5DUXA

Crystal structure of the human galectin-4 n-terminal carbohydrate recognition domain in complex with 2'-fucosyllactose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
138
Chain Sequence
PTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterisation of human galectin-4 N-terminal carbohydrate recognition domain in complex with glycerol, lactose, 3'-sulfo-lactose, and 2'-fucosyllactose.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-4
total genus 30
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5duxA00
3ILRA 5GLVA 1AVBA 1V6KA 3TB0A 1N1YA 2FHRA 1GICA 4ISRA 5L73A 3T1LA 1MS8A 1W6OA 2LTNA 2YY1A 1Q8VA 1C57A 1V6IA 1MS9A 2WQZC 3ILFA 1S0CA 2NMOA 2DU1A 2JECA 3AP4A 1BKZA 1SBFA 1WCSA 3IM0A 2D6PA 4FOQA 3ZXLA 3WDTA 1Q56A 1JYIA 1DQ5A 3L2YA 2G4IA 1W6PB 3MW2A 5IK4A 2WSVA 2A7AA 4GA9A 3TAYA 4YLZA 5H9PA 4P14A 4XBLA 4WVWA 1JN2P 2JDZA 3WCRA 4DRRA 1FV2A 2PHTA 1S1AA 1LOFA 2VH9A 4AGRA 4AWDA 1V6MA 5DUUA 3VKNA 3N3HA 2ZGRA 2GNMA 2Q5TA 3RSJA 3M1HA 3WDVA 2R16A 5T5JA 4XOGA 1YIFA 1MR5A 3V0BB 1WW5A 2A3YA 2I2SA 3IPVA 2WKKA 4F83A 2HYKA 3AXDA 4YG3A 1LHWA 3WG2A 3A0NA 2D6MA 4H55A 4LBQA 4YW1A 1KJRA 1V6OA 3AK0A 3KQRA 3O0VA 1IS4A 1NXD1 1QKQA 2ZBJA 5GLZA 1D0HA 1U0AA 1OFSA 1G9AA 1YRZA 4UW4A 5LK5A 4YW4A 4XMIA 5GLTA 4GWNA 4Y20A 2ZHMA 1H9WA 3SNMA 1CR7A 4JC1A 1LEMA 2NYYA 3BODA 4Y1YA 4BMEA 2D6KA 2DU0A 1D2SA 5CB7A 4FOVA 4C1XA 1KRIA 3PVOA 1NLSA 1WD3A 2AH2A 4YG6A 4AGGA 2WT0A 1WLDA 4YM1A 1DQ6A 1G86A 3IMNA 2CL2A 3VKOA 1BXHA 1CQ9A 3VKLA 4AGVA 1QNWA 1SBDA 1JYCA 4JCKA 4K1ZA 1MVEA 1SLCA 2WJSA 2YMZA 3PJQA 5BYNA 4FPGA 1CJPA 2YV8A 3D5OA 4OZXA 3FBYA 3FLPA 3LCPA 4LBNA 4P9XA 3N35A 2A6YA 4YZ4A 1DQ0A 1UX6A 2E51A 2ZGLA 4GXLA 2A70A 1URXA 3GALA 2KM2A 4Y22A 5E89A 2DVDA 2CY6A 4BOWA 1CPNA 3MW3A 4M00A 2ZHNA 3SLIA 4TZDA 4JRAA 1JW6A 3OYWB 3WG3A 4ISQA 4UW6A 1Y7BA 5JMCA 4YGBA 5FREA 5T55A 1LGNA 1LU1A 2P3KA 3AYCA 5F5QA 3NV1A 3VKMA 2UURA 4LBKA 1LGBA 4XXPA 4K20A 3R4UA 1SLLA 5T5OA 4YZ5A 3AP6A 5DG1A 3WDWA 3OBRA 3DUIA 1DBNA 4YG0A 2EXIA 5HCBA 2A75A 3AYDA 1GNZA 3R05A 1AJOA 1AZDA 4DRVA 1A3KA 2VW1A 1N3PA 1QMJA 2A3WA 1JOJA 2ZGTA 5JLVA 3M3OA 2DV9A 1VLNA 3APBA 2XG3A 1QNYA 3UK9A 4PF5A 3INAA 1MZ5A 2A5ZA 2NP0A 3N7JA 1AXYA 1AF9A 1W0PA 2NN8A 1AX2A 4ATFA 1OQ1A 3AP7A 4HANA 1F5FA 1KITA 4FPJA 1ULDA 2P3JA 1LHOA 3R4SA 2AREA 1RINA 4Q27A 1DGLA 2VXRA 3NV4A 2YXSA 4PBPA 5KXBA 3ATGA 1ENQA 5EYYA 3V0AB 1H9PA 5KXDA 1WD4A 1Q8QA 4ITCA 3ENRA 3LSEA 1AX0A 1CN1A 4Q1RA 1UMZA 1DYKA 2ZZJA 2A6VA 5T5PA 3M3QA 2R0FA 2ZAAA 2VW2A 5DG2A 5CNAA 1QDOA 3I8TA 4YW3A 3AP9A 4K21A 1N1TA 1PZ7A 1YYNA 3WUDA 1LULA 1LOAA 4GKYA 4YM2A 4XYXA 1W6MB 2H0BA 3PVEA 4Z8BA 1QOTA 1BZWA 2BQPA 1W6OB 3O0XA 1W0OA 4L8QA 1S0IA 1GKBA 4NO4A 3AZWA 5DZFA 2ZA9A 2OVUA 2C9AA 5DZEA 1CPMA 2AENA 4PQ9A 2GN7A 1YI7A 4K1YA 4YGCA 2AGSA 2OW4A 3KM5A 1C4RA 1LHVA 2E7QA 2E53A 4DQAA 4FPEA 4WV8A 2ZGKA 1H30A 2UWAA 4Q8LA 5IK7A 1B09A 3OPZA 4Y20B 3N36A 3POWA 3OY8A 1TEIA 3FLRA 2ZGSA 5GZCA 2ZKNA 2D43A 1SCRA 2DVAA 3Q9OA 1GZWA 1N3OA 4Y1VA 4BM8A 1Z78A 1WW6A 1SACA 1SBEA 1S0GA 1DQ2A 1JHNA 3DGTA 4UW5A 4LBMA 1EPWA 3W58A 5GZGA 2DYCA 4DPNA 3ZYRA 1G9FA 2WT1A 5IUQA 4XDQA 3AZZA 1ULGA 1AXZA 1DQ4A 2W68A 3GNEA 4M3CA 2TEPA 1AX1A 2ZMLA 1N3QA 3O5SA 5HCFA 1CONA 4GKXA 4XJ8A 1I3HA 2VY0A 2EAKA 4Y1XA 2YZ4A 3CNAA 1LECA 5GJ6A 3WCSA 3PMEA 4BMBA 3NWKA 1UZZA 1LOGA 2DTYA 1W6QB 1W6PA 4YM0A 2OUHA 2ZGMA 5E88A 1IOAA 4GWMA 1LESA 1WUVA 1ENSA 4Y24A 3AZVA 1GBGA 3AJZA 3SH5A 3PVNA 2PHXA 2DVBA 3AP5A 3HMYA 3ZSMA 2NZ9A 1LENA 3QLQA 1AJKA 2CWSA 4Q26A 1IS3A 4W65A 5EYXA 5DZGA 2WLQA 2DUPA 3WG1A 3U4XA 1SFYA 2B7YA 3FUOA 1A8DA 3QCWA 3ZYPA 1UKGA 4R9BA 2AUYA 2W08A 2EXKA 3UL2A 2JKBA 2D7FA 2GALA 1AXKA 1X50A 2ZMNA 3FFZA 4XJ9A 4FPYA 5JOWA 1QDCA 1WLCA 1FAYA 2GMMA 2ZHLA 3N7MA 4YGEA 3WZ1A 2R49A 2R0HA 3USUB 3AX4A 4C1WA 1KJLA 2UWCA 1J1TA 3WDYA 4UW3A 1I1EA 1UN1A 3D4KA 2SBAA 2DVGA 1Q8OA 3JUUA 4IQPA 4FPOB 4I30A 5CA6A 2ZGNA 3AJYA 4YZ2A 4CRQA 1GSLA 1CESA 1LTEA 2FMDA 4XBNA 2EIGA 3IKWA 1G9DA 4XE9A 3W59A 2JD4A 1W6NA 3POSA 1APNA 2D6OX 3V0AA 2GN3A 4R9DA 3BTAA 2GMPA 4LBQB 4PBOA 4RL7A 1Z0HA 1IS6A 1JXNA 1LHNA 2A6XA 1WBLA 2E7TA 2ZMKA 2DTWA 1FYUA 2A71A 1GZWB 2ENRA 2VW0A 5T54A 1MS3A 5DXDA 1VAVA 1V6LA 2VUAA 4WZFA 3D6EA 2PELA 1CVNA 2DVFA 5GLUA 4YZ1A 2EALA 4P9YA 1O4ZA 1G8WA 3RMXA 2CYFA 1ZA4A 3NV2A 1G9CA 3SH3A 5IK8A 2ARXA 1W6MA 1MACA 1MS4A 3WOGA 1BYHA 3OGGA 4M3CB 4AVTA 5EXOA 2D44A 3RQ0A 3I4IA 3C2UA 5SV8A 1LCLA 4TYSA 3MEPA 1S0EA 2A3XA 1C1LA 1PZ8A 2VU9A 1IKPA 3M2MA 1BQPA 3B3QE 2R1BA 1RITA 4LBOA 3SH4A 3WHUA 2CWMA 3RMYA 3N7LA 4FPLA 1G7YA 1GNHA 3V64A 2ZABA 3ZPYA 3HR9A 3O0WA 4XMAA 3M3EA 5GALA 3WG4A 5DUVA 2PHRA 1HLCA 3POYA 3ZXKA 4XHBA 3WDXA 2ZGUA 1UAIA 4KBBA 5GZDA 1N47A 1ULCA 1YXWA 3V65A 1MVQA 4M3CF 3MW4A 4YZ3A 2A6WA 3B69A 1PZ9A 2UU8A 4Y1UA 1HQWA 1MS0A 2ZACA 4ASMB 2NM1A 1V00A 4YW2A 4RA0A 5IT6A 1F31A 1OKQA 1XQNA 5JDBA 4R9CA 5JOXA 1ULEA 3H0OA 1LJ7A 1QOOA 3RG0A 5HCAA 2DURA 1KDMA 3T2TA 3IPVB 1FNYA 4LBJA 2EXJA 5KXEA 4BLJA 2GNBA 1LEDA 1W6QA 4BLIA 1DYPA 2D6LX 2ARBA 1ONAA 3OJBA 2ES3A 1LODA 1R1ZA 4Y22B 2GNTA 2E6VA 5E8AA 2D6NA 3ZXEA 4CZSA 1QOSA 1FNZA 4FP3A 2D3PA 3B9CA 5H9QA 1GANA 1Q8PA 5GZEA 4U36A 1V6NA 2DWRA 1DHKB 1VALA 3ILNA 4Y1ZA 3ZSLA 2Z42A 4D69A 4FVVA 5IK5A 1F9KA 5GLWA 1KQRA 2EF6A 4AYUA 4Q8KA 2LALA 1SLAA 2PHUA 1UL9A 2WSUA 4FOWA 4DS0A 1GZCA 3MPPG 4ATEA 3NV3A 1QF3A 1ULFA 5GZFA 1DZQA 5H9SA 3WHTA 2RHPA 1WLWA 2GMEA 1FX5A 1WW4A 2JE9A 5FRAA 2ZGQA 3ZVXA 1MS1A 1A78A 4FP2A 3LSDA 4XJAA 1HQLA 1VAMA 4YFZA 3BOPA 3AZYA 1LOBA 4XJZA 4AVSA 3B00A 4LBLA 4LBQD 2D3RA 1O4YA 2A6ZA 2ZGPA 4GALA 4XJUA 2ERFA 3VV1A 5CAZA 1S0FA 1GLHA 1V6JA 2ZHKA 1HDKA 3A0KA 2R1DA 3AYEA 3RS6A 3WVJA 2PHWA 3B01A 4XILA 4Q2FA 3OBTA 4XXAA 3WUCA 1SLTA 4YM3A 4FPCA 2CNAA 4R9AA 3RRDA 4PCRA 1DIWA 1ZM1A 2UWBA 4FQZA 2XB6C 1SLBA 4FPFA 3WDUA 1VIWB 1N1VA 3OYWA 4YFWA 5DUXA 5T5LA 1DFQA 2W52A 1KDKA 2GNDA 3N7KA 2YROA 1S0DA 3AFKA 5JOZA 2V73A 3JU9A 1UPSA 1GYKA 3ZSKA 1S0JA 3ZSJA 5AVAA 1HKDA 4FOYA 1IKQA 4YGDA 1MZ6A 2EXHA 5T52A 3SISA 1LOFC 1WW7A 1UZYA 1WBFA 1SLIA 2P37A 3ASIA 5EWSA 1LU2A 3AXEA 4FQ4A 1QU0A 2GDFA 3V0BA 2AR6A 1CIWA 1RIRA 4XTPA 2V5YA 4HL0A 3ZXFA 1MS5A 4MYEA 4XHXA 3AZXA 3T1MA 1S0BA 3WLUA 1IS5A 2NMNA 4XTMA 2JJ6A 3HN1A 3FUQA 4U2AA 4YW5A 4M01A 5T50A 4ZKTB 4M3CE 1DQ1A 2OUJA 3VKFC 1ENRA 4NOTA 2AYHA 1GZ9A 4FPKA 3IN9A 3UJOA 2D3SA 3VUOA 3O12A 5KXCA 4CTEA 1LHUA 1YO8A 1W6NB 4WVVA 1JBCA 1FATA 1N1SA 2CTVA 1LOEA 4XZPA 3UJQA 4Y26A 2SLIA 3BIWE 5JVVA 5H9RA 5F9TA 2PHFA 1Q8SA 4P9WA 5JOYA 3M3CA 1G9BA 1FV3A 3ZXJA 5DUWA 4BPZA 5CBLA 4XIOA 4XBQA 1JUIA 2DUOA 4FPHA 2WNEA 3WV6A 1BJQA 2ZGOA 4DFSA 1SCSA 1DLLA 3OY8B 4ZXKA 1QGLA 2P34A 3A4UA 5GM0A 3FLTA 2DUQA 2P2KA 3USUA 4AVVA 1C1FA 2C5DA 2P3IA 1LGCA 4Q1PA 4XIKA 3SITA 4SLIA 2JE7A 4XJWA 4BQ1A 1LOCA 3AYAA 3WNXA 1GV9A 2WT2A 2W39A
chains in the Genus database with same CATH superfamily
4EROA 2RR13 1W8UA 3BU7A 4PDWC 1AVBA 2GC0A 2Q4SA 3TB0A 3U4SA 1N1YA 4L0PA 1GICA 2ZX2A 1QH6A 2FZ1A 3GYDA 5L73A 2HEYF 1W6OA 4UFJA 2LTNA 5FZMA 3T1LA 5LWBA 4IV3A 3VBSB 1C57A 5FKCA 4JZRA 5FLHA 2WQZC 2EICA 4DZGA 1S0CA 1JS9A 1VMFA 1CAWB 3SKVA 3WSOA 2DU1A 2JECA 4FOQA 1BKZA 1UZ0A 1UOFA 5A3MA 1CAUB 3CZJA 5FZ6A 3WDTA 1OLME 1WMXA 1W3XA 3FE5A 3L2YA 4I0AA 5E1RA 4ZZ5A 2WSVA 5HXMA 1O91A 3TAYA 2O8QA 5A7QA 3MFAA 3WY6A 4O61A 5A7WB 3UGHA 1JOPA 1AR73 4Y4YA 1HRV1 2QQOA 4QHBA 2X5IA 1S1AA 2HWC1 3LEMA 2R071 4HOOA 1W2OA 1I9RA 4XVHA 1V6MA 5L36A 4Z92B 3RSJA 2GNMA 5FY5A 3I2KA 1CGPA 4QGLA 5FPAA 2BU9A 4J6GA 1H1AA 2A3YA 3UKTA 4QB1A 4BHPA 3IPVA 2ZJCA 2WKKA 4F83A 3AXDA 4HG6B 3LA2A 4YG3A 3H1YA 3WG2A 1RUE2 1REEA 1EV13 4URAA 2ARCA 2QQVA 3ELNA 4YW1A 2VOKA 1IS4A 1AL0G 3QACA 1QJFA 2ZBJA 3AL6A 1D0HA 4IETA 4K6BA 3VHPA 1DGWX 3RPQA 4UW4A 1Y9MA 1OA4A 2X29A 4QT6A 4XMIA 4YW4A 5GLTA 2ZHMA 3POEA 1JZ3A 2JDAA 3E97A 4N43B 5LB6A 2DU0A 2JKXA 3ORJA 5CB7A 1AYM1 4DB5A 2FCTA 1HX6A 3JCIA 2HEWF 4YM1A 2BJSA 2WFF1 3IMNA 3KCCA 5FMOS 1OKOA 5FY0A 1QNWA 5I0RA 1SLCA 1UZWA 2YMZA 1I5ZA 1GNYA 1UMHA 4JGYB 4OZXA 3FBYA 3PIGA 3NNJA 2UYAA 3N35A 2PQQA 3CJIC 4I2OA 4Q0UA 4YZ4A 2ZX3A 1DQ0A 1UX6A 5HI0A 4HFSA 5FUNA 4F3JA 4Y22A 2OZ6A 2DVDA 5FOBB 3U78A 3ETPA 2Y6HA 2YBKA 4LJHA 1CPNA 5I8SA 5AC92 4TZDA 2VQAA 1PO23 5AC91 3KV5A 2WO1A 1C8M1 3WG3A 4D7SA 3BI3A 2PAEA 4FTEA 1TMF3 4UW6A 1Y7BA 4XC9A 1YFYA 2RS12 2UY8A 3N9PA 4XABA 3LB9A 5JMCA 2MEV1 3AYCA 3DECA 5A7NA 1EV11 3RI9A 1K5MA 1L3JA 2UURA 2D98A 4QPGB 2WS92 1HB2A 3N9OA 2GH8A 3MDPA 5DG1A 4Q4W1 4EYUA 4XPVA 2YYOA 2EXIA 3GDBA 3I2JA 1TME3 5HCBA 4ET7A 1W9YA 2A75A 3OCPA 4CXYA 1VRH2 1GNZA 4JQTA 3LEIA 3R05A 1K5MB 4DUXA 1AZDA 4GMP1 1BVP1 5FZFA 5FXZA 1QMJA 1VBB3 2A3WA 1B35A 2PYTA 3AL5A 4NPLA 5JLVA 5KHJA 4E4ZA 3VBFC 2WFF3 2HWE3 3OD4A 2W0XA 4JVAA 3DYMA 1QNYA 4ASLA 5C71A 3BKZA 4PF5A 3R6SA 1OD3A 3VGIA 4DNYA 4QPIC 1MZ5A 4NN0A 1W0PA 2NN8A 4ORFA 4NHYA 4Q4X3 4ATFA 4JX0A 5KC5A 2JB4A 4O9GA 4NUBA 4GB32 2P3JA 3AKTA 3PU3A 4RFT0 2JG9B 2XJUA 3TNPB 4PBPA 3RVHA 5KXBA 3UKNA 2BERA 4D7TA 2W1SA 4GJYA 5F5IA 2EVXA 5E16A 4ARYA 2OQ7A 5FK7A 5BNPA 3ENRA 3LSEA 1WMFA 4CCOA 1H2MA 3WNNA 3LWCA 3T30A 2XGXA 3NKGA 4C91A 3M3QA 2R0FA 2ZAAA 2KA3A 3OBZA 2MEV3 4I09A 4ZPIA 5FPVA 3CDZB 5K9YA 1QDOA 3I8TA 4YW3A 5FYBA 2HWF2 3OSDA 1LULA 2PQSA 4XYXA 2H0BA 4H2AA 4IV1B 4Z8BA 4QQOA 1WCQA 3AMPA 3POJA 2JIGA 5DZFA 5FY8A 4K40A 3RWNA 5IVJA 1XU1A 2D5FA 2ZA9A 4NHMA 3ZR6A 4NVPA 2VZ3A 5DZEA 3ZN5A 1YI7A 2VBBA 1W2TA 2OW4A 3KGZA 2H6BA 3KM5A 3KF3A 4LO8A 4OULA 5C9AC 5BNOA 4AI8A 4WV8A 1B35B 5FY9A 4Q8LA 4O9EA 3POIA 5FAXA 5A70A 5D1IA 4KGQA 5IK7A 2BPA2 4CDWA 1O8PA 2VOTA 3POWA 1GUIA 3FLRA 4NPRA 1HRI1 4Y1VA 1Z78A 1FOD2 1DQ2A 1YFUA 3HT1A 4FI9A 2ZAHA 2YDEA 3ACFA 1YQCA 2J7MA 4AAPA 2BFUL 3W58A 5GZGA 2DYCA 2WO7A 4KNCA 5DABA 1G9FA 2HYXA 4FFIA 4N9HA 4XFCA 3ZKUA 1AX1A 3JBG3 1PO13 1VE0A 4NRPA 2WNUC 2EAKA 4RSUA 3NNMA 1PVXA 4CDWC 3PMEA 4BMBA 1PIV3 4RHV3 4ZY9A 3LOBA 3N9LA 3S5AA 1W6QB 1W6PA 2RS53 4YM0A 2QQMA 1ZA7A 2OUHA 4X8PA 4GWMA 3TN93 1WUVA 3PUSA 1RYYA 1GBGA 4GAZA 4JGZC 2ZOEB 3WP6A 4E4DX 4QKDA 1UY4A 1NCQA 2HWB3 2PHXA 4X6QB 2DVBA 3AP5A 5F2WA 3VBUA 4CUBA 3E6CC 3QLQA 1H6XA 1AJKA 1RGSA 2JD9A 2ZZQA 1IS3A 3NL1A 3RGBA 5DZGA 5FWEA 1X33A 4CU7A 3HT2A 1WKYA 2JXAA 2W9XA 3ZN6B 4WM7B 2VM9A 1L7LA 2WO2A 3W20A 4BE3A 2YGLA 5FMBA 1HIXA 1YNAA 3GXUA 4FSJA 1HB1A 1DG6A 2C1FA 2R30A 2OT7A 3EJKA 3NRUA 5LA2A 3TBDA 3UL2A 1AYN1 5FMDA 4DUVA 2FDIA 4QU1A 1AXKA 5FYVA 2K46A 1QJU2 1X50A 5LCWL 2RG4A 1QJY1 2RE9A 3FFZA 1XYNA 2XVLA 3HBKA 3I2GA 3N7MA 2GMMA 4IW3A 5F3GA 3WZ1A 1EAH2 5F8PA 1EAH1 3I2OA 2R0HA 3USUB 2JDKA 1IZ3A 4QQLA 3ROUA 2WAAA 5FY4A 4OHWA 1I1EA 4CEWC 3WNLA 4CXXA 4AEJA 1ACCA 2DVGA 3I2FA 5CA6A 2ZGNA 2YBSA 4QGNA 2WLPA 2OXBA 4PIYA 1LTEA 1WWYA 2CDOA 3VBFA 4EWAA 4P9LA 1APNA 5CFDA 5ANQA 1RUI2 1BEV2 1XYPA 3VBRB 4BDVB 3J7MA 1UY1A 4J1XA 1IS6A 5SV5A 1ZZ8A 5BNPB 3IDAA 2A6XA 2E7TA 3ME2A 4XEZA 4CEYA 4Y5SA 1VAVA 3UGFA 2VUAA 1V0AA 4AEDA 1CVNA 4BXFA 5FOJB 4P9YA 3VDDB 1G8WA 1OHFA 4LO7A 4N43C 1NY72 1O6UA 4PDWA 1PK6B 3BTZA 1V9U3 3O7OA 4QX0A 1Q3EA 4PIZA 4Y5TA 2ARXA 2B4KA 4BQWA 2VC9A 3DKQA 3GM8A 1QY4A 3CQOA 5IWFA 5ABJA 3VL9A 3CKHA 4M3CB 3TNQA 5A1AA 4MGTA 2F6BA 3P3NA 4FO9A 3C2UA 4HSLA 4QDQA 1W8NA 3S6PA 1LCLA 4TYSA 3RJ2X 1TNFA 1FMD1 5CFDC 4XFAA 3LQCA 1KGYA 1IKPA 1QJY3 1BQPA 1UU5A 4XETA 5C3OA 4BQ5A 4UFMA 4KU8A 1E5RA 1RITA 4IV3B 3VBSA 3ECQA 4FTSA 2CWMA 2LW8A 3FC0A 3SEEA 4BU2A 2YU2A 4A4AA 1W05A 4IEQA 3MLKA 4CCMA 1SDDB 4LHSA 5DAWA 1R1A1 2E26A 4D8MA 5GALA 4D0QA 2QE3A 3HNYM 4LMFA 5DUVA 2E32A 3MZHA 4HLTA 4XHBA 4AFAA 5KHGA 3K75B 1D4VB 1F2NA 3WDXA 3ZXGA 2J1SA 1UAIA 4MZUA 1BLZA 1YXWA 5CG9A 5DDJ3 2BDRA 1MVQA 2F4PA 3HQRA 4NWWA 3BGAA 2A6WA 4WBBA 1O4TA 1W9FA 1HQWA 1F4AA 1MS0A 1ZX5A 2NM1A 2MPFA 2ZACA 4CEYB 1F31A 1OKQA 1XQNA 3KVAA 1YFWA 3VZJA 1QOOA 2VAUA 5DAXA 1YQ8A 1NA1C 2IXJA 1J3QA 1OOPA 2GNBA 3WP3A 1LEDA 1BVVA 5ACA3 5B2GB 4IEYA 2D6LX 2IXCA 4LHLA 2W1UA 1RUD1 2ES3A 1LODA 2DCJA 2E6VA 3OF1A 2D6NA 1W39A 2E31A 1OLMA 5FP4A 4FP3A 4Q4V2 4AQ2A 3T2QA 1OH3A 4AFCA 1GANA 3RZKA 3O1MA 4U36A 1RUG3 1ZRFA 3T08A 4Y1ZA 3PHMA 5FDBA 2Z42A 5IJRA 3LDKA 4FVVA 2RDRA 4NRQA 4JTNA 5FYUA 3I3MA 1U12A 4KWLA 4ES9A 2EF6A 2AEYA 4FOWA 2PHUA 3EQEA 2WSUA 3LOIA 2X5IC 2ADEA 4HVQA 1GZCA 4RQPB 2C26A 3NV3A 1QF3A 5GZFA 3WHTA 1RUF3 3VBOA 1O3RA 1FX5A 3IDEA 3U37A 3VBSC 2JE9A 4KG8A 1EAH3 2GAUA 2ZGQA 3ZVXA 2IXLA 4R4ZA 3VDDC 3CZUA 1XRUA 3CLPA 4XJAA 2WS91 5FTTC 1QJU3 1POV3 4YFZA 5A6YA 1R1A3 1FPN1 4PT6A 5FUIA 3B94A 3K46A 3B00A 3BB6A 4GALA 1SQ4A 2ZGPA 2ERFA 5JCTA 4X6RB 1GLHA 1V6JA 3CL1A 3MIDA 4TSVA 1AR63 3B01A 3MGUA 3OBTA 4C90A 4TLFA 4N53A 1CAVA 1EPZA 4AW7A 2W1WA 1HN1A 1VIWB 2TNFA 4IV1C 4LKEA 3OYWA 3VBOC 4UFIA 3AVSA 3N7KA 2YROA 3AFKA 3ZN6A 3JU9A 1YC61 2VG9A 5FCCA 3ZSKA 1COV1 2HWC2 5JR2A 4YGDA 3T0DA 3GBWA 1HXS3 1LOFC 3VHOA 3TEYA 4OQ8A 1V9U1 4IE0A 2WNUA 3ASIA 4P5HA 1HN0A 1LU2A 3AXEA 5J1XA 1W28A 1Q43A 2GDFA 2AR6A 5KR7A 1PVC2 1XNTA 3H42B 1MS5A 3WF1A 4GJZA 5D2AA 3JBG2 2XLFA 4QDSA 1PHMA 4IEZA 1XU2A 3HN1A 3FUQA 4YW5A 5T3NA 2XOMA 2KR2A 1JZ6A 4AQSA 1WLTA 1UYYA 1PGL2 5I93A 5I0TA 2HWD3 4B4QA 1GZ9A 1SHWB 4FPKA 1POQA 2D3SA 2JG8B 1JBCA 1T2XA 1TG7A 1XB9A 4IEOA 5A6QA 3B7MA 1F15A 2PN5A 1FPN3 2Y33A 4I02A 5IAVA 3UJQA 4E2SA 5FPXA 2QFEA 4YYOA 2G9GA 2EA7A 2X8KA 3VBRA 5F9TA 5BNOC 5JOYA 3I7DA 1JYWA 2QUOA 3FHIB 3ZXJA 4EV0A 1AR61 5C3QA 3FBMA 1X8MA 3FN9A 4LOSA 5DDJ1 2CU5A 2DUOA 2VMDA 2WNEA 1US2A 4DFSA 1W8FA 5JPNB 2RDSA 5FO7B 4ZXEA 4D6RA 4MV2A 1W2UA 1QGLA 2P34A 4XFHA 3OGJA 1UU4A 2XJPA 2YG0A 3USUA 2ARAA 2P3IA 4YVWB 5F37A 4XF1A 2WA4A 1M4WA 1COV3 3VBUB 3I2HA 1UPIA 2J1TA 1L7QA 4B4PA 4LT5A 3WNXA 1QQP2 2WT2A 5C70A 4BJ0A 4F8AA 3ZFFA 1Z7S3 2QNKA 1RUJ3 3AMHA 4ISRA 1MS8A 1ND3B 4LOTA 3WP4A 2YY1A 4IEPA 1Q8VA 3WQBA 2VUCA 3ILFA 2JX9A 4XUOA 1W2AX 1D4M1 2IC1A 1SBFA 3PTRB 3ZXLA 2BOJA 1Q56A 1H8TB 1JYIA 2BWAA 2ILMA 1W6PB 3MLJA 3MW2A 3SEPA 5FZEA 5A7OA 4YLZA 3VDDA 2IWGB 4IE4A 1EY2A 1V70A 3BYWA 5C4WB 4PI2A 2MNGA 4QXBA 2JDZA 5J48A 1SFPA 2VZ1A 1FV2A 2PHTA 2BP6A 2VH9A 1OH4A 2JDUA 4OQ9A 2Q8EA 4AGRA 3J7LA 1EYBA 3ZFGB 1QJX1 2ZGRA 1GMMA 3N3HA 3M1HA 2R16A 5FZHA 5A1FA 1YFXA 5T5JA 1DF0A 3VBFB 2I2SA 3CIHA 4QX8A 1ST8A 4H55A 4BIOA 4N43A 1C8NA 4Q4Y1 2G1MA 1KJRA 2VBDA 4CP9B 3O0VA 3D0JA 2RS11 1GU3A 1ND3C 1UIJA 2ID4A 1C8M2 3W5NA 3LAGA 4NIIA 3LA7A 4P00B 3H1WA 2QQJA 4GWNA 4YW7A 5IAXA 3D0SA 4JC1A 4UOJA 5DAPA 2VNOA 3POGA 2D6KA 3MUY1 2QJVA 3WF2A 1VBD1 4K7JA 5F32A 1HB3A 4BCUA 5F5CA 1WD3A 2AH2A 4YG6A 1RVF1 4RYDA 3THTA 5FR3A 4AGGA 2XR4A 1WLDA 1E5IA 2VMIA 4IGQA 2CL2A 1RL3A 2D97A 3AVRA 1MQTB 1CQ9A 5EJZB 3WW3A 1JYCA 4HONA 2Y64A 4EN7B 1PMIA 1BBT1 5CU1A 3IAQA 1VRH1 1VBE2 4FPGA 3D5OA 2YV8A 3JD72 1GOFA 3EYPA 2JWPA 4P9XA 3LDBA 3THDA 2A6YA 4Q0SA 4MOAA 4AHZA 1RXFA 4QB2A 4AVAA 4OI0A 4PF1A 2A70A 4AHYA 1S55A 1T6BX 3ABZA 3GALA 4OHZA 3WR0A 1C28A 2WABA 2Y6JA 2WZR1 4D6SA 3MW3A 2Y6FA 1H1IA 4M00A 3GZTB 4RQPC 1JUHA 3SLIA 1PVC3 5IVFA 1JW6A 3AFGA 4QAWA 1F8VA 2XJTA 4MGYE 2YC4A 4YGBA 5T55A 4AXOA 3R0RA 1LGNA 1LU1A 1OLQA 2DBIA 4Q4Y3 1HRV3 1NY71 1HXS2 3H8OA 5F7UA 4AOCA 1KD7A 4OUEA 4LA3A 1GOGA 4XXPA 3R4UA 4COWA 4LE3A 1A8MA 4NR1A 4YZ5A 4XF4A 3AP6A 3WDWA 4NAMA 1JH5A 3RFRA 1RHI1 3DUIA 4CCEA 5C5TA 4AR2A 1RUJ2 1ODNA 4YG0A 3KLSA 5C4WC 4QKNA 3HQXA 2GP5A 1K5MC 5A3WA 4P02B 3I2DA 4JKKA 1XNKA 3ZXDA 4A6SA 4XAAA 1AR62 1GR3A 1SPPA 1XBFA 1ZZ7A 4CDUA 1SZBA 2OQ6A 3K3NA 3M3OA 2DV9A 5J37A 4CDWB 4PLMA 1HJFA 3J26N 3ZM8A 3UK9A 3ZFFB 1NXMA 2QBXA 2HBTA 5CZKA 1ASJ3 3KHBA 5IVBA 4OMCA 2NP0A 3J7NA 3SCFA 3N7JA 3WINE 1AF9A 3I2IA 4M0HA 1OQ1A 1L7RA 1ND3A 1REFA 2FCVA 1KITA 1R081 3J4UH 1ULDA 5F3CA 1J59A 1YLLA 1W3VA 3ZFEB 3VZLA 4LUMA 1DGLA 1VBE1 2VMHA 2VXRA 5I91A 5EYYA 4BZ4A 1CX4A 2W95A 3DL3A 2Y38A 1Q8QA 3AMMA 4ITCA 1PMJX 3FHAA 1PX3A 1AX0A 2XHKA 1PVC1 1QWRA 4A6OA 4F7ZA 2ZZJA 1JOBA 2A6VA 5T5PA 4XCAA 1H4HA 5FQ0B 2VW2A 4IEUA 5DG2A 5CNAA 3MO4A 3Q8FA 1HJGA 4CUCA 1QIQA 1ENXA 1PZ7A 3WUDA 5ACA2 3QBQA 2P6HA 4GKYA 3RDIA 3NVCA 1X82A 1CJDA 1QOTA 4Z82A 1BZWA 2WWUA 4OCTA 1UO9A 1W6OB 3O0XA 4L8QA 5G05L 1S0IA 4NO4A 3AZWA 2OVUA 2XDVA 4YVSB 1CPMA 3Q8EA 1AR92 2GN7A 4XCBA 2O0OA 2HLEA 4YGCA 2DCKA 2BBAA 5D8AA 3LPFA 3DYPA 1C4RA 1LHVA 2VGDA 2E7QA 3DXUA 3ZN4A 5BNNC 1JZ4A 1QXJA 2E53A 3VDAA 4DQAA 2QVSB 1JYTA 3MIEA 1BK1A 1H30A 2UWAA 5F3EA 1B09A 1VMHA 2BWCA 3J8F3 3OPZA 5K0UC 1H4GA 2G9FA 1ZBA3 1X9PA 2I45A 3WT3A 3WW4A 3WEZA 4EZHA 2ZGSA 2ZKNA 1SCRA 1UXXX 2DVAA 2Q8CA 1N3OA 1WW6A 4GZ9A 1SACA 1S0GA 2GC3A 1VRBA 2YBPA 1CAVB 1JHNA 3AKSA 1W99A 1QH7A 2WQ8A 4LBMA 2J1RA 5CEHA 1EPWA 5JIUA 4BQXA 1MQTA 3W9AA 4HZFA 2CHHA 2HWE1 3ZYRA 5BY5A 1AL22 3GBFA 2WT1A 1O3TA 4XDQA 2B5HA 3AZZA 3OD0A 4DXZA 5JZGB 2TEPA 2G19A 5C7GA 4GH4C 1N3QA 5HCFA 5JSOA 4GKXA 4XJ8A 5AVPA 1RUNA 2VY0A 4LXLA 3MF9A 4AVBA 2VOVA 4FXKB 3VDBA 5LEJA 3CNAA 4JDMA 5GJ6A 1DZRA 1RUF2 2XJQA 5CYYA 2ZCWA 3D8CA 4N90A 5FXWA 2PLV3 3NWKA 1GZTA 4URTA 4OVEA 3HOBA 4BH9A 4HBNA 2RJKA 2DTYA 4UAPA 5JUVA 4IL7A 5FY7A 3BOWA 3MBWA 2HWC3 1DLCA 1AR82 2ZGMA 3F2ZA 5E88A 3I59A 1OPMA 4XFBA 3AZVA 3VBHB 4A7KA 3EHKA 3TEXA 1PX4A 1ZZCA 3MF6A 3PVNA 3LEKA 5IYYA 1LENA 4AHXA 2VCBA 1RMU3 4ZHNA 3PIJA 4Q26A 3LFMA 1RUI3 2BFUS 3JXSA 1VP6A 3TN91 1A34A 3DPRA 3LD8A 1OVPA 1ZRRA 2DUPA 3ACIA 3MV01 3U4XA 1J3RA 3QCWA 4H3WA 4LO5B 3RNSA 3ZLIA 2FD8A 4R9BA 2VCAA 1US3A 1IHMA 1AR83 2Y34A 2X10A 1HB4A 1CAWA 1UY0A 2GALA 3WP5A 1RUD3 1XSQA 2Y6KA 3OGVA 4XF0A 2JEMA 5DDJ2 2ZHLA 3S57A 5LBEA 1VBA1 2CAVA 3RI8A 5FBJA 2BTVC 1W8TA 3EB7A 3ZYJB 1LAJA 3AX4A 4C1WA 3B9IA 4BYYA 2UWCA 1J1TA 1IG3A 1QJEA 4E4HA 2FZ2A 4DXSA 4RR3C 3O1RA 5BNNA 3ZIXA 5A6ZA 3O1TA 5CKMA 4I30A 4TN7A 1W9WA 2VQUA 3AKRA 3VBHC 3AJYA 4GULA 4YZ2A 4OI2A 4CRQA 1VPHA 1ZREA 4AE2A 2QZ3A 2XONA 2IXIA 1W6NA 4RD7A 2D6OX 1QJY2 4LIVA 2XLGA 2JIJA 2XVGA 4LHKA 1Q5OA 2D5HA 1AYN2 4LBQB 1NCRC 1Z0HA 1LHNA 2HWB2 1GZWB 2A71A 2ENRA 4V2WA 4A3XA 4WVMA 4Q0QA 2J1AA 2ZEWA 4WZFA 5L19A 1SPPB 2BVBA 1YEWA 3D6EA 2DVFA 2BNMA 3JQXA 4XUPA 5GLUA 1IPKA 3T3YA 1V9U2 1H6YA 4DXRA 4NIHA 3RMXA 1IPJA 2KXLA 5CG8A 3SH3A 1W6MA 1MACA 4LIUA 5F39A 5L9VA 3NJZA 1BYHA 4O65A 4RGGA 3HEIA 4AVTA 2D44A 3RQ0A 4BB3A 3I4IA 4N8MA 4W8JA 5A1LA 1TE1B 4N7UA 2ZX4A 5C3SA 2A3XA 5C3PA 4G9SB 4DMIA 4IEWA 1HXS1 2IUWA 5BUVA 2VU9A 1CWPA 1BEV3 2IXHA 4ZS2A 1ODMA 2VTXA 4RFRB 5APAA 4QQPA 5F5AA 1DDLA 5FZ1A 1MEC2 2R041 3VBOB 3H7YA 2WZEA 3WHUA 4MGZE 1UX7A 1G7YA 2WR9A 2YPDA 1OD5A 2ZABA 3ACGA 4FPLA 4MHUA 4C0BA 4C8DA 4Z2WA 5A3PA 2W92A 1WZXA 4CU9A 5LZ6A 3HR9A 3O0WA 4XMAA 5C33A 2R32A 2WFPA 1CIYA 2OPWA 4GMP0 2XQRA 4UBGA 3ZXKA 3J8F2 4LKDA 2HEVF 1W0NA 3I3QA 1N47A 3V65A 4M3CF 3MW4A 5FZAA 4HK8A 4CP2A 4TLGA 2AACA 5DQ0A 4QX5A 4FBFA 1ASJ2 2HWF1 1DU3D 1UNBA 1NZIA 2LUWA 4ASMB 3AM2A 5FPLA 4R9CA 3KV4A 5FYHA 2F4LA 1LJ7A 3H0OA 3H9AA 3RG0A 4WM8A 5HCAA 2DURA 1KDMA 3IPVB 2WDBA 3OEAA 2ADDA 1XXNA 4LBJA 4Q0VA 3ZYBA 4BLJA 2Z4FA 1U5XA 4MADA 5LEKA 1DYPA 4B1LA 1WMEA 1ONAA 3OJBA 5C8CC 5CKNA 1R1ZA 3ZXEA 3GCXA 1QOSA 2WRAA 2D3PA 5H9QA 4AFMA 4AAXA 4ZU7A 4EJRA 4CDUB 3ILNA 3ZSLA 3DXTA 5LK7B 1AR81 4QWNA 2RS52 4AEMA 5FZIA 3RZHA 1VR3A 4LORA 2YPJA 1W8OA 4GWIA 4KQ7A 4RS5C 3UESA 3V56A 3MPPG 4ATEA 1DGRN 5H9SA 2ETEA 2A73B 1POV0 2GMEA 3NSTA 5FRAA 1LRHA 1ALYA 1MS1A 3R4DB 3H7JA 4KWJA 4QX7A 2FBEA 3NKTA 4FP2A 3AMNA 5IFPA 2N7GA 3H1MA 4QXKA 5IATA 4LBLA 4LBQD 4XJUA 1O4YA 1AL23 4GH4A 5CKQA 5BPXA 1FI2A 4EN9B 5CAZA 1S0FA 4I3GA 2ZHKA 4MX3A 2R1DA 3C8XA 3DF0A 3M7AA 4GB31 3RS6A 1U5IA 2DFBA 2E33A 2PHWA 5ABJB 4CCJA 2XWJB 3N4MA 4XILA 2WWJA 3RZLA 4YM3A 4FPCA 2CNAA 4MHRA 5LATA 4CEWA 1JYNA 5HCHA 2W91A 4PCRA 4EN6B 1RUOA 2UY9A 5DAQA 4FQZA 2XB6C 2XL9A 3BTXA 1NE6A 1QJZA 1NLQA 1TME2 4QQ2A 5CFCA 4YFWA 1PNFA 2VNGA 3HNMA 4XURA 1KDKA 2DBNA 5F6LB 3KCXA 1GP5A 2MHFA 1UPSA 3FJSA 1S0JA 1VBC1 4XDOA 5AVAA 1HKDA 3A23A 3THCA 1IKQA 2QQNA 1OBNA 4IESA 4RS5B 3SISA 1AR93 5FWJA 3S7EA 1K5JA 4H14A 4RHV2 4L97A 4LE4A 5EFUA 4FQ4A 5FYYA 1QU0A 3KCYA 4MGIE 2BBVA 1O8SA 2ZXQA 1RIRA 3T4VA 4XTPA 2RS31 5AC93 5A80A 4MYEA 4XHXA 3O1VA 1PO12 2W87A 4RN5A 3WLUA 1IS5A 2NMNA 2TBVA 2ZPXA 4RS5A 4U2AA 2VTFA 5EZWA 4NIAA 2MEV2 4LO6B 4LULA 2OUJA 4NMIA 2OZJA 1A6CA 4RGKA 2WNOA 5FPBA 4A45A 3IN9A 5C9AB 2Q1ZB 2BGOA 4CTEA 4CE8A 2OA2A 1FATA 5IVYA 1LOEA 2W1QA 3P3PA 2XBO3 3BIWE 5C8CA 3PLQA 2IVIB 5JR7B 2GU9A 2WNVA 2WN2A 5D8AB 2X53S 1SMVA 1RJ7A 2HWD1 2Z79A 5C9AA 2K2SA 3J7HA 4GB33 1FV3A 4XFFA 4NE9A 5EIYB 4NHXA 1JUIA 3F95A 5KBFA 3RZJA 2K0GA 4JGYA 3TRSB 3H8RA 3M4FA 3WX5A 2Q0AA 3SKJE 1DLLA 1HV0A 3VN4A 2E7AA 2WINB 1UYXA 1CAXA 1DCSA 2DUQA 5GM0A 3U75A 4ASKA 5L9BA 3DPRC 4JGZA 2C5DA 1LGCA 3PVBB 4Q1PA 1VBB2 5FQ0A 1IPSA 5EP9A 4XJWA 3TEWA 3DKWA 4OYUA 3GBGA 1OI6A 3AYAA 1QQP3 4K8RB 3ILRA 3OUIA 1XC6A 1V6KA 5GLVA 2PTMA 1O7FA 1ND2A 4L11A 5BNPC 1CAXB 4S2GA 1KS5A 1UOJA 5ABJC 1JZ8A 3OUHA 5KWRA 4ES8A 1K45A 1UOBA 1V6IA 1MS9A 4KU7A 4WVZA 5C4WA 2NMOA 3I3BA 1HRV2 1S2BA 2C24A 2YC0A 2VCCA 2NPIA 3IM0A 1UYZA 3OBAA 2D6PA 4HVRA 3THPA 5A3LA 1OUSA 5BNOB 1K42A 1DQ5A 2ET7A 3LPGA 1RUJ1 2G4IA 5FZBA 4CA9A 5IK4A 2NQYA 2A7AA 3FFQA 4GA9A 4DO0A 4EN0A 4MG2A 4IERA 4WVWA 3QH7A 1JN2P 3B02A 4BWOA 4RR3A 3ZYGA 5EHDA 4DRRA 4D94A 5JXHA 1LOFA 1H8TA 2BEOA 2ZEXA 1UD1A 2HWE2 1S2EA 2R061 1RJ8A 3GGLA 2LROA 1X36A 4OUMA 2J1VA 3TOJA 3VZOA 2HWD2 4YW6A 4XOGA 2VECA 1YIFA 1H1MA 1WW5A 1X9TA 3JD73 1VBE3 5F2SA 3WW2A 1LHWA 3IT8A 2FMYA 3A0NA 4JHTA 1PNGA 4OHVA 1JZ5A 3LE0A 1V6OA 3KQRA 3O14A 4OZOA 1NXD1 2I74A 5GLZA 4AFDA 1MPXA 1G9AA 3VHRA 5FYZA 4XF9A 4SBVA 2VTXJ 5LK5A 3K4DA 5F3IA 2Q30A 4Y20A 3OB8A 1H9WA 3SNMA 4UFKA 1CR7A 4NHKA 2NYYA 3AKQA 3BCWA 4BMEA 1AR91 3E6DA 2WQ4A 5CFCB 1D2SA 1W8WA 2RS13 3T4HB 4L9BA 2VD7A 3PVOA 4C1XA 1NLSA 5C6CA 4AQ6A 1KRIA 3NNLA 5C5UA 2WT0A 1C8M3 4COYA 3W21A 1YJLA 5LBCA 1DQ6A 1G86A 2TUNA 3VKOA 1PIV1 4FT8A 3VKLA 2Y6LA 4AGVA 1SBDA 4JCKA 4LITA 4K1ZA 1MVEA 2IVJA 5LY2A 3PJQA 4UF0A 5FO9B 1OF3A 2XPJA 1SEFA 1RVF3 4GH4B 4LBNA 1H0BA 3CJIB 5JIAA 5BV6A 4LNVA 2JDNA 1H8VA 4MGSA 1TME1 2W5FA 5FZ3A 3BU0A 2ZGLA 3CO2A 1URXA 3URFA 1GP4A 2CY6A 1BBT3 2XMLA 1R1A2 5D21A 4BQ3A 3BTYA 2ZHNA 4TWTA 3C7OA 3VDCA 3OGRA 1NCQC 3OYWB 1NA1A 3I49A 4ISQA 2VJXA 5A3OA 5IW0A 2H0VA 2PHLA 1UWWA 4BQYA 3VKMA 5F5QA 1F4HA 4LBKA 1VB4A 2O1QA 2WNUB 4K20A 4XQDA 1SLLA 1OC1A 5T5OA 4HT1T 2VL4A 4YSFA 2RV9A 1RB8G 3ALQA 3HWJA 2G9ZA 3WNMA 1Z7S2 1YQ2A 2RR12 3D3AA 1EV12 1AJOA 3C7HA 3KGLA 4CDQA 1D4M2 3WF3A 1TZOA 1XNCA 2ZKLA 2VO5A 1A3KA 1COV2 1R64A 2VW1A 1LKNA 4CUGA 1HQNA 1OT5A 2PAMA 3NO8A 2ZGTA 2V4VA 3HPNA 1TMF1 5LA0A 3APBA 2XG3A 4DY3A 1W9SA 1BCXA 1PK6A 3KVBA 1RMU1 2Y0OA 2X09A 1RUI1 5FV3A 5JSPA 4RQPA 1AX2A 3IAPA 4HANA 3AP7A 1HW5A 3MHZA 3RJRA 1F5FA 1TQ5A 3ZFEC 4Q4W3 4A44A 5FLIA 1LHOA 2ZEYA 1RUH1 4L2NA 2AREA 2VE1A 4YVWC 2VMGA 4PQQA 4Q27A 5LA9A 4OHYA 3NV4A 2YXSA 5IFTA 2QKDA 3ATGA 3OPTA 1ENQA 5JPMB 4Z07A 1ASJ1 4MLOA 4AG4A 1FPN2 1H9PA 3ZYIB 2VZVA 3LKJA 1CX1A 4J25A 1WCUA 2QQKA 3PURA 2X05A 1W8HA 1VBB1 2ORZA 1CN1A 2Q8OA 1UMZA 1GFF2 4D6QA 3MFCA 3O1OA 4KWKA 4Q4V3 5FZ8A 3FX3A 4IGPA 2B39A 1FMD3 4N53B 1ZZ6A 3CHXA 4K21A 1YYNA 1PM7A 1PK6C 4K8FA 2VZUA 2R6QA 5K4LA 1WCDJ 1W6MB 3L9JT 2Z2SB 1R082 2BQPA 2QQIA 1GKBA 2RJ2A 4YVSC 3ZDVA 3POFA 4FXGB 4MXWA 5FO8B 3M8LA 3SC7X 4K1YA 2PAKA 1F5JA 1QEXA 2E9QA 2Z5WA 2EIEA 3NQHA 4ONUA 1CAUA 3EBRA 2Q1FA 4FPEA 4WM8B 2ZGKA 3IBMA 2K9ZA 5JXGA 3N36A 4N9IA 4CDXB 5JI9A 5JXJA 1TEIA 5GZCA 4HKWA 3KV6A 1GZWA 4XQWA 5FXVA 4BM8A 1XNBA 1J84A 4QXCA 3DGTA 4UYBA 4KL1A 5JWPA 3ZFEA 2VOXA 3IZOA 4DPNA 4MVTA 1FOD1 2GP3A 5C3RA 3B93A 4HETA 3A21A 1IGOA 1VB2A 5IUQA 4IUGA 2W68A 2VQTA 3DEMA 3GNEA 4M3CA 3KT1A 1RTVA 1CONA 3HBZA 3PUQA 4PJYA 2GH2A 3RZGA 1GWLA 2FCUA 4Y1XA 2GSYA 3ZX7A 1LECA 1RUG1 2RJLA 1UQXA 2VBPA 2VQ0A 2WA3A 4Q4V1 1OA2A 1OA3A 3T2PA 1RUD2 1GWKA 1UZZA 1LOGA 2HKXA 4A7YA 1ZBE2 1IOAA 3DPRB 1ENSA 4H7MA 3GJBA 3H50A 4OMDA 3AJZA 1XNDA 5A33A 3SH5A 5LASA 3VZMA 3NMBA 4QMAA 4TTGA 4YVSA 4XDPA 1T6GC 2JDYA 2V5DA 3ZSMA 2QQUA 1NQDA 4H7LA 5FZ7A 3U10A 4QPWA 2VMFA 1BHGA 4W65A 1UXZA 3ZDSA 1NCRA 4Y3OA 5FJKA 2D93A 3E5XA 3WG1A 1SFYA 2AEZA 2P6CA 2J42A 1A8DA 3ZYPA 1VJ2A 3CJIA 3UNPA 4L99A 4CDXA 1K3IA 2AUYA 5BNQA 2BRTA 3HAGA 3VD9A 2EXKA 2YFUA 3PL0A 5JZGC 3ITQA 2JKBA 3UYJA 2D7FA 3LFIA 3KB5A 4GWJA 4BXSV 2RS51 2WWSA 4ARXA 1RUC1 4XJ9A 3VHNA 1QDCA 1WLCA 1FAYA 2XXZA 2WC2A 4PLNA 3WQ0A 1OMIA 1M06G 4XAEA 2BUKA 1KJLA 4AF9A 3WDYA 3NJVA 2J1UA 4UW3A 4UFHA 1UN1A 3FHQA 3SCGA 3D4KA 3O1PA 2SBAA 1JYVA 1Q8OA 3JUUA 1U5ZA 3M70A 3PJYA 4FPOB 2CGPA 3B5LB 4Z1VA 3BUCA 2JE8A 2W46A 2WZPP 5ISLA 2C0ZA 4XBNA 1QJX2 2EIGA 3IKWA 4XE9A 4CDXC 5BXXA 3POSA 1AHSA 5K8SA 3KMHA 4QU2A 1KFUL 3Q8BA 4R9DA 3BTAA 3ES1A 4PDWB 2GMPA 3WXPA 1K12A 4PBOA 1JZ2A 2ZMKA 1WBLA 5T54A 5GKAC 3VD3A 5FZ4A 3EMRA 5FYIA 2W3JA 1B35C 1V6LA 1NYWA 2PELA 3NW4A 1ZBE1 2EALA 4A3ZA 4OHXA 1O4ZA 1PGW1 4UWDA 2CYFA 3SCHA 3NV2A 5CISA 3JZVA 2VZRA 4ZU5A 3ZMOA 2OYZA 3MV11 2FDGA 5L7OC 1YI9A 2AZ5A 5CFCC 3WOGA 3E5QA 3I3EA 1RUH2 1ZYBA 4M0NA 5SV8A 4X8NA 3WQ7A 3ZFGA 1JHJA 3MEPA 4IDZA 2BZDA 4BA6A 1S0EA 4S2FA 4AZZA 5EJ3A 1C1LA 1PZ8A 5FYSA 4Y5Z0 3ZMNA 4QPIA 3M2MA 1RUC3 3B3QE 2R1BA 2R073 3BVCA 1WMDA 3A22A 4LUKA 4QX3A 3SH4A 2B45X 4FAHA 3ZYHA 3RMYA 3N7LA 3V64A 4AVCA 4JHZA 1FOD3 3ZYFA 3CBNA 3S0MA 5A7PA 3OTFA 4AK3A 3M3EA 3WG4A 4LQRA 3KT4A 3ZFFC 1W03A 2W94A 5HV0A 4MGKE 2PHRA 4MO3M 4LO4B 1Z7S1 4OFGA 4YWAA 3WF4A 4PLOA 1QXRA 1ZZBA 4GD4A 4META 5L7OA 3MIGA 3HNBM 1NT0A 4Y33A 3UKVA 1DYOA 4W6YA 1IQDC 4JGZB 4MUVA 4NWVA 4FFFA 5JXIA 2XKPA 5A3TA 4DEQA 4P08A 3B69A 2LM3A 1Y43B 4KG0A 4B7KA 5FP3A 5KHIA 4Y1UA 1UZVA 5JAXA 2PMWB 3ZIWA 4YW2A 4XUNA 1WCKA 4QD2A 5D8AC 1ZRIA 2UYBA 5IT6A 5JDBA 2WFF2 2JG9A 1ULEA 4DUWA 2R042 3W5MA 1FNYA 2EXJA 1AYM2 1SFNA 5KXEA 1OOPC 1W6QA 4BLIA 3KHCA 3FZ3A 2ARBA 4JGYC 5CADA 1D7PM 4FCAA 3JBG1 2GNTA 4CZSA 2F17A 1FNZA 5A3NA 3VD4A 1Q8PA 1V6NA 2DWRA 3N9MA 2O8OA 2VZTA 5GLWA 3OPWA 1KQRA 3ZPOA 3ES4A 3ZOIA 4AYUA 1UL9A 2RVAA 2WN3A 3TYJA 1VBC2 5EQUA 4S2DA 1XPWA 1F35A 4BIFA 4JKMA 2B8MA 4WM7C 1DZQA 1UOGA 4P9JA 1J58A 2WBKA 3LGRA 4IEXA 3AB0A 4KMQA 3P1IA 1A78A 4P9IA 5FZOB 1XNAA 4B7EA 3MICA 1YJKA 2DFCA 3FMGA 3JB4C 3LSDA 1HQLA 5K0UB 4R4XA 3BOPA 4M4RA 3AZYA 5CVRA 4XJZA 2Y0IA 2YUEA 4IGOA 4QGMA 4HVOA 2A6ZA 1VBD3 2OIIA 2CGNA 3LA3A 2BVVA 1KXGA 2W2IA 1UIKA 3LF7A 1STMA 4QHOA 2PHDA 1I5PA 4TXWA 2DDUA 1SLTA 2FDJA 5ERLA 3RYRA 4KI5M 3UGGA 2RR11 1DP0A 1ND2C 1ZM1A 2VZPA 4N53C 1AL21 2UWBA 3WDUA 4Y4RA 5A6XA 1JTZX 3T2OA 2OX0A 5DUXA 3POBA 4WM7A 3U11A 5LW9A 4IE6A 5KHKA 5JOZA 2V73A 2VMEA 2YHJA 1YUDA 1GYKA 2VNVA 3H3ZA 3N9QA 4LEJA 3WF0A 2CGOA 2L9LA 2WS93 3ZSJA 1NE4A 4CU6A 1VMJA 1MZ6A 2ATFA 4FAGA 1WW7A 4W6WA 4YARA 3QH6A 4B8EA 1C3HA 2VNRA 2W47A 4INDA 5EWSA 4A41A 3VD7A 3V0BA 3DYOA 3HN3A 3MIHA 2V5YA 4HL0A 3NAPA 4J1WA 2RDQA 4L92A 4WM8C 3ZXFA 4A42A 2WYSA 3T1MA 2EIBA 4QX1A 3KF5A 1RUE3 5FIXA 3NNGA 5CIRA 1GP6A 2IFRA 1WA4A 4JRLA 5B4NA 4QXHA 2AYHA 2RS33 3UJOA 1RXGA 3OEBA 3VUOA 3O12A 3BIEA 2Y6GA 4GIQA 4JTOA 3LDRA 5IVCA 2CTVA 5CFDB 5FLJA 1UF2C 2VUJA 1OF4A 4Y26A 5I0SA 5JVVA 5FZLA 5H9RA 2RM23 1ULPA 3KWVA 1EUTA 4P9WA 4QPGA 5FPZA 5JMOA 3C7EA 1G9BA 1X8EA 3TEZA 2QDNA 5DUWA 3NNFA 5DPNA 4BPZA 4Q4X2 5FP9A 4ZZ8A 5CBLA 4CPBD 1KS4A 3P6BA 4HMZA 2OPKA 3H8UA 3WV6A 3ZKYA 3ZO0B 1W8ZA 2ZGOA 3RZMA 1W9TA 2HJIA 2VVDA 1XOYA 3ACHA 3OG2A 2VULA 4CDQB 3K3OA 2JDHA 5JSRA 2WNVB 4CP9A 4I0BA 3MI8A 3NJXA 3RWKX 4AI2A 5HXVA 3S5QA 4BQ2A 1R083 2YFZA 2JG9C 3UV9A 4CSWA 4XIKA 4V1PA 1NLRA 1UYPA 4ZU4A 2JE7A 3ZSEA 5LBBA 3VBUC 3K48A 3ZR5A 5DN2A 1Y3TA 1GV9A 2W39A 5J7MA 2P3YA 4COUA 2J1EA 3MIBA 1NCRB 2FHRA 5FKBA 4YPJA 4OUSA 1AUYA 2HBUA 3GJAA 1QQP1 4CP0A 3AP4A 4CCDA 1WCSA 4I01A 2VXJA 1S4CA 3K51A 2CV6A 2IXKA 1NAEA 4CCNA 1PO21 5I0UA 4BISA 1PO22 1JU3A 1NX9A 5H9PA 1MZEA 1YHFA 3DCQA 4P14A 3C7FA 5ACA1 4XBLA 3GZUC 4IXLA 4IEVA 2XVKA 5BNNB 3WCRA 2RM21 4LPLA 3I3DA 3U07A 4AWDA 4CXWA 5DUUA 2VZQA 3VKNA 1RC6A 2Q5TA 3WDVA 3IWZA 2OKXA 3VZKA 3V0BB 1MR5A 2XJRA 1HV1A 2B42B 2GC2A 1GOHA 3HJRA 2HYKA 3JB8A 1D4M3 4LBQA 2D6MA 4EWEA 4RGAA 2VUDA 3WQ1A 4CVUA 1C5IA 4NIGA 3AK0A 4UBHA 1QKQA 2ZX0A 3H3UA 1U0AA 1H2NA 3K77A 1OFSA 1VBA2 3KD4A 4WVMB 4DY5A 1YRZA 3Q8AA 2BYVE 1UMIA 1E57A 1QJU1 1JODA 2VZSA 1LEMA 3BODA 4UI9L 4Y1YA 5L7OB 3I59B 3O1UA 5FJHA 5LY1A 4FOVA 4QPGC 4Q4X1 4DOUA 1E5SA 4QQHA 3E6BA 5FBZA 1UU6A 5FZGA 4B3NA 4C0HA 1E5HA 2WO3A 3IB3A 4M4PA 5J96B 1BXHA 1OLRA 3QOPA 1BBT2 2YC2A 4HXCA 1RUE1 4LR4A 4HPKB 2WJSA 2WNVC 3LIHA 1FT9A 4IV1A 4D3WA 5BYNA 1GQPA 1CJPA 3FLPA 3LCPA 4NPMA 3AC0A 4FTBA 5FP7A 3IDCB 2D40A 2HH9A 2P5BA 2ZTNA 3DV8A 3EXUA 2E51A 4GXLA 2QQWA 4QX2A 5LBFA 3VLBB 2XUMA 2KM2A 5E89A 1X7NA 4BOWA 4AL9A 4R8HA 5TSWA 4AI1A 2V09A 2WUHA 4EN8B 2EIDA 4QM8A 1XE7A 4JRAA 2P17A 1UKRA 2YU1A 1O3QA 2XH6A 2BNOA 4OI4A 4YNIA 4QPYA 1IG0A 3BPSA 4Q4Y2 2CAUA 5FREA 2P3KA 2XQXA 3NV1A 5FXXA 1PGW2 1W04A 5EV7A 1LNSA 5KC6A 1LGBA 2WIIB 5HV4A 2QZ2A 4JAAA 3HIFA 2R063 1RUG2 3JQWA 3OBRA 5IVVA 1VBA3 2DCYA 4Q5OA 1DBNA 2C6SA 3G7DA 3DN7A 1OOPB 3MLLA 4K3UA 3AYDA 2YB7A 4XUTA 2Z69A 1BMV2 3K4ZA 4AI3A 4PIXA 4DRVA 2DCZA 2WZR3 1H2KA 1N3PA 2VMCA 1H8TC 1ULOA 3P5BA 1JOJA 3CU7A 3RYKA 1O5UA 2Y60A 1VBD2 1VLNA 4Q0PA 4HK9A 4XFIA 3GHMA 1YIPA 2E63A 2PFWA 4LLOA 2Q8DA 4HPKA 3INAA 3VBHA 2A5ZA 3T0AA 2V4AA 1AXYA 2PXJA 5J3UA 1UY3A 2VZOA 3BN6A 1NCQB 4FPJA 3ZXAC 3ZFGC 2QCSB 1REDA 2VPVA 3R4SA 1TNRA 1RINA 1LB2A 4N7IA 5C8WA 4UFLA 3GZAA 4QKFA 4JDNA 3V0AB 5KXDA 1WD4A 4DXTA 5M0TA 3I54A 4A2UA 1Y9QA 1NA1B 4Q1RA 1DYKA 1OXCA 1UCXA 1ZBA1 4IE7A 1C5HA 4QHZA 4RR3B 5FP8A 1OQEA 3SMHA 3AP9A 1N1TA 1WA6X 3D82A 1BEV1 4NJ4A 1LOAA 4WZCA 1AYM3 4QKBA 4YM2A 2JICA 3HVDA 5AFEA 3PVEA 2VVEA 3RYPA 2R043 3TWIA 4QB6A 1W0OA 2R7EB 2ZS6B 4R52A 1CZSA 1PGL1 3LEGA 1WGPA 2C9AA 2AENA 4PQ9A 5FZOA 2B46X 2C9KA 1TVGA 4CPBA 2AGSA 2XJSA 4Q29A 5HBAA 3WW1A 3KZ4C 1OQDA 2AC1A 4E2QA 3MPBA 5EPAA 3NAPB 1CD3G 1G6NA 4CCKA 2BW8A 4Y20B 3UT0A 2PLV1 3PUIA 4AI9A 4HN0A 4AEDC 3OY8A 3WNOA 1OFNA 2RM22 2XBO2 2B9UA 3Q9OA 2D43A 5FPUA 5DMYA 4W6XA 2BNNA 3PMSA 3CJXA 1SBEA 1PO11 2XUEA 1OURA 4UW5A 2RS32 4MSVA 4AQTA 1UW8A 2O14A 3VZNA 1MQTC 1FXZA 2C4XA 1J3PA 2JDMA 4LKFA 1PMHX 2I07B 4RHV1 1R093 3U0ZA 5C8CB 3U14A 1ULGA 1AXZA 1DQ4A 3PTYA 2ZX1A 4DEVA 4AHWA 2B9VA 2ZMLA 3O5SA 4G4FA 1I3HA 4CDUC 4AI0A 2VOWA 2YZ4A 4NRMA 5FMOL 3WCSA 5K0UA 4KH9A 2HWB1 2VCMA 1IQAA 2EAAA 1NZCA 4CDQC 2FDFA 1HRI2 1JU4A 2RMU2 4GMP3 3IIIA 4LA2A 2ORXA 1VAKA 1XSRA 1LESA 1NUKA 2BGCA 4Y24A 5E6HA 5I8TA 1JYXA 3MIFA 4KGGA 4S2HA 3OGSA 1H2LA 4EWDA 1O5LA 3HMYA 2NZ9A 1Y4WA 3M3IA 2CWSA 4G3YC 5EYXA 4B29A 2XWBB 2WLQA 3EO6A 2B7YA 5EJ1B 2H6CA 1OPOA 3FUOA 5J09A 4E2GA 5IVEA 1UKGA 5F6KA 2FDHA 1PGSA 2W08A 3TN92 2QQPA 5HPOA 2VVFA 3LIGA 3LZZA 3ST7A 5AFBA 1XE0A 4FFHA 4NIDA 1NQJA 1W2NA 2ZMNA 1PIV2 4FPYA 5JOWA 4YGEA 3VB9A 1RHI3 3C7GA 2R49A 4KWUA 3KV9A 4E4SA 3U1XA 5I8YA 4FFGA 5LRRA 4BK5A 4LK7A 1DGRA 3AKPA 2CDPA 3OUJA 1VBC3 1OVSA 4JQRA 4JKLA 4XUQA 1S2KA 4CEWB 4IQPA 4LLFA 1P8JA 2WZ8A 5FFOC 5JI7A 4E9KA 1GSLA 1CESA 1KEXA 2XKOA 2BOIA 2FMDA 1ZRCA 1G9DA 3W59A 2JD4A 3SQOA 2R072 1U5YA 5F1RA 4OLLA 3C3VA 1RUC2 1CZTA 3V0AA 2GN3A 1NG0A 4OI1A 3ETQA 3L2HA 4RL7A 1JXNA 1SDWA 3PNAA 4AEKA 3MYXA 5A3UA 1FYUA 2DTWA 2P4EA 2VW0A 3Q8CA 4GQ7A 4B1MA 2Q1MA 2J22A 4COVA 4CP1A 4LHNA 4O7XA 1MS3A 5DXDA 1JZ7A 2JB8A 4YZ1A 5FZ0A 4UT5A 4ZONA 2RMU3 1HRI3 2WAOA 3GZEA 1ZA4A 4XFGA 3N9NA 5FYTA 1EUUA 3RZZA 1G9CA 5IK8A 2Y26A 1MS4A 1RUF1 4CEYC 3OGGA 5EXOA 4YVWA 5FUPA 3KS7A 1D2QA 2IZWA 2JG8A 4MH0E 2HWF3 4W50A 4E8DA 1XYOA 1KFXL 1ND2B 4HN1A 4A7ZA 1SG3A 4MXVA 3WD5A 1W06A 4LBOA 1QJX3 3VL8A 5K7PA 4IV3C 5IHRA 1MEC3 5LA1A 2Y8KA 1GNHA 1GQGA 3FL7A 3H8XA 3ZPYA 1NKGA 5G04L 3PDQA 1R091 1Y9GA 4BQ4A 4XACA 2FQPA 3OOXA 1HLCA 3POYA 1YWKA 4XW3A 4CCCA 3K2OA 5FK8A 5J98B 2ZGUA 3J8F1 1RHI2 4KBBA 2JENA 1RUH3 3E5UA 1ULCA 3NJYA 5FYMA 3BPZA 5GZDA 4AFBA 2QQLA 4YZ3A 1PZ9A 2UU8A 1ZRDA 1V00A 4RA0A 4QM9A 5JOXA 5L9RA 4NROA 4QDRA 3S7IA 3GCWA 4CCLA 2BV4A 3T2TA 3T0BA 1O59A 2FDKA 2GZWA 1ZZ9A 1JMUB 2RMU1 1QHDA 1AYN3 2DCTA 1FMD2 5KXCA 2QDRA 4EQVA 4Y22B 5E8AA 1VRH3 1DGWA 3E1F1 3ON7A 3KT7A 4JV4A 3B9CA 3O1SA 5GZEA 3J9SA 1DHKB 1VALA 5B4XA 2R062 3PU8A 4D69A 3JD71 1ZBE3 1XE8A 5IK5A 1F9KA 2XJVA 3VBRC 1POV1 4EE2A 1NOVA 4QPIB 4Q8KA 2LALA 1SLAA 5FYCA 1JI6A 5FZDA 2OS2A 3IDBB 1W90A 4DS0A 1TMF2 1ULFA 2X5IB 3ACLA 4I0WB 5KHHA 2RHPA 1WLWA 3GHNA 4Q4W2 1WW4A 1I6XA 1MEC1 3NAPC 3HD8B 4P9GA 3IMMA 5DAVA 4D7YA 1VAMA 1YQ5A 4AEDB 4UF0B 1LOBA 4AVSA 4K9SA 4LTAA 3T09A 1R092 3VV1A 2D3RA 5LRSA 1HDKA 3A0KA 2V72A 5FMCA 2IFWA 3AYEA 3CF6E 3QD6A 3SHRA 5A33B 2XLAA 4LK6A 5A32B 3WVJA 4V2VA 5I0DA 2LS6A 4Q2FA 2WYFA 2WZR2 3FWEA 2JG8C 4XXAA 2ET1A 3WUCA 1YQ6A 3G6JB 1ZNPA 4R9AA 3RRDA 1RMU2 1DIWA 4I3PA 1SLBA 4FPFA 4P5YA 1N1VA 3K4AA 5T5LA 5J36A 1DFQA 2W52A 4W4ZA 2GNDA 2QTWB 4IE5A 2KD7A 4HKOA 1S0DA 3SXWA 2XHNA 3GF6A 4MXWB 2XL7A 1J83A 2VR4A 4COZA 2RDNA 3IIAA 4FOYA 2EXHA 5T52A 2XBO1 1DZTA 4E8CA 1UZYA 1BMV1 1WBFA 1SLIA 2PLV2 2P37A 2JDPA 1YCIA 3A7QA 4LKSA 5FZCA 1BK0A 2PA7A 3WNPA 1CIWA 3AMQA 4XF3A 1OSGA 2DF7A 2P1BA 4HSJA 3AZXA 4UXAA 4Z2AA 3UETA 1S0BA 3I97A 3H3LA 4NAOA 1LR5A 4XTMA 2JJ6A 4XQ4A 5T50A 1CZVA 4M01A 2WL1A 1OUXA 4ZKTB 2YGMA 1DQ1A 4M3CE 3CEWA 1MZFA 1ENRA 3BALA 3CMGA 4YRDA 3USSA 3VKFC 3VD5A 4NOTA 5FY1A 1J1LA 4XZUG 1D0GA 2BGPA 1RVF2 1LHUA 1YO8A 1W6NB 3KSCA 4WVVA 1N1SA 2NLRA 3PUAA 3PUHA 4JDOA 5A7WA 3WNKA 4MGQA 4CUAA 1UY2A 4XZPA 1AR71 4B4RA 5JZGA 1GWMA 2SLIA 2GC1A 1AR72 3KQ4B 3MUZ1 1QXPA 1ZBA2 1Q8SA 2PHFA 3M3CA 4KBZA 4NHLA 2LRPA 5A32A 1ZVFA 3HQUA 2ZEZA 1EP0A 5FZKA 4DINB 4ZS3A 4XIOA 4XBQA 4E27A 4FPHA 4CYDA 1GQHA 1BJQA 4PHZA 5ANNA 4HKLA 1SCSA 4BK4A 3OY8B 4ZXKA 2CSGA 5FZ9A 3A4UA 1PM4A 3S30A 3FLTA 2P2KA 4AVVA 4PI0A 1C1FA 3X29B 4CU8A 1XJAA 5A7SA 4DIQA 4EZ4A 1O3SA 3SITA 4SLIA 4BQ1A 1LOCA 2A1XA
chains in the Genus database with same CATH topology
4EROA 2RR13 3BU7A 4PDWC 1AVBA 2GC0A 2Q4SA 3TB0A 1N1YA 1GICA 2ZX2A 1QH6A 2FZ1A 3GYDA 5L73A 2HEYF 1W6OA 3T1LA 2LTNA 4IV3A 3VBSB 1C57A 5FLHA 2WQZC 4DZGA 1S0CA 1CAWB 2DU1A 2JECA 4FOQA 1BKZA 5A3MA 1CAUB 3WDTA 3L2YA 3FE5A 5E1RA 4I0AA 2WSVA 1O91A 3TAYA 2O8QA 3MFAA 3WY6A 1AR73 4Y4YA 1HRV1 4QHBA 2X5IA 1S1AA 2HWC1 2R071 1I9RA 1V6MA 5L36A 4Z92B 3RSJA 2GNMA 1CGPA 4QGLA 4J6GA 1H1AA 2A3YA 3UKTA 4BHPA 3IPVA 2ZJCA 2WKKA 4F83A 3AXDA 3LA2A 4YG3A 3H1YA 3WG2A 1RUE2 1REEA 1EV13 3ELNA 4YW1A 2VOKA 1IS4A 1AL0G 3QACA 2ZBJA 4IETA 1D0HA 4K6BA 3VHPA 1DGWX 3RPQA 4UW4A 1OA4A 2X29A 4QT6A 4XMIA 4YW4A 5GLTA 2ZHMA 3E97A 4N43B 2DU0A 5CB7A 1AYM1 4DB5A 1HX6A 3JCIA 2HEWF 4YM1A 2WFF1 3IMNA 3KCCA 5FMOS 1QNWA 5I0RA 1SLCA 2YMZA 1I5ZA 4JGYB 4OZXA 3FBYA 2UYAA 3N35A 2PQQA 3CJIC 4I2OA 4Q0UA 4YZ4A 2ZX3A 1DQ0A 1UX6A 5HI0A 4HFSA 4F3JA 4Y22A 2OZ6A 2DVDA 5FOBB 1CPNA 5I8SA 5AC92 4TZDA 2VQAA 1PO23 5AC91 3WG3A 1C8M1 4D7SA 2PAEA 4FTEA 1TMF3 4UW6A 1Y7BA 5JMCA 1YFYA 2RS12 2UY8A 3LB9A 2MEV1 3AYCA 1EV11 3RI9A 1K5MA 1L3JA 2UURA 2D98A 4QPGB 2WS92 2GH8A 3MDPA 5DG1A 4Q4W1 4XPVA 2YYOA 2EXIA 1TME3 5HCBA 2A75A 3OCPA 1VRH2 1GNZA 3R05A 1K5MB 1AZDA 4GMP1 1BVP1 1QMJA 1VBB3 2A3WA 1B35A 2PYTA 5JLVA 5KHJA 4E4ZA 3VBFC 2WFF3 2HWE3 3OD4A 2W0XA 4JVAA 4ASLA 1QNYA 4PF5A 3R6SA 3VGIA 4DNYA 4QPIC 1MZ5A 4NN0A 1W0PA 2NN8A 4ORFA 4ATFA 4Q4X3 5KC5A 4O9GA 4GB32 2P3JA 3AKTA 4RFT0 2JG9B 2XJUA 3TNPB 4PBPA 5KXBA 3UKNA 4D7TA 2EVXA 5E16A 5BNPA 3ENRA 3LSEA 1WMFA 1H2MA 3LWCA 2XGXA 3NKGA 4C91A 3M3QA 2R0FA 2ZAAA 2KA3A 4I09A 2MEV3 5K9YA 1QDOA 3I8TA 4YW3A 2HWF2 1LULA 4XYXA 2H0BA 4IV1B 4Z8BA 4QQOA 3AMPA 3RWNA 5DZFA 4K40A 1XU1A 2D5FA 2ZA9A 4NHMA 4NVPA 5DZEA 3ZN5A 1YI7A 2OW4A 3KGZA 2H6BA 3KM5A 4LO8A 4OULA 5C9AC 5BNOA 4AI8A 4WV8A 1B35B 4Q8LA 4O9EA 5FAXA 5IK7A 5D1IA 4KGQA 2BPA2 4CDWA 3POWA 3FLRA 4NPRA 1HRI1 4Y1VA 1Z78A 1FOD2 1DQ2A 1YFUA 3HT1A 2ZAHA 2YDEA 2BFUL 3W58A 5GZGA 2DYCA 4KNCA 1G9FA 4N9HA 4XFCA 1AX1A 3JBG3 1PO13 2WNUC 2EAKA 4RSUA 1PVXA 4CDWC 3PMEA 4BMBA 1PIV3 4RHV3 3LOBA 1W6QB 1W6PA 2RS53 4YM0A 2OUHA 4X8PA 4GWMA 3TN93 1WUVA 1GBGA 4JGZC 2ZOEB 3WP6A 4E4DX 1NCQA 2HWB3 2PHXA 4X6QB 2DVBA 3AP5A 3VBUA 3E6CC 3QLQA 1AJKA 1RGSA 2ZZQA 1IS3A 3NL1A 5DZGA 1X33A 3HT2A 2JXAA 3ZN6B 4WM7B 4BE3A 2YGLA 1HIXA 1YNAA 4FSJA 1DG6A 2C1FA 2R30A 3EJKA 3UL2A 3TBDA 1AYN1 1AXKA 1QJU2 1X50A 1QJY1 2RE9A 3FFZA 1XYNA 2XVLA 3N7MA 2GMMA 3WZ1A 1EAH2 1EAH1 2R0HA 3USUB 1IZ3A 4QQLA 3ROUA 4OHWA 1I1EA 4CEWC 4AEJA 2DVGA 5CA6A 2ZGNA 4QGNA 2WLPA 4PIYA 1LTEA 3VBFA 4EWAA 4P9LA 1APNA 5CFDA 1RUI2 1BEV2 1XYPA 3VBRB 5SV5A 5BNPB 4J1XA 1IS6A 1ZZ8A 2A6XA 2E7TA 3ME2A 4XEZA 4CEYA 1VAVA 2VUAA 4AEDA 1CVNA 5FOJB 4P9YA 3VDDB 1G8WA 1OHFA 4LO7A 4N43C 1NY72 4PDWA 1PK6B 1V9U3 3O7OA 1Q3EA 4PIZA 2ARXA 1QY4A 5ABJA 3VL9A 4M3CB 3TNQA 2F6BA 3P3NA 4FO9A 3C2UA 4HSLA 3S6PA 1LCLA 4TYSA 3RJ2X 1TNFA 1FMD1 5CFDC 4XFAA 1IKPA 1QJY3 1BQPA 1UU5A 4XETA 4KU8A 1RITA 4IV3B 3VBSA 4FTSA 3ECQA 2CWMA 3FC0A 4IEQA 3MLKA 1R1A1 5GALA 2QE3A 5DUVA 3MZHA 4HLTA 4XHBA 4AFAA 5KHGA 3WDXA 1D4VB 1F2NA 3ZXGA 1UAIA 4MZUA 1YXWA 5CG9A 5DDJ3 2F4PA 1MVQA 4NWWA 2A6WA 4WBBA 1O4TA 1HQWA 1MS0A 2ZACA 1ZX5A 2NM1A 2MPFA 4CEYB 1F31A 1OKQA 1XQNA 1YFWA 3VZJA 1QOOA 1NA1C 2IXJA 1J3QA 1OOPA 2GNBA 3WP3A 1LEDA 1BVVA 5ACA3 5B2GB 4IEYA 2D6LX 2IXCA 4LHLA 1RUD1 2ES3A 1LODA 2DCJA 2E6VA 3OF1A 2D6NA 1W39A 4AQ2A 4FP3A 4Q4V2 4AFCA 1GANA 4U36A 1RUG3 1ZRFA 4Y1ZA 3PHMA 5FDBA 2Z42A 4FVVA 4JTNA 1U12A 4KWLA 4ES9A 2EF6A 4FOWA 2PHUA 3EQEA 2WSUA 3LOIA 2X5IC 4HVQA 1GZCA 4RQPB 3NV3A 1QF3A 5GZFA 3WHTA 1RUF3 3VBOA 1O3RA 1FX5A 3IDEA 3VBSC 2JE9A 4KG8A 1EAH3 2GAUA 2ZGQA 3ZVXA 2IXLA 4R4ZA 3VDDC 3CLPA 1XRUA 4XJAA 2WS91 5FTTC 1QJU3 1POV3 4YFZA 1R1A3 1FPN1 3B94A 3B00A 3BB6A 4GALA 1SQ4A 2ZGPA 2ERFA 5JCTA 4X6RB 1GLHA 1V6JA 3CL1A 3MIDA 4TSVA 1AR63 3B01A 3MGUA 3OBTA 4C90A 4TLFA 4N53A 1CAVA 1EPZA 4AW7A 1VIWB 2TNFA 4IV1C 3OYWA 3VBOC 3N7KA 2YROA 3AFKA 3ZN6A 3JU9A 2VG9A 5FCCA 3ZSKA 1COV1 2HWC2 4YGDA 3GBWA 1HXS3 1LOFC 3VHOA 1V9U1 2WNUA 3ASIA 4P5HA 1LU2A 3AXEA 1Q43A 2GDFA 2AR6A 1PVC2 1MS5A 3JBG2 2XLFA 1PHMA 4IEZA 1XU2A 3HN1A 3FUQA 4YW5A 5T3NA 4AQSA 1WLTA 1PGL2 5I93A 5I0TA 2HWD3 4B4QA 1GZ9A 4FPKA 2D3SA 2JG8B 1JBCA 4IEOA 3B7MA 4I02A 2PN5A 1FPN3 4E2SA 3UJQA 5FPXA 2QFEA 4YYOA 2G9GA 2EA7A 2X8KA 3VBRA 5F9TA 5BNOC 5JOYA 3I7DA 2QUOA 3FHIB 3ZXJA 4EV0A 1AR61 3FBMA 1X8MA 5DDJ1 2DUOA 2WNEA 4DFSA 5JPNB 5FO7B 4MV2A 1W2UA 1QGLA 2P34A 4XFHA 3OGJA 1UU4A 2XJPA 3USUA 2P3IA 4YVWB 4XF1A 2WA4A 1M4WA 1COV3 3VBUB 1UPIA 4B4PA 4LT5A 3WNXA 1QQP2 2WT2A 4F8AA 3ZFFA 1Z7S3 2QNKA 1RUJ3 3AMHA 4ISRA 1MS8A 1ND3B 3WP4A 2YY1A 4IEPA 1Q8VA 3ILFA 2JX9A 1D4M1 2IC1A 1SBFA 3ZXLA 1Q56A 1H8TB 1JYIA 2BWAA 2ILMA 1W6PB 3MLJA 3MW2A 4YLZA 3VDDA 2IWGB 1EY2A 1V70A 5C4WB 2MNGA 2JDZA 5J48A 1FV2A 2PHTA 2VH9A 4AGRA 1EYBA 3ZFGB 1QJX1 2ZGRA 3N3HA 3M1HA 2R16A 1YFXA 5T5JA 1DF0A 3VBFB 2I2SA 4H55A 4BIOA 4N43A 1C8NA 4Q4Y1 1KJRA 3O0VA 3D0JA 2RS11 1ND3C 1UIJA 1C8M2 3LAGA 3LA7A 3H1WA 4GWNA 3D0SA 4JC1A 2VNOA 2D6KA 2QJVA 1VBD1 4K7JA 4BCUA 1WD3A 2AH2A 4YG6A 1RVF1 3THTA 4AGGA 1WLDA 2VMIA 2CL2A 1RL3A 2D97A 1MQTB 1CQ9A 3WW3A 1JYCA 4EN7B 1PMIA 1BBT1 5CU1A 1VRH1 1VBE2 4FPGA 3D5OA 2YV8A 3JD72 4P9XA 2A6YA 4Q0SA 4AHZA 4AVAA 4OI0A 2A70A 4AHYA 1S55A 3GALA 4OHZA 3WR0A 1C28A 2WZR1 3MW3A 1H1IA 4M00A 3GZTB 4RQPC 1JUHA 3SLIA 1PVC3 1JW6A 3AFGA 1F8VA 2XJTA 4MGYE 4YGBA 5T55A 4AXOA 3R0RA 1LGNA 1LU1A 1OLQA 4Q4Y3 1HRV3 1NY71 1HXS2 1KD7A 4LA3A 4XXPA 3R4UA 4COWA 4LE3A 1A8MA 4NR1A 4YZ5A 4XF4A 3AP6A 3WDWA 1JH5A 1RHI1 3DUIA 1RUJ2 4YG0A 5C4WC 3KLSA 3HQXA 1K5MC 3I2DA 1XNKA 3ZXDA 1AR62 1GR3A 1ZZ7A 4CDUA 3M3OA 2DV9A 5J37A 4CDWB 4PLMA 3J26N 3UK9A 3ZFFB 1NXMA 1ASJ3 2NP0A 3SCFA 3N7JA 3WINE 1AF9A 4M0HA 1OQ1A 1ND3A 1REFA 1J59A 1KITA 1R081 3J4UH 1ULDA 1YLLA 3ZFEB 3VZLA 4LUMA 1DGLA 1VBE1 2VMHA 2VXRA 5I91A 5EYYA 4BZ4A 1CX4A 3DL3A 2Y38A 1Q8QA 3AMMA 4ITCA 2XHKA 1AX0A 1PVC1 1QWRA 4F7ZA 2ZZJA 2A6VA 5T5PA 1H4HA 5FQ0B 2VW2A 4IEUA 5DG2A 5CNAA 1ENXA 1PZ7A 3WUDA 5ACA2 3QBQA 4GKYA 3RDIA 3NVCA 1X82A 1CJDA 1QOTA 4Z82A 1BZWA 1W6OB 3O0XA 4L8QA 1S0IA 4NO4A 3AZWA 2OVUA 4YVSB 1CPMA 1AR92 2GN7A 2O0OA 4YGCA 2DCKA 5D8AA 5C9AB 5BNNC 1C4RA 1LHVA 2VGDA 2E7QA 3ZN4A 1QXJA 2E53A 4DQAA 2QVSB 3MIEA 1BK1A 1H30A 2UWAA 1B09A 2BWCA 3J8F3 3OPZA 5K0UC 1H4GA 2G9FA 1ZBA3 2I45A 3WT3A 3WW4A 2ZGSA 2ZKNA 1SCRA 2DVAA 1N3OA 1WW6A 1SACA 1S0GA 2GC3A 3AKSA 1CAVB 1JHNA 1QH7A 4LBMA 1EPWA 5JIUA 1MQTA 3W9AA 4HZFA 2HWE1 3ZYRA 5BY5A 1AL22 3GBFA 2WT1A 1O3TA 4XDQA 2B5HA 3AZZA 3OD0A 4DXZA 5JZGB 2TEPA 4GH4C 1N3QA 5HCFA 5JSOA 4GKXA 4XJ8A 5AVPA 1RUNA 2VY0A 3MF9A 4AVBA 2VOVA 4FXKB 5LEJA 3CNAA 4JDMA 5GJ6A 1DZRA 1RUF2 2XJQA 2ZCWA 3D8CA 4N90A 2PLV3 3NWKA 4URTA 4OVEA 4BH9A 4HBNA 2RJKA 2DTYA 4IL7A 3BOWA 2HWC3 1AR82 2ZGMA 5E88A 3I59A 1OPMA 4XFBA 3AZVA 3VBHB 4A7KA 3EHKA 1ZZCA 3MF6A 3PVNA 1LENA 4AHXA 1RMU3 4Q26A 1RUI3 2BFUS 1VP6A 3TN91 3DPRA 1ZRRA 2DUPA 3U4XA 1J3RA 3QCWA 4H3WA 4LO5B 3RNSA 4R9BA 1IHMA 1AR83 1CAWA 2GALA 3WP5A 1RUD3 4XF0A 2JEMA 5DDJ2 2ZHLA 1VBA1 2CAVA 3RI8A 2BTVC 3ZYJB 3AX4A 4C1WA 3B9IA 4BYYA 2UWCA 1J1TA 2FZ2A 4RR3C 5BNNA 3ZIXA 4I30A 3AKRA 3VBHC 3AJYA 4GULA 4YZ2A 4OI2A 4CRQA 1ZREA 4AE2A 2QZ3A 2IXIA 1W6NA 4RD7A 2D6OX 1QJY2 2XLGA 2XVGA 4LHKA 1Q5OA 2D5HA 1AYN2 4LBQB 1NCRC 1Z0HA 1LHNA 2HWB2 1GZWB 2A71A 2ENRA 4A3XA 4WVMA 4Q0QA 5L19A 4WZFA 3S7IA 2BVBA 3D6EA 5GLUA 2DVFA 2BNMA 3JQXA 1IPKA 1V9U2 3RMXA 1IPJA 2KXLA 5CG8A 3SH3A 1W6MA 1MACA 3NJZA 1BYHA 4RGGA 4AVTA 2D44A 3RQ0A 3I4IA 1TE1B 4N7UA 2ZX4A 2A3XA 4G9SB 4DMIA 4IEWA 1HXS1 5BUVA 2VU9A 1BEV3 2IXHA 4QQPA 1DDLA 1MEC2 2R041 3VBOB 3H7YA 3WHUA 4MGZE 4FPLA 1G7YA 1OD5A 2ZABA 4C0BA 4Z2WA 3HR9A 3O0WA 4XMAA 5C33A 2R32A 2WFPA 4GMP0 4UBGA 3ZXKA 3J8F2 2HEVF 1N47A 3V65A 4M3CF 3MW4A 4CP2A 4HK8A 4FBFA 4QX5A 1ASJ2 2HWF1 1DU3D 2LUWA 4ASMB 3AM2A 4R9CA