5DUXA

Crystal structure of the human galectin-4 n-terminal carbohydrate recognition domain in complex with 2'-fucosyllactose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
138
Chain Sequence
PTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-4
publication title Structural characterisation of human galectin-4 N-terminal carbohydrate recognition domain in complex with glycerol, lactose, 3'-sulfo-lactose, and 2'-fucosyllactose.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5duxA00
1LENA 2FMDA 4P9YA 3B9CA 1ULDA 3QLQA 4Y1ZA 1LU2A 5HCFA 3N35A 2D6KA 4TZDA 2DWRA 1BYHA 3AZYA 2BQPA 1GANA 4FPOB 4XJUA 2WKKA 3WV6A 4HL0A 2R0FA 1CESA 4PQ9A 1F9KA 3NV2A 4FPKA 2EF6A 4YFWA 3SISA 4PBOA 4YW2A 5GLWA 3ZYRA 4FQZA 2AYHA 1FNZA 4FP3A 3ZSJA 3R4SA 4YM2A 2WT1A 5EXOA 2ZHLA 3AYAA 4TYSA 2A3YA 3V0AA 1S0BA 1LU1A 2XB6C 5FRAA 3N7KA 1C57A 4YG3A 1Z78A 5GLTA 5CNAA 5GZGA 4XBLA 1IS5A 1WW4A 1O4ZA 1YYNA 3WG3A 4YM1A 2D6NA 4SLIA 4XHBA 3OY8B 4U36A 1SBDA 4YW3A 3AZXA 4YZ3A 1GNZA 1SLAA 1JW6A 4XJZA 5CB7A 2DTYA 1IS3A 1MS8A 4Q26A 5DUUA 4M3CA 3PVNA 1DZQA 4C1WA 1KQRA 4M00A 2H0BA 1QDCA 3AFKA 1KRIA 3NV1A 5JOZA 1YO8A 1Z0HA 2NP0A 2D3PA 1F31A 1PZ8A 3B00A 5H9SA 1J1TA 5AVAA 2SBAA 4FPFA 1WLDA 2NN8A 3HN1A 1CVNA 1LOAA 1DHKB 4XDQA 4OZXA 4YW4A 1WBLA 2D3SA 4LBMA 4DS0A 3WNXA 1CPMA 1LGCA 3AZWA 1ULEA 1AF9A 3RMYA 5T5OA 3WUDA 1Q8OA 4YZ4A 4YGEA 4CZSA 1LOGA 2D6OX 2ZA9A 5GALA 2E53A 5BYNA 5KXEA 1BJQA 1N47A 3NV4A 1ONAA 1LCLA 1LHNA 1YRZA 2ZGOA 4P14A 3INAA 1OKQA 2E7TA 1XQNA 3M3CA 3PVOA 3HR9A 4LBQB 3SNMA 4AWDA 5SV8A 1LHOA 2CWMA 1S0CA 5EWSA 3U4XA 4Y26A 4XILA 1FV2A 1JN2P 1LEDA 3ATGA 4R9DA 1V6LA 2NZ9A 3RMXA 1WD4A 4Y22A 3B3QE 4LBLA 1W6QA 4P9XA 3MEPA 1W6OB 3O12A 5JOYA 2P2KA 4FPLA 4XIKA 2A6VA 3PMEA 3AK0A 1FAYA 4LBKA 3RG0A 1W6PA 4FOVA 1JYCA 2VUAA 4BOWA 3NWKA 4LBJA 4R9AA 4AVTA 3IPVB 2XG3A 3KQRA 1CR7A 4YFZA 1APNA 2P34A 2EIGA 2VH9A 1MS0A 4R9BA 4FPGA 3UK9A 4ATEA 3OYWA 1DLLA 1UN1A 3V0BB 1LGNA 1G7YA 2GN3A 2AR6A 2YMZA 2ZGTA 4AVVA 1Q8SA 4XJWA 1AXKA 2V73A 2D43A 2CTVA 1G9DA 2W68A 1DQ1A 4YW1A 5FREA 3JUUA 5DXDA 1DYPA 4IQPA 1H9PA 1KJRA 1KITA 1LESA 2DVAA 1IS4A 1G9CA 3IMNA 3APBA 1BKZA 1GZ9A 2NYYA 5E88A 5GLZA 5GZFA 4XMIA 2ZMKA 4H55A 4AYUA 2YZ4A 4XOGA 1HDKA 3IM0A 2JD4A 2EXIA 5E89A 5IK5A 3IKWA 3B69A 1RITA 4YM3A 2DV9A 3D6EA 4FPHA 4ZXKA 4M01A 1QOTA 1V6NA 1QOSA 1C1LA 1SACA 3B01A 5DG1A 2ENRA 2GALA 1LECA 2ZHMA 4AGGA 2ZACA 3BIWE 1QNWA 1S1AA 1MS9A 4U2AA 4FPJA 1R1ZA 4AGVA 1GNHA 4K20A 5HCAA 1V6KA 2ZGNA 3OY8A 3OGGA 4RA0A 5KXCA 4K21A 2ERFA 2AENA 3V65A 2V5YA 3AP9A 4XYXA 2ZGMA 5DUVA 1HQLA 2LALA 3SLIA 1LOEA 2UU8A 5H9RA 1A8DA 4JRAA 1Q8VA 5IK7A 2WT2A 4XIOA 3TB0A 1SBEA 1WW5A 2GNBA 2UWAA 2ZMLA 3AP7A 1N1SA 1BZWA 1WUVA 3Q9OA 1DQ0A 4LBQD 4YGBA 1ZM1A 3N36A 1DQ2A 5IK8A 4NO4A 5JOWA 3WDWA 1AX2A 4FOYA 4FPCA 5CBLA 1F5FA 2P37A 2YV8A 5T5JA 4DRRA 2WQZC 2DU1A 4DQAA 1AVBA 1N3PA 3FLTA 5T54A 5F5QA 5IK4A 2ZGPA 2P3KA 2D3RA 3VKNA 4Y1YA 3ASIA 4C1XA 1CJPA 1S0EA 3M3QA 3ZYPA 4WVWA 5E8AA 1MACA 1QKQA 2ZABA 3D5OA 5GZDA 3AP4A 5T55A 1URXA 2DURA 3UL2A 3R05A 3WCSA 1KDKA 4DRVA 1I3HA 1WBFA 2ZHNA 3AXDA 1LTEA 1GICA 2AUYA 2DVDA 3AP6A 4MYEA 5DZFA 3AP5A 3WG4A 3MW3A 1AX0A 4FQ4A 1JHNA 3VKOA 2JKBA 4LBQA 4Z8BA 1VLNA 2WT0A 1ENSA 1N1YA 1U0AA 2WSUA 1FYUA 1FV3A 4XMAA 2AGSA 1LHUA 3FBYA 3I4IA 1LJ7A 3O5SA 2ZGQA 1DBNA 4Q27A 2WNEA 3BTAA 4XBNA 2DUPA 2DUOA 1VIWB 4XTPA 2GMPA 3LSDA 1W6OA 5KXDA 3D4KA 2Z42A 3LCPA 2OVUA 3M3OA 2P3IA 3ILNA 4XTMA 2D6LX 2ZGUA 2C9AA 1AJKA 1DGLA 2JDZA 1HKDA 2EXKA 1HQWA 2W52A 3POSA 2A3XA 3JU9A 1MS4A 1ULGA 3AZZA 2UURA 1GZWB 3ILFA 3IPVA 4M3CB 1W0PA 4Y20B 3ZXLA 4BLIA 2PHFA 3O0VA 1G86A 1Q8QA 3WHUA 1WLCA 4UW6A 3WDVA 2DVGA 4YG6A 1DQ4A 1SLBA 1FX5A 5GJ6A 3V0BA 1LODA 1V6IA 4WV8A 1N3QA 2GNDA 1QF3A 2R0HA 3WOGA 1QDOA 2WSVA 3AYCA 2C5DA 2ZGSA 5JVVA 1AZDA 3AX4A 1QU0A 1YI7A 4HANA 2ZHKA 3WDTA 1IS6A 2OUHA 3DGTA 3ILRA 1GZCA 3M2MA 1LOCA 3PJQA 3ZVXA 1H9WA 2R1BA 2PELA 2VU9A 4UW4A 1QNYA 1LOFA 4Y1VA 5CA6A 3BOPA 2A75A 1LEMA 1YIFA 1V6MA 4FOQA 3AYEA 3WG2A 3RRDA 1CPNA 1BXHA 2CWSA 3POWA 1JBCA 2AREA 2R49A 2YROA 1A3KA 2OW4A 2B7YA 3A0NA 3LSEA 1SCRA 3H0OA 1W6NB 3M1HA 1QMJA 1VAVA 4P9WA 2G4IA 2DTWA 3CNAA 4ISRA 4L8QA 3W58A 2VW0A 2A71A 4BPZA 1X50A 1HLCA 1AX1A 1GYKA 1V00A 5T50A 1V6JA 4Q8LA 5GLUA 1IKQA 1SLCA 3W59A 5JMCA 4XJ9A 5H9QA 1ENQA 3VUOA 4BMBA 1UPSA 4M3CE 1KJLA 2CL2A 3N3HA 2EXJA 2PHXA 4NOTA 1MZ6A 4Y1UA 2R16A 1S0IA 3T2TA 3PVEA 2A3WA 3BODA 2A6WA 1Y7BA 2E7QA 2VW1A 1GSLA 1G9FA 2EXHA 2JECA 1QGLA 1N3OA 1N1VA 1UAIA 2OUJA 2RHPA 3GALA 3WDYA 3AJZA 3AJYA 2FHRA 2PHRA 1UKGA 2NMNA 5T52A 2PHTA 1CQ9A 2VY0A 4XJ8A 1PZ9A 3MPPG 2A70A 1NXD1 5JOXA 5H9PA 4FPEA 2HYKA 1CIWA 1S0FA 2GDFA 4JCKA 1OFSA 4KBBA 4CRQA 1SLLA 2NM1A 3N7LA 4BLJA 4XE9A 4YZ1A 5EYYA 1UMZA 2DU0A 1W6MB 1W0OA 2P3JA 4BM8A 3M3EA 1S0JA 2AH2A 2ZBJA 3IN9A 1S0DA 5F9TA 4FPYA 3OPZA 2JE9A 3RQ0A 3ZSMA 4ZKTB 5CAZA 3T1LA 4UW5A 5GLVA 3V64A 1SCSA 4YW5A 1OQ1A 2GMEA 3OJBA 2D44A 3USUB 3N7MA 3WLUA 4AGRA 1WLWA 3A4UA 4Q1RA 4XXAA 1SFYA 5DUWA 3OBTA 1ZA4A 2A6YA 4DFSA 1ULFA 1MVEA 2TEPA 3POYA 2DYCA 4GALA 1AXZA 1WW7A 2PHUA 3AZVA 3T1MA 5HCBA 4Q2FA 3UJQA 2A6ZA 2A5ZA 1MS1A 1JXNA 1CN1A 3WHTA 1CONA 3N7JA 3VKFC 4YG0A 1JUIA 1FNYA 1VALA 1DQ6A 2GMMA 4GWNA 1LHVA 2ARBA 1LOBA 3RSJA 1BQPA 5DZEA 4YZ2A 4WZFA 1WCSA 4DPNA 4GKYA 2E6VA 4CTEA 1GZWA 2ZAAA 3C2UA 4ITCA 4Y20A 3WG1A 4ATFA 1GKBA 1ULCA 4XBQA 2SLIA 3AXEA 2GNTA 2W08A 4Y1XA 3WVJA 4Q8KA 5JLVA 3V0AB 5DUXA 1JYIA 1SBFA 4GXLA 5GZEA 2D6PA 1SLIA 1FATA 4WVVA 1I1EA 2A6XA 4XHXA 3O0WA 3FUOA 3WUCA 2KM2A 2EAKA 2A7AA 3DUIA 4K1YA 2GN7A 4F83A 2DVFA 1JOJA 4ISQA 4BMEA 4PF5A 5KXBA 4YLZA 2ES3A 1MS5A 2CNAA 3VKMA 1DIWA 3ENRA 2E51A 2ZGRA 1NLSA 1LGBA 1LULA 1WD3A 4JC1A 2DUQA 2UWBA 1VAMA 2Q5TA 3FLPA 3WZ1A 3MW4A 3O0XA 5IT6A 1AJOA 1UZZA 4RL7A 3SITA 1YXWA 3ZXEA 1WW6A 2ZGLA 1RIRA 4PBPA 3ZSKA 1GV9A 1GBGA 3HMYA 1W6NA 1TEIA 2ZKNA 1C4RA 1UZYA 4YGDA 1DYKA 1Q56A 3AYDA 5T5PA 1H30A 3FLRA 1G9BA 2JJ6A 1MZ5A 1UL9A 2YXSA 3GNEA 2NMOA 4GA9A 2ZMNA 5IUQA 4YM0A 1MS3A 3RS6A 1KDMA 4FOWA 1RINA 1G8WA 1DQ5A 2VXRA 1EPWA 2ZGKA 2ZZJA 4XXPA 1S0GA 4FP2A 5DG2A 3FFZA 4GKXA 4YGCA 1PZ7A 2D7FA 2WJSA 3FUQA 1MVQA 1V6OA 1LHWA 4UW3A 3WDUA 2JE7A 1C1FA 1QOOA 2R1DA 4XZPA 3QCWA 5L73A 1O4YA 4K1ZA 4R9CA 4LBOA 4LBNA 4Q1PA 1A78A 4Y22B 1W6QB 4I30A 2GNMA 4D69A 4PCRA 2CY6A 1N1TA 1SLTA 4FVVA 1GLHA 2EALA 5GZCA 3I8TA 3WDXA 3NV3A 1B09A 3R4UA 4M3CF 1W6MA 1W6PB 3ZPYA 4W65A 3OBRA 3KM5A 1UX6A 3SH4A 2CYFA 2D6MA 4AVSA 4XJAA 1D0HA 1AXYA 4Y24A 2YY1A 1ENRA 2W39A 1IOAA 3SH5A 5LK5A 1MR5A 4GWMA 5DZGA 3ZXKA 3OYWB 3SH3A 1IKPA 3USUA 2LTNA 2VW2A 5JDBA 3VKLA 2DVBA 2UWCA 2WLQA 3UJOA 4BQ1A 5GM0A 3ZXFA 3ZXJA 1DFQA 5EYXA 2ARXA 3L2YA 5T5LA 3MW2A 1Q8PA 3VV1A 3WCRA 2I2SA 3A0KA 4ASMB 1LOFC 1D2SA 2PHWA 3ZSLA 1G9AA 3TAYA 4YZ5A
chains in the Genus database with same CATH superfamily
3UKNA 3WSOA 2PQSA 3KF3A 4META 1TMF1 2BNNA 5B2GB 1RC6A 3RZKA 1VRH3 1BYHA 4JGZA 4NVPA 5I0SA 4XJUA 4QXCA 3RZMA 3HOBA 2BBVA 1R1A3 4AQTA 3SISA 4LQRA 2J22A 3NRUA 4M4RA 3W5NA 4Q0PA 1K5MC 4FQZA 4DEQA 2V5DA 3LEGA 4YVSC 3ZSJA 3R4SA 2ZHLA 4TYSA 2TBVA 4JDOA 1O3RA 1S0BA 2HWC3 3K2OA 1Y9GA 4K7JA 4MGZE 3LFIA 5FRAA 4XF9A 4DUXA 2VNGA 1EUTA 3KT1A 5FCCA 3D8CA 5FZ7A 1BBT2 1IS5A 5CKNA 3WG3A 1O4ZA 1QXJA 4WZCA 1CAXA 5C3RA 3UGGA 3JQWA 1GNZA 2XBO2 2WR9A 1JW6A 4EZHA 1HB1A 1RUH1 4EWDA 4KH9A 5DUUA 5FYCA 5LB6A 4JQTA 3PVNA 4Y4YA 3D3AA 4J1XA 4FBFA 2R071 4RHV1 4XQ4A 1Q3EA 3I2JA 3OD4A 4N43C 5ISLA 3AFKA 3ACFA 3I3DA 2F17A 3E6DA 4QM9A 4UBGA 1GP6A 3PJYA 4A7YA 3NV1A 2VGDA 2RDNA 4Q4Y3 1ZRDA 1JODA 1C8NA 1Z0HA 1PZ8A 2JDUA 3DXUA 3ZFGC 1X9TA 5IHRA 3UV9A 4LO7A 2RMU2 2SBAA 1OOPA 2VZ3A 4OZOA 4BIFA 1CVNA 1F2NA 1LOAA 4XDQA 4C0BA 4AVAA 5JWPA 5ABJB 4CEYB 4MLOA 2HKXA 2X10A 3FHAA 3NKGA 4ZPIA 3WNXA 1QEXA 1CPMA 5BNOA 5C3OA 1ULEA 1AR61 2IXJA 1AR73 2VQTA 5FTTC 2BGCA 3ETQA 3FFQA 3IIAA 3J8F1 4N9IA 2VZSA 4CZSA 1LOGA 4HKWA 3AKPA 2ZA9A 1H2NA 1T6BX 5KXEA 1N47A 1VBB3 1NQJA 1YRZA 4K8RB 5FO7B 3INAA 1SZBA 3M3CA 2EAAA 2IXKA 3UETA 1LHOA 1YQCA 2CWMA 2Z79A 4DOUA 5FQ0A 3W9AA 1ODNA 4MHRA 5EWSA 4XILA 3V56A 3U4XA 4RQPB 4R9DA 3ZFFB 4NJ4A 1PM4A 1WD4A 2JKXA 2GP5A 1PO21 3B3QE 4Y22A 2VBDA 5DAQA 5LRRA 2OQ7A 1W6OB 4AQSA 2WS91 4UI9L 1VBD3 2A6VA 3K3NA 5KC5A 5FPUA 4AFMA 2AC1A 2BGOA 4GH4C 1DZRA 4N90A 4ASKA 2UY9A 4M0HA 3OG2A 2D97A 3HJRA 3A21A 4RQPC 4KWKA 1W8ZA 2J1RA 4GAZA 4EN7B 5A7WA 4ZZ5A 1OLMA 4R9AA 2XDVA 3IPVB 5JCTA 2ET1A 1QJU1 5FYYA 1APNA 5LK7B 1MS0A 4R9BA 3C7EA 4KU7A 1VMJA 1MEC2 3G7DA 4HLTA 1LGNA 2WC2A 3AVSA 5J96B 1OI6A 2PAMA 3KS7A 4F3JA 3UYJA 1IHMA 2AR6A 4LHSA 1RJ7A 4NMIA 1X9PA 2F4PA 1AR82 2QQOA 5FZOB 2D43A 4XFGA 5BV6A 1PVC3 1G9DA 4CP1A 3OF1A 4PIYA 2TUNA 1RUC3 3J7MA 3JUUA 3D0SA 4N53C 3H50A 5DXDA 3PIJA 1H9PA 5AFBA 1LESA 2RM23 1IS4A 3VBHB 4E4DX 1G9CA 4MXWB 3IMNA 3APBA 5FFOC 2NYYA 2ZTNA 5FP3A 5GZFA 3U11A 2K2SA 3ZIWA 2XJRA 4HN0A 4HZFA 4AYUA 2VM9A 4IV1C 4XOGA 5FP4A 4AHZA 2JD4A 2EXIA 2P6CA 2H6CA 2WFPA 5E89A 5FMOS 5FZAA 4OHZA 3IKWA 1JI6A 1OF4A 1RUE2 1YCIA 2ADDA 3DPRA 1K12A 3J7NA 3OUIA 4M01A 1JZ7A 2DF7A 5JSOA 2YFUA 4LIVA 3B01A 3C7OA 5JMOA 2GALA 1OUXA 2ZHMA 2R042 1LKNA 4ZHNA 5LA9A 4ZS2A 2XWBB 1RL3A 1MS9A 1PGW1 2VMHA 4NIGA 5CFDB 2C0ZA 5HCAA 3RWNA 5BNNC 2QKDA 3OY8A 5KXCA 4K21A 2ERFA 4XC9A 3JD71 2ET7A 2OXBA 4XYXA 2Z5WA 2Y6FA 1CAWA 2W5FA 3EXUA 1LOEA 1UY4A 3SLIA 4AFDA 1COV1 1VBE1 1W99A 4IGPA 2ARCA 2BRTA 1FT9A 4XAEA 4XIOA 3VBOB 4CDXB 2PYTA 1JYTA 1GQGA 2XHKA 4P9LA 3AP7A 2WN3A 4PDWB 5CFCC 3E6CC 4NIHA 1L7RA 5EJ3A 4QPIC 3I3EA 1IPJA 3E5QA 3P5BA 4IEUA 2VCMA 1YFXA 3Q9OA 1DQ0A 4YGBA 1G6NA 1XU1A 1ZM1A 5A1AA 2WBKA 5IK8A 3BGAA 1RXGA 1REEA 3BTXA 1AX2A 4FOYA 4XDPA 2QVSB 4CDUA 3ZYBA 1AR91 3NVCA 5FLHA 4DRRA 4HXCA 3KHCA 5A3MA 1N3PA 5T54A 5F5QA 4Z2AA 2ZGPA 4CXYA 3VKNA 2CHHA 3ITQA 1UX7A 4Q29A 3VZNA 1R091 3ASIA 2DBNA 1CJPA 1S0EA 1POV1 4L9BA 5FBZA 3RNSA 1MACA 1QKQA 2ARAA 5GZDA 1PM7A 5T55A 4CDWB 1URXA 4GMP3 4CU8A 3UL2A 3R05A 4AE2A 1AYM1 5DDJ1 5FK7A 1QJY1 2AEYA 2AEZA 3HQRA 3AXDA 4XFBA 1BLZA 2AUYA 5EJZB 1X8MA 2IWGB 4D7SA 4LT5A 1AX0A 2G1MA 3AKSA 2WO7A 2JKBA 5L7OA 5F2WA 1XB9A 2JG9C 4XMAA 1V9U1 2AGSA 1C3HA 4UT5A 2JDNA 5DQ0A 2Q8DA 1UOBA 2GMPA 2XLGA 1O8SA 2W0XA 4JGZC 1TVGA 5A6XA 3WEZA 3ZYFA 2OVUA 2WL1A 3MIFA 4YWAA 2YBPA 3E5UA 1UYZA 2XUMA 3ILNA 4ZONA 5C8CB 3POBA 2C9AA 1VJ2A 1J58A 2Y6JA 3LB9A 1BBT3 1CD3G 2WINB 3AFGA 3I3BA 4BU2A 3JU9A 4EN0A 5F1RA 5K0UB 2Y38A 4IEQA 2B39A 2XBO3 4GIQA 4XACA 4COWA 3T4VA 4IEPA 3O0VA 1PIV3 1RUOA 1VB2A 1WLCA 3DKWA 2DVGA 3H3ZA 3I2IA 3NAPA 3P6BA 1S4CA 4HOOA 1FI2A 5BNPB 5GJ6A 4C0HA 1V6IA 4WV8A 2DCTA 1N3QA 2GNDA 3WP3A 4NWVA 2WSVA 2ORXA 3E6BA 4LULA 5FDBA 3AX4A 1QU0A 1YI7A 4HANA 4PT6A 2QQWA 4QT6A 5KHHA 3DGTA 5J36A 1W03A 4DIQA 3VL8A 4GJZA 2AZ5A 3ZVXA 3I2OA 4DXTA 4H14A 2LRPA 2RMU3 2RDSA 4I0AA 4Q4W2 1CZVA 1GMMA 4MVTA 2B9UA 3LEKA 2C24A 1YIFA 4XQWA 1V6MA 4OHVA 5FYVA 3A0NA 2AREA 2P5BA 3POEA 4K20A 5JSRA 1UU5A 3UT0A 2WO1A 1OOPC 2XXZA 4N8MA 4KL1A 5C4WB 3T08A 2B4KA 3RZGA 3WNOA 3OPWA 3K48A 1YI9A 2VW0A 4L8QA 3RFRA 2FDKA 1UZVA 1X50A 2XL7A 3O1VA 4ONUA 5BNOC 2X09A 4MGSA 1BK0A 2MEV2 1DF0A 3BCWA 4AQ6A 5IVVA 1SLCA 2RR12 3W59A 3WY6A 5KHKA 1NUKA 2BOJA 3S57A 4BMBA 1KJLA 4IGOA 3DV8A 2PHXA 2VZ1A 1VE0A 4LPLA 5C9AB 4IUGA 3NNMA 3KMHA 1ASJ1 2A3WA 4JZRA 1Y7BA 5I8SA 5FPXA 1A8MA 4HETA 2WZ8A 1RUJ2 4IETA 4QD2A 4JGYA 3MI8A 5DAXA 1H4GA 4WVMB 4P9JA 1J83A 2VUCA 1QGLA 1N3OA 3AB0A 2OUJA 5FLJA 2NPIA 1C8M2 2FHRA 3THCA 5FYTA 4D7TA 4HMZA 1ZYBA 2VY0A 2ZX4A 2VXJA 4P02B 4XJ8A 3WF2A 5J09A 5IFPA 3LDBA 1NXD1 3SKVA 2XONA 4XUTA 5FY1A 5DAPA 2HYKA 3N9OA 2NM1A 1HXS2 2YYOA 3N7LA 4MSVA 4A6SA 4BLJA 4CEWA 2BP6A 2GH2A 3M3IA 3UGFA 3VD3A 3USSA 1WA6X 2VO5A 1AR83 3LGRA 5F9TA 3CF6E 3RQ0A 4ZKTB 3T1LA 4UW5A 2WNUA 5GLVA 3V64A 1CX1A 2VZQA 3RI9A 3K46A 3WLUA 5C3QA 2B8MA 3N7MA 3H1MA 3RZJA 2HWD2 3NNGA 3OTFA 1SFYA 4QKDA 5DUWA 3CKHA 1ZA4A 2A6YA 1I5ZA 1ULFA 1MVEA 5K7PA 3DPRB 2VBPA 3AVRA 3PUHA 4RD7A 3T30A 2R32A 3PUSA 4AOCA 3VD9A 4EE2A 2K0GA 4ASLA 3T1MA 1RUE3 3FJSA 5A7OA 1XU2A 4A44A 1MS1A 3PUQA 3KWVA 5IFTA 3RYPA 1OC1A 2ILMA 2WQ8A 3TN93 3E1F1 3VKFC 3WW1A 2R043 1A6CA 1FNYA 1VALA 5AC93 2GMMA 1WWYA 2BZDA 4MX3A 4XUQA 2WWJA 2Q8CA 3RSJA 1US2A 3TNQA 2RS32 3QD6A 4YZ2A 2JB4A 1UPIA 5FZCA 4JTNA 3CEWA 5B4XA 3WNKA 3BALA 2E6VA 2VCCA 4ZU7A 1GZWA 4A4AA 2EA7A 2ZAAA 3C2UA 1S2BA 1HRI1 3D0JA 4ITCA 3B7MA 4RR3A 4JKLA 5JIUA 1O4TA 1I9RA 1HRV2 1Y9QA 3V0AB 2GNTA 4Q8KA 2VE1A 5DUXA 4GXLA 2DDUA 3ACIA 3R6SA 1FATA 5HPOA 4HT1T 5I8YA 4IE4A 3K4DA 3LA2A 1H1MA 1NCRB 2BWCA 2EAKA 3JXSA 5D2AA 4F8AA 2HEWF 4K1YA 2GN7A 2DVFA 4PF5A 2ES3A 5HV0A 2R073 4HPKB 2J1TA 1AL22 1DIWA 2C6SA 5JUVA 1F8VA 5LWBA 1W8UA 2UWBA 4YVWB 2Q5TA 4AEMA 5IT6A 2FDIA 4PLOA 1UU4A 2BBAA 2JWPA 3SITA 2PLV1 4G3YC 3WNPA 2UY8A 3ZXEA 5JI9A 1EAH2 4I2OA 5LY2A 4YARA 1SQ4A 5BUVA 2ATFA 1UMIA 4UFHA 4CDUC 1GV9A 3HMYA 3T0AA 1SFPA 1TEIA 2ZKNA 2CDOA 4FXGB 1W90A 4BA6A 5C3PA 1YFWA 2BPA2 4YGDA 3EJKA 3I54A 4AVBA 1DU3D 4L11A 4NRPA 3RJRA 3KV6A 1H8TB 1H30A 3AMPA 1S55A 1EPZA 2ZX0A 2J42A 4IGQA 2WFF2 1UL9A 4K9SA 5B4NA 4KU8A 4LKFA 4GA9A 1YQ6A 2R063 2ZMNA 4UFIA 3ZSEA 2PMWB 4ZU4A 2YBSA 4KG8A 4SBVA 5FZEA 2G9GA 5FLIA 3VD5A 2QQIA 3BUCA 2XKOA 4HKOA 1EPWA 4XXPA 4B3NA 1T6GC 4FP2A 5DG2A 5C5UA 5F6LB 1OD5A 4LK7A 1MPXA 3I2DA 3ELNA 2LUWA 4YGCA 5L7OC 1W2OA 2WJSA 3FUQA 1V6OA 4UW3A 5LBEA 4LK6A 5FUNA 3VBFB 1C1FA 1JYVA 1JTZX 1ZZCA 3H7JA 4IV3B 1CX4A 1O4YA 3CL1A 1R1A2 4LBOA 1D4M1 4LBNA 4Q1PA 1J1LA 3OBAA 1W6QB 1H1IA 5A3TA 1YJKA 1LAJA 1N1TA 5DPNA 1Y4WA 5JPMB 1RUI2 1GLHA 1KS5A 4G9SB 2HEYF 4RN5A 1W2NA 1CIYA 3R4UA 1HW5A 3SEPA 2QBXA 3FC0A 4QKBA 4XF4A 4D0QA 4AHYA 1XSQA 1W6MA 3ZPYA 2WLPA 4OLLA 4LA3A 2FCTA 3IDBB 2D6MA 2G9ZA 2OIIA 4XJAA 2FDFA 3NAPC 4N43A 3L2HA 1PGL2 4Y24A 3EQEA 5LK5A 5IWFA 1MR5A 3ZXKA 1PO11 3OYWB 3HEIA 2O0OA 4QX7A 4Q4W3 4UYBA 5C8WA 1OT5A 4P00B 3LZZA 1X82A 5HCHA 2WZR2 2ARXA 2J7MA 1IG0A 3L2YA 1ND2B 2PQQA 3H1YA 5T5LA 3WCRA 1RVF1 1SDDB 2HWE1 3T2QA 1XNTA 3IDCB 4W6YA 2GH8A 4YZ5A 1VB4A 2FMDA 4D6QA 3WNNA 3PDQA 1ZREA 1ULDA 4Y1ZA 5EP9A 1NA1A 3DN7A 3ABZA 3N35A 3AZYA 2BQPA 4W50A 2OA2A 5AFEA 4Z1VA 1RUG1 3WV6A 1W2UA 2ZEXA 2MEV3 1F9KA 5FKCA 4FPKA 2EF6A 2RR13 4PBOA 4YW2A 1FXZA 2AYHA 1FNZA 2BFUS 2W9XA 3NJVA 3WQBA 1TNRA 4YM2A 2JG8A 2A3YA 2QCSB 5JXHA 3E97A 1LU1A 3Q8CA 1Z78A 4MO3M 5A3WA 3JD73 5FR3A 4YM1A 4SLIA 3LKJA 4U36A 1COV3 2VMFA 4E8CA 4YW3A 1SLAA 5F6KA 5A80A 2Y6LA 3O14A 4XJZA 4BH9A 5LRSA 1IS3A 4JGYC 4Q26A 3WP4A 5JZGB 4C1WA 2R30A 4YPJA 3VBUA 3K3OA 1OH4A 2XH6A 1VBD2 2YGLA 4IE0A 2H0BA 4FFIA 1QDCA 3MO4A 4CP9B 1EV11 3MUZ1 1KRIA 4NN0A 1Z7S1 1FMD1 5EFUA 3SCFA 4W6XA 2D3PA 2JICA 1W28A 4RS5A 2VOKA 2W1SA 5L36A 4HN1A 1PVXA 4FPFA 2HWB2 2DCKA 2Z2SB 3HN1A 3U0ZA 1HB4A 4CEWC 1E5RA 2JDYA 4Q0VA 1BEV3 2YHJA 3BN6A 3T2PA 4BQ3A 1VMHA 1IPKA 1ZZBA 1AYN2 2HWD3 3CO2A 4YSFA 5C33A 3AZWA 1AF9A 3MFAA 5LASA 5T5OA 2EVXA 1Q8OA 1PVC2 2WNUC 4YZ4A 1NLRA 3S5QA 5KHJA 1RUC2 1NT0A 3CHXA 4B4RA 4WM7A 1LHNA 4IW3A 4FI9A 2J1VA 2XVLA 3VBRA 1OKQA 1V9U3 4OYUA 3HR9A 4LBQB 4PJYA 4AWDA 5SV8A 3ZN6B 1K5JA 4K6BA 4K3UA 3WINE 4GZ9A 4I02A 4PQQA 3OUHA 4BQYA 3MDPA 4NPMA 4LBLA 3H3LA 4P9XA 2PHDA 4QXHA 1X36A 3VDDB 4OI1A 1HRV3 2P2KA 4XIKA 2A1XA 4IEYA 3PMEA 3LE0A 4P08A 3RDIA 3GBFA 5AVPA 4PLMA 2X5IA 1SG3A 3ZMOA 4A7ZA 4O65A 5BXXA 4CCEA 1GP5A 1W39A 4XURA 4FOVA 1RHI2 4RR3C 4QPGA 3T09A 3I59B 3NW4A 5JXIA 3HNBM 1CR7A 4QQLA 4OUMA 2RS12 1AL23 3UK9A 4DINB 4AEKA 3O1OA 2IXCA 1UN1A 4LA2A 3V0BB 4AQ2A 1JUHA 1G7YA 2BNOA 1B35A 2DFBA 5FYSA 4Y5TA 3RZHA 1MZEA 2GN3A 2YMZA 1EAH3 4BXSV 4AVVA 3ZYIB 1TME3 2VVEA 4P5HA 5F3CA 1PMJX 1JU4A 2W95A 2W68A 1DQ1A 4YW1A 3BIEA 5EZWA 3AMQA 4CUBA 3OD0A 3WD5A 4QU1A 3MBWA 4P5YA 2QNKA 2PAEA 3QACA 4EROA 4R4XA 5FWJA 3KSCA 1DGRA 1W06A 1H2MA 4XUNA 1XRUA 2WFF3 5GLZA 4OVEA 5LW9A 1SEFA 3ZMNA 2F6BA 3ALQA 2R7EB 1UOJA 1RMU1 5IK5A 1NY72 5HXVA 3B69A 4KBZA 2EICA 4YM3A 3D6EA 4FPHA 2KR2A 1QOTA 1D2QA 1QH6A 1QOSA 1SACA 1OD3A 1K5MB 2GZWA 2VZTA 2UYBA 3PLQA 4QX8A 5E1RA 1LECA 1ZRRA 4LJHA 4UXAA 1OLQA 4YVSB 4B7KA 2ZACA 5F3IA 1QNWA 1MEC1 3FX3A 3IB3A 4U2AA 4FPJA 1UO9A 1V6KA 1CAVA 2N7GA 5CVRA 3RVHA 3RGBA 3V65A 1ENXA 3ETPA 3POIA 1QJX1 3JBG2 2MNGA 4XDOA 5FY7A 3TOJA 2P3YA 3HPNA 3WP5A 5DUVA 1HQLA 2PFWA 2W94A 1XBFA 3U10A 2LS6A 1A8DA 1QJFA 1US3A 2K46A 3JB8A 4L99A 3T4HB 5IK7A 2WT2A 3TB0A 1SBEA 1WW5A 4JTOA 1RUI3 2Q1MA 2HWF1 3H3UA 3AMMA 2IZWA 2YUEA 4INDA 3OGVA 4XF1A 3OCPA 4N43B 4YNIA 2JDHA 4AFAA 5JOWA 5G04L 3U37A 4PI2A 4FPCA 1F5FA 1WCDJ 2P37A 4CPBA 2YV8A 1AVBA 4E9KA 4NHLA 1WZXA 4CCJA 1PIV2 1D7PM 2YU2A 3ZFGB 5IK4A 2D3RA 3BPSA 1RUF1 4RFT0 5BY5A 3QH7A 4FAGA 3B02A 3H42B 3A23A 2NQYA 3WNMA 2WZR3 4WVWA 1UYXA 5E8AA 5I0UA 1ND3A 3D5OA 3SQOA 3F2ZA 3VL9A 2VQ0A 5FMCA 4RYDA 3WW3A 3BB6A 3NQHA 4HVQA 5EV7A 2ADEA 4NHXA 5DZFA 1GICA 4QXBA 3IMMA 1DP0A 3LIHA 3VKOA 1F4HA 4B4PA 3KV4A 1W3XA 1ENSA 1N1YA 1U0AA 3M7AA 1FV3A 1ZX5A 3G6JB 3O5SA 5CG8A 1GOHA 2JG8B 2ZGQA 2WNEA 3Q8FA 5FZ3A 2DUOA 2RVAA 1VIWB 5C70A 1NA1C 4XTPA 1W8TA 3DF0A 1UWWA 5A3PA 5FPVA 1NOVA 2X05A 5KXDA 2Z42A 3HNMA 3LCPA 1E5IA 3RJ2X 3WQ0A 4XVHA 2TNFA 4XUPA 1OQEA 1T2XA 2W3JA 1ZVFA 5CYYA 4N7IA 2W52A 2VZUA 3NJZA 5A32B 1FPN1 4GH4B 4MG2A 2JG8C 1ULGA 3BU0A 3ILFA 1C28A 2D98A 1K42A 4BLIA 1VR3A 1OFNA 1HQNA 2X53S 3DYMA 1ZBA1 4YG6A 1DQ4A 1SLBA 4FSJA 1FX5A 4RFRB 4A3ZA 2CAUA 5A7SA 4AL9A 4AAPA 4LEJA 2WAOA 1QHDA 1VBC3 2ZGSA 3GYDA 1QQP1 5JVVA 1ALYA 5ACA2 3O1RA 1AUYA 3H7YA 4JKMA 5FUIA 2ZHKA 4M4PA 3WDTA 3M2MA 3ILRA 1GZCA 3VBUC 1VBA1 3PJQA 3VD7A 1H9WA 1OKOA 2R1BA 4NUBA 1WCKA 4CCLA 3H8XA 1ZRCA 4MV2A 1LOFA 2DFCA 4LMFA 2HWB3 5A1FA 2ZEWA 4N53B 4UFMA 2UYAA 3AYEA 4BB3A 5LBFA 1CPNA 1JBCA 2WUHA 2R49A 5SV5A 1A3KA 1HJGA 1AYN3 1YHFA 2B7YA 1GWMA 2O14A 2OW4A 4R52A 1QXPA 4RS5C 3BU7A 5FZ0A 3WQ7A 2Y34A 5I93A 2VOVA 4IV1B 1F35A 4P9WA 4CVUA 4XF0A 5FZ6A 4OI2A 2A71A 1OSGA 1GWKA 5J48A 1OA3A 4BPZA 2VMEA 1HLCA 1GYKA 3GHMA 4NIAA 4LNVA 5T50A 1V6JA 1E5HA 5FMOL 4B1LA 4Q8LA 1UCXA 4URAA 4BYYA 2CAVA 3ZKYA 5JMCA 2HH9A 4XJ9A 3H8UA 5H9QA 1D4VB 4BQ2A 2IXHA 5K9YA 1DYOA 2HEVF 1UPSA 1KD7A 4W6WA 5BNNB 1CAUA 5FZ8A 4WM7C 2EXJA 4Q4X1 4QQOA 1TMF2 2I74A 2WN2A 1S0IA 3GJBA 3VBRC 1UQXA 3TN92 1NCQA 2BV4A 2WWUA 5AC92 2VMDA 4YRDA 3VBSA 1G9FA 2EXHA 1XE0A 5CFCB 3WDYA 5KHIA 3EHKA 4QPIB 2VL4A 2ZS6B 1JOPA 1RHI3 2XHNA 3ZYJB 3CMGA 2OQ6A 5GKAC 5T52A 5JIAA 4KWJA 1PZ9A 3MPPG 4KWUA 1ZA7A 2A70A 2CGOA 4OCTA 4EN8B 5JOXA 2X5IC 2RS13 3ACHA 4AI0A 1CIWA 4JCKA 5C6CA 1OFSA 2ETEA 4MOAA 4QPGC 3UGHA 1UMZA 2DU0A 1XE7A 1W0OA 1Q5OA 1GQPA 1RUH2 3P1IA 2P3JA 1REDA 5D1IA 2O1QA 4IERA 4LO5B 5F5CA 5A7PA 3WT3A 5K4LA 4QB1A 2ZBJA 3GGLA 2ZX2A 4FPYA 4ZS3A 3OPZA 2R072 2J1SA 2EIBA 5CAZA 1JHJA 2PTMA 1B35C 1OH3A 3O1MA 1PNGA 2Q1FA 3GJAA 1O91A 2OZJA 4Y3OA 2GMEA 3AC0A 3IWZA 3OJBA 4AVCA 1XPWA 4P9GA 3IDAA 3A4UA 5IATA 4Q4V3 4D8MA 1RVF3 3OBTA 4IESA 2ID4A 4DFSA 4GB33 2TEPA 1C8M1 4UF0B 4EWAA 2DYCA 4X6RB 2VULA 1BHGA 2JG9B 4ES9A 4AZZA 1L3JA 3VDBA 4FFGA 3KF5A 3DXTA 5CU1A 1CONA 3N7JA 2C9KA 4YG0A 1XNAA 4QX0A 5HV4A 4JGZB 1OLME 4Y5Z0 5D8AA 3KZ4C 3T0BA 4BQWA 1AR62 2R062 4LHNA 5DZEA 3J8F2 4WZFA 1UY2A 4DPNA 4EZ4A 4GKYA 5FIXA 3O1UA 1FOD1 3W5MA 3JBG3 4Y20A 3SC7X 1R081 1OUSA 5FZDA 3HVDA 5FYHA 1NG0A 1SBFA 1DGWA 1XXNA 4IEWA 2D6PA 1I1EA 1BVP1 4WVVA 4XFAA 5IJRA 2CSGA 4XHXA 3I2GA 4MADA 2KM2A 4DUWA 3PUAA 1CAXB 1W8HA 2DCZA 3HT1A 3GZUC 5FZ4A 2VOXA 1JOJA 3CIHA 4YLZA 1YQ2A 1MS5A 3ENRA 2BU9A 2ZGRA 2IVIB 2Y6KA 5L19A 4P9IA 4MXVA 5CADA 4OHYA 3FLPA 1KGYA 3K4ZA 3MW4A 3TRSB 4JHTA 5IVYA 4RL7A 3D82A 1WW6A 1F5JA 1NQDA 2BYVE 2ZGLA 4XAAA 5FZGA 1ZRFA 3L9JT 4M0NA 4DXRA 4FTEA 1RUD3 3UNPA 2RS31 3OSDA 4UOJA 2W1WA 1W6NA 2QQLA 5HBAA 1UXZA 2P1BA 3IDEA 2XJVA 4XW3A 3O1SA 4AI3A 4CA9A 3AYDA 1OOPB 5T5PA 3FLRA 1WA4A 2JJ6A 1GP4A 1MZ5A 2RS51 3NL1A 3M4FA 3VD4A 1W8NA 2YXSA 4G4FA 2NMOA 4E2SA 5CKMA 4HONA 1ND3C 4YM0A 2Y60A 4BXFA 3S30A 2FDGA 5BNOB 2OT7A 2JEMA 1KDMA 3HBKA 3GCWA 4FOWA 2Y33A 5FXWA 4AFCA 1S0GA 4UFLA 1OQDA 3FFZA 4GKXA 4O9GA 4QGMA 1JOBA 1PGSA 2OKXA 2D7FA 5C7GA 1LHWA 3AL6A 4Q5OA 4CCOA 1U5IA 2VCBA 1QOOA 2GU9A 4XZPA 4OMCA 5CZKA 4D94A 2WNVA 4XCAA 5FQ0B 2QFEA 3CJXA 4R9CA 4TWTA 4MGKE 1A78A 1GR3A 1YQ8A 4Y22B 4LOSA 2VPVA 2GNMA 4MZUA 4PCRA 4D69A 1JZ8A 4FVVA 1PGW2 4WM8A 1O3SA 4UFKA 2EALA 5FBJA 3I8TA 1GOGA 3NV3A 3WDXA 2Z69A 3WF0A 4AI8A 4A42A 3O1TA 1ZBE1 1W9FA 2W46A 3JD72 4HFSA 4QGLA 5FMDA 5K8SA 1JZ2A 3OBRA 2WYSA 3ZYHA 5A7WB 1COV2 1D0HA 3VHOA 3LPFA 5ACA3 1AXYA 2E32A 2QQVA 5FMBA 1PX3A 2YY1A 4WBBA 2W39A 3Q8EA 1L7QA 4AEDA 1W9WA 2WZPP 3USUA 1NLQA 1IZ3A 1PK6A 1XJAA 2UWCA 3UJOA 1VRH1 2JB8A 5CIRA 4FTSA 1R1A1 1XNBA 5JXJA 1K45A 2E26A 2BOIA 3GBGA 3I2HA 3A0KA 4S2DA 4DO0A 1LOFC 2PHWA 3ZSLA 3KB5A 3CJIA 3TAYA 5A3UA 5F7UA 3BTZA 1LENA 3M70A 5A3OA 1UIJA 3B9CA 3QLQA 2HWC1 3MICA 2J1AA 3N9MA 1LU2A 4NWWA 1W9TA 2RDQA 2D6KA 4BE3A 3GBWA 2XR4A 1BEV2 3PIGA 5JXGA 3MPBA 4YFWA 2XQXA 2XKPA 2I45A 5GLWA 4JRLA 1AYM2 1W8OA 5DDJ2 1QJY2 3S6PA 4FP3A 3ZFEA 3KV9A 4LXLA 4JX0A 2WT1A 2ZPXA 3A22A 1PGL1 1TMF3 1C57A 1GFF2 5GLTA 4A41A 3TBDA 3VBSB 5GZGA 1U12A 4JDNA 4TLFA 1V9U2 1WW4A 1YYNA 2JIJA 2K9ZA 2W91A 2X29A 4Z2WA 4XHBA 3OY8B 4GMP0 1XC6A 4I0WB 1I5PA 3AZXA 4Q4Y1 4YZ3A 3S5AA 3HAGA 3DEMA 3VZOA 1CAWB 5CB7A 2QQKA 1JYWA 4X8PA 1NCQC 2YFZA 4XCBA 3U1XA 4M3CA 1DZQA 3CZJA 3VBSC 5A6QA 5FZIA 1SDWA 4ZY9A 1YIPA 4B8EA 1QJZA 1QH7A 4MHUA 4EN6B 3GHNA 5JOZA 2VZVA 2E31A 4YYOA 1W9YA 5L9RA 2IFWA 2BJSA 1RUH3 3B00A 5H9SA 1AR71 2WO3A 4CDUB 4IEZA 3MIHA 1OVPA 1W9SA 1I6XA 1RUF3 1J1TA 2RE9A 2BUKA 3J4UH 4Y4RA 1O3TA 3KLSA 5FJKA 1HN0A 2XL9A 4RHV3 1DHKB 3WX5A 4NAMA 2CGNA 1VBB1 4QHZA 2XJTA 4RSUA 4C91A 5F32A 3FBMA 4HBNA 4QKFA 4YW4A 2D40A 3C7GA 2GC1A 4DS0A 4X8NA 1LGCA 1RXFA 3TEZA 3RMYA 1TME2 3KCCA 4TSVA 3IAQA 2D6OX 5GALA 4B1MA 3JQXA 2E53A 5BYNA 1BJQA 3NV4A 1LCLA 3VLBB 2ZGOA 2VZOA 3I97A 1VBD1 4HSLA 2E7TA 3PVOA 1XQNA 2JD9A 3SNMA 2ZX3A 5L7OB 3N9PA 2P4EA 2VVFA 4LORA 5FZLA 1UOFA 4RGGA 1AR63 4Y26A 1JN2P 2E63A 3J8F3 4COYA 3RMXA 3N4MA 1OPMA 2YC4A 4IL7A 3ZYRA 5D8AC 4KGQA 1FPN3 1IGOA 1U5XA 3ZN5A 3RG0A 1DZTA 1W6PA 1MQTA 3NKTA 4BOWA 1PO23 2ZJCA 3NWKA 4LBJA 2MHFA 3ZLIA 1ASJ2 1PVC1 1POQA 2J1EA 4YFZA 2VH9A 1RUC1 4AFBA 5DAVA 2WS93 3KVBA 4ATEA 2XVGA 3NAPB 4OHXA 5JR2A 2C26A 1DLLA 1UKRA 1XYOA 2RM21 4BIOA 2BW8A 1KFXL 4ES8A 2VMIA 2ZGTA 4NRMA 2QQJA 5FK8A 1Q8SA 1AXKA 2JIGA 1W2TA 5IAVA 3Q8BA 2CTVA 2V4VA 4AHWA 1QJU3 1PNFA 3ZR6A 1NAEA 4QDRA 4IQPA 1LNSA 3ROUA 2DVAA 1KITA 1M4WA 3B5LB 1BKZA 1GZ9A 5E88A 3SMHA 1TQ5A 1C5IA 2ZMKA 1YFYA 2W1UA 3LA3A 3T2OA 3LDKA 3IM0A 3NJXA 2VNOA 3LDRA 4L92A 1C1LA 1YNAA 5DG1A 4MUVA 5FV3A 4AGGA 2HLEA 2QZ2A 3MIBA 2OX0A 3TEWA 3BIWE 3OEBA 3NNLA 4AGVA 1R1ZA 1OVSA 5FY4A 2AACA 5I0RA 2BFUL 3OGGA 4RA0A 4Q4X3 4QU2A 2AENA 2JDPA 3PVBB 3FMGA 2OPWA 2ZGMA 2F4LA 2LALA 1YFUA 2UU8A 5H9RA 4XUOA 1HB3A 2XMLA 3I2KA 3ZDSA 4AK3A 4LKSA 1OPOA 1X8EA 2ZMLA 2W47A 2WNVC 1QIQA 3DECA 4JGYB 4R8HA 4Y5SA 1LRHA 1N1SA 1BZWA 1X33A 2BERA 3VZLA 4LBQD 5FWEA 1DQ2A 1EY2A 1DDLA 4NO4A 2YBKA 1BVVA 4XZUG 3BOWA 5CBLA 4WM8C 1VBE3 3PU3A 1RJ8A 2DU1A 2WQZC 4BJ0A 3UKVA 4DQAA 1WMDA 5A33A 2P3KA 2OS2A 3ST7A 4IE5A 5ABJA 3GZAA 4CEYA 3CBNA 5FXZA 4CEWB 5EJ1B 4XEZA 3JCIA 1VBC2 1UY3A 2YGMA 2VZPA 2ZABA 4NPLA 4LO6B 4YW6A 2CGPA 1SFNA 1AR93 3U14A 2ZAHA 3ME2A 4AEDC 4KNCA 2DURA 3WR0A 3WCSA 1KDKA 4LIUA 1PK6C 1WBFA 3WP6A 3WG4A 2DVDA 2WNUB 2HBTA 5DMYA 3AP5A 3MFCA 4FQ4A 4GULA 1R093 4AI2A 4Z8BA 1PX4A 2WYFA 1POV3 1VLNA 3ZXDA 2WT0A 2WABA 2VMGA 1W3VA 1BBT1 2ZCWA 1FYUA 1GWLA 3CJIC 3DYPA 3FBYA 3FZ3A 3I4IA 1LJ7A 4KGGA 5FY0A 3ZFFA 4RGKA 1AYM3 2WA3A 5DDJ3 1D0GA 1QJY3 3IAPA 2XBO1 1A34A 1W6OA 3WW2A 4V2VA 5FZMA 5KBFA 2YG0A 2D6LX 5FZ9A 3NJYA 4NR1A 2ZZQA 5IAXA 3ZFEC 1HQWA 3POSA 3GXUA 2ORZA 4R4ZA 1MS4A 4J1WA 1W8WA 4H2AA 4J6GA 4D6RA 2DCJA 2UURA 1GZWB 1OXCA 3IPVA 1TG7A 3MLKA 4NAOA 3B93A 4M3CB 1ST8A 3ZXLA 4RR3B 2WZEA 4FAHA 1G86A 3KV5A 1VP6A 4A6OA 3WHUA 4UW6A 3WDVA 4PI0A 2RMU1 1TZOA 1LODA 4QXKA 1J59A 5FJHA 3TYJA 3R0RA 5IVCA 4X6QB 1D4M2 1H6XA 1W8FA 1QDOA 2R0HA 3BPZA 4LLOA 2C5DA 1HB2A 5FYUA 5IVJA 3VN4A 5FAXA 5FZOA 4OUEA 2VQAA 3MF9A 4Q0QA 1IS6A 1U5YA 2OUHA 3CZUA 2VUDA 1G9BA 1LOCA 4BK4A 2PELA 2VU9A 4UW4A 4DZGA 1H0BA 1QNYA 4S2HA 4CCNA 3VBHA 2A75A 4MXWA 5T3NA 4XF3A 4CE8A 4FOQA 1WMXA 1CWPA 3RRDA 1RTVA 1BXHA 2CWSA 2QJVA 3ZXAC 2YB7A 4ARXA 4EN9B 3H0OA 4GD4A 3VHNA 2A73B 2JDKA 4COVA 4DXZA 1IPSA 1VAVA 3C8XA 3CQOA 2G4IA 4ISRA 3CNAA 4TLGA 2Q0AA 3C7HA 3BYWA 3ES4A 3PL0A 4HK9A 2RDRA 4CXWA 4A7KA 1V00A 3P3PA 4TTGA 1TNFA 5CFDA 5GLUA 1IKQA 1IQAA 4NHYA 4Q4V2 1VRBA 1RVF2 3H9AA 2HWE2 3VUOA 2JENA 4GB32 1O6UA 2CL2A 3SEEA 1EYBA 1EUUA 1YQ5A 4Y1UA 5FP7A 2R16A 1J3RA 3K51A 3PVEA 3T2TA 4CDXA 3T0DA 3VBOA 4PDWA 1RUG2 2C4XA 2E7QA 2PHLA 5J1XA 1IQDC 2JECA 2RHPA 3GALA 4Z92B 2QZ3A 4NIIA 3AJYA 2PHRA 2D5HA 4DY5A 1UKGA 2NMNA 3ES1A 1ULOA 1AR81 1PMHX 2Y6HA 3NNJA 4JV4A 5G05L 1JMUB 1ASJ3 3EB7A 3FN9A 4FPEA 5LA0A 3F95A 1MQTC 1S0FA 3NMBA 1SLLA 2GSYA 1JH5A 1W6MB 1REFA 3C3VA 3VDAA 4E4ZA 5LEJA 3VZKA 5EHDA 4V1PA 1K3IA 4CDWA 2QE3A 3ACLA 3M3EA 5A3NA 3U07A 1S0DA 3R4DB 1PMIA 2JE9A 3ZSMA 1KEXA 1RUE1 5F5IA 2KXLA 1SMVA 2CU5A 4LO4B 3VHRA 4COUA 1SCSA 1EV12 4YW5A 3ACGA 4EWEA 3TN91 1Z7S2 2D44A 4COZA 4IDZA 1FMD2 2R041 4AGRA 5AC91 1JZ5A 3WF4A 4IE7A 4K8FA 5C71A 3SXWA 2YPDA 4CCMA 3O1PA 1RUD2 3B9IA 2XGXA 3B94A 1BMV2 4J25A 1WW7A 2PHUA 3MV01 5HCBA 3UJQA 2A6ZA 2A5ZA 3LPGA 2KA3A 1OA2A 3WHTA 1JUIA 1NA1B 3UESA 5C8CA 3BTYA 4GWNA 4PIXA 4DEVA 4UWDA 4HVOA 1LOBA 2ARBA 2XQRA 4URTA 3H8RA 5K0UA 3AMHA 1WCSA 4BQXA 1CZTA 3ORJA 3LAGA 4NE9A 4XETA 3WG1A 4KI5M 1OLRA 1ULCA 4LE3A 4XBQA 3AXEA 3WVJA 2W08A 1POV0 4Y1XA 1WKYA 4ZU5A 1GU3A 4CP0A 5BNPA 4QHOA 4BISA 1SLIA 1VAKA 2A6XA 3KCYA 2LROA 3LEMA 3WUCA 5E6HA 3THTA 3A7QA 3WF3A 5A6YA 3H1WA 3FHQA 4E8DA 3DUIA 1JZ4A 4XFIA 1HRI3 4ISQA 4BMEA 2XJUA 1O3QA 2BWAA 3VKMA 4CUGA 5I0TA 5A33B 2E51A 3O7OA 3MIEA 1LGBA 1LULA 1OHFA 3TNPB 2DUQA 3VBUB 3WZ1A 3O0XA 4HK8A 1QY4A 1AJOA 2VOWA 1YXWA 4OI4A 4GWIA 3OEAA 1BK1A 3OB8A 4QQPA 4QQHA 4PBPA 2R061 1KFUL 1V0AA 3ZSKA 3HD8B 1GBGA 1RYYA 3AL5A 1W2AX 2NLRA 2QQUA 5DN2A 1KXGA 1C4RA 1EP0A 1UZYA 5C4WA 4RS5B 1H1AA 1JU3A 3HIFA 5APAA 2IFRA 5ABJC 5LEKA 5DABA 1F15A 1UYPA 4CEYC 2PLV3 2E33A 3ZO0B 4ORFA 2FZ1A 3LOIA 5IUQA 4UFJA 3LA7A 5FYZA 2QUOA 3RS6A 1NX9A 1RUNA 3URFA 2IVJA 1UU6A 1DQ5A 2VJXA 3POGA 2DCYA 2ZZJA 3MIGA 3RYRA 4CUCA 2XPJA 2BVVA 5C9AA 4NIDA 2Q8OA 4XABA 5I0DA 1PZ7A 2XLFA 4WM7B 1Y43B 3OGSA 5KC6A 1JYNA 1QWRA 1MVQA 2IC1A 3VBRB 3LWCA 1H4HA 4JQRA 5FY9A 4WVMA 3TWIA 3ZFFC 4E2QA 2FCUA 2J1UA 1DCSA 2Q30A 1RMU2 3QCWA 5L9BA 5L73A 4K1ZA 2XLAA 4L0PA 1NKGA 5FP8A 4CP2A 3PU8A 1H2LA 5FZFA 2CY6A 4CYDA 4JDMA 3MZHA 2JE8A 3GDBA 3FE5A 1UW8A 3CU7A 2GC3A 4OFGA 5JI7A 5GZCA 5FPZA 5F5AA 4Q4W1 2X5IB 1WLTA 1QJX2 3LFMA 4NRQA 1O8PA 4B29A 4W65A 1D4M3 1ZZ6A 2YC0A 4QPGB 4B7EA 4AVSA 3LF7A 2BEOA 3S0MA 1NZCA 3QH6A 2VUJA 1IOAA 4TXWA 4DUVA 2H6BA 5EIYB 1W04A 2HWF2 5DZGA 4N7UA 3SH3A 2I07B 1LB2A 1IKPA 5JDBA 2LTNA 4F7ZA 4BQ1A 1B35B 5GM0A 3I2FA 4LE4A 3NNFA 3ZN4A 3MW2A 4AR2A 1Q8PA 2MEV1 3VV1A 5CISA 2RR11 4XFHA 2I2SA 4CPBD 4ASMB 1G9AA 1D2SA 3IT8A 2FCVA 2V72A 3VBHC 3J7LA 3THDA 4FFFA 1PO13 1RUF2 4P9YA 2PA7A 4QM8A 5HXMA 4O61A 5IYYA 5FPLA 5HCFA 4RHV2 3I3MA 4NPRA 4PF1A 4TZDA 1C5HA 2DWRA 3N9NA 1CZSA 1GANA 5FZKA 4FPOB 1RUJ1 2WKKA 4E4HA 4HL0A 2R0FA 1CESA 4PQ9A 3NV2A 5IVBA 4GWJA 4L2NA 2DBIA 3EMRA 2HWE3 1HV0A 2QDRA 4I0BA 4LO8A 2HJIA 5EXOA 3AYAA 4D3WA 3V0AA 1SHWB 5EPAA 3GM8A 3SKJE 3IIIA 3VZJA 2W87A 2XB6C 5FP9A 3HN3A 3N7KA 4FFHA 4YG3A 4ZZ8A 5CFDC 4ARYA 5CNAA 1WMEA 5J37A 1RUG3 1GOFA 2RG4A 4XBLA 4PIZA 2FDJA 3OOXA 1LR5A 3H8OA 1NCRA 2D6NA 1CAVB 3EO6A 3N9QA 3W20A 4CU9A 1HXS1 3J26N 1SBDA 2E9QA 3J7HA 1QJEA 4L97A 4CDXC 4A2UA 1YUDA 2C1FA 3VBOC 5KWRA 3ECQA 2DTYA 4HPKA 4PDWC 1MS8A 5F39A 3K75B 1NE6A 4S2FA 4UBHA 4YVWA 2YPJA 1KQRA 4M00A 4QGNA 1FPN2 1UNBA 2ZX1A 5A70A 1BEV1 4DB5A 2Y0OA 5ANNA 2HWD1 1YO8A 2NP0A 1PO22 1F31A 5DAWA 2Y64A 5LA1A 4BDVB 1ZBA2 4HKLA 1J84A 3KQ4B 4QKNA 5AVAA 5FZHA 1JZ6A 1WLDA 1H8TA 2NN8A 2VQUA 1O5LA 2WS92 2XJQA 4QPWA 3MYXA 4OZXA 1O7FA 3THPA 1EV13 1Y3TA 1MZFA 1QQP2 4FCAA 1TE1B 1Z7S3 5CEHA 4MGYE 2E7AA 1FMD3 1WBLA 2D3SA 4LBMA 5IW0A 4CDWC 2YU1A 3EYPA 4OUSA 4LR4A 2G9FA 2X8KA 1ND3B 1VBA2 2WDBA 5BPXA 3WUDA 1M06G 2FQPA 4YGEA 1QJU2 4AHXA 2Y26A 3TEYA 2G19A 3BI3A 1ONAA 1HRV1 2QDNA 4MH0E 4P14A 3MLJA 2VTXJ 3FHIB 4OQ9A 3VBFA 1NZIA 3KHBA 1S0CA 4IV3A 4QPYA 1FV2A 1LEDA 3ATGA 4Z07A 1V6LA 2NZ9A 4OMDA 4LUMA 4DMIA 1OA4A 1W6QA 5FOJB 4XQDA 2B9VA 3MEPA 5C8CC 3O12A 5JOYA 4QWNA 4FPLA 1AL21 2B45X 2P17A 3AK0A 1FAYA 5K0UC 4LBKA 1YWKA 2H0VA 1ULPA 2ZOEB 1EAH1 1JYCA 2VUAA 4KWLA 4Q4X2 1TME1 4JKKA 4AVTA 5LA2A 1J3PA 2XG3A 1JS9A 3KQRA 4Q0UA 5BNPC 1DG6A 1DLCA 2EIGA 2P34A 1AL0G 1WCUA 4FPGA 1GQHA 3OYWA 4OQ8A 2Z4FA 4OHWA 4CDQA 4LHKA 2VCAA 1W0NA 2WFF1 3PTRB 2WO2A 1ND2A 2JDMA 4XJWA 2BNMA 1UOGA 4TN7A 2V73A 2LW8A 4WVZA 3ZM8A 4BK5A 5FREA 1VBE2 3SCHA 4BQ4A 1DYPA 1VPHA 1OMIA 2VTFA 3I3QA 1KJRA 3POJA 3IBMA 4QX2A 3HBZA 5F2SA 4XMIA 1WMFA 2YZ4A 4AXOA 1CJDA 1HDKA 1NE4A 2WRAA 3DKQA 4KG0A 5C4WC 5ANQA 4MGQA 4BCUA 5FXXA 1RITA 2DV9A 2V4AA 1AR92 4ZXKA 3X29B 1V6NA 5CG9A 4C8DA 2ENRA 1X7NA 3I7DA 4HG6B 2WNOA 3JZVA 1S1AA 3RZZA 1RUI1 1QXRA 5FYMA 1GNHA 1R092 4H7MA 2ZGNA 5FPBA 5FXVA 2VVDA 1RMU3 1Q43A 1UXXX 4AW7A 2V5YA 5C9AC 2PAKA 3AP9A 2Q8EA 3ZIXA 4I09A 1CAUB 3PURA 1XYPA 4JRAA 1Q8VA 4H3WA 5JZGA 1R64A 1JZ3A 3RYKA 1MEC3 5EQUA 2RJKA 2GNBA 2UWAA 4CSWA 2LM3A 1NCQB 2P6HA 1ZNPA 4CP9A 2VECA 5LY1A 2FMYA 3AKTA 1WUVA 3M8LA 1FOD2 1QJX3 3N36A 4H7LA 4LKEA 2WZR1 3E5XA 4O7XA 1R082 2YDEA 3WDWA 2OZ6A 1ZZ9A 2XVKA 5T5JA 3MIDA 3FLTA 5D21A 2OPKA 1RB8G 1OBNA 1JYXA 2HWF3 4CXXA 3VHPA 2VOTA 2Y8KA 1VMFA 2XJSA 4Y1YA 4C1XA 3LQCA 3M3QA 3ZYPA 3AP4A 5A6ZA 5JPNB 3Q8AA 3AKRA 4FXKB 3U75A 1E5SA 3LEIA 1UD1A 4DRVA 1I3HA 4GJYA 2ZHNA 4MYEA 1LTEA 3AP6A 3WW4A 3CLPA 4LHLA 3MW3A 1JHNA 3WF1A 2VR4A 3DPRC 4LBQA 4XFCA 3ZN6A 3PHMA 4GQ7A 4DNYA 2BDRA 2WSUA 3KGZA 4DXSA 1S2KA 1LHUA 2HYXA 1UY0A 4QHBA 1DBNA 4Q27A 3S7EA 2Y6GA 5KR7A 1E57A 3BTAA 4XBNA 3HNYM 2DUPA 2VZRA 5LZ6A 2RS52 3VDDA 1ZRIA 3LSDA 2RJ2A 3D4KA 3M3OA 1KS4A 4CCKA 2P3IA 4XTMA 2ZGUA 3OGRA 1AJKA 1DGLA 2JDZA 1HKDA 2EXKA 4PLNA 5D8AB 3ZYGA 2A3XA 3GCXA 2D5FA 1VBC1 3I59A 3AZZA 4QX1A 2PN5A 4KMQA 3ON7A 3RWKX 4Y20B 1W0PA 2QQPA 2XJPA 2PHFA 2QQMA 1GUIA 1Q8QA 2FDHA 3MV11 1ODMA 2V09A 4FT8A 2FD8A 2CV6A 1NCRC 3N9LA 5J98B 3RPQA 3WNLA 3V0BA 2HWB1 1U5ZA 2VG9A 1SPPA 5F3GA 2Q1ZB 1QF3A 3WOGA 2L9LA 4B4QA 2BGPA 2YC2A 3AYCA 1YEWA 1AZDA 3AKQA 3KD4A 3FL7A 1AYN1 4QDQA 1V70A 4YVWC 4HSJA 4OI0A 3KCXA 4OULA 4EQVA 3P3NA 3PUIA 1HN1A 1ZBA3 4W8JA 5FZ1A 1GNYA 2WQ4A 1ZBE2 2ZEYA 4Y1VA 3U4SA 3BOPA 5A3LA 2VBBA 5CA6A 2JDAA 5ERLA 4FTBA 1LEMA 3MUY1 4AI1A 4AEJA 3EBRA 4QX5A 3IZOA 3WG2A 4LLFA 1QQP3 2EIDA 2GP3A 3POWA 1H2KA 4H55A 2GAUA 2YROA 3GZEA 3LSEA 5LBCA 3S7IA 1SCRA 2GC2A 1ACCA 1W6NB 3M1HA 2PXJA 3DCQA 3OGJA 4I01A 1H8TC 1VBA3 1QMJA 2BVBA 2DTWA 1PHMA 4LOTA 1K5MA 3GZTB 2VAUA 3W58A 3ZR5A 4BWOA 4YVSA 1VRH2 1AX1A 3KT7A 4V2WA 5FO8B 1ZZ7A 4Z82A 5L9VA 2OYZA 4QX3A 1XNCA 3I49A 5I8TA 1WGPA 1ENQA 4M3CE 2XUEA 1RHI1 3N3HA 4NOTA 1MZ6A 2KD7A 2HWC2 3AMNA 5FOBB 5FO9B 3BODA 2A6WA 5FKBA 3VBFC 2FBEA 2RS11 4IV3C 3BKZA 1HIXA 3TEXA 4LUKA 2VW1A 1GSLA 3ZXGA 1UAIA 1N1VA 1XE8A 2WNVB 5FUPA 4IEXA 5JAXA 4AF9A 3AJZA 5TSWA 5FY8A 2ZKLA 4IE6A 3WXPA 2PHTA 1CQ9A 2VMCA 1XNDA 5H9PA 3RI8A 3ZFGA 4CDQB 1NYWA 4WM8B 5F8PA 5M0TA 2GDFA 4KBBA 4CRQA 2W2IA 3U78A 4XE9A 4YZ1A 5EYYA 3W21A 4Q4Y2 4Q4V1 3ZDVA 4LITA 4A45A 1STMA 3VDCA 4EJRA 1XOYA 2WA4A 4K40A 4O9EA 4D7YA 4GB31 4BM8A 1HRI2 1S0JA 1UZ0A 2AH2A 4JVAA 2CDPA 3IN9A 2FZ2A 2W92A 2R6QA 3ZKUA 4CDQC 1NY71 3NO8A 4RGAA 4GMP1 5BNQA 1XYNA 4AEDB 3HT2A 5FZBA 1OQ1A 3WQ1A 4IXLA 1IG3A 1ND2C 3USUB 1PK6B 2QTWB 1WLWA 4PHZA 4Q1RA 3CDZB 4XXAA 4Y33A 4C90A 2B5HA 5A7NA 2VNRA 2RJLA 1AR72 1H8VA 1L7LA 3UKTA 3POYA 1GZTA 3K4AA 4GALA 1AXZA 2EIEA 4ZXEA 3AZVA 3CJIB 3DL3A 3JBG1 4NHKA 5E16A 4Q2FA 5A7QA 1DGWX 1VBB2 1YC61 5J7MA 1JXNA 1CN1A 3VGIA 1RUJ3 4XFFA 3RZLA 1O5UA 4N9HA 2PLV2 1DQ6A 3AM2A 2MPFA 5IVEA 2VNVA 1LHVA 2O8QA 5A32A 1BQPA 5JR7B 1C8M3 2VD7A 4GH4A 3ZPOA 4E27A 1J3QA 1S2EA 3KGLA 5LATA 3ZFEB 4CTEA 4QAWA 4CU6A 4I3GA 2B46X 4RQPA 4ATFA 4CUAA 1GKBA 1O59A 2SLIA 5LBBA 5JLVA 1JYIA 2WIIB 1WCQA 1UY1A 1CGPA 1HV1A 2IXLA 1HXS3 5GZEA 1PIV1 3MGUA 2RV9A 2HBUA 4AI9A 3O0WA 3FUOA 4AAXA 2QQNA 2W1QA 4KQ7A 4NHMA 3J9SA 1F4AA 2JXAA 2O8OA 1W05A 1FOD3 2A7AA 1RUD1 3KT4A 4F83A 1BMV1 5JZGC 5KXBA 5FYIA 1R083 4CCDA 2CNAA 4JAAA 2WAAA 5FPAA 4JC1A 1NLSA 2IUWA 1WD3A 3LIGA 3POFA 1UIKA 5I91A 1VAMA 3PTYA 4MGIE 5IVFA 1UZZA 3OUJA 4N53A 1HX6A 1NXMA 1RIRA 3LOBA 1AHSA 4QQ2A 5KHGA 5FY5A 3GF6A 4IV1A 3PMSA 5JSPA 4Q0SA 1DYKA 1BCXA 1Q56A 2RM22 2WWSA 3K77A 4CU7A 4UAPA 1Y9MA 2VTXA 3GNEA 3FWEA 5C3SA 1XNKA 2RS33 1MS3A 4BQ5A 4D6SA 3LD8A 3VZMA 2B42B 3PNAA 2Q4SA 1RINA 4HVRA 1G8WA 5A1LA 5BNNA 1H6YA 2VXRA 2ZGKA 3T3YA 1UMHA 4QMAA 1UYYA 2RS53 4QB2A 3MF6A 3SHRA 2IXIA 1PO12 5FYBA 4W4ZA 4JHZA 4IEOA 2VC9A 3OPTA 4FO9A 2BTVC 2JE7A 3WDUA 2R1DA 4AG4A 2D93A 5CFCA 5LCWL 4IEVA 3ZX7A 4QPIA 4EV0A 3MLLA 3VDDC 2ZXQA 4QB6A 1OURA 2GC0A 4I30A 5ACA1 2Y0IA 3DYOA 2JX9A 4LKDA 4NROA 1SLTA 3BVCA 3HQUA 3NSTA 1SPPB 4S2GA 3OBZA 1B09A 4M3CF 1UF2C 3KVAA 4DY3A 1W6PB 1MQTB 3HQXA 4E2GA 2XWJB 1ZZ8A 3KM5A 1UX6A 1P8JA 3ZOIA 3SH4A 2CYFA 4E4SA 5J3UA 1RGSA 4BHPA 5HI0A 3C7FA 4MGTA 4LTAA 1ENRA 5F3EA 3VB9A 1OF3A 3SH5A 4QDSA 3SCGA 4GWMA 4I3PA 4A3XA 1UZWA 1YJLA 1ZBE3 2VW2A 1YLLA 1DGRN 3JB4C 2DVBA 3VKLA 2WLQA 3ZXFA 3ZXJA 1HJFA 1DFQA 3QBQA 4XPVA 5CKQA 5EYXA 5C5TA 2ZEZA 4UF0A 3MHZA 4EYUA 2XOMA 3HWJA 3QOPA 4CCCA 5F37A 2JG9A 4ET7A 4YW7A 4BZ4A 1XSRA
chains in the Genus database with same CATH topology
3UKNA 4META 1TMF1 2BNNA 5B2GB 1RC6A 1VRH3 1BYHA 4JGZA 4NVPA 5I0SA 4XJUA 2BBVA 1R1A3 4AQTA 3SISA 4Q0PA 1K5MC 4FQZA 4YVSC 3ZSJA 3R4SA 2ZHLA 4TYSA 2TBVA 4JDOA 1O3RA 1S0BA 2HWC3 4K7JA 4MGZE 5FRAA 4XF9A 2VNGA 5FCCA 3KT1A 3D8CA 1BBT2 1IS5A 3WG3A 1O4ZA 1QXJA 4WZCA 1CAXA 3JQWA 1GNZA 2XBO2 1JW6A 1RUH1 4EWDA 4KH9A 5DUUA 3PVNA 4Y4YA 4J1XA 4FBFA 2R071 4RHV1 4XQ4A 1Q3EA 3OD4A 4N43C 3AFKA 4A7YA 4QM9A 3E6DA 4UBGA 3PJYA 3NV1A 2VGDA 4Q4Y3 1ZRDA 1C8NA 1Z0HA 1PZ8A 3ZFGC 3UV9A 4LO7A 2RMU2 2SBAA 1OOPA 4BIFA 1CVNA 1F2NA 1LOAA 4XDQA 4C0BA 4AVAA 5JWPA 5ABJB 4CEYB 4MLOA 2HKXA 3NKGA 3WNXA 1CPMA 5BNOA 1ULEA 1AR61 2IXJA 1AR73 5FTTC 2BGCA 3ETQA 3FFQA 3IIAA 3J8F1 4N9IA 4CZSA 1LOGA 4HKWA 3AKPA 2ZA9A 1H2NA 5KXEA 1N47A 1VBB3 1NQJA 1YRZA 5FO7B 3INAA 3M3CA 2EAAA 2IXKA 1LHOA 2CWMA 2Z79A 4DOUA 5FQ0A 3W9AA 5EWSA 3U4XA 3V56A 4XILA 4RQPB 4R9DA 3ZFFB 1WD4A 4Y22A 1PO21 3B3QE 5LRRA 1W6OB 4AQSA 2WS91 1VBD3 2A6VA 5KC5A 4AFMA 4GH4C 4N90A 1DZRA 2UY9A 4M0HA 2D97A 4RQPC 4KWKA 4EN7B 4R9AA 3IPVB 5JCTA 2ET1A 1QJU1 1APNA 5LK7B 1MS0A 4R9BA 4KU7A 1MEC2 3G7DA 4HLTA 1LGNA 2WC2A 5J96B 1OI6A 2PAMA 3KS7A 4F3JA 1IHMA 2AR6A 1RJ7A 2F4PA 1AR82 2D43A 4XFGA 5BV6A 1PVC3 1G9DA 4CP1A 3OF1A 4PIYA 2TUNA 1RUC3 3JUUA 3D0SA 4N53C 3H50A 5DXDA 1H9PA 5AFBA 1LESA 2RM23 1IS4A 3VBHB 4E4DX 1G9CA 4MXWB 3IMNA 3APBA 5FFOC 2NYYA 2ZTNA 5GZFA 3U11A 3ZIWA 2K2SA 4CP2A 2XJRA 4HN0A 4HZFA 4AYUA 4IV1C 4XOGA 4AHZA 2JD4A 2EXIA 2H6CA 2WFPA 5E89A 5FMOS 4OHZA 3IKWA 1RUE2 1YCIA 3DPRA 4M01A 2DF7A 3B01A 2GALA 2ZHMA 2R042 1LKNA 2XWBB 1RL3A 1MS9A 1PGW1 2VMHA 5CFDB 2C0ZA 5HCAA 3RWNA 5BNNC 2QKDA 3OY8A 5KXCA 4K21A 2ERFA 3JD71 2ET7A 4XYXA 2Z5WA 1CAWA 3SLIA 3EXUA 1LOEA 4AFDA 1COV1 1VBE1 4CDXB 4XIOA 1FT9A 3VBOB 2PYTA 1GQGA 2XHKA 4P9LA 3AP7A 4PDWB 5CFCC 3E6CC 5EJ3A 4QPIC 1IPJA 3E5QA 4IEUA 1YFXA 3Q9OA 1DQ0A 4YGBA 1G6NA 1XU1A 1ZM1A 5IK8A 1REEA 1AX2A 4FOYA 2QVSB 4CDUA 1AR91 3NVCA 5FLHA 4DRRA 5A3MA 1N3PA 5T54A 5F5QA 2ZGPA 3VKNA 4Q29A 3VZNA 1R091 3ASIA 1CJPA 1S0EA 1POV1 4L9BA 5FBZA 3RNSA 1MACA 1QKQA 5GZDA 1PM7A 5T55A 4CDWB 1URXA 4GMP3 3UL2A 3R05A 4AE2A 1AYM1 5DDJ1 1QJY1 3AXDA 4XFBA 2AUYA 1X8MA 2IWGB 4D7SA 4LT5A 1AX0A 3AKSA 2JKBA 5L7OA 2JG9C 4XMAA 1V9U1 2AGSA 1C3HA 2GMPA 2XLGA 2W0XA 4JGZC 2OVUA 2WL1A 3MIFA 3E5UA 3ILNA 2XUMA 5C8CB 2C9AA 1VJ2A 1J58A 3LB9A 1BBT3 1CD3G 2WINB 3AFGA 4EN0A 3JU9A 5K0UB 5F1RA 2Y38A 4IEQA 2B39A 2XBO3 4GIQA 4COWA 4IEPA 3O0VA 1PIV3 1RUOA 1VB2A 1WLCA 3DKWA 2DVGA 3H3ZA 3NAPA 1FI2A 5BNPB 5GJ6A 4C0HA 1V6IA 4WV8A 2DCTA 1N3QA 2GNDA 3WP3A 4NWVA 2WSVA 3E6BA 4LULA 5FDBA 3AX4A 1QU0A 1YI7A 4HANA 4QT6A 5KHHA 3DGTA 5J36A 3VL8A 2AZ5A 3ZVXA 4H14A 2RMU3 4I0AA 4Q4W2 4MVTA 2B9UA 1YIFA 4XQWA 1V6MA 4OHVA 3A0NA 2AREA 4K20A 5JSRA 1UU5A 1OOPC 4KL1A 5C4WB 4L8QA 3K48A 1YI9A 2VW0A 1X50A 2XL7A 4ONUA 5BNOC 2MEV2 1DF0A 3BCWA 4AQ6A 5KHKA 1SLCA 2RR12 3W59A 3WY6A 4BMBA 1KJLA 3DV8A 2PHXA 5C9AB 3KMHA 1ASJ1 2A3WA 1Y7BA 5I8SA 5FPXA 1A8MA 4HETA 4QD2A 1RUJ2 4IETA 4JGYA 3MI8A 1H4GA 4WVMB 4P9JA 1QGLA 1N3OA 3AB0A 2OUJA 5FLJA 2NPIA 1C8M2 2FHRA 4D7TA 4HMZA 1ZYBA 2VY0A 2ZX4A 4XJ8A 5J09A 1NXD1 2HYKA 2NM1A 1HXS2 2YYOA 3N7LA 4MSVA 4BLJA 4CEWA 3M3IA 2GH2A 3USSA 1AR83 3LGRA 5F9TA 3CF6E 3RQ0A 4ZKTB 3T1LA 4UW5A 2WNUA 5GLVA 3V64A 3RI9A 3WLUA 2B8MA 3N7MA 3H1MA 2HWD2 3OTFA 1SFYA 5DUWA 1ZA4A 2A6YA 1I5ZA 1ULFA 1MVEA 5K7PA 3DPRB 4RD7A 2R32A 2K0GA 4ASLA 3T1MA 1RUE3 3FJSA 1XU2A 1MS1A 3RYPA 2ILMA 3TN93 3WW1A 3VKFC 2R043 1A6CA 1FNYA 1VALA 5AC93 2GMMA 4MX3A 3RSJA 3TNQA 2RS32 3QD6A 4YZ2A 1UPIA 4JTNA 3CEWA 5JSOA 3BALA 2E6VA 4ZU7A 1GZWA 2EA7A 2ZAAA 3C2UA 1S2BA 1HRI1 3D0JA 4ITCA 3B7MA 4RR3A 5JIUA 1O4TA 1I9RA 1HRV2 1Y9QA 3V0AB 2GNTA 4Q8KA 5DUXA 4GXLA 3R6SA 1FATA 4HT1T 5I8YA 3LA2A 1H1MA 1NCRB 2BWCA 2EAKA 4F8AA 2HEWF 4K1YA 2GN7A 2DVFA 4PF5A 2ES3A 2R073 4HPKB 1AL22 1DIWA 1F8VA 2UWBA 4YVWB 2Q5TA 5IT6A 4PLOA 1UU4A 3SITA 4I2OA 2PLV1 4G3YC 3ZXEA 2UY8A 5JI9A 1EAH2 4YARA 1SQ4A 5BUVA 2ATFA 4CDUC 1GV9A 3HMYA 1TEIA 2ZKNA 4FXGB 4BA6A 1YFWA 2BPA2 4YGDA 3EJKA 3I54A 4AVBA 1DU3D 4L11A 3RJRA 1H8TB 1H30A 3AMPA 1S55A 1EPZA 2ZX0A 1G9BA 2WFF2 1UL9A 4K9SA 4KU8A 4GA9A 2R063 2ZMNA 3ZSEA 4ZU4A 4KG8A 4SBVA 2G9GA 5FLIA 2XKOA 4HKOA 1EPWA 4XXPA 4B3NA 1T6GC 4FP2A 5DG2A 5F6LB 1OD5A 3I2DA 3ELNA 2LUWA 4YGCA 5L7OC 2WJSA 3FUQA 1V6OA 4UW3A 3VBFB 1C1FA 1JTZX 1ZZCA 3H7JA 4IV3B 1CX4A 1O4YA 3CL1A 1R1A2 4LBOA 1D4M1 4LBNA 4Q1PA 1J1LA 1W6QB 1H1IA 1YJKA 1N1TA 5JPMB 1RUI2 1GLHA 1KS5A 4G9SB 2HEYF 3R4UA 1HW5A 3FC0A 4XF4A 4AHYA 1W6MA 3ZPYA 2WLPA 4OLLA 4LA3A 3IDBB 2D6MA 2OIIA 4XJAA 3NAPC 4N43A 3L2HA 1PGL2 4Y24A 3EQEA 5LK5A 1MR5A 3ZXKA 1PO11 3OYWB 2O0OA 4Q4W3 5C8WA 3LZZA 1X82A 2WZR2 2ARXA 3L2YA 1ND2B 2PQQA 3H1YA 5T5LA 3WCRA 1RVF1 2HWE1 3IDCB 4W6YA 2GH8A 4YZ5A 1VB4A 2FMDA 1ZREA 1ULDA 4Y1ZA 1NA1A 3DN7A 3N35A 3AZYA 2BQPA 2OA2A 5AFEA 4Z1VA 1RUG1 3WV6A 1W2UA 2MEV3 1F9KA 4FPKA 2EF6A 2RR13 4PBOA 4YW2A 1FXZA 2AYHA 1FNZA 2BFUS 1TNRA 4YM2A 2JG8A 2A3YA 2QCSB 3E97A 1LU1A 1Z78A 3JD73 4YM1A 4SLIA 3LKJA 4U36A 1COV3 4YW3A 1SLAA 5F6KA 3O14A 4XJZA 4BH9A 5LRSA 1IS3A 4JGYC 4Q26A 3WP4A 5JZGB 4C1WA 2R30A 3VBUA 2XH6A 2YGLA 1VBD2 2H0BA 1QDCA 1EV11 1KRIA 4NN0A 1Z7S1 1FMD1 5EFUA 3SCFA 4W6XA 2D3PA 2JICA 4RS5A 2VOKA 5L36A 4HN1A 1PVXA 4FPFA 2HWB2 2DCKA 2Z2SB 3HN1A 3U0ZA 4CEWC 4Q0VA 1BEV3 2YHJA 1IPKA 1ZZBA 1AYN2 2HWD3 3CO2A 4YSFA 5C33A 3AZWA 1AF9A 3MFAA 5T5OA 2EVXA 1Q8OA 1PVC2 2WNUC 4YZ4A 1NLRA 5KHJA 1RUC2 4B4RA 4WM7A 1LHNA 3VBRA 2XVLA 1OKQA 1V9U3 3HR9A 4LBQB 4PJYA 4AWDA 5SV8A 3ZN6B 4K6BA 4K3UA 3WINE 4I02A 3MDPA 4LBLA 4P9XA 2PHDA 1X36A 3VDDB 4OI1A 1HRV3 2P2KA 4XIKA 4IEYA 3PMEA 3RDIA 3GBFA 5AVPA 4PLMA 2X5IA 3ZMOA 4A7ZA 5BXXA 1W39A 4FOVA 1RHI2 4RR3C 4QPGA 3I59B 3NW4A 1CR7A 4QQLA 4OUMA 2RS12 1AL23 3UK9A 4DINB 4AEKA 2IXCA 1UN1A 4LA2A 3V0BB 4AQ2A 1JUHA 1G7YA 2BNOA 1B35A 2DFBA 1MZEA 2GN3A 2YMZA 1EAH3 4AVVA 3ZYIB 1TME3 2VVEA 4P5HA 2W68A 1DQ1A 4YW1A 5EZWA 3AMQA 3OD0A 3WD5A 2QNKA 2PAEA 3QACA 4EROA 4R4XA 3KSCA 1DGRA 1H2MA 1XRUA 2WFF3 5GLZA 4OVEA 1SEFA 3ZMNA 2F6BA 3ALQA 1RMU1 5IK5A 1NY72 5HXVA 3B69A 4YM3A 3D6EA 4FPHA 1QOTA 1D2QA 1QH6A 1QOSA 1SACA 2GZWA 1K5MB 5E1RA 2UYBA 3PLQA 1LECA 1ZRRA 4UXAA 4YVSB 1OLQA 4B7KA 2ZACA 1QNWA 1MEC1 3FX3A 4U2AA 4FPJA 1V6KA 1CAVA 2N7GA 5CVRA 3V65A 1ENXA 1QJX1 3JBG2 2MNGA 3WP5A 3TOJA 5DUVA 1HQLA 2PFWA 3U10A 1A8DA 4L99A 3JB8A 5IK7A 2WT2A 3TB0A 1SBEA 1WW5A 4JTOA 1RUI3 2Q1MA 2HWF1 3H3UA 3AMMA 2IZWA 2YUEA 4INDA 4XF1A 3OCPA 4N43B 4YNIA 4AFAA 5JOWA 4FPCA 1F5FA 1WCDJ 2P37A 2YV8A 1AVBA 4E9KA 4NHLA 1PIV2 3ZFGB 5IK4A 2D3RA 1RUF1 4RFT0 5BY5A 3QH7A 4FAGA 3B02A 2NQYA 2WZR3 4WVWA 5I0UA 5E8AA 1ND3A 3D5OA 3VL9A 2VQ0A 3WW3A 3BB6A 4HVQA 5EV7A 5DZFA 1GICA 3VKOA 4B4PA 1ENSA 1N1YA 1U0AA 3M7AA 1FV3A 1ZX5A 3G6JB 3O5SA 5CG8A 2JG8B 2ZGQA 2WNEA 2DUOA 1VIWB 1NA1C 4XTPA 3DF0A 1NOVA 5KXDA 2Z42A 3LCPA 3RJ2X 3WQ0A 2TNFA 1OQEA 1ZVFA 4N7IA 2W52A 3NJZA 5A32B 1FPN1 4GH4B 2JG8C 1ULGA 3ILFA 1C28A 2D98A 4BLIA 1VR3A 1OFNA 1HQNA 2X53S 1ZBA1 4YG6A 1DQ4A 1SLBA 4FSJA 1FX5A 2CAUA 4LEJA 1QHDA 1VBC3 2ZGSA 3GYDA 1QQP1 5JVVA 1ALYA 5ACA2 1AUYA 3H7YA 2ZHKA 3WDTA 3M2MA 3ILRA 1GZCA 3VBUC 1VBA1 3PJQA 1H9WA 2R1BA 1ZRCA 1WCKA 4MV2A 1LOFA 2DFCA 2HWB3 4N53B 2UYAA 3AYEA 1CPNA 1JBCA 5SV5A 2R49A 1A3KA 2OW4A 1AYN3 1YHFA 2B7YA 4R52A 4RS5C 5I93A 3WQ7A 1QXPA 3BU7A 2VOVA 4IV1B 4P9WA 4XF0A 4OI2A 2A71A 1OSGA 5J48A 1OA3A 4BPZA 1HLCA 1GYKA 3GHMA 4LNVA 5T50A 1V6JA 5FMOL 4Q8LA 1UCXA 4BYYA 2CAVA 5JMCA 4XJ9A 3H8UA 5H9QA 1D4VB 2IXHA 5K9YA 2HEVF 1UPSA 1KD7A 4W6WA 5BNNB 1CAUA 4WM7C 2EXJA 4Q4X1 4QQOA 1TMF2 2I74A 3VBRC 1S0IA 3TN92 1NCQA 5AC92 4YRDA 3VBSA 1G9FA 2EXHA 5CFCB 3WDYA 5KHIA 3EHKA 4QPIB 2ZS6B 1RHI3 3ZYJB 5GKAC 5T52A 5JIAA 4KWJA 1PZ9A 3MPPG 2A70A 2CGOA 4EN8B 5JOXA 2X5IC 2RS13 4AI0A 1CIWA 4JCKA 5C6CA 1OFSA 2ETEA 4QPGC 1UMZA 2DU0A 1XE7A 1W0OA 1Q5OA 1RUH2</