4YVWB

Crystal structure of an enterovirus 71/coxsackievirus a16 chimeric virus-like particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
236
structure length
224
Chain Sequence
b'GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRSGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMQLCKDASDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Crystal Structures of Yeast-Produced Enterovirus 71 and Enterovirus 71/Coxsackievirus A16 Chimeric Virus-Like Particles Provide the Structural Basis for Novel Vaccine Design against Hand-Foot-and-Mouth Disease
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
total genus 32
structure length 224
sequence length 236
chains with identical sequence F, H, K, N
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yvwB00
4QPGC 4CEWA 2HWB2 1HRI2 4JGYA 1W39A 1EAH2 1TMF2 1RUE3 1MEC3 2BUKA 1VRH1 1TME3 1VBD2 1F2NA 2RM23 4JGYC 5D8AC 1QQP2 1NCRA 1PVC2 2FZ1A 1QJY2 1NA1B 1BBT3 1RUI3 1AL21 4GB32 3VBRB 1ASJ1 4Q4Y3 1V9U1 4BCUA 1NCRC 2WS91 3CJIC 4CEYA 1BEV1 1POV3 2RS32 5C8CB 2HWF1 1ND3C 5ACA1 1VBC2 4Q4X1 5ABJB 4CEYC 1Z7S2 5JZGB 2PLV2 2FZ2A 1OPOA 2HWD2 2DF7A 1FOD3 4RR3B 1AYN2 1ZBE1 5BNOA 3JD72 1HXS3 1RHI3 5J98B 1AR83 1CD3G 1RUH2 1VB4A 1VBB1 2ZZQA 3DPRA 1K5MB 2RS52 5GKAC 4IV1B 1QJU2 1MQTC 2WWSA 3J8F2 5A33B 3VBSB 4JGZA 1RUF2 2BBVA 1RUG1 1HRV1 2R072 1B35A 2BPA2 1ZBA3 3ZFGA 2WZR1 2X5IB 2RR11 4WM7A 1TME2 1B35C 4RHV3 5C4WC 4YVWB 1PO11 1AR61 2HWB3 5K0UB 4WM7C 4Y4YA 3VBHB 1EAH3 3FBMA 1TMF3 4N53A 2R042 1VBD3 3JB8A 1PGW2 2HWC2 1C8M2 1PVC3 4RS5A 3ZFEB 1NY72 1QJY3 4Z92B 1RUJ2 4RQPA 4CDWB 4GB33 4RS5C 1R1A1 2RS33 4RFT0 4GMP0 5BNPC 2XBO1 4AEDB 1VBC3 3VDDA 1Z7S3 4GH4A 1IHMA 2PLV3 2R062 2HWD3 3NAPA 1ASJ2 1AYN3 3VDDC 1FPN1 3JD73 2WS92 2IZWA 4GH4C 1AYM1 1BEV2 1RUH3 4IV3C 4CDXA 4GMP1 2RS53 3JBG1 5BNNA 1FMD1 3VBUB 4QPGA 2WFF1 2WLPA 3J8F3 1AR71 1RMU2 1RUE1 4CDXC 1PO21 2MEV3 2BFUS 1RUF3 5BNNC 1EV12 2RS12 4PDWB 2RMU1 2RM21 5CFCB 2R073 5D8AA 3VBFB 4Q4W1 4N43B 4Q4Y1 1AR91 4WM8A 1NG0A 5LK7B 5C9AB 1NA1A 3CJIA 1HRV2 2R043 4Q4V1 1ND3A 3JB4C 4WM8C 4CEWB 2WZR2 1NA1C 2RR12 2HWC3 4JGYB 1C8M3 1FOD1 5C8CA 4SBVA 4YVSA 2GSYA 1RUJ3 1PO12 1AR62 3S6PA 1NCRB 5C8CC 1HQNA 4YVSC 2VQ0A 5FMOS 1VAKA 5ABJC 1RUC1 1MQTA 1OHFA 1X36A 1RUD1 4CEYB 1RVF1 2R063 1BMV1 1AL23 1ASJ3 1AUYA 3VBOA 2MEV2 2WS93 1BEV3 5AC92 2HWE1 1NCQA 3TN92 3VBSC 5C4WA 3ZXAC 5BNOB 1QJX1 2QQPA 2HWB1 3VBOC 1RB8G 4Q4X3 1HRI1 4QPIA 1VBA1 2TBVA 3DPRB 1RMU3 1TMF1 1NCQC 3ZFFA 1EV13 5A32A 2RS13 4CDUA 1PIV1 4QPIC 1FPN2 3M8LA 1QQP1 4JGZB 1VBB3 3ZFFC 4CDUC 3JBG2 1ND2A 1R081 2WFF2 5K0UC 3ZFGB 5L7OA 1AR72 1VBE1 1PO22 2RS31 4WM7B 1ND2C 1D4M1 5BNPA 1VBC1 1HRV3 2RMU2 5L7OC 2WZR3 2PLV1 2RR13 1VRH2 4CDWC 4N53B 4Q4W2 5FOJB 1COV1 1AR92 1PO13 1H8TB 1AR63 4FTBA 4RS5B 4IV3A 1AL22 1QJU1 4AEDC 1DDLA 4Q4V2 4RQPB 1V9U2 3J8F1 1R091 5DDJ1 4EJRA 2HWF2 5ACA2 3VBUA 1VB2A 1OOPA 4Q4X2 4FSJA 3LOBA 5CFDA 3VDDB 4NWWA 1POV0 1MEC1 5J96B 1TME1 3VBUC 1ZBE2 5AC93 1OOPC 1RUC2 3NAPB 1PGL1 3TN93 2XBO3 5CFDC 1RUD2 1E57A 1VBB2 4CDQB 1BBT1 1RUI1 3VBFA 4CDXB 1BMV2 4QPGB 1FPN3 1PGW1 1SMVA 2HWC1 1POV1 3IDEA 3VBFC 3HAGA 1AYM3 1RUG2 1NY71 2HWE2 3VBRA 4GMP3 1RUJ1 3JBG3 1FMD3 1QJX2 5C9AC 2WFF3 1NOVA 1VBA2 5D8AB 1AR73 3VBRC 1PO23 4CEWC 1HX6A 1HXS1 1RHI1 5ABJA 1PIV2 1AR81 2RMU3 4WM8B 5JZGA 3CJIB 4RR3A 2R061 4NWVA 1VRH3 4Q4W3 1R082 2XPJA 1ND3B 1WCDJ 1QJZA 5JZGC 1AR93 1K5MA 4RR3C 1VBE2 4IV1A 2ZAHA 4YVSB 1D4M2 1ZBA1 5A33A 4Q4V3 3VBSA 1V9U3 1K5MC 1RMU1 4IV1C 1R1A2 4RHV1 1EV11 2RS11 1X33A 2HWF3 2XBO2 5ACA3 1MQTB 1COV2 2X5IA 2ZTNA 1EAH1 2BFUL 5BNOC 1VBD1 4YVWA 1ZBE3 1RUC3 2X5IC 1R092 5K0UA 3DPRC 5DDJ2 3VBOB 1PVC1 1RUD3 4FTEA 1AYM2 1QJY1 3VBHA 1RVF3 4YVWC 4GB31 1FMD2 1NCQB 1B35B 5C4WB 4JGZC 1C8NA 4QPIB 3VBHC 1RUE2 4LLFA 3ZFEA 1MEC2 1RUG3 4CDWA 2HWE3 5A32B 3ZFFB 1PGL2 3ZFGC 2RM22 2Y26A 4CDUB 1GFF2 1QJX3 1Z7S1 3ZFEC 1HRI3 1BBT2 1RUI2 1VBA3 2HWD1 1AYN1 4Q4Y2 4AEDA 1ND2B 3JD71 1H8TA 1PIV3 1RUH1 5L7OB 1CJDA 1QQP3 2RS51 4N53C 1M06G 5BNPB 5FMOL 1H8TC 1R083 2MEV1 1RUF1 1FOD2 1VBE3 5AC91 1F8VA 4RQPC 3TN91 1HXS2 1RHI2 1D4M3 2R071 1AR82 1AL0G 4GH4B 1R1A3 4PDWA 4IV3B 5CFCA 2GH8A 1A6CA 1COV3 4CDQA 1RVF2 4FTSA 4PDWC 3NAPC 2R041 4N43A 5CFCC 5BNNB 1QJU3 1ZBA2 1OOPB 4CDQC 1C8M1 5C9AA 1R093 5CFDB 5DDJ3 4N43C 4RHV2 4Y5Z0
chains in the Genus database with same CATH superfamily
1LENA 3RQ0A 1ENRA 2HWB2 3ETQA 5FPZA 1SZBA 5GLUA 1MZEA 2VBDA 2QQMA 4JGYA 2VQTA 5JSRA 1TMF2 1RUE3 2P6HA 5FRAA 1OUSA 2B9VA 2Y38A 2ZMLA 2VL4A 2VZVA 1DGRN 1TME3 4MHUA 4NPLA 4YSFA 2QFEA 2NMNA 4OUMA 5AFEA 2EXIA 2J1UA 1QQP2 3KT1A 5HV0A 3B69A 2O8OA 1JZ4A 2VH9A 3LFIA 5FOBB 3K4DA 4I01A 2D6LX 1WW4A 3T4HB 1XB9A 1AL21 3M3CA 4AEKA 1H2KA 3I3MA 3WQ7A 1YQ6A 1NCRC 4XILA 4JDMA 2GC2A 2FDHA 5DPNA 3SEPA 2HLEA 2JIJA 1KDMA 3AM2A 3U14A 1H4HA 2HWF1 4E2SA 2ZPXA 1BLZA 3WDVA 2LTNA 4FOVA 4QD2A 1PVXA 4NIIA 1A34A 3NSTA 3WXPA 3ZYBA 3MV11 1Z7S2 3SH4A 2WYSA 2OUJA 2SBAA 4QAWA 2PLV2 2EF6A 1OPOA 3A23A 4YZ2A 4YPJA 2FZ2A 3ZX7A 4CP9A 1AJOA 4FP3A 1RHI3 5FIXA 4AL9A 3RPQA 1OVPA 5J98B 5FZ6A 3ST7A 1CD3G 1HLCA 1RUH2 4GWJA 1K5MB 3G7DA 3ZYFA 1UZZA 1H2MA 2VXRA 1K12A 1QJU2 3FBYA 4LBOA 2D7FA 3PMSA 1U5YA 4HSLA 2UWBA 4AFDA 5DN2A 3U07A 4YZ5A 1CPMA 3B93A 4KI5M 2OPWA 5DAQA 3H3UA 5C5UA 1RUF2 4R52A 5FZOB 4ZPIA 3UGHA 4P9JA 2D6MA 1HRV1 4LKDA 3TNQA 1OLQA 2WWJA 1CVNA 1B35A 3ZFGA 2WZR1 1QNWA 1BJQA 1XU2A 2V72A 3HBZA 4QX1A 4XIKA 4XZPA 2RR11 2WR9A 4CU7A 1MS1A 1O8SA 5C3QA 2R32A 3AVRA 3LA3A 1W9YA 5FP3A 5H9QA 3T2OA 3PLQA 1PO11 3Q9OA 2F6BA 2KR2A 1WMFA 2XHKA 3CHXA 3JU9A 5K0UB 2ERFA 3AXEA 4AQ2A 2P2KA 4N53A 5LBBA 2B39A 1DFQA 2QNKA 4YLZA 1VBD3 2IFWA 1UYZA 2E53A 2HWC2 2YBPA 1C8M2 1S0BA 4A7YA 4XXPA 1OBNA 1DLCA 2BGCA 5CBLA 1PVC3 2YU1A 4QHZA 4B7KA 5LBEA 5IUQA 2AEYA 5DMYA 4CDWB 4GB33 2DUQA 2WLQA 3T30A 2VU9A 4L8QA 3W9AA 1UD1A 2VD7A 2FQPA 3OEAA 2E32A 4KG0A 1HB2A 1R1A1 1BK0A 4RFT0 2GAUA 5FXXA 4YZ4A 5D21A 4AEDB 5IFTA 1E5SA 4IEVA 3KT4A 4IEZA 4HK9A 1D2SA 3D8CA 2GNBA 5GM0A 5J36A 1F4HA 1IHMA 2R062 4BQ2A 1OD5A 2J22A 3BU7A 3NAPA 5A7OA 3UYJA 5FR3A 3V0BB 5EYYA 2EIDA 1OD3A 1QNYA 2VUJA 3JD73 1C1LA 2VMIA 5F5IA 1UU5A 4XMAA 3HR9A 1W3XA 2JG8B 2V5YA 2I07B 2AYHA 3H0OA 3O12A 4GMP1 3OSDA 4IV3C 4YG6A 4CDXA 1QJEA 5CKMA 2WZEA 2HBTA 2TEPA 2XHNA 2WLPA 2VTFA 1N1VA 3AZXA 3J8F3 1ZZ9A 2ZEZA 4E4HA 1W6NB 2RDQA 1RGSA 1MZ6A 2MEV3 3MZHA 4ONUA 5BNNC 4PIZA 4IGQA 4PDWB 5FKCA 4BZ4A 1UAIA 3CU7A 2WFPA 2R49A 2RMU1 4IESA 4GKXA 3WW4A 4CXYA 1MS9A 1JZ5A 5SV5A 2GC1A 1GZWA 4QGLA 1SACA 2XKOA 1UMIA 4Y1VA 2ZZJA 4D6QA 3VBFB 1H1AA 1VR3A 2D6KA 2O0OA 1I1EA 3POGA 3VD3A 1FV3A 5FMBA 1D4VB 4ZU5A 3H1WA 4E9KA 2VZRA 3KV9A 1V00A 4META 3WNKA 1NG0A 4GXLA 2Q8CA 4OI4A 1NA1A 3CJIA 3DECA 2UYAA 3VZJA 2CDOA 1NLRA 4NPRA 1WMXA 2BDRA 5DG2A 1HRV2 3WQ0A 2R043 3ZN4A 2WZR2 1O3TA 2WNEA 1H2LA 2IVIB 3RZMA 2MHFA 2RR12 3R05A 4JGYB 4ASKA 3MHZA 1FOD1 1K3IA 1WGPA 1DQ5A 3BIEA 3NNLA 4LK6A 1H6XA 5B4XA 3ZYJB 5FZ7A 4GULA 3VB9A 3POJA 4KU7A 1PO12 4CP0A 2ATFA 3U1XA 2WN2A 5DAXA 2DUPA 5C8CC 1F35A 2VQ0A 2C9AA 1WLDA 3WQBA 5A6QA 1DG6A 2WZ8A 4BOWA 2QQUA 4U36A 4S2DA 1VAKA 5ABJC 1Q43A 1MQTA 4DUWA 1MS8A 4NN0A 3SNMA 1CQ9A 1UYYA 3PDQA 2HYXA 1FI2A 5CIRA 3SCFA 3PVEA 2A1XA 2BVBA 4D6RA 3AP6A 4ZHNA 4QMAA 3WNPA 4I30A 2WA4A 4FVVA 3I4IA 4H14A 4Z2AA 4MXVA 3I59A 1ENQA 2IWGB 1BMV1 1NE6A 3VKMA 5JVVA 3CKHA 4OFGA 4V2WA 5C3SA 2PA7A 3DN7A 1XE8A 3VBOA 1A8MA 3AMHA 1YIFA 4V2VA 3VL9A 3OGJA 3OPWA 2KXLA 4CCKA 1DU3D 3KCXA 4HKLA 5LY2A 4AFMA 3ZSLA 1SLIA 3JXSA 4Y20A 3WT3A 3VBSC 5C4WA 4NAMA 4CP9B 1OLME 4DUXA 3GHNA 4CA9A 5A3PA 4WZCA 4QPIA 4I2OA 1W8WA 4E27A 2WNVC 4LO8A 5KHGA 3BTXA 1JW6A 1NCQC 4LJHA 3B00A 2QQVA 5HCBA 4MUVA 4C1WA 4CDUA 4URAA 3RZLA 1PIV1 2G9FA 4LITA 1UMZA 4DO0A 3WDXA 2AENA 1OLMA 3ZDVA 1UXXX 3HMYA 5E6HA 4NJ4A 2WWUA 4BPZA 1LODA 1TZOA 3LOIA 4COUA 1L7QA 3IPVA 3WX5A 4YRDA 1N47A 1QXPA 3ZFGB 3MIEA 2VNGA 1V6NA 1BKZA 1RJ8A 4ZS2A 2OS2A 2RS31 5FQ0A 1ND2C 3H8XA 1WZXA 3MFAA 2G9ZA 4YW6A 5IWFA 3SQOA 5BNPA 2RMU2 2BTVC 3GJAA 4S2GA 4UXAA 2YHJA 4EWDA 4YZ3A 1W06A 4C0HA 4NO4A 2Y64A 3OCPA 1YXWA 4YGEA 3CO2A 4DOUA 2PAEA 1JMUB 4N53B 4QDSA 3FC0A 1SBEA 5LA2A 4BH9A 4BE3A 1ODMA 4TXWA 3H9AA 5A7PA 1AR63 1YFWA 3N9MA 2JB8A 3A0NA 5JIUA 2P6CA 4AGRA 4Q27A 1POQA 5A3NA 4OI0A 3ECQA 3PVOA 3VHNA 1LEDA 4UAPA 1GANA 3MIHA 1S4CA 3GF6A 1R091 3GCXA 3H42B 4AG4A 4BLIA 3MF9A 4UYBA 2Y60A 4L99A 3U78A 3VDAA 4EJRA 2DBNA 5ACA2 5T5OA 3VBUA 4FPFA 1OOPA 3HNBM 5I0RA 3WV6A 4W6XA 1Q3EA 3S5QA 2QCSB 4L0PA 4NWWA 5LA9A 3LDRA 4CXXA 3T08A 2EAKA 4JKLA 2JECA 5CA6A 3DCQA 3BODA 4PI2A 1TME1 3SMHA 1T6BX 3NQHA 3NAPB 5L19A 3MO4A 3O1UA 5CFDC 4TSVA 1O5UA 1KJLA 4COZA 1E57A 1VBB2 2W94A 1W2TA 1W6MA 4PHZA 1MPXA 4CDXB 1CAWA 1XPWA 1ZRRA 5F9TA 3JUUA 1GP6A 4F8AA 1GICA 2LW8A 4LKFA 1BMV2 4E2QA 1QDCA 3A7QA 4NIAA 1QIQA 3HT1A 1S1AA 5FZBA 2C0ZA 2WNOA 3THPA 1FPN3 2JDKA 4BXSV 1W8HA 3PIGA 4ASLA 4QX0A 4MG2A 2ZKNA 3MW2A 1AYM3 1WLWA 1NY71 1AXYA 4GWNA 2R7EB 2EIGA 1RUJ1 3JBG3 4M3CE 2ETEA 1FMD3 2Y33A 4W6WA 5A7WA 4LIUA 5IK8A 4X8NA 1O91A 2XL7A 4JVAA 1QDOA 1NOVA 1GZWB 5A3MA 4LTAA 3SCGA 1AR73 3VBRC 1QOSA 5EV7A 1PO23 3KHCA 1SLTA 4PCRA 1S0CA 1FNZA 1HX6A 2GNTA 1RHI1 1UN1A 2A6VA 2F17A 1PIV2 2DVBA 1X8EA 1PGL2 5FYBA 4M3CA 2O14A 4JV4A 2W47A 3CJIB 3OGGA 4EWEA 4YWAA 2VOWA 4KQ7A 5F3GA 1US3A 2OUHA 3FN9A 4NWVA 3RYPA 3WUCA 3HD8B 1DZRA 3ZYGA 4COYA 4LOTA 1VE0A 1LHVA 3A22A 2YFZA 4LHLA 2DUOA 1IZ3A 3T1LA 3WZ1A 3PURA 2VECA 1AR93 3FX3A 2QJVA 4RR3C 4W65A 3ZXDA 5FUIA 2J1RA 1IS6A 2ZS6B 2W0XA 4YW2A 3WF1A 1CX4A 3M4FA 1OQDA 2IFRA 1J3RA 4U2AA 4Q4V3 4OCTA 5DAPA 1YI9A 4YM1A 4AGVA 1LOEA 2DDUA 2DVAA 3ZYIB 1EV11 2RJKA 4HN1A 2RS11 2HWF3 1Y9GA 1MQTB 5GLWA 4ZY9A 4RYDA 2XJTA 4CCNA 3KF3A 3WUDA 2DU1A 1CGPA 4FFFA 4AK3A 3C7GA 2DCZA 5CKNA 2AUYA 4EN7B 3OB8A 2JDPA 2XUEA 5FYCA 4DQAA 1WCSA 3I59B 1VBD1 3W5MA 2NP0A 4R9DA 4EN8B 2GDFA 2PHTA 1UW8A 4LULA 2Y6HA 4AI8A 4BHPA 5J37A 1R092 3D6EA 3DPRC 5FZLA 1UZ0A 1W6OB 3VBOB 1PVC1 1RUD3 3ILRA 2NMOA 2PHWA 4YW5A 4GB31 4D6SA 1VIWB 2CGOA 4Y20B 5C4WB 5IK5A 4TN7A 3LEKA 5HCFA 4AVVA 4MGSA 2WIIB 4PQQA 5FFOC 3VBHC 4QPIB 3OBAA 1RUE2 3H3LA 2WAAA 3QLQA 5EJ3A 3PTYA 2JG9A 2Y0OA 2E51A 3T3YA 4LHSA 2NLRA 1JZ8A 3FHIB 4CDUB 3P6BA 4MV2A 1QJX3 3IIIA 5FZ1A 3S5AA 2ENRA 1LB2A 2ZXQA 1HRI3 1OF3A 2V09A 4XJZA 2J7MA 5CZKA 3RJ2X 3HIFA 3F95A 4UFIA 1W6QA 3JD71 3KV6A 1RC6A 5FZEA 2XJSA 2XG3A 3BCWA 3HQXA 3IPVB 1G9BA 3WSOA 3FHAA 4GIQA 1UOFA 1CJDA 4BDVB 2ILMA 5FQ0B 5A3TA 5ISLA 5IAVA 1PZ7A 4LBQA 2XGXA 4V1PA 2Q8OA 2ZMNA 4CCMA 1XSQA 5FY9A 2GALA 5BNPB 1DGLA 1H8TC 1MS3A 2XLFA 1VAVA 3MIFA 3OF1A 4NAOA 3AMMA 1OQEA 1H9PA 2MEV1 1DGWA 1Y4WA 2ORZA 5LBFA 1FT9A 1IOAA 2ZABA 4WVMA 4ARYA 4CE8A 5AC91 2X29A 1YEWA 5BY5A 3TN91 1RHI2 1D4M3 4NOTA 1HQLA 3M3IA 3AMPA 3O1TA 3VD9A 1PM7A 3POSA 2WNUC 2JE7A 1V6KA 5LZ6A 1AX0A 1Q56A 4MGZE 3DYMA 1AL0G 4BQXA 2PHXA 4GH4B 2CU5A 4UF0A 4B4PA 1R1A3 3HWJA 4JQRA 3RMXA 1J1LA 4IDZA 4LO5B 1AZDA 2IXIA 2MPFA 5CVRA 5CFCA 1P8JA 3GXUA 4OVEA 5APAA 4MHRA 4QQOA 4XCAA 2JXAA 2VTXA 3ZYHA 3TEWA 4K7JA 1X9PA 3U11A 4FTSA 5FZDA 1XNTA 3K77A 4Z82A 5FZIA 1O59A 4IEOA 2R041 2B5HA 2PXJA 3PJQA 4NE9A 2WO7A 5F5QA 3RYKA 1HV0A 2Q1FA 5B4NA 1LRHA 1OOPB 1STMA 3RZHA 4BQ1A 2VCCA 4CDQC 2XVGA 1GSLA 5F5CA 4B1LA 5C9AA 3D5OA 5GLVA 1IS3A 2ZOEB 1ONAA 2NYYA 3T0AA 2LUWA 2DCYA 1E5HA 4QPGC 4PIXA 5EIYB 4XFIA 4Y26A 2FMYA 4NIHA 4DPNA 5JSPA 4XPVA 4QU1A 1UQXA 4Q0VA 2P5BA 3AK0A 1W6MB 3I49A 1MEC3 1VRH1 2JDUA 1CAWB 3LF7A 1ULPA 3H7YA 1K45A 1VBD2 3PJYA 3MPPG 1H9WA 5JMCA 5FLJA 4IEPA 2EALA 2Y6LA 3GM8A 4IE7A 4LUMA 1NCRA 4XJ9A 1V0AA 1PVC2 3V64A 2FZ1A 3VD7A 3PTRB 3TRSB 4LBLA 1X82A 4QHOA 4BQ3A 1BBT3 1RUI3 1ZA4A 1U5IA 4GB32 3VHPA 4CCDA 1D7PM 2PAKA 1H2NA 5FYSA 5A7WB 3ACFA 4BCUA 5DUUA 2W3JA 5H9SA 5EHDA 1JOPA 2UURA 5A1AA 5FO8B 2JDHA 5CEHA 1ND3C 3USSA 2XQXA 4YZ1A 3M3EA 4WBBA 2JDAA 1ZX5A 2YBKA 4XEZA 3ZN6B 4Y22A 4NVPA 5ANQA 2PHFA 3H1MA 2E7TA 4CEYC 1JTZX 3KHBA 4M3CB 5A3LA 3VKFC 1F5JA 1UYPA 1FOD3 5GZFA 3FHQA 2Y6KA 5BNOA 4G9SB 3JD72 4B4QA 1HXS3 5IVJA 4FFHA 4X6QB 5IHRA 2A3WA 2XLAA 1LU2A 3C7EA 2ZZQA 4AI0A 1H0BA 1RXGA 1IPJA 5GKAC 2WSUA 3AKQA 4LXLA 2E6VA 1L7RA 1W8NA 1ULEA 2UYBA 1CESA 1GKBA 3J8F2 4HSJA 3OUHA 1LECA 2Y6JA 3THCA 4P5HA 4YARA 4WV8A 4XHBA 3LIGA 1CJPA 4AHXA 1RUG1 1NQJA 5FPBA 3BU0A 2WN3A 4TLGA 2W2IA 4L92A 1DZQA 1OI6A 3GYDA 2BPA2 5FPAA 3P3PA 5FUPA 3I2IA 2AGSA 3VKOA 1XXNA 3AFKA 5C3RA 2VNRA 3IDBB 2V73A 1PNFA 2PELA 5E8AA 5FY4A 4Q0QA 1EP0A 4IETA 2A75A 4I02A 4AQ6A 3B02A 1SQ4A 3WF4A 5AFBA 2QKDA 1BXHA 2DCJA 3LSEA 4AFBA 2VNVA 5LW9A 1AR61 5FYZA 4WM7C 3Q8FA 5I93A 1DHKB 4Y4YA 1EAH3 3N9PA 4D7SA 1GP4A 2R042 4YM2A 1NXD1 3SXWA 1O3RA 2DYCA 2JJ6A 1SCSA 1PGW2 3ES1A 5A7SA 5FCCA 3ZKUA 3C2UA 1PK6C 5C8WA 2JG9B 2VJXA 4FOYA 1HKDA 2BGPA 4K1YA 1F5FA 4RQPA 1ACCA 1NLSA 2VZPA 3Q8BA 3D82A 4XJ8A 2C1FA 1DQ0A 3PU8A 3PUHA 2B9UA 1H8VA 2YC0A 3UETA 4BQWA 3E1F1 2VBBA 3ABZA 1ENXA 4HANA 3W21A 1YWKA 5T54A 3H1YA 2RS33 2WAOA 3BPZA 2GMPA 3E5XA 3MIBA 4P9IA 4X8PA 2JD4A 1W2UA 3MLKA 1RITA 1W6QB 3PU3A 2D3RA 3ORJA 3IMMA 1W28A 4FOWA 2FDJA 4EN0A 2D6OX 4LQRA 1H1MA 2F4PA 5L9VA 2HWD3 1ZNPA 2Q30A 3WF0A 5H9PA 4AQTA 4LBQB 4DMIA 4KNCA 2XVLA 4QB1A 4LO7A 3K48A 1FPN1 3VDDC 3ZYRA 1VALA 4A6SA 1LAJA 2VM9A 1AYM1 4C0BA 3M1HA 3ZR5A 4WVVA 4WVMB 2RS53 1KFXL 1Y9MA 2WUHA 4DXSA 3P3NA 3JBG1 4R9AA 5BNNA 1FMD1 1X8MA 4CYDA 1JYNA 3CQOA 2XUMA 4TWTA 1UY2A 1XNBA 2OPKA 1AR71 1ULCA 2ARAA 1PO21 4IE4A 1EPZA 3LCPA 4IGOA 3S30A 2BNNA 3WW2A 4FAGA 4HXCA 5IVYA 2VQUA 2ZGMA 1WD3A 4NPMA 2X09A 2RM21 3I2HA 5CFCB 3WDTA 4C90A 1VPHA 4IE5A 3ZMNA 1OPMA 4LO4B 2VZUA 5D8AA 1ZREA 1ULOA 3N9LA 3N9OA 4HG6B 4D7TA 4DY5A 2XVKA 5FPUA 3E6DA 3LPGA 4OUSA 3AP4A 4Q1PA 4QKFA 2VCMA 2RJLA 3MGUA 2PHUA 5JR7B 4AEJA 1AR91 1ENSA 2GN3A 2JDYA 2QZ3A 5LK7B 5C9AB 4CU6A 2JDZA 3RZGA 1ZZ8A 3M70A 5FZGA 2GZWA 4XC9A 1VRBA 4Q4V1 3JB4C 4ZZ8A 4WM8C 3GZTB 1RL3A 4XUPA 2VOTA 3ITQA 3JQWA 5A6ZA 4L2NA 1W2AX 3IN9A 5AVPA 2E33A 2W92A 2YV8A 5I0TA 4W6YA 4N8MA 4BU2A 5C8CA 1YQ8A 1W04A 4SBVA 1WLCA 3IDCB 3UGFA 3OD4A 2ZHLA 3N7KA 3T0BA 1RUJ3 1UPSA 4MLOA 1AR62 3ME2A 4NIDA 4PT6A 2E9QA 3F2ZA 4IGPA 2LM3A 5LASA 1NCRB 4XYXA 3NRUA 4NIGA 1SFPA 1H30A 3N35A 1K42A 4LMFA 5FMOS 3CF6E 2JB4A 1RUOA 4W8JA 4G4FA 2IUWA 1OHFA 4AHZA 3O1RA 2R6QA 1RUD1 1PM4A 4L11A 5F6KA 2Z5WA 4JKKA 3FJSA 2OVUA 2H0VA 3AKSA 3I97A 1GQPA 4MGYE 3MIGA 4E4ZA 4FQ4A 4IE0A 4JQTA 4Y22B 1O4TA 3U37A 2VMEA 4OUEA 5GLTA 3V56A 4AVSA 1US2A 4BMEA 1YFXA 4HK8A 2I45A 5D1IA 3ZIXA 1NCQA 1JI6A 3TNPB 5T50A 3C7HA 5BNOB 1QJX1 1KITA 4MYEA 4Q4X3 1HRI1 2HH9A 1Y7BA 2C5DA 1SG3A 1WBFA 3LZZA 2TBVA 2A5ZA 3J7NA 1DZTA 1ODNA 4Q0PA 1J59A 1EV13 2BEOA 2RS13 4LHNA 1N1YA 3T4VA 1DYKA 1RYYA 1FPN2 3A0KA 5HXMA 2JE8A 5HPOA 1OKQA 1KRIA 4IEXA 5GALA 3TAYA 4CVUA 1IPSA 3C8XA 3ATGA 4OZOA 5T5PA 1LEMA 4FPOB 3ZFFC 4DINB 4UFLA 2GP5A 1J1TA 3JBG2 1ND2A 3FLPA 3QOPA 5BNQA 4OQ9A 4XXAA 5J3UA 3TEYA 2YFUA 3WR0A 5JOZA 5K0UC 2YROA 2YPJA 1AR72 1TVGA 2VMDA 4BQ4A 1PO22 2R0FA 4FAHA 2UY9A 2VO5A 4IQPA 1LGBA 4XHXA 2UWAA 1D4M1 3MV01 4R4XA 4HKWA 1VBC1 3WCSA 1WD4A 5FY7A 4E8CA 4A7ZA 2KD7A 4XW3A 1PNGA 1IKQA 2N7GA 5KHIA 5D2AA 2LRPA 4P14A 1OA4A 4PLOA 1J3PA 3AP9A 4CDWC 5G04L 1N1TA 1W9FA 4HETA 2ZHNA 5KR7A 5IVVA 5FY1A 2RE9A 4N9IA 1AR92 1UWWA 3VD5A 2WO2A 2FCTA 2CGPA 1PMJX 4DZGA 2XKPA 1AL22 4AEDC 3W5NA 3BB6A 3LPFA 4Q4V2 1O6UA 4RQPB 1FV2A 2QQWA 3OG2A 1QH7A 2PFWA 3J9SA 2BJSA 1E5IA 4XF3A 2JWPA 1SLCA 4M01A 2GNDA 4JTNA 4CXWA 5DAWA 3LEGA 1O4YA 2HWF2 5I8TA 5ANNA 4C8DA 1S0JA 3ENRA 1VB2A 4FSJA 2W68A 1N3QA 3WDWA 3PUSA 5M0TA 5CFDA 1NXMA 2OT7A 1R64A 3OPZA 5JWPA 4P5YA 1POV0 4OHZA 1MEC1 3RYRA 2Z2SB 5DZEA 2ZMKA 1ZA7A 4XBLA 4B3NA 4AYUA 5AC93 3O0VA 3N7MA 3V65A 4QHBA 2VMGA 5KHJA 3EO6A 1YI7A 2DU0A 1LESA 3TN93 2XBO3 2FD8A 3AZZA 1L7LA 1RUD2 1QH6A 1BBT1 1RUI1 1RXFA 4DEQA 1OMIA 1S0FA 4AI1A 1OA3A 4JDNA 2VY0A 2VR4A 2PN5A 3WOGA 1PMHX 1SMVA 1I6XA 4IL7A 3VBFC 3HAGA 2Q0AA 3SKVA 3JQXA 4QXBA 4XBNA 4QM9A 1ZYBA 4B1MA 2VZ3A 1JYTA 1C3HA 2Q1ZB 3I2FA 3VBRA 3RI8A 5A1FA 2OW4A 3WW3A 3FLTA 2BGOA 3OUJA 1QJX2 3DKWA 1CAUA 3DYPA 4AVBA 2Q1MA 2QE3A 5F39A 3M3QA 5D8AB 4KWJA 1NAEA 1NT0A 3CJXA 4JKMA 4BJ0A 2QQLA 2AREA 3NO8A 3PNAA 2JX9A 3PVBB 5FXZA 1HXS1 1EUTA 5T5LA 2BYVE 1V6IA 1S2EA 3EJKA 4K1ZA 4MGKE 3KGZA 5T55A 2P37A 1YC61 1V6LA 4RR3A 2JKXA 2BNOA 1NKGA 3WINE 5FDBA 4HL0A 1VRH3 4Q4W3 2XPJA 5A70A 3KSCA 3USUA 1F31A 2HJIA 3A4UA 5JZGC 1V70A 2Q4SA 3J7LA 5FXWA 5IK4A 1W03A 2VVFA 4EQVA 2BWAA 1D4M2 4YYOA 5CU1A 4LKSA 5A33A 4XACA 3FUQA 2ZACA 4BM8A 1KXGA 2ZGUA 4UFHA 1D0GA 3R4SA 4FFGA 1RMU1 2ZGRA 3Q8EA 4IV1C 1OC1A 4DRRA 5FPXA 1R1A2 4MOAA 5C70A 5I8SA 1NZIA 4AWDA 4XABA 4IERA 1UX6A 3M7AA 3B5LB 4J6GA 4ES8A 2CDPA 3C7FA 4CRQA 2BQPA 3J7MA 1EAH1 3H8RA 4X6RB 3I2JA 2Y0IA 3VHRA 3J4UH 1UY3A 2DBIA 2PAMA 4C1XA 4FXKB 4CU8A 1O7FA 3BOPA 4AR2A 3GCWA 3MEPA 2LROA 1RUC3 4AQSA 2X5IC 3IMNA 1V6OA 3POBA 2CGNA 4BIOA 4RGGA 1L3JA 4YM3A 5LEJA 4A3XA 5BV6A 4RA0A 4JZRA 3VBHA 2R30A 1RVF3 4IEUA 3ZIWA 4YVWC 1F9KA 1GQGA 4NHMA 2VVDA 1NCQB 1XNCA 2R16A 2RV9A 1B35B 5C3OA 2FBEA 4Y4RA 3WP6A 1QY4A 4I0AA 1GUIA 4Y1XA 3ZXGA 1MEC2 5DUVA 1LOAA 3S7EA 3WF3A 4IEWA 4WVWA 2C6SA 3GZEA 3BALA 4P9GA 1RUG3 1CAVA 1QGLA 2AC1A 3EBRA 2PMWB 4NRMA 4YW7A 2QQNA 4QQLA 2Y26A 3J26N 4I3GA 3UESA 4HPKA 3ZFGC 3ZMOA 4MZUA 4NR1A 4NUBA 4OHXA 1PX3A 3GHMA 1QOOA 4WZFA 4MGIE 3ZFEC 1BBT2 1RUI2 1VBA3 2HWD1 2ZHMA 4GQ7A 1YIPA 3INAA 4OHWA 4XFAA 3TBDA 4QQ2A 1ND2B 5IJRA 1A78A 3VLBB 5FP7A 5FJHA 1JUHA 1WKYA 3PUIA 5HXVA 1H8TA 3S0MA 5K9YA 2GN7A 1G9FA 1W8UA 4DNYA 1QQP3 4N53C 2RS51 2TUNA 2RDNA 3HEIA 1UO9A 4QKNA 4YW4A 3RG0A 3WD5A 4A45A 1M06G 1W8TA 2WT1A 3M2MA 3B94A 4CUAA 3WG3A 3IKWA 1C5IA 4FP2A 5C3PA 5F37A 2Z42A 1NQDA 4MADA 4XCBA 2WNUA 2CTVA 3TWIA 1FOD2 1S0GA 2ZAAA 1VBE3 3FFZA 5F6LB 2A3YA 1JZ7A 5A7NA 3IT8A 2DCTA 4HMZA 4FBFA 4A41A 1HXS2 4YM0A 3U0ZA 3I3EA 4AW7A 3J7HA 3W20A 5JI7A 1DF0A 3I54A 1AXZA 4PIYA 2P1BA 2H0BA 5L9BA 2OKXA 2YZ4A 3B9IA 3KV4A 1GQHA 1YJLA 3C3VA 3LB9A 5F32A 1OF4A 2GH8A 1HJGA 3BTAA 5IVBA 4PBOA 1UYXA 1WWYA 1DIWA 1COV3 2YDEA 2YG0A 3EYPA 3MUZ1 4RSUA 4UW4A 4CDQA 3RI9A 4AHWA 5FZAA 2W87A 3WDUA 3WF2A 2D44A 3NAPC 4JX0A 3RRDA 4L97A 4GALA 1LHWA 3O0WA 4IEYA 5GZEA 1QJU3 1EY2A 1OSGA 3O1OA 2GP3A 5FY0A 2FCUA 4DUVA 1CZVA 3AL5A 2EAAA 2GC0A 4CU9A 3KZ4C 3DGTA 2ZX2A 3O0XA 5CFDB 5DDJ3 4W50A 1TE1B 4N43C 4F3JA 2JD9A 3UKNA 5EWSA 1VLNA 4OMDA 2YUEA 1LOFC 4CEWA 4AI3A 3FE5A 2WBKA 4CP1A 1KQRA 5FYVA 2X53S 1W39A 1EAH2 2GC3A 4IXLA 2BUKA 1PZ8A 2WKKA 2VCBA 2X8KA 4RGKA 5DZGA 2RG4A 4G3YC 4DB5A 2UU8A 4UT5A 5LY1A 3ZKYA 2RM23 3ZSJA 5FYIA 5DXDA 2J1EA 5ERLA 2DFCA 4M0NA 4UBGA 1FXZA 1NA1B 3RGBA 4LBNA 3NWKA 2HEVF 2IXJA 4FPEA 4ZKTB 3VBRB 3VV1A 1LU1A 1RJ7A 5IK7A 3FLRA 1V9U1 1CAUB 1VMJA 1YQ5A 3CLPA 1QXRA 1DCSA 1FX5A 4YGCA 3CJIC 4CEYA 4FO9A 4D69A 2ZKLA 3K51A 2RS32 3ROUA 4NHXA 3P1IA 4Q8LA 4BYYA 4KMQA 1YYNA 4HLTA 2VPVA 4Q4X1 2VVEA 4JRLA 3VZKA 5J09A 1TG7A 2CWMA 4PLMA 5CAZA 3QH6A 4FPHA 1LOBA 2HWD2 1KDKA 3S7IA 4RR3B 1DBNA 1ZBE1 1ALYA 2W5FA 1AR83 1VB4A 1MS5A 1OA2A 3NV4A 2WRAA 2BOIA 2RS52 2OZ6A 3TYJA 2ZX1A 3CBNA 2RDRA 4Z1VA 1GWKA 1OH3A 1MQTC 1BCXA 2WSVA 2WWSA 1NLQA 3VZLA 3V0AA 4Q26A 2Z69A 3CNAA 1Q8OA 4ZONA 5A33B 4HFSA 4J1XA 2ZEXA 3ES4A 4JGZA 1K5JA 2BBVA 3VZNA 2R1BA 4R8HA 4A44A 3LA2A 1SFNA 4DEVA 3N9QA 1J3QA 4CCEA 1GBGA 5E88A 2FHRA 1ZBA3 2XJPA 1GNYA 4FI9A 3VZOA 5JI9A 1LOGA 1SBDA 2JEMA 4MVTA 4O61A 3G6JB 5FZHA 3DEMA 4UOJA 1XE0A 4WM7A 3RDIA 1GR3A 1TME2 5I0DA 4RHV3 5C4WC 5HCAA 2PQSA 2ZGOA 3D3AA 2D3PA 4CTEA 1MACA 3ACGA 1JYWA 3VBHB 3FBMA 3VN4A 1PK6A 2E7AA 2ID4A 3DF0A 1HB4A 4XFFA 1LHOA 2ZEWA 1SLBA 3T0DA 3ZM8A 4H3WA 2YC4A 5GZCA 1W2OA 3AB0A 3JB8A 1W8OA 4ZS3A 2WDBA 3DL3A 2K9ZA 5IVEA 2BBAA 4FPCA 4N7UA 3KF5A 2D3SA 1UX7A 2BW8A 1NY72 1JOBA 1QJY3 3EXUA 4LEJA 4BIFA 1RUJ2 1CAVB 1DQ6A 2FDGA 4HPKB 4LOSA 1GZCA 4EN6B 4D94A 3U75A 4CCJA 4RS5C 5E16A 4EWAA 1CZSA 5GJ6A 4GMP0 2VE1A 5BNPC 2CAVA 2XBO1 2G9GA 2XMLA 1VBC3 2V4AA 4CCOA 3VDDA 1JU3A 3O1PA 1G9AA 2E7QA 3GJBA 1YQ2A 5FTTC 4A2UA 1AYN3 1QMJA 4I0BA 4HVOA 5CYYA 3PUQA 5FZ4A 3KD4A 5KBFA 4FPJA 4GH4C 2GNMA 1TNRA 2WNUB 4FQZA 5FKBA 5FXVA 3ZXJA 2D6PA 1YFYA 4DRVA 3NNFA 4BK5A 5FZMA 1W9WA 1AF9A 1C28A 3GZUC 2A3XA 2D98A 4LUKA 3VBUB 2HBUA 1ZRFA 4BA6A 1I5ZA 5JXIA 1Y43B 1RTVA 2KA3A 1OT5A 2BFUS 2E31A 3E5UA 4UI9L 5IVFA 1UKGA 1EV12 5FY8A 2RS12 2ZGQA 5CADA 1D2QA 4M00A 4TLFA 5F3CA 1UKRA 4XDPA 2R073 4XTPA 4CPBA 2IXLA 3RZKA 4PQ9A 4XUTA 3NMBA 3RFRA 5EZWA 4D3WA 3RNSA 5F3IA 1OLRA 4LBJA 4LK7A 4Q4W1 3RVHA 4EYUA 2ARBA 5FK8A 1YFUA 5KWRA 4Q4Y1 2ZJCA 3L2YA 3AKTA 3CIHA 2WYFA 4WM8A 1J58A 3WNMA 2OYZA 4LORA 2ET1A 4XAAA 4XDQA 1XJAA 4F7ZA 4ISQA 1XRUA 2NZ9A 3LDKA 4CEWB 1GWMA 1ULGA 4HOOA 4LPLA 3H50A 3CZUA 3LEIA 4NRPA 4Z07A 3VKLA 4CCLA 4F83A 3VD4A 5FYHA 1W8FA 3AYDA 4A42A 4D0QA 2O1QA 1JS9A 3NJVA 2VXJA 1GV9A 3VUOA 3UKTA 4UWDA 4AXOA 1H6YA 1CAXA 3SH3A 1VMHA 2OQ6A 4ZU7A 2XXZA 4LO6B 1HQNA 3MBWA 1GLHA 4YVSC 4ZXKA 2BERA 3OY8A 5L73A 2CAUA 3EB7A 3VHOA 1G8WA 1RUC1 1X36A 2WQZC 4W4ZA 4NMIA 2PHDA 4B8EA 4CEYB 1RVF1 1GU3A 5C33A 4J1WA 2DV9A 1LCLA 4DXTA 1R1ZA 4JDOA 3LQCA 1XU1A 3DXTA 4O9EA 1I3HA 1WCQA 1ASJ3 1W9TA 4QU2A 5F5AA 4BQ5A 1AUYA 2MNGA 2VAUA 4OZXA 2VOKA 2MEV2 3GZAA 2BVVA 1E5RA 4KU8A 4P00B 2WS93 5DAVA 5DZFA 3FL7A 1F15A 1BEV3 3IWZA 5AC92 3ZR6A 1ZZ6A 1JUIA 3FWEA 2LS6A 3TN92 5JOWA 4KH9A 1X9TA 4E2GA 2QQPA 1RB8G 1W90A 2HWB1 4ASMB 1KEXA 1OH4A 1QJFA 2EA7A 1WA4A 2FCVA 3APBA 1VBA1 2WJSA 5JUVA 2P3YA 1RMU3 1TMF1 1UL9A 3KQRA 2A6WA 3PHMA 4QKBA 5IT6A 2B46X 3ZFFA 5A32A 3WVJA 3BUCA 2KM2A 4QM8A 3NV1A 4FCAA 4XAEA 3UGGA 2A73B 2A6ZA 3MYXA 1LHNA 3M8LA 3WEZA 1HQWA 2HEYF 1DQ2A 1QQP1 3LDBA 4JGZB 4JHZA 1UY0A 4N7IA 4CP2A 1VBB3 3D0SA 2B7YA 1GZ9A 2QQKA 3O1SA 1GWLA 2CHHA 2OA2A 3CZJA 1LKNA 3MPBA 4COVA 4BXFA 1KD7A 4YG3A 4ATEA 1RIRA 3MIDA 1UPIA 3LE0A 1VBE1 1OVSA 2FDIA 4AI2A 3WNNA 4WM7B 2WQ4A 4XZUG 3SH5A 4IEQA 3BPSA 4Y33A 1REEA 5FYMA 5FBZA 2IXHA 3H7JA 5L7OC 5FMDA 4KGQA 2QQOA 4NHKA 3I2OA 2PLV1 4IW3A 2QQJA 1VRH2 1WW6A 2ZGPA 4Q4W2 1DYOA 1UXZA 2EVXA 2X05A 3I3DA 5LRRA 1MZFA 3DKQA 3UL2A 1COV1 1LNSA 1XSRA 4Q0SA 5T5JA 3R6SA 1LHUA 2WABA 3K3OA 1J83A 3ZLIA 3HT2A 5KHHA 3S57A 5BYNA 2G4IA 5EFUA 1JH5A 4FTBA 4IV3A 1QJU1 1XNDA 1DDLA 3IIAA 3ALQA 4IUGA 1V6JA 3PIJA 2DWRA 5KXBA 3ZXKA 2C9KA 3NV2A 5DDJ1 2W1QA 5C6CA 1C1FA 4GZ9A 5FYUA 5KHKA 4MSVA 4Y3OA 5JDBA 3AKRA 3ACHA 2Q5TA 1WUVA 1YO8A 1F4AA 3LOBA 1Y3TA 1W6PA 3VDDB 1WW5A 4XOGA 3HVDA 2DURA 3LD8A 4JCKA 5J96B 3WP4A 4B4RA 2ZX3A 4UF0B 3DXUA 1RUC2 1IKPA 5CKQA 3WY6A 2DFBA 2VW0A 3TB0A 1XNKA 2D93A 1ZZBA 5EQUA 5FREA 4BQYA 3VBFA 1ZZCA 2JE9A 2VULA 2GH2A 3PMEA 4UFMA 3W59A 2GU9A 2BWCA 2IXKA 3KB5A 3RS6A 4YG0A 1APNA 2V5DA 4QPYA 2HWC1 2LALA 3OD0A 3T09A 2ZGNA 4BISA 5HBAA 1RUG2 4YW1A 3ASIA 1JYXA 3T2PA 1Q5OA 2VZ1A 1Y9QA 4A6OA 1G9DA 2VW1A 2K2SA 2DTWA 5FUNA 1JZ2A 5C9AC 1N3OA 1W8ZA 2BU9A 2WFF3 1ZRIA 4PJYA 4EROA 5A6YA 1VBA2 4R9CA 4UBHA 3R4DB 3GNEA 1AHSA 4XQWA 3KWVA 4XUNA 4HVRA 5FZFA 3OJBA 4XJAA 4CPBD 3AKPA 5DG1A 2W1UA 1YCIA 2H6BA 3LKJA 5ABJA 3D0JA 4J25A 2Q8EA 3DV8A 1AR81 1BVVA 4E8DA 1PX4A 2P3JA 4WM8B 2K0GA 1QEXA 3R0RA 4KL1A 2A71A 5JZGA 2D5HA 2YY1A 2W08A 3K2OA 1BQPA 1SLAA 2R061 3C7OA 3ETPA 2JENA 4PBPA 1OQ1A 1W3VA 1ULDA 3K75B 4XUOA 1EYBA 2WA3A 1QOTA 1WCDJ 2CWSA 4Q8KA 4QDQA 5TSWA 5C71A 5A3UA 2XB6C 2BRTA 1VBE2 3WNLA 4YFZA 1C57A 4IV1A 4QB6A 4BB3A 3U10A 2ZAHA 1C4RA 3OGSA 5F2WA 3ZSMA 1ZBA1 1CZTA 1YLLA 3VBSA 3AC0A 2Y6FA 1V9U3 1K5MC 3BTZA 1CAXB 3NNJA 2WNVA 5FAXA 3RMYA 3ZXEA 2XLGA 4QT6A 4RHV1 2OXBA 3OY8B 1SDWA 1X33A 2Y8KA 3ZVXA 2QUOA 4YFWA 4KWKA 2WINB 1COV2 4XFBA 3SITA 3HQRA 2X5IA 2ZCWA 2ZTNA 2QVSB 3NVCA 3WG1A 1XYPA 2R0HA 4PF1A 1OKOA 4RGAA 1O3SA 5BNOC 2Q8DA 4YVWA 1ZBE3 4C91A 5I91A 3K46A 5GZDA 3ON7A 5DDJ2 2JKBA 2AR6A 3UNPA 1AYM2 3K4AA 1QJY1 5FZ9A 1HV1A 3I3QA 3U4XA 2VUCA 1WCUA 4Q1RA 4XF0A 2RDSA 5IATA 2HEWF 2ZBJA 3BOWA 3I2DA 1FMD2 2J1SA 3I2KA 4LKEA 5CB7A 3WHUA 3H8OA 1Q8QA 4AE2A 1LGNA 4LE3A 3MICA 2RJ2A 4DS0A 3GBFA 1UIKA 1YHFA 4CCCA 4K20A 2C4XA 1W9SA 5FYYA 4QB2A 3ZFEA 4QGMA 4BMBA 4OYUA 2HWE3 5A32B 3ZFFB 3R4UA 2RM22 2CYFA 4FOQA 1S0IA 1PGSA 5C7GA 1S0DA 2JICA 3AJZA 4Y1UA 3GBWA 3N36A 2D5FA 1AYN1 2J1TA 1WW7A 2IC1A 1LULA 1CIWA 2XOMA 2XR4A 1CN1A 4Y5SA 1CIYA 5LA0A 4M0HA 3URFA 4CUGA 4XQDA 2YGMA 2CSGA 1TEIA 2XJUA 4K40A 4E4SA 5JPNB 4QX8A 2W95A 5FWJA 4XDOA 1R083 5FMOL 1OXCA 4FT8A 3LA7A 3IBMA 1KFUL 1U0AA 1UMHA 2W52A 4PF5A 2IVJA 2R1DA 2G1MA 3OGRA 2YC2A 4RQPC 1JHNA 1DQ1A 2XONA 1J84A 3FMGA 2R071 3ZPYA 1XYNA 5FZKA 1AR82 2VOXA 4EZ4A 5FZ0A 4ATFA 2JG8C 4ES9A 1KGYA 3E97A 3QBQA 2ZHKA 4A4AA 3O14A 4IV3B 2BNMA 4KBZA 3ZN5A 1HB3A 2EXKA 4XFCA 2W1SA 1A6CA 1IS5A 3OEBA 1BHGA 4IE6A 4Q29A 1A8DA 3PL0A 4I3PA 4PDWC 2L9LA 1JBCA 1UZWA 4EZHA 4N43A 4OHYA 1XOYA 5BNNB 1ZBA2 2OX0A 1LOFA 4EV0A 5J7MA 3POYA 3MUY1 4LR4A 1W6PB 1XBFA 2Y6GA 4N9HA 4RHV2 3WNXA 4AFAA 2YYOA 1CONA 1JU4A 1QHDA 2W46A 1SPPA 4NROA 2ARCA 1QF3A 2VZOA 2WT2A 4BLJA 1HRI2 1OFSA 3GBGA 1G7YA 2D40A 4GA9A 5F1RA 3HN1A 1DP0A 1O8PA 3P5BA 3UJQA 1REFA 2D97A 4PI0A 1Z78A 2QZ2A 1F2NA 2ZEYA 4JGYC 4Z8BA 3OUIA 5D8AC 4FPKA 4LE4A 4ORFA 5GZGA 1O5LA 4QQPA 3HQUA 1QJY2 3AMQA 4E4DX 2NM1A 1ASJ1 1GZTA 3BGAA 4MXWA 3KCCA 1W2NA 1IG0A 2BZDA 3PUAA 4Q4Y3 5F8PA 3FUOA 1T2XA 4QWNA 4K6BA 5EPAA 1YQCA 2WS91 1HIXA 2AACA 3OBZA 4M3CF 3TEXA 1G9CA 3NKGA 3WHTA 1BEV1 1POV3 4D8MA 5BUVA 2C24A 1XYOA 5C8CB 3ZO0B 1KS4A 1BVP1 1DLLA 4LA3A 5ACA1 1VBC2 2YPDA 3ZDSA 5ABJB 1PZ9A 1UOGA 4INDA 4LT5A 5EXOA 4B7EA 4UW5A 5JZGB 4GJZA 2WC2A 3ELNA 5BXXA 1UOJA 2DF7A 2OZJA 5IAXA 1AYN2 5L9RA 5LATA 2VW2A 4XQ4A 3T1MA 1W0PA 3POEA 1GP5A 4P02B 1S55A 4GWIA 2VOVA 4KWUA 4XBQA 3U4SA 3MLLA 2VG9A 4LNVA 1PGL1 1VBB1 1LOCA 2BV4A 3DPRA 4P9LA 3ZPOA 4CSWA 4IV1B 4EN9B 2A70A 1JZ6A 2WQ8A 2A6YA 3DYOA 3MDPA 4JAAA 4XF4A 3O1VA 3RWNA 4LLOA 3VBSB 1YRZA 2FDFA 1W6OA 4S2FA 1BK1A 2ORXA 5LCWL 4Q2FA 4I0WB 3WDYA 2WNVB 1MS4A 1NE4A 1U12A 2ZGKA 2CY6A 4OULA 5JOXA 2Z4FA 2R072 3QD6A 5E1RA 1WMEA 3OPTA 4JRAA 3W58A 4PLNA 4DY3A 3RJRA 2EXJA 2X5IB 4BWOA 1NUKA 1RUNA 4AEMA 1S0EA 4XFHA 1MS0A 1B35C 4HKOA 3CL1A 4YVWB 5KC5A 2VMCA 3OBTA 4H55A 1C5HA 2HWB3 4HONA 2XJVA 3POIA 3THTA 5FPLA 4RFRB 2EIEA 2K46A 1TMF3 4XTMA 5FP4A 5F3EA 1V6MA 4YNIA 1GMMA 1PHMA 4Y24A 1WMDA 2OQ7A 2YXSA 1JN2P 3POWA 5EP9A 1G6NA 1Z0HA 4QXCA 5A80A 3AYCA 4RS5A 3ZFEB 5JXJA 3RSJA 2EICA 4Z92B 1M4WA 4K8RB 5KXEA 1CPNA 4Y1YA 4KG8A 5GLZA 4MX3A 3LIHA 4RD7A 5LRSA 3RZZA 4AFCA 2Z79A 4EE2A 5IVCA 1SCRA 1TQ5A 2I74A 5IYYA 3LSDA 5FZCA 5LWBA 3HPNA 4HT1T 4YGDA 4OLLA 2OIIA 2DVDA 4HZFA 1REDA 3KVBA 3ZOIA 3EQEA 2V4VA 5T52A 3Q8AA 4LBMA 4M4PA 1Z7S3 2WO3A 2IXCA 3D4KA 4GH4A 4OI2A 2PLV3 2XQRA 4TZDA 1FYUA 1TNFA 3NJXA 1ASJ2 2UWCA 3IDAA 4DIQA 3LFMA 2FDKA 3VGIA 2JDNA 5LK5A 3NW4A 1ZM1A 4YW3A 2WS92 2IZWA 5F2SA 4TTGA 1RUH3 1BEV2 3SHRA 3KMHA 1ZVFA 1QU0A 3I2GA 1UNBA 2F4LA 4CUCA 2ET7A 2QDNA 5CISA 1VMFA 4QPGA 5EJ1B 4AF9A 1JXNA 2WFF1 1D0HA 2CV6A 2Y34A 3N7JA 5FYTA 3WW1A 5HI0A 3AVSA 3AJYA 1RMU2 4CDXC 1RUE1 4LIVA 5FZ8A 5JSOA 5JIAA 5JXHA 2B4KA 1RUF3 4XURA 3H3ZA 3AP7A 5K7PA 5LBCA 4XE9A 1FNYA 5FLIA 3HBKA 4O7XA 3IB3A 3ZXFA 1IQDC 3GGLA 4ZU4A 1B09A 4AVAA 5BPXA 4AZZA 4N43B 1DGWX 1UCXA 5KC6A 5A3WA 5LEKA 4QX5A 3VL8A 2XL9A 3SCHA 2JDMA 4HVQA 1GOHA 1SEFA 3AYAA 3O7OA 4MGQA 1CWPA 4L9BA 4XMIA 3K3NA 3THDA 5JCTA 2W91A 3AP5A 1WBLA 4ZZ5A 1U5ZA 1ND3A 1SPPB 3B9CA 1O3QA 2HYKA 2J1VA 1NA1C 1SHWB 2HWC3 1C8M3 4FPLA 5IFPA 4P9YA 4YVSA 3BVCA 2GSYA 1DYPA 5L36A 4OI1A 5K4LA 1FAYA 4M4RA 5JAXA 1GNHA 1UZVA 3ZN6A 3ZXLA 5B2GB 4QGNA 1H1IA 3H8UA 2ZX4A 3S6PA 5KXDA 3L2HA 3UK9A 1W99A 5A6XA 3KM5A 5CNAA 3VKNA 2C26A 3WG2A 3K4ZA 4MXWB 5FK7A 3USUB 1JZ3A 1AX2A 1UOBA 3AMNA 3KS7A 3SC7X 5EJZB 4K8FA 1CR7A 4UW3A 3WP3A 3NNGA 5T3NA 5JPMB 1X50A 2R063 3ILFA 3BN6A 1AL23 3WG4A 3LWCA 3VZMA 4O65A 2XJQA 3VDBA 1BZWA 3NL1A 1AJKA 3ILNA 5AVAA 2VCAA 1AXKA 3WCRA 4RN5A 3HN3A 4R9BA 5I0UA 1LJ7A 2HWE1 4QKDA 4A3ZA 3AXDA 4MH0E 3ZXAC 5FO9B 5JR2A 3TEZA 1VP6A 3VBOC 1JYVA 3NNMA 1IS4A 2CL2A 3AFGA 2WL1A 1YJKA 3DPRB 3MF6A 4KBBA 4P9WA 3ACLA 4HBNA 4QX2A 4UW6A 5A3OA 3ZSEA 4XFGA 3N3HA 4MGTA 2XDVA 3BTYA 3NJZA 2GMMA 4QPIC 4S2HA 1JHJA 1AX1A 4D7YA 4AAPA 4K3UA 4XJWA 2VNOA 3ZSKA 4CDUC 4I09A 5JOYA 3GALA 3Q8CA 1O4ZA 1R081 4SLIA 2G19A 2P34A 3ZYPA 2WFF2 2YU2A 1U5XA 3UT0A 1N1SA 2ZGTA 5L7OA 1YNAA 3M3OA 1JYCA 1JODA 1I5PA 4O9GA 4ISRA 3WP5A 3B01A 2D43A 2FMDA 1HRV3 1S2BA 1LR5A 3BKZA 4XVHA 1IPKA 3OYWA 2QTWB 2WZR3 2VTXJ 3AL6A 3MW4A 4OHVA 4XF9A 3NKTA 4P9XA 1OUXA 2RR13 1EUUA 2PYTA 5FOJB 2UY8A 2P3IA 4H7MA 3AZWA 1PO13 1S2KA 1SDDB 1H8TB 3AX4A 3MLJA 2VZTA 2NPIA 4Q5OA 3CMGA 3IAPA 3QCWA 1G86A 4ARXA 4WVZA 2PHLA 1ZZ7A 2RVAA 4RS5B 5FY5A 3SLIA 4LBKA 3L9JT 1UU6A 4DXRA 3GDBA 1V9U2 1W05A 1A3KA 2W9XA 3J8F1 2ZGLA 1HB1A 5K8SA 3AZYA 1BYHA 4XJUA 1URXA 2CNAA 2ES3A 3O1MA 3KCYA 3MI8A 3RZJA 2QBXA 2J42A 4Q4X2 3KLSA 1UY1A 1W0OA 3NV3A 4GKYA 1OURA 2VBPA 4P08A 3AYEA 5SV8A 2YBSA 4H7LA 3O5SA 1HW5A 4NRQA 2O8QA 4XF1A 4QX7A 5FWEA 3VDCA 3VBUC 5CG9A 1ZBE2 1OOPC 5DUWA 4GD4A 1OFNA 1Q8VA 2VMHA 2XJRA 2GMEA 2PTMA 3KT7A 1GNZA 1W0NA 1UIJA 4XUQA 4CDQB 1XNAA 3IM0A 1XE7A 4QXKA 5FMCA 1QKQA 4AAXA 4CUBA 3QACA 1ZRCA 5FV3A 5HCHA 4DXZA 1EPWA 1XC6A 1MZ5A 3OBRA 5FPVA 4COWA 2ADDA 5IW0A 4QPGB 3MFCA 3FFQA 4ET7A 3CDZB 1PGW1 1POV1 3HJRA 3IDEA 4K9SA 4AHYA 4Z2WA 2BP6A 1JYIA 4A7KA 2HWE2 3DUIA 4FPGA 4GMP3 2AZ5A 1QWRA 1H4GA 2QDRA 4LHKA 3WLUA 5J1XA 1WLTA 1YUDA 4R4ZA 2HKXA 5JMOA 1HDKA 3LEMA 2VZQA 1UF2C 3QH7A 2VMFA 4XETA 1UU4A 2ZX0A 2J1AA 4CEWC 3B7MA 2DVFA 4MO3M 2P4EA 4N90A 1MVQA 2RMU3 1Q8SA 4Y1ZA 2W1WA 3RWKX 4NHLA 1T6GC 4JHTA 5FLHA 2YB7A 3EMRA 3ACIA 1DGRA 4GWMA 2SLIA 2WO1A 2VGDA 1R082 4KGGA 3UJOA 1ND3B 3PVNA 1QJZA 1PMIA 3WQ1A 2P17A 2YMZA 1K5MA 3I7DA 5A7QA 5JLVA 4NHYA 3HOBA 2PHRA 3TOJA 3KGLA 5FP8A 4YVSB 4OMCA 3EHKA 2PQQA 2DVGA 3KV5A 3OGVA 2AEZA 5FBJA 5I8YA 2TNFA 2ZGSA 5FZOA 4CZSA 1DQ4A 4AVCA 1RINA 1UY4A 3CEWA 3BYWA 1IG3A 3OTFA 3IZOA 3AZVA 2XBO2 3I8TA 3N9NA 5ACA3 2VQAA 4H2AA 5FJKA 4AGGA 2X10A 5J48A 4JC1A 4FPYA 1SFYA 4B29A 3HNYM 2ARXA 2BFUL 2QQIA 3V0AB 1LGCA 3E6BA 3E5QA 1ST8A 2RHPA 5G05L 2XWJB 2YGLA 5CG8A 4HN0A 1N3PA 1GOFA 5K0UA 3UKVA 3NJYA 2E63A 3N7LA 4FTEA 2A6XA 4QX3A 3OOXA 4FXGB 5H9RA 3MW3A 1CX1A 5LA1A 5DQ0A 1LTEA 5DUXA 2BOJA 2D6NA 4Y5TA 4JGZC 3HNMA 2A7AA 1HJFA 1HN0A 3UV9A 1C8NA 1AVBA 4LLFA 1KJRA 5JXGA 1MVEA 1NX9A 5EYXA 2ADEA 3BIWE 1KS5A 2NQYA 4CDWA 3SKJE 1WA6X 5C5TA 4UFKA 1GFF2 2VUDA 2P3KA 4GAZA 2W39A 1Z7S1 3KVAA 4QPWA 2JG9C 3JZVA 4ZXEA 1GYKA 3T2QA 4QDRA 2VUAA 4JTOA 1ULFA 1PK6B 2B45X 4Q4Y2 4AEDA 4K21A 1I9RA 3FZ3A 3JCIA 1VJ2A 1PIV3 4URTA 1RUH1 2JIGA 4AOCA 5L7OB 2EXHA 2WZPP 1NYWA 2VZSA 4FFIA 3V0BA 4RL7A 2B8MA 2I2SA 3LAGA 3SEEA 5FP9A 2AH2A 5FO7B 3I3BA 2VC9A 1UZYA 3OYWB 1RUF1 2JG8A 3A21A 3BI3A 1MR5A 4XIOA 2XWBB 1F8VA 2WT0A 1SBFA 1IQAA 3IAQA 5I0SA 5F7UA 2DTYA 1QXJA 1W6NA 4QQHA 3SISA 2DCKA 4PDWA 1JOJA 1FATA 4Q0UA 3T2TA 5HV4A 1ZRDA 1NZCA 2E26A 5A1LA 1SLLA 4KWLA 2B42B 4ITCA 1WCKA 3LGRA 4BK4A 3POFA 5LB6A 3N4MA 4LBQD 1RVF2 1GOGA 5FZ3A 3B3QE 1X7NA 4AVTA 4GJYA 5CFCC 2XH6A 4TYSA 3X29B 3E6CC 2ZA9A 1VAMA 4YGBA 1HN1A 4LA2A 5E89A 3WNOA 4DFSA 4OQ8A 4QXHA 3KQ4B 4UFJA 2EIBA 1C8M1 1XQNA 1R093 2NN8A 5DABA 4AI9A 2H6CA 1IGOA 5KXCA 1Q8PA 4Y5Z0
chains in the Genus database with same CATH topology
1LENA 3RQ0A 1ENRA 2HWB2 3ETQA 5FPZA 5GLUA 1MZEA 4JGYA 5JSRA 1TMF2 1RUE3 5FRAA 2Y38A 2ZMLA 1DGRN 1TME3 4YSFA 2QFEA 2NMNA 4OUMA 5AFEA 2EXIA 1QQP2 3KT1A 3B69A 2O8OA 2VH9A 5FOBB 4I01A 2D6LX 1WW4A 1AL21 3M3CA 4AEKA 1H2KA 3WQ7A 1NCRC 4XILA 4JDMA 2GC2A 1KDMA 3AM2A 1H4HA 2HWF1 4E2SA 2ZPXA 3WDVA 2LTNA 4FOVA 4QD2A 1PVXA 3NSTA 3WXPA 1Z7S2 3SH4A 2OUJA 2SBAA 2PLV2 2EF6A 1OPOA 2FZ2A 4YZ2A 3ZX7A 1AJOA 4FP3A 1RHI3 3RPQA 5J98B 3ST7A 1CD3G 1HLCA 1RUH2 1K5MB 3G7DA 1UZZA 1H2MA 2VXRA 3FBYA 1QJU2 4LBOA 2D7FA 3PMSA 1U5YA 4HSLA 2UWBA 4AFDA 3U07A 4YZ5A 1CPMA 3B93A 3H3UA 1RUF2 4R52A 4P9JA 2D6MA 1HRV1 3TNQA 1OLQA 1CVNA 1B35A 3ZFGA 2WZR1 1QNWA 1BJQA 1XU2A 3HBZA 4XIKA 4XZPA 2RR11 1MS1A 2R32A 3LA3A 5H9QA 3PLQA 1PO11 3Q9OA 2F6BA 1WMFA 2XHKA 3JU9A 5K0UB 2ERFA 3AXEA 4AQ2A 2P2KA 4N53A 2B39A 1DFQA 2QNKA 4YLZA 1VBD3 2IFWA 2E53A 2HWC2 1C8M2 1S0BA 4A7YA 4XXPA 2BGCA 5CBLA 1PVC3 4B7KA 5IUQA 4CDWB 4GB33 2DUQA 2WLQA 2VU9A 4L8QA 3W9AA 1UD1A 2FQPA 4KG0A 1R1A1 4RFT0 2GAUA 4YZ4A 4AEDB 4IEVA 3KT4A 4IEZA 4HK9A 1D2SA 3D8CA 2GNBA 5GM0A 5J36A 1IHMA 2R062 1OD5A 3BU7A 3NAPA 3V0BB 5EYYA 1QNYA 2VUJA 3JD73 1C1LA 2VMIA 1UU5A 4XMAA 3HR9A 2JG8B 2V5YA 2I07B 2AYHA 3H0OA 3O12A 4GMP1 4IV3C 4YG6A 4CDXA 2TEPA 2WLPA 1N1VA 3AZXA 3J8F3 1ZZ9A 1W6NB 1RGSA 1MZ6A 2MEV3 3MZHA 4ONUA 5BNNC 4PIZA 4PDWB 4BZ4A 1UAIA 3CU7A 2WFPA 2R49A 2RMU1 4IESA 4GKXA 3WW4A 1MS9A 5SV5A 2GC1A 1GZWA 4QGLA 1SACA 2XKOA 4Y1VA 2ZZJA 3VBFB 1H1AA 1VR3A 2D6KA 2O0OA 1I1EA 1FV3A 1D4VB 4ZU5A 3H1WA 4E9KA 1V00A 4META 1NG0A 4GXLA 4OI4A 1NA1A 3CJIA 2UYAA 3VZJA 1NLRA 4NPRA 5DG2A 1HRV2 3WQ0A 2R043 3ZN4A 2WZR2 1O3TA 2WNEA 1H2LA 2MHFA 2RR12 3R05A 4JGYB 1FOD1 1WGPA 1DQ5A 3ZYJB 4GULA 4KU7A 1PO12 4CP0A 2ATFA 2DUPA 5C8CC 2VQ0A 2C9AA 1WLDA 1DG6A 4BOWA 4U36A 4S2DA 1VAKA 5ABJC 1Q43A 1MQTA 1MS8A 4NN0A 3SNMA 1CQ9A 5CIRA 1FI2A 3SCFA 3PVEA 2BVBA 3AP6A 4QMAA 4I30A 2WA4A 4FVVA 3I4IA 4H14A 4MXVA 3I59A 1ENQA 2IWGB 1BMV1 1NE6A 3VKMA 5JVVA 4OFGA 2PA7A 3DN7A 1XE8A 3VBOA 1A8MA 3AMHA 1YIFA 3VL9A 3OGJA 2KXLA 1DU3D 3KCXA 4HKLA 4AFMA 3ZSLA 1SLIA 4Y20A 3WT3A 3VBSC 5C4WA 3GHNA 4WZCA 4QPIA 4I2OA 4E27A 2WNVC 4LO8A 5KHGA 1JW6A 1NCQC 3B00A 5HCBA 4MUVA 4C1WA 4CDUA 1PIV1 2G9FA 1UMZA 3WDXA 2AENA 3HMYA 4BPZA 1LODA 3LOIA 4COUA 3WX5A 3IPVA 4YRDA 1N47A 1QXPA 3ZFGB 3MIEA 2VNGA 1V6NA 1BKZA 1RJ8A 2RS31 5FQ0A 1ND2C 3MFAA 5BNPA 2RMU2 2BTVC 4UXAA 4S2GA 2YHJA 4EWDA 4YZ3A 4C0HA 4NO4A 3OCPA 1YXWA 4YGEA 3CO2A 4DOUA 2PAEA 4N53B 3FC0A 1SBEA 4BH9A 4BE3A 3H9AA 1AR63 1YFWA 3A0NA 5JIUA 4AGRA 4Q27A 4OI0A 3ECQA 3PVOA 3VHNA 1LEDA 1GANA 3MIHA 3GF6A 1R091 4BLIA 4AG4A 3MF9A 4L99A 4EJRA 5ACA2 5T5OA 3VBUA 4FPFA 1OOPA 5I0RA 3WV6A 4W6XA 1Q3EA 2QCSB 4NWWA 2EAKA 2JECA 5CA6A 3BODA 3SMHA 1TME1 3NAPB 5L19A 5CFDC 4TSVA 1O5UA 1KJLA 4COZA 1E57A 1VBB2 1W6MA 4CDXB 1CAWA 1ZRRA 5F9TA 3JUUA 4F8AA 1GICA 1BMV2 4E2QA 1QDCA 3HT1A 1S1AA 2C0ZA 3THPA 1FPN3 4ASLA 2ZKNA 3MW2A 1AYM3 1WLWA 1NY71 1AXYA 4GWNA 2EIGA 1RUJ1 3JBG3 4M3CE 2ETEA 1FMD3 4W6WA 5IK8A 4X8NA 1O91A 2XL7A 4JVAA 1QDOA 1NOVA 1GZWB 5A3MA 4LTAA 3SCGA 1AR73 3VBRC 1QOSA 5EV7A 1PO23 1SLTA 4PCRA 1S0CA 1FNZA 1HX6A 2GNTA 1RHI1 1UN1A 2A6VA 1PIV2 2DVBA 1X8EA 4M3CA 4JV4A 3CJIB 3OGGA 4EWEA 2VOWA 4KQ7A 3RYPA 2OUHA 4NWVA 3WUCA 3ZYGA 3HD8B 1DZRA 4COYA 1LHVA 4LHLA 2DUOA 1IZ3A 3T1LA 3WZ1A 2VECA 1AR93 3FX3A 2QJVA 4RR3C 4W65A 3ZXDA 1IS6A 2ZS6B 2W0XA 4YW2A 1CX4A 3M4FA 1OQDA 2IFRA 1J3RA 4U2AA 4Q4V3 1YI9A 4YM1A 4AGVA 1LOEA 2DVAA 3ZYIB 1EV11 2RJKA 4HN1A 2RS11 2HWF3 1MQTB 5GLWA 2XJTA 3WUDA 2DU1A 1CGPA 4AK3A 2DCZA 2AUYA 4EN7B 4DQAA 1WCSA 3I59B 1VBD1 2NP0A 4R9DA 4EN8B 2GDFA 2PHTA 1UW8A 4LULA 4AI8A 4BHPA 5J37A 1R092 3D6EA 3DPRC 1W6OB 3VBOB 1PVC1 1RUD3 3ILRA 2NMOA 2PHWA 4YW5A 4GB31 1VIWB 2CGOA 4Y20B 5C4WB 5IK5A 5HCFA 4AVVA 2WIIB 5FFOC 3VBHC 4QPIB 3QLQA 1RUE2 5EJ3A 3PTYA 2JG9A 2Y0OA 2E51A 2NLRA 3FHIB 4CDUB 4MV2A 1QJX3 1LB2A 2ENRA 1HRI3 2V09A 4XJZA 3RJ2X 3HIFA 1W6QA 3JD71 1RC6A 2XJSA 2XG3A 3BCWA 3HQXA 3IPVB 1G9BA 4GIQA 1CJDA 2ILMA 5FQ0B 2Q8OA 1PZ7A 4LBQA 2XGXA 4V1PA 2ZMNA 2GALA 5BNPB 1DGLA 1H8TC 1MS3A 2XLFA 1VAVA 3MIFA 3OF1A 3AMMA 1OQEA 1H9PA 2MEV1 1DGWA 1FT9A 1IOAA 2ZABA 4WVMA 5AC91 2X29A 5BY5A 3TN91 1RHI2 1D4M3 4NOTA 1HQLA 3M3IA 3AMPA 1PM7A 3POSA 2WNUC 2JE7A 1V6KA 1AX0A 1Q56A 4MGZE 1AL0G 2PHXA 4GH4B 4B4PA 1R1A3 3HWJA 4JQRA 3RMXA 1J1LA 4LO5B 1AZDA 2IXIA 2MPFA 5CVRA 5CFCA 4OVEA 4QQOA 2JXAA 4K7JA 3U11A 4FTSA 4Z82A 4IEOA 2R041 2B5HA 3PJQA 5F5QA 3RYKA 1HV0A 1LRHA 1OOPB 4BQ1A 4CDQC 2XVGA 1GSLA 5C9AA 3D5OA 5GLVA 1IS3A 2ZOEB 1ONAA 2NYYA 2LUWA 2DCYA 4QPGC 4PIXA 4XFIA 4Y26A 2FMYA 4DPNA 5JSPA 4XPVA 4Q0VA 3AK0A 1W6MB 1MEC3 1VRH1 1CAWB 3H7YA 1VBD2 3PJYA 3MPPG 1H9WA 5JMCA 5FLJA 4IEPA 2EALA 4XJ9A 4LUMA 1NCRA 3V64A 1PVC2 2FZ1A 3TRSB 4LBLA 1X82A 1BBT3 1RUI3 1ZA4A 1U5IA 4GB32 3VHPA 2PAKA 1H2NA 4BCUA 5DUUA 5H9SA 2UURA 5FO8B 1ND3C 3USSA 4YZ1A 3M3EA 4WBBA 1ZX5A 4CEYC 4XEZA 3ZN6B 4Y22A 4NVPA 2PHFA 3H1MA 2E7TA 1JTZX 4M3CB 5A3LA 3VKFC 1F5JA 1FOD3 5GZFA 5BNOA 4G9SB 3JD72 4B4QA 1HXS3 4X6QB 2A3WA 2XLAA 1LU2A 2ZZQA 4AI0A 1H0BA 1IPJA 5GKAC 2WSUA 3AKQA 2E6VA 1ULEA 2UYBA 1CESA 1GKBA 3J8F2 4HSJA 1LECA 4P5HA 4YARA 4WV8A 4XHBA 1CJPA 4AHXA 1RUG1 1NQJA 4L92A 1DZQA 1OI6A 3GYDA 2BPA2 3P3PA 3VKOA 2AGSA 1XXNA 3AFKA 2VNRA 3IDBB 2V73A 1PNFA 2PELA 5E8AA 4Q0QA 1EP0A 4IETA 2A75A 4I02A 4AQ6A 3B02A 1SQ4A 5AFBA 2QKDA 1BXHA 2DCJA 3LSEA 4AFBA 1AR61 4WM7C 5I93A 1DHKB 4Y4YA 1EAH3 4D7SA 2R042 4YM2A 1NXD1 3SXWA 1O3RA 2DYCA 2JJ6A 1SCSA 1PGW2 3ES1A 5FCCA 3C2UA 1PK6C 2JG9B 4FOYA 1HKDA 4K1YA 1F5FA 4RQPA 1NLSA 4XJ8A 3D82A 2C1FA 1DQ0A 2B9UA 1H8VA 2YC0A 4HANA 1ENXA 4EN6B 1YWKA 5T54A 3H1YA 2RS33 3E5XA 3BPZA 2GMPA 3MIBA 4P9IA 4X8PA 2JD4A 1W2UA 3MLKA 1RITA 1W6QB 2D3RA 4FOWA 4EN0A 2D6OX 1H1MA 2F4PA 2HWD3 1ZNPA 2Q30A 4AQTA 5H9PA 4DMIA 4LBQB 4KNCA 2XVLA 4LO7A 3K48A 1FPN1 3VDDC 3ZYRA 1VALA 4C0BA 1AYM1 3M1HA 4WVVA 4WVMB 2RS53 1KFXL 3P3NA 3JBG1 4R9AA 5BNNA 1FMD1 1X8MA 4CYDA 2XUMA 4TWTA 1XNBA 2OPKA 1AR71 1ULCA 1PO21 4FAGA 1EPZA 3LCPA 3S30A 3WW2A 2BNNA 2ZGMA 1WD3A 2RM21 5CFCB 3WDTA 4C90A 3ZMNA 1OPMA 4LO4B 5D8AA 1ZREA 4D7TA 4DY5A 2XVKA 3E6DA 4OUSA 3AP4A 4Q1PA 2RJLA 3MGUA 2PHUA 5JR7B 4AEJA 1AR91 1ENSA 2GN3A 2QZ3A 5LK7B 5C9AB 2JDZA 1ZZ8A 3M70A 2GZWA 4Q4V1 3JB4C 4WM8C 3GZTB 1RL3A 3JQWA 4L2NA 3IN9A 5AVPA 2YV8A 5I0TA 4W6YA 5C8CA 4SBVA 1WLCA 3IDCB 3OD4A 2ZHLA 3N7KA 1RUJ3 1UPSA 4MLOA 1AR62 3ME2A 2E9QA 2LM3A 1NCRB 4XYXA 3N35A 1H30A 5FMOS 3CF6E 1RUOA 4G4FA 1OHFA 4AHZA 2R6QA 1RUD1 4L11A 5F6KA 2Z5WA 3FJSA 2OVUA 2H0VA 3AKSA 4MGYE 4E4ZA 3MIGA 4FQ4A 4Y22B 1O4TA 3V56A 5GLTA 4AVSA 4BMEA 1YFXA 4HK8A 2I45A 5D1IA 3ZIXA 1NCQA 3TNPB 5T50A 5BNOB 1QJX1 1KITA 4MYEA 4Q4X3 1HRI1 1Y7BA 2C5DA 1WBFA 3LZZA 2TBVA 2A5ZA 1DZTA 4Q0PA 1J59A 1EV13 2BEOA 2RS13 4LHNA 1N1YA 1DYKA 1FPN2 3A0KA 1OKQA 1KRIA 4IEXA 5GALA 3TAYA 3ATGA 5T5PA 1LEMA 4FPOB 3ZFFC 4DINB 1J1TA 3JBG2 1ND2A 3FLPA 3QOPA 5BNQA 5J3UA 4XXAA 3WR0A 5JOZA 5K0UC 2YROA 2YPJA 1AR72 1PO22 2R0FA 4FAHA 2UY9A 4IQPA 1LGBA 4XHXA 2UWAA 1D4M1 4R4XA 4HKWA 1VBC1 3WCSA 1WD4A 4A7ZA 4XW3A 1PNGA 1IKQA 2N7GA 5KHIA 4P14A 1OA4A 4PLOA 1J3PA 3AP9A 4CDWC 1N1TA 4HETA 2ZHNA 2RE9A 4N9IA 1AR92 2CGPA 4DZGA 2XKPA 1AL22 4AEDC 3BB6A 4Q4V2 4RQPB 1FV2A 4XF3A 1QH7A 2PFWA 3J9SA 1SLCA 4M01A 2GNDA 4JTNA 1O4YA 2HWF2 5I8TA 1S0JA 3ENRA 1VB2A 4FSJA 2W68A 1N3QA 3WDWA 5CFDA 1NXMA 3OPZA 5JWPA 1POV0 4OHZA 1MEC1 3RYRA 2Z2SB 5DZEA 2ZMKA 4XBLA 4B3NA 4AYUA 5AC93 3O0VA 3N7MA 3V65A 4QHBA 2VMGA 5KHJA 3EO6A 1YI7A 2DU0A 1LESA 3TN93 2XBO3 3AZZA 1RUD2 1QH6A 1BBT1 1RUI1 1OMIA 1S0FA 4AI1A 1OA3A 4JDNA 2VY0A 2PN5A 3WOGA 1SMVA 1I6XA 4IL7A 3VBFC 3HAGA 2Q0AA 3JQXA 4XBNA 4QM9A 1ZYBA 1C3HA 2Q1ZB 3VBRA 3RI8A 2OW4A 3WW3A 3FLTA 1QJX2 3DKWA 1CAUA 4AVBA 2Q1MA 2QE3A 3M3QA 5D8AB 4KWJA 3CJXA 2AREA 3NO8A 3PNAA 2JX9A 3PVBB 1HXS1 5T5LA 2BYVE 1V6IA 3EJKA 4K1ZA 4MGKE 3KGZA 5T55A 2P37A 1V6LA 4RR3A 3WINE 2BNOA 5FDBA 4HL0A 1VRH3 4Q4W3 2XPJA 3KSCA 3USUA 1F31A 2HJIA 3A4UA 5JZGC 1V70A 2Q4SA 5IK4A 2VVFA 2BWAA 1D4M2 4YYOA 5CU1A 5A33A 3FUQA 2ZACA 4BM8A 1KXGA 2ZGUA 1D0GA 3R4SA 1RMU1 2ZGRA 4IV1C 4DRRA 5FPXA 1R1A2 5I8SA 4AWDA 4IERA 1UX6A 3M7AA 3B5LB 4J6GA 4ES8A 4CRQA 2BQPA 1EAH1 4X6RB 3VHRA 2Y0IA 3J4UH 2PAMA 4C1XA 4FXKB 1O7FA 3BOPA 3MEPA 1RUC3 4AQSA 2X5IC 3IMNA 1V6OA 2CGNA 4BIOA 4RGGA 1L3JA 4YM3A 5LEJA 4A3XA 5BV6A 4RA0A 3VBHA 2R30A 1RVF3 4IEUA 3ZIWA 4YVWC 1F9KA 1GQGA 4NHMA 2VVDA 1NCQB 1XNCA 2R16A 1B35B 2FBEA 3WP6A 1QY4A 4I0AA 4Y1XA 3ZXGA 1MEC2 5DUVA 1LOAA 3S7EA 4IEWA 4WVWA 4P9GA 3BALA 1RUG3 1CAVA 1QGLA 3EBRA 4ZU4A 5C8WA 1PGL2 4QQLA 3ZFGC 2Y26A 3J26N 4I3GA 4HPKA 3ZMOA 4MZUA 4NR1A 4OHXA 3GHMA 4WZFA 1QOOA 4MGIE 3ZFEC 1BBT2 1RUI2 1VBA3 2HWD1 2ZHMA 4GQ7A 1YIPA 3INAA 4OHWA 4XFAA 3TBDA 4QQ2A 1ND2B 1A78A 3VLBB 5HXVA 1JUHA 1H8TA 3S0MA 5K9YA 2GN7A 1G9FA 4DNYA 1QQP3 4N53C 2RS51 2TUNA 4YW4A 3WD5A 3RG0A 1M06G 2WT1A 3M2MA 3B94A 3WG3A 3IKWA 1C5IA 4FP2A 2Z42A 1NQDA 2WNUA 2CTVA 3TWIA 1FOD2 1S0GA 2ZAAA 1VBE3 3FFZA 5F6LB 2A3YA 3IT8A 2DCTA 4HMZA 4FBFA 1HXS2 4YM0A 3U0ZA 4AW7A 5JI7A 1DF0A 3I54A 1AXZA 4PIYA 2H0BA 2YZ4A 3B9IA 1GQHA 1YJLA 3C3VA 3LB9A 3BTAA 2GH8A 4PBOA 1DIWA 1COV3 2YDEA 4RSUA 4CDQA 4UW4A 3RI9A 4AHWA 3WDUA 2D44A 3NAPC 3RRDA 4L97A 4GALA 1LHWA 3O0WA 4IEYA 5GZEA 1QJU3 1EY2A 1OSGA 2EAAA 2GC0A 3KZ4C 3DGTA 2ZX2A 3O0XA 5CFDB 5DDJ3 1TE1B 4N43C 4F3JA 3UKNA 5EWSA 1VLNA 2YUEA 1LOFC 4CEWA 4AI3A 3FE5A 4CP1A 1KQRA 2X53S 1W39A 1EAH2 2GC3A 4IXLA 2BUKA 1PZ8A 2WKKA 2X8KA 5DZGA 4G3YC 4DB5A 2UU8A 2RM23 3ZSJA 5DXDA 2DFCA 4M0NA 4UBGA 1FXZA 1NA1B 4LBNA 3NWKA 2HEVF 2IXJA 4FPEA 4ZKTB 3VBRB 3VV1A 1LU1A 1RJ7A 5IK7A 3FLRA 1V9U1 1CAUB 3CLPA 1QXRA 1FX5A 4YGCA 4D69A 3CJIC 4CEYA 4FO9A 2ZKLA 3K51A 2RS32 3ROUA 4Q8LA 4BYYA 1YYNA 4HLTA 2VPVA 4Q4X1 2VVEA 4JRLA 3VZKA 5J09A 2CWMA 4PLMA 5CAZA 3QH6A 4FPHA 1LOBA 2HWD2 1KDKA 3S7IA 4RR3B 1DBNA 1ZBE1 1ALYA 1AR83 1VB4A 1MS5A 1OA2A 3NV4A 2RS52 5B2GB 2OZ6A 3TYJA 2ZX1A 4Z1VA 1MQTC 1BCXA 2WSVA 2WWSA 3VZLA 3V0AA 4Q26A 2Z69A 3CNAA 1Q8OA 5A33B 4HFSA 4J1XA 3ES4A 4JGZA 2BBVA 3VZNA 2R1BA 4R8HA 3LA2A 1SFNA 1J3QA 1GBGA 5E88A 2FHRA 1ZBA3 2XJPA 3VZOA 5JI9A 1LOGA 1SBDA 2JEMA 4MVTA 3G6JB 4WM7A 3RDIA 1GR3A 1TME2 4RHV3 5C4WC 5HCAA 2ZGOA 2D3PA 4CTEA 1MACA 3VBHB 3FBMA 3VN4A 1PK6A 2E7AA 3DF0A 4XFFA 1LHOA 1SLBA 4H3WA 5GZCA 3AB0A 3JB8A 3DL3A 2K9ZA 4N7UA 4FPCA 2D3SA 2BW8A 1NY72 1QJY3 3EXUA 4LEJA 4BIFA 1RUJ2 1CAVB 1DQ6A 4HPKB 1GZCA 4D94A 4RS5C 5E16A 4EWAA 5GJ6A 4GMP0 5BNPC 2CAVA 2XBO1 2G9GA 1VBC3 3VDDA 1G9AA 2E7QA 5FTTC 4A2UA 1AYN3 1QMJA 4I0BA 4HVOA 3KD4A 5KBFA 4FPJA 4GH4C