1XNDA

High-resolution structures of xylanases from b. circulans and t. harzianum identify a new folding pattern and implications for the atomic basis of the catalysis
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
190
Chain Sequence
QTIGPGTGYSNGYYYSYWNDGHAGVTYTNGGGGSFTVNWSNSGNFVAGKGWQPGTKNKVINFSGSYNPNGNSYLSIYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWASHGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycosidase
molecule keywords XYLANASE
publication title High-Resolution Structures of Xylanases from B. Circulans and T. Harzianum Identify a New Folding Pattern and Implications for the Atomic Basis of the Catalysis
rcsb
source organism Hypocrea lixii
total genus 54
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1994-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xndA00
3B5LB 3RI8A 1H8VA 2F6BA 3AKPA 2B42B 2BW8A 1HV0A 1XYNA 4XQ4A 1BVVA 3WT3A 2DCJA 1H4GA 3AKRA 3EXUA 3RI9A 1OA2A 4XQWA 1KS5A 2DCKA 3VZMA 2DCYA 3WR0A 3VZOA 1TE1B 3VGIA 1HV1A 1NLRA 1XNDA 2Z79A 1M4WA 4HKWA 4S2HA 1OA4A 3O7OA 3VLBB 4HKOA 3WP4A 3HD8B 2D98A 3AMNA 3VHPA 1REDA 2DFCA 3MF9A 2QZ3A 2VULA 3WQ7A 2QZ2A 3WP6A 2C1FA 4NPRA 3MFCA 3LGRA 1UKRA 5EJ3A 1REFA 3AKQA 4H7MA 3AMQA 3VZNA 1H0BA 3VZLA 2VGDA 1XNCA 4XPVA 1H4HA 1OLQA 4S2FA 3AMMA 2B46X 2NQYA 1HIXA 4IXLA 2DCZA 4S2DA 2B45X 1XXNA 4XQDA 2BWAA 5K9YA 4S2GA 3VL8A 2JICA 1QH6A 3MF6A 1YNAA 1H1AA 1BCXA 1W2UA 2VG9A 2JENA 1REEA 3WY6A 2D97A 1XNBA 5HXVA 1T6GC 1AXKA 3LB9A 5K7PA 1C5IA 2BWCA 4HK8A 1BK1A 3AMHA 1ENXA 1OLRA 2NLRA 2VUJA 1QH7A 3WP3A 3M4FA 1KS4A 3ZSEA 3VHOA 2BVVA 3AKTA 3WP5A 3VZJA 4HKLA 3VL9A 2DFBA 1UU4A 1XYPA 1OA3A 2JEMA 1IGOA 3AKSA 3WQ1A 3VHNA 3WXPA 3AMPA 3B7MA 3MFAA 1UU5A 1UU6A 1C5HA 1PVXA 1XYOA 1XNKA 3WQ0A 3VZKA 4HK9A 3WX5A 1F5JA
chains in the Genus database with same CATH superfamily
2XB6C 1LTEA 3U75A 4KNCA 2WT2A 5FUIA 1N1YA 1HJGA 4CU7A 4JGYC 2VH9A 3RNSA 2VUDA 3HT2A 1PMJX 2NM1A 3WG2A 3WNKA 1ZRFA 2W1WA 3OCPA 5C70A 5C3QA 2HBUA 4I3GA 3OBRA 3DEMA 2YBSA 3DPRC 1TZOA 3FUOA 3VZMA 5C7GA 3K75B 1EV11 3OJBA 5HXMA 4IEWA 1ZZ6A 1IS6A 1EAH2 1MS3A 4LITA 1UWWA 2GSYA 4Q1RA 1UW8A 4MGQA 5DUWA 5BNOC 4S2HA 3JUUA 4BLJA 3R0RA 1MZEA 4OUMA 5LEKA 4YVWC 3WUDA 2E53A 4Y22A 3VKFC 2Q8OA 1YCIA 3LIGA 4Q4X1 5IK7A 3U4SA 1W9FA 4WM8A 2WFPA 2W1QA 1CWPA 3LSEA 2CV6A 3DKQA 4NPRA 2JD4A 1CX4A 2UYAA 5BPXA 2FDIA 3PU8A 5BNPA 1V9U1 1WUVA 5IVYA 2VNOA 3AP9A 1IPSA 3ZM8A 4XFIA 1XNAA 1YQ5A 4RR3A 2IUWA 2VTFA 5GLUA 5C6CA 4LUKA 1J58A 3ZLIA 5JDBA 3A4UA 5F2SA 3ZFGC 5CG9A 4HZFA 2ENRA 2QNKA 1PO12 3SH5A 4FBFA 3GZTB 4LR4A 3MYXA 3NMBA 3ZO0B 2VQTA 1QOSA 4FOQA 4FFFA 1S0JA 1QJU1 3AZXA 3ZXDA 3OPTA 3IB3A 4CDQA 2YB7A 1Q5OA 1MS0A 2JG8C 4XMIA 1WW6A 5FXVA 2WZ8A 2OS2A 1A78A 4LHNA 5FYMA 3CMGA 3TBDA 5HV0A 4AHZA 1S2BA 5T5LA 2FBEA 3LEMA 2ZX1A 3GHMA 4OMCA 1UY4A 2GALA 1LOBA 4A6SA 3HMYA 3QOPA 4B1MA 1W28A 4M3CB 4P14A 2WZR2 2ZGLA 2DUOA 4QAWA 3ZKYA 5K7PA 4JC1A 4A7KA 1HRV2 2A6XA 5A7SA 1RC6A 3WNOA 2MEV3 1RL3A 4E4ZA 3CF6E 4GWJA 1RB8G 1ENXA 1UO9A 1UIJA 1VBB3 1UL9A 2RDSA 4FPLA 3WD5A 4LO8A 3PVEA 1JMUB 2RS53 1VIWB 2O8QA 3CBNA 1FPN1 5J1XA 3WF2A 1YRZA 1QWRA 3H8OA 3WDTA 2YMZA 2HWE3 5C4WB 1B35B 3RZKA 3ABZA 3I2GA 4CZSA 2BRTA 2ZTNA 3DXTA 2UWAA 1ND2B 2WINB 4E4SA 3AKSA 2WNVC 3VHNA 2K9ZA 2JDAA 1F5FA 4PIXA 3IMMA 3CJXA 1RMU2 5CFCA 4WZCA 5CA6A 1LHUA 4AI3A 1Y7BA 2D93A 2A3WA 3VBHC 3ACHA 4LTAA 5EZWA 5I0UA 2P6CA 4FPEA 4JKKA 1W6QB 1TME2 3B5LB 4HFSA 1GZTA 2G4IA 2EIDA 2VBBA 3KVBA 4CUGA 1E5HA 2ZEXA 2XR4A 4YGEA 4TSVA 5EWSA 3WQBA 4XTPA 2YC4A 1KD7A 3GXUA 2QQOA 3LEIA 2JDPA 3HQRA 1I3HA 1UOBA 2ARAA 2CAUA 2B8MA 2JG9A 3FMGA 3I54A 3A0KA 3CZJA 3O14A 4HPKA 5M0TA 2GN3A 3M70A 3KZ4C 3N9OA 3PIGA 2R073 3W59A 2WNUB 4QX8A 3ZYHA 4AEDA 4WBBA 3LPGA 3ZFEC 4XW3A 1OA4A 2FMDA 2PLV1 2UU8A 2OVUA 1AR61 2W1UA 3N36A 3EB7A 3FLRA 4XCBA 1SCRA 3M3QA 2C24A 4AFAA 3AMNA 1PM7A 1REDA 4J1XA 1MZ5A 4PQ9A 3MF9A 4P5HA 4ZU5A 2R6QA 1C57A 1N3QA 2ZKNA 2V4AA 4OUSA 5FP8A 3UL2A 5DMYA 4AHXA 3NNJA 3J7LA 4A7YA 1W6NA 3FN9A 4GJYA 5CKQA 2GMMA 3RVHA 3SH3A 4DIQA 4EROA 5IVJA 1REFA 1XRUA 3KF5A 4Q4Y3 5FOBB 1URXA 2A6ZA 3AZWA 3D6EA 3TEYA 4LBQA 4AHWA 4GWNA 5FP9A 5LK5A 1QDOA 1G8WA 2BNMA 4HBNA 4Q2FA 3JQXA 4GB32 4WM8C 3MZHA 3B93A 1SFPA 3HAGA 1W2NA 4GH4A 5JPMB 2WS91 5BNPC 3BU0A 4Y5Z0 3LOIA 4FXKB 4IEOA 2F17A 5HBAA 5FZCA 3MIHA 5FZ0A 5AC93 4RR3C 4CEWB 2VTXJ 1WLTA 2Q0AA 1RUJ2 4QXKA 4EN6B 2HBTA 4MGKE 3OEBA 3WV6A 2VOTA 5FWJA 4B4RA 4LEJA 5FYCA 4GQ7A 4B1LA 1DQ0A 1KEXA 1GZWA 4B4QA 2WWJA 2NN8A 5FJKA 1XNBA 2V72A 1DQ5A 1CZVA 1T6GC 4CDQC 1WWYA 2EICA 1PGL1 1T6BX 1QOOA 1WMDA 5A7WB 1UQXA 2VOXA 2KA3A 3SEEA 2JWPA 4LBQD 4MOAA 5FIXA 5JOXA 3SCGA 3AL5A 4OI2A 4XHXA 3AZYA 3D4KA 4LPLA 1UCXA 2E33A 1CAVA 2W2IA 4XMAA 2CWSA 4UW4A 1Q43A 1DZTA 3OOXA 1HRI3 1LGCA 3LQCA 2R042 3VB9A 3KGZA 3RMYA 3CO2A 4IESA 2BVBA 2GMPA 3TAYA 2Q8CA 5JPNB 3QH7A 1IZ3A 5IK5A 2RR11 4BMBA 5BXXA 5FMBA 1S2KA 1PGL2 1IG0A 2VJXA 1D4M2 4NIHA 2HWF3 2DFBA 3PTRB 2VMGA 3ES1A 3VKLA 4A6OA 2BBVA 1OA3A 3HJRA 3KS7A 4AE2A 4AXOA 2XUEA 2RDQA 4PHZA 4HOOA 1PO23 2XJRA 4UFIA 4ZU7A 4O7XA 4G4FA 1N47A 3HT1A 4CXWA 1SLTA 5FKCA 3VZKA 5F3GA 4JGZB 3W20A 1C8M2 3DN7A 4JX0A 1UMZA 1H8TB 1VPHA 1SPPB 4GJZA 1R1ZA 5FZKA 4OFGA 3U11A 2H0VA 4IERA 1ASJ1 1BVVA 5FY9A 4QKNA 2H0BA 4B7EA 5FREA 2E51A 5CFCC 1VBA1 3JBG2 4NIDA 5JUVA 1GV9A 4BMEA 3MDPA 1ND3B 1J59A 5LA1A 2WDBA 1F4HA 4ISRA 4M0NA 4OQ8A 2GN7A 2ES3A 4I3PA 3AP6A 3GCXA 3I2JA 4W8JA 2GNMA 4K6BA 3FJSA 3J7MA 2I45A 4IEQA 2Q30A 2R16A 4KBZA 1AX2A 1POQA 2BGOA 5KXEA 3FHIB 3DUIA 2XPJA 2XBO2 2BTVC 5FMCA 4A41A 1VE0A 3HNMA 5JZGB 3V0AB 1O4TA 2K2SA 2JG9C 4MGTA 5I0SA 4HETA 1XB9A 2D98A 2X5IB 5JMOA 2IFRA 3I3QA 1TVGA 1WMEA 4IGQA 1ZZ8A 5CU1A 4AEDC 3W58A 1DBNA 2VOVA 3FFQA 4DINB 3RZMA 2VMCA 4YRDA 5DABA 4TZDA 3ASIA 3AYCA 3LWCA 1CAUB 1J1LA 4L8QA 3GZAA 1K12A 5FO9B 2R062 1NA1A 3VZNA 3SCHA 3POGA 4IV1A 4NRMA 5EJ1B 1DF0A 1W8UA 5L7OB 4Q29A 2ARXA 1FV3A 1GOFA 2J42A 5FYZA 2CU5A 4NROA 1PIV2 2HH9A 4RGAA 3AZZA 3LKJA 4IXLA 4YWAA 3L2YA 1BYHA 1XSQA 1WW4A 4BK5A 5LW9A 3NNMA 4AVBA 4BQ1A 1OUSA 3LF7A 1NXMA 1R64A 2ZX0A 1H1AA 5FXWA 1SBDA 1S0IA 1Y9MA 2YROA 1FMD3 3UJOA 2DURA 4AGVA 3H3LA 3J26N 4GH4C 1CIWA 1JOJA 3W5MA 4OMDA 4EWDA 1AVBA 1AXKA 1QU0A 1W9WA 4XDPA 1QJY3 4YW3A 4V1PA 4AQSA 2IXLA 4AVCA 5ACA2 1N3OA 4INDA 1DZQA 2IVIB 3AMHA 3CEWA 3RZGA 1ZNPA 1ENQA 3NL1A 1U5ZA 3CJIA 4QHBA 5LY1A 1CD3G 4EE2A 2NLRA 4QPWA 1QQP3 2W47A 5HCFA 4WM7B 1RYYA 5F1RA 4OI0A 2BNNA 4M3CE 3PTYA 5J3UA 4F7ZA 4XUQA 4BPZA 1DQ2A 1E5IA 3HWJA 1OH3A 1O5LA 1OBNA 1W8ZA 5GLVA 4C1WA 1WMFA 5FP4A 1Q3EA 1DGWA 1VJ2A 4L11A 1W90A 1F31A 4L99A 4U36A 1DIWA 2ZGTA 4CP9A 4Y3OA 1VBB1 3GNEA 4AI0A 4QKFA 2JDHA 5IK4A 2XL7A 2HEVF 1UU4A 4NN0A 2TNFA 4XXPA 4GWMA 2RS51 3JD73 2N7GA 5C33A 1OD3A 3WXPA 3E6BA 1M06G 4MXVA 2J1TA 2OKXA 1R083 5A6QA 1S1AA 2HWE1 3VBFA 1HKDA 1BBT3 2B39A 3ME2A 3B9IA 1Q8VA 4QPIA 1IG3A 2MPFA 4RHV3 3W21A 3ACFA 1A8DA 4LJHA 1SZBA 2DVBA 5DZGA 1FATA 3AZVA 4BHPA 3CHXA 3SXWA 3B94A 2VC9A 5FCCA 1U5IA 3Q8BA 1EUTA 4AGGA 1DFQA 5JXIA 1EV12 1MEC3 3FBMA 4FOWA 2B9VA 4V2VA 5L9BA 5ABJA 3WR0A 1UF2C 1W6MA 1TE1B 2W3JA 3VHRA 3MW3A 4JGYB 4XEZA 1JXNA 1UY1A 2A70A 4JDOA 4XAAA 2BQPA 3VDCA 1VLNA 3S6PA 4UF0A 4CCJA 1LESA 3MEPA 3VLBB 2TBVA 2VW2A 1RUE3 3FWEA 3K4DA 4P9WA 4H7LA 1VRBA 2R071 3DPRB 1MPXA 1UX6A 1W6OB 5F3IA 4Q4X2 1G6NA 3C7HA 4MV2A 1GWMA 2DFCA 4XUOA 3VN4A 4BLIA 4WVMA 1K5MA 3BYWA 1V6NA 1V9U2 1O8PA 4KL1A 5F8PA 4A45A 1DQ6A 2WIIB 2EIGA 4RGGA 3HNYM 4O9EA 3VBUA 2NP0A 2VZ1A 2EF6A 4YNIA 5I8SA 4YVWB 1FXZA 2XJSA 1IQDC 1H0BA 1DU3D 4YZ1A 2QKDA 2VW0A 4IE7A 3NV2A 2D6MA 2Z4FA 3OGVA 4QKDA 5E8AA 1PZ9A 3N9NA 1QJU2 3LSDA 1K5JA 1JZ2A 1V70A 2BV4A 3BPZA 1FNYA 3IAPA 3RYRA 3B02A 4CPBA 4GWIA 1R091 4LXLA 4Q4Y1 1NE6A 3MUY1 3WNLA 1PK6A 3CNAA 1NYWA 5F9TA 1GZ9A 1NA1C 4Y1ZA 1UZ0A 4S2GA 4XYXA 5FFOC 4NWWA 4IV1C 3ZFGB 4YZ5A 3VL8A 1LR5A 3GBWA 1VAKA 4YVSA 5GLZA 4Q0QA 1O91A 1GQGA 3FUQA 3LFMA 1YNAA 4QPGA 3M2MA 1AX0A 3N7JA 3OYWA 3WDVA 1EYBA 3LEGA 3BTAA 3I3DA 2Y6GA 5GKAC 3KV4A 4M4PA 2DTWA 5AC91 2Y6JA 3AXEA 1OT5A 1W2OA 2JG8B 3RPQA 1BEV3 1DQ1A 3AFKA 3KV6A 4B29A 1FT9A 1ONAA 5IUQA 3OD0A 2DTYA 3HEIA 2OPWA 1QKQA 3M3OA 5CZKA 4M0HA 3IAQA 3NV4A 1QH7A 4UFHA 5LA9A 3IIAA 4TXWA 5T5OA 3T1MA 1FPN2 4GA9A 5FZ6A 3ZYRA 3INAA 5F32A 2B9UA 3V64A 3VHOA 4M01A 1N1VA 5JSPA 3AK0A 4QX2A 1XNTA 4XOGA 5C3RA 1W9YA 1HB2A 4LIVA 5A3LA 1TMF2 3H1MA 3O5SA 4UI9L 3P1IA 4IEXA 3NWKA 4JKLA 3T4HB 2E26A 1HRI1 3FBYA 3J7NA 3UT0A 3CIHA 1C3HA 3A23A 2VOKA 2WJSA 3NRUA 4CDWA 2C4XA 1QOTA 2VCMA 3HVDA 1BMV2 1P8JA 4QU2A 4I0BA 1JODA 1PNFA 2HWF1 1UX7A 3WX5A 4BOWA 4R9BA 2HWB3 1F5JA 4I02A 3WDYA 4BXFA 4XUTA 3ZIXA 4M4RA 2XWJB 1PO21 4YLZA 4A3XA 2PHRA 4IDZA 2UWBA 4MGYE 3ZR5A 4Z1VA 3U1XA 1Q8PA 3IPVB 2WNVB 3PMSA 1RUOA 4DUVA 2P3IA 1H4GA 2OA2A 1WLWA 3AYAA 5LBEA 5F7UA 1GZCA 4HVOA 3VBFC 3VBHB 3ZDSA 1JUIA 2D3SA 4TN7A 2BUKA 3CKHA 5HI0A 3RMXA 3VGIA 3IBMA 5KHKA 4QPIC 4URAA 4FO9A 5A7NA 5J7MA 4TTGA 4CP2A 3I7DA 4LBLA 4HMZA 2PFWA 2PLV2 3UKTA 4A44A 2FDGA 1AR62 3FFZA 3TEWA 3PVOA 2JB8A 4C90A 1GICA 2E9QA 3B01A 2K0GA 3HOBA 1SDDB 4JKMA 5JXHA 3N7MA 5ABJC 4E2SA 3VD5A 1DGRN 3PL0A 2ZGKA 5F5IA 5A80A 3THDA 1AYM1 5EYXA 1RTVA 2R1BA 3THTA 3OEAA 2WNOA 5C5TA 4LOTA 3H9AA 3ZFEB 5EQUA 1NQJA 4DXTA 1MS8A 2YU1A 5CKNA 1LRHA 3WDXA 1S0EA 1TNRA 2FD8A 4XIOA 3RZZA 2WQ4A 2ZXQA 4NJ4A 3USUA 2IZWA 5A3WA 2GC3A 2JE7A 3AMMA 1K5MC 1RVF3 2NQYA 4R4ZA 2WS92 1I6XA 4CDUA 3WCRA 2EXJA 3NV1A 5K8SA 2PTMA 1YQ2A 5DDJ3 2FHRA 3BN6A 2J1EA 5FZOA 2QE3A 1BK0A 3UGHA 2VBPA 3VBUC 4KH9A 1BQPA 1UZWA 4Y22B 3LA7A 1HQWA 1QH6A 2O1QA 5FZMA 1WCUA 5T55A 4B8EA 3SEPA 4LHKA 5AFBA 4WM8B 2PAEA 1EPWA 3WOGA 2OT7A 3OBAA 4NPLA 1ACCA 1REEA 3M7AA 2QBXA 3PHMA 4Q0UA 2I07B 5DUVA 5BNPB 1GNYA 5AFEA 3V0BB 1PK6C 5C3PA 3GDBA 1OQEA 4G3YC 2D6KA 1UY0A 4ISQA 5BNQA 5I0DA 1G9AA 2ZGQA 2VXJA 5FY0A 3LA3A 5EV7A 1LOFA 2E31A 1FMD1 1OF3A 4GIQA 4Y26A 4YVSC 2NZ9A 4B4PA 4QPGC 5L9VA 3ZN4A 2WAAA 3WP3A 2RMU2 1MQTA 5LA2A 1J3PA 2VMIA 2XLAA 4LO6B 2ZHMA 3J7HA 3TOJA 1QJY1 5KR7A 2VZOA 4CVUA 4CDQB 3DYPA 1UPIA 2HEWF 2RR12 3U37A 5L19A 3AXDA 4E2GA 5FUNA 4D6QA 4W6WA 5A3NA 2W52A 1W8FA 4AFDA 1QQP1 1AR73 3B9CA 3WF1A 1O3RA 2W92A 4N53A 4DY5A 4QKBA 3WQ1A 3OY8A 2ETEA 4MHRA 3FE5A 3RQ0A 4ATFA 5J37A 1CAWA 5JOYA 2X29A 4IGOA 3ZDVA 4QDQA 3I8TA 1XE7A 4LO4B 4A7ZA 2XWBB 5FV3A 1RUC3 3W9AA 1JU4A 4LLOA 4O9GA 4UWDA 3JD71 4GKXA 4AL9A 1G7YA 5FPBA 4UBGA 1ASJ2 3RJRA 2Z2SB 1HQLA 2XHKA 2YFUA 1W06A 4DMIA 3S0MA 3O0VA 4XQ4A 5LWBA 3ILFA 4Q0PA 3THCA 4GALA 5I0RA 3MW4A 2VQUA 1BBT1 5EHDA 3A0NA 5FYYA 2YGMA 1SLIA 4RHV1 2HWD3 1W2AX 3RWNA 4AFCA 4BJ0A 4M3CF 3SQOA 4CCLA 4DZGA 2J1SA 3VZOA 1ZREA 4CP1A 4FTSA 3I4IA 3WF4A 1YIFA 3PUIA 4TYSA 3VKOA 3THPA 1OD5A 5IT6A 5FLHA 4KWJA 3OSDA 2DV9A 3OD4A 4GD4A 4N9IA 5C5UA 4ASKA 1QJX3 1VBA3 2RV9A 5E1RA 2AGSA 4CXXA 1WZXA 2YDEA 4QU1A 4DXZA 2ZMNA 4P02B 1PNGA 3ZSJA 1GKBA 3O1SA 1NLQA 4KU8A 1SMVA 2PHTA 2R1DA 3WP6A 1I9RA 4DO0A 2D6LX 2CGOA 5FZ3A 3VKNA 1JI6A 1RUE1 1QXJA 1WA4A 5GM0A 2ZAHA 1PMHX 2LW8A 5JOZA 1SACA 2JG9B 1VB4A 4IV3A 1OVSA 4HPKB 1ZBE3 3KLSA 4QQHA 3A21A 4SLIA 5D2AA 2D3PA 4GMP0 5T50A 2R7EB 2ZGMA 1RJ8A 3WG3A 5CADA 2VO5A 1AR83 3EYPA 1GP5A 3IKWA 4P9LA 1AJOA 2KD7A 1XXNA 4HANA 3BIWE 3KQRA 2XJUA 3MIDA 5A7OA 4A3ZA 4MXWA 1LCLA 4Q27A 1F35A 2P17A 4LKSA 4UYBA 4YW1A 1S0GA 3HN3A 5IW0A 3QH6A 5G04L 3ZIWA 5FPUA 1BCXA 1VBD3 4Y20A 4CDUC 2Y6FA 1W6NB 3GALA 4AF9A 5BY5A 5HXVA 4E9KA 3P6BA 4R4XA 3EBRA 2OUJA 4XETA 1H6XA 2NMNA 3ES4A 1BXHA 1WKYA 4LBQB 4PF1A 5IAVA 4Q8KA 2RJKA 3MIBA 4Y5SA 4AVTA 2LTNA 2QQIA 2JKXA 1WW7A 2EXHA 2GNTA 3HN1A 4W65A 5FR3A 3OUHA 1KFXL 4R8HA 3WSOA 2E7QA 3LAGA 2MEV2 4MX3A 4NHYA 1ST8A 1DYPA 4GH4B 5EPAA 5J36A 1BEV1 1Z78A 4FP3A 2Z42A 1VBB2 4RQPA 1GMMA 3EO6A 1OPOA 1Q8SA 2HYXA 2ZEWA 4IW3A 2WZEA 5ERLA 3R4UA 5FZ8A 2RS52 3ZXKA 1JZ7A 5ANNA 3IMNA 3J4UH 1XYPA 3LE0A 1LOFC 4AVSA 1V0AA 1NCRC 2JEMA 3A22A 4L2NA 4OI1A 4FPKA 4DXSA 2MNGA 3F95A 4ZY9A 1MQTC 5F5CA 4E27A 1JZ3A 1ZYBA 1RINA 2HWE2 5JR7B 3LIHA 4IEUA 5EP9A 2JDNA 3VBOA 4IUGA 2W68A 1TG7A 2XJTA 1PVXA 2ZMLA 3E5XA 4PJYA 4FFGA 1G9CA 2OW4A 2ZPXA 5D8AA 2XG3A 1GLHA 4KGQA 4NE9A 4O65A 1QMJA 3VBSA 3VDBA 1ZX5A 5FWEA 5I91A 1RUI3 4JZRA 1GNHA 4PI2A 2F6BA 4OQ9A 1XU2A 1CAVB 2WT0A 4FCAA 4N53C 5FY5A 3VDDA 4J1WA 2ARCA 1DGLA 5C8CA 3N4MA 2HWB1 4XQWA 1H2NA 4R9DA 5FJHA 5FYBA 3DYOA 3KHCA 1SEFA 2D44A 5FPAA 3R05A 3WINE 1IOAA 2AEZA 4KG0A 3WF3A 1HXS3 1QXRA 4CP0A 1SDWA 1RUF3 5IYYA 1LGBA 1HB4A 2R072 2VZ3A 4YG3A 3WW1A 2V5DA 4UFLA 4QD2A 3OGGA 5JIAA 4GXLA 2VECA 1PX4A 4P5YA 3O1UA 1IPJA 1US2A 2DVAA 2G1MA 2QZ3A 5A6XA 2XJVA 5F6KA 2J1RA 2VY0A 2IVJA 4JDNA 3O1OA 1X50A 3H42B 1W0OA 3PDQA 3TEXA 5C9AC 5FZFA 1ZRIA 4AHYA 1D2SA 3PUHA 2ZHNA 4CDWC 5LEJA 3TYJA 2VU9A 2AZ5A 1UAIA 2VGDA 2VNGA 3I3BA 4QGNA 5FYSA 1XNCA 5A3PA 4LIUA 4XPVA 3I2DA 1XU1A 2ATFA 4IE5A 3DF0A 3AJZA 1R092 2B46X 2JX9A 1FV2A 4Q4Y2 3GM8A 3ILNA 3NNFA 3W5NA 1VRH1 5FZBA 2ZHLA 4K1ZA 4OUEA 5FBZA 4FPYA 4NIIA 4XABA 2DF7A 3NJXA 3D82A 4Q8LA 2D3RA 1Y4WA 3ZN6A 1X82A 2PYTA 3OTFA 3WNNA 3NJZA 3POJA 3ATGA 3ECQA 2NPIA 3VD7A 5BUVA 3AFGA 3MPPG 2MHFA 5IFPA 3AP5A 3JU9A 3I59A 4IV3C 1ZZ7A 2VNVA 1RVF1 2JICA 3N9MA 4KWLA 5F3EA 1LHNA 3UV9A 1DYOA 2Y0OA 1UYPA 3ENRA 5DDJ1 1GANA 1AF9A 1W0PA 1OC1A 2VG9A 1VB2A 1POV0 5AC92 2JENA 1UOJA 1LOCA 4K40A 4NIAA 1R093 1UZYA 2XONA 5FZIA 4ARXA 4BQ3A 3BTZA 4OZXA 4FAGA 1OKOA 3IDEA 2IXJA 1NA1B 1F4AA 3WCSA 1CQ9A 5GZCA 3KT4A 4IV1B 4ZHNA 4FOYA 1EP0A 4NPMA 2QQMA 1FOD3 3N9LA 2D7FA 1VBC1 3OB8A 2A3YA 1Q8OA 2HWC3 1UZZA 2WFF3 2VZUA 1KS4A 2W46A 3AYEA 4I0WB 3BI3A 3AP4A 4OYUA 4COUA 2E6VA 2L9LA 3L2HA 4AQ2A 2UURA 2WN2A 1K42A 4BDVB 3KV5A 3IDAA 5FZLA 4JTNA 2BFUL 1HRI2 1V6KA 1L7LA 4PIZA 5FZ4A 1QHDA 1SFNA 3ACLA 3NVCA 1NUKA 4JVAA 4UFMA 1NG0A 1AYN3 5KXDA 2HWF2 2V4VA 1OURA 3UNPA 1OLMA 2LM3A 4RQPC 4K7JA 1DZRA 2Z5WA 1AR71 3ZN5A 1PO22 3PURA 1AR91 2YPJA 3KCXA 1J1TA 1DG6A 3KM5A 3KWVA 4P9JA 2VVFA 4RA0A 1JYXA 1YFYA 5K4LA 3S5QA 4D69A 5B4XA 2QUOA 3I2HA 4JRAA 1AX1A 1SLAA 3AKRA 3U07A 3TRSB 3BIEA 1RUC1 2AREA 4AAPA 3RSJA 3AYDA 2A71A 3ZFFA 3BTYA 2XQXA 5D8AC 1XQNA 4OHZA 4AI1A 1ZM1A 1WBLA 3VBSC 5DAWA 1B09A 4ARYA 2WNEA 1H2LA 1NLRA 2XVLA 2GP3A 3PUAA 5T5JA 3VDDC 2A75A 3PVNA 1IPKA 4LNVA 3ZYBA 1VMFA 5JOWA 1HQNA 4Q4W3 5C8CC 2HWD1 1UYXA 3VBRA 3ETPA 4EWAA 1GOHA 5EJZB 3DECA 4NMIA 5FAXA 3VBFB 4QB6A 5FYTA 4D0QA 2DUPA 3NAPA 1LNSA 3H3UA 2XHNA 3PJYA 5A3UA 4Q4V3 3VD4A 4FPGA 1X7NA 2WO7A 2ZAAA 3LDBA 2Z69A 2DWRA 1QNWA 3VKMA 2WT1A 3LPFA 1QJX1 4YM3A 5F5AA 1UKRA 3Q8EA 1COV1 1HDKA 4EWEA 1GU3A 2WYFA 2W87A 1F8VA 2Y6HA 3PMEA 2Y60A 1W6MB 3NNLA 1OLQA 1HLCA 1L7RA 1W6QA 5KHIA 1AYM3 3AC0A 3K4AA 1VP6A 2RJ2A 1IKPA 4W6XA 3ZSLA 1MVQA 2SLIA 2R0HA 5CFDB 2JE8A 3AVRA 3URFA 4UF0B 4K21A 4AOCA 4R9AA 2B5HA 4ORFA 1ZBE1 4F3JA 2P5BA 4LOSA 3MLKA 4Y1UA 4ZS3A 3QCWA 3EJKA 1AR81 5JSRA 1GSLA 3MF6A 4R52A 4XJAA 4FI9A 3NW4A 1K5MB 2DVFA 2DBNA 3APBA 3NQHA 4GULA 3E6CC 4YW6A 1SLCA 2CSGA 2XVKA 3NSTA 5JSOA 4YW7A 4F83A 5FZ1A 2VTXA 4NRPA 1G86A 3CU7A 4AAXA 3ACIA 3N9QA 1WD3A 4YGCA 1CPNA 3CDZB 4MGSA 2YHJA 1FMD2 2Q8EA 4L92A 5LASA 4JRLA 2X09A 1VBD1 2XKOA 4HVRA 5JXJA 3RZLA 4WVZA 1IHMA 1UY2A 3P3PA 2VXRA 1AL21 2GDFA 1UIKA 1QJY2 3Q9OA 4BIOA 4AQ6A 1SHWB 1OXCA 4Y1YA 5DXDA 1PK6B 3WP5A 3KMHA 2OIIA 4PBPA 1QQP2 3PU3A 4XAEA 1JOBA 4LKFA 1GWKA 3SC7X 5DQ0A 1FI2A 1XPWA 2VZSA 3CLPA 3TB0A 3I2KA 1WW5A 1GQHA 4YVSB 4BM8A 3SKJE 4QPGB 2DU1A 5HCAA 3HBKA 1JYNA 1OFNA 5B4NA 4N43A 4BXSV 2ZX2A 3KHBA 1JZ4A 4LKEA 2ZEYA 3ALQA 5FY8A 1PHMA 2J7MA 4TWTA 3NKTA 1XYOA 3PJQA 5H9SA 3JD72 1QJZA 2VE1A 3WQ0A 1D7PM 3BB6A 2XXZA 4HSLA 3WDWA 1R082 3ZVXA 3AP7A 1PVC3 2JXAA 4PDWB 1O8SA 2B42B 4HN0A 1NE4A 1XYNA 2JDYA 3T0DA 1O4YA 1BBT2 2VR4A 4QXHA 3N7KA 3ON7A 1W05A 1YIPA 1OH4A 1YO8A 3FLPA 1OA2A 2R32A 4GKYA 4NHXA 4RHV2 5FDBA 5JIUA 1SBFA 4LHLA 3B00A 1ULPA 3H0OA 4DUWA 1RUI1 4XIKA 5C3OA 4XFBA 5DUXA 2WWUA 5J09A 1ULFA 1RUH3 2DUQA 3S5AA 2VL4A 2E63A 4ZXKA 1E57A 5A3TA 2RS13 1MEC2 1ZZBA 1CAXA 4HKWA 3H8XA 1DGRA 1JZ6A 4FQ4A 4GZ9A 4XJ9A 4Y1VA 1W8HA 1X8EA 4EN8B 2QCSB 4LUMA 5J98B 3SMHA 2FDHA 3ZFFC 1XOYA 1G9FA 3VHPA 1ULCA 2FCTA 2JIGA 1HXS1 1F15A 3RJ2X 5L73A 1RUE2 5AVPA 1RUF1 2Q5TA 4MUVA 2RM23 2R49A 3FHAA 4ZU4A 1LHWA 2ZZQA 4UFJA 4PCRA 5IVVA 5KWRA 1MR5A 5EJ3A 2LROA 2ZX3A 3POBA 3VBRC 4H7MA 4E4DX 1YQ8A 1YYNA 4YGDA 5D21A 3E5UA 1DLCA 4CCMA 3H7JA 3NAPC 3WW2A 2XLFA 2HLEA 1HRV1 1PGW1 1C8NA 2QQKA 4S2FA 4EN9B 1JH5A 2EA7A 3TN93 3B3QE 3WNPA 4ONUA 1UXXX 5LB6A 2ZZJA 4HG6B 2JD9A 4P08A 5LCWL 1ZBA3 1Y43B 4P00B 4BQ2A 2PELA 5F3CA 1O4ZA 1VAMA 1TNFA 5DZEA 5BNOB 1UN1A 3N7LA 4D7SA 3F2ZA 2WKKA 2XUMA 1ODMA 1WLDA 4DUXA 1UPSA 1OKQA 4XVHA 4YFWA 1C1FA 5A1AA 2VQAA 2D6NA 1WA6X 2VM9A 3USUB 3U14A 1W3XA 4BWOA 3ROUA 4OHVA 4BQ4A 3QBQA 2C5DA 1XE0A 4JHZA 4XJWA 5LRSA 1BEV2 4CDUB 3T2OA 2W95A 4BCUA 3GYDA 3J8F3 3ZSEA 3DKWA 4YGBA 1S2EA 3D8CA 3O0WA 1EPZA 5FZOB 1T2XA 5FZHA 5BYNA 1YI7A 2RDNA 1FOD1 3DV8A 2QFEA 2QQWA 2KR2A 1YC61 4UAPA 3VL9A 4FAHA 2HWC1 2P1BA 2WFF1 4NUBA 4MADA 3ZXLA 5HPOA 1CZTA 2PHUA 3BALA 3K46A 4CU8A 1UU5A 3KQ4B 4D6RA 4LO5B 1JW6A 5KBFA 4OVEA 4QHZA 1X36A 1SCSA 1SG3A 2YFZA 1G9DA 1RUD3 3MO4A 3E1F1 2DBIA 2X8KA 1FAYA 1NCRB 4KMQA 1AYN1 2WLPA 4J6GA 4N43C 1MQTB 5CAZA 3WT3A 4CU6A 2HWB2 4UW5A 5IK8A 4YZ2A 2F4PA 1YQ6A 4XTMA 1E5RA 5F39A 1H30A 4QQOA 3UETA 4YZ4A 1AXYA 1APNA 2Q1ZB 5CIRA 4BE3A 1W04A 1RXFA 4AVVA 1LAJA 3CJIC 3K4ZA 3NJYA 2JDKA 2A1XA 5A3OA 1RHI3 2DVDA 4W50A 4IQPA 3MIFA 4DQAA 2CGNA 5HCHA 3FHQA 1DHKB 2FMYA 3AVSA 4N53B 2Z79A 5LBBA 1KITA 3OY8B 4WM7A 4AQTA 4AW7A 1CAWB 1S0DA 2AYHA 4CDXA 4COVA 3OBZA 4A2UA 3GHNA 4EV0A 1Y9QA 4QQLA 2IXIA 2DCTA 4I09A 2VCCA 1MVEA 3AX4A 2H6CA 4HONA 4XBLA 2YG0A 1WGPA 5A6YA 3GF6A 1QNYA 4Q4W1 3WW4A 5CISA 2EAAA 2QQPA 1AXZA 3POFA 1OPMA 5A1FA 4NAOA 2ZGRA 4UOJA 3LFIA 4YM0A 5K0UA 2JDUA 5LBCA 4ZZ8A 3P5BA 2IFWA 3POEA 1YQCA 3D5OA 1YJLA 4AR2A 1ENRA 4NVPA 1KFUL 4Q4V1 4CU9A 5IFTA 4CCOA 1HB1A 3KSCA 4ITCA 1RUG3 1CN1A 1R1A3 4LA3A 3S30A 4COWA 1O59A 3BUCA 2B4KA 1VRH2 4QX3A 5FPXA 3D3AA 4CCNA 4YW4A 2B45X 2WSUA 2AEYA 2ET7A 4EZ4A 5C9AB 3S57A 4XJZA 1O3TA 2Y34A 1RVF2 2BWAA 5SV5A 2ERFA 4CDWB 1OFSA 2CAVA 3ILRA 3POYA 1FX5A 5DDJ2 1RXGA 3WG1A 2BERA 1WMXA 5J96B 4OULA 5C8WA 4M00A 4XFCA 4NO4A 5KHGA 3JQWA 5DAPA 4CYDA 1VRH3 1MZFA 5DAQA 5GZDA 4EYUA 3RZHA 3VV1A 5JI9A 4CEYA 2VZVA 5CG8A 5A32A 2RHPA 3ST7A 5ANQA 1QEXA 4IV3B 3OBTA 4B7KA 5FYIA 1YFWA 2ZA9A 2WYSA 3MHZA 3AM2A 1UY3A 1OLRA 1W6PA 3M1HA 4Z92B 2BGCA 3RYKA 5DG1A 2YYOA 1VR3A 2EIBA 2QQJA 2GH2A 2JE9A 1D0HA 1MZ6A 1HB3A 2D40A 4LQRA 3X29B 2OYZA 4MG2A 2HKXA 4AG4A 3G7DA 2RDRA 4Y4RA 4MXWB 1C4RA 2EVXA 4RFRB 1ULOA 2CYFA 5CB7A 3WHTA 4Z2AA 2YBKA 3BKZA 2R30A 2K46A 2CDOA 4Y20B 1VBC3 2VNRA 3B7MA 2Q1FA 1KGYA 5I0TA 5BNNA 1UU6A 3BPSA 5KC5A 2HEYF 3PLQA 4YM1A 1O3QA 1LULA 1AR72 3H7YA 4RR3B 3IZOA 3IWZA 4Q5OA 2VCAA 5JVVA 5FQ0A 1VBE3 5FRAA 2ZEZA 3LA2A 2UY9A 3BGAA 4RGKA 5IVCA 3JCIA 1NLSA 2WA4A 4XE9A 3H3ZA 1UXZA 2PHWA 2C0ZA 3HIFA 1RUC2 1AUYA 3NJVA 4N7IA 4QX5A 5FMDA 1RJ7A 1OVPA 4RQPB 2WWSA 3SKVA 4HT1T 4Y33A 5L9RA 1PZ7A 1PVC1 1LENA 3M3EA 2G9FA 3ITQA 4RN5A 4D7TA 2WL1A 2E7TA 3OGRA 1AR93 4IEPA 2P37A 5GLWA 4HN1A 2W1SA 2WSVA 1CPMA 2RS33 1C1LA 3ZYPA 4E2QA 4C0BA 2HWD2 1ZVFA 2IC1A 1SFYA 3ZXEA 2ORXA 2W9XA 1Y3TA 2P4EA 4HKOA 3WDUA 1K3IA 1W8NA 3B69A 1GP4A 1BHGA 1RUH1 3GBGA 1HW5A 4R9CA 2VCBA 5D8AB 2J1AA 2SBAA 1OHFA 1JHJA 2RS11 3MGUA 4NHLA 4NHMA 4NRQA 3VBSB 4Z2WA 4CCDA 2EIEA 3T2PA 3O1RA 1QJX2 1VBA2 2QZ2A 3WQ7A 1Y9GA 3DL3A 1AHSA 2VZRA 5FO7B 4WM7C 4O61A 4CSWA 1G9BA 3TWIA 4CDXC 4CUAA 2YC2A 5JLVA 5KHJA 2ZBJA 5FMOL 1EY2A 4U2AA 4A42A 1UYZA 2V5YA 3POIA 1MS1A 4IL7A 4MVTA 2A6WA 5KHHA 2RM21 4MO3M 1LEDA 3I2IA 1RUNA 4NAMA 2GZWA 4GAZA 4WVWA 1HIXA 1X9TA 4F8AA 5CFCB 5JWPA 4XFAA 1ZBE2 1D0GA 2VOWA 5FYVA 2GC0A 4GMP3 5K0UC 4OLLA 2A6VA 1AR82 1COV3 1J84A 4AFBA 2C9KA 1GR3A 1LEMA 2KM2A 4CUCA 3TN91 1QF3A 2YBPA 3JB8A 2ADEA 2VQ0A 3SISA 3RZJA 4HVQA 1Z7S3 2X10A 2GMEA 1QXPA 3WY6A 1V00A 1X9PA 1ZBA1 3OUIA 2O14A 2LS6A 2VPVA 1VBD2 4MGZE 1PZ8A 2PQSA 3ZYIB 2H6BA 2UY8A 5FBJA 1GNZA 1JZ8A 2P2KA 3PIJA 4AEDB 2FQPA 1H1IA 2FDJA 1VAVA 1A8MA 3K51A 3MIEA 3ZYGA 2VUAA 5I8YA 3ZFEA 1S0CA 2Y64A 3OGSA 3ZN6B 4AK3A 4YARA 3U4XA 1V6LA 3ZYFA 1NCQA 4CEYC 2BP6A 1UD1A 2PHXA 4WZFA 1Q56A 2ILMA 3I59B 3MLJA 2B7YA 1QGLA 4TLFA 4DFSA 3CL1A 3D0SA 3J8F1 3FX3A 4I01A 4BU2A 1AL23 4CE8A 4QXCA 2WLQA 2WQ8A 5FY4A 4AGRA 3WG4A 4QB1A 1W2TA 1UMIA 4PT6A 3R4SA 1SLLA 2FDKA 4HK9A 2Y0IA 1IQAA 4LA2A 1H8VA 3K3NA 5T52A 2W08A 2BDRA 1LU1A 2YPDA 4QDRA 5GJ6A 4OCTA 2Y26A 2DCJA 4K8RB 1UKGA 4FT8A 5BNNC 1O3SA 3H8RA 1V6JA 1CX1A 1RUI2 1EAH3 1NOVA 2RVAA 3V0BA 1RUD1 4LK7A 4MYEA 3TNPB 4A4AA 4XUPA 2D6OX 2HYKA 2DCYA 5TSWA 3HQXA 2VZTA 5CYYA 4MH0E 1W03A 1HV1A 2CHHA 2XJQA 5E16A 1GZWB 1W39A 1O5UA 1YEWA 2QVSB 4EN0A 3MIGA 3U78A 2FCUA 3UKNA 1AJKA 3T2TA 2O0OA 3HR9A 1WCKA 4ASLA 1LOGA 3WP4A 1RHI1 2C6SA 3U10A 1HXS2 3P3NA 2PXJA 1RUF2 5JI7A 2Y38A 1XC6A 4QHOA 5G05L 4J25A 2XVGA 2ZGSA 4PLOA 4D6SA 1PO13 2P3JA 3LEKA 4C1XA 4C0HA 5HV4A 1PM4A 2QDNA 4E8DA 2ZMKA 1LOEA 2XJPA 1S55A 2PHFA 3ZFFB 1PGW2 4OI4A 1D4VB 4Y4YA 3RS6A 4XXAA 1OOPA 3UESA 1WCQA 3USSA 1H4HA 3UK9A 3LDRA 2CNAA 2FCVA 2W0XA 1W0NA 2IXCA 4L97A 3T09A 1WLCA 4YM2A 2IWGB 2JJ6A 2DCZA 1JTZX 5JCTA 4XC9A 4C8DA 4XILA 1HJFA 5CVRA 1LOAA 2A7AA 1JBCA 3VBRB 1RUG1 1R1A1 1KJRA 1CR7A 3NAPB 4QX0A 2RE9A 2WZR3 1U0AA 4N7UA 5GZGA 1ULDA 1HRV3 1DP0A 1V6MA 1W2UA 2VVDA 5A33A 4QQPA 3DCQA 1TMF1 3BOWA 5EXOA 4K9SA 3UYJA 4UW6A 5AVAA 2BEOA 5CEHA 1GBGA 3LB9A 2QQLA 4RS5A 2BJSA 1LECA 1C5IA 2DDUA 1F9KA 1YJKA 4IGPA 4N8MA 4RD7A 1BMV1 1POV3 1MS9A 3OGJA 2RJLA 2C9AA 2VUCA 4LLFA 5FP3A 3M3CA 5HCBA 1AL0G 3WF0A 2KXLA 4META 3C7FA 2AACA 4MZUA 4Q26A 4FP2A 4XF0A 4XDOA 4XUNA 5GLTA 3MLLA 5A7QA 1K45A 2BVVA 1H6YA 5DAVA 1FOD2 1KJLA 3V65A 2HWC2 2WFF2 1RITA 2Y8KA 4HKLA 1RMU3 4COYA 5JZGA 5EYYA 4FPFA 1BZWA 1O6UA 3MW2A 4XFFA 3T2QA 3I3EA 4BK4A 4HSJA 3OUJA 2XLGA 3T4VA 1TME3 2YGLA 4Z07A 2QDRA 1VMJA 3FL7A 4KI5M 5KXBA 1J3RA 4TLGA 1H2MA 1XNKA 2D5HA 1CJDA 3U0ZA 4EJRA 1NCQC 4CXYA 4BISA 1W3VA 3LD8A 1AYN2 1YHFA 2VBDA 4JTOA 1D2QA 3JXSA 2GNBA 2O8OA 1VALA 4PI0A 2WBKA 2Y33A 2OX0A 5FZEA 2J22A 5T3NA 2BZDA 3EXUA 4D8MA 5A1LA 3AL6A 1VBE1 2X05A 2W39A 2VMHA 1CZSA 4YZ3A 2XDVA 3H50A 3SLIA 4Y5TA 1OI6A 5LA0A 4JQTA 4YFZA 5J48A 3KD4A 2J1UA 2ZJCA 4N43B 5IVFA 5IAXA 4X6RB 3KGLA 3E97A 1A3KA 2VZPA 4XBQA 3VUOA 4PLNA 4I2OA 5DZFA 3KB5A 5EFUA 4IE0A 3LCPA 2ADDA 3T3YA 2BOIA 2E32A 1XBFA 2V73A 4LT5A 2BYVE 3CJIB 3DXUA 2CGPA 3BU7A 1ODNA 2RS31 2ZABA 2ZS6B 4Q4W2 3WZ1A 4XACA 2VVEA 4QPYA 2VD7A 1BVP1 4DY3A 2DU0A 1OUXA 4LO7A 1CONA 4Q0VA 1JYVA 3KCYA 2GH8A 1CJPA 4M3CA 4K1YA 3LDKA 2V09A 3VBOC 1JZ5A 2C26A 4Q4V2 1ZZCA 3JZVA 4GB33 3EQEA 4BQYA 4CP9B 1YI9A 3ZX7A 1U12A 3H1YA 3V56A 3VZLA 1LODA 2ET1A 3RGBA 5F6LB 5FK8A 1JU3A 1AZDA 5LZ6A 2BBAA 4FOVA 5H9RA 2WRAA 5E89A 2GC2A 2W5FA 1CAXB 2JECA 1RUJ3 4H14A 1CIYA 2A73B 4FVVA 1U5XA 2G9GA 4FPCA 4IEYA 5EIYB 2RMU1 4DPNA 4LBOA 4YPJA 1AYM2 1QJFA 1PGSA 4ET7A 1NQDA 3O1TA 5C4WA 1B35A 3ELNA 4QPIB 1OOPC 4KBBA 4QWNA 1ND2A 1Q8QA 4AEKA 5C3SA 4MHUA 5JAXA 4GMP1 1ZRDA 4CTEA 1MACA 4BQ5A 3FC0A 2TEPA 3UJQA 5ABJB 1NZCA 2NMOA 4JCKA 4B3NA 1W9SA 1X33A 4JV4A 3OPWA 2LUWA 2R043 3ETQA 4COZA 1MS4A 1UOGA 1JHNA 2GC1A 4MGIE 1Z7S1 4P9IA 5A7PA 3RDIA 4FQZA 1DYKA 2OZJA 4AWDA 1JYTA 1BKZA 2ZGOA 4PIYA 5CNAA 5IVBA 2DYCA 3K77A 1D4M3 1ENSA 4XF1A 1LB2A 4BH9A 3S7IA 3BCWA 4IE6A 4EQVA 3OG2A 4RS5C 1VMHA 5FYUA 4AI8A 2AENA 4G9SB 4Q1PA 3C3VA 4XHBA 3N9PA 3WNXA 3EMRA 4WVMB 2JIJA 2WNUA 1KDMA 5A6ZA 4N9HA 1IGOA 2WO2A 2QQVA 2D43A 3GCWA 1NY71 3GJBA 3K2OA 3ZSKA 2JB4A 1C8M3 2ARBA 3VBUB 3PUQA 4DEVA 1C5HA 4HL0A 1UOFA 1XJAA 1WD4A 4XF9A 4AEMA 3ZKUA 2AC1A 3CQOA 4FTBA 4YW5A 5JZGC 4UT5A 3RI8A 3JBG3 2XQRA 1TQ5A 4XZUG 4XJUA 4XZPA 1SBEA 4E4HA 1GWLA 2BW8A 1J83A 1HV0A 3T0AA 1SLBA 3UGGA 4I30A 4LBKA 4OZOA 3NV3A 5GALA 1PVC2 2ZOEB 2DCKA 2WA3A 4Y1XA 4AEJA 4FPJA 5T5PA 3C8XA 1HN0A 2XBO3 4QDSA 3WHUA 4IETA 2GNDA 3BVCA 3OYWB 5T54A 4DRRA 5F37A 4KWUA 5E88A 4E8CA 2ZKLA 3PNAA 4W6YA 1M4WA 4BIFA 1EAH1 1NAEA 2YY1A 4NHKA 4QT6A 5DG2A 3T30A 4LKDA 1RUH2 4ZKTB 2OQ7A 5IWFA 2W91A 3IDCB 1F2NA 2Q1MA 4CEWA 2RS12 1US3A 5DUUA 1JN2P 4FSJA 2ZX4A 3NNGA 1DLLA 3POSA 2R063 5LK7B 1WBFA 2ORZA 2FDFA 4X6QB 1E5SA 1KXGA 3OF1A 3GZUC 4FPOB 1GP6A 5FZDA 1OLME 1GUIA 2BOJA 1PIV3 2YU2A 3AKQA 5A7WA 4UXAA 3C7GA 5FPVA 3UKVA 5JMCA 1A34A 3QLQA 2RM22 5SV8A 4YG0A 1CGPA 3HPNA 1ALYA 1IS4A 1CESA 5FMOS 5FZGA 1ZA4A 1O7FA 2Q4SA 5IVEA 3I3MA 1PO11 4AZZA 1WCDJ 3O1MA 5A3MA 3TNQA 2VAUA 1A6CA 2RG4A 4H55A 3RYPA 4Z82A 2D5FA 3ZMNA 4CDXB 1UMHA 5FO8B 4XQDA 2MEV1 2G19A 1NKGA 5K9YA 3TN92 4DRVA 3EHKA 2XMLA 3I2OA 4ASMB 3SCFA 2ZHKA 4QXBA 1UNBA 2CL2A 4P9GA 2PHLA 4K3UA 1W9TA 2BPA2 3SNMA 1H2KA 3ZSMA 4BYYA 1H1MA 1ULEA 1YUDA 1ZBA2 3N35A 5F2WA 5CKMA 5ACA3 3MV01 2D97A 3DGTA 1WCSA 2XKPA 5FYHA 4D7YA 5K0UB 1S4CA 1ZRRA 4XJ8A 2ZACA 3LZZA 5GZEA 4DOUA 2JDZA 1I5PA 4N90A 2WZR1 2PAMA 4MSVA 1DQ4A 3WUCA 3ACGA 1KRIA 3KV9A 3PUSA 4JGZA 3ZXGA 5C4WC 1B35C 2HJIA 2R0FA 4KQ7A 3AB0A 3C7OA 1W8OA 2VZQA 1H8TA 2F4LA 2VUJA 1SPPA 5LATA 5LY2A 4ZS2A 1ND2C 3O1VA 1YXWA 3T1LA 1JS9A 4AI9A 2WO3A 4BA6A 1LKNA 2ID4A 3H1WA 1POV1 3O0XA 3E6DA 1ND3A 4ATEA 3S7EA 2YC0A 3ZPOA 2OPKA 3J8F2 1QY4A 1OQDA 4LORA 2VMEA 1RGSA 5FXZA 1U5YA 4W4ZA 2OZ6A 1JYCA 3C2UA 4HLTA 1I5ZA 3MFAA 1W8WA 3GJAA 1PMIA 4BB3A 3GGLA 5CFDA 3JB4C 3V0AA 5IHRA 1RMU1 3J9SA 4CEYB 2I2SA 5A32B 4CCEA 2X5IA 4QM9A 5DAXA 5B2GB 1HN1A 4FFIA 1UZVA 3N3HA 3WVJA 1RIRA 2WNUC 1W6PB 2PAKA 1EV13 4NOTA 1TME1 3GBFA 3AKPA 1IKQA 4PLMA 1NZIA 4PQQA 5LRRA 3R6SA 3KCCA 4URTA 5FOJB 2CY6A 1RUD2 1H9WA 1CAUA 2GAUA 3QACA 3RI9A 1JYWA 5FY7A 4CUBA 2QQNA 4IE4A 2BU9A 3MUZ1 4RSUA 1LJ7A 4P9XA 3I97A 4AI2A 5L7OA 2IXKA 3O12A 4YW2A 3T08A 4JHTA 1XSRA 4SBVA 2BGPA 2OQ6A 3K48A 2WN3A 1XNDA 4BZ4A 2WO1A 4K20A 4Q4X3 2LRPA 2P6HA 4KU7A 3IN9A 1JYIA 2Y6KA 2Y6LA 2NYYA 2PQQA 2WC2A 3O7OA 3FLTA 4I0AA 5E6HA 1RHI2 3ZXAC 4ES8A 1V9U3 3LOBA 2X53S 3ZMOA 4EZHA 3MI8A 5FXXA 3G6JB 5FQ0B 4CRQA 5ISLA 2WUHA 5CBLA 5KC6A 4ZPIA 3GZEA 1V6IA 5FPZA 2UWCA 2C1FA 3ZOIA 5IATA 4LK6A 3KVAA 5H9PA 1OSGA 3HNBM 2WZPP 1OQ1A 2WABA 3LGRA 3M3IA 5APAA 2CDPA 2DVGA 3VD3A 1ULGA 5FY1A 5F5QA 1QJU3 2ZGNA 1XE8A 2E7AA 3AMQA 5H9QA 2WR9A 1NX9A 1BJQA 1GOGA 1STMA 4CEWC 2LALA 4P9YA 4LBNA 1OF4A 4FFHA 2AH2A 2EAKA 4XF3A 2YV8A 4CCCA 3NO8A 4PDWA 4D94A 2EALA 4S2DA 4GB31 4XFGA 1BLZA 1LU2A 2PN5A 3SH4A 1RUG2 4CPBD 1R1A2 1CVNA 2A3XA 4UW3A 5JXGA 1S0BA 5FUPA 2GU9A 4H3WA 4QGLA 1FNZA 1ZRCA 4CCKA 4L9BA 4KG8A 1QJEA 2YUEA 3IIIA 1DDLA 4JAAA 1RUJ1 4XURA 4YYOA 5I8TA 4XDQA 1LHOA 1JUHA 5KXCA 4XCAA 1MS5A 4DXRA 2W94A 4IEVA 1FPN3 4NWVA 4QX1A 5JR2A 4HK8A 1GFF2 2J1VA 5FZ7A 1L3JA 1OMIA 3PVBB 1DGWX 4QMAA 1QIQA 3POWA 3Q8FA 1TMF3 2AR6A 2WQZC 4YG6A 3K3OA 3MBWA 3SHRA 1IS3A 3CZUA 4LULA 5IJRA 1YLLA 2R041 5I93A 5FKBA 2FZ2A 2XGXA 4JGZC 4X8NA 4NR1A 3VDAA 2EXKA 3WLUA 1KQRA 1D4M1 3C7EA 1H8TC 4JGYA 4KWKA 4RFT0 4XF4A 3ZXFA 3ZR6A 4CA9A 5BV6A 4HXCA 3WW3A 4Q0SA 3NKGA 4RYDA 4QM8A 5FZ9A 4UBHA 1N1TA 2JDMA 5FLIA 3ZXJA 1ND3C 1VBC2 1W6OA 2XH6A 3DPRA 1W8TA 4QGMA 2AUYA 1HX6A 2CTVA 2Q8DA 2CWMA 5FK7A 5C71A 4C91A 1C8M1 3E5QA 1C28A 4XBNA 2ZGUA 1Z0HA 5BNNB 3BTXA 5BNOA 3Q8AA 4H2AA 2FZ1A 4YSFA 1VBE2 3I2FA 3TEZA 3L9JT 5CFDC 2QQUA 3I49A 4YVWA 3H8UA 1KS5A 2P34A 3IDBB 2PLV3 1NCQB 3JBG1 4OHWA 1AR63 2X5IC 2PA7A 4ES9A 5FTTC 2BFUS 2VMDA 1ZA7A 3QD6A 2WAOA 2ZGPA 4BQXA 3WNMA 2VMFA 1QDCA 2I74A 3KF3A 2XOMA 2A6YA 1I1EA 5DPNA 1LHVA 1AR92 3ZPYA 2XBO1 2OXBA 3ZFGA 4DB5A 3HD8B 2RS32 1N1SA 2GP5A 3IM0A 4LBMA 5L7OC 4JDMA 5D1IA 2ZCWA 1NT0A 3ZYJB 3MV11 4EN7B 1S0FA 2VULA 4WV8A 5FPLA 3SITA 2G9ZA 1FYUA 4Y24A 3MFCA 3RRDA 4QB2A 1W99A 4JQRA 5DN2A 3KT7A 4K8FA 2JG8A 3D0JA 3M8LA 2WS93 1UYYA 4AYUA 2R061 2PHDA 2QTWB 2XL9A 3RFRA 4LE3A 1L7QA 3WEZA 1NCRA 4QX7A 4DNYA 2EXIA 1PIV1 3HQUA 4AFMA 4OHXA 2P3YA 3VBOB 4Z8BA 5A70A 3O1PA 4FPHA 2P3KA 3KT1A 4LMFA 3R4DB 4DEQA 4ZZ5A 2IXHA 1GQPA 2YZ4A 4LHSA 4MLOA 4OHYA 3BODA 1NXD1 1JOPA 4KGGA 3VDDB 2TUNA 3Q8CA 1YFXA 1COV2 4PDWC 4ZONA 2QJVA 1J3QA 5C8CB 2A5ZA 3FZ3A 3HBZA 1H9PA 1YWKA 4ZXEA 3RG0A 3DYMA 2YXSA 2RMU3 3A7QA 2BWCA 1DCSA 3AJYA 1Z7S2 4IEZA 1BK1A 4BQWA 2D6PA 1OOPB 2RR13 5ACA1 4WVVA 4D3WA 2PMWB 4LE4A 3RWKX 3IPVA 5LBFA 2WNVA 3M4FA 1TEIA 1LGNA 1KDKA 2OUHA 1R081 5GZFA 1EUUA 3AKTA 1V6OA 4V2WA 1ZZ9A 3VZJA 3VBHA 3OPZA 1X8MA 4UFKA 1N3PA 3MICA 1GYKA 4FXGB 3VD9A 4L0PA 2UYBA 2VW1A 2BNOA 4PF5A 3MPBA 1NY72 1SQ4A 4RL7A 4X8PA 4LBJA 5FZAA 5A33B 3AMPA 4PBOA 3ORJA 4FTEA 4AVAA 4DS0A 3BOPA 4QQ2A 2JKBA 5FLJA 1PX3A 1YFUA 1ASJ3 1MEC1 5FP7A 4RS5B 4XFHA 1IS5A 5C9AA 3T0BA 4NIGA 5L36A 1AL22 3UGFA 3IT8A
chains in the Genus database with same CATH topology
2XB6C 1LTEA 4KNCA 2WT2A 1N1YA 4JGYC 2VH9A 3RNSA 3HT2A 2NM1A 3WG2A 1ZRFA 3OCPA 4I3GA 3OBRA 3VZMA 3DPRC 3FUOA 1EV11 3OJBA 4IEWA 1ZZ6A 1IS6A 1EAH2 1MS3A 2GSYA 4Q1RA 1UW8A 5BNOC 5DUWA 4S2HA 3JUUA 4BLJA 3R0RA 1MZEA 4OUMA 5LEKA 4YVWC 3WUDA 2E53A 4Y22A 3VKFC 2Q8OA 1YCIA 4Q4X1 5IK7A 4WM8A 2WFPA 3LSEA 2CV6A 4NPRA 2JD4A 1CX4A 2UYAA 5BPXA 5BNPA 1V9U1 1WUVA 2VNOA 3AP9A 4XFIA 4RR3A 5GLUA 5C6CA 5JDBA 4LUKA 1J58A 3A4UA 3ZFGC 5CG9A 4HZFA 2ENRA 2QNKA 1PO12 3SH5A 4FBFA 3GZTB 4LR4A 3MYXA 3ZO0B 1QOSA 4FOQA 1S0JA 1QJU1 3AZXA 3ZXDA 4CDQA 1Q5OA 1MS0A 2JG8C 4XMIA 1WW6A 4LHNA 1A78A 4AHZA 1S2BA 5T5LA 2FBEA 2ZX1A 3GHMA 2GALA 1LOBA 3HMYA 3QOPA 4M3CB 4P14A 2WZR2 2ZGLA 2DUOA 5K7PA 4JC1A 4A7KA 1HRV2 2A6XA 1RC6A 2MEV3 1RL3A 4E4ZA 3CF6E 1RB8G 1ENXA 1UIJA 1VBB3 1UL9A 4FPLA 3WD5A 4LO8A 3PVEA 2RS53 1VIWB 2O8QA 1FPN1 1YRZA 1QWRA 3WDTA 2YMZA 2HWE3 5C4WB 1B35B 4CZSA 2ZTNA 2UWAA 1ND2B 2WINB 4E4SA 3AKSA 2WNVC 3VHNA 2K9ZA 1F5FA 4PIXA 3CJXA 1RMU2 5CFCA 4WZCA 5CA6A 1LHUA 4AI3A 1Y7BA 2D93A 2A3WA 3VBHC 4LTAA 5I0UA 5EZWA 4FPEA 1W6QB 1TME2 3B5LB 4HFSA 2G4IA 4YGEA 4TSVA 5EWSA 4XTPA 1KD7A 1I3HA 3FMGA 2CAUA 2JG9A 2B8MA 3I54A 3O14A 3TBDA 3A0KA 4HPKA 2GN3A 3M70A 3KZ4C 2R073 3W59A 2WNUB 4AEDA 4WBBA 3ZFEC 4XW3A 1OA4A 2FMDA 2PLV1 2UU8A 2OVUA 1AR61 3N36A 3FLRA 1SCRA 3M3QA 4AFAA 3AMNA 1PM7A 1REDA 4J1XA 1MZ5A 4PQ9A 3MF9A 4P5HA 4ZU5A 2R6QA 1C57A 1N3QA 2ZKNA 3UL2A 4OUSA 4AHXA 4A7YA 1W6NA 3SH3A 2GMMA 4EROA 1REFA 1XRUA 4Q4Y3 5FOBB 1URXA 2A6ZA 3AZWA 3D6EA 4LBQA 4AHWA 4GWNA 5LK5A 1QDOA 1G8WA 2BNMA 4HBNA 4Q2FA 3JQXA 4GB32 4WM8C 3MZHA 3B93A 3HAGA 4GH4A 5JPMB 2WS91 5BNPC 4Y5Z0 3LOIA 4FXKB 4IEOA 5HBAA 3MIHA 5AC93 4RR3C 4CEWB 1WLTA 2Q0AA 1RUJ2 4QXKA 4EN6B 4MGKE 3WV6A 4B4RA 4LEJA 4GQ7A 1DQ0A 4B4QA 1GZWA 2NN8A 1XNBA 1DQ5A 1T6GC 4CDQC 1PGL1 1QOOA 1WMDA 2VOXA 2KA3A 4LBQD 5JOXA 3SCGA 4OI2A 4XHXA 3AZYA 3D4KA 1UCXA 1CAVA 4XMAA 2CWSA 4UW4A 1Q43A 1DZTA 1HRI3 1LGCA 2R042 3KGZA 3RMYA 3CO2A 4IESA 2BVBA 2GMPA 3TAYA 5JPNB 5IK5A 3QH7A 1IZ3A 2RR11 4BMBA 5BXXA 1S2KA 1D4M2 2HWF3 2DFBA 2VMGA 3ES1A 3VKLA 2BBVA 1OA3A 3KS7A 4AE2A 4AXOA 1PO23 2XJRA 4ZU7A 4G4FA 1N47A 3HT1A 1SLTA 3VZKA 4JGZB 1C8M2 3DN7A 1UMZA 1H8TB 1R1ZA 4OFGA 3U11A 2H0VA 4IERA 1ASJ1 1BVVA 2H0BA 4B7EA 5FREA 2E51A 5CFCC 1VBA1 3JBG2 1GV9A 4BMEA 3MDPA 1ND3B 1J59A 4ISRA 4M0NA 2GN7A 2ES3A 4I3PA 3AP6A 2GNMA 4K6BA 3FJSA 2I45A 4IEQA 2Q30A 2R16A 1AX2A 5KXEA 3FHIB 3DUIA 2XPJA 2XBO2 2BTVC 3V0AB 1O4TA 2K2SA 2JG9C 5I0SA 4HETA 2D98A 2X5IB 2IFRA 1WMEA 1ZZ8A 5CU1A 4AEDC 3W58A 1DBNA 2VOVA 3FFQA 4DINB 4YRDA 4TZDA 3ASIA 3AYCA 3LWCA 1CAUB 1J1LA 4L8QA 3GZAA 5FO9B 2R062 1NA1A 3VZNA 3SCHA 4IV1A 1DF0A 5L7OB 4Q29A 2ARXA 1FV3A 1PIV2 4RGAA 3AZZA 3LKJA 4IXLA 3L2YA 1BYHA 1WW4A 4AVBA 4BQ1A 1NXMA 2ZX0A 1H1AA 1SBDA 1S0IA 2YROA 1FMD3 3UJOA 2DURA 4AGVA 3J26N 4GH4C 1CIWA 1JOJA 4EWDA 1AVBA 1AXKA 1QU0A 1QJY3 4YW3A 4V1PA 4AQSA 2IXLA 4AVCA 5ACA2 1N3OA 4INDA 1DZQA 3CEWA 3AMHA 1ZNPA 1ENQA 3NL1A 1U5ZA 3CJIA 4QHBA 1CD3G 2NLRA 1QQP3 5HCFA 5F1RA 4WM7B 4OI0A 2BNNA 4M3CE 3PTYA 5J3UA 4F7ZA 4BPZA 1DQ2A 3HWJA 1O5LA 5GLVA 4C1WA 1WMFA 1Q3EA 1DGWA 1VJ2A 4L11A 4U36A 1F31A 4L99A 4CTEA 1DIWA 2ZGTA 1VBB1 3GNEA 4AI0A 5IK4A 2XL7A 2HEVF 1UU4A 4NN0A 2TNFA 4XXPA 4GWMA 2RS51 3JD73 2N7GA 5C33A 3WXPA 3E6BA 1M06G 4MXVA 1R083 1S1AA 2HWE1 3VBFA 1HKDA 1BBT3 2B39A 3ME2A 3B9IA 1Q8VA 4QPIA 4RHV3 2MPFA 1A8DA 2DVBA 5DZGA 1FATA 3AZVA 4BHPA 3SXWA 3B94A 5FCCA 1U5IA 4AGGA 1DFQA 1EV12 1MEC3 3FBMA 4FOWA 5ABJA 3WR0A 1UF2C 1W6MA 1TE1B 3VHRA 3MW3A 4JGYB 4XEZA 1JXNA 2A70A 4JDOA 2BQPA 1VLNA 3S6PA 1LESA 3MEPA 3VLBB 2TBVA 2VW2A 1RUE3 3FWEA 4P9WA 4H7LA 2R071 3DPRB 1UX6A 1W6OB 4Q4X2 1G6NA 4MV2A 3VN4A 2DFCA 4BLIA 4WVMA 1K5MA 1V6NA 1V9U2 4KL1A 1DQ6A 2WIIB 2EIGA 4RGGA 4O9EA 3VBUA 2NP0A 4YNIA 2EF6A 5I8SA 4YVWB 1FXZA 2XJSA 1H0BA 1DU3D 4YZ1A 2QKDA 2VW0A 3NV2A 2D6MA 5E8AA 1PZ9A 1QJU2 3LSDA 1V70A 3BPZA 1FNYA 3RYRA 3B02A 1R091 4Q4Y1 1NE6A 1PK6A 3CNAA 1NYWA 5F9TA 1GZ9A 1NA1C 4Y1ZA 4S2GA 4XYXA 5FFOC 4NWWA 4IV1C 3ZFGB 4YZ5A 3VL8A 1LR5A 3GBWA 1VAKA 4YVSA 5GLZA 4Q0QA 1O91A 1GQGA 3FUQA 1YNAA 4QPGA 3M2MA 1AX0A 3N7JA 3OYWA 3WDVA 1EYBA 3BTAA 5GKAC 2DTWA 5AC91 3AXEA 2JG8B 3RPQA 1BEV3 1DQ1A 3AFKA 4B29A 1FT9A 1ONAA 5IUQA 3OD0A 2DTYA 3M3OA 1QKQA 4M0HA 3NV4A 1QH7A 5T5OA 3ZYRA 3IIAA 3T1MA 1FPN2 4GA9A 3INAA 3V64A 2B9UA 3VHOA 4M01A 1N1VA 5JSPA 3AK0A 4XOGA 5A3LA 1TMF2 3H1MA 3O5SA 4IEXA 3NWKA 1HRI1 3FBYA 1C3HA 2VOKA 2WJSA 1QOTA 1BMV2 4QU2A 4I0BA 1PNFA 2HWF1 3WX5A 4BOWA 4R9BA 2HWB3 1F5JA 4I02A 3WDYA 3ZIXA 2XWJB 1PO21 4YLZA 4A3XA 2PHRA 2UWBA 4MGYE 4Z1VA 1RUOA 1Q8PA 3IPVB 2WNVB 3PMSA 2P3IA 1H4GA 2OA2A 1WLWA 3AYAA 1GZCA 4HVOA 3VBFC 3VBHB 3ZDSA 1JUIA 2D3SA 2BUKA 5HI0A 3RMXA 3VGIA 3IBMA 5KHKA 4QPIC 4FO9A 5J7MA 4CP2A 3I7DA 4LBLA 4HMZA 2PFWA 2PLV2 3UKTA 1AR62 3FFZA 3PVOA 4C90A 1GICA 2E9QA 3B01A 2K0GA 3N7MA 5ABJC 4E2SA 1DGRN 2ZGKA 1AYM1 5EYXA 1RTVA 2R1BA 3THTA 3H9AA 3ZFEB 1NQJA 1MS8A 1LRHA 3WDXA 1S0EA 1TNRA 4XIOA 3RZZA 2WQ4A 3USUA 2IZWA 2GC3A 2JE7A 3AMMA 1K5MC 1RVF3 2NQYA 4R4ZA 2WS92 1I6XA 4CDUA 3WCRA 2EXJA 3NV1A 5K8SA 2PTMA 5DDJ3 2FHRA 2QE3A 3VBUC 4KH9A 1BQPA 4Y22B 3LA7A 1HQWA 1QH6A 2O1QA 5T55A 4B8EA 5AFBA 4LHKA 4WM8B 2PAEA 1EPWA 3WOGA 1REEA 3M7AA 3PHMA 4Q0UA 5DUVA 5BNPB 2I07B 1PGL2 5AFEA 3V0BB 1PK6C 4ISQA 1OQEA 4G3YC 2D6KA 5BNQA 1G9AA 2ZGQA 3LA3A 5EV7A 1LOFA 4YVSC 1FMD1 4GIQA 4Y26A 2NZ9A 4B4PA 4QPGC 3WP3A 2RMU2 1MQTA 1J3PA 2VMIA 2XLAA 4LO6B 2ZHMA 3TOJA 1QJY1 4CDQB 1UPIA 2HEWF 2RR12 5L19A 3AXDA 4E2GA 4W6WA 2W52A 4AFDA 1QQP1 1AR73 3B9CA 1O3RA 4DY5A 4N53A 3WQ1A 3OY8A 2ETEA 3FE5A 3RQ0A 4ATFA 5J37A 1CAWA 5JOYA 2X29A 3I8TA 1XE7A 4LO4B 4A7ZA 2XWBB 1RUC3 3W9AA 4LLOA 4O9GA 3JD71 4GKXA 1G7YA 4UBGA 1ASJ2 3RJRA 2Z2SB 1HQLA 2XHKA 3S0MA 4DMIA 3O0VA 4XQ4A 3ILFA 4Q0PA 4GALA 5I0RA 3MW4A 1BBT1 3A0NA 2YGMA 1SLIA 4RHV1 2HWD3 3RWNA 4AFCA 5I8YA 4M3CF 4FTSA 4DZGA 3VZOA 1ZREA 4CP1A 3I4IA 1YIFA 4TYSA 3VKOA 3THPA 1OD5A 5IT6A 5FLHA 4KWJA 2DV9A 3OD4A 4N9IA 1QJX3 1VBA3 5E1RA 2AGSA 2YDEA 4DXZA 2ZMNA 1PNGA 3ZSJA 1GKBA 4KU8A 1SMVA 2PHTA 2R1DA 3WP6A 1I9RA 2D6LX 2CGOA 3VKNA 1RUE1 1QXJA 1WA4A 5GM0A 2ZAHA 5JOZA 1SACA 2JG9B 1VB4A 4IV3A 4HPKB 1ZBE3 3KLSA 4QQHA 4SLIA 5T50A 5JZGB 2D3PA 4GMP0 2ZGMA 1RJ8A 3WG3A 5CADA 1AR83 3IKWA 4P9LA 1AJOA 4HANA 1XXNA 3BIWE 3KQRA 2XJUA 3MIDA 4MXWA 1LCLA 4Q27A 2P17A 4YW1A 1S0GA 3QH6A 3ZIWA 1BCXA 1VBD3 4Y20A 4CDUC 4AF9A 1W6NB 3GALA 5BY5A 5HXVA 4E9KA 4R4XA 3EBRA 2OUJA 4XETA 2NMNA 3ES4A 1BXHA 4LBQB 4Q8KA 2RJKA 3MIBA 4AVTA 4BA6A 2LTNA 3HN1A 1WW7A 2EXHA 2GNTA 4W65A 1KFXL 4R8HA 2E7QA 3LAGA 2MEV2 4MX3A 4GH4B 1DYPA 5J36A 1BEV1 1Z78A 4FP3A 2Z42A 1VBB2 4RQPA 3EO6A 1OPOA 1Q8SA 3R4UA 2RS52 3ZXKA 3IMNA 3J4UH 1XYPA 4AVSA 1LOFC 1NCRC 2JEMA 4L2NA 4OI1A 4FPKA 2MNGA 1MQTC 4E27A 1ZYBA 1RINA 2HWE2 5JR7B 4IEUA 3VBOA 2W68A 2ZMLA 2XJTA 1PVXA 3E5XA 4PJYA 1G9CA 2OW4A 2ZPXA 5D8AA 2XG3A 1GLHA 4KGQA 3VBSA 1QMJA 1ZX5A 5I91A 1RUI3 1GNHA 2F6BA 1XU2A 1CAVB 2WT0A 4FCAA 4N53C 3VDDA 4J1WA 1DGLA 5C8CA 3N4MA 2HWB1 4XQWA 1H2NA 4R9DA 1SEFA 2D44A 3R05A 3WINE 1IOAA 4KG0A 1HXS3 1QXRA 4CP0A 1SDWA 1RUF3 1LGBA 2R072 4YG3A 3WW1A 4QD2A 3OGGA 5JIAA 4GXLA 2VECA 1IPJA 2DVAA 2QZ3A 2XJVA 5F6KA 2VY0A 4JDNA 1X50A 5C9AC 1W0OA 4AHYA 1D2SA 5LEJA 2ZHNA 4CDWC 3TYJA 2VU9A 2AZ5A 1UAIA 2VGDA 2VNGA 4QGNA 1XNCA 4XPVA 3I2DA 1XU1A 2ATFA 3DF0A 3AJZA 1R092 2B46X 2JX9A 1FV2A 4Q4Y2 3ILNA 1VRH1 2ZHLA 4K1ZA 5FBZA 4FPYA 2DF7A 3D82A 4Q8LA 2D3RA 3ZN6A 1X82A 2PYTA 3OTFA 3NJZA 3ATGA 3ECQA 2NPIA 5BUVA 3AFGA 3MPPG 2MHFA 3AP5A 3JU9A 3I59A 4IV3C 1ZZ7A 4KWLA 1RVF1 2JICA 3UV9A 4DPNA 1LHNA 3ENRA 2Y0OA 5DDJ1 1GANA 1AF9A 1W0PA 2VG9A 1VB2A 1POV0 5AC92 2JENA 1LOCA 4K40A 1R093 1UZYA 4OZXA 4FAGA 3IDEA 2IXJA 1NA1B 3WCSA 1CQ9A 5GZCA 3KT4A 4IV1B 4FOYA 1EP0A 1FOD3 2D7FA 1VBC1 2A3YA 1Q8OA 2HWC3 1UZZA 2WFF3 1KS4A 3AYEA 4I0WB 3AP4A 4COUA 2E6VA 3L2HA 4AQ2A 2UURA 4JTNA 2BFUL 1HRI2 1V6KA 4PIZA 1QHDA 1SFNA 3ACLA 3NVCA 4JVAA 1NG0A 1AYN3 5KXDA 2HWF2 2LM3A 4RQPC 4K7JA 1DZRA 2Z5WA 1AR71 3ZN5A 1PO22 1AR91 2YPJA 3KCXA 1J1TA 1DG6A 3KM5A 4P9JA 2VVFA 4RA0A 1YFYA 4D69A 2QUOA 4JRAA 1AX1A 1SLAA 3AKRA 3U07A 3TRSB 1RUC1 2AREA 3RSJA 3AYDA 2A71A 3ZFFA 5D8AC 1XQNA 4OHZA 4AI1A 1ZM1A 1WBLA 3VBSC 1B09A 2WNEA 1H2LA 1NLRA 2XVLA 5T5JA 3VDDC 2A75A 3PVNA 1IPKA 4LNVA 5JOWA 1HQNA 4Q4W3 5C8CC 2HWD1 3VBRA 4EWAA 3VBFB 5FAXA 2DUPA 3NAPA 3H3UA 3PJYA 4Q4V3 4FPGA 1X7NA 2ZAAA 2Z69A 2DWRA 1QNWA 3VKMA 2WT1A 4YM3A 1QJX1 1UKRA 1COV1 1HDKA 4EWEA 1F8VA 3PMEA 1W6MB 1OLQA 1HLCA 1W6QA 5KHIA 1AYM3 1VP6A 4W6XA 1IKPA 3ZSLA 1MVQA 2SLIA 2R0HA 5CFDB 3URFA 4K21A 4R9AA 2B5HA 4ORFA 1ZBE1 4F3JA 3MLKA 4Y1UA 3QCWA 3EJKA 1AR81 5JSRA 1GSLA 3MF6A 4R52A 4XJAA 3NW4A 1K5MB 2DVFA 3APBA 3E6CC 4GULA 1SLCA 2XVKA 3NSTA 5JSOA 4F83A 1G86A 3CU7A 4YGCA 1WD3A 1CPNA 2YHJA 1FMD2 4L92A 4JRLA 1VBD1 2XKOA 4HVRA 4WVZA 1IHMA 3P3PA 2VXRA 1AL21 2GDFA 1UIKA 1QJY2 3Q9OA 4BIOA 4AQ6A 4Y1YA 5DXDA 1PK6B 3WP5A 3KMHA 2OIIA 4PBPA 1QQP2 3TB0A 1FI2A 3CLPA 1WW5A 1GQHA 4YVSB 4BM8A 4QPGB 2DU1A 5HCAA 1OFNA 4N43A 2ZX2A 3ALQA 1PHMA 4TWTA 3NKTA 1XYOA 3PJQA 5H9SA 3JD72 1QJZA 3WQ0A 3BB6A 4HSLA 3WDWA 1R082 3ZVXA 3AP7A 1PVC3 2JXAA 4PDWB 2B42B 4HN0A 1NE4A 1XYNA 1O4YA 1BBT2 3N7KA 1YIPA 1YO8A 3FLPA 4GKYA 1OA2A 2R32A 4RHV2 5FDBA 5JIUA 1SBFA 4LHLA 3B00A 3H0OA 1RUI1 4XIKA 4XFBA 5DUXA 5J09A 1ULFA 1RUH3 2DUQA 2E63A 4ZXKA 1E57A 2RS13 1MEC2 1ZZBA 1CAXA 4HKWA 1DGRA 4FQ4A 4XJ9A 4Y1VA 1X8EA 4EN8B 2QCSB 4LUMA 5J98B 3SMHA 3ZFFC 1G9FA 3VHPA 1ULCA 1HXS1 3RJ2X 5L73A 1RUE2 5AVPA 1RUF1 2Q5TA 4MUVA 2RM23 2R49A 4ZU4A 1LHWA 2ZZQA 5KWRA 4PCRA 1MR5A 5EJ3A 2ZX3A 3VBRC 4H7MA 4E4DX 1YYNA 4YGDA 3E5UA 3H7JA 3NAPC 3WW2A 2XLFA 1HRV1 1PGW1 1C8NA 4EN9B 4S2FA 1JH5A 2EA7A 3TN93 3B3QE 4ONUA 2ZZJA 1ZBA3 1Y43B 2PELA 1O4ZA 1VAMA 1TNFA 5DZEA 5BNOB 1UN1A 3N7LA 4D7SA 2WKKA 2XUMA 1WLDA 1UPSA 1OKQA 4YFWA 1C1FA 2VQAA 2D6NA 3USUB 4BWOA 3ROUA 4OHVA 3QBQA 2C5DA 5LRSA 4XJWA 1BEV2 4CDUB 4BCUA 3GYDA 3J8F3 3ZSEA 3DKWA 4YGBA 3D8CA 3O0WA 1EPZA 5BYNA 1YI7A 1FOD1 3DV8A 2QFEA 3VL9A 4FAHA 2HWC1 2WFF1 3ZXLA 2PHUA 3BALA 1UU5A 4LO5B 1JW6A 5KBFA 4OVEA 1X36A 1SCSA 1G9DA 1RUD3 2X8KA 1FAYA 1NCRB 1AYN1 2WLPA 4J6GA 4N43C 1MQTB 5CAZA 3WT3A 5IK8A 2HWB2 4UW5A 4YZ2A 2F4PA 4XTMA 1H30A 4QQOA 4YZ4A 1AXYA 1APNA 2Q1ZB 5CIRA 4BE3A 4AVVA 3CJIC 1RHI3 2DVDA 4IQPA 3MIFA 4DQAA 2CGNA 1DHKB 2FMYA 4N53B 2Z79A 1KITA 3OY8B 4WM7A 4AQTA 4AW7A 1CAWB 1S0DA 2AYHA 4CDXA 4COVA 4A2UA 3GHNA 4EV0A 1Y9QA 4QQLA 2IXIA 2DCTA 4I09A 1MVEA 3AX4A 2H6CA 4XBLA 1WGPA 3GF6A 1QNYA 4Q4W1 3WW4A 2EAAA 2QQPA 1AXZA 1OPMA 2ZGRA 4YM0A 5K0UA 2IFWA 3D5OA 1YJLA 1ENRA 4NVPA 1KFUL 4Q4V1 3KSCA 4ITCA 4COWA 1RUG3 1CN1A 1R1A3 4LA3A 3S30A 1VRH2 5FPXA 4YW4A 2B45X 2WSUA 2ET7A 5C9AB 4XJZA 1O3TA 1RVF2 2BWAA 5SV5A 2ERFA 4CDWB 1OFSA 2CAVA 3ILRA 3POYA 1FX5A 5DDJ2 3WG1A 5J96B 4OULA 5C8WA 4M00A 4XFCA 4NO4A 5KHGA 3JQWA 4CYDA 1VRH3 1MZFA 5GZDA 3VV1A 5JI9A 4CEYA 5CG8A 5A32A 2RHPA 3ST7A 4IV3B 4B7KA 3OBTA 1YFWA 2ZA9A 3AM2A 1OLRA 1W6PA 3M1HA 4Z92B 2BGCA 3RYKA 5DG1A 2YYOA 1VR3A 2GH2A 2JE9A 1D0HA 1MZ6A 2D40A 3X29B 2OYZA 2HKXA 4AG4A 3G7DA 4MXWB 1C4RA 2EVXA 5CB7A 2CYFA 3WHTA 2R30A 4Y20B 1VBC3 2VNRA 3B7MA 5I0TA 5BNNA 1UU6A 5KC5A 1O3QA 2HEYF 3PLQA 4YM1A 1LULA 1AR72 3H7YA 4RR3B 3IWZA 5JVVA 5FQ0A 1VBE3 5FRAA 3LA2A 2UY9A 3JCIA 1NLSA 2WA4A 4XE9A 3H3ZA 2PHWA 2C0ZA 3HIFA 1RUC2 1AUYA 4N7IA 4QX5A 1RJ7A 4RQPB 2WWSA 4HT1T 1PZ7A 1PVC1 1LENA 3M3EA 2G9FA 4D7TA 2WL1A 2E7TA 1AR93 4IEPA 2P37A 5GLWA 4HN1A 2WSVA 1CPMA 2RS33 1C1LA 3ZYPA 4E2QA 4C0BA 2HWD2 1ZVFA 2IC1A 1SFYA 3ZXEA 1Y3TA 4HKOA 3WDUA 3B69A 4R9CA 1RUH1 3GBGA 1HW5A 5D8AB 3ZN4A 2SBAA 1OHFA 2RS11 3MGUA 4NHLA 4NHMA 3VBSB 4Z2WA 1QJX2 1VBA2 2QZ2A 3WQ7A 3DL3A 1AHSA 5FO7B 4WM7C 1G9BA 3TWIA 4CDXC 5JLVA 5KHJA 2ZBJA 5FMOL 1EY2A 4U2AA 2V5YA 4IL7A 1MS1A 4MVTA 2A6WA 5KHHA 2RM21 1LEDA 1RUNA 2GZWA 4WVWA 1HIXA 4F8AA 5CFCB 5JWPA 4XFAA 1ZBE2 1D0GA 2VOWA 2GC0A 4GMP3 5K0UC 4OLLA 2A6VA 1AR82 1COV3 4AFBA 1GR3A 1LEMA 2KM2A 3TN91 1QF3A 3JB8A 2VQ0A 3SISA 4HVQA 1Z7S3 2GMEA 1QXPA 3WY6A 1V00A 1ZBA1 2VPVA 1VBD2 4MGZE 1PZ8A 3ZYIB 2H6BA 2UY8A 1GNZA 2P2KA 4AEDB 2FQPA 1H1IA 1VAVA 1A8MA 3K51A 3MIEA 3ZYGA 2VUAA 3ZFEA 1S0CA 3ZN6B 4AK3A 4YARA 3U4XA 1V6LA 1NCQA 4CEYC 1UD1A 2PHXA 4WZFA 1Q56A 2ILMA 3I59B 3MLJA 2B7YA 1QGLA 4TLFA 4DFSA 3CL1A 3D0SA 3J8F1 3FX3A 4I01A 1AL23 2WLQA 4AGRA 3WG4A 3R4SA 1SLLA 4HK9A 2Y0IA 1IQAA 4LA2A 1H8VA 5T52A 2W08A 1LU1A 5GJ6A 2Y26A 2DCJA 1UKGA 4FT8A 5BNNC 1O3SA 1V6JA 1RUI2 1EAH3 1NOVA 3V0BA 1RUD1 4MYEA 3TNPB 2D6OX 2HYKA 2DCYA 5TSWA 3HQXA 4MH0E 1HV1A 5E16A 2XJQA 1GZWB 1W39A 1O5UA 2QVSB 4EN0A 3MIGA 3UKNA 1AJKA 3T2TA 2O0OA 3HR9A 1WCKA 4ASLA 1LOGA 3WP4A 1RHI1 3U10A 1HXS2 3P3NA 5JI7A 1RUF2 2Y38A 2XVGA 2ZGSA 4PLOA 1PO13 2P3JA 4C1XA 4C0HA 2QDNA 2ZMKA 1LOEA 2XJPA 1S55A 2PHFA 3ZFFB 1PGW2 4OI4A 1D4VB 4Y4YA 3RS6A 4XXAA 1OOPA 3USSA 1H4HA 3UK9A 2CNAA 2W0XA 2IXCA 4L97A 1WLCA 4YM2A 2IWGB 2JJ6A 2DCZA 1JTZX 5JCTA 4XILA 5CVRA 1LOAA 2A7AA 1JBCA 3VBRB 1RUG1 1R1A1 1KJRA 1CR7A 3NAPB 2RE9A 2WZR3 1U0AA 4N7UA 5GZGA 1ULDA 1HRV3 1V6MA 1W2UA 2VVDA 5A33A 4QQPA 1TMF1 3BOWA 5EXOA 4K9SA 4UW6A 5AVAA 2BEOA 1GBGA 3LB9A 4RS5A 1LECA 1C5IA </