1HW5A

The cap/crp variant t127l/s128a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
208
Chain Sequence
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVLAEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the T127L/S128A mutant of cAMP receptor protein facilitates promoter site binding
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation
molecule keywords CATABOLITE GENE ACTIVATOR
total genus 60
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hw5A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hw5A01
3C3VA 5F1RA 4RAZA 3HRTA 5FLXK 3HYIA 3SMHA 4U0YA 1P4AA 1CF7A 2PJPA 2HFHA 3H7YA 2FSWA 1F1ZA 4ORFA 4MNUA 2EV5A 1O5LA 1NZCA 1W7PB 1JXSA 1FYKA 3ABTA 3ISPA 4L5IA 2XROA 2X0LA 3N4MA 4OIOF 4HW0A 1FYMA 2V09A 1J9IA 2EA7A 4N0BA 1SD4A 3BOQA 3DEUA 4P9FA 2GZWA 2PMUA 2C6YA 1QXJA 4UHTA 2AXLA 3BROA 2MLGA 2RV8A 3K1MA 1BN5A 2ZCWA 4M6YA 5BUVA 2DQRA 3FZ3A 2VXZA 5F6FA 1LKNA 2W85A 5DCMB 3TOAA 3WW3A 3SCFA 4BAYA 1G3YA 1U12A 5FD6A 3ES1A 3GW2A 5HS8A 2BYVE 5K8SA 2HEOA 4HX7A 4RGUA 2FA5A 1EY2A 2XLGA 3HRUA 3ELKA 5DCMA 5I0SA 2QQ9A 2YSRA 4P5OA 4M9ZA 2J5OA 4O3MA 1TTYA 2CV6A 5CADA 4NVPA 2HYGD 2GC1A 3MZYA 5LRSA 1H0MA 3LSTA 3TGNA 1SD6A 4MGRA 2BNOA 5KHHA 4IXAA 1TQPA 1UHWA 3DN7A 3M70A 2PQQA 1PP8F 5BS6A 5I93A 4M72A 1F4KA 2LKPA 1OYWA 2HOEA 1V70A 1FSHA 3FX3A 1C0WA 3EO6A 4PGGA 4KYWA 3ZDSA 1UPIA 1MDMA 4G6QA 2V79A 3IL2A 2PHLA 4ON0A 1KU3A 5AVPA 1BBYA 5D4RA 4Q0VA 1LJ9A 2M1BA 1XDUA 4AQ6A 2D5FA 3JSOA 3CF6E 3ZMTA 1Z9CA 3F72A 5AONA 2QUFA 1JUHA 3I58A 2K86A 5E16A 1I1GA 4AVCA 3L2CA 4UXAA 3KETA 3IWFA 5E8GA 2E7XA 3TOBA 3CLOA 1REPC 4QMAA 4XFHA 1W5SA 2DU9A 1LDJA 4LG0A 5LRRA 2R7DA 1Q43A 4AWXB 1I5ZA 3H9AA 1X82A 3F21A 2MHFA 4A0XA 5L3CA 2A61A 1ZRRA 3FJSA 1S6LA 5FO5A 2FU4A 4ESJA 2GH2A 1YQAA 4KIBA 1H1IA 5I8YA 3J7AO 5J3UA 3KP5A 3F22A 5BMZA 1MKMA 2GQQA 1A04A 2RVCA 2WC2A 3QAHA 4EVIA 5CVRA 1DPUA 5JVTA 2R3SA 3U10A 1XSXA 1XRUA 3O3KA 2FBIA 2XL9A 3EBRA 1DGRA 1QZZA 1FBUA 3HSFA 3K69A 2FRHA 1AWCA 5ICEA 5EFUA 2ADUA 1ODDA 1S8NA 2DK5A 3TNQA 4D7TA 2VOOA 1G3TA 4HLXA 1GXQA 2HDCA 2OPKA 1IAWA 2QJVA 1T98A 1UCXA 3U1DA 4ZU7A 3BY6A 1EPZA 5HDKA 4L9JA 4ZU5A 4KUMA 5D6EA 1U78A 2GAUA 2XAGA 1LQ1A 1ZZCA 4F8AA 1GQHA 2XAHA 3L2HA 5FD5A 4EM1A 4L9TA 2IXHA 3DXJF 4UV8A 2LF8A 2VBZA 3TDZC 3OD0A 4I3PA 1B9NA 1T39A 3WU1B 2IXLA 3HHHA 3BWGA 2STWA 2OYZA 3MEXA 4WXDA 1FSEA 4U88A 4LEJA 2BE5F 3MPBA 2DK8A 4JK1X 2V1DA 5LEJA 1ZYRF 2HQRA 2EA2A 1GQGA 2UY9A 5H20A 1D3YA 2Q8KA 3MFKA 4A0ZA 3LOIA 2MNGA 3J81Z 2CWEA 3GFMA 4RB1A 3UKNA 1P4WA 1FT9A 2OAZA 1XCVA 2PBIA 3F8FA 3HQXA 4LUKA 2F5FA 1KGSA 3FE5A 1SQ4A 2UY8A 2YR2A 1J75A 1G3WA 1FBSA 1O5UA 3I7DA 4JTNA 5D5VB 2OD5A 2RNJA 3GFJA 1ZH5A 3FXRA 3GVAA 4I01A 3MQ0A 1L3JA 3NSTA 3CDHA 4JVAA 5JR3A 1K78B 3FM5A 4KA4A 2KXLA 2L4MA 1HSTA 4HBNA 3ZN1A 4EM0B 3LAPA 3WTSC 5ICGA 1O3QA 3MZHA 4MGYE 2WV0A 3HHGA 4IERA 5EZWA 1KQ9A 1MZBA 3WTTC 4KU7A 3QACA 3TO6A 5ILVA 3H8UA 3WW1A 5H6RA 5D8KB 3RJPA 3SZPA 5FCCA 4P96A 5K5OA 1MGTA 4E70A 4L5JA 3VHRA 1TBXA 1ZGAA 4QXKA 2D2WA 4GO1A 4RB3C 2VBYA 4E2QA 3NJZA 1CAUB 4BIFA 2W25A 2NAZA 1FYLA 1J3PA 3H1WA 4YSFA 1UW8A 2ZBKA 3DPLC 3QOPA 4M73A 4UNOA 1CAVA 1YG2A 5L3BA 3TO7A 5FLIA 3UKTA 1OMIA 2FF4A 1BI2A 3W6KB 4Y13A 1J0RA 5H6QA 4Q0UA 1G6NA 4XEZA 2UYAA 3IBMA 1ON1A 3KP3A 1J1LA 2FMLA 3SCHA 1D5VA 2OA4A 1PUEE 5LBQA 2V6CA 3I4PA 4YFKF 4Q4ZF 5I0TA 1RI7A 3ZN0A 3EQLF 1YFHA 2RGVA 2PAEA 3E6DA 1ONVA 2V9VA 2WTEA 5I0UA 2FMYA 3RYKA 4ENKA 4HX8A 5DEQA 3IKTA 1ZLKA 2KIUA 3RZZA 3D0JA 1EH6A 2XGXA 2QLZA 4LB5A 4G7OF 3HTUA 1PP7U 1RL3A 2A68F 1S7AA 3G3ZA 2DTRA 5K5RA 3CUQA 3ACLA 4WZCA 4LLNA 1UIKA 4G8XA 4LJZF 5IT3A 3M1EA 3RPQA 2MPFA 2JTVA 2H94A 4WVZA 5I0RA 5HS9A 5BY5A 1B1BA 1F5TA 5ICFA 2PLYA 1X8MA 3G73A 2GC2A 4KDPA 2WFPA 1IZ1A 2L3DA 3LZZA 1JHHA 3E5XA 1JGSA 4IVNA 4HZFA 3V7CA 2G7HA 1IN6A 4PGHA 3JSPA 1U5TB 4XFBA 2F5DA 4Y17A 4LK1F 3QPTA 3R60A 4WXHA 2Q0AA 2L4AA 3MWMA 3LAGA 1W7PA 3IC7A 2XIGA 3WGGA 1IW7F 2KIMA 3IHUA 2Z33A 1O7FA 2MH9A 3WW4A 2WWYA 1H9GA 4WF2A 2K4BA 3H7JA 2EK5A 3O14A 1ZREA 4HN1A 1VR3A 2PQ8A 3DQVC 3DPTA 5JAXA 1J58A 1PM7A 4CHUA 3FMRA 3HUGA 4O6JA 3DV8A 1QXRA 3KZZA 3KMHA 1FXZA 1WI9A 3V8LA 1Z6RA 4IHTA 4IEWA 5ED4A 1GHCA 2CO5A 2P7CB 1TLHB 3BJOA 3WE3A 2FEZA 2P6TA 5HDNA 3WU0A 2DW4A 2IP2A 2BNMA 1RUOA 4P9GA 2QNKA 2CW0F 2P4WA 4HSJA 3D82A 4MH0E 4YIIA 2F5CA 1XGSA 3H92A 4IRIA 3LA2A 1R00A 4HV5A 1YFYA 4PJYA 1U6GA 5DUIA 3G7DA 2AS5F 1O3SA 2IA2A 1ZZ8A 3GBFA 1LR5A 3DF8A 1WRJA 4X6QB 3BJAA 1HKSA 3V4GA 3WTXC 2CAUA 2HKOA 3JAMK 4KT5C 1HW2A 3V7SA 1EH7A 2QQAA 1B9MA 1FNNA 1OKRA 3HSEA 5J8CA 1RNLA 2FOKA 5FLXZ 2VE8A 3CUOA 4EM2A 4MHGA 3GFIA 2IXKA 5K5QA 4MZUA 3DP7A 3WW2A 3WGHA 1R1UA 4OIQF 4OIPF 2Z2SB 2FBKA 5CLSA 4LB6B 1BIAA 4O5VA 1XE8A 2XAFA 1K78A 5C6CA 1OYIA 3U11A 1JE8A 2VT2A 2Y48A 4KN7X 5TRDA 4A0YA 4JBAA 3HSRA 3I59A 4PIZA 1XGNA 3L09A 5L3GA 4IHSA 4QX5A 1RUNA 2RQPA 1CAUA 1ZRDA 3CO2A 1UD1A 4GCVA 1ZAOA 1YWKA 4IEUA 1KYZA 1NE6A 1X3UA 4GGGA 2W24A 1OFNA 4HLYA 4UV9A 1FX7A 5IT9Z 1XB4A 3FHIB 5JFRA 1XMKA 3RNSA 4XRFA 4BHBA 2GXGA 1STZA 4CICA 1QZYA 2O61A 5KHIA 4N9IA 1V4RA 5FQ0A 1FZPB 2VT3A 2UYBA 4EROA 4YNIA 2IXJA 3JZVA 2DQLA 4OIRF 1LB2A 2FNPA 4KN4X 3NW4A 3OGJA 1LDKB 3K1NA 4IEZA 2ELHA 3GX4X 3ELNA 2IA0A 1FI2A 2ZMEB 2VQAA 1TNSA 3KEOA 2EAAA 5LGTA 2UXXA 1XCBA 1PDNC 3KE2A 2OZJA 1SD7A 2QQBA 3FHZA 1W5TA 5LEKA 3MYXA 1J7KA 3K2ZA 2CQKA 4XF0A 2ZJ2A 3ECHA 2VONA 3SHFA 5LHIA 4MTEA 2F5EA 3Q5FA 3MCZA 5F64A 3U9GA 4HMZA 3P9KA 3SFZA 4HVQA 4G6DA 1KQ0A 5HS7A 2ISYA 1KA8A 1ZHFA 4B29A 2DFIA 4R1HA 4HA8A 3GZ6A 2Q4SA 1UHMA 4X6RB 4WCGA 4MQ9F 4XSXF 1Z91A 1E2XA 2VPVA 1RIOH 3S0MA 3S7IA 4LMYA 3GFLA 1WLTA 4BQAA 4MUVA 4EQQA 4L11A 4QGMA 2PFBA 1SFUA 2QBYB 4MGIE 5KK1A 1KU7A 4M9XA 2FXAA 4MEXF 4UVBA 1H1MA 1OD5A 2JSCA 2HR3A 1ZRFA 5CJ9A 4EWEA 1SFEA 4HQMA 4KNYA 4UVCA 1YW9A 4ETSA 1K7AA 2QDRA 1EYBA 2P6SA 4BHCA 4OINF 3QU6A 2QWWA 3K1PA 1XD7A 1QO0D 2ACJA 3NL1A 1O7LA 2HJIA 4I98B 3FM3A 4NB5A 1IN7A 2GC0A 2DCTA 2GU9A 1YS6A 4ONUA 4FX4A 4KIGA 2ZKZA 3ROUA 1T0FA 2GA2A 5J48A 3SZTA 3REOA 4F7ZA 3HRSA 4M71A 3C7JA 3ZMZA 3LA7A 3M3IA 4KMUX 3T1BA 3KP2A 5KVRA 2M5WA 3C3WA 3GEZA 1CAWA 4HLTA 2HKXA 4WXCA 3WGIA 1J59A 4UBHA 3I5UA 3BJ6A 2CYYA 2UXNA 4LK0F 2DT5A 2XKPA 5LGNA 4H0EA 5FFXA 4ENMA 4EWAA 2J5PA 4DINB 1G4DA 3OF1A 1CAXB 2MC3A 4MV2A 3EUHA 4AVPA 4TLFA 1OPCA 1Q3EA 2K27A 2VODA 2IPQX 1R22A 4N9HA 2VBWA 5J7MA 4BH9A 2W57A 2XUBA 3I53A 4RGRA 2G9WA 4KWKA 2L01A 1IXRC 2KIFA 4G94A 1R58A 2L02A 5HLIA 2K9ZA 3BCWA 5JSRA 2A07F 3NVCA 2BNNA 2P17A 1K6OA 3U2RA 5I8SA 5DV5A 2VOPA 3F8NA 4XF9A 5I91A 1YTYA 3OTFA 2G7UA 5E1RA 4YYOA 1YFXA 4M9SA 3GWZA 5J8FA 3F6OA 1S29A 1QY4A 4YIFA 3T0YA 2CSOA 3H1YA 2KJBA 3ST7A 3EYYA 2NNNA 1YFUA 1VP6A 3WTZA 4JTOA 5E18F 3J81K 4JQFA 2NS0A 3I59B 3ZMSA 2OBPA 2A3SA 3IIAA 2GWRA 4XFCA 1LDDA 3E5QA 3NQOA 1EP0A 2A5YB 1KQ8A 3T8TA 1CX4A 1JHFA 4HX4A 4HOBA 1DDNA 1GVJA 2EV0A 5BOXA 4ZH4F 2Z99A 5BPDA 3B73A 4UXNA 2KRFA 1UIJA 2XRNA 1NHAA 2O6GE 3SXWA 1IRGA 4UVAA 3CEWA 4EGZA 3CUQB 3RI4A 1I6XA 3K0LA 2LSOA 3ZMVA 1HW1A 3ECOA 4OFGA 4ASNA 3NKTA 4L9NA 1TQ5A 2D40A 4HSLA 3OV8A 1L0OC 4GYIA 4A2UA 3HTSB 2PTMA 2H6CA 3OOPA 1U8RA 4WX9A 2Z5UA 3I54A 2HQNA 3BB6A 4GULA 4M74A 1QWRA 1CGPA 4IEXA 1R5GA 3IRRA 1BI1A 1YS7A 2M87A 3E3VA 1YLFA 3E5UA 5E1WA 1BOAA 2Y75A 2OQRA 4G7HF 4AXOA 2Q1ZB 2V1XA 5JHUA 3AAFA 1ZRCA 3KP4A 5JCTA 2IW5A 1D8KA 4MGZE 3ZPLA 2NNYA 4U0VA 4FT8A 1FP1D 4L2NA 4LLGF 1VJ2A 5BXXA 3KP7A 1EH8A 2BV6A 2A6EF 3OCPA 2Q0OA 4I2OA 3V7RA 4PIXA 3U0ZA 1P2FA 4EJUA 2RC4A 1U2WA 3CTAA 5DYMA 2DAOA 4KWLA 2D1HA 2EWNA 5FLHA 3F8BA 4IEQA 2ZNZA 1R36A 3D0SA 4G9YA 4I7HA 5KHKA 3JAMZ 2K4JA 3EHKA 2EA4A 5HDGA 4Q48A 4YFNF 2EJRA 4IEYA 1WA4A 2PYTA 3QP6A 3E97A 3M9AA 3GUDA 4E2SA 4XSZF 2ETHA 4IPAA 4ENNA 4HF1A 3F8MA 4ZU4A 4ZYEA 1HSJA 2KKOA 1Y3TA 2L54A 2XAQA 1Z6TA 4M6XA 2ESHA 4BYYA 1WSUA 2Z9OA 3RYPA 4META 4NHJA 4OU0A 1CAXA 3VOEA 2FE3A 4Q0PA 2HWVA 1W7PD 4A6DA 4Q0QA 5ERIA 3GYHX 6PAXA 3KP6A 3Q9SA 3IDCB 2O0YA 2IA1A 1J3QA 2GXBA 1NYWA 5FPXA 1CAWB 3BPXA 4P9UA 1FLIA 4XETA 1Y9QA 3CLPA 1UFMA 3Q9VA 4PCQA 5BQTA 2PG4A 4Q29A 5EEGA 5LGUA 3VB2A 4PDKA 3RKYA 3QRFF 2BGCA 5K1YA 1S7OA 2H6BA 1ZZBA 3EETA 4HF0A 2XVCA 1SFNA 2M8EA 3RIRA 4QLCU 5KHJA 3S7EA 4HV6A 2EVXA 2MBFA 1W4MA 4B09A 5FQ0B 4YRDA 1DUXC 3BPVA 1LVAA 4Q47A 2F2EA 2IVMA 2P5KA 5DD8A 1Q5OA 3PNAA 4Z2YA 2DLLA 4LD5A 3BDDA 2UZKA 2VC1A 2JT1A 3GO5A 1WQ2A 4BHPA 2OQGA 2LNBA 2DI3A 4XFAA 4LFUA 1HQCA 2JRTA 3F23A 3T5XA 3JTHA 1FOKA 5D5WB 1QBJA 4S04A 2OA2A 3ML6A 2EFPA 4I0BA 4HN0A 2IXCA 3ZMUA 2Y0MA 1BJAA 5FB2A 3USSA 4PZJA 1XSVA 2W84A 1K79A 1HKTA 2JZYA 5D6FA 4FAGA 4CGZA 2ETEA 3TQNA 4OMZA 4XFGA 3BZ6A 4ZYGA 2K0GA 3FMSA 3GXOA 2DBBA 1DZRA 3E6BA 3SHRA 3RDIA 3FZVA 3GLXA 4MX3A 2H0VA 2JPBA 2O1QA 1BIBA 2P5VA 4UUVA 1Z05A 4PIYA 4Z07A 1ZVFA 2TDXA 3KZYA 1ZN2A 2PAKA 3GYDA 3TNPB 3C18A 2QCSB 2QENA 2VC0A 5DCFA 1MD0A 3IRQA 4IEOA 3MAJA 4D0PA 5LHGA 4ZYDA 4WWCA 3J80K 5FFZA 2O8QA 1ON2A 3LQRA 2V1UA 2ATFA 3KGLA 2X4HA 1XSDA 3K9TA 4RS8A 3H50A 1LEBA 4L0YB 4O9EA 4WBBA 5LHHA 4QM9A 1USSA 2STTA 4ESBA 1QGPA 4QM8A 3C1DA 3LAJA 4YG2F 4AD9A 1OR7A 2HS5A 5KHGA 1TW2A 3L7WA 3TO9A 2ZKLA 4EWDA 4TV7A 5EEHA 1I1SA 5E8IA 3I0TA 1KU2A 3MDPA 3KGZA 2HGCA 1HXDA 3RPUA 3ZP5A 4CO8A 1X8EA 1Z1DA 1SMYF 2B0LA 3GF2A 3KLOA 3L9FA 1AOYA 3SXYA 4DQ2A 5L3EA 3PFIA 1FBQA 4ZZLA 3E6CC 3L00A 5JSOA 1O57A 3HRMA 1DGWA 2HZTA 4RAYA 5J6XA 2RDPA 3JW4A 1BC8C 3QU3A 4I02A 1QPMA 2FNAA 3KCCA 3JTGA 2B8MA 3LFKA 4L9VA 3FXQA 3J80Z 1DZTA 1U3EM 2XLFA 1SD5A 5BV6A 3HT1A 1Y0UA 4IF4A 2IC1A 1R5HA 4IRHA 1P92A 1YW7A 3NEUA 5E20A 2MA3A 2ISZA 2IT0A 2B9UA 2QBYA 2NYXA 1XMAA 3VEPA 4UBGA 3SQNA 1RGSA 2PAMA 3VODA 2IRFG 3PQJA 1R1TA 2YX7A 3TDUC 2EFQA 2OU2A 3QP5A 2M30A 1FC3A 1P6RA 3ETQA 1IF1A 2P8TA 1ZZ9A 3KFWX 4XLPF 4MGKE 2FQPA 1T6SA 4KWJA 2ZO4A 2FBHA 1CF7B 1I27A 1ZZ7A 2ZFWA 4CXFA 3RYRA 1H9TA 3GZ5A 5L3DA 2ET7A 2QVSB 2YPRA 1HW5A 2Q2EA 2IXIA 1S3JA 2E7WA 3WTVC 3ERED 3R0JA 2FQ3A 1B59A 2C0ZA 4XBFA 4EV0A 3IWZA 4CYDA 3FWEA 1SMTA 1YYVA 2Z69A 3KEQA 4JV4A 1IN5A 5ILSA 5D1IA 5FDBA 3QPHA 4ZZDA 4FHTA 4IEPA 2PA7A 4I0AA 2PN6A 4AVBA 5HLGA 4FX0A 4K8FA 4K2EA 3RTRA 5ICCA 4B8XA 4MQVA 3ES4A 1MJBA 5CVUA 4XF1A 1MJ9A 1PMIA 2KJCA 4RGSA 3FFQA 1EV7A 5T3NA 2D5HA 2O3FA 2O03A 1IUYA 2QM3A 3NRVA 1YUDA 4Q5SF 1IPKA 2JPCA 5DD4A 3CJXA 1G3SA 1FP2A 2MD5A 2PEXA 4QWQA 4LUMA 3DFGA 1CAVB 4AIKA 1SAXA 4RB2C 2DPDA 5TJJA 2E1CA 3FMQA 1KU9A 2CGPA 3WE2A 1YIOA 3CO6C 5D8LB 1KYWA 5LLQA 5AIPA 4ENJA 4IESA 4HF2A 2EB7A 1BI0A 2IJLA 2COMA 4HDUA 3M7GA 5HI0A 2ZNYA 2NRAC 3BPZA 1BM9A 2I45A 4DNCA 2H27A 3B02A 1T2KA 4QGNA 4E2GA 5A2QZ 3LWFA 1X7NA 3SCGA 4U0WA 2HYFA 2PHDA 5CVVA 4HDVA 5CVIA 2VE9A 1ZG1A 2XASA 1D8JA 3O6BB 3H3ZA 3UKVA 4AIHA 2GC3A 2EFOA 5HLHA 5CVJA 2CAVA 3CJNA 4CZZA 4KL1A 3HT2A 3COAC 4A5MA 2LF7A 5D5XB 4I09A 4A6EA 2QZ8A 3P7NA 5DUKA 1RZ4A 2VBXA 3EYIA 3F3XA 1WKMA 4KU8A 4OLLA 3WTWC 1YO5C 4Q0SA 4OMYA 2DPUA 1O3RA 3S2WA 4BXUA 1ZGJA 3D5LA 2P5LC 1IRFA 3E6MA 4KMFA 3EQEA 4IJAA 3ABUA 5D5UB 4RGXA 3LQQA 1HBXG 2DO7A 2CFXA 3RKWA 2A69F 4A12A 1QNTA 2VN2A 1HKQA 3PVBB 5BPXA 3F8CA 2MLKA 1DPRA 4LGWA 2D93A 4Z82A 2BBYA 2YU3A 3N97A 1FPQA 2ESNA 3VFZA 5AIQA 4AIJA 1GXPA 3WTYC 4L18B 3EJKA 3EDPA 4CDGA 3P9IA 1XGMA 3R0AA 5E17F 2PFWA 2UWMA 3H3UA 3TKYA 2ZXJA 4EJWA 1LEAA 2ET1A 4KIFA 2MH2A 5A2QK 4EGYA 4J1XA 1ZLJA 3PQKA 1DP7P 1TNTA 4EJOA 5JSPA 4S05A 5FPZA 4H7LA 1IXSB 2LDUA 1QQIA 4HVOA 5HVQC 4R8HA 3CO7C 4ZYHA 1O4TA 3CUQC 4XFFA 2E9QA 4GYGA 5JR7B 3R4KA 5BPIA 1U5TC 1LNWA 2Z3YA 4A5NA 1T38A 2K7LA 4EJTA 3LWCA 1SFXA 1Z7UA 4OOIA 4O9GA 4XF4A 2HTSA 3W6JB 4U7DA 3O2PE 4LLLA 3BP8A 2XKOA 5IT9K 1IXCA 2XHKA 1RC6A 2P7VB 4HVRA 3DL3A 3FF5A 5E1XA 1F9NA 4HAMA 1J3RA 5ILUA 2PI0A 1R23A 1TQMA 1TW3A 2HTJA 4NQWA 4J1WA 2N7GA 5CU1A 2CG4A 1BI3A 4AQ2A 4LULA 1NE4A 3HOSA 4U7BA 2RKHA 3FXUA 1YW8A 2QYOA 3RKXA 2Y0OA 2QVOA 2OZ6A 2VECA 5L3FA 4BNCA 4YFXF 1LRHA 2GIVA 3CL1A 1OYYA 1P4XA 1ZARA 1ZNPA 3BU7A 3LA3A 1YHFA 4EMSA 1ZZ6A 2XAJA 1B4AA 2EV6A 1J2XA 3V8JA 4MEYF 4LA2A 1TQIA 2XL7A 4KICA 2B5HA 1R7JA 2OZUA 4XF3A 2A6HF 4XLNF 2O8XA 3R61A 1IPJA 1WGPA 4FAHA 1ZG5A 2ZMEA 4IEVA 1ZG3A 4WK8F 1USTA 3ZQ7A 2RN7A 3F6VA 1U5TA 3DKWA 5E1ZB 1RTVA 4P55A 3H1MA 3ZMDA 3I71A 2EFWA 3IDBB 5CYVA 1BC7C 1MDMB 5D4SA 4LA3A 1XGOA 4GXOA 4L0ZB 2EFNA 4IRGA 1MJAA 4YARA 5HOOA 1UCRA 1YFWA 4QGLA 4D7SA 2XV4S 1YLLA 2GA1A 1E17A 3T8RA 1L3LA 1R1VA 1WWXA 3HIFA 4HBLA 5I8TA 2H09A 3IKVA 1J5YA 3P9CA 2E1NA 1Q1HA 5DDGA 2M45A 4AVAA 4FBFA 4ESFA 1XE7A 2YX4A 3ULQB 1OI6A 1NXMA 4Y15A 3M8EA 1UB9A 2BEOA 3V8KA 3WODF 1VTNC 3WTUC 1ZX5A 4RB0A 2K02A 1ULYA 4LG0B 3WG9A 1XDSA 4RD7A 3BALA 2PMHA 4HQEA 1XN7A 4XFIA 1B6AA 1FY7A 4G7ZF 1IN4A 2Q30A 4KFCA 2D1VA 1V3FA 4R52A 3HOTA 1FWZA 3I64A 3M8FA 2R7FA 4EJVA 3PLQA 1O3TA 3KSCA 4R79A 4IETA 4LLOA 1IN8A 5KBFA 4MTDA 3KLNA 3R6SA 4LTAA 2XLAA 1SEFA 2F4PA 5FLJA 5FGMA 5JI6A 4HYEA 5C8WA 2D45A
chains in the Genus database with same CATH superfamily
3H35A 4RAZA 2WO3A 4LOTA 1NTCA 2WAQA 4NNJA 3OL3A 4U0YA 1DYPA 1P4AA 1CF7A 1GP6A 2ZAHA 4E8DA 2FJ1A 1RUJ2 5GJ6A 1BBT1 5C7GA 1F1ZA 3RWNA 3AMMA 2GMMA 3AXEA 3VBSB 4MNUA 1UZWA 4AK3A 3NAPA 2X6YA 5A6ZA 1NZCA 2ILMA 2J1AA 2UU8A 1BA5A 1H4HA 1XNCA 3CJIC 2PX9A 4A3CJ 2X0LA 4OIOF 4HW0A 1LE8B 2V09A 5M3FJ 4P9WA 3BOQA 3MV11 4XRSA 1U5XA 2MLGA 3GF6A 2KQRA 4UFMA 3PM1A 3FZ3A 5F6FA 2DUPA 2GN3A 3WW3A 2BERA 3OGVA 5FD6A 3DXTA 5FPVA 2FA5A 4JRLA 2XLGA 4IKFA 5DCMA 2YSRA 1W8UA 3FBYA 5BNQA 2GC1A 3C7HA 1K45A 2ADDA 3SH4A 4MGRA 3UGFA 1RUI1 3DN7A 3M70A 3ZN6B 1PP8F 4QPIB 2LKPA 1OYWA 3K10A 2HOEA 4X8PA 3WY6A 2EZHA 1V70A 1JZ3A 1JXNA 3FX3A 1C0WA 4CCNA 1DHKB 1Y9MA 1XJAA 1UPIA 1VFCA 2UV1A 3I3MA 3S16J 1CIYA 3LSRA 4FP3A 4G6QA 2V79A 3IL2A 4IGOA 5C5UA 5D4RA 4Q0VA 1SLTA 2ADEA 2M1BA 2VMCA 2XR4A 4XDQA 4PLNA 3ZMTA 4ES9A 5AONA 1ERDA 1UL9A 4OUMA 2JA8J 5BNOA 3WHUA 3KETA 5E8GA 2VW0A 2WZR3 5BNGA 1REPC 2WWSA 1W5SA 1AA7A 3QYEA 5HLTA 4LG0A 4AWXB 4URAA 3H9AA 1X82A 3CZJA 2NXNB 1NZIA 4NIHA 4I76A 2A61A 1JI8A 2V5DA 5FO5A 2Z79A 2AC1A 1YQAA 3B9CA 2VC9A 2BP6A 2HBUA 1PGL1 4QPGC 3D8CA 1MKMA 1ND3B 2QQIA 3QAHA 5CVRA 3K4KA 3MKYB 4XUPA 1DPUA 5JVTA 5IWFA 2R3SA 3U10A 4RYDA 3POBA 1XRUA 1NA1C 3TYJA 2WBMA 3ILFA 3HSFA 3M4FA 3LSKA 2VOOA 5F04A 1G3TA 1P7IA 1GXQA 4CYCB 2AQFA 4XQFA 1U5YA 2V1NA 4RHV1 1COV1 4ZU5A 3WG1A 1WH7A 4M3BA 1DDLA 2WAFA 2GAUA 1QJFA 2QZ2A 2PHWA 4F8AA 2IZWA 2Q1MA 2VKDA 3ZXDA 3LDKA 1VRBA 2VZ1A 4Y22A 2FZ2A 2X1DA 3OD0A 1XU2A 2B4KA 4RM3A 1FNZA 3M3CA 2J1RA 3WU1B 4YM0A 4QKBA 2OYZA 4IO9F 3U1XA 5CISA 3VD3A 2FDFA 2CFOA 5DUXA 4QPWA 3ZQQA 5LEJA 5K7FA 1SANA 4J25A 5FZOA 2Y6LA 5C5TA 5GKAC 3HQRA 4CUGA 5GZEA 5GP9A 3G4SI 1ETOA 3MFKA 4AI9A 3LOIA 2CWEA 3GFMA 4JX4A 2RMU2 2AH2A 2A3YA 1I1EA 2PHUA 2VVEA 1GP5A 4AEMA 3ETPA 1X33A 5D5VB 4FQGA 2HWD1 4CP0A 3FXRA 4F91B 4I01A 3MQ0A 1L3JA 4A6SA 1H8AC 1K78B 1DGRM 4KA4A 4LHNA 4HBNA 3ZN1A 5IAVA 1SCRA 3T30A 1QZEA 1O3QA 5T55A 1SLCA 2WV0A 2LS6A 3JRIA 3RSJA 2I2SA 4BQQA 5AVAA 2BY0A 2W48A 5KC5A 3VBRA 3TO6A 2ZOEB 1O4XA 3H8UA 5H6RA 3GJBA 4DYCA 4ARXA 3RJPA 2RS12 5FCCA 5GLWA 1OSGA 4DJAA 3V64A 2LD5A 4EEFG 3RZKA 2QSGX 2Y0SN 3VHRA 3O8GA 4E7SA 2QQJA 1TBXA 3U07A 3LMMA 4RB3C 2BTVC 2QUOA 1TMF2 2HBTA 3NJZA 4BIFA 3LNQA 2NS7A 4XKBA 3QOPA 3ZSEA 2DFEA 4M73A 5FY0A 1DIWA 1W9SA 4BE0A 1CAVA 5GAGJ 5L3BA 2D6KA 3CCMI 4FPEA 3MIGA 4XICA 3UKTA 2FF4A 1RUF1 5C33A 5H6QA 2VZPA 2VQHA 1VQMI 3S1NJ 3TOJA 3VL9A 2L7KA 1ON1A 4G3YC 1AJOA 1J1LA 2OA4A 4LKDA 3AP9A 3AKTA 4AFCA 4XJWA 1YFHA 5ACA3 5IK8A 3DU5A 2E63A 5I0UA 5JUVA 4ENKA 3IKTA 3HPNA 1EH6A 3DWLE 2Z1DA 1E0EA 3LSMA 4YW3A 3HTUA 4BQYA 2MEV1 1S7AA 4XL9A 3WSOA 1W8OA 4LLNA 1JJ6C 1FMVA 5IT3A 3M1EA 2ZSIB 1VBC3 4UUSA 2CU7A 2H94A 2JG9A 1SBEA 5BY5A 2RDQA 2WUHA 1F5TA 5ICFA 2JB8A 1X8MA 3G73A 4O65A 2GC2A 1QNYA 2WFPA 4XACA 4JX6A 2Y30A 3E5XA 1YI2I 3LSPA 2CSGA 4IVNA 1GVDA 4BLJA 1YIPA 3V7CA 2BOJA 2VVFA 1POV0 3ZFEB 5EF6A 3JSPA 1IS3A 1U5TB 4E4HA 1VBB1 3I2OA 4XFBA 5GAHJ 4Y17A 3NNFA 1JBCA 3QPTA 2VZ3A 4DUXA 2BWAA 3MW3A 5E6HA 4KWUA 3LAGA 5A3PA 4A3MJ 5AC93 4Q4X2 3WDUA 4FTHA 2MH9A 1OUXA 2EK5A 2XGDA 4KITB 4INDA 4QPGA 2GIZA 4HN1A 3ZIXA 2BW3A 2JWTA 3DPTA 1WD4A 1J58A 1PM7A 4RR3B 5JAXA 4CHUA 3V42A 3HAGA 3HUGA 3DV8A 1AYM3 1VMHA 1JJ8C 2JE9A 1Z6RA 1TMF1 1N1YA 3BJOA 3WE3A 1X1DA 2FEZA 2WZR1 2DW4A 3H0DA 1VBE1 3BTAA 2BNMA 5EP9A 2DXIA 2BBAA 2P4WA 1XGSA 5D2AA 2VJJA 4MFEA 3HKZA 4CXYA 3BYWA 1Z77A 3FUOA 1YFYA 4K21A 1JUIA 2VMDA 4XQWA 5DUIA 4QXBA 3WZ1A 1EA3A 1JT0A 5FZOB 5LBEA 3GBFA 1T95A 3DF8A 4FETA 2ZGUA 3JBG2 3MZ8A 1WRJA 4X6QB 2W91A 3LPGA 2ZXWH 3VHNA 4KT5C 4ABZA 3UL2A 5TISC 1EH7A 2D98A 1Q56A 3U75A 1B9MA 4QKNA 1FNNA 3PFYA 3K4DA 4CE8A 4XIOA 5FLXZ 2KA3A 4MGQA 1YRZA 4FE4A 1RJ7A 3WW2A 3HBLA 2VL8A 4OIQF 5CLSA 4LBOA 1RINA 1JT6A 1BIAA 2ARAA 1ACCA 1XE8A 1G9AA 1GNYA 4XPVA 1K78A 3U11A 1D5YA 3O0WA 4KN7X 4C0BA 5M5WJ 2G19A 3AKZA 3L09A 4JKMA 2ZJPF 4IHSA 4QX5A 1RUNA 1IS5A 2ZZQA 3RRDA 1T6BX 1QOSA 1W0NA 4K6BA 1YWKA 2ZGNA 2Y33A 3SJMA 4SBVA 4LITA 2D3PA 3JQXA 4E7JA 4OI2A 2DFCA 3KV6A 1I3HA 1OLMA 4HSTA 4UV9A 4Q4V1 2ZGQA 3FHIB 1JKQC 2ZX2A 2UURA 2MGQA 2GXGA 1SMVA 2JICA 2XXZA 1N47A 2C6SA 4YRVA 2QQ8A 3O5SA 4N9IA 1H9PA 2VT3A 4EROA 3BTIA 2DQLA 4OIRF 4LKSA 1H6XA 4KN4X 3NV1A 3NW4A 3DTIA 5GLTA 3JRBA 4IEZA 3ELNA 2IA0A 2BOLA 2UXXA 1V6NA 1BHGA 3N9MA 3KE2A 2OZJA 1SD7A 4AEDB 3FHZA 3OYNA 5F5IA 4NRMA 4CDWA 4MTEA 4CP9A 1Y6IA 2VW2A 4QPYA 2AEZA 1BEV2 4K7JA 3ASOH 3MCZA 3U9GA 3FLPA 3ZIWA 2OIIA 2ZJRF 1KA8A 2HWE2 1JOPA 1ZHFA 2QSFX 4B29A 2ZEYA 4HA8A 3KX2A 1YQ8A 3ZOBA 4MOAA 4FPFA 1AU7A 1SFYA 2XHNA 2DFHA 4LMYA 4AEKA 3JD73 4MUVA 1PO13 1W04A 3POSA 5KK1A 2FXAA 3S5AA 3VZLA 3ATGA 1H1MA 4BA6A 1CN1A 1V6IA 1RUE2 2BHZA 5FKCA 3LKJA 2QDRA 2WZPP 1T08B 1EYBA 1AXYA 4OINF 2JWPA 5FY7A 4JKKA 4WVVA 1X4PA 2GC0A 5A7SA 4N53B 1AXZA 4COVA 2GSYA 4FX4A 2XF7A 4XQ4A 2ZKZA 1XPWA 5FV3A 3ZMZA 5FZ0A 3M3IA 1LOFC 4KMUX 2LFBA 3O1TA 1RC9A 3KP2A 4XBQA 5KVRA 1LU1A 1CAWA 4HLTA 4WXCA 1OCTC 2VPRA 3I5UA 5LGNA 4H0EA 2WS92 4EWAA 1G4DA 2JIJA 3EUHA 1LHOA 4TLFA 3VDDB 3HD8B 1K5MC 2VODA 2IPQX 4M3CE 1R22A 2QEXI 5DAXA 4N9HA 5FYVA 5J7MA 4UB8C 2E51A 5KAIC 4XJ9A 1D0YA 4UFJA 2JQ7A 4OHWA 4EN0A 3VDDA 1BVP1 4MVTA 3I9V2 5JOXA 1W2NA 2VNVA 3H5AA 1KEXA 5FR3A 2L02A 2BNNA 3O8HA 4A3GJ 1UOJA 2IS4A 3Q8CA 3VD4A 3MW2A 4ANJA 4LBQB 1VZ0A 2UWAA 3IPVA 4P9LA 4M9SA 1W6MB 3GWZA 5J8FA 2O9LA 3QCWA 3LIHA 1OOPB 4Q4V3 4YIFA 4B1LA 3GALA 5EZHA 2VCCA 4I99C 3T2PA 4BIOA 2H1KA 3I2HA 1W6QA 3PVNA 3WTZA 4CDQA 3C7GA 4F3JA 5E18F 4BGDA 3J81K 4JQFA 3ZMSA 3IAQA 3DGTA 1AYN2 2ARCA 2G9GA 2GWRA 1LDDA 2L7FP 3E5QA 4AGGA 4IDZA 1UY0A 4BXSV 3WF3A 1GVJA 1AR93 4M01A 4GJZA 3P3PA 2HVQA 4UXNA 4NC6A 5IW0A 3USUA 5C3EJ 2QE3A 1HN0A 3EYPA 2RR13 3K0LA 4QQ2A 4B1RA 1FOD3 4ASNA 3OEAA 2BBVA 2JG8A 3AKSA 1V5FA 4S2GA 5KCMA 1LGBA 1DU6A 1PO22 3OOPA 3CD6I 1U8RA 4Y1ZA 5DXDA 4K20A 2HQNA 4RLFA 1VF9A 4M74A 3CJIB 1QWRA 3I2JA 2VZOA 3E3VA 5E3NA 5T5LA 5HPOA 3HPHA 5A7QA 1OISA 2Y0SA 2VBPA 5BNOC 2YMZA 3M4OJ 4BM8A 5JCTA 1SAUA 2Z4FA 1D8KA 2KHMA 3VBHA 2YGMA 4Q5OA 2NNYA 4U0VA 1QHHD 3BTCA 1KD7A 4NROA 4FT8A 1FP1D 2EAKA 2JVHA 3MF6A 1VRH3 2K9MA 5C4JJ 3RQ4A 1QJY3 4DXZA 1EH8A 2A6EF 3OCPA 2RG4A 2RR12 4A3KJ 1QOOA 1S0JA 2YC0A 4EJUA 1W0UA 5F5CA 3CTAA 2DAOA 3F8BA 1BCXA 4EN9B 1JYVA 2ZEZA 1WJFA 4Y52J 2VQLA 2K4JA 1WD3A 1H8TC 2BGPA 4A93J 4YGEA 1LVKA 4XN3A 5T54A 2D97A 1FTTA 1AR91 3GUDA 5JZGB 1H4GA 1QH6A 4CVUA 4NAOA 2ZMNA 1HSJA 2KKOA 1MVEA 2XAQA 1Z6TA 2X1EA 4A4AA 4Y7NJ 2DJIA 4BYYA 1OPMA 2YU9J 2Z9OA 3RPUD 3JRDA 2VUDA 1CWPA 4E27A 3HC7A 3BR2A 3PSFA 2NQYA 4JDOA 2VTXJ 4Q0QA 4LK7A 4A3XA 3Q9SA 1XYOA 2O0YA 2IA1A 2JE8A 2OVUA 2GXBA 2A5WA 1ZKGA 1CAWB 5A7NA 4P9UA 4XETA 3IUOA 3V56A 2LUWA 2WAQN 2CL2A 1ENHA 2DA4A 2HYJA 5M5YJ 1WJCA 2X51A 2R0FA 5K1YA 2Y9ZA 2NYYA 1S7OA 4HF0A 4XHBA 5IYDJ 4QLCU 2WIIB 3HZJA 2EVXA 1UZVA 2E2HJ 2NMNA 3CC2I 4B09A 1R1ZA 5E3LA 3LFIA 3FK7A 1DUXC 3IH3A 3SISA 3WDVA 4B7EA 2KZVA 3BPVA 1CIWA 1LVAA 2F2EA 4YVSB 3BCBA 3IB3A 3CMYA 1IDZA 3BDDA 1BXHA 1Z67A 2VC1A 3KPHA 1DFQA 1PYVA 1P8JA 1YQ2A 4H2AA 4BQXA 5L36A 1N1TA 3GNEA 2GNDA 4FISA 3JTHA 2ZMKA 3ML6A 2ORZA 2OJED 2LBFB 4HN0A 2VOXA 2IXCA 1UY2A 2Y0MA 3BQZA 4AFMA 3HL2A 3BG9A 2FDGA 1IGNA 1K79A 4YW4A 4BQOA 4Z8BA 3F95A 2JZYA 4ATFA 2QQPA 3N9OA 2V6EA 4XFGA 2OQ7A 3FIWA 2K0GA 1V9U1 2DBBA 5FK7A 3E6BA 3NWKA 4MX3A 1JN2P 2NM1A 3K51A 5FZBA 3K7AJ 2IWGB 3MFAA 5IT6A 2O1QA 4PIYA 4J19A 1ZN2A 3ZO0B 1FV3A 2A6WA 3C18A 4DOZA 5DCFA 4BMBA 4IEOA 3MAJA 5LHGA 3J26N 4WWCA 1OOPC 4C2UA 4NHYA 2V1UA 3KGLA 2WSUA 4RS8A 2VOTA 4FFHA 3CCJI 4QM9A 1W2OA 2R1BA 4KNCA 1ND3A 4ESBA 1QGPA 4PK4A 4QM8A 4S2FA 5F1JA 2SLIA 3B6CA 1BMV1 4AD9A 5IYBJ 2HS5A 3L7WA 1GZWA 4TV7A 5EEHA 1I1SA 1Z0HA 2H1LA 2W46A 4N4NB 3N9QA 3KLOA 4DQ2A 4LLFA 3WNPA 5LASA 1FBQA 3MD2A 4XZUG 5JSOA 1QJX3 5FZKA 3VDAA 4O7XA 4NBQA 2RDPA 3DPRC 1OFCX 5F32A 3ZVXA 5ABJB 3JW4A 5IVBA 3QU3A 4JGZC 1RUJ3 3SNMA 1QPMA 2FNAA 3LFKA 4FFIA 5FZ6A 5FYIA 4XRSG 1RUH3 4LE4A 1DZTA 1U3EM 4MGSA 2A7AA 5E20A 3CCEI 5M0TA 4B3AA 2WJSA 4RAGA 2A6VA 2HYXA 3ZPOA 1XMAA 3VEPA 3SQNA 3FBIB 5FRNA 1REEA 1JYXA 2YC2A 2VZTA 4BK4A 3BG7A 2OU2A 1UF2C 2M30A 1FC3A 2Y9YA 1H30A 3MLJA 3PNYA 1N25A 2JDKA 1HDDC 2CQNA 4LQRA 3LL7A 1CF7B 4D6SA 2KT0A 3I2DA 4CXFA 2R043 1V9U2 5FOJB 1UU4A 2JMWA 2DFBA 2QVSB 1PVC2 1RUF3 2Q2EA 2JSPA 2IXIA 3VBUA 1RUC2 2XGCA 2C0ZA 4M3DA 2VVDA 5H9PA 4A7KA 3NWSA 1RUH2 5SV8A 4GZ9A 4XBNA 4RGKA 4ISRA 3ZQCA 4KMQA 2NVTJ 1W03A 1YYVA 3AP5A 3CCLI 1OUSA 4BL0B 3QPHA 3LDBA 4JGYB 2PA7A 4AVBA 5HLGA 3MKWB 2FDHA 1GP4A 1CZTA 4XF1A 4CZSA 1MJ9A 1B72B 1OLQA 2KJCA 3FFQA 1EV7A 1X3WB 5T3NA 1TE1B 2D5HA 2O3FA 2O03A 1IUYA 3H1CA 1HB4A 5FO8B 2QM3A 1FIPA 4Q5SF 2R042 1IPKA 5DD4A 2JPCA 4LUMA 2PEXA 1CZVA 2E6VA 3J7ZI 4AVSA 4RB2C 5DTDA 4QHZA 1B8IA 3H5NA 2BGOA 5TJJA 2GP5A 4CUCA 2ZHMA 3FMQA 4YVWA 2CGPA 2VU9A 3CNAA 5LLQA 1LOCA 3A03A 1CX1A 4UOJA 3VBOA 3K2AA 1T6GC 3M7GA 4DEQA 4XLFA 3FXKA 5KR7A 1O59A 2NRAC 2WQ4A 3NNLA 3IH2A 2I45A 2DVDA 4UUSB 1TWAJ 1VBC2 4QGNA 4E2GA 5A2QZ 3LWFA 1R1A1 4OZOA 1AX2A 5CVVA 4IQJA 3C8XA 1UKGA 4B48A 1HJGA 1D8JA 1GKBA 1AX0A 2L7ZA 3H3ZA 5LA0A 3OYWA 5JR2A 3TWIA 5JMOA 5CVJA 4GKXA 1BR2A 2PLV1 4KL1A 1YX5A 4A5MA 2LF7A 1EPWA 4XMYA 3ZYFA 2UUZA 2R5ZA 1RRJA 1RJ8A 3ZFFC 4NIAA 4C3HJ 5BNNB 5CAZA 1YI9A 2CQQA 2R93J 1JZ7A 3ACHA 5F0HA 1ZGJA 4BDVB 2QKMB 4Q1RA 2RR11 4FPLA 2V5YA 5H9QA 2QSHX 1D2SA 2DA7A 3LSGA 1ENSA 1UELB 1HQWA 3J7YJ 1X2NA 4XIKA 3RVHA 4Q27A 2Z5WA 1QNTA 3BVCA 3PVBB 5C9AC 3F8CA 1TC3C 4LJHA 5JMCA 2YU3A 3JRAA 2CYFA 2M2EA 3WDTA 4AIJA 1GXPA 3P9IA 2PFWA 1URXA 1XX5A 2JUCA 1KFUL 2E19A 2DA2A 2JDHA 2M3AA 5ANQA 2B9SA 1DP7P 1Z7S2 4EJOA 2ZB9A 4FTEA 2JECA 5FPZA 5CFDC 2C9KA 1QQIA 4XFFA 4CU9A 2E9QA 3RZGA 3L2UA 4GYGA 5JR7B 3R4KA 1UMHA 3CJRB 4A41A 2C5DA 3QQAA 2Z3YA 2RQQA 4OHXA 5EYYA 5LA1A 1RMU3 3LWCA 4BEHB 3VYUB 4OOIA 1E3HA 3KYCB 4AAXA 2XJQA 3AMNA 3WNLA 1W8HA 5ANNA 3K4JA 3CMMA 3I3LA 4LLLA 3B01A 5IT9K 2VGDA 3DL3A 3M3EA 4GH4C 3ZKYA 2AQEA 3X29B 1TW3A 1TQMA 2HTJA 4NQWA 2GP3A 2Y6GA 1BI3A 4AQ2A 3CHXA 1NE4A 2M7BA 1SLIA 3M3QA 2RDSA 1IS4A 4DW6A 2DVBA 2Y0OA 1A35A 2OZ6A 1LRHA 5G04L 1FMD3 1OYYA 1G9FA 2DF7A 4DXSA 1YOVB 3PJYA 4B1MA 1ZZ6A 2XAJA 3AL0C 3POWA 4P14A 4QX0A 5FY9A 2B5HA 4RSUA 3ORJA 1YJLA 2DDBA 4XLNF 2R061 3U14A 4Z1VA 1ZG5A 4Z2WA 2HLEA 3MIFA 3S1QJ 1ZG3A 4WK8F 5JLWA 4Q4W3 1X36A 5E1ZB 2ZZJA 3H1MA 3Q8EA 4PLMA 4E8CA 1UCRA 1XS9A 1YFWA 2Y0IA 2XV4S 1OURA 1E17A 3ZPYA 1L3LA 3WDXA 3OS1A 3C7FA 4HBLA 3T2QA 2X1CA 2ZX3A 2BHYA 2OTJI 3OBZA 3P9CA 3TMOA 1GOFA 1DZQA 1EV12 2K9QA 2L9RA 5DDGA 1PZ7A 2M45A 2C4XA 4IW3A 4ESFA 1BL0A 5DM6F 3BI3A 2C1FA 3F9KA 1OI6A 2X48A 4Y15A 2J1VA 2P81A 3M8EA 5FY8A 4OAZA 4R9AA 1UB9A 2BEOA 3WODF 1VTNC 3LQCA 3HG9A 1TEIA 3VSKA 2VZVA 5C9AA 3T4VA 2Y6KA 5E3MA 3BALA 3OSDA 1NCRA 1FY7A 4G7ZF 4CCOA 4DXRA 4LORA 4IOCF 1V3FA 3M3YJ 1P7JA 4PQ9A 4FFFA 1D4M2 4IE5A 2JA2A 2XLAA 1SEFA 2F4PA 3PJQA 5FGMA 3C3VA 3IAS2 2MSYA 5FYUA 3HYIA 2Q8DA 4AOCA 1X4OA 2PJPA 2HFHA 1LOBA 1WJDA 3RG0A 2ZXHA 4ORFA 1EV13 4XJ8A 2EV5A 5LD2C 4P5YA 4FOWA 1AR71 2HH9A 2VQGA 4LHSA 5JWPA 1BVVA 1JXSA 2Y64A 1BLZA 3ISPA 2HPMA 4Q4Y2 1UOGA 3N4MA 2TCTA 3B69A 3AMQA 1J9IA 3NNMA 4N0BA 4XLCA 3DEUA 4P9FA 2M9HA 1WVRA 5IYCJ 3K2OA 2RV8A 4AHWA 3VBFC 4ES8A 4D7MA 2P37A 2XDVA 5BUVA 2CDOA 1LKNA 2R062 2W85A 5DCMB 3TOAA 2W1QA 4OVEA 5L73A 4BAYA 4NHXA 1G3YA 3ES1A 3RQIA 4N43C 4R9BA 3MIEA 5KC6A 2EINH 5K8SA 4HX7A 2ARXA 2WNUA 1TL8A 4RS5A 5DN2A 1ENRA 2ZGPA 3KT1A 4XQDA 2IBDA 1FMD1 2F17A 3GZAA 1SD6A 1FX5A 4IXAA 2IXSA 4ITVA 1TQPA 2XUEA 5L7OB 4M3GA 4KJZA 2DDAA 5BS6A 2QKDA 2VBBA 1ZBE2 4M72A 1GZTA 3VBUC 3S17J 3MHZA 1QJU1 1FSHA 3EO6A 4PGGA 4KYWA 4HONA 1MDMA 1W2AX 4PFPA 1XSRA 1ETWA 4YG0A 4Q4Y3 2ID3A 5FPLA 2PHLA 4ON0A 1KS4A 3KVBA 3LCPA 4F55A 1S1AA 5AVPA 4EN8B 4Y1YA 1VBD1 1LJ9A 5FLVA 4AHZA 2ZSHB 1XDUA 1CJDA 2D5FA 3F72A 2RNGA 5FREA 2QUFA 4M3CA 4YGCA 4PJ0C 2K86A 4FCYA 4AVCA 2VJXA 3L2CA 3W20A 2J1SA 4UXAA 3IWFA 4LO7A 2GNBA 4QMAA 5H9RA 5JIAA 1I5ZA 2MABA 3AL5A 1AXKA 2NZ9A 2FHRA 1ZRRA 3J7NA 2FU4A 1D0GA 2ZGLA 5IOZA 3VUOA 1ULPA 2BY1A 5I8YA 1VPHA 3J7AO 4F83A 1QGLA 3J8F1 2GQQA 4CCEA 2WC2A 4EVIA 3WDYA 2I07B 2XVLA 3A0HC 2HWE3 3O3KA 2FBIA 2JG8C 2VXJA 5IVVA 3VBHC 1QZZA 2OT7A 1FBUA 4CEWC 3VPRA 4NPMA 3VZJA 4M00A 2DK5A 3TN91 3TNQA 3WXPA 4CEWA 4D7TA 5CEHA 3B00A 2HDCA 3AG4H 2OPKA 3PVEA 1IAWA 2QJVA 1T98A 1UCXA 3U1DA 4ZU7A 3D5SC 1OVPA 1HF0A 4L9JA 1NCRC 3IAM2 2HYKA 2E5NA 4J01A 3FXLA 2PJRB 1APLC 5T5JA 2WT0A 3PL0A 1V5EA 3VD7A 5GZCA 2YFUA 1F31A 4HG6B 1UX7A 2G0EA 4H55A 5J36A 4ZONA 4L9TA 2IXHA 4I0WB 4UV8A 2LF8A 4BXXJ 3DXUA 1ZR2A 4UI9L 2IXLA 3HHHA 3GMEA 4ZZ8A 1ZK8A 5FYTA 3D5RC 1UYYA 2R7VA 4OAYA 4LKFA 2HDWA 2CH0A 2BE5F 1FOD1 3H9GA 4CSWA 2XC7A 2A5ZA 3FBMA 2V4AA 1ZYRF 4UYBA 3L2VA 2EA2A 2UY9A 3ILNA 2WYSA 2CW8A 1PM4A 2BOIA 3VN4A 1W6NB 4A3DJ 5IYYA 4NC8A 4RB1A 3PIGA 4CCMA 1FT9A 3VBFB 2PBIA 3MVPA 3HM5A 3F8FA 1XXNA 2F5FA 1KGSA 1LODA 3FE5A 4PBPA 1WZXA 1SQ4A 4BOWA 1JZ2A 4YIRX 1V00A 5FZDA 2IVJA 3I7DA 1C8NA 2OD5A 2RNJA 3ZYBA 1V0AA 3I3DA 1EAH3 4BB3A 4YZ4A 3J8F3 4JVAA 5JR3A 4LO6B 3FM5A 5A33A 2KXLA 2L4MA 3DYOA 3PTYA 4CDWC 3S1RJ 4EM0B 4AHYA 3WTSC 5ICGA 1QHGA 5KWRA 2Y6FA 3G6JB 3R0RA 2JDPA 4UUTA 2VCBA 1NKGA 1T33A 2M8GX 2OF7A 1DYKA 3WTTC 4KU7A 5FP8A 1S0GA 4OI4A 5ILVA 2KRHA 5D8KB 2NVYJ 3SZPA 5AC91 3TRSB 1MGTA 2DFFA 4OULA 1YEWA 4CA9A 3TBDA 1ZGAA 4QXKA 2V9PA 3DCQA 2VBYA 1G8XA 2R30A 1U8BA 4YSFA 1UW8A 2ZBKA 3DPLC 1H1AA 1UOBA 5EV7A 1R71A 4AR2A 3C2HA 5I0DA 1OMIA 2YPJA 3GZUC 4AFDA 2PQSA 1J0RA 3HB9A 2Q1FA 4XEZA 2UYAA 3J8F2 5DAWA 3RMXA 4XJAA 1YCIA 5LATA 3WF0A 1DQ2A 2FMLA 2WWJA 5M5XJ 1RHI2 3MW4A 1ND2A 4P5HA 1JTYA 2V6CA 3I4PA 5J4VA 3M07A 1POV3 3UETA 3FMGA 1W36D 1RI7A 2OV7A 1Y8RB 4V2WA 4BUPA 4C3JJ 3EQLF 3ZR6A 2RGVA 1MPXA 1R093 5F6KA 2WTEA 2FMYA 1A6IA 1Y1WJ 4V2FA 2EZIA 1ONAA 2ARBA 5DEQA 1RESA 1ZLKA 4BLIA 2CW7A 2OC6A 3FHAA 3RZOJ 3JXSA 3WNKA 2RHPA 2IS1A 2JG9B 1XTAA 1RL3A 4C1WA 3UT0A 3EUAA 2BU9A 5K5RA 1JTZX 3TAYA 3ACLA 4WZCA 2AUYA 4G8XA 4LJZF 3RPQA 4IE0A 2R5ZB 2JTVA 4WVZA 5I0RA 5HS9A 1S2KA 1B1BA 3UESA 2PLYA 4E9KA 4N4OB 2ENRA 5DUVA 3LZZA 4H3WA 1JHHA 1QJU2 2I74A 4RHV2 1PK6B 1U9NA 4MHUA 5FRAA 2QQUA 1IN6A 5HV0A 4PGHA 3CZ6A 5A70A 1Q8SA 2D6OX 1RKWA 3FXOA 4LK1F 1W0TA 3R60A 4RA0A 4LBKA 1Y9GA 5FY4A 2YS9A 2XIGA 3WGGA 3RKQA 1IW7F 2KIMA 1NCQC 3IHUA 2Z33A 3TP0A 2PHRA 2WWYA 4LNVA 4IV3B 2HWE1 2W2IA 1VBD3 3O14A 4GFBA 4RGAA 3DQVC 4HKOA 4W1UA 2C24A 1SFPA 4Q8LA 3KZZA 4AI2A 3KMHA 2HWF3 1JUSA 4LO4B 4IHTA 2DCKA 1JYIA 2JA5J 2DCEA 2P6TA 5FKMA 3S93A 1QA6A 5FIXA 2IP2A 5ABJA 1RUOA 1D0ZA 1KONA 2IFWA 1XNTA 3UGGA 3D82A 5HXVA 4MH0E 5LBCA 4IRIA 2HI3A 3AMHA 2DOFA 4HV5A 4PJYA 1U6GA 3G7DA 1ETYA 2HWB2 3CCYA 1O3SA 1ZZ8A 1HXS2 3J7HA 1FV2A 1WMXA 2P5BA 3BJAA 2R7ZJ 2WKKA 1HKSA 1V9U3 2CAUA 3WTXC 2R072 5GLVA 5K0UA 3JAMK 1XB9A 1W6NA 2E71A 1E57A 3OIQA 4AQTA 2R5YB 1SEUA 2HWD3 2VI6A 3GM8A 1RUC3 3L2WA 4XYXA 2KL4A 1MMAA 4TSVA 1B35A 3JRCA 3CUOA 1NXD1 5K5QA 5DAQA 4GB31 3AZWA 1HX6A 2WINB 5FZEA 1DGWY 4RFRB 2Z2SB 2FBKA 2JK3A 2VNRA 2Y6HA 4FPOB 4IE7A 5C6CA 1OYIA 2BUKA 2VT2A 2Y48A 3WR0A 2DUQA 5CFCB 1XGNA 5FP7A 2W39A 1G7YA 2PMZN 4C8DA 5LW9A 3ZFFB 2V72A 1X19A 4K1YA 4EQVA 1VBA1 4IEUA 2K46A 1I3AA 4AIDA 1ZYBA 3GJAA 3VBRB 1X3UA 5GPCA 1Y39A 4FPYA 4BY1J 5B1AH 2W24A 1HXS3 2HU9A 2E26A 2RS11 2CJJA 4XRFA 2LROA 2MEV3 1RMU1 1W5CC 5FQ0A 1U9OA 2W1OA 4UW5A 1YQ5A 4BBRJ 2UYBA 1O8SA 4YNIA 3JZVA 2BXYA 1VAKA 2Y69H 2VJ4A 3H8XA 1LB2A 1IJWC 2FNPA 5FROA 4YPJA 3K1NA 2VUJA 3GX4X 2ZMEB 2Q8CA 4IHVA 5LGTA 1VQ7I 2XSDC 3MYXA 4RM2A 2DWRA 2CQKA 4XF0A 3T3YA 2DMNA 3BTLA 4Y20A 3P3NA 5F64A 1EUUA 2JN6A 2W1WA 4FXGB 4HMZA 2XH6A 5C3RA 3RI8A 4SLIA 4XLHA 4G6DA 1KQ0A 5HS7A 4DMIA 3VBOB 3U37A 2DTZA 3AG1H 1KQRA 1RUD3 2DFIA 3TN93 4LHKA 2Q4SA 1K5JA 4QX8A 4MQ9F 1Z91A 3OR1C 1WLTA 3GFLA 4KH9A 3PIJA 1D4VB 4QGMA 2WFF3 3JCIA 4MGIE 1KU7A 3RZMA 1SACA 4MEXF 4NRQA 2HR3A 2R7QA 1SFEA 4B3XA 4BJ0A 3PU3A 1K3IA 4UVCA 4ETSA 4YVWC 2NPIA 2GMPA 5L9BA 4HETA 2ACJA 4I98B 3FM3A 4NB5A 3AZYA 3QH7A 4D69A 3BTZA 1PGW2 5FRMA 2D6LX 3NV2A 2D44A 4JQRA 4F7ZA 3LA7A 2HOAA 3A0KA 2MG4A 2XPUA 1MS4A 3T1BA 3BZKA 1K6YA 2HPIA 5FYYA 1J59A 4UBHA 4HNUA 3AX4A 3ZXKA 5DUWA 2CYYA 3VGIA 5FFXA 4ENMA 3OF1A 2E32A 1FEXA 3K4AA 2K27A 3S8PA 5EG0B 3LB9A 2W57A 3ZM8A 1PVC3 1J84A 2CUZA 2LY9A 2XUBA 2IS2A 1AL21 4RGRA 2G9WA 3DEMA 4EJRA 1D1AA 1IXRC 2HVSA 3AP7A 4CA0A 2K9ZA 3CJTB 3BCWA 5JSRA 3JRFA 5LK7B 2VOPA 3B9IA 3F8NA 3A01A 1XNBA 1KDMA 4C91A 2G7UA 5E1RA 1KS5A 1YFXA 2G9FA 2ZAAA 4TXWA 2BJSA 1QY4A 2R7EB 3PUSA 2KRCA 1AF9A 5LA9A 1MH3A 1MZFA 3H1YA 1I3QJ 1FAYA 4ZDOA 4BQ2A 3THPA 1YFUA 3QLQA 1VP6A 1NUKA 3KZ4C 2B9VA 1KGYA 2LW8A 1JZ8A 2NS0A 4M3EA 3I59B 3BIWE 3B94A 2OBPA 3IIAA 1MZ6A 4XFCA 2A5YB 1CX4A 1JHFA 2BXZA 2VKHA 3KHCA 1XU1A 4AI0A 1DG6A 2Z99A 5BPDA 3B73A 4FPHA 2XRNA 1NHAA 2O6GE 4AVVA 2EIEA 2HQ5A 2QCOA 1W90A 4AQSA 3TP3A 4JGZA 1NY71 2YUSA 2K3FA 1OH3A 4AUXA 4A3FJ 1UKRA 3NKTA 3OV8A 2DTYA 2DA1A 2CGNA 5CG8A 4GYIA 4A2UA 2PTMA 2DTWA 2H6CA 4LO8A 3SITA 1BW6A 3I3BA 3U78A 2Z5UA 4GULA 5J1RA 4CEYB 3ZQFA 1BI1A 2M87A 1VQPI 1YLFA 3IM0A 5E1WA 4HT1T 1ULFA 2OQRA 5LWBA 4G7HF 1LHVA 4AXOA 5GTIC 4M0NA 2JB4A 1Y1VJ 1MW7A 4QHOA 5AFEA 2V1XA 4TN7A 5IVJA 2WY8Q 5JHUA 4ZHNA 4AI8A 4N43A 3LOBA 3NNGA 2W00A 4MGZE 4UAPA 2Y31A 4L2NA 2QGUA 4LLGF 4OZXA 3MV01 1YJ9I 2O8KA 3AYDA 5APAA 5BXXA 3VHOA 1QIQA 3KP7A 2TRTA 3KEYA 4CTEA 1XYNA 3NAPC 4YW1A 4I2OA 3UKGA 3V7RA 4I6ZA 1DP0A 3U0ZA 3SH3A 2RC4A 1S9HA 1TT0A 2ZMEC 4S2DA 2B7EA 1WCQA 3VDCA 2D1HA 4IEQA 1US3A 2ZNZA 3D0SA 1D4M3 1PO11 3LEGA 5KHKA 3KM5A 1NK2P 1ST8A 3V65A 4Q48A 4YFNF 2EJRA 2ERFA 1TWFJ 1ASJ3 1LAJA 2NS8A 4IEYA 3LPFA 2PYTA 1C5HA 3E97A 3M9AA 4E2SA 3OBRA 1W9WA 4XSZF 2ETHA 3Q3SA 4IZZA 5HBAA 3F8MA 3ZXSA 4B43A 1OKOA 3ZQGA 1Y3TA 3ZLIA 3VBRC 1JKPC 1A36A 3ITQA 4NHJA 4BJTA 1OPOA 4GWIA 1CAXA 1FOXA 3WVJA 5ERLA 3ZXFA 3VOEA 2FE3A 4Q0PA 5CFCC 1W7PD 1O4ZA 3QODA 3MO4A 5EYRA 1N3OA 2R063 2J42A 5KAFC 4B44A 3KP6A 2VQCA 3IDCB 2VMIA 3OPZA 4W97A 3BPXA 5FXZA 1YRNB 1FLIA 3CLPA 1UFMA 5FZLA 3Q9VA 5BQTA 1A6QA 2PG4A 3OGSA 5L19A 4UF0B 4PI2A 5LGUA 1HRI1 3RZLA 1GNHA 3S57A 4W8JA 3PJRA 2H6BA 4A6OA 2D6NA 3EETA 5D8AA 2M8EA 2QQLA 3S7EA 1OT5A 2BDRA 3LE0A 1ZBE3 3HDDA 2HQAA 1W3XA 1AL22 3T1MA 4CDQB 2W7NA 5E89A 1PVEA 1RITA 1ZA4A 3KLSA 3CESA 5DD8A 1Q5OA 4A3LJ 4QB2A 3ASNH 3PNAA 1BW5A 3R05A 4LD5A 2B63J 3AJZA 1UZCA 2R7TA 1H8VA 1LGCA 2VIXA 2K9NA 3GO5A 2ZX4A 3N9LA 4HG2A 4DUVA 4BHPA 2QQOA 2OQGA 2MC4A 2VY0A 2WNUC 2JRTA 4YZ2A 3T5XA 4QB1A 1QBJA 5JIUA 4QSHA 4I0BA 3HOXJ 1Y7BA 1HRV2 3MI8A 2L7MP 3GBGA 3PUQA 5C8CB 4S2HA 1R4NB 3EUHC 2R7RA 5C8CC 4A7YA 1OF3A 3T4HB 3G6EI 1W9FA 4OMZA 3Q0UA 3T09A 5F39A 1PIV3 5FYHA 3BZ6A 4IV3C 4CCLA 1S0FA 3FMSA 3GXOA 4E4SA 1DZRA 3VZMA 1EV11 2JUGA 1BIBA 4AFAA 3CJIA 1RETA 4Z07A 2JIGA 2E1MC 3RJ2X 3HEIA 4YG6A 3GYDA 2QCSB 2VC0A 3ME2A 1YIJI 4ZYDA 5FFZA 1LEMA 3N7JA 1AR92 2I5UA 4WBBA 5LHHA 2VNOA 2STTA 2DODA 2ME0A 5DZEA 2XRLA 1S2EA 1K4TA 3C1DA 5FMOL 1SDWA 2XBO2 2EF6A 1SC7A 5KHGA 1TW2A 3S3NA 3ZXEA 4EWDA 5FJHA 5C71A 3VBSA 1KU2A 3MDPA 1HXDA 3RPUA 1X8EA 1Z1DA 5JOZA 2RS33 4ZYAA 2FBEA 3E6CC 1PIV2 1DQ6A 1VQ8I 2VKEA 2YROA 1Q8OA 5IVCA 4LR4A 5DS9A 2K5CA 3OR2C 3KCCA 2B8MA 3J80Z 2X29A 2FDKA 5JZGA 2IC1A 1R5HA 2H8WA 4LBJA 1DP3A 2ISZA 4XCAA 3WF1A 2B9UA 2HNHA 5IFTA 1DGWX 2A6YA 3PIPF 2ORXA 2RJKA 1ETQA 2PAMA 1ZBA2 2NOGA 3AL6A 1NOVA 2WDBA 5IK7A 2EALA 3L2YA 4TTGA 1BQPA 4YM3A 2VO5A 2Q8OA 3QP5A 4QPIA 3BG3A 5LB6A 2OUJA 1IF1A 5FYMA 4MHRA 3KFWX 1N78A 4ZY9A 1W8ZA 5CQGA 1FJLA 3NWTA 1IUFA 1WW4A 3OPWA 5A6QA 5C3SA 1YX3A 1ZZ7A 4UB6C 5B4NA 3W2WA 3ZXJA 5L3DA 2LK2A 3ONQA 4PI0A 3H8OA 1K12A 1S3JA 2E7WA 5FZ9A 1GICA 1OHFA 5FFOC 1QQP1 4MYEA 3RSNA 4XBFA 1G59A 3B6AA 3D4KA 3FWEA 1G9BA 2EILH 2K85A 1LCLA 2VBDA 4JV4A 4P9JA 5FBZA 1XOYA 1IN5A 5ILSA 5C4WA 4HKWA 3POEA 3J7AY 5FDBA 4ZZDA 5JI9A 2IUWA 1X9TA 4XMAA 3ALQA 4WM8A 4L8QA 4FX0A 3C7EA 4K2EA 3RTRA 4Q4W1 2XF5A 2F4LA 4ZS3A 4B8XA 2CUFA 4MQVA 3ES4A 4IV1C 2VPLA 4FTBA 2FOWA 5H2FC 3CP2A 1S5LC 3FHNA 3M3OA 2N8GA 3H3VK 2AZ5A 2OCEA 4PT6A 2VKVA 2H0BA 4AYBA 1BZWA 3WQBA 4YVSA 1G3SA 4QWQA 2LRPA 5FYBA 2CUJA 1HQLA 3RJRA 3K70D 2E1CA 1RUD1 1K5MA 3JRHA 2R6QA 2XOMA 1KYWA 1IZ3A 2P2KA 5FUIA 4HF2A 2IJLA 4FE7A 2COMA 4AE2A 1ND2C 1M1EB 2ZEXA 3FBNB 1SLAA 5HI0A 2OUHA 3BPZA 1BM9A 3HNBM 4NN0A 2YY1A 1IOAA 5F37A 5J98B 5A3TA 4P9YA 3OYWB 3WLUA 4DIQA 4XUNA 1X7NA 2X9DA 3NV4A 3SCGA 1GU3A 4EN7B 1LOFA 4CDXA 2PHDA 5FP9A 5CVIA 4TWTA 3POFA 3BR6A 4AIHA 5A80A 3O1OA 5EQUA 3O12A 1LUJB 3MBWA 4CZZA 4P08A 2JG8B 4CDUB 4R9CA 3HT2A 4V1PA 3COAC 2DMTA 2XQXA 3DBRB 4I09A 3DF0A 5DUKA 1NQJA 1OR7C 3WP6A 3EYIA 3R4UA 5FYSA 4XAAA 3F3XA 4NO4A 1WKMA 4KU8A 3K4ZA 1VBD2 4RL7A 4Q0SA 1GLHA 5B4XA 4BXUA 2JDMA 1XPXA 4U87A 5F0CA 1JYWA 4KMFA 2FDJA 1WCDJ 2NLRA 3FHQA 2DA3A 4QKDA 3Q8AA 4IJAA 2WWUA 5D5UB 4RGXA 1QJX1 4GB32 2DO7A 2CMPA 3HBZA 2OKXA 3VYTB 4QB6A 2PJRA 3H36A 4Z92B 1PO12 2LY1A 1YYNA 2X5IA 1HKQA 5BPXA 3MLKA 3S14J 4PCRA 1DF0A 2MLKA 2JA6J 3ZR5A 4EATA 1F4AA 3PHMA 2X10A 1VBE3 1E5IA 3V0AB 2M34A 1RUG3 1CJPA 4CXWA 2RJ2A 2KISA 1OCRH 3WTYC 2X5IB 3WNXA 1CPNA 3EDPA 1MQTA 5FAXA 4CDGA 3THCA 3H3UA 2ZXJA 2ZTNA 4EJWA 1MEC1 1LEAA 2P3IA 3K4LA 4H14A 2P0WA 4GMP0 5A2QK 4EGYA 4CZCA 4B47A 1R091 2IGKA 2E35A 3PQKA 4ZZ5A 1MQTB 1TNTA 5JSPA 3AYEA 1IXSB 2LDUA 5HVQC 1JODA 3CO7C 1AZDA 4ZYHA 1O4TA 3CUQC 1S7EA 4ZDPA 3KD4A 1X3ZB 1PMJX 4MGTA 1LNWA 2X85A 2HWB1 1SPPA 2K7LA 3ZXGA 2YC4A 4O9GA 1W99A 4XF4A 2R071 4NWVA 4NDLA 4YZ3A 2A73B 2YB7A 3W6JB 2AACA 4Y5SA 4U7DA 2R5YA 4II2A 3IMMA 2XHKA 2LTNA 1UMIA 2W52A 3ZN5A 1PNGA 1J3RA 5ILUA 2PI0A 4QX1A 1R23A 3T1LA 3WCRA 4YG3A 4J1WA 2N7GA 5CU1A 2CG4A 1PGW1 1F4HA 4LULA 5F3IA 3KZIC 3CQOA 4QQHA 3HOBA 4CU8A 2WA0A 4U7BA 2RKHA 4FQ4A 1YW8A 2QYOA 1RIRA 2VECA 1RUH1 4PJMA 1TWHJ 4YFXF 3KS7A 1P4XA 3AKRA 1ZNPA 5A3UA 4RBOA 4LOCA 2IEKA 4EMSA 3NAUA 1J2XA 3AP6A 5FKNA 1TZLA 4LA2A 1S4CA 5C3QA 2XL7A 1AR81 5TSWA 4ZPIA 3IMNA 1WGPA 3R61A 1L7LA 1OA4A 2EPFA 2M7AA 3IN9A 3VKNA 2XJTA 4IEVA 5JOWA 1ZA7A 1USTA 3ZQ7A 3UJQA 1U5TA 2PMZA 2QQNA 2MFZA 4D0QA 5EDNA 4OHZA 5FJ8J 2O14A 5CYVA 4BPZA 2GOMA 3AXDA 5D4SA 1BJQA 3LFMA 4ASKA 4YARA 4JX0A 2D3SA 3T8RA 3GTOJ 2LH9A 1DCSA 3W21A 1R1VA 3HIFA 1R64A 2BW3B 4QT6A 1Q1HA 4FXKB 4FPJA 4AI1A 4FBFA 2GDFA 5A32A 1YIFA 3EB7A 1NXMA 2XJPA 4RB0A 1PZ8A 4LG0B 1SCSA 3WG9A 2CV0A 3R4SA 3BOWA 3PTRB 1CQTA 4XFIA 4QKFA 3J9SA 1GZCA 4R52A 5CKMA 1RYYA 5IVYA 1BKZA 3M8FA 2R7FA 5DG2A 3TEDA 1C28A 3R6SA 3HXLA 3I2IA 4DRVA 1BK0A 5A3LA 1VMJA 4IX7A 5F1RA 4JRAA 3HRTA 3S2DJ 5FLXK 4BISA 1UMQA 3H7YA 3JR9A 5F3EA 2FSWA 4DUWA 2JJ7A 2SBAA 1RPWA 2CQ7A 2AXTC 1Y8QB 4BEHA 4CP2A 1A5JA 1O5LA 3I4MJ 2IGNA 4XOTA 2B7YA 4WM7A 1CONA 1FYKA 4L5IA 5FZ3A 4WVWA 1LU2A 2X53S 4U36A 2EA7A 4PDWB 5EG0A 2R073 2LG4A 1L7RA 1SBDA 3JD71 1YI7A 2PMUA 2C6YA 1QXJA 4NE9A 4UHTA 3OGGA 3BROA 3ASIA 2ZCWA 4M6YA 2DQRA 3KV5A 1R1A3 2R7SA 1U12A 4BQ3A 3ERMA 1FOYA 2QKLB 3OOXA 1ULCA 2HOTA 3W9AA 1PVC1 2HEOA 1FPN2 5FZAA 1MQTC 3EMRA 2WB1A 2JA7J 5A6XA 3HRUA 3ELKA 5I0SA 2QQ9A 4P5OA 2XAUA 4M9ZA 1OOPA 4IE6A 1TTYA 4XUTA 4AFBA 3VKFC 5CADA 2HYGD 5FKLA 4ASMB 5LRSA 4XC9A 3LSTA 3TGNA 1MEC2 2D6MA 1IKPA 4JZRA 3S6PA 2BNOA 2X5IC 5KHHA 1ODNA 3OJBA 4D5FA 1QDCA 1VI0A 1UHWA 4LBQD 2ZGOA 5I93A 3QOEA 3IDAA 1N77A 3IAPA 3PU8A 1A8MA 1NK3P 3IIIA 2L0KA 3QPSA 2WZ8A 1JI6A 3WQ1A 2D43A 4Y1VA 1TP4A 1NCQA 4ET7A 5A3OA 5FKBA 3AZZA 1QF3A 2D3RA 4KISA 2Q2EB 4AQ6A 3KF5A 3WF2A 5IP7J 1V6MA 3JSOA 3CF6E 1Z9CA 1JUHA 3I58A 4PSXA 1D0XA 1WI3A 1UMZA 5FTTC 1I1GA 4GAZA 1ZQ3P 3PO3J 3F2ZA 2E7XA 3TOBA 1JH5A 4MIMA 4YW6A 5FP3A 2DU9A 3K6GA 1LDJA 2XJUA 3KF3A 2R7DA 1Q43A 3X2QH 3ZR8X 2XMLA 2MHFA 1UYZA 3H3LA 2WRAA 5L3CA 1QHDA 1R083 3FJSA 1DQUA 4ESJA 2QA4I 1E3PA 2O8OA 1MEC3 2GH2A 4KIBA 3PUHA 1C3HA 4NHKA 3F22A 3KQ4B 5BMZA 1A04A 2XBO1 3ABMH 1OFSA 2P34A 4LXLA 1NG0A 3O1SA 1NY72 1XSXA 1RUD2 3EBRA 1W8TA 1AWCA 3FUQA 5EFUA 2ADUA 1UX6A 3FISA 1S8NA 5FZ1A 1AR83 2VOKA 1C8M2 2PMWB 1SVOA 4I3GA 3GTQJ 4HLXA 3OYFA 1QEXA 1YJKA 5JLXA 3BY6A 3GCWA 1LHNA 3GCXA 3S3OA 4KUMA 4DZGA 2NOJB 1WFXA 3VHPA 5T52A 3WG7H 2VUCA 4A3BJ 1ZZCA 1HDKA 1PO21 1HJFA 2XWJB 5FD5A 4EM1A 2VMFA 3OS0A 2VBZA 3AMPA 3TDZC 3ZYRA 1ASJ2 5CB7A 1B9NA 4G9SB 1QJZA 3OEBA 3BWGA 5HCAA 3G2BA 4FASD 3MEXA 2YPDA 1AKHB 4U88A 4FTSA 4LEJA 2WNUB 5CFDA 2YV8A 4IV1B 3FFZA 1LEDA 3ECQA 1WLCA 4HSRA 3NKGA 1GUIA 5H20A 5FKKA 1D3YA 1PUFA 1R49A 2Q8KA 2JE7A 1WW6A 5FZGA 3SQOA 2V7FA 4CCJA 1UXXX 2FMDA 3UKNA 4H4KC 1ZRIA 3BOPA 5BNPC 3I49A 2OAZA 5FXVA 1MSEC 1QJX2 2PLV3 2VZRA 4LIVA 2JKBA 4LMFA 3HQXA 5ACA2 2G4IA 1W6QB 2YR2A 4KBBA 1G3WA 4JTNA 4DS0A 3GFJA 1ZH5A 2ZGMA 4GD4A 2F6BA 3G1OA 2M0MA 3NSTA 3CDHA 4PQQA 1N1SA 4WM7C 2XJSA 3WQ7A 1C5IA 1WLDA 1HSTA 2ZS6B 5EJZB 5F0FA 3LAPA 3ZDVA 3MZHA 1S0BA 4BMEA 5D8AC 4MGYE 3AFKA 3HHGA 3DKXA 5KNLA 2W1UA 1G9CA 5FZIA 2IVIB 1ETXA 3KYDB 1BEV3 5EZWA 1KQ9A 2E60A 1MZBA 2RM21 5F9TA 5B5EC 3QACA 1YRNA 3WW1A 3MF9A 2VTFA 2OPWA 4CDUC 3LSJA 2KFDA 3NRUA 2LYCA 3ZQHA 2D2WA 4GO1A 3CCQI 1XG1A 5DQ0A 1CAUB 1O6UA 2NAZA 4BK5A 1J3PA 2WL1A 4DXTA 1X58A 1Y0NA 3JREA 4UNOA 3CLQA 4QPOA 4HK8A 1YG2A 3AK0A 2A6TA 1AYM2 1HA8A 1I50J 3GTGJ 4Q0UA 2XJRA 3E1F1 4TYSA 3BGAA 1HRV3 3KP3A 3SCHA 5F3CA 1D5VA 5EYXA 3H5RA 2DUOA 2YXSA 4QU2A 3ZN4A 1RR7A 4YFKF 5EEAA 3WD5A 3GTJJ 5I0TA 1XYPA 3ZN0A 5FYZA 2KM2A 1LHUA 1RUE1 3E6DA 1ONVA 4M6VA 1DQ0A 1C4RA 2EXJA 3RYKA 1TG7A 4HX8A 4M3CB 5FXWA 3OYIA 3AL0B 3RZZA 3D0JA 2XGXA 5FZFA 2QLZA 2F5VA 2NVUB 4LB5A 3ON7A 1PP7U 4H7MA 3POJA 2A68F 2QQVA 2DTRA 4OMDA 2Y8KA 1NG6A 3SEPA 1N1VA 3C2GA 2JD9A 1W3VA 2DCYA 3WHCA 4E7KA 4G6TB 2ZGKA 1CESA 2Y60A 4KDPA 1BMV2 2I10A 1IZ1A 2L3DA 3K75B 3WINE 4GH4B 1M4WA 4HZFA 3BC8A 5DDJ2 3CCUI 4IV3A 5DM7F 1WJBA 2W82A 1AYN1 2RS32 2R0QC 4RMNA 4A69C 2Q0AA 2WSVA 2L4AA 4GH4A 2HEWF 3OYEA 3MWMA 4NMIA 1W7PA 1NG7A 3M1CA 4XM3A 3WW4A 3HKZN 4WF2A 4Y22B 2K4BA 3H7JA 1VAVA 2Y26A 1HOMA 4N43B 4Q4X1 1ZREA 4N7IA 4QQLA 1C8M1 4G4FA 3FLRA 1QXPA 4KBZA 3H8RA 3FMRA 4AGVA 4FCAA 1KITA 1QXRA 3O0VA 1FXZA 3V8LA 4IEWA 1GHCA 3HOUJ 5HODA 3WU0A 5JXGA 4MXWB 4XR6A 4L0PA 4P9GA 2M4GA 2B46X 2QNKA 2ZXQA 5IK5A 2CW0F 4HSJA 1NT0A 3HN1A 4YIIA 3H92A 1QNWA 3M8JA 1R00A 4E7ZA 5K7HA 5FZMA 3P5BA 4FI9A 4LG3A 3WP5A 3WG2A 1AHSA 3L1PA 2FUG2 2C9AA 2XG3A 2IA2A 4UT5A 4QD2A 1LR5A 2LREA 2H8RA 4A42A 5A7WB 2HKOA 2L2OA 1HW2A 1ZR4A 5JXJA 2PHXA 3K48A 1MBFA 2QQAA 4P9IA 2ES3A 5HCHA 3LSHA 2GLOA 2FOKA 2VE8A 4MSVA 2EXHA 4WZFA 4MHGA 3GFIA 3A21A 3I56I 1RUI2 2QTWB 3WGHA 1R1UA 1RXGA 2HEVF 4OIPF 4LB6B 3ZYGA 3UGHA 3DKYA 5IP9J 1JE8A 5T50A 5IATA 3NV3A 4Z2AA 2WN2A 1IV6A 4IOAF 1ZRDA 3OOUA 4K8RB 4GCVA 1I39A 2BPA2 2CY6A 4B4RA 5F3GA 5GLZA 5D8AB 1OFNA 4JKLA 4GA9A 1G86A 4HLYA 3ZGKA 3W5NA 4ZTJA 5IT9Z 3RNSA 5SV5A 1OCCH 5FMCA 4EN6B 1FATA 4BKXA 3O1PA 1QZYA 2P4EA 3C2UA 1FZPB 4L9BA 2WA4A 3LEKA 2HWC1 2IXJA 3Q8BA 4XXAA 3ZFEA 3MMYB 2DURA 3EUKL 5GM0A 1LDKB 3H0OA 2W9XA 1RUI3 3HEFA 2VQAA 1TNSA 2KPMA 3KEOA 3GCMA 5BNPB 1ZGWA 4AGRA 2RS51 1XCBA 2PXJA 5GADJ 2ZJ2A 1E5RA 1GR3A 1N75A 2DBNA 2F5EA 4FOQA 3K70C 3ZOIA 1IPSA 4QQOA 2GH8A 3LIGA 4HKLA 4NIIA 1UY4A 4HVQA 4KGQA 2E7AA 5J3LA 2ISYA 2RS13 1MMDA 4R1HA 3GZTB 1UHMA 1OJLA 3HNYM 4WCGA 1UYPA 4XSXF 2K9LA 3IV5A 2VPVA 1UXZA 3S0MA 3TBIA 1CR7A 4IHYA 2Y38A 3RZHA 2HXOA 1SFUA 2QBYB 4M9XA 5DPNA 4UVBA 1OD5A 1ZRFA 1JOJA 5CJ9A 3NQHA 1GZ9A 1OD3A 4HQMA 1UG0A 1K7AA 1IQAA 3VL8A 4BHCA 2PHTA 2QWWA 1ITYA 1XD7A 1QO0D 3NL1A 1QRYA 1O7LA 2HJIA 3VKMA 1SDDB 3P1IA 3GTMJ 4E7LA 2DCTA 2VH9A 5CNAA 2GU9A 1YS6A 3VDXA 3BTJA 2NVQJ 2KZGA 3GZNB 1NQDA 2YU1A 4KIGA 4QWNA 3ROUA 3N36A 2B42B 3ACFA 5J48A 5JI7A 3ZYIB 3SZTA 3HRSA 3C7JA 2VCAA 1KDKA 3JB8A 4MADA 5D21A 2M5WA 3C3WA 3FKJA 3GEZA 1QKQA 1QJU3 2JDZA 4JX5A 3WGIA 4QX3A 2VMGA 3HJRA 3PUIA 2DT5A 2R92J 2XKPA 1MS0A 1WJ5A 2J5PA 4DINB 4MV2A 4BJ6C 4AVPA 5GAEJ 2QZ3A 1Q3EA 2IFRA 1RUG1 3BTYA 1VBA2 3UNPA 1IG0A 3K77A 4LE3A 1S0IA 2CUEA 2ELJA 2X6OA 4BU2A 3TEZA 2QQKA 1F15A 4KWKA 2L01A 5A6YA 2LOOA 1WHUA 2KIFA 4G94A 1R58A 4GXLA 3NVCA 3KT7A 1K6OA 2RS52 3U2RA 5I8SA 2EIKH 4A44A 5DV5A 4CXXA 4XF9A 1YTYA 5KXBA 4YYOA 3J4UH 3U4SA 1S29A 1S0EA 4YM1A 1K61A 2CSOA 1Q8PA 3ZRGA 1SG3A 2KJBA 5FXXA 3ST7A 1X1AA 4C30A 2UWCA 2R7WA 4FSJA 4UW6A 3I4IA 4JDMA 3CMEI 5F6LB 1PX4A 1B09A 3AJYA 1X1PA 4MFDA 4JTOA 2CQXA 3OG2A 4XHXA 3MICA 3OUJA 3PNVA 3GLLA 1EP0A 3VBUB 2E1MB 1KQ8A 4B4QA 3HGGA 2EV0A 2YBKA 3S3MA 5BOXA 4NHMA 2BVLA 2DT7B 1W9TA 3J7LA 4D5CA 4IXLA 4UVAA 4LK6A 3NO8A 2HEYF 3SEQA 4EGZA 3CUQB 3RI4A 1VQ9I 1I6XA 1WZ2A 4OI1A 1COV2 4HEA2 1HW1A 3ECOA 3ZMVA 3KIOA 4YW2A 1LPQA 1D2QA 2DVAA 4AAPA 3OSFA 1KZHA 1FYUA 4WVMB 5KXDA 1IC8A 3LEIA 1H2KA 3BB6A 4COYA 1CGPA 1R5GA 4KI5M 4RFT0 1YS7A 4AEDA 1HKDA 5B1BH 4DYQA 1BOAA 1OQ1A 4X8NA 3AAFA 4XN0A 4OWR