1X50A

Solution structure of the c-terminal gal-bind lectin domain from human galectin-4
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
164
structure length
164
Chain Sequence
GSSGSSGHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-4
publication title Solution structure of the C-terminal gal-bind lectin domain from human galectin-4
rcsb
source organism Homo sapiens
total genus 12
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1x50A01
2VU9A 2VUAA 1LGBA 4GA9A 4LBKA 4AWDA 3W58A 4YW5A 3AP4A 2P3KA 3OPZA 4Q27A 1H9PA 1G86A 3BIWE 5DXDA 1YIFA 1NXD1 2AR6A 2SLIA 1GBGA 1PZ9A 2D3SA 3ZXEA 3N7KA 4Y24A 2VW1A 5H9RA 2R1BA 5GLVA 5GLZA 3ZSJA 5GJ6A 3OBRA 3D5OA 4NO4A 1W6NB 4Y1XA 3WV6A 3R4UA 1CPNA 1LOAA 3RMYA 3WLUA 2ZGUA 4XYXA 1BQPA 4FPOB 2WNEA 4FOYA 4D69A 1CESA 2GNMA 2GN3A 5EXOA 5JVVA 4M3CB 5T5OA 5T50A 3WCRA 1UMZA 4XMIA 3ZSLA 5JOYA 2A6XA 2P2KA 2V73A 3VKNA 4HANA 1ENQA 1RITA 1V6MA 1Z78A 1C57A 1WLDA 5IK4A 1CPMA 5JLVA 2V5YA 1LULA 3A4UA 1QOSA 1S0DA 4Q26A 4U2AA 2ES3A 2R0FA 3M1HA 4FOVA 3RG0A 3T2TA 1CN1A 3C2UA 1VAVA 3I4IA 3D6EA 2YXSA 3H0OA 1BYHA 2AUYA 3ZYRA 5BYNA 3AJYA 1MVEA 3SNMA 2UU8A 4DPNA 4Y22B 2WKKA 4SLIA 3AYCA 3POSA 3QLQA 3ILFA 3WG1A 3VUOA 2DTYA 2NZ9A 3V65A 4XIKA 3VV1A 1HQWA 2JD4A 3N7MA 4IQPA 4R9CA 5CNAA 5DUWA 2UWCA 4YZ5A 5GALA 4F83A 1AX1A 1WBLA 1URXA 5DZFA 1DIWA 1S0GA 3RMXA 1LHNA 3WG3A 1JHNA 4AGVA 1QNWA 1BZWA 1YRZA 5EWSA 3IMNA 1TEIA 2AH2A 2G4IA 3NV3A 4XJAA 1SLCA 2TEPA 3T1MA 4YFZA 1DYPA 1DGLA 2GN7A 2A3YA 2CY6A 2R1DA 1DQ0A 2YROA 1N3PA 1LJ7A 4CTEA 1SACA 1V6JA 5GZCA 3AFKA 3AP9A 1SCSA 3MW3A 3AP6A 2YV8A 4FPHA 4XJWA 1LOGA 1QU0A 1JYIA 1XQNA 1KITA 2DUQA 4K1YA 4OZXA 3HN1A 3JUUA 4P9XA 5H9QA 4JCKA 2ZACA 4GWMA 4CRQA 1KDKA 4NOTA 1Q8OA 2GMPA 2VW0A 2A3XA 2FHRA 3AXEA 4XILA 4YGEA 2GNTA 3FLTA 1JOJA 3APBA 1MS3A 4K21A 1AJKA 2CWSA 2JDZA 1N1SA 2PELA 4FOWA 1V6NA 3ATGA 2DWRA 3ZXFA 1S0FA 2ZMKA 1N47A 3MW4A 1V6LA 2A71A 1LEDA 3B00A 4P9WA 5H9SA 3WDXA 2PHXA 4XIOA 1G9AA 5GLTA 1A78A 4R9AA 3M3OA 2NM1A 5JDBA 4YZ3A 1C1LA 1S0JA 1F9KA 3WHUA 4JC1A 2JKBA 2PHTA 1Z0HA 1LECA 2I2SA 3LSDA 3QCWA 5EYXA 2NMNA 4GKYA 2UWAA 2ARXA 4ATEA 3WUDA 1QKQA 2D3RA 3PVEA 2PHRA 4AGRA 5IT6A 4M3CF 3POWA 2JJ6A 2D6LX 5E8AA 3FLPA 4LBQA 1AZDA 4XXPA 4FP2A 1V6OA 1WW4A 2GMMA 3O0XA 1JW6A 3AXDA 1ULFA 2W39A 1GZWB 2OUHA 2DU0A 2CYFA 1WBFA 2ZGSA 2AREA 1GZ9A 3SLIA 2EXHA 2A6ZA 1ULDA 3A0KA 1DLLA 3B69A 1A3KA 4BMEA 3OBTA 5JMCA 4FPLA 2ZGKA 3AP5A 1WW6A 3FUOA 1LOEA 1G7YA 1DQ2A 2A7AA 1B09A 2DVAA 4GXLA 3MW2A 1A8DA 2D7FA 2EIGA 4GWNA 4R9BA 5EYYA 1WUVA 4FPJA 1V6KA 1UX6A 2OW4A 1O4YA 3LSEA 1D2SA 4Y1UA 1G9CA 1GLHA 4K20A 1QOTA 4ISRA 4Z8BA 2W08A 4Y20A 1Q8PA 5DUVA 4Q1PA 3TAYA 4P9YA 3MEPA 3WNXA 1IKQA 2ZKNA 3RS6A 1C4RA 1SLIA 2NMOA 3AK0A 2Q5TA 4LBOA 1AF9A 1UZZA 3ZXKA 4K1ZA 3FUQA 4YM0A 4ATFA 2E7QA 4XHXA 1AVBA 1S0CA 2D6PA 2ZAAA 2ARBA 5HCFA 2OVUA 4I30A 2WSVA 1MS1A 1YI7A 4ASMB 1WD4A 2D6KA 5HCAA 4XOGA 2YMZA 3ILRA 1W0OA 3O12A 1YYNA 3SH5A 1GSLA 3ZYPA 1LOBA 4DQAA 5CAZA 1I1EA 2DURA 2AGSA 4C1WA 1CR7A 4RA0A 4DS0A 2ZMNA 5FREA 2DVGA 1SBDA 2E7TA 2DV9A 1AX0A 2A3WA 5E89A 3POYA 1SBFA 1UKGA 4XTMA 3L2YA 3ZXJA 4AVTA 1GNZA 4Q8LA 2E53A 5AVAA 5CB7A 5GZGA 3INAA 3RRDA 4LBQB 4PCRA 4WVWA 1LEMA 4FPYA 1IS6A 5F9TA 4ZKTB 4AGGA 4BLIA 1KJRA 1GICA 2ZHKA 4U36A 1KQRA 5L73A 1ENRA 2ZZJA 3OJBA 1N3OA 2NYYA 2P34A 3A0NA 4XJZA 1FYUA 1GZWA 1DBNA 3FBYA 3R05A 4YZ4A 4YG6A 5T5JA 4H55A 4XZPA 1OQ1A 4YGCA 2DVBA 5IK7A 1FV3A 4XE9A 1MS5A 1BXHA 1LOCA 2AENA 1UAIA 3AZWA 2LTNA 1N1VA 1SLLA 1MZ5A 2B7YA 2ZGLA 4BLJA 1ONAA 2D6MA 3VKLA 1Q8SA 5DUXA 3SISA 2DVFA 4BQ1A 3WG2A 4YW4A 2A70A 2YZ4A 1FNYA 2CNAA 3ZSMA 2GNBA 1LHWA 2D6NA 4Y20B 2Z42A 1WW5A 4M3CE 5GM0A 1HLCA 1JYCA 1MS0A 3WZ1A 5GZDA 5GLUA 4XHBA 2ZHMA 3KQRA 1VIWB 4YM3A 4YW3A 1JUIA 4TYSA 3W59A 2PHWA 1Q56A 1FAYA 1JBCA 1W6MB 4LBLA 4YGDA 1MS4A 4YZ1A 4XJ8A 1LOFA 4P14A 2D3PA 1W6QA 3M2MA 3R4SA 1S0BA 5KXDA 3B01A 4BM8A 5T5PA 5KXEA 1RIRA 1CONA 2ERFA 3TB0A 2GALA 4FPGA 3N36A 2P37A 3PVNA 5T5LA 4TZDA 3N3HA 2ZMLA 3D4KA 4YFWA 1LESA 4Y1YA 1MACA 1S1AA 2CL2A 5DZGA 5FRAA 3B9CA 2P3IA 2OUJA 3ASIA 1VLNA 3B3QE 4XBNA 1Y7BA 3WOGA 3KM5A 3NWKA 2D6OX 1AXZA 3LCPA 2C5DA 3BTAA 2A6WA 1FNZA 3V64A 1DHKB 1GV9A 4Y1VA 1IS3A 3SITA 1ENSA 3IKWA 1QOOA 1DYKA 1IS4A 1ULCA 3BOPA 2HYKA 4XBQA 1ULEA 1IOAA 1UZYA 1Q8QA 4R9DA 1LODA 1UN1A 3RSJA 3FFZA 1DQ4A 3JU9A 4YLZA 1CJPA 4YW1A 1W6PA 2CWMA 3NV4A 2SBAA 2A6VA 5GLWA 1RINA 2GNDA 3V0AB 2ZGQA 3GALA 1MS9A 2WQZC 5DZEA 1HKDA 4YW2A 1APNA 3O0WA 5T52A 3T1LA 1SCRA 1G8WA 2JE9A 5KXBA 2R16A 1LENA 1GANA 3WG4A 2DUPA 4FOQA 3SH3A 1ULGA 1C1FA 4BPZA 2E6VA 2W52A 3AYEA 1UPSA 1EPWA 3Q9OA 3IM0A 3DGTA 3AP7A 5E88A 2VY0A 3AZXA 1GZCA 1G9BA 1D0HA 2XG3A 4YG0A 1PZ8A 4M00A 5LK5A 3WDTA 3N35A 3V0BA 1BKZA 5IK5A 1J1TA 3UJQA 4XMAA 4FQZA 3N7LA 3U4XA 3AJZA 2VH9A 1DQ1A 2BQPA 2ZBJA 1SFYA 4LBJA 1YO8A 5DG2A 1V6IA 4Q2FA 3OGGA 1W6MA 1QDCA 1W0PA 1WD3A 3MPPG 1LTEA 4FPKA 1W6QB 3AZZA 3VKFC 4FPEA 3AYDA 4XXAA 1G9DA 4YZ2A 1F5FA 5T55A 3O5SA 5HCBA 2AYHA 3WCSA 2ZGOA 1MS8A 1KRIA 1AX2A 4BMBA 1R1ZA 2LALA 2P3JA 3HR9A 4RL7A 2RHPA 2VXRA 3AYAA 2VW2A 1DQ6A 2R49A 1LHVA 4AYUA 2ZGTA 1G9FA 2DYCA 5JOZA 2A6YA 1IKPA 3PJQA 1FV2A 4YM2A 1MVQA 5DUUA 2XB6C 3USUA 5JOXA 2E51A 3O0VA 1W6OB 3WVJA 3ZVXA 3HMYA 3AX4A 4AVVA 4ITCA 3CNAA 1SBEA 3OYWA 1DZQA 3AZYA 4PF5A 2EXKA 4KBBA 4L8QA 5KXCA 2JE7A 3I8TA 1KJLA 2DUOA 2EF6A 2A75A 1W6PB 4UW4A 3ZXLA 1HDKA 4FQ4A 1QNYA 3UL2A 4XBLA 1VAMA 3IN9A 2DTWA 1LU2A 1MZ6A 1LHUA 3UK9A 3VKOA 3IPVB 5CBLA 4Q8KA 3WDVA 1N3QA 3BODA 1V00A 3V0AA 1GKBA 2EAKA 5GZEA 5DG1A 3M3EA 2ZHLA 4LBNA 1FATA 2UURA 1DFQA 3OY8A 2W68A 1OFSA 3VKMA 4WZFA 1N1YA 4MYEA 3ZSKA 5GZFA 1O4ZA 4AVSA 3V0BB 3M3CA 4UW5A 2YY1A 4Y1ZA 2WSUA 2ZGMA 1VALA 1CIWA 1PZ7A 1AXKA 4FVVA 2WJSA 1AJOA 1SLTA 4W65A 1Q8VA 1JXNA 4XDQA 4XTPA 4ZXKA 1WLCA 1IS5A 4FPFA 1AXYA 1LU1A 1QGLA 4UW3A 1LOFC 1YXWA 3WDWA 1JN2P 4M01A 5T54A 5SV8A 4DRVA 4DFSA 2PHFA 1LCLA 1OKQA 2D44A 2FMDA 2ZA9A 1H9WA 2ENRA 3NV1A 1S0IA 3DUIA 3ZPYA 2DVDA 4DRRA 1CVNA 3N7JA 4XJUA 1LGNA 1NLSA 1W6NA 4YGBA 1CQ9A 1S0EA 2WT0A 1QMJA 1I3HA 1U0AA 1WLWA 2WT2A 4ISQA 4BOWA 2DU1A 2JECA 2H0BA 3USUB 1SLAA 4YM1A 4LBQD 4M3CA 1DQ5A 2R0HA 2D43A 4UW6A 4PQ9A 3OYWB 1W6OA 4HL0A 1GNHA 4JRAA 2C9AA 1UL9A 2EXJA 2EXIA 1F31A 1X50A 1MR5A 4GALA 2GDFA 1SLBA 2UWBA 2ZGPA 3UJOA 4WVVA 1ZM1A 1WCSA 5CA6A 2CTVA 3M3QA 2GMEA 1KDMA 3WHTA 2NN8A 1H30A 2ZGNA 4Q1RA 3IPVA 3SH4A 2WLQA 4PBOA 4Y22A 4YG3A 2ZGRA 3ENRA 3RQ0A 2A5ZA 3PMEA 1QF3A 4XJ9A 2ZABA 3OY8B 2WT1A 4Y26A 2NP0A 3WDUA 4GKXA 1HQLA 1QDOA 4LBMA 4PBPA 3WDYA 1LGCA 2EALA 4FPCA 3WUCA 5F5QA 3AZVA 3ILNA 3NV2A 1GYKA 1N1TA 1FX5A 2PHUA 4C1XA 5JOWA 4WV8A 5IUQA 5IK8A 3PVOA 3GNEA 4FP3A 1ZA4A 2KM2A 4CZSA 3FLRA 5H9PA 2ZHNA 1LHOA 1BJQA 1WW7A
chains in the Genus database with same CATH superfamily
3LEMA 3K48A 1WKYA 3KT7A 4IV1C 4PDWA 2Y6FA 3E1F1 4AWDA 2WNUA 1NZIA 2Y6HA 3MPBA 5A3TA 4OQ9A 1O59A 1TMF3 2X53S 3PUAA 2AZ5A 2V4VA 2YDEA 3NQHA 4M0HA 2C4XA 1U5ZA 5J7MA 5DAVA 1W2NA 3JD72 2HWE1 2SLIA 4Q4W2 3RI8A 3OPTA 1OD3A 2O8QA 4N9HA 5FCCA 1RMU2 5APAA 4P9JA 5H9RA 3WNNA 3ZSJA 2RR13 2Y34A 4N53A 3VBSB 5DAPA 3D5OA 2DBIA 4NO4A 4Y1XA 4EWDA 2B39A 3WV6A 4PHZA 1LOAA 4P5YA 3WLUA 2QFEA 2ZGUA 1CAWA 1BQPA 2WNEA 4A6SA 3BKZA 5LEJA 1MEC3 2GNMA 2DCTA 3NNJA 4RGGA 5EHDA 3LA7A 5IK5A 1D0GA 4M3CB 5JAXA 2IFWA 1RUJ3 3H1MA 2P2KA 2W5FA 4TN7A 3VKNA 1V6MA 5DPNA 2VMEA 1CGPA 1ZBA1 5IK4A 5JLVA 1CPMA 3RZLA 2HEYF 2B4KA 2RS32 4ZPIA 1LULA 1QOSA 2D5FA 2OQ7A 4CSWA 4Q26A 5BNOB 3S30A 5K0UC 4FOVA 3RG0A 2XH6A 3I4IA 3UGGA 4K3UA 3DF0A 3IDAA 3D6EA 2J1AA 4MGZE 2GZWA 4CDUA 3C8XA 5FPZA 1UYYA 4OI1A 4XQ4A 1VMFA 4QM8A 4E8CA 1GFF2 4Y22B 4RQPA 5L19A 1YCIA 3AYCA 3QLQA 1OD5A 4FTSA 3T30A 2W47A 4RSUA 3VUOA 3G7DA 3KV9A 1VBE1 1RUF3 2XQXA 4XIKA 1HQWA 2J1SA 5K8SA 4BQ3A 4QQOA 1REDA 3FBMA 5DUWA 5A7WB 2W87A 3SC7X 1QQP1 2GH8A 2YPDA 3J26N 3D0JA 2ID4A 1NLRA 1URXA 4GD4A 5EJZB 3RMXA 1LHNA 1JHNA 2VECA 4SBVA 1H8TB 1BZWA 1UYZA 5EWSA 2EVXA 5C3QA 2RDQA 1TEIA 4L97A 5I93A 1FMD2 4GH4C 1HJFA 5A3MA 2BUKA 4XJAA 3U37A 1BEV1 3KVBA 4C0HA 4ES8A 4WVMA 4LA3A 3RVHA 4AHWA 1DYPA 1HN1A 1DGLA 2J7MA 4CCNA 5HI0A 2R1DA 5IWFA 3CKHA 5FYZA 4EE2A 4LT5A 1SCSA 2RMU1 3AP6A 4J1XA 4XJWA 1JYIA 1XQNA 4K1YA 3LQCA 2VULA 3HN1A 1ZBE1 3JUUA 4LHNA 4EN0A 1U5YA 2ZACA 4Q4V1 3VB9A 4B29A 2RS53 1RUI3 5IAXA 3C7EA 3DPRA 3D3AA 4XF3A 4XCBA 2HWE2 4WM8B 5E16A 4ET7A 1OF4A 2GNTA 2WRAA 4XUQA 2VNGA 4N43C 4Q4Y3 4B8EA 4FXKB 2CWSA 2OIIA 3HVDA 4HPKA 4ZU4A 5KHKA 1V6NA 2DWRA 4P5HA 1W2TA 4M0NA 2XQRA 2ZMKA 4Q0UA 1VJ2A 3VD4A 4KWKA 1PX3A 1YEWA 1V6LA 2A71A 3GCWA 4EQVA 1NY71 3B00A 1EY2A 3OUHA 3WDXA 2PHXA 1W9YA 3I59A 1ZBA2 5C4WA 2NM1A 3FMGA 1O4TA 1DU3D 1PO21 1S0JA 5A7QA 1A8MA 2C9KA 1Z0HA 3LSDA 2WS91 4CDQB 4NHYA 3QCWA 2I45A 4GQ7A 5EYXA 3ZKUA 5EFUA 1QJY3 3WUDA 2D3RA 3PVEA 4UXAA 1F15A 1YQ5A 5FZ0A 3FFQA 3POWA 5FZAA 5IYYA 2QNKA 1B35A 1OQEA 3I2HA 2WFF3 3K51A 1P8JA 4CCDA 1RUD2 1UOGA 4OYUA 1VBE2 2GMMA 2FDHA 1Z7S3 1JW6A 4E9KA 1AR81 3LB9A 1W05A 3GZEA 3PMSA 3OEBA 1WBFA 3WP5A 4DUWA 2GC3A 4CDXC 2XR4A 3AP5A 2R071 4CVUA 3POJA 3FUOA 2X5IA 4AF9A 1KXGA 5FV3A 2VAUA 4DMIA 1BEV2 4LE3A 1UY1A 1VBB3 3NNFA 4GB31 1E5HA 3CDZB 1UYXA 2JIGA 3MI8A 5HXVA 4DY3A 3ES4A 1XPWA 1GLHA 1QOTA 4QPGA 3ZIWA 1HXS3 1ND3C 1Q8PA 2NPIA 4QHZA 2VZ1A 4P02B 4Q1PA 4FCAA 3TAYA 4P9YA 1ZBE2 3WNXA 2R063 1IKQA 1QWRA 3HAGA 4MSVA 4LE4A 2YGMA 2Q5TA 4Y3OA 4YVWB 1UZZA 2MNGA 1RUC1 4K1ZA 3RZMA 4ATFA 2QQUA 1AVBA 1S0CA 2ADEA 3HT1A 2ET1A 2VMDA 4AI0A 1K12A 4BQWA 5A3UA 1AR72 2DCYA 5D2AA 4URTA 2YMZA 3WQBA 4AEDB 3NRUA 4UBGA 4I0AA 3O12A 5CAZA 4MGTA 1GSLA 1LOBA 1ND2B 3KGLA 4I0WB 1EUUA 4CU9A 5A1AA 4BYYA 2AGSA 4COVA 4DS0A 1NY72 1XNKA 3NKGA 4X6QB 3BU7A 1HX6A 3DN7A 5FREA 3ZXAC 1UXXX 4AEKA 1GQHA 3PTYA 4IEOA 3LEGA 5EZWA 3HT2A 1CAXA 5A7SA 2DCJA 2P17A 3ZLIA 4CDQA 1PO22 2A3WA 4XTMA 3ZKYA 1UKGA 5JMOA 3L2YA 1GNZA 5CB7A 3IB3A 4JQRA 5GZGA 2WS92 4QXBA 5F5CA 3RRDA 5HV4A 3VHPA 5I91A 3J7LA 4LBQB 1S4CA 4Z2AA 2P5BA 3N9PA 4A41A 2DDUA 4OHWA 4C90A 3MICA 2NLRA 3TEZA 4XJZA 4MHRA 3VHRA 4L92A 3BUCA 1PMJX 4CXXA 4YG6A 5T5JA 1FOD1 2J1UA 2BGOA 3KSCA 4A45A 1AR82 3T2OA 2VD7A 1R64A 2DVBA 5IK7A 4IXLA 2AENA 5BNNA 3AZWA 1D7PM 3POGA 4PLNA 4EN8B 1US3A 3RJ2X 3ZFGA 1UPIA 1D4M1 1Q8SA 2R072 3GJAA 2DVFA 4LOSA 4BQ1A 4YW4A 1TG7A 2A70A 2YZ4A 3NL1A 4BXSV 4QX2A 1NCRB 2ZX2A 3ZSMA 4RS5A 4RD7A 4Y20B 1WW5A 1MS0A 4IETA 3ZFEC 2FD8A 2PTMA 4B4RA 1QJFA 3KQRA 4LTAA 4RFRB 5LBCA 4Z92B 1C8M3 4XF4A 5FY9A 2Z2SB 5FK8A 3H1WA 4IV1B 1VRH1 4JGZA 1XE0A 4EROA 5A33B 4TYSA 5FY4A 3W59A 1Q56A 1FAYA 1JBCA 1RC6A 3LEIA 3CZJA 1RUC2 4BK5A 4CUBA 1LOFA 3L2HA 4HOOA 1AYM1 1DF0A 1OFNA 2XOMA 2XXZA 1W6QA 2VVDA 2ZXQA 4GWJA 1S0BA 5KXDA 4BM8A 1PK6A 5FPAA 1E5IA 2VZSA 1ND2A 2JB8A 2VZUA 1O7FA 4PJYA 3AL5A 3PVNA 3N3HA 3ZYFA 1W3XA 2QUOA 3D4KA 4BIFA 4Y1YA 2OQ6A 4LKFA 5FRAA 3WD5A 3JB4C 3VZKA 1NCQC 3ASIA 1F5JA 2JICA 3J8F3 1CJDA 1BHGA 2OS2A 3KM5A 2YU2A 3NWKA 4B3NA 1YWKA 5A1FA 5A32B 3BTAA 2YGLA 5EJ1B 1DYOA 3A22A 4E4DX 2QDNA 4F7ZA 3H3ZA 1ENSA 2VMIA 4CCMA 1ULCA 2HYKA 1PVC1 2IXLA 4CPBD 2IXJA 3Q8CA 1JYWA 1NA1C 1UN1A 3RSJA 4YLZA 2ARAA 2W92A 2VZTA 5KWRA 2CWMA 2BOIA 3E5QA 2HJIA 4C0BA 2SBAA 2W1UA 2NQYA 2QKDA 3WP4A 5AC93 3H1YA 2VNVA 2A6VA 2V09A 1FOD2 4PDWC 2WWSA 5FY5A 5A3OA 2JDPA 2WNUC 5FZ6A 4D0QA 4H7LA 1SMVA 2JE9A 3O1SA 5KXBA 2GSYA 4BJ0A 3VBHA 2W46A 4BHPA 2HWB3 1D4M2 3FHQA 3H42B 5E88A 2VY0A 3ZFFB 1GZCA 1D0HA 2DFBA 2XG3A 4YG0A 3WW3A 1XB9A 2BZDA 2E9QA 4N53C 1EV13 1BKZA 4GH4B 3SXWA 5FXXA 4XMAA 4BQ2A 4YRDA 3ZM8A 3KLSA 3IWZA 3WX5A 3AJZA 5F2SA 3U4XA 2YPJA 4EZ4A 1NE6A 2ZBJA 1KFXL 2ARCA 2XKPA 1YO8A 3LIHA 4N90A 1RL3A 3OGGA 1VRH2 1QDCA 1WD3A 3MPPG 4NAMA 2CGPA 1JYNA 2BRTA 2OKXA 1G9DA 1RUG1 3M3IA 2X05A 3O1UA 3IT8A 2V4AA 1HQNA 2WUHA 4NHMA 4QDQA 3C7HA 5CG8A 5FY8A 1AYM2 3V56A 4Z1VA 1R093 2IXKA 4NRPA 3DYPA 1KRIA 4R8HA 2RJKA 2KXLA 2R32A 4N43B 4MGKE 3SKJE 4MH0E 4RL7A 4CDUC 1JHJA 1OVPA 1JZ7A 1FXZA 3AYAA 2DYCA 3B9IA 3RI9A 1IKPA 5JOZA 1FV2A 3AFGA 1MVQA 1DP0A 2XB6C 3CF6E 3LWCA 1IZ3A 1C5IA 2E51A 2GAUA 3KV5A 1X9TA 3WVJA 4JTOA 2VMGA 2GH2A 4XVHA 3CNAA 1BLZA 2H6BA 2Y33A 1DZQA 1TME3 5KHHA 3TRSB 5K0UA 4KBBA 2O0OA 1GOHA 2LUWA 2LRPA 4QHOA 2EF6A 2FZ1A 2A75A 4FQ4A 1PVC2 1WMFA 2C24A 4A42A 2VC9A 1FPN1 3VKOA 4CUAA 5CBLA 4Q8KA 3WDVA 1ULPA 1V00A 1OQDA 4M4PA 2RS11 4GMP0 4EWEA 5GZEA 4Q4X1 5DG1A 1GWKA 5AVPA 2DBNA 4L2NA 4QKDA 2UURA 3OY8A 4NHLA 4XUNA 5IVEA 1VP6A 1DZTA 3FX3A 3VKMA 2XWJB 5JZGA 3QD6A 3DPRC 4L0PA 4AVSA 3V0BB 3PUIA 4QPYA 4CDXB 1POV0 4IEWA 2YY1A 4WVZA 3NJZA 2W95A 2WA3A 3NMBA 2WJSA 4W65A 1Q8VA 5D1IA 1BCXA 1JXNA 2F6BA 3TEYA 4HKWA 1S2EA 2MEV3 4JKKA 1YI9A 3OD0A 4KH9A 1WLCA 2Q30A 2WBKA 4HONA 3H8XA 1IS5A 1AXYA 2ATFA 3E5XA 1R081 1E5RA 3H7JA 1HRV3 4QU1A 5LEKA 3ACIA 5L9VA 5C9AA 3H7YA 1OSGA 1YQCA 1F35A 3H3LA 3T09A 4YWAA 4AOCA 4P9GA 5FBJA 1H8VA 1YHFA 5FOJB 1ND3B 4BA6A 1V0AA 4NN0A 3I3QA 5C4WC 3DEMA 1H9WA 1YC61 2YUEA 3DUIA 4L9BA 4DRRA 1W28A 1CVNA 3N7JA 4UI9L 2WQ4A 2BGPA 1L7RA 1NLSA 3PDQA 4META 4FAHA 4N43A 1CQ9A 3OGSA 1S0EA 2Y6KA 2WT0A 3TN93 3BYWA 2WABA 1OA4A 1SFPA 2G19A 2WT2A 3USUB 5FYIA 1SLAA 1DGRA 4YM1A 3K77A 1B35C 1RHI1 4QAWA 5A7PA 1SG3A 2R0HA 1V9U2 2D43A 4PQ9A 3GBGA 4EYUA 5C70A 4Y33A 4JRAA 4MGQA 4OMDA 1CAUA 4NRQA 4B4PA 2VCBA 5CFDA 1XJAA 1F31A 2ADDA 1ACCA 3MV01 2GDFA 2CDPA 1ZM1A 1W8UA 4IERA 5FMBA 2CTVA 4O9GA 2GMEA 1NUKA 1D2QA 1BK0A 1KGYA 2WO2A 2ZX3A 3WHTA 2X5IC 4Q1RA 4QGLA 3AM2A 1DGWA 1VMHA 2EA7A 2ZGRA 2XBO1 1FPN2 4QQHA 3HQRA 1GOFA 3MLJA 3WQ0A 1JU4A 1ZVFA 2NP0A 2WT1A 3ZDSA 1JZ3A 1REFA 2RE9A 3DYMA 1OF3A 2O8OA 3OGJA 3S57A 1OXCA 2RS12 2PAMA 4LMFA 3I2IA 1NQDA 3O14A 4Q4X2 4QPGC 2WNVC 4BQ4A 1H1IA 1UIKA 1LGCA 5EIYB 4QHBA 5ERLA 5FZFA 1TNFA 1WLTA 4CDXA 5IK8A 1YFYA 2XLFA 3PVOA 2QDRA 4PLMA 3ZDVA 5IFTA 4OMCA 4K40A 4MV2A 4OHYA 4PF5A 1K45A 3DECA 3ME2A 2VUAA 4INDA 3R4DB 4GA9A 4WBBA 2WFPA 3B02A 5JPNB 2P3KA 2JG8C 4F3JA 3U4SA 3KT1A 1RUE1 1XYOA 4Q27A 1H9PA 5FJHA 5DXDA 1FMD3 1YIFA 2HLEA 1NXD1 1W3VA 2VZ3A 2AR6A 3LA3A 3F95A 1SQ4A 5AFBA 3ZXEA 3N7KA 4UFIA 3ZFEB 4Y24A 4EZHA 2XONA 2R1BA 5JI7A 2EAAA 5GJ6A 4CU7A 3W5NA 1L7QA 1JH5A 3VDDB 3RMYA 2VE1A 2LM3A 4FPOB 2W3JA 3NAPA 3O1TA 4EWAA 3ZN5A 1ODNA 2Q1ZB 5JVVA 3W5MA 1RJ7A 1UMZA 4COWA 1AL21 3LPFA 2XGXA 4AFDA 1H0BA 4HANA 1LRHA 1TZOA 4AAXA 4I2OA 1H4HA 2V5YA 4ZONA 1RHI2 1PHMA 1S0DA 4C8DA 1Y4WA 4XF9A 3T2TA 1V70A 3PTRB 4LK7A 4GWIA 4L99A 1LKNA 3LF7A 3DL3A 4QDSA 3LZZA 3ALQA 2BYVE 3RYKA 1NCQB 4IL7A 2UU8A 5CVRA 1O3TA 5BNNC 4KG0A 2WKKA 3LDKA 3NSTA 4I01A 3ACHA 5F32A 1AR91 5ANQA 3WF3A 3ZFGC 3ZXDA 1X8EA 1ZBA3 3SHRA 2NZ9A 3I2KA 1W8OA 3ZYGA 1AR61 2Q8EA 4CP2A 3N7MA 2VBDA 4IQPA 3G6JB 3EMRA 1ZNPA 2UWCA 5FJKA 4PI0A 1WBLA 4JDOA 1NA1B 4NJ4A 2IXHA 2BVBA 4NIHA 3WG3A 4AGVA 4KGQA 3HN3A 1UY0A 4XFAA 2ZOEB 3S5AA 1ODMA 5A3PA 2AH2A 3AMPA 5ACA3 1SLCA 2R7EB 2TEPA 4UF0A 2PLV1 2WLPA 4JGZC 4PDWB 3SCGA 2VCAA 3T1MA 1JYVA 1ZRDA 2WNUB 3PNAA 2YROA 4HLTA 1DQ0A 5EJ3A 4CTEA 5FIXA 5JWPA 5FYCA 1QQP3 4MGSA 1W99A 4FPHA 5L9BA 2BDRA 1LOGA 1KITA 4OZXA 5H9QA 2KA3A 4JCKA 1PK6C 3NJVA 4CEWA 1RUE2 4HN0A 4N53B 4QD2A 4EJRA 2VPVA 2X09A 4OHXA 2VOWA 3MZHA 3WQ1A 3LPGA 3D0SA 3KMHA 5ABJA 3DKWA 2B9VA 1YFWA 2JD9A 4GZ9A 3VD3A 1N1SA 4IE0A 4FOWA 5I8TA 2RMU3 4DEQA 5BXXA 1OMIA 1S0FA 5CKQA 1QJX1 1ZBE3 4Q4V3 5FZIA 3AL6A 3GCXA 3MIBA 4P9WA 3ZXGA 4QPIA 5H9SA 4RHV1 4EN9B 2OPWA 5I0SA 4R9AA 3M3OA 4LEJA 1J3QA 3ECQA 4LQRA 1RB8G 5JDBA 3TBDA 4TLFA 3I3EA 5FFOC 1F9KA 1PIV1 4JC1A 3RYPA 3WHUA 4XAEA 4CDUB 1LECA 2I2SA 3MUZ1 4N8MA 4W6YA 3VZJA 3X29B 5FZ4A 1NCQA 5M0TA 2UWAA 2XJTA 1BBT1 4AGRA 5FXZA 2VXJA 3MLLA 3U75A 3MF6A 3VBHC 1AR92 3BTZA 4XFGA 1V6OA 3O0XA 3SQOA 1AR62 1ULFA 4ZY9A 2OUHA 1R1A1 2CYFA 3ST7A 1F8VA 2AREA 1TNRA 2WL1A 4XCAA 4E4HA 1DLLA 2JDHA 4UFMA 4E2QA 1A3KA 3LDBA 4QB1A 4FPLA 5J48A 4WVMB 2ZGKA 2YG0A 1WW6A 5I0DA 1LOEA 1W2AX 3VD7A 1KFUL 4NIAA 4IDZA 3IMMA 4A2UA 1B09A 2Y60A 2OZJA 1SDWA 4R9BA 2D7FA 2PLV2 1H2NA 1OUXA 2XUMA 2OW4A 1O4YA 4QDRA 3ZR5A 2HBTA 1CWPA 2VUDA 3U0ZA 1W2OA 4Y1UA 1M06G 4K20A 3DPRB 2W08A 2QZ2A 3MYXA 2HWD2 4GIQA 4XFIA 2L9LA 2D93A 4CU8A 2R073 2TUNA 2G9FA 1C4RA 1SLIA 4NWVA 1UNBA 3ZMOA 1NZCA 4HPKB 5CYYA 4FTEA 1GUIA 3QH7A 4N7IA 4XHXA 2ZAAA 4YM0A 2CSGA 2D6PA 4H2AA 1JYXA 4RR3A 4GB33 2P4EA 2DCZA 2Y0OA 4LJHA 3U78A 2WO3A 2QQKA 3GM8A 4XFFA 5HCAA 2D6KA 4MG2A 1NXMA 4HFSA 5F39A 3I59B 1AYN3 3ZYPA 1QJX2 2BNOA 5EQUA 4YYOA 5C4WB 4YNIA 4NMIA 2DURA 3MIFA 4RHV2 1H4GA 4S2HA 5FPVA 5C5TA 2JKXA 4LITA 3LAGA 2YC4A 4QX0A 4LO4B 5A7NA 3ZXJA 1GP4A 1SBFA 1PIV2 4FAGA 4Q8LA 2E53A 5FQ0A 4I3PA 1B35B 2CU5A 4YPJA 5FLIA 1WCQA 1RUD1 2Y6GA 4Z82A 5FUNA 3FHAA 4WVWA 1W39A 4NIIA 5F9TA 1BBT2 3HIFA 4AGGA 1KJRA 3RZZA 4U36A 1ZRRA 1OA3A 1KQRA 1MZEA 3KT4A 1ENRA 5L73A 4MXVA 4GMP1 4DNYA 5JZGC 1XE8A 2RJLA 3A0NA 3MV11 1RTVA 1JZ8A 4FTBA 1E57A 4YZ4A 1OKOA 4W8JA 1DZRA 4Y4YA 2VOTA 1R1A2 4YGCA 1FV3A 2X5IB 1J3RA 2Z5WA 3LIGA 4XE9A 1LOCA 2VTFA 1POV1 4QX7A 3HOBA 4JDNA 4XUTA 1ONAA 3VBFC 2R043 4ARYA 3SISA 5BY5A 2XVKA 5C9AC 2EICA 3H8UA 2CNAA 3GJBA 1LHWA 2D6NA 3KCXA 4QPGB 4WM7C 5GM0A 1RGSA 4XW3A 3WZ1A 2QQIA 5G05L 1I5PA 1JMUB 4OHVA 4MX3A 3JB8A 3K2OA 2W1WA 1Y43B 4PIZA 4D7TA 4TWTA 1D4M3 2BGCA 2HWF3 1AR71 2Y64A 4O61A 3HWJA 2X29A 3TNQA 3M4FA 2XKOA 1OLRA 2JG8B 3TNPB 2B5HA 4HT1T 2QQJA 4GULA 3M2MA 3R4SA 4K7JA 3W21A 5KBFA 2RM23 4MLOA 1VBA3 1XNCA 3WSOA 1VR3A 3TB0A 2G9ZA 5CFDC 5L7OA 2YHJA 2VMCA 3N36A 3BCWA 4TZDA 2VMFA 3C7GA 3VHOA 4HZFA 4Y5TA 2ZEWA 1LESA 1K42A 1CAXB 5FP3A 1S1AA 2CL2A 5B4XA 4HK8A 2YBKA 2CAVA 4J25A 1STMA 2P3IA 4CDWA 1VLNA 3B3QE 4ASLA 1HJGA 2YU1A 3J9SA 3I3BA 1CZTA 3WOGA 1YNAA 4NVPA 1AXZA 2N7GA 4OLLA 1OPMA 3RZGA 2C5DA 2A6WA 2D5HA 2VTXA 4IGPA 1FNZA 4IV3A 1DHKB 1UOJA 4Y1VA 4IW3A 5FPLA 5F37A 4Q5OA 2AACA 3GXUA 3IDBB 4XBQA 3ORJA 1TVGA 2CDOA 4FT8A 4XUOA 1XNDA 3B7MA 3FFZA 1ZRFA 1CJPA 3LEKA 1W6PA 4G4FA 4XC9A 5IATA 4S2GA 5BNNB 3N9QA 1GZTA 5FZ1A 4IGQA 2GNDA 2ZGQA 3ZFGB 4XAAA 1IQDC 5DZEA 1QJEA 3O0WA 4H7MA 3VBRA 4D8MA 2VZOA 2R16A 3POEA 5DN2A 1C1FA 4BPZA 2W52A 1PVC3 1UPSA 5FPXA 1TMF1 4RS5B 3IM0A 3VBUA 1H2KA 4O9EA 5FWEA 1G9BA 2WNVA 1JOPA 4PI2A 2WZR2 1PZ8A 4M00A 2GC0A 1QXPA 1GWLA 1RJ8A 3EBRA 3MIGA 4ARXA 3JZVA 4FQZA 2RR11 4JGZB 5LRSA 3NAPC 2AEYA 3QACA 3J4UH 1SFYA 5D8AA 3RWKX 5A6XA 2RDRA 4OHZA 4Q2FA 1W0PA 1MEC1 1DGWX 2JG8A 1LTEA 3JBG3 4FPKA 1W6QB 3LOBA 2YB7A 4H14A 4ZZ5A 3AYDA 4XXAA 1RUJ1 3PUHA 1PK6B 1F5FA 5T55A 5FO8B 3P3NA 4YVSA 2QBXA 3WCSA 2E32A 1KEXA 4X8PA 3CMGA 1RVF1 2IVIB 3ZR6A 1R1ZA 2O14A 5DDJ3 3ZSEA 4AI2A 1IPJA 3BN6A 1LR5A 5FZLA 4AYUA 5IFPA 2XJSA 4JTNA 1EAH3 2IZWA 1C5HA 3PJQA 4E2GA 1RUG3 2YFUA 3FJSA 5F5AA 3O0VA 1Y9GA 3E97A 2JDKA 5IVFA 5LA1A 1SBEA 1J59A 5JXIA 2BP6A 3WF4A 2WR9A 2EXKA 3QH6A 2GP5A 3KCCA 5FZ3A 5KXCA 5FO9B 2DUOA 1K5JA 2ZKLA 3K4AA 4IE6A 1HDKA 2FCUA 5FO7B 4CCEA 3OUIA 1VAMA 1J1LA 3IDCB 4TLGA 4W50A 2Y38A 3UK9A 3IPVB 3OTFA 4IEQA 1UZVA 1YQ6A 1GR3A 1W90A 2FCVA 3GZUC 3ZYJB 3HQUA 1W9TA 5HPOA 3ABZA 5J37A 3VBHB 3CEWA 1JYTA 2ZHLA 4JQTA 4NHXA 1GP6A 1FT9A 5KC6A 3W20A 1W8NA 4R4XA 4WZFA 4CEWC 4MYEA 2W1QA 1WMXA 4QXHA 5GZFA 3W9AA 1TMF2 2WSUA 2PQSA 1RUI1 2RS51 2ZGMA 3ACFA 1PZ7A 5ABJC 1FI2A 2RV9A 1X36A 2PXJA 2RS13 4QT6A 3IIAA 1TQ5A 2HH9A 2VNRA 2RR12 4CYDA 1LU1A 3O1VA 2XJRA 5C3PA 1O6UA 3DXTA 1O8SA 3I3DA 4HK9A 5F8PA 5SV8A 4QPIC 3KF5A 4PF1A 1GQPA 1MEC2 2FMDA 5I0UA 3PUQA 3KCYA 5LB6A 3VL8A 1XNAA 2ZA9A 4G3YC 1PGW1 5FZBA 5FZGA 3BPSA 1RUJ2 1ZA7A 2PYTA 2HWC3 5IJRA 1U12A 1MQTC 1CX1A 1W6NA 1QH6A 3UT0A 1ZRCA 4YGBA 4IESA 4B7KA 3HD8B 1QMJA 1I3HA 3VLBB 1RVF2 3RZKA 1R083 3BTXA 2H0BA 4XQDA 1W8FA 2W9XA 1QJY1 5FYVA 2K9ZA 5F7UA 4HL0A 5JR2A 2DFCA 1WGPA 5K0UB 2Y6LA 4LPLA 2WFF1 4A3ZA 1UQXA 2VQTA 1MR5A 3TEWA 2WWJA 1SLBA 2ZGPA 3UJOA 5CADA 4UBHA 1Z7S1 3ROUA 1WA6X 5F2WA 2WWUA 2GC2A 4WVVA 1WCSA 5CA6A 4LUKA 1W8ZA 1F4HA 2NN8A 3EXUA 1H30A 1RHI3 3IPVA 3KHCA 4LHLA 4FO9A 2WLQA 4HKOA 5FAXA 1QF3A 1COV3 1US2A 2JG9A 3OY8B 1PO13 4MGIE 1A34A 2CGOA 4GKXA 1QDOA 4LBMA 3WDUA 4PBPA 5C8CA 5JZGB 1VBB1 1H2MA 2EIDA 2BW8A 1HRI3 2J1RA 3S5QA 3WUCA 4FPCA 3IIIA 3LFMA 4LO5B 3AZVA 2PMWB 1GYKA 2LROA 2W1SA 5JOWA 2QQPA 1M4WA 3Q8BA 3ITQA 4FP3A 4GAZA 2KM2A 4IEZA 2YBSA 5IAVA 5JIAA 4FSJA 2R061 2XBO3 4D7YA 2QTWB 2RS52 1RUI2 2VU9A 3VBFB 4OFGA 1OURA 5CISA 1QXJA 1LGBA 3OBZA 4RR3C 2P1BA 3W58A 2WZ8A 3AP4A 5FKCA 5C9AB 3PIJA 2JXAA 5E1RA 4Q4Y2 2UYAA 1G86A 1IQAA 4IE5A 4JHZA 4WM7B 1PZ9A 2BFUS 1NOVA 2D3SA 3J7HA 3KF3A 4E2SA 5FZHA 5GLVA 5GLZA 3J7MA 1UWWA 5FMDA 3WP3A 4A44A 1PMHX 5D21A 1GWMA 2HBUA 4DOUA 4E4SA 1PGW2 4AI1A 4JV4A 2VMHA 3ZN6A 4AVAA 1HIXA 4D69A 4FOYA 4G9SB 1CESA 1DCSA 4QQPA 1V9U1 2BFUL 1RUE3 1WCDJ 3P6BA 4OUEA 5CKMA 5EXOA 1TE1B 5T50A 3ZSLA 4X6RB 2A6XA 2BWAA 2V73A 5FMOS 3WNOA 4AI8A 1Z78A 2ZAHA 1C57A 1WLDA 3B93A 1CAUB 1O8PA 3VL9A 3VZLA 1QJY2 4Z2WA 5CFDB 4LULA 3ACGA 4LOTA 4U2AA 3I7DA 1ASJ3 2ES3A 2R0FA 3M1HA 4IUGA 4F8AA 1CN1A 3C2UA 3NJYA 3OUJA 2IXIA 4FBFA 2YXSA 3CJXA 4XF1A 2WFF2 3CBNA 2VR4A 5LA2A 5FMOL 4R52A 1Y3TA 3AJYA 1MVEA 1XBFA 3KS7A 5J96B 1Z7S2 1AL23 4JRLA 2WO7A 1PNGA 3POSA 4SLIA 3BI3A 4IEYA 2IFRA 1W9SA 2BVVA 3OSDA 1W06A 5FPBA 1NT0A 3VV1A 4BH9A 4URAA 2F17A 4AHZA 4R9CA 1W04A 1VBD1 4RFT0 5CZKA 4COUA 1QJU3 1JI6A 2XDVA 3OOXA 5GALA 1AX1A 4F83A 1MPXA 1DIWA 3ZPOA 1S0GA 4Q0QA 1QNWA 1VBB2 3PU8A 3ZX7A 4BISA 5A1LA 5G04L 1AR93 2UY9A 2XMLA 2R30A 4XACA 2GN7A 1QHDA 1AR63 1C8M1 2CY6A 5DQ0A 5FP4A 3VBFA 1YJLA 2R062 5IVCA 3LOIA 3SMHA 5GZCA 3RZJA 5FYUA 3U07A 3AP9A 2YV8A 5JXJA 4P9XA 4CXYA 4QX8A 2W0XA 1KDKA 1POQA 3FWEA 4JKMA 4NOTA 1Q8OA 4WM7A 2P3YA 1JTZX 3VBOA 5JSOA 5L7OC 5BPXA 2A3XA 2IUWA 3AXEA 3Q8FA 3VBSC 4N7UA 5LA0A 3FLTA 1JOJA 3APBA 3NAPB 5BUVA 4CDWC 2JDZA 3VDAA 3JD73 1O3RA 2ILMA 4Q4W3 5JR7B 1XNTA 2I07B 2XUEA 1RMU3 2YC2A 3ZXFA 2YYOA 4NPMA 4E8DA 1BVVA 4IV3C 3S7EA 4J6GA 5FY7A 1LEDA 4NWWA 4RGKA 4XIOA 1PGL1 1G9AA 1A78A 1YJKA 2GU9A 1ZREA 4UFKA 3K75B 1RXGA 3NVCA 3E6DA 1WMDA 5FZKA 2Q8OA 5HCHA 2PHTA 4EN6B 4NIDA 4GKYA 2RS33 3WW2A 3VHNA 4DY5A 2QQOA 1QKQA 2PN5A 2PHRA 3OGVA 5AC91 2BJSA 4MUVA 4M3CF 4J1WA 1Q5OA 2JJ6A 3ES1A 2D6LX 2ORZA 3VBRC 4AHXA 3AMNA 4DO0A 5E8AA 1AZDA 4XXPA 4FP2A 3NW4A 1SZBA 1A6CA 4OI2A 1T6GC 3VBUC 3BVCA 3GYDA 4BU2A 3NNMA 2W39A 1AUYA 1OVSA 1SDDB 2DU0A 2ZGSA 4NPLA 1VAKA 1VBD2 2QQNA 5E6HA 5CKNA 2EXHA 3WNPA 3A0KA 4Q0SA 3OBTA 4UF0B 3K4ZA 4JGYA 1OLME 1BBT3 1VRBA 1EV11 3THCA 5LBEA 1DQ2A 2A7AA 1UMIA 4IEUA 5D8AC 4CP9A 2QQMA 5CG9A 3MW2A 1A8DA 2EIGA 1WZXA 1QEXA 1CX4A 3AKQA 3NNGA 4NPRA 4P00B 4KQ7A 1V6KA 1CIYA 4X8NA 2Y6JA 1C8M2 2BOJA 3RDIA 3LSEA 4AI3A 5F1RA 1R1A3 1WCUA 4CEWB 3UESA 1NAEA 5FY1A 4ISRA 1I6XA 4QX3A 4YVSC 4HVQA 2OXBA 3D82A 2FDIA 3HBZA 4HBNA 1UW8A 2VQAA 3SEEA 4PT6A 4WM8C 3RS6A 4KL1A 5ABJB 4W6XA 1R091 4LBOA 3ZXKA 4LIVA 4K6BA 3SCFA 3IAQA 1YUDA 1XYNA 2ARBA 5IVBA 2OVUA 3ZYHA 3ZYBA 1YI7A 1W9FA 4BB3A 1HN0A 2HWE3 2Q1FA 3GHNA 4ASMB 3MFAA 3C7FA 1GOGA 4QPIB 4XOGA 3SEPA 3R0RA 2ZS6B 1W0OA 3J8F2 3SH5A 1PGSA 4A3XA 4DQAA 2HKXA 5FBZA 4XDPA 5JSRA 1I1EA 1CR7A 2UY8A 4RA0A 2ZMNA 4Q0VA 1SFNA 1PGL2 1SBDA 4HMZA 2E7TA 2DV9A 4K9SA 4KWLA 4FFGA 4IE7A 5E89A 4AVTA 4V2WA 3UYJA 3WNKA 1UCXA 3URFA 5AVAA 3WY6A 3CJIC 5IVYA 3KZ4C 4PCRA 5F5IA 1OT5A 4FPYA 3KV4A 4H3WA 5AC92 2ZHKA 4XURA 4MXWA 3BOWA 4LLFA 4DXZA 2Q8CA 1XU1A 2ZZJA 3OJBA 5FZOA 2X10A 1EUTA 1OOPA 5A3WA 1FYUA 4NHKA 3C3VA 1UZWA 1VMJA 2HWB2 4XZPA 1RXFA 5F3GA 1OQ1A 3ELNA 2RDNA 4HSLA 3WNMA 4XFCA 1UU4A 1IGOA 4OULA 5DAWA 1O5UA 3VZNA 3HPNA 4BZ4A 2WNOA 1RUD3 1UAIA 1N1VA 2ZGLA 1VBE3 4LO8A 4BLJA 2D6MA 2WZPP 1EP0A 1EV12 1UX7A 2CHHA 2KD7A 4I0BA 2BU9A 2WA4A 5DUXA 1ALYA 3WG2A 2MEV1 1YFUA 2ZCWA 1FNYA 1PM4A 3ZMNA 2HWD1 5FLHA 1HRV1 4K8RB 4M3CE 2YFZA 2BTVC 2J1EA 5GZDA 5FOBB 5LRRA 1BEV3 1ULOA 4FFFA 2OZ6A 1VIWB 5CU1A 5JXHA 4NR1A 1ZYBA 5FYYA 3T08A 4OCTA 4AW7A 3TYJA 1HB4A 4YM3A 4YW3A 5HBAA 1K5MA 4GJZA 4RR3B 1JUIA 1QH7A 1R092 2GP3A 2LS6A 2PHWA 3EHKA 3I2FA 1W6MB 5FZ9A 3TN91 4AFAA 5J36A 1W2UA 2XJPA 4YZ1A 4AVBA 1ZZCA 1HW5A 1O91A 4P14A 4IE4A 2D3PA 5K4LA 2XL7A 5T5PA 1RIRA 2ERFA 3ZFFA 1JZ4A 2GALA 5JCTA 1S55A 4ZHNA 4FPGA 2P37A 2QJVA 4LO6B 2VUCA 3MLKA 5IHRA 2EIBA 2ZX4A 4YFWA 2Q1MA 1MQTA 1AR73 1MACA 1PX4A 1ENXA 2MHFA 2QE3A 4Y5Z0 3UGFA 5A70A 5FWJA 1TME2 2ZEYA 1I5ZA 1KS5A 3H50A 5DABA 5FQ0B 4EV0A 1Y7BA 2WZEA 2YBPA 2OX0A 3LCPA 2JG9C 4JAAA 3GGLA 4AI9A 2H0VA 1T6BX 3V64A 1GV9A 3PIGA 5FTTC 2CAUA 3SITA 3IAPA 3IKWA 2XJUA 4KG8A 5C8CC 3E6CC 3M8LA 1DYKA 1IS4A 3WNLA 4XEZA 3FL7A 5BNPA 1PO23 2DF7A 5C3RA 5K7PA 3CZUA 1WWYA 1Q8QA 3BALA 3HJRA 4IEPA 2WS93 4R9DA 4D94A 3JU9A 3O1RA 3N9OA 3ZYIB 5SV5A 2ZEZA 4FI9A 1RINA 3GZTB 3GALA 4LR4A 2WQZC 2FDGA 2WAOA 1HKDA 4YW2A 3PURA 4JVAA 1SCRA 4A7KA 5FUPA 1Q43A 4IEVA 1LENA 3WG4A 4FOQA 3SH3A 3NJXA 3OB8A 1ZZ7A 2FCTA 2XLGA 3LD8A 1AR83 3RZHA 1EPWA 3Q9OA 2WIIB 4AK3A 3AP7A 2DCKA 4DXSA 2MEV2 1YQ2A 2VL4A 4CEYA 1AHSA 1IG0A 3BIEA 3RWNA 2OT7A 2JENA 1PMIA 1RUH1 5LK5A 3N35A 1HRV2 4PIYA 2Y0IA 3WDTA 4CPBA 3FC0A 3OPWA 3UJQA 5FMCA 1QJZA 4PQQA 5LCWL 3NNLA 1T2XA 2VH9A 1O3QA 2BQPA 3LKJA 2Q4SA 4LBJA 5ANNA 3S7IA 4AR2A 3T2QA 2VBPA 3KWVA 3UKVA 1W6MA 5EYYA 3VGIA 4TXWA 5FZ8A 2VQUA 4QGMA 3U10A 1F2NA 3AZZA 4FPEA 3VKFC 3TN92 3PVBB 3JQXA 4YZ2A 2RVAA 4BQ5A 3AVSA 5L7OB 2JB4A 4OQ8A 1JU3A 1OLMA 4COYA 4D6QA 2ZGOA 3O7OA 4MGYE 4XFBA 3WXPA 2B8MA 1EPZA 1RUC3 4N9IA 4IEXA 2QZ3A 3LE0A 3CO2A 2LALA 4CDWB 1VBC1 2VOXA 4QKFA 4QQLA 2R49A 2ZGTA 1G9FA 1XE7A 4LNVA 5FXVA 3F2ZA 2A6YA 4YM2A 5DUUA 2VCCA 5IVVA 4AFMA 1D4VB 4IV3B 1W6OB 3ZVXA 3B5LB 3AX4A 5GKAC 4CXWA 1L7LA 2D40A 3B94A 3OYWA 3AZYA 3WINE 3ZIXA 1XSRA 3J7NA 2PAEA 1RVF3 1QXRA 5FDBA 5HXMA 2KR2A 1KJLA 3GBWA 3EJKA 1W6PB 4UW4A 3ZXLA 4DIQA 1W0NA 2B9UA 1QNYA 4AQ6A 1CD3G 3IN9A 4XUPA 2DTWA 4ONUA 4ZS2A 1LHUA 1WMEA 2E63A 2J1TA 2B42B 3BODA 5ACA1 4BIOA 1GKBA 1XOYA 3VBRB 3HEIA 5FYTA 5JIUA 2EAKA 2CGNA 5FYHA 3MFCA 3M3EA 1UO9A 2C6SA 4LBNA 1FATA 4XABA 2K2SA 3N9NA 2G1MA 3K4DA 3VBUB 2WZR1 5LBFA 1X7NA 1OFSA 2WNVB 1N1YA 3VBOC 1FOD3 4QKBA 1O4ZA 3M3CA 4DXTA 4R4ZA 4Y1ZA 5J98B 1VALA 1CIWA 4FXGB 5FZCA 4JX0A 2ZPXA 1YIPA 1RUH2 1AJOA 1SLTA 5D8AB 3LGRA 2B46X 4IGOA 4KI5M 5LASA 3WF2A 2BERA 3T0BA 5A80A 3EQEA 4UW3A 1YXWA 3WDWA 2PFWA 1GQGA 4MO3M 1HB3A 4HN1A 5I8SA 1UMHA 1GP5A 5T54A 2PHFA 4DFSA 4DUVA 1OKQA 4YVSB 4QWNA 3LFIA 5B4NA 4KNCA 3H8RA 3I2OA 5BV6A 4XETA 5KHJA 1DDLA 3JCIA 3UV9A 3ZPYA 5FLJA 1C3HA 1VRH3 3KHBA 4XJUA 1LGNA 3VBSA 3T2PA 4I3GA 2C0ZA 4GJYA 4QGNA 4MADA 5KR7A 3CL1A 1U0AA 1WLWA 4A6OA 4ISQA 4WZCA 5DMYA 2JWPA 2HEWF 4BOWA 2DU1A 1AYM3 3ETQA 1VBC2 4M3CA 1DQ5A 4UW6A 2XJVA 1W6OA 5C3OA 2C9AA 1UL9A 2EXJA 2EXIA 3UGHA 5BNOA 3CIHA 1X50A 1OH3A 4GALA 2BV4A 2Y8KA 3VD9A 1J84A 3M3QA 4JGYC 4UT5A 4AHYA 2BPA2 1KDMA 2WO1A 4AQ2A 2ZGNA 5C8WA 1MZFA 4HETA 3UKNA 3E6BA 3CJIB 4Y22A 4YG3A 3ENRA 5FUIA 2A5ZA 1SEFA 4XJ9A 4FFIA 3A21A 4AEMA 1ZZBA 5ACA2 1HQLA 2WN3A 4QB6A 3P3PA 3WDYA 5FPUA 5A7WA 3VN4A 4E27A 4CA9A 3RNSA 2EALA 1W8HA 3NV2A 2VOKA 2XHNA 1QQP2 4D6SA 1H8TA 1AL0G 1JOBA 5J1XA 3GNEA 4KBZA 4CZSA 5H9PA 5B2GB 2ZEXA 2ZHNA 3SKVA 1BJQA 3EO6A 3MIDA 5F6LB 4LBKA 3ON7A 5LY2A 4YW5A 4D6RA 4UFHA 4XQWA 3N9LA 4ZS3A 3HNBM 4OUMA 3CHXA 3OPZA 2WYSA 3BIWE 1VE0A 3USSA 2Q0AA 5EV7A 1GBGA 3WF0A 5CEHA 1X82A 2RMU2 4XZUG 4B7EA 4ZU7A 3H8OA 2VW1A 1AYN1 2BBAA 3EB7A 5FP7A 3DV8A 3OBRA 4Q4V2 1W6NB 4WM8A 3EYPA 5DAQA 3R4UA 1CPNA 4XYXA 1OC1A 5FP9A 4MZUA 3OEAA 3T0AA 4XF0A 4KWUA 1SPPB 2GN3A 2VQ0A 5T5OA 3WCRA 5JOYA 4XMIA 4HKLA 4UWDA 2RJ2A 1ENQA 1RITA 3M70A 2J42A 1OUSA 3A4UA 1RUF1 3MBWA 1OOPC 3KVAA 3UKTA 4Z07A 1VAVA 2J22A 4Y5SA 5C33A 4AZZA 5FR3A 2PHLA 4TSVA 3M7AA 1DG6A 3AMMA 3H0OA 1BYHA 2AUYA 1V9U3 2VM9A 2D98A 3ZYRA 5BYNA 2TBVA 1JODA 3SNMA 4DPNA 4Q0PA 4NE9A 3I3MA 4DXRA 3AMQA 3HQXA 2E33A 1HV1A 1ST8A 3D8CA 3ILFA 3WG1A 1JZ5A 2JG9B 3CJIA 2DTYA 3V65A 2FMYA 1DLCA 2K46A 5FZMA 5C8CB 2JD4A 2R041 2XVGA 5CNAA 2QQVA 4DINB 3K46A 3T4HB 3BGAA 3POIA 5FKBA 4YZ5A 1UOBA 3MF9A 2XVLA 5DZFA 5KHGA 1VB2A 1J83A 1OHFA 2XHKA 3FE5A 1YRZA 1FPN3 3OG2A 5LK7B 2VGDA 3IMNA 3DXUA 2FDKA 2G4IA 3QBQA 3NV3A 5A6QA 1K5MC 1O3SA 4BQXA 3WQ7A 4A7ZA 4YFZA 1PVXA 4Q4X3 4Q4Y1 1KS4A 2A3YA 1ZZ9A 1N3PA 1LJ7A 1UY4A 3RPQA 4EN7B 2C1FA 1SACA 1LNSA 1V6JA 1VBD3 2HWF1 3A7QA 2JDYA 3AFKA 3MW3A 4QPWA 4ZU5A 2W94A 3P5BA 5CFCC 1RUOA 2D97A 1QU0A 2DUQA 1U5XA 2RG4A 4RYDA 3OBAA 3O1PA 1O5LA 3ACLA 4GWMA 3ZFFC 4GB32 3VDCA 4CRQA 3WW4A 2CV6A 2FBEA 2GMPA 1XC6A 1L3JA 2AEZA 2FHRA 1VBA1 2RM21 2VW0A 3H9AA 5JXGA 1UF2C 2W91A 4XILA 3GBFA 4YGEA 1BMV1 3ZN6B 1HB1A 4QKNA 1AYN2 1MS3A 2E7AA 4YVWA 1XSQA 1AJKA 2RDSA 4K21A 3VDDC 2IC1A 2PELA 4LHKA 3ATGA 1QIQA 1GMMA 1NKGA 1SPPA 5A3LA 5JI9A 1N47A 4OUSA 4Q29A 3MW4A 4QQ2A 1UIJA 4AEDA 5BNPC 5GLTA 3U14A 3JXSA 4AQTA 2VZQA 5IVJA 1W8TA 1LAJA 4YZ3A 1RUF2 1C1LA 3ZN4A 3I2GA 4OI0A 2BNNA 2JKBA 2ZTNA 3I2JA 3VZMA 2PQQA 2NMNA 4O65A 1GNYA 5FP8A 4BCUA 4V1PA 4ATEA 2ARXA 1CZSA 1Y9QA 4HG6B 5IT6A 1U5IA 3KGZA 3PU3A 3FLPA 4LBQA 2F4PA 2VVFA 4LKEA 5T3NA 1IG3A 5LA9A 1WW4A 2ORXA 4CEYC 3AXDA 2XL9A 1GZWB 2R042 2VZPA 1Y9MA 3SLIA 1GZ9A 4C91A 1HXS1 1ULDA 2A6ZA 5EPAA 3B69A 4BMEA 5BNQA 5JMCA 1H6YA 3JQWA 4LO7A 2ZJCA 3DCQA 1VB4A 3PLQA 2JDAA 1G7YA 5IW0A 5KC5A 2DVAA 3C7OA 5FYBA 3Q8AA 4GXLA 4GWNA 4P08A 4W4ZA 1WUVA 1OH4A 4FPJA 4AAPA 1UX6A 3KV6A 4CCKA 2BNMA 2EIEA 3T4VA 2VNOA 1E5SA 1NCRA 1D2SA 2HWF2 3JBG1 3VBOB 1G9CA 3BU0A 4AL9A 4Y20A 1W9WA 4Z8BA 5DUVA 4QU2A 4JZRA 4NROA 5A6YA 4UAPA 3MEPA 2P6HA 2VTXJ 2ZKNA 4HVRA 2A1XA 2NMOA 3AK0A 3OGRA 3P1IA 3NO8A 4HVOA 1AF9A 5FYMA 2RM22 1VBA2 3FUQA 3WR0A 3Q8EA 2E7QA 5HCFA 1BMV2 4IV1A 5DDJ1 5A33A 4I30A 2WSVA 2WC2A 4YW7A 2FZ2A 1MS1A 2WINB 1JZ2A 1UY3A 2Y26A 1WD4A 1EAH1 4CUGA 3N9MA 1XRUA 5I0TA 1PNFA 2VZVA 3AKPA 3S6PA 3ILRA 3HBKA 5FK7A 3UNPA 1YYNA 2V72A 2ETEA 4OZOA 4C1WA 1CZVA 2ZX0A 3I54A 5F3EA 2DVGA 4V2VA 4D3WA 3E5UA 2Z79A 4E4ZA 4KWJA 1AX0A 3PHMA 3POYA 4RQPC 5TSWA 4HXCA 4CCCA 2P6CA 1ZX5A 3INAA 4AG4A 3RJRA 1UU6A 3RFRA 1LEMA 4BWOA 1IS6A 5A32A 4ZKTB 3MDPA 4BLIA 1GICA 4ZZ8A 5FY0A 5KHIA 1IHMA 1N3OA 2NYYA 2P34A 3ZO0B 3BTYA 2VUJA 1SHWB 3FZ3A 3MHZA 5A7OA 1XYPA 1GZWA 3IZOA 4ASKA 4CE8A 1DBNA 3FBYA 3R05A 2JDMA 4KU7A 4UYBA 4JGYB 4H55A 4DB5A 1MS5A 3U1XA 1BXHA 1HXS2 3OD4A 4CP9B 4NRMA 2LTNA 2B7YA 1NQJA 1MZ5A 1SLLA 1H2LA 3VKLA 2E31A 2UYBA 4QX5A 3MGUA 3I97A 3RYRA 1W8WA 4NUBA 3WF1A 1F4AA 3IBMA 3T0DA 2GNBA 3R6SA 4MHUA 1NG0A 2Z42A 4DUXA 2Z4FA 1HLCA 1CAVB 1JYCA 5FZEA 5GLUA 3AKRA 4XHBA 3SCHA 4UOJA 1G6NA 3JBG2 2PLV3 2ZHMA 4BK4A 4GH4A 2JE8A 2HWC1 2YC0A 2G9GA 3K3OA 2QQWA 4LA2A 3AC0A 1REEA 4LBLA 3TEXA 2HWD3 2C26A 4YGDA 3J8F1 1MS4A 3PL0A 4XJ8A 2VZRA 3HNYM 5DDJ2 4BXFA 1GU3A 2JX9A 3B01A 5KXEA 1CONA 1EAH2 5BNOC 3L9JT 3GDBA 2O1QA 3PUSA 1RUG2 3VDBA 3N4MA 5T5LA 1I9RA 2J1VA 5LATA 4LKSA 1UZ0A 2ZMLA 1OPOA 2VOVA 3K3NA 1RUNA 5DZGA 1JS9A 4DEVA 1WA4A 3B9CA 1YQ8A 4XBNA 2OUJA 2XLAA 1UYPA 1QJX3 2WAAA 2OYZA 3A23A 1RYYA 1WCKA 2B45X 4B4QA 4TTGA 1LB2A 2D6OX 1UD1A 4RHV3 3WEZA 4MXWB 4KMQA 4Y4RA 4CCOA 4LKDA 1IS3A 3AKSA 1QY4A 5CIRA 1COV1 1QOOA 4QB2A 5FZOB 3BOPA 3CLPA 1PO11 2QCSB 1OOPB 2HWB1 1PIV3 1IOAA 1ULEA 1UZYA 4LXLA 4YW6A 3THPA 1LODA 2K0GA 2WN2A 1DQ4A 1HRI1 1H8TC 1ZZ6A 4YW1A 4AE2A 3FHIB 3NV4A 3RGBA 2E26A 2ZX1A 5GLWA 4MVTA 3V0AB 2HEVF 4P9LA 1MS9A 5T52A 1APNA 3T1LA 4YSFA 5C71A 1G8WA 5K9YA 2IVJA 1GANA 1NX9A 1OBNA 2DUPA 2VO5A 1ULGA 1S2KA 2QVSB 4HSJA 2E6VA 4PIXA 3AYEA 3NKTA 3U11A 2R6QA 5C6CA 1UKRA 3DGTA 4CP1A 5JSPA 4LLOA 4ES9A 3AZXA 1X8MA 4S2FA 4KU8A 3S0MA 1CAVA 1JUHA 3UETA 3V0BA 5JPMB 1BK1A 1J1TA 3N7LA 4QMAA 1K5MB 4BQYA 1K3IA 3ZOIA 1DQ1A 5DG2A 2Z69A 1V6IA 4NIGA 5CFCB 2HWC2 4UFJA 3O1MA 3GZAA 1UXZA 1PM7A 5ISLA 5A3NA 4A7YA 4B1MA 2OPKA 2WYFA 4XDOA 3O5SA 1R082 1RUH3 2AYHA 2I74A 2OA2A 2X8KA 4MOAA 5HCBA 3THDA 3WP6A 1ND3A 1J58A 1MS8A 1TME1 3GHMA 1AX2A 5J3UA 4LUMA 1MQTB 3I2DA 4KGGA 1ASJ1 2A73B 2VVEA 4BMBA 2VCMA 3HR9A 2P3JA 3OF1A 3WT3A 1OLQA 4CDQC 1C8NA 1W03A 2RHPA 2VXRA 1DQ6A 2VW2A 1LHVA 3THTA 1YFXA 1C28A 1NE4A 5I0RA 4DZGA 5LW9A 3USUA 5JOXA 3GF6A 4I02A 2ZZQA 4PLOA 3HMYA 4AVVA 3CQOA 4ITCA 4AFCA 5BNPB 1UY2A 4B1LA 4BE3A 5C5UA 5L36A 2QQLA 4L8QA 2IXCA 2JE7A 3I8TA 1XU2A 5F6KA 1QJU1 1COV2 5C7GA 4D7SA 1VBC3 1PO12 1JZ6A 3UL2A 5DAXA 4ZXEA 4XBLA 4L11A 1LU2A 1MZ6A 2PHDA 2XJQA 4JDMA 1HRI2 4O7XA 1N3QA 1DGRN 2ET7A 2BWCA 4LIUA 5F3IA 4RGAA 3V0AA 5FZ7A 2Q8DA 1YLLA 4I09A 2FDJA 5JUVA 3HNMA 1DFQA 4GMP3 1BVP1 2TNFA 3MIEA 2XBO2 1X9PA 2W68A 3OCPA 4RS5C 3TOJA 4CEYB 4P9IA 3ZSKA 2MPFA 2HYXA 4CP0A 3POBA 2PAKA 4ORFA 4UW5A 5EP9A 1Q3EA 3AMHA 1POV3 1AXKA 4FVVA 4YARA 1UOFA 4YVWC 2PA7A 4LK6A 4XDQA 4XTPA 4ZXKA 3KQ4B 4QM9A 2WZR3 4FPFA 3JD71 3MIHA 4CUCA 1QGLA 2JDNA 4Q4W1 5CFCA 1LOFC 1XNBA 5F3CA 3BB6A 1JN2P 4M01A 2BEOA 1RMU1 2VG9A 4QX1A 4W6WA 3AKTA 4DRVA 1KD7A 1S2BA 4LHSA 1LCLA 4AEDC 5LY1A 3IDEA 1IPSA 2D44A 2XWBB 2GC1A 1X33A 5LWBA 1ND2C 3ZFEA 1EYBA 4OVEA 4XFHA 2JIJA 2ENRA 4LORA 3NV1A 1S0IA 4QXCA 1OA2A 2DVDA 1ZZ8A 3H3UA 4CU6A 3POFA 1HB2A 1CAWB 3VD5A 3KB5A 2XPJA 3VDDA 2VJXA 4JHTA 3DKQA 4FFHA 2BBVA 1ASJ2 4AVCA 2IWGB 5C3SA 3WW1A 2H6CA 2JECA 5FXWA 3VZOA 5FZDA 3FN9A 2RS31 5A6ZA 2FQPA 4LBQD 5LBBA 4CCLA 5LZ6A 5J09A 3PJYA 2WQ8A 3OYWB 1GNHA 1NYWA 2JEMA 1AL22 1J3PA 3QOPA 4AFBA 2F4LA 1H1AA 4QXKA 4S2DA 5AFEA 1VPHA 3AB0A 1OI6A 1IPKA 2UWBA 1ZRIA 4A4AA 5HV0A 4AEJA 3LA2A 1H6XA 4CCJA 3MUY1 1QJU2 1XXNA 4RQPB 4UFLA 1UU5A 3KD4A 3O1OA 3SH4A 4JKLA 3CU7A 4PBOA 3RQ0A 1H1MA 4XPVA 4RN5A 3PMEA 4M4RA 2FDFA 4BDVB 2VBBA 2ZABA 4Y26A 2AC1A 4K8FA 3DYOA 3MO4A 1NLQA 5L9RA 3T3YA 1NCRC 4COZA 5I8YA 4AQSA 2WDBA 1FMD1 3LDRA 3ETPA 4OI4A 5F5QA 4AXOA 3ILNA 1NA1A 3BPZA 1N1TA 2LW8A 1FX5A 2PHUA 3TWIA 4C1XA 4WV8A 5IUQA 2JDUA 3AVRA 3I49A 1ZA4A 5FYSA 4NAOA 3FLRA 1HV0A 2V5DA 1LHOA 1WW7A 2W2IA
chains in the Genus database with same CATH topology
3K48A 4IV1C 3KT7A 4PDWA 4AWDA 2WNUA 3MPBA 1TMF3 2X53S 2AZ5A 2YDEA 4M0HA 1U5ZA 5J7MA 3JD72 2HWE1 2SLIA 4Q4W2 3RI8A 5FCCA 2O8QA 4N9HA 1RMU2 4P9JA 5H9RA 3ZSJA 2RR13 4N53A 3VBSB 3D5OA 4NO4A 4Y1XA 4EWDA 2B39A 3WV6A 1LOAA 3WLUA 2QFEA 2ZGUA 1CAWA 1BQPA 2WNEA 5LEJA 1MEC3 2GNMA 2DCTA 4RGGA 3LA7A 5IK5A 1D0GA 4M3CB 5JAXA 2IFWA 1RUJ3 3H1MA 2P2KA 3VKNA 1V6MA 1CGPA 1ZBA1 5IK4A 5JLVA 1CPMA 2HEYF 2RS32 1LULA 1QOSA 2D5FA 5BNOB 5K0UC 4Q26A 3S30A 4FOVA 3RG0A 2XH6A 3I4IA 4K3UA 3DF0A 3D6EA 4MGZE 2GZWA 4CDUA 5FPZA 4OI1A 4XQ4A 4QM8A 1GFF2 4Y22B 4RQPA 5L19A 1YCIA 3AYCA 3QLQA 1OD5A 4FTSA 4RSUA 3VUOA 3G7DA 1VBE1 1RUF3 4XIKA 1HQWA 4QQOA 1REDA 3FBMA 5DUWA 1QQP1 2GH8A 3J26N 3D0JA 1NLRA 1URXA 3RMXA 1LHNA 1JHNA 2VECA 4SBVA 1H8TB 1BZWA 5EWSA 2EVXA 5I93A 4L97A 1TEIA 1FMD2 4GH4C 5A3MA 2BUKA 4XJAA 1BEV1 4C0HA 4ES8A 4WVMA 4LA3A 4AHWA 1DYPA 5HI0A 1DGLA 2R1DA 4LT5A 1SCSA 2RMU1 3AP6A 4J1XA 4XJWA 1JYIA 1XQNA 4K1YA 2VULA 3HN1A 1ZBE1 3JUUA 4LHNA 4EN0A 1U5YA 2ZACA 4Q4V1 4B29A 2RS53 1RUI3 3DPRA 4XF3A 2HWE2 4WM8B 5E16A 2GNTA 2VNGA 4N43C 4Q4Y3 4B8EA 4FXKB 2CWSA 2OIIA 4HPKA 4ZU4A 5KHKA 1V6NA 2DWRA 4P5HA 4M0NA 2ZMKA 4Q0UA 1VJ2A 4KWKA 1V6LA 2A71A 1NY71 3B00A 1EY2A 3WDXA 2PHXA 3I59A 1ZBA2 5C4WA 2NM1A 3FMGA 1O4TA 1DU3D 1PO21 1S0JA 1A8MA 1Z0HA 3LSDA 2WS91 4CDQB 3QCWA 2I45A 4GQ7A 5EYXA 5EFUA 1QJY3 3WUDA 2D3RA 3PVEA 4UXAA 3FFQA 3POWA 2QNKA 1B35A 1OQEA 2WFF3 3K51A 1RUD2 1VBE2 2GMMA 1Z7S3 1JW6A 4E9KA 1AR81 3LB9A 3PMSA 1WBFA 3WP5A 2GC3A 4CDXC 3AP5A 2R071 3FUOA 2X5IA 4AF9A 1KXGA 4DMIA 1BEV2 4LE3A 1VBB3 4GB31 3MI8A 5HXVA 4DY3A 3ES4A 1GLHA 1QOTA 4QPGA 3ZIWA 1HXS3 1ND3C 1Q8PA 2NPIA 4Q1PA 4FCAA 3TAYA 4P9YA 1ZBE2 3WNXA 2R063 1IKQA 1QWRA 3HAGA 4MSVA 4LE4A 2YGMA 2Q5TA 4YVWB 1UZZA 2MNGA 1RUC1 4K1ZA 4ATFA 1AVBA 1S0CA 3HT1A 2ET1A 4AI0A 1AR72 2DCYA 4URTA 2YMZA 4AEDB 4UBGA 4I0AA 3O12A 5CAZA 1GSLA 1LOBA 1ND2B 3KGLA 4I0WB 4BYYA 2AGSA 4COVA 4DS0A 1NY72 1XNKA 3NKGA 4X6QB 3BU7A 1HX6A 3DN7A 5FREA 3ZXAC 4AEKA 1GQHA 3PTYA 4IEOA 5EZWA 3HT2A 1CAXA 2DCJA 2P17A 4CDQA 1PO22 2A3WA 4XTMA 1UKGA 3L2YA 1GNZA 5CB7A 4JQRA 5GZGA 2WS92 3RRDA 3VHPA 5I91A 4LBQB 4OHWA 4C90A 3MICA 2NLRA 4XJZA 3VHRA 4L92A 4YG6A 5T5JA 1FOD1 3KSCA 1AR82 2DVBA 5IK7A 4IXLA 2AENA 5BNNA 3AZWA 4PLNA 4EN8B 3RJ2X 3ZFGA 1UPIA 1D4M1 1Q8SA 2R072 2DVFA 4BQ1A 4YW4A 2A70A 2YZ4A 3NL1A 1NCRB 2ZX2A 3ZSMA 4RS5A 4RD7A 4Y20B 1WW5A 1MS0A 4IETA 3ZFEC 2PTMA 4B4RA 3KQRA 4LTAA 4Z92B 1C8M3 4XF4A 2Z2SB 3H1WA 4IV1B 1VRH1 4JGZA 4EROA 5A33B 4TYSA 3W59A 1Q56A 1FAYA 1JBCA 1RC6A 1RUC2 1LOFA 3L2HA 1AYM1 1DF0A 1OFNA 1W6QA 2VVDA 1S0BA 5KXDA 4BM8A 1PK6A 1ND2A 1O7FA 4PJYA 3PVNA 3N3HA 4BIFA 2QUOA 3D4KA 4Y1YA 5FRAA 3WD5A 3JB4C 3VZKA 1NCQC 3ASIA 1F5JA 2JICA 3J8F3 1CJDA 3KM5A 3NWKA 4B3NA 1YWKA 5A32B 3BTAA 2YGLA 4E4DX 2QDNA 4F7ZA 3H3ZA 1ENSA 2VMIA 1ULCA 2HYKA 1PVC1 2IXLA 2IXJA 1NA1C 1UN1A 3RSJA 4YLZA 5KWRA 2CWMA 4C0BA 3E5QA 2HJIA 2SBAA 2NQYA 2QKDA 3WP4A 5AC93 3H1YA 2A6VA 2V09A 1FOD2 4PDWC 2WWSA 2WNUC 4H7LA 1SMVA 2JE9A 5KXBA 2GSYA 3VBHA 4BHPA 2HWB3 1D4M2 5E88A 2VY0A 1GZCA 1D0HA 2DFBA 2XG3A 4YG0A 3WW3A 2E9QA 4N53C 1EV13 1BKZA 4GH4B 3SXWA 4XMAA 4YRDA 3KLSA 3IWZA 3WX5A 3AJZA 3U4XA 2YPJA 1NE6A 2ZBJA 1KFXL 2XKPA 1YO8A 4N90A 1RL3A 3OGGA 1VRH2 1QDCA 1WD3A 3MPPG 2CGPA 1G9DA 1RUG1 3M3IA 3IT8A 4NHMA 1HQNA 5CG8A 1AYM2 3V56A 4Z1VA 1R093 2IXKA 1KRIA 4R8HA 2RJKA 2KXLA 2R32A 4N43B 4MGKE 4MH0E 4RL7A 4CDUC 1FXZA 3AYAA 2DYCA 3B9IA 3RI9A 1IKPA 5JOZA 1FV2A 3AFGA 1MVQA 2XB6C 3CF6E 3LWCA 1IZ3A 1C5IA 2E51A 2GAUA 3WVJA 4JTOA 2VMGA 2GH2A 3CNAA 2H6BA 1DZQA 1TME3 5KHHA 3TRSB 5K0UA 4KBBA 2O0OA 2LUWA 2EF6A 2FZ1A 2A75A 4FQ4A 1PVC2 1WMFA 1FPN1 3VKOA 5CBLA 4Q8KA 3WDVA 1V00A 1OQDA 4EWEA 2RS11 4GMP0 5GZEA 4Q4X1 5DG1A 5AVPA 4L2NA 2UURA 3OY8A 4NHLA 1VP6A 1DZTA 3FX3A 3VKMA 2XWJB 5JZGA 3QD6A 3DPRC 4AVSA 3V0BB 4QPYA 4CDXB 1POV0 4IEWA 2YY1A 4WVZA 3NJZA 2WA3A 2WJSA 4W65A 1Q8VA 5D1IA 1BCXA 1JXNA 2F6BA 4HKWA 2MEV3 1YI9A 3OD0A 4KH9A 1WLCA 2Q30A 1IS5A 1AXYA 2ATFA 3E5XA 1R081 5LEKA 3H7JA 1HRV3 5C9AA 3H7YA 1OSGA 4P9GA 1H8VA 1YHFA 5FOJB 1ND3B 4BA6A 4NN0A 5C4WC 1H9WA 2YUEA 3DUIA 4L9BA 4DRRA 1CVNA 3N7JA 2WQ4A 1NLSA 4META 4FAHA 4N43A 1CQ9A 1S0EA 3TN93 2WT0A 1OA4A 2WT2A 3USUB 1SLAA 1DGRA 4YM1A 1B35C 1RHI1 2R0HA 1V9U2 2D43A 4PQ9A 3GBGA 4JRAA 4B4PA 1CAUA 5CFDA 1F31A 2GDFA 1ZM1A 4IERA 2CTVA 4O9GA 2GMEA 1D2QA 2ZX3A 3WHTA 2X5IC 4Q1RA 4QGLA 3AM2A 1DGWA 2EA7A 2ZGRA 2XBO1 1FPN2 4QQHA 3WQ0A 3MLJA 1ZVFA 2NP0A 2WT1A 3ZDSA 1REFA 2RE9A 2O8OA 3OGJA 2RS12 2PAMA 4Q4X2 1NQDA 3O14A 4QPGC 2WNVC 1H1IA 1UIKA 1LGCA 4QHBA 1TNFA 1WLTA 4CDXA 5IK8A 1YFYA 2XLFA 3PVOA 2QDRA 4PLMA 4K40A 4MV2A 4OHYA 4PF5A 3ME2A 2VUAA 4INDA 3R4DB 4GA9A 4WBBA 2WFPA 3B02A 5JPNB 2P3KA 2JG8C 4F3JA 3KT1A 1RUE1 1XYOA 4Q27A 1H9PA 5K8SA 5DXDA 1FMD3 1YIFA 1NXD1 2AR6A 3LA3A 1SQ4A 5AFBA 3ZXEA 3N7KA 3ZFEB 4Y24A 2R1BA 5JI7A 2EAAA 5GJ6A 1JH5A 3VDDB 3RMYA 2LM3A 4FPOB 3NAPA 4EWAA 3ZN5A 2Q1ZB 5JVVA 1RJ7A 1UMZA 4COWA 1AL21 2XGXA 4AFDA 1H0BA 4HANA 1LRHA 4I2OA 1H4HA 2V5YA 1RHI2 1PHMA 1S0DA 4XF9A 3T2TA 1V70A 4L99A 1LKNA 3DL3A 3LZZA 3ALQA 2BYVE 3RYKA 1NCQB 4IL7A 2UU8A 5CVRA 1O3TA 5BNNC 4KG0A 2WKKA 3NSTA 4I01A 1AR91 3ZFGC 3ZXDA 1X8EA 1ZBA3 3SHRA 2NZ9A 3ZYGA 1AR61 4CP2A 3N7MA 4IQPA 3G6JB 1ZNPA 2UWCA 1WBLA 4JDOA 1NA1B 2IXHA 2BVBA 3WG3A 4AGVA 4KGQA 4XFAA 2ZOEB 2AH2A 3AMPA 5ACA3 1SLCA 2TEPA 2PLV1 2WLPA 4JGZC 4PDWB 3SCGA 1ZRDA 3T1MA 2WNUB 3PNAA 2YROA 4HLTA 1DQ0A 5EJ3A 4CTEA 5JWPA 1QQP3 4FPHA 1LOGA 1KITA 4OZXA 5H9QA 2KA3A 4JCKA 1PK6C 4CEWA 1RUE2 4HN0A 4N53B 4QD2A 4EJRA 2VPVA 4OHXA 2VOWA 3MZHA 3WQ1A 3D0SA 3KMHA 5ABJA 3DKWA 1YFWA 1N1SA 5I8TA 4FOWA 2RMU3 5BXXA 1OMIA 1S0FA 1QJX1 1ZBE3 4Q4V3 3MIBA 4P9WA 3ZXGA 4QPIA 5H9SA 4RHV1 4EN9B 5I0SA 4R9AA 3M3OA 4LEJA 1J3QA 3ECQA 1RB8G 5JDBA 3TBDA 4TLFA 5FFOC 1F9KA 1PIV1 4JC1A 3RYPA 3WHUA 4CDUB 1LECA 2I2SA 4W6YA 3VZJA 3X29B 1NCQA 2UWAA 2XJTA 1BBT1 4AGRA 3MLLA 3MF6A 3VBHC 1AR92 4XFGA 1V6OA 3O0XA 1AR62 1ULFA 2OUHA 1R1A1 2CYFA 3ST7A 1F8VA 2AREA 1TNRA 2WL1A 1DLLA 4E2QA 1A3KA 4FPLA 5J48A 4WVMB 2ZGKA 1WW6A 1LOEA 1KFUL 4A2UA 1B09A 2OZJA 1SDWA 4R9BA 2D7FA 2PLV2 1H2NA 2XUMA 2OW4A 1O4YA 3U0ZA 4Y1UA 1M06G 4K20A 3DPRB 2W08A 2QZ2A 3MYXA 2HWD2 4GIQA 4XFIA 2D93A 2R073 2TUNA 2G9FA 1C4RA 1SLIA 4NWVA 3ZMOA 1NZCA 4HPKB 4FTEA 4YM0A 3QH7A 4N7IA 4XHXA 2ZAAA 2D6PA 4RR3A 4GB33 2DCZA 2Y0OA 4XFFA 5HCAA 2D6KA 1NXMA 4HFSA 3I59B 1AYN3 3ZYPA 1QJX2 2BNOA 4YYOA 5C4WB 4YNIA 2DURA 3MIFA 4RHV2 1H4GA 4S2HA 3LAGA 4LO4B 3ZXJA 1SBFA 1PIV2 4FAGA 4Q8LA 2E53A 5FQ0A 4I3PA 1B35B 5FLIA 1RUD1 4Z82A 4WVWA 1W39A 5F9TA 1BBT2 3HIFA 4AGGA 1KJRA 3RZZA 4U36A 1ZRRA 1OA3A 1KQRA 1MZEA 3KT4A 1ENRA 5L73A 4MXVA 4GMP1 4DNYA 5JZGC 1XE8A 2RJLA 3A0NA 1RTVA 4FTBA 1E57A 4YZ4A 1DZRA 4Y4YA 1R1A2 4YGCA 1FV3A 2X5IB 1J3RA 2Z5WA 4XE9A 1LOCA 1POV1 4JDNA 3VBFC 1ONAA 2R043 3SISA 5BY5A 2XVKA 5C9AC 3H8UA 2CNAA 1LHWA 2D6NA 3KCXA 4QPGB 4WM7C 5GM0A 1RGSA 4XW3A 3WZ1A 4OHVA 4MX3A 3JB8A 1Y43B 4PIZA 4D7TA 4TWTA 1D4M3 2BGCA 2HWF3 1AR71 3HWJA 2X29A 3TNQA 3M4FA 2XKOA 1OLRA 2JG8B 3TNPB 2B5HA 4HT1T 4GULA 3M2MA 3R4SA 4K7JA 5KBFA 2RM23 4MLOA 1VBA3 1XNCA 1VR3A 3TB0A 5CFDC 5L7OA 2YHJA 3N36A 3BCWA 4TZDA 3VHOA 4HZFA 1LESA 1CAXB 1S1AA 2CL2A 4HK8A 2CAVA 2P3IA 4CDWA 1VLNA 3B3QE 4ASLA 3J9SA 3WOGA 1YNAA 4NVPA 1AXZA 2N7GA 4OLLA 1OPMA 2C5DA 2A6WA 2D5HA 1FNZA 4IV3A 1DHKB 4Y1VA 4XBQA 3IDBB 4FT8A 1XNDA 3B7MA 3FFZA 1ZRFA 1CJPA 1W6PA 4G4FA 4S2GA 5BNNB 2GNDA 2ZGQA 3ZFGB 5DZEA 3O0WA 4H7MA 3VBRA 2R16A 1C1FA 4BPZA 2W52A 1PVC3 1UPSA 5FPXA 1TMF1 4RS5B 3IM0A 3VBUA 1H2KA 4O9EA 1G9BA 2WNVA 2WZR2 1PZ8A 4M00A 2GC0A 1QXPA 1RJ8A 3EBRA 3MIGA 3JZVA 4FQZA 2RR11 4JGZB 5LRSA 3NAPC 3QACA 3J4UH 1SFYA 5D8AA 4OHZA 4Q2FA 1W0PA 1MEC1 1DGWX 2JG8A 1LTEA 3JBG3 4FPKA 1W6QB 3LOBA 4H14A 3AYDA 4XXAA 1RUJ1 5FO8B 1PK6B 1F5FA 5T55A 3P3NA 4YVSA 3WCSA 4X8PA 1RVF1 1R1ZA 5DDJ3 3ZSEA 4AI2A