1HW5A

The cap/crp variant t127l/s128a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
208
Chain Sequence
b'VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVLAEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATABOLITE GENE ACTIVATOR
publication title The structure of the T127L/S128A mutant of cAMP receptor protein facilitates promoter site binding
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation
total genus 60
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hw5A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hw5A01
2Y0OA 3CDHA 4LFUA 3WW3A 4CGZA 5L3CA 1LB2A 3IHUA 2Q2EA 5HDNA 3MDPA 1KQ9A 1QXRA 3R4KA 1QY4A 1QZYA 4IHSA 1Y9QA 3VB2A 4IETA 3F8NA 5FLIA 3U11A 5LBQA 3I0TA 1YFXA 4BIFA 5ILVA 3QPTA 4KA4A 2O8QA 1W7PD 4LEJA 3ACLA 1ZZCA 3EDPA 1KU9A 3E6BA 2DW4A 3JTHA 5DUIA 1J75A 1O3TA 4A12A 1IAWA 2FRHA 4UBHA 1IXCA 1OMIA 3G3ZA 1V4RA 2PBIA 2XVCA 1R7JA 4RB2C 4LMYA 1HQCA 1P4WA 1YS7A 5D4RA 4M72A 4L9TA 2XGXA 3V7RA 5BQTA 1OI6A 3RI4A 2XLAA 3VOEA 4AVBA 3K9TA 3SCFA 4M73A 4FAHA 1TTYA 4Q0VA 5BUVA 4PDKA 5HLGA 3TO9A 3P9IA 2Q8KA 5ICGA 4M9ZA 5F1RA 5K5OA 3WTUC 1J3PA 4I98B 1EH6A 4UVBA 2PFWA 1T0FA 4GGGA 1RUNA 4H0EA 1NE4A 2TDXA 2IXHA 2V1DA 4S04A 3M70A 1ZH5A 1Q43A 1MGTA 5FCCA 4JBAA 3OTFA 4RB1A 2OU2A 4HQMA 3FHIB 2OA4A 4HMZA 2MH9A 1ZGAA 4KYWA 1ZG3A 4QM8A 4AVAA 2BE5F 2VN2A 1XCBA 5CVIA 5JVTA 1SFEA 2ETHA 2FOKA 2CQKA 4LLNA 3ZQ7A 3ES1A 4D0PA 4CICA 2ZFWA 4Q48A 3QOPA 1QGPA 3GEZA 4KWJA 4IEXA 1WI9A 1GXQA 3OOPA 3E6CC 1LJ9A 5ED4A 1UPIA 4E2SA 3GZ5A 5I0TA 4META 1U5TA 2Q0OA 4QGLA 2XLFA 3LA7A 1G6NA 4K8FA 5TJJA 2WTEA 5DD4A 5DYMA 3WE3A 1T39A 1O3SA 1D3YA 2IPQX 1U8RA 4OLLA 3MZHA 3EO6A 1YYVA 1BC8C 4MGYE 4YFKF 4LK1F 3O6BB 1LKNA 1Q5OA 2F5DA 4MX3A 1CAUA 1PP7U 4YG2F 1SD5A 5L3EA 4MGRA 3C3VA 3V7CA 4OMYA 3Q9VA 3NKTA 3BJAA 4EWDA 2VT3A 1IN7A 3RPUA 2F4PA 4L5JA 3U1DA 2HKXA 4AWXB 4ZYDA 4ONUA 4UVCA 1B4AA 1VJ2A 4RB0A 4B8XA 3COAC 4HBLA 2GA2A 3WE2A 3H3ZA 3EYIA 5IT9Z 4FBFA 2XV4S 5ICFA 4IERA 1O57A 4AVCA 2K9ZA 3GFIA 2FXAA 2ELHA 2RGVA 3LZZA 4U0VA 3RYPA 4E70A 5FFXA 1S7AA 2G9WA 1QQIA 3I7DA 1AOYA 1U5TC 3SZTA 1J3RA 4Q29A 1U5TB 2H0VA 1B59A 2DCTA 2D2WA 3TO6A 2CAVA 2ZCWA 4JV4A 2QQAA 4HF1A 3PLQA 2XKPA 5EFUA 1UB9A 3NVCA 2WV0A 4HYEA 3F6OA 1R5HA 4FT8A 1W5SA 2PLYA 4WXCA 4L2NA 4A6EA 1P2FA 4GCVA 3ZMUA 2KIUA 1CAUB 2M45A 4L9JA 2PTMA 4RB3C 1H0MA 3V8LA 3FWEA 4MTEA 5HS7A 1KU7A 1MJ9A 3GFMA 2LF8A 5A2QZ 4HF2A 1SEFA 5HLHA 4Q0PA 1WGPA 3DV8A 3F3XA 3SQNA 5D4SA 4KFCA 2HWVA 2XIGA 2OA2A 2HKOA 2OZUA 1Z6RA 1ZRRA 1SMYF 2K27A 1KU3A 2RC4A 4N0BA 3E5UA 2QDRA 3M3IA 1JUHA 2OQGA 1EH7A 3M8EA 3LQRA 1OYYA 3ZN1A 1ZLJA 1R58A 3HTUA 2VC0A 1R00A 3C1DA 3PQKA 1HKSA 1CX4A 1NXMA 4L9NA 1G3WA 4Q4ZF 2DI3A 4PIXA 3MWMA 2IW5A 5FQ0B 4UHTA 3UKTA 2DTRA 4D7SA 1IN4A 2VQAA 3EQLF 3ZMSA 1XN7A 2EA4A 5EZWA 5FB2A 5ILUA 4F8AA 4MQVA 5DCFA 2VE9A 2V79A 5LGUA 1VP6A 4PCQA 4IEUA 4Q5SF 3TOBA 1DUXC 1CAWA 3ZMZA 2Y75A 3GFLA 4UXAA 2XAQA 1WWXA 4IEOA 1ON2A 1FYMA 2RVCA 3L2HA 2AS5F 4CZZA 4OFGA 3M9AA 3CTAA 5DUKA 2COMA 1G3TA 3RJPA 2ATFA 4BQAA 1H9GA 3J80Z 2DPDA 1IPKA 1F5TA 2FQPA 2GIVA 4IRIA 3I64A 3JAMZ 3BY6A 1YWKA 2CYYA 3F72A 2EVXA 2O3FA 1PDNC 1UIJA 1O5LA 3G7DA 1FX7A 4YYOA 3ABTA 4CDGA 3KEQA 3BZ6A 2A61A 3HSFA 3HIFA 2L3DA 3Q5FA 4IEYA 4KIGA 3N4MA 2PYTA 1QWRA 3U9GA 4A0YA 1EH8A 3DXJF 4Z07A 2EB7A 2R3SA 2V1XA 4EV0A 1JGSA 1USSA 3DQVC 2IC1A 4LG0A 1XDUA 1OKRA 3REOA 4KDPA 2BEOA 4N9HA 3GX4X 2W25A 5JR3A 2L4MA 4P96A 3ROUA 4EROA 3IKVA 4GYGA 1BBYA 4IEQA 4R79A 2OD5A 3JSPA 3F8CA 2NNYA 1R5GA 3BJOA 1ZLKA 1TNTA 2Z2SB 5TRDA 3EHKA 4U7BA 2YX4A 4RAZA 2QNKA 1T2KA 4L9VA 5A2QK 4ZYGA 3SCHA 3C18A 1X7NA 4EM2A 5LLQA 4BH9A 5HLIA 4EWAA 3RTRA 4LB5A 4NVPA 2I45A 1NYWA 1K7AA 1ZRDA 3D5LA 3TDZC 4XEZA 1J3QA 2PG4A 2D5FA 3LAPA 2XRNA 4ETSA 3CLOA 3QRFF 1O7FA 1FYLA 2RV8A 5LEJA 3LFKA 1R22A 2A69F 4HA8A 3WGIA 2F5EA 2VPVA 2H6CA 2CSOA 4KN4X 1NZCA 5JCTA 4ZZLA 2CGPA 3R0JA 1ZYRF 1QPMA 3GFJA 4P55A 2GQQA 4UXNA 5LRSA 2BNOA 3BROA 4L0ZB 4HW0A 1RNLA 4AVPA 3DPTA 1ON1A 2XROA 2BGCA 4LG0B 3QACA 3P9CA 2ETEA 5L3FA 2G7UA 4I3PA 1J7KA 5BPDA 3BALA 3FJSA 4CO8A 1XSXA 3ST7A 2MLGA 3FMQA 3L00A 4BAYA 1WSUA 1MDMA 4OIOF 4HSLA 2K86A 1BOAA 2K0GA 5CLSA 1KYWA 2DQLA 4FAGA 1VR3A 4CYDA 2MD5A 4KL1A 2IXCA 1O5UA 3IC7A 4ON0A 4PGGA 2RKHA 4HX7A 3J80K 2RDPA 1BI0A 3WGHA 1JXSA 1UW8A 1CF7A 5KBFA 4LUKA 1P4XA 3H1MA 5E1XA 3HYIA 3RYKA 5D6FA 4YSFA 2VONA 4XFCA 2GC2A 4JTOA 2QWWA 1X3UA 4HBNA 3HHHA 1SFNA 1LQ1A 3RKWA 1VTNC 4PZJA 1IRGA 1ZNPA 4IEPA 4LTAA 1Q3EA 2P17A 1XGMA 1TW2A 1O3RA 1KGSA 5D5UB 2CO5A 1D8KA 1FBUA 4NB5A 2B8MA 2UY9A 2EV5A 5BMZA 3L9FA 3HRTA 3EQEA 2Z3YA 3ZMDA 4AXOA 3BU7A 3QU6A 3WW2A 2ADUA 1YO5C 4XF1A 2X4HA 5FPZA 2JPCA 2CWEA 3T8TA 1MDMB 2EFOA 4IPAA 1ZRFA 4RD7A 3H8UA 3CJNA 1LNWA 3K1PA 1LVAA 1GQGA 1W7PB 5E16A 4KICA 4L11A 1S6LA 4O5VA 4WVZA 4QWQA 5JR7B 3LQQA 1CF7B 3TDUC 1ZN2A 3GLXA 5I0SA 1SD4A 2IA1A 1IZ1A 1WLTA 1REPC 1PUEE 2V1UA 3WW4A 2GA1A 4HLXA 4PJYA 1O7LA 2G7HA 1RI7A 5D6EA 1ZG1A 3IIAA 1ZG5A 3T1BA 4MZUA 3S7EA 2VE8A 1W4MA 2J5PA 4XFGA 2VBXA 1WKMA 1WRJA 3RIRA 3MPBA 4P9GA 5ICEA 4MUVA 4ZH4F 1YTYA 3QP6A 1FLIA 2KIMA 4RS8A 2FMYA 1IN5A 1TW3A 2QBYA 4KIBA 1SFUA 3K2ZA 4LA3A 2M8EA 3DF8A 3ZMVA 4XSXF 4YRDA 2E7XA 2FQ3A 3LAJA 2PMHA 1EPZA 4A0ZA 5IT3A 1YFUA 5AONA 1IN8A 4FX4A 1BI1A 3IBMA 3QAHA 1YFYA 3I54A 2FA5A 5K5QA 2FBHA 1I27A 3K0LA 4IEVA 2GXGA 2OPKA 2EWNA 2P7CB 3UKVA 3LWFA 1DZRA 1J58A 1MD0A 4PIZA 2V9VA 2PJPA 3H7JA 3VEPA 1ZZBA 4H7LA 4ZYHA 1BN5A 1FSEA 3U2RA 2STTA 3K1MA 2D93A 5LRRA 3FHZA 1ZX5A 2ET1A 1YS6A 4OOIA 4UV9A 4AD9A 1OPCA 5FLHA 3DEUA 2ZO4A 3JSOA 1OR7A 1HKQA 1JHHA 2UYBA 1YQAA 1Q1HA 5ERIA 2HYFA 4GYIA 4BHBA 2GC0A 3HOSA 3R6SA 1YLLA 4M9XA 4M9SA 1EYBA 1V3FA 3FM3A 1J2XA 3BOQA 3SXYA 2QBYB 1S3JA 1Z1DA 4U0YA 4DQ2A 1BIAA 2A6HF 4DNCA 2A68F 4YIFA 4G6DA 2DPUA 2XAJA 5E20A 5I93A 4JK1X 4M6YA 2RQPA 2C0ZA 2EFPA 1YG2A 2HGCA 3TOAA 1F1ZA 2DK8A 3NEUA 3M7GA 5FDBA 2YSRA 1BM9A 2Z99A 2MPFA 2QM3A 1DZTA 3DPLC 3FXRA 4G8XA 4FX0A 1IUYA 4HVOA 1YW8A 4AIKA 1XCVA 4EGZA 1H1MA 5BPXA 5FLXK 5D5VB 3SXWA 1IW7F 5KHGA 2BYVE 2EK5A 4BXUA 1CAXA 4HVQA 3KP3A 1U78A 1UIKA 2CG4A 3QU3A 5HS9A 1BI2A 1DDNA 4UVAA 1XDSA 2LSOA 3NJZA 1LDJA 1JE8A 2O61A 3WGGA 1MKMA 4ZZDA 3GVAA 1L0OC 3NQOA 4HV6A 1YFWA 2MNGA 3H1WA 1S29A 1R1TA 3EUHA 3R61A 4HVRA 4EJWA 2E1CA 2KXLA 4KNYA 5KK1A 2L4AA 2PI0A 1OYWA 2JTVA 3EBRA 2P6SA 3P7NA 3JW4A 5DV5A 1HW5A 2FMLA 4UNOA 1GQHA 3E3VA 5E1ZB 2IXIA 2NAZA 3ISPA 3ZDSA 1WQ2A 1IPJA 4MEYF 4P9FA 2FBIA 4L18B 3WG9A 4IRHA 1RUOA 2MA3A 5EEGA 4WK8F 2O8XA 3Q9SA 1QXJA 3H1YA 3PQJA 1S8NA 1Z7UA 2KJCA 4ESBA 2YX7A 1RTVA 3HQXA 1R23A 1DPUA 1HSTA 4OIPF 4D7TA 4QGMA 4M71A 3BPXA 2CFXA 4XSZF 2FEZA 3VODA 1MZBA 4N9IA 2HR3A 2IXLA 5KHIA 3HHGA 3RNSA 1J9IA 1F9NA 3CLPA 1FXZA 4MV2A 3OCPA 2W24A 1CAXB 3MFKA 4BHCA 3I59A 1GXPA 5F6FA 3M8FA 3R0AA 3F23A 2JT1A 3WTSC 4HSJA 1J1LA 3FF5A 4G7ZF 2EV6A 3RKXA 1HKTA 2R7FA 2IA2A 4J1WA 3ECOA 1G3SA 4KWKA 1LR5A 2HEOA 2O03A 1XMAA 4IJAA 3WU0A 2XL9A 2NYXA 1UHWA 5FO5A 1JHFA 4MTDA 5DD8A 1Y3TA 3FZVA 1BIBA 3F22A 2LF7A 2UXNA 1U3EM 3QP5A 1FBQA 2H94A 2PAKA 1RGSA 4QX5A 3WTWC 1HW2A 4L0YB 2DQRA 3FM5A 3F21A 3HSEA 1I1GA 1B6AA 1KQ8A 3F8MA 4R1HA 1RC6A 4AQ2A 2EFQA 3E97A 5E8IA 2UXXA 2KKOA 4GO1A 1Z6TA 3IL2A 3WTVC 5HS8A 3CUOA 4EM1A 4Y15A 4AIJA 4ENNA 1AWCA 3LA2A 3FX3A 4L5IA 3IDBB 4G7HF 4WCGA 1EV7A 2XKOA 4I0AA 5H6RA 1F4KA 4LJZF 3DL3A 5E17F 2P5VA 4M74A 5CYVA 4KUMA 4TLFA 1U6GA 3I59B 3VFZA 3W6KB 3V7SA 3V8JA 3L09A 1LEAA 3BDDA 1CAWB 4UUVA 2QQBA 3RKYA 3S7IA 3BP8A 1LRHA 2YU3A 3HSRA 2C6YA 2PA7A 5D8KB 2J5OA 2EAAA 2Q30A 2O6GE 2FU4A 2ZNZA 3JZVA 3KGZA 3F8FA 2VT2A 1U2WA 1OD5A 4I0BA 4LK0F 3BPZA 2VBWA 2PAMA 5H6QA 4XFIA 1YLFA 3HT1A 1QZZA 5K8SA 5FD5A 5LEKA 1IXRC 2VECA 3PFIA 2WFPA 1XSVA 3EJKA 3WTZA 2D1VA 1B1BA 1ONVA 5I0UA 2IXKA 4EJVA 1L3JA 2QLZA 5HOOA 5FGMA 1FYKA 4MGKE 2MC3A 4YIIA 4RGUA 2PHLA 4OINF 1EP0A 4AQ6A 5CJ9A 2VOPA 4KU8A 2QZ8A 3GUDA 4Y13A 3RYRA 4RAYA 2DK5A 4XLNF 1XSDA 4O6JA 5JI6A 2VBYA 2HJIA 2OZJA 1FPQA 4MHGA 3K1NA 1OYIA 1ULYA 4IEWA 1ODDA 3SZPA 4OIQF 2XAHA 2XAFA 1XGSA 3UKNA 4HX8A 3FFQA 5L3BA 4B09A 3CO7C 3KGLA 3TNQA 3E6MA 1TQPA 3OF1A 1IRFA 4XF9A 4LLLA 2NS0A 3CEWA 1TQ5A 4HN1A 3ZPLA 6PAXA 1DPRA 1ZZ8A 2OBPA 3GYDA 3U10A 5J3UA 2OYZA 3ECHA 3KP6A 2W57A 3KP4A 2V6CA 2A5YB 4I02A 2D5HA 1R36A 4JQFA 3BPVA 2HTJA 3ML6A 3B73A 4Q0QA 4WZCA 1IF1A 4XRFA 1O3QA 3FXUA 5J8FA 1YFHA 3NSTA 4RGSA 3H7YA 1XE8A 2PFBA 2VXZA 4UV8A 1FP1D 3FMRA 1FOKA 1R1UA 3DKWA 3SHRA 5KHJA 3WTYC 2XLGA 2GH2A 2A3SA 4HF0A 2M30A 1GHCA 2VBZA 2L02A 1BC7C 3HUGA 2Z69A 1HW1A 4ZU4A 4X6QB 5I8SA 2PN6A 1I1SA 1ZVFA 2RNJA 4HAMA 2Q1ZB 3KP5A 3KZYA 2A6EF 1U12A 4S05A 2ESNA 1PMIA 3BJ6A 1OFNA 4XETA 4HN0A 1H9TA 3GZ6A 3KFWX 2Y48A 4A5MA 2D45A 2QCSB 3FMSA 1J5YA 2YPRA 2E7WA 4G9YA 2IA0A 4ZU5A 4X6RB 2KJBA 3FXQA 3ABUA 4B29A 5CU1A 5D5WB 3HT2A 2QJVA 4HQEA 4A2UA 2W84A 1ZRCA 5FLXZ 1XGOA 4Z2YA 5F64A 2MBFA 3RDIA 2OAZA 3OV8A 4BHPA 4WWCA 2Q0AA 4QM9A 4NQWA 2M87A 4QMAA 2Z33A 3R60A 4O9EA 2P7VB 5CVUA 1G4DA 1Y0UA 3KEOA 1STZA 2ZXJA 3I71A 4JTNA 4MQ9F 3PVBB 2XL7A 4O3MA 3HRUA 4WBBA 4G6QA 5AIPA 3NRVA 2LKPA 1FNNA 1T98A 2XAGA 5LHHA 3CL1A 5HI0A 4EM0B 5E18F 3HOTA 5I8TA 4ZU7A 5KHHA 4XFBA 2ZMEA 1X8MA 2VODA 3KETA 2HQNA 1HBXG 3K69A 2HYGD 4J1XA 2P8TA 3CO6C 2W85A 1TQIA 3MQ0A 5BV6A 2QVSB 2QENA 4ORFA 4E2QA 2OQRA 5LGTA 3ES4A 2H09A 3O14A 2E9QA 4XF3A 3IKTA 3J81Z 1UD1A 5T3NA 4XFHA 3KLOA 2X0LA 5JSRA 2MLKA 5JAXA 4HZFA 1I6XA 3SHFA 3D82A 3O2PE 3SCGA 3H3UA 5DEQA 2IJLA 5J8CA 4RGRA 4XBFA 4IF4A 3KE2A 3CUQA 5D1IA 3RZZA 2FF4A 1BI3A 4ASNA 2VC1A 4MNUA 3ELNA 3KP2A 2HZTA 3TKYA 1HSJA 4ENKA 5FD6A 1RZ4A 1D8JA 1J0RA 3T8RA 3TNPB 5K1YA 5EEHA 2Q4SA 4Q47A 1G3YA 3IRQA 5BS6A 2GC1A 1FC3A 2V09A 2PHDA 3OD0A 2EA7A 2BV6A 1UHMA 3HRSA 1LEBA 2HOEA 2D40A 1PP8F 5CVVA 2D1HA 3L2CA 2ESHA 4KMUX 2FNPA 5LHGA 3NL1A 3E6DA 2ISZA 2ZMEB 1KYZA 4XFFA 2AXLA 4I7HA 2STWA 3T5XA 2B9UA 2M1BA 4O9GA 1RIOH 3C3WA 2MHFA 3F6VA 4YARA 3J7AO 4Z82A 1YUDA 3P9KA 4LGWA 4LLGF 3E5XA 2HDCA 4LA2A 4FHTA 2FBKA 1QBJA 2ZJ2A 1XD7A 2N7GA 4MGZE 1B9NA 4ENJA 4I2OA 4EJUA 2JSCA 4HX4A 4IXAA 1LDDA 4R8HA 1HXDA 5D5XB 5ILSA 4HLYA 2O1QA 1XB4A 4BNCA 1UCXA 4ESJA 2BBYA 2IP2A 2R7DA 3CUQC 3MAJA 4K2EA 2A07F 3CO2A 2L54A 1T6SA 3IRRA 5FQ0A 3CUQB 4EJTA 4OIRF 2F2EA 2B5HA 3ETQA 3IDCB 3SMHA 3GO5A 2LDUA 4ZYEA 2GU9A 4HDUA 3CF6E 3ULQB 4QGNA 4EJOA 4KN7X 3ZMTA 2EA2A 2IRFG 1H1IA 4WXDA 3GYHX 4BYYA 2IT0A 1R1VA 1MJAA 4DINB 2E1NA 1L3LA 4XFAA 2RN7A 2H27A 5LHIA 1E2XA 2BNNA 5AVPA 1RL3A 2NRAC 2H6BA 1ZZ7A 2GAUA 1E17A 2FSWA 2HTSA 3S2WA 3LSTA 1IN6A 3KZZA 3WTTC 3D0JA 1W5TA 5FFZA 1K78A 3GWZA 4E2GA 2PQ8A 3WU1B 1X82A 1Z05A 1ZARA 2QYOA 2PAEA 4U0WA 4EWEA 1K6OA 2JPBA 3LOIA 3E5QA 1FT9A 4U88A 3RPQA 1XE7A 3J81K 2ZBKA 1ZREA 2M5WA 3MYXA 3SFZA 1J59A 3BCWA 3USSA 3V8KA 2CAUA 2LNBA 2OZ6A 4JVAA 3I53A 5KHKA 4LB6B 3ZN0A 4AIHA 2XUBA 3H50A 3BWGA 3ERED 5FPXA 4IRGA 5LGNA 1ZGJA 4G7OF 3KCCA 5E1WA 4XF0A 1SD6A 3CJXA 3GXOA 4ENMA 2HFHA 4LULA 4P5OA 5E8GA 3AAFA 3BB6A 4P9UA 2UYAA 4OU0A 5JFRA 1Z9CA 4F7ZA 4KT5C 3I4PA 1PM7A 2O0YA 4M6XA 1YW7A 1UCRA 2IVMA 3LA3A 1DGWA 1TBXA 2YR2A 3TO7A 1Z91A 5BPIA 4WX9A 2FNAA 1P92A 2QQ9A 3S0MA 2PMUA 1K78B 2WC2A 1SD7A 3V4GA 1FP2A 3TGNA 2JZYA 2KIFA 1D5VA 5D8LB 4I01A 1QNTA 1KQ0A 2K4JA 4ESFA 4IHTA 3TQNA 2DAOA 5IT9K 3U0ZA 1YW9A 2PQQA 5CVRA 1P4AA 3MZYA 5I91A 3KMHA 3ELKA 4EVIA 2QUFA 1NE6A 2ACJA 1WA4A 4IESA 4OMZA 4GULA 5BOXA 2JRTA 2ZKZA 5JSPA 2DO7A 3DFGA 3N97A 4XF4A 3MCZA 1UFMA 2Y0MA 5HDKA 3I58A 3EYYA 4KU7A 2EJRA 3O3KA 2UY8A 3QPHA 4Q0UA 4I09A 3WTXC 1ZZ9A 4Y17A 1BJAA 1ZZ6A 4LD5A 4LLOA 3KLNA 5CVJA 5H20A 4RGXA 5FLJA 5KVRA 1CAVA 5DDGA 1FBSA 2EV0A 4A0XA 5L3GA 4A6DA 5HDGA 3LWCA 5K5RA 1SFXA 4EMSA 3L7WA 3VHRA 3KP7A 3ZP5A 3JTGA 5CADA 2B0LA 2DT5A 3H9AA 4UBGA 2IXJA 3W6JB 2XHKA 3D0SA 5BY5A 5JSOA 5E1RA 1T38A 2F5CA 5J48A 3F8BA 1SQ4A 1B9MA 3MEXA 3T0YA 3C7JA 2XASA 4XLPF 5BXXA 1YHFA 1C0WA 3I5UA 1X8EA 2DLLA 1P6RA 2ZKLA 1MJBA 3EETA 1I5ZA 2ISYA 2HQRA 2UZKA 2P5KA 4GXOA 4KIFA 3DN7A 4NHJA 4MEXF 4R52A 2BNMA 4YNIA 1QO0D 3IWZA 5J6XA 4PGHA 3H92A 5C6CA 3KSCA 2L01A 2EFWA 3OGJA 3NW4A 4IEZA 2ZNYA 1IXSB 4CXFA 3GW2A 2P4WA 3B02A 2VOOA 5HVQC 2FE3A 3IWFA 3M1EA 1TLHB 5DCMA 2DBBA 3WODF 4WF2A 1USTA 2PEXA 1SMTA 5AIQA 3HTSB 4YFXF 1DGRA 2K02A 3PNAA 1FWZA 2Z9OA 4WXHA 1CAVB 4PIYA 4YFNF 2QVOA 2ET7A 1DP7P 3G73A 2WWYA 1FZPB 1ZHFA 4A5NA 4HV5A 3GF2A 1K79A 1V70A 2P5LC 5I0RA 2MH2A 1W7PA 3WW1A 1LDKB 3DP7A 2K7LA 2GWRA 3GBFA 1EY2A 4EQQA 1FI2A 5L3DA 4QXKA 4EGYA 3FE5A 3JAMK 1YIOA 4MGIE 1O4TA 4IVNA 2K4BA 5ICCA 1GVJA 2NNNA 1KA8A 2EFNA 1A04A 4U7DA 1FSHA 1TQMA 1FY7A 2GZWA 2DFIA 4TV7A 3LAGA 4Q0SA 4LUMA 4CHUA 4HLTA 2F5FA 5JHUA 5J7MA 1ZAOA 1XMKA 1SAXA 1XGNA 2HS5A 4G94A 3FZ3A 4QLCU 2P6TA 4KWLA 4MH0E 5I8YA 2CW0F 2UWMA 1NHAA 4HDVA 2GXBA 1S7OA 2GC3A 3HRMA 2CV6A 2DU9A 1TNSA 4HOBA 4KMFA 1XRUA 1CGPA 2KRFA 2Z5UA 5DCMB 5C8WA 1KU2A
chains in the Genus database with same CATH superfamily
4L99A 4LFUA 1LB2A 3GTJJ 1LVKA 3BIEA 1VMJA 1KQ9A 2P5BA 5FPLA 1ASJ2 1QXRA 1QY4A 1FYUA 4XKWA 1RMU1 2R7QA 3USUB 2VD7A 1JZ5A 1YFXA 4BIFA 5FKBA 3QPTA 4BK4A 4O65A 4AFBA 2GH8A 3ACLA 1DIWA 2W08A 2AUYA 2H8WA 2DW4A 3KT4A 3DYOA 4MGSA 3LSMA 3MVPA 4ZONA 1J75A 5C9AA 4UFIA 3J8F2 5JZGA 2FRHA 4ABZA 3MMYB 2HEYF 4P9YA 1E57A 3G3ZA 5A7QA 2XVCA 1R7JA 2RVAA 4GALA 2E51A 1D4VB 3VOEA 3K9TA 2HH9A 4AEJA 5T54A 2LK2A 3I2OA 3ZVXA 2OTLI 4ZTJA 4Z92B 1SLTA 1WGXA 2A6XA 1KS4A 5K5OA 1NCRA 5DMYA 1JXNA 4GGGA 4NJ4A 2TDXA 2V1DA 2DODA 2BOJA 1CIWA 3VBHC 1D0XA 1WJEA 3UK9A 3FKIJ 3JB4C 3GTGJ 4BEHB 2JE9A 5FCCA 2IGOA 4RB1A 1BW5A 4HQMA 4CXWA 4HMZA 2Q2EB 1PGW2 4LLNA 3Q0WA 3QQAA 3S3OA 1QHGA 4OQ9A 2ZFWA 3POJA 4C1XA 1PZ9A 3ZSKA 1XYNA 1EJ9A 5EHDA 2HVRA 3VGIA 2VOTA 3DTKA 4FPOB 2W52A 1UPIA 5FMOL 3LDRA 1JYTA 1XJAA 4META 4RS5A 1U5TA 2Q0OA 4CPBD 3CJIB 5TJJA 3N9MA 1ST8A 3WE3A 1UHSA 2JXAA 2W5FA 1SCSA 1W04A 2W00A 1YYVA 1DLLA 5F3GA 4YFKF 1FNYA 4KI5M 1Q5OA 1IRZA 4IOAF 2Q1FA 5EYYA 2Y26A 2JN6A 3HQUA 4YG2F 5FTTC 2KHMA 5L3EA 2NVQJ 1IV6A 1OA4A 4LHKA 2R061 4KBBA 5FMCA 5LK7B 1CZSA 4XAAA 2YHJA 4QAWA 3BJAA 3UR3C 3BTLA 2VT3A 2WNUA 1IN7A 3OR1C 3KCXA 3RFRA 1VNDA 3ABLH 3WG1A 4RMNA 4B8XA 1OUSA 3ZFEB 4IUGA 5IOYA 4MYEA 3EYIA 3DU5A 4XBQA 4OHYA 3B5LB 2HWB2 5CISA 3LSPA 1F5FA 2ELHA 2RGVA 5K0UB 4Y5SA 2VY0A 5DM6F 1T08B 4UB6C 4NOTA 1W9WA 1QQIA 3ZYIB 1HB3A 5JDBA 4FXKB 1F43A 5GTHC 5EXOA 4AZZA 2CAVA 2R7WA 2ZCWA 4XVHA 4BQ3A 4GMP0 3THPA 3AX4A 4BK5A 2LALA 4FT8A 2FCUA 1W5SA 1K45A 4XRMA 3PM1A 1OLMA 2AEYA 4GCVA 1EV11 3ZXAC 3ZMUA 2M45A 3TP0A 2CWMA 3U37A 1E5RA 1WMFA 3V8LA 4LHNA 4DY5A 3B6AA 1MJ9A 3GFMA 2BVMA 3HEIA 5C8CB 4MGQA 3OL3A 3CCLI 3F3XA 4K20A 4CP9B 2KT0A 1AF9A 4A3LJ 3LIHA 1VQ4I 1SMYF 2K27A 5J37A 1GZCA 3RQ4A 2HYJA 4N0BA 2K5CA 1OF3A 2QDRA 4ZY9A 3ZN1A 1OYYA 1TEIA 5E79C 5F37A 2ZMKA 2LY2A 3C1DA 4L9NA 1DHKB 4Q4ZF 1XSRA 2CFOA 1QJZA 2IW5A 2VCAA 5J36A 2CQQA 2BFUL 2DTRA 4HKLA 1IN4A 5EZWA 3ZR6A 4F8AA 4QQOA 2V79A 3WUDA 1QU3A 5FY7A 3KWVA 1JUIA 4Q5SF 1AR73 1CZTA 1BEV1 2TCTA 4GFBA 2DV9A 2Y75A 4OMDA 2XAQA 1W2NA 3EUHC 2VVEA 1JKRC 2RVCA 1VBE1 1W8WA 4DOUA 3VZNA 4CZZA 1WVRA 3M9AA 1BA5A 3LSKA 3ZM8A 1E5HA 4YEJA 2ATFA 1UYXA 3O12A 4DEQA 4BQAA 3G1MA 1IPKA 1F5TA 4E7JA 2SLIA 4N90A 2WZPP 1GP4A 2VUAA 3CCQI 1X4OA 1MACA 2GN3A 2GN7A 4BPZA 2FQ4A 1HB4A 2GMMA 4LO8A 2WY7Q 2XXZA 4CDGA 2G1MA 5A3PA 3AG1H 3W2WA 2A61A 2EICA 3E1SA 5FXXA 1Z7S2 4AUXA 3Q5FA 3C7EA 4KIGA 4XXAA 1OOPB 3O1TA 3POGA 2EIKH 4B8EA 1RUE3 3K4AA 1K4TA 5FLMJ 2E36A 2JG9C 1GZTA 2P3YA 2V1XA 4EV0A 1USSA 1KDMA 2JK3A 1FAYA 4CSWA 2BW3A 4XM3A 2BBAA 2BEOA 3O1RA 1ETKA 2W25A 1BXHA 1UG0A 2DT7B 5F8PA 2QF7A 3V42A 3IKVA 4GYGA 1BBYA 4XMAA 4I0WB 4R79A 1PUFB 2OD5A 4IEQA 1V6JA 4FFHA 5FRNA 4QKNA 1R5GA 1TNTA 5TRDA 2YX4A 2ZX0A 3FN9A 4ZYGA 3SCHA 1S2BA 1X7NA 4YZ5A 4D6QA 2FDHA 4EM2A 4BH9A 3OBTA 2R072 4IV1A 4EWAA 4RHV3 4NVPA 1VLNA 4ZDLA 2B9VA 3I2DA 2YC2A 4X0GA 1NYWA 3D5LA 1FMVA 1J3QA 4GDFA 2CWSA 3KYLA 4HKOA 2RR12 1WJDA 2XRNA 4ETSA 1AR83 3E1F1 3QRFF 5ABJC 1OH3A 3JQXA 3H36A 5LEJA 4QPIC 1R22A 4HA8A 2F5EA 2CSOA 3GTKJ 1A8DA 3NJYA 1B8IA 5IOZA 3RZGA 2JB8A 4P55A 4KJZA 1RUI3 1WCKA 3KQRA 2HWC1 4XUTA 1UOFA 1LOFA 2XROA 1MPXA 5FYSA 2Z16A 4LG0B 5L3FA 2G7UA 2A5ZA 3GZEA 4BQOA 4XLEA 4ISRA 4EQVA 1XSXA 3C2GA 3ST7A 3AL0B 1N47A 2X8KA 1TNFA 3O8HA 3AZWA 2RKHA 2RDPA 1T6GC 4GH4C 1JXSA 1UW8A 1QQP1 5C4JJ 2LY1A 4OI0A 3HYIA 4IW3A 5FY4A 3RYKA 5GZDA 3B9IA 2AR6A 1YJLA 2VIXA 5IYDJ 5HXVA 4KNCA 3KV9A 4HPKB 2GC2A 3WV6A 4HBNA 4UT5A 4PDWB 1VQ8I 3HPGA 1E3PA 1LQ1A 1VIWB 4UW6A 1S0FA 1CR7A 4N4OB 1ZNPA 1X4PA 4IEPA 4LTAA 1GT0C 2BQPA 5M3MJ 2HI3A 3SC7X 4IE0A 5EV7A 4BDZA 2W3JA 1BZWA 2VKDA 2KM2A 3RZLA 1JZ7A 4NPLA 2XB6C 1SDWA 5BMZA 3VBHA 4RGKA 4JZRA 3CMEI 2VL8A 3QU6A 3RSJA 1H4HA 1YO5C 2X4HA 1HXS2 1NLSA 1ZBE3 3T8TA 3N9PA 3LF7A 2YGLA 1MDMB 4DW6A 4RA2A 2W9XA 4C3HJ 3H8UA 3CJNA 1JTXA 4G9SB 5A33A 3K1PA 2JKXA 2WA4A 2Z42A 4HXCA 1WW5A 2C26A 3AXEA 1T2XA 1AR61 1TWGJ 2EBIA 3GLXA 5I0SA 4MO3M 2IA1A 1IZ1A 2BZTA 1WLTA 1HDKA 3ME2A 1OCRH 2GA1A 5DS9A 2QQIA 4GKXA 3ZLIA 3S7EA 2VE8A 2D6NA 1W4MA 2DDUA 1S9HA 4XFGA 2C9KA 2VUJA 2VZOA 5ICEA 4NMIA 4Y5TA 1POV1 3I4MJ 1GUUA 3QP6A 4BUPA 1ND3A 1IN5A 2J7MA 3A4UA 4P00B 2X48A 1WLCA 2OCCH 2R5YA 4XSXF 3BT9A 2RMU1 3AYAA 2JD9A 3LAJA 2RJKA 5JXHA 1X2MA 3LKJA 1EPZA 5BNNB 4YZ3A 1LKXA 4A0ZA 2HOSA 2NP0A 1S2EA 1YFUA 2ZGQA 3MIHA 1WUVA 2O5RA 3FXOA 4JYKA 3KEYA 3WF3A 1O8PA 2HBUA 2YGMA 2FDKA 3H0OA 4D7NA 1YFYA 2FA5A 1OISA 1I27A 3K0LA 4XKVA 4DO0A 2GXGA 1H30A 4OULA 4HFSA 2WO2A 1K4SA 3LWFA 1DZRA 1PO23 2P34A 4RFRB 1BR1A 3KT7A 3VBRC 1N1SA 4M3GA 1JI8A 3U2RA 1FSEA 2STTA 1OLTA 1TME1 4NROA 2D7FA 4XKCA 5FRMA 1WA6X 2JKBA 1AVBA 2HEVF 2VQLA 2TRTA 1VBA1 1OPCA 3ACFA 3BTZA 2ZO4A 3QPLA 2XUMA 2HEWF 2R7XA 3S30A 1JHHA 2UYBA 1YQAA 5GLTA 5A6ZA 3QODA 4GYIA 3HOSA 1H8TC 4RYDA 2DOAA 1ENQA 3G6EI 3Q0UA 1YLLA 4M9XA 2KR2A 4ZYAA 1GOHA 2FCTA 4PBOA 3UGFA 4DQ2A 1BIAA 4B3XA 3LEKA 4DNCA 1VQOI 2A68F 5IYCJ 4JHZA 3RVHA 2VMGA 5E20A 3UT0A 1UZVA 1OVPA 3TOAA 1REDA 2CQ7A 2LW8A 2CUZA 4OI1A 1NCQC 5L36A 5FDBA 1YNAA 1BM9A 1W2AX 4Q8KA 1DZTA 3P1IA 1IS3A 1R1A2 2VOKA 1TWCJ 4AOCA 4JGYB 5KHGA 2EK5A 5FK8A 3LSEA 1GLHA 1U78A 1BI2A 4UVAA 1XDSA 2LSOA 1S72I 2J1AA 2BUKA 4QXCA 4UW3A 4ZZDA 2JE8A 1AYM2 1YE9A 3PUHA 1B72A 4CYCA 1MQTC 4BB3A 3H1WA 2YDEA 2VQTA 3EUHA 3R61A 3ALQA 4W6YA 1R9TJ 1V9U2 1JUSA 1V6OA 1XYPA 2FX0A 3EBRA 2DA7A 2X09A 2Y6JA 4HG6B 5D8AB 1PVC2 3O0WA 3E3VA 4M3CE 5E1ZB 2IS1A 2DFFA 4Z1VA 1COV3 3G71I 4FI9A 2GP3A 4P9FA 1MR5A 2QQMA 3R4UA 1UX6A 2HPMA 5FKKA 5K4LA 2OUHA 3GZTB 4WK8F 3MKZA 4HSTA 1ERDA 4OVEA 5L9VA 2WINB 5M3FJ 1DCSA 1Z7UA 1GV5A 1R23A 1HSTA 4D7TA 1LAJA 3MLLA 5SV8A 1WCQA 4XRSG 3VHOA 5B4NA 4QKBA 2EIDA 4XOPA 2IXLA 3HHGA 4FE7A 5KHIA 3MW3A 1F9NA 4AFAA 3OYMA 1CAXB 3SEEA 1NTCA 3K4BA 4Y24A 1RUF2 5CKTA 2O14A 3HAGA 1QGLA 2JT1A 5C3PA 2EV6A 3RKXA 1HKTA 4LMFA 3WF4A 3ECOA 1DQ4A 4WM7B 5HBAA 4UW4A 4JKLA 1R081 4LR4A 3NKGA 5CNAA 3D5SC 2XL9A 2E1MC 5FYVA 1BMV2 4AW7A 4L8QA 3TAYA 3VYTB 2C1FA 5FO8B 5AC92 3QP5A 4R9DA 4IHVA 2DMQA 1BCXA 1W36C 2DVDA 4XDOA 3EUAA 5E8IA 2DVGA 3KD4A 1ETWA 2JX9A 3GTPJ 1Z6TA 3IL2A 2PXJA 4DYQA 2LOOA 4Q4W2 4S2DA 3CF5F 2HWF1 1W6NA 1N1TA 4HT1T 4A3JJ 1GDTA 1JU3A 2ZJCA 1EV7A 1X58A 1R5ID 1M4WA 3I55I 3Q8FA 4AK3A 3ZN4A 2J1VA 3BQYA 1U6GA 4JC1A 4Y3OA 1CAWB 5D21A 1D0GA 4XYXA 5B66C 5DTDA 2XVGA 2JG8C 1FV2A 3N7KA 3KGZA 2BOLA 2ECBA 3FHQA 1UKGA 3I9V2 3UKGA 1RUC1 4BQ2A 5FFOC 3ZFGC 4MVTA 1YLFA 2BGOA 4DGWB 5K8SA 5FD5A 4XLHA 5LEKA 2WFPA 3A02A 5DZFA 1BL0A 3DPRB 5ANQA 4D7MA 5A3MA 3WTZA 4EN0A 3A0HC 1RIRA 2P4EA 1MS0A 3OYBA 4DYRA 3INAA 3RZHA 3D1NI 5JLWA 5FJ8J 3AZZA 4CP1A 2QLZA 5FGMA 4MGKE 4A45A 3VBFA 5FXVA 3OS2A 4CZCA 3VN4A 5CBLA 2I10A 4YPJA 4LBJA 2CQNA 1JOBA 3ZX7A 1JZ4A 1Y9MA 1ZELA 4CEWB 1AJKA 4M0NA 2RS53 2Y64A 3CU7A 3RYRA 5L73A 2DK5A 2MEV2 4XLNF 2HJIA 1I6HJ 3K1NA 1ODDA 2HBTA 2NQYA 1XGSA 3UKNA 4EN9B 2EQRA 3FFQA 3DTEA 5F5AA 2E53A 4A7KA 1K83J 2HDWA 5GADJ 3CQZJ 1IRFA 4XF9A 1S55A 2VMEA 2ES3A 3OYIA 2NS0A 2G9FA 2VXJA 1NG7A 4CUGA 1SBEA 3CEWA 3POSA 1TQ5A 2NOJB 5CQGA 2KZGA 4P1WA 4QX7A 3CJRB 5J4VA 4OI4A 5GAHJ 2V9PA 3KT1A 4CDUC 2LS6A 3KP6A 5C4XJ 4QX8A 1AKHA 2ARCA 3KP4A 2A5YB 4I02A 3W3CA 1FTTA 2HTJA 4UUSA 2FOWA 3ML6A 3OSFA 3B73A 1WMEA 4BLIA 1O3QA 5FJKA 3NSTA 4AAPA 1XE8A 2VXZA 2JB4A 5F6KA 5APAA 1FOKA 1LGBA 2WIIB 1WHUA 1C8M1 2XH6A 1BC7C 3KCYA 4N7UA 3KF3A 5I8SA 2RNJA 2Q1ZB 5IFPA 4WVMA 4AEDB 3OD4A 2ZOEB 2WT0A 5C44J 1OFNA 4NN0A 2OUMA 4HN0A 1SLAA 3BCAA 3G4SI 3LDBA 4IE5A 1SFKA 1KGYA 1J09A 3LSRA 2E7WA 3PL8A 4J6GA 5L7OB 4G9YA 4NPRA 2IA0A 4LIVA 3WQ0A 4Y1XA 4LHSA 1G9FA 5ACA2 4XZUG 1RKWA 4DZGA 1VBC1 2ZX2A 2DMNA 3FXQA 3ABUA 4DUXA 5CU1A 5D5WB 1RRJA 2Y60A 4JOMA 4HQEA 1TC3C 2W84A 3VBRA 5FLXZ 1XGOA 4QM9A 1LE8B 3VZOA 4N43A 2M9HA 3VD5A 4O9EA 2W91A 5J40A 1G4DA 2ZEXA 4LQRA 3RQ0A 1STZA 1JU4A 2DU1A 1YEWA 4MXWB 4NWVA 3MPPG 3AZVA 5A7NA 2B63J 5AIPA 5JVGF 4K1YA 2LKPA 4I99C 1DU6A 3BTYA 2F5VA 2R1DA 3FHNA 3BR5A 4ITCA 2HQNA 4BACA 1HBXG 3TB0A 4Q4Y3 1C1LA 2HYGD 2P8TA 4RAGA 4PQ9A 1Y1WJ 2OKXA 4EJRA 4ORFA 1ULFA 5F6LB 5LGTA 5T55A 2VQGA 2MABA 2E9QA 4R9AA 4XF3A 3IKTA 3B69A 3N9OA 1D4M3 5T3NA 3CBNA 3KLOA 4QU1A 1G9DA 3HJRA 2JVHA 1I6XA 1H2KA 4YM1A 3O2PE 5FZOB 3RJ2X 5DEQA 1ZM1A 1HLCA 2YU2A 1SHWB 1S0CA 2HZTA 5IVBA 3TKYA 4I30A 3PU8A 1ASJ3 1IV8A 5EZHA 1OT5A 5EEHA 5FY0A 2E34A 1YIJI 1Q8QA 3KYCB 2IFRA 4CCMA 1YRNA 2RAEA 2X6OA 2V09A 5EQUA 5IVEA 2VZRA 3HRSA 4X6AJ 2HOEA 1PP8F 3J4UH 1O59A 2ESHA 4CU9A 4CXXA 2FNPA 1VQPI 1VBB3 2OT7A 3A01A 3E6DA 2O8KA 2QQKA 4XFFA 1WH5A 3F0CA 2STWA 3RKQA 4O9GA 4YARA 1X19A 3ZXDA 1PM4A 2KLOA 3AK0A 3JRGA 4FHTA 4YZ4A 2W1OA 3A7QA 1D5YA 4ENJA 3THDA 2ZXWH 4EJUA 4E9KA 5LK5A 5LA0A 3AG2H 4HX4A 3VYUB 2VUMJ 4PT6A 4U36A 1VQLI 5C4WA 1VMFA 1HXDA 4XAEA 4HLYA 3PNTA 5DAQA 2ZX1A 3P5BA 1UCXA 4WM8A 3CUQC 3CO2A 2L54A 1AJOA 2FUG2 3NNMA 3DBRB 1ODNA 2B5HA 1O4ZA 1EUUA 4RAFA 3UNGC 5KNLA 1ITYA 1X3WB 5A3TA 3ZMTA 3AVRA 5GZGA 1OFCX 2IRFG 4WXDA 2CS3A 2CNAA 2IT0A 5KC6A 4XC9A 2E1NA 3L9JT 5GPCA 2R042 3VDDA 1RVF1 2VBPA 1W8HA 2OF7A 3PTYA 4UWDA 1JYVA 1NLQA 3SDBA 2R062 4V2FA 5EIYB 1W5TA 2XGEA 2WSUA 3D3AA 3ZQIA 1K78A 5IVYA 2PQ8A 3WU1B 1S5LC 1Z05A 1TWAJ 1S0BA 1N3QA 1RHI1 3AFGA 2ZGTA 4JX4A 2JPBA 3LOIA 3PVOA 1BOBA 1MBEA 1KFXL 1DGWX 1M06G 2ZBKA 2M5WA 1MS3A 1ZRIA 4D6SA 2RQQA 3K4KA 1J59A 4IHYA 2PELA 3TEDA 1K61A 3USSA 2CAUA 3ZKUA 4P9WA 1HN1A 4AIHA 2XUBA 3QYBA 4A93J 4XZPA 1WCMJ 3LEMA 2RDRA 1WJCA 1AUYA 4Y1UA 1K6YA 3A22A 2GOMA 4JX5A 4TWTA 2PLV3 3G1OA 2DFCA 2HYKA 4FP2A 4OUMA 2GOXB 2EZIA 3AAFA 4DB5A 1YQ2A 4XUOA 4F7ZA 5KXBA 4KT5C 1AL21 1DQ1A 4AVVA 4E8CA 1EV12 5EG0B 2IVMA 4CCJA 5A6QA 3LA3A 1TBXA 4C0BA 3TO7A 4WX9A 2PMUA 4QIWN 5FXWA 3TGNA 3KF5A 5D8LB 3A0KA 3LSGA 3FIWA 2XQRA 2DAOA 2B4KA 3SQOA 1RXGA 3MZYA 4BJTA 2KMUA 4CP0A 3OYJA 2V9KA 2QUFA 2ACJA 1WA4A 4OMZA 5J1UA 5GJ6A 1UU6A 5K7PA 3PJQA 5FZCA 3D5RC 1R49A 4N53B 3MCZA 2DA5A 1IGOA 1RJ7A 2A05A 2EJRA 4MIMA 3LOCA 3O3KA 4J19A 5C33A 3WTXC 4CA0A 3MIEA 3DBHB 4PSXA 1X36A 1ZZ9A 2BV4A 3W2VA 4LLOA 4YGDA 5H20A 4RGXA 1DDLA 3CP2A 3T2PA 2EV0A 5FZ9A 3AP5A 5HDGA 3A21A 1NG0A 4JDNA 3OYWA 5E6HA 1NA1A 3VHRA 3GMEA 1OLQA 1UZZA 3GF6A 5D2AA 5GZEA 3D0SA 2C9AA 1F8VA 1SQ4A 3C7JA 2XASA 1R4NB 1LESA 4Y1VA 1C0WA 3PMEA 2WSVA 4RSUA 1IS6A 1X8EA 1Q8PA 4OHXA 2RJLA 2UZKA 3VHPA 1B35B 3DN7A 1PO13 1QO0D 3IH3A 2LROA 4B4RA 2VG9A 5FP4A 1JI6A 5FYZA 2D3PA 2EFWA 1XBFA 2HYXA 3S3NA 4DNYA 2VUCA 3M1EA 4FOQA 4BZ4A 2DBBA 3IDAA 4WF2A 2K02A 3PNAA 4WXHA 4YFNF 1H2LA 1DP7P 5F5QA 1FZPB 1ZHFA 1H6YA 4A5NA 1ETXA 1Z7S3 4H55A 5JOYA 3A0BC 2E7TA 5BNPB 2PMZN 4W6XA 3K75B 3WW1A 3DP7A 4XIKA 2FDGA 2GWRA 3GBFA 1UY4A 3MKWB 1EY2A 3W5MA 1FI2A 2DWRA 4QXKA 4W97A 4PJMA 4QQ2A 3FE5A 4D7YA 3JAMK 1R092 1FTZA 1GZWB 1HX6A 4PJ0C 3RRDA 2QA4I 1MIJA 5GLVA 1O4TA 3S5QA 2NNNA 2VC9A 4U7DA 1FSHA 4BLJA 2DFIA 5J1RA 3IAS2 2OJED 2ZZQA 4CHUA 4HLTA 3BC8A 1G7YA 4EYUA 5J7MA 2R073 3CCSI 3AP6A 1ZAOA 5GLWA 1KD7A 3IAM2 3AZYA 1XGNA 2VQCA 5J96B 2ADDA 4IXLA 4LORA 1TNSA 4KMFA 2RR13 1MNMC 4IKFA 5B1BH 4QPGA 3WVJA 5J1YA 1SANA 4RLFA 2HOTA 1JT0A 1LOEA 4IHSA 3HL2A 1VBD2 4XMYA 3U11A 1FNZA 3I0TA 3RQIA 5T5LA 5ILVA 3AKRA 4KA4A 3BVCA 1H2NA 2LVSA 1ZQ3P 3A4CA 3EDPA 3M4FA 3JTHA 5DUIA 3OBRA 2PMZA 1LOCA 1QQP2 4A12A 4NAMA 5HV4A 4UBHA 2YBKA 4NHMA 1FIAA 1IXCA 1S2KA 3ZMNA 2RM23 2F48A 3CCMI 1V4RA 3J26N 1YS7A 4M72A 5FKMA 4L9TA 2XLAA 3E7LA 2WNOA 1U9OA 2YPJA 5M5YJ 3SCFA 4FAHA 2AH2A 5J4YA 4LOTA 5A3NA 4TSVA 1R6RA 3LD8A 4UW5A 4M9ZA 4M3EA 1J3PA 4I98B 1EH6A 1SMVA 4UVBA 4JP0A 1ETQA 5C5TA 1T0FA 4H0EA 2IXHA 3ZQQA 4S04A 1QJEA 3H8XA 1ZH5A 1Q43A 1AR93 4WV8A 4XUNA 1AR71 4ZKTB 4JBAA 3OTFA 2OA4A 4MFEA 1F4AA 1W03A 4KYWA 4QM8A 2W68A 1XCBA 3WF0A 4AI2A 3Q8BA 4AWDA 2VBBA 2FOKA 1X3ZB 3ZQ7A 4Q48A 3NAPA 4LE3A 1LOGA 2ENRA 4IEXA 4QXBA 1AR62 2V72A 5C9AB 1N3OA 4C91A 1S0DA 5JZGB 3E6CC 1IGNA 3GZ5A 4AG4A 5I0TA 4KISA 3I3LA 4P9LA 3I2HA 4QGLA 3H8OA 1HXS3 3O1UA 3LA7A 4B1MA 4LO5B 5DD4A 5DYMA 4NC7A 2X10A 1D3YA 1W9YA 1C3HA 1GV9A 3X2QH 2V6EA 1AHDP 1CAUA 3I97A 5M5WJ 1SD5A 3ASNH 4F3QA 2DMTA 3VBUA 1DYOA 2XB5A 3ZXFA 5KAIC 1VQMI 2XJPA 1NCRB 1MMGA 4CDXA 1WLDA 2XUEA 2RMU2 3NKTA 5TISC 3PUAA 3O1OA 1IDYA 3T4HB 2QQPA 3ZFEC 4HG2A 2HKXA 3WNOA 1VJ2A 2ZKNA 5GM0A 3COAC 2YB7A 2ZHKA 3H3ZA 1ETYA 4BQXA 4FBFA 3FDYA 5ICFA 1LU1A 5K0UC 2BVLA 4NAOA 4XOGA 1MEC3 4IERA 3TYJA 4D3WA 1R64A 2JIGA 3S6PA 4Y26A 4RHV1 1BR2A 2D5VA 2FDIA 5BNOB 5GTIC 3SZTA 1US3A 4KITB 4SBVA 2J22A 1NY71 4RS5B 1U5TB 1B59A 2DCTA 3UL2A 1VB4A 2DCYA 1AR81 2QQAA 5M5XJ 4HF1A 3NWTA 1H2MA 2XKPA 2NVUB 3POWA 3KS7A 3F6OA 1W5CC 3LOBA 1K12A 1A3KA 3DEEA 5DG1A 4L2NA 4A6EA 4Y7NJ 3J7YJ 2BHZA 4CCEA 1F5JA 1I5PA 2D6KA 3K51A 2VULA 3T2OA 3VB9A 3VD9A 4TTGA 5IY5H 5C8CC 5HS7A 1RUI1 5A2QZ 1QHHD 1SEFA 5HLHA 1P9QC 4ATEA 4CCKA 4Q0PA 2ZGOA 2X51A 3SQNA 1FIPA 4Q4V2 4RR3A 5D4SA 1XU2A 3M4OJ 2XIGA 3LSIA 2OA2A 1Y0NA 2OZUA 1ZRRA 3P3NA 2E2HJ 2BDRA 4AM3A 1DYPA 1KU3A 2OS2A 3E5UA 4XTMA 1HF0A 2OQGA 4DZJA 3LQRA 5CYYA 5IJRA 2XF5A 1REFA 5DG2A 3AYDA 4E4SA 1UYPA 1G3WA 5IK4A 3HKZN 4PIXA 1ENXA 3MWMA 2N8GA 1M1EB 1OA2A 1FV3A 4CUBA 4UHTA 1IO2A 2VMDA 4D7SA 2VQAA 3ZMSA 2IS6A 1SLLA 1XN7A 3QOEA 2F6CA 4NE9A 1JUPA 3HBZA 1YIFA 3WD5A 3Q3SA 5LGUA 1S1AA 4LO6B 2WN2A 3TN92 4ZJZA 3GGLA 3TOBA 1DUXC 1UKRA 1CAWA 3TW6A 1DG6A 1JYNA 4UXAA 2QDNA 1YX5A 1WWXA 2OTJI 2LYCA 2P0WA 4IEOA 2O0OA 1LNSA 3FMGA 1FYMA 1ULCA 2WYSA 3L2HA 1DBNA 3CMGA 5JMCA 2VMCA 1TZOA 4CDWA 2YU9J 5GZCA 2GIVA 5H2FC 4IRIA 4HNVA 3KIOA 1MW7A 3I64A 1AYM3 3HB9A 1KZHA 1ONAA 2CYYA 4YW4A 1W9SA 3F72A 1ZBE1 2EVXA 1PDNC 1O5LA 5FP8A 1FX7A 4YYOA 1NUKA 4BQ1A 1V9U3 1MS8A 3B6CA 3MKLA 1LHWA 1EUTA 4F3JA 2WZEA 4B1RA 2BERA 4AGRA 3LSDA 4BMEA 4YGCA 3N4MA 1HQWA 3WP5A 3HKZA 1QWRA 3LFIA 1PVC3 2D6LX 3DXJF 5FMBA 1VALA 5B1AH 2BU9A 5JIAA 1XDUA 1G8WA 4COUA 4KDPA 3JRDA 4M4PA 5JR3A 1AX2A 2PHFA 2PHRA 3JSPA 1UZCA 1SLCA 3GXUA 1CD3G 4RAZA 3K77A 1W2UA 3CCVI 2L7KA 4GAZA 3RWKX 2V5YA 5HLIA 3RTRA 4LB5A 2KISA 2K9LA 1RUF3 3OYEA 4XEZA 1GWMA 4A3EJ 3LAPA 1H4GA 2WAFA 2RV9A 2LG4A 2R6QA 1FYLA 2RV8A 2JDZA 1X9PA 3LFKA 3TBIA 4A3ZA 3AP4A 2R5ZA 2H6CA 2HWF2 4IE4A 4W8JA 1NZCA 5FUIA 4A3MJ 1HN0A 2VW0A 1ZYRF 3C2HA 5FKNA 2D6OX 2K85A 5F08A 1PZ8A 5AC93 4IV3A 2GQQA 1PO21 4OZXA 1RNLA 4A3XA 5LB6A 2X85A 3TOJA 1AYN3 2CMPA 2XPVA 4ASLA 4YGBA 5C71A 3P9CA 2WT2A 2ETEA 4I3PA 1AXZA 2BW3B 4AEDA 3WHCA 1GBGA 3FJSA 4CO8A 2MLGA 3L00A 3VDBA 4BAYA 1WSUA 1FATA 4OIOF 1WMDA 1Y7BA 4UUTA 2K86A 1Q8OA 1BOAA 3BG9A 3SISA 5CLSA 2DQLA 4FAGA 1YX3A 5A1FA 1O5UA 4ON0A 4BKXA 3TBDA 1RUC2 1BI0A 4IV1B 1QJU3 5F2WA 3WGHA 2K40A 1CF7A 4LUKA 1P4XA 3H1MA 5E1XA 4PDWC 1PK6A 2VONA 4XFCA 1X3UA 5FZ1A 4XJAA 1IKQA 1VTNC 2NVXJ 4PZJA 2HLEA 3LB9A 1IRGA 1BVVA 4BCUA 3JRCA 1Q3EA 2F4MB 5JOXA 4R9BA 1TMF2 1TW2A 4BBSJ 3CDIA 1MBFA 5D5UB 2O7OA 1FBUA 4NB5A 2B8MA 1MS4A 4QQLA 2EV5A 3PIJA 1VQKI 3L9FA 3HRTA 3NQHA 1GICA 3BU7A 1SVLA 4E4HA 3WW2A 4Y1YA 4TXWA 4Y4YA 5FPZA 2XBO2 5F39A 2LH9A 2MGQA 5I0DA 2Y0SN 4RD7A 4FETA 3LFMA 4Q27A 1W7PB 4KICA 2ORXA 4WVZA 2QCOA 2FZ2A 4QWQA 5JOWA 3V56A 2XSJC 2MEV3 4H2AA 1ZBA3 1LTEA 3TDUC 4XXPA 3GCWA 4NHLA 1SD4A 3WQ1A 4AQTA 2F4LA 1COV1 2XJSA 1PUEE 2V1UA 5C3OA 1DU0A 2AGSA 3WT3A 1NXD1 3TEWA 1ZG1A 1H0BA 3FBNB 2Y6HA 5AFEA 3H0DA 2J5PA 3VZLA 3AM2A 1Y8QB 4HPQA 3SEZA 2OUJA 2VGDA 2UU8A 3QCWA 5EYXA 1C8M2 1FLIA 3MV01 4RS8A 2FMYA 1TW3A 4FQ4A 1ZA4A 3POIA 2VQ0A 4UFJA 1WMXA 3VBHB 5FYIA 5KWRA 4DBQA 2FQ3A 4KH9A 5BNNC 1QJX3 2DFEA 3K10A 1R1ZA 2E19A 4K1ZA 1IKPA 2BY2A 2VUDA 5AONA 2ZBJA 3PNVA 5IP7J 5A33B 5FLVA 3QAHA 1VBC2 3P6BA 1W2OA 3DXUA 2X9DA 2M0MA 2EWNA 4RQPA 2P7CB 4PSWA 1MD0A 2MG4A 1WJFA 1ZZBA 4BJ0A 1L7RA 1BN5A 3FK6A 3LSJA 5LRRA 3C7FA 5LA2A 5FZIA 3JREA 4AD9A 5FLHA 5ACA3 3JSOA 2DTZA 2A6YA 3DUIA 2ZC2A 1Q1HA 5ERIA 5EEAA 4A6SA 4LBOA 2WNEA 4BHBA 1WJ5A 4FVVA 1ETVA 5LFAA 1ND3B 1EYBA 2BPA2 5F0CA 1ULGA 2ZMEC 2TUNA 3RG0A 2JUCA 4F83A 3MGUA 4XQDA 4LBKA 1Z1DA 4U0YA 3ONQA 2R5YB 2ZGRA 5I93A 4M6YA 2RQPA 2NS7A 1A34A 3IIIA 1YG2A 2HGCA 1EAH3 2QQWA 2M8GX 4XURA 4X1EA 2GDFA 5EGOA 4BDYA 2QZ2A 2BY1A 2VKEA 3T1LA 3S1RJ 3AP9A 5ANNA 1N3PA 3DPLC 4JGYC 3FK7A 5F0HA 3VBOA 5J09A 5JMOA 3K3OA 4BXUA 1UIKA 2CG4A 2WL1A 3NJZA 1LDJA 1JE8A 1XU1A 2L2OA 2E7AA 2I5UA 1JKQC 1KEXA 5CAZA 2CGNA 5CFCA 4A44A 3K2OA 3R4DB 4HVRA 3H5NA 1HV0A 4IGQA 2LTPA 4LXLA 5T5JA 4LKFA 1KRIA 4KNYA 5KK1A 2L4AA 2PI0A 2P6SA 3P7NA 2RS51 5DV5A 5D8AC 1DGWY 4FFGA 3S14J 5IVCA 4UNOA 1GQHA 2BRTA 2ZGMA 4Q26A 3DYMA 3ISPA 2CL2A 3KPHA 4MEYF 2M7BA 5CZKA 5FYYA 3DYPA 4A7YA 2MA3A 3WP4A 5EEGA 1MMSA 1QXJA 1SLBA 2ZHMA 4MG2A 2KZVA 3K3NA 3HQXA 1DPUA 3AMHA 2OQ7A 4M71A 4BE2A 4BQQA 5CKNA 3VODA 3K4NA 1I1EA 4XKBA 3PL0A 2HR3A 4E7IA 4N53A 1FXZA 4MV2A 3OCPA 1I3HA 2KL4A 3MFKA 4BHCA 3M8FA 3ZYGA 3AFHA 3WTSC 4WM7C 1HRI3 1F4HA 4G7ZF 4GJZA 5A6XA 2ZJRF 2QTWB 4YIRX 2R7FA 2IA2A 2W48A 4CYCB 4XPVA 1G3SA 3NARA 2VMHA 1RVF2 1XMAA 3GDBA 2GLOA 3WU0A 5DABA 4XICA 4FXGB 1JHFA 1GP6A 4CXYA 3FZVA 3CC4I 2W94A 1BIBA 3F22A 2UXNA 1U3EM 3S2HJ 1H89C 3WTWC 4XCAA 1HW2A 3FM5A 3A2KA 3F21A 1KITA 2XWBB 3ZYRA 3HSEA 3CCUI 1I1GA 1B6AA 1KQ8A 1HQNA 2DT6A 1VQ9I 4R1HA 1Y8RB 3E97A 3ZR8X 4GMP3 4GO1A 4BQ4A 5F5CA 2Y6LA 4QDSA 2R043 3WTVC 5HS8A 1NLRA 4C3IJ 3CUOA 4AGVA 1AWCA 4ENNA 4DY3A 4BMBA 4CEYA 3FX3A 4L5IA 3HEFA 5FP7A 4E7LA 5JXIA 1JJ8C 3C2UA 4I0AA 2A75A 5H6RA 1B35A 4QB6A 3M2MA 4UYBA 3DL3A 5E17F 2P5VA 2E5ZA 4Q1PA 3L2QA 1OQ1A 1S4CA 2E5NA 4LNVA 2LUWA 4YWAA 3W6KB 1YJWI 3I2KA 1I3QJ 3BDDA 4UUVA 2QQBA 3SJMA 2WA3A 3BP8A 1LRHA 4CDQA 1F15A 3HPNA 2C6YA 2PA7A 2Q30A 2DBNA 3JZVA 2W95A 5FZHA 3HN3A 1U2WA 4W6WA 4I0BA 1AX1A 5KCMA 5H6QA 1QZZA 1UY1A 2XC7A 4URAA 1SVMA 3DPRC 1K5MA 1IXRC 2VECA 5LW9A 5JI9A 1V6MA 2JD4A 4Q4Y1 5DZGA 4BY7J 5DUWA 5IHRA 3FHAA 4COWA 2A1XA 5DXDA 2QKLB 1VRH2 4EJVA 1OCZH 1DZQA 1APNA 1GR3A 3ILFA 3WP6A 1FYKA 2MC3A 4RGUA 4YW5A 1D2QA 4CEWC 5K7ZA 2R7RA 1D4M1 3M1HA 2Z1DA 1G2HA 2JDKA 3AXDA 1W6NB 1WD4A 5CJ9A 4KU8A 2QZ8A 1H9WA 4Y13A 4C90A 4CTEA 4RAYA 3OYAA 3T08A 1XSDA 5A1LA 1HDPA 3M3YJ 4MO7A 2IEKA 2XAHA 1ASJ1 4AL9A 4LJHA 1WBFA 3H9GA 2BWCA 4LO7A 2RS12 3TNQA 3E6MA 5FROA 4LPLA 2Y6KA 2E26A 2E63A 3F9KA 3OF1A 3PDQA 4RBOA 2KD7A 4NIDA 3SLIA 2QBXA 5FIXA 4XMIA 3JRIA 1VBB1 4XJUA 6PAXA 3JD72 1DPRA 1ZZ8A 3GYDA 3AKQA 3U4SA 4HK9A 2OYZA 4M01A 1SDDB 2W57A 1R36A 1HV1A 3ETPA 4F55A 2WKKA 4Q0QA 3WOGA 4N7IA 1JODA 3WDTA 1YFHA 2PHWA 3PO2J 3H7YA 2PFBA 4FO9A 1R1UA 3Q8EA 3WUCA 3V0BA 4BJ6C 4GB32 1HB2A 3SHRA 5KHJA 1SC7A 2L9VA 3OGGA 2GH2A 2A3SA 3MZ8A 3HUGA 2Z69A 3WG3A 2ARAA 1YI2I 5JIUA 3KP5A 2XJQA 3KZYA 4MGTA 2YUSA 1U12A 4S05A 1ENSA 3QPSA 4BM8A 1PMIA 3OYCA 1H9TA 2RS33 1AL0G 5L7OC 2QCSB 2W0XA 4KWUA 5LATA 4W4ZA 5DPNA 3H9QA 1XS9A 4RM2A 2GM4A 4PI0A 2NN8A 2RNGA 4X6RB 3ZN6A 2KJBA 3PVEA 5FKOA 3DCFA 4ZHNA 2QJVA 1RB8G 2HWD2 1AXYA 2QGUA 1AKHB 2DDAA 1RUH3 5F64A 2MBFA 3RDIA 4BHPA 4WWCA 4UUSB 2WT1A 1HJGA 4FTBA 2P7VB 3BOPA 1U0JA 3KV5A 3KX2A 1Y0UA 3SNMA 3ZIWA 2ZXJA 4CU8A 1ZKGA 2GXAA 1QOOA 3ORJA 4MQ9F 5HCAA 3K46A 3PVBB 2FJ1A 4E7HA 1FNNA 3QWLA 4WZFA 2X5IA 4EM0B 5E18F 3BPSA 4FFIA 5KHHA 4V2GA 1JBCA 3PURA 2ZMEA 4XFBA 1R093 3U1XA 3KETA 1UXXX 4P9IA 2PLV1 5HODA 5IWFA 4WVMB 4X8NA 1C5HA 1KONA 4XN0A 2B42B 2W85A 3PIGA 1PNFA 3S16J 1JN2P 3HMYA 4E2QA 4QPOA 2QSFX 2K9NA 2H09A 4C9YA 4IX7A 3T1MA 1UD1A 1CJPA 2JWPA 2CW7A 5CB7A 2CQXA 3LPGA 1PZ7A 1OH4A 2VU9A 3D82A 4Y33A 2R0QC 1FJLA 1Y56A 3IT8A 1TZLA 2NM1A 3WP3A 3VBRB 3DBLB 5D1IA 4ASNA 3ELNA 1JZ8A 5CG8A 5BNOA 1UOJA 2BFUS 1LJ7A 2EXKA 4N43B 1D8JA 3TMOA 2XHNA 3TNPB 2BBVA 1VBD3 1HC8A 4Q47A 3IRQA 1UZYA 5GLZA 5T52A 1FC3A 3OR2C 4FPHA 1MMDA 3UGHA 1BW6A 4F93B 3A1YA 3W5NA 1ZK8A 1FPN3 2D1HA 5EWSA 1MMAA 3NL1A 4CUAA 1G8XA 4I7HA 1PIV3 1OJLA 1JKOC 1GP5A 2WS92 2B9UA 2M1BA 4EN8B 1WW4A 5DDJ3 2MHFA 3F6VA 3J7AO 1VE0A 4Z82A 1YUDA 2VZVA 1AR72 3TW7A 4LLGF 4XABA 3E5XA 2HDCA 2XPWA 1FOD3 4LA2A 5F2SA 5CG9A 1QBJA 1XD7A 4A6OA 1B9NA 4I2OA 3B3QE 5HCBA 2VTXJ 4Q2FA 2W7NA 2O8OA 4R8HA 3PUQA 2WY8Q 3N35A 3ZFFA 3BZCA 5D5XB 3OIOA 4YW7A 1XB4A 4BNCA 1NG6A 2BBYA 4K2EA 2A07F 2HVSA 1T6SA 2MFZA 2JDAA 2CV1A 3S3MA 3W21A 4GJYA 4XLFA 4NIIA 4OIRF 2E71A 5DAVA 3SMHA 4ARYA 2JDHA 3CF6E 3OYLA 2QZ3A 4QGNA 2VM9A 2WZR2 1W8UA 3GYHX 1R1VA 3ECQA 1MJAA 1NK3P 1L3LA 1YRNB 2H27A 4LBQB 5AVPA 1RL3A 3RCOA 1E17A 1IC8A 1PO11 5HCFA 1AR63 4LK6A 4FPLA 3WTTC 2NPIA 4XONA 3A01B 5BNQA 1OURA 1KDKA 4E2GA 4QX3A 1EA3A 2R7SA 2CH0A 3L2VA 1K6OA 1Q8VA 2VOVA 1XE7A 3B9CA 3ATGA 1VZ0A 1LFBA 5FZMA 1Z7S1 1GWLA 2X1DA 4JVAA 5KHKA 4LB6B 1HCRA 1JJ6C 5C4WB 1HRV3 3BWGA 3DWLE 1MNDA 3ERED 2VCBA 4RHV2 1LCLA 5FBJA 2QQVA 4CCLA 1NX9A 4UI9L 2ID6A 4WM8B 3RGBA 3HC7A 3KCCA 2R0FA 2DXIA 1E3OC 1I9RA 2MW8A 2HFHA 2CDOA 4LULA 1NY72 1O4YA 3AKTA 4B43A 1AR82 4MADA 2LD5A 4P9UA 1LEDA 3AMMA 1D2SA 5LBFA 1IQAA 4LKEA 3K4DA 3W2AA 2R071 2CSGA 1YQ6A 3VDDB 3HZJA 5A80A 1QKQA 1JYXA 1DGWA 2E1MB 1X1DA 3SYTA 5BPIA 4HSRA 2QQ9A 1RUI2 3S0MA 2R7VA 5LD2C 5IAXA 1K78B 3HBKA 1SD7A 3V4GA 2RR11 4YG6A 2WRAA 5EDNA 4QKDA 1QNTA 2VI6A 4LITA 1KQ0A 1NT0A 2G4IA 5IT9K 3U0ZA 1YW9A 2PQQA 3UV9A 3AYEA 2XJUA 3ELKA 1NE6A 2NMOA 4IESA 4Q4X2 5IVJA 2GMEA 2ZKZA 1LEMA 5FWEA 5JSPA 1CIYA 4XR6A 3N97A 2ZAAA 2GNBA 1UFMA 1Y39A 3HNMA 3K4ZA 3EYYA 4KU7A 4YM3A 1N1YA 3VDAA 1H9PA 4Q0UA 4Q4V3 5E8AA 4I09A 1KS5A 2RM21 1ZZ6A 4MFDA 2A5WA 4M3CA 3GLLA 2O9LA 4LD5A 1BBT3 3LQCA 1ND2C 2R7OA 5FLJA 5DDGA 1HIXA 2OQ6A 5L3GA 3HOUJ 5FV3A 1WW7A 2UWAA 3LWCA 4B7KA 3M3EA 3L7WA 3KP7A 3HNBM 2D3SA 4RDUA 3OS1A 3NNJA 3MUZ1 2JDYA 2DT5A 3OYGA 2IVIB 3W6JB 1CPNA 3OBZA 1WW6A 1T38A 3MBWA 2JA7J 3GCXA 1C8NA 3FBMA 4NIAA 2WNVC 4DBRA 1AR91 3TN93 2ZACA 3J7ZI 5BXXA 4JGZA 4A41A 4XIOA 2ZGUA 2ZKLA 5EP9A 4OWRB 2DYSH 4XRSA 1HB1A 1QJY3 1LULA 2P5KA 4KIFA 4R52A 4YNIA 1OQYA 4D5CA 5J6XA 1XYOA 3W58A 1VQ6I 3NNGA 3KSCA 2L01A 2HWE2 4FE4A 4ITVA 2YUEA 3NW4A 1CX1A 3RZJA 2P4WA 3RZMA 1HXS1 3WODF 2DOFA 3LIGA 1SMTA 4AYBN 2CUJA 3HTSB 2Y33A 3N9LA 1FWZA 2XMLA 1LHVA 3JQWA 4OUSA 3RI8A 1X2NA 3G73A 2D43A 2M7AA 4QXHA 5BNPC 2UV1A 2KIQA 5HNFA 4HV5A 1U5XA 1K79A 3OYWB 1NA1B 4AI1A 4OUEA 5I0RA 3KYDB 4PJNA 3IKWA 1W7PA 1LDKB 3WDUA 1DF0A 4EQQA 5FUPA 4EGYA 3I8TA 1SZBA 3CDLA 2EXHA 1UMHA 4IVNA 2DVAA 1ULEA 3ZSEA 1A04A 1W05A 1W0UA 5HLTA 4Q0SA 2I07B 4LUMA 1MEC1 5JHUA 4BQ5A 1UWWA 4OCTA 2M0CA 1XMKA 3F95A 4D9JA 2VO5A 1GYKA 2X1EA 4YVSC 2W46A 2HS5A 5IYYA 5JPMB 4QLCU 2WLPA 1PO22 2DJIA 3U14A 2UWMA 1NHAA 1VI0A 3ZN5A 4YM2A 3HRMA 3EYPA 1DQ5A 2DYCA 2AXTC 5H9PA 4IDZA 2R7UA 2Z5UA 3G2BA 1W6PB 2LC2A 2C24A 5C8WA 1X33A 3WW3A 3NWSA 5FMDA 5L3CA 3IHUA 3ZXSA 3MDPA 2G19A 4AYBA 3R4KA 2QQLA 2KRCA 1AHSA 4IETA 2DA3A 5LBQA 5H9QA 2O8QA 1HLVA 2VCCA 2YXSA 1KU9A 3E6BA 2M2EA 4WVVA 2AACA 3C7OA 3DLLF 1IAWA 4MXVA 1UOGA 2KQRA 2JJ7A 1X1PA 4FOYA 2AHQA 3M3OA 3IPVA 3BUCA 4RB2C 1BYHA 5DUXA 4LMYA 4FPJA 5D4RA 3BTAA 1OI6A 2XGXA 3V7RA 5BQTA 1G86A 4RL7A 3G6JB 4AVBA 2CTVA 1BK1A 1TTYA 4D94A 5HLGA 3TO9A 2IS2A 1GZ9A 3P9IA 3IB3A 3KB5A 4QT6A 4JX0A 5ICGA 4P5YA 1T33A 3WTUC 3H3LA 3MHZA 4JX6A 2DMUA 1ZR2A 1FMD3 1NE4A 3S1MJ 3VBSC 1UY2A 3WZ1A 2ARBA 4LBLA 3ZQFA 4IGPA 4MLOA 3VKFC 4K3UA 1GOGA 1NK2P 4UAPA 4QPGB 4ASMB 1W8ZA 2HQAA 2NLRA 3WLUA 3UETA 3CF2A 3S5AA 2XF6A 2YYOA 1NAEA 5A7WA 4AVAA 2VN2A 1ULDA 5JVTA 2PX9A 1YQCA 1SFEA 1TMF3 2ETHA 1IG7A 2CQKA 1MZ5A 5K7HA 3ES1A 4D0PA 1W3VA 3VDXA 5C9AC 3GEZA 2X6XA 5FZ4A 4CVUA 1WI9A 3CDZB 3BR2A 4CRQA 3OOPA 2VNGA 4V2VA 4E2SA 3MF9A 1COV2 2ELKA 4IL6C 1AYM1 2P2KA 3GHMA 5EYRA 3VSLA 4COYA 4K8FA 2ID3A 2XBO3 5FUNA 1O3SA 1U8RA 4OLLA 4ANJA 3DKYA 5TGTA 3MZHA 3HG9A 4MGYE 1RKTA 2LLKA 3HGYA 4LK1F 1V9U1 3WHUA 5DM7F 4ZDPA 2WZ8A 1LKNA 2A3WA 3L2WA 1T56A 4MX3A 1MVQA 1MBHA 3CESA 1O8SA 4N4NB 3GBGA 2K9SA 1NCRC 4MGRA 1PVC1 3FXLA 5FP3A 5JXJA 4OMYA 3Q9VA 1XB9A 1XNKA 4IGOA 1JTYA 5FZ6A 5LBEA 3BOWA 4GRIA 4EWDA 4O7XA 3IMNA 3RPUA 4M3FA 1URXA 4S2FA 3U1DA 4ZYDA 4ONUA 4UVCA 1B4AA 4C0HA 2XGDA 5DAXA 1RUJ3 4NBQA 2GA2A 3WE2A 5AVAA 3ZPYA 2XV4S 3NV3A 4LHLA 3BTIA 1OQDA 1O57A 5FYTA 1WH7A 3NAPB 5FAXA 3ASOH 3PSFA 4A3BJ 2XDVA 3RYPA 1REEA 2W1QA 2ZPXA 5FFXA 1DQ0A 2VVDA 2G9WA 3I7DA 1AOYA 1RUF1 1U5TC 1QNWA 3WINE 4IQPA 2E32A 2Q8EA 4JV4A 5FZKA 5LY2A 1Q1VA 3CMMA 3PLQA 2VW1A 5EFUA 1UB9A 2WV0A 3ZR5A 4HYEA 1R5HA 1UYZA 4AVTA 1W90A 2PLYA 2IXSA 4WXCA 1OR7C 3AVSA 1BMV1 2DDBA 2K46A 2A70A 1CAUB 2AREA 2PTMA 4FPFA 4PJLA 2GNMA 5AC91 2VMIA 3PJRA 4MTEA 1KU7A 3VBUB 2LF8A 1LFUP 4F52A 2L9RA 1OF4A 5FKLA 2C6SA 3GNEA 4CDXB 1UMZA 1OSGA 1AYN1 2WNUC 2BP6A 4XBLA 2CGOA 4JQTA 4OMCA 1W1WE 1Z6RA 4IQJA 4FPGA 4P02B 1Z21A 2ZX3A 2ZHLA 1RC9A 5CFDC 2RC4A 2F4OB 1JUHA 3JBG3 1EH7A 3M8EA 4LG3A 4HNTA 1ZLJA 1R58A 5FYMA 2JE7A 1Z78A 3D4KA 2VZSA 2VC0A 1HKSA 5F04A 4XK4A 1WZXA 5IPAA 2PJRB 5A1AA 3Q8CA 5FQ0B 1QJU1 3CZ6A 1HDDC 3CNAA 2VL4A 4JAAA 4LOSA 3UKTA 5LASA 3WSOA 2HVQA 5FB2A 5ILUA 1AU7A 4MQVA 2JG9A 5LY1A 4CUCA 4IEUA 4PCQA 3L2YA 4BQWA 3ZMZA 3GFLA 5FO9B 4Z8BA 3ABMH 2EXIA 5HXMA 2VVFA 1ON2A 3OIQA 4ZS3A 3CP8A 2Z79A 3ESWB 5EZGA 2RE9A 2RS52 4OFGA 2KDOA 5DUKA 3CTAA 2COMA 4Y52J 3IMMA 1H9GA 3J80Z 2FQPA 5L9RA 3JAMZ 4RR3B 1J84A 1YWKA 1I3AA 1XNTA 5FZAA 4BQYA 2O3FA 2ZFUA 2WQ4A 3G7DA 5ABJA 3ABTA 4RGAA 4QPIA 1OCCH 3KEQA 3FL7A 3BZ6A 3HIFA 1GQPA 4IEYA 1W6OB 2CU7A 3OOXA 5JPNB 2MEV1 1ZBA1 2PYTA 3U9GA 1Z77A 4LE4A 4FOVA 4LKSA 4Z07A 3AL6A 2EB7A 1RUG2 3URFA 4EZ4A 1S0IA 1JGSA 2ZB9A 3DQVC 2IC1A 1PGL1 1MS5A 2R4GA 2G9GA 1VQ7I 1W6MB 3QLQA 1OKRA 4DIQA 2TNFA 2Y69H 3DEWA 3M3QA 4N9HA 2VPLA 3BYWA 3GZUC 2L4MA 4P96A 3MFCA 4EROA 3TEZA 3BTXA 3F8CA 5H9RA 1IG0A 2QUOA 1ZLKA 2Z2SB 2QNKA 2VBDA 1T2KA 4L9VA 4B4QA 1DP3A 3GTLJ 4XW3A 5A2QK 3C18A 3V0AA 3OS0A 3B94A 2I45A 4Z2WA 4GH4A 2B7EA 4C2MJ 4CDWB 1K7AA 1ZRDA 3E0JB 3AG3H 2H1LA 1TP4A 5F5IA 2KP6A 2KFDA 2L9NA 3I2FA 1QJX1 1MSEC 2YS9A 5K7FA 3PVNA 3U75A 4QB2A 5FK7A 3S8PA 2RJ2A 1TE1B 1QMJA 3WGIA 1SFPA 1UYYA 2JENA 3KHCA 2R92J 1Z7LA 4LT5A 4AC0A 2L7MP 2HNHA 4ZZLA 2CGPA 4E7KA 1K5JA 1Z67A 1QPMA 3GFJA 3JRBA 3BROA 4A3FJ 3DPTA 2WLQA 1OCPA 1SPPA 3ABZA 2EINH 2V4AA 3W20A 3QACA 4NRPA 3K4MA 1JZ3A 4YW6A 3SDGA 2K0GA 5ACA1 1KYWA 1VR3A 3OOUA 4CYDA 3OYFA 4KL1A 1IRXA 4IV1C 3MFAA 1GANA 4HX7A 3IAQA 2F6BA 2EIBA 3VL9A 4XJ9A 2DU0A 5KBFA 5JXGA 3CCJI 4YG3A 4Q4Y2 3D5OA 4GWMA 4ZZ8A 2VE1A 4YSFA 1J1TA 3NMBA 3RKWA 1EAH1 4JRLA 4AFCA 5DUVA 1CPMA 3D6EA 2R5ZB 1D4M2 3K70C 3AMNA 4DPNA 1O3RA 1NOVA 3ZGKA 3S2DJ 3UNPA 1WPKA 1KGSA 2FHRA 1W8FA 1E5IA 3OEAA 4IV3B 1LOFC 2OCEA 2UY9A 3VBSA 2PQSA 1IZ3A 2Y9ZA 2X29A 3WNXA 4ASKA 4UF0A 2Z3YA 3ZMDA 1KQRA 1VRH3 5A3OA 4D5FA 2WFF3 4NC8A 2A7AA 1XOYA 2EFOA 1ZRFA 3GHNA 4S2GA 3O1MA 1LNWA 2ME6A 5A7OA 2A3YA 3X29B 5E3OA 2H0BA 3K4LA 1S6LA 2L7FP 5E3NA 2IGKA 1VBB2 5JR7B 3FUOA 1CF7B 2WADA 1RUD3 2E33A 5KXEA 1D7PM 4GKYA 2NVTJ 4QX0A 3C7GA 1REPC 1PK6B 4PJYA 2DYRH 3MIBA 2VKHA 2RS13 5KXDA 2G7HA 1RI7A 5D6EA 4QQPA 1ZG5A 4MZUA 5L19A 2KA3A 2L9SA 3OMYA 4G12A 1MZEA 2VBXA 3VWBA 5IW0A 1W2TA 1WKMA 1WRJA 2E1OA 4P9GA 1LOAA 4KGQA 1W0TA 4ZH4F 1LGCA 3JD73 4BXSV 1TG7A 1NH3A 4ATFA 1H8TA 4FCAA 2QBYA 2J1RA 1SFUA 4LA3A 2M8EA 3DF8A 3ZMVA 2B7YA 2R93J 2E7XA 1DQ2A 1BHGA 2PMHA 1HRI1 3Q0VA 2P3KA 2ZGSA 3GTOJ 1IN8A 4FX4A 4GB33 1BI1A 1RMU2 1WD3A 3IBMA 1NCQA 2FDJA 3HBLA 2X53S 2EXJA 5K5QA 1IPSA 1OD3A 4IEVA 3TEXA 2OPKA 1H8AC 4PIZA 2PJPA 2QQOA 3H7JA 3VEPA 4H7LA 4ZYHA 5M0TA 3K1MA 4HOOA 1W0NA 4Y1ZA 2P3JA 3FHZA 1ZX5A 4GMP1 2COBA 2JUGA 4OAYA 1YS6A 4UV9A 3L1PA 1VQ5I 5FJHA 2R041 2UWBA 3ILNA 2L9LA 3IH2A 2D3RA 3FBYA 4FPCA 1OR7A 1HKQA 1MQTA 2Z5WA 1DP0A 5C3QA 1ND3C 2GC0A 4LBQA 2HWD3 1EKEA 1BK0A 3R6SA 4M9SA 3BU0A 1V3FA 3FM3A 1J2XA 3SXYA 3J8F3 2PLV2 1LFPA 1S3JA 3ZXLA 4C2TA 2A6HF 4LIUA 1RXFA 2XPJA 4YFZA 2DPUA 2DA4A 2XAJA 4JK1X 1XX5A 3VUOA 1SVOA 2EFPA 2ZA9A 3T2QA 5CFDA 2WBMA 4ZZ5A 5GP9A 4XQ4A 5H9SA 2DK8A 1YXWA 3OPZA 3SEPA 3SITA 3M7GA 4YM0A 2YSRA 1AX0A 2Z99A 3LL7A 3MKYB 4FX0A 1IUYA 2HQ5A 4J01A 3OUJA 4AIKA 1XCVA 4EGZA 1H1MA 3FXMA 5D5VB 3MI8A 4RQPB 2VJ4A 4H7MA 1FMWA 4NHXA 4HVQA 1H1AA 2VNOA 3QU3A 1DDNA 2O61A 3WGGA 1UZ0A 1MKMA 1CESA 1L0OC 4AHWA 3NQOA 5IUQA 4XJZA 3I3DA 1D0HA 2MNGA 2ZJPF 1VMHA 3MEPA 1ZTRA 1KFUL 1TL8A 3AJYA 1OYWA 3J9SA 2W82A 2JTVA 3DEMA 3ZMOA 1HW5A 4PF1A 3N9NA 5L9BA 4OQ8A 3N36A 1D0YA 1X50A 1PVEA 2JA8J 1CONA 3OEBA 2NAZA 3NNLA 3ZDSA 2VOXA 1IPJA 2FBIA 4L18B 3WG9A 3KV6A 4ES9A 1RUOA 4TYSA 3Q9SA 1PX3A 3ACIA 4OYUA 3H1YA 3PQJA 3OL4A 1S8NA 5EGOB 4BGDA 2YX7A 4OIPF 3VKLA 4QGMA 3BPXA 1N77A 1OBNA 2JJ6A 2CFXA 3AG4H 3KHBA 1U5ZA 2WS93 3VBOB 2IAIA 3O1VA 1UY0A 3RNSA 1J9IA 3CLPA 4XQWA 3I59A 4YVWC 3JXSA 4HSJA 1QF3A 1J1LA 5FZDA 3O5SA 2VCMA 1OCOH 3AFKA 1CVNA 2WQ8A 3UESA 1ACCA 5CFCB 3SH3A 3ZQHA 1LR5A 2CY6A 1N75A 1DQUA 2HEOA 2O03A 2HWB3 2JG8A 1MS1A 4BOWA 1JT6A 1XG1A 4IJAA 2VTXA 4AQSA 1PO12 2NYXA 5JR2A 1UHWA 2XF7A 1LUJB 2CU5A 1Y3TA 3EUKL 3ZFGA 2LF7A