3AMMA

Cellotetraose complex of cellulase 12a from thermotoga maritima
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
255
structure length
255
Chain Sequence
MVLMTKPGTSDFVWNGIPLSMELNLWNIKEYSGSVAMKFDGEKITFDADIQNLSPKEPERYVLGYPEFYYGYKPWENHTAEGSKLPVPVSSMKSFSVEVSFDIHHEPSLPLNFAMETWLTREKYQTEASIGDVEIMVWFYFNNLTPGGEKIEEFTIPFVLNGESVEGTWELWLAEWGWDYLAFRLKDPVKKGRVKFDVRHFLDAAGKALSSSARVKDFEDLYFTVWEIGTEFGSPETKSAQFGWKFENFSIDLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-glucanase
publication title Crystal structure and substrate-binding mode of cellulase 12A from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 59
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ammA00
3MF6A 3AMQA 3RI8A 1M4WA 1XNKA 3O7OA 1XYNA 1OLQA 2DFBA 1UU5A 2F6BA 2DCYA 3LGRA 2B45X 3AKQA 3VL9A 2DCZA 3VGIA 3WY6A 1IGOA 1H0BA 2JICA 2JENA 5K9YA 1F5JA 1KS5A 3AMHA 2NQYA 1REEA 3AMNA 3AKRA 4XQDA 1H8VA 2BWAA 2NLRA 3VZLA 1OA2A 4NPRA 1XNDA 1XXNA 2VULA 1REFA 1OA3A 3VZOA 3RI9A 3WP3A 4IXLA 3WR0A 3VZJA 3WT3A 3WX5A 5EJ3A 3AKSA 2VUJA 1HV1A 2D98A 4HKWA 3EXUA 3HD8B 2DCJA 3VZKA 1C5IA 1UKRA 2QZ2A 3AKPA 2VG9A 3VHNA 3AKTA 1QH7A 1H4HA 3WP6A 1UU4A 4HK9A 4HKOA 1HIXA 1C5HA 1QH6A 2B42B 3VHOA 3VL8A 1XNCA 3WP5A 1OA4A 1W2UA 2BWCA 2JEMA 1H1AA 1HV0A 1BK1A 1REDA 3VLBB 2Z79A 1XYPA 1BCXA 1UU6A 3MFCA 1KS4A 1AXKA 1NLRA 1BVVA 2DCKA 3MF9A 3B7MA 3WXPA 1H4GA 3VZNA 3MFAA 2VGDA 2QZ3A 2BVVA 2DFCA 2C1FA 3ZSEA 3WQ0A 2D97A 3VHPA 4S2HA 2B46X 2BW8A 1XYOA 5K7PA 3B5LB 1T6GC 1XNBA 1ENXA 4HK8A 4S2GA 5HXVA 3AMMA 1PVXA 4S2DA 3M4FA 3VZMA 1OLRA 1TE1B 4S2FA 4H7MA 3WQ1A 3AMPA 1YNAA 3LB9A 4XPVA 4XQWA 4HKLA 3WP4A 4XQ4A 3WQ7A
chains in the Genus database with same CATH superfamily
3MIGA 3NWKA 1DCSA 1Y4WA 2WN2A 4AQSA 4V1PA 2RS53 3WLUA 2GAUA 1L7LA 4PQ9A 4HG6B 1G7YA 1I1EA 4R9DA 4BQ1A 2WFF1 2XLAA 1LJ7A 2QQKA 1WW6A 3C7EA 1VBB3 3G6JB 3JQWA 3NJXA 4FI9A 1CN1A 1RL3A 4I02A 1XNAA 4CEWC 4QX0A 2OW4A 2ORXA 2VC9A 4BWOA 4R4ZA 1SFNA 3M3EA 4LE4A 3ZXGA 1DQ6A 5JXHA 1UMHA 1V6NA 4N43B 1GBGA 4YZ3A 4AVTA 1JZ8A 1US3A 4Z82A 1GKBA 1UMIA 1SFYA 1Y43B 4CXWA 2VMGA 4CCJA 1OLME 1QHDA 4Y33A 2E51A 5DQ0A 1JYXA 4EYUA 3AFGA 3OBRA 3W9AA 1EAH1 2WYFA 3LIGA 4HXCA 4Y20B 4JAAA 3F95A 5C8CC 4XQDA 4Y1UA 1DLLA 4QKFA 1LCLA 4ZHNA 5FLHA 5FJKA 4CP1A 1Q8QA 1GU3A 1V9U2 3UGGA 1GICA 2GP5A 4Y5TA 1XRUA 4AVAA 2E31A 2R041 4K20A 4D0QA 5IFTA 4YW6A 1DHKB 4KBBA 3WVJA 2PHLA 3HR9A 1V6LA 2DBIA 3AYAA 3MLJA 4HKWA 5CIRA 2ZHLA 4UF0B 2QE3A 5F3EA 5KHGA 5FZLA 5KXDA 2DCJA 5I93A 5JLVA 1MS3A 5KHHA 4Z1VA 5K4LA 2O14A 4I09A 5C4WA 3TN92 1FATA 4Q4Y1 3CKHA 4ZU4A 4W50A 1W90A 1SG3A 5C3QA 2PTMA 1Q43A 1H4HA 1QJEA 2RMU1 4KWJA 5J37A 1L7QA 2WSUA 1CJDA 1HRI1 5F3IA 1UU4A 2SBAA 2EIGA 4HKOA 4K7JA 5FY4A 3HWJA 5C9AB 4QB6A 4CCEA 3WF4A 3SITA 1WMDA 5T55A 4J6GA 5GZCA 1WLCA 1C8M3 5GZFA 1STMA 1JYWA 4CEWB 2P1BA 2XLFA 2BWCA 5FZ6A 2FDHA 4LQRA 1SLAA 1ULEA 1BJQA 4TSVA 3JD73 4XUQA 4L8QA 2JDYA 1CWPA 3SH3A 1PIV1 1KRIA 4CCCA 4XF3A 2BOIA 5KHJA 3A23A 4OHYA 1DFQA 2GALA 5A1AA 3VD3A 2FCTA 3ZFGA 1W39A 1NQDA 4XZPA 3BIWE 3LF7A 2CTVA 2P3IA 1DQ2A 5A3OA 3ZR5A 1NCRC 3LPFA 5IYYA 1OKOA 5FO9B 1VBD1 1JZ5A 2Z69A 1O4TA 4Q8LA 1RUH1 5T5JA 5FY8A 1XPWA 1QJX3 5LA9A 1RUE1 1OVPA 4MGTA 2LRPA 3IB3A 4KWKA 1YLLA 1F31A 1NZIA 3FBMA 2BNMA 2J1UA 2XDVA 2X53S 1Z0HA 4AFMA 3IM0A 4QXKA 2H6BA 1AR71 2A3XA 4WM8B 5LZ6A 2I45A 2QNKA 4BE3A 4E2SA 2JG9A 2ETEA 5FY7A 3J26N 3H8RA 4V2VA 5LBEA 1MEC1 4AHXA 5F3CA 1W04A 3PTYA 4R9AA 4XXAA 4FAGA 1KGYA 1IPJA 3CJIA 3PIJA 4Q4W2 4QXBA 4CDXA 3WDYA 1MZ6A 1GZWB 2BGOA 3RNSA 2A1XA 1SLCA 2WYSA 2A7AA 1JHJA 2ARAA 4QKDA 3VN4A 2K2SA 5C5TA 2Y6LA 1GOHA 2RR12 1POV3 1RUJ2 5GJ6A 3MLLA 2ADDA 3DKWA 4C1WA 1GQHA 2VJXA 3SHRA 3I2KA 5KXCA 3AZXA 2D6PA 5F5CA 5JR2A 3FLPA 3POEA 4QT6A 3DN7A 4KL1A 4UW3A 3WDWA 2ZGUA 4DZGA 2IC1A 4WZFA 1RINA 1RVF2 1BBT3 3MGUA 3QOPA 2W9XA 2DCTA 3USSA 4FBFA 4CDWA 3VBHC 3ASIA 4EE2A 3NL1A 3LDRA 3BTXA 1JBCA 3IPVA 4H7LA 5EJZB 1W6QA 1H9WA 1ODMA 1AF9A 1GNZA 1OHFA 4RR3C 1TMF1 2WNUC 4Y1YA 2OUJA 2WZEA 4CU9A 2W39A 4XVHA 3S30A 2RS12 3Q8EA 4Z07A 3LD8A 4LK6A 3ME2A 2R043 5FZFA 5FMOS 3KT4A 1REFA 1PO22 1JHNA 2E32A 5FZBA 5C6CA 1N3QA 3LFMA 3ZX7A 1LRHA 4H55A 5CA6A 1J3PA 3I2DA 4NAOA 1AR91 5A7NA 4DXZA 1ZA4A 1C4RA 2XUMA 3VD7A 3ZSKA 3ORJA 1GWMA 4Q4Y3 3HT2A 4RS5C 3OPTA 1ZRFA 3VHNA 3J7LA 1HRI3 4A6OA 1QH7A 4OVEA 4UBGA 3B01A 2PHFA 5I8TA 3WP6A 3ZMOA 1BEV2 1O7FA 3I59A 4HK9A 4HPKB 4GJZA 3W58A 5I0SA 5JPNB 1GP5A 4I3PA 4CP9A 3VDDC 3K48A 2C0ZA 3O1VA 1OOPA 2HBUA 2HWE3 1COV2 4LHKA 4DINB 1W2UA 1WMFA 2RM23 1AXZA 3TBDA 2X5IA 5JI9A 4LE3A 2R7EB 4CDUA 2WAAA 3U4SA 1BK1A 3TYJA 1K5MB 1B35B 3MIEA 2RS52 1XYPA 3KZ4C 1BCXA 3DPRC 3D5OA 4BLIA 4AQ6A 4JTOA 4E2GA 4NWVA 4DXRA 2WZR1 2NZ9A 3KCYA 2R063 3AZYA 2IVJA 3H9AA 1ZRIA 1SEFA 2DCKA 2WNVC 3CDZB 3HQXA 3NSTA 5FP7A 1RUE3 4AG4A 3WXPA 1W8ZA 4FOYA 2Z5WA 5J7MA 3NNJA 2RE9A 4RHV2 2RDSA 2ZXQA 1DGRA 3UT0A 2BP6A 2TBVA 4QU2A 5BNPC 1W8WA 4PQQA 4E4HA 5F5IA 3WW3A 4W6WA 3TAYA 1ENRA 2JD9A 1UN1A 1VB2A 4YVSC 3BU0A 4EN8B 4ET7A 3SCFA 1MR5A 3ILNA 5EHDA 2E6VA 2GSYA 4WVWA 2A73B 2IZWA 3DV8A 1GLHA 3IN9A 3FFQA 2XGXA 4EWAA 1R093 1NKGA 2YB7A 3PVEA 4PF1A 2VZVA 3E5UA 5I0DA 2GC3A 3WEZA 4DS0A 1LULA 1NE6A 4RQPA 2G4IA 2ZTNA 3KV9A 1K5JA 1QOOA 4UFMA 5FMBA 4IV3B 1A3KA 4DRVA 5LEKA 2P37A 2ZGSA 4DRRA 1QDCA 4NRMA 3OEBA 4OLLA 4RFT0 1IQDC 3SEEA 4Y26A 1A78A 1DYKA 1NCQB 1XE7A 2ZEXA 5CFDA 1G9AA 3HMYA 2VMCA 3V0AB 5C3SA 3W5NA 2J1EA 2PMWB 4IV1A 2ZAAA 3TEYA 2WIIB 3WF2A 5FYCA 5IVBA 3DPRB 1CGPA 2FDJA 4C0HA 2D7FA 4BCUA 1C8M2 1IQAA 2WWUA 1W6PB 4JGYC 1J59A 1TMF3 3O1OA 3ZXLA 2CNAA 2FD8A 2XOMA 2VOKA 5JIAA 4XF1A 4NHYA 3IDAA 1X7NA 3POFA 5FYSA 3JD72 1OD5A 1NLQA 1Y9MA 5GLTA 5F5QA 2NLRA 2LUWA 2QFEA 4LHLA 5FUIA 5FY9A 1AX0A 5DABA 4E4SA 2HYXA 3MZHA 5L9RA 4QB1A 1Z7S2 5DAQA 3UKTA 1QWRA 4XTPA 4LBKA 3APBA 3VHRA 1MS9A 4OHWA 2WWJA 1W6NB 3KQRA 4YFZA 2FMYA 2J1SA 2W92A 4AQ2A 3NNLA 1PO13 4C90A 5J09A 3CZUA 4KH9A 3LWCA 3RZJA 5ABJA 2G9ZA 3D6EA 3GBFA 3VBFC 5FPLA 2A3YA 2XJTA 2EF6A 5T3NA 5HV4A 1PNFA 2G9GA 3I54A 2W0XA 3EBRA 4QPGC 5BNNC 1CIWA 1HIXA 3UJOA 5EP9A 2IXLA 2B42B 5DXDA 1VRH3 3VD4A 1ZYBA 3BN6A 2V73A 4N53B 2Q4SA 1S0CA 2KA3A 1AYM1 3D8CA 3MICA 3R05A 4LBQB 5FJHA 1JH5A 1OUXA 4EN9B 4Y22A 1Y9GA 4QPYA 3ES4A 2O8QA 4YZ2A 1EPWA 2CHHA 4A3XA 5BNOA 3FUQA 1UU6A 1TZOA 3POJA 4AI9A 3LSDA 2DUQA 3T0BA 3ZKUA 3ITQA 1F8VA 5AC93 2GNDA 4JRLA 3K75B 1H4GA 5K8SA 3DF0A 4CEWA 2DYCA 1S0DA 2QZ3A 5GKAC 3P1IA 3VDBA 1CAWA 5IK5A 2C5DA 5CBLA 4PIXA 4I30A 2D97A 5GM0A 4IQPA 3V64A 4XJZA 2BYVE 2PLV3 5FXVA 1QU0A 2VMHA 1VB4A 2GU9A 1ACCA 2G9FA 1O4ZA 2YPJA 2XVKA 4LUMA 5FZIA 5T54A 4XF0A 3NO8A 4FP3A 4LORA 4NPLA 1ND2B 2ZKNA 3VBRC 1R081 2VU9A 1QGLA 1L7RA 1VR3A 3C7FA 2CGOA 2R042 3KV4A 1RGSA 3M4FA 5C8CA 5JZGC 3CMGA 4META 4R9BA 3AJZA 2CAUA 3VB9A 2W46A 2J1AA 2ZEZA 3H50A 2PN5A 4XPVA 4XQWA 1V9U1 3ZXKA 3ZM8A 2E33A 3L9JT 4W4ZA 2WO1A 3BPZA 4PJYA 4PHZA 1YFXA 1PZ8A 4BLJA 4LOTA 4Q4Y2 1V6IA 4XXPA 3VBSC 4GA9A 2GP3A 1XYNA 1U5ZA 1NA1C 2RMU2 4XUOA 1AR83 2F6BA 1HRI2 2JWPA 3ILFA 3SQOA 3IBMA 4E9KA 1I6XA 1KJLA 5CKNA 5FOJB 2BBAA 3KS7A 2VQUA 1SLBA 3ZYRA 2GDFA 5C7GA 2FQPA 4Y3OA 5FXXA 4YPJA 5FPXA 3FBYA 4FTSA 4BB3A 1V70A 4P9GA 1UZ0A 3ZVXA 1YQ6A 2HWE2 1EV11 1I5ZA 1D2QA 1IGOA 1PVC1 4WVMA 2UWBA 2PAKA 5A32A 1QJU1 2GN3A 2VUAA 3A0NA 2GC0A 1W3VA 4LEJA 2GNMA 3H3LA 3AMNA 1X33A 3FJSA 4Q0QA 5DAXA 5T5PA 3WG3A 3U37A 3ZSMA 1JYIA 3SH4A 2ZAHA 4FPHA 2VZTA 3SCHA 4QU1A 1JODA 5DUUA 1S0JA 2R062 1RUH2 3WW2A 1F2NA 2W91A 1NY71 1RUE2 1T6BX 3EYPA 5GLUA 1NCRA 1HV1A 4MGQA 5FY0A 4ASLA 1ULPA 2A6WA 2A75A 1LEMA 4YW2A 4DXSA 2TNFA 1AR72 4HBNA 3QCWA 5GLWA 2KD7A 3HEIA 4YZ5A 4HVQA 4B7EA 2HKXA 2QUOA 3FX3A 1W6OB 4MUVA 4OCTA 3S57A 1MEC2 1QJY3 1PK6C 3E6DA 4DB5A 1C1FA 1NG0A 2HEYF 2VCCA 3DECA 5JSOA 1YRZA 3ZYHA 2GMMA 4YYOA 4YM0A 2PQQA 3ZKYA 4NROA 3FMGA 3HIFA 3NNGA 1R092 1H2MA 3DYPA 1PX4A 3FL7A 5A7WB 2VCMA 2DTYA 3MLKA 2OXBA 4H3WA 1EUUA 1OFNA 3OUIA 3OGSA 4ZS3A 5JMOA 1UIKA 2NM1A 1J1TA 2Y0OA 1YUDA 5F1RA 4GH4C 1BMV2 2ET1A 4CU6A 3IAPA 4Q2FA 2D6KA 1N1YA 3OGRA 4E27A 4BK4A 2D3SA 4LO4B 1HDKA 3V56A 4JC1A 4M3CA 1UMZA 1WKYA 4QX5A 5CFCC 3MFAA 2RDQA 2VPVA 4FPEA 5A6QA 1JYNA 4KGQA 2VZPA 5A3TA 4FPGA 2Q0AA 2NMOA 4B3NA 4BXSV 3JZVA 1F35A 1OC1A 1TMF2 3VBHA 4WBBA 3AL6A 1NE4A 3IDBB 3MUY1 4NMIA 4XW3A 3F2ZA 2VY0A 3CJXA 4D94A 3Q8FA 2B7YA 2JDKA 2WNEA 4QDRA 5D8AB 5ISLA 1VLNA 1C3HA 2X8KA 4RR3A 1LU2A 3INAA 4LO7A 4S2GA 2WNUA 4CUBA 5L7OC 4YGEA 2FDGA 3RPQA 3T1LA 3VZMA 1HW5A 4PIYA 4S2FA 3RRDA 3RZLA 2EXKA 3DEMA 2P3YA 2ZCWA 5FBZA 3VBOB 1PO12 3IZOA 1UO9A 3T08A 4QM9A 1GZTA 3U10A 4MLOA 1HB1A 2Q1FA 4XUNA 1QIQA 4RS5A 3TRSB 2QQJA 3A21A 1HJGA 3AKQA 1C57A 2OZJA 1DG6A 3ZYIB 1PNGA 1KJRA 3WG1A 5FP4A 1FI2A 3VGIA 1EV13 1PVC3 3T2PA 3MW3A 4GQ7A 4NO4A 5JXGA 1WCUA 1PHMA 4BPZA 3I2OA 5LRSA 1BEV1 4HL0A 3V0BB 1RUG3 3NRUA 3VDDA 1JN2P 1FXZA 3AZVA 1XBFA 5JXIA 4IEWA 3RWNA 2WNOA 1JUHA 1REEA 4GAZA 2G19A 1CZSA 4LBQD 3ZSLA 5A3LA 2W5FA 1A8MA 1D4M1 3IIAA 5EZWA 4GKYA 3DPRA 3KT1A 4GALA 3QACA 1S0BA 1EY2A 3W5MA 4IEVA 1ZRRA 3WT3A 1LHVA 2P34A 1VE0A 5JAXA 3M3OA 2WNVA 1KITA 2ARBA 3C2UA 1H8TB 1VBB1 5FKCA 2ARCA 1O8PA 1QXJA 3LA2A 4NIHA 5J96B 4UI9L 5L36A 2D44A 2VMIA 4FSJA 3TNPB 1H1MA 2PLV2 2VG9A 3OY8A 1RYYA 3H0OA 1IZ3A 3GM8A 1JZ3A 2EXIA 3DL3A 4ZKTB 2XUEA 1SFPA 2ZABA 3LZZA 3PVNA 1E5IA 5C5UA 1CONA 2AACA 4YVSA 4Q0UA 1GZCA 1ALYA 1C5HA 1QH6A 2HWC3 2UY9A 5DDJ3 5LA2A 5F5AA 4Q5OA 5FZ3A 5LBFA 3P5BA 5FKBA 2PHDA 3EHKA 5T5LA 2WQ4A 2YU1A 3BTYA 4CP2A 2VCAA 4DUWA 3E1F1 3VLBB 4UW5A 3JUUA 1LEDA 3WF0A 5LASA 3WUCA 2PQSA 2AEZA 1AR82 3D3AA 4XMAA 2O8OA 1O3RA 1W9WA 4J1WA 3WW4A 1JZ2A 4XFIA 1BXHA 4GWNA 3D0SA 1NXMA 4JX0A 4B4RA 3LKJA 3RG0A 4YW5A 2Z4FA 5K0UB 3KF3A 1S0FA 4I2OA 1DF0A 2XJQA 5FZAA 1US2A 3VHPA 2WT2A 5FRAA 1WLDA 4JGYA 2X29A 1TVGA 4LBLA 5A6ZA 1MS5A 4CTEA 3LEKA 1P8JA 3WF1A 4HVOA 2CDOA 2VTFA 3H7YA 2ZPXA 5FY1A 1GWKA 2B4KA 3NKTA 4D7SA 2VZSA 3JD71 4N43C 5IATA 2W1UA 1QQP1 1UY1A 4UFKA 2DVBA 2YBSA 1YNAA 2DTWA 2OQ7A 3P6BA 3B9CA 4FFGA 1W2OA 4ES9A 2ARXA 1BHGA 3WNNA 2WN3A 4HETA 4XIKA 4D7YA 5IWFA 3VBUB 4E8DA 5LK7B 3QD6A 4LKFA 1QJX1 2CGNA 4P5HA 1QJY2 5H9SA 4CCOA 4A7KA 2CU5A 3I2JA 3R4DB 2CWMA 5GZEA 3VBFA 2WS91 1OD3A 1ZZBA 4OI4A 4RYDA 1YJLA 4QPGA 2JIJA 1WCSA 2OQ6A 2OVUA 3GF6A 3OJBA 4AVVA 5BNNA 2NP0A 3CEWA 4QX3A 4XAAA 4EZHA 4PLOA 1TEIA 2ZS6B 5T50A 1ONAA 2ZHKA 3ON7A 1PZ9A 2VZOA 4MGYE 4UAPA 2ZHMA 1SZBA 4CEYB 1I5PA 4K8RB 2XKOA 5FZOB 4CCMA 5JCTA 2A5ZA 1CJPA 4GMP0 4AEDB 4BYYA 4I0WB 1EYBA 2PHXA 4TTGA 3AP4A 5C9AC 2ZMLA 3KCCA 4PF5A 3ZN6A 4JKMA 3ES1A 1BKZA 2RS31 1POV1 4ONUA 2ENRA 3J8F3 4CCNA 1LR5A 4RSUA 2MHFA 5IVYA 3PHMA 1ASJ3 2IFWA 1XJAA 3BI3A 2QQWA 4UW6A 3WHTA 1IOAA 4D8MA 1BBT1 4N9IA 4GWIA 1R082 5BPXA 2ZGMA 1DLCA 2CAVA 3AXEA 3NKGA 3URFA 2IXHA 3LEMA 1JZ7A 1PX3A 3HNMA 1TNFA 3HNYM 4HN0A 5BNPA 3UV9A 4CCKA 2JKXA 4LKDA 5G05L 5FAXA 3VBRA 3ZXDA 2VBBA 4JKLA 1MVEA 4R4XA 5DUWA 2BV4A 1D0GA 1YIPA 2P17A 5JZGA 1KXGA 4NAMA 3KCXA 3DGTA 3ZO0B 3CNAA 4BA6A 2HWB3 3U11A 2GNBA 2X10A 2C24A 4J1XA 4WM8C 5FPZA 2I74A 2YXSA 5B2GB 1X9PA 1KFXL 3GZEA 4QWNA 1KQRA 1WW7A 1YXWA 4FPJA 3O1RA 5A70A 5FP3A 4OULA 1AXKA 4AE2A 4KQ7A 3VBSA 5CEHA 1HB2A 1DGLA 1NA1A 1UYPA 2D40A 1AHSA 4GWMA 2ID4A 1RC6A 1IG0A 2E7AA 3I2GA 1OF3A 1CAVB 1AJOA 1D7PM 5JOXA 1EV12 1J84A 1PVC2 5DAPA 5JXJA 2JDUA 1QJU2 1RJ8A 1MS1A 4M01A 5EFUA 1NZCA 5FYBA 5DN2A 5DAVA 1IS6A 4QX8A 5KHIA 2YYOA 3GZTB 1SCRA 5IJRA 2JDZA 3RS6A 3QLQA 2AZ5A 4XURA 1A8DA 2HWE1 2ILMA 4ORFA 5HXVA 5LK5A 4COVA 1QQP3 3LDBA 1Y3TA 1JYTA 1NY72 2RM21 1QXPA 2ATFA 2XJVA 1Q8PA 4A7ZA 3CZJA 5CU1A 3LIHA 4QQOA 2VOWA 4XIOA 4DUXA 1W0PA 4QPIA 1RB8G 2P6HA 3VUOA 4CP0A 2R061 3ACIA 5FZEA 3C3VA 5BUVA 3GZAA 1UOBA 1H2KA 1R64A 3W21A 3PU8A 4MXVA 2WS93 5EWSA 5A1FA 1ZZCA 4UW4A 4JGZB 1UX6A 5CISA 4JRAA 1W03A 4ASKA 2IXCA 3M3QA 1PK6A 2EXJA 4AVSA 1UZVA 2DCZA 2BVBA 2UYAA 4NHMA 1AL23 1E57A 2HWC2 3SMHA 4DXTA 2Y64A 5B4NA 5T52A 3OEAA 1UYXA 4OHXA 3E5XA 4LIVA 1H6YA 2H6CA 2Z2SB 2ZACA 2UWCA 5F2SA 4ATEA 2K46A 1OLMA 4ZU5A 1R091 2XWBB 1RUC3 3DUIA 2EIDA 2MEV3 3VZLA 5BNQA 4BOWA 4LA3A 5I8SA 4TLFA 2RS33 5J1XA 4GH4A 2ZZJA 3KWVA 3L2HA 1QDOA 3I2FA 3OYWB 5CKMA 5FPUA 5KR7A 1BMV1 1NX9A 2CWSA 1S4CA 1RUNA 3FN9A 1CVNA 2HWF3 2YFUA 3KV5A 4JV4A 1LECA 2YY1A 5CFCA 3O1SA 1L3JA 1FMD3 5DG2A 4G9SB 1K5MC 1B35C 4NPMA 1XE8A 1UKRA 2QZ2A 3NAPB 1OH4A 4XJ9A 2YMZA 4YVWB 3UJQA 4L92A 4AAPA 2FDFA 3KM5A 1CAUA 2Y6FA 4XILA 5CYYA 4Z92B 2YGMA 4BH9A 2EAKA 5F6KA 3WV6A 4MO3M 5J48A 3BCWA 1G9DA 5L7OA 4Q4X1 4XJAA 1WW4A 3CF6E 5C70A 3USUB 4O61A 3L2YA 1SHWB 2V5YA 4LO6B 1ULCA 4NHKA 5IHRA 3OSDA 5FWJA 2VZ3A 3OGVA 2R0FA 2Q8CA 3UNPA 3TEZA 5JOZA 2HEVF 5G04L 4NRPA 4GULA 4YM3A 1CQ9A 3NV3A 4MADA 5C71A 1SQ4A 1WCDJ 1PGSA 3HQRA 3ZXFA 1NLRA 2JDMA 1XSRA 3ZXAC 2Q8DA 3D82A 4IEUA 2E7TA 2IXJA 2QJVA 4PLMA 1PO11 1WGPA 4QKNA 2WA3A 4F3JA 2YV8A 3WNXA 5FO8B 1IS4A 3P3NA 5EPAA 1W8UA 1XC6A 2I07B 3JB4C 4UFJA 4AZZA 4YWAA 2JG8B 3UETA 1GV9A 5IVJA 4IV3C 2WABA 2VCBA 1VMHA 3EB7A 1NCQC 4DIQA 4LXLA 4DFSA 1VRH1 1T6GC 5A33A 1D4M2 4AI1A 5IVCA 1ZZ8A 3M70A 2QQIA 3THCA 3Q8AA 3ZPOA 1YO8A 1DGWX 4H2AA 1LHWA 2V5DA 2YGLA 5LBCA 2LTNA 4K1ZA 1VBB2 2VQTA 1FAYA 2V4AA 5JMCA 2RG4A 1FT9A 3H7JA 4H14A 4NWWA 3GYDA 4HSJA 4LBNA 4XHBA 4L0PA 2V72A 5AC91 4LBOA 2QQUA 3PVBB 1W9FA 2X09A 5JWPA 1R1A3 2EXHA 1OQEA 3JBG1 3ZFEB 3W59A 1DIWA 1C28A 3PJYA 5AFBA 3BIEA 2C9AA 4SBVA 4GJYA 4L2NA 1WW5A 2BZDA 2B45X 3AC0A 4AI2A 2IFRA 2C6SA 3TOJA 1GQPA 2PLV1 3POSA 4HSLA 3MIBA 3GCWA 4MXWA 1QF3A 2Y8KA 2VVFA 3IDCB 1W6MA 2LALA 4ARYA 4D69A 2ZGTA 5J36A 3ZFFB 1GOFA 3B93A 3LEIA 4N7IA 4WZCA 4EV0A 2VOXA 3PMSA 2HWB2 3A7QA 1BZWA 5GLVA 3RGBA 5IT6A 5FLIA 1DU3D 2D6NA 4EN6B 3ZR6A 5KWRA 2XMLA 4OI2A 3J7MA 4TLGA 1YEWA 2Q30A 1GQGA 4M0HA 1VMFA 2AREA 1OA3A 4XJWA 4EROA 4UWDA 4WM7A 2D3RA 3POBA 4IUGA 4JDOA 4Z2AA 4N53C 5F9TA 1HB3A 1S2KA 1AR81 2Y6KA 4CPBD 4AL9A 2F4LA 3N7KA 3B3QE 1ZNPA 3JU9A 4ZY9A 3UKVA 4RA0A 1G86A 4B7KA 2RJLA 3VZKA 4Q26A 4QDQA 4PT6A 1WCQA 3ZMNA 1H9PA 3AKTA 1WLWA 4FOQA 4W6YA 1Q8VA 2ZA9A 3WD5A 1OH3A 4OMDA 2Y6JA 4Q4X3 1UPSA 1QQP2 3KHCA 4YGDA 2WWSA 5DPNA 2DVDA 1JW6A 2TEPA 4UOJA 3SEPA 5EYXA 5FY5A 1XNCA 4AW7A 1DGWA 3JCIA 4N43A 5FZ4A 1OA4A 4MOAA 1WBFA 4FCAA 1LODA 3HOBA 3B9IA 3T2TA 4OMCA 1HRV3 1REDA 5ANNA 5FYMA 1QJX2 3O1TA 3O0WA 4FT8A 1ND2C 2GH2A 1AXYA 4NRQA 2PAEA 3SISA 4Y20A 3IIIA 2WS92 1XU2A 4CDQB 4JDMA 4QHZA 1A34A 3KF5A 3JQXA 2BNOA 4FXGB 5H9PA 4NUBA 1WBLA 5A7QA 1POV0 2R16A 3RYKA 4ISQA 4FAHA 5CNAA 1LAJA 5EQUA 1V6OA 1AL22 5FP9A 2BVVA 1QJY1 2C1FA 5E1RA 1W2NA 2C26A 1G9BA 2C9KA 1HN0A 5D21A 2QVSB 1VBE3 3TEXA 4UF0A 4TN7A 4BHPA 1J83A 5K7PA 2AH2A 2UU8A 5FIXA 3ZYJB 1YCIA 2VH9A 2WQZC 1ENXA 3AZWA 4K1YA 4PDWB 2MEV2 2WFPA 4MHRA 3N9PA 5KC5A 3AMMA 3WG4A 3ETQA 2RS32 5FZDA 3B69A 3RJRA 1LHUA 2PAMA 4G4FA 1GZ9A 3BOWA 5J3UA 1WCKA 1YQCA 4CSWA 5C9AA 1KDKA 4E8CA 1FOD3 1W8NA 4P9JA 2DDUA 4UFIA 4WVZA 5KHKA 4Q8KA 1BBT2 4TWTA 5F3GA 4CZSA 3ZPYA 3HJRA 3JBG3 5HCAA 3MO4A 2IXIA 5FZMA 1M4WA 1SDWA 1UOJA 4BQ2A 5H9RA 4XUTA 1RUI3 5DUXA 3CL1A 1W2TA 2WO2A 1O91A 5ANQA 3OCPA 2DU1A 3WCRA 2ZZQA 4COUA 1CIYA 2GH8A 4JHTA 1ZZ6A 2W87A 3DKQA 3RJ2X 5JSRA 2NYYA 1NQJA 4AGGA 2XLGA 3RZHA 2Y0IA 2D6MA 3WY6A 3RYRA 3ATGA 2VNVA 1OI6A 3A22A 1H0BA 4WV8A 1JOJA 2FZ2A 2VW1A 5L73A 3ZOIA 1ND3B 2K9ZA 3NQHA 4A44A 4Z8BA 2BUKA 1NAEA 2RV9A 4NIIA 4Q0SA 4A7YA 4ASMB 5E16A 5HCFA 4QHOA 1Q3EA 3N7MA 4BQ3A 4NPRA 4WM8A 2JIGA 4W65A 4INDA 3VD5A 4QMAA 2VZ1A 1QXRA 4FOWA 5FBJA 3WP3A 2WLPA 3NJVA 4BQYA 4DY3A 2XPJA 4HONA 2A6YA 5SV5A 2LM3A 4XUPA 2D98A 3U75A 3EXUA 4KGGA 3HD8B 1SPPB 1GZWA 3H8OA 3CIHA 2WAOA 4EQVA 2B8MA 1SBDA 4ITCA 1RUF1 4A42A 3AKPA 3AB0A 3BU7A 3BVCA 2RM22 3RFRA 1O5UA 3HT1A 1U0AA 4Y24A 2XVGA 3OD0A 1KD7A 3BUCA 1W9SA 1RUG1 5EV7A 1O4YA 2ET7A 3C7OA 3E97A 3FLTA 3NJYA 5A3MA 1LHNA 2XJRA 3HN3A 1MACA 4LNVA 1W2AX 3FE5A 3J4UH 3GHMA 1EP0A 3MPPG 4GKXA 4O9EA 4XABA 3UGHA 1H1AA 4XOGA 1V6JA 4CYDA 1ULFA 3PUAA 4XJUA 5D8AC 2ZEYA 2BDRA 4EN7B 5IUQA 1NOVA 2AGSA 5F7UA 1UWWA 3AXDA 1BVVA 3POIA 2ZEWA 2WR9A 3AZZA 4LBMA 2RVAA 3K2OA 2VGDA 5L9BA 1V0AA 3VZNA 3WDUA 2ERFA 1XE0A 1V6KA 1X36A 2DFCA 2JB8A 2YHJA 4XDPA 4Y5SA 3VBOC 4FQZA 3ZSEA 4A41A 1ZBA3 2D3PA 2DBNA 3N9MA 3Q9OA 4S2HA 3UESA 2WT0A 4OZXA 2CDPA 3KLSA 1XYOA 2HWC1 1GMMA 1W8HA 1AYN3 2P2KA 5DDJ1 3ZN5A 2YC2A 5CADA 3AVRA 1UY0A 5IFPA 5L9VA 4EZ4A 2BFUL 1ZVFA 1ZX5A 1HXS3 3GCXA 4XETA 4BQ5A 2Q1ZB 4HPKA 5FYZA 1C1LA 4KG0A 2WZPP 4Y1VA 4JQTA 4P14A 1UXXX 2DWRA 4YFWA 3AP7A 3MF6A 2QBXA 5FMDA 5C4WB 4M4PA 2AEYA 2ZGOA 2D43A 3IWZA 5IVEA 1QNWA 2DF7A 4QB2A 4HMZA 5T5OA 5FFOC 3HNBM 3OBTA 2FCVA 1K5MA 1B35A 3ROUA 3AX4A 2VMFA 4Q4X2 5EJ1B 3MHZA 1CZVA 5FP8A 2Q5TA 3VL9A 4UT5A 1POQA 5EYYA 1O3SA 1BQPA 3RMXA 3U14A 4EJRA 1H8TC 3KSCA 3N7JA 3AJYA 1LB2A 4Q0VA 4N90A 4XFHA 2Y33A 4A4AA 2RDRA 4MH0E 3ZSJA 2SLIA 1YI9A 3ZFGB 4YM2A 4HZFA 4R8HA 2BWAA 2P3JA 4X8NA 5IW0A 4B4PA 2D6OX 2ZX4A 3UK9A 5FLJA 5DMYA 1XXNA 2PHTA 2P4EA 3K4DA 3T4VA 4C91A 5FZ0A 4QGLA 2PFWA 1GUIA 2JDPA 4UFHA 5FZ8A 3AM2A 1DZQA 4Q29A 1PM4A 1PGW2 2JX9A 2ZX1A 1RUF3 2VTXA 3KGLA 4LR4A 1N47A 1C8NA 1SBEA 4XFBA 3BODA 3GHNA 1OBNA 5AFEA 1VRH2 4FPFA 4HANA 2JG9B 4FFIA 4HVRA 4UFLA 3VKFC 4IV3A 3BTAA 2Q8OA 4AHZA 5C3OA 2Y26A 1QJFA 3Q8BA 4QX7A 2WDBA 4YW3A 5E6HA 1NCQA 3LQCA 4XTMA 4F7ZA 4CXXA 1DGRN 3CJIB 4CDXB 2XXZA 3V0AA 1ZA7A 3LPGA 5K0UC 4D6SA 1ULGA 2ORZA 4OUEA 5BXXA 4BXFA 5JPMB 3Q8CA 4QD2A 3V0BA 5AC92 4MZUA 3TN93 4U36A 3AFKA 1ULOA 1JI6A 1DP0A 1W6PA 4K3UA 5CB7A 1N3PA 3JBG2 3ZLIA 1MS4A 1YQ8A 1YWKA 5EXOA 1GWLA 1RUI2 4ATFA 1AX1A 3NV2A 2WUHA 1CAXB 4ZXEA 2DURA 2XB6C 3WDXA 4AR2A 3ACGA 3J8F1 3RZMA 1YHFA 4O65A 5C3RA 4CDWB 2JDNA 1ASJ1 2Y34A 4BQWA 2JDAA 3N9OA 3IPVB 1RMU1 5A3NA 4BQ4A 1W6QB 2BERA 3WOGA 2W94A 3OBZA 3OUJA 3DXTA 4B29A 2W95A 3WW1A 2VBDA 1GP4A 3T2OA 1JS9A 1LKNA 1LU1A 4QQPA 2P5BA 5DUVA 3AK0A 5C3PA 1W6NA 2WZ8A 2N7GA 3ZXJA 3LFIA 4Q27A 1XNTA 2DV9A 3CBNA 3VBUC 4EN0A 2VM9A 1N1SA 1U5IA 1VBA1 2LROA 3EJKA 2XHKA 4PLNA 1TG7A 1XNBA 1RXGA 4XCAA 5FK8A 5LRRA 4PBPA 1IS5A 1G6NA 3WDVA 1LOEA 4DY5A 4OFGA 5FZKA 2VZQA 1HKDA 2AR6A 2ZGKA 2HWB1 4RGGA 1UYZA 4QX2A 1YI7A 2VQAA 1RXFA 3PMEA 3GNEA 2VL4A 4RGAA 4V2WA 5A6XA 1NYWA 3M2MA 4J25A 1NXD1 1JMUB 2JKBA 5E89A 3S6PA 4DQAA 4N53A 3QBQA 2C4XA 1MPXA 4LOSA 1PGL1 4CEYC 4LBQA 1PM7A 2AYHA 2OT7A 3BYWA 3VKNA 2YZ4A 1JUIA 1OLQA 2Z42A 1SMVA 3THPA 4AEDC 5A6YA 1CESA 1YFUA 4Q4W3 5SV8A 1XB9A 3I59B 2PYTA 4N7UA 4AXOA 1OF4A 4XC9A 1SBFA 2GNTA 3DYOA 3IMMA 3K3OA 5FCCA 1SLIA 2Y6HA 4LKSA 5JIUA 2QTWB 2RDNA 4CP9B 2ADEA 1E5HA 4R52A 1OOPB 4IE7A 2UYBA 3AP6A 4Y5Z0 2RR13 1RUJ3 2VAUA 2X5IB 5JDBA 2XVLA 3HAGA 4BZ4A 4CDUB 4EWEA 3C8XA 1GP6A 4RFRB 2D5HA 4Y4RA 3N3HA 2OPWA 5DG1A 5F8PA 1DQ1A 1WD4A 1WWYA 3AMHA 3R0RA 4ES8A 3RZKA 1RVF3 3H3ZA 1O6UA 3IT8A 4YW1A 2A70A 3TWIA 4QXCA 1VBC3 1XNDA 4TXWA 1ND2A 2P3KA 3AYDA 1OMIA 4YGBA 2VW2A 3VZOA 3RI9A 4NIDA 1JU4A 2ZGNA 4HN1A 4IXLA 1QY4A 5GZDA 3TB0A 4AOCA 5GLZA 1OT5A 2PA7A 2A71A 3LDKA 2VUJA 1S1AA 2YC0A 2RS13 1RITA 2BGCA 1BK0A 1C5IA 2VZRA 2JECA 3TNQA 1AL21 1LOBA 2JD4A 2YPDA 1N1TA 4OUSA 4ZU7A 3THDA 4IEXA 5CG9A 1OQDA 2VECA 3KVBA 4LJHA 1N1VA 3AYEA 3ACLA 1JTZX 3PTRB 4JKKA 4RQPB 4LLOA 3VL8A 5A3UA 1GOGA 1I3HA 1GR3A 1RUC1 1H6XA 2A6XA 2XONA 1KFUL 2MEV1 4YNIA 4GB33 3PUHA 4NN0A 1S2EA 1V6MA 1IKPA 1UPIA 4MV2A 2ZMNA 4AGRA 3EQEA 4BQXA 5EIYB 2EIBA 1OVSA 4LTAA 2Y38A 3FWEA 3O0XA 3BTZA 1CX1A 1M06G 3ABZA 5CFDB 4JZRA 4LK7A 3EO6A 3OPWA 5BV6A 3J9SA 1OQ1A 3MFCA 4LULA 1HLCA 1KS4A 4KG8A 4IV1B 2YFZA 2HWF1 2GMEA 1Q8OA 1RMU3 4OI1A 2QQNA 3RSJA 1K3IA 2HBTA 1FMD1 1HQWA 2VW0A 1LOAA 2XQXA 3H3UA 1LENA 1XQNA 1GFF2 2VOVA 2ZKLA 4IE0A 2OYZA 3N9NA 1F15A 1AR61 3ZYPA 4AQTA 1VBA3 3GBGA 4JTNA 5BY5A 3I8TA 3MI8A 4ZXKA 2VBPA 1VP6A 5FYYA 4KU8A 5CVRA 4JGZC 4FOVA 1W6OA 4RHV3 3G7DA 3T4HB 4AFAA 5IK4A 2XL7A 2WT1A 4CVUA 1LOFC 1UYYA 4NIGA 1TE1B 4TYSA 1IG3A 2WO3A 2FDKA 1YQ2A 2VUDA 5FZ7A 4LIUA 2DU0A 5I0TA 3WQ7A 1GYKA 1YJKA 1RUF2 2IXKA 5CAZA 2A6VA 2EALA 4IL7A 5A7WA 5ABJB 4HOOA 3BGAA 4Y4YA 4RL7A 3K4ZA 1DDLA 3WSOA 1ZBE1 4ZZ8A 1S2BA 3RQ0A 4Q4V1 3GGLA 3SH5A 1VAVA 3AP5A 1RUG2 4N9HA 4XMIA 4AYUA 2DCYA 3LGRA 4OHVA 4IGOA 5D2AA 1MS8A 3S5QA 3ZIWA 1WD3A 4M3CF 4P9XA 4MVTA 1UNBA 4YG0A 3MEPA 3POYA 4QGNA 3MW2A 3NNMA 4Y22B 4E4DX 4RGKA 4XF9A 3H1YA 4K8FA 1WA4A 3VDCA 1MQTC 3NAPC 1HQLA 4IW3A 5BNOB 2OIIA 1RIRA 4LPLA 4YVWC 4R9CA 2YROA 2VO5A 4AEJA 1RJ7A 3AKRA 1VAKA 4XE9A 5FO7B 1J3QA 1MZFA 2VXRA 1AJKA 4P02B 5D8AA 2FMDA 1K12A 5A80A 4E4ZA 2GC2A 4FVVA 5FZ1A 1CAWB 4KNCA 2Q8EA 4FTEA 3SLIA 1ENQA 1HX6A 1S0GA 1R1A1 1ZM1A 3ZIXA 3B94A 4JQRA 4NHXA 5LY2A 2WO7A 1FPN1 4FO9A 3I7DA 1VALA 3D0JA 4AFDA 3ACFA 1EPZA 2WRAA 4IEPA 5DDJ2 5FPBA 3T1MA 1UIJA 2NN8A 1Z7S3 2A6ZA 4A45A 4YSFA 3HN1A 2XBO3 3VBOA 1W8TA 1UY3A 5LCWL 2BEOA 2XJUA 2HWD3 5C8CB 1ZREA 2FHRA 1TME3 4NOTA 2X05A 5FUNA 2BJSA 3WINE 4GXLA 1U5XA 2VNRA 5FXZA 1J58A 4IE6A 4AHWA 2WINB 4FPKA 4URTA 2VMEA 2JG8C 3ACHA 3VHOA 1UF2C 3FHIB 2WBKA 3FC0A 1O5LA 5KC6A 2FZ1A 2JEMA 5FTTC 4AWDA 1GNHA 4A2UA 4X8PA 5KBFA 3M8LA 1E5RA 3AP9A 3HBZA 4FPLA 4XEZA 3QH6A 3OPZA 1MVQA 4LLFA 4UYBA 3K3NA 3SXWA 4FFFA 1NLSA 4FFHA 3JXSA 5FQ0B 1H30A 1D0HA 1MQTB 4JDNA 2ZX3A 1I9RA 3FFZA 3ZN4A 1AR63 2B5HA 2WFF3 3B00A 4WVMB 1Y7BA 4ZONA 4CU8A 5A32B 4AI0A 3NW4A 1TNRA 4DNYA 3RZGA 3BKZA 1OSGA 3NV1A 4ZZ5A 3N36A 5E8AA 4PI2A 1H8TA 2GC1A 1U5YA 5FMOL 3VKMA 2HH9A 2QQLA 1UXZA 2B39A 3ZFEC 4LT5A 1CAXA 3B5LB 1HN1A 4I01A 2R6QA 4N8MA 1WZXA 2XJPA 1FV3A 5FR3A 1VBC2 1PVXA 3HQUA 1OURA 2EVXA 1UW8A 1EAH3 4A6SA 5FWEA 4M4RA 1NCRB 1HRV1 1X8MA 3GBWA 2AC1A 2QDNA 1GNYA 4YRDA 2Q1MA 1XOYA 3SNMA 3WP4A 3ZFFC 1LESA 1G9FA 2E63A 1ZBE3 4XQ4A 4MGSA 5F39A 3MDPA 1IPKA 3CLPA 3KQ4B 4GD4A 4DOUA 1Q8SA 4I0BA 3RI8A 4Q4V3 2PHUA 2J1RA 4BM8A 4XHXA 5FOBB 2CL2A 2J7MA 4GIQA 4P9WA 4YG3A 1CD3G 4IDZA 1PGW1 4JVAA 4URAA 3N4MA 2J1VA 4FPCA 2ZGRA 4XCBA 3GJAA 2PHWA 1RUD1 4AK3A 3M3IA 1VBE1 5H9QA 1W28A 3PLQA 5B4XA 1UD1A 4IEQA 1JYCA 2RMU3 4KBZA 4L99A 4GB32 5FZGA 5K0UA 2BTVC 1W9YA 4FPYA 3WDTA 1RHI1 4QXHA 4KMQA 4Q1RA 5FZCA 1F5JA 2VXJA 2ZGQA 4ZPIA 4CXYA 2YC4A 2XG3A 2WSVA 2XJSA 1H8VA 3J8F2 2VTXJ 2W2IA 3ZYFA 4O9GA 1ASJ2 1FOD1 5IK8A 4M3CB 5BYNA 3MBWA 3OOXA 1RMU2 2F4PA 2QKDA 1A6CA 1XSQA 3H8UA 4GWJA 1PIV3 5DAWA 2CYFA 3DYMA 1FPN3 1NT0A 2H0BA 1J3RA 2ZX2A 5F6LB 3VZJA 3VBHB 1RUI1 3WR0A 5GALA 2QQVA 4XFCA 2P6CA 5HCBA 1Y9QA 1VBA2 2L9LA 1VBD3 4RR3B 1OUSA 1RUH3 1YQ5A 4IETA 2WNUB 3THTA 1V00A 4KWUA 4YLZA 4YG6A 4FP2A 3RYPA 3VBUA 4C8DA 4CDQC 5L19A 4LO8A 3NVCA 2AUYA 3LE0A 2OZ6A 5LEJA 2XWJB 4IEOA 4P5YA 3LEGA 1OKQA 1AR73 2NPIA 3AVSA 4DPNA 3WHUA 1ENSA 4BISA 3I3EA 5HCHA 3A0KA 4LA2A 4YGCA 2FCUA 3K77A 1LGNA 3O1PA 1QOSA 4QGMA 1PGL2 4QDSA 1MEC3 2VD7A 2ZGPA 2ZOEB 1QKQA 2YDEA 4C0BA 2VNGA 4RS5B 4B4QA 4F83A 2H0VA 2EA7A 4PDWC 2OKXA 1NUKA 2OPKA 1JZ4A 2WA4A 3T0AA 4BIFA 2KXLA 3FHQA 1LGCA 2WLQA 3MIDA 1CZTA 2XH6A 5FZOA 5DZGA 4GZ9A 2E26A 3RZZA 3U1XA 3WNLA 5IAXA 4PCRA 4AEDA 1QMJA 1SLLA 1UQXA 4BU2A 5A3PA 2DVFA 2OS2A 4NE9A 4QHBA 4LHSA 3GXUA 4B1LA 4BMBA 3U0ZA 5HBAA 2ZBJA 2OUHA 2R49A 2VE1A 5A3WA 3VDDB 4EWDA 4YZ1A 1ZZ9A 3C7HA 2B46X 1Q5OA 2VVEA 4XAEA 4FTBA 4X6RB 1CX4A 4DUVA 2WC2A 4YARA 3OG2A 1OPOA 4NHLA 2FBEA 1MZEA 4PBOA 1H2NA 3ST7A 4BDVB 3CO2A 4OQ9A 2O0OA 5JOWA 1YYNA 4BK5A 1SDDB 1JOPA 1GSLA 2WNVB 3I3BA 4KU7A 2B9UA 2R071 4SLIA 3SC7X 2RJ2A 3DXUA 3ILRA 4QQLA 1F4HA 3SKVA 4XYXA 1B09A 3WUDA 1ND3C 1VJ2A 4IE4A 5HPOA 4AVCA 4I3GA 3OY8B 3T0DA 2WQ8A 4CUAA 4OZOA 1ST8A 4XDQA 1T2XA 5ACA1 1UU5A 2XBO2 3PUIA 4YW4A 1X82A 4AFCA 2BU9A 3H1MA 4YVSB 1RUD3 1N3OA 1AR93 1BYHA 2HWD2 2XKPA 2YUEA 1TME2 4LHNA 1ZBA1 4XZUG 3ZDSA 2TUNA 5AVPA 1RUC2 4PI0A 4K6BA 2UWAA 4CPBA 1RHI3 1AYN1 2W47A 2ZHNA 3MV11 5JVVA 4COWA 3ENRA 3IAQA 1CAVA 4ZS2A 2WKKA 2W1SA 1WA6X 2ZJCA 1MS0A 3OF1A 1HXS1 4AI8A 2BNNA 2QQPA 5AVAA 2HWF2 4NJ4A 3I97A 4FPOB 4CUCA 5LWBA 3ZXEA 3UGFA 4B8EA 1FMD2 5JOYA 2GZWA 2HLEA 2XHNA 4AI3A 3O14A 1PMIA 1DBNA 1HQNA 5M0TA 3WG2A 1VRBA 4QKBA 1J1LA 4Y1ZA 2JDHA 5FDBA 2V09A 4ARXA 5FMCA 2KR2A 1AR62 3MIHA 3PJQA 4C1XA 2WFF2 2CSGA 3SCGA 1LNSA 1WUVA 4FQ4A 4QM8A 2WZR3 4XFGA 4D6QA 3S5AA 4JGYB 2XR4A 2D5FA 1FNZA 3FLRA 1F4AA 1W0OA 2EICA 2PXJA 5FZHA 4P9YA 3I49A 1APNA 2LS6A 2QQMA 1X50A 3E5QA 3WNPA 2ZMKA 3TEWA 4LITA 2J22A 3UKNA 4CCLA 3WNKA 4COZA 1W8FA 3WZ1A 4F8AA 4K9SA 2KM2A 2YBPA 3PVOA 3ETPA 4W8JA 2BPA2 3NMBA 4JGZA 1EAH2 4IESA 3CU7A 4ISRA 4NR1A 1IS3A 4OUMA 4CCDA 1W05A 1LOFA 2K0GA 3WP5A 3BB6A 5LA0A 1SLTA 1ZBE2 2BBVA 3ELNA 4MYEA 1GANA 2AENA 4GMP1 4LUKA 4Q4V2 2FDIA 4AVBA 4MGZE 3O12A 3E6BA 1H2LA 4QQHA 3VBFB 3PNAA 3PUQA 2W1WA 4M3CE 2CY6A 4U2AA 1FV2A 1QNYA 1UX7A 3POWA 3PUSA 4QPGB 5BNNB 2MPFA 1WMXA 4IGPA 1D4VB 1HB4A 2Y60A 3FUOA 3UL2A 2O1QA 3A4UA 2VUCA 3OYWA 1VAMA 5DZFA 2J42A 2OA2A 3FHAA 3R4UA 2ES3A 4JCKA 5F2WA 3WQ0A 5C4WC 2HJIA 2IWGB 1BLZA 2W1QA 4UXAA 4LO5B 5A7PA 4OQ8A 3KHBA 4CUGA 2YBKA 4MGKE 5FQ0A 4L11A 2YU2A 1MQTA 3T09A 1AUYA 3NAPA 4HK8A 5I91A 3D4KA 4YVWA 5JSPA 3TN91 4AEKA 3OBAA 3ZN6B 2LW8A 2DVAA 5A1LA 5I0UA 1S0EA 3O1MA 2R073 5IAVA 1R1A2 1PIV2 1H1IA 1FPN2 3AMPA 3LA7A 4B1MA 5IK7A 4XF4A 1MZ5A 1O3TA 1WMEA 2GMPA 4IE5A 1YC61 5A7SA 3USUA 3CHXA 1W8OA 5ACA3 5C33A 5FYTA 1K42A 3AMQA 3ZFGC 5FZ9A 1VBD2 4KWLA 1XNKA 1DZTA 1ZRCA 2DFBA 4QPIC 5BNPB 5C8WA 1YFWA 4NIAA 2E53A 1IKQA 1DYOA 3VBRB 1JU3A 3LA3A 4NVPA 4UBHA 3M1HA 5F37A 5HV0A 3IKWA 3H42B 1CPNA 3MUZ1 5JZGB 2BRTA 3RDIA 3HBKA 1E5SA 3WQBA 4P9IA 2EIEA 4PIZA 5APAA 5FYIA 1OFSA 2F17A 2VVDA 1JYVA 5FYUA 2JG8A 2JICA 2JENA 5LY1A 2JG9C 5FUPA 1G8WA 3RMYA 3RVHA 1KEXA 2GN7A 2IUWA 1W3XA 2NQYA 3JB8A 3MIFA 3VBSB 3WNMA 4HFSA 1UY4A 2V4VA 1NA1B 1OA2A 1AYM3 2YG0A 3CJIC 4CDXC 3DCQA 5I8YA 4MG2A 2ZX0A 1JXNA 2JB4A 1YFYA 4MX3A 4P08A 2BQPA 3N35A 5TSWA 2DUOA 5EJ3A 3AKSA 3GALA 4OYUA 1OPMA 2BFUS 4IGQA 4Q4W1 4XDOA 3I3MA 1IHMA 3FZ3A 1S55A 3LAGA 1VIWB 3POGA 5IVFA 1UZWA 1X8EA 3I3DA 3N7LA 4G3YC 1AZDA 2RJKA 4A3ZA 4CE8A 4D6RA 4DMIA 3P3PA 4OHZA 2R32A 3IMNA 3OGGA 2VOTA 4HT1T 3I3QA 2RR11 4QAWA 1RUJ1 3R4SA 3ZYBA 4CDWC 5I0RA 1ULDA 3H1WA 3ZFEA 1HRV2 5FYVA 4P00B 3KV6A 3ECQA 3U4XA 1YIFA 2W68A 1JOBA 1IPSA 4QPIB 1RVF1 1D2SA 1DZRA 3VDAA 1R083 3PDQA 3U07A 3V65A 3M7AA 4GMP3 2RHPA 3AYCA 1VBC1 4K21A 1SCSA 1PMJX 1UOGA 1HV0A 2QQOA 2BOJA 2XQRA 1Z78A 4JHZA 3ZFFA 4Y1XA 4OI0A 5ERLA 4P9LA 4E2QA 4X6QB 1V9U3 4YZ4A 1UKGA 1UL9A 1UY2A 4AF9A 4DEVA 1RUD2 5CG8A 3LOBA 1VBE2 1XU1A 1AR92 1PK6B 2RS11 3GJBA 3MF9A 3B7MA 1W0NA 4QQ2A 1PO21 1HJFA 2W08A 3VKLA 2VNOA 5FREA 4XBQA 1RHI2 2WJSA 1UAIA 3T30A 1BVP1 1QJZA 5DZEA 1F5FA 2UY8A 1FYUA 5A7OA 3W20A 2JE8A 1FOD2 4M00A 3OTFA 2JE9A 4BJ0A 1JZ6A 4GH4B 2QDRA 1ODNA 4GB31 4XACA 1QJU3 4IEYA 1OOPC 1OLRA 3J7NA 2MNGA 2W52A 2G1MA 2XL9A 3M3CA 4H7MA 5JR7B 3LSEA 2X5IC 5CFCB 3WQ1A 4CDUC 1DYPA 3KGZA 1W06A 1W99A 4HKLA 4RN5A 4L97A 3WCSA 3I4IA 2WZR2 1CR7A 3AL5A 4WVVA 1COV1 3K4AA 3IDEA 5JI7A 3LCPA 1O59A 1UCXA 2DVGA 3BOPA 2DUPA 3BPSA 3O7OA 3ZDVA 2D93A 3I2HA 3X29B 1CAUB 2VQ0A 1SACA 2RS51 5E88A 5JUVA 2HYKA 3MW4A 5L7OB 5LB6A 5LW9A 4IEZA 1F9KA 4CDQA 4BMEA 1AL0G 1AX2A 1DQ4A 2HEWF 2R1DA 3I2IA 2R30A 3KVAA 3NJZA 3SKJE 2B9VA 3KT7A 4MGIE 3N9LA 4RHV1 5FYHA 5K9YA 3O0VA 1KS5A 2VZUA 4AHYA 1QOTA 2D6LX 2E7QA 1FX5A 4CRQA 4XBNA 4XJ8A 3CQOA 3O1UA 4LBJA 2Y6GA 4CEYA 3EMRA 3BALA 2VULA 4PDWA 3T3YA 5CKQA 5LBBA 3O5SA 4LKEA 3K46A 1TQ5A 4RQPC 5GZGA 4LMFA 4W6XA 3WX5A 1W9TA 1LGBA 3HPNA 1LHOA 4CU7A 1VMJA 1KDMA 3NNFA 5FPAA 1RTVA 4TZDA 4WM7C 1PMHX 5CFDC 2ZGLA 5J98B 1S0IA 4COYA 5A33B 5IVVA 2R1BA 3R6SA 4Q1PA 1O8SA 1R1ZA 4AFBA 2CGPA 4IV1C 2IVIB 3OUHA 4AEMA 1PZ7A 2PHRA 3T2QA 5FK7A 3WF3A 5HI0A 1FNYA 3KB5A 3MPBA 1U12A 3GZUC 4XFAA 2R072 2JXAA 2R0HA 5LATA 1WLTA 2PELA 4AGVA 4HLTA 3RWKX 3PURA 3S7EA 3ZYGA 3U78A 4D3WA 4CA9A 3E6CC 1UZYA 4YW7A 4QPWA 3WNOA 1C8M1 1URXA 3HVDA 3VKOA 4K40A 5ACA2 3NV4A 5KXEA 4XFFA 1X9TA 2J1TA 3K51A 3PU3A 2Z79A 3B02A 3UYJA 2WL1A 1ND3A 3LOIA 2JJ6A 4IERA 3KMHA 4D7TA 4Q0PA 1ZBA2 1LOGA 3VV1A 1AVBA 1PO23 5CZKA 1DQ0A 1EUTA 1LOCA 5KXBA 5FV3A 1OXCA 1LTEA 1QEXA 1AYN2 3S0MA 3KD4A 3OD4A 4MXWB 1G9CA 3H8XA 2BGPA 1Q56A 1Z7S1 1VPHA 1W6MB 2JE7A 4RD7A 2W3JA 2XBO1 4FXKB 3S7IA 4AAXA 2VMDA 4Z2WA 2I2SA 1HXS2 2HWD1 3GDBA 4MHUA 5ABJC 1TME1 4BIOA 5FPVA 5HXMA 5D1IA 2QCSB 5LA1A 2OX0A 1K45A 3PIGA 2BW8A 1SPPA 2UURA 4DO0A 2EAAA 3QH7A 4I0AA 1DQ5A 5FXWA 4WM7B 1AYM2 3ALQA 4S2DA 1BEV3 2CV6A 4QX1A 2E9QA 2NMNA 1UZZA 1ZZ7A 1CPMA 3C7GA 2A3WA 3MV01 3OGJA 4L9BA 4O7XA 4MSVA 3OB8A 1O3QA 1RUOA 4DEQA 4YM1A 3J7HA 5F32A 4KI5M 1UOFA 1COV3 2VR4A 3LB9A 3MYXA 3VD9A 1ZRDA 3N9QA 4XBLA 1D4M3 3PL0A 5BNOC 4M0NA
chains in the Genus database with same CATH topology
3MIGA 3NWKA 4AQSA 4V1PA 2RS53 3WLUA 2GAUA 4PQ9A 1G7YA 1I1EA 4R9DA 4BQ1A 2WFF1 2XLAA 1LJ7A 3G6JB 1WW6A 3JQWA 1VBB3 4I02A 1CN1A 1RL3A 4CEWC 2OW4A 4BWOA 4R4ZA 1SFNA 3M3EA 4LE4A 3ZXGA 1DQ6A 1V6NA 4N43B 1GBGA 4YZ3A 4AVTA 4Z82A 1GKBA 1SFYA 1Y43B 2VMGA 1QHDA 2E51A 3AFGA 3OBRA 3W9AA 1EAH1 4Y20B 4JAAA 5C8CC 4XQDA 4Y1UA 1DLLA 1LCLA 5FLHA 4CP1A 1Q8QA 1V9U2 1GICA 1XRUA 4AVAA 2R041 4K20A 1DHKB 4KBBA 3WVJA 2PHLA 3HR9A 1V6LA 3AYAA 3MLJA 4HKWA 5CIRA 2ZHLA 2QE3A 5KHGA 5KXDA 2DCJA 5I93A 5JLVA 1MS3A 5KHHA 4Z1VA 4I09A 5C4WA 3TN92 1FATA 4Q4Y1 4ZU4A 2PTMA 1Q43A 1H4HA 2RMU1 4KWJA 5J37A 2WSUA 1CJDA 1HRI1 1UU4A 2SBAA 2EIGA 4HKOA 4K7JA 5C9AB 3HWJA 3SITA 1WMDA 5T55A 4J6GA 5GZCA 1WLCA 1C8M3 5GZFA 4CEWB 2XLFA 2BWCA 1SLAA 1ULEA 1BJQA 4TSVA 3JD73 4L8QA 1KRIA 3SH3A 1PIV1 4OHYA 4XF3A 5KHJA 1DFQA 2GALA 3ZFGA 1W39A 1NQDA 4XZPA 3BIWE 2CTVA 2P3IA 1DQ2A 1NCRC 5FO9B 1VBD1 2Z69A 1O4TA 4Q8LA 1RUH1 5T5JA 1QJX3 1RUE1 4KWKA 1YLLA 1F31A 3FBMA 2BNMA 2X53S 1Z0HA 4AFMA 3IM0A 4QXKA 2H6BA 1AR71 2A3XA 4WM8B 2I45A 2QNKA 4BE3A 4E2SA 2JG9A 2ETEA 3J26N 4AHXA 1MEC1 3PTYA 4R9AA 4XXAA 4FAGA 4Q4W2 1IPJA 3CJIA 4CDXA 3WDYA 1MZ6A 1GZWB 3RNSA 1SLCA 2A7AA 3VN4A 2K2SA 2RR12 5GJ6A 1POV3 1RUJ2 3MLLA 3DKWA 4C1WA 1GQHA 3SHRA 5KXCA 3AZXA 2D6PA 3FLPA 4QT6A 4UW3A 3DN7A 4KL1A 3WDWA 2ZGUA 4DZGA 2IC1A 1RINA 1RVF2 1BBT3 3MGUA 3QOPA 3USSA 2DCTA 4FBFA 4CDWA 3VBHC 3ASIA 3NL1A 1JBCA 3IPVA 4H7LA 1W6QA 1H9WA 1AF9A 1GNZA 1OHFA 4RR3C 1TMF1 2WNUC 4Y1YA 2OUJA 2W39A 3S30A 2RS12 4Z07A 3ME2A 2R043 5FMOS 3KT4A 1REFA 1PO22 1JHNA 5C6CA 1N3QA 3ZX7A 1LRHA 4H55A 5CA6A 1J3PA 3I2DA 4DXZA 1AR91 1ZA4A 1C4RA 2XUMA 3ZSKA 4Q4Y3 3HT2A 4RS5C 1ZRFA 3VHNA 1HRI3 1QH7A 4OVEA 4UBGA 3B01A 2PHFA 5I8TA 3WP6A 3ZMOA 1BEV2 1O7FA 3I59A 4HK9A 4HPKB 3W58A 5I0SA 5JPNB 4I3PA 3VDDC 3K48A 2C0ZA 1OOPA 2HWE3 4LHKA 1COV2 4DINB 1W2UA 1WMFA 2RM23 1AXZA 3TBDA 2X5IA 5JI9A 4LE3A 4CDUA 1BK1A 3TYJA 1K5MB 1B35B 3MIEA 2RS52 1XYPA 3KZ4C 1BCXA 3DPRC 3D5OA 4BLIA 4AQ6A 4JTOA 4E2GA 4NWVA 2WZR1 2NZ9A 3KCYA 2R063 3AZYA 3H9AA 3HQXA 2DCKA 1SEFA 2WNVC 3NSTA 4AG4A 1RUE3 3WXPA 4FOYA 2Z5WA 5J7MA 4RHV2 2RE9A 1DGRA 2TBVA 4QU2A 3WW3A 4W6WA 3TAYA 1ENRA 1UN1A 1VB2A 4YVSC 4EN8B 3SCFA 1MR5A 3ILNA 2E6VA 2GSYA 4WVWA 2A73B 2IZWA 3DV8A 1GLHA 3IN9A 3FFQA 2XGXA 4EWAA 1R093 3PVEA 3E5UA 2GC3A 4DS0A 1LULA 1NE6A 4RQPA 2G4IA 2ZTNA 1QOOA 4IV3B 1A3KA 4DRVA 5LEKA 2P37A 2ZGSA 4DRRA 1QDCA 4OLLA 4RFT0 4Y26A 1A78A 1DYKA 1NCQB 1XE7A 5CFDA 1G9AA 3HMYA 3V0AB 4IV1A 2ZAAA 2WIIB 3DPRB 1CGPA 4C0HA 2D7FA 4BCUA 1C8M2 1IQAA 1J59A 1W6PB 4JGYC 1TMF3 3ZXLA 2CNAA 2VOKA 5JIAA 4XF1A 1X7NA 3JD72 1OD5A 5GLTA 5F5QA 2NLRA 2LUWA 2QFEA 4LHLA 4E4SA 3MZHA 1AX0A 1Z7S2 3UKTA 1QWRA 4XTPA 4LBKA 3APBA 3VHRA 1MS9A 4OHWA 3KQRA 1W6NB 4YFZA 2FMYA 4AQ2A 1PO13 4C90A 5J09A 4KH9A 3LWCA 5ABJA 3D6EA 3GBFA 3VBFC 2A3YA 2XJTA 2EF6A 5T3NA 1PNFA 2G9GA 3I54A 2W0XA 3EBRA 4QPGC 5BNNC 1CIWA 1HIXA 3UJOA 2IXLA 2B42B 5DXDA 1VRH3 1ZYBA 2V73A 4N53B 2Q4SA 1S0CA 2KA3A 1AYM1 3D8CA 3MICA 3R05A 4LBQB 1JH5A 4EN9B 4Y22A 4QPYA 3ES4A 2O8QA 4YZ2A 1EPWA 4A3XA 5BNOA 3FUQA 1UU6A 3LSDA 2DUQA 1F8VA 5AC93 2GNDA 4JRLA 1H4GA 5K8SA 3DF0A 4CEWA 2DYCA 1S0DA 2QZ3A 5GKAC 1CAWA 5IK5A 2C5DA 5CBLA 4PIXA 4I30A 2D97A 5GM0A 4IQPA 3V64A 4XJZA 2BYVE 2PLV3 1QU0A 2VMHA 1VB4A 2GU9A 2XVKA 2G9FA 1O4ZA 2YPJA 4LUMA 5T54A 4DNYA 5BNPC 4XF0A 3NO8A 4FP3A 1ND2B 2ZKNA 3VBRC 1R081 2VU9A 1QGLA 1VR3A 2CGOA 2R042 3M4FA 1RGSA 5C8CA 5JZGC 4META 4R9BA 3AJZA 2CAUA 3H50A 4XQWA 2PN5A 4XPVA 3ZXKA 1V9U1 3L9JT 4PJYA 3BPZA 1YFXA 1PZ8A 4BLJA 4Q4Y2 1V6IA 4XXPA 3VBSC 4GA9A 1XYNA 1U5ZA 1NA1C 2RMU2 1AR83 2F6BA 1HRI2 3ILFA 4E9KA 3IBMA 1I6XA 1KJLA 5FOJB 3KS7A 1SLBA 3ZYRA 2GDFA 2FQPA 5FPXA 3FBYA 4FTSA 1V70A 4P9GA 3ZVXA 2HWE2 1EV11 1I5ZA 1D2QA 1IGOA 1PVC1 4WVMA 2UWBA 2PAKA 5A32A 1QJU1 2GN3A 2VUAA 3A0NA 2GC0A 4LEJA 2GNMA 3AMNA 1X33A 3FJSA 4Q0QA 5T5PA 3WG3A 3ZSMA 1JYIA 3SH4A 2ZAHA 4FPHA 3SCHA 5DUUA 1S0JA 2R062 1RUH2 3WW2A 1F2NA 1NY71 1RUE2 5GLUA 1NCRA 1HV1A 4ASLA 2A6WA 2A75A 1LEMA 4YW2A 2TNFA 1AR72 4HBNA 3QCWA 5GLWA 4YZ5A 4HVQA 4B7EA 2HKXA 2QUOA 3FX3A 1W6OB 4MUVA 1MEC2 1QJY3 1PK6C 3E6DA 4DB5A 1C1FA 1NG0A 2HEYF 5JSOA 1YRZA 2GMMA 4YYOA 4YM0A 2PQQA 3FMGA 3HIFA 1R092 1H2MA 2DTYA 3MLKA 4H3WA 1OFNA 1UIKA 2NM1A 1J1TA 2Y0OA 1YUDA 5F1RA 4GH4C 1BMV2 2ET1A 4Q2FA 2D6KA 1N1YA 4E27A 2D3SA 4LO4B 1HDKA 3V56A 4JC1A 4M3CA 1UMZA 4QX5A 5CFCC 3MFAA 2VPVA 4FPEA 4KGQA 4FPGA 2Q0AA 2NMOA 4B3NA 3JZVA 1TMF2 3VBHA 4WBBA 1NE4A 3IDBB 4XW3A 2VY0A 3CJXA 4D94A 2B7YA 2WNEA 5D8AB 1VLNA 1C3HA 2X8KA 4RR3A 1LU2A 3INAA 4LO7A 4S2GA 2WNUA 5L7OC 4YGEA 3RPQA 3T1LA 3VZMA 1HW5A 4PIYA 4S2FA 3RRDA 2EXKA 2ZCWA 5FBZA 3VBOB 1PO12 4QM9A 3U10A 4MLOA 4RS5A 3TRSB 3AKQA 1C57A 2OZJA 1DG6A 3ZYIB 1PNGA 1KJRA 3WG1A 1FI2A 3VGIA 1EV13 1PVC3 3MW3A 4GQ7A 4NO4A 1PHMA 4BPZA 5LRSA 1BEV1 4HL0A 3V0BB 1RUG3 3VDDA 1JN2P 1FXZA 3AZVA 4IEWA 3RWNA 1JUHA 1REEA 4LBQD 3ZSLA 5A3LA 3IIAA 1A8MA 1D4M1 5EZWA 4GKYA 3DPRA 3KT1A 4GALA 3QACA 1S0BA 1EY2A 4IEVA 1ZRRA 3WT3A 1LHVA 2P34A 5JAXA 3M3OA 2WNVA 1KITA 2ARBA 3C2UA 1H8TB 1VBB1 1QXJA 3LA2A 5J96B 5L36A 2D44A 2VMIA 4FSJA 3TNPB 1H1MA 2PLV2 2VG9A 3OY8A 3H0OA 1IZ3A 2EXIA 3DL3A 4ZKTB 3LZZA 2ZABA 3PVNA 1CONA 4YVSA 4Q0UA 1GZCA 1ALYA 1C5HA 1QH6A 2HWC3 2UY9A 5DDJ3 2PHDA 3EHKA 5T5LA 2WQ4A 4CP2A 3VLBB 4UW5A 3JUUA 1LEDA 3WUCA 1AR82 4XMAA 2O8OA 1O3RA 4J1WA 3WW4A 4XFIA 1BXHA 4GWNA 3D0SA 1NXMA 4B4RA 3LKJA 3RG0A 4YW5A 5K0UB 1S0FA 4I2OA 1DF0A 2XJQA 3VHPA 2WT2A 5FRAA 1WLDA 4JGYA 2X29A 4LBLA 1MS5A 4CTEA 4HVOA 3H7YA 2ZPXA 3NKTA 4D7SA 3JD71 4N43C 1QQP1 2DVBA 1YNAA 2DTWA 3B9CA 4ES9A 2ARXA 4HETA 4XIKA 4D7YA 3VBUB 5LK7B 3QD6A 1QJX1 2CGNA 4P5HA 1QJY2 5H9SA 4A7KA 3R4DB 2CWMA 5GZEA 3VBFA 2WS91 1ZZBA 4OI4A 1YJLA 4QPGA 5BNNA 1WCSA 2OVUA 3GF6A 3OJBA 4AVVA 2NP0A 3CEWA 4PLOA 1TEIA 2ZS6B 5T50A 1ONAA 2ZHKA 1PZ9A 4MGYE 2ZHMA 4CEYB 2XKOA 5JCTA 2A5ZA 1CJPA 4GMP0 4AEDB 4BYYA 4I0WB 1EYBA 2PHXA 3AP4A 5C9AC 2ZMLA 3KCCA 4PF5A 3ZN6A 3ES1A 1BKZA 2RS31 1POV1 4ONUA 2ENRA 3J8F3 1LR5A 4RSUA 2MHFA 3PHMA 1ASJ3 2IFWA 4UW6A 3WHTA 1IOAA 1BBT1 4N9IA 1D4M3 1R082 5BPXA 2ZGMA 2CAVA 3AXEA 3URFA 3NKGA 2IXHA 1TNFA 5BNPA 4HN0A 3UV9A 5FAXA 3VBRA 3ZXDA 1MVEA 4R4XA 5DUWA 1D0GA 1YIPA 2P17A 5JZGA 1KXGA 3KCXA 3DGTA 3ZO0B 3CNAA 4BA6A 2HWB3 3U11A 2GNBA 4J1XA 4WM8C 5FPZA 2I74A 2YXSA 5B2GB 1KFXL 1KQRA 1WW7A 1YXWA 4FPJA 4OULA 1AXKA 4AE2A 4KQ7A 3VBSA 1DGLA 1NA1A 2D40A 1AHSA 4GWMA 1RC6A 2E7AA 1CAVB 1AJOA 5JOXA 1EV12 1PVC2 1QJU2 1RJ8A 1MS1A 4M01A 5EFUA 1NZCA 5KHIA 1IS6A 2YYOA 3GZTB 1SCRA 2JDZA 3RS6A 3QLQA 2AZ5A 1A8DA 2HWE1 2ILMA 4ORFA 5HXVA 5LK5A 4COVA 1QQP3 1Y3TA 1NY72 2RM21 1QXPA 2ATFA 2XJVA 1Q8PA 4A7ZA 5CU1A 4QQOA 2VOWA 4XIOA 1W0PA 4QPIA 1RB8G 3VUOA 4CP0A 2R061 3C3VA 5BUVA 3GZAA 1H2KA 4MXVA 2WS93 5EWSA 1ZZCA 4UW4A 4JGZB 1UX6A 4JRAA 2IXCA 3M3QA 1PK6A 2EXJA 4AVSA 2DCZA 2BVBA 2UYAA 4NHMA 1AL23 1E57A 2HWC2 3SMHA 5T52A 4OHXA 3E5XA 2H6CA 2Z2SB 4ATEA 2ZACA 2UWCA 4ZU5A 1R091 2XWBB 1RUC3 3DUIA 2MEV3 3VZLA 5BNQA 4BOWA 4LA3A 5I8SA 4TLFA 2RS33 4GH4A 2ZZJA 3L2HA 1QDOA 3OYWB 1BMV1 2CWSA 1RUNA 1CVNA 2HWF3 4JV4A 1LECA 2YY1A 5CFCA 1L3JA 1FMD3 5DG2A 4G9SB 1K5MC 1B35C 4XJ9A 1XE8A 1UKRA 2QZ2A 3NAPB 2YMZA 4YVWB 3UJQA 4L92A 3KM5A 1CAUA 4Z92B 4XILA 2YGMA 4BH9A 2EAKA 5F6KA 3WV6A 5J48A 3BCWA 1G9DA 5L7OA 4Q4X1 4XJAA 1WW4A 3CF6E 3USUB 3L2YA 2V5YA 4LO6B 1ULCA 4NHKA 2R0FA 5JOZA 2HEVF 4GULA 4YM3A 1CQ9A 3NV3A 1SQ4A 1WCDJ 1PGSA 3ZXFA 1NLRA 3ZXAC 3D82A 4IEUA 2E7TA 2IXJA 2QJVA 4PLMA 1PO11 1WGPA 2WA3A 4F3JA 2YV8A 3WNXA 5FO8B 1IS4A 3P3NA 3JB4C 2I07B 2JG8B 1GV9A 4IV3C 1NCQC 4DFSA 1VRH1 1T6GC 5A33A 1D4M2 4AI1A 1ZZ8A 3M70A 1YO8A 1DGWX 1LHWA 2YGLA 2LTNA 4K1ZA 1VBB2 1FAYA 5JMCA 1FT9A 3H7JA 4H14A 4NWWA 3GYDA 4HSJA 4LBNA 4XHBA 5AC91 4LBOA 3PVBB 5JWPA 1R1A3 2EXHA 1OQEA 3JBG1 3ZFEB 3W59A 1DIWA 1C28A 3PJYA 5AFBA 2C9AA 4SBVA 4L2NA 1WW5A 2B45X 4AI2A 2IFRA 3TOJA 2PLV1 3POSA 4HSLA 3MIBA 4MXWA 1QF3A 2VVFA 3IDCB 1W6MA 2LALA 4D69A 2ZGTA 5J36A 3ZFFB 3B93A 4EV0A 4N7IA 4WZCA 2VOXA 3PMSA 2HWB2 5GLVA 1BZWA 5IT6A 5FLIA 1DU3D 2D6NA 4EN6B 5KWRA 4OI2A 2Q30A 1GQGA 4M0HA 2AREA 1OA3A 4XJWA 4EROA 4WM7A 2D3RA 4JDOA 4N53C 1S2KA 1AR81 3N7KA 3B3QE 1ZNPA 3JU9A 3UKVA 4RA0A 1G86A 4B7KA 2RJLA 3VZKA 4Q26A 3ZMNA 1H9PA 3AKTA 1WLWA 4FOQA 4W6YA 1Q8VA 2ZA9A 3WD5A 4Q4X3 1UPSA 1QQP2 4YGDA 2WWSA 2DVDA 1JW6A 2TEPA 5EYXA 1XNCA 4AW7A 1DGWA 3JCIA 4N43A 1OA4A 1WBFA 4FCAA 1LODA 3B9IA 3T2TA 1HRV3 1REDA 1QJX2 3O0WA 4FT8A 1ND2C 2GH2A 1AXYA 2PAEA 3SISA 4Y20A 2WS92 1XU2A 4CDQB 4JDMA 3JQXA 2BNOA 4FXGB 5H9PA 3RYKA 1WBLA 1POV0 2R16A 4ISQA 4FAHA 5CNAA 1V6OA 1AL22 2BVVA 1QJY1 2C1FA 5E1RA 1G9BA 2QVSB 1VBE3 4BHPA 5K7PA 2AH2A 2UU8A 3ZYJB 1YCIA 2VH9A 2WQZC 1ENXA 3AZWA 4K1YA 4PDWB 2MEV2 2WFPA 5KC5A 3AMMA 3WG4A 3ETQA 2RS32 3B69A 3RJRA 1LHUA 2PAMA 4G4FA 1GZ9A 3BOWA 5J3UA 1WCKA 5C9AA 1KDKA 1FOD3 4P9JA 4WVZA 5KHKA 4Q8KA 1BBT2 4TWTA 4CZSA 3ZPYA 3JBG3 5HCAA 2IXIA 1M4WA 1SDWA 5H9RA 1RUI3 5DUXA 3CL1A 1O91A 3OCPA 2DU1A 3WCRA 2ZZQA 4COUA 2GH8A 3RJ2X 1ZZ6A 5JSRA 2NYYA 1NQJA 4AGGA 2XLGA 2Y0IA 2D6MA 3WY6A 3RYRA 3ATGA 1OI6A 1H0BA 4WV8A 1JOJA 2FZ2A 2VW1A 5L73A 1ND3B 2K9ZA 4Z8BA 2BUKA 4Q0SA 4A7YA 4ASMB 5E16A 5HCFA 1Q3EA 3N7MA 4NPRA 4WM8A 4W65A 4INDA 4QMAA 1QXRA 4FOWA 3WP3A 4DY3A 2WLPA 2XPJA 2A6YA 5SV5A 2LM3A 2D98A 3EXUA 4KGGA 3HD8B 1GZWA 2B8MA 1SBDA 4ITCA 1RUF1 3AKPA 3AB0A 3BU7A 2RM22 1O5UA 3HT1A 1U0AA 4Y24A 2XVGA 3OD0A 1KD7A 1RUG1 5EV7A 1O4YA 2ET7A 3FLTA 3E97A 5A3MA 1LHNA 2XJRA 4LNVA 1MACA 4WZFA 3FE5A 3J4UH 3MPPG 3GHMA 1EP0A 4GKXA 4O9EA 1H1AA 4XOGA 1V6JA 4CYDA 1ULFA 4XJUA 5D8AC 4EN7B 5IUQA 1NOVA 2AGSA 3AXDA 1BVVA 3AZZA 4LBMA 3VZNA 2VGDA 3WDUA 2ERFA 1V6KA 1X36A 2DFCA 2YHJA 3ZSEA 3VBOC 4FQZA 1ZBA3 2D3PA 3Q9OA 4S2HA 2WT0A 4OZXA 3KLSA 1XYOA 2HWC1 5CADA 5DDJ1 1AYN3 2P2KA 3ZN5A 2BFUL 1ZVFA 1ZX5A 1HXS3 4XETA 4HPKA 1C1LA 4KG0A 2WZPP 4Y1VA 4P14A 2DWRA 4YFWA 5C4WB 3AP7A 3MF6A 3IWZA 2ZGOA 2D43A 1QNWA 2DF7A 4HMZA 5T5OA 5FFOC 3OBTA 3ROUA 1K5MA 1B35A 3AX4A 4Q4X2 3VL9A 2Q5TA 5EYYA 1O3SA 1BQPA 3RMXA 4EJRA 1H8TC 3KSCA 3N7JA 3AJYA 1LB2A 4Q0VA 4N90A 4XFHA 4MH0E 3ZSJA 2SLIA 1YI9A 3ZFGB 4YM2A 4HZFA 4R8HA 2BWAA 2P3JA 4X8NA 4B4PA 2D6OX 2ZX4A 3UK9A 5FLJA 1XXNA 2PHTA 4C91A 4QGLA 2PFWA 3AM2A 1DZQA 4Q29A 1PGW2 2JX9A 2ZX1A 1RUF3 3KGLA 4LR4A 1N47A 1C8NA 1SBEA 4XFBA 3BODA 3GHNA 5AFEA 1VRH2 4FPFA 4HANA 2JG9B 4HVRA 3VKFC 4IV3A 3BTAA 2Q8OA 4AHZA 2Y26A 4YW3A 1NCQA 4XTMA 4F7ZA 1DGRN 3CJIB 4CDXB 3V0AA 5K0UC 1ULGA 5BXXA 5JPMB 4QD2A 5AC92 4MZUA 3TN93 4U36A 3AFKA 1W6PA 4K3UA 5CB7A 1N3PA 3JBG2 1MS4A 1YWKA 5EXOA 4ATFA 1RUI2 1AX1A 3NV2A 1CAXB 2DURA 2XB6C 3WDXA 3J8F1 1YHFA 4CDWB 1ASJ1 3IPVB 1RMU1 1W6QB 3WOGA 4B29A 3WW1A 1LKNA 5DUVA 1LU1A 4QQPA 3AK0A 1W6NA 2N7GA 3ZXJA 4Q27A 3VBUC 2DV9A 4EN0A 1N1SA 1U5IA 1VBA1 3EJKA 2XHKA 4PLNA 1XNBA 5LRRA 4PBPA 1IS5A 1G6NA 3WDVA 1LOEA 4DY5A 4OFGA 1HKDA 2AR6A 2ZGKA 2HWB1 4RGGA 1YI7A 2VQAA 3PMEA 3GNEA 4RGAA 1NYWA 3M2MA 1NXD1 2JKBA 5E89A 3S6PA 4DQAA 4N53A 3QBQA 1PGL1 4CEYC 4LBQA 1PM7A 2AYHA 3VKNA 2YZ4A 1JUIA 1OLQA 2Z42A 1SMVA 3THPA 4AEDC 1CESA 1YFUA 4Q4W3 5SV8A 3I59B 2PYTA 4N7UA 4AXOA 5FCCA 1SBFA 2GNTA 5JIUA 1SLIA 4R52A 1OOPB 2UYBA 3AP6A 4Y5Z0 2RR13 1RUJ3 2X5IB 5JDBA 2XVLA 3HAGA 4BZ4A 4CDUB 4EWEA 2D5HA 3N3HA 5DG1A 1DQ1A 1WD4A 3AMHA 3R0RA 4ES8A 1RVF3 3H3ZA 3IT8A 4YW1A 2A70A 3TWIA 1VBC3 1XNDA 1ND2A 2P3KA 3AYDA 1OMIA 4YGBA 2VW2A 3VZOA 3RI9A 2ZGNA 4HN1A 4IXLA 1QY4A 5GZDA 3TB0A 5GLZA 2PA7A 2A71A 2VUJA 1S1AA 2YC0A 2RS13 1RITA 2BGCA 1C5IA 2JECA 3TNQA 1AL21 1LOBA 2JD4A 4ZU7A 1N1TA 4OUSA 5CG9A 4IEXA 1OQDA 2VECA 1N1VA 3AYEA 3ACLA 1JTZX 4RQPB 4LLOA 3VL8A 1I3HA 1GR3A 1RUC1 2A6XA 1KFUL 2MEV1 4YNIA 4GB33 4NN0A 1V6MA 4MV2A 1IKPA 1UPIA 4AGRA 2ZMNA 3EQEA 4LTAA 2Y38A 3FWEA 3O0XA 1M06G 5CFDB 3EO6A 5BV6A 3J9SA 1OQ1A 3MFCA 4LULA 1HLCA 1KS4A 4KG8A 4IV1B 2HWF1 1Q8OA 1RMU3 2GMEA 4OI1A 3RSJA 1FMD1 1HQWA 2VW0A 1LOAA 3H3UA 1LENA 1XQNA 1GFF2 2VOVA 2ZKLA 2OYZA 1AR61 3ZYPA 4AQTA 1VBA3 3GBGA 4JTNA 5BY5A 3I8TA 3MI8A 4ZXKA 1VP6A 4KU8A 5CVRA 4JGZC 4FOVA 1W6OA 4RHV3 3G7DA 4AFAA 5IK4A 2XL7A 2WT1A 1LOFC 1TE1B 4TYSA 2DU0A 5I0TA 3WQ7A 1GYKA 1YJKA 1RUF2 2IXKA 5CAZA 2A6VA 2EALA 4IL7A 5ABJB 4Y4YA 4RL7A 1DDLA 1ZBE1 1S2BA 3RQ0A 4Q4V1 3SH5A 1VAVA 3AP5A 1RUG2 4N9HA 4XMIA 4AYUA 2DCYA 3LGRA 4OHVA 1MS8A 3ZIWA 1WD3A 4M3CF 4P9XA 4MVTA 4YG0A 3MEPA 3POYA 4QGNA 3MW2A 4Y22B 4E4DX 4XF9A 3H1YA 4K8FA 1WA4A 1MQTC 3NAPC 1HQLA 5BNOB 2OIIA 1RIRA 4YVWC 4R9CA 2YROA 4AEJA 1RJ7A 3AKRA 1VAKA 4XE9A 5FO7B 1J3QA 1MZFA 2VXRA 1AJKA 5D8AA 2FMDA 4E4ZA 2GC2A 4FVVA 1CAWB 4KNCA 4FTEA 3SLIA 1ENQA 1HX6A 1S0GA 1R1A1 1ZM1A 3ZIXA 3B94A 4JQRA 4FO9A 1FPN1 3I7DA 1VALA 3D0JA 4AFDA 1EPZA 4IEPA 5DDJ2 3T1MA 1UIJA 2NN8A 1Z7S3 2A6ZA 4YSFA 3HN1A 2XBO3 3VBOA 2XJUA 2BEOA 2HWD3 5C8CB 1ZREA 2FHRA 1TME3 4NOTA 3WINE 4GXLA 1U5XA 2VNRA 1J58A 4AHWA 2WINB 4FPKA 4URTA 2JG8C 3VHOA 1UF2C 3FHIB 3FC0A 1O5LA 5KC6A 2FZ1A 2JEMA 5FTTC 4AWDA 1GNHA 4A2UA 4X8PA 5KBFA 3M8LA 3AP9A 3HBZA 4XEZA 4FPLA 3V0BA 3QH6A 3OPZA 1MVQA 4LLFA 3SXWA 1NLSA 5FQ0B 1H30A 1D0HA 1MQTB 4JDNA 2ZX3A 1I9RA 3FFZA 3ZN4A 1AR63 2B5HA 2WFF3 3B00A 4WVMB 1Y7BA 5A32B