1XNDA

High-resolution structures of xylanases from b. circulans and t. harzianum identify a new folding pattern and implications for the atomic basis of the catalysis
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
190
Chain Sequence
b'QTIGPGTGYSNGYYYSYWNDGHAGVTYTNGGGGSFTVNWSNSGNFVAGKGWQPGTKNKVINFSGSYNPNGNSYLSIYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWASHGLTLGTMDYQIVAVEGYFSSGSASITVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE
molecule tags Glycosidase
source organism Hypocrea lixii
publication title High-Resolution Structures of Xylanases from B. Circulans and T. Harzianum Identify a New Folding Pattern and Implications for the Atomic Basis of the Catalysis
rcsb
total genus 54
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1994-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xndA00
1OA2A 3AMNA 3AKTA 3VHNA 3MF6A 3RI8A 4XQ4A 3MFCA 3WXPA 1W2UA 3VHOA 3LGRA 3LB9A 1H1AA 3WR0A 4NPRA 3VZNA 3VLBB 2QZ3A 1HV1A 2DFCA 2QZ2A 5K7PA 1H8VA 3AMQA 3WP3A 1REFA 1H0BA 3VL9A 1NLRA 3HD8B 3B5LB 1XNCA 2D97A 2JEMA 2VGDA 2NQYA 3O7OA 1OA4A 3VGIA 1XNKA 3WP4A 3VZLA 1YNAA 2DCZA 2B45X 2Z79A 3VZMA 1XXNA 5HXVA 3VZJA 1XYPA 2DFBA 1OLQA 3AMMA 1HV0A 1TE1B 3AKRA 1UU5A 1PVXA 1T6GC 4HKLA 1H4HA 3WP5A 3WQ7A 3AKPA 1M4WA 4HK9A 3WX5A 3ZSEA 2BW8A 2BVVA 2F6BA 3RI9A 3AMPA 2B42B 3WQ0A 1BCXA 1C5IA 1XYNA 1H4GA 3M4FA 3MF9A 1XYOA 1F5JA 2VG9A 4HKOA 4XQDA 4XQWA 3VHPA 3MFAA 1QH7A 3AKQA 1C5HA 1XNBA 3VZKA 3AKSA 4XPVA 1UU4A 1OLRA 4HK8A 1BVVA 4S2HA 3B7MA 2DCYA 1ENXA 3WP6A 3WY6A 2BWAA 2B46X 1QH6A 1XNDA 4S2DA 2JENA 2NLRA 2DCJA 2DCKA 5EJ3A 1KS4A 2JICA 2VULA 1UKRA 1REEA 1IGOA 3EXUA 1KS5A 1UU6A 4H7MA 4IXLA 3VZOA 1BK1A 3WQ1A 1HIXA 4S2FA 1OA3A 2C1FA 2D98A 3VL8A 1REDA 4S2GA 5K9YA 2VUJA 3AMHA 4HKWA 1AXKA 3WT3A 2BWCA
chains in the Genus database with same CATH superfamily
4NHMA 3VHNA 3VDBA 5FYTA 5FP7A 1SCRA 4P5HA 4WBBA 1S0JA 3ZDVA 2BP6A 1DGRN 1W9FA 2DUOA 3BTYA 1QJU2 2PHFA 3ZFEA 1SLAA 3QD6A 4XZUG 2XBO3 3WLUA 1WLDA 5BNPC 1G9BA 2VOWA 1RMU2 1Q8VA 3UK9A 2QVSB 3LGRA 3BKZA 4NPRA 1NX9A 3OB8A 4Y5TA 1BLZA 1NE4A 4HN1A 3WG3A 4Y33A 2JDUA 3RYKA 3RG0A 5LK5A 4XF9A 3UKVA 3I2IA 2ZTNA 1OPOA 3BYWA 3B94A 4V2WA 1AR91 4CP1A 4RQPB 3SCFA 1PIV2 1VAKA 2QTWB 2JDKA 1DYKA 4Y1XA 4YM2A 4CU7A 3VBRA 4HPKA 1AR93 3CDZB 1QJZA 2W52A 4YG6A 1HRV3 4IE5A 2BGOA 5FZLA 5GLVA 4AVVA 3CF6E 5EYYA 1R64A 3GM8A 3LA7A 4MYEA 2JKXA 5LATA 4UF0A 4AQ2A 3SKVA 4COZA 4R9CA 1NA1C 3H0OA 3NKTA 1PO13 2FBEA 2R49A 1OH3A 4D6RA 4AK3A 2CSGA 3WV6A 1OFSA 5FQ0B 4HETA 2JDNA 3IDCB 1T6GC 2YUEA 2Q8CA 4C1XA 4URAA 1CN1A 4MO3M 4FPOB 2RM22 3H50A 4K8FA 4DB5A 2C6SA 3N7MA 1SQ4A 2Y64A 1W9SA 4I0AA 2B42B 4R9AA 4NIAA 3N9PA 4PJYA 2WT2A 1SHWB 1H4GA 4QPIC 3VD7A 3RJRA 1ZBA2 4NO4A 5HBAA 2AACA 2AH2A 4KL1A 4NWWA 4W65A 1W0OA 4X8NA 5KXBA 3AYEA 1GZ9A 1VLNA 3UGFA 1UWWA 5C8CA 3QACA 3HR9A 3ZN6A 3WHUA 3DN7A 5LCWL 3T4HB 1MQTB 5FBZA 2E7QA 2MEV1 4GWNA 2CGOA 5ACA1 1JZ4A 1W2OA 1BEV3 4CCJA 5FCCA 1ZBA3 4XUNA 4EZHA 1VAVA 4RN5A 4B3NA 2FQPA 4MLOA 2ZHLA 1H9WA 3NQHA 3CU7A 1LODA 1PVC3 1GP4A 2ZGNA 4Y20B 2HWB1 2NLRA 4XDPA 1LEDA 3RWKX 4IETA 5FZOA 3H7YA 3FMGA 2WWUA 3QOPA 4DPNA 4RR3B 5D21A 2C5DA 2GSYA 4IEWA 4AEJA 4E4ZA 2YHJA 4YYOA 2YY1A 3HPNA 1GR3A 3MW2A 4JRAA 2VBBA 1GWKA 2PQSA 1MEC3 3FN9A 2PHLA 2HBTA 1HJFA 1OQ1A 4ZS2A 4XJUA 5JI7A 4AF9A 4TSVA 3RGBA 3LZZA 1H6XA 4R4XA 2CAUA 2PHRA 1W06A 1SZBA 2FCTA 2QQIA 3WDTA 1S0EA 4S2GA 2G9ZA 3W9AA 1DQ0A 2PAEA 2XWBB 4P14A 2J1EA 1NYWA 5A7WB 3VHRA 3ZN5A 1ENQA 5DUWA 1QJFA 3VBUC 5IK5A 4EZ4A 2BWCA 1DLLA 4L9BA 3FBYA 2LRPA 2PHTA 3W21A 1QJEA 4R52A 3EYPA 2CGPA 3WXPA 3LFMA 1X8EA 1OPMA 3I8TA 4B1LA 2A75A 3T0AA 5IVYA 1VBA3 4NMIA 5CG8A 2EXJA 1GMMA 3N7JA 1W6NB 4RHV3 2DVGA 4NAMA 4BA6A 3WHTA 5LBBA 4A7KA 2YPJA 3LA2A 4IEZA 4XJ8A 3P5BA 4Q4Y1 1MZ6A 4H14A 5FPUA 2ZGTA 2X53S 1UXZA 2H6BA 5IK4A 1AYM3 4PQ9A 1KJRA 1UY3A 3FJSA 3VBSC 1QJX1 4GXLA 1EV11 1UZZA 2GAUA 2JEMA 3O7OA 1VALA 1O3RA 4QPIA 4Z82A 1LOAA 3ZXJA 3I54A 2FMYA 1BZWA 4QPYA 4SBVA 3GDBA 4PLNA 1G9CA 4AHWA 2BBAA 4XFFA 4W8JA 4QQLA 4EN7B 5E16A 1HV0A 3D0JA 2B8MA 3IAPA 4XHBA 2QQKA 1JOJA 1OOPC 2VZ1A 3AFGA 5CISA 4GQ7A 5JZGB 5HPOA 1U5XA 2JE8A 2P1BA 4K6BA 4P9IA 3AXEA 2E51A 1UOGA 4FSJA 4MUVA 1EY2A 2VBPA 3KMHA 4L97A 3I3MA 3WQBA 4B8EA 2RHPA 5I0TA 5FXWA 1G7YA 3CKHA 3BVCA 1BCXA 4ORFA 3U07A 5F37A 1QHDA 1X9TA 3JUUA 1VB2A 1PMHX 4FO9A 4LXLA 5GM0A 4DXRA 4IV1B 2CL2A 1VPHA 1VBA2 3NNGA 4OMDA 3B00A 2QQJA 5JXGA 2BBVA 3SXWA 3WG2A 4LO8A 4NOTA 1PNGA 1HRI1 1XSQA 3P6BA 2P3JA 2GC1A 5FZGA 1JXNA 3LEMA 1HB3A 2DURA 4LLOA 1EV13 5A7SA 3ACHA 4GWJA 1ZZ9A 1CVNA 1PVC1 4NR1A 1O91A 1H8TB 2PN5A 1UCXA 1C3HA 2ATFA 1RVF3 3CNAA 2OPKA 1XE0A 1ZBA1 5A1FA 3N4MA 3J8F2 1JMUB 2RS51 4IV3B 2VXRA 2X5IC 3EJKA 5FZ3A 1UW8A 1VBA1 2MEV3 1IG3A 2GC2A 2MHFA 2WKKA 5KHIA 5DQ0A 2ET7A 5JSPA 3ILRA 5FY4A 4JKMA 3E5XA 3PIJA 1CX4A 5ACA2 2GNTA 1X7NA 5FQ0A 2LW8A 3SITA 5FOBB 4FFIA 5KHHA 3AFKA 5FY8A 5BNOB 1NY71 5JXJA 2A5ZA 1DQ2A 4LKEA 1OKQA 1HX6A 5J09A 2L9LA 1GSLA 4YG0A 1KFXL 1JODA 1FPN1 1GV9A 1H1MA 1XPWA 2CYFA 3AKTA 1W6MB 2JG9C 5FUPA 1F9KA 3L2HA 1W6MA 5C3OA 3VBFA 1X33A 1JTZX 3TBDA 2ID4A 5FZIA 3VHOA 1PO11 3A22A 4B4RA 2IWGB 3ZYFA 4GIQA 5JCTA 2CGNA 3ZYHA 2ZBJA 3VLBB 4WVMB 1W8ZA 1US3A 1NY72 2HWB3 2RMU2 2UY9A 4P9XA 5K0UA 4UAPA 2V4VA 5A7PA 4PCRA 5EXOA 1KFUL 2VMIA 5D8AA 1ENSA 2VGDA 3WW3A 2W87A 1HN0A 3GHNA 2WAOA 4D8MA 4NPLA 3UJQA 4CDWC 1UX6A 1DGRA 4GZ9A 5FP9A 4CCOA 3T1LA 1ASJ1 2EA7A 1YIFA 5CKNA 1WCDJ 2WDBA 4GJZA 4OUEA 1VMHA 4UW3A 2R0HA 1W04A 2XH6A 1YO8A 1UAIA 1QOOA 2ORXA 2D3PA 2XBO1 4HVQA 2VZUA 4NRQA 2KD7A 1ND3B 5I8YA 3VBFC 1AVBA 2VE1A 4KWUA 1ND3A 4FVVA 3WX5A 4GMP0 2QQWA 1F15A 2TEPA 4MVTA 1QXPA 3AMPA 1OURA 3AJYA 4LBJA 1VRH3 1LTEA 2YC2A 5FXVA 2AGSA 3TYJA 1WD3A 5LWBA 1BXHA 1NT0A 4JDMA 5F3EA 4FTEA 3JXSA 1RUOA 3TWIA 1KDKA 4C0BA 4FPYA 4HLTA 3RMYA 4ASKA 4Y26A 4LIUA 3I59B 1KDMA 1SEFA 3J26N 4CYDA 4BOWA 2DCTA 2VH9A 3GZEA 2EF6A 4KH9A 3V65A 3VDAA 2W47A 5C9AB 4YVWC 4R8HA 1S1AA 3KF5A 2V73A 1W3XA 4OQ9A 5FZBA 1CD3G 1RUE3 4OCTA 3KV5A 5FREA 1WA6X 5KR7A 1ULFA 2FDIA 2CHHA 4RQPA 4EN9B 2OW4A 1QJY1 2D7FA 4LKDA 2D6PA 3L2YA 4BDVB 1OXCA 1IPSA 1REEA 1W8OA 3KCCA 4LBQA 1R091 4PDWB 2P34A 4DXTA 1KGYA 3SKJE 5IT6A 1NG0A 5IYYA 4P9LA 4XURA 3LQCA 1N1VA 4EYUA 3RZKA 2VQ0A 1YLLA 3T08A 4CU6A 1J1LA 1FPN3 4BK5A 1RUG3 3ZMOA 1ENRA 1VBC3 3ZFGB 4LUMA 5F5QA 2EAKA 2RE9A 1RVF2 2DV9A 5A32B 3AP5A 4LIVA 5CFDC 3V0BB 3VBHA 4W6WA 2RS13 1JW6A 3MI8A 4DUVA 2QQLA 2JD4A 4ITCA 4QPGA 3MLKA 3SC7X 1JH5A 3WCRA 5FK7A 4NRMA 5ANNA 4N8MA 4Q4V3 2AC1A 4K40A 2AR6A 2JDYA 3B9CA 4ZPIA 4JCKA 3T09A 3OGRA 4UFMA 4OHZA 2VQTA 3LAGA 3OUJA 5FZ1A 4IESA 4CEWB 5GZCA 1PGL1 3IPVB 2ZZQA 3WUCA 1WCUA 2CDPA 2OXBA 2WINB 3ZN6B 5EFUA 1OQEA 2PHWA 1BVP1 2ERFA 5IATA 4BHPA 4A6SA 3B93A 2JDMA 3R4SA 4E4DX 3POBA 5LEKA 3ZFFC 2JJ6A 1ZZ6A 3VDDA 1EAH3 1PMJX 2NN8A 3R05A 3C7EA 1H8TA 2R7EB 4G4FA 1DDLA 5KXDA 2RS12 5GZFA 4Q0UA 1NA1A 3UGGA 1WMDA 1XNKA 1XSRA 3JU9A 5JMOA 1R1ZA 1OOPB 4UFLA 5CNAA 4P00B 3W58A 4BLJA 4BMBA 2DYCA 4CE8A 5FZOB 1N1SA 1XXNA 3LFIA 4XUTA 1FOD2 1W03A 5A6QA 1WD4A 2HWF2 1DQ1A 3HMYA 4HBNA 4ATFA 5AC92 1QQP1 4YWAA 5CYYA 4AVSA 1WCKA 2QKDA 5GLTA 4RGGA 4B1MA 2NZ9A 5JMCA 4QX2A 1R081 1TEIA 3DUIA 4YGBA 3OYWB 5FYYA 1M4WA 5KC6A 3WF2A 3ZYPA 3I2DA 3OYWA 4P9WA 4QPWA 2Y6LA 3HNMA 3UV9A 1CX1A 3K2OA 1CESA 2VMEA 1TNFA 3ZO0B 1ZRFA 4D6SA 1RUH3 3ES4A 1DQ4A 1ULDA 4FQ4A 5C3SA 2I07B 4YGCA 3MFAA 3RRDA 3VKOA 2ZX3A 3MO4A 1Z7S2 1B35C 1NCRA 3JD71 1VE0A 2KM2A 1QQP2 3BODA 3WW4A 2R061 5L36A 3ZR6A 1O4ZA 1G86A 1J58A 2D5HA 4HK8A 4AFDA 1CAXB 5IVBA 3POIA 3VBUB 1LCLA 4IQPA 1CAXA 3AZVA 4QT6A 3E5QA 4UYBA 3AZXA 4FPGA 1CAWA 1DHKB 4PI0A 5J96B 1QJY3 5BNOC 2X29A 1RUF2 3GALA 3LWCA 3PTYA 4ZXEA 1EUTA 1Z78A 2JENA 5I8SA 3ZIXA 5J48A 5E6HA 1COV3 2A3XA 4W6YA 4XBQA 4YW2A 4XABA 2ZX0A 5C71A 2B4KA 4I0WB 3C3VA 1HLCA 3RQ0A 2DUQA 4AOCA 5F3CA 1QOSA 1WZXA 4ZY9A 2NPIA 2XKPA 3MBWA 5A3UA 1JZ8A 4IXLA 2WQ4A 1HN1A 3MIFA 5IJRA 4WVVA 2R062 3RFRA 1VAMA 2OVUA 1I1EA 2HYXA 3HN3A 3WQ1A 2BFUL 2UYBA 1SBDA 2OT7A 2RR11 4AVBA 1Y4WA 2VM9A 5CADA 2N7GA 2PAKA 3NRUA 3AX4A 3VL8A 5K9YA 1ALYA 1IS5A 2Y6HA 2Q0AA 4K9SA 5EQUA 3TN91 3VUOA 2RJKA 3W5NA 2WO2A 3UKNA 2R32A 3JZVA 2A71A 3AMHA 1EV12 3MIEA 1Q8QA 4HKWA 5A3WA 2D40A 2GP3A 4WVWA 4SLIA 1OA2A 4HZFA 5DDJ2 3GCWA 3SISA 3KQ4B 4HANA 3LA3A 3OSDA 3ZYJB 2HWE2 1IS6A 5L9VA 1GFF2 3GJAA 4IEOA 1UMIA 2ZA9A 4NUBA 1W2UA 2AUYA 4ARXA 5C9AA 1JUHA 3E97A 5FXXA 1LU2A 5KC5A 1G9DA 1CGPA 2D5FA 2WSVA 4K1YA 2DVDA 2E7AA 4N53B 2PLV1 4CDQB 3TN92 4YGEA 3MIBA 1UNBA 2Q4SA 3PVOA 1JYXA 1KEXA 4N53A 1V6IA 1UO9A 2BNOA 4XUOA 2VCBA 3NVCA 4NHXA 1ZZ7A 2YMZA 5FP4A 3LPGA 4PDWA 1Q3EA 5EWSA 1AZDA 1YNAA 4MGIE 1K5MB 2E63A 3JCIA 4QB6A 1JZ5A 2CNAA 2ZGRA 3MYXA 2ZCWA 5IAVA 3KZ4C 4O61A 1TE1B 1TME3 1AUYA 1Y3TA 2W0XA 3VDCA 1IS4A 1BBT1 2WRAA 3HQRA 3KVBA 3MLLA 4L2NA 3KB5A 4U2AA 2FZ1A 5FKBA 3JBG2 2HYKA 4RQPC 5BNOA 3K4DA 1COV2 2Y6JA 2VZ3A 3FHIB 4QKDA 5L7OA 1WMEA 3B9IA 3IDBB 4QDRA 1OF3A 2VMFA 2PHXA 3WDUA 3FUOA 4TZDA 3ZFFB 1LNSA 1VBB3 4LEJA 3OBRA 2IUWA 3OPZA 1J3QA 3J8F1 3TRSB 2RJLA 4LE4A 3USUB 1Y7BA 3KHCA 2QCSB 4E2GA 3KWVA 2R041 3O14A 1PM7A 1VBE2 1LRHA 2WT1A 3PIGA 4OZOA 5BPXA 2XOMA 4QMAA 1ZM1A 5EP9A 4JGYA 5HCFA 4GD4A 5HXMA 2DU0A 4S2HA 5ABJB 2XVLA 4CCNA 4B4QA 3FL7A 4MGTA 1WW6A 2C0ZA 5HCHA 1C8M3 1TQ5A 3B01A 4N43A 2DCJA 2DVBA 3NNMA 1D2SA 3LD8A 1NQDA 1KS4A 4QU2A 5LA2A 4YZ3A 5K8SA 2HBUA 4LHKA 1N3OA 1UU6A 1O4TA 4IEPA 3LDKA 1HRI3 4H7MA 3ZFGC 2ARAA 3VKFC 4D6QA 5A3LA 1JU4A 3IIIA 3RVHA 1W8HA 1XE8A 1S4CA 2ZEWA 4XF4A 4QQ2A 1CAUA 1O5LA 4FCAA 1FOD3 1WKYA 2VUDA 4MZUA 5I8TA 2IXLA 3BU7A 4F7ZA 1CONA 1NQJA 2VTFA 2J1SA 1FMD2 1KRIA 2W91A 5L9RA 2DUPA 4NIGA 3Q8EA 3VBRB 4AHYA 3DV8A 1C8M2 1CQ9A 3LDBA 1GUIA 5CU1A 3ZSJA 1GP5A 2QDNA 1LGCA 1MQTC 2ETEA 4M3CF 4ZZ5A 3MF6A 1G6NA 5F2SA 1I5ZA 2XMLA 2D6NA 2J1UA 1O4YA 1FXZA 2E26A 2WS92 4UF0B 4AEDB 3IAQA 4HVRA 3ZKUA 1LECA 2ZABA 4L92A 4QXKA 1AR71 1Q5OA 1CAVB 1TMF2 2FDJA 1K42A 5D8AC 2P3IA 3M1HA 3KD4A 3VN4A 4Q2FA 3MIHA 3U14A 3DEMA 4XC9A 1HW5A 4YFZA 4DMIA 1NLQA 5F6LB 5EJ1B 3F95A 2Y26A 4Y5SA 4G9SB 5KBFA 3HD8B 2IXCA 4FBFA 4JGZB 5BNNA 4MXVA 3NKGA 1AYN1 4OHWA 3NV4A 4Q1PA 1QJX3 3H1MA 2BPA2 1O7FA 2B9UA 2V4AA 2DTYA 1H9PA 3K4ZA 3PVBB 2GP5A 4LBQB 1OLMA 3O1OA 1H2MA 3IMMA 3JD73 1W05A 4QB1A 4A41A 3BTAA 5L73A 3RS6A 3SH5A 1W6PB 1Z0HA 4PBPA 1L3JA 2ZGPA 1O6UA 4Z2AA 2JX9A 4MXWB 1RUH1 5LEJA 2J1RA 3ZFEC 3ACGA 3ZXKA 2O0OA 4GKYA 1BMV1 4MGZE 4CP0A 4HKLA 2ENRA 4XDOA 3U37A 2FDHA 1YCIA 3OGJA 1Y9QA 4ZXKA 3DL3A 1QJX2 5FMDA 1GLHA 4QM8A 1O3TA 5FUIA 2Z5WA 1BHGA 2P6HA 1CIYA 1UZ0A 1QJY2 1UN1A 4NAOA 3M4FA 2P37A 1F5JA 3NNLA 5GZGA 1R092 5FZEA 1UKGA 2YROA 1W8WA 3I7DA 3RJ2X 5C4WB 3E5UA 2Y38A 3MUZ1 1O8PA 1RUI1 3PUSA 3ZSLA 4EJRA 3I3BA 5A3PA 5DUVA 2WYFA 4YM3A 2G1MA 3NW4A 5BNPB 2PA7A 5CKMA 2Q8DA 1AR63 1APNA 2DDUA 4XTMA 2DCYA 3CJXA 4TN7A 4CEYC 4NWVA 3KCXA 1EAH1 2X5IA 1PZ9A 2YB7A 5K4LA 1V6JA 2TNFA 4NHYA 4Q1RA 4DNYA 4BE3A 2IXIA 4QDSA 1A34A 5CFCA 2IVIB 1YXWA 1UMHA 1V6LA 4OMCA 2E7TA 2AEYA 3WF0A 2WNUA 5C8CC 1ZRIA 2BFUS 1LOEA 2EIGA 1VIWB 2LM3A 5IVCA 5CZKA 1LOCA 3H1YA 1AX2A 2YFZA 1NXMA 4X8PA 1WLCA 4KMQA 1V00A 3HBZA 5A6ZA 1PO12 4MGQA 1P8JA 2VQUA 3CL1A 2JB8A 3NSTA 3SHRA 4DIQA 1ONAA 3DYMA 4OVEA 1DGWX 1W9YA 3ASIA 3I3QA 4FPLA 1U5IA 3MUY1 2C1FA 2EIDA 1HRV2 4D7TA 1S0FA 1OSGA 1W90A 2AENA 2VUJA 4JDOA 1UY4A 2OIIA 2P4EA 3I97A 4XXAA 5FIXA 2I45A 3KGLA 3I3EA 4NN0A 4GALA 4LULA 3GZTB 5J1XA 5T52A 4N7IA 1MS9A 1RHI3 2J1AA 3KT1A 3N9QA 1Q43A 4P9YA 1G9FA 2WBKA 4HPKB 3D82A 2OZ6A 3FX3A 5LW9A 1VBE3 3O1VA 3H3UA 4XMIA 2HWE3 1R093 2BEOA 4CXYA 1SCSA 1AXZA 1JHNA 2XBO2 3U1XA 5HV4A 3N9MA 4CDXC 4CCLA 4ZU5A 3RZGA 2GMMA 5FPBA 1HRV1 2F4LA 1R082 3NJZA 3F2ZA 5GJ6A 3ZDSA 1LHVA 3JB4C 1YFXA 4P9GA 4N43B 4UBGA 1T2XA 4IW3A 1DGWA 1FATA 1NLRA 3SMHA 1XQNA 3NO8A 4UW5A 4LT5A 1RUE1 2HKXA 2A6VA 2ZGOA 2J42A 5FWJA 2EALA 4XVHA 5JPMB 3WP4A 3W59A 1LGNA 1EP0A 3DECA 4ISQA 2IC1A 2OA2A 3MHZA 4N7UA 5H9SA 2E32A 2A6ZA 3TEXA 1DYOA 4YZ1A 2XHNA 1ND3C 5FY1A 3VZJA 4FP2A 2DBIA 3N36A 5FLJA 2E53A 1CPNA 5FTTC 4JGYC 4M0NA 4EN8B 5FYHA 3WG4A 1O5UA 3AJZA 4UW4A 1LU1A 4Q4Y2 1W9WA 3MV11 1C4RA 1HQLA 1MS8A 3WVJA 4JTNA 4CUCA 3KT4A 2FDFA 1J1TA 5JXHA 1BK0A 1DZTA 4Q4X3 3VBSB 3OG2A 4N43C 5JSOA 4XUQA 4GAZA 2GU9A 2W1WA 3P3NA 2YG0A 1S2KA 4Y1ZA 4AYUA 2A3YA 4Z2WA 1C5IA 5LY2A 3ZXEA 5F8PA 4BIOA 4CA9A 4XHXA 4XQDA 5FY9A 2VMDA 3O5SA 3S30A 2AZ5A 5J37A 3RZLA 3NL1A 5IW0A 2H0BA 2JG8C 3VKLA 1UY2A 4K3UA 4MADA 3BALA 1RJ8A 2VO5A 5A6XA 1CAVA 4OZXA 4QXHA 5GLUA 1UYXA 1ZRDA 1UXXX 5A3OA 4LTAA 4O65A 4YW7A 5LZ6A 3MDPA 1JZ6A 1YFUA 2OS2A 3AYAA 4IE4A 4J1XA 2VW0A 2PQQA 2WNVB 4Z8BA 5FZHA 4O9EA 3RZMA 3BPZA 4R9BA 3W20A 4M3CA 4JGZA 2F4PA 3KT7A 3J7NA 1JI6A 4E27A 2ET1A 4Q4X2 3ZSKA 2XJTA 4IUGA 2QQMA 4U36A 3BIWE 2BRTA 4XFAA 4BLIA 2VULA 3UJOA 1GBGA 4Y1UA 2X05A 4F3JA 2JXAA 1S0GA 3PL0A 1F31A 2VU9A 1QJU1 3OF1A 3S7IA 4BJ0A 4CDUA 3M3EA 4CCEA 4RR3C 3LSEA 4UFHA 1J3RA 1RMU1 5DAPA 2PFWA 2X10A 2ZKNA 4H55A 5B4XA 3OCPA 2W46A 3KQRA 1PGL2 5LBCA 3U4SA 3E6DA 4JVAA 1W6NA 4Y1VA 4ES9A 4QD2A 1SLLA 1QU0A 1D0GA 1TNRA 4Y5Z0 4IE6A 3VD5A 3GJBA 2A6XA 1OMIA 2JE7A 1ZBE2 5C7GA 1PIV3 4CEYB 1EYBA 1GU3A 2GNDA 1PO23 3IM0A 4OI1A 3THTA 5LY1A 1PVC2 1VRBA 4QPGB 3Q9OA 4FPCA 5JLVA 4OQ8A 1S2EA 1C8NA 4XFIA 1YJLA 3ZYBA 4XQ4A 3WNMA 3FLPA 4A6OA 3K4AA 3D3AA 1B35B 1C1FA 1V9U2 3CJIA 3ON7A 1XJAA 2Y6FA 4QQOA 1K45A 2VAUA 2Y8KA 4CP2A 2PELA 2VXJA 3A4UA 5H9PA 2JG8B 3KV9A 3U10A 5JIUA 1PNFA 3S6PA 4M4PA 4M4RA 3GHMA 2QZ3A 4OI2A 3ZLIA 2VOXA 1V9U3 5CAZA 1BBT2 1XC6A 1C57A 1WMXA 1SBEA 3WUDA 4ZZ8A 4ES8A 4LORA 2R072 2CAVA 1QY4A 4GJYA 1VRH2 4JAAA 1AYN3 2RVAA 1FMD3 2Y60A 3T0DA 3RMXA 1OA4A 1JYIA 4UFKA 3VZLA 4KBZA 1NA1B 1W2AX 4PHZA 5JR2A 4I2OA 4XZPA 1HXS1 3K3NA 5APAA 3FBMA 1V6MA 4KGQA 4ONUA 4YW3A 5HXVA 3ZOIA 4XOGA 4LA3A 2OX0A 4MX3A 1RUJ3 3NNJA 2VL4A 5F5CA 4BWOA 5JZGC 2ZGQA 5LA1A 2R042 2UY8A 4GWIA 2HWF3 3PVEA 3URFA 4E8CA 5LK7B 3KHBA 4QM9A 1GICA 1ZNPA 4MHRA 4QQPA 1JUIA 4UW6A 1DYPA 4BQ3A 5DMYA 4XJWA 4LK6A 4WZFA 2TUNA 3DPRC 1J59A 5T50A 3VB9A 5CFCC 2SLIA 3BGAA 2O8QA 1V70A 1RUE2 4HSLA 3DKQA 5EHDA 4YW1A 3UETA 4CXWA 2W68A 1UYPA 4IGOA 1AR62 2W92A 4HKOA 4JDNA 3FHQA 5FPZA 4P08A 5LBFA 1VJ2A 3ZPYA 4PF5A 4I0BA 3SQOA 2VPVA 3AKQA 2XLGA 1RUJ1 2D6MA 4LOSA 1WWYA 2RS32 1V6OA 2VCAA 2X09A 4HFSA 3NWKA 3D4KA 3INAA 4M3CE 4Z1VA 3G7DA 1NCQC 1SBFA 3VBOA 4PF1A 2OUJA 1RITA 3RZJA 1J3PA 3WINE 4CUAA 1POV3 1SACA 5FPXA 1AL21 1UYZA 2PMWB 5LBEA 1D0HA 1OT5A 3ATGA 4H2AA 3WNOA 3V0BA 4AL9A 1ENXA 4Z92B 1FMD1 5E88A 1N1TA 1OF4A 4H7LA 1OBNA 1L7RA 1XOYA 1XNDA 3JQXA 4EWAA 2ZEZA 5F6KA 1WCQA 4MOAA 1YUDA 1C8M1 4LOTA 2ZXQA 1W2NA 1RYYA 4MSVA 3MGUA 5CFDB 3QCWA 2WS91 2IFWA 2BGCA 2EXKA 4RHV1 3CQOA 1MEC2 5DN2A 4CU9A 1Q56A 2BNNA 5TSWA 1RUD1 2JWPA 2DVFA 1GQPA 5EIYB 2R6QA 4YLZA 4DFSA 2W1QA 4ZU4A 2A70A 1ODNA 2C9AA 4S2FA 1MQTA 2SBAA 2PTMA 3POSA 3H8RA 3A0KA 1OKOA 3HT2A 4Y1YA 4OI4A 5LB6A 1AR92 2QNKA 3SLIA 1W0NA 1WBLA 3N35A 4BXFA 3N9LA 4LBLA 3OBAA 3HAGA 2HEYF 4QX5A 3V64A 2HH9A 5ABJC 2YC0A 5C9AC 2E31A 5I0RA 3E6BA 2VW2A 5KXCA 2JDAA 5JIAA 1BEV2 2AREA 4DZGA 3DF0A 3KLSA 2O8OA 3S5AA 4FPKA 3N3HA 4XTPA 3SH3A 4Q27A 1MEC1 1K12A 4PIZA 2Q8EA 2W9XA 1O59A 4AG4A 5E89A 5FZ4A 2JB4A 4RS5A 1PGSA 3D6EA 5FXZA 4RS5B 1C1LA 4CZSA 1JZ3A 1RUH2 2VNRA 4MHUA 1GZWB 3WW1A 4OFGA 2V5DA 3EQEA 4M3CB 3PUHA 1W99A 3DPRA 4COUA 5BUVA 1CIWA 4FOVA 5FDBA 5FZFA 2ZHKA 2RM21 3O1SA 5D1IA 3DPRB 1H0BA 5FO9B 3WNXA 2KR2A 4CDQA 1PX4A 4ZU7A 4XFCA 4LO7A 2LTNA 2WZPP 2RDRA 4RGAA 3A7QA 4WV8A 5DDJ1 2GDFA 4OUSA 1BEV1 1UYYA 4XFBA 5CFCB 2PLV3 4AE2A 2HWD3 4Y22A 2LROA 1X36A 4PLMA 5IAXA 5AFBA 1U5YA 3WDXA 3KF3A 3T2PA 5BYNA 4OHXA 3ZXGA 2R16A 3VBOC 2PHUA 1KD7A 3WDWA 4FPEA 2WFF2 4MV2A 3Q8AA 2BGPA 5DAWA 3AKRA 4KNCA 1GNZA 2DWRA 4JGZC 2WWSA 5AFEA 4D94A 5IHRA 3AKPA 2B5HA 3TNPB 4PLOA 2BW8A 2QQNA 2Z69A 2Q1FA 5DAXA 1ULPA 2XLFA 5F3GA 5L7OB 3M3CA 4QX7A 1RIRA 3ILNA 1XYOA 3TN93 5FWEA 1AYM2 2VMHA 4RGKA 5FLHA 5A80A 3VHPA 4ASMB 1ZA4A 1RXGA 3ZFFA 1FI2A 4CCKA 5IVVA 2WO1A 4QGLA 4NPMA 4JC1A 1LEMA 2LUWA 2WFF1 4GH4B 2D3SA 1UU4A 3H8UA 1AR81 4XW3A 4HXCA 5JR7B 2V5YA 4QWNA 1SPPB 4BQ4A 2VOKA 3OBTA 2O14A 4W4ZA 3B7MA 5JOYA 1JHJA 1Q8SA 3O0VA 4Q0SA 1YQ5A 4J1WA 1LOFC 2E9QA 5FBJA 4YSFA 4K1ZA 3JBG1 2BWAA 4LQRA 4X6RB 3ZFGA 5BY5A 1GANA 3RDIA 3WG1A 2PYTA 4YGDA 1LOGA 3N7KA 3LSDA 4IERA 3H3ZA 5T3NA 4WM8A 3NV2A 3WNKA 5DUUA 4DRRA 3VBRC 5EJ3A 4FXKB 3SEPA 4CP9B 4J6GA 1S55A 2QBXA 2NYYA 1IGOA 5A33A 4UXAA 2WLQA 3H8XA 2YXSA 1S0IA 2VCMA 4IV1A 3E6CC 1G9AA 3HNBM 5HV0A 1CR7A 2UWCA 3RZHA 2MEV2 1Y9MA 2ZEXA 1YC61 2XJRA 4RFT0 3ELNA 4KG0A 2A6YA 1UQXA 2EXHA 2V09A 1LJ7A 1KJLA 4KGGA 3ILFA 3O1PA 4IGPA 4O9GA 2O1QA 1R1A3 4AI0A 3VBHC 3HN1A 5FZCA 1HQNA 4UFIA 3POFA 4LR4A 5A3MA 1S2BA 3RYRA 3V0AB 3K51A 3WW2A 4RHV2 4BQXA 3POWA 3MLJA 2OZJA 3IN9A 5FKCA 3C7OA 5A6YA 1UZWA 1H30A 2VZPA 4INDA 4AWDA 5FUNA 2HEWF 4H3WA 4XYXA 5I93A 3AL5A 1H8VA 5KHKA 1DBNA 4BIFA 2VBDA 1R1A2 4WM7C 5FMOL 4DO0A 3A23A 3C7GA 1K3IA 1E57A 2J22A 3VL9A 1QMJA 1DZRA 2XUMA 3B5LB 3HVDA 4XDQA 4UOJA 1F4HA 2FHRA 2JDZA 1ZRRA 3H3LA 1NE6A 2VUCA 2WN2A 3NJYA 2UU8A 4FTSA 1XU2A 1FX5A 1N47A 4BM8A 3IZOA 1I5PA 2YZ4A 3LF7A 3N9OA 2ZGMA 3M3IA 3WOGA 3ITQA 4AI1A 1OLQA 3AMMA 4BB3A 1K5MC 1TVGA 3MIGA 3THDA 1IPJA 4KU8A 1D4M1 5DUXA 4JGYB 4F83A 1W6QA 3PJQA 4ATEA 3IT8A 2J7MA 3TOJA 5FK8A 2FCVA 2C24A 4CSWA 5FFOC 2PLV2 3AVRA 1ND2C 1AX0A 2JDPA 3LCPA 1RUC2 4HK9A 4N9IA 2D6KA 4Q4V1 5FY7A 1JOPA 3IMNA 2XL9A 3K77A 1SLCA 5FYSA 1ULOA 3UGHA 2R073 5IFPA 1KQRA 1PO21 4BQWA 3USSA 2R1BA 2GNBA 3POEA 2KXLA 3OEAA 4A44A 2BNMA 3TEWA 2NP0A 3GCXA 2YYOA 2ZMLA 1IHMA 2XWJB 5CBLA 3IKWA 1RUG1 3VDDC 4N53C 1OC1A 1QXRA 3IBMA 1C5HA 1H2LA 5FYIA 2E6VA 4CVUA 4CDXB 3RPQA 4FPFA 4YW4A 4FI9A 4FFHA 4NE9A 5CB7A 1WBFA 1NUKA 3WDVA 4LBNA 1BKZA 4XBNA 1PM4A 1YQCA 1HJGA 2P2KA 4AQTA 1QJU3 5J36A 1UX7A 4JHTA 1RUC1 4PQQA 2HLEA 2QDRA 2VZSA 3POYA 3GXUA 4S2DA 5FP8A 4BQ5A 4DY5A 1F5FA 2RG4A 3C2UA 5F39A 4YVSA 1JS9A 2XQRA 4AFAA 2XVKA 4FPHA 3DYOA 5JUVA 3JBG3 1MS1A 1UKRA 2XKOA 4EN0A 4AEDA 2E33A 3IDAA 1AL0G 4BCUA 4CCMA 1AF9A 4NJ4A 5AC93 1UIKA 4AGGA 2IXHA 5LRRA 2WJSA 2GMEA 4D7YA 2BOJA 3PLQA 4P5YA 4N90A 3ROUA 3VZOA 1W9TA 3I59A 4I01A 4FT8A 3AXDA 3ACLA 4MH0E 3NAPA 2WR9A 1OQDA 1O3SA 3PMSA 1CAWB 4PIYA 3ZKYA 3HBKA 1NZIA 3RWNA 5IVFA 4E2QA 1NZCA 1FAYA 4EN6B 1VRH1 4PT6A 3ZMNA 4C91A 2WABA 2WC2A 4JRLA 2H0VA 3M8LA 4DEVA 2QFEA 5F9TA 2ZGSA 2VCCA 4LBQD 1OUSA 3D8CA 1HXS2 3MFCA 2BDRA 4I02A 4LE3A 5JOWA 3J9SA 2WNVC 3OPWA 1K5MA 4UI9L 4NHKA 3T2QA 3GBGA 1XRUA 4I09A 2VMCA 3LB9A 1IQAA 1H2KA 4GKXA 4AGVA 3LPFA 1FT9A 1J84A 1NXD1 1OUXA 1ND2A 3FWEA 3K3OA 4J25A 5F7UA 1LAJA 2OQ6A 2TBVA 2WZR3 4IEUA 4JHZA 1BQPA 1OD5A 4IE7A 1NAEA 2VNGA 1XNCA 3ZIWA 2CWMA 4B29A 3X29B 1FPN2 1F4AA 4HT1T 3VGIA 2FCUA 4Q4W1 3WNLA 1PK6C 2CV6A 4A3ZA 3CZUA 1GYKA 5SV8A 2PHDA 5DZGA 1GKBA 3A0NA 1U12A 2QJVA 4ISRA 5E1RA 2YGLA 3HQUA 1PZ8A 2BQPA 2ZAHA 3R4DB 5A3TA 4HN0A 4YW5A 5IVJA 1H6YA 3UL2A 3VKMA 1AL22 3LE0A 1WGPA 1OH4A 1IG0A 3IPVA 4Q29A 4K20A 1HQWA 4QDQA 4E2SA 1DCSA 1RHI1 1NLSA 3OUIA 4HONA 1AHSA 5JI9A 4BZ4A 1RUF3 3DCQA 4X6QB 2WNEA 1NCQA 4XE9A 4IEQA 1W3VA 1ZZCA 4AFMA 4XQWA 4RSUA 2XB6C 3KV4A 1ASJ2 4XUPA 1V0AA 1CPMA 2A1XA 2ES3A 3OGVA 2Q5TA 4LO6B 1JZ2A 3V56A 3BTZA 1TMF3 1CZSA 4IGQA 4FQZA 2ADDA 5EYXA 2HWD1 3ENRA 1JYNA 2RS53 2UURA 4Y24A 5L19A 1CAUB 2WS93 2XQXA 2ZHMA 1S0DA 1XNAA 1RVF1 2ADEA 4KBBA 5FMCA 4AQ6A 4XAEA 2B46X 1SLIA 3MV01 4IDZA 5HCBA 4WVZA 3PHMA 3WCSA 1PO22 4JKKA 4I3PA 1ULEA 4QKFA 1RINA 2VECA 4YG3A 3HIFA 1DF0A 2IVJA 3WF3A 2XR4A 2GMPA 3FC0A 4XAAA 1KS5A 3EO6A 4YM1A 1U0AA 1POV1 3BCWA 1MR5A 4KI5M 1ZX5A 2WN3A 3TNQA 3NNFA 2ZGLA 5GZEA 2D44A 4LMFA 4CTEA 4XF1A 1ZRCA 4Y3OA 3T2TA 4IE0A 3ZX7A 4C90A 5ABJA 4OHYA 1GWLA 4JX0A 4HMZA 2P17A 1HRI2 3U78A 5GALA 1ODMA 3AL6A 4ASLA 5F32A 3VBUA 3P3PA 3ABZA 2WO3A 4MGSA 1AXKA 2W3JA 3I2HA 2RMU3 1UL9A 4AAPA 1PMIA 4BQ1A 1OHFA 2RDQA 3CIHA 2XVGA 2VTXA 5IFTA 1I6XA 1HB4A 5I91A 1W8TA 1AJOA 4LK7A 4DQAA 2D43A 4K21A 5CG9A 5J7MA 3EBRA 3CEWA 2YDEA 3RZZA 1FYUA 2HWF1 2JE9A 1B35A 1NCRC 3CJIB 3EHKA 4FPJA 4L0PA 5CVRA 5FYBA 4AVTA 5FZKA 4CRQA 2BERA 1OFNA 3WR0A 3T4VA 4AI2A 1ULCA 5JOZA 4DS0A 1HV1A 2DFCA 2PXJA 2Y33A 4AHZA 4Q8KA 2ZJCA 3VBSA 2YBKA 3T2OA 1GWMA 1YFWA 3FFQA 5C3QA 3WP3A 4XIOA 4FP3A 3ME2A 2ZPXA 1UZYA 3M2MA 1TZOA 3SCHA 3PUQA 2BTVC 4FOQA 4BQYA 1IZ3A 1AL23 2YBSA 3BPSA 1V6KA 4GULA 1AYM1 1WLTA 2B45X 1QNYA 4Q0PA 2RV9A 2ZGUA 2EIEA 2IXKA 2DFBA 1X82A 2D93A 2BUKA 3ZFEB 3VKNA 3O12A 5T5LA 5A7QA 3K75B 2QQPA 2YU2A 2A6WA 3GNEA 3T30A 2JKBA 4AZZA 3N9NA 2XGXA 3ACIA 3M3OA 5CEHA 4G3YC 3BUCA 1UU5A 2RJ2A 5C70A 1DLCA 5M0TA 4HOOA 1VBD2 2R071 2B39A 3ETPA 1STMA 4KWKA 5BNNB 3PJYA 4EWDA 2F6BA 4YVSC 5GKAC 5IK8A 3OY8A 2DVAA 3TEYA 1BYHA 2LS6A 4E8DA 1ZREA 2XL7A 1US2A 5BV6A 4NIIA 3K46A 2WLPA 1I3HA 2I74A 4Q4W2 4LPLA 4XXPA 1MVEA 2IXJA 1YHFA 1DU3D 3MW3A 4KWLA 2NM1A 4LJHA 4MGYE 5CA6A 1D4M3 1WMFA 3TAYA 3ZXDA 4COWA 3UESA 1FOD1 4WZCA 1XNBA 3I2JA 4CPBD 1HXS3 4XPVA 2ZOEB 1N1YA 1EPZA 5ERLA 5A7NA 3SCGA 2W95A 5DG2A 5IK7A 5FY0A 4XF0A 2VQAA 2B9VA 2VZQA 1HKDA 1WUVA 3WP6A 2JG9A 1QF3A 5FYVA 4I3GA 1MPXA 5T5PA 3C7FA 3MZHA 2JG9B 3BOPA 4OLLA 3K48A 3FUQA 4XJAA 2Q30A 2GN7A 2WZ8A 3IIAA 4JZRA 5A7OA 1LB2A 3I4IA 3EXUA 3I3DA 4XEZA 3ZN4A 1W8FA 1A8MA 2JIGA 3CLPA 5HCAA 4TYSA 3S0MA 2VVDA 4BMEA 2R043 4BISA 1SFPA 4QKNA 5FZ8A 1TMF1 5LRSA 4C0HA 3R0RA 1SFYA 4EE2A 3QH7A 2FDKA 2ZX4A 3O0WA 3UYJA 1OI6A 1UY1A 3RNSA 2X5IB 4QX1A 4L11A 2R0FA 1DZQA 1VBB1 4CDWA 3S57A 4ZHNA 5DZEA 1AX1A 1PIV1 3GBFA 1H1IA 1E5SA 1LR5A 1RC6A 4HG6B 4BU2A 1RUF1 1UY0A 2BZDA 3LKJA 2EVXA 4ZONA 1RUNA 2VVEA 1PK6A 1A78A 1JBCA 1Q8PA 1H2NA 2WWJA 1ZA7A 4LNVA 4C8DA 4M00A 3J4UH 4GH4C 3AZYA 3DGTA 2OUHA 4DXZA 4IV3A 1LOBA 1YEWA 1AJKA 1AXYA 2UWAA 3FZ3A 3NV3A 3TEZA 3HQXA 5DXDA 2RS33 2NMNA 3WSOA 4P9JA 4ET7A 4LHLA 1H1AA 5FYMA 1FNYA 1U5ZA 1XB9A 2GN3A 2A3WA 2QE3A 2Y34A 3AP7A 3C8XA 4QU1A 3WD5A 4CDUC 5B4NA 4NIHA 1BMV2 4AAXA 4KQ7A 3AMQA 5FRAA 5FZAA 1RJ7A 1YQ8A 1ZBE1 2AYHA 2XONA 3POGA 4NROA 1CJDA 2RDNA 2WA4A 4NRPA 5C8WA 4Y4YA 1E5RA 2J1TA 1X9PA 5H9QA 5FOJB 2WZR1 4KG8A 3N7LA 2DU1A 4YVSB 4DRVA 3VV1A 4LKSA 1AR83 4YW6A 5GLZA 2Z79A 5JSRA 3H7JA 3Q8FA 2HJIA 1W2TA 3AP6A 3J7MA 4Y22B 5DAQA 1XYPA 2GC0A 5LA9A 3LEGA 4QQHA 1RTVA 1RUI2 2YV8A 1QGLA 1VBE1 2QQUA 2XJPA 2WYSA 2WL1A 1UIJA 1AR82 1UOJA 3LDRA 3FE5A 4F8AA 4Q0QA 3B69A 3U75A 3OGGA 1LULA 3ST7A 1CWPA 3QBQA 2GH2A 1GOFA 5K0UB 1YRZA 3APBA 3WP5A 1EUUA 4DINB 3IDEA 5FO7B 2R1DA 3MPBA 1A3KA 4FOWA 3WNNA 2CWSA 3H1WA 4QXBA 1JU3A 2VY0A 1QKQA 3O1RA 2OQ7A 3FHAA 3MF9A 2VG9A 1YFYA 3WZ1A 3GBWA 2VZVA 5IUQA 3ZXFA 2P5BA 3AC0A 2R30A 4RYDA 4AW7A 4LO5B 1OVSA 1QIQA 1XU1A 1ZYBA 4CDUB 5JVVA 4AFBA 4QHBA 2A7AA 4OI0A 1DIWA 1GNYA 4AI3A 1JZ7A 3OOXA 4AI9A 3LIHA 4YVWA 1ASJ3 3OGSA 4AVCA 2ZHNA 1F35A 2VZOA 3I2KA 1W6PA 4V2VA 5L9BA 5DDJ3 2ZEYA 4TLFA 3ZM8A 1LHWA 4DUWA 4YNIA 1GOHA 2J1VA 2XUEA 3FFZA 1VBD1 1IQDC 1MS0A 4GB32 4META 1QH6A 1COV1 2F17A 5F2WA 3U11A 1ZBE3 3MPPG 2RM23 4IEXA 5J98B 1LHNA 4AGRA 4BQ2A 4I30A 3VBHB 2GNMA 3VD4A 4HL0A 1W8NA 2Q1MA 4JV4A 1ZZ8A 2JICA 2ARCA 1W8UA 3T0BA 1O8SA 4E4HA 3ETQA 3NAPC 2VJXA 1LHUA 1POV0 4XF3A 1RUJ2 4XMAA 1FV2A 4PIXA 5A33B 4GMP1 2RS31 1MS5A 1RUI3 3THCA 5JOXA 5FMBA 5LA0A 4Q8LA 2Q1ZB 3DXTA 3T1MA 5C33A 2HWC1 2JG8A 2XJUA 4OULA 2CU5A 4CEWA 1G8WA 5EJZB 5FYZA 5E8AA 4Z07A 3R6SA 2D98A 2GC3A 1REDA 5EPAA 3AP9A 4AXOA 1JYVA 4Q5OA 5A7WA 3PUAA 2GALA 4TWTA 2HWB2 3GF6A 4A2UA 2EIBA 1MS4A 1YYNA 1MVQA 3I2GA 2GZWA 1JYTA 3RI8A 1NCQB 3VD3A 2XJVA 2YU1A 4LKFA 4Q26A 3ZYGA 2W94A 1WA4A 3M3QA 2XDVA 2D3RA 1UZVA 3KV6A 5G05L 3V0AA 1EPWA 3DKWA 1UD1A 2IZWA 1D4M2 1UPIA 2HWC2 2DBNA 2X8KA 3MIDA 3VZNA 4UFJA 1JN2P 3BOWA 2RR12 4RL7A 3CO2A 2OKXA 5K7PA 4XJZA 2BV4A 1VBB2 4CEYA 4D69A 4FTBA 2ZACA 1MZFA 1RHI2 2P3KA 4KWJA 3NV1A 4RA0A 2WFPA 4UWDA 4QPIB 2YBPA 2DF7A 5AVAA 2ZX1A 3PURA 5I0SA 4QGMA 3OD4A 3C7HA 3CHXA 4OHVA 2A73B 4AI8A 5CKQA 5HI0A 3E1F1 3PTRB 4MG2A 2W1UA 1Y43B 4ZKTB 1RUG2 3SNMA 3VZMA 1W6OB 4A45A 1D7PM 2VZRA 1YI9A 5FZ9A 5JXIA 4FFGA 4LBOA 1WCSA 2XJSA 1AR72 5C5TA 1SPPA 3LIGA 2BYVE 2OPWA 2D6OX 2ZX2A 5C5UA 1CZVA 2HWD2 3KS7A 4XACA 5FMOS 3VBOB 4EROA 4YRDA 5G04L 1L7QA 1QWRA 2ARBA 1YQ2A 3GZAA 5T54A 1QDCA 3ZVXA 1NOVA 1TG7A 2QQOA 2VVFA 1SLBA 1EAH2 3WQ7A 2VR4A 1WW4A 1PK6B 2ZZJA 3PU3A 4AVAA 2VUAA 1VR3A 1OOPA 4PI2A 3WQ0A 1AYN2 2BOIA 1ST8A 2YFUA 5D8AB 5GZDA 2K2SA 3LOBA 4O7XA 4NHLA 4BH9A 2W08A 2ZKLA 1GNHA 1YWKA 3IB3A 2FMDA 1HB1A 5I0UA 5SV5A 4LHNA 1LENA 1PGW2 1J83A 3HT1A 3ZYRA 3AYDA 2DTWA 1WLWA 3S5QA 1QNWA 1VB4A 1DGLA 5FZ0A 2Z2SB 1N3QA 4CEWC 2VMGA 4QPGC 5JAXA 1ULGA 4QGNA 3WF4A 2RDSA 1IS3A 5IVEA 4XCBA 4AEDC 5FY5A 2ZMNA 2BU9A 2AEZA 3POJA 4V1PA 3LEIA 1E5IA 1O3QA 3ES1A 2ZGKA 4COVA 1DQ5A 4QHOA 4XBLA 1B09A 3O1TA 2WQ8A 4D7SA 1XBFA 2ZS6B 5T55A 1UOBA 1E5HA 1PZ7A 4Q4Y3 1OLME 3CZJA 3M70A 1GZCA 3D5OA 5LASA 4QX8A 3UT0A 5GLWA 2C26A 4DY3A 3B3QE 1PGW1 3ECQA 4LBMA 3AVSA 1DG6A 4XFHA 5CIRA 4A3XA 3SEEA 2WFF3 3OD0A 4YFWA 2MNGA 1BK1A 2WQZC 2ILMA 2WIIB 1H8TC 1CJPA 2K0GA 1HIXA 1GQHA 4YM0A 1LGBA 2ZMKA 3J8F3 4L99A 3ZR5A 1DQ6A 3B02A 4B7EA 2XHKA 2EXIA 2RMU1 3G6JB 4BYYA 4PDWC 3NAPB 2K46A 2VD7A 4ARYA 2WNVA 4COYA 1FNZA 2Q8OA 1LESA 3WF1A 3WT3A 5ISLA 3CMGA 4N9HA 3OEBA 3OY8B 4EWEA 1M06G 1IKPA 4XETA 1IPKA 2VNVA 3VBFB 3J7LA 4HVOA 1VMJA 4K7JA 2Z42A 1DFQA 3RSJA 1A8DA 1GOGA 3OPTA 2W5FA 4YVWB 3WNPA 1RB8G 3J7HA 2CY6A 4WVMA 1UMZA 4DXSA 2FD8A 1QOTA 4A7ZA 4QXCA 2UWBA 3PNAA 1XE7A 4TXWA 1MS3A 1URXA 4CCCA 4AHXA 4YARA 2XLAA 1RGSA 5EZWA 1RL3A 5F1RA 5A1LA 3WEZA 2Y0OA 3DXUA 5DAVA 5FJHA 1JOBA 4IV1C 1F2NA 2VC9A 5A3NA 1GZTA 1ND2B 2D97A 4QB2A 4AEKA 5J3UA 1W0PA 2NQYA 4BXSV 4AR2A 2EICA 1WW5A 3CBNA 5KWRA 3NMBA 5JDBA 2JDHA 1FV3A 5T5JA 4IL7A 2ORZA 2VTXJ 4DUXA 1VBC2 4NIDA 1YIPA 2DCZA 1TME2 4LHSA 4B4PA 2WSUA 3ZXAC 5DABA 2NMOA 3ORJA 4HSJA 2MPFA 5K0UC 4ZS3A 4AQSA 3D0SA 4LUKA 1QEXA 1F8VA 2JD9A 2VOTA 2OYZA 3HOBA 3OUHA 5BNPA 2HEVF 1GZWA 2D6LX 3AK0A 4DOUA 1W28A 1PVXA 2JECA 4BK4A 3NJXA 4D3WA 1H4HA 5F5AA 2K9ZA 3ZSEA 2WUHA 2JIJA 4AEMA 4CDWB 5I0DA 4Q4X1 1UOFA 3HNYM 3P1IA 1BJQA 3H42B 2UYAA 3Q8CA 2WA3A 1MACA 1BBT3 5FAXA 2KA3A 4Y4RA 3BIEA 1V6NA 4WM7A 2EAAA 3AYCA 2GH8A 5DG1A 4MGKE 4IEYA 4FOYA 5DPNA 4YPJA 3THPA 1TME1 1QH7A 4CDQC 4PBOA 4WM7B 4CP9A 1K5JA 1VMFA 3I2FA 3MW4A 5FPAA 5C3PA 1SMVA 4LO4B 5FZ6A 3GGLA 4Q0VA 3VZKA 3KVAA 3Q8BA 1RUD3 4GA9A 3I49A 1IOAA 1S0BA 3OBZA 4AFCA 4FAGA 3I2OA 4XILA 1N3PA 1OLRA 4QX3A 4XCAA 1YQ6A 5FZMA 4Q4W3 3BN6A 1BVVA 3O0XA 1PHMA 2VNOA 2W39A 4FXGB 4Q4V2 2WT0A 3OTFA 2QQVA 1I9RA 1UPSA 4P02B 2BVBA 4NVPA 5ANQA 2VZTA 4RD7A 5F3IA 2DCKA 2G9GA 2WO7A 3IWZA 4QAWA 3U0ZA 1YJKA 4CPBA 1A6CA 4WM8C 1CZTA 1SFNA 3O1MA 3T3YA 3TB0A 2HWE1 3AZWA 3GZUC 3USUA 4FFFA 1L7LA 4LITA 4R9DA 2CDOA 3PDQA 3AZZA 1GP6A 2R063 5JZGA 1MZ5A 1SDDB 5EV7A 3QLQA 5D2AA 5FYUA 1JYWA 4CUBA 3M7AA 2Y6GA 3W5MA 1UF2C 1OA3A 3GYDA 5A32A 3VD9A 2PAMA 1W39A 4IV3C 2YGMA 3UKTA 3A21A 5FLIA 4CU8A 4WM8B 2G4IA 3JB8A 1LKNA 3JQWA 1C28A 4DEQA 4QKBA 4C1WA 3KM5A 1YI7A 2RR13 1MZEA 2WZR2 3AMNA 2FZ2A 1LOFA 2XJQA 2QUOA 1OVPA 1NKGA 3AM2A 4K8RB 1Y9GA 4D0QA 5KHGA 5FJKA 3FLRA 2RS52 5C4WC 5CFDA 5FO8B 4IEVA 3AP4A 4LA2A 1Z7S3 4XFGA 3PMEA 4L8QA 5AC91 1QQP3 3UNPA 1VP6A 5L7OC 2WNOA 4CUGA 2C9KA 2QZ2A 3MEPA 1W6QB 5FR3A 3KCYA 2Y0IA 4JKLA 1HDKA 3ACFA 1PX3A 3FLTA 3OJBA 4QX0A 4UT5A 3VDDB 1XNTA 4M0HA 5BNNC 2B7YA 3O1UA 4JQTA 5FZ7A 1REFA 3BU0A 1RUC3 3ZYIB 1D2QA 5FYCA 3KSCA 5B2GB 1AR61 3NJVA 1OD3A 5DZFA 4Y20A 3S7EA 4FAHA 2G19A 4YZ4A 5FP3A 5A1AA 5KXEA 2YC4A 2YPDA 2G9FA 2P6CA 1V9U1 4A7YA 1POQA 4A42A 4JTOA 5AVPA 1SLTA 4OYUA 2LALA 5KHJA 4XJ9A 4RR3A 4KU7A 3L9JT 4M01A 3RYPA 3DYPA 4W6XA 4LBKA 1LHOA 3HWJA 3SH4A 1KXGA 5F5IA 3ZSMA 1D4VB 2FDGA 3EMRA 4W50A 1QDOA 2V72A 5FZDA 4BPZA 4URTA 5FPVA 1S0CA 2WZEA 4GB31 3WDYA 4TLGA 2BVVA 1KITA 4GB33 3RI9A 1ACCA 2WAAA 1R083 2RS11 3R4UA 1T6BX 1XYNA 2VOVA 2I2SA 4EV0A 3BTXA 3BI3A 2Z4FA 1VBC1 2ZAAA 3HEIA 1Q8OA 3U4XA 1NCRB 3CJIC 1IKQA 2P3YA 2Y6KA 5A70A 2VW1A 2HWC3 2BJSA 4RS5C 1RUD2 3AKSA 1RMU3 4GWMA 4MXWA 5FV3A 5C6CA 2XPJA 4GMP3 4LLFA 4RFRB 4CCDA 4UBHA 3HJRA 5BXXA 3EB7A 3BB6A 3ZPOA 3WY6A 4EQVA 4R4ZA 3ALQA 1ZVFA 5FPLA 3H8OA 4E4SA 5IWFA 1JYCA 2WNUC 4B7KA 1DP0A 2XXZA 4E9KA 1VBD3 2IFRA 3H9AA 2W2IA 5C4WA 3PU8A 5H9RA 4CDXA 4CXXA 1AR73 3LEKA 5ACA3 3AB0A 1Z7S1 1ZZBA 5T5OA 1QXJA 1W6OA 3JD72 1GQGA 2XG3A 4XIKA 3QH6A 5JPNB 3PUIA 4JQRA 5C3RA 3KGZA 3ZXLA 4GH4A 1SDWA 3LOIA 1X50A 1RXFA 4YZ2A 4TTGA 1HB2A 1R1A1 2CTVA 2ARXA 4YZ5A 4A4AA 5BNQA 5C8CB 1X8MA 2W1SA 2C4XA 1SG3A 5JWPA 3MICA 4OUMA 2H6CA 2WNUB 3PVNA 4QHZA 1WW7A
chains in the Genus database with same CATH topology
4NHMA 3VHNA 1SCRA 4P5HA 4WBBA 1S0JA 1DGRN 2DUOA 1QJU2 2PHFA 3ZFEA 1SLAA 3QD6A 2XBO3 3WLUA 1WLDA 5BNPC 1G9BA 2VOWA 1RMU2 1Q8VA 3UK9A 2QVSB 3LGRA 4NPRA 1NE4A 4HN1A 3WG3A 3RYKA 3RG0A 5LK5A 4XF9A 3UKVA 2ZTNA 1OPOA 3B94A 1AR91 4CP1A 4RQPB 3SCFA 1PIV2 1VAKA 1DYKA 4Y1XA 4YM2A 3VBRA 4HPKA 1AR93 1QJZA 2W52A 4YG6A 1HRV3 5GLVA 4AVVA 3CF6E 5EYYA 3LA7A 4AQ2A 4MYEA 4COZA 4R9CA 1NA1C 3H0OA 3NKTA 1PO13 2FBEA 2R49A 4AK3A 3WV6A 1OFSA 5FQ0B 4HETA 3IDCB 4C1XA 1T6GC 2YUEA 1CN1A 4FPOB 2RM22 3H50A 4K8FA 4DB5A 3N7MA 1SQ4A 4I0AA 2B42B 4R9AA 4PJYA 2WT2A 1H4GA 4QPIC 3RJRA 1ZBA2 4NO4A 5HBAA 2AH2A 4KL1A 4NWWA 4W65A 1W0OA 4X8NA 5KXBA 3AYEA 1GZ9A 1VLNA 3QACA 3HR9A 3ZN6A 3WHUA 3DN7A 1MQTB 5FBZA 2E7QA 2MEV1 4GWNA 2CGOA 5ACA1 1BEV3 5FCCA 1ZBA3 1VAVA 4B3NA 2FQPA 4MLOA 2ZHLA 1H9WA 3CU7A 1LODA 1PVC3 2ZGNA 4Y20B 2HWB1 2NLRA 1LEDA 4IETA 3H7YA 3FMGA 3QOPA 4DPNA 4RR3B 2C5DA 2GSYA 4IEWA 4AEJA 4E4ZA 2YHJA 4YYOA 2YY1A 1GR3A 3MW2A 4JRAA 1MEC3 2PHLA 1OQ1A 4XJUA 5JI7A 4AF9A 4TSVA 3LZZA 4R4XA 2CAUA 2PHRA 3WDTA 1S0EA 4S2GA 3W9AA 1DQ0A 2PAEA 2XWBB 4P14A 1NYWA 3VHRA 3ZN5A 1ENQA 5DUWA 3VBUC 5IK5A 2BWCA 1DLLA 4L9BA 3FBYA 2PHTA 4R52A 2CGPA 3WXPA 1X8EA 1OPMA 3I8TA 2A75A 1VBA3 5CG8A 2EXJA 3N7JA 1W6NB 4RHV3 2DVGA 4BA6A 3WHTA 4A7KA 2YPJA 3LA2A 4IEZA 4XJ8A 4Q4Y1 1MZ6A 4H14A 2ZGTA 2X53S 2H6BA 5IK4A 1AYM3 4PQ9A 1KJRA 3FJSA 3VBSC 1QJX1 4GXLA 1EV11 1UZZA 2GAUA 2JEMA 3O7OA 1VALA 1O3RA 4QPIA 4Z82A 1LOAA 3ZXJA 3I54A 2FMYA 1BZWA 4QPYA 4SBVA 4PLNA 1G9CA 4AHWA 4XFFA 4QQLA 4EN7B 5E16A 1HV0A 3D0JA 2B8MA 4XHBA 1JOJA 1OOPC 3AFGA 4GQ7A 5JZGB 1U5XA 4K6BA 4P9IA 3AXEA 2E51A 4FSJA 4MUVA 1EY2A 3KMHA 4L97A 4B8EA 2RHPA 5I0TA 1G7YA 1BCXA 4ORFA 3U07A 1QHDA 3JUUA 1VB2A 4FO9A 5GM0A 4IV1B 2CL2A 1VBA2 3B00A 2BBVA 3SXWA 3WG2A 4LO8A 4NOTA 1PNGA 1HRI1 2P3JA 2GC1A 1JXNA 4LLOA 2DURA 1EV13 1ZZ9A 1CVNA 1PVC1 4NR1A 1O91A 1H8TB 2PN5A 1UCXA 1C3HA 2ATFA 1RVF3 3CNAA 2OPKA 1ZBA1 3N4MA 3J8F2 4IV3B 2RS51 2VXRA 2X5IC 3EJKA 1UW8A 1VBA1 2MEV3 2GC2A 2MHFA 2WKKA 5KHIA 2ET7A 5JSPA 3ILRA 3E5XA 5FQ0A 1CX4A 5ACA2 2GNTA 1X7NA 3SITA 5FOBB 5KHHA 3AFKA 5BNOB 1NY71 2A5ZA 1DQ2A 1OKQA 1HX6A 5J09A 1GSLA 4YG0A 1KFXL 1FPN1 1GV9A 1H1MA 2CYFA 3AKTA 1W6MB 2JG9C 1F9KA 3L2HA 1W6MA 3VBFA 1X33A 1JTZX 3TBDA 3VHOA 1PO11 4B4RA 2IWGB 4GIQA 5JCTA 2CGNA 2ZBJA 3VLBB 4WVMB 1NY72 2HWB3 2RMU2 2UY9A 4P9XA 5K0UA 4PCRA 5EXOA 1KFUL 2VMIA 5D8AA 1ENSA 2VGDA 3WW3A 3GHNA 3UJQA 4CDWC 1UX6A 1DGRA 3T1LA 1ASJ1 2EA7A 1YIFA 1WCDJ 4UW3A 2R0HA 2XH6A 1YO8A 1UAIA 1QOOA 2D3PA 2XBO1 4HVQA 1ND3B 1AVBA 1ND3A 4FVVA 3WX5A 4GMP0 2TEPA 4MVTA 1QXPA 3AMPA 3AJYA 4LBJA 1VRH3 1LTEA 2AGSA 3TYJA 1WD3A 1BXHA 4JDMA 4FTEA 1RUOA 3TWIA 1KDKA 4C0BA 4FPYA 4HLTA 3RMYA 4Y26A 3I59B 1KDMA 1SEFA 3J26N 4CYDA 4BOWA 2DCTA 2VH9A 2EF6A 4KH9A 3V65A 5C9AB 4YVWC 4R8HA 1S1AA 2V73A 1CD3G 1RUE3 5FREA 1ULFA 4RQPA 4EN9B 2OW4A 1QJY1 2D7FA 2D6PA 3L2YA 1REEA 3KCCA 4LBQA 1R091 4PDWB 2P34A 5IT6A 1NG0A 4P9LA 1N1VA 2VQ0A 1YLLA 1J1LA 1FPN3 1RUG3 3ZMOA 1ENRA 1VBC3 3ZFGB 4LUMA 5F5QA 2EAKA 2RE9A 1RVF2 2DV9A 5A32B 3AP5A 5CFDC 3V0BB 3VBHA 4W6WA 2RS13 1JW6A 3MI8A 4QPGA 2JD4A 4ITCA 3MLKA 3WCRA 1JH5A 4Q4V3 4K40A 2AR6A 3B9CA 4JCKA 4OHZA 3LAGA 4CEWB 4IESA 5GZCA 1PGL1 3IPVB 2ZZQA 3WUCA 2WINB 3ZN6B 5EFUA 1OQEA 2PHWA 1BVP1 2ERFA 4BHPA 3B93A 3R4SA 4E4DX 5LEKA 3ZFFC 2JJ6A 1ZZ6A 3VDDA 1EAH3 2NN8A 3R05A 4G4FA 1DDLA 1H8TA 5KXDA 2RS12 5GZFA 4Q0UA 1NA1A 1WMDA 1XNKA 3JU9A 1R1ZA 1OOPB 3W58A 5CNAA 4BLJA 4BMBA 2DYCA 1N1SA 1XXNA 1FOD2 1WD4A 2HWF2 1DQ1A 3HMYA 4HBNA 4ATFA 5AC92 1QQP1 4AVSA 1WCKA 2QKDA 5GLTA 4RGGA 2NZ9A 5JMCA 1R081 1TEIA 3DUIA 4YGBA 3OYWB 1M4WA 5KC6A 3ZYPA 3I2DA 3OYWA 4P9WA 3UV9A 1CESA 1TNFA 3ZO0B 1ZRFA 1RUH3 3ES4A 1DQ4A 1ULDA 4FQ4A 2I07B 4YGCA 3MFAA 3RRDA 3VKOA 2ZX3A 1Z7S2 1B35C 1NCRA 3JD71 3BODA 2KM2A 1QQP2 3WW4A 5L36A 2R061 1O4ZA 1G86A 1J58A 2D5HA 4HK8A 4AFDA 1CAXB 3VBUB 1LCLA 4IQPA 1CAXA 3AZVA 4QT6A 3E5QA 3AZXA 4FPGA 1CAWA 1DHKB 5J96B 1QJY3 5BNOC 2X29A 1RUF2 3GALA 3LWCA 3PTYA 1Z78A 2JENA 5I8SA 3ZIXA 5J48A 1COV3 2A3XA 4W6YA 4XBQA 4YW2A 2ZX0A 4I0WB 3C3VA 1HLCA 3RQ0A 2DUQA 1QOSA 2NPIA 2XKPA 4IXLA 2WQ4A 3MIFA 4WVVA 2R062 1VAMA 2OVUA 1I1EA 3WQ1A 2BFUL 2UYBA 1SBDA 2RR11 4AVBA 5CADA 2N7GA 2PAKA 3VL8A 3AX4A 5K9YA 1ALYA 1IS5A 4K9SA 2Q0AA 3TN91 3VUOA 2RJKA 3UKNA 2R32A 3JZVA 2A71A 3AMHA 1EV12 3MIEA 1Q8QA 4HKWA 2D40A 4WVWA 4SLIA 1OA2A 4HZFA 5DDJ2 3SISA 4HANA 3LA3A 3ZYJB 2HWE2 1IS6A 1GFF2 4IEOA 2ZA9A 1W2UA 2AUYA 5C9AA 1JUHA 3E97A 1LU2A 5KC5A 1G9DA 1CGPA 2D5FA 2WSVA 4K1YA 2DVDA 2E7AA 4N53B 2PLV1 4CDQB 3TN92 4YGEA 3MIBA 2Q4SA 3PVOA 4N53A 1V6IA 2BNOA 3NVCA 1ZZ7A 2YMZA 4PDWA 1Q3EA 5EWSA 1AZDA 1YNAA 4MGIE 1K5MB 2E63A 3JCIA 2CNAA 2ZGRA 3MYXA 2ZCWA 3KZ4C 1TE1B 1TME3 1AUYA 1Y3TA 2W0XA 1IS4A 1BBT1 3MLLA 4L2NA 3KB5A 4U2AA 2FZ1A 3JBG2 2HYKA 4RQPC 5BNOA 1COV2 3FHIB 5L7OA 1WMEA 3B9IA 3IDBB 2PHXA 3WDUA 3FUOA 4TZDA 3ZFFB 1VBB3 4LEJA 3OBRA 3OPZA 1J3QA 3J8F1 3TRSB 2RJLA 4LE4A 3USUB 1Y7BA 2QCSB 4E2GA 2R041 3O14A 1PM7A 1VBE2 1LRHA 2WT1A 5BPXA 4QMAA 1ZM1A 4JGYA 5HCFA 2DU0A 4S2HA 5ABJB 2XVLA 4B4QA 1WW6A 2C0ZA 1C8M3 1TQ5A 3B01A 4N43A 2DCJA 2DVBA 4QU2A 1D2SA 1NQDA 1KS4A 4YZ3A 5K8SA 4LHKA 1N3OA 1UU6A 1O4TA 4IEPA 1HRI3 4H7MA 3ZFGC 3VKFC 5A3LA 1XE8A 4XF4A 4QQ2A 1CAUA 1O5LA 4FCAA 1FOD3 4MZUA 5I8TA 2IXLA 3BU7A 4F7ZA 1CONA 1NQJA 1FMD2 1KRIA 2DUPA 3VBRB 4AHYA 3DV8A 1C8M2 1CQ9A 5CU1A 3ZSJA 2QDNA 1LGCA 1MQTC 2ETEA 4M3CF 3MF6A 1G6NA 1I5ZA 2D6NA 2WS92 1O4YA 1FXZA 4AEDB 4HVRA 1LECA 2ZABA 4L92A 4QXKA 1AR71 1Q5OA 1CAVB 1TMF2 5D8AC 2P3IA 3M1HA 3KD4A 3VN4A 4Q2FA 3MIHA 1HW5A 4YFZA 4DMIA 5F6LB 2Y26A 4G9SB 5KBFA 3HD8B 2IXCA 4FBFA 4JGZB 5BNNA 4MXVA 3NKGA 1AYN1 4OHWA 3NV4A 4Q1PA 1QJX3 3H1MA 2BPA2 1O7FA 2B9UA 2DTYA 1H9PA 3PVBB 4LBQB 1H2MA 3JD73 3BTAA 5L73A 3RS6A 3SH5A 1W6PB 1Z0HA 4PBPA 1L3JA 2ZGPA 2JX9A 4MXWB 1RUH1 5LEJA 3ZFEC 3ZXKA 2O0OA 4GKYA 1BMV1 4MGZE 4CP0A 4HKLA 2ENRA 1YCIA 3OGJA 1Y9QA 4ZXKA 3DL3A 1QJX2 1O3TA 1GLHA 4QM8A 2Z5WA 1QJY2 1UN1A 3M4FA 2P37A 1F5JA 5GZGA 1R092 1UKGA 2YROA 3I7DA 3RJ2X 5C4WB 3E5UA 2Y38A 1RUI1 3ZSLA 4EJRA 5DUVA 4YM3A 3NW4A 5BNPB 2PA7A 1AR63 1APNA 4XTMA 2DCYA 3CJXA 4CEYC 4NWVA 3KCXA 1EAH1 2X5IA 1PZ9A 1V6JA 2TNFA 4Q1RA 4DNYA 4BE3A 2IXIA 5CFCA 1YXWA 1V6LA 2E7TA 2WNUA 5C8CC 2BFUS 1LOEA 2EIGA 1VIWB 2LM3A 1LOCA 3H1YA 1AX2A 1NXMA 4X8PA 1WLCA 1V00A 3HBZA 1PO12 3CL1A 3NSTA 3SHRA 1ONAA 4OVEA 1DGWX 3ASIA 4FPLA 1U5IA 2C1FA 1HRV2 4D7TA 1S0FA 1OSGA 2AENA 2VUJA 4JDOA 2OIIA 4XXAA 2I45A 3KGLA 4NN0A 4GALA 4LULA 3GZTB 5T52A 4N7IA 1MS9A 1RHI3 3KT1A 1Q43A 4P9YA 1G9FA 4HPKB 3D82A 2OZ6A 3FX3A 1VBE3 3H3UA 4XMIA 2HWE3 1R093 2BEOA 1SCSA 1AXZA 1JHNA 2XBO2 4CDXC 4ZU5A 2GMMA 1HRV1 1R082 3NJZA 5GJ6A 3ZDSA 1LHVA 3JB4C 1YFXA 4P9GA 4N43B 4UBGA 1DGWA 1FATA 1NLRA 3SMHA 1XQNA 3NO8A 4UW5A 4LT5A 1RUE1 2HKXA 2A6VA 2ZGOA 2EALA 5JPMB 3WP4A 3W59A 1LGNA 1EP0A 4ISQA 2IC1A 2OA2A 4N7UA 5H9SA 2A6ZA 4YZ1A 3VZJA 1ND3C 4FP2A 3N36A 5FLJA 2E53A 1CPNA 5FTTC 4JGYC 4M0NA 4EN8B 3WG4A 1O5UA 3AJZA 4UW4A 1LU1A 4Q4Y2 1C4RA 1HQLA 1MS8A 3WVJA 4JTNA 3KT4A 1J1TA 1DZTA 4Q4X3 3VBSB 4N43C 5JSOA 2GU9A 3P3NA 1S2KA 4Y1ZA 4AYUA 2A3YA 4Z2WA 1C5IA 3ZXEA 4BIOA 4XHXA 4XQDA 3S30A 3O5SA 5J37A 2AZ5A 3NL1A 2H0BA 2JG8C 3VKLA 4K3UA 3BALA 1RJ8A 1CAVA 4OZXA 5GLUA 1ZRDA 4LTAA 3MDPA 1YFUA 3AYAA 4J1XA 2VW0A 2PQQA 2WNVB 4Z8BA 4O9EA 3BPZA 4R9BA 4M3CA 4JGZA 2F4PA 3KT7A 4E27A 2ET1A 4Q4X2 3ZSKA 2XJTA 4U36A 3BIWE 4XFAA 4BLIA 2VULA 3UJOA 1GBGA 4Y1UA 4F3JA 2JXAA 1S0GA 1F31A 2VU9A 1QJU1 3OF1A 3S7IA 4CDUA 3M3EA 4RR3C 3LSEA 1J3RA 1RMU1 2PFWA 2ZKNA 4H55A 3OCPA 3KQRA 1PGL2 3E6DA 4JVAA 1W6NA 4Y1VA 4ES9A 4QD2A 1SLLA 1QU0A 1D0GA 1TNRA 4Y5Z0 2A6XA 1OMIA 2JE7A 1ZBE2 1PIV3 4CEYB 1EYBA 2GNDA 1PO23 3IM0A 4OI1A 3THTA 1PVC2 4QPGB 3Q9OA 4FPCA 5JLVA 1C8NA 4XFIA 1YJLA 4XQ4A 3FLPA 1B35B 1C1FA 1V9U2 3CJIA 4QQOA 4CP2A 2PELA 3A4UA 5H9PA 2JG8B 3U10A 5JIUA 1PNFA 3S6PA 3GHMA 2QZ3A 4OI2A 2VOXA 1V9U3 5CAZA 1BBT2 1C57A 3WUDA 1SBEA 4ES8A 2R072 2CAVA 1QY4A 1VRH2 4JAAA 1AYN3 1FMD3 3RMXA 1OA4A 1JYIA 3VZLA 1NA1B 4I2OA 4XZPA 1HXS1 3FBMA 1V6MA 4KGQA 4ONUA 4YW3A 5HXVA 4XOGA 4LA3A 4MX3A 1RUJ3 4BWOA 5JZGC 2ZGQA 2R042 2UY8A 2HWF3 3PVEA 3URFA 5LK7B 4QM9A 1GICA 1ZNPA 4UW6A 4QQPA 1JUIA 1DYPA 4XJWA 4WZFA 2TUNA 3DPRC 1J59A 5T50A 5CFCC 2SLIA 2O8QA 1V70A 1RUE2 4HSLA 4YW1A 2W68A 1AR62 5FPZA 4HKOA 4JDNA 3ZPYA 1VJ2A 4PF5A 4I0BA 2VPVA 3AKQA 2XLGA 1RUJ1 2D6MA 2RS32 1V6OA 4HFSA 4Z1VA 3NWKA 3D4KA 3INAA 4M3CE 3G7DA 1NCQC 1SBFA 3VBOA 2OUJA 1RITA 1J3PA 3WINE 5FPXA 1POV3 1SACA 1AL21 1D0HA 3ATGA 3V0BA 1ENXA 4Z92B 1FMD1 5E88A 1N1TA 4H7LA 1XNDA 3JQXA 4EWAA 5F6KA 1YUDA 1C8M1 4MSVA 3MGUA 5CFDB 3QCWA 2WS91 2IFWA 2BGCA 2EXKA 4RHV1 1MEC2 1Q56A 2BNNA 5TSWA 1RUD1 2DVFA 2R6QA 4YLZA 4DFSA 4ZU4A 2A70A 2C9AA 4S2FA 1MQTA 2SBAA 2PTMA 3POSA 3A0KA 3HT2A 4Y1YA 4OI4A 3SLIA 1AR92 2QNKA 1WBLA 3N35A 4LBLA 3HAGA 2HEYF 4QX5A 3V64A 5ABJC 2YC0A 5C9AC 5I0RA 3E6BA 2VW2A 5KXCA 5JIAA 1BEV2 2AREA 4DZGA 3DF0A 3KLSA 2O8OA 4FPKA 3N3HA 4XTPA 3SH3A 4Q27A 1MEC1 4PIZA 4AG4A 5E89A 4RS5A 1PGSA 3D6EA 4RS5B 1C1LA 4CZSA 1RUH2 2VNRA 1GZWB 3WW1A 4OFGA 3EQEA 4M3CB 3DPRA 5BUVA 4COUA 1CIWA 4FOVA 5FDBA 2ZHKA 2RM21 5D1IA 3DPRB 1H0BA 5FO9B 3WNXA 4CDQA 4ZU7A 4XFCA 4LO7A 2LTNA 2WZPP 4RGAA 4WV8A 5DDJ1 2GDFA 4OUSA 1BEV1 4XFBA 5CFCB 2PLV3 4AE2A 2HWD3 4Y22A 1X36A 4PLMA 5AFBA 1U5YA 3WDXA 5BYNA 4OHXA 3ZXGA 2R16A 3VBOC 2PHUA 1KD7A 3WDWA 4FPEA 2WFF2 4MV2A 3AKRA 4KNCA 1GNZA 2DWRA 4JGZC 2WWSA 5AFEA 4D94A 3AKPA 2B5HA 3TNPB 4PLOA 2BW8A 2Z69A 2XLFA 5L7OB 3M3CA 1RIRA 3ILNA 1XYOA 3TN93 1AYM2 2VMHA 5FLHA 3VHPA 4ASMB 1ZA4A 3ZFFA 1FI2A 4QGLA 4JC1A 1LEMA 2WFF1 2LUWA 4GH4B 2D3SA 1UU4A 3H8UA 1AR81 4XW3A 5JR7B 2V5YA 2VOKA 3OBTA 3B7MA 5JOYA 1Q8SA 4Q0SA 3O0VA 5C6CA 4J1WA 4YSFA 1LOFC 2E9QA 5C8CA 4K1ZA 3JBG1 2BWAA 4X6RB 3ZFGA 5BY5A 1GANA 3RDIA 3WG1A 2PYTA 4YGDA 1LOGA 3N7KA 3LSDA 4IERA 3H3ZA 5T3NA 4WM8A 3NV2A 4DRRA 5DUUA 3VBRC 5EJ3A 4FXKB 4J6GA 1S55A 2NYYA 1IGOA 5A33A 4UXAA 2WLQA 2YXSA 1S0IA 4IV1A 3E6CC 1G9AA 1CR7A 2UWCA 2MEV2 2XJRA 4RFT0 3ELNA 4KG0A 2A6YA 2V09A 2EXHA 1LJ7A 1KJLA 4KGGA 3ILFA 4O9GA 2O1QA 1R1A3 4AI0A 3VBHC 3HN1A 1HQNA 4LR4A 5A3MA 1S2BA 3RYRA 3V0AB 3K51A 3WW2A 4RHV2 3POWA 3MLJA 2OZJA 3IN9A 1H30A 4INDA 4AWDA 2HEWF 4H3WA 4XYXA 5I93A 1H8VA 5KHKA 1DBNA 4BIFA 4WM7C 1R1A2 5FMOL 1E57A 3VL9A 1QMJA 1DZRA 2XUMA 3B5LB 4XDQA 2FHRA 2JDZA 1ZRRA 1NE6A 2UU8A 4FTSA 1XU2A 1FX5A 1N47A 4BM8A 2YZ4A 2ZGMA 3M3IA 3WOGA 4AI1A 1OLQA 3AMMA 1K5MC 3MIGA 1IPJA 4KU8A 1D4M1 5DUXA 4JGYB 4F83A 1W6QA 3PJQA 4ATEA 3IT8A 3TOJA 5FFOC 2PLV2 3LCPA 1ND2C 1AX0A 4Q4V1 4HK9A 1RUC2 4N9IA 4COYA 2D6KA 3IMNA 2XL9A 1SLCA 2R073 1KQRA 1PO21 3USSA 2R1BA 2GNBA 2KXLA 2BNMA 2NP0A 2ZMLA 2YYOA 1IHMA 2XWJB 5CBLA 3IKWA 1RUG1 3VDDC 4N53C 1QXRA 3IBMA 1C5HA 1H2LA 2E6VA 4CDXB 3RPQA 4FPFA 4YW4A 5CB7A 1WBFA 3WDVA 4LBNA 1BKZA 4XBNA 4AQTA 2P2KA 1QJU3 5J36A 1RUC1 2QDRA 3POYA 4S2DA 4DY5A 1F5FA 3C2UA 4YVSA 4AFAA 2XVKA 4FPHA 3JBG3 1MS1A 1UKRA 2XKOA 4EN0A 4AEDA 4BCUA 1AL0G 1AF9A 5AC93 1UIKA 4AGGA 2IXHA 5LRRA 2WJSA 2GMEA 4D7YA 3PLQA 4N90A 3ROUA 3VZOA 3I59A 4I01A 4FT8A 3AXDA 3ACLA 4MH0E 3NAPA 1OQDA 1O3SA 3PMSA 1CAWB 4PIYA 3RWNA 4E2QA 1NZCA 1FAYA 4EN6B 1VRH1 3ZMNA 4C91A 2WC2A 4JRLA 2H0VA 3M8LA 2QFEA 5F9TA 2ZGSA 4LBQD 3MFCA 3D8CA 1HXS2 4I02A 4LE3A 5JOWA 3J9SA 2WNVC 1K5MA 4NHKA 3GBGA 1XRUA 4I09A 3LB9A 1IQAA 1H2KA 4GKXA 4AGVA 1FT9A 1NXD1 1ND2A 3FWEA 2TBVA 4IEUA 2WZR3 1BQPA 1OD5A 2VNGA 1XNCA 3ZIWA 2CWMA 4B29A 3X29B 1FPN2 3VGIA 4HT1T 4Q4W1 1PK6C 2CV6A 1GYKA 5SV8A 2PHDA 5DZGA 1GKBA 3A0NA 1U12A 2QJVA 4ISRA 5E1RA 2YGLA 1PZ8A 2BQPA 2ZAHA 3R4DB 4HN0A 4YW5A 3UL2A 3VKMA 1AL22 1WGPA 3IPVA 4Q29A 4K20A 1HQWA 4E2SA 1RHI1 1NLSA 1AHSA 5JI9A 4BZ4A 1RUF3 4X6QB 2WNEA 1NCQA 4XE9A 4IEQA 1ZZCA 4AFMA 4XQWA 4RSUA 2XB6C 1ASJ2 1CPMA 2ES3A 2Q5TA 4LO6B 3V56A 1TMF3 4FQZA 5EYXA 2HWD1 3ENRA 2RS53 2UURA 4Y24A 5L19A 1CAUB 2WS93 2ZHMA 1S0DA 1RVF1 4KBBA 4AQ6A 2B46X 1SLIA 5HCBA 4WVZA 3PHMA 3WCSA 1PO22 4I3PA 1ULEA 1RINA 2VECA 4YG3A 3HIFA 1DF0A 2GMPA 3FC0A 1KS5A 3EO6A 4YM1A 1U0AA 1POV1 3BCWA 1MR5A 1ZX5A 3TNQA 5GZEA 2ZGLA 4CTEA 2D44A 1ZRCA 4XF1A 3T2TA 3ZX7A 4C90A 5ABJA 4OHYA 4HMZA 2P17A 1HRI2 5GALA 4ASLA 3VBUA 3P3PA 1AXKA 2RMU3 1UL9A 1PMIA 4BQ1A 1OHFA 2XVGA 1I6XA 5I91A 1AJOA 4DQAA 2D43A 4K21A 5CG9A 5J7MA 3EBRA 3CEWA 2YDEA 3RZZA 1FYUA 2HWF1 2JE9A 1B35A 1NCRC 3CJIB 3EHKA 4FPJA 5CVRA 4AVTA 4CRQA 5FOJB 1OFNA 3WR0A 4AI2A 1ULCA 5JOZA 4DS0A 1HV1A 2DFCA 4AHZA 4Q8KA 2ZJCA 3VBSA 1YFWA 3FFQA 3WP3A 4XIOA 4FP3A 3ME2A 2ZPXA 1UZYA 3M2MA 3SCHA 2BTVC 4FOQA 1IZ3A 1AL23 1V6KA 4GULA 1AYM1 1WLTA 2B45X 1QNYA 4Q0PA 2ZGUA 2IXKA 2DFBA 1X82A 2D93A 2BUKA 3ZFEB 3VKNA 3O12A 5T5LA 2QQPA 2A6WA 3GNEA 2JKBA 2XGXA 3M3OA 4G3YC 1UU5A 1VBD2 2R071 2B39A 4KWKA 5BNNB 3PJYA 4EWDA 2F6BA 4YVSC 5GKAC 5IK8A 3OY8A 2DVAA 1BYHA 1ZREA 2XL7A 5BV6A 2WLPA 1I3HA 2I74A 4Q4W2 4XXPA 1MVEA 2IXJA 1YHFA 1DU3D 3MW3A 4KWLA 2NM1A 4MGYE 5CA6A 1D4M3 1WMFA 3TAYA 3ZXDA 4COWA 1FOD1 4WZCA 1XNBA 1HXS3 4XPVA 2ZOEB 1N1YA 1EPZA 5IK7A 3SCGA 5DG2A 4XF0A 2VQAA 1HKDA 1WUVA 3WP6A 2JG9A 1QF3A 4I3GA 5T5PA 3MZHA 2JG9B 3BOPA 4OLLA 3K48A 3FUQA 4XJAA 2Q30A 2GN7A 3IIAA 1LB2A