3AMMA

Cellotetraose complex of cellulase 12a from thermotoga maritima
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
255
structure length
255
Chain Sequence
MVLMTKPGTSDFVWNGIPLSMELNLWNIKEYSGSVAMKFDGEKITFDADIQNLSPKEPERYVLGYPEFYYGYKPWENHTAEGSKLPVPVSSMKSFSVEVSFDIHHEPSLPLNFAMETWLTREKYQTEASIGDVEIMVWFYFNNLTPGGEKIEEFTIPFVLNGESVEGTWELWLAEWGWDYLAFRLKDPVKKGRVKFDVRHFLDAAGKALSSSARVKDFEDLYFTVWEIGTEFGSPETKSAQFGWKFENFSIDLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-glucanase
publication title Crystal structure and substrate-binding mode of cellulase 12A from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 59
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ammA00
1XNBA 3LGRA 1H8VA 1H4GA 3ZSEA 1XYNA 1C5IA 4XQWA 3VGIA 5HXVA 2B42B 1UU6A 3AKQA 2VG9A 2NQYA 2DFCA 3B5LB 2C1FA 4S2DA 2VUJA 5K9YA 1OLQA 1YNAA 4HKLA 2DCZA 2F6BA 2JEMA 1XYOA 2DCKA 1AXKA 3WQ7A 1TE1B 3RI9A 4HKOA 1BVVA 1OA4A 1W2UA 3AMMA 1REFA 1BCXA 2Z79A 1XNKA 3WX5A 1F5JA 3VHNA 1REDA 1NLRA 1UKRA 3VZLA 3WQ1A 5K7PA 2JICA 3VL8A 1H1AA 1OLRA 2B46X 3MFCA 3WY6A 4S2GA 1BK1A 3EXUA 1UU5A 2BVVA 3MFAA 3VZJA 3AKPA 2VULA 1HV1A 1XNCA 3VZNA 4XQDA 1XNDA 3WXPA 4HK8A 4S2HA 1T6GC 1KS5A 3LB9A 3WP5A 3AMHA 2D97A 3AMQA 3O7OA 3WQ0A 2BWCA 3AKRA 3AMNA 3VLBB 3VL9A 1ENXA 1XYPA 4H7MA 1IGOA 3MF9A 1H0BA 4HKWA 1UU4A 4NPRA 2NLRA 4XQ4A 3WT3A 5EJ3A 1HIXA 4HK9A 1QH6A 2QZ3A 3VHPA 3AMPA 2BW8A 2DCYA 3WP3A 1KS4A 2DCJA 2VGDA 3AKTA 3VZOA 3WP4A 4S2FA 4XPVA 1XXNA 3M4FA 3VHOA 3WP6A 1PVXA 1REEA 1OA2A 3WR0A 3B7MA 2QZ2A 3RI8A 3VZKA 2DFBA 2D98A 1HV0A 1M4WA 3HD8B 1OA3A 3AKSA 2JENA 4IXLA 3VZMA 1H4HA 1C5HA 1QH7A 2BWAA 3MF6A 2B45X
chains in the Genus database with same CATH superfamily
1GQHA 3IB3A 4WM7B 3BTZA 1ND2A 2LW8A 3K3OA 1Y43B 4FFFA 5A70A 4K3UA 1H9PA 2P3YA 1ZRRA 1G9DA 3UESA 2XJPA 1ZRIA 2WIIB 4BK4A 2ID4A 1HW5A 2WS92 1B35C 4MX3A 4OUEA 3VDBA 1LGNA 2ZCWA 4RR3C 3P1IA 5GLWA 3AFGA 2RR13 3MIDA 4JHZA 3VKOA 3QLQA 2WUHA 2G4IA 1UY1A 3E97A 3U1XA 3HOBA 3ZFFC 3I97A 2VMFA 3AZZA 2QDNA 3T09A 4CUGA 2CSGA 4CTEA 3BUCA 1C3HA 1CAWA 2XHKA 2F6BA 2ZGOA 1QY4A 3C7GA 2VY0A 2KXLA 3ZXEA 2QTWB 2RR12 4UAPA 1DZQA 4CDWB 4DRVA 3KVBA 1AXKA 4XBLA 5KXBA 1TE1B 2XOMA 1KDKA 2XB6C 3R05A 3FFZA 5F9TA 4A6OA 4LOSA 1W2UA 2PA7A 3J4UH 5FXZA 4YZ1A 4GIQA 1EYBA 4KI5M 3N36A 2R043 4N7UA 1FXZA 4LK6A 5LY1A 4GH4A 4K20A 1LB2A 1SPPB 2XDVA 3UGHA 1Q8VA 2FCUA 2JDPA 3E1F1 2VNGA 4IEVA 2FZ1A 1JI6A 4L0PA 4U36A 1V6IA 3ZXJA 4C0BA 4CCMA 5C7GA 4AFAA 4QQLA 5F7UA 1WLDA 1TQ5A 2W1SA 1COV1 2FDJA 1JMUB 2JWPA 2DTYA 3CF6E 5FYCA 4YVSB 3BODA 2TNFA 2JDMA 2NN8A 2R042 2Y0OA 3OCPA 4X6RB 3N35A 2X05A 1CESA 4MGIE 1UZWA 2A6XA 1QKQA 3JQWA 3OYWA 5C3PA 3ZPYA 2W68A 4GAZA 4K8FA 4D69A 1JYTA 4QGLA 2DYCA 2WAOA 4X6QB 1F4HA 5M0TA 1WD3A 3WUCA 4J25A 4AVVA 1GWKA 2P6CA 4N90A 1L7RA 3HWJA 1DQ1A 4RN5A 4PLOA 5I0TA 3OUHA 3ZFEC 2XQRA 2LALA 3NVCA 1U12A 2GMPA 2ZGLA 3RDIA 2A71A 1JUHA 3ILNA 3V0AB 2JIGA 3LF7A 4QX2A 1KS4A 1UIJA 4H2AA 2PFWA 5K0UC 4N53C 2C4XA 2G9FA 4XHBA 1H6YA 4LPLA 4AHXA 1C28A 2JB8A 2GN3A 3KV5A 2JXAA 4O7XA 2XL9A 4OULA 2P5BA 1PZ8A 3K4AA 1KDMA 4P9WA 3J8F3 4BQ1A 1W9SA 4Y26A 1GZWA 1IQAA 1GWMA 1YQ8A 2CDOA 4NHMA 3WHUA 5CG9A 1FNZA 4B4PA 4EN7B 2G1MA 4GB32 4XUPA 4CDXB 1EAH1 1ZZ8A 4IXLA 4Z82A 2WYFA 3I7DA 3KHCA 2IXLA 4M0HA 3KT1A 4RHV1 4ZONA 1PMIA 3FN9A 1ALYA 2WYSA 1CVNA 2XONA 5A7OA 3I2HA 1GP5A 3SEEA 4CXYA 4UW6A 4IEOA 1ULPA 2YC2A 3MF6A 3HPNA 4N43C 4LBMA 3RS6A 3J8F2 3VKMA 4AVBA 1UOBA 4Y22A 4IEPA 4XBQA 2V5DA 3ROUA 3UKTA 4E2SA 1XNBA 4KWJA 1E5RA 4Q0VA 3K2OA 1SBFA 4FPCA 2WA4A 1J59A 2ZEYA 3WUDA 5BNOA 1GNHA 2VVFA 5F39A 4DRRA 2R6QA 4L99A 1VP6A 3ES1A 2WWJA 4DXRA 1URXA 2VOXA 2VVDA 2W94A 1OOPA 5FYIA 1BMV2 3ZKYA 3Q8CA 2A1XA 3RSJA 5FJKA 4MGQA 2WFF3 4GWJA 2H0VA 4S2DA 4YVWC 4CEYA 4D6QA 4AW7A 1PGW1 2Z2SB 4TTGA 1A3KA 2ZX1A 2QDRA 3NJZA 4PI0A 5FZ4A 3MV11 3GCXA 3HQRA 2VUDA 1ULFA 2OUHA 3O1RA 2IFRA 3MPBA 3OPTA 3HAGA 2WNUB 1LENA 1QHDA 1WMDA 4OHYA 4EROA 4A3XA 5J96B 1FV3A 1O5UA 2WFF2 1SCSA 1AX2A 2OZJA 1DU3D 2VCMA 4HN1A 3H3ZA 4AEDC 1DFQA 3C8XA 4NAOA 1V9U3 1W39A 3BCWA 5JWPA 4L97A 3NAPA 1CZTA 4K7JA 4QWNA 4Q4X3 4YGCA 1JUIA 1S4CA 1ZM1A 3EB7A 1HXS1 3LWCA 1QOOA 1X8EA 2OKXA 1K5JA 3TRSB 3VBFC 4MLOA 3H42B 4U2AA 2RS13 4W6XA 2A6WA 3RWKX 3WXPA 1T6GC 3A23A 2EIDA 3FUOA 4UFMA 4ZY9A 3ZXLA 1BJQA 5I8YA 1O5LA 1ULDA 4TLFA 1CR7A 2PHRA 3FUQA 2HEYF 4A4AA 4Q4X2 2YBKA 2GDFA 1Z78A 3B94A 2BEOA 3S30A 3SH3A 1O3QA 3M3OA 2D5HA 5JXHA 3IDAA 2VC9A 3MLKA 2HWE3 3MV01 2HWF1 4QPGB 4KG8A 2AREA 4LUMA 5FYTA 4CZSA 2GSYA 2I74A 4FI9A 3WT3A 5I0RA 5BNPB 3IMMA 5AC91 1IPSA 2ARBA 2RS12 3H9AA 1ODNA 3N9OA 3AKTA 3IN9A 1TEIA 4P9YA 5FO7B 1UYYA 2RV9A 4I09A 1R64A 2VCCA 5FY9A 2BGPA 1CAUA 5FYYA 1KD7A 5ABJC 2BRTA 4MVTA 2HWE2 3T2PA 1DHKB 3O1UA 3OY8B 1V6MA 4KH9A 1UYZA 1YCIA 2Y34A 4NRQA 4YW7A 2XPJA 1HV0A 2VMCA 3PUHA 5F32A 5GJ6A 4GMP0 1POV1 3TB0A 3HBKA 5EP9A 4GXLA 3VDCA 3WHTA 4COVA 4YW1A 4IGOA 1JYVA 2JENA 3OTFA 1QJZA 5SV5A 2QQNA 3KV6A 4B8EA 4DNYA 3T0DA 1X36A 3ST7A 4NUBA 2AEYA 3T2TA 3I2KA 4XJ9A 3QBQA 4AGVA 1ZNPA 1IPKA 3FHIB 4OHWA 3KT7A 1NY72 1W6OB 5FZ6A 5J7MA 2ZGPA 1MR5A 3IIIA 4HN0A 2HBUA 1F15A 4LE4A 4ONUA 4UBGA 2P37A 2ZGKA 2WLQA 4XXPA 1UXZA 4QPIC 3GDBA 3WF3A 2ARAA 4Y5SA 4Y24A 2D44A 5FP3A 2RDSA 3RVHA 1C5IA 2PXJA 1L7LA 2E32A 2QJVA 2RVAA 4HOOA 3RYPA 5HXVA 2P3KA 3CQOA 2ADDA 3UYJA 4DINB 2UYBA 5DZFA 1D7PM 5D2AA 3USSA 1K45A 4JKKA 1DLCA 4JGYC 4NWVA 4CP9B 1HB2A 2Q0AA 1OI6A 3ZVXA 1WMEA 1NXD1 1QJU1 3WINE 3R6SA 2DVBA 1MACA 2LM3A 2BTVC 4KMQA 1GZ9A 1AR81 4W50A 3JD71 1C8NA 1F31A 3NV1A 4E2GA 2J42A 2D7FA 2AR6A 5B2GB 5IK8A 4WM7A 5DUWA 4BB3A 1AZDA 2W0XA 5JLVA 1N1TA 5EFUA 1MZ6A 4YSFA 2OT7A 2XWJB 1JODA 4A3ZA 4BQ2A 5IVVA 4Y4RA 2J1AA 5H9RA 4Y20B 4BYYA 1Q43A 1REFA 1H8TB 1UW8A 2BBVA 2HEWF 5IW0A 3VL8A 3E6CC 3GNEA 3RMYA 2ERFA 3T2QA 4E9KA 5CIRA 4PBPA 3KB5A 1NCRC 3MW2A 5D21A 4PLNA 5IVBA 4XTMA 4JTNA 2IFWA 3H8UA 4MOAA 3WG2A 2PHXA 2NYYA 1COV3 3NSTA 4K1YA 2W1UA 3X29B 4X8PA 4CDWA 4CU8A 5IAXA 5LA2A 4IGPA 1W2NA 1LOBA 5H9SA 3WQ0A 3KCCA 5LK7B 2VAUA 4Y1ZA 1VJ2A 2RG4A 4FPEA 2EIBA 3BB6A 1OPOA 2VPVA 3H3UA 5CZKA 4MGKE 5HV0A 1H2KA 4WVVA 4ES9A 4I0WB 4ZU7A 1COV2 1BBT1 2W92A 2Y6KA 2N7GA 4DFSA 4HK9A 3MIFA 5CFCA 4UW5A 5HCAA 5FXWA 1DP0A 4FFIA 5LA9A 1W8WA 4EJRA 2ET1A 4QB6A 2BOIA 1X82A 2ZGRA 5CISA 1N1YA 3UV9A 3KF3A 1X9PA 2PN5A 3KCYA 1EPZA 1XE0A 1LHNA 4CDUA 1J84A 3JBG1 3WR0A 3B7MA 5C71A 1R081 3A21A 1O59A 3I2FA 1KFXL 2B8MA 3AZVA 5DDJ1 3P5BA 1YWKA 4YVSC 1GOGA 1Y9GA 2WRAA 2ZX3A 1JU4A 4FT8A 4Y1UA 1UX6A 3U07A 2FMDA 1EAH3 3VBRB 3ZN4A 3H50A 5CAZA 4R4ZA 4RHV3 2AEZA 1V6NA 4PBOA 1ULGA 1GICA 3V0AA 2A6ZA 2W9XA 3WDVA 1ENQA 1CIYA 2HWD3 1CAXB 3S5QA 2VBPA 1UMIA 2Y0IA 2DWRA 2P17A 2D6MA 5CKQA 5FZ9A 1BK0A 1ND2B 4LULA 1RUOA 1OH4A 1LULA 4RL7A 1EP0A 3IT8A 1D0GA 2WT2A 4Y5TA 3POJA 5DZEA 3VKNA 2VZUA 4JHTA 2X09A 4DXZA 1DLLA 1EAH2 4HZFA 3NJXA 2YBSA 3VDAA 3M1HA 4RHV2 3WW3A 1JZ5A 3WD5A 4YGBA 4JDMA 5JCTA 4OI1A 2VG9A 5LATA 3ZPOA 1VBD1 2D3PA 5C9AB 4CDXA 2KA3A 2C1FA 4Y33A 4L8QA 4PDWC 2VMGA 5IVFA 4MV2A 2ZABA 3GHMA 4P9LA 3RZLA 2EAKA 2BDRA 2AZ5A 2EF6A 4OZXA 5A7PA 4EN0A 5LW9A 2DVFA 4DOUA 2CGNA 2ZZQA 5T3NA 5KBFA 2NP0A 5EQUA 5FBJA 2P4EA 1CJDA 2DCKA 1V70A 1SDDB 5T52A 4J1WA 3KF5A 4PI2A 3DCQA 3VBHB 4IL7A 5FLIA 1LODA 3N9MA 4LBKA 5ACA1 3W5NA 1K5MC 4W65A 5FPZA 2EXIA 3GF6A 1O4ZA 5FY1A 3DKWA 4INDA 4NOTA 1OA4A 2QFEA 3HQUA 3ZFGA 4P5HA 3OGSA 1OBNA 3S5AA 1ASJ1 1PGW2 2A5ZA 2EVXA 4FTBA 1C4RA 4GH4B 2ZXQA 4XJUA 3WY6A 3WDWA 5F5IA 2XGXA 2ZGNA 4XYXA 3ZYJB 4NJ4A 2W1QA 4O61A 4JZRA 4UFHA 4G4FA 4XDOA 4QMAA 1HXS3 2VZTA 1HN1A 3PUAA 4R9AA 2DBIA 2AC1A 2WO3A 2Y6LA 2XKOA 4AVSA 1VAMA 2VJXA 4Q0PA 4FOWA 3ZDVA 1UKGA 2ZMKA 4N8MA 1WCUA 5GLUA 3CJIC 2WNUA 5FMCA 1AL0G 1WW4A 2QUOA 2R32A 1U5IA 3CIHA 1RIRA 4YW4A 4Q1RA 2CNAA 3HT1A 1Y9MA 1HLCA 3UT0A 3ZYFA 3MBWA 2R041 2Y26A 1HXS2 3FX3A 1BXHA 3MF9A 4EWEA 3PVOA 5LA0A 1L7QA 5JSOA 4CEWC 3QACA 2G9GA 2UWBA 3PTRB 5AC93 1HKDA 2BW8A 4JV4A 1DGRA 1UX7A 3WG3A 4TSVA 2DURA 1U5YA 1RMU1 4P08A 1XBFA 2CWSA 5GZCA 5LA1A 3M4FA 3RQ0A 4ORFA 4IE6A 2WDBA 4HANA 1PO21 1VB4A 2HWF2 1LOEA 2VZ3A 3TN93 3J7NA 5FLHA 3UJOA 4YM1A 2RDNA 2D98A 4XOGA 4UFKA 4AEKA 3ACFA 2BPA2 4NN0A 5C4WC 5AC92 1WW7A 1POV3 2VZQA 4XF9A 1PK6B 4KWUA 1W28A 1YXWA 3LFIA 1NZCA 4R52A 4IEWA 3ITQA 2IVIB 4HT1T 1JHJA 3I2GA 2BP6A 2LS6A 3QH6A 2WNVB 4LO8A 4ISQA 4AWDA 4BQYA 4Q8KA 5J09A 2R1BA 4XF1A 1NCQC 1G9FA 1WCKA 4ITCA 3TN92 4DUWA 1UZYA 3SCFA 1C8M1 1E5SA 2C9AA 5BXXA 3W9AA 4B29A 5BNPC 2WJSA 3CLPA 5JMCA 3RPQA 1W8TA 2BZDA 3RZKA 1XYNA 4PHZA 5L7OA 3RZHA 2CWMA 2GP5A 3FHAA 1O3TA 3LA7A 5FZ1A 5LB6A 4Y5Z0 1JZ7A 1AYN1 2WT1A 1NLQA 3AP9A 3LDBA 4EN9B 1PM4A 3RJ2X 3RFRA 4XDQA 4XIKA 2GNMA 3MICA 3POEA 3B5LB 4V2WA 1QJU3 2VL4A 1JOBA 1UOFA 4YZ2A 1ZZCA 4XCAA 4ATFA 1H30A 1JOJA 4XUQA 3ZYPA 2L9LA 1AR83 4CEYB 3J7MA 3JXSA 3WNOA 3JD73 4RS5A 1GYKA 1BLZA 5IATA 3OUIA 1LOFC 4E2QA 4O65A 3D8CA 1OD5A 4C90A 4BDVB 5F3IA 3W20A 1E57A 4GD4A 4RD7A 3W59A 1OF4A 1QDCA 4BU2A 3O12A 5F8PA 3D0JA 4UWDA 1QJU2 3AM2A 1UN1A 5F2WA 4RGAA 1AR82 2J1VA 2CTVA 4WM8B 5FMBA 1BCXA 4CCEA 4EQVA 3JD72 3TNQA 4CP9A 1A78A 1HB4A 5FUIA 2J1EA 1GFF2 2WFF1 4P9IA 3MUZ1 5FUPA 2B46X 3K3NA 1CWPA 3ZIXA 3HN3A 1LNSA 1XQNA 4AAXA 4QGMA 2OA2A 5F3CA 3IM0A 2I45A 2CYFA 1NE6A 3E5QA 3F2ZA 4OI0A 1LCLA 4NRMA 3WLUA 1HV1A 1W8UA 3J7LA 3P3NA 3HJRA 5F3EA 1F4AA 3IPVB 1WW6A 3OG2A 5FZIA 1MS5A 2WZ8A 1JBCA 2XVKA 2A6VA 5L73A 4HVRA 4Y20A 3T1MA 1OHFA 1FMD1 3ZLIA 3ZXDA 2ZACA 1V9U1 4FBFA 4NMIA 2ZHMA 2GC1A 3WNLA 2PHTA 1MZEA 4HKWA 1W04A 1H8TA 3WCSA 4E4DX 1BBT3 4Q4X1 2ZHKA 3AJYA 3DYPA 4XFCA 3Q8FA 5I93A 1WBLA 2B5HA 4QXKA 3PVBB 2V73A 4I02A 1RC6A 1W05A 1GZCA 3VBUA 1ODMA 1I5ZA 2TUNA 2W91A 2IXJA 1IOAA 3OEBA 2PTMA 1V6JA 3BVCA 1AX0A 2HYKA 2VOWA 2Y6JA 3C7HA 4QQHA 2WN3A 4E8DA 4AVTA 3ECQA 5JXGA 3WNMA 3JBG3 3I3MA 1S0CA 2B4KA 1R083 1BBT2 2YDEA 5HPOA 1EUTA 5DDJ3 1E5IA 4NRPA 1POQA 2WQZC 1DYOA 3N7MA 3HD8B 4IV3C 1GWLA 3PNAA 3OBAA 1GOHA 3ABZA 5IT6A 5FPUA 2E63A 3D4KA 2QQUA 5EYYA 2OYZA 1RB8G 3JBG2 1H2MA 4ZXEA 4LA3A 1KITA 1R082 4RGGA 3SITA 3VD5A 3H8XA 2F4PA 4MG2A 3WNKA 1ZX5A 5DDJ2 5A33A 4L9BA 5BNNB 3KLSA 5EPAA 3IMNA 4AQTA 3OSDA 4XQWA 3DXUA 5CG8A 1ZBA1 1VBE1 4WZFA 2GN7A 3TWIA 1ZRDA 5FAXA 2GC0A 2JECA 5SV8A 3USUB 2EA7A 1IZ3A 3R4DB 3NNJA 2WSUA 4XEZA 4AFBA 5FZOA 1QIQA 2WSVA 4HXCA 2SLIA 4PQQA 3AL6A 5FY0A 4YW2A 2CY6A 1VBD3 1JZ3A 2FBEA 2XLGA 1KEXA 2VR4A 4EN6B 4K9SA 1ZZ6A 1HDKA 2FDIA 4OMDA 1OLQA 4LKFA 3NNGA 4Y1VA 5FZBA 5JOWA 1XC6A 4ZKTB 3VBRC 4CA9A 1CAXA 3VBSB 4QQ2A 1RUI1 4JRAA 1UXXX 1XYOA 5JPMB 1PX4A 3BYWA 3S7EA 4TXWA 2ORZA 3C2UA 4COYA 5CBLA 3V0BA 5FXXA 4FPOB 4GWNA 1RUNA 4L11A 1VBD2 5ACA3 1ND2C 2QKDA 1RVF1 5IVYA 4XMAA 2XQXA 4YG0A 4CCOA 3UGGA 4RQPC 4ZU5A 4AK3A 5C3OA 2VW1A 3AVSA 1AF9A 1CGPA 3RZMA 4L92A 1NLRA 1ASJ3 4FPKA 1IHMA 1RUC1 4B7KA 2BBAA 3HMYA 3JB8A 2AACA 2GAUA 5FZLA 5C9AA 4XUOA 2FCVA 2Q30A 3CHXA 5FZDA 3IKWA 2GP3A 1STMA 2VE1A 1RITA 3PJQA 4NHKA 3MFAA 5ACA2 3RZZA 3AVRA 2R0HA 1Q5OA 4Q27A 4RR3A 4F7ZA 3LSDA 1UY4A 1JYWA 5K8SA 4QM8A 1DQ0A 1ASJ2 1G9CA 1O3RA 3VBHA 2GH2A 4UYBA 2D93A 3C7OA 4FQ4A 1LAJA 3B02A 3AKRA 3ZFFA 5FYMA 5G04L 1SFPA 2ZZJA 4LE3A 1W9TA 2Q8EA 4QDSA 5L9RA 1IGOA 3KWVA 3OJBA 4BK5A 3D3AA 4FFHA 4M3CA 5CEHA 3BU7A 3B01A 2ZEWA 3TOJA 4DXSA 5CFCB 5L9VA 4M01A 1G8WA 1HJGA 3VHPA 1JZ8A 1MEC1 3WDUA 4BXFA 5C8WA 3AB0A 5KC5A 4GH4C 3RWNA 3MIHA 3E5UA 1RMU3 2ZEZA 4QDQA 4ISRA 4CDUB 3VHOA 2VTFA 2J1RA 2ZX4A 5T5OA 5FO9B 1REEA 4R9CA 2RHPA 5DZGA 1PO23 5IUQA 5FP8A 1PMJX 1XSQA 1OKQA 1Q8SA 1UZ0A 5EYXA 3TYJA 2WWSA 4OI2A 4LQRA 1QOSA 2IVJA 3NRUA 2OQ6A 4PLMA 5IYYA 1S0FA 2UY9A 3I54A 4UXAA 1ENRA 4RA0A 4EN8B 3S7IA 1POV0 1RMU2 1H4HA 2D40A 3ELNA 1J58A 5BYNA 4MUVA 3I2JA 1MS1A 3FJSA 3M3IA 4CU9A 1PO22 4TYSA 5FYZA 3WF4A 5C3SA 4PJYA 5JXJA 1C8M3 3JU9A 3LPGA 1GMMA 2P1BA 4JTOA 1LHWA 4LK7A 2ZGSA 3A22A 3WCRA 4CEWA 3EBRA 1S0GA 4AF9A 1KGYA 4GULA 2ZGUA 3T1LA 3R4UA 1J3QA 1UU6A 5HV4A 3ZR5A 4A6SA 1AYN3 5T54A 4QKBA 4AI8A 3FHQA 3SNMA 5FXVA 2DFCA 1PK6A 2VM9A 4N53A 3BN6A 1N3QA 1C8M2 2LRPA 1Z7S3 2A3WA 4NPMA 2ETEA 3OPWA 5KHIA 5A32B 3D82A 3MHZA 1U5XA 5JUVA 2WNVA 3FLRA 5FTTC 2HWD1 5DAWA 2JIJA 3Q8EA 4WZCA 3SKVA 1S0IA 1WCSA 3ZSMA 4ZZ8A 4LO6B 4QB2A 1VMHA 3DYOA 1AYN2 1GOFA 3POSA 4OQ8A 2KD7A 1YQCA 4FOQA 3N9NA 5LASA 4J1XA 1OPMA 1YQ2A 1VBB1 2VZOA 1Z7S2 4IETA 3OBTA 3GJAA 5K4LA 5JOYA 1AVBA 1W8ZA 3ZFGB 5FLJA 3IBMA 5BNOC 5FY4A 3I2DA 3U4XA 4IESA 3DXTA 4LKDA 5LRRA 2FQPA 4XC9A 4A44A 4N7IA 3ZR6A 5FZMA 1D2SA 4LO7A 4XFHA 2DU0A 3MIGA 1OOPC 5ERLA 3OPZA 1W9WA 4MGZE 3EXUA 1UU5A 2C0ZA 3I4IA 2Y33A 3NQHA 2BU9A 1IQDC 3EJKA 4CUBA 3H0OA 2J1UA 2K46A 4TLGA 3G7DA 1UZZA 1XNCA 3H3LA 5FR3A 1GP4A 1A8MA 1C1LA 2PLV1 2D3SA 4A42A 2ZBJA 4Q8LA 3FLTA 4OZOA 5IVEA 3AL5A 3DN7A 1PO11 1MS9A 4Q29A 1UF2C 4NROA 1U5ZA 3AC0A 4URTA 5LY2A 1NOVA 4XHXA 5F5CA 1L3JA 2X5IB 4M3CE 1FMD3 3UGFA 3ATGA 4WM8A 1DCSA 1DGLA 2QVSB 4MO3M 1WKYA 1XJAA 1QJFA 2UURA 4KWLA 3GBGA 1KJRA 3P3PA 1WLTA 2YPJA 5FFOC 1WGPA 4CXXA 5C33A 2WFPA 3CMGA 5LK5A 3IDEA 3WW4A 3ZXAC 1XOYA 2VGDA 3NAPC 4Q0QA 3NKTA 3VZOA 1O7FA 3RZJA 1TNRA 2XLFA 4Q4V1 4I01A 1H1IA 3WF0A 4AI0A 2PHLA 1XRUA 1FMD2 3DGTA 1V9U2 2O14A 4Z1VA 3IPVA 4WVZA 3ZN6B 5FOJB 5A3MA 1YHFA 4C8DA 2JG9B 5FY8A 1WMFA 3ZDSA 1C5HA 1S1AA 3S0MA 4LIUA 2VMEA 4JAAA 2YG0A 5B4XA 4AHWA 2FDHA 1SZBA 2B45X 1ULCA 5KWRA 1IPJA 1ZBE1 4M3CF 1RXFA 2GMMA 1HJFA 5CFDB 4XJWA 1BZWA 3M3EA 5DAVA 1H4GA 4OMCA 1LHVA 2BFUS 4BQWA 5JR2A 5L7OB 3N4MA 3M2MA 3TN91 1LJ7A 1W6PB 1VBE3 1ZBA3 2VNVA 1Q8OA 1NZIA 2WKKA 3AYAA 4Z92B 2E7QA 2A70A 1I5PA 4YW5A 3VBOA 2V5YA 3IWZA 4XJ8A 3H8RA 2WLPA 4R4XA 2FDFA 4AR2A 4BIFA 2NQYA 4QHBA 3BIEA 3LOBA 4URAA 1UMHA 2UY8A 4IV1A 2OPKA 3WW2A 1AXZA 2CV6A 1W8NA 4K21A 4RS5B 3TAYA 3O1MA 1OQ1A 1ZBA2 1VBE2 2DCZA 3LFMA 3EHKA 5HCBA 4CRQA 4LLFA 5B4NA 1RUI3 1W8OA 2Z5WA 3POYA 3TEZA 3D5OA 5GLVA 5BNNA 2GC2A 1HRI1 1HB3A 4UW4A 2PHWA 4NWWA 5FY5A 5FZAA 5A7SA 2VZPA 5FP4A 4F83A 1V0AA 1BVVA 5JZGA 1RVF3 2Y6FA 1DZTA 1QU0A 1SLAA 2YZ4A 3AMMA 4MHRA 4QD2A 3USUA 3DPRA 1XNKA 1X33A 3GALA 3ME2A 3DYMA 3FC0A 3N3HA 4D0QA 2GNBA 5JI9A 5IWFA 4E8CA 4AHZA 1RUC3 3LIGA 5CKNA 1JYNA 1BKZA 1RUI2 2OVUA 4Q1PA 4BMBA 1JYIA 3LA3A 5FYVA 4HETA 2LTNA 1DYPA 5CU1A 2MHFA 4FCAA 4PIZA 5IAVA 3WDYA 3PVEA 1ZZBA 1CJPA 2JKBA 1NA1B 3BOWA 1RVF2 3VBSA 4PIYA 3VZNA 1OH3A 4HK8A 5KHJA 1CN1A 1IS5A 2C26A 4NVPA 4MHUA 4QU1A 2GALA 3O1TA 5FREA 1RUC2 4WM7C 5FIXA 5T55A 4AI2A 4DUVA 4FTEA 1AJKA 1LRHA 2YB7A 1ENXA 4OVEA 1CZVA 3VLBB 2WWUA 4GQ7A 3SMHA 1NKGA 3PHMA 3AXEA 4H7MA 4IE7A 3ASIA 4XMIA 2Q8DA 1YYNA 3VD7A 4QM9A 5CB7A 2DCTA 4V1PA 1DGRN 1Z0HA 2RJLA 4NO4A 1MEC3 1CQ9A 4ARYA 2AENA 2K9ZA 3LEKA 1QNYA 3VBUB 1DF0A 1W2TA 2BFUL 1QXRA 3WG4A 1VBA1 2IXCA 2MEV1 2P3JA 5ISLA 1WA4A 4CUAA 4ZXKA 1UYXA 5DG2A 1UIKA 2H6BA 3OBZA 5FZFA 3VZKA 1CAVB 4FPJA 4YRDA 4MADA 1DQ4A 3ETQA 4JVAA 5G05L 2XJQA 3U37A 3MW4A 3U75A 4CDWC 1MEC2 2V72A 2QQKA 4BZ4A 3J26N 1F9KA 2C6SA 1VIWB 4AZZA 1RTVA 3VZMA 3PUSA 2JG8A 2WBKA 5J37A 5CADA 3FBMA 2R1DA 1IS3A 1DGWX 1CONA 1HQWA 4I30A 3VDDB 3VUOA 3QOPA 5DXDA 2VQ0A 3H7YA 4FOVA 3B69A 1VPHA 2YC4A 4XILA 1SHWB 5CFCC 3ACLA 2HBTA 5A33B 4DZGA 2V4AA 2XJSA 5JVVA 3NJYA 4LKEA 2FMYA 3ACIA 5FKCA 3I2IA 2YPDA 4Q2FA 4J6GA 3T0BA 5C8CA 2P2KA 5FQ0A 2EAAA 3UNPA 3SEPA 4TN7A 2IXKA 4CDUC 2E9QA 1FOD1 3I3EA 5FZOB 1RUF1 1FAYA 1I9RA 3B3QE 3WZ1A 5D1IA 1GQGA 3MW3A 2JDZA 1OFNA 3NKGA 3QD6A 4Q4Y1 4HL0A 4DPNA 2PHUA 1S2KA 4UBHA 2J7MA 2VZ1A 2PAMA 1YQ6A 4QX0A 1Y9QA 1WCQA 1QXPA 4R9BA 1QMJA 1W3VA 2BGCA 4PT6A 4DQAA 1ND3A 4XUNA 1OKOA 3MGUA 4BHPA 5A80A 3FWEA 3V0BB 4NHLA 2YFZA 2ZGTA 5A7WB 1V6KA 1T2XA 4HKOA 2B9UA 2BERA 4B1LA 4LT5A 5A1FA 1FPN1 1VBB3 4ZS2A 2TEPA 4AI9A 4QHZA 5F1RA 3I49A 3E6BA 1JYCA 3NJVA 4RYDA 5CVRA 5EXOA 2OIIA 2HWD2 1NUKA 5A3OA 5LWBA 1RUG3 1X7NA 4JX0A 2ZMLA 3GM8A 1H1AA 1UOJA 3MFCA 4CP0A 2JDAA 3QH7A 1K3IA 1BK1A 5A32A 3A7QA 5FPXA 3PU3A 5T5LA 4META 4CDXC 5HXMA 4K1ZA 1UL9A 1B35B 1YEWA 1YFWA 1VBB2 4CSWA 3CNAA 3DV8A 4RR3B 2W5FA 1WD4A 1VAVA 2FHRA 1SFNA 1RUG2 1IKQA 2WZR1 2PLV3 3LB9A 1YJKA 1VB2A 5LRSA 3O7OA 2X53S 3GJBA 1YFUA 2GC3A 1PO13 2QCSB 3ZFFB 5I0DA 4NHXA 3OD4A 3HNYM 4ET7A 2UWAA 4A41A 3MLLA 2QBXA 1CPNA 1LHUA 4M3CB 3U10A 5I8SA 3FMGA 3CEWA 4I3PA 4BQ4A 2QQLA 2DCYA 4LITA 3U4SA 4WVWA 1K5MA 1NQJA 2PLV2 3HBZA 3WP4A 3PUQA 4BCUA 1B09A 1EV11 2ORXA 4L2NA 2P34A 1PO12 1PMHX 2Y64A 4DY3A 2I07B 4Q4V3 3ZN5A 4COWA 3ZYBA 4AYUA 4KGQA 1D4M1 1QXJA 1LU1A 2XG3A 1WUVA 3EYPA 4A7KA 1RUE1 2OZ6A 4WV8A 5E1RA 2NM1A 2BNNA 3H1MA 4IERA 1AYM3 1CPMA 1JH5A 2WNUC 2X5IA 2RJKA 2XBO3 4BISA 1OQEA 2WABA 2Q4SA 2YY1A 4FPGA 4LBJA 4MZUA 4XE9A 4CPBD 4Q4V2 3AZWA 2BWAA 4JDNA 1F35A 3SKJE 3PTYA 1IKPA 3OOXA 1ZBE3 1XB9A 2CAUA 1H8VA 5C3RA 2QE3A 3ZOIA 4CEWB 1TME1 5FY7A 2XBO2 1RUH1 3VGIA 4B7EA 3ZFEB 3KQRA 4FTSA 2WO1A 3AP4A 1O8PA 2RS31 4YFWA 1JZ4A 4XFFA 3ZN6A 2OUJA 5AFEA 3O1SA 4DEQA 1HB1A 1OUXA 1ONAA 2QQWA 3P6BA 2H6CA 2WA3A 2KM2A 4P5YA 1ZYBA 1ZBE2 1FNYA 4N53B 3VN4A 5IFPA 5K0UB 2JG9A 1EUUA 3AP6A 3CKHA 3O1PA 4D94A 3CU7A 2JDHA 2CHHA 4QPGC 3AFKA 5L19A 4A2UA 3DEMA 3KV4A 2JD4A 2E53A 3OGGA 2CGOA 4AEJA 4AGGA 4CUCA 1RYYA 2V4VA 5CFDA 2Z69A 5TSWA 3MLJA 1HX6A 5JXIA 1R091 1DBNA 1HRI3 4HVQA 1W6PA 5C5TA 3DECA 4UT5A 5H9PA 3TEWA 4N43B 2WL1A 4H14A 4YZ3A 2C9KA 4WVMB 5D8AA 2XXZA 4TWTA 4H55A 1UY2A 1OLRA 1Z7S1 1PGSA 4UFJA 3NMBA 1GSLA 3AX4A 4XJAA 2GU9A 2ZA9A 3O0XA 1KRIA 4OHXA 1K12A 1HRI2 3MEPA 3VZJA 2AGSA 2PQSA 2XL7A 5JOZA 2DV9A 1H1MA 3M8LA 4FPFA 4UW3A 4XQDA 3UJQA 4S2HA 1W9YA 4RS5C 3OB8A 5DAXA 5F5QA 3SXWA 2H0BA 5C3QA 1NQDA 2JDKA 2WQ4A 2J22A 3NV4A 5LBBA 4BJ0A 5KC6A 2W3JA 4C91A 4NIAA 1XYPA 4LORA 1GR3A 3GZUC 1LEMA 4XDPA 1GBGA 1H0BA 2QQJA 2HEVF 3I3DA 4XQ4A 1YRZA 1JHNA 1DQ6A 3QCWA 1MZFA 4Y3OA 3POIA 4OLLA 4O9GA 1JU3A 4QT6A 5JSRA 1US2A 1RXGA 1DQ5A 2WO7A 4XPVA 4C0HA 4K40A 4IW3A 2R071 5FV3A 1TNFA 1NA1A 4CDQA 3MO4A 2FCTA 1VBA3 3HT2A 3R0RA 4XZUG 2MEV3 3WP6A 3I59B 3INAA 1HQNA 1HRV3 1I3HA 2CL2A 1PVC1 3RYKA 3GBWA 3W5MA 2ZKLA 1MQTA 4LIVA 5KHGA 3BPZA 3M3CA 1BEV1 1AJOA 3N9PA 1GUIA 1V6OA 3PU8A 5EHDA 4LKSA 3EO6A 2QQMA 2XLAA 5GZFA 2XH6A 3HN1A 3LEGA 3G6JB 3VBFB 4EWDA 3NL1A 1FX5A 1QH7A 1VBA2 2MEV2 1GNZA 1DGWA 1F2NA 2ZOEB 5DN2A 1F8VA 1JS9A 4IQPA 1HRV2 1X50A 3SLIA 3VD3A 1H8TC 5BV6A 2ZEXA 4B4RA 2A3YA 3KGLA 4UOJA 4D8MA 1R1A1 2OX0A 3LGRA 4DXTA 4AAPA 1WCDJ 3ZSEA 4V2VA 4FSJA 3POGA 2OQ7A 3MIEA 1AUYA 3ZIWA 3DL3A 3JUUA 4LBQD 1QJY1 1CAVA 3LIHA 3VBOB 3B93A 3H1YA 4CCLA 2XVGA 4JQTA 1FOD3 1LHOA 5HI0A 1RUF3 1QF3A 2PYTA 3Q8BA 4B3NA 5KR7A 4IV1B 2JJ6A 1QQP3 4JKLA 4XZPA 4AFMA 4HONA 5ABJB 1JZ6A 4AG4A 4Q4Y3 3ZO0B 4JDOA 3VDDA 1SLBA 1YNAA 3URFA 2TBVA 2WINB 4AVCA 4Q4W1 5A3LA 2QQPA 4SBVA 4NHYA 2B39A 2FD8A 1J83A 1G86A 3CBNA 4M4PA 5GZGA 2VXRA 1SLIA 4LEJA 1H2NA 3C7FA 4QXHA 3VD4A 5C4WB 1FOD2 1W03A 4OHVA 4HVOA 1OFSA 4W6WA 1RUF2 4A7ZA 2AH2A 1VRH1 1QQP2 4JQRA 2D6KA 1UPSA 3DF0A 5JZGB 3N7KA 4IEUA 5J1XA 1FPN3 4Q4Y2 4P14A 1NLSA 3DPRB 1NT0A 3K51A 1YI7A 5CKMA 4DB5A 2RMU1 5APAA 4MGSA 1VBC1 1YIPA 4XABA 5FZHA 4RSUA 4S2GA 3BKZA 4K6BA 4GJZA 2IC1A 1GQPA 1PIV1 2MNGA 2YU2A 4YWAA 5T5JA 1ZA4A 4B4QA 3THTA 4JGZA 5HCHA 4Q26A 3WW1A 3LEMA 4AQ6A 2ARCA 2DDUA 3FFQA 4M00A 1TG7A 1FPN2 1G6NA 3MI8A 4JGYB 3SCGA 3ZXKA 2BVBA 1N1VA 3UK9A 4ASKA 2VMHA 2ZHLA 1MZ5A 2WZR3 3AMQA 3KMHA 4FFGA 5A7WA 3LCPA 2ZTNA 3JB4C 4IEQA 3VL9A 4KBBA 1NX9A 3ACGA 3KCXA 3JCIA 4UFLA 3WV6A 4BH9A 1O6UA 2D6LX 1S0EA 5FK7A 3Q9OA 1RL3A 5FYHA 5EJ3A 4ZZ5A 2A73B 4BQ3A 5C5UA 1V6LA 2VECA 2RM21 2ZGQA 1SACA 4YM2A 4RFT0 2VD7A 1AR73 1Q8PA 3L2HA 3AK0A 4HBNA 2VCBA 2WZR2 2Z4FA 4S2FA 1UZVA 5C9AC 2AYHA 3APBA 1B35A 2O8QA 1X9TA 1EV13 4RQPA 2VZVA 1PZ9A 1OMIA 1SQ4A 4LNVA 3ZYHA 2GNDA 4AHYA 3KSCA 4PCRA 2QZ2A 1N1SA 2W95A 3GZEA 1D4M3 1MPXA 4QKDA 4MXWA 2WO2A 1WWYA 4Y4YA 1RUE3 5FKBA 1SG3A 3FE5A 3L9JT 1NCRB 3M70A 1VRBA 1OUSA 2YGMA 4P00B 1AR72 1DIWA 4XTPA 3RZGA 3VBHC 2ILMA 3O5SA 2BNOA 3ALQA 4AE2A 1LOGA 2JG8B 3EMRA 1EV12 1TZOA 5A1AA 3PMEA 1WLCA 1W6MB 4X8NA 1VAKA 3VD9A 4NIHA 4HMZA 1D4M2 1VMFA 4P9XA 4E4SA 1FT9A 4LBNA 1RUE2 2VNRA 4Q0SA 5FPLA 2MPFA 3TNPB 2E7TA 3LA2A 1YLLA 5BPXA 1JYXA 1J3RA 5FQ0B 1TME3 5C8CB 1RUH3 2VNOA 3THPA 5A3PA 2B42B 2B9VA 2SBAA 5DQ0A 4IE0A 1BVP1 4FAGA 5IFTA 2RS33 4AGRA 1YIFA 3KV9A 4Q0UA 1JTZX 1MS4A 2HWB1 1NAEA 1OURA 2Q1MA 2EXKA 2R0FA 3S6PA 2J1TA 3ZX7A 3NV2A 3AZYA 1AR91 1WBFA 3LD8A 5GZEA 4K8RB 1TME2 1KJLA 2NPIA 3BU0A 1RUH2 3AYEA 5GKAC 1P8JA 4D6SA 2O0OA 2UU8A 5J36A 4HFSA 1I1EA 1ND3B 1XU1A 2RS32 4M4RA 3RRDA 2E51A 5LBCA 3LQCA 2W87A 3SHRA 2VOVA 4DUXA 4P9JA 3AYCA 1R093 5JSPA 2X10A 4UF0A 3D6EA 2BYVE 3ZFEA 2RE9A 4LMFA 4EWAA 3WEZA 4BLJA 2XKPA 3LDKA 2Z79A 5IJRA 2LROA 4SLIA 1CX1A 4A7YA 1TMF1 2IXIA 1U0AA 1LECA 1SMVA 5FPVA 4UI9L 4EE2A 4NIIA 2JICA 5JIUA 5K0UA 2DUPA 2A3XA 2XUMA 1S0BA 2K0GA 4LXLA 5A7NA 4BLIA 2W52A 1QOTA 4GB33 4N9HA 3ZYRA 3JQXA 1PK6C 4CCDA 1R092 1XE8A 2ZKNA 1A34A 2VCAA 3O0VA 5GM0A 2V09A 1S55A 2VULA 2Z42A 3AZXA 4IDZA 3MYXA 2WNVC 3PIGA 1IG0A 4QX1A 3AXDA 3IZOA 1AX1A 2ZGMA 1Q3EA 1NE4A 3AMHA 1W6QB 4XETA 1SBDA 4PDWB 3T0AA 3ACHA 3E5XA 1YO8A 3F95A 4OHZA 5JDBA 1SFYA 2DBNA 5DUVA 3SCHA 1W06A 2XMLA 4N43A 1RUG1 4LTAA 5FK8A 3KVAA 4F3JA 5FDBA 5I0SA 4WVMA 4XIOA 2Y6GA 1G9BA 4CE8A 3H8OA 4XXAA 5AVPA 2BQPA 5FO8B 3L2YA 5I91A 2KR2A 1K5MB 2YROA 3WNXA 1EY2A 1YI9A 4GZ9A 4AQ2A 1PX3A 2XWBB 4O9EA 1W8FA 1DQ2A 1RINA 2R073 5L9BA 2IXHA 2C5DA 1YFXA 2GZWA 2RS51 4CEYC 5DUUA 4N9IA 3KZ4C 4LOTA 5F6LB 5I8TA 1OA2A 5A3NA 5LBFA 3ILFA 3OUJA 5DAPA 3RI8A 3WNPA 1PVC3 2Y38A 3WDXA 4YG6A 3HVDA 4YVWA 1BEV3 5A6XA 1ACCA 4P02B 3U0ZA 4FOYA 4LHNA 4NIGA 3V64A 1OT5A 2VZSA 4YM3A 4D7TA 1CX4A 2VUAA 2R072 4BM8A 4WM8C 3ZM8A 2VQUA 1XNTA 1A6CA 2JE7A 3CJIB 5CNAA 4BA6A 4BOWA 5A3UA 1CIWA 5F2SA 1CZSA 4LBQB 3THDA 1PVC2 2EIEA 4G9SB 4E4HA 4FXGB 1LKNA 2JB4A 3HR9A 1R1A3 2R49A 1BEV2 2HWC1 3A0KA 4AEDA 2C24A 4XACA 2W08A 3UKNA 4EYUA 4LBLA 4ZPIA 1QDOA 2IWGB 3LZZA 2JE8A 3I59A 5FPAA 4OUSA 4DMIA 1JN2P 3ZMNA 3MZHA 1UMZA 1ULEA 1QJY3 3FBYA 2A7AA 4XURA 3PIJA 4R9DA 2WZPP 1AYM1 2QQOA 4QX5A 2XBO1 5AVAA 3K46A 1DZRA 2B7YA 3AJZA 4DO0A 2CU5A 2HJIA 1VR3A 2VMIA 5FPBA 1AR63 2BOJA 5LEJA 5IK4A 1R1A2 3VBFA 2WQ8A 3NO8A 2YFUA 5FP9A 4IE5A 5FUNA 1O91A 2A6YA 2EXJA 1RUJ1 2VU9A 1PGL2 2YMZA 4Q4W3 3PL0A 2JEMA 4GJYA 1QJY2 4MXVA 5F5AA 5FRAA 2YGLA 4CU7A 1W2AX 3WQ7A 4HPKA 4QHOA 3UETA 2ARXA 2VMDA 1AR62 5J98B 3IAQA 1VRH3 4LHLA 3AP5A 3NNFA 4XBNA 5FYSA 4XJZA 1NCQB 1PZ7A 3PLQA 3O0WA 3WX5A 3VZLA 1YFYA 5D8AB 5FZEA 5GLZA 5K7PA 2RMU3 4Q4W2 5A6QA 1VBC3 4CCJA 5I0UA 3WVJA 3ETPA 3VBOC 1AHSA 5A3TA 4OUMA 5ABJA 3KT4A 2VTXJ 1PIV3 2YC0A 2PAEA 5F3GA 5HCFA 4IV1C 2ZS6B 1VRH2 2XHNA 2O1QA 3PUIA 1OXCA 4PIXA 4I3GA 2LUWA 2UWCA 1LR5A 1C57A 2VZRA 2RMU2 2D6NA 1VBC2 3WP5A 4OI4A 2W46A 4C1XA 1WZXA 3WSOA 2RDQA 5BNNC 2R061 3AYDA 1W2OA 1PIV2 2X29A 2G19A 5FZ8A 1MVEA 1C1FA 5IHRA 1O4YA 1YC61 2F17A 3D0SA 3IIAA 5E89A 5JZGC 1IS4A 1GZTA 1W0PA 1UY3A 5DMYA 4QPIA 3VKFC 2HKXA 3DPRC 4BXSV 2RM23 1MS0A 3RJRA 3KHBA 5FZ7A 3VB9A 4XF4A 4QB1A 3WF2A 1T6BX 3SISA 2WZEA 5C6CA 1W3XA 1XXNA 2VBDA 3HIFA 4FPHA 3OD0A 4AEMA 4CDQB 3KM5A 3NNLA 3NNMA 4JGYA 2D43A 4MYEA 4KG0A 2HH9A 1APNA 3U14A 1MQTB 3VBSC 2EXHA 4PQ9A 1W99A 1M4WA 1Y4WA 3T4HB 2RM22 4GA9A 1OA3A 2ZJCA 5JI7A 4RFRB 2CDPA 5EJ1B 4DIQA 1PNFA 1Y3TA 1GU3A 3BPSA 4C1WA 5BY5A 1D4VB 3V56A 2JE9A 2OW4A 2NZ9A 3IDBB 5JOXA 3A4UA 4HG6B 1ZZ7A 4EV0A 4LO4B 5FZ3A 3CO2A 5E8AA 1W8HA 3ZYGA 1W0OA 1UQXA 2EICA 4COZA 1W90A 2E31A 3BTXA 4ATEA 3POFA 5DPNA 4OFGA 1JW6A 5C70A 1W6NB 4NR1A 1FI2A 1J1LA 1XNAA 2GMEA 5BNQA 1HRV1 4YG3A 4D3WA 4CU6A 5FWJA 1DDLA 1D2QA 1LGBA 2DVAA 4XW3A 1OD3A 1LU2A 5FJHA 4PF1A 1UNBA 2G9ZA 1QGLA 4CPBA 3A0NA 4QQOA 4IEXA 4AI3A 1NCRA 1NXMA 2HWB3 3ON7A 2JDNA 5CYYA 4XAEA 1RJ7A 1VLNA 1KFUL 1QJX1 1SBEA 1M06G 5A6ZA 1AR93 4COUA 1Q56A 2UYAA 3JZVA 3OBRA 5L36A 2CGPA 4HKLA 1W6MA 1O8SA 2WR9A 1SDWA 3BALA 4W6YA 2JG8C 2EIGA 1FYUA 2Y60A 2XVLA 2OS2A 3BTAA 4IV3B 3T3YA 4CYDA 2Q8CA 2HWB2 3GHNA 4FQZA 4LHKA 3N9QA 3WOGA 1ZRFA 4HSLA 5FWEA 4RGKA 2ADEA 1W9FA 5KXDA 1YQ5A 4Y1YA 3ZXFA 4IE4A 4Y1XA 1AR92 1LOCA 4BQXA 1HQLA 2PQQA 3GZTB 3WF1A 5C8CC 1REDA 2DVGA 2PHFA 1TMF3 3RNSA 4Z07A 4KNCA 1PM7A 5GALA 1GNYA 1QQP1 1RUD1 1RHI1 2XJVA 2JKXA 3LSEA 3M3QA 5FZCA 1ULOA 5KHHA 1JZ2A 1SPPA 3BOPA 4QQPA 4I2OA 3K75B 3BGAA 4YGEA 3K4DA 2YV8A 4QXBA 4JGZB 3PVNA 5LZ6A 3WQBA 2R7EB 2WC2A 4E4ZA 1VMJA 3IDCB 2WAAA 4Q5OA 1FV2A 1S2EA 3J9SA 5FZ0A 1XU2A 4YVSA 1EPWA 2WT0A 3LDRA 3B9IA 1KS5A 1UOGA 1TMF2 2WNEA 4FP2A 2GNTA 4A45A 3W21A 4JKMA 4YNIA 4QDRA 1ND3C 2JX9A 4KL1A 3HQXA 3AMNA 4P9GA 1N47A 1E5HA 1WW5A 1UPIA 2VUCA 4WBBA 1AL21 4FPLA 3UKVA 1UU4A 3OGRA 4KQ7A 4JC1A 2DU1A 3TEYA 2JDUA 4DEVA 2YHJA 3HNMA 4LA2A 2NMOA 4BWOA 3AMPA 3O1OA 5EIYB 3RGBA 3WP3A 2DCJA 3MUY1 3WG1A 3GBFA 1UCXA 4CCCA 3CDZB 3K48A 4RQPB 5J48A 2P3IA 4LHSA 4H7LA 1K42A 3ZMOA 2D3RA 2RS53 1PVXA 3FL7A 4GMP1 3I3BA 4BMEA 2PELA 5KXCA 5HBAA 4MXWB 5AFBA 1W6QA 1ZA7A 4AVAA 2J1SA 1OC1A 1OF3A 4FVVA 4PDWA 4YZ4A 2RDRA 3VKLA 5LBEA 3VV1A 4QX7A 4IUGA 2WN2A 1W0NA 1RJ8A 4YARA 3GYDA 3U78A 1GLHA 4EZHA 2WS91 4MH0E 4NE9A 4QU2A 5T50A 3ZFGC 4GKYA 1A8DA 2RS52 4LO5B 1CAWB 2BUKA 1AR71 1XE7A 4QX8A 4I0BA 4LUKA 1FATA 1GP6A 1TVGA 3KQ4B 4FP3A 2HWC3 3T4VA 4CVUA 1G9AA 1GV9A 3Q8AA 3SC7X 2E6VA 2D6PA 4HLTA 4BE3A 3CZJA 2RR11 4D6RA 4GKXA 4GWIA 1J3PA 3AKQA 1UD1A 3LPFA 4UFIA 3LKJA 3PDQA 5FP7A 2ZAHA 2BV4A 2Y6HA 3OGJA 2VW2A 4M0NA 2YU1A 2JDYA 2YYOA 3V65A 2HWC2 2X5IC 5K9YA 1LEDA 2BNMA 1HN0A 5BUVA 2Q5TA 3CJIA 2GH8A 3E6DA 5F6KA 4XF3A 1N3PA 5DUXA 1QEXA 4LBQA 1RUJ3 2WNOA 2YXSA 2VW0A 4XUTA 3LE0A 4ZU4A 2K2SA 2O8OA 3H7JA 4OQ9A 1XSRA 3POWA 3GCWA 1AYM2 1WLWA 2DUQA 3HNBM 1F5FA 5FCCA 5EWSA 1CD3G 3OYWB 3TEXA 1ZVFA 2OPWA 1R1ZA 3ORJA 2BGOA 4UF0B 5FZGA 4ZS3A 3RYRA 3ES4A 1OLMA 4XAAA 5A6YA 1F5JA 1QNWA 2HWF3 2VBBA 3PMSA 1WMXA 3WQ1A 2VQTA 1RUJ2 2Y8KA 4AFCA 3ZKUA 4CXWA 1S0DA 1VALA 4R8HA 3S57A 3CZUA 1UO9A 2E7AA 4DY5A 4QAWA 3AKPA 2JG9C 3BIWE 4B1MA 1KXGA 1BHGA 1Q8QA 2VQAA 1BQPA 5FMDA 4CP2A 3BTYA 3R4SA 4KGGA 1LOAA 4BPZA 5C4WA 4XF0A 2QNKA 1GZWB 1PHMA 1VE0A 3ZXGA 1SLCA 2DTWA 4PF5A 2W39A 3T08A 2D97A 1O4TA 1UAIA 3THCA 2BWCA 3H1WA 4NIDA 5CFDC 4ASMB 5ANNA 5EV7A 3ZSKA 3PURA 5LEKA 1UWWA 2R063 1NCQA 1UY0A 4QPGA 5L7OC 3VHRA 1ZREA 4NPRA 2NLRA 1AXYA 4NAMA 4YW6A 2PHDA 4ZHNA 5BNPA 1QH6A 1XPWA 2HLEA 2QZ3A 3MIBA 4XCBA 4IEYA 4D7YA 4EZ4A 5IVCA 1SCRA 2PMWB 4YW3A 4GB31 4YFZA 4IEZA 4Y22B 5D8AC 1DG6A 5E6HA 2QQVA 4QKFA 4FAHA 1LTEA 2FDKA 3WNNA 5FZKA 1JXNA 1LESA 3NW4A 4FPYA 2R16A 4AXOA 3RMXA 5BNOB 5LCWL 1RGSA 2R062 5FBZA 3J8F1 5JMOA 3HEIA 1NYWA 3KD4A 4KU8A 3OY8A 5GZDA 1MVQA 4QPWA 4E27A 2ZX0A 4MGTA 2DFBA 2X8KA 1OOPB 4AFDA 4W4ZA 4YVWB 1JOPA 4BIOA 5FYUA 1SEFA 3AKSA 4QX3A 1BYHA 1GANA 1LOFA 1OQDA 2AUYA 3KGZA 2OXBA 3M7AA 4LR4A 3T2OA 1N3OA 2ZX2A 5IVJA 4TZDA 5FMOS 1BMV1 3POBA 1OSGA 5H9QA 2RJ2A 4IGQA 2JD9A 3O1VA 4YGDA 2HYXA 5A3WA 1D0HA 2W47A 1W6OA 1LGCA 3EQEA 2BJSA 2IZWA 3NV3A 1QJEA 3TBDA 4F8AA 4AL9A 3LEIA 2DVDA 2E26A 2D5FA 3AP7A 3OF1A 3T30A 2FDGA 4I0AA 4AEDB 3N7JA 2F4LA 5KHKA 4QGNA 1X8MA 4AI1A 1V00A 5FYBA 5JIAA 4ES8A 4YM0A 4MGYE 1I6XA 4MSVA 2Q1FA 3CL1A 5A1LA 2ZHNA 4H3WA 1NA1C 1US3A 4OCTA 4CDQC 1H6XA 5A7QA 3ENRA 4KWKA 1IG3A 3NAPB 3OGVA 4XVHA 2W1WA 4LBOA 1MQTC 2ZPXA 4QKNA 1S0JA 1S2BA 3J7HA 2I2SA 3N9LA 5E88A 3ZSLA 2VTXA 2VUJA 4AOCA 1PNGA 1QJX3 1IS6A 3I2OA 2E33A 1UYPA 2Q1ZB 4FO9A 2XJRA 1O3SA 4JCKA 2DF7A 3GGLA 5ANQA 1G7YA 5EZWA 4AQSA 2ZMNA 3PJYA 1ZZ9A 3ZYIB 5IK7A 4YLZA 2D6OX 1W6NA 2VO5A 4HPKB 3ZSJA 1YJLA 3OEAA 1OLME 3RI9A 3VBUC 1PGL1 5KXEA 2W2IA 1Y7BA 1QJX2 4YYOA 4LLOA 5T5PA 2XUEA 3K77A 1YUDA 2VOKA 3I3QA 3VHNA 1MS8A 1UKRA 3MPPG 2XJUA 1SLLA 2P6HA 3W58A 4HSJA 1AR61 3B9CA 3WDTA 4KBZA 1RUD3 4XFIA 1RHI3 2ZAAA 5JR7B 4BQ5A 1OVSA 2ENRA 2BVVA 1GKBA 2VXJA 1H9WA 3MDPA 4YZ5A 2IUWA 1ZRCA 4NPLA 3I8TA 1CAUB 3UL2A 4JRLA 4LJHA 2PAKA 3LAGA 2RS11 1XNDA 4GALA 3N7LA 4KU7A 1WA6X 3VDDC 1MS3A 4IV3A 4YPJA 3O14A 4QPYA 4XFBA 2Q8OA 4FXKB 4GWMA 4XFGA 1RUD2 1RHI2 3NWKA 1QWRA 2HWE1 3SQOA 4ASLA 5DAQA 2R30A 4G3YC 5E16A 5JPNB 5IK5A 3CJXA 3FZ3A 2DUOA 3KS7A 5J3UA 5FMOL 1AL23 4OYUA 2ES3A 5JAXA 5CA6A 2A75A 1HIXA 4QPIB 2ATFA 2EALA 4XFAA 3LOIA 3SH4A 5EJZB 1OVPA 2NMNA 3C7EA 2YBPA 2VVEA 4W8JA 3C3VA 5GLTA 4D7SA 5F37A 3GZAA 3DUIA 2VOTA 5FOBB 1NY71 4JGZC 3U11A 1DYKA 3K4ZA 1AL22 1ST8A 2CAVA 4GMP3 5DABA 2FZ2A 2ET7A 4CCNA 4DS0A 1H2LA 1NG0A 1SLTA 4CCKA 1ENSA 4ARXA 2VH9A 2YUEA 1J1TA 3GXUA 3RG0A 5DG1A 3SH5A 3VBRA 2WS93 3DKQA 1KQRA 2XJTA 3ILRA 2XR4A 3BI3A 3B00A 4Z8BA 2QQIA 4CP1A 4Z2WA 4Z2AA 4QXCA 3IAPA 3FLPA
chains in the Genus database with same CATH topology
1GQHA 4WM7B 1ND2A 1Y43B 4K3UA 1H9PA 1ZRRA 1G9DA 2XJPA 2WIIB 1HW5A 2WS92 1B35C 4MX3A 1LGNA 2ZCWA 4RR3C 5GLWA 3AFGA 2RR13 3MIDA 3VKOA 3QLQA 2G4IA 3E97A 3ZFFC 3AZZA 2QDNA 4CTEA 1C3HA 1CAWA 2XHKA 2F6BA 2ZGOA 1QY4A 2VY0A 2KXLA 3ZXEA 2RR12 1DZQA 4CDWB 4DRVA 1AXKA 4XBLA 5KXBA 1TE1B 1KDKA 2XB6C 3R05A 3FFZA 5F9TA 1W2UA 2PA7A 3J4UH 4YZ1A 4GIQA 1EYBA 3N36A 2R043 4N7UA 1FXZA 4GH4A 4K20A 1LB2A 1Q8VA 2VNGA 4IEVA 2FZ1A 4U36A 1V6IA 3ZXJA 4C0BA 4AFAA 4QQLA 1WLDA 1TQ5A 1COV1 2DTYA 3CF6E 4YVSB 3BODA 2TNFA 2NN8A 2R042 2Y0OA 3OCPA 4X6RB 3N35A 1CESA 4MGIE 2A6XA 1QKQA 3JQWA 3OYWA 3ZPYA 2W68A 4K8FA 4D69A 4QGLA 2DYCA 4X6QB 1WD3A 3WUCA 4AVVA 4N90A 3HWJA 1DQ1A 4PLOA 5I0TA 3ZFEC 2LALA 3NVCA 1U12A 2GMPA 2ZGLA 3RDIA 2A71A 1JUHA 3ILNA 3V0AB 1KS4A 1UIJA 2PFWA 5K0UC 4N53C 2G9FA 4XHBA 4AHXA 1C28A 2GN3A 2JXAA 2XL9A 4OULA 1PZ8A 1KDMA 4P9WA 3J8F3 4BQ1A 4Y26A 1GZWA 1IQAA 4NHMA 3WHUA 5CG9A 1FNZA 4B4PA 4EN7B 4GB32 4CDXB 1EAH1 1ZZ8A 4IXLA 4Z82A 3I7DA 2IXLA 4M0HA 3KT1A 4RHV1 1PMIA 4DOUA 1ALYA 1CVNA 4UW6A 4IEOA 3MF6A 4N43C 3RS6A 4LBMA 4AVBA 3J8F2 3VKMA 4Y22A 4IEPA 4XBQA 3ROUA 4E2SA 3UKTA 1XNBA 4KWJA 4Q0VA 1SBFA 4FPCA 2WA4A 1J59A 5BNOA 3WUDA 1GNHA 2VVFA 4DRRA 2R6QA 4L99A 1VP6A 3ES1A 1URXA 2VOXA 2VVDA 1OOPA 1BMV2 3RSJA 2WFF3 2H0VA 4S2DA 4YVWC 4CEYA 4AW7A 1PGW1 2Z2SB 1A3KA 2ZX1A 2QDRA 3NJZA 1ULFA 2OUHA 2IFRA 3MPBA 3HAGA 2WNUB 1LENA 1QHDA 1WMDA 4OHYA 4EROA 4A3XA 5J96B 1FV3A 1O5UA 2WFF2 1SCSA 1AX2A 2OZJA 1DU3D 4HN1A 3H3ZA 4AEDC 1DFQA 1V9U3 1W39A 3BCWA 5JWPA 4L97A 3NAPA 4K7JA 4Q4X3 4YGCA 1JUIA 1ZM1A 1HXS1 3LWCA 1QOOA 1X8EA 3TRSB 3VBFC 4MLOA 4U2AA 4W6XA 2RS13 3WXPA 2A6WA 5C4WB 1T6GC 3FUOA 5I8YA 3ZXLA 1BJQA 1O5LA 1ULDA 4TLFA 1CR7A 2PHRA 3FUQA 2HEYF 4Q4X2 3SH3A 2GDFA 1Z78A 3B94A 2BEOA 3S30A 1O3QA 3M3OA 2D5HA 4QPGB 3MLKA 2HWE3 2HWF1 4CZSA 4KG8A 2AREA 4LUMA 2GSYA 2I74A 5I0RA 3WT3A 5BNPB 5AC91 2ARBA 2RS12 3H9AA 3AKTA 3IN9A 1TEIA 4P9YA 5FO7B 4I09A 1CAUA 1KD7A 5ABJC 4MVTA 2HWE2 1DHKB 3OY8B 1V6MA 4KH9A 1YCIA 2XPJA 1HV0A 5GJ6A 4GMP0 1POV1 3TB0A 4GXLA 3WHTA 4COVA 4YW1A 2JENA 3OTFA 1QJZA 5SV5A 4B8EA 4DNYA 1X36A 3ST7A 3T2TA 4XJ9A 3QBQA 4AGVA 1ZNPA 1IPKA 3FHIB 4OHWA 3KT7A 1NY72 1W6OB 5J7MA 2ZGPA 1MR5A 4HN0A 4LE4A 4ONUA 4UBGA 2P37A 2ZGKA 2WLQA 4XXPA 4QPIC 4Y24A 2D44A 1C5IA 2QJVA 3RYPA 5HXVA 2P3KA 4DINB 2UYBA 5DZFA 3USSA 4JGYC 4NWVA 2Q0AA 1OI6A 3ZVXA 1WMEA 1NXD1 1QJU1 3WINE 3R6SA 2DVBA 1MACA 2LM3A 2BTVC 1GZ9A 1AR81 3JD71 1C8NA 1F31A 3NV1A 4E2GA 2D7FA 2AR6A 5B2GB 5IK8A 4WM7A 5DUWA 1AZDA 2W0XA 5JLVA 1N1TA 5EFUA 1MZ6A 4YSFA 2XWJB 5H9RA 4Y20B 4BYYA 1Q43A 1REFA 1H8TB 1UW8A 2BBVA 2HEWF 3VL8A 3E6CC 3GNEA 3RMYA 2ERFA 4E9KA 5CIRA 4PBPA 3KB5A 1NCRC 3MW2A 4PLNA 4XTMA 4JTNA 2IFWA 3H8UA 3WG2A 2PHXA 2NYYA 1COV3 3NSTA 4K1YA 3X29B 4X8PA 4CDWA 1LOBA 5H9SA 3WQ0A 3KCCA 5LK7B 4Y1ZA 1VJ2A 4FPEA 3BB6A 1OPOA 2VPVA 3H3UA 4MGKE 1H2KA 4WVVA 4ES9A 4I0WB 4ZU7A 1COV2 1BBT1 4DFSA 2N7GA 5CFCA 4HK9A 3MIFA 4UW5A 5HCAA 4EJRA 2ET1A 1X82A 2ZGRA 1N1YA 3UV9A 2PN5A 3KCYA 1EPZA 4CDUA 1LHNA 3JBG1 3WR0A 3B7MA 1R081 1KFXL 2B8MA 3AZVA 5DDJ1 1YWKA 4YVSC 2ZX3A 4FT8A 4Y1UA 1UX6A 3U07A 2FMDA 1EAH3 3VBRB 3ZN4A 3H50A 5CAZA 4R4ZA 4RHV3 1V6NA 4PBOA 1ULGA 1GICA 3V0AA 2A6ZA 3WDVA 1ENQA 2HWD3 1CAXB 2Y0IA 2DWRA 2P17A 2D6MA 1RUOA 1ND2B 4LULA 1LULA 4RL7A 1EP0A 3IT8A 1D0GA 2WT2A 5DZEA 3VKNA 1DLLA 1EAH2 4HZFA 3M1HA 4RHV2 3WW3A 3WD5A 4YGBA 4JDMA 5JCTA 4OI1A 2VG9A 1VBD1 2D3PA 5C9AB 4CDXA 2KA3A 2C1FA 4L8QA 4PDWC 2VMGA 4MV2A 2ZABA 3GHMA 4P9LA 2EAKA 2AZ5A 2EF6A 4OZXA 4EN0A 2DVFA 5KBFA 2CGNA 2ZZQA 5T3NA 2NP0A 1CJDA 2DCKA 1V70A 5T52A 4J1WA 3VBHB 4IL7A 5FLIA 1LODA 4LBKA 5ACA1 1K5MC 4W65A 5FPZA 2EXIA 3GF6A 1O4ZA 3DKWA 4INDA 4NOTA 1OA4A 2QFEA 3ZFGA 4P5HA 1ASJ1 1PGW2 2A5ZA 2EVXA 4FTBA 1C4RA 4GH4B 4XJUA 3WY6A 3WDWA 3ZYJB 2XGXA 2ZGNA 4XYXA 4G4FA 4QMAA 1HXS3 4R9AA 4AVSA 2XKOA 1VAMA 4Q0PA 4FOWA 1UKGA 2ZMKA 5GLUA 3CJIC 2WNUA 1AL0G 1WW4A 2QUOA 2R32A 1U5IA 1RIRA 4YW4A 4Q1RA 2CNAA 3HT1A 1HLCA 2R041 2Y26A 1HXS2 3FX3A 1BXHA 3MF9A 4EWEA 3PVOA 5JSOA 3QACA 2G9GA 2UWBA 5AC93 1HKDA 2BW8A 4JV4A 1DGRA 3WG3A 4TSVA 2DURA 1U5YA 1RMU1 2CWSA 5GZCA 3M4FA 3RQ0A 4ORFA 4HANA 1PO21 1VB4A 2HWF2 1LOEA 3TN93 5FLHA 3UJOA 4YM1A 2D98A 4XOGA 4AEKA 2BPA2 4NN0A 5C4WC 5AC92 1WW7A 1POV3 4XF9A 1PK6B 1YXWA 1NZCA 4R52A 4IEWA 4HT1T 3QH6A 4LO8A 4Q8KA 2WNVB 4AWDA 4ISQA 5J09A 2R1BA 4XF1A 1NCQC 1G9FA 1WCKA 4ITCA 3TN92 1UZYA 3SCFA 1C8M1 2C9AA 5BXXA 3W9AA 4B29A 5BNPC 2WJSA 3CLPA 5JMCA 3RPQA 1XYNA 5L7OA 2CWMA 1O3TA 3LA7A 4Y5Z0 1AYN1 2WT1A 3AP9A 4EN9B 3RJ2X 4XDQA 4XIKA 2GNMA 3MICA 3B5LB 1QJU3 4YZ2A 1ZZCA 4CEYB 4ATFA 1H30A 1JOJA 3ZYPA 1AR83 3JD73 4RS5A 1GYKA 4E2QA 1LOFC 3D8CA 1OD5A 4C90A 1E57A 4RD7A 3W59A 1QDCA 3O12A 3D0JA 1QJU2 3AM2A 1UN1A 4RGAA 1AR82 4WM8B 2CTVA 1BCXA 3JD72 3TNQA 1A78A 1GFF2 2WFF1 4P9IA 2B46X 3ZIXA 1XQNA 4QGMA 2OA2A 3IM0A 2I45A 2CYFA 1NE6A 3E5QA 4OI0A 1LCLA 3WLUA 1HV1A 3P3NA 3IPVB 1WW6A 1MS5A 1JBCA 2XVKA 2A6VA 5L73A 4HVRA 4Y20A 3T1MA 1OHFA 1FMD1 3ZXDA 4FBFA 2ZACA 1V9U1 2ZHMA 2GC1A 2PHTA 1MZEA 4HKWA 1H8TA 3WCSA 4E4DX 1BBT3 4Q4X1 2ZHKA 3AJYA 4XFCA 5I93A 1WBLA 2B5HA 4QXKA 3PVBB 2V73A 4I02A 1RC6A 1GZCA 3VBUA 1I5ZA 2TUNA 2IXJA 1IOAA 2PTMA 1V6JA 1AX0A 2HYKA 2VOWA 4QQHA 4AVTA 3ECQA 3JBG3 1S0CA 1R083 1BBT2 2YDEA 5DDJ3 2WQZC 3N7MA 3HD8B 4IV3C 3PNAA 5IT6A 2E63A 3D4KA 5EYYA 2OYZA 1RB8G 3JBG2 1H2MA 4LA3A 1KITA 1R082 4RGGA 3SITA 2F4PA 1ZX5A 5DDJ2 5A33A 4L9BA 5BNNB 3KLSA 3IMNA 4AQTA 4XQWA 5CG8A 1ZBA1 1VBE1 4WZFA 2GN7A 3TWIA 1ZRDA 5FAXA 2GC0A 2JECA 5SV8A 3USUB 2EA7A 1IZ3A 3R4DB 2WSUA 4XEZA 4AFBA 2WSVA 2SLIA 4YW2A 2CY6A 1VBD3 2FBEA 2XLGA 4EN6B 4K9SA 1ZZ6A 1HDKA 1OLQA 5JOWA 4Y1VA 4ZKTB 3VBRC 1CAXA 3VBSB 4QQ2A 1RUI1 4JRAA 1XYOA 5JPMB 5CBLA 3S7EA 3V0BA 3C2UA 4COYA 4FPOB 4GWNA 1RUNA 4L11A 1VBD2 5ACA3 1ND2C 2QKDA 1RVF1 4XMAA 4YG0A 4RQPC 4ZU5A 4AK3A 1CGPA 2VW1A 1AF9A 4L92A 1NLRA 1ASJ3 4FPKA 1IHMA 1RUC1 4B7KA 3HMYA 3JB8A 2GAUA 5C9AA 2Q30A 3IKWA 3PJQA 1RITA 4NHKA 3MFAA 5ACA2 3RZZA 2R0HA 1Q5OA 4Q27A 4RR3A 4F7ZA 3LSDA 5K8SA 4QM8A 1DQ0A 1ASJ2 1G9CA 1O3RA 3VBHA 2GH2A 2D93A 4FQ4A 3B02A 3AKRA 3ZFFA 2ZZJA 4LE3A 1IGOA 3OJBA 4M3CA 3BU7A 3B01A 5CFCB 3TOJA 4M01A 1G8WA 3VHPA 1MEC1 3WDUA 5C8WA 3AB0A 5KC5A 4GH4C 3RWNA 3MIHA 3E5UA 1RMU3 4ISRA 4CDUB 3VHOA 2ZX4A 5T5OA 5FO9B 1REEA 4R9CA 2RHPA 5DZGA 1PO23 5IUQA 5EYXA 1OKQA 1Q8SA 3TYJA 2WWSA 4OI2A 1QOSA 4PLMA 1S0FA 2UY9A 3I54A 4UXAA 1ENRA 4RA0A 4EN8B 3S7IA 1POV0 1RMU2 1H4HA 2D40A 3ELNA 1J58A 5BYNA 4MUVA 1MS1A 3FJSA 3M3IA 1PO22 4TYSA 4PJYA 1C8M3 3JU9A 4JTOA 1LHWA 4CEWA 2ZGSA 3WCRA 3EBRA 1S0GA 4AF9A 4GULA 2ZGUA 3T1LA 3R4UA 1J3QA 1UU6A 1AYN3 5T54A 4AI8A 3SNMA 2DFCA 1PK6A 4N53A 1N3QA 1C8M2 1Z7S3 2A3WA 2ETEA 5KHIA 5A32B 3D82A 1U5XA 2WNVA 3FLRA 5FTTC 2HWD1 4WZCA 3ZSMA 1S0IA 1WCSA 4LO6B 1AYN2 3POSA 4FOQA 4J1XA 1OPMA 1VBB1 1Z7S2 4IETA 3OBTA 5JOYA 1AVBA 3ZFGB 5FLJA 3IBMA 5BNOC 3I2DA 3U4XA 4IESA 5LRRA 2FQPA 4N7IA 1D2SA 4LO7A 4XFHA 2DU0A 3MIGA 1OOPC 3OPZA 4MGZE 3EXUA 1UU5A 2C0ZA 3I4IA 3EJKA 3H0OA 3G7DA 1UZZA 1XNCA 1A8MA 1C1LA 2PLV1 2D3SA 2ZBJA 4Q8LA 3FLTA 3DN7A 1PO11 1MS9A 4Q29A 1UF2C 1U5ZA 4URTA 1NOVA 4XHXA 1L3JA 2X5IB 4M3CE 1FMD3 3ATGA 4WM8A 1DGLA 2QVSB 2UURA 4KWLA 3GBGA 1KJRA 3P3PA 1WLTA 2YPJA 5FFOC 1WGPA 5C33A 2WFPA 3WW4A 5LK5A 3IDEA 3ZXAC 2VGDA 3NAPC 4Q0QA 3NKTA 3VZOA 1O7FA 1TNRA 2XLFA 4Q4V1 4I01A 1H1IA 4AI0A 2PHLA 1XRUA 1FMD2 3DGTA 1V9U2 4Z1VA 3IPVA 4WVZA 3ZN6B 5FOJB 5A3MA 1YHFA 2JG9B 1WMFA 3ZDSA 1C5HA 1S1AA 3S0MA 4JAAA 4AHWA 2B45X 1ULCA 5KWRA 1IPJA 1ZBE1 4M3CF 2GMMA 5CFDB 4XJWA 1BZWA 3M3EA 1H4GA 1LHVA 2BFUS 5L7OB 3N4MA 3M2MA 3TN91 1LJ7A 1W6PB 1VBE3 1ZBA3 2WKKA 1Q8OA 3AYAA 4Z92B 2E7QA 2A70A 4YW5A 3VBOA 2V5YA 3IWZA 4XJ8A 2WLPA 4R4XA 4BIFA 2NQYA 4QHBA 3LOBA 2UY8A 4IV1A 2OPKA 3WW2A 1AXZA 2CV6A 4K21A 4RS5B 3TAYA 1OQ1A 1ZBA2 1VBE2 2DCZA 3EHKA 5HCBA 4CRQA 4LLFA 1RUI3 3POYA 2Z5WA 3D5OA 5GLVA 5BNNA 2GC2A 1HRI1 4UW4A 2PHWA 4NWWA 4F83A 1BVVA 5JZGA 1RVF3 1DZTA 1QU0A 1SLAA 2YZ4A 3AMMA 4QD2A 3USUA 3DPRA 1XNKA 1X33A 3GALA 3ME2A 3N3HA 3FC0A 2GNBA 5JI9A 4AHZA 1RUC3 1BKZA 1RUI2 2OVUA 4Q1PA 4BMBA 1JYIA 3LA3A 4HETA 2LTNA 1DYPA 5CU1A 2MHFA 4FCAA 4PIZA 3WDYA 3PVEA 1ZZBA 1CJPA 2JKBA 1NA1B 3BOWA 1RVF2 3VBSA 4PIYA 3VZNA 4HK8A 5KHJA 1CN1A 1IS5A 4NVPA 2GALA 5FREA 1RUC2 4WM7C 5T55A 4AI2A 4FTEA 1AJKA 1LRHA 4OVEA 1ENXA 3VLBB 4GQ7A 3SMHA 3PHMA 3AXEA 4H7MA 3ASIA 4XMIA 1YYNA 4QM9A 5CB7A 2DCTA 4V1PA 1DGRN 1Z0HA 2RJLA 4NO4A 1MEC3 1CQ9A 2AENA 2K9ZA 3VBUB 1QNYA 1DF0A 2BFUL 1QXRA 3WG4A 1VBA1 2IXCA 2MEV1 2P3JA 1WA4A 4ZXKA 5DG2A 1UIKA 2H6BA 3VZKA 1CAVB 4FPJA 4YRDA 1DQ4A 3ETQA 4JVAA 2XJQA 3MW4A 4CDWC 1MEC2 4BZ4A 3J26N 1F9KA 1VIWB 1RTVA 3VZMA 2JG8A 5J37A 5CADA 3FBMA 2R1DA 1IS3A 1DGWX 1CONA 1HQWA 4I30A 3VDDB 3VUOA 3QOPA 5DXDA 2VQ0A 3H7YA 4FOVA 3B69A 4XILA 5CFCC 3ACLA 5A33B 4DZGA 2XJSA 5JVVA 2FMYA 5FQ0A 5C8CA 4Q2FA 4J6GA 2P2KA 2EAAA 2IXKA 4CDUC 2E9QA 1FOD1 1RUF1 1FAYA 1I9RA 3B3QE 3WZ1A 5D1IA 1GQGA 3MW3A 2JDZA 1OFNA 3NKGA 3QD6A 4Q4Y1 4HL0A 4DPNA 2PHUA 1S2KA 4UBHA 2PAMA 1Y9QA 1QXPA 4R9BA 1QMJA 2BGCA 4DQAA 1ND3A 3MGUA 4BHPA 3V0BB 3FWEA 4NHLA 2ZGTA 1V6KA 4HKOA 4LT5A 2B9UA 1FPN1 1VBB3 2TEPA 5F1RA 3E6BA 1JYCA 5EXOA 5CVRA 2OIIA 2HWD2 1RUG3 1X7NA 2ZMLA 1H1AA 3MFCA 4CP0A 3QH7A 1BK1A 5A32A 5FPXA 5T5LA 4META 4CDXC 4K1ZA 1UL9A 1B35B 1YFWA 1VBB2 3CNAA 3DV8A 4RR3B 1WD4A 1VAVA 2FHRA 1SFNA 1RUG2 2WZR1 1IKQA 2PLV3 3LB9A 1YJKA 1VB2A 5LRSA 3O7OA 2X53S 1YFUA 2GC3A 1PO13 2QCSB 3ZFFB 3OD4A 2UWAA 3MLLA 1CPNA 1LHUA 4M3CB 3U10A 5I8SA 3FMGA 3CEWA 4I3PA 2DCYA 4WVWA 1K5MA 1NQJA 2PLV2 3HBZA 3WP4A 4BCUA 1B09A 1EV11 4L2NA 2P34A 1PO12 4DY3A 2I07B 4Q4V3 3ZN5A 4COWA 4AYUA 4KGQA 1D4M1 1QXJA 1LU1A 2XG3A 1WUVA 4A7KA 1RUE1 2OZ6A 4WV8A 5E1RA 2NM1A 2BNNA 3H1MA 4IERA 1AYM3 1CPMA 1JH5A 2WNUC 2X5IA 2RJKA 2XBO3 1OQEA 2Q4SA 2YY1A 4FPGA 4LBJA 4MZUA 4XE9A 4Q4V2 3AZWA 2BWAA 4JDNA 3PTYA 1IKPA 1ZBE3 2CAUA 1H8VA 2QE3A 4CEWB 1TME1 2XBO2 1RUH1 3VGIA 4B7EA 3ZFEB 3KQRA 4FTSA 3AP4A 2RS31 4YFWA 4XFFA 3ZN6A 2OUJA 5AFEA 1ONAA 2H6CA 2WA3A 2KM2A 5K0UB 1ZYBA 1ZBE2 1FNYA 4N53B 3VN4A 2JG9A 3AP6A 4D94A 3CU7A 4QPGC 3AFKA 5L19A 4A2UA 3OGGA 2JD4A 2E53A 4AEJA 2CGOA 4AGGA 5CFDA 2Z69A 5TSWA 3MLJA 1HX6A 1R091 1DBNA 1HRI3 4HVQA 1W6PA 5H9PA 4N43B 2WL1A 4H14A 4YZ3A 5D8AA 4WVMB 4TWTA 4H55A 1OLRA 1Z7S1 1PGSA 1GSLA 3AX4A 4XJAA 2GU9A 2ZA9A 3O0XA 1KRIA 4OHXA 1HRI2 3MEPA 3VZJA 2AGSA 5JOZA 2XL7A 2DV9A 1H1MA 3M8LA 4FPFA 4UW3A 4XQDA 3UJQA 4S2HA 4RS5C 5F5QA 3SXWA 2H0BA 1NQDA 2WQ4A 3NV4A 5KC6A 4C91A 1XYPA 1GR3A 3GZUC 1LEMA 1GBGA 1H0BA 4XQ4A 2HEVF 1YRZA 1JHNA 1DQ6A 3QCWA 1MZFA 4OLLA 4QT6A 4O9GA 5JSRA 1DQ5A 4XPVA 4C0HA 4K40A 2R071 1TNFA 1NA1A 4CDQA 3HT2A 1VBA3 3R0RA 3WP6A 2MEV3 3I59B 3INAA 1HQNA 1HRV3 1I3HA 2CL2A 1PVC1 3RYKA 3GBWA 2ZKLA 1MQTA 5KHGA 3BPZA 3M3CA 1BEV1 1AJOA 1V6OA 3EO6A 2XLAA 5GZFA 2XH6A 3HN1A 3VBFB 3G6JB 4EWDA 3NL1A 1FX5A 1QH7A 1VBA2 2MEV2 1DGWA 1GNZA 1F2NA 2ZOEB 1F8VA 4IQPA 1HRV2 1X50A 3SLIA 5BV6A 1H8TC 4B4RA 2A3YA 3KGLA 1R1A1 3LGRA 1WCDJ 3ZSEA 4FSJA 3MIEA 1AUYA 3ZIWA 3DL3A 3JUUA 4LBQD 1QJY1 1CAVA 3VBOB 3B93A 3H1YA 2XVGA 1FOD3 1LHOA 5HI0A 1RUF3 2PYTA 1QF3A 4B3NA 4IV1B 2JJ6A 1QQP3 4XZPA 4AFMA 5ABJB 4AG4A 4Q4Y3 3ZO0B 4JDOA 3VDDA 1SLBA 1YNAA 3URFA 2TBVA 2WINB 4AVCA 4Q4W1 5A3LA 2QQPA 4SBVA 2B39A 1G86A 5GZGA 2VXRA 1SLIA 4LEJA 1H2NA 1FOD2 4OHVA 4HVOA 1OFSA 4W6WA 1RUF2 4A7ZA 2AH2A 1VRH1 1QQP2 4JQRA 2D6KA 1UPSA 3DF0A 5JZGB 3N7KA 4IEUA 1FPN3 4Q4Y2 4P14A 1NLSA 3DPRB 3K51A 1YI7A 4DB5A 2RMU1 1VBC1 1YIPA 4RSUA 4S2GA 4K6BA 5T5JA 2IC1A 1PIV1 2MNGA 1ZA4A 4B4QA 3THTA 4JGZA 4Q26A 3WW1A 4AQ6A 4M00A 3FFQA 1FPN2 1G6NA 3MI8A 4JGYB 3SCGA 3ZXKA 2BVBA 1N1VA 3UK9A 2VMHA 2ZHLA 1MZ5A 2WZR3 3AMQA 3KMHA 3LCPA 2ZTNA 3JB4C 4IEQA 3VL9A 4KBBA 3KCXA 3JCIA 3WV6A 4BH9A 2D6LX 1S0EA 3Q9OA 1RL3A 5EJ3A 2A73B 1V6LA 2VECA 2RM21 2ZGQA 1SACA 4YM2A 4RFT0 1AR73 1Q8PA 3L2HA 3AK0A 4HBNA 2WZR2 4S2FA 5C9AC 2AYHA 3APBA 1B35A 2O8QA 4RQPA 1EV13 1PZ9A 1OMIA 1SQ4A 4LNVA 4AHYA 2GNDA 3KSCA 4PCRA 2QZ2A 1N1SA 1D4M3 4MXWA 4Y4YA 1RUE3 3FE5A 3L9JT 3M70A 1NCRB 2YGMA 1AR72 1DIWA 4XTPA 3VBHC 2ILMA 3O5SA 2BNOA 3ALQA 4AE2A 1LOGA 2JG8B 1EV12 3PMEA 1WLCA 1W6MB 4X8NA 1VAKA 4HMZA 1D4M2 4P9XA 4E4SA 1FT9A 4LBNA 1RUE2 2VNRA 4Q0SA 2MPFA 3TNPB 2E7TA 3LA2A 1YLLA 5BPXA 1J3RA 5FQ0B 1TME3 5C8CB 1RUH3 2VNOA 3THPA 2B42B 2SBAA 1BVP1 4FAGA 2RS33 4AGRA 1YIFA 4Q0UA 1JTZX 1MS4A 2HWB1 2Q1MA 2EXKA 2R0FA 3S6PA 3ZX7A 3NV2A 3AZYA 1AR91 1WBFA 5GZEA 1TME2 2NPIA 1KJLA 1RUH2 3AYEA 5GKAC 2O0OA 2UU8A 5J36A 4HFSA 1I1EA 1ND3B 1XU1A 2RS32 3RRDA 2E51A 3SHRA 2VOVA 4P9JA 3AYCA 1R093 5JSPA 3D6EA 2BYVE 3ZFEA 2RE9A 4EWAA 4CEWC 4BLJA 2XKPA 2Z79A 4SLIA 4A7YA 1TMF1 2IXIA 1U0AA 1LECA 1SMVA 2JICA 5JIUA 5K0UA 2DUPA 2A3XA 2XUMA 1S0BA 2K0GA 4BLIA 2W52A 1QOTA 4GB33 4N9HA 3ZYRA 3JQXA 1PK6C 1R092 1XE8A 2ZKNA 3O0VA 5GM0A 2V09A 1S55A 2VULA 2Z42A 3AZXA 3MYXA 2WNVC 3AXDA 1AX1A 2ZGMA 1Q3EA 1NE4A 3AMHA 1W6QB 4XETA 1SBDA 4PDWB 3E5XA 1YO8A 5JDBA 4OHZA 1SFYA 5DUVA 3SCHA 4N43A 1RUG1 4LTAA 4F3JA 5FDBA 5I0SA 4WVMA 4XIOA 1G9BA 4XXAA 5AVPA 2BQPA 5FO8B 3L2YA 5I91A 1K5MB 2YROA 3WNXA 1EY2A 1YI9A 4AQ2A 2XWBB