3AMMA

Cellotetraose complex of cellulase 12a from thermotoga maritima
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
255
structure length
255
Chain Sequence
MVLMTKPGTSDFVWNGIPLSMELNLWNIKEYSGSVAMKFDGEKITFDADIQNLSPKEPERYVLGYPEFYYGYKPWENHTAEGSKLPVPVSSMKSFSVEVSFDIHHEPSLPLNFAMETWLTREKYQTEASIGDVEIMVWFYFNNLTPGGEKIEEFTIPFVLNGESVEGTWELWLAEWGWDYLAFRLKDPVKKGRVKFDVRHFLDAAGKALSSSARVKDFEDLYFTVWEIGTEFGSPETKSAQFGWKFENFSIDLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-glucanase
publication title Crystal structure and substrate-binding mode of cellulase 12A from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
total genus 59
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ammA00
2VUJA 1H1AA 3AMPA 4S2HA 2BW8A 1C5HA 1KS5A 2DFBA 2F6BA 3MFAA 3AMMA 1XNBA 3M4FA 4NPRA 3MFCA 4XQWA 1XYPA 3WP3A 4H7MA 3RI8A 3B5LB 1REDA 2BWCA 1BVVA 3EXUA 4XPVA 1TE1B 5EJ3A 3AKPA 1H4GA 1XNDA 4XQ4A 2BVVA 3AKRA 3LB9A 2C1FA 4HK9A 5K7PA 1OA4A 2VULA 1YNAA 1KS4A 2QZ2A 1REEA 3AKTA 3VZLA 2DFCA 1REFA 1C5IA 3VZKA 3VHOA 2DCKA 2VGDA 4S2DA 2DCZA 3RI9A 3WQ7A 2JICA 3VHNA 5K9YA 1XYOA 3WQ0A 2D97A 3WXPA 2B42B 1HIXA 1H4HA 3MF9A 1HV1A 3VL9A 3VZJA 1BK1A 3HD8B 1ENXA 3WT3A 3WX5A 1XNKA 1T6GC 4HKLA 3AKSA 3VZNA 2NLRA 3O7OA 3VZMA 2B46X 4S2GA 3VL8A 1H0BA 3AKQA 3ZSEA 2VG9A 1H8VA 1NLRA 3WQ1A 2JENA 5HXVA 3AMNA 1XXNA 2JEMA 2D98A 3MF6A 2DCJA 3AMHA 3VLBB 2Z79A 2NQYA 2QZ3A 1BCXA 1OLRA 2BWAA 4XQDA 1QH7A 4HK8A 2B45X 2DCYA 3VGIA 3VZOA 4HKWA 3VHPA 1AXKA 3WP6A 1XNCA 1UU4A 1OA3A 1UU5A 3AMQA 3LGRA 1OLQA 1XYNA 3WY6A 1M4WA 1QH6A 4S2FA 1UKRA 1IGOA 3WR0A 1W2UA 1UU6A 3B7MA 1HV0A 3WP4A 3WP5A 1OA2A 4HKOA 1PVXA 4IXLA 1F5JA
chains in the Genus database with same CATH superfamily
1RUJ1 2G4IA 2XOMA 5E16A 2ZBJA 3SXWA 4DXZA 4QMAA 4KBZA 2PQQA 4DPNA 3PTRB 1NCQB 3HVDA 1OPOA 4X8NA 3H8UA 4A6OA 3W20A 3O0VA 4META 2YFZA 2PLV2 2X10A 4JGZC 4C1WA 1OVSA 1AR61 2YU2A 1XNAA 5A3OA 5IVJA 2HWF3 3MDPA 4MYEA 3G7DA 3PMSA 2ETEA 3LA7A 3LSDA 4AFAA 4HVOA 3O1UA 3DPRA 5C5UA 1MR5A 1QIQA 1N3QA 5J48A 3CQOA 2WZPP 1W9YA 3W9AA 3RYKA 2EA7A 1UOFA 1S2KA 2XH6A 1I9RA 3VKMA 1ULOA 3WDXA 1AL21 5C8CA 1NQDA 5ERLA 4LHSA 2Z4FA 1W8WA 4P9JA 4QPIC 4LMFA 1RUJ2 5FZOB 5K7PA 1R081 5T55A 3KS7A 3ZSKA 4NAOA 3KCXA 3PNAA 3I59B 4AHZA 4AGVA 3MLKA 4FSJA 3NJZA 2AYHA 2DCZA 2Y6FA 4IEUA 5CISA 1AR62 2Y33A 4FPEA 4AAXA 5FAXA 1AR81 5GLWA 4DUXA 2JDKA 3W5NA 5JSOA 3MI8A 2XONA 4YGDA 3GNEA 3LEGA 3QH7A 2OUHA 1QQP3 1YFXA 3IBMA 5CYYA 3HT1A 3N7LA 4QX7A 1BK1A 4XF3A 4AEDA 2IXCA 1LOAA 2DYCA 4AEKA 1SMVA 1AL22 3PIGA 5C4WB 1DQ2A 5GALA 4QB2A 1ASJ1 3VV1A 2Q4SA 1RINA 2P1BA 3KT1A 5J98B 1GV9A 1R082 2IXHA 3VZNA 1OQDA 2GMMA 5FY8A 2C26A 4AVVA 1W9TA 4R9BA 3TYJA 4GMP0 1RUH1 1QJX1 5H9SA 3VD3A 4AR2A 4CXYA 1WMDA 4LA3A 4K6BA 4MGIE 5LATA 4PQQA 5HXVA 5LCWL 1AR82 3N9NA 3FMGA 1S4CA 2PXJA 3NV2A 2Y6GA 5FPLA 3WCRA 1WMFA 5C33A 4YM3A 3H3ZA 3J8F1 1FYUA 4P5HA 4UFHA 1HJFA 1OFNA 5BNOC 4HONA 3M2MA 1BCXA 2PAEA 3V56A 4H7LA 1TVGA 3CL1A 2HYXA 3H42B 3ZXEA 4EROA 4WM8A 1W39A 4OHWA 2Q30A 2BBVA 1ASJ2 1FV2A 4HN0A 4NVPA 4QKDA 1U5IA 1UKGA 3ILFA 2OQ7A 2VMGA 3N9MA 1NA1C 5BPXA 5HI0A 1DHKB 5CKQA 3F2ZA 3RGBA 4JQTA 2BRTA 4UXAA 4Y1XA 1YFYA 2ZGSA 3JD73 5FKCA 4S2FA 1VPHA 4NWWA 1RUH2 1IKQA 1QJX2 3H9AA 5H9PA 4B1MA 4NAMA 5GZEA 3WCSA 3A21A 4HETA 5FMOS 2HWC3 1HV0A 1YO8A 1QGLA 1R1A1 3S57A 1ENRA 1W6QB 5DZEA 4AXOA 3J8F2 3WDYA 1VRBA 3A7QA 5CG8A 4BA6A 1AUYA 3SH5A 1BXHA 1OH4A 2XBO3 5AC91 3C7GA 1O4YA 2DVDA 4KBBA 4MGQA 4XXPA 5DDJ3 5FZLA 1ODNA 1OF3A 4AGGA 2RE9A 4R8HA 5A80A 1K45A 1F9KA 4H7MA 2E63A 3GHNA 5BNPA 1DLLA 3OPZA 2W95A 1FATA 3K4ZA 1QKQA 4DUWA 2BUKA 3LAGA 3MW3A 4XFHA 3FHQA 3C7OA 2J1VA 2FZ2A 3MUY1 2OKXA 1JOJA 2QTWB 1XNDA 3GF6A 3E97A 3M3IA 3MV01 4LBQD 4Q0PA 4XQ4A 1W6OB 4ASLA 2ZEYA 5F3CA 4ZHNA 1R1A2 3I59A 5FXZA 2NN8A 3C7FA 3R4DB 5BXXA 1RJ7A 1ZX5A 2ZCWA 4Q29A 5L36A 3VZLA 2BNNA 3N7MA 3POIA 4A45A 2XKOA 4I2OA 4Y4RA 4MX3A 2VTXA 4RL7A 3VZKA 2VBPA 3IDCB 5AC92 1HB3A 4PI0A 3M3EA 2WZR1 5FZFA 3WQ7A 1RUG1 2HLEA 4RFRB 3I2DA 4QDRA 2WNOA 4B8EA 2B4KA 4FO9A 5KBFA 3K3OA 1OBNA 4I09A 5B4XA 1WWYA 1ZBA1 4P9WA 1ZZ6A 1RB8G 1TMF1 3LF7A 2R041 2ZMLA 4OMDA 4FI9A 5C4WA 5IYYA 3IIIA 3K75B 3MF9A 5T3NA 3E6DA 1HB1A 3LA3A 1QJFA 4Y22B 4XXAA 5IVEA 1YJLA 2W47A 1VJ2A 4LIVA 3PUAA 2R1BA 5A3MA 3WX5A 3RMYA 1DFQA 1OOPB 1WW7A 3I8TA 4UT5A 3BTYA 4ASMB 4DNYA 4QXKA 2OVUA 3VDDA 5IATA 3AZVA 2DU1A 2EF6A 3VBUB 1MZEA 4Q0QA 1QNWA 2VMFA 1HN0A 5AFBA 1GP6A 2WKKA 5JAXA 5D1IA 1CJDA 1KQRA 2WZR2 3DGTA 1RUG2 5ABJB 4UW6A 4YW4A 2HWB1 1R093 1TQ5A 4DB5A 1ZBA2 2ES3A 5LZ6A 1TMF2 1HLCA 3I7DA 2R042 5JCTA 1DBNA 2DCJA 4Q4Y1 4AF9A 2VAUA 5LWBA 2ZGTA 3CJIC 4K7JA 2P6HA 1GP5A 4AK3A 1NCRC 3MIFA 3AZZA 4YZ2A 3GJBA 2J42A 2QQJA 4AWDA 4JTOA 1H6XA 4QAWA 2YROA 2WNUA 1B35A 1YIFA 4PDWB 4CSWA 3A4UA 5FMOL 2ILMA 4FP2A 5A3PA 3ZPYA 2YBSA 1STMA 3QOPA 3ZX7A 4B4RA 5LA1A 3RPQA 4F7ZA 3HN3A 1FPN3 1YUDA 5LEJA 1ONAA 1S1AA 2ERFA 3VD9A 4GQ7A 5FBJA 1VALA 1UD1A 3K77A 1FOD3 3OPTA 4HL0A 4Y5TA 5FYCA 5JIAA 1PK6C 4XCBA 2ZGNA 2HWB2 1UWWA 2HWD3 3OYWB 4D6RA 5JMOA 3VB9A 3ZPOA 4JGYB 3AL5A 2IFRA 4BMBA 2DUPA 1W8HA 4Q4Y2 1R1ZA 2EIDA 2DFBA 4Y1UA 5DQ0A 4D7YA 3AMMA 4Q2FA 3H0OA 4QPYA 4E4HA 3NV3A 4GULA 3MPBA 4N43C 2Q5TA 2ORXA 3ILNA 3J7HA 3NV1A 4FCAA 4L2NA 4XQWA 4UW5A 1MQTC 4XYXA 5CFDA 4Y5SA 1VP6A 2VM9A 3DN7A 1DGRA 4Q1PA 4YW7A 4BB3A 2RS33 4Z8BA 4YVSC 4D3WA 1VR3A 3QH6A 5F6KA 3DV8A 1Z7S1 2ZZQA 4QB6A 1JHNA 4XPVA 4A3ZA 2B39A 3NAPB 2QBXA 2R0FA 2Y0OA 1W2AX 4IEPA 4KWKA 1CZVA 4MSVA 5KHHA 5GZGA 3UKNA 3CO2A 3LB9A 1V6KA 4C90A 2CAVA 2MNGA 3AJYA 4HK9A 1O3QA 5DPNA 4IV1B 4BPZA 3HNMA 1JZ2A 1HX6A 1YQ8A 5GM0A 4CDXC 1SLAA 1WLDA 2QZ2A 2OZJA 4GH4A 2V09A 3WW4A 4XVHA 4QPWA 1MZ6A 1REFA 1US2A 3UNPA 5JOWA 4MOAA 4W6XA 1V9U1 2ZAHA 2CDOA 3H1MA 2R7EB 3DEMA 2ZX2A 4Q4X1 5I8SA 2BYVE 1FI2A 3RI9A 4QQOA 4YPJA 2ZGLA 1IS5A 2EIEA 5EJZB 3D6EA 3V0BA 1N3PA 5T5OA 1CIYA 4GWJA 1XJAA 4UF0A 4XDQA 4WVWA 2JDMA 1RUI1 2D6KA 2VVDA 3JD71 2JB8A 4IEOA 1HB4A 5A32B 3APBA 1Z7S2 1LCLA 4DXTA 4MGTA 3GCWA 3ZFGA 4W8JA 2W0XA 2UWAA 4XBNA 2C9KA 2V4AA 2VQAA 4MG2A 1PGSA 1POV3 1UOJA 5F1RA 4OI0A 5DAXA 5FY5A 3ZMNA 4Q5OA 1U5XA 4AI3A 4E8CA 4YRDA 4CCCA 1RXGA 2Q8EA 3UK9A 5I8YA 4S2GA 2W5FA 1F5FA 2XBO1 1W3VA 1V9U2 2FCTA 4PLNA 3WQ1A 4YARA 5FQ0A 1POV0 4Y1VA 4RS5A 2HKXA 4Q4X2 4X8PA 1W8UA 5KWRA 4Q4W3 1W99A 4B29A 1N1VA 1XXNA 3TBDA 2D98A 1C3HA 3FFQA 3ZSLA 3LE0A 1RUI2 1S2EA 3JD72 4LHLA 4OMCA 2BVBA 4KMQA 5A6ZA 2BNOA 2QZ3A 2W87A 4PBPA 2QQIA 4M0NA 4PJYA 4IE0A 1AHSA 2W08A 2XVGA 2QQLA 1PM7A 2GNTA 3HR9A 1KDKA 2VMCA 4NN0A 4XBQA 5FFOC 1DYPA 1SLCA 3VHPA 5FZDA 3E6BA 4MH0E 2NMOA 4LKDA 1CX1A 3AMQA 3ZFEA 5LY2A 2XWJB 4GA9A 3DYPA 2BGOA 2XBO2 5DAVA 4IE4A 1QH6A 3VBRA 5CAZA 3THPA 1QWRA 3D0JA 3UETA 3WW3A 3ZYGA 1UAIA 2WRAA 4XF4A 3NNGA 3ZYFA 1VB4A 1V6LA 2WBKA 4YW2A 1LGBA 1OA2A 2W94A 2GMEA 2HEVF 4C1XA 4D7SA 3TWIA 1PVXA 1JUHA 5F2WA 4UBHA 5FZBA 3WG4A 4QPIB 3OUHA 4AI9A 3VDBA 2W68A 2A6WA 3U07A 2OZ6A 3GALA 1LEMA 1VAVA 5JSRA 2D40A 4LOTA 2RJLA 2Y8KA 2A3XA 3H1WA 2VQ0A 5F5AA 5A7PA 5SV5A 5FY1A 2QQWA 2WABA 5D21A 1XYPA 2QDNA 4QX2A 3ZYRA 2FDFA 1WLTA 2A6XA 1W3XA 3AZWA 3P3NA 1SBFA 1SBDA 5A7WB 3IPVA 4Q4V1 4BQYA 4QM9A 4GZ9A 4BOWA 1PX3A 1ND2C 3HT2A 4CZSA 3B5LB 4I3GA 1JW6A 1REDA 3PIJA 3BKZA 1H9PA 4A42A 2KA3A 5EJ3A 3ZSMA 2IVJA 1FAYA 4D69A 4O7XA 4ZY9A 3N35A 2VCCA 3UGFA 4BHPA 1W6PA 4PF1A 3WSOA 3BIEA 1JYNA 2R063 5JIUA 3ZVXA 1RIRA 1S0EA 1YNAA 1ODMA 2QQVA 3ZXDA 4HANA 2DFCA 2OA2A 4XC9A 1AXZA 2DURA 3POEA 4DXSA 4GJYA 1UYPA 3ZXGA 2WS93 1Q8VA 1JHJA 3M3QA 1ULGA 5BNNC 1HXS3 5C9AB 1UNBA 4YVWB 4AVSA 2BPA2 4NHYA 2TEPA 1F35A 3WD5A 5FYYA 4MZUA 1RVF1 5FMBA 4Q4V2 2BFUS 4NHKA 2JD9A 3U4XA 5LBFA 3BOPA 3ZFFA 3NMBA 1JYIA 2VNOA 3LDKA 4O9EA 3FN9A 3O0WA 4JDMA 1ZZCA 3VBSC 3H8RA 5JVVA 3ENRA 2PLV3 1JYTA 4GIQA 2HWD1 4BQXA 1CONA 3PUIA 1RUE1 1PVC1 3WT3A 3WUCA 2P5BA 5A3NA 2VZSA 3ABZA 4JKKA 5FJHA 4C8DA 3LQCA 1Q3EA 4AI2A 2DCTA 1QJY1 5A6XA 2JE7A 4NIDA 2R30A 1LOFC 4QPGA 2B46X 3RWNA 4G4FA 2J1AA 1CN1A 3PURA 4ITCA 1LESA 2ZS6B 4IV3C 3HNBM 4COZA 4PHZA 4LOSA 3EHKA 1OFSA 1CAUB 2VW2A 3AMNA 3KGLA 1LB2A 3ZDSA 3DCQA 5IAXA 5A3TA 1RVF2 1XBFA 1GNZA 4CEWC 2CGPA 1UZYA 3OBTA 1RUJ3 1HQWA 1AJOA 2V5YA 4JGZA 4XFBA 4CE8A 1QXRA 3AP5A 4UFKA 1JU4A 4XUTA 1QY4A 3GM8A 1O8SA 2ATFA 1YYNA 2GAUA 1KEXA 3NO8A 3OUJA 1UYZA 1YWKA 4FFHA 5C3QA 3VKNA 2HWD2 4AI0A 1BMV1 4AFCA 1RUE2 1PVC2 1A8MA 1WD3A 1AR63 1BBT1 1LHNA 3ECQA 1YQ5A 2JG9B 3HQXA 2CWMA 4JTNA 1LULA 1QJY2 1DQ4A 3FC0A 4LBMA 3WG2A 2ET1A 3GYDA 1AX2A 2B9VA 2WZEA 3NNLA 2WWUA 3MEPA 3WR0A 1JYCA 4QPIA 2P3KA 2WO1A 5EQUA 4EWAA 4XIOA 3RFRA 2G9GA 4HKOA 4LKFA 5F37A 1AL23 1Y7BA 4FPFA 2PA7A 3ETQA 1YIPA 4EZHA 2H6CA 1PNGA 1WD4A 1U5ZA 2WO2A 3AMPA 1R083 2BW8A 4YYOA 5JI7A 1KS5A 3P6BA 3RYPA 1DDLA 2V73A 4XDOA 2VD7A 3TNPB 5JXHA 1BMV2 2GH2A 1CVNA 1BBT2 3MYXA 4YSFA 1AR83 4JKMA 5FR3A 1G9FA 1D4VB 1ND3C 5FK7A 4UAPA 2VMDA 4N9IA 1JODA 1WCKA 5FYSA 5I0DA 3IAQA 2Z2SB 2A5ZA 3IDAA 2UWBA 5FJKA 2DWRA 4B4QA 1MS3A 4Y24A 3SEPA 1ZZBA 4Q4W1 4ASKA 2V4VA 4BQWA 3H3LA 2BZDA 1EUUA 2RMU3 2NZ9A 1J83A 1GU3A 1CX4A 1PMIA 1WW4A 1G6NA 3BCWA 4LUKA 3OY8B 1OXCA 3VKOA 4CUAA 3C8XA 5FWJA 3AC0A 1GOFA 3I2OA 3N3HA 3CF6E 3IN9A 5FYHA 3VDCA 4CUBA 5FPXA 2V72A 4XFFA 4K21A 3UL2A 3S0MA 1QU0A 1RUH3 5H9RA 2BU9A 2YG0A 1RXFA 4FP3A 3MW2A 1QXPA 4N7IA 3T2OA 2ZEZA 5BNOA 3AP6A 3O0XA 5K9YA 4CU9A 4A3XA 5HCAA 3N9OA 4LK6A 1JZ7A 4I30A 1RMU1 2MPFA 2EICA 2C0ZA 1LECA 3J8F3 1I5PA 1O91A 4Q4W2 4ISQA 3DPRB 3WQBA 4K8RB 4OFGA 4FPJA 1NA1A 5J37A 4Q0SA 3DL3A 2X05A 3Q8BA 5AVAA 4RGGA 4XILA 3M7AA 2LUWA 5C8CB 3LZZA 3KD4A 1BLZA 2E9QA 4CEYC 3VL8A 2WO3A 1Q43A 3EJKA 2VG9A 3GCXA 4ZXKA 3VBHC 3C3VA 2FD8A 3UJQA 3E5QA 4AYUA 4HBNA 4QKFA 1E5HA 5F7UA 1JYXA 2VOKA 2E7QA 1R1A3 5L73A 1RMU2 3JB4C 3KCYA 1VLNA 4V2WA 2WZ8A 1D0HA 3TEXA 3TAYA 1A34A 1JZ4A 1W05A 3PVBB 2F17A 3Q8EA 1QEXA 2X5IC 2YC2A 4TYSA 1VMFA 2ZA9A 3BODA 5AC93 2EIBA 3O1TA 3EO6A 3JXSA 5F5QA 3WW1A 1DGRN 4AEDB 1COV3 4UW3A 1JMUB 5EPAA 5A7QA 1XE8A 4KWLA 4F3JA 1QHDA 4FTBA 3LGRA 3M8LA 1RJ8A 2PHDA 5IUQA 2B5HA 2ZMNA 1X7NA 4YM1A 4XJAA 4OLLA 1ULPA 2VZUA 4BWOA 3FBYA 2J7MA 1IGOA 1Q8PA 4C0HA 3R0RA 3BTXA 3UYJA 3TEZA 5IK5A 1J3PA 5CNAA 2A3YA 3WDUA 3WLUA 5F9TA 2VE1A 4TZDA 1VBE1 3ES4A 2Y38A 3QBQA 5EV7A 4CDXB 1IG0A 4Q0VA 2L9LA 1A78A 3OGRA 2JDYA 2WLQA 1EAH1 3OGVA 2A6VA 4W50A 4V1PA 3UKTA 3M4FA 1G9CA 3BALA 4PT6A 2JJ6A 2WZR3 3TRSB 1RUG3 5I93A 1FMD1 1WLCA 1P8JA 1C57A 4J1XA 4WM8B 2JDNA 3GZTB 1ZBA3 1RUD1 5I0UA 4N53C 2JG8C 3QD6A 2R043 3ASIA 2ZHNA 3VBOC 1CGPA 1BEV1 4Z2AA 3D0SA 2BTVC 4LBLA 5D8AC 4GALA 1E5SA 4BK4A 4FOYA 3AKPA 3T08A 5F8PA 4JCKA 4LNVA 1PZ8A 2XJSA 4OHVA 2ADDA 4TLFA 3HIFA 2P34A 2ZHMA 3M70A 1VBE2 2A3WA 3MBWA 4JVAA 4M01A 4MXWA 4FQZA 1BK0A 4LA2A 1REEA 4XUOA 3RVHA 3WG1A 1J59A 1SCSA 1YQ6A 4AFMA 1SEFA 1EAH2 2E53A 1ULDA 1PZ7A 1WW5A 4HVRA 5DZFA 3G6JB 3WF2A 2OIIA 2RS51 4YNIA 2ZEWA 2JECA 1AR91 1FMD2 1PMHX 2BOIA 3KWVA 4NO4A 3CBNA 2QKDA 5L9RA 2HWB3 4R52A 3CJIA 5K0UC 1GZCA 1RUD2 1NCRA 1WZXA 2EALA 4IETA 4XFIA 3I3QA 5A33A 4COVA 3J9SA 4AHWA 1ZVFA 3WNKA 1IPJA 4QQ2A 5JDBA 4IEWA 1BEV2 4Q4Y3 2Y6JA 2VVEA 5BNPB 4FFIA 1UYYA 4FXKB 4TSVA 2E7AA 5KC6A 3O1RA 2QFEA 2VC9A 1L3JA 5EP9A 1S0CA 2Z69A 1S0IA 5LB6A 1K5MC 5T5JA 5C7GA 3ZKYA 4XTPA 5LK7B 4ZONA 1WBLA 4HKLA 4QGLA 5FY4A 4QX8A 4RR3C 2NLRA 2P6CA 1VMHA 4F83A 1EY2A 2FDHA 4I0BA 3FUQA 1PK6A 4NIHA 3ZR6A 1NLRA 1AJKA 4G9SB 3AJZA 2C9AA 1OURA 2YMZA 3U78A 2VPVA 2RS52 1NX9A 2J1UA 4B7KA 1AR92 3DXUA 2P2KA 1IZ3A 3L2YA 3JCIA 1PMJX 1S0JA 3ITQA 5F5IA 5L19A 3CIHA 4NHLA 4N43A 2CL2A 1JTZX 1VRH1 4P9GA 1RITA 4E4SA 4Q8KA 3DKWA 2RMU1 1C1LA 3P5BA 1MQTA 5A70A 4Q1RA 3HJRA 5ACA1 3SMHA 1O5UA 2A7AA 5KHIA 3WNPA 3E6CC 5IW0A 3KZ4C 4DS0A 2VOXA 2D6MA 4NRMA 4XAAA 4YVSA 5T52A 5J96B 2I07B 1AXKA 1KXGA 2YB7A 3KQRA 4EN6B 5I0RA 4SBVA 1CAWA 1OLQA 2XVKA 1LJ7A 1XYNA 3FFZA 4DINB 1MVEA 1UL9A 2YGLA 1NE4A 2ZGRA 4IUGA 1Z7S3 5F2SA 1LHOA 5F3EA 3VDDB 4CDXA 4CP9B 3ZXFA 4QT6A 5FLIA 2D93A 2GC1A 2ZX1A 4ZU4A 5FP7A 1JZ6A 5A7NA 2CSGA 4UFMA 1VRH2 5FV3A 1F4HA 2RMU2 5FPAA 3CKHA 2ZZJA 4BQ5A 2EXIA 5ACA2 1V9U3 1V6IA 2SLIA 3AP7A 1JH5A 5BNNB 3TOJA 2A1XA 1CD3G 3GBGA 2EIGA 4Q4X3 4K9SA 3TN91 1OD3A 2LROA 5HV0A 1ZRFA 1E57A 1TNRA 5F5CA 2QUOA 5GKAC 3ROUA 3I2FA 5C3SA 5CADA 1O3RA 2WNUB 1B35B 2NMNA 1RUI3 2P3IA 2XGXA 2RDNA 3AYDA 3CU7A 1XSRA 3SH4A 2B9UA 1BYHA 1AVBA 2CWSA 4JRAA 1JU3A 5LRRA 3PTYA 1H4GA 2RV9A 5FXWA 1ENSA 1Q8OA 3AZYA 1UXXX 2XKPA 1ULCA 3R4SA 4FQ4A 5KXDA 5FYIA 5IFTA 5IK4A 2XJPA 2XLFA 2VW1A 3JBG1 2VZRA 2QDRA 3OGJA 2OYZA 5FO9B 1MS5A 4RQPC 2VTFA 4NHMA 1OUSA 2ZKLA 2CY6A 2N7GA 4P9YA 1H2KA 4QHZA 3RZZA 1COV1 1GOHA 3TN92 4YW3A 2EAKA 3SEEA 2CYFA 4K20A 3KMHA 1DYOA 1SLTA 3D3AA 5CFDB 1CESA 1GUIA 1RGSA 1ST8A 4HPKB 1MZ5A 4KQ7A 5EXOA 5LK5A 3TEYA 5C71A 4XMIA 2C24A 4LUMA 4GB31 4ZZ5A 1DF0A 3HBKA 4CCOA 5JZGC 2BDRA 3H7JA 3I3MA 5ISLA 5GLVA 2WFPA 1IG3A 4AG4A 5CB7A 1LODA 1W9SA 3PL0A 4CTEA 2QQMA 4URTA 3JBG2 1JN2P 2YFUA 5DAPA 1CR7A 5JXIA 3AKQA 4JQRA 5CFCC 1CZTA 4GH4B 2XUMA 2AREA 3T3YA 1JUIA 2JENA 5FBZA 3JZVA 1COV2 5FK8A 3LKJA 1JYWA 5E6HA 1LHUA 2WWSA 2VZOA 4XJZA 1JOBA 4CDUC 3RJ2X 5GZCA 2PHFA 1GWMA 3WHUA 4F8AA 2AENA 1KJLA 3V0BB 2Z79A 5FLJA 4UF0B 4QDSA 4AEJA 3NNJA 2BNMA 5FP9A 3I2KA 4GB32 4L9BA 1MS0A 1XU2A 4A7YA 4COUA 2YV8A 2KXLA 1DQ5A 1ZNPA 3BOWA 5CKNA 3MV11 3BVCA 3ZFGB 3W58A 2WWJA 1LHWA 4IE7A 5DUWA 4P9IA 1ND2A 1SDDB 4PLMA 5BV6A 5DUXA 4A7ZA 4Q4V3 4ZS3A 1RUNA 4CP9A 3WY6A 3OB8A 3VUOA 5IVCA 4QQHA 2WN2A 5DMYA 5IVYA 2FDKA 1EUTA 1NE6A 4LO4B 4WM7C 1O5LA 1H9WA 3ME2A 5FQ0B 1S0FA 5J7MA 4YZ4A 4RS5B 4U36A 2JIJA 1ULEA 4CPBD 3ZOIA 5BNNA 4DRVA 1X9PA 1TZOA 2YU1A 1C5HA 3I2JA 3RZGA 2FCVA 2QQNA 2ZGMA 2ZJCA 2D7FA 5LA2A 2P4EA 2IC1A 4COYA 3GZEA 1GR3A 2Y6KA 5DZGA 1YLLA 4PBOA 1OPMA 5FYVA 4ONUA 3WP3A 2W91A 2R1DA 1RVF3 3GBWA 3NJVA 2LS6A 2ID4A 4UI9L 3VBSA 3LA2A 1WMXA 3NV4A 3RMXA 2O1QA 4CDWC 3AYCA 3O5SA 1VAMA 3ZFEB 1XE0A 1HQLA 1L7QA 4GKXA 2ZEXA 4OUEA 1TE1B 1YFUA 2XJQA 4LO7A 5J09A 3VBRB 1CJPA 1PZ9A 3ETPA 2PAMA 4EWDA 1RUE3 1LOFA 1PVC3 1VBA1 5IFPA 4LLFA 2C1FA 3WF4A 3RZHA 5IT6A 2BGCA 4LT5A 5A3LA 5EYXA 1QOOA 2YPJA 4IV3A 3U14A 1WCQA 4EN0A 1QJY3 3HBZA 3MZHA 4DMIA 1UIKA 4DZGA 2ARCA 2X53S 5DUVA 1LAJA 1HQNA 2A70A 3DYOA 4CEWA 4ARYA 1ZRDA 2K46A 1UXZA 3KF3A 2ARAA 4HPKA 2KM2A 4HSJA 3ZKUA 2JE9A 4EJRA 1VBB1 1XNTA 3IB3A 3ZIWA 1L7RA 3NNFA 1V70A 3U4SA 5FUNA 4O65A 2WUHA 3IPVB 4H14A 1HJGA 2P3YA 3IWZA 1OQ1A 4N8MA 1H8TC 2OS2A 4Z82A 1Y9MA 4GMP1 1GOGA 4N9HA 5LASA 1VBA2 4Z2WA 5C3RA 1H1IA 1BBT3 4IQPA 1EV11 1W8ZA 1YEWA 2IWGB 1B09A 2XB6C 1UPSA 3AKSA 4IW3A 5FYBA 5B4NA 1W6PB 3BPSA 3O7OA 1NLQA 5EZWA 4NPMA 1OF4A 3LEMA 3IZOA 1NLSA 2CGOA 4RA0A 1UF2C 3THDA 1G9BA 2WO7A 3I3DA 5E88A 5JPNB 1OUXA 1VBB2 3ZR5A 4P08A 2BOJA 2H0VA 1HRI1 1XSQA 1PX4A 3AMHA 3B9CA 3POWA 2Q8OA 3VD4A 5A7SA 2VCMA 2VNGA 3OD4A 3UT0A 3ZFFB 2PHRA 1ND3A 1Q5OA 2LW8A 1OH3A 1OMIA 3POJA 4J25A 1RUOA 4A4AA 2FDJA 5FZ6A 3VHRA 2VUAA 2I2SA 1OT5A 3IIAA 3K46A 2XLGA 3LPFA 3H8OA 4IL7A 1EV12 3QLQA 1RHI3 1UU5A 1OVPA 4FVVA 2E33A 3Q8FA 1N1TA 4JV4A 4N53B 1F31A 4LHNA 3A23A 3FLRA 5C70A 3RJRA 2UU8A 4MXVA 4QPGB 4CCEA 1HRV1 4Y1YA 2GC2A 5TSWA 3RWKX 3ZYHA 4LHKA 2GMPA 4YWAA 1X50A 4OZXA 2RM21 3SQOA 3J7NA 1HRI2 2H0BA 2G1MA 3Q8CA 3OSDA 2R071 1NCQC 2E31A 1T6BX 2VY0A 3OG2A 2XQRA 4JGZB 3EQEA 3PU8A 3HOBA 4FXGB 4JHZA 4P00B 4AEMA 4PCRA 4A7KA 1VBD3 2GU9A 4M0HA 1V6MA 3DUIA 2UYBA 4M4PA 5B2GB 2D3PA 3IDBB 3OBRA 1D0GA 3HEIA 4QDQA 5IVFA 1AZDA 2ZAAA 1XQNA 2GNDA 4MADA 5K0UB 5GLTA 4MGSA 3LEIA 3NWKA 1RMU3 4FOVA 5JWPA 2XR4A 2WINB 1J3QA 2DTYA 2PAKA 4XF0A 5JXGA 4XOGA 5FLHA 4LBJA 2BWCA 2BGPA 2RS11 4EQVA 2CDPA 3UGHA 1IHMA 1UW8A 1HRV2 1GLHA 2WT0A 2EXJA 1D7PM 1WLWA 4LTAA 4NRPA 4HSLA 2EVXA 1J1TA 4CEYA 5IVVA 4OQ8A 1UY3A 5JOZA 3WVJA 2RM22 3GHMA 3CEWA 3VBHA 5A1LA 2VL4A 3USUB 4QGNA 4ATEA 2YZ4A 4YGBA 2R072 1DZQA 1HDKA 4FOWA 1XU1A 3L9JT 4PIZA 2DCKA 5FZ8A 3VBFC 3PHMA 1V00A 5CG9A 2F4PA 4LQRA 4ZU5A 1YI7A 1LNSA 3THTA 2JICA 4FBFA 4ZS2A 2IXKA 5IJRA 3VHNA 1YJKA 1YXWA 1XYOA 2X5IA 2D6PA 5FY7A 2E26A 4GXLA 1Q8SA 2B42B 5T5PA 3X29B 2PHLA 2PHUA 1HV1A 2RS12 4GD4A 1KJRA 3T09A 3VD7A 3IMMA 1W06A 2D3SA 4EV0A 3RZJA 4L99A 2G9FA 1Y3TA 4OI1A 3PJQA 2J1EA 4OI2A 4E27A 3NQHA 2DTWA 2H6BA 4YG3A 1W28A 1XRUA 1H0BA 4CCLA 3ZSEA 1SPPA 3P3PA 4BQ1A 3WV6A 1GSLA 1PGW1 4COWA 1K5JA 1KDMA 2E51A 2AGSA 1GWKA 4HLTA 5FZ3A 3CJXA 3NSTA 2GC0A 1NKGA 2OW4A 4PF5A 4D8MA 2QJVA 4QGMA 1UOBA 1VBE3 4FPCA 1QMJA 5BNOB 2UYAA 3PVOA 3AK0A 3VLBB 3OOXA 3ZO0B 4LE3A 3ZN5A 3FWEA 3M3CA 3RNSA 4NOTA 5T5LA 1EAH3 4XQDA 5CU1A 1QH7A 3PU3A 4HK8A 3BB6A 2NP0A 3KVBA 3BU0A 3VZOA 2ZGOA 2JDHA 2JG8A 4N53A 1W90A 4Y5Z0 5K4LA 3UESA 4BMEA 1FMD3 1NA1B 3VBOA 2OPWA 1DIWA 2P17A 5BUVA 1YC61 5D8AA 4Y26A 2LALA 4CU7A 5FP8A 1RUD3 1QXJA 4I3PA 5FZKA 4BQ2A 5G04L 1BEV3 1VMJA 2MEV1 1LGCA 1W2UA 1PGW2 3WP5A 2YPDA 2HH9A 1N1SA 1GKBA 4XJ8A 3NKTA 4CCNA 1AXYA 1IKPA 2UWCA 2VUJA 3JUUA 1H1AA 2J22A 2TNFA 5GLZA 4K1YA 4CXXA 3KGZA 3KF5A 1U12A 5FCCA 1XNBA 1YCIA 1DU3D 4Q0UA 1C8NA 2BQPA 4KWUA 5K0UA 2IUWA 4W65A 2RS53 4BLJA 4FAGA 2FDGA 1AR93 3NJXA 1NYWA 1MZFA 2VZVA 3CMGA 3E1F1 3PUQA 4MUVA 3SLIA 1PO11 3T1LA 2DBIA 3WUDA 5LRSA 4QKNA 2DVAA 3LDRA 3WHTA 4A44A 1K5MA 2MEV2 3GXUA 3HQUA 2VXRA 4Z07A 4XUPA 2BVVA 3AKRA 3H1YA 1AR71 4RR3A 3USUA 4KGQA 3OGSA 1SBEA 4QQPA 3ON7A 4R9CA 1F2NA 3F95A 4H55A 4M00A 4XE9A 2Q8CA 4CRQA 3BI3A 1KS4A 3AKTA 3LFMA 1MEC1 2CV6A 4I0WB 4FPYA 4YZ1A 5FYTA 3MGUA 1WUVA 3LSEA 1IS3A 4YW6A 1UMIA 4CA9A 1KFUL 2ZX4A 4IGQA 5LW9A 3KV9A 4XABA 1RHI1 4Q27A 4ES9A 1JS9A 2ZGQA 2G9ZA 3B01A 5HCFA 1VBC1 4BLIA 3RZMA 1PO12 2W46A 3POGA 2WFF3 3KB5A 1DQ6A 1VRH3 1E5RA 4LJHA 4PIYA 1W8FA 2D6LX 3ELNA 3W21A 5ACA3 3NRUA 3KV4A 4L92A 1AR72 2V5DA 3DF0A 1JXNA 1GZ9A 5CBLA 1AYM1 2YBPA 4AFBA 2KR2A 1OOPC 2X09A 3K51A 4YGCA 3IT8A 1RC6A 2EXKA 1MEC2 2W1SA 2WC2A 2BFUL 4LO6B 1GQHA 4Y1ZA 3VBUC 2ZOEB 4KG0A 4LBNA 4MXWB 3AL6A 3SCFA 3T4VA 3WF0A 1VBD1 5ANQA 1V6JA 2XXZA 1M06G 5DABA 1TME1 5FZMA 1RHI2 3ZYJB 5ABJC 2NPIA 4NE9A 5JOXA 5JOYA 3DXTA 2FMYA 4QXBA 1VBC2 1GNHA 4R9AA 2AC1A 2B7YA 3CJIB 1NCRB 3WF1A 4P9LA 4XJUA 5A33B 1XOYA 2VJXA 3T30A 2R32A 4AQ6A 4MGYE 5C5TA 2W9XA 2HBTA 5H9QA 2E32A 3TN93 1AYM2 3AP4A 3MUZ1 4HXCA 4PDWC 5T50A 3Q8AA 3MIDA 5CEHA 4WV8A 2RR11 2VNVA 3VDAA 3I3BA 4L8QA 4R9DA 2DVFA 2FMDA 3KT7A 5FZIA 1VBD2 1C4RA 4NUBA 5FZGA 1TME2 4ZXEA 1PK6B 1AYN1 3TNQA 5KC5A 1S55A 2XHNA 1PIV1 4QX5A 2WQZC 4XCAA 4HFSA 4XFAA 3MO4A 3B3QE 3JQXA 1POQA 3CLPA 5LA9A 4RQPA 5F39A 4JGYC 4LBKA 4CUCA 2LTNA 4LIUA 4S2HA 2A75A 3AX4A 3JBG3 5CZKA 3J7MA 4Y20A 2WAAA 1X33A 5CKMA 4FOQA 1F4AA 5JUVA 4N43B 4PLOA 3KLSA 3CZUA 2QVSB 1LENA 1MQTB 3I2HA 2VQTA 2YY1A 2KD7A 3WF3A 2AUYA 2BJSA 3K4AA 4IGOA 1DZRA 2PELA 4XURA 1GYKA 2EXHA 4BH9A 5APAA 2QNKA 2DVBA 2RR12 4YVSB 1FV3A 4LITA 3CDZB 1IQAA 5JZGA 4U2AA 2AR6A 2WIIB 3O1VA 3ORJA 1VIWB 1UY1A 4AOCA 3HWJA 1H2MA 1CAWB 3AZXA 4GB33 2SBAA 3B02A 3NAPC 4DO0A 1AYN2 3WNOA 2GN3A 4JC1A 1PIV2 1DQ1A 1GFF2 4AZZA 3LEKA 4DY5A 4IEVA 4O9GA 1UCXA 2VULA 4SLIA 5LBCA 5CFCA 4IV1C 5AFEA 2VH9A 1NG0A 1IS4A 4BQ4A 4G3YC 1K42A 1CPNA 5KHJA 5A6YA 3WDVA 3ZXAC 4LULA 4TXWA 5EWSA 4CDUA 3ZIXA 2ZACA 3LDBA 3K2OA 4YGEA 2FDIA 4C91A 5FXVA 1OHFA 5LBEA 2XJRA 3R4UA 4HMZA 3BUCA 2WDBA 2K0GA 3MW4A 2QCSB 3SCGA 2D97A 4HG6B 1YQ2A 4AE2A 3T0BA 2CNAA 2HWE1 1DP0A 4AHYA 4MGKE 5HXMA 2W92A 4KU8A 4E9KA 3I3EA 3WZ1A 2WJSA 2XJUA 3Q9OA 4YZ3A 1GZWA 3ZYIB 1UZWA 1ZBE1 2MHFA 5C3PA 2XJTA 4JRLA 4P5YA 3WOGA 3OCPA 3HNYM 2VXJA 4NR1A 4AAPA 1S0BA 3DKQA 4WM7A 2GH8A 2JKXA 3N36A 4K40A 3WNNA 4GKYA 3MLLA 3WNMA 3ATGA 1JZ8A 1NOVA 1DYKA 3ZMOA 3EB7A 4KWJA 3USSA 1ACCA 5FP3A 5KR7A 1UIJA 1HN1A 3QCWA 4CYDA 1MVQA 4CP1A 5LEKA 2VZPA 2O8OA 3OTFA 1S2BA 4QB1A 2HWE2 3AP9A 1UY4A 2JIGA 4XW3A 1LHVA 2VCAA 1ENQA 3M1HA 5FMCA 3VGIA 3GGLA 4HN1A 2AH2A 1ZBE2 5CA6A 4NIGA 4CDWA 4NJ4A 4CCDA 1OQEA 1YRZA 5CVRA 1UU4A 5HCBA 2JDPA 3SHRA 1W6NA 1IPKA 3POBA 4V2VA 1J58A 4D6SA 1Y9GA 2ZHLA 1M4WA 3ILRA 3NW4A 5JR7B 2VO5A 1UKRA 3RYRA 2I74A 4RSUA 1SFNA 4NRQA 3WINE 1UU6A 3B7MA 3KV5A 3WP4A 3PVNA 1VBA3 1W03A 2VMHA 1QJEA 4AW7A 1RUF1 2WFF1 5IHRA 4XFGA 4FTSA 1J1LA 3PUSA 3THCA 4FFFA 4XDPA 3PMEA 4FPOB 4M3CE 1PO21 3LD8A 3VBFB 2R49A 1SACA 3LIHA 3OBZA 5FY9A 1V0AA 5I0SA 3GZUC 3JU9A 2DVGA 3RS6A 4UBGA 1DLCA 2VBBA 3KHCA 1AX1A 4DFSA 3N9QA 4XFCA 4HVQA 3V0AA 4DEVA 2P37A 3I97A 1VBB3 4YW5A 4EYUA 1ND2B 1H8TA 2O0OA 2RJ2A 5A1FA 3DYMA 1X8EA 1MPXA 4W6WA 3ES1A 4KNCA 4NMIA 2D5FA 2A73B 3PUHA 4CP0A 2IZWA 4TTGA 4GMP3 4RGKA 1RUF2 1OA4A 2WFF2 2Q1FA 1EV13 3O1SA 2GNMA 1OKQA 3OPWA 1ZZ9A 2RVAA 2J1RA 5E89A 4BZ4A 3I54A 3CHXA 3LCPA 4JHTA 4WBBA 4OHZA 4N90A 1PO22 1XE7A 1DCSA 2JWPA 2VGDA 3IKWA 5DXDA 3O1OA 3L2HA 2CTVA 4E2SA 3EBRA 1LOBA 4BU2A 4UWDA 4YVWC 2GN7A 2WNVC 4BYYA 1O7FA 4JAAA 5C9AC 4QU2A 2QQOA 2VOWA 5EIYB 4UFLA 3AVSA 1F15A 3WQ0A 4OQ9A 1LOCA 5FPVA 5FPBA 1CQ9A 1HRI3 2Y64A 4XJWA 1HIXA 1TNFA 3FLPA 5L7OC 2VECA 3VBSB 4D0QA 3H50A 3H7YA 3ZM8A 4XEZA 3DECA 3VZJA 4YW1A 4R4ZA 5DUUA 2XMLA 2XUEA 1W2TA 1ZA7A 1ZYBA 5AVPA 1T6GC 1T2XA 2OQ6A 1O3TA 1G9DA 1ZRRA 2O8QA 1O4ZA 2AACA 4IV3B 2DF7A 4M3CA 2B8MA 2BP6A 3AYAA 4AGRA 4DRRA 3S30A 1HRV3 2QQKA 1W2OA 2RG4A 4H2AA 4K1ZA 2E6VA 3BN6A 3VKLA 3KCCA 4CEWB 2WR9A 5DG2A 1NCQA 4HT1T 4XBLA 3WEZA 4ATFA 4CUGA 3W5MA 3TEWA 2G19A 4OYUA 2RM23 3KV6A 2ARXA 2ZMKA 4AVAA 3N4MA 3C7EA 2R073 1IQDC 3HQRA 2I45A 4XZPA 2A71A 5G05L 2J1SA 4UOJA 4B7EA 3ZSJA 1D4M1 1U5YA 5F32A 3BIWE 4ORFA 1YFWA 4P9XA 2LRPA 2UY8A 2JG9C 5C3OA 1OA3A 4AVTA 5C6CA 5F6LB 1RYYA 1ZM1A 2AEZA 3MHZA 4GWNA 4LLOA 4PQ9A 3IM0A 1YQCA 2RS13 1BKZA 1PM4A 5FY0A 2XL7A 2CGNA 1SFPA 3GJAA 3IDEA 5FZOA 2HBUA 4AI8A 1LOGA 1QOSA 3A22A 1C8M1 4IXLA 3RZKA 1OC1A 2YXSA 3VBFA 3E5UA 4RHV1 4RD7A 1SHWB 3MFAA 3LOBA 3R05A 1Y9QA 1SLBA 3WDTA 1AL0G 4BJ0A 4M3CF 2UURA 5FREA 3U37A 1W04A 4CDQC 1D4M2 3IMNA 2VR4A 3MFCA 3D82A 4NROA 3D8CA 5FZ1A 2K2SA 1J3RA 1ND3B 5FZCA 4RFT0 4DEQA 3OUIA 3MIHA 4M4RA 3KSCA 5HPOA 1GWLA 3RI8A 1KD7A 3ZDVA 4OULA 4XUNA 2BEOA 1SLIA 4E2QA 1UY2A 3R6SA 1EPZA 2ZXQA 3T2QA 2YYOA 3LPGA 2WYFA 3UGGA 1SDWA 2WNEA 4JX0A 5BYNA 1D2QA 1C8M2 2ZX0A 1JI6A 5FXXA 4QX1A 4AQTA 4DY3A 1IPSA 2JB4A 1WKYA 1UY0A 2ZABA 5FZEA 4RHV2 5FZHA 3UV9A 3J4UH 4CVUA 3H8XA 1O8PA 4I0AA 5JMCA 3SC7X 2JDZA 5SV8A 3S5AA 1GNYA 3LOIA 3EMRA 2WN3A 3H3UA 2X8KA 2QE3A 4XF9A 1H2LA 1LRHA 1W9WA 1MS4A 1PNFA 1XC6A 2HWF1 4YG6A 1SCRA 1BJQA 1MS8A 4LKSA 1QJU3 4FPHA 1KRIA 5I0TA 2IXIA 1HKDA 3MIEA 1BZWA 4KH9A 5FZ0A 1SLLA 1F8VA 1GMMA 1N3OA 1QDCA 2VMEA 4Y33A 3AFGA 1H30A 4E8DA 4I01A 1FX5A 3DPRC 3HD8B 4UW4A 1H6YA 4GWMA 1NXD1 5A3WA 2D5HA 1UX7A 1XNKA 2RDSA 3INAA 1IOAA 1OLME 2XDVA 2PN5A 1ALYA 4TLGA 4AHXA 4CEYB 5C8CC 3P1IA 1UPIA 3U0ZA 2YHJA 3VBHB 5FMDA 1UZZA 4A41A 1ZZ8A 2MEV3 1LKNA 3AB0A 3NNMA 3POYA 4ISRA 2WSVA 4IERA 5DAQA 1W6QA 2HWF2 1LTEA 4IESA 5KHGA 3MF6A 4IEYA 3ST7A 2D3RA 3FBMA 3OGGA 3GZAA 4XJ9A 2VOTA 3C2UA 2FQPA 5EJ1B 4Y3OA 1S0GA 4MHRA 1XB9A 1WW6A 1QQP1 5HV4A 3JB8A 4YZ5A 2X5IB 4CCKA 5FOBB 1OLRA 4LBQB 1NXMA 3UJOA 1YHFA 2YUEA 1NUKA 2DCYA 2GSYA 5IK8A 4CCJA 3C7HA 4HKWA 5FPZA 2Y34A 1W9FA 2Q8DA 3T2PA 1GBGA 3MPPG 5K8SA 3U1XA 2OPKA 3VD5A 2YC4A 4AEDC 3ACIA 1A8DA 5FYMA 3MIGA 2VZ1A 4KG8A 1PO13 1QOTA 2CAUA 4QD2A 4QX3A 1NY71 1AF9A 1W6OA 5GLUA 1WCUA 4B3NA 2ARBA 3UKVA 4CXWA 2D44A 4ARXA 1UZ0A 3A0KA 5FP4A 4RGAA 4QX0A 1I6XA 2BBAA 5IVBA 1SPPB 1AR73 1G7YA 3NL1A 1OSGA 4TN7A 1JYVA 4XUQA 4FPKA 1EPWA 4GWIA 2WL1A 1QQP2 2QQPA 1GQPA 1MEC3 5JPMB 1DQ0A 1WGPA 1CAVB 3I2IA 5FO8B 2CU5A 1OI6A 1RL3A 2RDRA 2HEYF 4N7UA 1X36A 1RTVA 2YBKA 3W59A 4YM0A 4NIAA 1EYBA 2Q0AA 1IS6A 4MHUA 4QM8A 5HBAA 2JG8B 1VBC3 3B00A 4HOOA 2PQSA 1OLMA 2GP3A 4WM8C 1HW5A 2VW0A 5E8AA 2FCUA 4FTEA 4Y22A 3VBOB 1BVP1 2VCBA 1NY72 3K4DA 5D8AB 2ET7A 2YGMA 1BVVA 3EXUA 1CZSA 5JSPA 3FE5A 1WA4A 1OOPA 1GANA 2HWC1 4CP2A 1UO9A 5BNQA 2JKBA 5ANNA 2ZTNA 2WA3A 3BTAA 5CIRA 3VBUA 1URXA 1W0PA 1AYM3 3B94A 4INDA 4BE3A 2IVIB 4FAHA 2Y6LA 1C5IA 1X82A 4E4DX 5ABJA 2DDUA 2FZ1A 1MACA 2IXJA 1RUC3 4IE6A 1I1EA 3S5QA 3O1PA 1Y4WA 3QACA 5FWEA 3RQ0A 5DDJ1 2PHWA 1TME3 1WBFA 4IEQA 5LBBA 4EN8B 4J6GA 4NIIA 3FL7A 3O14A 4BIOA 2XWBB 1PHMA 3WXPA 3D4KA 1FXZA 1Z0HA 1H4HA 5EYYA 3BTZA 4L11A 5FYZA 4E2GA 4PDWA 2HWC2 4ZKTB 5BNPC 1ENXA 5A1AA 1K5MB 4QXCA 4EWEA 1VAKA 4J1WA 4OHXA 5FZ9A 1O3SA 5FO7B 2JX9A 2W3JA 2XG3A 5IAVA 4RR3B 3AM2A 4XACA 1W0NA 4OHYA 1N47A 2ZGKA 5FUPA 4D7TA 1G9AA 2RR13 3VZMA 4OZOA 1C1FA 4NHXA 3ACLA 3FUOA 1XPWA 1H8VA 2VMIA 2ORZA 4KL1A 4AVCA 3BGAA 3OYWA 4XETA 2YDEA 3B9IA 2RDQA 1V6OA 3E5XA 4GJZA 4JGYA 1C28A 2WT1A 3HN1A 1AYN3 2VTXJ 1MS9A 1PIV3 2JEMA 4OI4A 4EN7B 3FX3A 4LBQA 3JQWA 4QKBA 4B1LA 2JDAA 3N9LA 5T54A 2IXLA 2RJKA 3OEBA 1H2NA 4L0PA 5A3UA 1GZTA 2BWAA 1H1MA 1MS1A 4JKLA 2NYYA 3AFKA 4AFDA 1QDOA 2HYKA 3ZXKA 5C4WC 4XIKA 3LWCA 1AX0A 2QQUA 1UX6A 4X6RB 1US3A 1NT0A 3AYEA 1W2NA 4BIFA 1ZRIA 3KHBA 3U11A 3KVAA 4IEZA 1ZZ7A 4XZUG 3A0NA 3NAPA 4DXRA 3S6PA 2XPJA 3ACFA 5A6QA 4BXSV 2RHPA 2W52A 2K9ZA 4JZRA 5J36A 1L7LA 3ZXLA 3VDDC 4A6SA 4IV1A 4YFZA 1QJU1 2EAAA 3PLQA 5GJ6A 4D94A 1R091 2WT2A 4LE4A 2ENRA 1CAVA 3T1MA 5J1XA 3O12A 4BCUA 3KQ4B 1OD5A 3RDIA 2F6BA 4UFIA 3POFA 4UFJA 3ALQA 4BISA 5A7OA 3SKJE 2ZGUA 3ZLIA 2AEYA 4BK5A 3AVRA 2FHRA 2A6ZA 4NPLA 4O61A 1QJZA 4YLZA 2ADEA 2OXBA 1TEIA 4BM8A 4DOUA 2WNVB 2VZ3A 5A32A 3OJBA 2GALA 4NWVA 1ZRCA 1CWPA 2ZKNA 1WA6X 3CZJA 4JDNA 1SQ4A 5L9BA 3S7EA 2W1WA 3N7KA 2VZQA 4MV2A 2WNUC 1B35C 2GNBA 4Q8LA 2XJVA 4MO3M 5F3IA 3POSA 5KHKA 5L7OB 1FPN1 1J84A 1FT9A 4CPBA 1W0OA 2HWE3 4IEXA 3RSJA 2OUJA 4AQ2A 1X8MA 1W6MB 2F4LA 1FOD1 4UYBA 4CCMA 1QJU2 1BHGA 1O6UA 5DDJ2 1R092 5I91A 2Q1MA 1ZBE3 3ZXJA 2J1TA 4A2UA 1DZTA 3K48A 3SISA 1ZREA 3I4IA 1GP4A 4XTMA 1FNYA 3MIBA 3SH3A 4EN9B 3ZYPA 3FZ3A 4OVEA 4QQLA 4RQPB 1E5IA 3VHOA 1QF3A 3BPZA 2WYSA 2DUQA 4S2DA 3U75A 4HZFA 5FOJB 5DAWA 2BERA 3B93A 4Y20B 2VU9A 3ZN6B 1JZ5A 2YC0A 1VE0A 1K12A 2CHHA 2ZX3A 3SNMA 4ES8A 4LR4A 4CU6A 2OT7A 4OUSA 2BV4A 2RS31 4QU1A 5CFDC 4BQ3A 3O1MA 3ACGA 4LEJA 1UOGA 4AQSA 1FPN2 4DIQA 5F3GA 1WCDJ 3VL9A 5JZGB 3LIGA 1FOD2 4X6QB 2JDUA 5FRAA 2ZHKA 1CAXB 5KXEA 3OBAA 2IFWA 1BQPA 2XLAA 1EP0A 2VZTA 5FUIA 3WG3A 4RN5A 5DN2A 3KT4A 3ZYBA 1DGWA 5CFCB 3I49A 1UMHA 1VB2A 2GDFA 2PMWB 1ULFA 3OD0A 4PIXA 4DQAA 1KFXL 2XHKA 3IAPA 4K3UA 4GH4C 4P02B 4WVMB 1NQJA 2W2IA 3SKVA 2XVLA 1DGLA 2Z5WA 4PI2A 4B4PA 2PYTA 3HPNA 3FLTA 4CDUB 2JD4A 1CIWA 2PTMA 3N9PA 1RUF3 2RS32 1K3IA 2A6YA 2GP5A 2Z42A 1A6CA 2HJIA 4Y4YA 4DUVA 3WDWA 3OF1A 1PO23 3KM5A 3M3OA 1Y43B 3LFIA 3PVEA 4MVTA 5FKBA 2B45X 5GZDA 2W1UA 4KU7A 1POV1 1V6NA 5E1RA 1KITA 2E7TA 4CDQB 5A7WA 2WQ4A 5LY1A 2DV9A 2HEWF 1UZVA 2X29A 3ZFGC 5FPUA 2WAOA 2D43A 3WP6A 5KXBA 3T0DA 4P14A 1GZWB 3I2GA 2UY9A 2XQXA 3BYWA 5FZ4A 1RUC1 2DUOA 3B69A 4LK7A 3U10A 2TUNA 2NM1A 3EYPA 5FYUA 2FBEA 4WZFA 1A3KA 3MICA 4WM7B 5D2AA 1N1YA 5EFUA 4WZCA 3CNAA 5M0TA 1KGYA 2R16A 1UYXA 1SFYA 1S0DA 3HAGA 4TWTA 4FPGA 4WVVA 2TBVA 2Y26A 1NZCA 1JBCA 4FPLA 4JDOA 4RS5C 1ASJ3 3SCHA 1NAEA 3FJSA 4C0BA 3RRDA 5IWFA 3K3NA 5GZFA 5C9AA 4YVWA 4IDZA 2WNVA 1DGWX 1YI9A 4EZ4A 2GC3A 2R0HA 2AZ5A 4IGPA 2VUCA 1JOPA 1QJX3 4NPRA 4XMAA 3J7LA 4LXLA 5FZAA 2W39A 3VN4A 4BDVB 4LBOA 4IE5A 5L7OA 4I02A 1TG7A 5DG1A 3WNXA 3GDBA 4BXFA 2XL9A 1W6MA 2W1QA 1RUC2 4CDWB 4K8FA 4MGZE 1R64A 1W6NB 1UQXA 4LO8A 4R4XA 5EHDA 3ZFEC 3PDQA 3NKGA 1W8OA 1I5ZA 4YFWA 1CPMA 4QHBA 4EE2A 3J26N 1UMZA 3VBRC 4Z92B 2DU0A 2WSUA 3RG0A 3TB0A 5FDBA 5BY5A 1ZA4A 2C6SA 4W4ZA 5J3UA 3D5OA 3HMYA 1U0AA 5KXCA 4QHOA 3S7IA 3ZN6A 1JZ3A 1WMEA 2VVFA 2VBDA 3N7JA 1X9TA 3GBFA 1CAUA 4WVZA 2R6QA 3AXEA 4L97A 4D6QA 1O4TA 3T2TA 2LM3A 1LOEA 1PGL1 5JR2A 2PFWA 4LO5B 2Y6HA 4QXHA 1GQGA 1LR5A 5LA0A 1HB2A 2C5DA 3PJYA 4GAZA 3BU7A 4XHXA 2GZWA 2JXAA 2VUDA 4LKEA 4YG0A 5IK7A 1WCSA 3T4HB 1CAXA 3V0AB 4OCTA 4XHBA 2JE8A 5JLVA 1QNYA 1H8TB 4CU8A 1Q56A 2JG9A 1G86A 3RZLA 1D2SA 4AVBA 5L9VA 2VQUA 1D4M3 2Y0IA 1W8NA 2R061 2WLPA 3FHAA 4KGGA 3NVCA 4KI5M 4WVMA 4URAA 2C4XA 2Y60A 1GICA 2D6NA 2WS91 5FIXA 3WNLA 4XAEA 1PGL2 1Q8QA 1HXS1 4ZPIA 1G8WA 2PHTA 2PHXA 4ET7A 4RYDA 4W6YA 5FTTC 4FT8A 4XF1A 2VNRA 5C8WA 3V65A 1LGNA 3AXDA 1UN1A 4FFGA 4YM2A 3SITA 1C8M3 4AL9A 5JXJA 2WQ8A 3OEAA 4RHV3 4CDQA 4Z1VA 2NQYA 2D6OX 4LPLA 4AI1A 1Z78A 3ACHA 2PLV1 3ZFFC 1APNA 1OKOA 4Q26A 1SG3A 5HCHA 2O14A 2VOVA 3FHIB 4H3WA 3VKFC 2R062 4QWNA 4OUMA 1LU1A 1XNCA 2P3JA 2DBNA 5JI9A 1FNZA 3URFA 5I8TA 2Q1ZB 4LORA 3NJYA 3ZN4A 3MLJA 1LEDA 1O59A 2WS92 5FZ7A 1TMF3 3V64A 4MLOA 1W8TA 2ZPXA 3OY8A 1HXS2 2ZGPA 1I3HA 1LU2A 1SZBA 4QPGC 1NZIA 4M3CB 3T0AA 3WW2A 4E4ZA 4ZZ8A 4ZU7A 2OX0A 1DG6A 2WA4A 1F5JA
chains in the Genus database with same CATH topology
1RUJ1 2G4IA 5E16A 3SXWA 2ZBJA 4DXZA 4QMAA 2PQQA 4DPNA 1NCQB 1OPOA 4X8NA 3H8UA 3O0VA 4META 2PLV2 4JGZC 4C1WA 1AR61 2HWF3 3MDPA 4MYEA 3G7DA 3PMSA 2ETEA 3LA7A 3LSDA 4AFAA 4HVOA 3DPRA 1MR5A 1N3QA 5J48A 2WZPP 3W9AA 3RYKA 2EA7A 2XH6A 1S2KA 1I9RA 3VKMA 3WDXA 1AL21 5C8CA 1NQDA 5K7PA 4P9JA 4QPIC 1RUJ2 1R081 5T55A 3KS7A 3ZSKA 3KCXA 3PNAA 3I59B 4AHZA 4AGVA 3MLKA 4FSJA 3NJZA 2AYHA 2DCZA 4IEUA 1AR62 4FPEA 5FAXA 1AR81 5GLWA 5JSOA 3MI8A 4YGDA 3GNEA 3QH7A 2OUHA 1QQP3 1YFXA 3IBMA 3HT1A 3N7LA 1BK1A 4XF3A 4AEDA 2IXCA 1LOAA 2DYCA 4AEKA 1SMVA 1AL22 5C4WB 1DQ2A 5GALA 1ASJ1 3VV1A 2Q4SA 1RINA 3KT1A 5J98B 1GV9A 1R082 2IXHA 3VZNA 1OQDA 2GMMA 4AVVA 4R9BA 3TYJA 4GMP0 1RUH1 1QJX1 5H9SA 1WMDA 4LA3A 4K6BA 4MGIE 5HXVA 1AR82 3FMGA 3NV2A 3WCRA 1WMFA 5C33A 4YM3A 3H3ZA 3J8F1 1FYUA 4P5HA 5BNOC 1OFNA 3M2MA 1BCXA 2PAEA 3V56A 4H7LA 3CL1A 3ZXEA 4EROA 4WM8A 1W39A 4OHWA 2Q30A 2BBVA 1ASJ2 1FV2A 4HN0A 4NVPA 1U5IA 1UKGA 3ILFA 5HI0A 2VMGA 5BPXA 1NA1C 1DHKB 4UXAA 4Y1XA 1YFYA 2ZGSA 3JD73 4S2FA 4NWWA 1RUH2 1IKQA 1QJX2 3H9AA 5H9PA 5GZEA 3WCSA 4HETA 5FMOS 2HWC3 1HV0A 1YO8A 1QGLA 1R1A1 1ENRA 1W6QB 5DZEA 4AXOA 3J8F2 3WDYA 5CG8A 4BA6A 1AUYA 3SH5A 1BXHA 2XBO3 5AC91 4XXPA 1O4YA 2DVDA 4KBBA 5DDJ3 4AGGA 2RE9A 4R8HA 1F9KA 4H7MA 2E63A 3GHNA 5BNPA 1DLLA 3OPZA 1FATA 1QKQA 2BUKA 3LAGA 3MW3A 4XFHA 2FZ2A 1JOJA 1XNDA 3GF6A 3E97A 3M3IA 4LBQD 4Q0PA 4XQ4A 4ASLA 1W6OB 1R1A2 3I59A 2NN8A 3R4DB 5BXXA 1RJ7A 1ZX5A 2ZCWA 4Q29A 5L36A 3VZLA 2BNNA 3N7MA 2XKOA 4I2OA 4MX3A 4RL7A 3VZKA 3IDCB 5AC92 3M3EA 2WZR1 3WQ7A 1RUG1 3I2DA 4B8EA 4FO9A 5KBFA 4I09A 4P9WA 1ZBA1 1ZZ6A 1RB8G 1TMF1 2R041 2ZMLA 5C4WA 3MF9A 5T3NA 3E6DA 3LA3A 4Y22B 4XXAA 1YJLA 1VJ2A 2R1BA 5A3MA 3WX5A 3RMYA 1DFQA 1OOPB 1WW7A 3I8TA 4ASMB 4DNYA 4QXKA 2OVUA 3VDDA 3AZVA 2DU1A 2EF6A 3VBUB 1MZEA 4Q0QA 1QNWA 5AFBA 2WKKA 5JAXA 5D1IA 1CJDA 1KQRA 2WZR2 3DGTA 1RUG2 5ABJB 4UW6A 4YW4A 2HWB1 1R093 1TQ5A 4DB5A 1ZBA2 2ES3A 1TMF2 1HLCA 3I7DA 2R042 5JCTA 1DBNA 2DCJA 4Q4Y1 4AF9A 2ZGTA 3CJIC 4K7JA 4AK3A 1NCRC 3MIFA 3AZZA 4YZ2A 4AWDA 4JTOA 2YROA 2WNUA 1B35A 1YIFA 4PDWB 3A4UA 5FMOL 2ILMA 4FP2A 3ZPYA 3QOPA 3ZX7A 4B4RA 3RPQA 4F7ZA 1FPN3 1YUDA 5LEJA 1ONAA 1S1AA 2ERFA 4GQ7A 1VALA 1UD1A 1FOD3 5JIAA 4HL0A 1PK6C 2ZGNA 2HWB2 2HWD3 3OYWB 4JGYB 2IFRA 4BMBA 2DUPA 4Q4Y2 1R1ZA 4Y1UA 2DFBA 4D7YA 3AMMA 4Q2FA 3H0OA 4QPYA 3NV3A 4GULA 3MPBA 4N43C 2Q5TA 3ILNA 3NV1A 4FCAA 4L2NA 4XQWA 5CFDA 4UW5A 1MQTC 4XYXA 1VP6A 3DN7A 1DGRA 4Q1PA 2RS33 4Z8BA 4YVSC 4D3WA 1VR3A 3QH6A 5F6KA 3DV8A 1Z7S1 2ZZQA 1JHNA 4XPVA 2B39A 3NAPB 4IEPA 2Y0OA 2R0FA 4KWKA 5GLTA 5KHHA 3SLIA 4MSVA 5GZGA 3UKNA 3CO2A 3LB9A 1V6KA 4C90A 2CAVA 2MNGA 3AJYA 4HK9A 1O3QA 4IV1B 4BPZA 1HX6A 5GM0A 4CDXC 1SLAA 1WLDA 2QZ2A 2OZJA 4GH4A 2V09A 3WW4A 1MZ6A 1REFA 5JOWA 4W6XA 1V9U1 2ZAHA 3H1MA 5I8SA 2ZX2A 4Q4X1 3RI9A 2BYVE 1FI2A 4QQOA 2ZGLA 1IS5A 3D6EA 3V0BA 1N3PA 5T5OA 4XDQA 4WVWA 1RUI1 2D6KA 2VVDA 3JD71 4IEOA 5A32B 3APBA 1Z7S2 1LCLA 3ZFGA 2W0XA 2UWAA 4XBNA 2VQAA 1PGSA 1POV3 5F1RA 4OI0A 3ZMNA 1U5XA 4AI3A 4YRDA 3UK9A 5I8YA 4S2GA 1F5FA 2XBO1 1V9U2 4PLNA 3WQ1A 4YARA 5FQ0A 1POV0 4Y1VA 4RS5A 2HKXA 4Q4X2 4X8PA 5KWRA 4Q4W3 4B29A 1N1VA 1XXNA 3TBDA 2D98A 1C3HA 3FFQA 3ZSLA 1RUI2 3JD72 4LHLA 2BVBA 2BNOA 2QZ3A 4PBPA 4M0NA 4PJYA 1AHSA 2W08A 2XVGA 1PM7A 2GNTA 3HR9A 1KDKA 4NN0A 4XBQA 5FFOC 1DYPA 1SLCA 3VHPA 3E6BA 4MH0E 2NMOA 3AMQA 3ZFEA 2XWJB 4GA9A 2XBO2 5CAZA 3VBRA 1QH6A 3THPA 1QWRA 3D0JA 3ZYGA 3WW3A 1UAIA 4XF4A 1VB4A 1V6LA 4YW2A 1LGBA 1OA2A 2GMEA 2HEVF 4C1XA 4D7SA 3TWIA 1PVXA 1JUHA 3WG4A 4UBHA 4QPIB 2W68A 2A6WA 3U07A 2OZ6A 3GALA 1LEMA 1VAVA 5JSRA 2D40A 2RJLA 2A3XA 3H1WA 2VQ0A 5SV5A 1XYPA 2QDNA 3ZYRA 1WLTA 2A6XA 3AZWA 3P3NA 1SBFA 1SBDA 3IPVA 4Q4V1 4QM9A 4BOWA 1ND2C 3HT2A 4CZSA 3B5LB 4I3GA 1JW6A 1REDA 1H9PA 2KA3A 5EJ3A 3ZSMA 4D69A 1FAYA 3N35A 4BHPA 1W6PA 2R063 5JIUA 3ZVXA 1RIRA 1S0EA 1YNAA 3ZXDA 4HANA 2DFCA 2OA2A 1AXZA 2DURA 3ZXGA 2WS93 1Q8VA 3M3QA 1ULGA 5BNNC 1HXS3 5C9AB 4YVWB 4AVSA 2BPA2 2TEPA 3WD5A 4MZUA 1RVF1 4Q4V2 2BFUS 4NHKA 3U4XA 3BOPA 3ZFFA 1JYIA 2VNOA 4O9EA 3O0WA 4JDMA 1ZZCA 3VBSC 5JVVA 3ENRA 2PLV3 4GIQA 2HWD1 1CONA 1RUE1 1PVC1 3WT3A 3WUCA 1Q3EA 4AI2A 2DCTA 1QJY1 2JE7A 2R30A 1LOFC 4QPGA 2B46X 3RWNA 4G4FA 1CN1A 4ITCA 1LESA 2ZS6B 4IV3C 4COZA 3EHKA 1OFSA 1CAUB 2VW2A 3AMNA 3KGLA 1LB2A 3ZDSA 1RVF2 4CEWC 1GNZA 2CGPA 1UZYA 3OBTA 1RUJ3 1HQWA 1AJOA 2V5YA 4JGZA 4XFBA 1QXRA 3AP5A 1QY4A 2GAUA 2ATFA 1YYNA 3NO8A 1YWKA 3VKNA 2HWD2 4AI0A 1BMV1 4AFCA 1RUE2 1PVC2 1A8MA 1WD3A 1AR63 1BBT1 1LHNA 3ECQA 2JG9B 3HQXA 2CWMA 4JTNA 1LULA 1QJY2 1DQ4A 3FC0A 4LBMA 3WG2A 2ET1A 3GYDA 1AX2A 3MEPA 3WR0A 1JYCA 4QPIA 2P3KA 4EWAA 4XIOA 2G9GA 4HKOA 1AL23 1Y7BA 4FPFA 2PA7A 3ETQA 1YIPA 2H6CA 1PNGA 1WD4A 1U5ZA 3AMPA 1R083 2BW8A 4YYOA 5JI7A 1KS5A 3RYPA 1DDLA 2V73A 3TNPB 1BMV2 2GH2A 1CVNA 1BBT2 3MYXA 4YSFA 1AR83 1G9FA 1D4VB 1ND3C 4N9IA 1WCKA 2Z2SB 2A5ZA 2UWBA 2DWRA 4B4QA 1MS3A 4Y24A 1ZZBA 4Q4W1 2RMU3 2NZ9A 1CX4A 1PMIA 1WW4A 1G6NA 3BCWA 4LUKA 3OY8B 3VKOA 3N3HA 3CF6E 3IN9A 5FPXA 4XFFA 4K21A 3UL2A 3S0MA 1QU0A 1RUH3 5H9RA 4FP3A 3MW2A 1QXPA 4N7IA 5BNOA 3AP6A 3O0XA 5K9YA 5HCAA 4A3XA 4I30A 1RMU1 2MPFA 2C0ZA 1LECA 3J8F3 1O91A 4Q4W2 4ISQA 3DPRB 4OFGA 4FPJA 1NA1A 5J37A 4Q0SA 3DL3A 5AVAA 4RGGA 4XILA 3M7AA 2LUWA 5C8CB 3LZZA 3KD4A 2E9QA 4CEYC 3VL8A 1Q43A 3EJKA 2VG9A 4ZXKA 3VBHC 3C3VA 3UJQA 3E5QA 4AYUA 4HBNA 2VOKA 2E7QA 1R1A3 5L73A 1RMU2 3JB4C 3KCYA 1VLNA 1D0HA 3TAYA 3PVBB 2X5IC 4TYSA 2ZA9A 3BODA 5AC93 3EO6A 5F5QA 3WW1A 1DGRN 4AEDB 1COV3 4UW3A 1XE8A 4KWLA 4F3JA 1QHDA 4FTBA 3LGRA 3M8LA 1RJ8A 2PHDA 5IUQA 2B5HA 2ZMNA 1X7NA 4YM1A 4XJAA 4OLLA 4BWOA 3FBYA 1IGOA 1Q8PA 4C0HA 3R0RA 5IK5A 1J3PA 5CNAA 2A3YA 3WDUA 3WLUA 5F9TA 1VBE1 3ES4A 2Y38A 3QBQA 5EV7A 4CDXB 4Q0VA 1A78A 2WLQA 1EAH1 2A6VA 4V1PA 3UKTA 3M4FA 1G9CA 3BALA 2JJ6A 2WZR3 3TRSB 1RUG3 5I93A 1FMD1 1WLCA 1C57A 4J1XA 4WM8B 3GZTB 1ZBA3 1RUD1 5I0UA 4N53C 2JG8C 3QD6A 2R043 3ASIA 2ZHNA 3VBOC 1BEV1 3D0SA 2BTVC 4LBLA 5D8AC 4GALA 4FOYA 3AKPA 4JCKA 4LNVA 1PZ8A 2XJSA 4OHVA 4TLFA 3HIFA 2P34A 2ZHMA 3M70A 1VBE2 2A3WA 4JVAA 4M01A 4MXWA 4FQZA 4LA2A 1J59A 1REEA 3WG1A 1SCSA 4AFMA 1SEFA 1EAH2 2E53A 1ULDA 1PZ7A 1WW5A 4HVRA 5DZFA 3G6JB 2OIIA 2RS51 4YNIA 4NO4A 2JECA 1AR91 1FMD2 2QKDA 2HWB3 4R52A 3CJIA 5K0UC 1GZCA 1RUD2 1NCRA 2EALA 4IETA 4XFIA 4COVA 5A33A 3J9SA 4AHWA 1ZVFA 5JDBA 1IPJA 4QQ2A 4IEWA 1BEV2 4Q4Y3 5BNPB 2VVEA 4FXKB 4TSVA 2E7AA 5KC6A 2QFEA 1L3JA 1S0CA 2Z69A 1S0IA 1K5MC 5T5JA 4XTPA 5LK7B 1WBLA 4HKLA 4QGLA 4RR3C 4F83A 2NLRA 1EY2A 4I0BA 3FUQA 1PK6A 1NLRA 1AJKA 4G9SB 3AJZA 2C9AA 2YMZA 2VPVA 2RS52 4B7KA 1AR92 2P2KA 1IZ3A 3L2YA 3JCIA 1S0JA 5L19A 4NHLA 4N43A 2CL2A 1JTZX 1VRH1 4P9GA 1RITA 4E4SA 4Q8KA 3DKWA 2RMU1 1C1LA 1MQTA 4Q1RA 5ACA1 3SMHA 1O5UA 2A7AA 5KHIA 3E6CC 3KZ4C 4DS0A 2VOXA 2D6MA 5T52A 5J96B 4YVSA 2I07B 1KXGA 1AXKA 4EN6B 3KQRA 5I0RA 4SBVA 1CAWA 1OLQA 2XVKA 1LJ7A 1XYNA 3FFZA 4DINB 1MVEA 1UL9A 2YGLA 1NE4A 2ZGRA 1Z7S3 1LHOA 3VDDB 4CDXA 3ZXFA 4QT6A 5FLIA 2D93A 2GC1A 2ZX1A 4ZU4A 1VRH2 2RMU2 2ZZJA 2EXIA 5ACA2 1V9U3 1V6IA 2SLIA 3AP7A 1JH5A 5BNNB 3TOJA 1CD3G 3GBGA 2EIGA 4Q4X3 4K9SA 3TN91 1ZRFA 1E57A 1TNRA 2QUOA 5GKAC 3ROUA 5CADA 1O3RA 2WNUB 1B35B 2NMNA 2XGXA 1RUI3 2P3IA 3AYDA 3CU7A 3SH4A 2B9UA 1BYHA 1AVBA 2CWSA 4JRAA 5LRRA 3PTYA 1H4GA 1ENSA 1Q8OA 3AZYA 3R4SA 2XKPA 1ULCA 5KXDA 4FQ4A 5IK4A 2XJPA 2XLFA 2VW1A 3JBG1 3OGJA 2QDRA 2OYZA 5FO9B 1MS5A 4RQPC 4NHMA 2ZKLA 2CY6A 2N7GA 4P9YA 1H2KA 3RZZA 1COV1 3TN92 4YW3A 2EAKA 2CYFA 4K20A 3KMHA 5CFDB 1SLTA 1CESA 1RGSA 4HPKB 1MZ5A 4KQ7A 5EXOA 5LK5A 4XMIA 4LUMA 4GB31 1DF0A 5JZGC 3H7JA 5GLVA 2WFPA 4AG4A 5CB7A 1LODA 4CTEA 4URTA 3JBG2 1JN2P 1CR7A 3AKQA 4JQRA 5CFCC 4GH4B 2XUMA 2AREA 1JUIA 2JENA 5FBZA 3JZVA 1COV2 3LKJA 1LHUA 2WWSA 4XJZA 4CDUC 3RJ2X 5GZCA 2PHFA 3WHUA 4F8AA 2AENA 1KJLA 3V0BB 2Z79A 5FLJA 4AEJA 2BNMA 4GB32 4L9BA 1MS0A 1XU2A 4A7YA 4COUA 2YV8A 2KXLA 1DQ5A 1ZNPA 3BOWA 3ZFGB 3W58A 1LHWA 5DUWA 4P9IA 1ND2A 4PLMA 5BV6A 5DUXA 4A7ZA 4Q4V3 1RUNA 3WY6A 3VUOA 4QQHA 1NE6A 4LO4B 4WM7C 1O5LA 1H9WA 3ME2A 5FQ0B 1S0FA 5J7MA 4YZ4A 4RS5B 4U36A 1ULEA 5BNNA 4DRVA 1C5HA 2ZJCA 2ZGMA 2D7FA 2IC1A 4COYA 1GR3A 5DZGA 1YLLA 4PBOA 1OPMA 4ONUA 3WP3A 2R1DA 1RVF3 3GBWA 3VBSA 3LA2A 3NV4A 3RMXA 2O1QA 4CDWC 3AYCA 3O5SA 1VAMA 3ZFEB 1HQLA 4GKXA 1TE1B 1YFUA 2XJQA 4LO7A 5J09A 3VBRB 1CJPA 1PZ9A 4EWDA 2PAMA 1RUE3 1LOFA 1PVC3 1VBA1 4LT5A 4LLFA 2C1FA 5IT6A 2BGCA 5A3LA 5EYXA 1QOOA 2YPJA 4IV3A 4EN0A 1QJY3 3HBZA 3MZHA 4DMIA 1UIKA 4DZGA 2X53S 5DUVA 1HQNA 2A70A 4CEWA 1ZRDA 4HPKA 4EJRA 4HSJA 2KM2A 2JE9A 1VBB1 3ZIWA 1V70A 3IPVB 4H14A 3IWZA 1OQ1A 1H8TC 4Z82A 4GMP1 4N9HA 1VBA2 4Z2WA 1H1IA 1BBT3 4IQPA 1EV11 2IWGB 1B09A 2XB6C 1UPSA 3AKSA 1W6PB 3O7OA 5EZWA 1NLSA 2CGOA 4RA0A 1UF2C 1G9BA 5E88A 5JPNB 1VBB2 2H0VA 1HRI1 3AMHA 3B9CA 3POWA 2Q8OA 2VNGA 3OD4A 3ZFFB 2PHRA 1ND3A 1Q5OA 1OMIA 1RUOA 3VHRA 2VUAA 2I2SA 3IIAA 2XLGA 4IL7A 1EV12 3QLQA 1RHI3 1UU5A 4FVVA 1N1TA 4JV4A 4N53B 1F31A 4LHNA 3FLRA 3RJRA 2UU8A 4MXVA 4QPGB 1HRV1 4Y1YA 2GC2A 5TSWA 4LHKA 2GMPA 1X50A 4OZXA 2RM21 1HRI2 2H0BA 2R071 1NCQC 2VY0A 4JGZB 3EQEA 4FXGB 4AEMA 4PCRA 4A7KA 1VBD3 2GU9A 4M0HA 1V6MA 3DUIA 2UYBA 5B2GB 2D3PA 3IDBB 3OBRA 1D0GA 1AZDA 2ZAAA 1XQNA 2GNDA 5K0UB 4TZDA 3NWKA 1RMU3 4FOVA 5JWPA 2WINB 1J3QA 2DTYA 2PAKA 4XF0A 4XOGA 5FLHA 4LBJA 2BWCA 2RS11 1IHMA 1UW8A 1HRV2 1GLHA 2WT0A 2EXJA 1WLWA 4LTAA 4HSLA 2EVXA 1J1TA 4CEYA 5JOZA 3WVJA 2RM22 3GHMA 3CEWA 3VBHA 3USUB 4QGNA 4ATEA 2YZ4A 4YGBA 2R072 1DZQA 1HDKA 4FOWA 1XU1A 3L9JT 4PIZA 2DCKA 3VBFC 3PHMA 1V00A 5CG9A 2F4PA 4ZU5A 1YI7A 3THTA 2JICA 4FBFA 2IXKA 3VHNA 1YJKA 1YXWA 1XYOA 2X5IA 2D6PA 4GXLA 1Q8SA 2B42B 5T5PA 3X29B 2PHLA 2PHUA 1HV1A 2RS12 1KJRA 2D3SA 4EV0A 4L99A 2G9FA 1Y3TA 4OI1A 3PJQA 4OI2A 4E27A 2DTWA 2H6BA 4YG3A 1XRUA 1H0BA 3ZSEA 3P3PA 4BQ1A 3WV6A 1GSLA 1PGW1 4COWA 1KDMA 2E51A 2AGSA 4HLTA 3CJXA 3NSTA 2GC0A 2OW4A 4PF5A 2QJVA 4QGMA 1VBE3 4FPCA 1QMJA 5BNOB 2UYAA 3PVOA 3AK0A 3VLBB 3ZO0B 4LE3A 3ZN5A 3FWEA 3M3CA 3RNSA 4NOTA 5T5LA 1EAH3 4XQDA 5CU1A 1QH7A 4HK8A 3BB6A 2NP0A 3VZOA 2ZGOA 2JG8A 4N53A 4Y5Z0 4BMEA 1FMD3 1NA1B 3VBOA 5BUVA 1DIWA 2P17A 5D8AA 4Y26A 2LALA 1RUD3 1QXJA 4I3PA 1BEV3 2MEV1 1LGCA 1W2UA 1PGW2 3WP5A 1N1SA 1GKBA 4XJ8A 3NKTA 1AXYA 1IKPA 2UWCA 2VUJA 3JUUA 1H1AA 5GLZA 2TNFA 4K1YA 3KGZA 1U12A 5FCCA 1XNBA 1YCIA 1DU3D 4Q0UA 1C8NA 2BQPA 5K0UA 4W65A 2RS53 4BLJA 4FAGA 1AR93 1NYWA 1MZFA 3T1LA 4MUVA 3WUDA 1PO11 5LRSA 2DVAA 3WHTA 1K5MA 2MEV2 2VXRA 4Z07A 2BVVA 3AKRA 3H1YA 1AR71 4RR3A 3USUA 4KGQA 1SBEA 4QQPA 4R9CA 1F2NA 4H55A 4M00A 4XE9A 4CRQA 1KS4A 3AKTA 1MEC1 2CV6A 4I0WB 4FPYA 4YZ1A 3MGUA 1WUVA 3LSEA 1IS3A 1KFUL 2ZX4A 1RHI1 4Q27A 4ES9A 2ZGQA 5HCFA 3B01A 4BLIA 1VBC1 1PO12 2WFF3 3KB5A 1DQ6A 1VRH3 4PIYA 2D6LX 3ELNA 5ACA3 4L92A 1AR72 3DF0A 1JXNA 1GZ9A 5CBLA 1AYM1 4AFBA 1OOPC 3K51A 4YGCA 3IT8A 1RC6A 2EXKA 1MEC2 2WC2A 2BFUL 4LO6B 1GQHA 4Y1ZA 3VBUC 2ZOEB 4KG0A 4LBNA 4MXWB 3SCFA 1VBD1 1V6JA 1M06G 1TME1 1RHI2 3ZYJB 5ABJC 2NPIA 5JOXA 5JOYA 2FMYA 1VBC2 1GNHA 4R9AA 2B7YA 3CJIB 1NCRB 4P9LA 4XJUA 5A33B 2R32A 4AQ6A 4MGYE 5H9QA 3TN93 1AYM2 3AP4A 5T50A 4PDWC 3MIDA 4WV8A 2RR11 4L8QA 4R9DA 2DVFA 2FMDA 3KT7A 1VBD2 1C4RA 1TME2 3TNQA 1PK6B 1AYN1 5KC5A 1S55A 4QX5A 1PIV1 4XFAA 2WQZC 4HFSA 3B3QE 3JQXA 3CLPA 4RQPA 4JGYC 4LBKA 2LTNA 4S2HA 2A75A 3AX4A 3JBG3 4Y20A 1X33A 4FOQA 4N43B 4PLOA 3KLSA 2QVSB 1LENA 1MQTB 2YY1A 2AUYA 1DZRA 2PELA 4BH9A 1GYKA 2EXHA 2QNKA 2DVBA 2RR12 4YVSB 1FV3A 1IQAA 5JZGA 4U2AA 2AR6A 2WIIB 1VIWB 3HWJA 1H2MA 1CAWB 3AZXA 4GB33 2SBAA 3B02A 3NAPC 1AYN2 2GN3A 4JC1A 1PIV2 1DQ1A 1GFF2 4DY5A 4IEVA 4O9GA 1UCXA 2VULA 4SLIA 5CFCA 4IV1C 5AFEA 2VH9A 1NG0A 1IS4A 4G3YC 1CPNA 5KHJA 3WDVA 3ZXAC 4LULA 5EWSA 4CDUA 3ZIXA 2ZACA 4YGEA 4C91A 1OHFA 2XJRA 3R4UA 4HMZA 3MW4A 2K0GA 2QCSB 3SCGA 2D97A 4AE2A 2CNAA 2HWE1 4AHYA 4MGKE 4KU8A 4E9KA 3WZ1A 2WJSA 2XJUA 3Q9OA 4YZ3A 1GZWA 3ZYIB 1ZBE1 2MHFA 2XJTA 4JRLA 3WOGA 3OCPA 4NR1A 1S0BA 4WM7A 2GH8A 3N36A 4K40A 4GKYA 3MLLA 3ATGA 1NOVA 1DYKA 3ZMOA 4KWJA 3USSA 1UIJA 3QCWA 4CYDA 1MVQA 4CP1A 5LEKA 2O8OA 3OTFA 1S2BA 2HWE2 3AP9A 4XW3A 1LHVA 1ENQA 3M1HA 3VGIA 4HN1A 2AH2A 1ZBE2 5CA6A 4CDWA 1OQEA 1YRZA 5CVRA 1UU4A 5HCBA 3SHRA 1W6NA 1IPKA 1J58A 2ZHLA 1M4WA 3ILRA 3NW4A 5JR7B 1UKRA 3RYRA 2I74A 4RSUA 1SFNA 3WINE 1UU6A 3B7MA 3WP4A 3PVNA 1VBA3 2VMHA 4AW7A 1RUF1 2WFF1 4XFGA 4FTSA 1J1LA 3PMEA 4FPOB 4M3CE 1PO21 3VBFB 2R49A 1SACA 5I0SA 3GZUC 3JU9A 2DVGA 3RS6A 4UBGA 1AX1A 4DFSA 4XFCA 4HVQA 3V0AA 2P37A 1VBB3 4YW5A 1ND2B 1H8TA 2O0OA 1X8EA 4W6WA 3ES1A 4KNCA 2D5FA 2A73B 4CP0A 2IZWA 4GMP3 1RUF2 1OA4A 2WFF2 1EV13 2GNMA 1OKQA 1ZZ9A 5E89A 4BZ4A 3I54A 3LCPA 4WBBA 4OHZA 4N90A 1PO22 1XE7A 2VGDA 3IKWA 5DXDA 3L2HA 2CTVA 4E2SA 3EBRA 1LOBA 5C9AC 4YVWC 2GN7A 2WNVC 4BYYA 1O7FA 4JAAA 4QU2A 2VOWA 3WQ0A 1LOCA 1CQ9A 1HRI3 4XJWA 1HIXA 1TNFA 3FLPA 5L7OC 2VECA 3VBSB 3H50A 3H7YA 4XEZA 3VZJA 4YW1A 4R4ZA 5DUUA 1ZYBA 5AVPA 1T6GC 1O3TA 1G9DA 1ZRRA 2O8QA 1O4ZA 4IV3B 2DF7A 4M3CA 2B8MA 3AYAA 4AGRA 4DRRA 3S30A 1HRV3 4K1ZA 2E6VA 3VKLA 3KCCA 4CEWB 5DG2A 1NCQA 4HT1T 4XBLA 4ATFA 2RM23 2ARXA 2ZMKA 4AVAA 3N4MA 2R073