5DUXA

Crystal structure of the human galectin-4 n-terminal carbohydrate recognition domain in complex with 2'-fucosyllactose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
138
Chain Sequence
PTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-4
publication title Structural characterisation of human galectin-4 N-terminal carbohydrate recognition domain in complex with glycerol, lactose, 3'-sulfo-lactose, and 2'-fucosyllactose.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 30
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5duxA00
2AENA 3RS6A 2E51A 4ATEA 3AJZA 3FUQA 1AJOA 4YM2A 5CAZA 1ULFA 2P3JA 2ARBA 2WKKA 3CNAA 2D6LX 2WNEA 1SFYA 3MEPA 3T1LA 4FPJA 1CN1A 1LHWA 3O0XA 4YM0A 4YFWA 1KDMA 1ENRA 1XQNA 3OYWA 2CY6A 4LBQA 3ZXJA 2D44A 2R49A 2D6PA 2SLIA 2D3PA 2ZZJA 4Y20A 3N3HA 3OJBA 2R16A 3SLIA 4ISQA 3UK9A 2R0HA 3WCRA 3AYEA 3FLPA 5IUQA 3AJYA 2GALA 4NOTA 2A6WA 3M3CA 3ZPYA 1AXZA 1DZQA 1X50A 2JD4A 4GKXA 4LBQD 1DQ4A 3ZXEA 1U0AA 5IT6A 2P3KA 3M2MA 1LHVA 3M3OA 2ZHLA 3OY8B 1QU0A 5GLWA 3USUA 2A6VA 2ZGTA 3WOGA 2A7AA 2PHXA 2ZHKA 1CIWA 2DVGA 2WT0A 1CVNA 1QNWA 3AZWA 1W6NA 1JYCA 3LSDA 1MS9A 3AP4A 1V6JA 3AYCA 3IMNA 5HCFA 4PBPA 1Q8PA 5DZGA 3O0WA 1I1EA 4AGGA 1UKGA 3WG2A 2P2KA 1AXKA 1CQ9A 2E53A 2EF6A 2NMNA 3ILFA 4P9XA 3UJOA 4Y24A 3ILRA 4U36A 2NN8A 3ASIA 1QDOA 1S0JA 2PELA 2PHTA 5HCBA 3O0VA 2UWBA 5T55A 2PHWA 5T5JA 1SCSA 1SLLA 1GV9A 1S0FA 1YIFA 2VY0A 1LHOA 4NO4A 1QMJA 1LOAA 4YG0A 3WHTA 3WLUA 2GNMA 1JHNA 3NV1A 4DS0A 2Q5TA 2ZGUA 2SBAA 3AP9A 2CL2A 2GN3A 4CRQA 1R1ZA 1TEIA 4GKYA 1LU1A 4Y22B 1JXNA 3AXEA 2ZGKA 1S0IA 1GZWA 2GMMA 1W6PB 4BPZA 3ENRA 3NV4A 4GALA 1UN1A 1H30A 1V6NA 2DVDA 3WDUA 1Y7BA 2JE9A 3M1HA 1N1YA 1ULEA 2D3RA 5GZDA 1IS6A 5FRAA 1CR7A 1HLCA 4ASMB 5F5QA 4PF5A 2AGSA 3T2TA 3GNEA 4CTEA 4PCRA 1WBFA 1Z78A 2Z42A 3AYDA 4AVTA 5JVVA 1DFQA 2VW1A 1N1TA 3N36A 1GICA 4JC1A 1G9FA 5CNAA 1RINA 3M3EA 1ULDA 4ZXKA 4XJUA 3POSA 1SLIA 1WLWA 3JUUA 3WDWA 1IOAA 1SLCA 1F31A 1D0HA 2CWMA 2NYYA 5DXDA 4ATFA 2DTYA 2YV8A 4FOWA 4FVVA 2LTNA 1QOSA 2ZKNA 1LOEA 3FBYA 5GALA 3VKLA 4DFSA 2FHRA 3GALA 5HCAA 1C4RA 1FATA 1EPWA 2PHUA 2VU9A 3C2UA 3LCPA 3WUDA 4YGCA 4Y1UA 2DU1A 4Y1XA 3WDXA 2A71A 1S0BA 2OW4A 3A0KA 4XE9A 3WG3A 3DGTA 3ZVXA 4XXPA 1YYNA 1KJRA 3WCSA 4JRAA 4M3CB 4K1YA 1DHKB 4XXAA 1LOCA 2UWAA 4LBLA 3B3QE 4LBOA 1MS1A 3UJQA 3A0NA 3ZSKA 4YZ5A 4XMAA 2W52A 1QGLA 3D5OA 2CWSA 4XHBA 3RMYA 1G9AA 1I3HA 1S0DA 5F9TA 1AJKA 1W6OA 2ZGLA 4XHXA 2PHRA 5GZFA 1PZ8A 2D6OX 4CZSA 3N35A 5L73A 5IK8A 1G9DA 1W6OB 2ARXA 2EXIA 2W08A 2ERFA 4Q26A 4FQ4A 1BJQA 4FOYA 3W58A 2ZGRA 1FAYA 1DIWA 4FPKA 1GBGA 4C1WA 1CJPA 4M3CE 5DUVA 1N3PA 2ZMLA 2VXRA 1O4YA 5DG1A 1IS4A 2DURA 4SLIA 5DZEA 1UMZA 4LBMA 1GANA 2P3IA 1LCLA 3LSEA 1MZ6A 3SITA 1YXWA 2A3WA 4R9CA 2VW0A 4GWMA 4WZFA 4WVVA 1H9PA 2EIGA 1WW5A 1MVEA 2ZBJA 3N7LA 3OY8A 4FP2A 3RRDA 1AVBA 1SLAA 3WG1A 1SCRA 1CONA 2LALA 2D43A 2YMZA 1CPMA 1VAMA 5JOYA 4XJWA 2ZGNA 3WG4A 1QDCA 4DPNA 2PHFA 2DUQA 4FPYA 4BMBA 3AFKA 3SNMA 1WW6A 3OGGA 4JCKA 3RG0A 1URXA 3I4IA 4M00A 4AVSA 1WCSA 1JYIA 3ZXLA 4K1ZA 1GLHA 2R1DA 1LHNA 4Q27A 2JE7A 1LOFA 5JLVA 4DQAA 4XOGA 5EXOA 3VKNA 1O4ZA 1VAVA 3M3QA 4K21A 2DV9A 3V0BA 3AZYA 2WT2A 1Q8SA 2CYFA 2OUHA 3OBRA 4AWDA 1G9BA 3HN1A 1V6IA 4YG3A 4R9BA 4Y1ZA 5GLZA 2P34A 5EYYA 3V0BB 5JMCA 2GDFA 4XILA 1FV3A 1MS8A 1WLDA 1S1AA 2WQZC 2ZGOA 4Y22A 3ZSJA 5H9QA 2D6MA 1GZCA 1N3OA 1YI7A 3B01A 3N7JA 5CBLA 1A8DA 1W6PA 2AUYA 3MW3A 1W6MB 4YM3A 4MYEA 4RA0A 1MACA 3VKMA 2D6KA 2KM2A 4TZDA 5DUWA 2DWRA 5GLTA 4Y1VA 3PVOA 2ES3A 2XG3A 4R9DA 2ZAAA 1DYKA 4UW6A 3MW2A 4XBNA 1C1FA 1A78A 2E6VA 1Z0HA 2NMOA 1KQRA 1QKQA 2WSUA 5EYXA 5GLUA 2ZABA 4BLIA 1QNYA 2R0FA 3SH4A 1G7YA 4AGRA 2RHPA 4R9AA 3V0AB 3I8TA 2EXJA 5H9SA 2UURA 2ZGSA 4AVVA 4YW3A 1S0CA 1LODA 1WLCA 4IQPA 4YW4A 5DZFA 1GYKA 1FYUA 3AZXA 1FX5A 2WSVA 5T52A 3OPZA 3TAYA 1ENQA 2A70A 4OZXA 3PJQA 4ISRA 4XIOA 3IPVB 2GMEA 2NM1A 3RSJA 4BLJA 1LU2A 1MS3A 2VH9A 4Q1RA 3POYA 5GJ6A 1HQLA 1NLSA 4XZPA 5BYNA 5GZGA 3PVEA 1LULA 3AYAA 2EAKA 3IM0A 4UW3A 4RL7A 4WVWA 4XJ9A 3T1MA 5LK5A 4H55A 1UZZA 3R05A 3A4UA 1OQ1A 1AX2A 1CPNA 2DVFA 2DUPA 2WLQA 1W0PA 2A75A 4M3CA 3ZXFA 4Z8BA 3VKFC 4I30A 3WV6A 5GZCA 1B09A 5AVAA 3KQRA 2DVBA 5GM0A 5KXBA 5H9PA 2C5DA 1DQ5A 2A3YA 1Q8VA 1SBFA 5T5OA 1LGCA 5H9RA 1JN2P 4KBBA 3W59A 1GZ9A 4F83A 4C1XA 3O12A 1DLLA 1DQ6A 1GNZA 1ZM1A 4LBJA 1S0EA 4DRRA 3NWKA 4XMIA 2ZMKA 1CESA 3BOPA 1SBDA 2FMDA 1SACA 4Q8LA 1SBEA 3B00A 3ILNA 1N1VA 4M3CF 4LBNA 3RMXA 1MR5A 3NV2A 3WDVA 2VW2A 1OKQA 3R4UA 3AX4A 5E8AA 1FV2A 1ONAA 1G9CA 5T5PA 2AH2A 2WT1A 1D2SA 1PZ9A 3AK0A 5T5LA 2GNTA 1LHUA 2EXHA 4FP3A 3U4XA 3O5SA 3V64A 3AP7A 1V6KA 4XJZA 1UAIA 2ZACA 4P14A 4YGDA 1MS5A 1MZ5A 4BOWA 4XTMA 1AF9A 2D3SA 1JOJA 2A5ZA 3MW4A 3ATGA 4BMEA 1BYHA 3HR9A 2DVAA 2ZHNA 3BTAA 2YY1A 1DQ2A 4FOVA 1G86A 1N3QA 1LTEA 5SV8A 4XDQA 1FNZA 5CA6A 2OVUA 2VUAA 5E89A 3RQ0A 1LJ7A 1A3KA 2XB6C 3KM5A 1V6OA 3WNXA 1UX6A 2HYKA 2EALA 2ZHMA 3B9CA 4FQZA 4XBLA 4Q2FA 3WDTA 3N7MA 3OYWB 1V6MA 1DQ1A 3VUOA 1HKDA 4LBQB 4YGEA 2GN7A 1YRZA 4FPHA 4AGVA 1SLTA 2AR6A 4Y20B 3SISA 4LBKA 4AYUA 1WBLA 1KDKA 3Q9OA 3V65A 1QOTA 3WUCA 1NXD1 1Q56A 2DU0A 4Q1PA 3ZYPA 4M01A 4D69A 4XJAA 1IKPA 1OFSA 2YZ4A 3BIWE 4YZ1A 2BQPA 2AYHA 2YXSA 1LOBA 2UU8A 1MS0A 3APBA 3DUIA 4PBOA 4Y26A 4L8QA 1Q8OA 1W6MA 4YZ3A 4WV8A 2JECA 2P37A 3WVJA 1AX0A 4HL0A 3USUB 3IKWA 5DUUA 1LEDA 4GA9A 4YW5A 4P9YA 2E7QA 5DG2A 4ZKTB 1VALA 2ZGQA 3INAA 3WHUA 2ENRA 2I2SA 1W6NB 5IK5A 1VLNA 1UPSA 2JKBA 1HQWA 3B69A 3QCWA 4P9WA 4UW4A 1IKQA 1AX1A 1BKZA 2GNDA 3POWA 1MVQA 1WD3A 4Y1YA 1V00A 4GXLA 2ZGMA 3AP6A 2DUOA 3V0AA 4FPFA 1APNA 4BM8A 3ZSMA 5DUXA 4YGBA 3AP5A 1W0OA 3VV1A 3WDYA 2D7FA 2AREA 5KXEA 2V73A 5JDBA 1WD4A 4FOQA 4XBQA 1ZA4A 4YM1A 3IPVA 2A6XA 1QF3A 1SLBA 1WUVA 1KRIA 2R1BA 2D6NA 1C57A 2CTVA 1LEMA 4TYSA 1HDKA 2YROA 3L2YA 4YLZA 2W39A 2V5YA 1DYPA 1UZYA 3AZZA 1DGLA 1WW4A 2DYCA 3NV3A 3QLQA 3HMYA 1GKBA 1WW7A 2A6ZA 2TEPA 3BODA 1GZWB 1JW6A 3VKOA 3D6EA 1DBNA 1N47A 3UL2A 1IS5A 5KXDA 1N1SA 3H0OA 3FLTA 2B7YA 2ZMNA 3PVNA 3FLRA 1QOOA 2A6YA 1C1LA 5JOXA 3D4KA 5E88A 5IK7A 2C9AA 1F9KA 2UWCA 3WZ1A 5JOZA 4PQ9A 2NZ9A 4YFZA 5GZEA 1H9WA 5T50A 1FNYA 2GNBA 4YG6A 3AXDA 4FPCA 5CB7A 1GSLA 3SH5A 4FPLA 1GNHA 1ULGA 4XIKA 4K20A 2ZA9A 1G8WA 1RITA 1KJLA 1J1TA 1F5FA 3IN9A 3ZYRA 3ZXKA 1YO8A 4DRVA 4YW1A 3AZVA 1AXYA 1LECA 1W6QA 4FPGA 3SH3A 2JJ6A 3FUOA 1ENSA 4FPOB 5GLVA 5IK4A 5JOWA 4XJ8A 4Q8KA 2CNAA 2H0BA 1JUIA 4XYXA 2EXKA 1KITA 1LOGA 3MPPG 1W6QB 2A3XA 1BQPA 1JBCA 2E7TA 4XTPA 3TB0A 5FREA 5EWSA 1IS3A 3JU9A 1BXHA 1MS4A 1LGNA 1AZDA 1Q8QA 3PMEA 3ZSLA 4UW5A 3R4SA 4YW2A 1RIRA 1ULCA 3N7KA 1LGBA 1LOFC 1V6LA 1LESA 2G4IA 4HANA 2W68A 1VIWB 2ZGPA 1UL9A 1BZWA 1PZ7A 4YZ4A 4YZ2A 2NP0A 1DQ0A 3OBTA 5T54A 3FFZA 4W65A 2GMPA 2OUJA 2DTWA 4BQ1A 4FPEA 2JDZA 4GWNA 4ITCA 5KXCA 2WJSA 1S0GA 1LENA 4U2AA
chains in the Genus database with same CATH superfamily
1JYWA 2JDHA 1XNKA 2RS12 2W95A 3FUQA 1AJOA 4YM2A 1ASJ3 5FXVA 4OHXA 5CAZA 2GP3A 5FKBA 1D4M3 3Q8CA 1R1A2 3CNAA 5A7PA 1F2NA 2KD7A 3NAPC 4P9LA 4RFT0 5CU1A 4YFWA 1KDMA 4XUNA 1VE0A 1XQNA 5FZBA 1TMF2 4R8HA 3T08A 5EIYB 2CY6A 1W2OA 4JVAA 3PNAA 5C8CB 2D6PA 3I2IA 2SLIA 2D3PA 4QQHA 3S7EA 2XJSA 2HLEA 2ZZJA 3N3HA 3OJBA 4OFGA 3WCRA 3UK9A 2R0HA 3EQEA 3KVBA 4JRLA 1TME1 5BNNC 1PO11 2ZX2A 3IDEA 1OLMA 3CZJA 5IUQA 5C9AB 4Y3OA 2RDSA 5CFCA 4NOTA 5FPAA 2HWB2 3ZPYA 4GKXA 1DGWA 1QJX2 4AEDB 3I59B 3OGRA 4CYDA 3M2MA 5IT6A 1D2QA 4I3GA 1QU0A 4JTNA 2A6VA 4LO6B 2BWAA 1RYYA 1OH4A 2DVGA 1CVNA 2WT0A 2BTVC 4CP9A 2VOWA 1V6JA 3AYCA 1UOFA 5IJRA 5DZGA 3ZDSA 4BDVB 3WG2A 4HKLA 2NMNA 2R041 4XF3A 2YPDA 5C4WB 3KGZA 1KXGA 5FIXA 4E4HA 2QDNA 4JDNA 4U36A 2WWJA 2NN8A 5HCBA 1NXMA 2VPVA 4A6OA 4CU7A 2UWBA 4LO5B 5BUVA 5T5JA 5A70A 4DY5A 1NCQB 1SLLA 2WQ4A 4H14A 4PDWA 3S5AA 1ND3B 4KQ7A 1GP4A 2OS2A 3ACGA 1JI6A 4YWAA 5A3WA 4EN9B 5AC91 5I0UA 4CEWA 2BNMA 4EYUA 4AQTA 3IDAA 3WHTA 4CEYA 2GNMA 3KS7A 4BXFA 4DS0A 2WNUA 2WFF1 2D5HA 2Y8KA 3AP9A 5F3IA 4CDUC 4A7YA 1QJFA 1TEIA 4GKYA 1LB2A 2XKOA 4FTSA 2C6SA 2VOVA 4OVEA 3AXEA 3WF0A 5FFOC 3OCPA 5C3RA 1AYN3 2WS93 5K0UA 4GALA 1QEXA 2DVDA 4R4XA 2R062 3TOJA 1VBB1 3BU7A 5GZDA 1RUF1 5FRAA 1REDA 2AGSA 4PF5A 4B4PA 5C3QA 2XLAA 4IE5A 3SHRA 2VJXA 1WBFA 1Z78A 1ZZ7A 3WW4A 5C71A 1VMHA 2VW1A 3JD73 2A73B 1RINA 1L7RA 1AR81 2IXCA 4CUCA 1ND2C 1ULDA 2XXZA 2WO1A 2VL4A 3KZ4C 4RD7A 5F8PA 3RI9A 5FYYA 2CAUA 1RUG2 1VRH1 1I9RA 1CIYA 4B29A 2BEOA 3WDWA 1IOAA 5DXDA 1NUKA 4IEZA 1E5SA 4GJYA 4K40A 5A80A 5JZGB 2HWD1 3VBFA 4IETA 4P08A 3FBYA 4Y4RA 5GALA 1OF4A 3TYJA 4LO8A 3VD7A 2W5FA 4LLOA 4ZS2A 4YGCA 4AI0A 5LBBA 4Y1XA 3WDXA 3TBDA 2A71A 3KF5A 2XQXA 1AL0G 2B9VA 2OW4A 2QUOA 2CHHA 3K51A 3A0KA 2VNGA 4QXHA 1GU3A 3DGTA 4XE9A 3SCHA 3WG3A 5K9YA 2VECA 2YB7A 2J1TA 4EN0A 2RJLA 1O5UA 5FQ0A 3K48A 3PUHA 3MPBA 4PLNA 1QQP3 4BQYA 5C5TA 3B02A 3OSDA 2XJUA 2W2IA 4LBOA 3ZYGA 5CISA 3UJQA 3ZSKA 5IAXA 1J58A 4EROA 4Q4Y1 4QGNA 3BPSA 2TUNA 5KC5A 3O7OA 5KHJA 1PX4A 3DYOA 1NLQA 2PLV2 2DFBA 2Y6FA 5FYTA 1S0DA 2WAAA 2Q30A 4JKKA 1HN1A 2VOKA 4DY3A 1PMIA 1XE8A 4LHKA 4CZSA 1ASJ2 1YCIA 2OIIA 2PHDA 3IIAA 1D4M2 5L73A 1V70A 2W08A 1NQJA 1W04A 2W91A 3MO4A 1BJQA 4FOYA 5F37A 2ZGRA 2J1AA 4FPKA 1DGWX 4HETA 3PIJA 4CU9A 4NAMA 1EP0A 4HVOA 1IZ3A 1W8UA 4LLFA 5LWBA 1O4YA 3E5QA 4DEVA 5IVVA 1H8TC 5C9AA 1GANA 5E16A 3SITA 1UZWA 2VW0A 4Z1VA 4UFLA 3ZOIA 4DUXA 1WW5A 4AEDA 3H8RA 1MVEA 3I59A 3MYXA 2ZBJA 2VTFA 1AVBA 4QX3A 5BXXA 2LALA 2YFUA 3E97A 2VZUA 5D8AB 4MX3A 1CPMA 5A7OA 2ZGNA 4XCAA 3POFA 3JD71 2DBNA 2HH9A 3M7AA 3R4DB 3AFKA 4FPYA 1U12A 4L2NA 5ACA1 4HG6B 5CEHA 1WW6A 3RG0A 5A7QA 4QPGC 5C4WA 5HPOA 4AVSA 3VL9A 5CVRA 2VBDA 1EAH1 3GCXA 4K1ZA 2E33A 1KEXA 1R083 1LHNA 4BK5A 1NCQA 2YDEA 2JE7A 1LOFA 5JLVA 1BEV1 3E5XA 1YI9A 3L2HA 1ND3A 4CUGA 4QD2A 2DCKA 1VAVA 1UU6A 2DV9A 5FZAA 2Q8OA 1F15A 4N7UA 3S5QA 4IV3B 4CXXA 5LZ6A 1G9BA 1RUD3 3K75B 1FXZA 4LKDA 1MEC1 4YVWB 3ZKUA 2C4XA 2P34A 4QPWA 5F7UA 2BYVE 4I2OA 1FMD3 1S1AA 2ZGOA 1JOBA 3VD5A 1N3OA 3K4ZA 4ES9A 4TLFA 5JI7A 1STMA 1GQGA 2Q8CA 4RA0A 4NE9A 3DXUA 4E4SA 4GIQA 4CPBA 5LA1A 5DUWA 2DWRA 4BISA 4Y1VA 1RUNA 1AYN2 2VMGA 2WS92 3HEIA 3TN93 3I49A 2ZAHA 3ABZA 1W9YA 1YQ5A 2E6VA 1A78A 4W50A 3E5UA 1X7NA 1Z0HA 1ZBA1 2NMOA 1KQRA 1VBD3 5I8SA 4AI1A 1B35C 4LHSA 5GLUA 5BNPB 5I0TA 5K7PA 2ZABA 1PHMA 4AGRA 4XFGA 4AHZA 3I8TA 5DAQA 2EXJA 4A6SA 2JDUA 3JD72 5H9SA 2ZGSA 4AVVA 2BOJA 2VZRA 5EQUA 1GYKA 4AOCA 5JXHA 1EY2A 1FX5A 2BERA 5T52A 2QKDA 4LORA 2A70A 3NQHA 3FJSA 2XLGA 5JZGA 3PJQA 3BN6A 2GMEA 2NM1A 4COVA 1JYVA 2WWSA 1UW8A 4COWA 4XZPA 1NLSA 5FZEA 4B1MA 5I8TA 2EAKA 1CAWB 1RUH1 4XJ9A 2ZXQA 4IL7A 5LK5A 4OHZA 2VUJA 5A3MA 3A4UA 2W92A 2JICA 3LIGA 4QQLA 2DVFA 2P6CA 2WLQA 2XLFA 4CE8A 5ISLA 2VQTA 4NIAA 3ZXFA 2YPJA 4Z8BA 2VNVA 5GZCA 2KXLA 3FE5A 2JDKA 3KQRA 5T3NA 1O5LA 2LM3A 1BCXA 4YZ2A 1XNAA 2C5DA 5T5OA 2LW8A 1QQP2 1S55A 1OOPC 1GZ9A 1XYNA 4O9EA 1DQ6A 3GZUC 1UY1A 3E6DA 4QX2A 4XVHA 4DRRA 3NVCA 4QXCA 3BUCA 3ZFFB 3E6CC 2ZX1A 3OF1A 5FZCA 3W5NA 1HW5A 3RNSA 2Z5WA 3I3EA 4AQ2A 3RZGA 1MR5A 1KFXL 5CFDB 2PAEA 1RUOA 4IUGA 4Q4V1 2OZJA 2XBO1 4OCTA 4ZU4A 4S2DA 2AH2A 2OZ6A 1HXS1 2C9KA 5ANQA 1PZ9A 1XSRA 1V9U1 2WFPA 4FP3A 4QDSA 2VZVA 3U4XA 2ADEA 4K6BA 3WNLA 1A6CA 4PF1A 4RHV1 4EWAA 1O91A 1UAIA 2XOMA 2ZACA 4P14A 4YGDA 5LBEA 4CP0A 3T2OA 4XTMA 1AF9A 1W8TA 1CD3G 4G4FA 3RJ2X 3ATGA 5D8AA 1YJLA 3R0RA 5A3NA 2DVAA 2XVGA 3GZAA 5LA2A 1GMMA 1N3QA 2VVEA 1W0NA 2YUEA 3MHZA 1SHWB 1OD5A 4XDQA 1FNZA 4KG0A 5CA6A 5AVPA 2DBIA 3T0AA 5E89A 3SQOA 4L97A 2XB6C 5I8YA 5JI9A 3KM5A 3VDDB 4OHWA 5FYCA 5L19A 1UX6A 1LKNA 3WDTA 2YU1A 3T2PA 4Q2FA 4WZCA 3N7MA 1R082 1DQ1A 1Y9MA 2XVKA 1EPZA 4MOAA 1YFUA 4IV3A 5A3OA 5JSOA 2GN7A 3HPNA 1YRZA 3FZ3A 3RGBA 4ZZ5A 4QPIC 4X8PA 4YVWA 4LBKA 4IEUA 3Q9OA 1XU1A 1RUD2 1H2KA 4NAOA 3IB3A 2JG9C 1Y9QA 3FL7A 3JBG1 4X8NA 3WUCA 1Q56A 2DU0A 4UFMA 4INDA 5JXGA 2E32A 1IKPA 3H42B 4YZ1A 3ZN4A 2F17A 1FMD2 2HWE1 4Y26A 5HXMA 2AEZA 2VMDA 4L8QA 3THTA 3ZO0B 4CCLA 5L7OC 4WV8A 4MGTA 3IKWA 5DUUA 5FAXA 4AI9A 4ZKTB 3C7OA 2ZGQA 1W6NB 4EWEA 4DNYA 3FX3A 1UPSA 4I02A 5KHIA 1HQWA 1W2NA 1GNYA 3QCWA 4UW4A 5A32B 3TN92 5BNPA 4YARA 3KLSA 1ZRCA 1PGSA 4Q4X3 5C70A 1JMUB 1ZA7A 2ZGMA 2DUOA 3CQOA 1VBD2 3AVRA 5E6HA 2HEWF 2MNGA 5FZKA 3WF1A 5BNQA 4M0NA 4G3YC 1PGL1 5A3PA 4I01A 4LOTA 3F95A 5JPNB 4GH4C 3GJAA 1FT9A 3ZR6A 3KD4A 2D7FA 2W1QA 2WABA 1M06G 5JDBA 4YVSA 3ECQA 4XBQA 2GAUA 4TSVA 3IZOA 4BE3A 2QJVA 1WUVA 5FMBA 2D6NA 2OT7A 1C57A 2FQPA 4N53B 1LEMA 4TYSA 1YIPA 4AR2A 3L2YA 3OEAA 2BOIA 1O6UA 4NJ4A 2R32A 1POQA 3C7HA 2B39A 3NV3A 4FFHA 5FP4A 3RYPA 4KU8A 5C3SA 4LXLA 2A6ZA 2XUEA 3QH6A 1JW6A 1W2AX 2V5DA 3UL2A 1IS5A 1ENXA 1UCXA 3CMGA 3VBUB 3EYPA 1NA1B 4QPIA 3WW1A 4DOUA 3D4KA 1RMU3 3LDBA 4OI4A 4XC9A 5IK7A 4LK6A 4GZ9A 1T2XA 3U78A 2C9AA 5FMDA 5FP9A 1H0BA 4FO9A 4PQ9A 3D0SA 1VBA1 2NPIA 3IMMA 3NNGA 4UOJA 5FTTC 1AR93 5B4XA 4BHPA 1WLTA 4RQPB 5CB7A 3SH5A 3CU7A 1GNHA 2P17A 4W4ZA 4EV0A 2HWF3 1S2BA 1J3QA 1MZEA 2FDKA 2QNKA 1YO8A 2FBEA 3MLLA 1H2NA 2XHNA 4E9KA 3TEWA 3ZFFA 4BQXA 4FPGA 3ZIXA 5FYZA 5JOWA 3D3AA 5FY9A 4JGZB 4RN5A 4HZFA 5F6KA 2EXKA 2JG8C 4AF9A 4FBFA 2WC2A 3MPPG 1W6QB 1BQPA 1XRUA 2E7TA 3OGVA 3TB0A 4EZ4A 4GULA 5EWSA 3BTZA 4CCMA 1LGNA 3LEMA 3ZSLA 3PUQA 1UIKA 2XMLA 2WZ8A 1A34A 3FN9A 3FHIB 3PU8A 5LB6A 1LESA 3NNFA 1HX6A 4JDMA 5A6QA 2Q8EA 1UL9A 4RGAA 3VZJA 4LK7A 5GKAC 2BGCA 2RDNA 3H3UA 4BQ1A 3KVAA 1Q5OA 3VHPA 4F8AA 4FPEA 2JDZA 4UBGA 2XGXA 2WJSA 3BVCA 5FLJA 3WUDA 1YQ6A 2AENA 1DGRA 2E51A 3FHQA 4IESA 1PGW1 3RS6A 2RM21 5JUVA 4GMP3 2BUKA 3AJZA 2GH2A 3BU0A 3HQUA 2R073 2BGOA 2ZJCA 5CG8A 2P3JA 2ARBA 5FZOB 2JE8A 4Q29A 2VOTA 4XURA 4CXWA 4FPJA 1LHWA 3O0XA 3VDDA 5IVEA 4LE4A 4QQ2A 2C1FA 1ZZ6A 3VBSC 1UMIA 3O1VA 2FDIA 1YQCA 4BWOA 3AFGA 1LNSA 2V4VA 3DKQA 3TNQA 2BNNA 3MUY1 1YFYA 4IE0A 3OD4A 2R16A 1HB1A 4G9SB 3QOPA 3EJKA 4A42A 2VNRA 3AYEA 3M3IA 4J1WA 2QTWB 3AJYA 1QIQA 2GALA 2K2SA 2OQ6A 3IAPA 1PVC3 1EV13 1RXGA 2HWC3 1DZQA 3M3CA 5D21A 2J42A 2Y0IA 2P3KA 1CZVA 1LHVA 3OY8B 2ZHLA 3ZXGA 5F1RA 4F7ZA 3ZFGC 4DUVA 2OX0A 2ZGTA 2VXJA 1NCRC 1AR71 2WUHA 2RR11 4C0BA 1HRV3 1QNWA 1Y3TA 3AZWA 3N9MA 1W6NA 4MGIE 5I0DA 3LSDA 1MS9A 4AFDA 5A32A 5FZ1A 5LEKA 1Q8PA 4P5HA 1AL23 4RS5C 5I93A 1CQ9A 1VMFA 2E53A 2EF6A 3A7QA 3ILFA 4I3PA 4PI0A 4Y24A 3ILRA 5JSPA 3RDIA 1QDOA 1S0JA 4XW3A 3NNMA 3O0VA 5JWPA 3P1IA 4AZZA 2JIGA 4JHTA 4Q4X2 1GV9A 3TRSB 4AEMA 1ZVFA 5FP3A 2CDOA 3VBHC 1RVF1 2DF7A 1AR63 4YPJA 5A3TA 1LOAA 4YG0A 3WLUA 3KHBA 1JHNA 4KU7A 2ZGUA 3WXPA 2ZEZA 4IV1C 1OLQA 1UQXA 2YBPA 3C7EA 4N53A 4WM7C 4OI0A 2CL2A 4CEYB 4Y22B 4BIOA 3P6BA 1JXNA 1OURA 4MZUA 1QY4A 2XUMA 5A3LA 4CU8A 4DEQA 2ZGKA 3ES4A 3ZPOA 1GFF2 3ENRA 3DECA 4QKDA 3HNMA 5EV7A 1Z7S3 3UKVA 1OPMA 1V0AA 3NAPB 3DF0A 1NA1A 3FFQA 4LTAA 5DDJ1 2C26A 2D3RA 4IERA 4FFGA 2X05A 4OULA 5A1LA 4QGMA 3WP6A 1OHFA 3NJXA 4PCRA 2RS11 3H3LA 5FYIA 5FYMA 3WT3A 1RMU2 4ET7A 3AYDA 4RQPA 5JVVA 1DFQA 5BNNB 5EP9A 1R1A1 4DXTA 2JXAA 3IIIA 1AR92 3SCFA 4E4DX 3LA3A 4B4RA 1RJ7A 3SEEA 1TMF1 2MHFA 2HWF2 2PN5A 3ZFEC 5F3CA 1W99A 4N9IA 4HVQA 1WLWA 4Q0VA 1DP0A 1CZTA 4JGZA 4C0HA 4OUSA 2DTYA 4FOWA 4PI2A 4FVVA 5IVCA 1QOSA 2K9ZA 4IDZA 5FPZA 1H1IA 1LOEA 2ZX0A 4DFSA 2ARCA 5HCAA 4JKLA 1C4RA 2HWB1 1NKGA 1EPWA 1AYM3 1SZBA 2QZ2A 2J1SA 3C2UA 3CO2A 1J3PA 1HJGA 1QJX1 2J22A 3LCPA 5FPBA 1ODMA 2DU1A 4ORFA 4J6GA 1W05A 1I5ZA 4QPYA 5FZ0A 3VBOC 3ZVXA 3MI8A 1XNCA 2XJPA 1KJRA 2VZTA 4XAAA 4JRAA 3VD9A 4XXAA 5FMCA 5JIUA 1LOCA 2UWAA 4GWIA 2X8KA 3B3QE 3POGA 1R64A 1MS1A 3U0ZA 3CDZB 3A0NA 1T6GC 5EJ3A 4HBNA 5FZDA 2BP6A 4GD4A 4COYA 4YZ5A 5J98B 2W52A 1QGLA 2XVLA 3D5OA 3MIEA 3RMYA 3ZYBA 2VMEA 4XETA 4NIIA 4BH9A 4CDUB 2PQSA 2KA3A 3O14A 4HN0A 1W6OA 4L9BA 4XHXA 5FZOA 2D5FA 2PHRA 1DF0A 3B94A 3POBA 4O65A 5GZFA 3IBMA 2CSGA 3GF6A 1WMFA 1YJKA 2R072 4K7JA 1BK0A 5IK8A 1ULOA 5F3GA 2FD8A 3H1YA 4FAHA 4FQ4A 2O8OA 3W58A 2VZ3A 4MG2A 1FAYA 4C1WA 5FZ8A 5DQ0A 3I2KA 4CXYA 4M3CE 1UIJA 3T3YA 5JMOA 2ZMLA 2Z69A 4R4ZA 3ORJA 4FXGB 1JOPA 1W9FA 2I45A 2P3IA 4LBMA 3DN7A 5FZ4A 3T30A 5JIAA 4LKSA 4R9CA 1LAJA 3MFAA 3NNLA 5FZ7A 2R061 3GGLA 3NJYA 3USSA 3T4HB 2RS33 2VMIA 3OY8A 1PVC2 2IZWA 2G1MA 1EV12 1SLAA 2HWC2 3RRDA 3WG1A 2YMZA 4OHVA 5JOYA 4XJWA 1JYXA 3MGUA 3VHOA 1UF2C 1QDCA 4QKBA 4EZHA 4IE4A 2VZ1A 3OGGA 4JCKA 2R7EB 1HRV2 3LA2A 4JQTA 3P3PA 4M00A 1O59A 4IGQA 3SKVA 1WCSA 3W21A 1HQNA 2IWGB 1AL22 1RUG1 3NO8A 4GB33 4URAA 3EXUA 5FXWA 5I0RA 3J7HA 4PIXA 1XBFA 2X10A 3VKNA 5HXVA 5B4NA 1K5MC 3M3QA 4QGLA 1L7QA 3V0BA 2B8MA 2CYFA 1KGYA 2XKPA 1CWPA 2EIBA 2BVBA 3AVSA 1AR62 5EYYA 5JMCA 5FZIA 3NMBA 3RZJA 5F39A 4XILA 1FV3A 3ZKYA 4Y22A 2D6MA 1YI7A 2VD7A 1VPHA 2VTXJ 4W8JA 5DN2A 1PO23 1REEA 2VCAA 5CBLA 1A8DA 3A23A 2VBBA 4QXKA 4QX0A 3D82A 1W6MB 1GWKA 4AAXA 4AQ6A 3VKMA 1MACA 2D6KA 3NAPA 4A4AA 3RPQA 2BBVA 1DLCA 3PVOA 1Z7S2 3URFA 1JZ5A 3NJVA 3ON7A 2VMFA 1NY72 4LO4B 1ALYA 4W6XA 4XBNA 3MLKA 2PLV1 2GU9A 4OYUA 1QKQA 2NLRA 1YHFA 2D93A 5BNNA 3SH4A 1H8TB 1G7YA 1W9TA 3HBKA 2R30A 3AKRA 3OG2A 1ASJ1 2XONA 4ZHNA 2EIDA 4QHZA 1D4M1 3QACA 4IW3A 3V0AB 4E27A 3FC0A 2BRTA 3U37A 1S0CA 1WLCA 4IQPA 4YW4A 2E9QA 2Y6LA 4AAPA 1GOFA 2W46A 1IG0A 2EVXA 1JODA 4XF9A 5BNOC 1ENQA 2CU5A 2IFRA 3HQRA 4NHLA 1HIXA 4N7IA 1F4AA 5FYBA 4LHLA 4BLJA 1LU2A 4FTEA 2VH9A 3J4UH 4Q1RA 4UYBA 3LFIA 4KMQA 5GJ6A 5BYNA 2VM9A 5G05L 1X36A 2P1BA 2WN3A 4QPGB 4Q0PA 4WVMB 3T1MA 4RL7A 2LROA 3DPRC 2QQWA 2VNOA 3TNPB 4OZOA 5C8CC 2QBXA 3AC0A 1AYM2 1UZZA 5EJZB 4CUAA 1OQ1A 2JWPA 2DUPA 1W0PA 1C5IA 1OVSA 2A75A 3AM2A 4IEVA 1GUIA 3VKFC 4I30A 5F3EA 3DEMA 3UNPA 1MZFA 2Y6HA 4E2GA 2RS53 2DVBA 5GM0A 1W3VA 3HNBM 4HK8A 4TN7A 1DQ5A 1HV0A 5FLIA 2XWJB 3W59A 4CDUA 1POV3 3U4SA 2O14A 3UGGA 3WQ7A 1YLLA 4C1XA 4F83A 2B5HA 5DMYA 3LOBA 3O12A 4NPMA 3LD8A 1GNZA 4FFIA 1W03A 3NWKA 1CESA 1PMJX 1JU4A 1SBDA 4MVTA 4ZY9A 2P4EA 4NHMA 1ULPA 3WNPA 1NYWA 1N1VA 4M3CF 2Q1FA 4RR3C 3ACHA 3RMXA 2VW2A 3R4UA 2UYAA 2ID4A 3UESA 1BBT3 2ETEA 2QDRA 1PX3A 4X6QB 1D2SA 3AK0A 1B35B 2X09A 2YC0A 1KS5A 3V64A 4Z2WA 3TEZA 2FZ1A 1ND2A 1RL3A 3IWZA 1MS5A 1MZ5A 2YC2A 5JCTA 4J25A 1AYN1 4BOWA 2WS91 3SKJE 1JOJA 1GZTA 2A5ZA 1OUSA 2YHJA 3MW4A 4HLTA 4BMEA 4CCEA 2RS32 4AFMA 3WR0A 1RUC3 1DQ2A 2Y38A 1TG7A 4MV2A 1UO9A 3RVHA 4V2VA 3T09A 3K4AA 3GHNA 5J7MA 1TNRA 2OVUA 4M0HA 4OHYA 1LJ7A 4XDPA 4AI3A 1A3KA 1V6OA 3CJIC 3WNXA 2Y6KA 4AHXA 2WA3A 2WNVC 3X29B 3OYWB 1V6MA 4GB32 5IVJA 1YFWA 4JTOA 4LBQB 4O61A 5FUPA 4AEJA 4YGEA 4ZONA 5FY5A 1GP6A 3GYDA 4PIZA 2C24A 3H50A 4FPHA 5FP8A 1SLTA 2AR6A 1OXCA 2IFWA 2W9XA 3SISA 1S2KA 1WMXA 4AYUA 3CBNA 1WBLA 1KDKA 3KT1A 3SXWA 1OMIA 1NXD1 1QXRA 2ADDA 4QX1A 1OOPB 2IXIA 2QQOA 3CKHA 4QHBA 2QZ3A 4UT5A 3BIWE 1YC61 2VCMA 4L0PA 5F5IA 2BQPA 3PMSA 3APBA 4YZ3A 4OQ9A 1HB4A 1I5PA 3I3MA 1W6MA 2EIEA 1ZZ8A 3WX5A 1OQDA 1VR3A 2JECA 2P37A 3WP5A 1PO22 1W8HA 2ZS6B 3K46A 3USUB 1JZ8A 3WD5A 4GA9A 4YW5A 4AG4A 3TWIA 5LCWL 1ZREA 2ENRA 2I2SA 5EZWA 1RTVA 5D1IA 1QQP1 1REFA 1US2A 3OOXA 1F4HA 1U5IA 2BJSA 3B69A 3ROUA 2RE9A 3J8F3 1AX1A 4QKNA 1GWMA 1FOD3 1H8TA 2W94A 2F4PA 5EHDA 4AI2A 1IGOA 1X33A 3V0AA 4QDQA 4BM8A 3ZSMA 5DUXA 2JDNA 1OLME 4ZU7A 5KWRA 4YGBA 3AP5A 4XF1A 5FY7A 1OQEA 4H3WA 3S0MA 1UZVA 4JHZA 3O1PA 2AREA 1ZBE3 2V73A 4FOQA 4GQ7A 2VGDA 1ZA4A 1EUUA 1NLRA 4UBHA 2QQLA 1GOGA 3VB9A 1SLBA 3RYKA 2R1BA 2W1WA 5JAXA 4NRMA 4YVSB 4NWWA 4CUBA 3H1WA 3EMRA 4QPGA 4XFCA 4WVMA 3RWNA 4MH0E 4PLOA 1ZRIA 2ATFA 1QJEA 3VKOA 4CCOA 4CP2A 1UYPA 2QFEA 1N1SA 4QB6A 3WEZA 2ZMNA 3VD3A 2HEYF 3FLRA 1QOOA 1QJU3 2VVFA 1C1LA 5FZ3A 5J09A 5F2SA 3UGFA 2BNOA 3OPTA 2UWCA 5FWJA 3KV6A 2BBAA 2NZ9A 4QPIB 1GP5A 4YFZA 5C7GA 5GZEA 2RS52 3AXDA 4FPCA 2XJVA 1GSLA 4QB2A 1COV3 1ULGA 4D7YA 3WSOA 2JG9B 2ZA9A 2OKXA 4ARXA 1Y4WA 3LFMA 1K5JA 1KJLA 4I09A 3CF6E 4DRVA 2RJKA 3BCWA 3ACIA 3A21A 1R081 3AZVA 1UD1A 2CAVA 3AKTA 1LECA 5L7OB 2RDQA 5KHGA 3FUOA 4FPOB 5LBFA 2G9GA 4QM8A 2VQ0A 3HIFA 5J48A 5FY1A 2Q0AA 1D4VB 2JX9A 4BIFA 3O1SA 1KITA 3VL8A 3UT0A 4EQVA 2WO2A 1RUD1 4HOOA 5FJHA 2YBSA 4XTPA 4OI1A 3THPA 1IS3A 1NE6A 2Y26A 4N43C 3PMEA 1B35A 1XNDA 2CGOA 3PU3A 4GAZA 1BBT2 3IDBB 4UW5A 4Z92B 1FMD1 4K8FA 1E57A 1RIRA 4YW2A 3POIA 3N7KA 1LGBA 4PQQA 1S2EA 2G4IA 3FBMA 2BU9A 4MLOA 1OT5A 1VIWB 5FYUA 1W2UA 1BZWA 1PZ7A 2P5BA 2QQIA 2YBKA 3LDRA 4GH4B 4HPKB 4JX0A 1NQDA 3OBTA 2GP5A 2GMPA 2FDHA 1CJDA 2VVDA 2EA7A 4ITCA 4NROA 2E63A 2GC1A 4PT6A 3TN91 5BV6A 1LENA 3D8CA 4NHXA 4ATEA 2EAAA 3NRUA 4LO7A 5HV4A 1VBD1 1RUC2 4CDXC 2H6CA 2IVIB 1ULFA 3MIGA 1WMEA 4OQ8A 2D6LX 1DCSA 2WNEA 3T1LA 1FPN3 1OKOA 3I7DA 3VZOA 2VULA 1O3SA 2AZ5A 4NIGA 1ENRA 1G6NA 3NSTA 2UY8A 5FZMA 3OYWA 2IXLA 4LBQA 2X29A 3ZXJA 2R49A 2VZPA 5A33B 4BZ4A 3W5MA 4HMZA 3SLIA 4QHOA 3OUJA 4P9IA 3ME2A 3I3BA 1SG3A 1W3XA 4JV4A 4D0QA 1MQTC 2B4KA 1XC6A 1OOPA 4LUMA 4CDWC 1PK6C 1WCUA 4Q5OA 3AMQA 1Q3EA 2WO7A 3ALQA 1U0AA 1OFNA 4QKFA 5DAPA 3M3OA 4CSWA 5GLWA 3B93A 2HKXA 2DFCA 3I3QA 3USUA 1W8ZA 2RV9A 3I2GA 4WM8C 5F5CA 5FBJA 3WOGA 2PHXA 1CIWA 1GQPA 1BMV2 2JG8B 1PNFA 3AP4A 4C8DA 5HCFA 2JB8A 2BZDA 4L92A 3O0WA 1I1EA 4AGGA 4A44A 2ET7A 3MICA 4P9XA 3UJOA 3OEBA 4CDQC 2CGNA 3ASIA 5T55A 1JYNA 3J8F2 1SCSA 3N9LA 4HSJA 1RUI3 1FOD2 1HRI3 1W2TA 1XSQA 1OA2A 1X82A 2HBTA 4XACA 4D7SA 1LHOA 4NO4A 5FLHA 1VBC3 3VHNA 4Z82A 3UETA 1JZ6A 2W87A 1F35A 1X8MA 2PXJA 3GZTB 4S2FA 3LEGA 4XFAA 5LBCA 4CDXA 2Q5TA 4RYDA 2ORXA 2SBAA 1ZBE2 2OPKA 1PM4A 1S4CA 3HD8B 3TEYA 3MF6A 4CRQA 1R1ZA 1NZCA 3BKZA 2MPFA 3RJRA 1IQDC 4L11A 2BWCA 1U5YA 5CFDC 1W6PB 4BPZA 3M70A 3NV4A 5BPXA 1V6NA 3GBFA 1YFXA 3WDUA 1CX4A 1Y7BA 2Y34A 3M1HA 3VBSB 5FMOL 3VBRC 4WVZA 1IS6A 4DIQA 1CR7A 1HLCA 2G19A 5F5QA 3GNEA 2JD9A 1QJU2 5C33A 5J96B 2Z42A 4QMAA 3ZSEA 4AEKA 1RHI3 5FPUA 1H1MA 1N1TA 4W6WA 1W8OA 5K8SA 4JC1A 5FZ9A 2JG9A 3Q8EA 4Q0UA 3M3EA 4BU2A 3G7DA 5CZKA 4OMCA 3NNJA 1COV2 1ZYBA 4ZXKA 1SLIA 2TNFA 5L7OA 4K9SA 1DG6A 3JUUA 2QQMA 3ZFGB 1SLCA 1D0HA 2NYYA 3PJYA 4SBVA 2YV8A 1NCRB 3B5LB 3IDCB 4KGQA 2RMU3 5JXIA 4UAPA 3KB5A 3MV11 2RJ2A 1PIV3 3C8XA 4V1PA 3VKLA 5J3UA 2FHRA 4B7KA 1U5ZA 2ZEYA 1NZIA 1X9PA 4QAWA 4RS5B 2VU9A 3K77A 4Y1UA 3LA7A 4LIVA 3KT7A 2WNOA 4NMIA 4YYOA 4CCCA 1IG3A 4C91A 4XXPA 5BY5A 1ZZ9A 5ANNA 1W28A 3WCSA 4HPKA 4K1YA 4GH4A 4OUEA 3WF3A 1JHJA 4LBLA 3NL1A 2IXKA 2VMCA 3MF9A 3VBHB 5TSWA 4KBZA 5A6YA 1ACCA 1UPIA 4PHZA 4V2WA 2VC9A 4QWNA 3LDKA 4XMAA 4IV1B 3VZMA 1OPOA 4WM7B 2PFWA 1I3HA 2W3JA 1F5JA 2OQ7A 5FZGA 5F9TA 4Q4X1 1AJKA 3LB9A 2FCUA 1PZ8A 3VBRA 4LPLA 2YG0A 3N35A 3W9AA 1G9DA 1C3HA 1W6OB 2ARXA 5FY0A 2EXIA 1A8MA 1VBE3 1FPN2 2J1VA 4Q26A 3VLBB 4AK3A 2GSYA 1XXNA 1DIWA 2PMWB 1SDWA 5A33A 3SEPA 3TEXA 3ZR5A 1UU4A 4I0BA 1BHGA 1R093 3JQWA 2Q8DA 3GCWA 2UYBA 3PHMA 3KCYA 5EFUA 1OD3A 2DURA 4FT8A 1W06A 5DZEA 1UMZA 3LSEA 1MZ6A 4DXRA 5J37A 1YXWA 4ZU5A 3WNKA 3F2ZA 4YW7A 1BK1A 5FBZA 4IEOA 4P9JA 3N7LA 3ZFEB 5F32A 1CONA 4NUBA 5IWFA 2Q1ZB 2W1UA 5JR7B 1L7LA 1RMU1 5HI0A 4AHWA 1TNFA 2JG8A 2XJTA 2DUQA 1OLRA 1XYPA 2X5IC 2Z79A 4BMBA 5KR7A 4XFHA 3SNMA 1O3RA 2X53S 1O8SA 2YGMA 1AR91 3JB8A 4RGGA 1C8M3 3WP3A 2EICA 3H3ZA 2XJRA 2HWF1 4NR1A 3WQBA 1W8FA 2R1DA 4BQ5A 5LY1A 3VBOB 5C3OA 3AMHA 3J9SA 2RVAA 2D97A 2K46A 5FPXA 4K3UA 1W39A 1ZRRA 1I6XA 3AL5A 4I0AA 4Q4W3 2WT2A 1RUI2 1VB2A 4UF0B 1HRI2 1Q8SA 2OUHA 4QX7A 3VD4A 1US3A 2WO3A 3HN1A 1V6IA 4Y1ZA 1VBC2 2MEV3 2BFUL 3CHXA 5GLZA 1RUE3 5A1FA 3V0BB 3SCGA 3OB8A 3OBZA 5HV0A 1MS8A 2WQZC 1WLDA 2P6HA 4D7TA 4LA2A 2J1RA 3B01A 3N7JA 3WW2A 2YYOA 4IEPA 4D6QA 1PM7A 3JB4C 3MIDA 5FZHA 5CADA 1QJY3 1W6PA 4ARYA 3MW3A 4A3XA 3P5BA 4YM3A 1ZNPA 4CA9A 1CZSA 1SEFA 2DCJA 2KM2A 5FY8A 3VBSA 4TTGA 4Q0QA 5GLTA 3OTFA 3PUIA 2JDMA 1XU2A 4X6RB 1YQ2A 3Q8FA 4JGYC 5LK7B 2VR4A 3DV8A 4R9DA 3WF2A 4AVBA 2VQAA 3MW2A 5DAXA 1C1FA 1WGPA 4S2GA 3KV9A 5F6LB 2XL9A 4GMP1 3R6SA 3ZX7A 1UOGA 4EE2A 2RHPA 4R9AA 2R071 3UYJA 1RHI2 2Y6GA 5C8WA 5ABJC 2UURA 4YW3A 1WA6X 2WBKA 1QH6A 1NAEA 1AUYA 1FYUA 1H8VA 3AZXA 3VZNA 1IPKA 2WSVA 5IVYA 3OPZA 3ZFGA 1TVGA 3LWCA 1NCRA 4OZXA 3C3VA 4N9HA 5SV5A 4ISRA 4XIOA 3CJXA 2OYZA 3HT2A 3ZYFA 5HBAA 1TME3 3RSJA 2KR2A 1PO13 4DXSA 3UKTA 2RMU2 4RS5A 3ZXDA 5GZGA 2D98A 3AYAA 3RZHA 4WVWA 1PIV2 5FY4A 1PVC1 1J3RA 1EV11 2VE1A 2HWC1 4H55A 2K0GA 3HOBA 3R05A 4H7MA 1AX2A 1VP6A 1XPWA 4LNVA 1JS9A 3PDQA 2HJIA 4UXAA 1DDLA 5FP7A 3U11A 1K5MB 1ZZBA 2YU2A 1B09A 5AVAA 1J1LA 2Q4SA 4UFHA 3I97A 5A7WB 3VBHA 5C3PA 3K3NA 1HRV1 1YUDA 5FZFA 3PLQA 2R043 4IV1A 1SBFA 2XWBB 1L3JA 2ZZQA 4LR4A 4WM7A 2CDPA 4KBBA 1AL21 1XJAA 5CFCC 3DCQA 2ZCWA 2WZPP 3ZMOA 4LQRA 5IYYA 2YC4A 1DLLA 2VZSA 1S0EA 4XMIA 3KCXA 4DMIA 2ZMKA 2W1SA 3BOPA 4Q8LA 1SACA 5AC93 1SBEA 2GC0A 3U07A 2AACA 4LBNA 5FV3A 5FKCA 5FYSA 3BTXA 1VJ2A 1OKQA 1AR61 1AHSA 1C5HA 1Y43B 2GH8A 4BA6A 2WFF3 1VBE2 3WINE 1UOJA 2ZEWA 2WT1A 3BB6A 3BYWA 1K12A 3MUZ1 5T5LA 3K4DA 4B1LA 1XE7A 1R092 1CGPA 5K4LA 4EN7B 1V6KA 4H2AA 2WINB 4XJZA 3LEKA 4IGPA 4PDWC 4LOSA 4KH9A 5FZLA 3ZFEA 4BJ0A 1VBB3 1Z7S1 2WR9A 1RUF3 1X9TA 4CEWC 1ND2B 1NY71 3ITQA 5HCHA 3B9IA 4CEYC 5BNOB 2CV6A 2ZHNA 2YY1A 2NQYA 3CL1A 4FI9A 4LA3A 1GQHA 1G86A 2WNUC 4FOVA 5E1RA 2BW8A 4MXWA 2OXBA 3EB7A 3GBGA 4A2UA 2YGLA 1AR83 3H7JA 5IATA 4XAEA 1H2MA 2G9ZA 2B42B 4QXBA 2ZTNA 3DPRB 3H1MA 1UNBA 1C8M2 5K0UC 3VBOA 4GMP0 1VRH3 4QQPA 3NKGA 5C5UA 2HYKA 2ZOEB 1ZX5A 2E26A 2ZHMA 4FQZA 4XBLA 2XHKA 1YQ8A 3WW3A 4LKEA 3C7GA 3VUOA 4Y5Z0 1HKDA 2PAKA 2GC3A 2FDFA 4UF0A 3ETQA 4D6SA 1O8PA 1UYZA 2HWD3 2Y33A 5IVBA 4Y20B 2AC1A 2IXHA 3EBRA 3PTYA 4Q4W2 2PAMA 3MBWA 2VZOA 3IT8A 3K3OA 5FO7B 1VRBA 4JDOA 2MEV2 2JEMA 2PA7A 1AYM1 1RUE2 4XJAA 3B7MA 3AMPA 2YXSA 2Q1MA 1LOBA 2UU8A 1CAUB 1MS0A 4PBOA 4E4ZA 1DU3D 3UKNA 3WVJA 3HBZA 4HL0A 4KWLA 3VN4A 3JQXA 1QJY2 3OGJA 1OVPA 2WYSA 4P9YA 2E7QA 5DG2A 4RR3B 5IVFA 1VALA 3WHUA 1CAXB 3VBFC 5IK5A 2Y6JA 1VLNA 4Q4Y3 5CYYA 2JKBA 4P9WA 5DPNA 3S7IA 4BCUA 3RYRA 1K45A 1H1AA 3S6PA 1IKQA 1BKZA 3FHAA 2GNDA 4KG8A 3O1MA 4Y1YA 2WL1A 3AP6A 3ES1A 2QQPA 1ST8A 3I3DA 4MGSA 2WLPA 3ZMNA 3ZYJB 2J1UA 3I2HA 3H9AA 1U5XA 3EHKA 1JZ4A 3RZKA 4OMDA 3NKTA 4CPBD 3WDYA 3WNNA 4COZA 4ZXEA 5KXEA 4PJYA 2JDYA 2VO5A 3M4FA 2JENA 3KF3A 2VMHA 2A6XA 2FDJA 1QF3A 4XF0A 4B4QA 1KRIA 4XZUG 4YLZA 1HDKA 3LF7A 4JZRA 2W39A 2V5YA 3KHCA 3QLQA 2VAUA 1DZRA 1TME2 4XUQA 2VBPA 1PO12 2QQUA 3HMYA 1GKBA 1GZWB 3D6EA 1DBNA 4QU2A 3PTRB 3H0OA 3CJIB 1E5RA 2B7YA 3FLTA 3PVNA 1HV1A 2RS31 4W6YA 5CKMA 3A22A 4C90A 2WNVB 2A6YA 5JOXA 2F4LA 1K5MA 2A1XA 5E88A 2H0VA 3KT4A 3T4VA 2PYTA 5A7WA 4P00B 4AVAA 4XF4A 3WZ1A 4XABA 5ACA3 5JOZA 4AXOA 2DDUA 2XL7A 3ZYHA 2GNBA 5C9AC 4FPLA 4NRQA 1EAH3 5IW0A 2WZR3 4K20A 1CAVB 5A7NA 1IPSA 1UYYA 2R042 4FFFA 4AEDC 1J1TA 1F5FA 1BEV3 4KL1A 4GB31 1UXXX 3HN3A 1UXZA 5JXJA 5FDBA 2JDPA 3SH3A 5GLVA 1VMJA 5IK4A 4COUA 4Q8KA 4NIHA 1JUIA 5I91A 4XYXA 4YSFA 1MEC3 5AC92 5B2GB 1JBCA 5APAA 3JU9A 4B3NA 5C4WC 1YNAA 1BXHA 1Q8QA 4FXKB 1AZDA 4HVRA 3WQ1A 2B45X 2WFF2 2Z2SB 3R4SA 4P02B 4OUMA 1NCQC 2L9LA 3AL6A 1LOFC 1ZZCA 1PO21 4ONUA 3I54A 3LOIA 1ND3C 4ES8A 1BVP1 4HANA 2W68A 1K42A 2ZGPA 5ERLA 1OSGA 2NP0A 5T54A 3FFZA 5BNOA 2V09A 1VBB2 1KS4A 1ZBA3 2ARAA 1S0GA 3D0JA 1RUF2 3HQXA 4OI2A 2LRPA 1NT0A 1OA4A 4YNIA 4NPLA 5FMOS 2WKKA 4BQWA 1UYXA 2B46X 3DPRA 3MEPA 1SFYA 1UX7A 4PLMA 3SC7X 1AR82 4BQ3A 5C8CA 1CN1A 5FR3A 4YM0A 4D3WA 2LS6A 4NVPA 3GM8A 3ST7A 2XQRA 4FTBA 3CEWA 1VRH2 2D44A 4Y4YA 2DCZA 2R6QA 4LITA 2OPWA 3C7FA 5M0TA 1JZ2A 2RDRA 3ACLA 4Y20A 4NHYA 4ISQA 3BALA 3DL3A 5FYVA 2HWD2 4E2SA 3FLPA 1RUH3 1JYTA 5AFEA 1O7FA 2A6WA 4MGYE 3ZXEA 1AXZA 3UGHA 1X50A 2JD4A 3H8UA 1HN0A 1DQ4A 4LBQD 1CAUA 2QVSB 4XEZA 4YRDA 5FO9B 1W8NA 3Q8AA 1K3IA 4A45A 4F3JA 2A7AA 2Y0OA 3WQ0A 2ZHKA 4EWDA 1LRHA 5IAVA 4RR3A 3GXUA 5JZGC 1CAXA 3HVDA 4RFRB 2RS51 1JYCA 3I2JA 3IMNA 3DXTA 1QWRA 2WZR1 4PBPA 5L9RA 4EN8B 5J36A 1PVXA 1UKGA 4QX5A 4M4PA 3THDA 2P2KA 5FCCA 1AXKA 3V56A 3WF4A 4BQ4A 4E2QA 4N43B 4Q4Y2 1UY3A 4MGZE 1POV1 2PELA 2PHTA 1QJZA 2ZX3A 2VTXA 1HB3A 2PHWA 3JXSA 2Y60A 5CIRA 2VCBA 4IEQA 5A3UA 4LE3A 5LW9A 3PUSA 1S0FA 1YIFA 2VY0A 4A7ZA 3AKPA 5FK7A 4HXCA 4Q4V3 2XBO3 1QMJA 3THCA 2V72A 3OPWA 4AI8A 2ORZA 5LY2A 1WMDA 2ZEXA 3NV1A 4LJHA 4XUOA 1ZRDA 1HXS3 1BBT1 1YEWA 5EPAA 3ZN6B 2C0ZA 1V9U3 2GN3A 4AVCA 2J1EA 1LU1A 4CDXB 4RHV3 4LT5A 2WRAA 5F2WA 3GZEA 1S0IA 1GZWA 2GMMA 4ZPIA 2FZ2A 1UN1A 3CJIA 1H30A 2PHLA 4XFIA 4M4RA 2JE9A 2WNVA 1N1YA 1ULEA 2IXJA 4ASMB 2WAOA 3BIEA 3PURA 3T2TA 3GJBA 4HKOA 1H4GA 3RZZA 3JCIA 4CTEA 1JTZX 1RC6A 1RUC1 4META 4UFKA 4MHUA 1OC1A 4AL9A 4AVTA 4MXVA 3N36A 5L9BA 4CCKA 1GICA 1G9FA 1W9SA 1MQTB 4K8RB 5CNAA 5ACA2 1CAVA 4NIDA 4CDWB 1PK6B 2XH6A 3RI8A 4D94A 1EAH2 1NE4A 1TQ5A 1UOBA 2WZR2 3KV4A 3POSA 4XJUA 1XE0A 4AQSA 1QXPA 3DYMA 1X8EA 5D8AC 1W90A 2VUDA 4ZZ8A 1KD7A 2RG4A 1BEV2 1F31A 2CWMA 4ATFA 4WM8B 4R52A 2LTNA 1TE1B 2ZKNA 4TWTA 3LPGA 4AFAA 3T0BA 3CZUA 4EN6B 4ASLA 3GALA 3JBG3 3ZM8A 3ACFA 1FATA 1MEC2 3POJA 2PHUA 3E6BA 4AHYA 5FXXA 2ZPXA 3KQ4B 3Q8BA 3LEIA 1RXFA 5CKQA 4HSLA 2HWE3 4CDQB 3KWVA 4BQ2A 1S0BA 1XOYA 2ILMA 4URTA 5IFPA 1WCQA 4XQDA 1JZ7A 4UI9L 4TLGA 5FZ6A 4CP1A 4DZGA 1SQ4A 2BFUS 4LIUA 1YYNA 3BTYA 3KGLA 4M3CB 1DHKB 1BMV1 4IV3C 1WKYA 3KCCA 1VB4A 2WIIB 3K2OA 5DAVA 3VZLA 4CCDA 3MZHA 5FPVA 2WA4A 2XJQA 4YVWC 2GZWA 3G6JB 4E8DA 2XDVA 3O1TA 3N9QA 2IVJA 4XHBA 2CWSA 1G9AA 3J8F1 1ZBA2 1XNBA 3PVBB 3LKJA 1JU3A 5KHHA 3N9PA 5D2AA 4OLLA 1FOD1 2ZGLA 4B7EA 4IEXA 2D6OX 1LR5A 1UKRA 2WZEA 1POV0 3M8LA 3GDBA 4KGGA 1FI2A 1JUHA 2ERFA 2VG9A 4UWDA 3KMHA 5IFTA 2BPA2 1OA3A 3VBRB 3WP4A 3KV5A 1GBGA 5FJKA 1ZBE1 1CJPA 1PNGA 3LQCA 5DUVA 2QQKA 1N3PA 4KI5M 2VXRA 4XQWA 5BNPC 5DG1A 5KHKA 1IS4A 3HT1A 3N9OA 4SLIA 5FUNA 5C6CA 3ZYIB 5LATA 5FOBB 1LCLA 3OUHA 1Y9GA 2A3WA 1UY2A 4GWMA 4WZFA 4WVVA 1H9PA 2EIGA 2H6BA 4N8MA 4Y5SA 5DAWA 3S57A 1RUH2 4Y33A 4XCBA 1WCDJ 3LZZA 4FP2A 3H8OA 3W20A 1J59A 1SCRA 2D43A 4FAGA 1Q43A 3ETPA 4YVSC 1VAMA 1QJU1 5LA0A 2PQQA 3ZLIA 2GC2A 4D8MA 1DGRN 1VBA3 3WG4A 3MIFA 1WWYA 4JKMA 2I74A 2PHFA 4BXSV 4DPNA 2HBUA 4IEYA 3MLJA 1URXA 3I4IA 4O9GA 3U10A 1OH3A 3QD6A 4N43A 1QXJA 1COV1 1JYIA 3ZXLA 4JQRA 1RUJ3 1GLHA 4P5YA 2HEVF 3PL0A 4TXWA 2HYXA 4Q27A 4DQAA 4XOGA 5EXOA 1O4ZA 4I0WB 5FK8A 2DCYA 3PUAA 4K21A 1OUXA 1KFUL 3AZYA 3O1RA 3ZN5A 4N90A 3MV01 3OBRA 4AWDA 2VZQA 3VDCA 4YG3A 3LE0A 4R9BA 4J1XA 4LUKA 4MGKE 4KNCA 5LRRA 2YFZA 4Q4V2 2E7AA 2XBO2 3ZN6A 2GDFA 4CCNA 5G04L 3ZSJA 2VCCA 1RB8G 3AB0A 5H9QA 1HXS2 1GZCA 4KWJA 1V9U2 2AUYA 3WY6A 4DINB 3ZFFC 4A41A 4MYEA 4YZ4A 4RHV2 2VUCA 2J7MA 2QQJA 4TZDA 1E5IA 3ELNA 2ES3A 3H8XA 2XG3A 4BB3A 1OI6A 1DYKA 2OA2A 2ZAAA 4HK9A 4UW6A 2ZKLA 4RGKA 3VDBA 2RM23 3LAGA 3IAQA 4DXZA 2WSUA 1IQAA 5EYXA 3ZDVA 1SFNA 3AKSA 4BLIA 1MQTA 1QNYA 2R0FA 5FOJB 1WA4A 1W9WA 4CDWA 1PK6A 3MIHA 4WBBA 1GOHA 1TZOA 1LODA 1FPN1 3LPFA 1XYOA 2W47A 5DZFA 2WWUA 2IUWA 2FMYA 2Z4FA 4A7KA 4XQ4A 1O4TA 3U75A 4FCAA 3TAYA 1JH5A 3I2FA 4WM8A 5J1XA 3IPVB 1CAWA 4HKWA 1C8NA 1MS3A 1HB2A 2X5IB 3L9JT 3NJZA 4LMFA 3BPZA 3POYA 5A7SA 1HQLA 3I2DA 3JZVA 3PVEA 1LULA 1XNTA 3IM0A 4UW3A 3UV9A 3U1XA 3VGIA 3JBG2 4CDQA 1F8VA 3VDDC 3MIBA 2FCVA 1SPPB 1MPXA 1WZXA 3HAGA 1IPJA 2WYFA 1CPNA 3EO6A 4M3CA 2HWE2 2QCSB 3AMNA 1AR73 3PIGA 1NX9A 3WV6A 2RR13 1ZRFA 4LHNA 4MUVA 2QE3A 5DABA 5H9PA 4IE6A 2A3YA 1Q8VA 1RUJ1 4MADA 4UFJA 1LGCA 3CLPA 4Y5TA 5H9RA 1JN2P 4LKFA 3T0DA 3HWJA 5LEJA 4KWUA 1ZM1A 4LBJA 3N9NA 4QB1A 4MHRA 5CFDA 2QQNA 5FWEA 1GR3A 2N7GA 1RUI1 2FMDA 1UWWA 1HRI1 3B00A 1RVF3 2JB4A 3ILNA 3POEA 1PGL2 2WQ8A 3VHRA 2JDAA 1VBC1 4NRPA 3NV2A 1C28A 3WDVA 2JKXA 4JGYB 1E5HA 3AX4A 4XFBA 1FV2A 1ONAA 5E8AA 3ZIWA 1IHMA 1G9CA 5T5PA 5LASA 5F5AA 4XPVA 4XUPA 3RZLA 1CX1A 2BDRA 1RGSA 2GNTA 1LHUA 4NHKA 2EXHA 5KC6A 3O5SA 3FWEA 2ZX4A 3AP7A 1D7PM 4O7XA 4PIYA 5FO8B 5I0SA 2ET1A 2FCTA 5ABJB 2PTMA 3VZKA 3BGAA 2XPJA 2D3SA 5DDJ3 3HJRA 3J7MA 4HFSA 1WCKA 3SMHA 1BYHA 3HR9A 5LRSA 3OBAA 2RS13 3BTAA 4QT6A 5AFBA 3I2OA 2D40A 1P8JA 4NN0A 5JR2A 4IXLA 4N53C 1LTEA 4MGQA 3AKQA 4Z2AA 1H4HA 1R1A3 5SV8A 1UY0A 2WDBA 1VBA2 2BVVA 1RHI1 3GHMA 3RFRA 4BYYA 5LA9A 2FDGA 3U14A 4ZS3A 2G9FA 5A6ZA 4MXWB 2VUAA 3RQ0A 1TMF3 3N4MA 4RSUA 4MO3M 1SDDB 3VBUC 2EALA 3B9CA 5FXZA 1NA1C 1RUJ2 1UZ0A 1W8WA 3DKWA 4GJZA 4AW7A 4D6RA 1H6YA 3WNMA 3OGSA 1SFPA 4AGVA 2RMU1 4RQPC 4E8CA 2HWB3 2E31A 3V65A 1PIV1 1QJX3 1QOTA 1J84A 1D0GA 5JPMB 4Q1PA 4XUTA 4M01A 3ZYPA 4D69A 5CFCB 1T6BX 1OFSA 2YZ4A 3RWKX 3BOWA 2W0XA 2AYHA 3DUIA 1HJFA 3NW4A 4AE2A 5KXBA 4YW6A 1UU5A 1Q8OA 2IC1A 5A1AA 1AX0A 1GWLA 4JGZC 3GBWA 3J26N 1BLZA 3QBQA 1LEDA 4LEJA 1OF3A 1JZ3A 3INAA 2B9UA 4CP9B 1SMVA 3CIHA 2WN2A 4DO0A 3POWA 4IEWA 4UFIA 4CCJA 1MVQA 1WD3A 1PGW2 1V00A 2RM22 2DCTA 4GXLA 3LIHA 4FPFA 4EJRA 1APNA 5L9VA 2P3YA 5KBFA 1W0OA 4Z07A 4PDWB 4AFBA 3VV1A 5A6XA 3AMMA 4DUWA 3P3NA 3FMGA 4NWVA 1VBE1 1J83A 2QQVA 1BVVA 3MDPA 1WD4A 3QH7A 4CEWB 4CU6A 3KSCA 5JSRA 3O1UA 4YM1A 3IPVA 4FSJA 1RJ8A 2WNUB 2X5IA 2CTVA 4QM9A 1R091 3OUIA 2O1QA 2YROA 4HONA 4HN1A 4B8EA 3H7YA 1DYPA 1UZYA 1YWKA 1DGLA 1ODNA 1WW4A 2DYCA 2O0OA 2F6BA 3AZZA 3J7NA 3VBUA 4A3ZA 3VDAA 5L36A 1WW7A 2R063 2TEPA 3BODA 1SPPA 5KXDA 1N47A 2AEYA 4BK4A 5K0UB 1OBNA 4MSVA 4AFCA 5FPLA 2V4AA 3MFCA 1UY4A 1F9KA 2BGPA 4HT1T 3O1OA 5FUIA 1AR72 2RR12 1EUTA 2JIJA 4QX8A 1H9WA 1M4WA 1FNYA 5T50A 4YG6A 4Q0SA 4CVUA 2BV4A 2LUWA 4XDOA 4XIKA 1C8M1 1RUG3 1G8WA 2O8QA 1RITA 3E1F1 4GWJA 3ZXAC 1QH7A 3BI3A 5CG9A 4JAAA 4QDRA 3IN9A 3ZYRA 3ZXKA 4YW1A 3DYPA 1AXYA 1DZTA 1QHDA 1UMHA 1W6QA 2XR4A 3LGRA 2JJ6A 4H7LA 1ENSA 4KWKA 4L99A 1NOVA 4XJ8A 5IHRA 2UY9A 1DYOA 2CNAA 2H0BA 3HNYM 5EJ1B 4Q4W1 3RZMA 1LOGA 4JGYA 1VAKA 1RVF2 3VBFB 2VQUA 3WNOA 2A3XA 2I07B 4ASKA 2MEV1 1NG0A 5FREA 3S30A 2VOXA 1RUE1 1MS4A 2TBVA 1H6XA 1H2LA 4P9GA 1ULCA 4IE7A 1PMHX 4NPRA 4IGOA 5ABJA 3T2QA 1QJY1 1V6LA 5FYHA 3OD0A 2CGPA 5CKNA 4XFFA 4LULA 1DQ0A 1EYBA 1XB9A 4QU1A 5FQ0B 4W65A 2Y64A 2OUJA 2DTWA 4GWNA 1O3QA 4S2HA 5DDJ2 2PLV3 4DB5A 3J7LA 5KXCA 1O3TA 4QQOA 4U2AA
chains in the Genus database with same CATH topology
1XNKA 2RS12 3FUQA 1AJOA 4YM2A 1ASJ3 4OHXA 5CAZA 1D4M3 1R1A2 3CNAA 1F2NA 3NAPC 4P9LA 4RFT0 5CU1A 4YFWA 1KDMA 1XQNA 1TMF2 4R8HA 2CY6A 4JVAA 3PNAA 5C8CB 2D6PA 2SLIA 2D3PA 4QQHA 3S7EA 2XJSA 2ZZJA 3WCRA 3N3HA 3OJBA 4OFGA 3UK9A 2R0HA 3EQEA 4JRLA 1TME1 5BNNC 1PO11 2ZX2A 3IDEA 5C9AB 5IUQA 5CFCA 4NOTA 2HWB2 3ZPYA 4GKXA 1DGWA 1QJX2 4AEDB 3I59B 4CYDA 5IT6A 3M2MA 1D2QA 4I3GA 1QU0A 4JTNA 2A6VA 4LO6B 2BWAA 2DVGA 2WT0A 1CVNA 2BTVC 2VOWA 1V6JA 3AYCA 5DZGA 3ZDSA 3WG2A 4HKLA 2NMNA 2R041 4XF3A 5C4WB 3KGZA 1KXGA 2QDNA 4JDNA 4U36A 2NN8A 5HCBA 1NXMA 2VPVA 5BUVA 2UWBA 4LO5B 5T5JA 4DY5A 1NCQB 1SLLA 2WQ4A 4H14A 4PDWA 1ND3B 4KQ7A 4EN9B 5AC91 5I0UA 4CEWA 2BNMA 4AQTA 3WHTA 4CEYA 2GNMA 3KS7A 4DS0A 2WNUA 2WFF1 2D5HA 3AP9A 4CDUC 4A7YA 1TEIA 4GKYA 1LB2A 2XKOA 4FTSA 2VOVA 4OVEA 3AXEA 5FFOC 3OCPA 1AYN3 2WS93 5K0UA 4GALA 2DVDA 4R4XA 2R062 3TOJA 1VBB1 3BU7A 5GZDA 1RUF1 5FRAA 1REDA 2AGSA 4PF5A 4B4PA 2XLAA 3SHRA 1WBFA 1Z78A 1ZZ7A 3WW4A 2VW1A 3JD73 2A73B 1RINA 2IXCA 1AR81 1ND2C 1ULDA 3KZ4C 4RD7A 3RI9A 2CAUA 1RUG2 1VRH1 1I9RA 4B29A 2BEOA 3WDWA 1IOAA 5DXDA 4IEZA 4K40A 5JZGB 2HWD1 3VBFA 4IETA 3FBYA 5GALA 3TYJA 4LO8A 4LLOA 4YGCA 4AI0A 4Y1XA 3WDXA 3TBDA 2A71A 1AL0G 2OW4A 2QUOA 3K51A 3A0KA 2VNGA 4XE9A 3DGTA 3WG3A 3SCHA 5K9YA 2VECA 4EN0A 2RJLA 1O5UA 5FQ0A 3K48A 3MPBA 4PLNA 1QQP3 3B02A 4LBOA 2XJUA 3ZYGA 3UJQA 3ZSKA 1J58A 4EROA 4Q4Y1 4QGNA 2TUNA 5KC5A 3O7OA 5KHJA 2PLV2 2DFBA 1S0DA 2Q30A 2VOKA 4DY3A 1PMIA 1XE8A 4LHKA 4CZSA 1ASJ2 1YCIA 2OIIA 2PHDA 3IIAA 1D4M2 5L73A 1V70A 2W08A 1NQJA 1BJQA 4FOYA 2ZGRA 4FPKA 1DGWX 4HETA 1EP0A 4HVOA 1IZ3A 4LLFA 1O4YA 3E5QA 1H8TC 5C9AA 1GANA 5E16A 3SITA 4Z1VA 2VW0A 1WW5A 4AEDA 1MVEA 3I59A 3MYXA 2ZBJA 1AVBA 5BXXA 2LALA 3E97A 5D8AB 4MX3A 1CPMA 2ZGNA 3JD71 3R4DB 3M7AA 4FPYA 4L2NA 3AFKA 1U12A 5ACA1 1WW6A 3RG0A 4QPGC 5C4WA 4AVSA 3VL9A 5CVRA 1EAH1 4K1ZA 1R083 1LHNA 1NCQA 2YDEA 2JE7A 1LOFA 5JLVA 1BEV1 3E5XA 1YI9A 3L2HA 1ND3A 4QD2A 1VAVA 2DCKA 1UU6A 2DV9A 2Q8OA 4N7UA 4IV3B 1G9BA 1RUD3 1FXZA 1MEC1 4YVWB 2P34A 2BYVE 4I2OA 1FMD3 1S1AA 2ZGOA 1N3OA 4ES9A 4TLFA 5JI7A 1GQGA 4RA0A 4E4SA 4GIQA 5DUWA 2DWRA 4Y1VA 1RUNA 1AYN2 2VMGA 2WS92 3TN93 2ZAHA 2E6VA 1A78A 3E5UA 1X7NA 1Z0HA 1ZBA1 2NMOA 1KQRA 1VBD3 5I8SA 4AI1A 1B35C 5GLUA 5BNPB 5I0TA 5K7PA 2ZABA 1PHMA 4AGRA 4XFGA 4AHZA 3I8TA 2EXJA 3JD72 5H9SA 2ZGSA 4AVVA 1GYKA 1EY2A 1FX5A 5T52A 2QKDA 2A70A 3FJSA 2XLGA 5JZGA 3PJQA 2GMEA 2NM1A 4COVA 2WWSA 1UW8A 4COWA 4XZPA 1NLSA 5I8TA 2EAKA 1CAWB 1RUH1 4XJ9A 4IL7A 5LK5A 4OHZA 2VUJA 5A3MA 3A4UA 2JICA 4QQLA 2DVFA 2XLFA 2WLQA 3ZXFA 2YPJA 4Z8BA 5GZCA 2KXLA 3FE5A 3KQRA 5T3NA 1O5LA 2LM3A 1BCXA 2C5DA 5T5OA 1QQP2 1S55A 1OOPC 1GZ9A 1XYNA 4O9EA 1DQ6A 3GZUC 3E6DA 4DRRA 3NVCA 3ZFFB 3E6CC 2ZX1A 3OF1A 1HW5A 3RNSA 2Z5WA 4AQ2A 1MR5A 1KFXL 5CFDB 2PAEA 1RUOA 4Q4V1 2OZJA 2XBO1 4ZU4A 4S2DA 2AH2A 2OZ6A 1HXS1 1PZ9A 1V9U1 2WFPA 4FP3A 3U4XA 4K6BA 1A6CA 4RHV1 4EWAA 1O91A 1UAIA 2ZACA 4P14A 4YGDA 4CP0A 4XTMA 1AF9A 1CD3G 4G4FA 3RJ2X 3ATGA 5D8AA 1YJLA 3R0RA 2DVAA 2XVGA 3GZAA 1N3QA 2VVEA 2YUEA 1OD5A 4XDQA 1FNZA 4KG0A 5CA6A 5AVPA 5E89A 4L97A 2XB6C 5I8YA 5JI9A 3KM5A 3VDDB 4OHWA 5L19A 1UX6A 1LKNA 3WDTA 4Q2FA 4WZCA 3N7MA 1R082 1DQ1A 2XVKA 1EPZA 1YFUA 4IV3A 5JSOA 2GN7A 1YRZA 3FZ3A 4QPIC 4X8PA 4YVWA 4LBKA 4IEUA 3Q9OA 1XU1A 1RUD2 1H2KA 5KHGA 2JG9C 1Y9QA 3JBG1 4X8NA 3WUCA 1Q56A 2DU0A 4INDA 1IKPA 4YZ1A 3ZN4A 1FMD2 4Y26A 2HWE1 4L8QA 3THTA 3ZO0B 5L7OC 4WV8A 3IKWA 5DUUA 5FAXA 4ZKTB 2ZGQA 1W6NB 4EWEA 4DNYA 3FX3A 1UPSA 4I02A 5KHIA 1HQWA 5A32B 3QCWA 4UW4A 3TN92 5BNPA 4YARA 3KLSA 1ZRCA 1PGSA 4Q4X3 2ZGMA 2DUOA 1VBD2 2HEWF 2MNGA 5BNQA 4M0NA 4G3YC 1PGL1 4I01A 5JPNB 4GH4C 1FT9A 3KD4A 2D7FA 1M06G 5JDBA 4YVSA 3ECQA 4XBQA 2GAUA 4TSVA 4BE3A 2QJVA 1WUVA 2D6NA 1C57A 2FQPA 4N53B 1LEMA 4TYSA 1YIPA 3L2YA 2R32A 3NV3A 2B39A 3RYPA 4KU8A 2A6ZA 3QH6A 1JW6A 3UL2A 1IS5A 1ENXA 1UCXA 3VBUB 1NA1B 4QPIA 3WW1A 4DOUA 3D4KA 1RMU3 4OI4A 5IK7A 2C9AA 1H0BA 4FO9A 4PQ9A 3D0SA 1VBA1 2NPIA 5FTTC 1AR93 4BHPA 1WLTA 4RQPB 5CB7A 3SH5A 3CU7A 1GNHA 2P17A 4EV0A 2HWF3 1J3QA 1S2BA 1MZEA 2QNKA 1YO8A 2FBEA 3MLLA 1H2NA 4E9KA 3ZFFA 4FPGA 3ZIXA 5JOWA 4JGZB 4HZFA 5F6KA 2EXKA 2JG8C 4AF9A 4FBFA 2WC2A 3MPPG 1W6QB 1BQPA 1XRUA 2E7TA 3TB0A 4GULA 5EWSA 1LGNA 3ZSLA 1UIKA 3FHIB 1LESA 1HX6A 4JDMA 1UL9A 4RGAA 3VZJA 5GKAC 2BGCA 3H3UA 4BQ1A 3VHPA 1Q5OA 4F8AA 4FPEA 2JDZA 4UBGA 2XGXA 2WJSA 5FLJA 3WUDA 2AENA 1DGRA 2E51A 4IESA 3RS6A 1PGW1 2RM21 4GMP3 2BUKA 3AJZA 2GH2A 2R073 2ZJCA 5CG8A 2P3JA 2ARBA 4Q29A 4FPJA 1LHWA 3O0XA 3VDDA 4LE4A 4QQ2A 2C1FA 1ZZ6A 3VBSC 4BWOA 3AFGA 3TNQA 2BNNA 1YFYA 3OD4A 2R16A 4G9SB 3QOPA 3EJKA 2VNRA 3AYEA 3M3IA 4J1WA 3AJYA 2GALA 2K2SA 1PVC3 1EV13 3M3CA 2HWC3 1DZQA 2Y0IA 2P3KA 1LHVA 3OY8B 2ZHLA 3ZXGA 5F1RA 4F7ZA 3ZFGC 2ZGTA 1NCRC 1AR71 2RR11 4C0BA 1HRV3 1QNWA 1Y3TA 3AZWA 1W6NA 4MGIE 3LSDA 1MS9A 4AFDA 5A32A 5LEKA 1Q8PA 4P5HA 1AL23 4RS5C 5I93A 1CQ9A 2E53A 2EF6A 3ILFA 4I3PA 4Y24A 3ILRA 5JSPA 3RDIA 1QDOA 1S0JA 4XW3A 3O0VA 5JWPA 4Q4X2 1GV9A 3TRSB 4AEMA 1ZVFA 3VBHC 1RVF1 2DF7A 1AR63 1LOAA 4YG0A 3WLUA 1JHNA 4KU7A 2ZGUA 3WXPA 4IV1C 1OLQA 4OI0A 4N53A 4WM7C 2CL2A 4CEYB 4Y22B 4BIOA 1JXNA 4MZUA 1QY4A 2XUMA 5A3LA 2ZGKA 3ES4A 1GFF2 3ENRA 5EV7A 3UKVA 1Z7S3 1OPMA 3NAPB 3DF0A 1NA1A 3FFQA 4LTAA 5DDJ1 2D3RA 4IERA 4OULA 4QGMA 3WP6A 1OHFA 4PCRA 2RS11 3WT3A 1RMU2 3AYDA 4RQPA 5JVVA 1DFQA 5BNNB 1R1A1 2JXAA 1AR92 3SCFA 4E4DX 3LA3A 4B4RA 1RJ7A 1TMF1 2MHFA 2HWF2 2PN5A 3ZFEC 4N9IA 4HVQA 1WLWA 4Q0VA 4JGZA 4C0HA 4OUSA 2DTYA 4FOWA 4FVVA 1QOSA 2K9ZA 5FPZA 1H1IA 1LOEA 2ZX0A 4DFSA 5HCAA 1C4RA 2HWB1 1EPWA 1AYM3 2QZ2A 3M8LA 3LCPA 3C2UA 3CO2A 1J3PA 1QJX1 1ZRFA 2DU1A 4ORFA 4J6GA 4QPYA 1I5ZA 3VBOC 3ZVXA 3MI8A 1XNCA 2XJPA 1KJRA 4JRAA 4XXAA 5JIUA 1LOCA 2UWAA 2X8KA 3B3QE 1MS1A 3U0ZA 3A0NA 1T6GC 5EJ3A 4HBNA 4COYA 4YZ5A 5J98B 2W52A 1QGLA 2XVLA 3D5OA 3MIEA 3RMYA 4XETA 4CDUB 4BH9A 2KA3A 3O14A 4HN0A 1W6OA 4L9BA 4XHXA 2D5FA 2PHRA 1DF0A 3B94A 5GZFA 3IBMA 3GF6A 1WMFA 1YJKA 2R072 4K7JA 5IK8A 3H1YA 4FAHA 4FQ4A 2O8OA 3W58A 1FAYA 4C1WA 4M3CE 1UIJA 2ZMLA 2Z69A 4R4ZA 4FXGB 2I45A 4LBMA 2P3IA 3DN7A 5JIAA 4R9CA 3MFAA 2R061 3USSA 2RS33 2VMIA 3OY8A 1PVC2 2IZWA 3RRDA 1EV12 1SLAA 2HWC2 3WG1A 2YMZA 4OHVA 5JOYA 4XJWA 3MGUA 3VHOA 1UF2C 1QDCA 3UKTA 3OGGA 4JCKA 1HRV2 3LA2A 3P3PA 4M00A 1WCSA 1HQNA 2IWGB 1AL22 1RUG1 3NO8A 4GB33 3EXUA 5I0RA 4PIXA 3VKNA 5HXVA 1K5MC 3M3QA 4QGLA 3V0BA 2B8MA 2CYFA 2XKPA 2BVBA 1AR62 5EYYA 5JMCA 4XILA 1FV3A 4Y22A 2D6MA 1YI7A 1PO23 1REEA 5CBLA 1A8DA 4QXKA 3D82A 1W6MB 4AQ6A 3VKMA 1MACA 2D6KA 3NAPA 3RPQA 2BBVA 3PVOA 1Z7S2 3URFA 1NY72 4LO4B 1ALYA 4W6XA 4XBNA 3MLKA 2PLV1 2GU9A 1QKQA 2NLRA 1YHFA 2D93A 5BNNA 3SH4A 1H8TB 1G7YA 2R30A 3AKRA 1ASJ1 3V0AB 1D4M1 3QACA 4E27A 3FC0A 1S0CA 1WLCA 4IQPA 4YW4A 2E9QA 2EVXA 4XF9A 5BNOC 1ENQA 2IFRA 4NHLA 1HIXA 4N7IA 4LHLA 4BLJA 1LU2A 4FTEA 2VH9A 3J4UH 4Q1RA 5GJ6A 5BYNA 1X36A 4QPGB 4Q0PA 4WVMB 3T1MA 4RL7A 3DPRC 3TNPB 2VNOA 5C8CC 1AYM2 1UZZA 1OQ1A 2DUPA 1W0PA 1C5IA 2A75A 3AM2A 4IEVA 3VKFC 4I30A 1MZFA 4E2GA 2RS53 2DVBA 5GM0A 4HK8A 5FLIA 1DQ5A 1HV0A 2XWJB 3W59A 4CDUA 1POV3 3WQ7A 4F83A 4C1XA 1YLLA 2B5HA 3LOBA 3O12A 1GNZA 3NWKA 1CESA 1SBDA 4MVTA 4NHMA 1NYWA 1N1VA 4M3CF 4RR3C 3RMXA 2VW2A 3R4UA 2UYAA 1BBT3 2ETEA 2QDRA 4X6QB 1D2SA 3AK0A 1B35B 2YC0A 1KS5A 3V64A 4Z2WA 2FZ1A 1ND2A 1RL3A 3IWZA 1MS5A 1MZ5A 5JCTA 4BOWA 1AYN1 2WS91 1JOJA 2A5ZA 2YHJA 3MW4A 4HLTA 4BMEA 2RS32 4AFMA 3WR0A 1RUC3 1DQ2A 2Y38A 4MV2A 3GHNA 5J7MA 1TNRA 2OVUA 4M0HA 4OHYA 1LJ7A 4AI3A 1A3KA 1V6OA 3CJIC 3WNXA 4AHXA 2WA3A 2WNVC 3X29B 3OYWB 1V6MA 4GB32 1YFWA 4JTOA 4LBQB 4AEJA 4YGEA 3GYDA 4PIZA 3H50A 4FPHA 1SLTA 2AR6A 2IFWA 3SISA 1S2KA 4AYUA 1WBLA 1KDKA 3KT1A 3SXWA 1OMIA 1NXD1 1QXRA 1OOPB 2IXIA 4QHBA 2QZ3A 3BIWE 2BQPA 3PMSA 3APBA 4YZ3A 1W6MA 1ZZ8A 3WX5A 1OQDA 1VR3A 2JECA