5DUXA

Crystal structure of the human galectin-4 n-terminal carbohydrate recognition domain in complex with 2'-fucosyllactose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
138
Chain Sequence
PTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-4
publication title Structural characterisation of human galectin-4 N-terminal carbohydrate recognition domain in complex with glycerol, lactose, 3'-sulfo-lactose, and 2'-fucosyllactose.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 30
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5duxA00
3VUOA 4ITCA 3B01A 4UW3A 5T5PA 4XJ8A 1ZM1A 5KXDA 2A3WA 4M00A 3WG3A 3ZSJA 2XG3A 3AP6A 3OY8A 1W6QB 3SNMA 3WZ1A 1JYCA 4PQ9A 1KRIA 3ILRA 1DFQA 2WJSA 4FVVA 1LOBA 3USUA 2ZHLA 2Z42A 5GZFA 2AREA 3ZXJA 4LBNA 1LGCA 3WUDA 2DTWA 2ES3A 3WDVA 1BXHA 2LTNA 1JN2P 2ZGTA 4YGDA 4BQ1A 3MW4A 2ARBA 2VH9A 1VAVA 1N1SA 2TEPA 3D4KA 3OY8B 3QCWA 1G86A 1RIRA 2D7FA 2VUAA 2ZABA 3IPVB 4LBKA 1N3QA 3M3CA 4XBQA 2W68A 1FATA 4ISRA 4XMIA 2VU9A 2EF6A 3N7LA 5H9QA 2A6ZA 2DVGA 4FOWA 4K1ZA 1LOFC 2PHWA 2YY1A 3KQRA 4YZ4A 2R0HA 1SBDA 2VW2A 4TYSA 4XTMA 4Y20A 3USUB 1UAIA 5GZCA 1Y7BA 3AZXA 2PHXA 3B00A 3AYEA 3OBRA 5DXDA 2D3RA 2DYCA 2CY6A 5JLVA 1WLWA 1Z0HA 2A6WA 3N36A 4FOYA 3RMXA 4XIKA 1EPWA 2DV9A 2ZKNA 3AJYA 3WG4A 2A6VA 4BLJA 4GXLA 5JOYA 3M3EA 2HYKA 3B69A 3NV4A 1S0IA 3JU9A 3VKFC 2V73A 3IN9A 3OGGA 3V64A 1JHNA 1SBEA 1DYPA 2GNTA 3ZSKA 5T55A 1XQNA 1AXYA 1IS3A 1V6OA 2DVFA 1SLCA 2ZGMA 3OPZA 5T52A 1WW6A 1F31A 2B7YA 3IM0A 2BQPA 5H9PA 3NV1A 1AXZA 1V6MA 2YZ4A 1HQLA 2EALA 4XDQA 1F5FA 2W39A 2DTYA 2WQZC 3WHUA 5EWSA 4AVTA 4BPZA 1KQRA 5GLWA 1GV9A 5GZEA 1YI7A 2WT2A 4YFWA 1H9WA 3ATGA 5IK7A 1GKBA 1HQWA 4XJAA 5HCFA 2A75A 1N3PA 4LBMA 5SV8A 5DG1A 1Q8OA 3BODA 4Q26A 3POSA 1BZWA 1W0PA 1IKPA 4JCKA 4R9BA 3RMYA 3INAA 2GNMA 4AVVA 3LSDA 2WSVA 3WG2A 3A4UA 1SLIA 3V0AA 1WBFA 3WCSA 1VLNA 3PMEA 1JBCA 4FPLA 4UW5A 5GLVA 1ZA4A 3O0XA 3PJQA 4H55A 1LHNA 5CAZA 2UWAA 1DGLA 2EAKA 2NMOA 5H9SA 2P34A 2D3SA 1UKGA 4FPKA 3RS6A 3N35A 3AP4A 4Y24A 4YM3A 4DQAA 3HMYA 2A6YA 2ZBJA 1LULA 3T1MA 3N7KA 5JOZA 1AX0A 2A3YA 2WKKA 4L8QA 4FP3A 3V0AB 1CQ9A 1LU2A 2DVAA 2WLQA 4YGEA 4C1XA 2YXSA 3O12A 1N1YA 4FPCA 1B09A 1SCRA 1OKQA 1QOOA 1AXKA 2PHRA 4XHBA 4YM0A 1V6JA 3AZWA 3RSJA 3TB0A 1ENQA 3AYCA 3SH4A 4XXAA 4LBJA 1H9PA 2GMPA 4U36A 3AP7A 1IS5A 2PHTA 3D6EA 4GWNA 2GNBA 3POWA 4F83A 4WV8A 1IS4A 1MR5A 1RINA 4GKXA 3VKNA 1ENSA 4U2AA 4XJUA 3UJOA 4P9WA 1DZQA 3HN1A 1GNZA 4FPGA 4RA0A 5JVVA 5T50A 4YM1A 1Q8VA 3I8TA 1WD4A 1WCSA 4AGRA 3Q9OA 3WUCA 1WLDA 5E8AA 4WVVA 1C57A 1D0HA 1URXA 3AYDA 2E7QA 2R49A 1LESA 1WBLA 2OUJA 2D6NA 3OBTA 1UL9A 1APNA 2SLIA 1S0BA 1WUVA 1R1ZA 5T5JA 4FPEA 1PZ8A 4W65A 4I30A 2CWMA 3AYAA 3L2YA 2ZGKA 3ZSLA 3ZYRA 1SBFA 2W08A 2CWSA 1LEDA 1PZ9A 4YG0A 2GALA 4RL7A 1QOTA 1N3OA 1QU0A 2LALA 5CBLA 2SBAA 2GN7A 1DQ5A 3AK0A 5KXEA 2A7AA 4GKYA 4CZSA 3NV2A 5JOXA 2UU8A 2ZGLA 1FAYA 3SLIA 1SACA 2AYHA 2JKBA 5JOWA 1SLAA 3WDWA 5F9TA 1CR7A 2I2SA 4FOQA 3WDYA 1NLSA 1BQPA 1LCLA 1LEMA 3CNAA 2NZ9A 4XE9A 5GLTA 1UPSA 5IUQA 4K1YA 4YGBA 3SH3A 1LOFA 2VY0A 4XMAA 2R16A 4YM2A 4Y1XA 5E88A 3ZSMA 2EIGA 2NYYA 3DUIA 1GSLA 1W6OA 4OZXA 1MS8A 1HKDA 2ZGRA 4LBLA 1AX2A 4BMEA 2DVBA 3RQ0A 1GZ9A 3ZXLA 1JYIA 1YYNA 5DG2A 3WG1A 3VKMA 1MZ5A 4HANA 3AXDA 3V65A 4AGGA 4M3CF 1CN1A 4AYUA 1G8WA 2ZGQA 2P37A 1V6KA 2ZZJA 4XTPA 3WHTA 4CTEA 5IK4A 1SLTA 4Y1VA 4Y20B 1TEIA 1WLCA 1ULEA 5T54A 1SCSA 3FLRA 1LOEA 1JXNA 2R1DA 1AJOA 1V00A 3H0OA 3N7MA 1LGBA 2YROA 2ZA9A 3NV3A 1JUIA 4FPFA 2OVUA 4KBBA 4YZ3A 1RITA 1W0OA 3ILNA 4FPHA 3TAYA 1QMJA 1Q8QA 1AF9A 4PF5A 4PBOA 1G9FA 3T1LA 4DFSA 1GICA 2E53A 2XB6C 3MEPA 1LU1A 3AXEA 3ZVXA 4P14A 1YRZA 1C1LA 4FPYA 1DQ2A 4P9YA 5GLUA 4XXPA 5GZGA 3A0KA 4GA9A 3O0VA 2KM2A 2NP0A 1JOJA 1Q56A 1GZWA 1S0DA 3O0WA 2D6KA 2VW0A 2CNAA 2A71A 4D69A 3AP9A 1LGNA 4XILA 3DGTA 4M3CA 3WVJA 2UWBA 1CPMA 3AX4A 3N7JA 4GALA 1MS4A 1A8DA 1GBGA 2G4IA 2GNDA 2ZMKA 3A0NA 5LK5A 1LHUA 2P2KA 1QNWA 5T5LA 4AWDA 3VKLA 1DQ6A 1LHOA 1UN1A 2H0BA 3GALA 4YW3A 2A3XA 1LTEA 5FRAA 4Y1ZA 1HLCA 1LOGA 1W6MA 4SLIA 3W58A 1VIWB 1JW6A 2P3KA 1WW7A 1AX1A 5JDBA 4LBQA 1GZWB 3BIWE 1MS0A 1LHVA 1UZZA 1QDOA 2PHUA 4XBLA 4YLZA 5GJ6A 4YW2A 3WNXA 2FMDA 2ZGOA 3U4XA 1DIWA 1X50A 4FPOB 5DUUA 4K20A 4YZ2A 2JJ6A 3OYWA 3WDTA 2FHRA 4Q2FA 2JDZA 1DLLA 3FLTA 5HCAA 3UJQA 3ASIA 3ZXEA 1LJ7A 3AZZA 5IK8A 1W6NA 1MS9A 5KXCA 1KJLA 1CJPA 1H30A 2A6XA 4M01A 4K21A 4P9XA 1WW5A 4YZ1A 3UL2A 2EXKA 1DQ0A 5EXOA 4Y1UA 4BLIA 3PVEA 1S0GA 2DVDA 4DRRA 1WW4A 1F9KA 3OYWB 4FP2A 5IT6A 4Q8KA 1FV3A 2C5DA 2YV8A 4R9CA 4XJWA 5EYYA 1DQ4A 1S0JA 3FLPA 3AZYA 1KJRA 3JUUA 1W6NB 3NWKA 1GZCA 1S0EA 4JRAA 4Q8LA 3APBA 1QNYA 3MW2A 3AP5A 2VXRA 2Q5TA 1UZYA 2WT1A 2AR6A 2DWRA 4LBOA 4NOTA 1ULGA 3M1HA 4IQPA 1D2SA 5GZDA 4Y22A 4BM8A 3SISA 1CPNA 1FNZA 3BOPA 3WCRA 1IOAA 5DZFA 1GNHA 2ZGUA 2PELA 4Q27A 1A3KA 3R05A 4Z8BA 1V6IA 3D5OA 2YMZA 2D3PA 3W59A 1UX6A 1S0CA 1BKZA 1IKQA 2D44A 5HCBA 4ATEA 3IPVA 4MYEA 2DURA 1V6LA 1C1FA 2AENA 2EXJA 3M3OA 4XOGA 4ISQA 5BYNA 5T5OA 1MS5A 4ATFA 4YFZA 1FNYA 2JE7A 3WLUA 1DYKA 1DQ1A 3M3QA 5DZEA 4XZPA 4ZKTB 1G7YA 2C9AA 2E6VA 1DHKB 4XHXA 4Y22B 1G9AA 2E7TA 5KXBA 1LOAA 3WOGA 1GLHA 1FV2A 2ARXA 5CNAA 3VV1A 5L73A 4CRQA 2GN3A 3I4IA 1I3HA 2D6OX 3FUOA 4FQZA 1HDKA 4R9DA 3FBYA 4LBQD 1LECA 1MS3A 2DU1A 1AZDA 3WV6A 1AJKA 3M2MA 2V5YA 1Z78A 4Q1RA 3OJBA 3AJZA 3ZXKA 4ZXKA 1CVNA 2WNEA 3V0BA 3AFKA 3WDXA 1OQ1A 1W6OB 4XBNA 3RRDA 4UW6A 1GANA 4Y26A 1NXD1 1LODA 2EXHA 4XJZA 2JE9A 2ZAAA 1ONAA 2P3IA 3B9CA 5AVAA 3ILFA 1A78A 1S0FA 2AGSA 4YG3A 5H9RA 1YO8A 2DU0A 1QKQA 4UW4A 2GMMA 3IKWA 3R4SA 1CIWA 3R4UA 4NO4A 1O4YA 5DZGA 1G9BA 2ERFA 4XIOA 4DRVA 1OFSA 2ZMNA 3QLQA 3V0BB 4PCRA 1SLBA 2UWCA 1GYKA 4GWMA 4FOVA 4BMBA 1YIFA 4BOWA 4YG6A 1O4ZA 1N1TA 1MZ6A 2JD4A 3WDUA 3LSEA 2W52A 1MS1A 3GNEA 1WD3A 1LENA 4YW4A 5GM0A 3SITA 2NN8A 1SLLA 4DPNA 1G9DA 1W6PA 2D43A 1MVEA 4Q1PA 1ULCA 4FPJA 3LCPA 1QDCA 2ZMLA 2DUPA 1FYUA 3T2TA 1IS6A 2D6PA 2R1BA 4R9AA 1V6NA 2ZGPA 4TZDA 2E51A 4M3CE 3MW3A 1ULDA 5F5QA 4YZ5A 2OUHA 3PVNA 1KDKA 4AVSA 1ULFA 3FFZA 3ZYPA 3IMNA 3VKOA 1YXWA 4M3CB 3KM5A 1FX5A 2NMNA 3ENRA 5EYXA 1J1TA 1W6PB 2A5ZA 2AUYA 2CYFA 3FUQA 4YW5A 3SH5A 4ASMB 1CONA 2UURA 2VW1A 3B3QE 2ZACA 3POYA 1QOSA 5DUWA 1MACA 3HR9A 3PVOA 5GLZA 5FREA 2JECA 1W6MB 1LOCA 1S1AA 1BYHA 1QF3A 2CTVA 3BTAA 2WT0A 1AVBA 2ZGNA 2GMEA 2WSUA 4LBQB 2DUQA 1LHWA 4Y1YA 2A70A 1N47A 1ENRA 1QGLA 1I1EA 4YW1A 1MVQA 3C2UA 2P3JA 2ZHKA 3AZVA 5IK5A 1BJQA 5GALA 3UK9A 4YGCA 1VAMA 5CA6A 3N3HA 1PZ7A 1C4RA 4FQ4A 1U0AA 2AH2A 1UMZA 2D6LX 2GDFA 2OW4A 2RHPA 4XJ9A 4DS0A 2ZGSA 2CL2A 1W6QA 3RG0A 4AGVA 2ZHMA 2EXIA 2ZHNA 4C1WA 2D6MA 3MPPG 5CB7A 4XYXA 1DBNA 1G9CA 5DUVA 3O5SA 1KITA 1CESA 1VALA 4PBPA 1N1VA 1SFYA 1KDMA 2R0FA 5E89A 2PHFA 3ZXFA 1Q8PA 4JC1A 5JMCA 4WZFA 4WVWA 5DUXA 3ZPYA 2DUOA 4HL0A 1Q8SA 2NM1A 2ENRA
chains in the Genus database with same CATH superfamily
2ARCA 3VUOA 3MZHA 1UYYA 5EJ3A 3NNLA 3WF2A 2E7AA 5EQUA 2QQLA 3PVBB 3AP6A 4KGQA 4OI0A 3OBAA 3OY8A 1W6QB 2CAVA 3WZ1A 1UY3A 1Z7S2 3QOPA 4PQ9A 5L19A 1U5YA 2XL9A 1KRIA 5FZIA 4FVVA 1DFQA 2WJSA 4N7IA 4QXCA 2RJLA 4IEOA 1JZ6A 3ZXJA 4K8RB 4LBNA 1ZBA1 5J37A 3WUDA 2DTWA 2Y6LA 1HXS1 1X7NA 2H0VA 3ZPOA 3J8F1 3WQ7A 4QPGC 1OKOA 2VJXA 3VZJA 1YJLA 4HZFA 1QJU2 2R073 1N1SA 3D4KA 3OY8B 1JYNA 2D7FA 4LBKA 2VUAA 5CB7A 3M3CA 2W68A 2VU9A 2XUMA 1HB3A 4FOWA 1FPN3 1QJX3 2YY1A 2R0HA 4NN0A 1H4HA 5GZCA 1AYN1 2ID4A 2VMCA 5CFDC 1DYOA 1VBE1 4Q4V3 2DYCA 5FMDA 1ZVFA 5KHHA 3N9NA 2J1AA 4LE3A 1WCUA 5F2WA 4I01A 2Z79A 4JGZB 4BXFA 4XPVA 4GMP3 3RI9A 5F7UA 4XFFA 2ZKNA 3AJYA 1OPMA 3KWVA 4A45A 2VVDA 3M3EA 2WO3A 3NV4A 2C0ZA 2YC2A 2OYZA 3IN9A 1OVSA 1UY4A 3F95A 4R8HA 3VZNA 5J48A 1XQNA 1ZZ6A 2DVFA 1SLCA 3IB3A 3S7IA 1CJDA 1FMD3 3VBFA 1LKNA 4X6QB 4BHPA 1WW6A 1F31A 4ZPIA 1YFUA 2YG0A 1ZREA 1PO13 2YZ4A 1XYOA 2W39A 2DTYA 2UY8A 5FPXA 4OHXA 1ENXA 5GLWA 1F8VA 1GV9A 1T6GC 1YI7A 4XAEA 1BEV3 1RUG1 3BTZA 1GKBA 4RQPC 1FOD2 1UYZA 1RB8G 1KS4A 1LNSA 3OPTA 5DG1A 3KV4A 4Q26A 3POSA 2QNKA 1W0PA 2CV6A 4A7ZA 2XHNA 1DGRA 4UF0A 3VDDB 1R081 3LSDA 4QKBA 3VBFB 1COV2 2DBIA 3TNQA 2OPKA 2VZPA 3H7JA 3ZM8A 4UXAA 3AMMA 4K7JA 3WP3A 2JENA 4GWIA 1LHNA 5F6KA 2EAKA 1F5JA 5LA2A 3K51A 4INDA 1ZBA3 3S57A 1XPWA 4FPKA 4AHYA 3RNSA 1HXS3 1QXRA 4D7SA 2XLAA 3J8F3 4FAGA 4BZ4A 3HMYA 2WQ8A 2HWD2 5BNQA 2QJVA 4UF0B 1GOFA 5L7OA 5IWFA 4L8QA 3MF9A 5SV5A 3GZAA 2NQYA 2XOMA 2K2SA 2DVAA 2YBKA 4XVHA 1ASJ2 3LF7A 3ZXGA 2BYVE 1PVC2 1B09A 3IZOA 2YC4A 1H1MA 1SCRA 4ZHNA 4OHZA 3CIHA 3TB0A 1AYN3 3CZUA 4FTSA 1WWYA 1NYWA 2J1EA 2VCMA 2WFF2 1VBE3 1H9PA 1YFXA 2XWBB 2YUEA 3GCWA 4M0HA 4GKXA 4U2AA 3DXUA 5CIRA 5FY4A 3CJIC 2OKXA 3UJOA 4P9WA 4EE2A 5IYYA 1DZQA 5L7OB 5T50A 4COYA 4AVAA 1Q8VA 1JS9A 4LQRA 1WD4A 4W6XA 3DN7A 1KD7A 1XE8A 5D21A 5E8AA 1IPJA 2XJPA 4X6RB 3UGFA 3J26N 1D0HA 4B7KA 1KXGA 4LOTA 4I3GA 5I8YA 4CDQC 1MQTA 1UL9A 2E26A 2YBSA 1RUG3 3OUIA 3SKVA 1WUVA 2DBNA 2D93A 2ZOEB 4UYBA 2BV4A 1J58A 4WM7B 3K46A 4ZU7A 5C5UA 2ZGKA 4G4FA 3SEEA 2TNFA 4EZHA 1OVPA 2CWSA 4MGSA 5FZKA 5ABJA 3MLJA 4YG0A 4RL7A 4H3WA 1QOTA 1QU0A 3R4DB 4HN0A 1ULPA 2GN7A 4N7UA 1W04A 2IWGB 1IGOA 3AK0A 3AM2A 3RI8A 3VBHA 3NV2A 4AL9A 3SLIA 1SACA 3E6DA 4Z92B 2O0OA 1UZ0A 1MQTB 3PMSA 1HJGA 1YQ5A 3MFCA 4Y33A 5F9TA 2QQJA 5FXZA 3ST7A 4K3UA 1DCSA 1LEMA 2WIIB 1XSRA 3LPGA 4A6SA 1PGSA 5DAXA 3PJYA 5GLTA 1NAEA 3D82A 5JI7A 4NE9A 5ABJB 1I5PA 2VY0A 4XMAA 5E88A 2JE8A 1W8NA 3TEYA 5LEKA 3THPA 2JICA 4WZCA 1OF3A 1W9SA 1GSLA 1W6OA 2P6CA 1MS8A 5F5AA 3ZN4A 4LBLA 1AX2A 3VBHB 5FY1A 4LJHA 1Y43B 2ETEA 3WG1A 1D4M3 1MZ5A 3IIAA 3KF3A 3B5LB 1PIV1 4M3CF 3ZN6A 1YQ8A 2ZGQA 4RR3C 2VAUA 4BQYA 2P37A 3NNJA 3WHTA 5FP8A 4CTEA 2PXJA 3OEBA 4EQVA 4UFLA 1GMMA 1NOVA 3FHAA 4C8DA 1JU3A 5FO8B 4Y20B 5LEJA 2AZ5A 3WP5A 4HONA 4CPBA 1UU4A 1SCSA 3FLRA 4L92A 4QKDA 5IK4A 1QJFA 2YPDA 3GM8A 4ASLA 1AJOA 1UW8A 5DAWA 2DCYA 1XYPA 4URTA 2BW8A 1J3PA 2YROA 5JWPA 1VBC1 1O5UA 3PIGA 4FPFA 4HSJA 4CVUA 1X8EA 3RZMA 3WF1A 4N43C 1QMJA 5DDJ1 1W3XA 3ACLA 1QQP1 4WBBA 4PBOA 2VTXJ 2J1TA 4RS5B 3POGA 1G9FA 4IEVA 5FZOA 5IHRA 4QGNA 1VAKA 2RS31 2VZ3A 4DFSA 2N7GA 3ROUA 1LU1A 5FKBA 2ADEA 4P9YA 4EN0A 4DXZA 4XXPA 2E63A 3W9AA 4D7YA 2KM2A 4DS0A 1Q56A 1GZWA 2QQVA 2VW0A 4NWWA 4OFGA 2XHKA 3CL1A 1CGPA 3MIEA 2OQ7A 1LAJA 3DGTA 3JD71 3WVJA 3UGGA 4XUOA 5CEHA 2WWJA 2VNRA 3RZKA 1MS4A 4LHSA 4BQXA 1A8DA 3A0NA 5LK5A 1AUYA 1O91A 2GNDA 5C8WA 2FDGA 1EAH1 3E97A 5A3UA 4AWDA 3THDA 1W2AX 3UETA 1DQ6A 2QZ3A 2W1SA 2VTFA 3GALA 2BOJA 3ECQA 5FMCA 3CJXA 5FRAA 1UYXA 1LOGA 4D3WA 1W6MA 4OHYA 1JZ3A 1AX1A 2XDVA 3I3QA 1RC6A 3L2HA 1GZWB 3BIWE 3HQUA 5GJ6A 1QDOA 1HV0A 4YW2A 5A7PA 4CCJA 2ZGOA 2GP5A 5A7WB 5BNNA 1OA4A 3U4XA 1QXPA 4PLMA 1X50A 1GWMA 4FPOB 5DUUA 4K20A 4YZ2A 2LUWA 2E31A 3OYWA 5FJKA 3WDTA 5CADA 3FLTA 5HXVA 3ZXEA 1PIV3 3KF5A 3BTXA 4XFGA 3BVCA 3MICA 2YBPA 1W6NA 1MS9A 5KXCA 5LA9A 2A6XA 1CJPA 4J25A 4JKKA 2DFCA 4LLOA 5EJ1B 4P9XA 3BI3A 2FCVA 4J1WA 4NJ4A 4SBVA 3WW4A 2VMGA 3AMQA 4HG6B 3PVEA 5BNNB 3ZOIA 5A7SA 1JZ4A 5T3NA 4MOAA 1ND3A 3OYWB 5F5CA 5IT6A 1JZ2A 4Q8KA 4R9CA 3VZLA 2YB7A 4YVWC 4CPBD 2WUHA 4Y4RA 3AZYA 1Y9MA 4YSFA 5DDJ3 3UGHA 1SFNA 4OULA 1QQP3 2PQQA 1W6NB 3NWKA 4P9JA 1FT9A 1S0EA 5FIXA 1TG7A 2B8MA 4JQTA 2Q5TA 2RS33 2VD7A 4LBOA 2XUEA 3M1HA 4IQPA 4D69A 5A3MA 4Y22A 3WCRA 1K5JA 5BNOC 1IOAA 3HQRA 5DZFA 1CZVA 4Q4X2 1GNHA 2AEZA 3AVRA 4UFHA 4XUPA 1A3KA 4Z8BA 2PAEA 3H1YA 1JUHA 4LE4A 3I3MA 2D3PA 2FDKA 4OUSA 3JD73 2BGOA 1R082 1S0CA 3K3NA 3OUJA 2D44A 4GB31 5FZ9A 3N4MA 2P5BA 4MYEA 1V6LA 1RJ7A 1S4CA 4E8DA 5A3NA 4ISQA 4JKMA 4ATFA 3T0BA 2OX0A 1E5HA 1GU3A 4P00B 4CCKA 1FNYA 2JE7A 3FE5A 4QQLA 4AW7A 2ZX4A 5JIAA 3VBRC 3BB6A 5DZEA 4GH4C 2J7MA 1W06A 4KMQA 4XHXA 2HH9A 4Y22B 3HVDA 2BWAA 1TMF1 5KXBA 1X82A 4IEWA 1JYTA 5CG8A 4K6BA 2ARXA 5CNAA 4OI1A 1SG3A 3KCXA 2BPA2 1TNRA 2XH6A 4GULA 4FQZA 5LY1A 3KT1A 4AFBA 2DU1A 3M2MA 2V5YA 3ZXKA 3OJBA 1P8JA 2WNEA 3WDXA 2HWB1 1RUJ1 5CYYA 4XBNA 2QQOA 3POFA 3GJBA 3S7EA 3CMGA 2KXLA 2FCUA 2EXHA 3I2DA 1BK0A 3RYPA 1ONAA 3S5QA 2P3IA 1VB2A 4MXWB 3VBUA 2G1MA 1CWPA 4LO4B 5JPMB 4CDUC 1I6XA 5I0SA 3POEA 2DU0A 1J59A 1PK6A 1OD3A 2IVIB 4UW4A 3WX5A 2GMMA 4FO9A 1PGW1 2C26A 4ASKA 3K2OA 2ERFA 4P08A 3GF6A 4XIOA 1WCKA 1G9BA 1NCQA 2ZMNA 3U0ZA 3MLLA 5ERLA 2BBVA 5D8AC 2WO2A 2P1BA 4LUKA 3WDUA 5JIUA 1OLRA 2W52A 3SC7X 3WNKA 4XQ4A 2B46X 4DXTA 1STMA 1IG0A 2P17A 4CEYC 4F3JA 1PGL2 5LA0A 2NN8A 2R062 1RUC2 1W6PA 3ITQA 5ANQA 1PK6B 2J1VA 5FZ6A 2VZUA 1IPSA 3KV5A 1BBT2 3WD5A 5F3EA 1QDCA 1NQDA 1J83A 3WSOA 2J1RA 1NCQB 4W6WA 1FYUA 1WA6X 3POJA 5EV7A 2IUWA 4Q0QA 4R9AA 3N9PA 3JBG2 1EYBA 2QQKA 4COZA 2G9ZA 3GBWA 5F5QA 3HPNA 1KDKA 4CUGA 3VHNA 2WA3A 1ULFA 1UOGA 5IVEA 3IMNA 1YXWA 4M3CB 1MPXA 1TMF3 1W6PB 1JZ5A 1HRI1 2JDPA 4NMIA 4ASMB 1NY71 5K4LA 1K5MA 2RDNA 1RUD2 3KSCA 2RVAA 4YW7A 1W8HA 3H8XA 3HR9A 1O8SA 3AC0A 3DPRC 3H3UA 1RUH1 4Q29A 2WT0A 2ZGNA 5BNPC 1GWLA 2RS51 3J4UH 3QD6A 2ZEWA 4PIYA 5A3WA 4DUVA 4Y1YA 4QB2A 3TNPB 1ND2B 1OA2A 2VG9A 1QJEA 1HRV1 1QGLA 1RUJ3 1UX7A 2R32A 4LKFA 4LOSA 2RS11 3C2UA 4ONUA 1I1EA 3AZVA 4HBNA 3M3IA 4KQ7A 3NAPA 1KFUL 1VAMA 4CP2A 4D8MA 1PZ7A 3QH7A 1PMIA 5FUPA 3TRSB 5I8SA 1U0AA 1K5MB 2D6LX 2RHPA 2GDFA 3POIA 4LMFA 4C0HA 4BQ4A 4KBZA 3RGBA 3DL3A 3OGVA 4W6YA 3FL7A 2VBPA 3HWJA 5FAXA 4EWDA 4AGVA 2WN3A 2D98A 2ZHMA 1OLMA 3JXSA 5FLIA 3MPPG 4XYXA 4NIAA 4CDWC 1G9CA 4RD7A 1CESA 1XBFA 1SFYA 2R0FA 3PNAA 4H2AA 2PHFA 4C0BA 4JC1A 5K7PA 3O1VA 1UQXA 1VBC2 2HLEA 3K3OA 4WVWA 1V9U2 1EUUA 5JSPA 2XL7A 1RUI1 3ZMNA 2JD9A 4KG0A 4CDXA 1NA1C 3M70A 3A0KA 5AVPA 3TN91 4Y4YA 2JDAA 3B01A 4QQOA 1ZM1A 3WG3A 3ZSJA 1QJY1 4AAXA 3ZIXA 3VZMA 4CA9A 1UWWA 5CFCC 4CCOA 4Z82A 2VOKA 2BNNA 3ZYJB 2CGOA 2RDRA 3S0MA 4IERA 2FDHA 3T4VA 5A3OA 3ILRA 3CKHA 2W3JA 4BQ2A 2BOIA 3USUA 3ZDSA 1XC6A 4CU8A 4UWDA 4DY3A 2GC1A 2Z42A 2MNGA 2AREA 4CDXB 3ETPA 4EN7B 1U5IA 3WDVA 1BXHA 5C8CA 2VL4A 2LTNA 2ZGTA 1NCRA 1EAH2 3CU7A 4OI2A 4AI9A 1H4GA 4BQ1A 4LXLA 2ARBA 2VH9A 1PO21 2BUKA 4GMP0 4CU6A 1OI6A 1GP4A 5EPAA 1RMU1 4AI2A 3M7AA 1RUE1 4WM8A 3ZFEA 1W9FA 1GQPA 4D6RA 5H9QA 1OSGA 1C5IA 2AC1A 1LOFC 2PHWA 3QACA 4YZ4A 3USUB 2JEMA 2VW2A 4TYSA 2ZCWA 4HETA 4LO5B 1UAIA 1Y7BA 4AEDB 2DCTA 3OBRA 1RUH3 5K8SA 2D3RA 2CY6A 2RS53 1OPOA 2E32A 3C7HA 5BV6A 2IXKA 5C8CB 3W5MA 3N36A 4FOYA 1NCRB 1B35B 4XIKA 1EPWA 2BVBA 2DV9A 3PIJA 1HRV3 4NPRA 5AC91 4GXLA 2JX9A 5JOYA 1AL22 3B69A 4MV2A 4QB6A 3VKFC 4WM8B 3OGGA 1A6CA 3I2FA 3WY6A 3ZFEB 3ZSEA 2GNTA 1JYIA 3ZSKA 3I49A 1IS3A 1V6OA 3OPZA 4RHV1 5BUVA 3ZYFA 3OGSA 4NRQA 2CHHA 4CP0A 2GC0A 2G9GA 5JUVA 3H1MA 2BQPA 1TME1 3NV1A 1V6MA 3KGLA 4XDQA 1HQLA 1YIPA 2EALA 1F5FA 3FN9A 1DZTA 3WHUA 4XDPA 5EWSA 4AVTA 4BPZA 1KQRA 1VBD2 1SDDB 4YFWA 2O14A 1H9WA 3ATGA 3OGJA 5IK7A 2JDMA 3B94A 5JZGC 1RUI3 1GQGA 2PA7A 1OC1A 5HCFA 3B9IA 4NRMA 2A75A 3ZDVA 4LBMA 1Q8OA 2I74A 5FPZA 3ZR6A 1AR82 3INAA 1QJY3 1BCXA 2Q1FA 3WG2A 5C6CA 4Q0UA 3A4UA 4QQHA 1XE0A 1VLNA 1JBCA 2XGXA 4IE6A 4N8MA 4MSVA 4BQWA 5I91A 1UF2C 4AQSA 3VDCA 3NJYA 2Z69A 1C28A 1CAWB 1DGLA 4IE4A 4E2GA 5A70A 3ZYBA 3B93A 2NMOA 3P5BA 5C3OA 4E4HA 2D3SA 4GB32 1UKGA 3AP4A 3LKJA 1E5SA 2A6YA 4UFKA 1QJX1 1VRH3 4FI9A 1AX0A 2A3YA 2WKKA 2X5IA 3RWNA 3T1MA 5HV4A 4CEWA 4QXKA 1CQ9A 3E1F1 1LU2A 2XR4A 3MYXA 4C1XA 3VBOA 3MBWA 2JDHA 4LUMA 1UO9A 4QX8A 5FZAA 4AEMA 5I0RA 1GFF2 3OCPA 4AXOA 5FMOS 4Y5Z0 1OKQA 2PTMA 2PHRA 2HWC1 4YM0A 1V6JA 4AI8A 4X8NA 3RSJA 1ENQA 3SH4A 5F5IA 3BALA 5KC6A 1REFA 4XCAA 2GU9A 3AL6A 3D6EA 4F83A 1IS4A 1O3QA 4QGLA 3THCA 5FP3A 1J1LA 1OOPA 1ENSA 5AC93 5CISA 1FMD1 3RZGA 2X5IB 4H7MA 2CU5A 4IUGA 3HN1A 4CEWB 1VMFA 1XJAA 2HWB2 4Q0PA 3T09A 1BMV2 1H8TC 4YM1A 3ZFGB 2HWE2 3SEPA 3RZHA 4MVTA 3NW4A 3P3PA 1WCSA 3IMMA 2VCAA 3AVSA 4RHV3 5FZMA 4AVCA 1OH4A 3LOBA 5FZLA 1WLDA 1MEC2 4WVVA 1TME3 3CHXA 1URXA 2WNUC 1K12A 2E7QA 2R49A 1YJKA 2RM21 1CX4A 1LESA 2D6NA 3OBTA 4F8AA 2Y6FA 1OLME 2SLIA 4LR4A 1OOPB 2QE3A 2W92A 3DYPA 3OOXA 4LK7A 3ACIA 5DABA 4W65A 4DXSA 3NNFA 4ZS3A 5C9AC 5C9AA 5KR7A 1SBFA 2QBXA 2W08A 4H7LA 1PX3A 3UKNA 4IGOA 1LEDA 1PZ9A 3AKRA 3TBDA 4DUXA 3LEKA 2GSYA 3ZLIA 4QMAA 1N3OA 5CBLA 4BCUA 4AFCA 1IQAA 3FC0A 5KXEA 3T2PA 2A7AA 4GKYA 4CZSA 1PNFA 1FAYA 2ZGLA 2AYHA 4QPGA 5FMOL 1PNGA 3CEWA 4BIFA 5JOWA 3BUCA 2FDJA 1SLAA 2VNVA 5KBFA 3HT2A 3DECA 5C3PA 4HKWA 1NG0A 3GZUC 1PMHX 1WZXA 5EZWA 3ZKYA 5FZ7A 5IUQA 3G7DA 4JDMA 1POQA 1K3IA 1QH6A 2R16A 4RFT0 3ZSMA 5F6LB 5CFDA 2ZGRA 4J6GA 3GZEA 4Q5OA 4LT5A 4YPJA 1GZ9A 1YFWA 4XF4A 2ZS6B 3ZXLA 1HRI2 1U5ZA 1YYNA 5DG2A 3VKMA 4D6SA 2HWC3 4JGZC 2WZR3 5FK7A 4AGGA 4AG4A 1QXJA 1C8NA 2RR11 4FT8A 3WNOA 1G8WA 4LIUA 4QT6A 3JZVA 3HNMA 3SCFA 1D7PM 2FDFA 2ZX1A 4XTPA 2PLV1 3A7QA 4R52A 3MO4A 5FZ4A 4Y1VA 2HEYF 1WLCA 3KV6A 4OMCA 4AAPA 5FZDA 1RGSA 5IW0A 3T0AA 4BYYA 4B3NA 2HWF2 2RS12 3UESA 1JXNA 3KGZA 3H0OA 3N7MA 2WO1A 4RQPA 2FMYA 2OVUA 2ZZQA 4KBBA 1LRHA 2XQXA 3HNYM 5FLHA 3HIFA 1Q8QA 1WLTA 1L7QA 2RM23 4NRPA 3GBGA 3LA2A 5FPBA 3RPQA 3I2IA 5C3QA 2ILMA 3T1LA 1OFNA 3VDDC 1H0BA 2WYFA 2XB6C 2AEYA 3H9AA 4XDOA 5LATA 4E4ZA 2C6SA 4QPIC 1AYM3 3H8UA 3JQWA 4Y5TA 3TN92 2XJTA 2A71A 2BRTA 2XBO2 3E5QA 5C71A 3O1MA 3DF0A 1WGPA 4G3YC 5DN2A 4QD2A 3BIEA 5LY2A 1GP5A 2VZ1A 2WNOA 5F3IA 1F35A 3N7JA 5J36A 1TVGA 4FFFA 3ELNA 4NHLA 5FYUA 1RJ8A 1LHUA 1ZZ9A 2P2KA 2WNVC 5T5LA 1C5HA 1PM4A 2XKOA 5IFPA 3VKLA 1HIXA 1LHOA 2Q30A 3KD4A 4NIHA 3UNPA 3UKVA 4MH0E 1HLCA 4SLIA 3ACGA 1VIWB 1YEWA 1JW6A 1GUIA 5FBJA 2IXLA 3DEMA 1NXMA 2IFWA 5CKNA 5JDBA 3FHIB 1O3TA 1D4M1 1DP0A 2YPJA 3WNXA 4C91A 1CZSA 2MEV2 3NNGA 3HBKA 1PO22 4NHXA 2FDIA 3IIIA 3PUHA 1OBNA 1RMU2 5J98B 1VP6A 2FD8A 4CP9A 1RUE2 2XONA 2FHRA 2VQTA 4PIZA 3EQEA 3HD8B 4GIQA 2JDZA 3CJIA 4OYUA 3ASIA 2VMDA 3AZZA 4B1LA 2RR13 1RHI2 1C8M3 2W87A 5F2SA 2Z2SB 4M01A 4QPWA 2R042 1X8MA 2PLV3 1OMIA 3T4HB 2GZWA 3URFA 2JDNA 4KWKA 4YRDA 3C7GA 1AR71 4E2SA 3P6BA 3FJSA 2YGMA 1VBA2 1S0GA 5B4NA 2ORXA 4AHXA 2IFRA 3LAGA 4CDQA 1ZRCA 4ARYA 1K45A 3HJRA 2QDRA 2YV8A 4MO3M 1RVF3 2E9QA 5CVRA 1XNKA 5K9YA 3ETQA 1DQ4A 1S0JA 4K9SA 1W99A 4WM7C 3O1SA 2DFBA 3JUUA 2KD7A 2Z5WA 5DAVA 4JRAA 1AR61 4Q8LA 3APBA 5D1IA 5HXMA 3H8RA 4ZY9A 2VXRA 3FHQA 2V4VA 1NT0A 2WT1A 2AR6A 3K4ZA 4NOTA 2WR9A 2XJRA 1VB4A 3H42B 1FNZA 3J7NA 4JTNA 4R4ZA 2UYAA 5CKQA 1LR5A 4CDQB 2NLRA 2PELA 4QAWA 4Q27A 3R05A 1BHGA 5F1RA 1SEFA 1ZZCA 3W59A 5FV3A 1Y3TA 1YLLA 1IKQA 4Z2AA 1O7FA 1JU4A 2RE9A 3IPVA 3IAQA 2AENA 1C1FA 2QQIA 3ALQA 3EO6A 5BYNA 2VECA 2MHFA 5T5OA 3VBSC 4PF1A 2VQUA 3WLUA 4JHTA 1XB9A 2A1XA 3AL5A 1DQ1A 3M3QA 4ZKTB 3I2GA 2E6VA 1G9AA 2R072 4LLFA 2VR4A 4EJRA 3FX3A 2W1QA 4QX1A 3VV1A 1REDA 4CRQA 1FPN2 1QJX2 4OHWA 3WF3A 4BK4A 2D6OX 4XETA 4RR3A 3LE0A 1HDKA 5J1XA 4P9GA 4R9DA 3FBYA 1JYXA 4Q4V2 4KWJA 2FQPA 3H50A 4YARA 3VD4A 1BVP1 1CX1A 5B4XA 4Q1RA 3AJZA 1M06G 4E27A 1W6OB 4ZZ8A 2WYSA 4L11A 4UW6A 3D8CA 1GANA 2EIEA 5FZBA 2HBTA 1PVXA 1WMDA 1AR73 3KCYA 5AVAA 4JQRA 3ILFA 1A78A 4JAAA 2AGSA 4GJYA 1FMD2 2FBEA 3CLPA 4N43A 2VBDA 5FKCA 5FY0A 3VD5A 3ZN6B 4PI2A 2BWCA 1J3RA 2Y26A 1QKQA 4QU2A 2J42A 3IKWA 3R4UA 1LB2A 1PO12 2VM9A 5DZGA 3WR0A 1DZRA 3OTFA 1UY1A 1AL0G 3SCGA 4EWEA 5FR3A 5FYMA 2ZX0A 1BEV2 1SLBA 1GYKA 4GWMA 4BOWA 1HV1A 2JWPA 4LHKA 1S55A 3FWEA 1X33A 2RDSA 1AR63 4NAMA 2X29A 4FXKB 4IEYA 3ZYHA 1AR91 1XXNA 4FTBA 4LTAA 2WBKA 1WD3A 2WL1A 4RN5A 5LW9A 5GM0A 5L9RA 4UBGA 4N43B 3SITA 1SLLA 3KHCA 4EZ4A 2D43A 3U75A 5FZ3A 1CZTA 2FZ1A 5L36A 4GZ9A 5FZOB 1NX9A 2ZMLA 5LA1A 2Q0AA 1W2TA 5FUIA 1IS6A 2BEOA 2R1BA 4NPLA 1V6NA 4O61A 3VL9A 2W47A 2E51A 5JR2A 1O8PA 1ZBA2 3LEMA 3MW3A 5FXWA 4E4DX 1ULDA 3KV9A 1HXS2 2OZ6A 2OUHA 3KT7A 5A33A 4YZ5A 3J8F2 2Y60A 2DCZA 3FFZA 4YW6A 5A1FA 1O59A 4XURA 2P3YA 2VOTA 2PYTA 2A5ZA 1JTZX 2QDNA 3VLBB 2CYFA 3FUQA 5IVCA 3USSA 3BN6A 5FWEA 4XF0A 3NJVA 1H6XA 1W8OA 3WNLA 3SQOA 5KXDA 1MACA 3IDBB 5GLZA 1AYN2 5DPNA 5ACA1 1W6MB 1VBE2 1QF3A 3WW2A 2MPFA 2GMEA 2WSUA 4NAOA 4IXLA 3SXWA 4PHZA 4KWUA 2JIGA 2QQWA 3GBFA 3FMGA 1ENRA 2G19A 1VE0A 1X36A 3OD4A 1UOJA 5GALA 3N3HA 3PU8A 4MXVA 3U11A 1C4RA 5G04L 2BFUS 1JODA 4YVWA 2OW4A 4XJ9A 1A8MA 2B5HA 2Q1MA 4XAAA 5A7OA 4CSWA 4IETA 5A1LA 5C70A 2CAUA 3A22A 4O65A 2X53S 1WCDJ 2ZHNA 2D6MA 4AVBA 2RMU1 3O1PA 2X09A 1IG3A 3MIBA 3K48A 4PBPA 3ZXFA 5E89A 5HBAA 5JMCA 4TSVA 4LITA 1RUG2 4WZFA 3ZPYA 5LK7B 4LO6B 5BNOA 2Y0OA 5C4WC 3HN3A 2Q8EA 2R6QA 5ACA3 2C4XA 1ND3B 5CU1A 1YQCA 1AR93 4ITCA 3HEIA 4YVSC 1KFXL 4FAHA 4XJ8A 4BK5A 4HOOA 1Y9GA 1YFYA 4M00A 5FXVA 4MGKE 3U07A 4QB1A 1YHFA 2HYXA 3SNMA 3MF6A 1JYCA 3RWKX 2V5DA 3T2OA 4BH9A 4LORA 1RUNA 4IV1C 1XNDA 1LOBA 3VBRA 4XUQA 4GH4A 5B2GB 4I2OA 1GOHA 2ET1A 1NQJA 1OT5A 5BNOB 1W9WA 2OXBA 2VOVA 1UPIA 1LGCA 2ES3A 1KEXA 5EJZB 2CSGA 4CE8A 1JN2P 3PUIA 4YGDA 1EV11 4DXRA 4QXHA 3MW4A 4GWJA 4IDZA 5C5TA 3BU0A 4IEXA 4DZGA 4IGQA 2ZABA 4XBQA 3NO8A 4RSUA 4ISRA 4KG8A 3U14A 2BFUL 1D2QA 1XU2A 3N7LA 4IEPA 1Q5OA 4K1ZA 4KGGA 2W95A 2Y0IA 1D4M2 3VBRB 4BB3A 3FBMA 4BWOA 4NUBA 1UOBA 1J3QA 4GH4B 2VUJA 4V2VA 2J1SA 3AYEA 3B00A 5DXDA 5FUNA 2QQPA 4OZOA 5F3CA 4NIIA 4HLTA 5JLVA 1GR3A 1WLWA 1Z0HA 2A6WA 2C24A 3RMXA 3WG4A 4C1WA 2VZSA 3ZXAC 4CDUA 2A6VA 4MGZE 1WKYA 1R1A1 2HYKA 2XKPA 4CUBA 4AI3A 1CAXA 2V73A 3ZR5A 1DU3D 1ZNPA 2QQUA 1JHNA 1SBEA 1DYPA 5T52A 2VZQA 2XLGA 2YDEA 3J9SA 2OA2A 2B7YA 4S2GA 5D8AA 3IM0A 5FK8A 3MV01 3Q8BA 1AXZA 5I93A 2RMU3 1BK1A 3D3AA 2D5FA 2I45A 3LA7A 3WEZA 5GZEA 2WT2A 3VBUB 4AFDA 4CEYA 4DEQA 4QGMA 2KA3A 1HQWA 4Q4Y1 4XJAA 5F3GA 3ZX7A 3OPWA 1N3PA 1QJZA 3SKJE 2Y64A 5SV8A 1UCXA 2B4KA 1IKPA 4R9BA 4QX2A 1RTVA 2GNMA 2XVLA 4A3ZA 4AVVA 2WSVA 1ODMA 5F37A 3LDRA 5D8AB 3WCSA 3ABZA 5J96B 1Z7S1 4FPLA 4AHWA 3GJAA 3O0XA 4M4PA 3U4SA 3DYOA 3GGLA 3VD3A 5FZGA 4QKFA 2Q4SA 2VC9A 5CAZA 2UWAA 5C33A 4CEYB 5KHKA 1HN0A 5H9SA 2VZRA 4ES9A 5JSOA 3EYPA 1ZRFA 3TWIA 3ES1A 5I8TA 4Y24A 5LBCA 1EV13 3N9QA 2ZBJA 3MUZ1 3UYJA 1ZYBA 5JOZA 1OURA 1ALYA 1W8TA 3DPRA 3TEXA 1W2OA 4UFJA 1HX6A 3AKSA 3N9OA 4B7EA 3MI8A 4A44A 4YGEA 1XNBA 3RZLA 5BNPA 1O3SA 3L9JT 1W8ZA 4QQPA 2YXSA 3O12A 1UZVA 1ZBE3 3BU7A 4QM9A 4AEKA 3AZWA 4LKDA 4K8FA 4M4RA 1ND2C 4XXAA 5FP4A 4LBJA 3RZZA 2GC3A 1PIV2 2GMPA 1IPKA 4U36A 3AP7A 1IS5A 3U10A 5A1AA 3KQ4B 2WS93 1UY2A 1Y9QA 3POWA 1E57A 5FLJA 5A3PA 4MZUA 5ANNA 2JDYA 4XJUA 5EIYB 1VBB3 3DPRB 4FXGB 2ZPXA 1R1A3 5FY8A 4FPGA 4RA0A 4CDWA 5BNPB 4JVAA 1R093 4N53C 2O8OA 1ZX5A 3I8TA 1DGWX 5A7QA 2CDOA 1S2EA 2GP3A 2JG9C 1YUDA 3EJKA 1MZFA 3Q9OA 4B4RA 5A6ZA 3WUCA 4CCMA 1NA1A 3CDZB 3BPZA 4XACA 2EIBA 3NAPB 3AYDA 3LEIA 5DDJ2 2YFUA 4I0AA 1QQP2 1WBLA 2OUJA 3D0SA 1JI6A 5E1RA 3ZKUA 4UFIA 1S0BA 1FOD1 1W39A 5DQ0A 2RS32 4FFIA 4FPEA 1PZ8A 2VNOA 2VO5A 4I30A 2CWMA 4Q4Y3 5T5JA 4AOCA 2VQ0A 2Q8OA 2VZVA 4CCCA 2OZJA 4CDWB 2ZEZA 5FPLA 4EYUA 5J09A 2YU1A 1COV1 1F15A 1JYWA 2SBAA 1XNCA 1DQ5A 1NA1B 1Z7S3 1ZZ7A 3JD72 2VGDA 5EFUA 5JOXA 5KHJA 3DV8A 1CAUA 2HKXA 1O3RA 2JKBA 1VRH1 2WWSA 5G05L 2C1FA 2WC2A 5IVYA 5CFCB 1BQPA 3CNAA 2VQAA 1BVVA 2NZ9A 4XE9A 5C3RA 3MUY1 1V70A 4PDWA 3BGAA 4K1YA 4E9KA 4YGBA 4PDWC 1LOFA 2HWD1 4YYOA 2W1WA 1JZ7A 1QJU3 2V72A 5FYYA 5JSRA 1HKDA 1OUXA 2WWUA 5FOJB 4AEDC 1JYVA 1ASJ1 4QX5A 2JDUA 1ST8A 2DVBA 2PFWA 1PVC1 4BMEA 3WQBA 1OLQA 2BGCA 1OF4A 1CAUB 2JG8A 4Z07A 3KLSA 2JG8C 4HANA 3VDBA 5L9VA 2VULA 1B35C 3AXDA 3V65A 2WFF1 3DCQA 3MPBA 3RZJA 2P4EA 4AYUA 2ZX2A 4E2QA 1V6KA 1W0NA 4IV3C 4I0BA 4NVPA 5LB6A 1O5LA 3KS7A 1TEIA 1ZA7A 3ZIWA 1IZ3A 4QHOA 5T54A 4LPLA 3KVBA 1LOEA 1SHWB 1WA4A 4LKEA 5FY9A 3BTYA 2R1DA 3CZJA 3MIGA 1DF0A 5FQ0A 5BXXA 1UMHA 2DCKA 3IT8A 3ZFFC 1US3A 5JZGA 4RGGA 3O1OA 3EBRA 4HKOA 1W0OA 1SPPA 4FPHA 4AI1A 3TAYA 3OF1A 5K0UC 5A3LA 5C3SA 2WRAA 5IVVA 4PF5A 4MGYE 4OHVA 2RMU2 1OA3A 1FOD3 4A42A 2E53A 1AHSA 2Z4FA 3MEPA 4JTOA 2Q8CA 3THTA 2B9UA 2CDPA 1C1LA 1GOGA 1DQ2A 5GLUA 3O14A 5GZGA 3WQ1A 3F2ZA 1S0DA 4MGQA 2D6KA 2IVJA 4P5HA 5FQ0B 4ZU5A 1COV3 4JDNA 5JZGB 4UAPA 4QDRA 3T30A 2WN2A 1SPPB 1CPMA 1QH7A 4GQ7A 3E6CC 2VMIA 4D94A 4S2DA 5A32A 4HFSA 3AB0A 3ON7A 5FZHA 3LEGA 2H0BA 4YW3A 1UN1A 2BNMA 3OB8A 5IAVA 4AE2A 5FZEA 1A34A 2A3XA 1LTEA 5LBBA 2WO7A 4GJZA 1Y4WA 3W58A 2BTVC 2W9XA 4QX7A 3RDIA 1W9YA 2A73B 1QIQA 4HPKA 4EN9B 5FYVA 1TMF2 2HWD3 2QVSB 4LBQA 4XFCA 1MS0A 1K42A 4YLZA 2W0XA 4MG2A 2LS6A 3GYDA 2WZR1 3D0JA 3T2QA 4JGYC 2FZ2A 5I0TA 1ASJ3 1DIWA 3NRUA 3VD9A 1YI9A 2QCSB 1PVC3 1JHJA 2JJ6A 4HSLA 1CD3G 2QZ2A 5HCAA 3I97A 2WFF3 3UJQA 4M0NA 1LJ7A 4XFHA 1NUKA 1NKGA 2ZTNA 4C90A 1H8TA 1RUJ2 3VBOB 1W2NA 1HN1A 1SQ4A 1UMIA 1H1IA 2XJSA 1WW5A 3BCWA 1XU1A 4K21A 3UL2A 4YZ1A 4N90A 5EXOA 4BJ0A 3W20A 5A6YA 2J22A 4PLNA 2WNUA 1H1AA 4DRRA 3CBNA 1WW4A 1TZOA 1D4VB 1F9KA 2YC0A 4FP2A 3IBMA 2BJSA 1PGW2 3I54A 4XJWA 4BA6A 1JMUB 4XF9A 5FPAA 4BISA 3T08A 5A6XA 2V4AA 1GZCA 4PI0A 1QNYA 3MW2A 1AYM1 3AKQA 4GD4A 3JB4C 4LHLA 4META 3E6BA 1UZYA 5JI9A 3W5NA 1XRUA 3GCXA 1ULGA 2R30A 4BM8A 3S30A 4A7YA 1CPNA 3BOPA 1RYYA 1UU6A 1XYNA 1YQ2A 2D97A 2ZGUA 1BLZA 2X05A 4DNYA 1V6IA 3D5OA 5HCHA 1REEA 5F32A 3HT1A 1UIJA 1UX6A 5C9AB 1TE1B 3PTRB 3C7EA 5HCBA 4ATEA 2DURA 3M3OA 2RJKA 4XOGA 1F4HA 2IXJA 2BNOA 3R6SA 3HQXA 4CXWA 1O6UA 2X8KA 3DKWA 4I3PA 3MIFA 4KU7A 4R4XA 5JXHA 4YFZA 2RV9A 2YFZA 1DYKA 2VNGA 4B4PA 1CAVA 5F39A 1G7YA 2C9AA 1DHKB 3OBZA 5J3UA 1GZTA 2E7TA 3KVAA 4HXCA 4X8PA 4XZUG 1LOAA 4HT1T 4B29A 1GLHA 4QPGB 4CEWC 2JXAA 4JGZA 1H2MA 4N9HA 1NY72 2WLPA 3C7FA 2VCBA 4QM8A 2IZWA 3I59A 5L73A 1HB4A 4UT5A 2GN3A 2Y6GA 1I3HA 2ZEXA 3VZOA 4AK3A 2JIJA 1C8M1 4LBQD 1LECA 1RUH2 5AFBA 4OUMA 4TLFA 1AJKA 2RS52 1Z78A 4URAA 2IC1A 4AZZA 3V0BA 2BZDA 5CFDB 1G6NA 3AFKA 3P3NA 1HRV2 3RRDA 1CAVB 3WNNA 4CXXA 3MLKA 4IGPA 1NXD1 1LODA 3S5AA 1XNAA 5FYIA 2JE9A 2ZAAA 4RYDA 5KWRA 1RVF1 3H3LA 2Y8KA 1HW5A 3I59B 1S0FA 4OLLA 1POV3 4Y5SA 4QHZA 4L2NA 2K0GA 2NPIA 2VMFA 1CIWA 1WMFA 3NVCA 1O4YA 2J1UA 4PQQA 4L0PA 2R7EB 3VDDA 3R0RA 1OFSA 3TYJA 1W03A 3VBFC 3V0BB 2UWCA 4BMBA 1XSQA 1RUI2 4YG6A 3NMBA 4QPIA 1O4ZA 1N1TA 3DYMA 4TXWA 4ZONA 2JD4A 4Q4W1 1OUSA 2ZEYA 3C3VA 3HNBM 5FYCA 3J7HA 1MS1A 3GNEA 4RQPB 4A4AA 4XUNA 3M4FA 1QJY2 2QUOA 1LENA 4E8CA 1G9DA 3GXUA 4XQDA 4Q4X1 4PIXA 5FYBA 5LBFA 2BGPA 1MVEA 2WNVA 2YGLA 1NLRA 2WINB 3FFQA 3ME2A 1V0AA 4Q1PA 4IEUA 1ULCA 3U1XA 2VCCA 5BPXA 4IL7A 3ZYIB 3I3BA 4EV0A 3PLQA 5A6QA 4XCBA 4MHRA 5FO9B 3T2TA 2D6PA 2KR2A 4ZU4A 2WZPP 3GDBA 4AFMA 4DEVA 5DMYA 4AHZA 2ZGPA 4TZDA 4QPIB 5LCWL 4Y3OA 5FZCA 4JHZA 3GHMA 3AKTA 1RUOA 3VKOA 1VRH2 3KM5A 2PAMA 5LZ6A 3KB5A 1FX5A 4YNIA 2NMNA 2WZ8A 5JXJA 1J1TA 2TBVA 4LEJA 4YW5A 1SFPA 2WNVB 3KHBA 3I2HA 3SH5A 1CONA 3UKTA 2H6BA 3VN4A 4HMZA 1H6YA 1OQDA 2ZACA 2ZJCA 3POYA 1QOSA 1QWRA 1W9TA 5DUWA 5L7OC 2P6HA 4KL1A 4AR2A 2JECA 2D40A 1S1AA 3I7DA 1BYHA 3BTAA 5FXXA 4LA2A 3MV11 3KCCA 2A70A 1W28A 1N47A 5LASA 5AC92 1QHDA 2JDKA 1MVQA 3OG2A 2ZHKA 2HJIA 3GHNA 1BJQA 3UK9A 4YGCA 1DG6A 3WW1A 4DOUA 4K40A 1QY4A 5LRRA 2AH2A 3AKPA 3CJIB 4RHV2 1FXZA 2PMWB 2ZGSA 4WM7A 4Q0SA 1TQ5A 2F4PA 1ZRIA 5C7GA 1GNYA 1TME2 3WT3A 5DUVA 2W2IA 5IVBA 3I2JA 3O1TA 1N1VA 1I9RA 4CU9A 4Z2WA 4JZRA 4BQ5A 2DUOA 3ZXDA 2NM1A 3I3EA 4CYDA 4Q4W3 2X10A 4A3XA 4UW3A 5T5PA 4XF1A 3WNMA 3H8OA 1MQTC 1Q3EA 2A3WA 2VUCA 3VHRA 4EWAA 5IATA 3VL8A 1PGL1 2QQNA 2R061 1H8VA 2LRPA 2VOWA 1RUC1 2XG3A 4Q4X3 3ACHA 5A7NA 4I02A 5A3TA 4FFGA 3VBSA 1BBT1 4JX0A 5EP9A 1MZEA 5LBEA 2EICA 3TOJA 5ABJC 1ACCA 3PUSA 1WCQA 1R083 4I09A 5BY5A 1UXXX 2ZHLA 4J1XA 1JOPA 2WZEA 4AI0A 5HPOA 4OCTA 3JBG1 5GZFA 1VR3A 4NROA 4COVA 2ZKLA 2VTXA 2ZAHA 4QHBA 3VBHC 4EN6B 3NL1A 3RJ2X 4B8EA 3RVHA 3EHKA 1VAVA 2TEPA 3LGRA 3QCWA 1G86A 1RIRA 3IPVB 1XOYA 3PURA 1N3QA 4XMIA 1FATA 1ZRRA 1YQ6A 3VBSB 2EF6A 5FWJA 1RUD1 2A6ZA 2DVGA 1WMXA 5IJRA 2OT7A 3KQRA 5I0UA 3OEAA 3NKGA 1SBDA 4Y20A 4XTMA 2HWC2 3Q8CA 2WZR2 3AZXA 2PHXA 5IVJA 4CUAA 4UFMA 4LO7A 2XPJA 4F7ZA 2VPVA 5TSWA 4IEZA 2XJUA 3K4AA 4MLOA 3M8LA 4JKLA 3N9LA 4BLJA 1W2UA 4UI9L 3O1RA 4RR3B 2VMHA 2H6CA 1S0IA 3JU9A 3LA3A 3VHPA 4CCNA 3AMHA 3V64A 2ET7A 4BDVB 5FYZA 2WABA 3DKQA 2WAAA 4RS5A 5T55A 4RS5C 1AXYA 3RJRA 3VB9A 2ZGMA 5FPVA 1UY0A 2B45X 4EN8B 5H9PA 4V2WA 4QQ2A 5IFTA 5JPNB 2WQZC 3EXUA 4PT6A 1NZCA 2RM22 3AFGA 1EP0A 4FTEA 4DIQA 1V9U1 2BVVA 1W3VA 1HB1A 5FPUA 4JV4A 3E5UA 3UV9A 4LIVA 2L9LA 3BODA 4CP9B 1BZWA 4JCKA 3RMYA 2O1QA 1AYM2 2VMEA 2R063 2OIIA 1X9TA 1RUC3 4KI5M 1SLIA 3WF4A 3B02A 3V0AA 1WBFA 2Y6KA 3PMEA 1OH3A 4UW5A 5GLVA 3RYRA 1ZA4A 1BBT3 3PJQA 4H55A 2EIDA 4MADA 3UT0A 3JBG3 5A7WA 2LROA 3DXTA 2P34A 4CXYA 2XJQA 1XNTA 1YC61 3RS6A 4HVRA 3N35A 3NNMA 4ZS2A 3WQ0A 4YM3A 2Y6HA 4DQAA 1LULA 3N7KA 3PHMA 1DGWA 3N9MA 4FP3A 3V0AB 2WLQA 4XF3A 4E4SA 1RUD3 1N1YA 4FPCA 4QXBA 3WP4A 2Y6JA 1O4TA 3QH6A 1QOOA 1AXKA 5A33B 4XHBA 3CO2A 2VZOA 3AYCA 1FI2A 4MGIE 3S6PA 4B4QA 3NKTA 3I3DA 3MIDA 4CUCA 5BNNC 2OS2A 2RR12 3IAPA 4MGTA 2F6BA 2PHTA 1C8M2 4GWNA 4DO0A 2GNBA 4WV8A 1MR5A 1RINA 4W4ZA 4QWNA 1OQEA 1NZIA 2PLV2 1YCIA 2ZX3A 3EMRA 5DAPA 3VKNA 3PU3A 1AL21 1RUF1 4P9IA 1GNZA 2B42B 4WVMA 3JCIA 5F8PA 2JB4A 5JVVA 4AFAA 4D6QA 5ISLA 3I2KA 4NHMA 1PMJX 4AGRA 2VUDA 2XLFA 4IW3A 1RVF2 4L97A 2Q1ZB 2CGNA 4LA3A 1C57A 5C4WA 5JCTA 3OGRA 3LPFA 3TEZA 3I2OA 4YVSA 5FYSA 1W8UA 1ND3C 1VBD1 4QX3A 1VBC3 4YVWB 1APNA 3PTYA 1V9U3 1R1ZA 5DAQA 1ZRDA 3AYAA 3L2YA 3LDKA 3ZSLA 3ZYRA 4WVMB 4BXSV 4FSJA 1AR81 4IV1A 2O8QA 3QBQA 4Q4W2 2GALA 4KNCA 2LALA 5HV0A 2UYBA 4RGKA 1PX4A 2GH8A 4KU8A 5C4WB 4NWVA 4LHNA 4YWAA 2UU8A 5JR7B 4YVSB 4O9GA 2UY9A 1RXGA 3WINE 3NJZA 3WDWA 1CR7A 1CIYA 2GH2A 2I2SA 4FOQA 3WDYA 1NLSA 3BPSA 1LCLA 3P1IA 3ZO0B 1UPSA 1VMJA 1EAH3 4XEZA 1OXCA 4IV1B 4HN1A 2PN5A 4YM2A 2WQ4A 2ARAA 3HOBA 3SH3A 2W5FA 4Y1XA 5JXIA 2EIGA 1ZBE1 4IE5A 2EVXA 2NYYA 2Q8DA 2WAOA 3DUIA 3VZKA 4OZXA 2FCTA 4LULA 2XJVA 4UBHA 4G9SB 5FOBB 4A7KA 3J7LA 2WS91 3RQ0A 2K46A 1KGYA 3CQOA 1DGRN 3IDEA 1US2A 4MXWA 1DDLA 3W21A 4DUWA 4XABA 1VBB1 2JB8A 3K77A 1CN1A 4ES8A 1EY2A 2ZZJA 1ZZ8A 1R091 5FY5A 4JRLA 1L3JA 2G9FA 2HBUA 1H2NA 4OUEA 4WVZA 1HJFA 4XUTA 5FMBA 3CF6E 1SLTA 1AL23 4LKSA 1ZZBA 4AF9A 3BOWA 1ULEA 1AR72 1RUF3 2B9VA 1BMV1 2VOXA 2HWE1 4OMDA 2F4LA 3RYKA 1V00A 2JKXA 1VPHA 2VE1A 1LGBA 2ZA9A 3KT4A 3NV3A 4XC9A 2PHDA 1JUIA 4FFHA 1MEC1 1RITA 3LDBA 4YZ3A 3VBUC 2RJ2A 3ILNA 4AQ2A 4CDUB 2W94A 5CFCA 1ODNA 4L99A 2GAUA 1AF9A 1UOFA 4D7TA 1PK6C 1CAXB 4O9EA 2LW8A 1VBD3 2RG4A 1AR62 1UYPA 4LNVA 3VDAA 1Q43A 1GICA 1PM7A 2ORZA 1NCQC 3AXEA 3ZVXA 4P14A 2TUNA 3RFRA 1YRZA 4FPYA 2IXCA 3SMHA 1W05A 1AR83 4PJYA 4GA9A 3O0VA 3ZYGA 2NP0A 1JOJA 4IE0A 3O0WA 3OSDA 2CNAA 3AP9A 4A2UA 1LGNA 4XILA 1UIKA 1X9PA 4M3CA 2UWBA 3H7YA 1OD5A 4RFRB 3AX4A 4GALA 4XFAA 3BKZA 2WA4A 5E16A 2G4IA 1GBGA 2ZMKA 3WF0A 4NIGA 4HVQA 3MHZA 1QNWA 1XE7A 3AMNA 1UNBA 1JZ8A 1QJU1 4D0QA 4GB33 4Y1ZA 3C8XA 4A6OA 3ORJA 4QKNA 2P3KA 1T6BX 1WW7A 5JMOA 1HB2A 4V1PA 3A23A 1UZZA 1LHVA 2PHUA 2YU2A 4S2FA 4XBLA 2CGPA 1ND2A 1DLCA 2D5HA 2FMDA 4BE3A 4EROA 2VVFA 5FZ8A 3LQCA 1L7RA 5FYHA 2ATFA 1U12A 4N9IA 2XVGA 3MDPA 1EUTA 4Q2FA 4P9LA 5FP7A 3VHOA 1DLLA 4ET7A 1K5MC 4L9BA 3MGUA 3BYWA 5IK8A 4N53A 2Y33A 1KJLA 1H30A 3POBA 4HVOA 3WW3A 2JG9A 1TNFA 2B39A 2EXKA 1DQ0A 3O1UA 2BU9A 4QU1A 4XQWA 4I0WB 4Y1UA 4BLIA 3T0DA 2HWB3 4OVEA 2HWF1 2DVDA 4ZZ5A 3O7OA 4XW3A 1IQDC 2HWE3 3ACFA 3VD7A 3T3YA 2VVEA 3NAPC 1FV3A 2C5DA 1MEC3 4IE7A 3NSTA 3FLPA 5EYYA 4NPMA 1KJRA 4FCAA 3X29B 3PUQA 4MUVA 3IDAA 4N53B 1ULOA 3JQXA 4COUA 2JG9B 3AP5A 1U5XA 3Q8FA 4IEQA 1AR92 2DWRA 2VZTA 3LFMA 5A80A 2PAKA 5GZDA 1D2SA 4AQ6A 3SISA 4HK8A 3E5XA 3C7OA 4CDXC 5FFOC 2W46A 5KHIA 2XBO1 4JDOA 3U37A 1VJ2A 2YMZA 5FZFA 3HBZA 5J7MA 1BKZA 2BERA 1YWKA 2EXJA 5KHGA 1MS5A 2QKDA 3J7MA 3JB8A 4AEDA 4XZPA 4QX0A 5IAXA 3WXPA 1S2KA 4KH9A 4TWTA 4CU7A 4BIOA 4ZXEA 5L9BA 3WOGA 2BP6A 5I0DA 1FV2A 1W8FA 2DDUA 3IDCB 5GKAC 5C8CC 5IVFA 1B35A 4NIDA 2MEV1 1NCRC 5APAA 4FBFA 3WNPA 4TTGA 3I4IA 2VXJA 4CCLA 3FUOA 4QDSA 5LRSA 3A21A 5ACA2 3TEWA 3G6JB 4IV3A 1EPZA 1HRI3 1MS3A 1E5RA 1POV0 4ORFA 4PDWB 1AZDA 4WM8C 4TN7A 2YHJA 3WV6A 3ZFEC 1C3HA 2XWJB 1NLQA 4ZXKA 3U78A 1CVNA 1RHI1 2BDRA 3LIGA 1OQ1A 2HEVF 2OQ6A 3SHRA 2PHLA 4QPYA 4Y26A 4UOJA 2R041 2XXZA 4XJZA 5FY7A 1W8WA 3MFAA 5FTTC 5FYTA 3FZ3A 3B7MA 2JG8B 3ZFFA 4RGAA 4IESA 3B9CA 2ZXQA 5FCCA 4CCEA 4W50A 1VBA1 2HWF3 5CKMA 4YG3A 5H9RA 2RS13 1YO8A 5EHDA 5K0UA 1SDWA 3H3ZA 2Y38A 4IV3B 1RUF2 1HQNA 2K9ZA 1UKRA 3ES4A 3R4SA 2C9KA 4NO4A 1RL3A 2XMLA 5KC5A 1T2XA 1F4AA 3KZ4C 3LFIA 4DRVA 1F2NA 3QLQA 5JXGA 1UD1A 4PCRA 3PDQA 5FBZA 1KS5A 4FOVA 1YIFA 2QTWB 1WMEA 4NHYA 1MZ6A 3KMHA 2W1UA 3LSEA 3OUHA 3H1WA 3HAGA 3ZFFB 3GZTB 1R64A 3V56A 1CAWA 5M0TA 2AACA 3OD0A 2DCJA 1QEXA 4YW4A 4DPNA 4BQ3A 2GC2A 5K0UB 4COWA 4PLOA 4S2HA 5HI0A 3TN93 1YNAA 2F17A 2XBO3 4Z1VA 1JH5A 1L7LA 4MHUA 1UU5A 3LIHA 3LCPA 4FPJA 5FO7B 4AEJA 2V09A 2DUPA 2QQMA 1NE6A 4XFBA 3Q8AA 3VGIA 4CP1A 4M3CE 4OI4A 2YYOA 3SCHA 3PVNA 4AVSA 5JAXA 5CZKA 4JGYA 1PHMA 3LOIA 2EAAA 1EV12 3NJXA 3ZYPA 2HEWF 3LZZA 3K4DA 5AFEA 5FDBA 2R071 2WFPA 3ENRA 4LO8A 3EB7A 5EYXA 2AUYA 5E6HA 4W8JA 4NR1A 1UZWA 1VRBA 2EA7A 5A32B 2ADDA 3ZMOA 2UURA 2QFEA 2MEV3 2VW1A 3B3QE 4H14A 4TLGA 2Y34A 1FPN1 1W90A 1H2KA 1PO23 3IWZA 1ZBE2 3WP6A 1UXZA 2X5IC 3PVOA 4HK9A 5FREA 1RMU3 1LOCA 3PUAA 4Q4V1 1RUE3 5FJHA 4HKLA 2CTVA 2WDBA 2IXHA 1AVBA 2IXIA 4HPKB 1J84A 2XVKA 3VBOC 3ZFGA 2WS92 3ZFGC 3MIHA 3K75B 4LBQB 2DUQA 1LHWA 1I5ZA 2BBAA 2RDQA 5FZ0A 4GMP1 4AQTA 4JGYB 2E33A 1RHI3 4GAZA 5FP9A 2VBBA 2PQSA 4CCDA 1GWKA 1POV1 1VBB2 2W91A 4YW1A 4OQ9A 4DINB 2P3JA 1GP6A 1R1A2 2R043 4P02B 4A41A 5IK5A 4DB5A 5CA6A 1NE4A 4DY5A 1IHMA 1JOBA 4O7XA 4FQ4A 1VMHA 1RXFA 1SZBA 1R092 4Q0VA 1M4WA 5D2AA 4MX3A 1D0GA 1UMZA 4XFIA 1S2BA 1GQHA 1OOPC 1VBA3 2I07B 5CG9A 1E5IA 2CL2A 1W6QA 4QDQA 3RG0A 1OHFA 2OPWA 5FZ1A 1H8TB 5LWBA 2LM3A 2EXIA 4P5YA 1PO11 4KWLA 1DBNA 4DMIA 1SMVA 3ZN5A 3LD8A 1H2LA 1KITA 3LB9A 2DF7A 3O5SA 1VALA 3PL0A 4B1MA 1KDMA 4LK6A 1Q8PA 1BEV1 3NQHA 5DUXA 4NHKA 4BU2A 4OQ8A 2WNUB 3AMPA 4ARXA 4Q4Y2 4HL0A 1Q8SA 3Q8EA 3LWCA 2ENRA 2XQRA
chains in the Genus database with same CATH topology
3VUOA 3MZHA 5EJ3A 2E7AA 3PVBB 4KGQA 3AP6A 4OI0A 3OY8A 1W6QB 2CAVA 3WZ1A 1Z7S2 3QOPA 4PQ9A 5L19A 1U5YA 2XL9A 1KRIA 4FVVA 1DFQA 2WJSA 4N7IA 2RJLA 4IEOA 3ZXJA 4LBNA 1ZBA1 5J37A 3WUDA 2DTWA 1HXS1 1X7NA 2H0VA 3J8F1 3WQ7A 4QPGC 3VZJA 1YJLA 4HZFA 1QJU2 2R073 1N1SA 3D4KA 3OY8B 2D7FA 4LBKA 2VUAA 5CB7A 3M3CA 2W68A 2VU9A 2XUMA 4FOWA 1FPN3 1QJX3 2YY1A 2R0HA 4NN0A 1H4HA 5GZCA 1AYN1 5CFDC 4Q4V3 1VBE1 2DYCA 1ZVFA 5KHHA 4LE3A 4I01A 2Z79A 4JGZB 4XPVA 4GMP3 3RI9A 4XFFA 2ZKNA 3AJYA 1OPMA 2VVDA 3M3EA 3NV4A 2C0ZA 2OYZA 3IN9A 4R8HA 3VZNA 5J48A 1XQNA 1ZZ6A 2DVFA 1SLCA 3S7IA 1CJDA 1FMD3 3VBFA 1LKNA 4X6QB 4BHPA 1WW6A 1F31A 1YFUA 1ZREA 1PO13 2YZ4A 1XYOA 2W39A 2DTYA 2UY8A 5FPXA 4OHXA 1ENXA 5GLWA 1F8VA 1GV9A 1T6GC 1YI7A 1BEV3 1RUG1 1GKBA 4RQPC 1FOD2 1RB8G 1KS4A 5DG1A 4Q26A 3POSA 2QNKA 1W0PA 2CV6A 4A7ZA 1DGRA 3VDDB 1R081 3LSDA 3VBFB 1COV2 3TNQA 2OPKA 3H7JA 4UXAA 3AMMA 4K7JA 3WP3A 2JENA 1LHNA 5F6KA 2EAKA 1F5JA 3K51A 4INDA 1ZBA3 4FPKA 4AHYA 3RNSA 1HXS3 1QXRA 4D7SA 2XLAA 3J8F3 4FAGA 4BZ4A 3HMYA 2HWD2 5BNQA 2QJVA 5L7OA 4L8QA 3MF9A 5SV5A 3GZAA 2NQYA 2K2SA 2DVAA 3ZXGA 1ASJ2 2BYVE 1PVC2 1B09A 1H1MA 1SCRA 4OHZA 3TB0A 1AYN3 4FTSA 1NYWA 2WFF2 1VBE3 1H9PA 1YFXA 2XWBB 2YUEA 4M0HA 4GKXA 4U2AA 5CIRA 3CJIC 3UJOA 5L7OB 4P9WA 1DZQA 5T50A 4COYA 4AVAA 1Q8VA 1WD4A 4W6XA 3DN7A 1KD7A 1XE8A 5E8AA 1IPJA 2XJPA 4X6RB 3J26N 1D0HA 4B7KA 1KXGA 4I3GA 5I8YA 4CDQC 1MQTA 1UL9A 1RUG3 1WUVA 2D93A 2ZOEB 1J58A 4WM7B 4ZU7A 2ZGKA 4G4FA 2TNFA 2CWSA 5ABJA 3MLJA 4YG0A 4RL7A 4H3WA 1QOTA 1QU0A 3R4DB 4HN0A 2GN7A 4N7UA 2IWGB 3AK0A 1IGOA 3AM2A 3RI8A 3VBHA 3NV2A 3SLIA 1SACA 3E6DA 4Z92B 2O0OA 1MQTB 3PMSA 3MFCA 5F9TA 3ST7A 4K3UA 1LEMA 2WIIB 1PGSA 5GLTA 3PJYA 3D82A 5JI7A 5ABJB 2VY0A 4XMAA 5E88A 5LEKA 3THPA 2JICA 4WZCA 1GSLA 1W6OA 1MS8A 3ZN4A 4LBLA 1AX2A 3VBHB 1Y43B 2ETEA 3WG1A 1D4M3 1MZ5A 3IIAA 3B5LB 1PIV1 4M3CF 3ZN6A 2ZGQA 4RR3C 2P37A 3WHTA 4CTEA 5FO8B 1NOVA 4Y20B 5LEJA 2AZ5A 3WP5A 1UU4A 1SCSA 3FLRA 4L92A 4ASLA 1AJOA 1UW8A 2DCYA 1XYPA 4URTA 2BW8A 1J3PA 2YROA 1VBC1 1O5UA 4HSJA 4FPFA 1X8EA 4N43C 1QMJA 5DDJ1 3ACLA 1QQP1 4WBBA 4PBOA 4RS5B 4IEVA 1G9FA 4QGNA 1VAKA 2RS31 4DFSA 2N7GA 3ROUA 1LU1A 4P9YA 4EN0A 4DXZA 4XXPA 2E63A 3W9AA 4D7YA 2KM2A 4DS0A 1Q56A 1GZWA 4NWWA 2VW0A 4OFGA 2XHKA 3CL1A 1CGPA 3MIEA 3DGTA 3JD71 3WVJA 2VNRA 1MS4A 1A8DA 3A0NA 5LK5A 1AUYA 1O91A 2GNDA 5C8WA 1EAH1 3E97A 4AWDA 1DQ6A 2QZ3A 3ECQA 3GALA 3CJXA 5FRAA 4D3WA 1LOGA 1W6MA 4OHYA 1AX1A 1RC6A 3L2HA 1GZWB 3BIWE 5GJ6A 1QDOA 1HV0A 4YW2A 2ZGOA 5BNNA 3U4XA 1OA4A 1QXPA 4PLMA 1X50A 4FPOB 5DUUA 4K20A 4YZ2A 2LUWA 3OYWA 3WDTA 5CADA 3FLTA 5HXVA 3ZXEA 1PIV3 4XFGA 3MICA 1W6NA 1MS9A 5KXCA 2A6XA 1CJPA 4LLOA 2DFCA 4P9XA 4J1WA 4SBVA 3WW4A 2VMGA 3AMQA 3PVEA 5BNNB 5T3NA 1ND3A 3OYWB 5IT6A 4Q8KA 4R9CA 3VZLA 4YVWC 3AZYA 4YSFA 5DDJ3 1SFNA 4OULA 1QQP3 2PQQA 1W6NB 3NWKA 4P9JA 1FT9A 1S0EA 2B8MA 2Q5TA 2RS33 4LBOA 3M1HA 4IQPA 4D69A 5A3MA 4Y22A 3WCRA 5BNOC 1IOAA 5DZFA 4Q4X2 1GNHA 1A3KA 4Z8BA 2PAEA 3H1YA 1JUHA 4LE4A 2D3PA 4OUSA 3JD73 1R082 1S0CA 2D44A 4GB31 4MYEA 1V6LA 1RJ7A 4ISQA 4ATFA 5JWPA 1FNYA 2JE7A 3FE5A 4QQLA 4AW7A 2ZX4A 5JIAA 3VBRC 3BB6A 5DZEA 4GH4C 4XHXA 4Y22B 2BWAA 1TMF1 5KXBA 1X82A 4IEWA 5CG8A 4K6BA 2ARXA 5CNAA 4OI1A 3KCXA 2BPA2 1TNRA 2XH6A 4GULA 4FQZA 3KT1A 4AFBA 2DU1A 3M2MA 2V5YA 3ZXKA 3OJBA 2WNEA 3WDXA 2HWB1 1RUJ1 4XBNA 3S7EA 2KXLA 2EXHA 3I2DA 3RYPA 1ONAA 2P3IA 1VB2A 4MXWB 3VBUA 4LO4B 5JPMB 4CDUC 1I6XA 5I0SA 2DU0A 1J59A 1PK6A 4UW4A 3WX5A 2GMMA 4FO9A 1PGW1 1G9BA 2ERFA 3GF6A 4XIOA 1WCKA 1NCQA 2ZMNA 3U0ZA 3MLLA 2BBVA 5D8AC 5JIUA 4LUKA 3WDUA 1OLRA 2W52A 4XQ4A 2B46X 4CEYC 2P17A 4F3JA 1PGL2 2NN8A 2R062 1RUC2 1W6PA 1PK6B 1BBT2 3WD5A 1QDCA 1NQDA 1NCQB 4W6WA 1FYUA 5EV7A 4Q0QA 4R9AA 3JBG2 1EYBA 4COZA 3GBWA 5F5QA 1KDKA 3VHNA 2WA3A 1ULFA 3IMNA 1YXWA 4M3CB 1TMF3 1W6PB 1HRI1 4ASMB 1NY71 1K5MA 1RUD2 3KSCA 3HR9A 3DPRC 3H3UA 1RUH1 4Q29A 2WT0A 2ZGNA 5BNPC 2RS51 3J4UH 3QD6A 4PIYA 4Y1YA 3TNPB 1ND2B 1OA2A 2VG9A 1HRV1 1QGLA 1RUJ3 2R32A 4ONUA 1I1EA 2RS11 3C2UA 3AZVA 4HBNA 3M3IA 4KQ7A 3NAPA 1KFUL 1VAMA 4CP2A 1PZ7A 3QH7A 1PMIA 3TRSB 5I8SA 1U0AA 1K5MB 2RHPA 2D6LX 2GDFA 4C0HA 3DL3A 4W6YA 5FAXA 3HWJA 4EWDA 4AGVA 2D98A 2ZHMA 5FLIA 3MPPG 4XYXA 4CDWC 1G9CA 4RD7A 1CESA 1SFYA 2R0FA 3PNAA 4C0BA 2PHFA 4JC1A 5K7PA 1VBC2 4WVWA 5JSPA 1V9U2 2XL7A 1RUI1 3ZMNA 4KG0A 4CDXA 1NA1C 3M70A 3A0KA 5AVPA 3TN91 4Y4YA 3B01A 4QQOA 1ZM1A 3WG3A 3ZSJA 1QJY1 3ZIXA 3VZMA 5CFCC 4Z82A 2VOKA 2BNNA 3ZYJB 2CGOA 3S0MA 4IERA 3ILRA 3USUA 3ZDSA 4DY3A 2GC1A 2Z42A 2MNGA 2AREA 4CDXB 4EN7B 1U5IA 3WDVA 1BXHA 5C8CA 2LTNA 2ZGTA 1NCRA 1EAH2 3CU7A 4OI2A 1H4GA 4BQ1A 2ARBA 2VH9A 1PO21 2BUKA 4GMP0 1OI6A 4AI2A 1RMU1 3M7AA 1RUE1 4WM8A 3ZFEA 5H9QA 1OSGA 1C5IA 4YZ4A 1LOFC 2PHWA 3QACA 3USUB 2JEMA 2VW2A 4TYSA 2ZCWA 4HETA 4LO5B 1UAIA 1Y7BA 4AEDB 2DCTA 3OBRA 1RUH3 5K8SA 2D3RA 2CY6A 2RS53 1OPOA 5BV6A 2IXKA 5C8CB 3N36A 4FOYA 1NCRB 1B35B 4XIKA 1EPWA 2BVBA 2DV9A 5AC91 1HRV3 4NPRA 4GXLA 2JX9A 5JOYA 1AL22 3B69A 4MV2A 3VKFC 4WM8B 3OGGA 1A6CA 3WY6A 3ZFEB 3ZSEA 2GNTA 1JYIA 3ZSKA 1IS3A 1V6OA 3OPZA 4RHV1 5BUVA 4CP0A 2GC0A 2G9GA 3H1MA 2BQPA 1TME1 3NV1A 1V6MA 3KGLA 4XDQA 1HQLA 1YIPA 2EALA 1F5FA 3WHUA 1DZTA 4AI8A 4AVTA 5EWSA 4BPZA 1KQRA 1VBD2 5IK7A 4YFWA 1H9WA 3ATGA 3OGJA 3B94A 5JZGC 1RUI3 1GQGA 2PA7A 5HCFA 3B9IA 2A75A 4LBMA 1Q8OA 2I74A 5FPZA 1AR82 3INAA 1QJY3 1BCXA 5C6CA 3WG2A 4Q0UA 3A4UA 4QQHA 1VLNA 1JBCA 2XGXA 4MSVA 5I91A 1UF2C 4AQSA 2Z69A 1C28A 1CAWB 1DGLA 4E2GA 3B93A 2NMOA 2D3SA 4GB32 1UKGA 3AP4A 3LKJA 2A6YA 3RWNA 1QJX1 1VRH3 3T1MA 1AX0A 2A3YA 2WKKA 2X5IA 4CEWA 4QXKA 1CQ9A 3MYXA 1LU2A 4C1XA 3VBOA 4LUMA 5I0RA 4AEMA 1GFF2 3OCPA 4AXOA 5FMOS 4Y5Z0 1OKQA 2PTMA 2PHRA 2HWC1 4YM0A 1V6JA 4X8NA 3RSJA 1ENQA 3SH4A 3BALA 5KC6A 1REFA 2GU9A 3D6EA 4F83A 1IS4A 1O3QA 4QGLA 1J1LA 1OOPA 1ENSA 5AC93 1FMD1 2X5IB 4H7MA 3HN1A 4CEWB 4Q0PA 1BMV2 2HWB2 1H8TC 4YM1A 3ZFGB 2HWE2 4MVTA 3NW4A 3P3PA 1WCSA 4RHV3 4AVCA 3LOBA 1WLDA 1MEC2 4WVVA 1TME3 1URXA 2WNUC 2E7QA 2R49A 1YJKA 2RM21 1CX4A 1LESA 2D6NA 3OBTA 4F8AA 2SLIA 4LR4A 1OOPB 2QE3A 5C9AA 4W65A 5C9AC 1SBFA 2W08A 4H7LA 3UKNA 1LEDA 1PZ9A 3AKRA 3TBDA 2GSYA 4QMAA 1N3OA 5CBLA 4BCUA 4AFCA 1IQAA 3FC0A 5KXEA 2A7AA 4GKYA 4CZSA 1PNFA 1FAYA 2ZGLA 2AYHA 4QPGA 5FMOL 1PNGA 3CEWA 4BIFA 5JOWA 5KBFA 1SLAA 3HT2A 4HKWA 1NG0A 3GZUC 5EZWA 5IUQA 3G7DA 4JDMA 1QH6A 4RFT0 2R16A 3ZSMA 5F6LB 5CFDA 2ZGRA 4J6GA 4LT5A 1GZ9A 1YFWA 4XF4A 2ZS6B 3ZXLA 1HRI2 1U5ZA 1YYNA 5DG2A 3VKMA 2HWC3 4JGZC 2WZR3 4AGGA 4AG4A 1QXJA 1C8NA 2RR11 4FT8A 3N4MA 1G8WA 4QT6A 3JZVA 3SCFA 2ZX1A 4XTPA 2PLV1 4R52A 4Y1VA 2HEYF 1WLCA 4BYYA 1RGSA 4B3NA 2HWF2 2RS12 1JXNA 3KGZA 3H0OA 3N7MA 4RQPA 2FMYA 2OVUA 2ZZQA 4KBBA 1LRHA 5FLHA 3HIFA 1Q8QA 1WLTA 2RM23 3GBGA 3LA2A 3RPQA 2ILMA 3T1LA 1OFNA 3VDDC 1H0BA 2XB6C 3H9AA 4E4ZA 4QPIC 1AYM3 3H8UA 3JQWA 3TN92 2XJTA 2A71A 2XBO2 3E5QA 3DF0A 1WGPA 4G3YC 4QD2A 5J36A 3N7JA 3ELNA 4NHLA 1RJ8A 1LHUA 1ZZ9A 2P2KA 2WNVC 5T5LA 1C5HA 2XKOA 3VKLA 1HIXA 1LHOA 2Q30A 3KD4A 3UKVA 4MH0E 1HLCA 4SLIA 1VIWB 1JW6A 2IXLA 1NXMA 2IFWA 5JDBA 3FHIB 1O3TA 1D4M1 3WNXA 2YPJA 4C91A 2MEV2 1PO22 1RMU2 5J98B 1VP6A 1RUE2 2FHRA 4PIZA 3EQEA 3HD8B 4GIQA 2JDZA 3CJIA 3ASIA 3AZZA 2RR13 1RHI2 1C8M3 2Z2SB 4M01A 3URFA 2R042 1X8MA 2PLV3 1OMIA 2GZWA 4KWKA 4YRDA 1AR71 4E2SA 3FJSA 2YGMA 1VBA2 1S0GA 4AHXA 2IFRA 3LAGA 4CDQA 1ZRCA 2QDRA 2YV8A 1RVF3 2E9QA 5CVRA 1XNKA 5K9YA 3ETQA 1DQ4A 1S0JA 4K9SA 4WM7C 2DFBA 3JUUA 2Z5WA 4JRAA 1AR61 4Q8LA 3APBA 5D1IA 2VXRA 2WT1A 2AR6A 4NOTA 2XJRA 1VB4A 1FNZA 4JTNA 4R4ZA 2UYAA 1LR5A 4CDQB 2NLRA 2PELA 4Q27A 3R05A 5F1RA 1SEFA 1ZZCA 3W59A 1Y3TA 1YLLA 1IKQA 1O7FA 2RE9A 3IPVA 2AENA 1C1FA 3ALQA 3EO6A 5BYNA 2VECA 2MHFA 5T5OA 3VBSC 3WLUA 1DQ1A 3M3QA 4ZKTB 2E6VA 1G9AA 2R072 4LLFA 4EJRA 3FX3A 3VV1A 1REDA 4CRQA 1FPN2 1QJX2 4OHWA