5DUXA

Crystal structure of the human galectin-4 n-terminal carbohydrate recognition domain in complex with 2'-fucosyllactose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
138
Chain Sequence
b'PTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-4
publication title Structural characterisation of human galectin-4 N-terminal carbohydrate recognition domain in complex with glycerol, lactose, 3'-sulfo-lactose, and 2'-fucosyllactose.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 30
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5duxA00
3SNMA 4C1XA 1H9WA 2DVGA 2ZKNA 5JVVA 4LBNA 3C2UA 3N7MA 4XJ9A 1WCSA 4LBQB 3INAA 3RQ0A 5JOWA 1AVBA 2R49A 2ZABA 3M1HA 3SH5A 2XG3A 3MEPA 3V0BB 2A75A 2A3YA 2VW1A 1YYNA 5EYYA 1ENQA 1AX1A 1GZ9A 1QU0A 2D6NA 2EAKA 3R05A 1AX2A 1YXWA 3B69A 1SACA 4Y1VA 5H9PA 2P3IA 1RIRA 1F9KA 4M3CF 3PVNA 1G9AA 4SLIA 2YROA 1AXYA 3TAYA 2A6XA 4WV8A 4XXPA 4CTEA 1W6MB 4P9XA 2D7FA 1LU2A 1V6JA 1QOSA 1LEMA 4XBLA 4ATEA 2VW2A 5CBLA 3VKMA 4CZSA 1LOAA 2D6KA 1VALA 1GSLA 1YI7A 4DRRA 3NV1A 1LHOA 1S0EA 1VAMA 4Q27A 4DQAA 5CAZA 3OBTA 1URXA 5T52A 4AWDA 1D0HA 2ZGRA 4M3CB 2ZZJA 1UZZA 1WLDA 4YM0A 2AUYA 1IKQA 1SCRA 3N35A 5E88A 4ZXKA 4BQ1A 3A4UA 3POSA 4XYXA 3VKFC 3ZXJA 3O0WA 2RHPA 2UU8A 4YGDA 1GNHA 1MVQA 5IK5A 1WD3A 2R1DA 4LBQD 3OYWB 2ZA9A 1KJLA 3AZWA 3JUUA 4FOQA 4YZ3A 1LEDA 3RG0A 4K1YA 3N3HA 5T55A 5JLVA 2I2SA 2ZMLA 1VIWB 3WUDA 3KM5A 2ZGOA 3AP5A 1FNYA 1LOFC 2AYHA 1CESA 5DUXA 1DQ2A 3ZSLA 2VY0A 1G9FA 4TYSA 2Z42A 2DURA 4YM1A 2VH9A 1UZYA 4GWNA 3RRDA 1QNWA 4WVWA 4LBKA 4WVVA 5DG2A 2DVAA 4HL0A 1DHKB 2R16A 1V6OA 3ZYRA 1FX5A 4YLZA 3UJQA 4DS0A 4AVVA 1S0GA 2DVDA 3O12A 1FYUA 3USUA 4YM2A 1QNYA 1UN1A 3WDVA 1LOBA 2UWCA 1JYIA 2G4IA 3AFKA 2DVFA 1N3PA 2SBAA 1S0CA 1WUVA 2GMPA 2EALA 2ZGPA 3AZVA 1DQ5A 4IQPA 4ASMB 1KQRA 1LHVA 5JDBA 5E8AA 3WV6A 3FFZA 1UX6A 4GKYA 1SLAA 4ATFA 4YFZA 2VU9A 4ISRA 5F5QA 4R9CA 1N47A 1YIFA 1SBEA 5LK5A 1NXD1 4U36A 3UJOA 1BQPA 1A8DA 1XQNA 4WZFA 4XXAA 2EF6A 1KDMA 3I8TA 1GZCA 5KXEA 5H9RA 3QCWA 2Q5TA 1CIWA 1SLLA 4Y1UA 4XJAA 5KXDA 1A78A 3N7JA 2HYKA 1LOCA 2V73A 2NN8A 1UMZA 2P3KA 1SCSA 3SITA 1ULDA 2GNDA 3UK9A 1V00A 1MZ5A 3OY8A 2AR6A 4FQ4A 4XTPA 5GZDA 4Q8KA 4FPCA 1DZQA 2LTNA 4FP3A 2PHXA 3POYA 3SISA 1AXZA 5FRAA 3ZXEA 1LODA 2WT0A 1Q8OA 3OJBA 1C4RA 4UW5A 3RS6A 3AYCA 4BM8A 1V6MA 2P34A 3ZXFA 2AREA 3VKNA 1I1EA 1DIWA 4YW3A 4M3CA 2DVBA 4YGEA 3USUB 1BXHA 3WHUA 4BOWA 1GBGA 4YW5A 2DUQA 1WLWA 4Q8LA 1WD4A 3VUOA 1BYHA 2DWRA 4PBOA 4ITCA 2A70A 2A7AA 2A3WA 2GN3A 5GLTA 3VV1A 5KXBA 4XJUA 1ULGA 3WOGA 2E51A 3OYWA 1V6KA 1GYKA 5T54A 1LECA 1CN1A 2CNAA 4XJZA 1LHUA 4F83A 4Y20A 1LHNA 1UPSA 3WDTA 4GA9A 4KBBA 2JJ6A 1BKZA 1JN2P 4GWMA 4R9BA 4K21A 1HQWA 1WW7A 3WZ1A 4CRQA 1YRZA 2D3RA 3N7LA 4Y1XA 3WCRA 4JRAA 4OZXA 5L73A 3RSJA 2E53A 4U2AA 1U0AA 1VAVA 2CL2A 2DTWA 2FMDA 2ARXA 4YFWA 3R4UA 2C5DA 5GLUA 1DQ6A 2CTVA 5EYXA 1GV9A 1B09A 1LGNA 1QDOA 1F5FA 1W6PA 2D6OX 3KQRA 5AVAA 1BJQA 2ERFA 1V6IA 2JECA 3D4KA 2D43A 4XMAA 4YGCA 5GJ6A 3WUCA 4Y24A 5GLVA 3ILRA 3SLIA 2P37A 2ZGKA 3OY8B 1Q8QA 2JKBA 3WDXA 4W65A 3ZYPA 1MS4A 1UAIA 2KM2A 2C9AA 1N1TA 1GZWB 1G7YA 2ZGUA 5H9SA 4XZPA 4P9YA 2AH2A 2DU0A 3AP9A 3W58A 4K1ZA 5IK8A 1N1YA 3APBA 1Z78A 4FOWA 1APNA 3V64A 1DYKA 5IK4A 3N36A 4GALA 2AGSA 5SV8A 3AJYA 1FATA 1OKQA 4YG3A 5HCBA 2YY1A 3N7KA 5JMCA 1IS4A 2E7QA 1ZM1A 2NP0A 3IKWA 1HLCA 1SLTA 2ARBA 1MS0A 5FREA 1S0FA 3OBRA 5DZGA 3WLUA 4M3CE 1EPWA 3FBYA 4Y20B 4YZ4A 1PZ7A 1IS3A 1JBCA 4H55A 3V0AA 2YZ4A 3ATGA 3LCPA 3MW2A 4Y26A 3ZSJA 5EXOA 1LENA 4PCRA 2ZACA 2SLIA 4Y1YA 2A3XA 2A5ZA 5DUWA 2GMEA 1SLBA 2GMMA 3WNXA 3AK0A 3GNEA 1W6PB 1LJ7A 2TEPA 1LGCA 1AJKA 3RMYA 1YO8A 4Q2FA 3ZXLA 4GXLA 3WG4A 2PHFA 3M3CA 3SH4A 1WW6A 1LCLA 4PQ9A 3ILNA 3A0KA 2W68A 4XIOA 3WHTA 5JOYA 3MW3A 1I3HA 4AGRA 3AXDA 1ENRA 3AZYA 1AZDA 1LU1A 5GLZA 2H0BA 4YZ2A 1LOFA 1MS5A 4DFSA 4I30A 4Q1RA 2DV9A 3ZSKA 5T5JA 2WKKA 1S0DA 2EXIA 2NM1A 2DYCA 4FPEA 3AZXA 3MPPG 4YZ5A 1W0PA 5CNAA 1GLHA 1W6NA 2W52A 2FHRA 4PBPA 2JDZA 2ZGSA 4XJWA 5GZCA 1AJOA 3M2MA 1HDKA 5T5PA 1WLCA 4UW3A 1OQ1A 5GZFA 2A6VA 3AP7A 3POWA 3ZSMA 1IOAA 4NOTA 4AVSA 3D6EA 1KJRA 3AP6A 4LBOA 2ZMNA 3A0NA 2CWMA 1ULCA 3ENRA 4P9WA 2VUAA 1TEIA 2R0FA 1OFSA 4FOVA 4Q26A 1DQ1A 1W6OA 2NMOA 3BOPA 1AF9A 5E89A 3V0AB 2UWBA 4RL7A 3T1LA 5F9TA 1GICA 2YXSA 2ZMKA 1MS8A 1LOGA 2EXHA 2GN7A 1MS3A 2D6LX 1ULFA 1JUIA 3B01A 3WG1A 1VLNA 2D44A 2NZ9A 3BTAA 3WDWA 1ENSA 4PF5A 4M01A 1QF3A 3ZVXA 3AJZA 1GZWA 4XBQA 3O0XA 2ES3A 1UKGA 3JU9A 5GALA 3AYDA 2PHUA 3HN1A 5JOZA 1W6QA 3T2TA 3CNAA 4FP2A 2UURA 4LBMA 1QGLA 1HKDA 1SBFA 4AGVA 1WW5A 2CY6A 4YM3A 2CWSA 4YW2A 3FUQA 1JXNA 4FPJA 3WDUA 4FOYA 4XE9A 1DBNA 4XHBA 1KDKA 1JHNA 2JD4A 2WJSA 3PJQA 3IMNA 4RA0A 5JOXA 2ZHKA 1SFYA 2AENA 2DU1A 2WQZC 1IS5A 2YMZA 1SLCA 1JW6A 3WG3A 3IPVA 1FAYA 1AX0A 1W6NB 1N1SA 3AYAA 1MS9A 1HQLA 2EIGA 4FPYA 1O4ZA 1S0IA 1G86A 1S1AA 2WT1A 2PHWA 4UW6A 3OPZA 1RITA 1Q56A 4XOGA 1C1FA 3VKOA 2W08A 1N3QA 4Q1PA 4XDQA 2VXRA 4YZ1A 1G9BA 5HCFA 2WNEA 1W6OB 2WLQA 3AZZA 4LBLA 2JE7A 4DRVA 3AX4A 3BODA 2DTYA 4GKXA 1G9DA 1DQ0A 3QLQA 4C1WA 2PHRA 2JE9A 3M3OA 1LULA 1BZWA 1CR7A 4P14A 3DGTA 5DUVA 5T50A 3BIWE 2R1BA 5CA6A 2OW4A 1DQ4A 1H9PA 1FV2A 1CVNA 1W6QB 3M3EA 3AXEA 3PVOA 1MS1A 4YW4A 3WVJA 5KXCA 1FV3A 3B3QE 2P2KA 4BLJA 3M3QA 1QDCA 4XHXA 4ZKTB 5BYNA 4NO4A 3RMXA 3NV2A 1GKBA 2A6WA 1MZ6A 4Y22A 5IK7A 3IM0A 1QOOA 3FUOA 3IPVB 1JOJA 3WDYA 4BPZA 1Z0HA 4YGBA 1RINA 2OUJA 2DUPA 1QOTA 2ZAAA 2ZHLA 4R9AA 1SLIA 4FVVA 1CJPA 3R4SA 2LALA 3PMEA 1F31A 1JYCA 3TB0A 3FLPA 1ONAA 1CPMA 1X50A 2ZBJA 2ENRA 4LBJA 2ZGTA 2W39A 3FLRA 4FPOB 3SH3A 1CPNA 3NWKA 3ZXKA 1S0BA 4FPGA 3ASIA 5EWSA 5GZGA 1LESA 3AYEA 1LTEA 3LSDA 4YG6A 3W59A 1C1LA 1MR5A 1WBFA 4BMEA 1Q8SA 1IKPA 2PELA 1LGBA 2PHTA 3O0VA 1MACA 1N1VA 1O4YA 3ILFA 2B7YA 4BMBA 1V6LA 3L2YA 4XBNA 1V6NA 4Z8BA 2E7TA 5GLWA 1J1TA 2ZHMA 1W0OA 2A6ZA 2E6VA 2EXJA 3HR9A 1NLSA 1KITA 4DPNA 1C57A 5DZFA 3V65A 4JC1A 4XMIA 1Q8VA 2A6YA 4MYEA 4XTMA 1R1ZA 4FQZA 5CB7A 3VKLA 2UWAA 2R0HA 2GNTA 2P3JA 2D6PA 2ZGLA 1QMJA 3Q9OA 2EXKA 1DLLA 4Y22B 1WBLA 1FNZA 1H30A 3NV4A 5GM0A 1A3KA 2ZHNA 3GALA 2ZGMA 5IT6A 1N3OA 4LBQA 1MVEA 1ULEA 3DUIA 3I4IA 1LOEA 4HANA 1G8WA 1S0JA 2GDFA 4FPLA 5GZEA 1SBDA 2XB6C 5DZEA 4YW1A 3V0BA 2A71A 2ZGQA 3IN9A 2WT2A 1AXKA 2OVUA 3B9CA 2VW0A 5IUQA 2OUHA 3OGGA 4FPFA 1DFQA 4YG0A 1KRIA 4BLIA 1G9CA 3AP4A 4Y1ZA 3T1MA 2D3PA 2NMNA 4TZDA 4AVTA 5T5OA 4K20A 5DXDA 1PZ9A 4FPHA 3PVEA 1UL9A 3B00A 4XIKA 5DG1A 4M00A 2BQPA 4ISQA 4L8QA 3LSEA 5DUUA 4FPKA 1W6MA 1WW4A 1Q8PA 2DUOA 5T5LA 2GNMA 2D3SA 2NYYA 3HMYA 3H0OA 3O5SA 1DGLA 2YV8A 1QKQA 1D2SA 3WG2A 2GALA 2GNBA 5HCAA 3D5OA 3WCSA 3U4XA 1DYPA 1ZA4A 3UL2A 1GANA 2WSUA 2ZGNA 1Y7BA 1CONA 3FLTA 4D69A 3ZPYA 4R9DA 5H9QA 1LHWA 4AGGA 3NV3A 2WSVA 2D6MA 2CYFA 1PZ8A 2V5YA 1GNZA 4AYUA 4XILA 4XJ8A 4UW4A 4JCKA 1CQ9A 3MW4A 1IS6A
chains in the Genus database with same CATH superfamily
1K42A 5AC93 2DVGA 2QZ2A 5JVVA 4I01A 4LBNA 3WW4A 3PLQA 1WCSA 5FMBA 3E97A 3ZFEC 2YC0A 4DB5A 1PM4A 5JOWA 3LEMA 3TEZA 2QE3A 2ZABA 1VR3A 3M1HA 5KHHA 5J1XA 3MPBA 3SHRA 5LATA 5FO9B 2NQYA 4NWWA 1AX1A 1GZ9A 3R05A 4JGYB 4YVSA 3B69A 4CCNA 4CCCA 3VZLA 3I2OA 2WFF2 2X5IC 1RIRA 5LA9A 2ET1A 3PVNA 5L7OA 1AXYA 3T3YA 5IYYA 4WV8A 1YFWA 2F4LA 4LIUA 1W6MB 4ZU5A 2BVBA 2JG8B 2MEV3 2Y6LA 5BNQA 4C8DA 2W1UA 5K0UA 4Q4V3 4E8DA 4ATEA 2WAOA 3FX3A 2XL9A 1JZ4A 3LEKA 3VBHC 3ZN6B 1LOAA 1VALA 4DRRA 2RJKA 4DUWA 1GQPA 2QQIA 1AR71 3IMMA 1GMMA 1LHOA 4HK8A 2IVJA 3GCWA 1H2NA 1UZVA 1UY2A 5F2SA 3VD3A 5JIAA 1AL23 3USSA 3P3PA 4AWDA 2R042 2WYSA 3MO4A 2ZZJA 1JMUB 4CP1A 4Q0VA 3HBZA 2AUYA 4YM0A 1XB9A 3N35A 5FZLA 1CAUA 1ZZ6A 1QXJA 1QQP2 4Q4X2 3ZXJA 3PUQA 1GOHA 3L2HA 4HKOA 2WAAA 5C3RA 1ZYBA 1TME1 3CJIC 1VRH1 4LBQD 4TWTA 2XQRA 3OYWB 3NNMA 1ULOA 1ZBE2 2BEOA 3AZWA 3JUUA 3LQCA 3RG0A 5JLVA 3WUDA 1RUF1 3ORJA 3AP5A 2WO7A 1FNYA 1UO9A 4Q4W3 2OT7A 3UNPA 1DQ2A 1X8MA 3CL1A 2VY0A 4QHOA 4YVWC 2ZZQA 3ZSLA 2W2IA 4BJ0A 1WMXA 1NYWA 4GWNA 3RRDA 4NHMA 4WVWA 1BBT3 1WLTA 1H4GA 4WVVA 3F95A 3ZSEA 3GZTB 1DLCA 3MYXA 5DG2A 3AMPA 4AVAA 2NPIA 3MIHA 2R16A 1OVSA 2CHHA 5K9YA 5SV5A 2JG9C 3UJQA 1S0GA 2VPVA 4UFIA 1Y43B 4URTA 3IIAA 3USUA 1NLQA 3VBRA 1YLLA 3ZR6A 2TNFA 1QIQA 4AAXA 1CWPA 1UYZA 2VR4A 3B9IA 5FZIA 3GJAA 4B29A 3THTA 1OLRA 1X33A 2DVFA 4RFT0 2QQPA 1S0CA 1WUVA 3DEMA 4CCLA 3WNOA 1Y9QA 3AZVA 1DQ5A 4IQPA 4L2NA 2G19A 4ASMB 1LNSA 1VBC2 4UOJA 5E8AA 3LDBA 3MLJA 1B35A 3PUSA 1PMHX 5CFCA 2XLAA 5J37A 2WFPA 1WCDJ 3CEWA 3HQXA 1R64A 3E5UA 4IEQA 3ZMNA 4CVUA 1NXD1 3VBSC 5FWJA 1W9FA 2EF6A 2Q8DA 3ACHA 1GZCA 2BRTA 4IERA 5H9RA 5I0DA 3BGAA 4LHLA 1RUJ3 2RMU2 5E6HA 3HIFA 5FJKA 2NN8A 3OPWA 2P3KA 2WWUA 4EE2A 2J7MA 3SITA 1X9PA 1ND2B 4GIQA 3OF1A 4C0BA 5IAXA 3OY8A 4FAHA 1RUH1 5ACA2 5A3MA 4A7KA 5JWPA 3KT7A 1CAWA 4FPCA 3TRSB 1RXGA 2WT0A 1OBNA 3OJBA 3RS6A 1C4RA 1W8ZA 2W3JA 3TBDA 2WA3A 1I1EA 1GWLA 5FYMA 2DVBA 4YGEA 5FUIA 5FFOC 1WLWA 2FCVA 3LEGA 3PTYA 4PBOA 3DL3A 4KGQA 2X09A 3EHKA 4XUOA 5JAXA 2A70A 1J59A 2A7AA 1BBT1 5KXBA 4NN0A 4JHTA 4MGZE 1CAVB 1S2EA 1XNTA 2E51A 4QGNA 2FBEA 1V6KA 4P9JA 4QPGA 1ST8A 5FIXA 5FYCA 4W50A 5IVVA 3C8XA 2BERA 5J09A 4F83A 4Y20A 3AKQA 4XQ4A 1BKZA 4IUGA 4IV1B 1ZBE3 5DAPA 1HQWA 4CRQA 1HRV1 3BPZA 2YPJA 3WCRA 5BUVA 4JRAA 1PK6C 4OZXA 1F2NA 2B45X 2E53A 2VOTA 3RSJA 4GH4C 2QBXA 1F5JA 3B02A 2Y0IA 4GULA 1DQ6A 2CTVA 5FZ3A 4AHZA 5BY5A 5AVAA 1F5FA 2D6OX 3IIIA 2ERFA 1V6IA 1R093 2GP5A 2D43A 4XMAA 4NAOA 5GJ6A 3ZFEA 4AAPA 2HWD2 4XF3A 3KD4A 3WD5A 2D93A 2QQLA 1A34A 1FT9A 2J1TA 2JX9A 3KV6A 4S2GA 3K48A 2JDHA 4NMIA 2C9AA 3VN4A 4QB2A 1N1TA 1G7YA 2WINB 2WNUB 3VZJA 1GWKA 4FTBA 3POBA 1OOPB 4R8HA 3W58A 5FOJB 1RUJ1 2VNRA 5FY8A 5HV0A 1JU3A 2X5IA 4OYUA 3U10A 3VZNA 2WFF1 4AHXA 4QHZA 4GALA 3H8OA 4HLTA 1ZRRA 1VBC3 4ORFA 5SV8A 5F7UA 2QQKA 2VZ1A 4O9EA 4MHRA 4YG3A 1EPZA 1IS4A 3ES1A 2OYZA 1XU2A 2E7QA 4HN1A 4LHSA 1HLCA 1NCQC 2XKPA 3BOWA 2Y38A 1MS0A 1UF2C 4QQOA 4QKBA 3ZXDA 4AI1A 3VBHA 2VZUA 3WLUA 5F37A 3TEYA 4CPBD 3FBYA 4AZZA 3NSTA 1PO12 1IS3A 3WF1A 4TLFA 2YZ4A 4AF9A 3MW2A 4XAAA 1OH3A 1HRI2 1WZXA 5I0TA 1CZVA 2SLIA 2RJ2A 2GP3A 1SLBA 2R041 5FP9A 1KFUL 1XNAA 3DKQA 4LE3A 4P9GA 2XLGA 3KHCA 3ZFGA 1YO8A 4UI9L 3ZXLA 4CP2A 3CJIA 1QQP1 2PHFA 3M3CA 4Q4X1 1NY72 1U5YA 1REFA 3AMMA 4GWJA 5FZCA 4D6RA 1SPPB 2W68A 3WHTA 5JOYA 1CJDA 1I3HA 1KS4A 3AZYA 1ZBE1 3FN9A 2B39A 4IGOA 3W9AA 2H0BA 5FLJA 3OPTA 1H8TB 5A7WB 3UESA 4AHYA 2OKXA 4BK4A 5T5JA 4I0AA 4YVWA 2WKKA 3UKNA 2WNOA 2DYCA 2GH8A 1FI2A 1QJX2 3AZXA 2QQNA 3MPPG 4MHUA 3SC7X 3VB9A 1WMEA 3TYJA 4DMIA 5CNAA 3DXUA 4URAA 2UYBA 1AJOA 1O91A 4UWDA 1WLCA 2JG9A 1SZBA 1IG3A 4UFHA 4AVSA 3U0ZA 1STMA 4KWLA 4OUEA 2ZMNA 3A0NA 4XACA 1ULCA 1DCSA 3ENRA 1BK1A 4IEVA 1TEIA 2R0FA 4M4PA 2BZDA 1JOBA 4LO5B 1OFSA 4FOVA 2JG8C 4Q26A 1W6OA 3O1SA 1VB2A 2E63A 3NNJA 5AVPA 2B9UA 5E89A 1JZ3A 3V0AB 1IPJA 1TE1B 2UWBA 1OD5A 1GICA 4QU1A 1W90A 1MS8A 4I02A 4LHNA 2D6LX 1HV0A 1JUIA 4NE9A 1RUD2 3WG1A 1VLNA 1VBC1 1RUG2 3BTAA 1ENSA 3ZVXA 1QF3A 3I97A 4XBQA 3O0XA 4A4AA 5GALA 1YQ6A 3SEPA 3VBSA 1O7FA 3I7DA 4LBMA 5M0TA 1WW5A 4P9IA 3AMNA 5FOBB 2EIDA 1JXNA 1VMHA 4FPJA 3WDUA 4FOYA 1VBD3 2Y6JA 1PMIA 3PJQA 4XETA 2RMU1 2V4VA 2VVFA 4CU6A 4IDZA 3IMNA 1MZFA 3B93A 1OT5A 4HVQA 1NCRA 4WM7C 5KHKA 2ZHKA 1SFYA 3SKJE 3VBUC 2WQZC 1IS5A 1EP0A 2YMZA 4IE4A 1UOBA 2G1MA 2D97A 1GZTA 3C7FA 1W6NB 3ZFFA 5ACA1 4C91A 1FPN2 1RUI3 3FZ3A 5FY9A 1MS9A 4BQ3A 3O1TA 1VP6A 4FPYA 5JSOA 2C26A 2JICA 3D0SA 4UW6A 3OPZA 2WA4A 2W08A 5FZFA 4RGKA 1GQHA 4MG2A 3AMHA 4Q1PA 5JZGB 4XDQA 3KV4A 2WN3A 3N4MA 3ETQA 1XYPA 5FMOL 1FXZA 1S4CA 2J1UA 5L9BA 2BU9A 3AX4A 1W05A 3E5XA 5HXVA 1NUKA 3FL7A 3PL0A 2X05A 2GC3A 2PHRA 3M3OA 1JU4A 4LE4A 1LULA 1CR7A 3LB9A 4X8NA 5T50A 5CKNA 1VMJA 3BIWE 4IE7A 2OW4A 3PDQA 5IVBA 1O3RA 3VDDB 4F8AA 4ES9A 5JIUA 1W6QB 4PDWB 3VHOA 1DF0A 4LO7A 3K2OA 1O5UA 1K5MB 1PK6A 2JWPA 3JCIA 4UBGA 1FV3A 3WVJA 5KXCA 4GH4A 2EIBA 4C90A 1ND3B 5J3UA 5A7NA 4XHXA 5BYNA 1W2UA 4NO4A 1QJX3 3MF6A 4JKMA 5FQ0B 4CP9B 3B94A 1UU5A 3THDA 3WP6A 4LLFA 4TXWA 4QDSA 3HT2A 3IM0A 4HKWA 5LWBA 1US2A 4FXGB 4RSUA 4BQYA 4CEWC 1WA4A 1IG0A 1KS5A 2HWD1 4Y4YA 5L9RA 3ZYFA 3WDYA 2FQPA 2LUWA 1Z0HA 1RINA 4E4ZA 3BTZA 2ZHLA 2VO5A 3AL6A 1H6YA 1ND2C 1JTZX 2JB8A 3PMEA 3EYPA 3TB0A 3FLPA 2VXJA 2XDVA 5DDJ3 5G04L 4K9SA 4CU7A 4DNYA 2XLFA 3SH3A 2GC0A 3NKTA 1S0BA 5FK7A 3T0BA 3ASIA 3EO6A 3GZAA 2VZQA 3LOIA 1OI6A 1LESA 2ID4A 4KMQA 1LTEA 4IV3B 1RUG3 4BWOA 3LSDA 4YG6A 5FZ1A 4EN8B 3IDAA 4DOUA 1NCQA 4BMEA 5BXXA 2PELA 1YJKA 2XJSA 4G3YC 4DIQA 3NAPB 1JYNA 2PHTA 4LK7A 4LUKA 4Z07A 1MACA 1O4YA 1H6XA 4BMBA 4GMP3 1V6LA 2P6CA 4Z8BA 1PO11 1RUE3 3ZDSA 1UIKA 2E6VA 2A6ZA 4HPKB 3ACGA 4Q29A 1KITA 4DPNA 1C57A 3V65A 1ENXA 1HRI1 1QJY2 4MADA 1Q8VA 4AHWA 3TOJA 4BISA 4LKEA 4QQHA 4NIAA 3E6BA 5FY4A 2FDFA 2P3JA 4NPMA 1EAH2 2BOIA 1OKOA 2EXKA 1JZ6A 4Y22B 1JZ8A 3KGLA 1W2TA 3HOBA 1OURA 4IGQA 2ZGMA 1NY71 1SDWA 1ULEA 4IE0A 3DN7A 1LOEA 4CUBA 4AW7A 4FPLA 2IZWA 3KCYA 1COV2 3QACA 3IN9A 5IUQA 2VW0A 1UD1A 1QJX1 1ZVFA 2QQMA 4YG0A 5FY1A 1KRIA 2WNUC 3I3DA 4BLIA 1UX7A 3AKPA 4Y1ZA 2NMNA 4DEVA 3JB8A 5A7QA 5DXDA 1RVF3 2VMCA 2VCAA 1UL9A 3RWNA 5C71A 4EN7B 4HZFA 2BGOA 4ISQA 4L8QA 2LS6A 2WS92 3NJXA 5DUUA 5C6CA 1W6MA 2DCKA 2R7EB 4GJZA 2Q8EA 5T5LA 4LO8A 2JG8A 2NYYA 3HMYA 5D8AC 3I3QA 4MGIE 1QKQA 2VZSA 5DDJ1 4XUNA 1AR82 2W92A 1QJEA 3NNLA 1JYWA 2GALA 3M3IA 4B7KA 2ZX1A 3RI9A 3C3VA 3A21A 1W9TA 3FHQA 3OEAA 3PNAA 4PT6A 4WZCA 3UL2A 2RV9A 1GANA 4LKDA 4AQTA 5C33A 3S0MA 2ZGNA 1CONA 3ZPYA 1H1MA 1RUD1 2YC4A 5I93A 1RUG1 2VE1A 4AGGA 4XABA 3NV3A 2JD9A 1YI9A 2WSVA 3OUHA 2JB4A 2V5YA 3I59A 1GNZA 3I2IA 4JV4A 2VNOA 1PVC3 4XILA 4XJ8A 4AYUA 1GWMA 4CUCA 3KGZA 3WNNA 1CQ9A 3HT1A 4HK9A 1W39A 1IS6A 3BIEA 4OUMA 5IFPA 3MHZA 4GMP1 3DKWA 5FMDA 4KQ7A 4GB32 3QD6A 1VBB3 1H1AA 2IXIA 1OHFA 1RHI3 3O1PA 2K0GA 2R49A 3VBUA 4OZOA 3MEPA 1AYM2 2IUWA 1YYNA 2ZEZA 4HN0A 2OA2A 4AFBA 1H8TC 3J8F2 2QQOA 2P3YA 5IWFA 2EAKA 4A42A 1RUNA 1H0BA 1FPN1 1AYN2 2CDPA 3N9NA 5EZWA 1SACA 5FY5A 1PMJX 1F35A 4LOSA 5TSWA 1AR92 2YBPA 2A6XA 4RHV3 3RNSA 4K8FA 4JVAA 3H8RA 4CTEA 4P9XA 5KWRA 2Y6GA 2XJUA 2Y6HA 2A73B 3J7HA 5FYUA 5ERLA 4E27A 1Q43A 5A70A 5CKMA 1GR3A 4BIFA 5LY1A 3MV01 1OLMA 1W8OA 1VB4A 2LRPA 3DPRB 4KI5M 3MIDA 5EIYB 1YI7A 4KWKA 3WF4A 3NV1A 1EAH3 1YC61 4JKLA 1VAMA 2JEMA 5CAZA 3OBTA 3VBFB 1HV1A 5T52A 3A7QA 1PX3A 1UZWA 2XH6A 2O0OA 2BYVE 4M3CB 5HCHA 1UZZA 1HXS2 3R6SA 1WLDA 3U14A 4EYUA 1SCRA 5E88A 4LT5A 4LTAA 2CGOA 4MGSA 4XYXA 4LK6A 3VKFC 3MICA 2Z4FA 3O0WA 1IHMA 1GNHA 1BK0A 1WD3A 3A22A 4QX1A 1UY1A 5A33B 1HB1A 1LEDA 3N3HA 5T55A 1XSRA 5FZGA 4CEWA 4LR4A 4SBVA 3PU3A 2AYHA 1LOFC 4IEYA 1SFNA 4ZZ8A 1QJZA 2E7AA 1ND2A 2DURA 4W4ZA 3VDCA 1VMFA 1UZYA 1W04A 2VH9A 3J7LA 1QNWA 1NQJA 4JX0A 3LF7A 5ANNA 5GKAC 4PHZA 1M06G 2HWE2 2VTFA 4HL0A 3NRUA 3T09A 1AR83 2PMWB 1V6OA 4ARXA 3ZYRA 1FX5A 4XZUG 5JPNB 1PGL2 4AVVA 2DVDA 2VTXJ 4PQQA 2ZJCA 3WQBA 3E6DA 4YM2A 4OHXA 4NHLA 1QNYA 1UN1A 2HEVF 3LFMA 2DF7A 5JZGC 1LOBA 3OCPA 2UWCA 4CXYA 5FYTA 4I0BA 4Y5SA 4LEJA 2O8OA 4XFIA 1Y3TA 1DZRA 2UYAA 3POJA 1NG0A 5JDBA 4M0NA 1W8HA 1UX6A 4QPYA 4N8MA 3EMRA 3VBOB 2VU9A 4IETA 5F5QA 3U4SA 1N47A 3TNPB 2D98A 4Y5TA 2YYOA 4YRDA 2RS12 5FDBA 1QJY1 3VDDC 4U36A 5FO7B 4XXAA 2Y6KA 4UBHA 3WNMA 3N9OA 3I8TA 1K5MC 5KXEA 3C7OA 2AEYA 4XF4A 1QWRA 1W9WA 5JR7B 3J8F3 5LY2A 2RS32 1EAH1 3QCWA 1SLLA 4CDQB 4RQPC 3Q8FA 4XJAA 4BXFA 1A78A 3N7JA 5KXDA 1LB2A 4NIHA 1AYN3 4R52A 4C0HA 2IC1A 1SCSA 2HH9A 5ABJB 2QQJA 1ULDA 2GNDA 3K4AA 1UMIA 1V00A 2E31A 5F8PA 1MZ5A 3JBG2 4XTPA 2VZ3A 3K4ZA 3VL8A 4AG4A 1W8WA 1X82A 1JYVA 1D2QA 1K12A 3JB4C 5FMOS 1AXZA 2OQ7A 2BNMA 5B2GB 2WNUA 4NHKA 1UXZA 4UW5A 2HWB2 4XPVA 3MFAA 1OOPA 4IEXA 3FBMA 4OULA 2AREA 3PU8A 4Q4Y2 5IJRA 4CUGA 5CFDB 1BXHA 2PAKA 2W91A 2DUQA 1CZSA 2H6CA 4Q8LA 5JUVA 1DGRN 4ZU4A 1BYHA 4PIXA 5A1FA 5DN2A 2B46X 2WS91 5D8AA 4OHZA 1J1LA 3WQ7A 1Z7S2 2VZRA 4XJUA 1ULGA 4HG6B 4BK5A 4DXRA 1FOD2 5IVJA 5T54A 1AR81 4DY3A 2XJTA 4E2QA 1LHNA 3HWJA 1SEFA 1K5JA 4XQDA 1YCIA 1JN2P 2WR9A 4FXKB 4K21A 2D3RA 1K3IA 2RS52 2XJVA 3OGSA 2ZEWA 5BNOB 3RYRA 5FR3A 3JD72 5ANQA 3LFIA 2OQ6A 1JI6A 3H1YA 5FV3A 3I2JA 1LGNA 3SMHA 1GQGA 4BU2A 3CO2A 1UCXA 2FD8A 1T6GC 2ZEYA 2JECA 4XFCA 3VDBA 4GB31 4NR1A 5GLVA 1KFXL 3ILRA 4META 5F3EA 3SLIA 1RL3A 4QPIB 4A44A 1SPPA 1HW5A 2JKBA 2BGPA 3WDXA 1MS4A 1UAIA 1O3QA 2BNOA 2ZX4A 1H8TA 1AYM1 5A7WA 4I2OA 2ZGUA 1EYBA 4HBNA 4MUVA 4P9YA 4NIDA 2VMDA 2ZX2A 3J8F1 5C5TA 4K1ZA 4QB6A 4LXLA 5IK8A 1JYXA 1UOJA 1WCUA 1AYN1 4D7SA 2FCUA 5IK4A 3OTFA 3VD5A 5FKBA 1RUH3 5DAQA 1AR91 1WA6X 3AJYA 4Z2AA 2ARCA 3ZFGC 1FATA 1OKQA 1F4HA 5HCBA 2YY1A 3WW3A 4ARYA 2LROA 3N7KA 4L92A 2FMYA 5C4WB 5A3UA 2NP0A 2ARBA 4BA6A 5FREA 3BU0A 4OUSA 5DZGA 2B9VA 4M3CE 2GZWA 4CE8A 1PZ7A 2E9QA 3V0AA 1L7QA 4JGZC 2XWBB 3LCPA 2JDUA 2R072 3CQOA 4Y26A 1IGOA 5D2AA 4WVMB 1NA1C 4D0QA 5F32A 2A5ZA 2HBTA 2VVEA 5EV7A 5JXJA 3AK0A 1HXS1 5FY0A 3GHNA 4A45A 1LR5A 2TEPA 1LGCA 2CV6A 3CBNA 1QH7A 1XC6A 2HEWF 2J42A 3GJBA 3LIGA 5FZ9A 1CIYA 3VGIA 4J6GA 4EZ4A 2WLPA 3I3MA 4XIOA 3N9MA 1HRV3 2VQTA 4PLNA 4AGRA 3K3NA 5GLZA 1ZNPA 1LOFA 4Q4Y3 3AL5A 5EJZB 4I30A 2DV9A 2YHJA 5JMOA 3ZKYA 4XFGA 2NM1A 1CAXA 2DDUA 4IEOA 1W6NA 2W52A 1I5PA 1OVPA 2FHRA 2JDZA 3LD8A 3W5MA 1XNBA 3RZHA 1UYPA 2XONA 2RE9A 3DYMA 4JHZA 5FO8B 5L9VA 2G9ZA 2HWE1 1HDKA 5T5PA 1FOD3 1OQ1A 4UFMA 2WZEA 5GZFA 3CF6E 5JI7A 4NOTA 3D6EA 3AP6A 3M4FA 4LBOA 1PGL1 3IBMA 2CWMA 2EICA 4CDUC 5A7OA 2VUAA 5JZGA 1UWWA 3POIA 1S55A 4QDQA 3O1VA 2VCMA 3R0RA 1UY4A 3AKSA 1EY2A 2FDKA 1AF9A 2WFF3 4E4DX 2CAUA 1NCRC 4PLMA 1QEXA 1XSQA 1XRUA 2YXSA 3DPRC 1W3VA 3JD73 4B8EA 2D5FA 5C5UA 1PHMA 2D44A 2NZ9A 4UFJA 4IESA 4OI4A 3TNQA 3ZFFC 5BNPC 4WM8B 5LW9A 4J25A 4M01A 3AJZA 1GZWA 4KG8A 3JU9A 3VDDA 1JUHA 1W6QA 1NE4A 2RS11 1D4M2 2JXAA 4FP2A 4PDWA 2XOMA 1K5MA 1QGLA 4K7JA 3S7IA 3TWIA 4AGVA 4MXWB 2RG4A 4RQPA 3UT0A 1DBNA 2RS31 3KCCA 1JHNA 2JD4A 4KL1A 4XFAA 3WNPA 4CP9A 5FQ0A 2R043 1PNGA 3P6BA 2AENA 1YJLA 2DU1A 2I07B 3EBRA 4WBBA 5DPNA 3KMHA 3NL1A 3WG3A 3ZN5A 1HJFA 2KA3A 3VHRA 3K77A 1QQP3 3ITQA 4Q4X3 4X8PA 4CP0A 2Y26A 1N1SA 2R30A 3JBG1 4AFAA 3AYAA 1XE0A 2VCCA 3POEA 1O4ZA 1S0IA 5FZHA 1S1AA 5FTTC 2HWB1 1QXRA 4Z92B 3OGVA 2IWGB 3ETPA 4CSWA 4XF0A 4Q4Y1 4EWAA 1G9BA 1XYOA 3BPSA 3WQ1A 4BZ4A 1OD3A 1BLZA 2OPWA 4XFHA 2QZ3A 3VHPA 4D6SA 1YQ8A 5FBJA 4GMP0 4DRVA 2A1XA 1G9DA 3P5BA 4XUPA 5EJ3A 3WX5A 1Z7S1 1GOGA 3PMSA 5IVEA 4YNIA 1J84A 5IVYA 5CISA 2BDRA 1BZWA 1FOD1 4P14A 3DGTA 2B5HA 5JXGA 4O65A 4FI9A 1DQ4A 4GZ9A 1FV2A 2HWF2 1CVNA 4QXHA 1VJ2A 5A1LA 3AXEA 4HPKA 4IEUA 1BHGA 5F3IA 3FFQA 5BPXA 1C8M2 2JDPA 2P2KA 1UIJA 4BLJA 5C8CC 2Q1ZB 2RS51 1ZZ9A 3KS7A 4QKFA 4QM9A 4XDPA 1ALYA 3NJYA 3NV2A 4JAAA 5A80A 3RMXA 2OIIA 3JD71 4AFDA 5A1AA 2A6WA 2R32A 2CGPA 4Y22A 2PQQA 4D7TA 5IK7A 5FZBA 5CYYA 2IFWA 4CDQC 1QH6A 4N53B 4A3XA 4I3GA 4S2FA 2VOKA 4EROA 1JOJA 4BPZA 2Q30A 3ZLIA 2CGNA 3FE5A 3UETA 2XVGA 5ABJC 3AB0A 1SLIA 3VZMA 3IAQA 3Q8BA 3OBAA 1OFNA 1F31A 1JYCA 2RMU3 5EHDA 1CPMA 1FMD2 2VZVA 2ZBJA 4LBJA 1CPNA 1D0GA 3Q8AA 3ZXKA 3BYWA 2VBDA 4BB3A 5ACA3 3AYEA 4G4FA 4GD4A 5CFDC 4MLOA 4MSVA 1WKYA 4AR2A 3WP5A 3KLSA 1MR5A 5IAVA 5JXHA 4QXBA 1LGBA 2VVDA 4IW3A 3QOPA 3HN3A 3O0VA 3AVSA 5JCTA 4RFRB 2IXLA 4CDXB 4GJYA 3L2YA 1V6NA 4JGZA 4QX8A 1POV0 4CCEA 4KU8A 2ZHMA 3HR9A 1OUSA 1NA1A 2BW8A 2R071 5L7OB 1S2KA 1IQAA 1PIV2 2WN2A 2A6YA 5FBZA 5CB7A 4JGYC 4A3ZA 3NVCA 2UWAA 2R0HA 4NIGA 2Z5WA 5IFTA 3Q9OA 2AEZA 2D6PA 2WABA 3DYOA 2PLV2 4Q5OA 4X6RB 5EJ1B 5K0UB 2WBKA 4HKLA 4QX7A 4EQVA 5BNOC 3HNMA 1PVXA 2G9FA 2Y0OA 3ALQA 3GALA 5LBBA 5IT6A 1N3OA 1XE8A 2C1FA 5FKCA 2ORZA 4EWEA 1GNYA 3O1OA 3I4IA 4Y4RA 5D1IA 4L97A 3M7AA 1G8WA 1S0JA 3KWVA 5GZEA 1Q3EA 1SBDA 4YW1A 2WL1A 2XHNA 1A8MA 1YFXA 1AXKA 2OVUA 2VQ0A 2WT2A 3B9CA 5I8SA 3OGGA 1RB8G 1DFQA 2WNVB 5LBEA 2P4EA 4W6WA 4HSLA 1L3JA 3N9LA 1CAUB 2IXKA 3AP4A 2HWD3 4NPRA 5F6KA 4TZDA 5FLIA 5T5OA 1ZZ8A 1ASJ2 3U07A 3B00A 3Q8CA 4BYYA 4LHKA 5HI0A 2BQPA 3MGUA 4CDUA 3ZYJB 4DEQA 1HN0A 1LRHA 2NLRA 1WW4A 1OH4A 4P5YA 2DUOA 2WO2A 3KV9A 2GNMA 2BNNA 5LZ6A 1E5IA 2YDEA 3FJSA 3ZYIB 1R1A2 1C8M3 3D5OA 3WCSA 3DPRA 4CA9A 3H50A 3U4XA 4LLOA 1ZA4A 2ZX0A 3RYPA 5ISLA 5BNPA 2GC2A 4PF1A 5DABA 1NE6A 1UY0A 4D69A 1XJAA 1RUOA 1MEC2 5IVFA 4RR3B 4R9DA 1AR62 2JIGA 2X29A 1LHWA 4JZRA 1OPOA 2B8MA 3VBRB 3WP3A 1ZBA2 1W8FA 4JCKA 4D94A 4XVHA 3ZSMA 1D4M1 1PO13 2J1SA 2W87A 1Y9GA 1YEWA 4AQSA 4PI0A 5F1RA 4LBQB 3INAA 3RQ0A 5FP3A 5LA2A 1HRI3 2QCSB 3R4DB 2W0XA 3I2KA 2YUEA 4H7LA 1RGSA 3T0DA 3SH5A 2XG3A 5L19A 1B35B 5CFCB 1OC1A 5FPUA 4LOTA 4QXKA 3V0BB 2A3YA 1YQ2A 1REDA 5EYYA 4WVZA 3U11A 1RYYA 1T6BX 1JS9A 1TQ5A 1C5IA 2D6NA 3POFA 1AX2A 4CU9A 2HWC2 3LIHA 5H9PA 2P3IA 4RYDA 4M3CF 1G9AA 3PUIA 4SLIA 3TAYA 1WMDA 4CXWA 3PJYA 4GWIA 1WCKA 1US3A 2D7FA 1C28A 1V6JA 1W03A 2OZJA 2Z69A 5FXXA 5LBFA 3TN92 3WQ0A 4CEYB 4CUAA 2PHDA 3PHMA 5A32B 2LM3A 4B1LA 4A2UA 3KF3A 1NAEA 2VD7A 1KGYA 3EQEA 1LEMA 2JIJA 4XBLA 2ADEA 2VW2A 4AEKA 2I45A 2H0VA 4CZSA 1R082 2XUEA 4OCTA 2D6KA 4ZY9A 1GSLA 4HXCA 3ZKUA 2RJLA 4Q27A 4DQAA 4AOCA 3S30A 4OHYA 1HQNA 2YBSA 5FYZA 2VOWA 3UKVA 4DY5A 5FYSA 4I3PA 1D0HA 2C4XA 2HWF1 3UGHA 5CKQA 5C8WA 3GXUA 4WM8C 1UMHA 1IKQA 5C8CA 3POSA 1C8M1 3CHXA 5C9AB 1GP6A 2RHPA 3I2DA 2XR4A 4YGDA 3VL9A 1MVQA 1UOGA 5IVCA 1RUD3 2R1DA 2RM22 3X29B 2ZA9A 1KJLA 2YGMA 4YZ3A 3UV9A 4CDQA 3K46A 4GAZA 1WCQA 2I2SA 2ZMLA 2Q8OA 5LRSA 1GUIA 3NNGA 1CESA 5DUXA 1ASJ3 1D7PM 5ABJA 4OQ8A 1O8PA 2P6HA 4YPJA 2HYXA 1YQ5A 2XPJA 4TYSA 5LB6A 4YM1A 2OX0A 4NVPA 2VOVA 4LBKA 2YFZA 5FLHA 5FZDA 4ZONA 1GP5A 4AI9A 1FMD1 3I3EA 4UF0B 1R1A3 3HNYM 4IV1C 4D3WA 3CZJA 2XL7A 1DDLA 2G9GA 5A3NA 1V9U2 4NROA 1FYUA 3ZFEB 4QX5A 5CFDA 3AVRA 4W8JA 1FPN3 4MH0E 3OGRA 1JH5A 2XJPA 1JYIA 2G4IA 3AKTA 1V70A 3AFKA 4FO9A 1N3PA 2SBAA 2W1WA 4ZXEA 3O1RA 1W9YA 2EALA 5A6ZA 1LHVA 1SMVA 2VZTA 3WV6A 3FFZA 1K45A 2X5IB 2W94A 3S5AA 4EN0A 4ATFA 3SQOA 4R9CA 3ZYGA 1YIFA 3PVBB 4QHBA 1SBEA 1PIV1 5LK5A 5C3PA 4JGYA 3UJOA 1OOPC 4XFFA 4NAMA 2DCZA 1JYTA 2HBUA 2P5BA 5F5AA 1BVVA 2XQXA 4Z1VA 3VD4A 1QY4A 5DAVA 5BNOA 2PLV1 2QFEA 4Y1UA 2DBNA 4S2DA 4P9LA 3IDCB 1LOCA 2HWC3 1P8JA 1YFYA 2PN5A 1QXPA 1ODNA 3SCFA 1PGSA 1ULPA 1QJFA 2R062 5CG9A 4N53C 3GZEA 3FC0A 2AR6A 3JQWA 1C3HA 3TN93 3ZN6A 5GZDA 4Q8KA 1JZ5A 1DZQA 1ODMA 4FP3A 3GGLA 2BTVC 3POYA 4GQ7A 4QM8A 5E1RA 2VMGA 5FUPA 1LODA 4RD7A 1Q8OA 3SISA 4E2GA 3RZJA 1G6NA 1KEXA 5JR2A 1J3PA 4L0PA 5FZOB 3ZXFA 4HOOA 1UQXA 1W99A 1DIWA 3WHUA 4BOWA 2XUMA 4YW5A 1ASJ1 4YW7A 4J1XA 2DWRA 4ITCA 5FZAA 3SCGA 1YNAA 2A3WA 2GN3A 4PIYA 5GLTA 2Z79A 3WOGA 4JTOA 4KH9A 3OYWA 4ZU7A 3H7YA 5CZKA 1R1A1 3CMGA 1LHUA 2HKXA 2QKDA 4GA9A 1I6XA 4LNVA 4KBBA 5LRRA 3MIGA 4CDXC 3BB6A 4Q0SA 1F4AA 2IVIB 1WW7A 1XU1A 2JENA 2YC2A 3LAGA 1MEC1 3MI8A 4LQRA 4BQWA 5FPLA 3MIFA 1AR61 3LWCA 5L73A 3ZN4A 4U2AA 1VAVA 2DTWA 1ZBA1 2C5DA 5EYXA 5GLUA 3WNKA 4AQ6A 1B09A 3G6JB 2BV4A 3HQUA 4S2HA 5FZ8A 1BJQA 1Q5OA 1UU4A 5A6XA 1SG3A 4Y24A 2GC1A 3S57A 1QJY3 2P37A 3M70A 5A6QA 1ZA7A 1EV12 1Q8QA 4W65A 2XHKA 4OHWA 1JHJA 1V9U3 4MGYE 5H9SA 5CU1A 2DU0A 1ZRIA 3VBSB 3D0JA 3LKJA 4N43B 4UXAA 1JZ7A 4D6QA 4L99A 3APBA 1Z78A 2GSYA 1APNA 2HWC1 1DYKA 2RDRA 4FOWA 3WXPA 3ZIWA 4G9SB 5KC5A 4N7UA 3KCXA 2PQSA 2AGSA 3HD8B 4FSJA 2W1QA 1COV3 3CIHA 1DGWX 3N9PA 2D40A 1A6CA 3TN91 1AL0G 3HAGA 3T2QA 1POQA 4QT6A 1U12A 5JMCA 3LPGA 1ZM1A 2V09A 3QBQA 3IKWA 4W6XA 1SLTA 1W9SA 2VQUA 4OI2A 1S0FA 2Q0AA 2DCYA 3B5LB 1W8UA 1W28A 3O1MA 3VLBB 1R081 1JBCA 5AC92 1H4HA 4A41A 3RVHA 3ZSJA 1XPWA 2VUJA 5EXOA 5FMCA 2WS93 2ZACA 3NKGA 4FTSA 4IEPA 3H3LA 3V56A 5DUWA 2K46A 2GMEA 2ORXA 4WM8A 3WNXA 3JQXA 1WWYA 4QDRA 2YU1A 4QPWA 4RR3C 2R063 2VNGA 1W6PB 4N90A 1J3QA 3I54A 5A3PA 1AJKA 4KBZA 3RMYA 4Q2FA 4GXLA 2PA7A 5K4LA 3S5QA 5JI9A 1WW6A 1ZRFA 4CDWB 3OEBA 5K7PA 2RM21 1LKNA 3AXDA 1DZTA 1ENRA 3KT4A 4EJRA 2ZPXA 1YFUA 4QQLA 4YZ2A 2MPFA 2VGDA 3ZSKA 3MFCA 3PIGA 4FT8A 3T30A 1S0DA 3RPQA 1CAVA 2MEV2 2WIIB 3ON7A 4FPEA 2XJQA 4K8RB 1F8VA 4Q4V2 1W0PA 2L9LA 4ZPIA 4DXZA 1GLHA 4GB33 3UGFA 1LAJA 4XJWA 2V4AA 2BWAA 5GZCA 2WWSA 4IV1A 4UW3A 3OSDA 2AZ5A 3POWA 1HB3A 1IOAA 1AYM3 2ARAA 4PDWC 3S6PA 4CU8A 3CJXA 3H8XA 1V9U1 4P9WA 1AL22 5DAXA 1ND3C 3QH7A 4LJHA 1AUYA 4CEYC 4FFHA 2NMOA 3NJZA 1X36A 3DXTA 3T1LA 3UGGA 1AR93 3DYPA 1LOGA 2GN7A 1MS3A 4O61A 3B01A 1U5IA 3VHNA 3WDWA 1COV1 4PF5A 2YU2A 4HMZA 2VG9A 1UKGA 1ZZBA 4H3WA 4Q4W2 3W20A 3OUJA 1UKRA 3URFA 3T2TA 3CNAA 1RMU2 2UURA 4B7EA 3MLKA 1HKDA 3LA2A 3OB8A 2CY6A 2CWSA 1OUXA 3SXWA 1UZ0A 4LIVA 1OXCA 4XE9A 1NT0A 1RC6A 4IGPA 5C9AC 1YUDA 3O14A 3WNLA 4RA0A 4QGMA 3ACIA 3GCXA 2XMLA 5EPAA 4IV3C 4QKNA 1HXS3 4MXVA 1SLCA 4N53A 1MQTB 2HLEA 2RR12 2R061 1FAYA 1AX0A 3NAPC 3K75B 3ABZA 1JZ2A 4LKSA 4BQ5A 4KGGA 1HQLA 2EIGA 4TSVA 1E5HA 4XC9A 3LZZA 3H3UA 2C9KA 3P3NA 3WT3A 1RITA 4XOGA 1C1FA 5LK7B 1N3QA 4QAWA 4UYBA 1ZREA 4AK3A 2QVSB 5FYVA 2VXRA 2BBAA 2J22A 1HB2A 2ZS6B 3HPNA 5HCFA 4AFCA 4YZ1A 4B4QA 2WLQA 3AZZA 4XQWA 4XAEA 1VBA2 2JE7A 2K2SA 4JTNA 4ZHNA 1BVP1 2DTYA 2DFBA 3BODA 4GKXA 2HWE3 1DQ0A 1AHSA 3MZHA 5AFEA 2WZR2 2R1BA 1RUJ2 2ZEXA 2KD7A 1PX4A 1TZOA 4CDXA 3ZIXA 5BNNB 5EQUA 5CA6A 5HPOA 3ZMOA 4AI2A 4DO0A 3M3EA 1W0NA 1W8NA 2O1QA 4EZHA 4Z2WA 3PVOA 3O7OA 2IXJA 2Q1FA 5JSPA 4I0WB 1U5ZA 2PXJA 3B3QE 4AI0A 3M3QA 1CD3G 4ZKTB 3BKZA 4BQ2A 4D7YA 1GKBA 3OGJA 3IWZA 4F7ZA 2PHLA 1QOOA 1OQDA 4ZZ5A 4Z82A 3CDZB 4Y3OA 3IPVB 5FP4A 1I9RA 5F3GA 2RS13 2D5HA 3OOXA 4JKKA 2UY8A 1NX9A 2OUJA 1EV11 1QOTA 2ZAAA 4QX2A 4K6BA 4E9KA 3T0AA 2XBO2 2VBPA 3PIJA 4FBFA 5CG8A 5FK8A 1CJPA 3LDRA 3R4SA 2UY9A 2LALA 2RS33 4J1WA 3I59B 4NUBA 1ONAA 1X50A 4R4XA 2ENRA 1L7RA 3JZVA 4QXCA 2FDIA 3FLRA 2WNVA 1M4WA 3MW3A 3KQ4B 1RJ7A 4FPGA 4QX3A 5GZGA 2VTXA 1EUTA 1TNRA 1VPHA 3AKRA 5FP7A 3JBG3 5FUNA 2RDQA 1UW8A 4WM7B 2WQ4A 3VBUB 1OA4A 5FXWA 2DCTA 3ZDVA 2AACA 3RZGA 3KF5A 2V5DA 5DMYA 1C1LA 1WBFA 3BN6A 1Q8SA 3GDBA 2HWB3 3ZYBA 4QD2A 4HT1T 1HX6A 3KZ4C 1RMU3 1N1VA 1T2XA 3ILFA 4JQTA 2B7YA 2XJRA 2QTWB 4P02B 4DUVA 5FYBA 4XBNA 2E7TA 4XFBA 5AC91 4LPLA 3W5NA 4OHVA 1W0OA 1R092 5FZMA 2EXJA 1I5ZA 3WINE 1V0AA 4XMIA 3NJVA 4MYEA 5G05L 2VULA 5FP8A 4YSFA 1Z7S3 4FQZA 4N9HA 5FY7A 1W8TA 4RR3A 4N7IA 3BU7A 5C70A 2GNTA 2RR13 2ZGLA 1QMJA 1MZEA 1DLLA 1W3XA 5LASA 4AEJA 5IHRA 5KHGA 5DQ0A 5F39A 1H30A 3NV4A 5GM0A 4UFLA 1W06A 3UYJA 2ZHNA 4INDA 4NWVA 4CCOA 4LBQA 3DUIA 3T4HB 1Y4WA 5FPBA 2Y33A 4HANA 2GDFA 2RS53 2VJXA 4Q0UA 4AVBA 4CCJA 3THCA 5DZEA 3V0BA 2PAEA 4LA2A 2J1VA 2MEV1 5FZ7A 1DYOA 2OUHA 1QHDA 2DBIA 4FFFA 1VBA3 3CZUA 4Q4V1 4RS5B 1G9CA 3T1MA 2WQ8A 2D3PA 3VBFC 4AVTA 4N43C 2BBVA 2HJIA 4FPHA 2PFWA 2Z2SB 3I3BA 3PVEA 4NRMA 5LEKA 2WZR3 5DG1A 4M00A 1JODA 4TTGA 4A6SA 4CEWB 3KVBA 1ND3A 1H8VA 1AL21 3I2HA 4CEYA 1HN1A 3O5SA 1UYXA 5A7SA 2Y60A 2PAMA 5A32A 2YV8A 1D2SA 3GBWA 4AEMA 5C7GA 3THPA 4E2SA 4BDVB 5HCAA 2Q1MA 4QMAA 5HV4A 5KBFA 3RJ2X 4A6OA 3GBGA 4QWNA 2WSUA 1ZZCA 1S2BA 2VMEA 3FLTA 3D82A 1H2MA 4PIZA 4TLGA 4AFMA 3WF2A 4E4HA 5C3SA 4XDOA 4PLOA 1ZX5A 5FZ0A 5A3WA 2D6MA 1HB4A 2CYFA 4COZA 4NJ4A 2X8KA 4KWUA 2WWJA 4Q4W1 2GH2A 1SDDB 1RMU1 3SNMA 2XBO3 4C1XA 1H9WA 2ZKNA 3MBWA 3U78A 5HBAA 3C2UA 3N7MA 4XJ9A 4ET7A 2F6BA 2R073 4EWDA 5C9AA 3GF6A 4OMDA 2BJSA 1AVBA 4V2WA 4IV3A 4CDWC 5A3TA 1XNKA 1XE7A 2BGCA 4RGGA 4X6QB 4CYDA 4ASLA 2A75A 2VW1A 4M0HA 5F2WA 3BI3A 2JDMA 1ENQA 1NQDA 2LW8A 3H7JA 3NAPA 1OLQA 1XOYA 2RR11 1QU0A 4O9GA 1W2AX 1XBFA 3FHIB 4AVCA 2RVAA 1YXWA 4M4RA 3DCQA 4Y1VA 2YB7A 2JDAA 4QGLA 1F9KA 3VBOC 2YROA 5I8YA 4CCMA 1YWKA 4UF0A 4XXPA 4IEZA 1LU2A 2IXHA 5B4NA 2X10A 1MPXA 4AI3A 4XCBA 1QOSA 4QX0A 5FYHA 1VBA1 5CBLA 3VKMA 3ST7A 2CU5A 2QNKA 3RYKA 3CLPA 3HJRA 4AEDB 3RZLA 1XXNA 4OMCA 3LGRA 1S0EA 2B42B 1GOFA 2VAUA 3LDKA 2ETEA 2WZR1 2YG0A 1OF4A 1URXA 1VBD2 1BEV2 3CU7A 1DG6A 2ZGRA 1TVGA 3RDIA 2BFUS 3MUY1 2VECA 4DUXA 2WRAA 3VD9A 1TNFA 3C7EA 4ZXKA 4BQ1A 2IFRA 3A4UA 4O7XA 4P00B 1NOVA 5D8AB 4FFGA 2UU8A 5J98B 2QQVA 1RUI2 5IK5A 3EB7A 3BVCA 1IPSA 4N9IA 4FOQA 3W21A 4K1YA 4ES8A 1VIWB 4COUA 5KR7A 3KM5A 2ZGOA 5CEHA 4KG0A 3DECA 3KT1A 1NZIA 4IXLA 1D4M3 4PJYA 1G9FA 3G7DA 4YVSB 2Z42A 3MUZ1 1MQTC 2XBO1 4RGAA 4HETA 3MLLA 1ZZ7A 2JDYA 1NXMA 2DVAA 5LA1A 1DHKB 5A7PA 2W47A 2JE8A 3VZOA 2W9XA 2VMIA 4YLZA 4OI0A 4DS0A 4B4RA 5FZOA 4V2VA 3O12A 2J1RA 4HONA 3ZXAC 3CKHA 3AMQA 5J96B 2W1SA 2BP6A 1HJGA 3WDVA 1IZ3A 4BE3A 4MV2A 2BOJA 4LKFA 3NQHA 5FPVA 3K3OA 2GMPA 4BQXA 2ZGPA 3MV11 1OSGA 4MVTA 4NPLA 1KQRA 5JXIA 4KNCA 4QPIC 3H42B 4CPBA 4IE6A 3KB5A 3GHMA 4GKYA 1SLAA 4YFZA 1VBE2 4ISRA 1R091 2FZ1A 5BNNC 1OLME 2QDRA 3C7GA 4FTEA 1BQPA 1A8DA 1XQNA 2ET7A 3HEIA 4PI2A 4WZFA 4Q0PA 1KDMA 1D4VB 4NRPA 2ATFA 1E5SA 2XVKA 2Q5TA 2XWJB 1CIWA 4JQRA 1E57A 4I09A 1CX1A 1O59A 1SQ4A 1GP4A 2F17A 3BCWA 4QU2A 2HWF3 2HYKA 2V73A 3DF0A 5DDJ2 1J83A 1UMZA 3BTXA 2XVLA 4H7MA 3UK9A 4LA3A 4MOAA 3I2GA 1YQCA 3RWKX 5FPZA 2GU9A 5C4WC 2I74A 4FQ4A 1GU3A 1PO22 3PUAA 2LTNA 4DINB 5HXMA 2PHXA 3ZXEA 3H1WA 5FRAA 5LA0A 4QB1A 3OUIA 4KWJA 3AYCA 4BM8A 1YIPA 3VBFA 1V6MA 2P34A 3KVAA 2QUOA 4N43A 3KV5A 3VKNA 4YW3A 4M3CA 3USUB 1GBGA 1RUE2 3P1IA 4LORA 4MZUA 4HVOA 2H6BA 3FMGA 2BWCA 1WD4A 2FDJA 5FXVA 2P17A 2WZPP 3SEEA 3AM2A 3VUOA 5I0RA 1BEV3 4H2AA 1FMD3 3VV1A 1BCXA 1CAXB 5A33A 1GYKA 1LECA 1CN1A 2CNAA 2VMHA 4HVRA 5FZ4A 4XJZA 3ZM8A 5DAWA 1UPSA 4LO4B 3WDTA 2E26A 3MIBA 2JJ6A 2OS2A 2EA7A 4GWMA 4R9BA 4UFKA 3T2OA 4CXXA 3ZOIA 3N9QA 5I8TA 2HEYF 3WZ1A 1YRZA 1RUC2 3N7LA 3POGA 4Y1XA 3DV8A 4YARA 4ZS2A 3MW4A 1U0AA 2CL2A 2QQUA 2ILMA 2FMDA 4QQPA 5FPAA 4XF1A 2ARXA 4YFWA 3TEXA 3R4UA 3VD7A 1GV9A 1W6PA 1QDOA 3FHAA 3KQRA 2C24A 2VQAA 4ASKA 2VMFA 3U75A 3IZOA 3J7MA 3D4KA 1J58A 3HNBM 4YGCA 4NIIA 4MGKE 3WUCA 1H2LA 1PIV3 4XURA 2ZGKA 4CDWA 1OF3A 3OY8B 1RVF2 3ECQA 2WYFA 3PTRB 1UYYA 2ZXQA 3J9SA 4XCAA 3ZYPA 2KM2A 1CAWB 3LOBA 1GZWB 1NLRA 2PLV3 3MIEA 4XZPA 1DGRA 1UXXX 2AH2A 3Q8EA 3AP9A 4P5HA 5CADA 3WW1A 1N1YA 5FZEA 3ROUA 4BH9A 4W6YA 4V1PA 3V64A 2EAAA 3VBOA 1C8NA 4RS5C 3N36A 4RQPB 5C3QA 5F3CA 3EJKA 4IL7A 4BIOA 3C7HA 5JSRA 1U5XA 2Y64A 3IDEA 3AC0A 3L9JT 1VBE3 3BUCA 3AFGA 4QPGB 2OPKA 2XXZA 2B4KA 3OBRA 3QH6A 1IQDC 2FCTA 1PVC2 4TN7A 1O6UA 1EPWA 4Y20B 4YZ4A 3ACFA 2ADDA 4COWA 1QJU2 3FWEA 4H55A 5K8SA 2CDOA 2ZKLA 3ATGA 2CAVA 1OA2A 1LENA 1VBB2 4PCRA 4JDNA 3RZKA 4Y1YA 1RHI2 1VBD1 3H1MA 2A3XA 4BHPA 2GMMA 1BEV1 2XGXA 4Y33A 4YYOA 3MDPA 5E16A 5F6LB 3OBZA 3GNEA 5T3NA 3IT8A 4P08A 3K4DA 1O3SA 2ZCWA 1LJ7A 3H9AA 2XKOA 3IAPA 3NMBA 4H14A 3GM8A 2W46A 4FCAA 1PO23 2W5FA 3SH4A 3WG4A 3VZKA 3ZO0B 1LCLA 2V72A 2VZOA 3ILNA 1RUI1 4PQ9A 5J48A 3A0KA 1CGPA 1ZRCA 1MEC3 2OXBA 2VOXA 2VCBA 3HVDA 1XNDA 1AZDA 1AR63 1LU1A 2ZAHA 4BQ4A 4IE5A 3OG2A 4AXOA 1MS5A 4RHV2 4DFSA 4Q1RA 3WP4A 5FYYA 2TUNA 2EVXA 2YPDA 1ZBA3 4UT5A 1GFF2 2FDGA 2EXIA 3H3ZA 3K51A 3WF0A 3ZX7A 4B4PA 1MQTA 2VC9A 2JDNA 4R4ZA 4YZ5A 2QQWA 2EIEA 1CZTA 2F4PA 3D3AA 2C0ZA 2ZGSA 4JDMA 4PBPA 1UPIA 4YWAA 3E6CC 1BMV2 3NW4A 3SCHA 3M2MA 1TMF2 2IXCA 5CIRA 3ZXGA 1O3TA 2A6VA 3AP7A 1F15A 2DFCA 1KJRA 1W2NA 3BALA 4ZS3A 4OVEA 3IDBB 4UAPA 5I0SA 3VBHB 2WO1A 1RUC3 1DQ1A 1KXGA 1WGPA 3BOPA 4HSJA 2TBVA 3ES4A 3U37A 4RL7A 5IW0A 5F9TA 1PGW2 2ZMKA 4XF9A 2EXHA 4JRLA 4A7YA 3O1UA 1ULFA 4QPIA 4DXTA 1PM7A 3J7NA 4AEDC 2AC1A 2Y34A 3S7EA 3A23A 1O5LA 2BVVA 2RDSA 4AQ2A 3RZZA 3RFRA 2ES3A 1VBE1 3LA7A 3M8LA 5BNNA 3AYDA 2PHUA 3HN1A 5JOZA 3ZFGB 2K9ZA 4JDOA 1R083 3HBKA 3CJIB 5A6YA 1SBFA 1X7NA 4DZGA 2VUDA 4YM3A 4YW2A 3FUQA 4LULA 3BTYA 4XHBA 1KDKA 2WJSA 2BPA2 2FDHA 5L7OC 1UOFA 5J36A 4NRQA 5JOXA 3LEIA 4YVWB 1X9TA 4JGZB 4OI1A 3GBFA 5FZKA 5C4WA 1JW6A 1NA1B 3IPVA 3I2FA 2VUCA 4HFSA 3T4VA 4DXSA 2QDNA 4LUMA 1O4TA 1OPMA 5FZ6A 3PUHA 3PURA 1PO21 2RM23 3EXUA 4YVSC 5EFUA 5FWEA 2ZX3A 1XNCA 1POV3 3ZYHA 2JG9B 3JXSA 1G86A 2WT1A 2PHWA 4WVMA 1RXFA 1Q56A 3VKOA 4F3JA 4OLLA 2ZOEB 1UU6A 3D8CA 1W2OA 3RGBA 1QJU3 4AE2A 4OFGA 5FXZA 4L11A 4MGQA 1X8EA 3H8UA 4AL9A 1RUE1 2WNEA 2J1AA 1W6OB 2W95A 4IEWA 3RJRA 1UY3A 4FFIA 3B7MA 5K0UC 4LBLA 4WM7A 4AI8A 2Y6FA 3QLQA 4C1WA 3ME2A 1AR72 4LITA 2JE9A 1XYNA 5DUVA 2QJVA 1H9PA 2VBBA 5FPXA 1SHWB 3WEZA 1REEA 1MS1A 4YW4A 4CDUB 1RUC1 2WNVC 5C3OA 2Q8CA 1NZCA 1ZRDA 4A7ZA 3KSCA 1QDCA 1VE0A 3LE0A 2YFUA 1RJ8A 1TME2 1VRH2 1EUUA 1TG7A 1ACCA 5D21A 1VAKA 4D8MA 1NCRB 1MZ6A 4CCKA 1E5RA 1RUF2 4K3UA 5BV6A 3FUOA 4RN5A 2JKXA 2JDKA 2VZPA 5FYIA 5L36A 3IB3A 1TMF3 5BNPB 5B4XA 3ZFFB 2BUKA 4YGBA 1RVF1 4KU7A 5J7MA 2DUPA 3WF3A 5KC6A 4R9AA 2VNVA 4FVVA 2E33A 4E8CA 3NNFA 2Y8KA 4QKDA 3MF9A 2PTMA 1OQEA 5APAA 2VM9A 2W39A 2R6QA 2ZGTA 4FPOB 4EN6B 3T08A 4RS5A 5A3LA 3NWKA 3HQRA 1Y9MA 5FAXA 4K40A 5EWSA 3GYDA 4ONUA 2O8QA 4MGTA 3E5QA 4BXSV 2KXLA 3VBRC 2FZ2A 2VL4A 4Y5Z0 3W59A 4MXWA 1CX4A 1IKPA 4E4SA 2BFUL 1WMFA 1POV1 3NO8A 1OMIA 4QQ2A 1PVC1 2MHFA 5A3OA 3E1F1 3UKTA 1QJU1 3U1XA 5GLWA 1B35C 5CFCC 1J1TA 2E32A 5LCWL 1HIXA 1DGWA 1NLSA 3SKVA 3J26N 1PK6B 5DZFA 3RI8A 4COVA 4JC1A 1SFPA 1VBB1 3WSOA 4GH4B 3RZMA 2CSGA 1RHI1 4L9BA 1R1ZA 4XTMA 2KR2A 1RTVA 3VKLA 3WY6A 5LBCA 2OZ6A 1NKGA 2O14A 3WW2A 4B3NA 2C6SA 1WBLA 1FNZA 4B1MA 2YBKA 1A3KA 4FAGA 2X53S 3LPFA 3TEWA 1JOPA 4OQ9A 1OA3A 1MVEA 4BCUA 2WZ8A 1RUH2 4RHV1 4YW6A 2XB6C 2GAUA 3OD4A 1H2KA 2PYTA 5I91A 2A71A 2ZGQA 2YGLA 2P1BA 4FPFA 3KHBA 1C5HA 5I0UA 2WDBA 4MO3M 2MNGA 5C8CB 3I49A 2RDNA 5FJHA 5FCCA 3T2PA 3J4UH 4K20A 2DCJA 4NHYA 1PZ9A 1AR73 1EV13 1BMV1 1L7LA 1PNFA 1TMF1 2N7GA 1UNBA 4XIKA 4MX3A 1DU3D 4NHXA 3LSEA 1O8SA 1NCQB 3ELNA 4FPKA 4Q0QA 4XEZA 5KHJA 3ZR5A 1BBT2 1Q8PA 5JPMB 4XW3A 2D3SA 1YHFA 4XUQA 3H0OA 4LO6B 4COYA 1DGLA 3WR0A 1J3RA 2WUHA 4LMFA 4QPGC 4XUTA 2GNBA 2J1EA 3WG2A 3OD0A 5AFBA 5LEJA 2WO3A 2WC2A 5IATA 1DYPA 1TME3 1DP0A 1VRH3 2ZTNA 1PGW1 3LA3A 3VDAA 1Y7BA 3GZUC 5F5IA 4AEDA 5EP9A 1HRV2 5F5CA 1RUF3 1H1IA 2Q4SA 5H9QA 1IPKA 4EN9B 5KHIA 5CVRA 4CCDA 3F2ZA 1PZ8A 1KD7A 4UW4A 4EV0A 1VRBA 3ACLA 3ZPOA
chains in the Genus database with same CATH topology
5AC93 2DVGA 2QZ2A 5JVVA 4I01A 4LBNA 3WW4A 3PLQA 1WCSA 3E97A 3ZFEC 2YC0A 4DB5A 5JOWA 2QE3A 2ZABA 1VR3A 3M1HA 5KHHA 3MPBA 3SHRA 5FO9B 2NQYA 4NWWA 1AX1A 1GZ9A 3R05A 4JGYB 4YVSA 3B69A 3VZLA 2WFF2 2X5IC 1RIRA 2ET1A 3PVNA 5L7OA 1AXYA 4WV8A 1YFWA 1W6MB 4ZU5A 2BVBA 2JG8B 2MEV3 5BNQA 5K0UA 4Q4V3 4ATEA 3FX3A 2XL9A 3VBHC 3ZN6B 1LOAA 1VALA 4DRRA 2RJKA 1AR71 1LHOA 4HK8A 1H2NA 5JIAA 1AL23 3USSA 3P3PA 4AWDA 2R042 2ZZJA 4CP1A 4Q0VA 3HBZA 2AUYA 4YM0A 3N35A 1CAUA 1ZZ6A 1QXJA 1QQP2 4Q4X2 3ZXJA 3L2HA 4HKOA 1ZYBA 1TME1 3CJIC 1VRH1 4LBQD 4TWTA 3OYWB 1ZBE2 2BEOA 3AZWA 3JUUA 3RG0A 5JLVA 3WUDA 1RUF1 3AP5A 1FNYA 4Q4W3 1DQ2A 1X8MA 3CL1A 2VY0A 4YVWC 3ZSLA 2ZZQA 1NYWA 4GWNA 3RRDA 4NHMA 4WVWA 1BBT3 1WLTA 1H4GA 4WVVA 3ZSEA 3GZTB 5DG2A 3MYXA 3AMPA 4AVAA 2NPIA 3MIHA 2R16A 5K9YA 5SV5A 2JG9C 3UJQA 1S0GA 2VPVA 4URTA 1Y43B 3IIAA 3USUA 3VBRA 1YLLA 2TNFA 3B9IA 4B29A 3THTA 1OLRA 1X33A 2DVFA 4RFT0 2QQPA 1S0CA 1WUVA 1Y9QA 3AZVA 1DQ5A 4IQPA 4L2NA 4ASMB 1VBC2 5E8AA 3MLJA 1B35A 5J37A 5CFCA 2XLAA 2WFPA 1WCDJ 3CEWA 3HQXA 3E5UA 4IEQA 3ZMNA 1NXD1 3VBSC 2EF6A 1GZCA 4IERA 5H9RA 4LHLA 1RUJ3 2RMU2 3HIFA 2NN8A 2P3KA 3SITA 1ND2B 4GIQA 3OF1A 4C0BA 3OY8A 4FAHA 1RUH1 5ACA2 5A3MA 4A7KA 5JWPA 3KT7A 1CAWA 4FPCA 3TRSB 2WT0A 3OJBA 3RS6A 1C4RA 3TBDA 2WA3A 1I1EA 2DVBA 4YGEA 5FFOC 1WLWA 3PTYA 4PBOA 3DL3A 4KGQA 3EHKA 5JAXA 2A70A 1J59A 2A7AA 1BBT1 5KXBA 4NN0A 4MGZE 4QPGA 1CAVB 2E51A 4R4XA 5JI7A 4QGNA 2FBEA 1V6KA 4P9JA 4FSJA 5J09A 4F83A 4Y20A 3AKQA 4XQ4A 1BKZA 4IV1B 1ZBE3 1HQWA 4CRQA 1HRV1 3BPZA 2YPJA 3WCRA 5BUVA 4JRAA 1PK6C 4OZXA 1F2NA 2B45X 2E53A 3RSJA 4GH4C 1F5JA 3B02A 2Y0IA 4GULA 1DQ6A 2CTVA 4AHZA 5BY5A 5AVAA 1F5FA 2D6OX 2ERFA 1V6IA 1R093 2D43A 4XMAA 5GJ6A 3ZFEA 2HWD2 4XF3A 3KD4A 3WD5A 2D93A 1FT9A 2JX9A 4S2GA 3K48A 2C9AA 3VN4A 1N1TA 1G7YA 2WINB 2WNUB 3VZJA 1OOPB 4R8HA 3W58A 5FOJB 1RUJ1 2VNRA 2X5IA 3U10A 3VZNA 2WFF1 4AHXA 4GALA 4HLTA 1ZRRA 1VBC3 4ORFA 5SV8A 4O9EA 4YG3A 1EPZA 1IS4A 3ES1A 2OYZA 1XU2A 2E7QA 4HN1A 1HLCA 1NCQC 2XKPA 3BOWA 2Y38A 1MS0A 1UF2C 4QQOA 3ZXDA 4AI1A 4FTBA 3VBHA 3WLUA 3FBYA 3NSTA 1PO12 1IS3A 4TLFA 2YZ4A 4AF9A 3MW2A 1HRI2 5I0TA 2SLIA 1SLBA 2R041 1KFUL 4LE3A 4P9GA 2XLGA 3ZFGA 1YO8A 3ZXLA 4CP2A 3CJIA 1QQP1 2PHFA 3M3CA 4Q4X1 1NY72 1U5YA 1REFA 3AMMA 2W68A 3WHTA 5JOYA 1CJDA 1I3HA 1KS4A 3AZYA 1ZBE1 3W9AA 2B39A 2H0BA 5FLJA 1H8TB 4AHYA 5T5JA 4I0AA 4YVWA 2WKKA 3UKNA 2DYCA 2GH8A 1FI2A 1QJX2 3AZXA 3MPPG 4DMIA 1WMEA 3TYJA 5CNAA 2UYBA 1AJOA 1O91A 1WLCA 2JG9A 4AVSA 3U0ZA 4KWLA 2ZMNA 3A0NA 1ULCA 3ENRA 1BK1A 4IEVA 1TEIA 2R0FA 4LO5B 1OFSA 4FOVA 2JG8C 4Q26A 1W6OA 1VB2A 2E63A 5AVPA 2B9UA 5E89A 3V0AB 1IPJA 1TE1B 2UWBA 1OD5A 1GICA 1MS8A 4I02A 4LHNA 2D6LX 1HV0A 1JUIA 1RUD2 3WG1A 1VLNA 1VBC1 1RUG2 3BTAA 1ENSA 3ZVXA 1QF3A 4XBQA 3O0XA 5GALA 3VBSA 1O7FA 3I7DA 4LBMA 1WW5A 4P9IA 3AMNA 5FOBB 1JXNA 4FPJA 3WDUA 4FOYA 1VBD3 1PMIA 3PJQA 4XETA 2RMU1 2VVFA 4HVQA 3IMNA 1MZFA 3B93A 5KHKA 1NCRA 4WM7C 2ZHKA 1SFYA 3VBUC 2WQZC 1IS5A 1EP0A 2YMZA 2D97A 3ZFFA 1W6NB 5ACA1 4C91A 1FPN2 1RUI3 3FZ3A 1MS9A 1VP6A 4FPYA 5JSOA 2JICA 3D0SA 4UW6A 3OPZA 2WA4A 2W08A 1GQHA 3AMHA 4Q1PA 5JZGB 4XDQA 3N4MA 3ETQA 1XYPA 5FMOL 1FXZA 3AX4A 3E5XA 5HXVA 2GC3A 2PHRA 3M3OA 4LE4A 1LULA 1CR7A 3LB9A 4X8NA 5T50A 3BIWE 2OW4A 1O3RA 3VDDB 4F8AA 4ES9A 5JIUA 1W6QB 4PDWB 3VHOA 1DF0A 4LO7A 1O5UA 1K5MB 1PK6A 3JCIA 3WVJA 4UBGA 1FV3A 5KXCA 4GH4A 4C90A 1ND3B 5J3UA 4XHXA 5BYNA 1W2UA 4NO4A 1QJX3 3MF6A 5FQ0B 3B94A 1UU5A 3WP6A 4LLFA 3HT2A 3IM0A 4HKWA 4FXGB 4RSUA 4CEWC 1WA4A 2HWD1 1KS5A 4Y4YA 3WDYA 2FQPA 2LUWA 1Z0HA 1RINA 4E4ZA 2ZHLA 1ND2C 1JTZX 3PMEA 3TB0A 3FLPA 5DDJ3 4K9SA 4DNYA 2XLFA 3SH3A 2GC0A 3NKTA 1S0BA 3ASIA 3EO6A 3GZAA 3LOIA 1OI6A 1LESA 1LTEA 4IV3B 1RUG3 4BWOA 3LSDA 4YG6A 4EN8B 4DOUA 1NCQA 4BMEA 5BXXA 2PELA 1YJKA 2XJSA 4G3YC 3NAPB 2PHTA 4LUKA 4Z07A 1MACA 1O4YA 4BMBA 4GMP3 1V6LA 4Z8BA 1PO11 1RUE3 3ZDSA 1UIKA 2E6VA 2A6ZA 4HPKB 4DPNA 4Q29A 1KITA 1C57A 3V65A 1ENXA 1HRI1 1QJY2 1Q8VA 4AHWA 3TOJA 4QQHA 3E6BA 2P3JA 1EAH2 2EXKA 4Y22B 3KGLA 2ZGMA 1NY71 1SDWA 1ULEA 3DN7A 1LOEA 4AW7A 4FPLA 2IZWA 3KCYA 1COV2 3QACA 3IN9A 5IUQA 2VW0A 1UD1A 1QJX1 1ZVFA 4YG0A 1KRIA 2WNUC 4BLIA 3AKPA 4Y1ZA 2NMNA 3JB8A 5DXDA 1RVF3 1UL9A 3RWNA 4EN7B 4HZFA 4ISQA 4L8QA 5DUUA 2WS92 5C6CA 1W6MA 2DCKA 5T5LA 4LO8A 2JG8A 2NYYA 3HMYA 5D8AC 4MGIE 1QKQA 5DDJ1 1AR82 2GALA 3M3IA 4B7KA 2ZX1A 3RI9A 3C3VA 3PNAA 4AQTA 4WZCA 3UL2A 1GANA 5C33A 3S0MA 2ZGNA 1CONA 3ZPYA 1H1MA 1RUD1 5I93A 1RUG1 4AGGA 3NV3A 2WSVA 1YI9A 2V5YA 3I59A 1GNZA 4JV4A 4AYUA 2VNOA 1PVC3 4XILA 4XJ8A 3KGZA 1CQ9A 3HT1A 4HK9A 1W39A 1IS6A 4OUMA 4GMP1 3DKWA 4KQ7A 4GB32 3QD6A 1VBB3 1H1AA 2IXIA 1OHFA 1RHI3 2K0GA 2R49A 3VBUA 3MEPA 1AYM2 1YYNA 4HN0A 2OA2A 4AFBA 1H8TC 3J8F2 2EAKA 1RUNA 1H0BA 1FPN1 1AYN2 5EZWA 1SACA 5TSWA 1AR92 2A6XA 4RHV3 3RNSA 4K8FA 4JVAA 4CTEA 4P9XA 5KWRA 2XJUA 2A73B 4E27A 1Q43A 1GR3A 4BIFA 3DPRB 1VB4A 3MIDA 1YI7A 4KWKA 3NV1A 1EAH3 1VAMA 2JEMA 5CAZA 3OBTA 3VBFB 1HV1A 5T52A 2XH6A 2O0OA 2BYVE 4M3CB 1UZZA 1HXS2 3R6SA 1WLDA 1SCRA 5E88A 4LT5A 4LTAA 2CGOA 4XYXA 3VKFC 3MICA 3O0WA 1IHMA 1GNHA 1WD3A 5A33B 1LEDA 3N3HA 5T55A 4CEWA 4LR4A 4SBVA 2AYHA 1LOFC 4IEYA 1SFNA 1QJZA 2E7AA 1ND2A 2DURA 2VH9A 1UZYA 1QNWA 1NQJA 5GKAC 1M06G 2HWE2 4HL0A 1AR83 1V6OA 3ZYRA 1FX5A 5JPNB 1PGL2 4AVVA 2DVDA 2ZJCA 3E6DA 4YM2A 4OHXA 4NHLA 1QNYA 1UN1A 2HEVF 5JZGC 2DF7A 1LOBA 3OCPA 2UWCA 4I0BA 4LEJA 2O8OA 4XFIA 1Y3TA 1DZRA 2UYAA 1NG0A 5JDBA 4M0NA 1UX6A 4QPYA 3VBOB 2VU9A 4IETA 5F5QA 1N47A 3TNPB 2D98A 2YYOA 4YRDA 2RS12 5FDBA 1QJY1 3VDDC 4U36A 5FO7B 4XXAA 4UBHA 3I8TA 1K5MC 5KXEA 4XF4A 1QWRA 5JR7B 3J8F3 2RS32 1EAH1 3QCWA 1SLLA 4CDQB 4RQPC 4XJAA 5KXDA 1A78A 3N7JA 1LB2A 1AYN3 4R52A 4C0HA 2IC1A 1SCSA 5ABJB 1ULDA 2GNDA 1V00A 1MZ5A 3JBG2 4XTPA 4AG4A 3VL8A 1X82A 1D2QA 3JB4C 5FMOS 1AXZA 2BNMA 5B2GB 2WNUA 4NHKA 4XPVA 4UW5A 2HWB2 3MFAA 1OOPA 4IEXA 3FBMA 4OULA 2AREA 4Q4Y2 5CFDB 1BXHA 2PAKA 2DUQA 2H6CA 4Q8LA 1DGRN 4ZU4A 1BYHA 4PIXA 2B46X 2WS91 5D8AA 4OHZA 1J1LA 3WQ7A 1Z7S2 4XJUA 1ULGA 1FOD2 5T54A 1AR81 4DY3A 2XJTA 4E2QA 1LHNA 3HWJA 1SEFA 4XQDA 1YCIA 1JN2P 4FXKB 4K21A 2D3RA 2RS52 2XJVA 5BNOB 3RYRA 3JD72 3SMHA 3H1YA 1LGNA 1GQGA 3CO2A 1UCXA 1T6GC 2JECA 4XFCA 4GB31 4NR1A 5GLVA 1KFXL 3ILRA 4META 3SLIA 1RL3A 4QPIB 1HW5A 2JKBA 3WDXA 1MS4A 1UAIA 1O3QA 2BNOA 2ZX4A 1AYM1 1H8TA 4I2OA 2ZGUA 1EYBA 4HBNA 4MUVA 4P9YA 2ZX2A 3J8F1 4K1ZA 5IK8A 1AYN1 4D7SA 5IK4A 3OTFA 1RUH3 1AR91 3AJYA 3ZFGC 1FATA 1OKQA 5HCBA 2YY1A 3WW3A 3N7KA 4L92A 2FMYA 5C4WB 2NP0A 2ARBA 4BA6A 5FREA 4OUSA 5DZGA 4M3CE 2GZWA 1PZ7A 2E9QA 3V0AA 4JGZC 2XWBB 3LCPA 2R072 4Y26A 1IGOA 4WVMB 1NA1C 2A5ZA 2VVEA 5EV7A 3AK0A 1HXS1 3GHNA 1LR5A 2TEPA 1LGCA 2CV6A 1QH7A 2HEWF 3VGIA 4J6GA 2WLPA 4XIOA 1HRV3 4PLNA 4AGRA 5GLZA 1ZNPA 1LOFA 4Q4Y3 4I30A 2DV9A 2YHJA 4XFGA 2NM1A 1CAXA 4IEOA 1W6NA 2W52A 2FHRA 2JDZA 1XNBA 2RE9A 5FO8B 2HWE1 1HDKA 5T5PA 1FOD3 1OQ1A 5GZFA 3CF6E 4NOTA 3D6EA 3AP6A 3M4FA 4LBOA 1PGL1 3IBMA 2CWMA 4CDUC 2VUAA 5JZGA 1S55A 3R0RA 3AKSA 1EY2A 1AF9A 2WFF3 4E4DX 2CAUA 1NCRC 4PLMA 1XRUA 2YXSA 3DPRC 3JD73 4B8EA 2D5FA 1PHMA 2D44A 2NZ9A 5BNPC 4IESA 4OI4A 3TNQA 3ZFFC 4WM8B 4M01A 3AJZA 1GZWA 4KG8A 3JU9A 3VDDA 1JUHA 1W6QA 1NE4A 2RS11 1D4M2 2JXAA 4FP2A 4PDWA 1K5MA 1QGLA 4K7JA 3S7IA 3TWIA 4AGVA 4MXWB 4RQPA 1DBNA 2RS31 3KCCA 1JHNA 2JD4A 4KL1A 4XFAA 5FQ0A 2R043 1PNGA 2AENA 1YJLA 2DU1A 2I07B 3EBRA 4WBBA 3KMHA 3NL1A 3WG3A 3ZN5A 2KA3A 3VHRA 1QQP3 4Q4X3 4X8PA 4CP0A 2Y26A 1N1SA 2R30A 3JBG1 4AFAA 3AYAA 1O4ZA 1S0IA 1S1AA 5FTTC 2HWB1 1QXRA 4Z92B 2IWGB 4XF0A 4Q4Y1 4EWAA 1G9BA 1XYOA 3WQ1A 4BZ4A 4XFHA 2QZ3A 3VHPA 4DRVA 4GMP0 1G9DA 3WX5A 5EJ3A 1Z7S1 3PMSA 4YNIA 1BZWA 1FOD1 4P14A 3DGTA 2B5HA 1DQ4A 1FV2A 2HWF2 1CVNA 1VJ2A 3AXEA 4HPKA 4IEUA 3FFQA 5BPXA 1C8M2 2P2KA 1UIJA 4BLJA 5C8CC 2Q1ZB 2RS51 1ZZ9A 3KS7A<