4YVWB

Crystal structure of an enterovirus 71/coxsackievirus a16 chimeric virus-like particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
236
structure length
224
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRSGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMQLCKDASDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Yeast-Produced Enterovirus 71 and Enterovirus 71/Coxsackievirus A16 Chimeric Virus-Like Particles Provide the Structural Basis for Novel Vaccine Design against Hand-Foot-and-Mouth Disease
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 32
structure length 224
sequence length 236
chains with identical sequence F, H, K, N
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yvwB00
4N53A 5BNOB 5C4WA 2BUKA 4QPGC 2BFUL 1PVC3 1RHI3 3VBHA 4CDXA 1FOD1 2X5IC 1C8M3 1NCQC 2BPA2 1AR73 1ND3C 1AR93 1VB4A 3VDDC 5ABJB 3TN93 1W39A 4RQPA 1V9U2 3VBRA 1VBB1 2XBO2 3ZFGC 1RUE3 2WWSA 1VB2A 2HWF2 2R043 4JGYC 1BMV2 1RUI1 1AR61 2WFF3 4GB31 1AYM1 1FPN3 4Y5Z0 4CDWC 1HRI3 1AR81 2WS92 1MQTC 1VBD3 1BEV1 1VBB2 2BFUS 1RMU2 4FTBA 1RUD2 1QQP2 2VQ0A 1VBC3 4N43C 5CFDA 1ZBA1 2RS33 2RS32 1ND3A 1AR91 1VBE2 1HXS2 4RS5B 1TME2 4Q4V2 1R082 1VBC1 1RUH1 1PO11 1H8TC 1PO22 5FMOS 5C9AC 3DPRC 1MEC1 5AC92 2PLV2 4AEDC 2TBVA 4IV1B 4IV3C 1ZBE1 2HWD1 4Y4YA 3VBUB 3ZFFB 1VBE3 1BBT1 1COV1 3JD71 2WFF1 1QJX2 1OOPC 1TMF3 5ACA3 4CDXB 5CFDB 1HXS3 5ABJA 1NG0A 1PO21 4CDUC 1EV13 4Q4W3 3VBOC 1POV3 4RQPB 5D8AB 3VBRB 5L7OA 2ZZQA 1RUD3 2BBVA 2R072 4GMP3 2WZR1 4CDQC 1ZBE2 2ZAHA 1OPOA 5ACA2 3CJIC 1ASJ1 4CEYA 1PGW2 1K5MA 3JD73 1BBT3 1RHI1 3VBUA 3ZFFA 4GB32 2RMU1 1NOVA 3VBFC 4GMP0 2R042 1QQP1 1EAH1 1A6CA 2RMU3 4EJRA 3J8F1 1TME3 4JGZC 1RUJ1 5D8AA 5L7OB 4Q4Y3 5BNPC 1RHI2 1ND3B 2RS31 4CEYB 4RS5A 3VBOA 1RUJ3 1HRV1 1POV1 1BEV3 3J8F2 1HRI2 2HWC2 4Q4V3 4CEYC 5FOJB 4IV1A 5FMOL 5C8CA 4RHV1 1RUI3 1VBA3 1AR63 1AYN1 4QPGB 4CEWB 1RUE1 3JBG1 4Q4X3 2WS93 1NY71 4RFT0 2ZTNA 2RR11 5DDJ2 4RHV2 1PO12 5ACA1 4QPIA 3VBRC 1FMD1 1K5MB 1TME1 3IDEA 5C9AA 3DPRA 1EAH3 1RB8G 1F8VA 5GKAC 1PGL2 4CEWA 1V9U3 1RUG2 1RVF1 4YVSA 4FSJA 5A33B 2RS53 1K5MC 2HWB2 4WM8B 2RM23 4RR3A 1RUI2 3HAGA 2RM22 1ASJ3 1PIV3 2RR13 1MQTB 1VRH1 2DF7A 1AL23 2RS13 2HWE1 1NA1C 1VBD2 3VBOB 1EV11 4Q4W1 4FTEA 2Y26A 3ZFEC 5BNNC 1HXS1 1AR71 3JB4C 1HRI1 4YVSB 2RS51 1FPN1 1AYM3 1R1A2 1PGW1 5A33A 4FTSA 1MEC2 5C8CB 1ZBE3 4RR3B 2HWE2 2R041 1DDLA 2XBO3 4QPGA 5C4WC 2HWD2 1EV12 4Q4W2 4SBVA 3JBG2 2MEV1 4JGZA 4YVWC 3VBHC 1FMD3 4CDXC 1B35A 2X5IA 5CFCC 1AR72 3VBFB 1AR62 1AYM2 1C8M2 1QJY2 1R1A3 3VBSB 2WFF2 1Z7S3 3NAPB 1ZBA3 2WZR3 2HWC3 4QPIB 5J96B 3ZFGA 3JBG3 5C9AB 3DPRB 1GFF2 1VRH3 1RUF3 1HQNA 1PGL1 4CDWB 1QJU2 1H8TB 1COV3 1PIV2 1AR92 1VBE1 4QPIC 2XPJA 3VBUC 3ZFFC 4WM8A 1X36A 5LK7B 1RUF1 2X5IB 5BNOC 3VBFA 5K0UC 3M8LA 3VBSA 1MQTA 1RUG3 1VRH2 3NAPA 2WLPA 1VBB3 1CD3G 1HX6A 1NY72 2R063 1RUC3 1PO13 1NCQB 5DDJ3 5CFDC 1M06G 1R1A1 4Q4Y1 4CDUB 1Z7S2 1D4M2 5DDJ1 2FZ2A 2MEV3 2R061 2HWD3 1ND2A 4Q4X1 2RS52 1FMD2 3ZFEB 1PVC1 5BNNA 2GH8A 1QJU3 4JGZB 1OOPA 2MEV2 3FBMA 4PDWA 3S6PA 4RR3C 1NCQA 1B35B 1QJX3 1TMF2 4WM8C 1D4M3 1CJDA 4WM7A 1RUH2 5ABJC 2R062 4RQPC 1NCRC 4GMP1 4CDUA 2PLV3 1RUE2 1HRV3 2R073 2HWF1 1B35C 2RR12 1RUJ2 3ZFGB 4JGYA 1AL21 2RS11 4Z92B 1PIV1 4NWWA 5BNNB 1COV2 1OHFA 1NCRB 3TN92 1NA1B 1TMF1 1VBA2 1R092 4CDWA 1H8TA 1C8NA 1VAKA 2HWB3 1RVF3 1WCDJ 1OOPB 1QQP3 4PDWB 2QQPA 4LLFA 1RUF2 4WM7B 1MEC3 3LOBA 2HWB1 2WZR2 1BEV2 5L7OC 5D8AC 4NWVA 1QJY1 3TN91 5BNPB 3VDDA 4JGYB 4WM7C 1R091 1RUC2 1AYN2 1QJY3 3NAPC 2HWF3 4YVWB 1R081 1VBC2 2PLV1 4CDQB 1ND2B 5CFCB 4Q4X2 1SMVA 3ZFEA 4AEDA 1VBD1 3CJIB 5JZGC 5J98B 4IV3A 4YVSC 1QJX1 1E57A 1AUYA 4IV1C 5C8CC 4GB33 1QJU1 1ND2C 5BNOA 5C4WB 5JZGB 3VDDB 1HRV2 1AL0G 4RS5C 1RUD1 3VBHB 1R083 1AL22 2RS12 1ZBA2 1RUH3 4N43A 4YVWA 3ZXAC 1RMU1 1PO23 2HWC1 4CDQA 5CFCA 2GSYA 1R093 4Q4Y2 4GH4C 5K0UB 5A32A 4AEDB 1FOD2 4IV3B 1FOD3 1C8M1 1NCRA 1RMU3 1NA1A 5AC91 4N53C 1V9U1 1EAH2 4GH4B 2XBO1 1F2NA 1PVC2 4CEWC 5JZGA 2FZ1A 1AR83 5AC93 1BBT2 3JD72 4RHV3 1BMV1 4N53B 4PDWC 4N43B 1FPN2 5BNPA 3VBSC 5K0UA 5A32B 1AR82 1RUC1 2IZWA 2R071 2WS91 2HWE3 1RUG1 1RVF2 3JB8A 1ASJ2 1Z7S1 1D4M1 3CJIA 4GH4A 1AYN3 1IHMA 1QJZA 1X33A 1POV0 1VBA1 2RM21 2RMU2 4BCUA 3J8F3 4Q4V1
chains in the Genus database with same CATH superfamily
1UYPA 3LAGA 3NJVA 4N53A 3BALA 3I2GA 1Z0HA 2NLRA 3KV9A 4ZXKA 5LATA 4B4RA 1ALYA 2ZGQA 3AKRA 4LKSA 1UMHA 2D6LX 1WCQA 3GXUA 1W8OA 3E6BA 2I07B 2VMEA 1X8EA 1YHFA 1RHI3 2BQPA 4KGQA 5EWSA 4XJWA 2XQXA 1AR73 4HK8A 2B39A 5IVEA 1ENXA 2VNRA 5HCFA 4KU8A 1OVSA 4YZ3A 4GA9A 2WWJA 3SQOA 3TN93 3TYJA 3T30A 4QXCA 4RQPA 1QOOA 3SCHA 4BISA 3TEYA 4OQ8A 1DGWX 4A7KA 1HN0A 4FXGB 4UT5A 1CPNA 4LBQA 3NNMA 3ZYPA 4CCOA 3DXTA 3KQRA 2RG4A 5FY4A 4CU6A 3VLBB 3ZYBA 3PMSA 3RYRA 1BMV2 3TEXA 2MHFA 3S7EA 2WFF3 1ONAA 1AYM1 5FZAA 3U1XA 1VIWB 1WLWA 4XW3A 4XHXA 4CDWC 1ZZBA 2WFPA 5FP7A 1AR81 4LBLA 3D5OA 1DYOA 4IQPA 3B00A 3B3QE 2VAUA 5ANNA 3PNAA 1MQTC 1CZSA 1GSLA 1HV0A 2W5FA 3RJ2X 4IEPA 4BHPA 3G7DA 1YUDA 3L2YA 4LO6B 2ZX1A 3WDTA 3POFA 4RA0A 1T2XA 3I2KA 2DCZA 2WT1A 1VBC3 2DTWA 4N43C 4XF9A 5G04L 3ZDSA 5HBAA 5KXCA 1S1AA 4CU7A 1W9TA 3HIFA 4MZUA 4COWA 1UOBA 1NZCA 3KMHA 1UW8A 5IFPA 1LCLA 3O0WA 1TME2 5LRRA 3TNPB 2R49A 1RUH1 5DZEA 1PO11 1HKDA 1PGSA 2D3SA 5LBCA 3RI9A 1H8TC 1QF3A 1WCSA 3PTYA 5FMOS 5I0TA 3ZMNA 5C9AC 3DPRC 2W52A 3VD4A 1LEDA 1REDA 4XFFA 5J37A 1H2KA 1CGPA 4NIHA 5CZKA 5FZ8A 5IK4A 2WNUC 3GALA 2G9ZA 2WNVB 4IV1B 4BXSV 4JCKA 3UESA 3N9LA 2LUWA 3T08A 2E51A 2VXJA 2VW0A 4D6QA 5J09A 3QCWA 3CDZB 3WQ7A 1OOPC 5ACA3 4HPKA 5CKQA 4CDXB 5CFDB 3MPBA 2YYOA 3AZVA 1HXS3 2C0ZA 4JTNA 4JTOA 2J42A 2V5YA 5E8AA 4Z07A 3H8OA 5T52A 3I7DA 3ZXFA 3HT2A 4D3WA 4DZGA 3FBYA 1OD5A 1T6GC 3RQ0A 2XXZA 4CDUC 2XLAA 4CCDA 3VBOC 5B4NA 1LGBA 1POV3 2O14A 1ENQA 2P3JA 4N9IA 3VBRB 1RINA 4BQ1A 1RUD3 3N7LA 4PLOA 4GMP3 2GC2A 5A3WA 2WZR1 3O1RA 2GC3A 3C3VA 1QOTA 4M3CE 2ZAHA 1OPOA 4L2NA 4XF1A 4DRVA 4TWTA 5ACA2 1ASJ1 5A7WA 2QZ3A 3OUHA 1RC6A 1PGW2 3ENRA 5DAVA 1K5MA 2I45A 3ZXKA 4QQLA 1NLSA 1O4YA 4COYA 2RMU1 1NOVA 1WLCA 2P17A 4NE9A 4TLFA 4PJYA 4HPKB 4GMP0 1YXWA 1VLNA 5F5AA 4TYSA 3AKPA 1YLLA 5LB6A 1UPIA 3SH3A 4WZCA 4FP2A 3J7HA 1STMA 4J25A 5JSPA 1PMJX 1VAVA 3ES4A 1VALA 2JB4A 4QX5A 3FWEA 5FUNA 4LHNA 2Y38A 3ORJA 4Q4Y3 4UW6A 5BXXA 2WO1A 4KWUA 4V1PA 1XNTA 5LY1A 3POWA 3I3DA 1RHI2 1AX2A 3S7IA 1WGPA 2ORZA 2VQUA 3R4SA 5GLUA 4XCBA 3H42B 4PCRA 2OKXA 4QB1A 3ZR5A 2FDIA 4RS5A 4ZS2A 2QDNA 1JYIA 2H0VA 2OXBA 1I5PA 1IOAA 2QCSB 2QUOA 5JR7B 5A3NA 5K8SA 1QJFA 1W6PA 2D98A 3SEPA 3U4XA 1F9KA 3D3AA 3USUB 3UV9A 4AL9A 4Q1PA 1CVNA 4DFSA 2WN2A 4B7EA 3J8F2 4A4AA 1G8WA 3LPFA 3VDAA 4HMZA 2LTNA 1ULEA 2GALA 3RZJA 3H50A 4NPMA 1SBFA 4COZA 3ZXEA 1RUI3 1CZTA 2A6WA 4XBLA 1BLZA 4QPGB 4QXBA 1YC61 3O1SA 5F6KA 4LO5B 1DZTA 3JBG1 2LS6A 1HDKA 1OA2A 1OLMA 2GNBA 2ZKLA 4WVMB 1PX3A 3NV3A 1JOBA 4DB5A 4Q4X3 1S0CA 2UWCA 5T5OA 1AJKA 1KDKA 2DU0A 4RFT0 3HVDA 4CRQA 2ZTNA 4CUBA 3ASIA 2JG8C 1J84A 2RR11 4DUVA 2C24A 1YCIA 3MW3A 3U10A 5ACA1 3WD5A 4TN7A 4LTAA 3RZLA 4AR2A 1TME1 1OQEA 2XH6A 1DFQA 3N9MA 4XMIA 1AX1A 1W6QA 2Q1ZB 1EY2A 5IWFA 4DEQA 2RJLA 3BGAA 5FY8A 1NLQA 5IVYA 1RB8G 2TUNA 2J1TA 5GKAC 1GOHA 4WZFA 2EIEA 1PGL2 3FHAA 3KF3A 1V9U3 1RUG2 1RVF1 5JMOA 5FYBA 1GZ9A 2A71A 4NIDA 3N7KA 4AVCA 5L9VA 3PUAA 1LOCA 3ZR6A 1H2MA 4CUAA 5FZOB 4XTPA 2RM22 4HK9A 4YZ5A 2RR13 2G4IA 3MLJA 3NNGA 5A1LA 4UFIA 1ZREA 2DF7A 1AL23 3H3LA 4PQQA 2OZJA 1NA1C 2HBTA 1GZTA 3WEZA 1XJAA 1DGRN 3DYMA 3IPVA 3OPWA 1EV11 4Q4W1 5FAXA 2Y26A 3MBWA 4E8DA 2UWBA 1DLCA 3C7OA 5DAPA 3E5XA 4LKFA 3GYDA 4JVAA 5IW0A 4QD2A 3N9PA 4GD4A 3ZYHA 2KA3A 4CCJA 4V2WA 1FPN1 2R0HA 1AYM3 1PGW1 2CWMA 4LHLA 4NRMA 1MEC2 1O5UA 5IUQA 2XVKA 4RR3B 2HWE2 5FQ0B 1W0NA 2VECA 4W65A 5FY0A 2WT0A 3ZMOA 1DDLA 2YPJA 3SNMA 1N47A 3WP4A 2ETEA 2ZBJA 2NMNA 4BB3A 2XWJB 1O7FA 4P9GA 4YFWA 1OBNA 4UBGA 4BQXA 2ZX0A 3C7GA 4OVEA 5I8YA 4MUVA 5ERLA 4QQOA 1B35A 5KHHA 1YIFA 1E5RA 1IS3A 2GC1A 3N3HA 1AYM2 3ZXDA 1QJY2 1UOJA 3BTYA 2E33A 2GDFA 3OF1A 1Z7S3 1ZBA3 3LWCA 5DUXA 5FZCA 2J1AA 3I4IA 5L9RA 2VR4A 4LKEA 4D7TA 2BTVC 1H4GA 4QPIB 2YDEA 4OI1A 3S0MA 4Q0VA 3ZIWA 3ZFGA 2XHKA 3JBG3 4D7YA 3DL3A 2JB8A 1RXFA 3QACA 2WNUA 1G9CA 1VRH3 2ZPXA 4HFSA 3D0JA 1FYUA 1HQNA 3N4MA 3OY8B 4CU8A 1NXD1 4IE7A 2D6OX 1PGL1 1ZZ8A 4ZONA 1H8TB 1COV3 1GZWB 1SLBA 4QPIC 2D43A 3MIBA 4FPCA 4NVPA 3ZFFC 3I59B 5E6HA 3GM8A 4Y1ZA 5L36A 2WJSA 1OLME 1NAEA 2PAKA 3IN9A 5JAXA 2Z4FA 1O3QA 3AJYA 2P6HA 1V6IA 2V09A 4FOQA 3MV11 1HX6A 1LKNA 2PHLA 4F8AA 1ZRCA 2XL7A 4MGKE 1OLRA 4P9XA 5CFDC 5ISLA 2FMDA 1DU3D 2D40A 3MICA 1ZNPA 3MO4A 2MNGA 4CDUB 5JMCA 4LO4B 1URXA 1KD7A 2FZ2A 2XJSA 2HWD3 3IMMA 1HLCA 1SPPA 2BVVA 2UYAA 1W3XA 1FMD2 4GULA 2GU9A 1DGRA 1JUIA 2ZJCA 5BNNA 4COVA 1UPSA 1UU6A 3C8XA 3GDBA 3MIDA 2W39A 1MS9A 2ZMNA 4L11A 4BQ2A 4YFZA 5HI0A 4KBZA 4ISQA 4QKBA 1ENRA 2OW4A 4JGZB 3OBTA 2ZGNA 4W6XA 2GMPA 3AMNA 3C2UA 1QJX3 1TMF2 3OJBA 4GZ9A 1U5IA 2YBSA 3CZUA 5T5PA 5ABJC 4MHUA 2BW8A 1NCRC 2QDRA 3FLTA 3IAQA 4CDUA 5T50A 3C7EA 2PLV3 3P5BA 2XGXA 1QNWA 2ZGTA 2FD8A 1LU2A 1UAIA 1DQ1A 3E5UA 5IAVA 2VCCA 5FXXA 2RR12 3AYCA 1O4TA 4OULA 1G9AA 2ZEZA 1QJEA 1CIYA 2A3WA 4G3YC 4Z2AA 3BTZA 1OHFA 1NCRB 2X53S 5EP9A 3LEGA 5HXVA 5A1AA 1G9FA 1YI9A 3EYPA 2VQAA 4MVTA 4MGYE 3S30A 2WKKA 1R092 2Q30A 4UWDA 1BK0A 1LB2A 1SFPA 1C8NA 3MGUA 3M3IA 1YJKA 5FPUA 1B09A 4A7ZA 3POYA 4BMBA 3ZXJA 4A2UA 3OB8A 3WX5A 1RUF2 3URFA 2CSGA 5T3NA 1SLCA 3EMRA 2Y60A 1MEC3 1HJGA 4FPGA 3DYOA 4LK7A 3H0OA 5A6ZA 2C1FA 2WZR2 2DCJA 4QX2A 4S2DA 4NN0A 5GZDA 5L7OC 4NWVA 4XBQA 4CCLA 5CIRA 2JENA 3GBGA 5DPNA 3M3QA 4IE6A 4P5HA 2P6CA 3FL7A 4EN8B 3ZSLA 4WV8A 3FHQA 1MVQA 4QHOA 4JAAA 2UURA 5FK8A 1RUC2 2D93A 4BQYA 1QJY3 3WW4A 2WN3A 1JW6A 3HEIA 1N1SA 4Y22B 4YG3A 1L7RA 5JWPA 3WG4A 1R081 1VBC2 2QE3A 4XUPA 5FYMA 2EAKA 1P8JA 3VKNA 1V70A 1ND2B 3VKFC 2JG8B 2I2SA 3CJIB 3PTRB 5FPAA 5J98B 4Q8LA 2ZGMA 3A4UA 3S57A 2VW2A 1FI2A 3L9JT 4YM0A 1UY2A 3S5AA 4DXTA 1OH3A 1IS6A 3T0DA 4RGKA 3W58A 1QJU1 2VUDA 1ND2C 4JHZA 4LO8A 4DXRA 2VL4A 4MV2A 2CY6A 4AEKA 1YI7A 1CZVA 5IK7A 1XU1A 2RV9A 2BV4A 1RUD1 3PVNA 1S2BA 5LA1A 2BU9A 1R083 3AP6A 4H14A 4W50A 3VL9A 2QVSB 2C6SA 1AJOA 4FFGA 1RMU1 4HZFA 4MGQA 4N43A 4YVWA 5TSWA 2JEMA 4MX3A 5CFCA 1GQPA 3MHZA 4GH4C 2YROA 4Q4Y2 5A32A 5FYVA 3OD0A 4L97A 1O8PA 2DVBA 4FFFA 1PZ9A 1PNGA 3RNSA 5A6XA 5LA9A 4XVHA 5J36A 2VTXJ 4JHTA 2YV8A 1MZ6A 1NA1A 1RUNA 2XMLA 2ZHKA 1GU3A 4BQ5A 1QOSA 2VZRA 3Q8AA 1NE6A 2ZGLA 5IJRA 5FZHA 1ZM1A 2V5DA 4GH4B 1LENA 1F2NA 4CEWC 2A73B 1O91A 5LASA 3BU0A 4R9CA 5FZ4A 5I8SA 4DQAA 1FX5A 5AC93 4LBMA 5SV5A 2DFBA 3QH7A 3POIA 1W2OA 5CKNA 4JQTA 1W2TA 3AMMA 2G1MA 1W9FA 3C7HA 3LDBA 5LZ6A 5IYYA 4PDWC 3AP7A 4AFCA 2HEYF 2IC1A 2DUQA 3F2ZA 4M00A 4BZ4A 5JPNB 1D2QA 5A32B 4UW4A 1VP6A 5FZIA 2JDNA 5DXDA 4ZZ5A 2HH9A 2IZWA 2WS91 4ZU4A 3OBAA 2WZPP 3ZDVA 4DXSA 1XE7A 4B1LA 1VMHA 1XNBA 3JQWA 5HCHA 1RUG1 1RVF2 4K20A 2OZ6A 5FLHA 1ASJ2 2GP3A 1Z7S1 1D4M1 5EIYB 4GH4A 5GZGA 1QJZA 5FYHA 3OYWA 5LK5A 2BGPA 3AKTA 3O1VA 2OA2A 4BCUA 2W1SA 1JZ6A 5EYXA 5FDBA 5FREA 1DYPA 1QH7A 2J1RA 3USSA 1DGWA 5JI9A 5K9YA 1L7QA 3AZYA 2ZEWA 1F31A 2RJKA 4AG4A 3MUY1 4HVQA 3VUOA 1FV2A 5LA2A 3TEWA 4UXAA 2JDYA 2BFUL 4YNIA 1PVC3 1Y43B 5AVAA 5K7PA 2JIGA 2QBXA 3X29B 4DY5A 3WOGA 2F4LA 2VOKA 4FPKA 4KNCA 3T3YA 2DUOA 4HKWA 2X10A 3NMBA 5FLJA 4DINB 4CDXA 4XQ4A 1FOD1 5BY5A 1C8M3 2D5FA 3HD8B 3ZYFA 5FZBA 1F35A 3VDDC 2VNVA 2VZ3A 3RGBA 2J1SA 1HQLA 3CBNA 4IGQA 1NT0A 1W39A 5GM0A 4UAPA 4AQ6A 1DLLA 1V9U2 2YU1A 4N7UA 3VBRA 3CL1A 3KCXA 2V73A 1VBB1 4RSUA 1ZZ6A 1KS4A 1Q8PA 3D4KA 3HQRA 3PDQA 2WWSA 4NHXA 3U78A 1VB2A 3LEMA 5A7WB 3KF5A 3UKNA 3WG2A 3GZTB 5FP3A 4FVVA 2ZZJA 1DZRA 3H1MA 2Y6HA 4Y5Z0 1HRI3 2XOMA 2D6KA 2VC9A 3WDYA 1CONA 2IVIB 2C4XA 4RN5A 2O1QA 2VMFA 1W99A 3S5QA 4QQHA 3ZN4A 5L73A 2BFUS 5JDBA 1W03A 1XE8A 3OBRA 5HXMA 1RUD2 3VZOA 5FUPA 4FTBA 5F1RA 2CTVA 1ZBA1 3T2TA 1UWWA 1VJ2A 2GC0A 4B3NA 3E97A 2PELA 1AR91 1VBE2 4L99A 2SBAA 3FUQA 2R7EB 4IEUA 1HXS2 4QX0A 1V0AA 2JG9A 1QNYA 1R082 1VBC1 1XNDA 2QZ2A 4Q4V2 4RS5B 4YM2A 2QQMA 2WAAA 5EJZB 1ZRIA 4Q0QA 1DQ4A 3RYPA 1W6PB 1PO22 2OUJA 3RPQA 1DYKA 5A3OA 4BK4A 3ZN6A 1GR3A 5CAZA 1U5ZA 1OKOA 2XG3A 1A3KA 3HJRA 2VW1A 4OHZA 3WY6A 4NAMA 4F7ZA 5F3CA 5JSOA 4AHXA 3WVJA 2Y6JA 4LE3A 5C3QA 2YUEA 2EALA 4YG0A 2HWD1 4Y4YA 3W20A 3VBUB 4ES9A 1VBE3 4A3ZA 2NP0A 4Z8BA 1UU4A 1LGCA 5JOWA 1IZ3A 3MFCA 1VMJA 3D0SA 5H9RA 3RMYA 4FP3A 3U11A 2AEYA 5KXDA 2ZEYA 3ZIXA 1UX7A 5FZ9A 5LBEA 5L7OA 1OA4A 5LW9A 1FATA 3KCCA 2D6PA 5F32A 3PU3A 2R072 3AX4A 3VB9A 1ZA7A 4LBQB 4CDQC 1ZBE2 3ME2A 4LBJA 4E2GA 4LLOA 1C5IA 4G4FA 4XAAA 3WCSA 3LFIA 4JRAA 5AVPA 4QDQA 4IE0A 2QFEA 2FDGA 2CV6A 2XQRA 2FCTA 3ES1A 3WV6A 4CXXA 2JD4A 3IDAA 3B94A 4XDOA 4R8HA 2BGCA 1NUKA 5DG2A 4OQ9A 4ORFA 3TB0A 1IS5A 2AGSA 4FO9A 4N90A 2R042 5JVVA 3WNXA 3WXPA 1Y4WA 1JZ4A 1EAH1 5E88A 2RMU3 4LK6A 4C1XA 1X7NA 1H4HA 5E16A 3WHUA 4EJRA 4AE2A 1S0BA 2CGOA 4DEVA 5L7OB 3VD5A 3J4UH 1Q5OA 3AMHA 1LHUA 2VCMA 4GQ7A 1CESA 1W6MB 1YQ5A 2PHFA 2WR9A 4Q0SA 2K9ZA 4AI0A 4C8DA 3H3UA 2CDPA 4CEYB 4YARA 4MGTA 2JDKA 4FPOB 2VBDA 3ETQA 3ITQA 4ARYA 1WMEA 1ZRDA 4RFRB 2QQKA 3I54A 4K7JA 2WZ8A 4PQ9A 2F4PA 3RSJA 1XYPA 5LCWL 2HWC2 1JOPA 3U4SA 4CEYC 4IV1A 2R30A 5FMOL 4DPNA 3KZ4C 3U07A 2EXHA 2AACA 5LEJA 3AL6A 1MS0A 3EQEA 4BK5A 4JV4A 3RZHA 1KRIA 1OC1A 1RJ7A 2VM9A 2W87A 4OHVA 3ZXGA 4FPEA 2PHTA 3UJQA 4CEWB 3TEZA 4XF0A 2BEOA 2VNOA 2F17A 3PVBB 1JBCA 4K8RB 4JDMA 5DUUA 5LA0A 1PHMA 3E6DA 3BOWA 3DYPA 3K4AA 5CNAA 1MVEA 1NY71 3EHKA 4XYXA 3WNPA 1FXZA 4OI2A 4EN9B 1H9PA 2JE7A 5FKBA 1H1MA 3GCWA 4M0HA 2D6MA 3M7AA 2AZ5A 4RHV2 4OZXA 3WHTA 4QPIA 3VBRC 4I3GA 1FMD1 1W04A 4G9SB 1K5MB 2RDQA 3CQOA 1H9WA 4XJ8A 2VZSA 3R4DB 3DPRA 2WSVA 1CJPA 2VMDA 1OFNA 3V56A 1TNRA 1F8VA 5FZEA 1W8WA 1BCXA 1CAWB 3WW2A 1LOEA 4D6RA 3SCGA 2J1VA 5FJHA 2WAOA 1WLDA 3ZYJB 3F95A 1GZWA 2FHRA 5A33B 1TVGA 4AW7A 1K5MC 3K75B 3A23A 3NKTA 2EIGA 5FZ1A 4FPFA 4A7YA 4DMIA 1K42A 5FP9A 1CPMA 4H7LA 5FZ7A 1W9SA 5GZEA 4OMCA 4JZRA 4LT5A 2YZ4A 3ALQA 2HWE1 3SISA 1ZRRA 2Y6GA 1SACA 3OTFA 5IATA 1VBD2 1PNFA 4QAWA 4XIOA 3VBOB 1RGSA 5FMDA 3GZUC 1YRZA 5T5LA 4XFIA 3VN4A 4DO0A 3ZFEC 5BNNC 4ZHNA 2YGLA 5LBFA 4ASKA 1HXS1 3LIHA 2HYXA 1FT9A 4IGPA 5A80A 5CG9A 3JB4C 5J48A 3RZGA 3CZJA 5FZKA 5C6CA 1SPPB 1R1A2 2Y0OA 4UFHA 4EN6B 4FTSA 1JUHA 1ZBE3 4B4QA 4RYDA 3ILFA 2ES3A 4RD7A 3UK9A 4ES8A 4FQ4A 1DG6A 4M3CF 3T0BA 2WLQA 2P5BA 4SBVA 2Q1FA 5H9QA 2IXIA 1CWPA 3JBG2 1C5HA 2WO7A 4I0BA 1G9DA 4JGZA 3HBKA 3J7LA 4YWAA 3ZKUA 1AR72 3VBFB 2PFWA 1R1A3 5KBFA 4M4RA 3SXWA 2XDVA 2CHHA 3NAPB 2UU8A 5FFOC 5AFBA 5FZ6A 1DF0A 3NV4A 4BIOA 4XQWA 5DG1A 1IKQA 1REEA 1YEWA 2E7TA 3OEBA 3WG3A 4EROA 3IIAA 3Q8EA 1K45A 3KHBA 4WVWA 4BA6A 5J96B 2JIJA 3U0ZA 4LE4A 3WQ1A 3CU7A 5GLVA 1WA6X 1GUIA 4UYBA 3AYAA 4PHZA 3CMGA 3O12A 2ARCA 1C4RA 4KU7A 1ZZ7A 5K4LA 4QDRA 1QWRA 2DCYA 2CU5A 1OLQA 3OGGA 2IVJA 3LZZA 2DVGA 1QJU2 1PIV2 2WL1A 1ST8A 1AR92 1VBE1 2XPJA 4GAZA 2K2SA 4WM8A 5A7QA 1X36A 2Z69A 1C3HA 1OKQA 3POSA 2UWAA 3VBFA 4CUCA 4YGCA 1UNBA 2ZXQA 3AFGA 4Y20A 1WW6A 3NAPA 1V6JA 3BPZA 3ABZA 5J1XA 1VBB3 3A22A 2YG0A 2VZUA 2AR6A 4LUKA 4INDA 3FC0A 3O1OA 2YXSA 2IFRA 4R9AA 4SLIA 5DAXA 5FR3A 3P6BA 1GNZA 4IETA 1PVXA 2W1WA 2XLFA 5DDJ1 1D0HA 1R1ZA 2JG9C 2ZMLA 5DN2A 5AFEA 5KXEA 2PHDA 2VCBA 2MEV3 2ET7A 1ND2A 4Q4X1 2G9GA 4XABA 1VR3A 5FLIA 4FBFA 4XFBA 1A8DA 1PVC1 5LY2A 4CCKA 2A1XA 5CA6A 2CNAA 2CGPA 2RDRA 3FJSA 3J7MA 3M2MA 2DBNA 4HG6B 2GH8A 4XJUA 3DCQA 4DRRA 1HB1A 3BU7A 4QKDA 1OOPA 4MADA 4W6YA 4PDWA 4RR3C 1NCQA 1B35B 3QD6A 4Z2WA 1XSQA 4WM7A 3VKMA 3AB0A 2P34A 5DAWA 5FZDA 3GZEA 1Y7BA 4AF9A 5BNPC 2P3KA 3LA2A 3EBRA 2X8KA 1OF4A 3THCA 4E4SA 1B35C 4QHBA 4QPWA 4QXHA 5KWRA 4Z92B 2RS11 4EN7B 1UL9A 2BRTA 4KI5M 3ACHA 1YNAA 3DV8A 4LXLA 5LRSA 1FNZA 2WO2A 4QX1A 1KJLA 3LGRA 1MZFA 3ILRA 1GP6A 1UZ0A 2ET1A 2WABA 4P9IA 3BPSA 1W8HA 1H8TA 2VJXA 2W95A 2E53A 2ARAA 4XEZA 4FXKB 1ODNA 4GALA 4MLOA 4OLLA 1QQP3 1GWMA 4QM8A 3APBA 3WF1A 4BE3A 3PIGA 5GLZA 2DVDA 3KGLA 4WM7B 3ZYIB 4IEVA 2Y6LA 1A78A 3O5SA 3O14A 2XJUA 5FO8B 2FDKA 1TG7A 1X50A 1J59A 4FCAA 2JICA 3MF9A 3VD7A 5D8AC 1W8NA 3ZOIA 3W5MA 3POGA 3PMEA 1MS3A 4XUTA 3KT1A 1OUSA 2XUMA 3VDDA 4OHWA 5F2WA 3ETPA 4WM7C 3IAPA 3R4UA 4YZ2A 1AYN2 2RDSA 5I91A 1N3QA 1V6MA 4CP2A 2VOWA 3BTAA 4UFMA 1WA4A 3AJZA 3NSTA 2P37A 3KS7A 1XXNA 4Q4X2 2FCVA 4H3WA 3TBDA 5FO7B 1VBD1 3UT0A 4AEDA 4AWDA 5JZGC 3ZSMA 1JTZX 1NLRA 2GZWA 2R16A 4IV3A 4OUMA 4UW5A 4AGVA 4YVSC 1QJX1 3VZMA 5BV6A 1AUYA 2ZGKA 2ADDA 2PHXA 2WIIB 4IV1C 4HONA 4ISRA 5C8CC 5KC5A 3NV1A 2DVFA 4R4ZA 2W9XA 4QQ2A 4D69A 5C4WB 3FMGA 5JZGB 5C3PA 3M70A 1HRV2 2EXIA 5FJKA 1KEXA 4RS5C 1GANA 4BLIA 3NJZA 3PUIA 5C5UA 3VBHB 2ZOEB 4LR4A 2EAAA 4FAHA 1ZBA2 1EPWA 3B9IA 1RUH3 3ZXAC 4Z1VA 3OBZA 1POQA 1K5JA 2HWC1 4MO3M 1UKRA 2W2IA 4HN1A 2GSYA 2JE8A 5K0UB 1YWKA 4A6SA 5F3IA 4LJHA 3PUQA 4YW1A 4XFHA 5FTTC 1NCRA 1RMU3 4XZUG 2AUYA 5LBBA 4Y26A 1RL3A 2ZA9A 1M4WA 3GCXA 4AVBA 4QU2A 3I3MA 1YFUA 1LU1A 3FN9A 4N53C 1A8MA 1CIWA 5T5JA 2XKOA 5JXJA 3KGZA 1H0BA 2D44A 3D6EA 5JUVA 1O3RA 2QJVA 1PVC2 4FI9A 4QQPA 2FZ1A 5JZGA 3H8XA 1KS5A 2PHRA 3K3OA 2GH2A 1ZX5A 4CSWA 1EYBA 1VE0A 3Q9OA 1MS5A 3NNJA 4LIVA 2ZGOA 1V6LA 3EB7A 4N53B 1MZEA 4AQ2A 4E2SA 4XC9A 3GBWA 4Z82A 4PIXA 3VBSC 3K51A 3WQBA 3WW3A 3NVCA 5C8WA 3BN6A 2DVAA 2XHNA 2ZMKA 4QX3A 1EUUA 1AR82 4KWKA 2XJVA 1Q3EA 1RUC1 1SG3A 1SLAA 1XYOA 1RTVA 2R071 5FY5A 5GZFA 3JCIA 4UI9L 4LQRA 2EXKA 3U14A 1GWKA 3JB8A 3Q8FA 3WF0A 3NWKA 3O1TA 5DZFA 3PHMA 1X33A 1POV0 2A7AA 1PZ7A 4LEJA 1PMIA 3Q8CA 5F39A 1OQDA 4ZU7A 5F6LB 2DV9A 5BPXA 1MS1A 4CP9A 2JD9A 5HV4A 4AI1A 4AHZA 3THDA 5BNOB 4QPGC 1SDWA 1OD3A 1W0PA 4Q8KA 2VE1A 3E5QA 1KITA 4IE5A 1LTEA 4QT6A 2ZGSA 3TRSB 5F37A 2VUAA 4P9YA 4I30A 4A45A 3VKOA 1GBGA 1GQGA 4HT1T 1NCQC 1OVPA 1W6NB 2QTWB 1VB4A 1ND3C 4X6QB 2PMWB 3RVHA 2Y6FA 3QLQA 4FQZA 3POBA 4ONUA 1W28A 1J83A 5FBZA 1UYXA 1WW7A 1X82A 1FAYA 4LOTA 3RWNA 1PMHX 1QY4A 2XBO2 4GKXA 3ZFGC 3DGTA 4A41A 2ID4A 1REFA 4XILA 3UNPA 1RUE3 1J58A 3ACGA 4MGZE 1X8MA 2VTXA 4TLGA 4BQWA 2R043 3VL8A 4CP9B 3P1IA 4S2GA 4PIYA 2XJPA 3TNQA 2XKPA 1AR61 3A0KA 4GB31 1V6NA 3HWJA 1UOGA 3B01A 2HEVF 3BKZA 5B2GB 4QX8A 4ATEA 5JXHA 4LBQD 4BWOA 4Y4RA 3K46A 2LALA 1S0JA 1VRBA 4U2AA 3ST7A 3JXSA 3NNLA 1VBD3 2Q8OA 4CCEA 4GKYA 1CAUB 1W0OA 3OUJA 2A3XA 4WBBA 1XQNA 3PVOA 2WSUA 1RMU2 3AL5A 2PQSA 1QQP2 2VQ0A 2QQWA 5CFDA 2W46A 3IIIA 1UY0A 2RS33 5FMBA 1W6MA 1YQ6A 3W21A 4XFGA 1ND3A 1MPXA 1HN1A 2J1UA 1D7PM 4B7KA 4EYUA 2Z79A 4ZU5A 5FPVA 3MV01 1RIRA 3OYWB 1UY3A 2C26A 1XRUA 3PJYA 4MH0E 4MOAA 1US2A 3CHXA 5EQUA 1GICA 3WDXA 3RZMA 5FBJA 1IPKA 5FXVA 2VVEA 2E6VA 3VHRA 1S0IA 1DCSA 2D7FA 2GMMA 2PAEA 3NRUA 3LFMA 5F5IA 1W2NA 5IVCA 3KQ4B 3V65A 1W9YA 1ZBE1 4JRLA 3RI8A 2WA3A 4IGOA 3WG1A 5A3UA 1CAUA 5DMYA 2P1BA 3HBZA 3ZFFB 1S0DA 2ATFA 3JD71 3SH4A 3SEEA 3HNMA 2WFF1 5FKCA 2VVFA 3B93A 1PM7A 5DUVA 4ASLA 3VZLA 1DGLA 4P9LA 3DN7A 5FCCA 4AXOA 5ABJA 1NG0A 3O7OA 5A3PA 3TOJA 1F5FA 1S4CA 2ZKNA 3A21A 5KHKA 4Y33A 5D8AB 5A7PA 1W8UA 5GLWA 5DQ0A 3WUDA 3JZVA 3J9SA 2ZZQA 1JODA 4NRPA 3LA7A 4K3UA 1YFWA 4XJ9A 5EV7A 4XUQA 1F15A 1GP5A 2NN8A 1T6BX 3LOIA 4XPVA 2Y34A 2WNVA 4XDPA 3FUOA 3J7NA 3JD73 1RHI1 4W6WA 4X6RB 3ZFFA 4GB32 4HANA 2PA7A 4JX0A 3T2QA 1O3SA 1YFXA 1O59A 3VBFC 4CCCA 1D0GA 4J1WA 5FZFA 1WW5A 4NMIA 4FOVA 2A5ZA 2Q4SA 1H8VA 3CF6E 4KG0A 3W9AA 5JOXA 1A6CA 4IERA 3LEKA 1RJ8A 1IPJA 1TME3 3J8F1 4JGZC 3T0AA 2VY0A 4YZ4A 5D8AA 1UZWA 3NKGA 2N7GA 1JHJA 1LOFA 3T4HB 3BIEA 5FV3A 2R1BA 3KVAA 4KGGA 3WSOA 1O6UA 2G9FA 3RMXA 2ZAAA 2ADEA 3B02A 4MYEA 3LDKA 3QBQA 3OGJA 4NRQA 4RL7A 3M4FA 4TTGA 3VBOA 3BOPA 2VH9A 1HRV1 4IESA 5JIUA 3FFQA 1POV1 5IK5A 3MUZ1 5DABA 4YLZA 1X9PA 4UBHA 2WA4A 1G86A 4NHLA 5EFUA 4NHKA 3WNOA 3OUIA 2JXAA 4Q4V3 1U5XA 2JE9A 2WYSA 3PIJA 2K0GA 3J26N 4URTA 5FOJB 3ECQA 3L2HA 4QMAA 5C8CA 5JPMB 4S2FA 4BDVB 3SMHA 2A6ZA 3I2DA 1AYN1 1OA3A 4D7SA 1UY4A 4NROA 3RZZA 1DBNA 1RUE1 3MIGA 1IKPA 4AI9A 3T1LA 4L9BA 4HVRA 4LULA 1CN1A 1Q8OA 4EQVA 3VDCA 2WS93 1KXGA 1DZQA 3AXEA 4PT6A 5GALA 2G19A 1DP0A 2VMHA 4A3XA 1ENSA 3HPNA 2AC1A 4D94A 1LGNA 4P9JA 3WDVA 5DDJ2 4KMQA 4EE2A 2J7MA 4OI0A 2B42B 1PO12 3NW4A 3VD3A 4JC1A 2QKDA 3CNAA 2VTFA 4M01A 1S55A 3I2FA 4NAOA 4ZS3A 1EAH3 3WNNA 2JECA 1H6XA 3VKLA 3ACFA 3H7YA 2OVUA 4S2HA 1QHDA 3KM5A 4YW3A 3WZ1A 4FSJA 4ITCA 4MG2A 5EXOA 4WVMA 1UQXA 2RS53 3V0BB 1ZYBA 4WM8B 1F4AA 4E27A 4RR3A 5FQ0A 3HAGA 1ULCA 2NM1A 4QB6A 3ZLIA 1BVVA 1SFYA 4IE4A 3RRDA 2Q1MA 4LA3A 1MQTB 3N9NA 1VRH1 4MGIE 1OF3A 3I8TA 4MSVA 2VZPA 3NJXA 2V72A 3K4ZA 3IT8A 2WNOA 4LHKA 5FK7A 3ZO0B 4YW2A 2VZTA 2ARXA 2VPVA 3LA3A 3HOBA 2IUWA 1HV1A 4QX7A 5FMCA 1YYNA 1CAVA 3KT4A 1W6QB 3AFKA 4IEWA 4Q26A 4WVVA 1XNCA 4KQ7A 5BYNA 2DUPA 2MPFA 1W90A 4META 2GNTA 5F5CA 3AXDA 2D6NA 4ZPIA 4YW5A 2X29A 4LHSA 1Y9GA 5IK8A 2RS51 1JN2P 3CJXA 3LB9A 4BMEA 3WINE 4Q29A 4KH9A 3AYDA 2Y6KA 2BJSA 4AGRA 1UMZA 2WNUB 2CAUA 2R041 3A0NA 3VHNA 1N1TA 2JDPA 1UZYA 2HWD2 4UW3A 5SV8A 1IS4A 2WUHA 4OFGA 2AREA 2OQ6A 5FP8A 1NE4A 2RHPA 5APAA 3SHRA 3UL2A 3UKTA 3ACIA 2ZABA 4CDXC 4E4ZA 1PM4A 2DYCA 2VOXA 2X5IA 4I09A 4CA9A 4CP1A 4B8EA 4LNVA 1AR62 3GF6A 1C8M2 2BWCA 3H3ZA 4CVUA 2WFF2 2YHJA 1O4ZA 4TXWA 2YU2A 4XJZA 3N9OA 4XXAA 1PK6C 4CCNA 1QU0A 1UCXA 2HWC3 5I8TA 5E89A 5C33A 3WF2A 5C71A 2J1EA 4UFJA 2WBKA 5FPZA 5C9AB 1SBDA 3DPRB 4Y1XA 1UD1A 3VZKA 3KV5A 2NPIA 4NO4A 4NHMA 4XURA 1RUF3 1DQ0A 5LEKA 5DUWA 1PK6B 3RJRA 1KFXL 3LSEA 3WT3A 2GNMA 2B7YA 5IT6A 3M3CA 4IXLA 1WCUA 4H55A 5LK7B 1JYTA 2X5IB 3AK0A 1JOJA 4GXLA 2Z5WA 2KM2A 4HXCA 5K0UC 4O9GA 3BTXA 1W9WA 4DUXA 1LR5A 2A3YA 1RUG3 4FPHA 4BQ3A 1SLIA 2B9UA 4NIGA 5HCAA 4LBNA 2XLGA 1CD3G 2QQNA 4YW7A 1XC6A 3VZNA 4X8PA 4IL7A 3QH6A 4IEQA 5FY9A 3VHPA 1FNYA 1JZ3A 2W94A 1S2KA 1TEIA 3AC0A 5FZMA 5CVRA 5T54A 3RWKX 1BQPA 3B69A 3O1MA 1S0FA 3WUCA 5CEHA 2VG9A 4YM1A 3ZSEA 4AFBA 4CPBD 4I01A 3KSCA 3T2OA 3OY8A 3RS6A 4LITA 2A6VA 3UYJA 3FX3A 1SLTA 2NYYA 1C28A 5KR7A 1QKQA 3ZFEB 3I59A 1N1VA 4RGAA 3AM2A 1ULOA 1W2AX 2E31A 3V0AB 1YFYA 1CQ9A 4BOWA 1X9TA 1Y9MA 4IW3A 1ZVFA 1AVBA 2JKBA 2KXLA 3VZJA 1PX4A 1QEXA 3T2PA 5F9TA 3LSDA 4MXWB 5FRAA 1W8TA 3FBMA 4QHZA 3SITA 4AFMA 1C57A 1WZXA 4AOCA 1CJDA 3IZOA 3NV2A 1GKBA 4Y5SA 5IAXA 3V64A 2YPDA 4OZOA 2R062 4RQPC 1BHGA 4GMP1 1IG0A 5B4XA 2HJIA 2XR4A 1WCKA 2HWF1 4XETA 2D3RA 1JZ7A 2WZEA 3JU9A 5EJ3A 4BH9A 1ZZ9A 1AL21 2WWUA 3JUUA 4OYUA 1UY1A 4A42A 5FYIA 5BNNB 4MGSA 5IVBA 1BYHA 3VGIA 5CU1A 3C7FA 3I2HA 2BVBA 3KT7A 3THTA 4W4ZA 1IQAA 1IGOA 1MS4A 1VBA2 4CDWA 2HWB3 4LA2A 2CWSA 4AHWA 2W92A 3ZKYA 3IDBB 3OGSA 2Z2SB 1JZ5A 2QQPA 3MFAA 3WDUA 2JKXA 4K40A 4QB2A 1AF9A 4Y1UA 4L0PA 2UY9A 3AYEA 3I2IA 3LOBA 1BEV2 1KQRA 2L9LA 2H0BA 3MZHA 1ACCA 3KCYA 1QJY1 1NQDA 1OUXA 1D2SA 1YQCA 2BGOA 2TNFA 3THPA 3TN91 2HBUA 5EHDA 1LULA 5D21A 3DKWA 3VD9A 5C70A 2OX0A 1UXZA 4JKLA 3MIFA 2E63A 3POJA 1JHNA 3NAPC 2HWF3 1E5IA 1OPMA 1I9RA 2R32A 4YVWB 3N7MA 2PLV1 4CDQB 1JI6A 2ZX3A 4AAPA 5CFCB 2IWGB 4GWJA 3CLPA 1WMFA 2W08A 1O8SA 1SMVA 3GBFA 4E9KA 2PQQA 4PF5A 3B7MA 3H1YA 4QGNA 1AXZA 5EPAA 3B9CA 3IDCB 1JYNA 5FPBA 5I93A 4O65A 1H2NA 4CCMA 1YQ8A 2YMZA 2P3YA 4AYUA 3K48A 3HT1A 3N9QA 1SZBA 4Y3OA 3ZVXA 2W1QA 5BNOA 4K8FA 5IVVA 1V6OA 3EJKA 1HB3A 4O9EA 3AKQA 3WLUA 2I74A 1AL0G 3E1F1 1VAMA 3OCPA 5C7GA 2EXJA 2WQ8A 4K9SA 2RS12 1V6KA 2HEWF 5JCTA 2NQYA 2BZDA 4CDQA 1UIJA 1UMIA 3MF6A 3UGFA 1GNHA 1BK1A 3OG2A 3PURA 1OXCA 2E7QA 2D97A 4I0AA 5AC91 1V9U1 3K2OA 2VZOA 4AVTA 3KD4A 4ZXEA 5KHIA 2XONA 4LO7A 4C90A 4W8JA 1S2EA 2VUCA 2PYTA 1HJFA 4L8QA 4KWLA 3JD72 2Y64A 4RHV3 4AI8A 1U0AA 4NJ4A 1ZRFA 4TZDA 1BMV1 4N43B 2LRPA 2ORXA 2JWPA 1K3IA 3LDRA 5BNPA 4FOWA 3WQ0A 3ROUA 1W6OA 1HW5A 4Q2FA 2B9VA 4XZPA 4D0QA 4XXPA 5FY7A 3FLRA 2P3IA 2QQOA 1UO9A 4PI2A 1F5JA 4YSFA 2YC2A 2HWE3 4FPLA 3AVSA 2O0OA 1WW4A 5IHRA 2XL9A 3EO6A 1LHNA 2P4EA 2DCTA 1YJLA 5CKMA 2OPKA 3WF4A 3UGGA 3B5LB 2WNVC 2EF6A 4AVVA 1JU4A 1LECA 1F4HA 3IM0A 4CTEA 3AZXA 2DU1A 2VGDA 3A7QA 2EIBA 4Q4V1 5JI7A 1XNKA 2YC0A 4FPYA 4LOSA 1ZA4A 2BUKA 4O61A 5C4WA 3LF7A 3GJAA 5F8PA 2F6BA 4ATFA 1W6OB 4HLTA 2YGMA 4OI4A 3H9AA 3BVCA 3POEA 1GP4A 3VBHA 4P02B 4LUMA 3ACLA 2X5IC 4C91A 2GMEA 4K21A 4M4PA 2BPA2 1AR93 5ABJB 3LIGA 3K77A 2YBKA 5F5QA 4YW4A 2TEPA 3AKSA 3JQXA 4QDSA 5T55A 4UF0B 3AVRA 2O8OA 2A75A 3OPZA 4N7IA 3WNMA 4AI2A 3WW1A 4D8MA 2DBIA 5IVFA 3E6CC 1EPZA 2PAMA 2GN3A 4XE9A 4HOOA 5A6QA 5FWJA 4EN0A 2W0XA 4J1XA 1W05A 1HB4A 1NKGA 2EICA 2HWF2 2WDBA 4JGYC 4JKKA 2WO3A 5H9PA 2BBAA 2Q8CA 1SBEA 3U37A 1I6XA 4CPBA 1RUI1 4URAA 5FIXA 4LIUA 4HSLA 4AK3A 1FPN3 2W68A 1QIQA 3BI3A 3KLSA 4NR1A 4C0HA 3WF3A 2EIDA 5CYYA 3ZX7A 3HNYM 1QMJA 2BP6A 1LHWA 5BNQA 1WMDA 2WS92 1WKYA 3H8UA 3OD4A 1BEV1 5G05L 1NZIA 1VBB2 2LROA 4NUBA 2R1DA 2DWRA 4UF0A 3RG0A 4DS0A 4PIZA 1RYYA 2RVAA 3SCFA 1XNAA 2UYBA 1L3JA 5IVJA 2ILMA 1LHVA 2VBPA 5FYSA 4CP0A 2EA7A 3ATGA 2VZQA 5DZGA 4H2AA 4COUA 4QM9A 5FWEA 3HQUA 3VHOA 4ZKTB 2Q0AA 2RS32 4P5YA 3WP6A 2YB7A 1Q8SA 4OUSA 4ASMB 2VQTA 2W3JA 2XVGA 2BNMA 3FLPA 5FUIA 5CG8A 5F2SA 2EVXA 4LMFA 4YM3A 3KWVA 4K1ZA 1MEC1 4AFDA 4MHRA 4Y5TA 5AC92 5C3SA 4N9HA 5LWBA 2Q5TA 4GJZA 2PLV2 4AEDC 1ODMA 5C5TA 2TBVA 3CKHA 2X09A 4IV3C 2HKXA 5D2AA 4EZHA 2J22A 2VMCA 1BBT1 1COV1 1QXJA 2VU9A 3CIHA 4E2QA 5JXIA 1JZ2A 1QJX2 1TMF3 2BOIA 3BYWA 4QPYA 3NJYA 3UETA 4KL1A 4AAXA 1FV3A 4R4XA 3IBMA 3T4VA 4A44A 4JKMA 4LBKA 4YZ1A 1PO21 3ELNA 5E1RA 1EV13 4Q4W3 3R6SA 4RQPB 3SC7X 5FYZA 4KBBA 3FZ3A 4J6GA 1QXPA 1I5ZA 4YRDA 2DDUA 1NQJA 3BB6A 1PZ8A 1CX1A 2BNNA 2OS2A 1KFUL 4XFAA 4D6SA 2BBVA 2IXKA 3WP3A 2C9AA 4HKLA 2W47A 2W1UA 3PL0A 2XJRA 4GWMA 3IKWA 3CJIC 4CEYA 4AGGA 3PLQA 3MLLA 2ZACA 4HETA 2KD7A 4GJYA 4TSVA 1BBT3 4LBOA 3I49A 3VBUA 2ZGRA 3WR0A 2LM3A 1W3VA 5A3MA 5KHJA 5L19A 2W91A 3K3NA 5J7MA 2D5HA 4Q5OA 2YBPA 4Y24A 3K4DA 4E8CA 4NIAA 2VCAA 2SLIA 2WC2A 4X8NA 1CAXA 1DIWA 1QQP1 4FT8A 3OOXA 3SH5A 4P9WA 1QDOA 4AVSA 3V0BA 2VBBA 1RUJ1 4B4PA 4CU9A 3P3PA 1IG3A 5FO9B 5JOYA 4IUGA 3O1UA 5FOBB 4PLMA 1W2UA 1APNA 4DXZA 3FHIB 1WD4A 2PTMA 3O1PA 4Q1RA 1JYWA 1H1AA 1ND3B 2RS31 1UOFA 5JIAA 2B46X 4YG6A 4HL0A 3IPVB 3ILNA 1C1LA 3LKJA 4Q0UA 5C3OA 1RUJ3 2ZHNA 1CAVB 3QOPA 1MACA 1N3PA 1WBFA 1GV9A 4XFCA 4BQ4A 1W8ZA 1BEV3 3PU8A 3IMNA 2V4VA 4YGEA 2JDHA 2IFWA 4AEMA 5A3LA 2HYKA 1HRI2 3LCPA 4Y1VA 4ZZ8A 3N36A 2AENA 2RJ2A 5F7UA 5FZ0A 1CAXB 4XMAA 1L7LA 5HCBA 1DHKB 1LNSA 1UIKA 1UKGA 2DTYA 1TZOA 3N35A 4RHV1 3HQXA 1VBA3 1AR63 1YO8A 1OFSA 2VOTA 2ZGUA 4XOGA 3NNFA 2WQZC 1BZWA 1CAWA 1UZZA 4Y1YA 3DKQA 5I0RA 2B5HA 3Q8BA 4KG8A 2VVDA 5FZGA 3HMYA 4QGMA 3OGVA 1GNYA 2D3PA 5I0DA 1K12A 1BXHA 2QNKA 2QQLA 3U75A 3GZAA 3GGLA 5FPXA 1H30A 2ZX4A 1WLTA 2FCUA 4IEOA 3LQCA 3SLIA 4EZ4A 3PUHA 2QQIA 1A34A 4AZZA 1ZZCA 2FMYA 2ERFA 4AHYA 3HR9A 1BKZA 1KDMA 1UYZA 2VOVA 2YFZA 4B1MA 1G6NA 5D1IA 4ET7A 2WINB 3MW4A 1TNFA 2A6XA 3IDEA 5JOZA 4DIQA 5C9AA 4F83A 4EV0A 1QDCA 1XOYA 3GJBA 1S0EA 4P00B 2C5DA 1H6YA 4BYYA 4CEWA 2FDJA 4OMDA 3UJOA 2ZHMA 4YVSA 3ZYRA 3VDBA 2JDMA 2Q8EA 1DQ6A 3LPGA 4MXVA 4XHBA 2HWB2 4QKNA 1YIPA 2RM23 2XUEA 4IEZA 3H7JA 1RUI2 3BODA 2AH2A 4JDNA 1ASJ3 3MPPG 4XBNA 1PIV3 5KC6A 2ARBA 2WNEA 4AI3A 1RUOA 5FXWA 4Q27A 2OQ7A 5J3UA 2RS13 5IFTA 3OGRA 2VZVA 3M1HA 5FZ3A 1JYVA 5ANQA 3D8CA 5C3RA 1XSRA 2DCKA 3SKVA 3ZPOA 4PBOA 4AEJA 5JLVA 5A3TA 4FTEA 1NXMA 2Z42A 1JXNA 1O3TA 2BNOA 2UY8A 4R9BA 1XU2A 3USUA 2AYHA 5GLTA 1JYXA 3AMPA 1AR71 1ULFA 1HRI1 4QXKA 2IXJA 4YVSB 4FAGA 4XF4A 1QGLA 4U36A 2FQPA 3ZSJA 1JS9A 2OPWA 2O8QA 2OUHA 5A33A 2OYZA 4PF1A 2B8MA 4F3JA 5C8CB 5EJ1B 1J1LA 1NYWA 4BPZA 4B29A 3OEAA 2XBO3 5F3EA 3V0AA 4QPGA 4AQTA 3IB3A 5C4WC 1RITA 1OH4A 3DECA 1ULDA 1EV12 4Q4W2 4I02A 4GWNA 1DQ2A 3I97A 1SHWB 2MEV1 2YFUA 4MXWA 4CZSA 4YVWC 4XACA 1ULPA 1FMD3 2ZGPA 4ZY9A 3VBHC 2PXJA 4NIIA 1W8FA 1BJQA 5CFCC 4P08A 1IPSA 2IXCA 1TQ5A 1WWYA 3I3QA 3RFRA 3VBSB 1XBFA 4ARXA 2FBEA 2GP5A 3MI8A 2VMIA 1LRHA 4XAEA 3INAA 2WZR3 1AHSA 1US3A 2CL2A 2ZHLA 2C9KA 3AP5A 1UF2C 3AP9A 1UXXX 4XJAA 2WT2A 4HKOA 3UGHA 3H1WA 3W5NA 3FE5A 4HN0A 3W59A 1V00A 3I3BA 3PVEA 5CISA 1GFF2 5CB7A 3GHNA 4BM8A 1CX4A 1CR7A 1LOBA 5I0UA 3PJQA 4M0NA 3WDWA 4CDWB 1G7YA 1SFNA 1WMXA 2VO5A 1XPWA 3HN1A 4UOJA 3LEIA 2BOJA 3VBUC 5I0SA 1JMUB 3I2JA 4IDZA 4JQRA 1RUF1 1GMMA 2XJQA 5FZOA 4H7MA 1JYCA 5BNOC 1J3RA 1GYKA 1SLLA 1SCSA 3M8LA 3VBSA 1YQ2A 1MQTA 4AFAA 4YGBA 2VULA 2CAVA 1VRH2 4BLJA 2R6QA 2YY1A 2WLPA 2VNGA 4BU2A 1C1FA 5A7SA 2CYFA 4BIFA 1NY72 2R063 2IXHA 5JSRA 1RUC3 4BJ0A 2VZ1A 1PO13 1NCQB 2CGNA 4DOUA 2KR2A 3O0VA 4QKFA 5DDJ3 3D82A 5L9BA 2WQ4A 2QQJA 1LOFC 1UX6A 3DUIA 1U12A 5A7OA 1MS8A 3OSDA 1M06G 1WBLA 1EUTA 1GZCA 4XUNA 1R1A1 3CO2A 4Q4Y1 1OURA 1Z7S2 5FPLA 4Y22A 1D4M2 3ON7A 5FY1A 4GIQA 5KHGA 1J3QA 1KJRA 2R061 4XTMA 2QQVA 4YYOA 2RS52 1I3HA 4UFKA 3I2OA 4XDQA 4A6OA 2RE9A 4QU1A 4YPJA 1SQ4A 1LODA 2XB6C 4NPRA 1R64A 1BVP1 4M3CB 5EYYA 1S0GA 5A70A 4Y20B 1QJU3 2YC4A 1UN1A 4RGGA 4WVZA 1OQ1A 3KB5A 4YGDA 2DURA 1UZVA 1LOAA 3M3EA 2MEV2 4IEYA 4DNYA 3S6PA 3ZXLA 1AXYA 1ULGA 3HNBM 5A7NA 2RDNA 2PHUA 4WM8C 1D4M3 4DY3A 3MW2A 2BERA 4XF3A 1RUH2 4FFHA 2JDUA 5FYTA 3MYXA 2NMOA 3DF0A 4EWEA 1WUVA 2B4KA 4CE8A 3TWIA 1G9BA 4LKDA 2XJTA 1RUE2 1HRV3 2GN7A 3WCRA 2R073 4UFLA 1AX0A 1JU3A 2AEZA 3P3NA 1OI6A 4L92A 2R0FA 4BXFA 1RUJ2 3ZFGB 2JJ6A 4JGYA 4XUOA 1PIV1 1EP0A 3AZWA 1COV2 2JDZA 4HBNA 4NWWA 4OCTA 5FYCA 4C0BA 3TN92 5F3GA 1XE0A 1NA1B 2HLEA 4KWJA 4M3CA 1PK6A 4CYDA 1TMF1 2BYVE 3PUSA 2FDHA 1Z78A 1QXRA 1IQDC 2CDOA 1LOGA 1VAKA 4PBPA 1NX9A 1RVF3 1N3OA 1WCDJ 1OOPB 1HIXA 2Y0IA 2Y8KA 4PDWB 4QWNA 2A70A 1HB2A 4OHXA 2K46A 1XYNA 4LLFA 3I3EA 5FZLA 5JXGA 4V2VA 4PI0A 1GOFA 5FXZA 3FFZA 1U5YA 4E4HA 2VD7A 1VPHA 4R9DA 2ZCWA 3WNLA 4QGLA 2HWB1 5CADA 4R52A 2WRAA 3HN3A 4OUEA 3MIEA 5A6YA 1GQHA 2GAUA 3TAYA 2QQUA 3MIHA 3ZN5A 2PHWA 4FPJA 5BNPB 1GOGA 3EXUA 3VV1A 1LEMA 2XWBB 4JGYB 2VXRA 1R091 4GWIA 4HVOA 2E7AA 5DAQA 3GNEA 1OT5A 1OMIA 2PN5A 3UKVA 4OHYA 4PLNA 1MZ5A 5H9SA 3LD8A 1DQ5A 3ZFEA 3AMQA 4EWAA 3BUCA 1O5LA 3NO8A 2FDFA 1H2LA 3R0RA 5CBLA 3DEMA 2H6CA 4XCAA 3KVBA 1UYYA 2BWAA 1AZDA 4IEXA 5A1FA 4FFIA 1E57A 3M3OA 4N8MA 1E5SA 1UU5A 3AP4A 3NL1A 4GB33 3SKJE 4NHYA 1JZ8A 3LE0A 4DUWA 1GLHA 1H1IA 1SDDB 3IWZA 4JDOA 4K1YA 2Q8DA 1Y3TA 5FYYA 2ZS6B 3WNKA 3T1MA 3VDDB 1W06A 5GZCA 1QH6A 1LJ7A 4I3PA 4FOYA 1AL22 2P2KA 3WP5A 3R05A 3H8RA 1SEFA 1AXKA 2ZX2A 1PO23 3OPTA 2VMGA 3RZKA 5HV0A 4XQDA 4CXYA 1R093 4HSJA 4XIKA 5KXBA 4AEDB 1FOD2 3DXUA 4IV3B 1FOD3 1C8M1 3BCWA 2H6BA 2OT7A 1XB9A 2BDRA 4YW6A 2ZEXA 1LESA 4NPLA 1KGYA 1Y9QA 1E5HA 3KV6A 3RYKA 3ZPYA 2GNDA 3G6JB 1TE1B 1GWLA 1EAH2 2ENRA 4I2OA 5FYUA 2XBO1 1VMFA 3MDPA 4E4DX 3MLKA 1AR83 2OIIA 2WYFA 3NQHA 5M0TA 1LAJA 1BBT2 1J1TA 2XVLA 4K6BA 3ZYGA 4LPLA 4I0WB 2NZ9A 1Q8QA 4AVAA 1OSGA 3BIWE 2Y33A 1HQWA 2A6YA 4Q0PA 4O7XA 1Q8VA 1FPN2 2JDAA 3T09A 1D4VB 2JX9A 4C1WA 5K0UA 3AZZA 2B45X 3MEPA 2VUJA 4CUGA 3CEWA 1RXGA 1I1EA 3GHMA 3ZM8A 3KHCA 1LHOA 2E32A 3N7JA 3RDIA 2DFCA 1W6NA 4CXWA 5BUVA 1J3PA 3KV4A 3O0XA 2V4AA 5HPOA 1SCRA 1MR5A 2JG8A 3CJIA 1AYN3 5FP4A 2JG9B 1IHMA 1WD3A 3ZSKA 1JH5A 5JR2A 2LW8A 1VBA1 5EZWA 1N1YA 1Q56A 2E9QA 2E26A 2RM21 4AQSA 2RMU2 5GJ6A 4NOTA 4P14A 4EWDA 3J8F3 4LORA 3ZN6B 2IXLA 1Q43A 2X05A
chains in the Genus database with same CATH topology
3LAGA 4N53A 3BALA 4ZXKA 1Z0HA 2NLRA 4B4RA 1ALYA 2ZGQA 3AKRA 2D6LX 3E6BA 2I07B 1X8EA 1YHFA 1RHI3 2BQPA 4KGQA 5EWSA 4XJWA 1AR73 4HK8A 2B39A 1ENXA 2VNRA 5HCFA 4KU8A 3TYJA 4YZ3A 4GA9A 3TN93 3SCHA 4RQPA 1QOOA 1DGWX 4A7KA 4FXGB 1CPNA 4LBQA 3ZYPA 3KQRA 3VLBB 3PMSA 3RYRA 1BMV2 2MHFA 3S7EA 2WFF3 1ONAA 1AYM1 1VIWB 1WLWA 4XW3A 4XHXA 4CDWC 1ZZBA 2WFPA 1AR81 4LBLA 3D5OA 4IQPA 3B00A 3B3QE 3PNAA 1MQTC 1GSLA 1HV0A 3RJ2X 4IEPA 4BHPA 3G7DA 1YUDA 3L2YA 4LO6B 2ZX1A 3WDTA 4RA0A 2DCZA 2WT1A 1VBC3 2DTWA 4N43C 4XF9A 3ZDSA 5HBAA 5KXCA 1S1AA 3HIFA 4MZUA 4COWA 1NZCA 3KMHA 1UW8A 1LCLA 3O0WA 1TME2 5LRRA 3TNPB 2R49A 1RUH1 5DZEA 1PO11 1HKDA 1PGSA 2D3SA 3RI9A 1H8TC 1QF3A 1WCSA 3PTYA 5FMOS 5I0TA 3ZMNA 5C9AC 3DPRC 2W52A 1LEDA 1REDA 4XFFA 5J37A 1H2KA 1CGPA 5IK4A 2WNUC 3GALA 2WNVB 4IV1B 4JCKA 2LUWA 2E51A 2VW0A 5J09A 3QCWA 3WQ7A 1OOPC 5ACA3 4HPKA 4CDXB 5CFDB 3MPBA 2YYOA 3AZVA 1HXS3 2C0ZA 4JTNA 4JTOA 2V5YA 5E8AA 4Z07A 5T52A 3I7DA 3ZXFA 3HT2A 4D3WA 4DZGA 3FBYA 1OD5A 1T6GC 3RQ0A 4CDUC 2XLAA 3VBOC 1LGBA 1POV3 1ENQA 2P3JA 4N9IA 3VBRB 1RINA 4BQ1A 1RUD3 3N7LA 4PLOA 4GMP3 2GC2A 2WZR1 2GC3A 3C3VA 1QOTA 4M3CE 2ZAHA 1OPOA 4L2NA 4XF1A 4DRVA 5ACA2 1ASJ1 2QZ3A 1RC6A 1PGW2 3ENRA 1K5MA 2I45A 3ZXKA 4QQLA 1NLSA 1O4YA 4COYA 2RMU1 1NOVA 1WLCA 2P17A 4TLFA 4PJYA 4HPKB 4GMP0 1YXWA 1VLNA 4TYSA 3AKPA 1YLLA 1UPIA 3SH3A 4WZCA 4FP2A 5JSPA 1VAVA 3ES4A 1VALA 4QX5A 3FWEA 4LHNA 2Y38A 4Q4Y3 4UW6A 5BXXA 4V1PA 3POWA 4COZA 1RHI2 1AX2A 3S7IA 1WGPA 5GLUA 5BNPC 3R4SA 4PCRA 4RS5A 2QDNA 1JYIA 2H0VA 1IOAA 2QCSB 2QUOA 5JR7B 5K8SA 1W6PA 2D98A 3U4XA 1F9KA 3USUB 3UV9A 4Q1PA 1CVNA 4DFSA 4B7EA 3J8F2 1G8WA 4HMZA 2LTNA 1ULEA 2GALA 3H50A 1SBFA 3ZXEA 1RUI3 2A6WA 4XBLA 4QPGB 5F6KA 4LO5B 1DZTA 3JBG1 1HDKA 1OA2A 2GNBA 2ZKLA 4WVMB 3NV3A 4DB5A 4Q4X3 1S0CA 2UWCA 5T5OA 1AJKA 1KDKA 2DU0A 4RFT0 4CRQA 2ZTNA 3ASIA 2JG8C 2RR11 1YCIA 3MW3A 3U10A 5ACA1 3WD5A 4LTAA 1TME1 2XH6A 1OQEA 1DFQA 4XMIA 1AX1A 1W6QA 2Q1ZB 1EY2A 2RJLA 1RB8G 2TUNA 5GKAC 4WZFA 1PGL2 1V9U3 1RUG2 1RVF1 1GZ9A 2A71A 3N7KA 4AVCA 1LOCA 1H2MA 4XTPA 2RM22 4HK9A 4YZ5A 2RR13 2G4IA 3MLJA 1ZREA 2DF7A 1AL23 2OZJA 1NA1C 1DGRN 3IPVA 1EV11 4Q4W1 5FAXA 2Y26A 2UWBA 3E5XA 3GYDA 4JVAA 4QD2A 2KA3A 1FPN1 2R0HA 1AYM3 1PGW1 2CWMA 4LHLA 1MEC2 1O5UA 5IUQA 2XVKA 4RR3B 2HWE2 5FQ0B 2VECA 4W65A 3ZMOA 2WT0A 1DDLA 2YPJA 3SNMA 1N47A 3WP4A 2ETEA 2ZBJA 2NMNA 2XWJB 1O7FA 4P9GA 4YFWA 4UBGA 2ZX0A 4OVEA 5I8YA 4MUVA 4QQOA 1B35A 5KHHA 1YIFA 1IS3A 2GC1A 3N3HA 1AYM2 3ZXDA 1QJY2 3OF1A 2GDFA 1Z7S3 1ZBA3 3LWCA 5DUXA 3I4IA 4D7TA 2BTVC 1H4GA 4QPIB 2YDEA 4OI1A 3S0MA 4Q0VA 3ZIWA 3ZFGA 2XHKA 3JBG3 4D7YA 3DL3A 3QACA 2WNUA 1G9CA 1VRH3 2ZPXA 4HFSA 3D0JA 1FYUA 1HQNA 3N4MA 3OY8B 1NXD1 1PGL1 2D6OX 1ZZ8A 1H8TB 1COV3 1GZWB 1SLBA 4QPIC 2D43A 3MIBA 4FPCA 4NVPA 3ZFFC 3I59B 4Y1ZA 5L36A 2WJSA 2PAKA 3IN9A 5JAXA 1O3QA 3AJYA 1V6IA 2V09A 4FOQA 1HX6A 1LKNA 2PHLA 4F8AA 1ZRCA 2XL7A 4MGKE 1OLRA 4P9XA 5CFDC 2FMDA 1DU3D 2D40A 3MICA 1ZNPA 2MNGA 4CDUB 5JMCA 4LO4B 1URXA 1KD7A 2FZ2A 2XJSA 2HWD3 1HLCA 2BVVA 2UYAA 1FMD2 4GULA 2GU9A 1DGRA 1JUIA 2ZJCA 5BNNA 4COVA 1UPSA 1UU6A 3MIDA 2W39A 1MS9A 2ZMNA 4L11A 4YFZA 5HI0A 4ISQA 1ENRA 2OW4A 4JGZB 3OBTA 2ZGNA 4W6XA 2GMPA 3AMNA 3C2UA 1QJX3 1TMF2 3OJBA 1U5IA 5T5PA 5ABJC 2BW8A 1NCRC 2QDRA 3FLTA 4CDUA 5T50A 2PLV3 2XGXA 1QNWA 2ZGTA 1LU2A 1UAIA 1DQ1A 3E5UA 2RR12 3AYCA 1O4TA 4OULA 1G9AA 2A3WA 4G3YC 1OHFA 1NCRB 2X53S 5HXVA 1G9FA 1YI9A 4MVTA 2VQAA 4MGYE 3S30A 1LB2A 2WKKA 1R092 2Q30A 1C8NA 3MGUA 3M3IA 1YJKA 1B09A 4A7ZA 3POYA 4BMBA 3ZXJA 4A2UA 3WX5A 1RUF2 3URFA 5T3NA 1SLCA 1MEC3 4FPGA 3H0OA 2C1FA 2WZR2 2DCJA 4S2DA 5GZDA 4NN0A 5L7OC 4NWVA 4XBQA 5CIRA 2JENA 3GBGA 3M3QA 4P5HA 4EN8B 3ZSLA 4WV8A 1MVQA 4JAAA 2UURA 1RUC2 2D93A 1QJY3 3WW4A 1JW6A 4Y22B 1N1SA 4YG3A 5JWPA 3WG4A 1R081 1VBC2 2QE3A 3VKFC 2EAKA 3VKNA 1V70A 1ND2B 2JG8B 2I2SA 3CJIB 5J98B 4Q8LA 2ZGMA 3A4UA 2VW2A 1FI2A 3L9JT 4YM0A 1IS6A 3W58A 1QJU1 1ND2C 4LO8A 4MV2A 2CY6A 4AEKA 1YI7A 5IK7A 1XU1A 3PVNA 1RUD1 1S2BA 1R083 3AP6A 4H14A 3VL9A 2QVSB 4HZFA 1AJOA 4N43A 1RMU1 4YVWA 5TSWA 2JEMA 4MX3A 5CFCA 4Q4Y2 4GH4C 2YROA 5A32A 3OD0A 4L97A 2DVBA 1PZ9A 1PNGA 3RNSA 5J36A 1RUNA 2YV8A 1MZ6A 1NA1A 2ZHKA 1QOSA 1NE6A 2ZGLA 1ZM1A 4GH4B 1LENA 1F2NA 4CEWC 2A73B 1O91A 4R9CA 5I8SA 4DQAA 1FX5A 5AC93 4LBMA 5SV5A 2DFBA 3QH7A 3AMMA 4PDWC 3AP7A 4AFCA 2HEYF 2IC1A 2DUQA 4M00A 4BZ4A 5JPNB 1D2QA 5A32B 4UW4A 1VP6A 5DXDA 2IZWA 2WS91 4ZU4A 2WZPP 1XE7A 3JQWA 1XNBA 1RUG1 1RVF2 4K20A 2OZ6A 5FLHA 1ASJ2 1Z7S1 1D4M1 4GH4A 5GZGA 1QJZA 3OYWA 5LK5A 3AKTA 2OA2A 4BCUA 5EYXA 5FDBA 5FREA 1DYPA 1QH7A 5JI9A 3USSA 1DGWA 5K9YA 3AZYA 1F31A 2RJKA 4AG4A 4HVQA 3VUOA 1FV2A 4UXAA 2BFUL 4YNIA 1PVC3 1Y43B 5AVAA 5K7PA 3X29B 4DY5A 3WOGA 2VOKA 4FPKA 4KNCA 2DUOA 4HKWA 5FLJA 4DINB 4CDXA 4XQ4A 1FOD1 5BY5A 1C8M3 2D5FA 3HD8B 3VDDC 1HQLA 1W39A 5GM0A 4AQ6A 1DLLA 1V9U2 3VBRA 4N7UA 3CL1A 3KCXA 2V73A 1VBB1 4RSUA 1ZZ6A 1KS4A 1Q8PA 3D4KA 2WWSA 1VB2A 3UKNA 3WG2A 3GZTB 4FVVA 2ZZJA 1DZRA 3H1MA 4Y5Z0 1HRI3 2D6KA 3WDYA 1CONA 2O1QA 4QQHA 3ZN4A 5L73A 2BFUS 5JDBA 1XE8A 3OBRA 4FTBA 1RUD2 3VZOA 5F1RA 2CTVA 1ZBA1 3T2TA 1VJ2A 2GC0A 4B3NA 3E97A 2PELA 1AR91 1VBE2 4L99A 2SBAA 3FUQA 4IEUA 1HXS2 4RS5B 2JG9A 1QNYA 1R082 1VBC1 1XNDA 2QZ2A 4Q4V2 4YM2A 4FAHA 5KXBA 1O3SA 4Q0QA 1DQ4A 3RYPA 1W6PB 1PO22 2OUJA 3RPQA 1DYKA 3ZN6A 1GR3A 5CAZA 1U5ZA 2XG3A 1A3KA 4OHZA 2VW1A 3WY6A 4F7ZA 5JSOA 4AHXA 3WVJA 4LE3A 2YUEA 2EALA 4YG0A 2HWD1 4Y4YA 3VBUB 4ES9A 1VBE3 2NP0A 4Z8BA 1UU4A 1LGCA 5JOWA 1IZ3A 3MFCA 3D0SA 5H9RA 3RMYA 4FP3A 3U11A 5KXDA 3ZIXA 5L7OA 1OA4A 1FATA 3KCCA 2D6PA 2R072 3AX4A 4LBQB 4CDQC 1ZBE2 3ME2A 4LBJA 4E2GA 4LLOA 1C5IA 4G4FA 3WCSA 4JRAA 5AVPA 2QFEA 2CV6A 3ES1A 3WV6A 2JD4A 3B94A 4R8HA 2BGCA 5DG2A 4ORFA 3TB0A 1IS5A 2AGSA 4FO9A 4N90A 2R042 5JVVA 3WNXA 3WXPA 1EAH1 5E88A 2RMU3 4C1XA 1X7NA 1H4HA 5E16A 3WHUA 4EJRA 4AE2A 1S0BA 2CGOA 5L7OB 3J4UH 1Q5OA 3AMHA 1LHUA 4GQ7A 1CESA 1W6MB 4AI0A 2PHFA 4Q0SA 2K9ZA 3H3UA 4CEYB 4YARA 4FPOB 3ETQA 1WMEA 1ZRDA 3I54A 4K7JA 4PQ9A 2F4PA 3RSJA 1XYPA 2HWC2 4CEYC 4IV1A 2R30A 5FMOL 4DPNA 3KZ4C 3U07A 2EXHA 5LEJA 3EQEA 1MS0A 1KRIA 4JV4A 1RJ7A 4OHVA 4CEWB 3ZXGA 4FPEA 2PHTA 3UJQA 4XF0A 2BEOA 2VNOA 3PVBB 1JBCA 4JDMA 5DUUA 1PHMA 3E6DA 3BOWA 5CNAA 1MVEA 1NY71 3EHKA 4XYXA 1FXZA 4OI2A 4EN9B 1H9PA 2JE7A 1H1MA 4M0HA 2D6MA 3M7AA 2AZ5A 4RHV2 4OZXA 3WHTA 4QPIA 3VBRC 4I3GA 1FMD1 4G9SB 1K5MB 1H9WA 4XJ8A 3R4DB 3DPRA 2WSVA 1CJPA 1OFNA 3V56A 1TNRA 1F8VA 3WW2A 1BCXA 1CAWB 1LOEA 3SCGA 1WLDA 3ZYJB 1GZWA 2FHRA 5A33B 4AW7A 1K5MC 3NKTA 2EIGA 4FPFA 4A7YA 4DMIA 1CPMA 4H7LA 5GZEA 4LT5A 2YZ4A 3ALQA 2HWE1 3SISA 1ZRRA 1SACA 3OTFA 1VBD2 1PNFA 4XIOA 3VBOB 1RGSA 3GZUC 1YRZA 5T5LA 4XFIA 3VN4A 3ZFEC 5BNNC 2YGLA 1HXS1 1FT9A 5CG9A 3JB4C 5J48A 5C6CA 2Y0OA 1R1A2 4EN6B 4FTSA 1JUHA 1ZBE3 4B4QA 3ILFA 2ES3A 4RD7A 3UK9A 4ES8A 4FQ4A 1DG6A 4M3CF 2WLQA 4SBVA 5H9QA 2IXIA 3JBG2 1C5HA 1G9DA 4I0BA 4JGZA 1AR72 3VBFB 2PFWA 1R1A3 5KBFA 3SXWA 3NAPB 2UU8A 5FFOC 5AFBA 1DF0A 3NV4A 4BIOA 4XQWA 5DG1A 1IKQA 1REEA 2E7TA 3WG3A 4EROA 3IIAA 4BA6A 4WVWA 5J96B 3U0ZA 4LE4A 3WQ1A 3CU7A 5GLVA 3AYAA 3O12A 1C4RA 4KU7A 1ZZ7A 1QWRA 2DCYA 1OLQA 3OGGA 3LZZA 2DVGA 1QJU2 1PIV2 2WL1A 1AR92 1VBE1 2XPJA 2K2SA 4WM8A 1X36A 2Z69A 1C3HA 1OKQA 3POSA 2UWAA 3VBFA 4YGCA 3AFGA 4Y20A 1WW6A 3NAPA 1V6JA 3BPZA 1VBB3 2AR6A 4LUKA 4INDA 3FC0A 2YXSA 2IFRA 4R9AA 4SLIA 1GNZA 4IETA 1PVXA 2XLFA 5DDJ1 1D0HA 1R1ZA 2JG9C 2ZMLA 5AFEA 5KXEA 2PHDA 2MEV3 2ET7A 1ND2A 4Q4X1 2G9GA 1VR3A 5FLIA 4FBFA 4XFBA 1A8DA 1PVC1 5CA6A 2CNAA 2CGPA 3FJSA 3M2MA 2GH8A 4XJUA 4DRRA 3BU7A 1OOPA 4W6YA 4PDWA 4RR3C 1NCQA 1B35B 3QD6A 4Z2WA 4WM7A 3VKMA 3AB0A 2P34A 1Y7BA 4AF9A 2P3KA 3LA2A 3EBRA 2X8KA 4E4SA 1B35C 4QHBA 4Z92B 5KWRA 2RS11 4EN7B 1UL9A 3DV8A 1YNAA 5LRSA 1FNZA 1KJLA 3LGRA 1MZFA 3ILRA 2ET1A 4P9IA 4XEZA 1H8TA 2E53A 4FXKB 4GALA 4MLOA 4OLLA 4QM8A 1QQP3 3APBA 4BE3A 5GLZA 2DVDA 3KGLA 4WM7B 3ZYIB 4IEVA 3O5SA 1A78A 3O14A 2XJUA 5FO8B 1J59A 1X50A 4FCAA 2JICA 3MF9A 5D8AC 3PMEA 1MS3A 3KT1A 2XUMA 3VDDA 4OHWA 4WM7C 3R4UA 4YZ2A 1AYN2 5I91A 1N3QA 1V6MA 4CP2A 2VOWA 3BTAA 1WA4A 3AJZA 3NSTA 2P37A 3KS7A 1XXNA 4Q4X2 3TBDA 4H3WA 5FO7B 1VBD1 4AEDA 4AWDA 5JZGC 3ZSMA 1JTZX 1NLRA 2GZWA 2R16A 4IV3A 4OUMA 4UW5A 4AGVA 4YVSC 1QJX1 3VZMA 5BV6A 1AUYA 2ZGKA 2PHXA 2WIIB 4IV1C 5C8CC 4ISRA 5KC5A 3NV1A 2DVFA 4R4ZA 4QQ2A 4D69A 5C4WB 3FMGA 5JZGB 3M70A 1HRV2 2EXIA 4BLIA 4RS5C 1GANA 3NJZA 3VBHB 2ZOEB 4LR4A 2EAAA 1ZBA2 3B9IA 1EPWA 1RUH3 3ZXAC 4Z1VA 2HWC1 1UKRA 4HN1A 2GSYA 5K0UB 1YWKA 4YW1A 5FTTC 4XFHA 1NCRA 1RMU3 2AUYA 4Y26A 1RL3A 2ZA9A 1M4WA 4AVBA 4QU2A 1YFUA 1LU1A 4N53C 1A8MA 1CIWA 5T5JA 2XKOA 3KGZA 1H0BA 2D44A 3D6EA 1O3RA 2QJVA 1PVC2 4QQPA 5JZGA 2FZ1A 1KS5A 2PHRA 2GH2A 1ZX5A 1EYBA 3Q9OA 1MS5A 2ZGOA 1V6LA 4N53B 4E2SA 1MZEA 4AQ2A 3GBWA 4Z82A 4PIXA 3VBSC 3K51A 5C8WA 3WW3A 3NVCA 2DVAA 2ZMKA 1AR82 4KWKA 2XJVA 1Q3EA 1RUC1 1SLAA 1XYOA 1RTVA 2R071 5GZFA 3JCIA 2EXKA 3JB8A 3NWKA 5DZFA 3PHMA 1X33A 1POV0 2A7AA 1PZ7A 4LEJA 1PMIA 1OQDA 4ZU7A 5F6LB 2DV9A 5BPXA 1MS1A 4AI1A 4AHZA 5BNOB 4QPGC 1SDWA 1W0PA 4Q8KA 3E5QA 1KITA 1LTEA 4QT6A 2ZGSA 3TRSB 2VUAA 4P9YA 4I30A 3VKOA 1GBGA 1GQGA 4HT1T 1NCQC 1W6NB 4X6QB 1VB4A 1ND3C 3QLQA 4FQZA 4ONUA 5FBZA 1WW7A 1X82A 1FAYA 3RWNA 1QY4A 2XBO2 4GKXA 3ZFGC 3DGTA 4XILA 1REFA 1RUE3 1J58A 4MGZE 1X8MA 2R043 3VL8A 4S2GA 4PIYA 2XJPA 3TNQA 2XKPA 1AR61 3A0KA 4GB31 1V6NA 3HWJA 3B01A 2HEVF 5B2GB 4ATEA 4LBQD 4BWOA 2LALA 1S0JA 4U2AA 3ST7A 1VBD3 2Q8OA 4GKYA 1CAUB 1W0OA 2A3XA 4WBBA 1XQNA 3PVOA 2WSUA 1RMU2 1QQP2 2VQ0A 5CFDA 2RS33 1W6MA 4XFGA 1ND3A 4B7KA 2Z79A 4ZU5A 1RIRA 3OYWB 3PJYA 1XRUA 4MH0E 1GICA 3WDXA 1IPKA 2VVEA 2E6VA 3VHRA 1S0IA 2D7FA 2GMMA 2PAEA 3V65A 1ZBE1 4JRLA 3RI8A 2WA3A 3WG1A 1CAUA 3HBZA 3ZFFB 1S0DA 2ATFA 3JD71 3SH4A 2WFF1 2VVFA 3B93A 1PM7A 5DUVA 4ASLA 3VZLA 1DGLA 4P9LA 3DN7A 5FCCA 4AXOA 5ABJA 1NG0A 3O7OA 3TOJA 1F5FA 2ZKNA 5KHKA 5D8AB 3WUDA 5GLWA 3JZVA 3J9SA 2ZZQA 3LA7A 4K3UA 1YFWA 4XJ9A 5EV7A 2NN8A 3LOIA 4XPVA 2WNVA 3FUOA 3JD73 1RHI1 4W6WA 4X6RB 3ZFFA 4GB32 4HANA 2PA7A 1YFXA 3VBFC 1D0GA 4J1WA 1WW5A 4FOVA 2A5ZA 2Q4SA 1H8VA 3CF6E 4KG0A 3W9AA 5JOXA 1A6CA 4IERA 1RJ8A 1IPJA 1TME3 3J8F1 4JGZC 2VY0A 4YZ4A 5D8AA 3NKGA 2N7GA 1LOFA 2R1BA 4KGGA 2G9FA 3RMXA 2ZAAA 3B02A 4MYEA 3QBQA 3OGJA 4RL7A 3M4FA 3VBOA 3BOPA 2VH9A 1HRV1 4IESA 5JIUA 3FFQA 1POV1 5IK5A 4YLZA 4UBHA 2WA4A 1G86A 4NHLA 5EFUA 4NHKA 2JXAA 4Q4V3 1U5XA 2JE9A 5FOJB 2K0GA 3J26N 4URTA 3ECQA 3L2HA 4QMAA 5C8CA 5JPMB 4S2FA 3SMHA 2A6ZA 3I2DA 1AYN1 1OA3A 4D7SA 3RZZA