3AMMA

Cellotetraose complex of cellulase 12a from thermotoga maritima
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
255
structure length
255
Chain Sequence
MVLMTKPGTSDFVWNGIPLSMELNLWNIKEYSGSVAMKFDGEKITFDADIQNLSPKEPERYVLGYPEFYYGYKPWENHTAEGSKLPVPVSSMKSFSVEVSFDIHHEPSLPLNFAMETWLTREKYQTEASIGDVEIMVWFYFNNLTPGGEKIEEFTIPFVLNGESVEGTWELWLAEWGWDYLAFRLKDPVKKGRVKFDVRHFLDAAGKALSSSARVKDFEDLYFTVWEIGTEFGSPETKSAQFGWKFENFSIDLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and substrate-binding mode of cellulase 12A from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-glucanase
total genus 59
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ammA00
2DCKA 1HIXA 4HKLA 3AKTA 3VL9A 1H4GA 1QH6A 2BWAA 4NPRA 1W2UA 1UU4A 4S2GA 3WQ1A 3WR0A 5K9YA 1UU5A 1IGOA 2B45X 2VULA 3VZKA 2JICA 2VUJA 4HKWA 2NLRA 3WT3A 1REEA 3RI9A 3AMQA 1KS4A 3MFAA 1OA2A 3MF6A 4XQWA 3VLBB 1C5IA 5K7PA 4S2FA 2F6BA 3WP6A 3AMHA 1ENXA 4S2HA 4XQDA 1H1AA 2B46X 3MF9A 4XPVA 1TE1B 2Z79A 2C1FA 1XNCA 2BVVA 2B42B 3B7MA 3MFCA 3VGIA 3VZJA 3AMPA 2DFBA 2D97A 2JENA 3LGRA 1REDA 4HKOA 4S2DA 4HK8A 3AMMA 3VHOA 1XYNA 4H7MA 3AKSA 3VL8A 3M4FA 2QZ3A 1BK1A 3RI8A 2BW8A 4IXLA 3WX5A 1YNAA 1HV1A 2QZ2A 2NQYA 3AKPA 1HV0A 1XNBA 2DCZA 1C5HA 1T6GC 1F5JA 1M4WA 4HK9A 1KS5A 2DFCA 3LB9A 3WP5A 1UKRA 1XXNA 1H4HA 1OLQA 3AKQA 3B5LB 1XNKA 3VZMA 1UU6A 2VGDA 3HD8B 2D98A 5EJ3A 3O7OA 3WXPA 3WP3A 1OLRA 5HXVA 3VZOA 3WQ7A 1XYOA 3AMNA 1AXKA 1H0BA 3VZNA 3VZLA 1XYPA 3AKRA 1REFA 2DCYA 1OA3A 1H8VA 3ZSEA 3WP4A 3EXUA 2BWCA 1BVVA 3WQ0A 2VG9A 1PVXA 2JEMA 1QH7A 4XQ4A 1BCXA 1NLRA 1OA4A 1XNDA 3VHPA 2DCJA 3WY6A 3VHNA
chains in the Genus database with same CATH superfamily
4LQRA 1S0GA 3VL9A 4CCOA 4LBLA 4AZZA 5FBZA 1M06G 4BE3A 3LF7A 4BQ1A 1QMJA 3WEZA 4QX8A 4EQVA 3VV1A 3PU3A 5B4NA 5L36A 3LOIA 3VBOA 4MGIE 2GNTA 1REEA 2FZ2A 1DZTA 2XVGA 4GXLA 4Q4X2 3RZZA 2VVFA 1C1LA 1OFNA 1BQPA 1VB2A 4NIGA 3ZXKA 4FOQA 1W39A 2YPDA 4DNYA 4QXBA 5LW9A 1RUC3 1EUTA 1CGPA 1HN0A 4OMDA 5LA2A 1ZBA1 1RVF2 2ZMNA 1TE1B 2YYOA 5FUIA 3U75A 3AVRA 3KQ4B 1FX5A 1JZ4A 3PTRB 2RS13 4P9LA 4Y4YA 2PMWB 3BTXA 5F7UA 1RYYA 3OUIA 5KC5A 3BOPA 3TEZA 3VD9A 4YVWC 1FMD2 5JPMB 1UO9A 4RN5A 4UW3A 1WLCA 4Q1RA 1UN1A 4BIOA 2C0ZA 1W06A 2DUQA 3RRDA 2IUWA 1AR92 3NKTA 1EYBA 3UV9A 2XUMA 2A1XA 3HJRA 2LW8A 3JB8A 4L9BA 4BK4A 1NCQA 3CEWA 1S2BA 1UIJA 2QQWA 4LKEA 3TEYA 2AEZA 5A80A 3BYWA 4XJ8A 5FBJA 4M01A 1S2EA 2DVDA 5KHIA 4XIOA 4COYA 1YYNA 1EPWA 2RS51 2VNVA 4PI2A 1RGSA 1UYXA 4PF1A 5FPUA 4XILA 5I8SA 3HMYA 3HR9A 5GLZA 1JTZX 4HETA 3MIFA 2G9ZA 4FI9A 4FP2A 1NXMA 4AR2A 2QBXA 3LEMA 4XBNA 2A6ZA 2A6VA 1LECA 4J1XA 3RGBA 5EYYA 2DWRA 3WP5A 2PN5A 1VBC1 2OZJA 1UY4A 5FZ7A 5DDJ3 4M0NA 3CO2A 2X53S 4XDOA 3KQRA 5FO9B 2VW0A 1GSLA 4HBNA 4GZ9A 3B69A 3CIHA 1SFPA 1KFXL 3BI3A 3NJXA 2YBKA 4UW5A 3ELNA 4QHOA 4AI3A 5G04L 3POEA 5LY1A 1RUOA 4E2SA 4V2WA 3T3YA 2Z42A 3AFKA 2VOKA 4MGZE 5AFEA 3WQ7A 3OCPA 4D7YA 4XXPA 3H8RA 2VO5A 2RJLA 3J8F2 1DQ0A 1TMF2 4YVWB 2XB6C 1UYZA 1TQ5A 1UOBA 4CDWC 1C8NA 1SLLA 3T2QA 2B9VA 4GQ7A 4XMAA 4NIAA 2EAKA 1PGW1 2X10A 1W2TA 5FUPA 4ZXEA 2WL1A 2BWCA 2C5DA 3OBZA 4ORFA 3RYKA 1FOD3 1SCSA 3I2JA 5I93A 1F8VA 4QB2A 1VE0A 1OA4A 5LBBA 3WY6A 1S0DA 1HB4A 5LEKA 3WNMA 2UURA 4P02B 1LOFC 1ZA4A 1W9YA 3ETQA 4Q0UA 2GC0A 4RHV3 5JSOA 4V2VA 1AR82 5BY5A 2P1BA 2CL2A 1FT9A 3IKWA 4AVAA 2YC2A 3LIHA 4FPOB 3WW4A 5CNAA 2VMEA 1HRV1 3MLKA 4ZONA 3SISA 2AACA 2NLRA 1LB2A 5FPAA 3TAYA 1RXGA 4XFFA 3EJKA 2XHKA 3CZJA 4YGCA 1U0AA 1IS4A 2VCBA 4XFCA 5FYMA 5BYNA 1Y43B 5C70A 3DL3A 1W9WA 4D6RA 1BEV3 4YW2A 3Q8AA 2XVLA 5JCTA 4QB6A 1LHUA 4LO4B 5J37A 4IEWA 4QX0A 3R4UA 2Z79A 1W6OB 5JI9A 2WO3A 4OMCA 5LA9A 4EZ4A 5FZ3A 2VOTA 3O5SA 4FFFA 1W2AX 4Q27A 5T50A 3ZDSA 2CNAA 2FD8A 2ORZA 2O1QA 4EE2A 1Q8PA 4NOTA 3P1IA 3USSA 3SCGA 3AYCA 4DO0A 2VC9A 2XJVA 3B00A 4BK5A 4N7UA 4OZXA 4HKOA 2WNEA 4GB33 1QKQA 4QMAA 1H1MA 2RJ2A 3A0KA 1UY1A 4JV4A 4LHSA 4E27A 1H8TA 5F37A 2RMU3 2R041 1IPKA 4XDQA 2VUDA 4RGAA 4YZ3A 1DQ4A 1NG0A 3VHOA 1WCUA 4C91A 1OF4A 1UCXA 2WWUA 3T1MA 4I2OA 3L2HA 4BQ2A 4NIHA 2WS93 1WLTA 4HFSA 3RI8A 1GMMA 1QNWA 2BOIA 4MHRA 4AHZA 4XF4A 1QJEA 1RUJ2 3TNPB 5EPAA 1E5HA 1AL21 2VQAA 2YU2A 4GULA 4IERA 5IAVA 1QU0A 1SLTA 2ET7A 2RG4A 4Q26A 4UFKA 3MLLA 2J1EA 4YG0A 5JPNB 4Y5TA 4Q4V2 1LAJA 1SDWA 4HN1A 4WM7B 4AXOA 3UK9A 2BGCA 5FY5A 3WNPA 4QPIC 1AZDA 4AGVA 5GLUA 4XCBA 1C4RA 1VR3A 2UY9A 3KT1A 4QGLA 4BQXA 5C3RA 5FXWA 3J8F1 2OQ6A 5GLWA 4CVUA 5A3LA 4YFZA 3W5MA 3RZMA 1ND3B 2GC3A 2H0BA 4BXFA 1ZZCA 5HCHA 1HRI3 4DUVA 3OD4A 4GIQA 1ULGA 5BNOC 2VD7A 4EZHA 4NHYA 3WG4A 5BNNB 1MZ6A 4NRMA 4X8NA 1OUXA 1XSQA 1F5FA 2D43A 3PLQA 4P9IA 4Y1YA 4AVTA 2ARBA 4IQPA 4LKFA 2DCYA 2YV8A 4UYBA 2RM22 5FZFA 3RMXA 1W8HA 1JUHA 1R64A 2WQ8A 3HBKA 5L7OA 1JH5A 5C3QA 2P3KA 3RPQA 1CWPA 3UETA 2ZGMA 4EN0A 4JKKA 1R083 3N9OA 3KV5A 3VBFC 1QJU1 4MVTA 3URFA 3IPVA 1PZ8A 2LROA 2CAVA 3IMMA 4MUVA 1TMF3 2VBPA 3AM2A 2JG8A 2YC0A 3LQCA 4Y1VA 4FOVA 3BALA 2D7FA 2BNNA 1BYHA 2VPVA 4MGQA 3AZVA 3WNNA 2OUHA 3IWZA 4LHNA 4JGZB 3FZ3A 3C7EA 4M3CF 4XURA 2XJQA 4JGZC 3KV6A 1Q8VA 5LB6A 2RDRA 2QFEA 1SBFA 1R082 2Q8OA 4I09A 2XBO1 4OCTA 1S0EA 2IVJA 2CDOA 2OA2A 2VL4A 5IK4A 5CVRA 4AAXA 1BEV1 5CU1A 2F4PA 4K9SA 2R30A 3UL2A 4GWNA 5EP9A 4BIFA 4YM0A 1US3A 2WNVC 4Y3OA 1PIV3 2DURA 1SDDB 5IW0A 2VTXA 3SH5A 1CR7A 5CIRA 1UL9A 4H7LA 4LA2A 5FZ4A 5GZDA 5B2GB 1U5ZA 2XL9A 2XLGA 4NUBA 3B7MA 4DEVA 2BGPA 3VZJA 1DQ6A 1RVF3 2Q5TA 1VAMA 5CFCC 3E5XA 2VZOA 4IV1C 3O1MA 2JENA 1AYM1 3FFQA 3LGRA 4LO7A 4HN0A 2QJVA 3SH4A 1W6MA 3K4DA 2IFWA 3AL5A 3JCIA 4K20A 4WM7C 5E16A 1DQ2A 2YFUA 4LBMA 4AEDA 3MZHA 5E1RA 1NCRC 2WAOA 3KSCA 1GOHA 3VKFC 3ETPA 2C9AA 4A6SA 1DF0A 4Z2AA 3D3AA 4F8AA 3NJYA 1DG6A 4WZFA 3I59A 4P9XA 2DYCA 3FL7A 3KT7A 4NN0A 1QJX1 2ERFA 4CUBA 1BHGA 3SC7X 1FMD1 1W6OA 3WDXA 1VRH1 3K77A 4IEYA 4YG3A 1MS1A 4IEUA 5A6YA 4LOSA 2R073 5BNPC 2CDPA 2VZVA 3HVDA 2J42A 3A23A 3RVHA 2Q8DA 3JU9A 3HT2A 2NZ9A 4Q29A 4URTA 5FREA 1RB8G 2GMEA 1LCLA 5FPLA 4DY5A 5C3OA 4N7IA 1BMV2 1PNFA 2FDJA 4MHUA 3P3PA 3ZFFA 4WM8A 5FP3A 3RZGA 1W8OA 4H3WA 2C4XA 1JODA 1H2LA 3VZMA 1CX1A 1T6BX 3VBHC 3JD73 4FOYA 3CJXA 4HOOA 2OKXA 1KXGA 4K8FA 3SKVA 1PO11 3K46A 1K12A 4R52A 4BHPA 4JTNA 1OQEA 1NUKA 2C6SA 1PMIA 2XWBB 1G6NA 2PHXA 1MS3A 1POQA 1HDKA 2RS11 1LOEA 4KWUA 3ZFFB 3U0ZA 4PBPA 1ENRA 1MVEA 3NSTA 3RWKX 1D0GA 1WD3A 1QJY3 2XKPA 4XTPA 1ST8A 1G7YA 1HB3A 5JDBA 1JYXA 3V0AB 3N9QA 2QNKA 2VXRA 5TSWA 2W3JA 4Y20B 2YGMA 4OQ8A 5FO8B 1S0IA 5L19A 1QJU2 3D6EA 2CAUA 1R1A3 2I07B 3J26N 4LITA 1NLRA 4Q0PA 2Q1FA 2R0FA 3A7QA 2YUEA 2BERA 4IUGA 5KXEA 2JB4A 3ACLA 4OI1A 3BUCA 2W52A 4FTSA 4RGKA 5BNQA 3AZXA 3MBWA 4EWEA 1R092 1YQ2A 3FMGA 5IYYA 3WR0A 4CEWC 1JS9A 2B45X 3D5OA 3ZXEA 2HWC2 4JAAA 5JMOA 4IL7A 1QNYA 4HLTA 1CX4A 4HKWA 3VDDA 3ZVXA 4AF9A 2GNBA 1TME2 1LNSA 1KS4A 2J1AA 3AK0A 4AVVA 3MF6A 4CEYA 3MHZA 2UY8A 3ZM8A 2JDYA 1UOGA 2OX0A 2WN3A 3I2FA 1GLHA 2ZGOA 1L7RA 4DQAA 1HRV3 1D7PM 4BPZA 1Q56A 3S0MA 1XNAA 4KMQA 2HWE3 5DQ0A 3VBRA 3MF9A 5A7SA 4XPVA 3W21A 4EN9B 5F3CA 5GZGA 3SKJE 4CU8A 2W2IA 1LOBA 4LR4A 3KHCA 2VW2A 4ATEA 1FV2A 4FBFA 1EY2A 3THCA 1FNYA 3WQBA 4C1XA 3VKLA 1ZYBA 3UKTA 1RMU2 3H3UA 4A7KA 2EIGA 1MACA 4HXCA 5A7NA 1KRIA 3I2GA 2XG3A 4QXKA 1VBD1 3ZKUA 4P9JA 5FYHA 4A3ZA 3NAPC 1DBNA 4N43C 2LUWA 5E88A 1STMA 2RV9A 2GP3A 1DLLA 2OZ6A 3POYA 3ZPYA 4XYXA 3FUQA 4COWA 2A6WA 3ROUA 1GZWA 2FHRA 3CNAA 3MIDA 3POBA 1AR72 2YHJA 5C9AB 3ORJA 1A6CA 4JVAA 4XZUG 3AP7A 1RC6A 1LTEA 2XLAA 5FYBA 3SEEA 3T30A 4FQ4A 4CDUB 3CDZB 5HV0A 1LGBA 1H9WA 1BK1A 2A3XA 3KGLA 5A6QA 3OBTA 1O3RA 2WZR2 1WA6X 4YZ4A 2NQYA 2HWF3 3GZTB 2YB7A 2DCZA 4AEDB 4W50A 2X29A 1EV11 1GU3A 5A7WB 5T5JA 2X05A 4HVQA 1OURA 1WMFA 4OVEA 1X33A 4WM8C 5J96B 3ZFFC 4O9GA 4BCUA 3S5AA 1YFXA 4E4HA 2VTFA 4ZU4A 3N9LA 1IQDC 3T08A 3HPNA 1UKRA 3UGGA 2VZRA 4CP9A 1MQTC 5FZ1A 4I0BA 1RUI3 1ZBE2 1N1SA 2VGDA 1BKZA 2BPA2 1IKQA 4A44A 3GNEA 5JOZA 1PVC2 3GALA 4ARYA 4D69A 4I0WB 2WSVA 4Y20A 1UMIA 5FTTC 1QXJA 2WWSA 3POFA 5J48A 2HYKA 3I3MA 1ZREA 1RUH2 5C6CA 1AXKA 4RQPC 4HPKB 1WCQA 2GDFA 3O0WA 5F6LB 4FSJA 1XB9A 1NCRA 2LALA 4NROA 1OFSA 1PIV2 4QXCA 1W6NA 3NKGA 4RS5B 3WHUA 4L99A 2ZX4A 4WM7A 5FK7A 1QJZA 1SFYA 2GN7A 2PQSA 1RUC2 2RMU2 2V09A 4PT6A 1NYWA 5F3GA 4AGGA 4CDUC 2W91A 1GICA 4D7TA 3T0BA 3M8LA 2K2SA 1VBA3 3VHPA 1YI9A 4W6XA 1T2XA 3O1OA 3BPZA 1TME1 1GQPA 1DGRN 1JUIA 3B94A 3DUIA 2Y34A 4XFHA 3ZXAC 1WMEA 1H2NA 3KF3A 4OI2A 5FOBB 3WF2A 4YW6A 2QQOA 3WF1A 5KBFA 1O8PA 1AYN1 4YG6A 1H30A 1KFUL 4QDQA 2JICA 1JMUB 4JGZA 5JZGC 1JI6A 1UYPA 1YFUA 2XVKA 4BISA 1V6MA 3BCWA 4HVOA 4YVSA 4OHYA 4CUAA 1G9AA 2ZBJA 4AFDA 2G9GA 4GA9A 1F9KA 3AXDA 2UYBA 1AL0G 2Q0AA 5LBFA 4GJZA 1OUSA 4EV0A 2ZTNA 5ISLA 1URXA 4K21A 3H1YA 5CAZA 3CLPA 5FPXA 1ZRFA 4KWLA 3MLJA 2C1FA 3K2OA 3IPVB 5F3IA 2Q8EA 1HRI1 3T2TA 2XBO2 2D3RA 4NWVA 3GHNA 3T2PA 2D6NA 2IZWA 3VBFA 5HPOA 3ZYHA 3I4IA 3PVEA 4CYDA 3WF4A 4KL1A 1CPNA 2EALA 3D82A 3UT0A 3H3LA 2R16A 5J3UA 3EO6A 5DAWA 1JZ8A 2IXCA 4L97A 4QQHA 4S2DA 4F3JA 1CAXB 2IC1A 2VMGA 3NV1A 4IEVA 4HK8A 4XJAA 1U12A 4ISRA 3ZYPA 1O4ZA 4LOTA 4G9SB 1BK0A 3U4XA 1NA1C 1Q8SA 3V0AA 3LDBA 1MEC3 1NA1B 2J1SA 1K5MA 2ZHMA 2A3WA 5KHGA 1O5LA 1U5XA 5EIYB 2KA3A 2QZ3A 2JDZA 4LO8A 4CP1A 1E5RA 5F2SA 5LBCA 2JD4A 1YNAA 4K1YA 2HWB3 5L9RA 2SBAA 2ZHNA 4CU7A 1AF9A 5F1RA 1AXYA 1JYIA 5FZ0A 3ZFEC 2D6PA 5CFDB 2BNMA 3ZFEB 2HWF1 5FDBA 5T3NA 2FMDA 3LWCA 3VBUC 3MUZ1 1F5JA 3OYWB 3ALQA 3PVOA 2BFUL 3PIGA 4LBNA 1SHWB 2B4KA 1OT5A 3UGHA 3VB9A 1VMHA 3MDPA 3ZN6B 1DFQA 4AFAA 4A7ZA 3BGAA 2MEV1 5ABJA 5IVCA 4LE4A 2HKXA 3KV9A 4XTMA 5FZGA 3CU7A 3E5UA 5IVBA 1H4HA 4Y1ZA 2ZX1A 4Q8KA 3C7OA 2FDHA 4UFHA 3QD6A 4XJZA 5DZFA 4K3UA 1UZWA 3GDBA 3LA7A 3TBDA 3KM5A 2HWD2 5C8CB 4C0HA 3I2IA 4Q4Y2 3I3DA 5EJ3A 4CDQB 1KITA 1NQDA 2VM9A 5DAQA 4EN6B 4PQ9A 2OW4A 3CMGA 3U37A 1Y3TA 1B35A 1Q8OA 4J25A 1PGSA 1AR61 1KJRA 1NT0A 2K46A 3MW3A 3T0AA 4XBLA 3ZYGA 4URAA 3VZNA 1WW5A 3U1XA 1MZFA 3NQHA 1H8TC 1RVF1 2J22A 1AX0A 1REFA 5FLHA 5FYUA 4HPKA 4LUMA 3N7JA 1OBNA 4Y5Z0 5FP8A 1G9BA 1LGNA 4MO3M 3PTYA 4XFGA 2UYAA 3SNMA 5A3WA 1PK6A 3HT1A 4NR1A 2WRAA 1I5PA 4Q4V3 3PUAA 1ALYA 3LD8A 4FVVA 4GH4C 3ZYJB 4MXWB 1RJ8A 3JBG3 4CRQA 3KMHA 1DP0A 2PFWA 3W20A 4CDXC 4PI0A 3AZWA 3NNGA 4GWMA 4GB31 1ZZ7A 4MLOA 3INAA 5LZ6A 4AFMA 1OXCA 1QY4A 3PMEA 2BEOA 4N9IA 2GALA 1LOAA 2WS92 4IV3C 3W9AA 2PAKA 3O0VA 3N36A 2NM1A 3J7NA 3MIGA 4M4PA 1S4CA 4CP0A 2VVEA 4XUPA 4Y22B 4C1WA 1WMXA 3NNLA 2YBPA 4Q4X3 2E26A 5KXBA 3IZOA 4YW3A 1XQNA 4FPEA 1ZRDA 3LOBA 4IV3A 2RS31 2ZCWA 3WP6A 3AMHA 5LATA 3L9JT 4KNCA 2NP0A 1UWWA 3PURA 1LOFA 1YWKA 4I02A 1Q43A 4YRDA 3ZFGC 2WA3A 4B4QA 5CZKA 4L92A 3JD71 4XETA 4CDXA 5C4WB 3RZKA 3D0JA 5C4WC 4DPNA 4GH4A 2R32A 4JC1A 1XNCA 1RUH1 1HQWA 4FXGB 2VTXJ 3WNKA 3O1PA 4P9YA 4XIKA 5KR7A 2Y6HA 3MFCA 1EUUA 2XJUA 2ZGNA 5FK8A 2WSUA 1WGPA 2DFBA 4IEQA 1GWKA 1AJOA 3IDAA 2HWE2 2WZR3 1YIFA 4RGGA 3WLUA 1DIWA 2D6KA 1REDA 5AVPA 1LHWA 4NHLA 1OOPC 4PLOA 3FBMA 5DAVA 2VH9A 3EYPA 1RHI2 3GCWA 1JOPA 3I8TA 5FYTA 3T4VA 4IESA 3UESA 5IVVA 1AJKA 4YZ1A 3SH3A 1ZA7A 5C71A 5IWFA 4RSUA 4AL9A 5EYXA 1WBLA 1JYWA 1FATA 1YFYA 1QDOA 1RMU3 1HV1A 1FPN3 5JI7A 1QXRA 5BV6A 4LK7A 5JOWA 2KXLA 4MXVA 3AVSA 3VDCA 4FO9A 5KXDA 3SLIA 3BODA 5L9VA 1KS5A 1B35B 2QQLA 2V73A 3OY8B 3PUHA 4QD2A 3RFRA 4FTEA 1J3PA 5CKMA 4ZZ8A 3K4ZA 4XCAA 2PLV3 4K7JA 1JHNA 2PLV2 3RDIA 1IKPA 3OD0A 1ZM1A 2VQUA 4NPLA 3AL6A 2WBKA 4RFRB 5HV4A 3GJAA 3MV11 3ZFEA 2WNUC 4CSWA 5I0SA 5FYZA 1VBB3 3FBYA 4LE3A 4Z2WA 2W39A 4FCAA 4Y24A 3WXPA 1ODNA 2YROA 4Y26A 1OOPA 1RUI1 3DN7A 5DG1A 5FR3A 3FJSA 1NCQC 3O1UA 1K5MC 2GP5A 5BNNC 2WDBA 4J1WA 1RUF1 4LHKA 4P14A 5CKQA 4DRVA 2XBO3 4QB1A 1PVC1 3IM0A 4XC9A 4BQ3A 1D4VB 3MEPA 5T5LA 2ZGRA 3OSDA 2DUPA 4COVA 2IXLA 1W90A 4XUQA 5HI0A 3TEWA 5K8SA 2E31A 5C4WA 4N90A 1W0PA 4NO4A 4UF0A 3ZFGA 2VZQA 4JHTA 3VBRB 3GBGA 3ZYBA 5IATA 1VB4A 4R8HA 1KGYA 1BCXA 3E97A 1GWMA 3H7YA 4XQ4A 2CU5A 3POGA 2BVBA 5A7PA 1QJY2 4XUTA 5DUUA 2B7YA 4BQYA 2DCKA 3VD4A 3TN92 5L7OB 4MX3A 4P5HA 1GKBA 1CONA 1MZEA 4FPGA 1J58A 4B4PA 1WCDJ 4NPMA 1KDMA 1CQ9A 3PVNA 3B9IA 3R0RA 3GBFA 4CUGA 1PX3A 3VBOC 3DGTA 3NAPB 3POSA 1KEXA 1NKGA 3QOPA 4MXWA 3TB0A 4CXWA 5JXJA 2CHHA 3HN3A 1QJX3 4AEJA 3VUOA 5FY9A 1R1ZA 1OD3A 3ZOIA 4D6QA 4EJRA 1UIKA 1WA4A 4ZZ5A 2ZOEB 2HWD1 2JG9C 3MPPG 2QQNA 3R4SA 4DUWA 1FI2A 5ACA1 1O6UA 2ZGUA 1OMIA 2YDEA 3GGLA 3SHRA 1AR62 1DLCA 4FFGA 5JSPA 4GMP1 4FFHA 4COUA 3ES4A 4CU9A 1A8DA 2EICA 4P5YA 2UU8A 4EWDA 3IT8A 1L7LA 3SCHA 1QJX2 1ZZBA 2KM2A 4WZCA 1B35C 4XF0A 2OPKA 4PDWC 1W8NA 1PZ7A 1ODMA 5T55A 3SXWA 3N9MA 2A75A 4YM2A 1NY72 3AMMA 1X36A 4RQPA 3HAGA 5DMYA 4JKMA 3L2YA 4LPLA 3VL8A 4KGGA 5J36A 3C7HA 1UOJA 2E6VA 5I91A 4PCRA 3ACFA 3VHRA 2DUOA 2ZGTA 5BUVA 5FWEA 3ASIA 4RS5A 2QZ2A 5GALA 4LMFA 2TEPA 5ABJC 3M7AA 4KQ7A 2HWF2 4SBVA 5DAXA 5FXZA 4YM3A 5JXHA 3WINE 4XOGA 1D2QA 1Q5OA 1ZBE1 4Q0SA 4IE5A 5A1FA 3H7JA 2GMPA 3ME2A 4ARXA 1MS9A 5FY7A 1JU4A 1J83A 1VJ2A 3CL1A 3KWVA 4H55A 1JYCA 4IEZA 2XQRA 2IXKA 3AC0A 3FUOA 3WSOA 2XOMA 2ZS6B 1MR5A 5FY0A 5K4LA 1RUG2 1U5YA 1PK6B 2JE8A 3AKQA 2ZX0A 4ZPIA 5JSRA 4GAZA 1RUF2 2IXJA 1AL23 3SEPA 4JGYC 1BBT2 2MEV3 2PAEA 2XKOA 2D98A 3TWIA 2JWPA 3VBHB 2N7GA 4C8DA 4UFLA 1GNZA 1ULEA 2W94A 2PHLA 4N53B 4OUMA 2TUNA 3TEXA 4E4ZA 1YJKA 2VVDA 1JXNA 4FFIA 5F5AA 1W6QA 1ENSA 2WINB 3AMNA 4P00B 1UZVA 3OG2A 4NHKA 1O4TA 2OYZA 3LFIA 1PM7A 4PJYA 4N43A 4WVMB 1GV9A 3H42B 3VKNA 2OIIA 1GYKA 4KWKA 2XJSA 4XF9A 3OUHA 5FZAA 1UQXA 4CUCA 1O3QA 1BVVA 1O5UA 3WQ0A 1SQ4A 1VBD3 4D3WA 2ZHKA 3MPBA 1AR81 2QE3A 1QOSA 3AJYA 1W3XA 1APNA 4GH4B 1IS5A 2ZGLA 3ZYIB 1O4YA 3ILFA 5JR7B 4OQ9A 1XRUA 2VUCA 4X6RB 3S5QA 4CXYA 3F95A 1TVGA 4QPGA 2CYFA 2WUHA 4HKLA 4LEJA 4YVSC 2ILMA 3U14A 1GNYA 5ERLA 1HB1A 4DXTA 3BU0A 1QXPA 4K40A 3ZN5A 2P3IA 4W6WA 3P6BA 4QQPA 2VBDA 4IDZA 3GZUC 2WLQA 1OVSA 2ARCA 3NW4A 4FPCA 1Z7S3 4Y22A 4CEYC 3HNBM 5FQ0A 2JE9A 2OPWA 3VBSB 2JKBA 1OA2A 1RHI3 1W03A 4AAPA 3R05A 4GMP0 1HLCA 2D40A 1FOD1 1POV0 1XE0A 3AYDA 4XFBA 3RZHA 4AI9A 1IOAA 2AYHA 4XEZA 1DYKA 1FV3A 1IG3A 4BQ5A 4LIVA 3DPRB 4BWOA 3RZJA 3B02A 2JDPA 3M3CA 4E2QA 2RS33 5FPZA 2DTWA 5KHJA 2VCCA 1C8M2 1QIQA 3H50A 5B4XA 2PHUA 2ZGQA 4CCCA 1WCSA 1V6KA 3NV3A 4ZY9A 1RUJ3 2D97A 5FP4A 2W1UA 4XHXA 3O1VA 2C24A 1BEV2 1E5SA 3TOJA 2EIEA 4L8QA 2BDRA 3JD72 4QDRA 4R4XA 5FY4A 1IZ3A 1VP6A 3THPA 3OB8A 3E6BA 4L0PA 1X9TA 5FZEA 3AZYA 2FDIA 1OHFA 3K4AA 2O0OA 3MV01 3FLPA 1ND3A 2B9UA 4CPBD 5CG8A 4R9DA 4ASLA 2P4EA 3ILRA 3BB6A 1SG3A 1COV3 3MO4A 5FMCA 4A41A 1N1YA 1UXXX 1H1IA 1JN2P 2JDAA 4GKXA 2BRTA 3AKPA 1MPXA 5FYCA 2NMNA 5FZKA 2CGPA 2VBBA 2R072 1UZ0A 3BTAA 5FQ0B 2VU9A 5AC91 2ZMKA 2LM3A 5I0DA 3POIA 5C9AA 1BLZA 1TNFA 1PO21 3ZYFA 4C0BA 4O7XA 1HB2A 2XLFA 5CB7A 1HJGA 5IVJA 4NHMA 3DEMA 2XQXA 1OVPA 1CJDA 3WW3A 4YFWA 2WO1A 4M3CB 2DVBA 4BMEA 4YYOA 3FHAA 4QPGB 5F6KA 2ZGPA 3HNYM 3TNQA 1VRH3 5BNPA 1OSGA 1S0BA 3E6DA 1ND3C 1CZSA 4CCMA 2VNGA 1UY2A 2W47A 1LKNA 4DFSA 5FMDA 5ACA2 5FLIA 1NZIA 1OLRA 2DVFA 1CPMA 4MG2A 2EIBA 1RINA 3VKMA 2E7QA 1K5MB 2ATFA 4DZGA 5HXMA 4Q0VA 2ZJCA 2HH9A 2BBAA 1OC1A 3JUUA 1S2KA 1DQ1A 4AEMA 1XYPA 4XACA 2CGNA 1S1AA 4U2AA 4CEWB 5KHKA 1AX1A 2VW1A 5G05L 3CQOA 1YQ5A 2UWBA 4ISQA 3HQXA 3RQ0A 1CD3G 4Y1XA 4FPFA 2YGLA 3LKJA 3VBRC 3IMNA 2FCTA 1MS5A 2ZAHA 2RR12 2YBSA 1ZRRA 1DDLA 1WLDA 1IQAA 4BH9A 3ZYRA 4LBOA 1CAUA 1OKOA 1VAKA 1ASJ1 4IEPA 1G9CA 2WNVA 1QJY1 1QWRA 1WMDA 2VMCA 3LCPA 4FPLA 4FPHA 1VAVA 3THDA 1F31A 1DU3D 2W87A 5EZWA 1UU4A 3WQ1A 4RYDA 2VOVA 1GZ9A 1PMHX 3R6SA 2FQPA 1HQLA 1IGOA 4CEWA 2VULA 1TNRA 1MEC1 1LGCA 5A32A 3CBNA 1LESA 4Q4Y3 1A8MA 4QPGC 2DBIA 4SLIA 2WABA 4Z07A 3X29B 1R081 5EXOA 4QAWA 1ACCA 1RHI1 2AR6A 2B8MA 2HWB1 2WNUB 4IGPA 4XAEA 4S2FA 5DDJ2 5K7PA 3D4KA 4NE9A 2BU9A 1YQ8A 1GZWB 1X8EA 2QQIA 3AP9A 5JOYA 5F8PA 2HWC3 3U10A 1PM4A 4BQWA 4BXSV 3NO8A 4DUXA 1BBT1 1V6JA 4XJUA 3OEBA 1R093 1UXZA 4YZ2A 2HBUA 3I54A 2D93A 4ZU5A 2WT0A 4KGQA 2D5FA 2DVGA 4CP2A 5FZDA 5A33A 5A1LA 3ITQA 2UWCA 4X8PA 3BU7A 2RDSA 2G4IA 2ET1A 3WG2A 3F2ZA 5ACA3 4F7ZA 3VKOA 3SQOA 4WM8B 3WV6A 2PHFA 3GXUA 4GMP3 4GWJA 3V65A 1DYOA 1I1EA 5KC6A 1AR93 3VBFB 3KS7A 4UFJA 3AKSA 4QM9A 3VBHA 4FQZA 2P34A 1YIPA 3WNOA 5C5UA 1PIV1 3N4MA 5BNOA 2QUOA 1GWLA 3ACGA 1J1LA 3PDQA 3NMBA 2PHDA 5KXCA 5LA1A 3AP5A 2AREA 2V72A 2R1DA 2J1RA 3USUA 1CAWA 4PQQA 2RJKA 1LOCA 3GBWA 4FPJA 2NN8A 4Y1UA 5DXDA 1LULA 4WVMA 2W5FA 4INDA 3VD5A 3ZXDA 1XJAA 1D4M3 2ZEZA 2XH6A 3WF0A 4JDNA 5L9BA 2JIGA 4RS5C 1XXNA 4MYEA 4UBGA 5HBAA 1LODA 4AFBA 4BLIA 1XNKA 1E5IA 1JYVA 1HXS1 4WV8A 1UU6A 2Y60A 3FE5A 3KCXA 5DUXA 3MUY1 1FAYA 3P3NA 5F3EA 1AYM2 3KLSA 1QOOA 2CWSA 4MGYE 2ZPXA 3ZIXA 2JDNA 5HXVA 4AEDC 4LKDA 4MGKE 3VZOA 2YU1A 3S57A 1OI6A 2WQZC 2ZA9A 3EB7A 2KR2A 2Y0IA 3K48A 1XNTA 3O14A 1C8M3 2WZPP 4IV1A 4HANA 3TN93 5CFCA 5JXGA 5FPBA 3WDVA 4BZ4A 3IDCB 4YW4A 1H8TB 3POJA 3UJQA 1OA3A 2B5HA 4QKDA 1VBA2 5T52A 3VN4A 1ZZ8A 1SLAA 1X7NA 4LBQA 2MPFA 3OPTA 1VIWB 3GYDA 3NV4A 3ZSEA 5FY8A 1I3HA 2WO7A 4A42A 1W2OA 1YJLA 2JG9A 1OOPB 2VOWA 5IJRA 4AFCA 3HQRA 1SLBA 1X82A 5DDJ1 4XFAA 3M1HA 2ZEWA 1PO13 1OQDA 1QH7A 2WT2A 4YNIA 4BOWA 1I9RA 5IFPA 4A6OA 2PAMA 4A7YA 4IGOA 3WCSA 1S0JA 1TZOA 2W92A 3E6CC 1UPIA 1AR83 1XPWA 2E53A 5FY1A 2H0VA 4HT1T 4AYUA 1JOBA 1GP6A 2QTWB 3Q8BA 3WD5A 1KD7A 4ITCA 1JZ3A 1ULCA 3LSDA 4IE0A 5LASA 3SCFA 1MZ5A 4Z1VA 1RMU1 4WBBA 1XE7A 3RI9A 1VBB2 1W6QB 1ZZ9A 5FZHA 4NIDA 3M3EA 1UZZA 4KWJA 1FOD2 3IDEA 4LIUA 5A7QA 3KT4A 1FPN1 4XXAA 5F32A 2VNRA 2BUKA 2WS91 1F15A 2Q1ZB 2JJ6A 3WVJA 1WKYA 2VOXA 3WDTA 1LJ7A 3VDBA 4QQ2A 3J7HA 5FCCA 4ZKTB 5L7OC 2XONA 5C33A 1PHMA 1W8WA 5T54A 1XC6A 3AMPA 3ZXLA 3ZSMA 5A33B 2B39A 2BNOA 1QQP2 2E7AA 3H3ZA 5BNNA 3ZN4A 1LU1A 3PJQA 1HRV2 4MV2A 1UOFA 2ZXQA 3ZKYA 1WBFA 1VBB1 5FKCA 4LO6B 5FOJB 3BIWE 1RUF3 2E63A 3QH6A 1MS4A 2A7AA 3AFGA 4WVZA 5F5CA 4GALA 3WDWA 2LS6A 3PUIA 3CJIC 2Y6FA 4LNVA 4CU6A 1ZNPA 2WNUA 5FZOB 1LEMA 1POV3 3MGUA 3M4FA 3DYMA 3WF3A 4EN8B 4KH9A 2BW8A 4TZDA 5BXXA 2E9QA 1RUD2 2BBVA 1YLLA 4LBQD 2W1WA 4B29A 3KVAA 5IK7A 2WQ4A 2Y8KA 1C5HA 1V6LA 3LEKA 4XW3A 1JYTA 2KD7A 3DXUA 4PIYA 1J59A 2GH2A 2OXBA 4R9BA 3KZ4C 5IUQA 3J7MA 2G9FA 5GZEA 4XUOA 4AQTA 1Z7S1 4G3YC 4CDWB 5HCFA 5D2AA 4BQ4A 1CAUB 2PYTA 3MI8A 3U07A 5FYYA 2RVAA 3JQWA 3OGRA 5H9SA 2AC1A 4AHXA 2MNGA 2RMU1 4TTGA 1KQRA 1WLWA 4CZSA 2O14A 1ENQA 1V9U2 2JD9A 3A4UA 1HXS3 2NMOA 4QU1A 1YUDA 2VE1A 2XUEA 1QHDA 3O7OA 3T1LA 2GNDA 1V6NA 2W95A 3HIFA 3RWNA 4BMBA 1VALA 3WCRA 1AHSA 1N1VA 4XMIA 2A73B 4CTEA 1SMVA 1D0HA 5CKNA 1NCQB 2H6CA 2GMMA 2QCSB 2RS12 5C5TA 4YSFA 1EAH3 5AFBA 1CAWB 4HONA 3V56A 1H6YA 3G7DA 3WHTA 3C2UA 1NOVA 2R063 1QJFA 1Z0HA 2SLIA 3WW2A 4CEYB 4P08A 5FJKA 1PO12 5FWJA 4QU2A 4YGDA 1PZ9A 1W6PB 3ABZA 4PF5A 4OFGA 3H8XA 5A7WA 3C7FA 5SV8A 1AYN2 2V4AA 2HEYF 5LRSA 1OPMA 3PUSA 4AQ6A 2VG9A 2WYFA 4I30A 2A71A 1AR71 2WR9A 4LTAA 2XL7A 1UZYA 5CA6A 3NNJA 4FT8A 5DG2A 4R4ZA 2CWMA 1CN1A 5F5IA 1ZBA3 2ZGSA 3DKWA 3K3OA 4OUEA 1QH6A 2WZEA 5K0UA 3DYOA 2C26A 4V1PA 4B4RA 4PIZA 3FX3A 5F9TA 5K9YA 4CXXA 2VUJA 5GKAC 1YQ6A 2CGOA 3ZMOA 3PJYA 2F4LA 3AMQA 3IIIA 2DBNA 3GZEA 1Q3EA 5C3PA 1CIYA 1BJQA 1C5IA 2JDHA 2XPJA 1O3SA 2EXKA 2TNFA 1ENXA 4UFMA 1PK6C 2DCTA 3LA2A 1LENA 1D4M2 5LRRA 2CTVA 1IS3A 5IHRA 1AVBA 5A3NA 3O0XA 1W2NA 3FLTA 4IETA 3JB4C 3DV8A 4HZFA 4AVCA 1XE8A 4YPJA 4LHLA 1VBC2 3KV4A 3LDRA 5C3SA 3UKVA 1VRBA 1RIRA 1TMF1 1U5IA 4Q4X1 1W0OA 1SLIA 4H14A 5HCBA 1W8FA 2XDVA 3KCCA 4NRQA 2Q4SA 3ZXFA 1W6PA 5JWPA 3H8OA 2VAUA 3H9AA 5FIXA 2HYXA 3GJBA 1K45A 1YQCA 2X5IA 4QWNA 1V70A 2FCVA 2YZ4A 3C3VA 3NVCA 4CCNA 4CCJA 2VUAA 2Y33A 1MQTB 5FXVA 5A6XA 2P3YA 1C57A 1W9TA 2VR4A 5DAPA 3ZLIA 1LEDA 1ZZ6A 4AWDA 4E8DA 4E2GA 3B3QE 3PMSA 4UFIA 1RUD1 2BGOA 4OULA 4YARA 1RUNA 1AR91 4YLZA 1SACA 3IDBB 5CFDC 2W68A 3DF0A 3I97A 5SV5A 3ATGA 5ABJB 1YI7A 1V9U1 3VBUA 1UY0A 3HOBA 3HWJA 4RQPB 1GP4A 4HVRA 2VZUA 4A4AA 4B1LA 1W99A 1EPZA 2WFF3 5T5PA 3U78A 2WA4A 1Y9QA 4BJ0A 1DGWX 2D6MA 1V0AA 5M0TA 3ST7A 2P6HA 5C8CC 4R9AA 1SEFA 5JLVA 4JGYB 2YMZA 3FN9A 1SBEA 1NA1A 4CE8A 5J1XA 1SPPA 1FYUA 2FDFA 5E8AA 3WP3A 1ZRIA 1N3OA 1UNBA 3ZIWA 1ONAA 3CZUA 1W05A 3NNFA 2BQPA 5FZ9A 4YVWA 1NLQA 1H0BA 2PLV1 3ON7A 3IN9A 1NLSA 4IGQA 4Q5OA 2JDMA 3RMYA 3ZSLA 2ZZQA 4UW6A 1MEC2 1WUVA 3EHKA 5E6HA 2A6XA 3ZN6A 3DXTA 2PTMA 4I3GA 4OHZA 4W6YA 1IPJA 2AZ5A 5JZGB 4YW1A 1CAVB 1ND2A 3CHXA 5FMOL 4NIIA 3WP4A 3IAPA 2IFRA 4ASKA 1W8TA 2VMHA 2DU1A 1UF2C 4LULA 4XUNA 2VZSA 1DHKB 1Y7BA 5DN2A 4AHYA 2W08A 5C7GA 4XDPA 5FKBA 3W5NA 1WZXA 4OHWA 1K3IA 2ZEXA 2ZGKA 2XR4A 1RUJ1 1OD5A 2GC1A 1AR63 4DMIA 3V64A 4ASMB 4XABA 1JZ5A 4DXZA 3FWEA 4AI1A 2DDUA 3LSEA 3T0DA 2BWAA 5E89A 4AVSA 4DB5A 1YFWA 4S2GA 3WUCA 2BTVC 3BPSA 4QGNA 2X5IB 3RSJA 5JZGA 4CCLA 1XU1A 4LUKA 1W8UA 5KWRA 1JZ2A 5IVFA 5GLTA 4L2NA 1ULPA 3NV2A 3QH7A 4H2AA 2OT7A 2WKKA 2ADEA 3K75B 3RYRA 1ULFA 2QQKA 4XQWA 3DCQA 2YPJA 2XGXA 3D8CA 4UOJA 2H6BA 4QPIB 2ADDA 3ES1A 3MICA 4JDOA 2UWAA 4Q4V1 4S2HA 4B1MA 3BN6A 1H1AA 3JBG1 4CDUA 3M3QA 4BYYA 4BA6A 3I3BA 1SCRA 2BVVA 3QCWA 5FO7B 5CYYA 4AEKA 2ID4A 3W58A 1WW7A 4NAMA 2Y0OA 2JX9A 4TXWA 4KU8A 1JBCA 2DTYA 5D8AB 1RUE2 5FMOS 1ND2C 5FYIA 3ZMNA 2P5BA 4UAPA 3VBUB 3FHQA 1I5ZA 5FJHA 3Q8EA 1Y4WA 3RZLA 3WDYA 2HWD3 4IW3A 1IHMA 2ZZJA 4TN7A 4M4RA 4U36A 2VECA 5LBEA 4CCKA 4M3CE 4H7MA 2R062 5CEHA 4QX5A 1N3PA 3GCXA 4RR3A 5EJ1B 4DXRA 4JHZA 3OPWA 3ZR5A 3APBA 1UY3A 1MQTA 4XHBA 4IXLA 1RUH3 3WX5A 1SPPB 2Y6LA 1LR5A 1NE4A 4QT6A 1UX6A 3MIHA 1VBE2 1UD1A 2Q1MA 3OTFA 3FLRA 4QQLA 1POV1 5DZEA 2ZABA 5CFCB 1I6XA 2RDNA 4IEXA 2EXHA 4JRAA 4NHXA 1BZWA 1T6GC 2PHTA 3DKQA 4RL7A 5I0RA 1HXS2 3B9CA 4PBOA 5FMBA 3WNXA 1V9U3 3ZSJA 4OI0A 1VBD2 2DFCA 3NWKA 1NCRB 1RUI2 2WO2A 1W3VA 4I01A 1WCKA 3E5QA 4QKFA 1W04A 5JR2A 2JECA 5A32B 3S7IA 2WFF1 4DINB 2GU9A 2ZACA 5JIAA 3N7MA 4O9EA 3A22A 4JX0A 5FYVA 2YFZA 4A2UA 1GQGA 1TME3 4Q4Y1 1W8ZA 5A70A 3OGGA 1X8MA 2XJPA 1JHJA 5GM0A 5KHHA 4E9KA 2RDQA 3DPRA 5A3PA 1OF3A 2WNVB 1CZVA 3NAPA 4UWDA 1GNHA 2VCAA 5JUVA 4IE6A 1BXHA 5EQUA 4CP9B 2QQVA 1H2MA 1F4HA 2E33A 2NPIA 4HSLA 4D6SA 1R091 3ZSKA 3LFMA 4MADA 1UMZA 2ZHLA 2P3JA 3WZ1A 3CF6E 2HWC1 1R1A2 1RITA 3UGFA 4FAGA 4TLFA 1S55A 1UPSA 2W1SA 4LK6A 4AE2A 4KBBA 2WFF2 3EXUA 3KD4A 1V00A 1W0NA 3PHMA 2R49A 1P8JA 1QGLA 2ARXA 5FZ8A 3FC0A 1YO8A 5LA0A 2W1QA 2RM21 4QPWA 5EWSA 4MGTA 4ET7A 4UF0B 3ZFGB 2ZX2A 4QX2A 1XNDA 2R7EB 2A70A 4TSVA 1YEWA 4AOCA 5A3UA 5DPNA 1HIXA 3AKTA 1SLCA 1MS8A 3N7KA 4NPRA 2AENA 3VDDC 4PLMA 1GUIA 4JKLA 4XJWA 1VLNA 5FP7A 4ZU7A 1UU5A 4UXAA 3R4DB 1ZBA2 2WJSA 2JE7A 4M3CA 3LEIA 3KCYA 3MFAA 3KVBA 2D44A 2NYYA 4N43B 4OYUA 2IXIA 2J1UA 2JB8A 1FNZA 4XVHA 1S0CA 4AK3A 3BTYA 2DF7A 2Y64A 3PIJA 2YY1A 2GN3A 3I59B 3N3HA 4NWWA 1DGWA 1N47A 3HBZA 5K0UC 1D4M1 1G9FA 3I49A 3UYJA 4AVBA 5H9RA 1VBA1 3THTA 3Q8CA 5BPXA 1X50A 5GZCA 2WT1A 4EYUA 5ANQA 4ES9A 4Q4W3 3VGIA 1VBE1 2PELA 4HSJA 2A3YA 4FP3A 1W6MB 4L11A 4P9WA 5LK5A 3N7LA 4YGBA 2WIIB 2R0HA 3HEIA 3ZDVA 1C3HA 1G86A 3JQXA 3RS6A 2O8OA 1N3QA 4PDWB 4Y4RA 2QQUA 4LXLA 5I0TA 5A7OA 3TN91 2V5YA 3KF5A 4DEQA 4EN7B 5JXIA 2ZX3A 2G19A 3VBSC 2VZPA 2VQTA 1W28A 4JQTA 3ZPOA 3T09A 4OZOA 3GF6A 2GAUA 1L3JA 4A3XA 2RE9A 2AUYA 4XF3A 5LK7B 1H9PA 4OHXA 3T2OA 1YHFA 3HNMA 2G1MA 5J09A 2WAAA 3MYXA 5GJ6A 5JIUA 5FZLA 4I3PA 4IE4A 4AQ2A 2Q30A 1RUD3 4HK9A 1HJFA 1Y9GA 2PHRA 4I0AA 3LB9A 4DRRA 2OVUA 5IT6A 4E4DX 4META 5IVYA 3H1WA 4RFT0 4AQSA 1VPHA 1XU2A 4JCKA 4IEOA 3B5LB 1C28A 5K0UB 1DYPA 1RJ7A 3ENRA 3GM8A 5FYSA 3HD8B 4PLNA 4LLOA 4M00A 3EMRA 4TYSA 1HN1A 2EA7A 3LEGA 5AC93 4UW4A 1R1A1 3WG1A 1WD4A 4QM8A 4M0HA 3J4UH 4YGEA 2HWB2 3PVBB 3NJVA 2I74A 4PIXA 3BIEA 3CJIA 2E32A 2VMFA 4BLJA 3O1RA 2Y6JA 3BVCA 1DZQA 2JKXA 1NE6A 2C9KA 5J98B 5LCWL 4ONUA 1CJPA 2QVSB 3HQUA 2RS53 5F5QA 4MGSA 2IXHA 3WOGA 1YC61 4LJHA 2GZWA 5FZIA 1AUYA 4CCEA 4QHBA 5FZ6A 5JOXA 2BP6A 3CJIB 2RM23 3I7DA 3MW4A 3OPZA 4FOWA 4QX1A 1Z7S2 3RJRA 4FTBA 3Q9OA 1H4GA 2GC2A 4N53A 4N9HA 1OPOA 5FV3A 3O1SA 3OYWA 2VQ0A 1W2UA 4LBQB 1GBGA 1JYNA 1GZTA 3SMHA 4AHWA 5FP9A 4F83A 3WDUA 3IAQA 4XE9A 2CY6A 2GSYA 2JG8C 3OGJA 5I8TA 4GJYA 5FAXA 1W9FA 2P6CA 4B8EA 3AP4A 1GP5A 4AI2A 3AB0A 4Q0QA 2EVXA 3G6JB 3VD7A 3TYJA 1JZ6A 2WZ8A 4CDQA 4AW7A 1KJLA 1S0FA 3H8UA 1RUE3 3I2OA 4N53C 2FMYA 3M2MA 4K1ZA 3W59A 3I2KA 1A34A 1PNGA 5FFOC 4HG6B 4Z92B 4LT5A 2B42B 1DQ5A 1IPSA 2W0XA 3GZAA 4GKYA 3J7LA 5D1IA 1DGLA 4IE7A 5ANNA 1FPN2 1CZTA 5DABA 1VBE3 4AI8A 1EP0A 4GWIA 2FCUA 4MH0E 1A78A 2I45A 1GR3A 1TEIA 3T4HB 4D0QA 5AC92 5D8AA 1OLME 3USUB 4E4SA 2R071 1BBT3 2LRPA 2MEV2 3MIEA 4QKBA 1AL22 4DXSA 1QDCA 5EJZB 3ACHA 3ECQA 5FRAA 1OLMA 5FZBA 2QKDA 2R061 1Q8QA 3M3OA 2VJXA 1O91A 2HBTA 3J9SA 3S30A 2Q8CA 4XZPA 4YVSB 1EAH1 3O12A 1PO22 2MHFA 4QPIA 1CIWA 1V6IA 2R042 2XMLA 2X8KA 2PHWA 3OGVA 1XNBA 4JQRA 1A3KA 1NXD1 5H9PA 1PVC3 3ZX7A 4BB3A 2IWGB 4BU2A 3KGZA 2WZR1 5LWBA 3S6PA 2CV6A 4CA9A 1LHVA 4ATFA 2AEYA 2YG0A 3I2DA 1D2SA 4YWAA 4J6GA 2XJRA 4AG4A 4KI5M 4FPYA 2ZKNA 2QQPA 3LA3A 2P2KA 3HN1A 3RNSA 2ES3A 3EQEA 2W46A 1COV1 3IIAA 4K8RB 5JAXA 2Z2SB 1JW6A 2QDNA 4O61A 3RYPA 4B3NA 1RTVA 4LLFA 3WW1A 1WWYA 5BNOB 1O8SA 2DVAA 2JIJA 2QDRA 2P17A 4W4ZA 4CDXB 4X6QB 4E8CA 5D8AC 1F4AA 1RUG1 2FDGA 1V6OA 5IFTA 1LOGA 4O65A 3H0OA 4G4FA 1J1TA 4Q4W2 4IV3B 4EWAA 3AKRA 1GFF2 2X09A 1JOJA 2DU0A 2Y38A 3VD3A 3O1TA 3RJ2X 5A3OA 2VMDA 5FLJA 3ZXGA 4AGRA 2L9LA 3H1MA 4QDSA 1YCIA 3NJZA 1H2KA 2I2SA 2JG8B 2VZ3A 5A1AA 5LEJA 1UW8A 5IK5A 1LU2A 2WWJA 2Z4FA 3OF1A 5H9QA 1B09A 1LHOA 3PU8A 4EROA 4CDQC 1ZRCA 5FPVA 4KG0A 4Y5SA 1DCSA 1DZRA 1HKDA 4XF1A 3VHNA 2FZ1A 4D7SA 3E1F1 5DUVA 4QX7A 3J8F3 4KBZA 4LKSA 1QOTA 1SZBA 4HL0A 3PUQA 3D0SA 4JDMA 2BFUS 5F39A 2ZEYA 4BM8A 4Q8LA 4ZS3A 2OS2A 3OBRA 1OH4A 1RUC1 1XBFA 4LA3A 3WT3A 1OH3A 3AZZA 2Y6KA 2JDKA 2RR13 1RXFA 3A0NA 3OOXA 4CCDA 3WG3A 2WYSA 1X9PA 3C8XA 3OEAA 5F2WA 5JVVA 2VZ1A 1VMJA 2E51A 2XWJB 2FBEA 1RUE1 2EXIA 3ZR6A 5EV7A 3I2HA 3UNPA 4RHV2 3BTZA 1O3TA 2CSGA 1J84A 1H6XA 5LY2A 5A3TA 4CDWA 2PXJA 3LAGA 1L7QA 2PA7A 1IS6A 2VY0A 5CBLA 3N9PA 1AX2A 4NMIA 5C8WA 3LZZA 1F35A 2BV4A 1HRI2 5FZCA 1EV13 1QEXA 2HEVF 4Y33A 3S7EA 1VRH2 2RS52 3P5BA 2K0GA 1W9SA 1XYNA 1ULDA 4YZ5A 1EV12 1ZX5A 3WNLA 3B93A 1GOFA 3DPRC 2ARAA 1WW4A 2XHNA 1QQP1 5A6ZA 1KDKA 2BZDA 1GQHA 1BVP1 4RHV1 3NRUA 1K5JA 2E7TA 2J1TA 4XAAA 2R6QA 1HV0A 1HW5A 2YXSA 5BNPB 3N9NA 1UKGA 1UMHA 1VBC3 3FFZA 2V5DA 1M4WA 4NJ4A 4WVWA 3U11A 3VDAA 4Z8BA 1K42A 1COV2 4W8JA 5GLVA 4UT5A 2R1BA 2YC4A 3QBQA 1XOYA 2BOJA 5APAA 2D3PA 5C9AC 1N1TA 3JXSA 2Y26A 2A5ZA 4LBKA 4Q2FA 1NAEA 2VMIA 3I3QA 1MS0A 2VNOA 3PNAA 2BJSA 2AGSA 3K51A 3LDKA 4OI4A 4YM1A 5CG9A 1Z78A 2EIDA 3PL0A 4TLGA 4FPKA 1J3QA 3A21A 3LPGA 3OY8A 1BMV1 4NRPA 3V0BA 5IVEA 4NAOA 4D8MA 4RR3C 2OQ7A 4RR3B 1XYOA 3ILNA 4Q4W1 3VZLA 4ES8A 4UBHA 4OLLA 1SBDA 1PMJX 4FXKB 3KB5A 1YRZA 5I0UA 1ZBE3 5HCAA 4YW7A 1J3RA 1HQNA 1H8VA 1QF3A 1AYN3 5I8YA 3MW2A 5EFUA 1FMD3 5FUNA 4MZUA 3U4SA 1JZ7A 1PVXA 4WVVA 2JEMA 1UYYA 2J7MA 1TG7A 2F17A 4COZA 2EF6A 2DCJA 2GNMA 3BKZA 5CADA 1PGL2 1LRHA 1EAH2 2EAAA 5AVAA 4QXHA 2LTNA 1C8M1 1XSRA 5D21A 5J7MA 2XJTA 3FHIB 4B7KA 4LO5B 3VZKA 4IV1B 3JBG2 3OBAA 4YW5A 5IAXA 2RHPA 1O7FA 1IG0A 1AR73 1ASJ2 3B01A 2QQJA 2D5HA 2XXZA 3NNMA 1SFNA 3VLBB 1CVNA 2AH2A 2RR11 1CESA 2JXAA 4RA0A 2F6BA 2JDUA 1VMFA 1MVQA 2TBVA 3LIGA 4JRLA 2OUJA 3OUJA 1UAIA 4QPYA 4XQDA 4BDVB 3UJOA 2B46X 2V4VA 1WW6A 3DYPA 4XBQA 2PQQA 4Z82A 3VDDB 2WC2A 2RS32 3K3NA 3OGSA 2HLEA 2QQMA 4KU7A 4OHVA 2Y6GA 5DZGA 2A6YA 2ZKLA 3IB3A 2R043 3MIBA 4D94A 2ENRA 3I3EA 1C1FA 1PO23 3POWA 3VBOB 1CAVA 1ND2B 5IK8A 1GOGA 2ZMLA 3WUDA 2IVIB 2WLPA 4AI0A 3AJZA 3AYAA 3AYEA 1O59A 3LE0A 5FXXA 3UKNA 2K9ZA 1PGW2 4QHZA 3NL1A 4JZRA 2GH8A 4LORA 4ZHNA 5CISA 2VXJA 2ETEA 4RD7A 1Y9MA 1G9DA 1NQJA 5A3MA 3CKHA 2EXJA 1LHNA 1NZCA 1HX6A 1OQ1A 3EBRA 1QQP3 3RG0A 4TWTA 4MOAA 4R9CA 2P37A 4B7EA 1NX9A 4DS0A 2BYVE 2HEWF 2O8QA 3JZVA 4JGYA 4CPBA 4QGMA 1ULOA 2HWE1 5C8CA 4QKNA 4W65A 4XFIA 1JU3A 3VBSA 4OUSA 2J1VA 3ZXJA 5FZMA 5L73A 4HMZA 1UX7A 5JMCA 4UI9L 1W6NB 1E57A 1PX4A 2D3SA 1OKQA 3OJBA 2D6OX 2Z69A 3AXEA 5DUWA 1GZCA 2VCMA 4MSVA 1OLQA 3QLQA 3AX4A 4XJ9A 3SITA 4NVPA 4JTOA 1DGRA 2W9XA 1AXZA 3Q8FA 5CFDA 5FZOA 1ASJ3 2DV9A 1ZVFA 3QACA 3ZO0B 2Z5WA 1FXZA 4GD4A 4K6BA 5EHDA 2JG9B 3LPFA 3TRSB 4QQOA 4N8MA 3DECA 5GZFA 3C7GA 4LBJA 4Q1PA 4FAHA 1F2NA 4ZXKA 3KHBA 4KG8A 4ZS2A 2WNOA 3BOWA 4PHZA 1AYM3 4QX3A 5T5OA 4DOUA 2ORXA 2X5IC 2WN2A 4PDWA 4A45A 1CAXA 1RL3A 2VZTA 2ZAAA 3M70A 1QJU3 1RUG3 1PGL1 3IBMA 4DY3A 2D6LX 1NY71 1G8WA 4C90A 2HJIA 3V0BB 3AP6A 1US2A 4GB32 4P9GA 2FDKA 3N35A 3GHMA 3ACIA 4DIQA 1YXWA 1GANA 2WFPA 3M3IA
chains in the Genus database with same CATH topology
1S0GA 3VL9A 4LBLA 5FBZA 1M06G 4BE3A 4BQ1A 1QMJA 3VV1A 5L36A 3LOIA 3VBOA 4MGIE 2GNTA 1REEA 2FZ2A 1DZTA 2XVGA 4GXLA 4Q4X2 3RZZA 2VVFA 1C1LA 1OFNA 1BQPA 1VB2A 3ZXKA 4FOQA 1W39A 4DNYA 1RUC3 1ZBA1 1RVF2 2ZMNA 1TE1B 2YYOA 1FX5A 2RS13 4P9LA 4Y4YA 5KC5A 3BOPA 4YVWC 1FMD2 5JPMB 4UW3A 1WLCA 4Q1RA 1UN1A 4BIOA 2C0ZA 2DUQA 3RRDA 1AR92 3NKTA 1EYBA 3UV9A 2XUMA 3JB8A 4L9BA 1NCQA 3CEWA 1S2BA 1UIJA 4XJ8A 4M01A 2DVDA 5KHIA 4XIOA 4COYA 1YYNA 1EPWA 2RS51 1RGSA 4XILA 5I8SA 3HMYA 3HR9A 5GLZA 1JTZX 4HETA 3MIFA 4FP2A 1NXMA 4XBNA 2A6ZA 2A6VA 1LECA 4J1XA 5EYYA 2DWRA 3WP5A 2PN5A 1VBC1 2OZJA 5DDJ3 4M0NA 3CO2A 2X53S 3KQRA 5FO9B 2VW0A 1GSLA 4HBNA 3B69A 1KFXL 4UW5A 3ELNA 4AI3A 1RUOA 4E2SA 2Z42A 3AFKA 2VOKA 4MGZE 5AFEA 3WQ7A 3OCPA 4D7YA 4XXPA 2RJLA 3J8F2 1DQ0A 1TMF2 4YVWB 2XB6C 1TQ5A 4CDWC 1C8NA 1SLLA 4GQ7A 4XMAA 2EAKA 1PGW1 2WL1A 2BWCA 2C5DA 4ORFA 3RYKA 1FOD3 1SCSA 5I93A 1F8VA 1OA4A 3WY6A 1S0DA 5LEKA 2UURA 1LOFC 1ZA4A 3ETQA 4Q0UA 4RHV3 2GC0A 5JSOA 1AR82 5BY5A 2CL2A 1FT9A 3IKWA 4AVAA 4FPOB 3WW4A 5CNAA 1LB2A 1HRV1 3MLKA 3SISA 2NLRA 3TAYA 4XFFA 3EJKA 2XHKA 4YGCA 1U0AA 1IS4A 4XFCA 5BYNA 1Y43B 3DL3A 1BEV3 4YW2A 2XVLA 5JCTA 1LHUA 4LO4B 4IEWA 3R4UA 2Z79A 1W6OB 5JI9A 3O5SA 3ZDSA 4Q27A 5T50A 2CNAA 2O1QA 1Q8PA 4NOTA 3USSA 3SCGA 3AYCA 3B00A 2XJVA 4N7UA 4OZXA 4HKOA 2WNEA 4GB33 1QKQA 4QMAA 1H1MA 3A0KA 4JV4A 4E27A 1H8TA 2RMU3 2R041 1IPKA 4XDQA 4RGAA 4YZ3A 1DQ4A 1NG0A 3VHOA 4C91A 1UCXA 3T1MA 4I2OA 3L2HA 2WS93 1WLTA 4HFSA 3RI8A 1QNWA 4AHZA 4XF4A 1RUJ2 3TNPB 2VQAA 1AL21 4IERA 4GULA 1QU0A 1SLTA 2ET7A 4Q26A 3MLLA 4YG0A 5JPNB 4Q4V2 1SDWA 4HN1A 4WM7B 4AXOA 3UK9A 2BGCA 4QPIC 1AZDA 4AGVA 5GLUA 1C4RA 1VR3A 2UY9A 3KT1A 4QGLA 3J8F1 5GLWA 5A3LA 4YFZA 1ND3B 2GC3A 2H0BA 1ZZCA 1HRI3 3OD4A 4GIQA 1ULGA 5BNOC 3WG4A 5BNNB 1MZ6A 4X8NA 4Y1YA 3PLQA 1F5FA 2D43A 4P9IA 4AVTA 2ARBA 4IQPA 2DCYA 2YV8A 2RM22 3RMXA 1JUHA 5L7OA 1JH5A 2P3KA 3RPQA 4EN0A 2ZGMA 1R083 3VBFC 1QJU1 4MVTA 3URFA 3IPVA 1PZ8A 2CAVA 4MUVA 1TMF3 3AM2A 2JG8A 2YC0A 4Y1VA 4FOVA 3BALA 2D7FA 2BNNA 1BYHA 2VPVA 3AZVA 2OUHA 3IWZA 4LHNA 4JGZB 3FZ3A 4M3CF 2XJQA 4JGZC 1Q8VA 2QFEA 1SBFA 1R082 2Q8OA 4I09A 2XBO1 1S0EA 2OA2A 5IK4A 5CVRA 1BEV1 5CU1A 2F4PA 4K9SA 2R30A 3UL2A 4GWNA 4BIFA 4YM0A 5J37A 2WNVC 3SH5A 1PIV3 2DURA 1CGPA 1CR7A 5CIRA 1UL9A 4H7LA 4LA2A 5GZDA 5B2GB 1U5ZA 2XL9A 2XLGA 3B7MA 3VZJA 1DQ6A 1RVF3 2Q5TA 1VAMA 5CFCC 3E5XA 4IV1C 2JENA 1AYM1 3FFQA 3LGRA 4LO7A 4HN0A 2QJVA 3SH4A 1W6MA 2IFWA 3JCIA 4K20A 4WM7C 5E16A 1DQ2A 4LBMA 4AEDA 3MZHA 5E1RA 1NCRC 3KSCA 3VKFC 2C9AA 1DF0A 4F8AA 1DG6A 4WZFA 3I59A 4P9XA 2DYCA 3KT7A 4NN0A 1QJX1 2ERFA 1FMD1 1W6OA 3WDXA 1VRH1 4IEYA 4YG3A 1MS1A 4IEUA 2R073 5BNPC 3JU9A 3HT2A 2NZ9A 4Q29A 4URTA 5FREA 1RB8G 2GMEA 1LCLA 1BMV2 4DY5A 4N7IA 1PNFA 3P3PA 3ZFFA 4WM8A 4H3WA 1H2LA 3VZMA 3VBHC 3JD73 4FOYA 3CJXA 1KXGA 4K8FA 1PO11 4R52A 4BHPA 4JTNA 1OQEA 1PMIA 2XWBB 1G6NA 2PHXA 1MS3A 1HDKA 2RS11 1LOEA 3ZFFB 3U0ZA 4PBPA 1ENRA 1MVEA 3NSTA 1D0GA 1WD3A 1QJY3 2XKPA 4XTPA 1G7YA 5JDBA 2QNKA 2VXRA 5TSWA 4Y20B 2YGMA 5FO8B 1S0IA 5L19A 1QJU2 3D6EA 2CAUA 1R1A3 2I07B 3J26N 4Q0PA 1NLRA 2R0FA 2YUEA 5KXEA 3ACLA 4OI1A 2W52A 4FTSA 5BNQA 3AZXA 4EWEA 1R092 3FMGA 3WR0A 4CEWC 2B45X 3D5OA 3ZXEA 2HWC2 4JAAA 4IL7A 1QNYA 4HLTA 1CX4A 4HKWA 3VDDA 3ZVXA 4AF9A 2GNBA 1TME2 1KS4A 3AK0A 4AVVA 3MF6A 4CEYA 2UY8A 1GLHA 2ZGOA 4DQAA 1HRV3 4BPZA 1Q56A 3S0MA 2HWE3 3VBRA 3MF9A 4XPVA 4EN9B 5GZGA 1LOBA 4LR4A 2VW2A 4ATEA 1FV2A 4FBFA 1EY2A 1FNYA 4C1XA 3VKLA 1ZYBA 3UKTA 1RMU2 3H3UA 4A7KA 2EIGA 1MACA 1KRIA 4QXKA 2XG3A 1VBD1 4P9JA 3NAPC 1DBNA 4N43C 2LUWA 5E88A 3ZPYA 1DLLA 2OZ6A 3POYA 4XYXA 3FUQA 4COWA 2A6WA 3ROUA 3CNAA 1GZWA 2FHRA 3MIDA 1AR72 2YHJA 5C9AB 1A6CA 4JVAA 3AP7A 1RC6A 1LTEA 2XLAA 4CDUB 4FQ4A 1LGBA 1H9WA 1BK1A 2A3XA 3KGLA 3OBTA 1O3RA 2WZR2 4YZ4A 2NQYA 2HWF3 3GZTB 2DCZA 4AEDB 2X29A 1EV11 5T5JA 4HVQA 1WMFA 4OVEA 1X33A 4WM8C 5J96B 3ZFFC 4O9GA 4BCUA 1YFXA 4ZU4A 1UKRA 1MQTC 4I0BA 1RUI3 1ZBE2 1N1SA 2VGDA 1BKZA 2BPA2 1IKQA 3GNEA 5JOZA 1PVC2 3GALA 4D69A 4I0WB 2WSVA 4Y20A 5FTTC 1QXJA 2WWSA 5J48A 2HYKA 1ZREA 1RUH2 5C6CA 1AXKA 4RQPC 4HPKB 2GDFA 5F6LB 3O0WA 4FSJA 2LALA 1NCRA 1OFSA 1PIV2 1W6NA 3NKGA 4RS5B 3WHUA 4L99A 2ZX4A 4WM7A 1QJZA 1SFYA 2GN7A 1RUC2 2RMU2 2V09A 4AGGA 1NYWA 4CDUC 1GICA 4D7TA 3M8LA 2K2SA 1VBA3 3VHPA 1YI9A 4W6XA 3BPZA 1TME1 1DGRN 1JUIA 3B94A 3DUIA 4XFHA 3ZXAC 1WMEA 1H2NA 4OI2A 5FOBB 5KBFA 1AYN1 4YG6A 1H30A 1KFUL 2JICA 4JGZA 5JZGC 1YFUA 2XVKA 1V6MA 3BCWA 4HVOA 4YVSA 4OHYA 1G9AA 2ZBJA 4AFDA 2G9GA 4GA9A 1F9KA 3AXDA 2UYBA 1AL0G 2Q0AA 4EV0A 2ZTNA 1URXA 4K21A 3H1YA 5CAZA 3CLPA 5FPXA 1ZRFA 4KWLA 3MLJA 2C1FA 3IPVB 1HRI1 3T2TA 2XBO2 2D3RA 4NWVA 3GHNA 3V0AB 2D6NA 2IZWA 3VBFA 3I4IA 3PVEA 4CYDA 4KL1A 1CPNA 2EALA 3D82A 2R16A 5J3UA 3EO6A 2IXCA 4L97A 4QQHA 4S2DA 4F3JA 1CAXB 2IC1A 2VMGA 3NV1A 4IEVA 4HK8A 4XJAA 1U12A 4ISRA 3ZYPA 1O4ZA 3V0AA 4G9SB 3U4XA 1NA1C 1Q8SA 1MEC3 1NA1B 1K5MA 2ZHMA 2A3WA 5KHGA 1O5LA 1U5XA 2KA3A 2QZ3A 2JDZA 4LO8A 4CP1A 2JD4A 1YNAA 4K1YA 2HWB3 2SBAA 2ZHNA 1AF9A 5F1RA 1AXYA 1JYIA 3ZFEC 2D6PA 5CFDB 2BNMA 3ZFEB 2HWF1 5FDBA 5T3NA 2FMDA 3LWCA 3VBUC 3OYWB 1F5JA 4LBNA 3ALQA 3PVOA 2BFUL 3ZN6B 4AFAA 3MDPA 5ABJA 4A7ZA 1DFQA 2MEV1 4LE4A 2HKXA 4XTMA 3CU7A 3E5UA 1H4HA 4Y1ZA 2ZX1A 4Q8KA 4XJZA 3QD6A 5DZFA 4K3UA 3LA7A 3TBDA 3KM5A 2HWD2 5C8CB 4C0HA 4Q4Y2 4EN6B 5EJ3A 4CDQB 1KITA 1NQDA 4PQ9A 2OW4A 1Y3TA 1B35A 1Q8OA 1PGSA 1AR61 1KJRA 3MW3A 4XBLA 3ZYGA 3VZNA 1WW5A 1MZFA 1H8TC 1RVF1 5FLHA 1AX0A 1REFA 4HPKA 4LUMA 3N7JA 4Y5Z0 1G9BA 1LGNA 3PTYA 4XFGA 2UYAA 3SNMA 1PK6A 3HT1A 4NR1A 4Q4V3 1ALYA 4FVVA 3ZYJB 4GH4C 4MXWB 1RJ8A 3JBG3 4CRQA 3KMHA 2PFWA 4CDXC 3AZWA 4GWMA 4GB31 1ZZ7A 4MLOA 3INAA 4AFMA 1QY4A 3PMEA 2BEOA 4N9IA 2GALA 1LOAA 2WS92 4IV3C 3W9AA 2PAKA 3O0VA 3N36A 2NM1A 3MIGA 4CP0A 2VVEA 4Y22B 4C1WA 4Q4X3 5KXBA 4YW3A 1XQNA 4FPEA 1ZRDA 3LOBA 4IV3A 2RS31 2ZCWA 3WP6A 3AMHA 3L9JT 4KNCA 2NP0A 3ZFGC 1LOFA 1YWKA 4I02A 1Q43A 4YRDA 4B4QA 2WA3A 4L92A 3JD71 4XETA 4CDXA 5C4WB 3D0JA 5C4WC 4DPNA 4GH4A 2R32A 4JC1A 1XNCA 1RUH1 1HQWA 4FXGB 4P9YA 4XIKA 3MFCA 2XJUA 2ZGNA 2WSUA 1WGPA 2DFBA 4IEQA 1AJOA 2HWE2 2WZR3 1YIFA 4RGGA 3WLUA 1DIWA 2D6KA 1REDA 5AVPA 1LHWA 4NHLA 1OOPC 4PLOA 3FBMA 2VH9A 1RHI2 3I8TA 4IESA 1AJKA 4YZ1A 3SH3A 4RSUA 5EYXA 1WBLA 1FATA 1QDOA 1YFYA 1RMU3 1HV1A 1FPN3 5JI7A 1QXRA 5BV6A 5JOWA 2KXLA 4MXVA 4FO9A 5KXDA 3SLIA 3BODA 1KS5A 1B35B 2V73A 4FTEA 3OY8B 4QD2A 1J3PA 2PLV3 4K7JA 1JHNA 2PLV2 3RDIA 1IKPA 3OD0A 1ZM1A 3ZFEA 2WNUC 5I0SA 1VBB3 3FBYA 4LE3A 4Z2WA 2W39A 4FCAA 4Y24A 3WXPA 2YROA 4Y26A 1OOPA 1RUI1 3DN7A 5DG1A 3FJSA 1NCQC 1K5MC 5BNNC 4LHKA 4J1WA 1RUF1 4P14A 4DRVA 2XBO3 1PVC1 3IM0A 1D4VB 3MEPA 5T5LA 2ZGRA 2DUPA 4COVA 2IXLA 5HI0A 5K8SA 5C4WA 4N90A 1W0PA 4NO4A 3ZFGA 3VBRB 3GBGA 1VB4A 4R8HA 4XQ4A 1BCXA 3E97A 3H7YA 2BVBA 1QJY2 5DUUA 2B7YA 2DCKA 3TN92 5L7OB 4MX3A 4P5HA 1GKBA 1CONA 1MZEA 4FPGA 1J58A 4B4PA 1WCDJ 1KDMA 1CQ9A 3PVNA 3B9IA 3R0RA 3GBFA 3VBOC 3DGTA 3NAPB 3POSA 3QOPA 3TB0A 4MXWA 1QJX3 4AEJA 3VUOA 1R1ZA 4EJRA 1UIKA 1WA4A 2ZOEB 2HWD1 2JG9C 3MPPG 3R4SA 1FI2A 5ACA1 2ZGUA 1OMIA 2YDEA 3SHRA 1AR62 5JSPA 4GMP1 4COUA 3ES4A 1A8DA 2UU8A 4EWDA 3IT8A 3SCHA 1QJX2 1ZZBA 2KM2A 4WZCA 1B35C 4XF0A 2OPKA 4PDWC 1PZ7A 5T55A 3SXWA 2A75A 4YM2A 1NY72 3AMMA 1X36A 4RQPA 3HAGA 3L2YA 3VL8A 4KGGA 5J36A 2E6VA 5I91A 4PCRA 3VHRA 2DUOA 2ZGTA 5BUVA 3ASIA 4RS5A 2QZ2A 5GALA 2TEPA 5ABJC 3M7AA 4KQ7A 2HWF2 4SBVA 4YM3A 3WINE 4XOGA 1D2QA 1Q5OA 1ZBE1 4Q0SA 3H7JA 2GMPA 3ME2A 1MS9A 1VJ2A 3CL1A 4H55A 1JYCA 4IEZA 2IXKA 3FUOA 2ZS6B 3VBSC 1MR5A 1RUG2 1U5YA 1PK6B 3AKQA 2ZX0A 5JSRA 1RUF2 2IXJA 1AL23 4JGYC 1BBT2 2MEV3 2PAEA 2XKOA 2D98A 3TWIA 3VBHB 2N7GA 1GNZA 1ULEA 4N53B 2PHLA 4E4ZA 4OUMA 2TUNA 1YJKA 2VVDA 1JXNA 1W6QA 3AMNA 2WINB 1ENSA 4NHKA 2OYZA 1O4TA 1PM7A 4PJYA 4N43A 4WVMB 1GV9A 3VKNA 2OIIA 1GYKA 4KWKA 2XJSA 4XF9A 1O3QA 1BVVA 1O5UA 3WQ0A 1SQ4A 1VBD3 4D3WA 2ZHKA 3MPBA 1AR81 2QE3A 1QOSA 3AJYA 1APNA 4GH4B 1IS5A 2ZGLA 3ZYIB 1O4YA 3ILFA 5JR7B 1XRUA 4X6RB 4QPGA 2CYFA 4HKLA 4LEJA 4YVSC 2ILMA 1QXPA 4K40A 3ZN5A 2P3IA 4W6WA 4QQPA 3GZUC 2WLQA 3NW4A 4FPCA 1Z7S3 4Y22A 4CEYC 5FQ0A 2JE9A 3VBSB 2JKBA 1OA2A 1RHI3 3R05A 4GMP0 1HLCA 2D40A 3AYDA 1FOD1 1POV0 4XFBA 1IOAA 2AYHA 4XEZA 1DYKA 1FV3A 3DPRB 4BWOA 3B02A 3M3CA 4E2QA 2RS33 5FPZA 2DTWA 5KHJA 1C8M2 3H50A 2PHUA 2ZGQA 1WCSA 1V6KA 3NV3A 1RUJ3 2D97A 4XHXA 1BEV2 3TOJA 4L8QA 3JD72 4R4XA 1IZ3A 1VP6A 3THPA 3E6BA 3AZYA 1OHFA 2O0OA 3FLPA 1ND3A 2B9UA 5CG8A 4R9DA 4ASLA 3ILRA 3BB6A 1COV3 1N1YA 1H1IA 1JN2P 4GKXA 2CGPA 3AKPA 2NMNA 2R072 3BTAA 5FQ0B 2VU9A 5AC91 2ZMKA 2LM3A 5C9AA 1TNFA 1PO21 4C0BA 2XLFA 5CB7A 4NHMA 1CJDA 3WW3A 4YFWA 4M3CB 2DVBA 4BMEA 4YYOA 4QPGB 5F6KA 2ZGPA 3TNQA 5BNPA 1VRH3 1OSGA 1S0BA 3E6DA 1ND3C 2VNGA 4DFSA 1LKNA 5ACA2 5FLIA 1OLRA 2DVFA 1CPMA 1RINA 3VKMA 2E7QA 1K5MB 2ATFA 4DZGA 4Q0VA 2ZJCA 3JUUA 1S2KA 1DQ1A 4AEMA 1XYPA 2CGNA 1S1AA 4U2AA 4CEWB 5KHKA 1AX1A 2VW1A 2UWBA 4ISQA 3HQXA 3RQ0A 1CD3G 4Y1XA 4FPFA 2YGLA 3LKJA 3VBRC 3IMNA 1MS5A 2ZAHA 2RR12 1ZRRA 1DDLA 1WLDA 1IQAA 4BH9A 3ZYRA 4LBOA 1CAUA 1VAKA 1ASJ1 4IEPA 1G9CA 2WNVA 1QJY1 1QWRA 1WMDA 3LCPA 4FPLA 4FPHA 1VAVA 1F31A 1DU3D 5EZWA 1UU4A 3WQ1A 2VOVA 1GZ9A 3R6SA 2FQPA 1HQLA 1IGOA 4CEWA 2VULA 1TNRA 1MEC1 1LGCA 5A32A 1LESA 4Q4Y3 1A8MA 4QPGC 4Z07A 4SLIA 3X29B 1R081 5EXOA 1RHI1 2AR6A 5K7PA 2B8MA 2HWB1 2WNUB 5DDJ2 4S2FA 3D4KA 3AP9A 1GZWB 1X8EA 5JOYA 3U10A 2HWC3 3NO8A 1BBT1 1V6JA 4XJUA 1R093 4YZ2A 3I54A 2D93A 4ZU5A 2WT0A 4KGQA 2D5FA 2DVGA 4CP2A 5A33A 2UWCA 4X8PA 3BU7A 2G4IA 2ET1A 3WG2A 5ACA3 4F7ZA 3VKOA 4WM8B 3WV6A 2PHFA 4GMP3 3V65A 1I1EA 5KC6A 1AR93 3VBFB 3KS7A 3AKSA 4QM9A 3VBHA 4FQZA 2P34A 1YIPA 3N4MA 1PIV1 5BNOA 2QUOA 1J1LA 2PHDA 5KXCA 3AP5A 2AREA 2R1DA 3USUA 1CAWA 2RJKA 1LOCA 3GBWA 4FPJA 2NN8A 4Y1UA 5DXDA 1LULA 4WVMA 4INDA 3ZXDA 1D4M3 2XH6A 4JDNA 4RS5C 1XXNA 4MYEA 4UBGA 5HBAA 1LODA 4AFBA 4BLIA 1XNKA 1HXS1 4WV8A 1UU6A 5DUXA 3FE5A 3KCXA 1FAYA 3P3NA 1AYM2 3KLSA 1QOOA 2CWSA 4MGYE 2ZPXA 3ZIXA 5HXVA 4AEDC 4MGKE 3VZOA 1OI6A 2WQZC 2ZA9A 2Y0IA 3K48A 3O14A 1C8M3 2WZPP 4IV1A 4HANA 3TN93 5CFCA 3WDVA 4BZ4A 3IDCB 4YW4A 1H8TB 3UJQA 1OA3A 2B5HA 5T52A 1VBA2 3VN4A 1ZZ8A 1SLAA 1X7NA 4LBQA 2MPFA 1VIWB 3GYDA 3NV4A 3ZSEA 1I3HA 1YJLA 2JG9A 2VOWA 1OOPB 4AFCA 1SLBA 1X82A 5DDJ1 4XFAA 3M1HA 1PO13 1OQDA 1QH7A 2WT2A 4YNIA 4BOWA 1I9RA 2PAMA 4A7YA 3WCSA 1S0JA 3E6CC 1UPIA 1AR83 2E53A 2H0VA 4HT1T 4AYUA 3WD5A 1KD7A 4ITCA 1ULCA 3LSDA 3SCFA 1MZ5A 4Z1VA 1RMU1 4WBBA 1XE7A 3RI9A 1VBB2 1W6QB 1ZZ9A 3M3EA 1UZZA 4KWJA 1FOD2 3IDEA 3KT4A 1FPN1 4XXAA 2VNRA 2BUKA 2WS91 2Q1ZB 2JJ6A 3WVJA 2VOXA 3WDTA 1LJ7A 4QQ2A 5FCCA 4ZKTB 5L7OC 5C33A 1PHMA 5T54A 3AMPA 3ZXLA 3ZSMA 5A33B 2BNOA 1QQP2 2E7AA 2B39A 3H3ZA 5BNNA 3ZN4A 1LU1A 3PJQA 1HRV2 4MV2A 1WBFA 1VBB1 4LO6B 5FOJB 3BIWE 1RUF3 2E63A 3QH6A 1MS4A 2A7AA 3AFGA 4WVZA 3WDWA 4GALA 3CJIC 4LNVA 1ZNPA 2WNUA 1LEMA 1POV3 3MGUA 3M4FA 4EN8B 4KH9A 2BW8A 4TZDA 5BXXA 2E9QA 1RUD2 2BBVA 1YLLA 4LBQD 4B29A 5IK7A 2WQ4A 1C5HA 1V6LA 4XW3A 4PIYA 1J59A 2GH2A 4R9BA 3KZ4C 5IUQA 5GZEA 2G9FA 4AQTA 1Z7S1 4G3YC 4CDWB 5HCFA 1CAUB 2PYTA 3MI8A 3U07A 5H9SA 3JQWA 4AHXA 2MNGA 2RMU1 1KQRA 1WLWA 4CZSA 1ENQA 1V9U2 3A4UA 1HXS3 2NMOA 1YUDA 1QHDA 3O7OA 3T1LA 2GNDA 1V6NA 3RWNA 3HIFA 4BMBA 1VALA 3WCRA 1AHSA 1N1VA 4XMIA 2A73B 4CTEA 1SMVA 1D0HA 1NCQB 2H6CA 2GMMA 2QCSB 2RS12 4YSFA 1EAH3 5AFBA 1CAWB 3V56A 3G7DA 3WHTA 3C2UA 1NOVA 2R063 1Z0HA 2SLIA 3WW2A 4CEYB 1PO12 4QU2A 4YGDA 1PZ9A 1W6PB 4PF5A 4OFGA 5SV8A 1AYN2 2HEYF 5LRSA 1OPMA 4AQ6A 2VG9A 4I30A 2A71A 1AR71 4LTAA 5CA6A 2XL7A 1UZYA 4FT8A 5DG2A 4R4ZA 2CWMA 1CN1A 1ZBA3 2ZGSA 3DKWA 1QH6A 5K0UA 4V1PA 4B4RA 4PIZA 3FX3A 5F9TA 5K9YA 2VUJA 5GKAC 2CGOA 3ZMOA 3PJYA 3AMQA 1Q3EA 1BJQA 1C5IA 2XPJA 1O3SA 2EXKA 2TNFA 1ENXA 1PK6C 2DCTA 3LA2A 1LENA 1D4M2 5LRRA 2CTVA 1IS3A 1AVBA 3O0XA 3FLTA 4IETA 3JB4C 3DV8A 4HZFA 4AVCA 1XE8A 4LHLA 1VBC2 3UKVA 1RIRA 1TMF1 1U5IA 4Q4X1 1W0OA 1SLIA 4H14A 5HCBA 3KCCA 2Q4SA 3ZXFA 1W6PA 5JWPA 3H9AA 2X5IA 1V70A 3NVCA 2YZ4A 3C3VA 2VUAA 1MQTB 1C57A 1LEDA 1ZZ6A 4AWDA 4E2GA 3B3QE 3PMSA 1RUD1 4OULA 4YARA 1RUNA 1AR91 4YLZA 1SACA 3IDBB 5CFDC 2W68A 3DF0A 5SV5A 3ATGA 5ABJB 1YI7A 1V9U1 3VBUA 3HWJA 4RQPB 4HVRA 1EPZA 2WFF3 5T5PA 2WA4A 1Y9QA 1DGWX 2D6MA 3ST7A 5C8CC 4R9AA 1SEFA 5JLVA 4JGYB 2YMZA 1SBEA 1NA1A 1FYUA 5E8AA 3WP3A 1N3OA 3ZIWA 1ONAA 2BQPA 4YVWA 1H0BA 2PLV1 3IN9A 1NLSA 3RMYA 3ZSLA 2ZZQA 4UW6A 1MEC2 1WUVA 3EHKA 2A6XA 3ZN6A 4I3GA 2PTMA 4OHZA 4W6YA 1IPJA 2AZ5A 5JZGB 4YW1A 1CAVB 1ND2A 5FMOL 3WP4A 2IFRA 2VMHA 2DU1A 1UF2C 4LULA 1DHKB 1Y7BA 4AHYA 2W08A 4OHWA 2ZGKA 1RUJ1 1OD5A 2GC1A 1AR63 4DMIA 3V64A 4ASMB 4DXZA 3FWEA 4AI1A 3LSEA 2BWAA 5E89A 4AVSA 4DB5A 1YFWA 4S2GA 3WUCA 2BTVC 4QGNA 3RSJA 2X5IB 5JZGA 1XU1A 4LUKA 5KWRA 5GLTA 4L2NA 3NV2A 3QH7A 3RYRA 2WKKA 1ULFA 4XQWA 2YPJA 2XGXA 3D8CA 2H6BA 4QPIB 3ES1A 3MICA 4JDOA 2UWAA 4Q4V1 4S2HA 1H1AA 3JBG1 4CDUA 3M3QA 4BYYA 4BA6A 1SCRA 2BVVA 3QCWA 5FO7B 4AEKA 3W58A 1WW7A 2Y0OA 2JX9A 4KU8A 1JBCA 2DTYA 5D8AB 1RUE2 5FMOS 1ND2C 3ZMNA 3VBUB 1I5ZA 3WDYA 2HWD3 1IHMA 2ZZJA 4U36A 2VECA 4M3CE 4H7MA 2R062 4QX5A