 1T8IA 4MYEA 1S8NA 1LEBA 1PVC1 2IRFG 4M73A 2VW0A 1ONAA 1H30A 4N53A 1E3PA 2W92A 3WEZA 2XR4A 2IS2A 1LNWA 4BBSJ 3RZGA 4FFHA 4Y5SA 1QJX3 3M3OA 4HLTA 5LK7B 4I7HA 1BEV3 3H9AA 4CRQA 2XG3A 1X1PA 3ZQQA 3ZFGC 5DQ0A 2FUG2 2ZXQA 1GP6A 1DLLA 2ES3A 2P7CB 3NL1A 1P9QC 3S57A 1BKZA 2QDNA 2XJPA 3BP8A 3VHNA 3RQIA 3WQ1A 4S2FA 3ZQCA 1TT0A 3IPVA 2EFPA 4CEWB 5HV0A 5JI7A 4FQZA 1ZN2A 3OGRA 4CEWA 2ACJA 3S8PA 3O0WA 1ND3B 4FFFA 2D1HA 2H1LA 5M5WJ 3O8GA 5C4WC 2XONA 5C8CB 4KU7A 4YIFA 5C8CA 4DINB 4RQPB 1GV9A 1QU0A 5E88A 3PUFA 2PTMA 3JB8A 1HV1A 1LFPA 2ZAAA 3LIGA 3SZTA 5B1AH 3AP9A 1B6AA 3BWGA 4D7TA 4ZYAA 1XRUA 4Q0SA 5FV3A 2E36A 5JDBA 2VIXA 2ZC2A 5FZOB 2GMPA 4UFMA 3C18A 2XJUA 1CZVA 3K4DA 4Q4Y1 5J98B 3C2HA 3KVBA 2EH3A 5FZCA 2DFBA 3HKZA 2CWSA 2J5OA 3O3KA 4WM7A 1A5JA 1D5YA 3DXTA 4A0YA 4DQ2A 5CKMA 1R5GA 4URTA 4QXBA 3T2OA 2A7AA 2DT6A 4BB3A 2HFHA 2LY9A 1ZARA 1RXFA 2FHRA 1CVNA 1DP7P 3BIWE 5DUUA 4PF1A 4NVPA 5FMOS 2E60A 3MIGA 5FMOL 5A3UA 4B1LA 4JC1A 5DUXA 4EJOA 1PK6A 5E8GA 5DAQA 2OF7A 2QWWA 2E63A 2LUWA 3KWVA 4HX7A 3V8KA 4XIDA 2W68A 4JX5A 5AIPA 1MMSA 3PVEA 3CCUI 3UJOA 1VBD2 2ZCWA 1DQUA 3PUHA 4QM8A 4L5JA 4HV6A 4XOGA 1ZBA2 3BTAA 3GYDA 4PI0A 1QJU2 4HFSA 3E6DA 3KGLA 1RUG2 4K1YA 2ZBKA 3I59B 3FBIB 1OLTA 1TNRA 4ZS3A 3U21A 4IV3C 3I59A 4YGDA 3J7HA 1TP4A 2HWE3 1K6OA 4QQPA 1OSGA 4UW5A 3G4SI 3HC7A 3TN91 4EN9B 2OQRA 3BJAA 1JHNA 3DUIA 1W2NA 1RMU1 3E1F1 1KYWA 4O5VA 2STTA 2Y34A 4META 3KT4A 2YPJA 4BACA 4XSXF 1RUJ3 2KR2A 1HJFA 2JECA 5FB2A 2VC0A 3AJYA 5FRMA 2AXLA 5ACA2 2O0YA 3AVSA 3K51A 3EYYA 1AR81 1W5CC 2NYXA 3DCFA 4BPZA 1DQ5A 4XCAA 5IAXA 4EJVA 2NVXJ 4OIPF 4HPKB 2QVOA 3ZXJA 3RDIA 3GTKJ 1C8M1 4MFDA 3V7SA 1ZRDA 3OG2A 4IV1C 4ZU4A 1VBB2 3J7MA 2VOOA 5IVJA 4OINF 3L09A 4QXKA 1Q8OA 1CF7B 5I91A 4FAHA 4Q0UA 1DQ6A 1W2TA 4QX5A 3CCMI 1R1A3 3HT1A 4CUAA 4GGGA 1YOVB 1K5MC 5LBCA 1HLCA 3W59A 2MH2A 3AZXA 2R7RA 1TWGJ 2LD5A 3OD0A 5L3CA 3JRGA 3PTRB 1RUI1 2E32A 1TWAJ 1UMQA 1XE8A 1K7AA 3WU1B 2YG0A 5FZLA 3MLLA 3LFUA 4OMCA 5FKLA 4MGRA 3WW1A 1GOGA 1G9BA 1UW8A 1M06G 2WNVB 1R5ID 2WNVA 3JRIA 5A33A 2V7FA 2DW4A 1COV2 1ODNA 1U0AA 1MEC2 2LP0A 3LEMA 3LWCA 4ZYDA 2VKDA 1IKQA 5KHIA 1H9WA 3CMMA 3K70D 3AYEA 5LD2C 2FRHA 1ZREA 2OUJA 2R7EB 4QPIA 3CF2A 3QAHA 4HSRA 5D8AC 5BS6A 1ZRCA 4BK4A 2V4JC 2E7AA 5LLQA 1N1YA 3ES1A 3BPSA 2L3DA 1VQ7I 1VBE1 2W25A 1VIWB 3A02A 4AL9A 3WNMA 4G6DA 1D1AA 2R062 3ZQGA 3G1LA 5LY2A 1V0AA 5HLTA 5KHJA 5FP3A 3TGNA 2EA4A 4LB6B 2FXAA 1QNTA 3L2HA 5M5YJ 3VBFA 1XNBA 2LVSA 3P1IA 5J1UA 4EWEA 3DYPA 2WAQA 1I5ZA 3BG5A 5JVGF 5T5JA 2LFBA 1PJRA 2VG9A 2DOEA 3GZNB 5J8CA 1V6JA 2EZHA 4M6VA 1LJ7A 5FO8B 2PFWA 2W95A 1NXD1 2DTRA 4AEDC 3LMMA 2XVLA 3VDDC 4HF1A 3W3CA 1R1TA 1O5UA 2LY2A 1EKEA 4OMYA 3O1UA 1R9TJ 2JQ7A 3S32A 3ZFEC 5HXMA 1GZ9A 4LBLA 3HG9A 1UY4A 2CL2A 2RR11 4KITB 3FBNB 1FMD3 3EMRA 2VQAA 3KVAA 3TEZA 4C0HA 3U1XA 4B4RA 2PLV3 2WZR2 3LCPA 3BPZA 4U36A 2XXZA 4BYYA 1ZA4A 4F52A 4DXRA 2ZJQF 3H7JA 5HVQC 4D5CA 3V8JA 3K4JA 4UBGA 5FO9B 2TCTA 2GMMA 3WP5A 5A7NA 4PIXA 3A23A 4K9SA 2PHFA 1UZCA 1JUMA 1XCBA 1WI3A 4R52A 3K4MA 4KI5M 1QVTA 2FCTA 4DMIA 4BY7J 2V9KA 2HS5A 4XXPA 1LOFA 2LOOA 3QCWA 4RDUA 3ZR5A 1MIJA 5L36A 1HKDA 1G9CA 3DWLE 5IK4A 1S0CA 1BIBA 5FYYA 3KEOA 3HXLA 2VMIA 3ZXAC 2MC4A 4LBJA 3WNXA 1DZRA 1OD3A 3H0DA 3A0KA 4MIMA 1ZVFA 1CWPA 2HWD2 4DRRA 2W1UA 3WY6A 2A3YA 3W5MA 2ZB9A 2JG8C 1UFMA 5IJRA 2EQRA 1BK0A 3S5QA 2ARCA 1V55H 3CJTB 3RKYA 1OISA 2WT0A 4YNIA 1UZVA 5A2QK 3VKFC 5H20A 1KQRA 2HI3A 2WWUA 4IHVA 1KGYA 1YLFA 2OTLI 1A3KA 1VBD3 5CA6A 3B6CA 1XC5A 1VQ4I 4QX8A 4KT5C 1I50J 1H89C 3N4MA 1R7JA 2FA5A 4PLNA 5KHDA 2XL9A 5GLVA 3NW4A 1K78B 4Z2WA 4RBOA 1CESA 1OT5A 1QJU3 3UT0A 1QHHD 3K2ZA 5GJ6A 4RB0A 3O6BB 3ZYRA 1KD7A 1PGW2 1NG6A 4I02A 5F6LB 3I3MA 1WW4A 4TZDA 2YU9J 1YFXA 4A6SA 1QXRA 1FWZA 3L00A 2VQCA 3BODA 1W0NA 1W36D 3EDPA 5GAEJ 3L2CA 1MS5A 4B8EA 3LGRA 5FYHA 4UUSA 1HKTA 2EFOA 2A5ZA 5GZDA 2V6EA 1GYKA 2PELA 3G71I 4XONA 1T56A 2YDEA 4I99C 2WZEA 2D97A 4XKCA 2YBKA 1ONVA 4IEYA 5FLXK 4PZJA 5LGNA 5KVRA 4MHRA 4XJ8A 5GM0A 4BLIA 3C7HA 4TLGA 4QPGA 5FLHA 2RN7A 4AVPA 3FC0A 5IPAA 1FTTA 4AG4A 2BOIA 3RSJA 1RR7A 3W20A 3POYA 4OHVA 4YEJA 2Y6GA 5BY5A 5B4XA 5BNPB 3EHKA 4N9HA 1UD1A 4NC7A 3BZKA 3RZHA 2D6OX 5JOXA 1JJ6C 2GA2A 4CICA 4CVUA 3K4BA 3W2VA 2CFXA 5BPDA 2XKOA 3Q5FA 3HEIA 1O3TA 3CJQB 4QKDA 2ECBA 5FZBA 4ZYEA 2W3JA 4LKEA 3T3YA 1DG6A 4KYWA 3KZ4C 1JU3A 2DMPA 5HCHA 3BDDA 1W2OA 1P4WA 1WW6A 3CC7I 3LD8A 2ZXIA 1TME2 3ZFFC 1ENQA 1YQ2A 3LSIA 1ENSA 1YLLA 3VLBB 4AI2A 3OCPA 4HOOA 3DPRA 4Y4RA 2BERA 3V42A 5FKOA 3OGGA 2OS2A 2E35A 1WJEA 3LOCA 1NAEA 1UZWA 5FZDA 4NHKA 4MEXF 1VPHA 1UCXA 4XJ9A 4OI0A 3IIAA 5FYSA 1PM4A 3G6JB 3VDAA 2ADEA 3EUHC 2WNUC 4DFSA 1U5TB 4CP0A 4M3CB 4NC6A 5APAA 4P55A 5HODA 4GFBA 5JZGB 3OV8A 3A01A 1VQ6I 3D4KA 1U8BA 4FXKB 4NQWA 2W7NA 1HQCA 3ZN6B 4CH7A 2L4MA 4GMP0 4HX4A 5FD5A 3JB4C 4G12A 1PNFA 3RZDJ 5A6XA 1DIWA 1XG1A 5J09A 3NAPC 5J36A 4M72A 4GH4B 2M7BA 1R091 2YUEA 3PTYA 2VGDA 3IN9A 2ZEZA 2C26A 4M9ZA 1D4M1 4I01A 3BUCA 4KNYA 2KRHA 3OJBA 1X3UA 1W0OA 1I3AA 2HDWA 1Q56A 4FP3A 1IZ3A 2AGSA 2EB7A 2PQ8A 2ZMEC 4A3XA 4ZU5A 3ZXEA 1NQDA 1AR91 3PDQA 4L99A 4QB6A 4Y26A 3M4OJ 4IW3A 2E5NA 3KB5A 2X8KA 1IRGA 2R5YA 2YYOA 3SZGA 4Y22B 2IS6A 5DG1A 1OUXA 1J3RA 2DYSH 1MMNA 5K1YA 3KEQA 2EZLA 2LK2A 2XJRA 4XKVA 4XBNA 4K2EA 3UJQA 5B3SH 5DMYA 2XLFA 3JW4A 1V6LA 3V65A 2XUBA 5F0CA 5FP7A 3TP0A 5C9AA 4OQ9A 3M70A 1W5TA 1Z7S1 3QOPA 3DKXA 3LOBA 3OOPA 2RQQA 1OXCA 1XYOA 4XRSA 5CAZA 4TSVA 2HR3A 2TRTA 3B00A 1MSFC 3A21A 1S4CA 1SVMA 3D5RC 1XX5A 3S2WA 2I07B 3LKJA 1SD7A 4RHV1 5IVYA 2YC0A 1R1ZA 1HV0A 3MPPG 2G9ZA 5C6CA 4B7KA 1KA8A 3CKHA 4A0ZA 2P34A 3OS1A 4W50A 4NMIA 4PF5A 4UFKA 3SHRA 1RYYA 5ABJA 3TBDA 4F91B 3MZYA 5A6YA 3CJNA 2WL1A 1ZBE1 2QQJA 1NY71 2HZTA 1DU3D 1KQ8A 5DV5A 5FZEA 3AKZA 4LXLA 1EAH1 5A7SA 1MSEC 4XVHA 4BE0A 1VQMI 1LEMA 2ELJA 1PUFA 2CSGA 5CIRA 5K0UA 3X29B 4FPCA 3UGHA 2GSYA 4EN0A 1NCRC 4AVSA 1LOAA 1JZ5A 2RJLA 5C3SA 4A3LJ 3OTFA 4WXHA 1AF9A 5TRDA 3MN2A 5F2WA 2D7FA 3NEUA 4P9XA 1QIQA 3J81Z 2OD5A 4R9DA 2WUHA 1AVBA 3KP4A 1QZEA 2HVSA 1B35C 1AXKA 1WQ2A 4HSJA 5BXXA 2NS8A 2B9SA 2ISZA 1CZSA 5GTHC 1XNAA 1IDYA 3MKWB 2FEZA 3POSA 1Q1VA 4AFCA 4AE2A 1ZH5A 3AB0A 4XSZF 2O61A 3E3VA 1CIYA 2QJVA 4XZUG 4M9XA 5DZFA 2BUKA 4S2DA 3OYGA 1VMFA 3OD4A 3H8RA 2DODA 2N7GA 2E19A 1RUH2 1T95A 3S5AA 5FZFA 4CCJA 2E53A 2ID3A 1S1AA 1Y39A 4XLAA 4KQ7A 1U6GA 5IFTA 5F7UA 2Y60A 2VZTA 4GJZA 3OYWB 3OYIA 4XXAA 1WGXA 2B4KA 2CDOA 3WG4A 3SLIA 4JKMA 1UIKA 2JDYA 4B44A 4HKOA 1C28A 2A1XA 1DGLA 5JR7B 1JW6A 4UFLA 4L9VA 5CVUA 2CUEA 3ZGKA 1SACA 1Y7BA 1U12A 2C9KA 3K70C 3N9LA 1IXRC 5F39A 3TEYA 4LG0A 4LHSA 1HCRA 2EZIA 4Q4V1 2VZRA 3ZFGA 3DXJF 2VJJA 2HH9A 5FYMA 5JHFA 2XBO3 1W6PB 1WZXA 3OPTA 4YW4A 5HNHA 1UMZA 1U5YA 1XMAA 1YW9A 2HPMA 2WQ8A 2FF4A 3SKJE 2DLLA 4ZYHA 4EWAA 2V1XA 3JD72 3OIQA 3SJMA 4LUKA 4FVVA 4DY5A 3J7YJ 1HB2A 2ZGMA 2C4XA 3I0TA 2VL8A 3VKOA 1O7FA 1AXYA 2XAQA 2GZWA 4KICA 2DMTA 3PUIA 4HXCA 3DEUA 2IXCA 2J1UA 5C4WA 3VHPA 3J8F3 3L2VA 1BLZA 2X6YA 3B9CA 1IQDC 2G9GA 4ZS2A 3NJYA 2BW3A 1Y9GA 1X3ZB 3ZXKA 2VE1A 3MIEA 3FN9A 4MX3A 1Q1HA 1A6QA 4L9NA 4B48A 4FQ4A 4DXTA 1BOAA 1ZTRA 2M5WA 3WUCA 5E17F 3JSPA 1L7LA 2VE8A 1XYPA 4Y20B 3RI8A 3K6GA 4Y20A 4GJYA 3FISA 2CTVA 4ITVA 1F9KA 1QZZA 4PJMA 1NKGA 3D5SC 4Y15A 5GPCA 4XDOA 4P14A 3AMMA 3GTGJ 4QKNA 4U0VA 3CO2A 3Q8FA 3OL3A 2HWC1 5D6FA 3M3QA 1J75A 2IP2A 4PJNA 3VKNA 4LBQD 1A6CA 3TP3A 4UUTA 2GXAA 4DY3A 2Z1DA 2XH6A 2FBIA 4QHZA 1I5PA 2WAFA 1FBQA 1QQP3 1RRJA 3GM8A 4CDXB 4HYEA 5IYYA 3RMYA 2XGEA 4L0PA 4COVA 1ZZ9A 2VW2A 2DA6A 4WZCA 4RS5B 1AOYA 4KWLA 3WF0A 4RS5A 3OY8B 5IVBA 4HKWA 5FYUA 4C9YA 3O7OA 2QCOA 2QYOA 4UV9A 3WDYA 2EPFA 2WRAA 2E7QA 1BMV2 3T8TA 2E1CA 2W87A 2XOMA 3WXPA 2DDUA 1FYMA 1JYWA 3WHCA 4LIVA 1AL21 4IV3A 3AZZA 2LM3A 4C3JJ 2RMU2 1SD4A 3LAJA 1NTCA 3OYNA 3AC0A 4ON0A 1KU2A 2XQXA 3O1PA 1GP5A 3O14A 5M5XJ 2C0ZA 4CXWA 1E3OC 4AIJA 2WYFA 4AI0A 3PQKA 1OQEA 2CAUA 2DU1A 2OQGA 2O8QA 3N7JA 1GLNA 5FXZA 2Q30A 3HSEA 1KJLA 2HZDA 4R1HA 3TOAA 1NK2P 3EPZA 2VTFA 1D1CA 5EZWA 3K1PA 3HIFA 3WTYC 2IXIA 4QB1A 4MZUA 1H88C 2PEXA 1G3YA 2VUJA 3CESA 4FCYA 5HS7A 5GZFA 1T98A 1IC8A 2ZX1A 4H4KC 1MNMC 3U14A 3TNPB 3VBUC 2BZDA 3FMQA 4XNFA 2FD5A 4I76A 2A6VA 4P9LA 3SHFA 1ORKA 1FOXA 5LCWL 1W36C 4FHTA 4IV1A 2RKHA 4PSWA 2QA4I 2XC7A 5H9SA 4A3BJ 1DGWX 1AR82 1VRH3 3PJYA 4ATEA 1K5MA 4HSTA 5EYRA 2F4LA 5IT3A 2PX9A 5KHHA 3RI9A 1F5FA 2BHZA 2PMZN 3OYEA 2RREA 1VAMA 2XMLA 3R4KA 2DU0A 4L0ZB 3C3VA 2NNYA 2QQMA 1XU2A 3J9SA 1MZFA 2GBYA 2R043 5TJJA 1Z21A 5AC91 4R9BA 1WSUA 3CCVI 4RR3C 4XF0A 1UZZA 4H7MA 4PGHA 1HXS1 4AI1A 1HC8A 1S0BA 5IYBJ 1XTAA 5D4RA 1TEIA 3WHBA 1US2A 3VBRB 4O9GA 1F8VA 3VBRA 2VJXA 1DHKB 3ABUA 1QVUA 4HT1T 4B09A 1UELB 3ZMVA 3WTWC 5CNAA 1IRXA 4FCAA 2QQNA 1SCSA 1RUH3 1FJLA 4GO1A 3AG2H 3GZ6A 4ASNA 4CDQB 4ONUA 2VNVA 2P0WA 4JK1X 2A5WA 2ET7A 4BQWA 4CDQA 1JBCA 1KS4A 4EJWA 4BISA 1XSDA 5KK1A 1YQ5A 4YVWC 4M3GA 5LHGA 4U7DA 4Z82A 5FYVA 1CJPA 1UOJA 5IFPA 2R30A 2RM22 4PIZA 1ETXA 5JSPA 5HDNA 2M8EA 2O8OA 5BNNC 3T1BA 1VBE2 1NHAA 1O3SA 1ERDA 1H4GA 1W6NB 1GKBA 2FJ1A 1RGSA 2DCKA 2M34A 3CCLI 5J8FA 2JG9B 1ULPA 2JG9A 3L2QA 1PVC3 4RGGA 4AEDB 2ZXHA 3POEA 4AEDA 2M7AA 2BJSA 1G2HA 2ZGUA 4Q2FA 4C2UA 4E7SA 3MZHA 1MS8A 5HPOA 1YHQI 3ZFEA 1WCQA 2BQPA 3MAJA 4N7UA 5JR3A 5FO7B 1W6MA 2WAEA 5HDGA 4AU7A 3BG3A 3WZ1A 1JZ6A 1GQPA 3AFHA 2XAUA 1ITYA 3WHUA 2YROA 2VN2A 4O3MA 4EZ4A 1XGMA 1DBNA 2X6OA 4XIKA 5JLVA 1MBHA 3KP7A 2X1DA 1DYKA 4SLIA 1HN1A 3OOXA 2K0GA 3T4HB 2KT0A 1LE8B 4CP9A 3LL7A 2UWCA 3DL3A 3KM5A 2OW4A 1S2KA 1RUF1 5I0TA 1FOWA 4A3KJ 2R5ZA 3S1MJ 5F6FA 1XS9A 5JFRA 5FYIA 1NA1B 5IVCA 5DUWA 1YQAA 3MEXA 2P2KA 1S0FA 4Z92B 5FJKA 5A3PA 4L11A 1K45A 1EUUA 2DCEA 1TWHJ 5IUQA 5JPMB 2B7YA 5ANQA 2A6YA 1WLDA 4XN0A 2XKPA 2OA4A 5DCMB 1J3PA 4Y1YA 3QWLA 4IEQA 1EH7A 1MGTA 3IH2A 2LC2A 5FUIA 5CZKA 5BNQA 4D0PA 4XQWA 2CV1A 2LKPA 2KD7A 2EILH 4XC9A 2JG8A 1UB9A 1ZZ8A 1WJBA 3L2YA 4B1RA 5IOYA 4EROA 4PDWB 2CU7A 4CP1A 3GDBA 2CWEA 3WF1A 1APNA 1P8JA 5I0SA 2XJVA 4XLCA 1TZOA 1JH5A 2YZ4A 2ZHKA 3H50A 5H9RA 4A3CJ 2EJRA 2AEZA 4PDKA 2XAFA 4QQOA 4CO8A 2Y6JA 3PIGA 1MR5A 4NR1A 1CD3G 2I5UA 3CCJI 5IVEA 2RNGA 3BQYA 4CXXA 2J1VA 3VDCA 2WN2A 3ZXLA 1OR7A 1L7RA 1N3PA 1PZ9A 4LPLA 4AUXA 3UKNA 4UXNA 3BG7A 3BALA 2BV6A 5E8AA 2A3SA 1O57A 1IN7A 4OUEA 2FDIA 3GF6A 2M4GA 4E4DX 3SEEA 1YFWA 1ON1A 1LDDA 5EV7A 4Y7NJ 1IRZA 4NRMA 1E0EA 3MW4A 1X1CA 4ZYGA 5JVTA 1RXGA 4YVSC 3DQVC 2VOVA 1AYM1 3HJEA 2XAGA 3OB8A 4QQLA 3I2HA 3BPVA 3GTLJ 2JDZA 1YE9A 4BJ6C 3LPFA 4FETA 3MW3A 4XMIA 4G7ZF 3USUB 3NKTA 4NJ4A 1YO5C 2XHKA 3HSRA 2UY8A 4HL0A 3VZNA 3TN93 2WDBA 4R9AA 3VOEA 2GOXB 3BJOA 5I8YA 1TMF2 2E33A 5EG0B 1ZAOA 1RMU3 2JD9A 2RDNA 1IG3A 3MIDA 3T0BA 4Q4W1 4A4AA 4L18B 5IWFA 3U1DA 2KIFA 1LDJA 3V7RA 2RDSA 2R7ZJ 1BI2A 4RYDA 2XF6A 2VMGA 2QZ2A 4I3PA 5IK5A 3DYMA 1O8PA 1AA7A 1Y4WA 1SEUA 1HIXA 1ZG3A 2HWE1 1AR83 1BOBA 4AGVA 1U0JA 3CLQA 4JTOA 1C8M3 2CUJA 3U78A 3ZQLA 4XKWA 4HK8A 4A0XA 4YWAA 3KP2A 2X5IC 1UG2A 3H1MA 2DN0A 4IE5A 3NQOA 4QDQA 4XFAA 1UWWA 4MXVA 4Q48A 1MMGA 1IV8A 3I3BA 4N4OB 4O6JA 3PNVA 4G4FA 1GWKA 4CCMA 1F5TA 2KJBA 4CGZA 2JDAA 1AR72 5LEKA 1BVVA 2OZJA 3WHTA 4QDSA 5F3GA 2W91A 3VDBA 5FPXA 4FTSA 4LHKA 1KU9A 2FE3A 4Y1VA 3EUHA 3IKTA 5F32A 3RZMA 2WNUA 3VSKA 2NOGA 3THPA 2Y9ZA 3ZPOA 2EXHA 1OA4A 1IO2A 3SEPA 4G6TB 4AHWA 2RGVA 3GF2A 1LU1A 4IE7A 3RYRA 2DCYA 3M7GA 2LROA 2V9VA 3D6EA 4BNCA 1I3HA 1K12A 1MNEA 2MGQA 2JMWA 3CO7C 2STWA 3B93A 1D2SA 4BJ5C 3WNKA 4M3BA 3K4LA 1GVJA 1S0IA 1F15A 2X53S 4MO3M 3DBLB 4PCRA 1LHOA 3NAPA 2COMA 3SH4A 5FUPA 4EN6B 3LSTA 3AYDA 1NXMA 4CEYC 2FZ2A 1MH3A 1VBA1 2MD0A 3DCQA 1R1VA 1OCRH 1P92A 2ESHA 5JOZA 2ZMEA 1VBE3 2QQIA 2R0FA 4CPBD 4GYGA 1LODA 2VKHA 2GN7A 4YARA 4QU2A 2FCVA 3CCYA 3FL7A 4DXSA 5FR3A 4IEJA 1Q43A 2GH2A 5F1JA 3KFWX 1W8TA 4A5NA 4XFCA 3F6VA 4BS9A 2ILMA 3B94A 5FZHA 3MHZA 1TNSA 3MWMA 5DABA 1AR92 3PIJA 4AEKA 3J81K 1QOSA 4B47A 3H5NA 1NCQC 4Q26A 1KXGA 4UWDA 2X4HA 3WU0A 2G0EA 4G3YC 2XRNA 4FX0A 4CE8A 2XF7A 4KGGA 3ILFA 4JX4A 2VMDA 2VPLA 1V6MA 1BR1A 1LPQA 2A6HF 2DCJA 1WLTA 3QODA 4A6OA 2RR13 5A3TA 1YI9A 5I0UA 1NH3A 3FHIB 3DKYA 1BN5A 3WG3A 2Y6HA 1WUVA 1Z7S2 3SH3A 4Z8BA 4A6EA 1WGPA 5BPXA 4K1ZA 2JPBA 2Q1ZB 4FFGA 1J84A 3ACHA 2B8MA 2WIIB 5EJZB 4KUMA 3ACLA 5BUVA 4XABA 1YJNI 4E4SA 2E34A 3JZVA 4IGPA 4OZOA 2H8WA 1RB8G 3ZDSA 3IL2A 3USSA 2V9PA 4NC8A 3ATGA 5JIUA 1S0DA 1BR4A 3RSNA 5JXHA 2RVCA 1D3YA 4HV5A 5LBEA 3EXUA 4RS8A 4X8PA 3DPLC 5GZCA 4BHPA 2L5QA 4E7KA 3MFCA 4WVMA 4GZ9A 1OD5A 3RPQA 2XAHA 2VNRA 1SFOJ 4XBLA 4YW7A 4U88A 2IXSA 3ASOH 3KX2A 1YYVA 4CCEA 2A6XA 1Z7LA 3T1LA 5EYYA 4OI2A 2MG4A 4CDWB 4A3DJ 2DYRH 4CDWA 2YBPA 1B35A 3O0XA 5AVPA 4LO7A 2UYBA 3BC8A 1OOPC 3KEYA 1AYN2 3E5UA 4AIKA 2D3SA 3M4FA 5FTTC 2RS32 2OT7A 3S3NA 4P5HA 5CFDC 5JXIA 1VALA 3Q8AA 1OPCA 5C5UA 2VMCA 3FXUA 2A6TA 2GNBA 3DPUA 1OJLA 2W9XA 3AZYA 4UNOA 3N9QA 1DQ1A 2QM3A 2D40A 1S29A 3F8NA 4O9EA 1JKQC 4OU0A 4XEZA 3VBSB 1RNLA 2PYTA 2VR4A 5ILVA 1FZPB 3TW7A 1LHUA 5FIXA 4EGZA 4NHYA 1SZBA 3IB3A 4B4CA 3U0ZA 2AQEA 1ETWA 4DBQA 1UAAA 1MZBA 1JS9A 2IVMA 1GSLA 2M9HA 3H1YA 2R4GA 4A3JJ 2RDRA 3CMYA 1RC9A 2IFRA 5I0RA 4E2QA 2B9VA 3CEWA 1VQPI 4PIYA 1G4DA 1H1AA 3AP5A 1MACA 3MW2A 3O2PE 4KMUX 4ASLA 2K3PA 5DAWA 3PUQA 3FMRA 5L3FA 4FPHA 4LOSA 3KQ4B 4EN7B 2NRAC 1OPMA 4Y33A 2EBIA 2KKOA 1ZBA1 2I10A 1HB3A 2FDGA 2BDRA 2BV4A 1FSHA 1QJU1 2BZTA 3C2BA 4DZJA 5F0HA 1RUG1 1V3FA 3A0BC 4G7HF 3SZPA 2OUHA 3MV11 2ZOEB 1NOVA 4TXWA 1P7IA 5IY5H 3I49A 2ZFUA 2UWMA 5EEHA 4RGUA 1XNCA 1GUUA 3NSTA 3S15J 1WKYA 4FE4A 2B9UA 1NX9A 4LITA 4FISA 1OBNA 2M3AA 2TBVA 5C3OA 5LY1A 1PO22 4MEYF 2LS6A 1VAKA 3WGIA 4QT6A 3SDBA 2LALA 1VQ5I 3R0JA 4WF2A 3IMNA 4N4NB 4QPYA 2DYCA 3OY9A 3WDWA 4XACA 2XROA 5H9PA 5ICEA 3KSCA 5ACA1 4LK7A 2OCEA 1XMKA 4QX0A 2OQ6A 4PT6A 4L9BA 3LQRA 4Y5TA 5JAXA 3LNQA 6PAXA 1PNGA 2FX0A 1VBB1 2YPRA 1UNBA 2PHDA 4BEHB 2HPIA 1W04A 2VC1A 2HTJA 2GDFA 3KYLA 3VBHC 1Y43B 1Y0UA 4XRFA 4CU9A 4YZ3A 3QQAA 5DD4A 2C6YA 3LWFA 2OX0A 3OYHA 4P02B 3VKLA 1YITI 2WA4A 5T5PA 3UGGA 1QZYA 4ASKA 1RKTA 2RNJA 2HQAA 2B7EA 1L0OC 1YEWA 3HB9A 2TEPA 1HJGA 4Q5OA 3P5BA 4LBMA 1COV1 3KGZA 4RFT0 1MEC1 1RTVA 1R093 4LLNA 5LA9A 5L7OC 4LE3A 3K1NA 5T5LA 5FKNA 4QTRA 5KXEA 2W48A 1QJEA 3L2WA 5FKBA 1SD6A 2OZUA 1S7AA 1JYCA 3SDGA 4RN5A 4RA0A 1AR93 1SAXA 4GA9A 1JKRC 1GLHA 3A0NA 3S1NJ 5F3IA 2MD5A 4UFHA 4YFKF 4A3EJ 3F3XA 2R49A 3OYKA 2VNGA 3KT1A 2CO5A 4L0YB 3T4VA 2QDRA 5AFBA 3HZJA 2GC1A 1H9GA 2VBWA 2LF7A 3TQNA 2R061 4CCNA 5J4YA 1J58A 1P7JA 4E7IA 2K9NA 2RS51 4IQ4A 1X58A 1NLQA 1W8OA 1KRIA 2JPCA 3IRRA 1AL22 4HX8A 3ERMA 4U7BA 1Z7S3 2AH2A 4M6XA 2BHYA 3FMSA 4HLYA 3GHMA 3I3DA 3VBUA 1CR7A 1BBT1 4A3GJ 2J1TA 4RHV3 4U87A 3RRDA 2GNTA 5LWBA 5FOBB 3ETQA 1US3A 3ZMNA 2BY1A 5J6XA 1ZGAA 3QLQA 4DRVA 1BIAA 3GALA 2HQ5A 1F4HA 2K2SA 3BQZA 1ZBE3 2FDFA 3VZLA 2Y38A 2WZR1 3LA7A 1FYKA 2KZVA 2P4WA 1EAH3 4OULA 4KMQA 1NG7A 3UK9A 3WTTC 5IW0A 2VASA 3E6CC 1AZDA 3CLPA 4CZZA 3VBOC 4H0EA 4XETA 3WLUA 5A6QA 2BBYA 2MLKA 2R7OA 5J37A 1W39A 3U4SA 1V6NA 4XHXA 4RR3A 4MTDA 4A3IJ 4Q29A 2OV7A 5HCAA 3ECOA 4ESBA 1VQKI 4AVZA 5CFCC 3IZOA 2E1MC 4JGYC 1ZX5A 1UMHA 3OBAA 4YM1A 3HOXJ 1YS6A 4WBBA 1JTZX 4WCGA 1JU4A 3ABTA 5FREA 2DTYA 2DMUA 1SQ4A 1JZ2A 1JYXA 3OYFA 3WF2A 5JOYA 3GZ5A 4FFIA 4CYCB 1HXS2 1WH5A 2HWD1 2W24A 1EPZA 3WW4A 4YW6A 3AL0C 3CUOA 3MVPA 4XLNF 4XICA 1RIOH 2QQVA 4N43C 2JD4A 1R23A 4Y52J 2MNGA 2OCCH 3QP6A 5BNGA 3TOBA 3ZP5A 2LLKA 2HVRA 2GXGA 1R64A 4YVWA 2QBYA 1MS3A 3P3NA 2D45A 1GQGA 1IN6A 3Q8CA 3MUY1 1MJAA 4HEA2 3FHNA 3IH4A 1CAUA 1C1LA 4KMFA 2HEVF 5BNNA 1DP3A 5AFEA 3S17J 3CP2A 1VQLI 5I0DA 1ULGA 1IUFA 4MLOA 4FTBA 3DTEA 2B63J 1Z1DA 1PGW1 3I4NJ 3R05A 5GLUA 1ENRA 4MFEA 5B5EC 2Y31A 3I5UA 4GWNA 1Y6IA 5JSRA 2F5EA 3NARA 4M00A 3ZVXA 4PK4A 1CX4A 2VM9A 5CYVA 5DS9A 4AF9A 2V1DA 4Q4V3 2JVHA 3PSFA 5FMCA 3FMGA 4MADA 2PA7A 3H1CA 3D1NI 4IERA 2P5BA 2Y0OA 1OFNA 2FOWA 2WO1A 3KF3A 2O6GE 1TQMA 4ZXKA 1WLCA 4Y24A 1AKHA 1OLQA 4MHUA 4AVBA 4JGZB 3B9IA 2CQXA 4U0WA 1SLLA 5KXBA 2TUNA 4NDLA 4AI8A 5J3UA 1FP1D 2K7LA 3BT9A 3N9MA 4Q8LA 2JEMA 2VTXA 2EXKA 4MQVA 1D7PM 2M2EA 3J7AY 4ZJZA 3VV1A 1ASJ2 1YG2A 5HLIA 2IT0A 4LK1F 3SC7X 3OBTA 2E9QA 4FOWA 4LEJA 4EZHA 4XLHA 1TLHB 1WD4A 4XW3A 1V54H 4AWXB 2CWMA 4GWMA 3GFLA 4MGQA 4H2AA 3J7AO 4K8RB 3K77A 4UAPA 2CU5A 2JB4A 1E57A 4RMNA 2HYJA 1R6RA 5DM6F 1IS3A 5K5OA 5EYXA 4NUBA 1WBLA 3H1WA 4NIHA 3CDZB 5F64A 3UNPA 5KCMA 4CU7A 3GXUA 3RNSA 2GP5A 1VR3A 1TME1 1Z91A 1IV6A 4JDMA 2C9AA 4ARYA 5FWEA 1OVSA 1QY4A 2W85A 5CU1A 5A3WA 4PFOA 1WPKA 3ZMOA 1N25A 2HWC3 2V1UA 5JR2A 2ADDA 1YQCA 2PLYA 2VXDA 5J48A 1Q8VA 3S30A 5B2GB 3HRTA 2VQHA 4ENNA 3OF1A 2B46X 3LSMA 4XUQA 5K7ZA 2RS11 2H8RA 1FAYA 3RTRA 2QSFX 1FPN1 1JGGA 1MS4A 2DFIA 4W4ZA 2XPWA 2C6SA 2G9FA 4YG0A 3UKTA 3ECHA 4KGQA 1W8WA 4ESJA 5HXVA 4EVIA 4XURA 3I2FA 2KIMA 1LGBA 1SFNA 3AX4A 3POBA 3U75A 4YVSA 3LB9A 4MHGA 2KISA 2VBYA 2ZJPF 1AL23 2OTJI 4AQ6A 3S1RJ 5D8KB 4HLXA 4KU8A 1T2XA 2MH9A 1JUHA 3BR1A 3H9JA 3KS7A 4LR4A 4FO9A 1ZRIA 5FY9A 2W47A 1R082 3UV9A 1WLWA 4CZCA 4YLZA 3ERED 4RL7A 3OYMA 2HDDA 1ULOA 2L9SA 3WNOA 5FZ3A 2A69F 3S14J 2ORXA 4JVAA 5CADA 5FCCA 1REPC 1EH8A 1QNWA 2VVDA 1GOFA 2ZX4A 4WWCA 5A70A 1XMXA 1H6YA 2DUPA 2R0QC 1SPPA 3ZXGA 3ACFA 2JJ6A 4BOWA 5JXJA 2GU9A 3K75B 3KPHA 2VB6A 2QQAA 4V19K 2X5IA 4M3FA 4LK6A 2WYSA 4BMBA 5IOZA 1QPMA 2VUAA 1DP0A 3Q9OA 5A3OA 4RA2A 2FQ3A 1CAWB 3QYEA 3ILRA 1Y0NA 1CAWA 2TNFA 4XFBA 4PBOA 2L01A 3UGFA 4P5YA 4PBPA 2OU2A 4NHMA 2RV8A 1USSA 3F22A 2E7WA 5AC93 1QHDA 3OGJA 1W2AX 5L73A 4NRQA 5B4NA 1QKQA 4EYUA 2E26A 3IKWA 9ANTA 1LEAA 1HXS3 4MV2A 1LR5A 1IDZA 4CDUC 1GQHA 1WZ2A 1DU0A 5IT9Z 2ZGSA 2VCCA 3IAPA 3ZSJA 2ZPXA 1J2XA 1T39A 1SVOA 3N7MA 1ZELA 4P1WA 5JMOA 4EE2A 4TLFA 4B4PA 4RGXA 3M3IA 4NN0A 1H1IA 4CEYA 1W28A 2F5FA 4HNTA 2VZ1A 3CJXA 1BXHA 1LOEA 4Y3OA 2FDHA 4YFNF 4L9JA 3B7MA 4HSLA 5FXWA 4AAXA 2F5CA 3RZOJ 1APLC 1IOAA 3P9IA 2D6KA 1OCOH 5FYBA 3Q0WA 3NJXA 5D4SA 1W6OB 3BG9A 2P5VA 2WZ8A 2V09A 3A2KA 2F6CA 1W6OA 3F6OA 5DUKA 3RGBA 5AVAA 3OUIA 4FTEA 2OXBA 3I2JA 3POIA 4BIFA 1N77A 4WM8C 4LBQB 1TWFJ 5J4VA 3CUQC 2HOAA 5TSWA 4LBQA 5FPZA 1S2EA 4D6SA 1JYVA 3ZSLA 2IS4A 1MBKA 1NCQA 1UQXA 4JX0A 2LTPA 2VULA 3REOA 1WW5A 5FLMJ 1G9FA 4XR6A 1XOYA 4DNCA 3M3YJ 3BTYA 4KDPA 2J42A 3FXQA 4IZZA 4E2SA 3RQ0A 4M74A 3KCCA 4AFMA 3N9PA 1S9HA 3CQOA 1CAVB 4A7KA 4IPAA 1UPSA 2WY8Q 3ZYGA 1PGSA 4GD4A 3PQJA 4QD2A 2VCMA 4FP2A 1SANA 4P9UA 1OUSA 2BP6A 2WFF2 3OWTA 1ZGJA 3G7DA 3VFZA 3CJIC 3ZQFA 3N97A 4N53B 3RS6A 3PIOF 3JRDA 1RUF3 2FMDA 1MVQA 2CV0A 4GULA 4XFGA 2BY0A 3VB2A 1UF2C 2WLPA 3JCUC 1P2FA 4QM9A 3JD71 2PHWA 5FFXA 3CZ6A 5BNOC 3WTUC 2QTWB 1AHDP 4ARXA 3AYAA 2I74A 4IE0A 1W8ZA 2WA0A 1S6LA 1KQ9A 4Z6YA 2L7FP 5C3EJ 5L9VA 2RJKA 2B45X 2FD8A 3DKWA 3C7FA 3CZJA 5IATA 3WDVA 2ZFWA 5K7PA 3M1CA 4QWQA 1I39A 4I3GA 4ZDPA 2LBFA 2VBXA 5DTDA 5IAVA 4QIWN 3AG1H 4AVTA 2VBZA 1PO12 3X2QH 3GCXA 3IPVB 1HRV1 2VI6A 2OZ6A 1J3QA 2ARXA 4INDA 2O1QA 3RZLA 1LHWA 3CF6E 4N8MA 2KIQA 2HQNA 2L02A 1OOPA 1GT0C 1F35A 2HWF2 3U9GA 1WVRA 2YGMA 3H8OA 2CMPA 1AXZA 1XDSA 5BOXA 1T38A 2E2JJ 1QJY2 1RI7A 1HDDC 1JE8A 5F0FA 5CFDA 1TBXA 2OKXA 4LO5B 2XUEA 2JN6A 2PMWB 3ML6A 2Y0MA 2C24A 2LRPA 3D3AA 4B7EA 3ZMUA 1SC7A 1V6KA 2QQLA 2XL7A 1OPOA 4XMAA 2DPUA 3LSRA 4OI1A 5HBAA 2EIMH 2QENA 1POGA 1PP7U 4WM7B 3ZN5A 4JV4A 3ZKYA 2ZABA 2DA3A 1ZQ3P 4W1UA 1C8NA 4Y1ZA 3AMNA 4BQAA 5A1FA 1JHJA 5CEHA 1XQNA 1Z3XA 5JI9A 4COWA 2E2IJ 4QPQA 1SLIA 2H94A 3DF8A 2UWAA 1AHSA 4OVEA 1AYM3 1IZ1A 1PYVA 2GLOA 5DPNA 4LMFA 2PHXA 3ZRGA 3E0JB 1PK6B 4F8AA 4JHTA 3R4SA 2ZJRF 2LW8A 5E89A 1OKRA 4O61A 1RVF2 3SNMA 1BMV1 1HQNA 1W99A 5FY0A 5D21A 3CDIA 5KHGA 3PNYA 3NRUA 5D5XB 3SMHA 2RMU1 3S7EA 4JRAA 3ITQA 1AX0A 4Q4W3 2F4OB 3WTVC 2D6LX 4QXCA 1X33A 1LESA 5FKKA 4J01A 4IGQA 4LK0F 2XJTA 2W39A 4CEWC 3VD9A 2JA8J 4AQSA 2M45A 3NV2A 2R072 1DQ2A 1QGPA 1ND3C 2IPQX 4LOTA 5C8WA 4AHXA 2RHPA 4RQPC 4IRIA 2JE7A 2WAOA 4BXUA 2VMHA 2ZKLA 1SLBA 3VWBA 3FXRA 3H3VK 3GWZA 4QKBA 1VZ0A 3E5QA 5HI0A 3BU7A 1DGWA 1PUEE 1Z78A 3FUQA 5T5OA 5T55A 3U07A 2UUZA 5FY4A 4FXGB 4GKXA 1HKSA 5FPVA 1OURA 3I2DA 1GR3A 2DAOA 1I3QJ 3H3UA 1FIAA 1PP8F 1TC3C 2LH9A 1VQ8I 4AEJA 4XOPA 2KM2A 1JXNA 4E4HA 3VBHA 2A68F 5FROA 4HG6B 1QHGA 2FBHA 1TQ5A 1AX2A 1DGWY 3U37A 1DCSA 4HOBA 1J59A 3HT2A 3UKVA 4BU2A 2YX7A 1ULFA 5FDBA 1G9DA 5KAIC 4ZDOA 1Z6RA 3KHBA 2OUMA 4FE7A 4FQGA 4MTEA 1ZG1A 2AYHA 1BK1A 4B43A 4GRIA 2Y9YA 1VBA3 2QF7A 2P3JA 3W2AA 2QSHX 1F1ZA 4ENMA 4AZZA 5A33B 4XQ4A 1AR62 2IGOA 3O5SA 3GTJJ 2XRLA 4C0BA 5KHKA 2ECCA 1M1EB 1UY0A 2WFPA 4BLJA 2WS91 3GCMA 2DVAA 3KP6A 4XL9A 2ZGOA 2JVGA 3MFKA 5A7QA 1QH7A 3K2AA 3IM0A 4U0YA 3ZSMA 3UL2A 1LU2A 5C71A 2XUMA 2W0XA 1CQ9A 5J1XA 4EM2A 5C3RA 3DTKA 5EFUA 4CP2A 4NIGA 4QPIB 4UB6C 4XLFA 5EPAA 3K9TA 4X8NA 3ZYFA 3APBA 4HN0A 1GNYA 2RM21 3KF5A 3WDUA 3ZMTA 1GICA 4L92A 2NVTJ 5JHUA 1X8EA 2BGCA 4LULA 3GLXA 2PFBA 3GUDA 1ETQA 3C7GA 3ETPA 4LT5A 3VBFB 1IUYA 2ZGRA 2RS52 2Q8CA 5C3QA 1VMJA 2BVBA 4WXCA 2XV4S 4B4QA 1R36A 1BR2A 3WDXA 4W6YA 1X3WB 5CQGA 1FYUA 1YUDA 3DLLF 2O3FA 3BIEA 3QPLA 3IWZA 2VECA 2WINB 3FF5A 4UB8C 2K9ZA 4HW0A 4TTGA 1I6HJ 3V64A 4IEVA 4OLLA 1H8VA 3JRHA 4CA9A 4IEXA 3IHUA 2WV0A 1BBT2 2K3FA 2CRGA 1IG7A 1WRJA 4BY1J 2R16A 1V70A 4XF1A 3KLSA 2WWJA 2EV0A 3F9KA 3LIHA 1QBJA 2MPFA 4PJLA 2DVFA 2GOMA 2D6MA 2D3PA 4FASD 2E31A 1Z7UA 1IS5A 2PQQA 1QO0D 1E5HA 4BE3A 2CGPA 2DVGA 4GMP1 2CNAA 2IAIA 3DEMA 2R93J 3AM2A 2KHMA 5F5CA 4FOYA 3MKZA 5CFCA 4YG3A 4A12A 2J1AA 5F6KA 3KT7A 4O7XA 4G9SB 4JGYA 1EV12 2F4PA 1EPWA 2LY1A 1RUC1 3RG0A 4Q5SF 4OHYA 1O6UA 2QQPA 2VQ0A 2WV1A 4M0NA 3OL4A 3DPTA 4IETA 1CAXA 1MVEA 3HOVJ 3I3QA 3NJZA 3WQ7A 2ZMNA 5DDJ2 5K9YA 3OR1C 3R0RA 2FZ1A 4QSHA 5LGTA 4IEUA 2DK8A 3OSGA 1TNFA 4N43A 4Y17A 2PN5A 1FNNA 2BWAA 3VZJA 3BTIA 1N3QA 2EA2A 2L0KA 3SQNA 3MZ8A 2X48A 2QSGX 3JXSA 3C3WA 2Q1FA 1UX7A 4NO4A 2RDPA 3EQEA 2OQ7A 4JP0A 2E71A 2O5RA 1ZM1A 2OA2A 4FOVA 4PQQA 2JRTA 4HPQA 4BKXA 4HKLA 3J7LA 2AHQA 1IGOA 4GYIA 4BJTA 1FOD2 1UYZA 3HMYA 4M3CF 3BR2A 2MSYA 5EGOB 4O65A 2V73A 4DQAA 5GTIC 1ND2C 5EGOA 1G7YA 5FPAA 1QPIA 3R0AA 2GIZA 3LSHA 2VPVA 4WZFA 2CAVA 3OPZA 5LASA 1RUE2 2VOXA 3BVCA 1MQTB 4UF0A 2BXZA 1MQTA 4R8HA 5F9TA 3HPNA 2BW8A 4P5OA 2XPUA 1ZBA3 4QPWA 3QD6A 4IL6C 1VTNC 4FPLA 3RFRA 3JTGA 1W90A 2JICA 1RUG3 2BGOA 4BDVB 2D6NA 1V5FA 1Y9MA 4MVTA 4CPBA 3LFIA 4XYXA 2PMZA 2DOAA 5EF6A 2QUFA 2RDQA 4R4XA 5E3LA 4XJAA 4ETSA 4IOCF 2MYSA 4UUSB 2H6BA 2DDBA 1LOCA 2VBDA 3H5RA 1TMF1 3JU9A 1GZWB 1URXA 4C90A 2EIBA 1F31A 2WC2A 4FAGA 1ON2A 2X51A 3KP5A 3EUKL 3ZN0A 1GZWA 2PJRB 2QKDA 1KFUL 2P37A 4OI4A 3O1SA 2M0MA 3RWKX 4K6BA 2PJRA 4QPGB 4RLQA 3M9AA 2VTXJ 1TG7A 4IVNA 4D7NA 4KH9A 4UFJA 1XSXA 1YYNA 1UO9A 4AFBA 5CPRB 3Q8EA 5H6QA 4UW3A 2KL4A 5ACA3 1BBYA 4UVAA 4MSVA 1Q8SA 1Z9CA 2WWSA 4MGTA 1W05A 2EZKA 2VOTA 1ZYRF 2CQKA 4SBVA 1FP2A 1O4ZA 1KGSA 2IWGB 2K40A 1VBB3 5FZIA 1IPJA 5A3NA 2AR6A 1JI6A 2DMQA 4YIIA 5L3DA 3PURA 1CGPA 3VD7A 3F21A 2A3XA 3WW3A 1V00A 5KC6A 2P6CA 1GV2A 5FP4A 4BZ4A 1AR71 2VE9A 3LA2A 5F08A 1GXQA 1Z77A 1GUIA 3HNYM 4A93J 3WF4A 2VKVA 1IJWC 4RFRB 3LOIA 2YU2A 2ZX3A 3EO6A 3T5XA 4XRSG 3G2BA 1HDPA 2BNOA 4AOCA 5F04A 3PL0A 3N7LA 5A3LA 3DPRB 5I93A 4QX2A 3ZSKA 2XGCA 1AR63 2IVJA 2XLGA 4UBHA 1YXWA 3KP3A 3BY6A 1COV3 2VQGA 4CXFA 1JYTA 3KV6A 1Z3YA 1MEC3 3BJ6A 1GWMA 3K69A 3J7NA 1VB2A 3DEWA 1KDKA 1T0FC 2XB0X 3OOUA 3MFAA 4LE4A 2ETHA 3A01B 3IV5A 3FXLA 2RS12 4NQWB 3ZX7A 3O1TA 2CYFA 1X9TA 1V6OA 1FPN2 3IT8A 2Z3YA 2UV1A 3DGTA 1ULCA 3G73A 3RWNA 3WINE 5EZHA 2BXYA 2Y8KA 3LF7A 2FOKA 1E3HA 2DQLA 1R4MB 2R063 1XNTA 3IAM2 4HA8A 3K1MA 2DUOA 4EJTA 2VY0A 5IT9K 1QJX2 3PU8A 4P9FA 2VUDA 2RS53 1BEV2 3M8FA 3T2QA 1ETOA 5BNPC 3IBMA 4UVCA 5BMZA 3K3OA 3PM1A 1DF0A 1BW5A 3ON7A 5CVIA 3L7WA 1YHFA 2R5YB 1Q3EA 1OLME 1OYWA 2DJIA 4Q4X1 1BBT3 5ICCA 4JOMA 4AIDA 2WT2A 5GPAA 4EJUA 3QP5A 2W1SA 4KNCA 1PZ7A 3WE3A 3CMAI 2VOWA 3RPUA 3GVAA 3H3ZA 1K3IA 2IXHA 4QKFA 1ZR2A