4YVWB

Crystal structure of an enterovirus 71/coxsackievirus a16 chimeric virus-like particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
236
structure length
224
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRSGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMQLCKDASDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein VP1
publication title Crystal Structures of Yeast-Produced Enterovirus 71 and Enterovirus 71/Coxsackievirus A16 Chimeric Virus-Like Particles Provide the Structural Basis for Novel Vaccine Design against Hand-Foot-and-Mouth Disease
pubmed doi rcsb
source organism Enterovirus a71
total genus 32
structure length 224
sequence length 236
chains with identical sequence F, H, K, N
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yvwB00
1BMV1 1ND2C 1NCRC 1RUD1 2VQ0A 5C8CA 1NY72 5DDJ1 4N43C 2RS53 1BEV2 1VAKA 2WZR3 1POV3 1HXS3 4RR3A 4CDXA 1PIV3 2RS11 1K5MA 1EAH2 5ABJC 1VBB2 1QQP2 2HWF1 1AR71 4RQPA 1QJX2 5A32A 1HRV2 5K0UC 4PDWB 1COV3 1TMF1 2R071 1OOPC 1ZBE1 1RUC3 5CFCA 1QJU3 1B35A 1NCQB 2GH8A 5BNOC 2XPJA 3LOBA 5FMOS 4WM8B 1RUI3 1EV11 2TBVA 1D4M3 1GFF2 1RMU1 4Q4V1 5AC92 4GH4B 4IV3B 4QPIB 1AR93 2RMU1 4WM7B 1AYM2 2Y26A 4CDUC 2RR11 1VBE2 5FMOL 3JBG2 1VRH1 1BEV1 1SMVA 1AL22 5D8AA 3TN92 1CD3G 4FTBA 4Q4X3 1QJU2 3VDDB 1AYN2 2RM23 2WS91 4Q4W2 1PO23 1FPN1 2IZWA 1R1A3 1VBA1 4RHV1 1VBD2 3ZFGA 5FOJB 1Z7S3 1RUD3 4RS5A 1C8NA 5DDJ3 2R041 1RUE2 1PGW2 3VBOB 5BNNA 4PDWC 1AR61 1PGL1 1RUF2 2RS13 4IV1B 1PVC1 3ZFEA 3ZXAC 3NAPB 1NA1A 1NCQC 1AR73 3VBSB 2ZAHA 1V9U1 1HRI2 3J8F1 1QJY3 1R082 1TMF3 4WM8C 1ZBE3 1VBE1 4LLFA 1OHFA 4GH4C 4IV3C 4QPIC 5ACA1 1ND2A 1IHMA 1NCRA 4WM7C 4YVWB 4CDQB 1MQTB 1RUH2 4N53B 1RVF2 4CDWB 1EV13 4N43A 1BBT3 1MEC2 1RMU3 4Y4YA 4Q4V3 1VBD1 2RMU3 1RHI2 2MEV1 4NWVA 3VDDC 4QPGB 5C9AB 1ZBA1 1FMD2 1RUG3 2RR13 2HWC2 2WFF1 1M06G 2HWD2 2XBO1 5ABJA 3S6PA 1RUE1 1VRH3 5LK7B 3NAPA 5K0UA 5A33B 1OOPA 2WS93 1FPN3 3JD72 1RUF1 3VBRB 1VBA3 3VBHB 4RHV3 1ASJ1 2FZ2A 1AR81 1RUJ2 2PLV2 3VBOC 5BNOA 2GSYA 1C8M1 1PO13 1R081 4EJRA 1TME1 2RS31 3HAGA 3VBFB 2WLPA 4IV1C 2HWE2 2R043 2X5IB 3NAPC 5L7OB 4GB31 2BBVA 4CEYB 4CDUA 4Q4Y1 1AR63 2R061 1R091 2HWB1 2RS52 1MEC1 3ZFFB 1PVC3 1VBC1 2WZR2 1A6CA 1OPOA 1HXS2 4YVWC 4CDQC 5JZGB 1MQTC 1V9U3 1FOD1 4N53C 3J8F3 1PIV2 4CDWC 4JGYB 1HQNA 5ACA3 5C4WB 4Y5Z0 1NY71 5C9AC 4QPGC 1HX6A 1COV2 4JGZB 2FZ1A 1F2NA 1X33A 1H8TB 1RUC2 1RUJ1 2BFUS 4NWWA 2MEV3 4PDWA 1EAH1 1RUI2 1VBB1 1ZBA3 1QQP1 2WFF3 1D4M2 2DF7A 2XBO3 3VBRC 1DDLA 1AR92 3VBHC 3CJIB 1QJX1 1NCQA 1HRV1 4YVSB 2BFUL 4WM8A 5CFDB 3VBFC 4CEWB 4GH4A 4IV3A 4QPIA 2RS51 4AEDB 4WM7A 2X5IC 5L7OC 1ASJ3 1HXS1 5BNPB 1AR83 1E57A 4Q4X2 4CEYC 5J96B 3DPRB 2RM22 1C8M3 1PO22 5AC91 1NG0A 1PIV1 1WCDJ 1R1A2 2HWF3 2RS33 1AYM1 3ZFFC 1Z7S2 4GB33 2R073 1RUD2 3VDDA 5JZGC 1BMV2 3JBG1 1ND3B 3VBUB 4GMP0 1X36A 4Q4Y3 1AL21 2R063 4JGYC 5DDJ2 1R093 2HWB3 3TN91 4BCUA 1QJU1 1AYN1 1VBC3 5C4WC 4Q4W1 5C8CB 4JGZC 1FOD3 1H8TC 2RS12 2WWSA 4RR3B 4CDXB 3VBOA 1AR72 1POV0 2ZTNA 1QJY2 1TMF2 1K5MB 1ZBE2 1BEV3 4IV1A 1PGW1 4RQPB 3CJIC 2QQPA 3VBSA 5A32B 4YVSC 4Q4X1 5CFDC 5CFCB 1EAH3 1EV12 1VBB3 1QQP3 4FTSA 1BBT2 4CEWC 1RMU2 1B35B 4Q4V2 2RMU2 4YVWA 1NOVA 1HRI1 1QJX3 1HRV3 4CDQA 5BNPC 1Z7S1 1MQTA 4N53A 3DPRC 1RUG2 2RR12 4CDWA 3VBSC 1VRH2 1RUH1 5C9AA 4QPGA 1RVF1 1ND3C 3VBUC 2WS92 5AC93 1FPN2 3M8LA 5D8AB 1RHI1 1VBA2 3JB4C 4RHV2 1AYM3 1FMD1 1VB2A 2HWC1 5A33A 5C8CC 1PO12 1VBE3 2HWD1 3JBG3 1QJY1 2BPA2 3VBRA 1AL23 3TN93 3VBHA 3ZFGB 2R042 4RR3C 4CDXC 1AYN3 1CJDA 4RS5B 4Q4W3 1F8VA 1QJZA 3JD71 4FTEA 1K5MC 1AR62 3VBFA 1PGL2 1VBD3 1BBT1 2PLV1 4GMP1 4RQPC 2X5IA 1PVC2 5L7OA 4CEYA 5BNNB 3JB8A 1V9U2 4RFT0 3J8F2 1RUG1 2HWE1 5CFCC 1RUE3 3ZFEB 1NA1B 1VB4A 3ZFFA 1B35C 5ACA2 5JZGA 1RB8G 1RUF3 4JGYA 2WZR1 1POV1 1ND2B 1NCRB 5C4WA 1HRI3 1R083 2MEV2 4JGZA 2BUKA 1AL0G 1PO11 1TME3 1ZBA2 4N43B 1H8TA 2WFF2 2XBO2 5D8AC 3FBMA 4SBVA 1COV1 1RUH3 1RVF3 1RUC1 1MEC3 3IDEA 5ABJB 1AUYA 3ZFGC 3CJIA 1RHI3 1ASJ2 4YVSA 1AR82 5K0UB 4RS5C 1RUI1 1FMD3 1OOPB 2HWC3 1D4M1 1C8M2 5CFDA 2HWD3 5J98B 1AR91 1TME2 4CEWA 2HWF2 2RS32 2ZZQA 4AEDA 5BNOB 4Z92B 5BNPA 4GB32 2R072 5BNNC 3DPRA 3JD73 4Q4Y2 2R062 1R092 2HWB2 3ZFEC 1W39A 1RUJ3 1NA1C 2PLV3 4GMP3 1VBC2 2RM21 1PO21 5GKAC 4CDUB 1ND3A 3VBUA 1FOD2 1R1A1 4FSJA 4AEDC 2HWE3
chains in the Genus database with same CATH superfamily
1XNAA 2Z4FA 3MUZ1 1ND2C 3RWKX 1IPSA 2W87A 2VOKA 3V56A 1LGNA 4OLLA 2OUHA 2P3YA 2Y8KA 4FFGA 5DDJ1 4OI4A 5JR7B 1BEV2 3LOIA 1VAKA 5H9PA 5A3WA 4R4XA 4RR3A 1O91A 1MS5A 3KB5A 4UXAA 5IW0A 2I45A 3PUAA 1JXNA 5IK7A 4NR1A 3FL7A 4LBLA 3VL8A 1BKZA 4M4PA 3NJXA 1PIV3 4DO0A 2RS11 3ZXJA 1K5MA 5IATA 1DZRA 3ZYHA 1EAH2 3RJ2X 1VBB2 3CMGA 1QQP2 5FZOA 5ABJC 4XUQA 2QCSB 3WEZA 4LO8A 2HWF1 3WQBA 5LA1A 5FIXA 4S2DA 1W03A 1ZREA 4JV4A 4AHWA 3QH7A 4ITCA 1OOPC 1J3PA 1OPMA 2P37A 4QX3A 1SFNA 4QDSA 1SLBA 3RMYA 1I3HA 5CFCA 2O0OA 3FLRA 3N9NA 4Q5OA 4XUOA 3WNKA 1W8UA 4RN5A 1V6IA 2D6NA 1NCQB 1AXYA 5GZGA 1NX9A 3LCPA 5A3MA 1CX4A 3K4DA 3MFAA 4AXOA 3HEIA 3NNMA 1C4RA 5DUUA 2C24A 2JEMA 4LBQB 3VZOA 3UJOA 2TBVA 2UY9A 5CAZA 2XMLA 4JCKA 3NKTA 4FPYA 1YYNA 3LD8A 2BJSA 4OUSA 5FYVA 3NNJA 4K40A 3ACIA 5JXIA 3ZSMA 4BU2A 2CWMA 2IUWA 1BVVA 2RR11 1UD1A 1D2QA 3AKQA 3HBZA 3POWA 2LALA 3I2FA 2LROA 3M7AA 2ZGKA 3UGHA 2P6CA 1NXMA 4QXBA 1F9KA 1W6MB 1DHKB 4LHNA 4WVZA 3L2YA 2PHTA 3VZNA 1VMFA 4E2QA 1AYN2 1HDKA 1Q8QA 1IGOA 3GXUA 4Q4W2 3LZZA 1S1AA 2HKXA 2DUQA 4CCLA 4NHXA 2PHDA 1L7RA 2WLQA 2Y0IA 3QD6A 2E9QA 3WINE 1N1SA 1Z7S3 1LOFC 4J25A 3D6EA 4XDPA 1RXGA 3MIHA 4Y26A 3I2JA 2ET1A 5DDJ3 3CLPA 1RUE2 3AZYA 1PMJX 2WDBA 1C1FA 5JWPA 1Y9MA 3N9MA 5FZ9A 5JMOA 1ZZ7A 5CA6A 2BP6A 4MXWA 4AR2A 5BNNA 3FHIB 1UO9A 2EICA 2VD7A 1PGL1 1YQ8A 2O14A 5DZFA 3SHRA 3MV01 1CX1A 1GQGA 2RS13 4CCCA 5A3PA 4ZKTB 2XJPA 3D8CA 3RRDA 4AQSA 1JZ2A 3UGFA 3ETQA 3PVEA 3NAPB 4BQWA 4OI1A 4QKBA 2BWAA 2DBNA 3I3EA 3PL0A 3CIHA 1V9U1 4D7SA 4IGQA 1W8HA 1R082 3LIHA 2J7MA 2VUDA 4UF0B 4CCOA 2CDPA 4CU6A 4JRLA 3BTAA 1W2OA 3OTFA 3DYMA 4GH4C 4IV3C 4YGCA 3M1HA 2UURA 4LA3A 5ACA1 5HBAA 1ND2A 3P5BA 2EXIA 1WMEA 4JTOA 2VCCA 3PURA 3AKTA 1WW6A 3AZXA 1MQTB 3NJZA 2OYZA 3ZN6B 2FDKA 3SQOA 4IE6A 4AHXA 3U11A 3FLTA 1F4HA 1UZYA 3OEBA 1ULGA 1W8NA 1YEWA 2VTXA 4CDWB 3TB0A 2W46A 2YPDA 4YG3A 3KGLA 1RHI2 3ZM8A 1UZVA 2MEV1 4KWLA 1MPXA 3AZVA 3D82A 1ZBA1 1N3OA 4RFRB 1UYXA 2AC1A 2RR13 2BTVC 2HWC2 1M06G 2ZA9A 1HN0A 1LJ7A 2HWD2 3NQHA 4I3PA 2K9ZA 1A8DA 4XABA 4ZZ8A 4LBNA 3S6PA 5ABJA 1DYKA 2WA3A 1MS3A 3DXTA 4Z2WA 3DCQA 1BYHA 3VHNA 2AR6A 3NAPA 4BHPA 1WLWA 2J1UA 1S0BA 1OOPA 4XAAA 4L9BA 1OD3A 5D1IA 2GMPA 4CP9A 4BYYA 3HR9A 3C7GA 3JD72 5G05L 4TZDA 1KS4A 2KR2A 3WOGA 1SCSA 2DFCA 4G4FA 1L3JA 2VOWA 1AR81 5FY9A 3GM8A 5FYSA 5GLTA 4OULA 2FCUA 2OA2A 2D98A 3THPA 1Y7BA 4PBPA 1PMIA 1WBLA 2CGPA 4YZ3A 1UY1A 1VRBA 1XYNA 3IT8A 2XLFA 2R32A 2WLPA 4RYDA 4DXTA 1LULA 3HIFA 3ZIXA 2B42B 2R1BA 4NUBA 1ZZ9A 3IM0A 1QH6A 1GWLA 2OW4A 5FZ1A 5CKNA 5L7OB 1OD5A 4YGEA 4CEYB 3I4IA 3SISA 2VBDA 4CSWA 1N1YA 4NRQA 4WVMB 5BNQA 2VBBA 5CIRA 2OZ6A 4YW3A 5BV6A 1HN1A 4BMBA 4Q0PA 4LKEA 1WA4A 5CYYA 2RS52 2Q4SA 1KQRA 2WZPP 3VB9A 4QAWA 1EY2A 4JZRA 3NKGA 5JZGB 5C71A 3WUDA 1W06A 5A7NA 1MZ6A 1V9U3 4N53C 5JPMB 1JU3A 1XQNA 1QDOA 3SLIA 3M70A 3BN6A 4YG0A 1S2KA 1YLLA 4FPOB 5FLJA 4MYEA 4QDRA 5ACA3 1LOFA 3KV5A 3J9SA 4Y5Z0 1W8OA 2GC3A 4JAAA 4N8MA 4AAPA 1HX6A 1COV2 2WNVC 1DFQA 3LE0A 4JGZB 1W6NA 1XOYA 1BZWA 4LT5A 4C0BA 1JMUB 1RUC2 2WABA 4XEZA 4OYUA 3ZMOA 2CGOA 5FMCA 1IG0A 5EQUA 1TVGA 1UOBA 4CZSA 2VZTA 1RUJ1 3LB9A 5T5JA 5JOYA 5F3GA 4NWWA 2MEV3 4DXZA 5ANQA 3NL1A 2W1QA 2UU8A 2UYBA 2ZACA 1ZBA3 3C7HA 3LPGA 1W99A 4S2GA 5IVCA 3VBRC 4AI8A 5A3TA 4AQ2A 4LA2A 1QJX1 3B9CA 3DGTA 3CZJA 4YZ1A 1G7YA 1A8MA 1ZZCA 2BFUL 1UOFA 2Q0AA 1EUTA 3I2HA 1H4GA 3WDTA 2Y60A 3VBFC 1VR3A 4C1WA 4GH4A 4IV3A 5FY1A 2BW8A 2XUEA 4ZXKA 2F6BA 1AR83 5F37A 4QXKA 3LQCA 2OPKA 4XFGA 2YDEA 4RA0A 5AC91 2BGPA 1NG0A 5FZEA 2O8QA 3Q8AA 3DUIA 2I2SA 4LHKA 3ZSLA 4B1MA 4CP2A 3AMPA 1UMHA 1RINA 3RI8A 2OKXA 3J7HA 3RGBA 3JBG1 3U75A 2VG9A 3AYAA 2OT7A 3VBUB 5JIUA 2Y38A 4JVAA 2H6CA 1XBFA 4NOTA 5FO9B 3TNQA 4KU8A 3R4SA 3OGGA 2XGXA 4W50A 2WA4A 3HN1A 4HVOA 5C4WC 2CSGA 2JENA 3ON7A 1WUVA 2NLRA 5DAWA 1O4YA 3GCXA 3KS7A 1LTEA 1XC6A 5T55A 4I09A 1V0AA 3RZHA 5A1FA 1LEDA 1UF2C 3GF6A 4Y20B 3AYDA 5A70A 3BGAA 1GZCA 2HEYF 4XFBA 2A6YA 4IEOA 4CCEA 1G8WA 1CQ9A 1SFPA 1TMF2 1VJ2A 4LUKA 5FXZA 3R6SA 3BU0A 4CP1A 5T5LA 2CL2A 5F2SA 1YCIA 2XVKA 1VALA 2YC4A 3AC0A 1VAMA 4IE5A 4JC1A 4RQPB 2EA7A 5EWSA 1LOAA 1Y4WA 2Y33A 2Y6HA 3JUUA 4L97A 4B3NA 5A32B 4E9KA 1NYWA 3RSJA 2ORXA 2VZVA 3EO6A 2WSUA 1JW6A 1F5JA 2VNGA 5CFDC 2PQQA 4A44A 1V6MA 2JD9A 1OUSA 2YPJA 4UFJA 2VNVA 2DDUA 3MUY1 3P6BA 5LK5A 4FTSA 3PUQA 1B35B 2YBSA 4Q4V2 1DGLA 3IAQA 2RMU2 3KSCA 3BTZA 1QJX3 4Q29A 2HBUA 4NPRA 3ME2A 2ZEYA 1AHSA 2GAUA 3J4UH 3MYXA 4N53A 4EYUA 5C3QA 1VAVA 1Q8VA 5A7WB 3U78A 5JSOA 4K1YA 5JOWA 2JXAA 1RITA 2KA3A 4HONA 2WT0A 1Y3TA 4WZCA 1YFUA 4AG4A 1LR5A 2ZKNA 1FI2A 2W39A 4XVHA 3KV4A 1VPHA 4AI3A 4AHZA 4D6RA 4FP3A 2YC0A 3T3YA 5T52A 5IFTA 4M4RA 2WNVA 2ZGLA 5DUXA 5EP9A 3W5MA 4XFAA 5AC93 1JOPA 4YW2A 3OD0A 4NROA 4XUNA 3M8LA 3R05A 3AJZA 4JDMA 2WR9A 4TTGA 1VBA2 3NNGA 4QQLA 4A7YA 4N7IA 5L9RA 3C3VA 4DRRA 2Q8OA 1UQXA 1FMD1 4LMFA 5IK8A 1VB2A 1M4WA 1YUDA 2ATFA 3LA2A 1VBE3 3JBG3 3ZIWA 1QJY1 5SV8A 2VNOA 4HN1A 3IBMA 5FO7B 1GZWA 1I5ZA 1OA4A 1BK0A 1UNBA 2NN8A 3VBRA 4PBOA 3ZFGB 3ZYGA 4A41A 3AZZA 4CDXC 2K46A 2Q1FA 4AF9A 4CXWA 2VGDA 4OHXA 1OI6A 2A7AA 1XYOA 2JG8B 4RS5B 5LASA 1OLQA 4X8PA 3T08A 1F8VA 5F5CA 1CIWA 4M3CB 1ONAA 2C5DA 2UWCA 4I02A 4QKFA 4Y24A 5FP9A 5B2GB 2IWGB 3VBFA 1OSGA 3I8TA 3V0BB 5AVAA 4FPEA 4RGAA 1W8WA 3O0XA 3IAPA 1OVSA 4M0HA 4AGRA 1I1EA 2VCBA 1STMA 3MLLA 4LKSA 1OT5A 3AXDA 3ZDVA 4C1XA 5LY1A 1ALYA 3J8F2 1RUG1 2HWE1 3GJAA 5FXXA 3M4FA 1XB9A 2QNKA 1MS4A 3LA7A 4IEZA 1OLMA 3TYJA 2W94A 1XXNA 4L92A 5C33A 3I59A 1IKPA 4BK4A 2R0HA 4PLNA 3Q8CA 5F32A 3USUA 1Y43B 1US2A 2AH2A 4O7XA 3SKVA 4EV0A 1RUF3 4GXLA 4IEUA 3I54A 5F3CA 2Z79A 1CZTA 4OQ8A 3WHTA 1JS9A 4JDOA 4O9GA 1NCRB 5C4WA 3WG1A 3WQ0A 1KDMA 3JQXA 3DYPA 3PJYA 3QH6A 1JYNA 1PO11 1TME3 3CJXA 4N43B 1SDWA 1W8ZA 2A3XA 2WC2A 2XQXA 2XBO2 1RGSA 4Q0UA 5D8AC 4OUEA 3VKNA 4ZU4A 4KQ7A 4CCMA 5EJZB 3DKQA 3CQOA 3H0OA 2RJKA 3BCWA 5LB6A 1S55A 2UWBA 3A0KA 4OZOA 1ZZ8A 3EMRA 5KHJA 2QQPA 4E4ZA 1MEC3 3IDEA 2ZXQA 4R9BA 4X6QB 2BNOA 4QGLA 4J1WA 1GOHA 2JKBA 3H9AA 4BQ2A 2PELA 3VDAA 2EIGA 1FMD3 1N3QA 1C8M2 5CFDA 4IGOA 4CPBD 1VE0A 5J98B 1W8FA 3AP5A 1AR91 4LIVA 3WDWA 4M3CF 1TME2 4QX7A 2Y6KA 2Y6LA 2RS32 5FZ8A 5HCBA 2YG0A 1JZ4A 1FV2A 4Z92B 3T4VA 1W6PB 3LAGA 4UAPA 4PT6A 1W8TA 5EPAA 1Q56A 3KQ4B 3B02A 2QDRA 5HI0A 3VLBB 1ZRFA 3A0NA 2RE9A 2WO3A 3TOJA 4FPLA 1YRZA 1KJRA 4FOQA 1DYOA 1W39A 2WT1A 4EWDA 4MXVA 1S0DA 4AFDA 1VBC2 5FPXA 2RM21 1UW8A 4UWDA 4K6BA 5EJ3A 1ULDA 4QPWA 4QX1A 2CHHA 1R1A1 1ZZBA 4FBFA 5A3UA 2E7TA 4PI2A 1MS8A 2HWE3 2JWPA 2H0BA 3GDBA 4XFCA 2D44A 4AEDC 4YW1A 3WHUA 4OI2A 2ARXA 5C5UA 2WNEA 2V4AA 2PTMA 3PIGA 4ET7A 1BMV1 1BXHA 2AEZA 1S0JA 4I0BA 2VQ0A 3JQWA 3BIEA 5LEJA 2BOIA 5DN2A 1NY72 2ZAAA 2HEWF 1GSLA 2TNFA 2P1BA 2VVFA 1HLCA 1UWWA 1SDDB 4A2UA 3CO2A 1HXS3 3W21A 4CDXA 3OD4A 4Y33A 3HQRA 2XJRA 5LBFA 5L9VA 3J26N 2A73B 1NZIA 4L2NA 2CY6A 2XJQA 3TEZA 1O4TA 5F6LB 2B45X 3MDPA 1RC6A 3LDRA 2WUHA 1MZ5A 4MGYE 2DFBA 2JDZA 1FXZA 3LA3A 4Q1PA 4AW7A 1PK6B 1AR71 5CU1A 3AB0A 1LOEA 3S7IA 2XQRA 2FBEA 1S0CA 2P3JA 1AZDA 5H9SA 1HV1A 4HZFA 4Y1ZA 2R071 5A3OA 2ADEA 4ZZ5A 3DF0A 3E1F1 3KHBA 4FFFA 2VXRA 4UFHA 1G9BA 3POIA 3BTYA 3EHKA 5A1LA 4HL0A 5C5TA 1IPKA 4PIZA 1SLAA 3OPWA 3QOPA 1GQPA 3RDIA 5BNOC 4AVBA 2VOTA 5KXEA 3LOBA 1QDCA 4O61A 4WM8B 1EV11 4E4DX 3R4UA 3AMQA 3MF9A 4JKMA 4P00B 1GFF2 2ZGUA 1FX5A 3BKZA 2VC9A 1AR93 3ETPA 4WM7B 5FZDA 2OS2A 1DQ6A 1H30A 4WV8A 1PHMA 3JU9A 3CEWA 3ZSKA 1KFUL 2WSVA 5BUVA 1O3SA 1OFNA 3BPZA 3IDAA 3OYWA 3ACGA 2DYCA 4FFIA 2WYSA 5FMOL 4I2OA 4EN7B 5B4XA 5F5IA 5FYBA 3ZMNA 5CISA 1VRH1 1BEV1 2AREA 5D8AA 1AL22 4E27A 5LATA 1JTZX 4URAA 4AEMA 4BMEA 3P3PA 2K0GA 4Q4X3 2JECA 5GZEA 2VMHA 2ZZJA 2P4EA 2RM23 4D7YA 4V1PA 5F3EA 3ZXKA 4M00A 3E6DA 3IIAA 5I0TA 2IZWA 1HB2A 3O1SA 2XWJB 1R1A3 4YM0A 2R0FA 1REDA 3U4XA 5J48A 1VBD2 1J1LA 5FOJB 1F31A 4ZS3A 1LESA 1WMFA 5BY5A 4FT8A 1UU4A 2ZEWA 4HETA 3B00A 5JOXA 4XBNA 4JHTA 1PVXA 1D4VB 3AK0A 3BU7A 3LIGA 4EN8B 4GD4A 2JDUA 4AFMA 1WA6X 2ERFA 3ZKUA 4R4ZA 1PGW2 3ILNA 4PIXA 3KF3A 1W9FA 2QQMA 1W90A 1JODA 2D6KA 3D0SA 4LULA 1BVP1 4OHVA 5A80A 3RPQA 4A42A 5KXBA 5F8PA 2BNNA 3I3MA 1WLDA 4IV1B 1SBFA 5C3PA 5L36A 1NCQC 5A7PA 1AR73 3VBSB 2ZAHA 3EYPA 5JOZA 2JD4A 3KCCA 5DAVA 3WXPA 3KV9A 2A1XA 4BQXA 2F17A 3UKNA 2BV4A 1GZTA 1GP6A 4QU1A 4XQDA 5J36A 4LLFA 2VVDA 5CZKA 5T5OA 2PAEA 1DZQA 4I30A 3DL3A 3NSTA 1F4AA 1IHMA 1J84A 1AX0A 2VUJA 3ES1A 3KCXA 4ZU5A 4CDQB 3H8RA 1CAXA 5BYNA 1W6OA 1RUH2 4QU2A 2J1RA 5FP4A 4AFBA 3WNOA 2WQ8A 1RVF2 1EV13 5FYZA 1BBT3 3O14A 3MW2A 1DP0A 1YQ6A 2WO2A 3AKPA 2WNUB 4UFIA 4HANA 4V2WA 3WCRA 4BXSV 2P34A 2BERA 2ZHMA 3NVCA 1NLSA 1JU4A 1H2LA 1X82A 1GR3A 4NWVA 1IS3A 5H9QA 3RG0A 4HPKB 3H7YA 1F35A 2WFF1 4GZ9A 3UGGA 2QZ2A 5FXVA 5H9RA 2ZX3A 3M3IA 4XTMA 2HBTA 1RUE1 2DWRA 2W1UA 1VRH3 1AXKA 2CDOA 4BK5A 1ENXA 5LK7B 1D7PM 4BQ4A 4CUBA 1Q8OA 2HH9A 2PYTA 3DXUA 4DUWA 5KHIA 3AP4A 3C2UA 4H14A 2DU1A 1C3HA 4P9XA 4K8FA 4BM8A 2C9AA 3LDBA 3VBHB 1ASJ1 5F9TA 4NIGA 3KD4A 3FHAA 3ZXGA 2PLV2 2EAKA 4NHLA 4UBHA 5B4NA 2NQYA 5BNOA 3ZX7A 1IS4A 5FAXA 4PCRA 3TWIA 3ACHA 2W92A 3OBTA 4XW3A 1R081 4EJRA 1W6QB 1J3QA 3HAGA 4XUPA 1CAUB 1UPSA 3NAPC 2KXLA 4GB31 4IE0A 4EROA 3AFKA 2VH9A 1WCSA 2Z2SB 4D7TA 1U5ZA 4A3ZA 1BQPA 1W04A 4P14A 5CADA 5JDBA 4W6YA 4Q4Y1 2R061 3WP3A 3Q9OA 1R091 1SQ4A 4GIQA 4LBKA 4YM3A 3OGVA 1GANA 3I3DA 3ZFFB 3BPSA 2QE3A 1QOTA 1AX1A 2D6OX 5FK7A 4DUVA 3T0BA 1RTVA 2G1MA 3KMHA 2WO1A 1MQTC 2XVLA 1JYCA 3URFA 1FOD1 3WP5A 1AVBA 5F1RA 4KL1A 2QUOA 3W58A 1PIV2 5FBJA 5JPNB 4CDWC 3CL1A 2HJIA 1HQNA 3ZSEA 5FZFA 4NAMA 4GWJA 1B09A 3WQ1A 4DY5A 2DBIA 1LHOA 3OB8A 3KV6A 2R6QA 2B9UA 4Q0QA 5I0DA 5KBFA 4BIFA 1MACA 4H7LA 3U0ZA 2E53A 5JSRA 3O1MA 2FDFA 1H8TB 2VZQA 2ZCWA 1OLRA 3D3AA 1NLRA 5FDBA 2GC2A 3VD3A 1D0GA 4A6SA 3AL5A 4YYOA 4A45A 4AQ6A 1D0HA 2BFUS 2ZMLA 2BYVE 2GMMA 2WJSA 4BPZA 3AFGA 3PUHA 1CIYA 1MZFA 2YB7A 1W2UA 3HNBM 3Q8BA 3KWVA 4AI0A 4B4QA 1O3QA 4XIOA 1WD4A 2E7QA 1UCXA 2JE7A 2WFF3 3N7MA 2PHFA 4HVQA 5K9YA 2ZABA 3CJIB 3DEMA 4BH9A 1NCQA 1HRV1 5DUWA 1OLME 2ADDA 4EN0A 3WP4A 2ZGSA 4LBQA 3NJYA 3S30A 5IAXA 3CZUA 3DKWA 4A3XA 1WLCA 2D3RA 2RS51 3B9IA 4AE2A 2ETEA 5L7OC 1ASJ3 1YIFA 1DLLA 1W9YA 4CEYC 2RDNA 3AXEA 3DPRB 3MEPA 3M3QA 3IKWA 4AI9A 1H2MA 2V09A 2XKPA 4FQZA 1POQA 2IXLA 3A23A 1YQ5A 2HWF3 4Q0SA 2OIIA 2DCYA 1AYM1 1W6MA 2GP5A 4DINB 3D4KA 4PLOA 1V6LA 3AZWA 1P8JA 4D8MA 2Y34A 1Z7S2 1C5IA 4GB33 4W6WA 4YWAA 5JZGC 1CVNA 4META 4LOSA 2A6XA 1QNYA 4KWJA 1FATA 4HK8A 2R063 4Q4Y3 5DDJ2 1R093 5K4LA 3TN91 1V6JA 3UK9A 5JXJA 5FY7A 2FD8A 1QJU1 4X8NA 3ZLIA 4XXPA 2IVIB 2CAVA 2DUPA 5C8CB 1K45A 4WZFA 2VW0A 4JGZC 2Q5TA 4XJAA 1FOD3 2NMOA 1J58A 4BOWA 5EYXA 1ZA7A 2RS12 1ACCA 4A7KA 1NE4A 2JDPA 4CCDA 4ASKA 3DYOA 5JI7A 1XNDA 3U14A 1PX4A 4Y22B 2A3YA 4XURA 5FTTC 4YGDA 5FYHA 3WF4A 1WBFA 4D0QA 2XL9A 4OMDA 4QQ2A 2E32A 3F95A 3PUIA 3BB6A 4UOJA 4GWIA 3OPZA 4EN6B 1Q43A 3GNEA 5E16A 2VOVA 4BQYA 1U0AA 2EIBA 5IAVA 4DPNA 4CU7A 4P9WA 2YU2A 1UL9A 2GNDA 2X53S 3OG2A 4QWNA 4UF0A 4CU9A 3MLJA 5F3IA 2TEPA 5E1RA 4I0AA 4BLIA 1GNHA 4Z82A 4XQ4A 2ZBJA 2GNTA 2E26A 4AI2A 1AXZA 2ENRA 3HWJA 1HRI1 1HRV3 2QQNA 2YC2A 1UN1A 3O0WA 1WKYA 1MQTA 2IC1A 4MGKE 3LPFA 3ZN6A 3MGUA 4YW4A 3TNPB 4UFKA 2RR12 3O1UA 4BJ0A 4CDWA 5EZWA 5GLZA 4JDNA 4FAHA 4ZPIA 3FBYA 2WFPA 3WP6A 2XB6C 2PMWB 2P3KA 4COUA 4YW5A 3WX5A 3MI8A 4F8AA 3KLSA 2P5BA 1Z0HA 2FMDA 3AL6A 5GJ6A 3PTYA 3BYWA 3FUOA 5JCTA 5I0RA 3VBUC 1IZ3A 1IG3A 1TE1B 3BALA 2XONA 5HV0A 3N35A 2AUYA 1QF3A 4IE4A 2MNGA 4QXCA 4AEKA 2XKOA 1AYM3 2ZGRA 3DECA 3AP6A 5I8SA 3B3QE 4XFIA 1UAIA 1DIWA 1GNZA 2DVGA 2XH6A 2D97A 3ZYIB 3ZR5A 5DABA 1GNYA 3TN93 5CKQA 3ZYPA 1HJFA 4MGTA 3MFCA 5BPXA 2YFZA 4DY3A 4A6OA 1CJDA 1YNAA 3HN3A 4AVAA 1GU3A 4L11A 3VD5A 5A3NA 2WT2A 4DZGA 1GQHA 1GWMA 2W68A 1PGL2 1MVQA 1QIQA 1T6BX 1US3A 2YMZA 2ZGMA 3AVSA 2G9ZA 5CEHA 4RQPC 1CR7A 2Y6FA 2PHUA 4LEJA 5IJRA 5L7OA 4MGIE 4TLFA 5AFBA 1J3RA 2X10A 4YW6A 4CEYA 1OA3A 1YJKA 5C3SA 1QJEA 1V9U2 1QGLA 3I2GA 4RFT0 4WVMA 1HKDA 3NV1A 4E4SA 2J1EA 3FX3A 5FY8A 3ZFEB 1SHWB 2V72A 3HOBA 3OCPA 1NA1B 1B35C 2GDFA 2RDSA 2WKKA 2NM1A 2ZGTA 3NV2A 1KJLA 5ACA2 2XLAA 5JZGA 1GUIA 3LSEA 5J09A 5LA2A 1N3PA 3HT2A 4LO7A 2Y6GA 4TLGA 1W2NA 2J1SA 4IXLA 3MV11 5C3RA 4JKKA 4AEJA 5KC5A 1UXZA 2CYFA 2WZR1 3LDKA 3T2QA 4Y5SA 2JIGA 5F39A 2C26A 1UMIA 3IDCB 3NMBA 2B8MA 4KG8A 1LGBA 1OKOA 5IT6A 1HRI3 3QCWA 1FAYA 1XNKA 4LBQD 2MEV2 2WZEA 2FCVA 4JGZA 1JN2P 5A1AA 1ZBA2 3GCWA 2OPWA 2UWAA 2D5HA 4XACA 1G9FA 5IK4A 3NW4A 1RUOA 1QOOA 3H3UA 1W9SA 2SLIA 3WF3A 1IPJA 4CCKA 3VD9A 3ILFA 1XNBA 5FYYA 4O65A 5E89A 2ZX2A 4CPBA 2LRPA 1JZ7A 4XF0A 1XNCA 1R64A 2VMCA 3HVDA 3OY8B 3WV6A 2WN2A 1AUYA 4ARXA 2Z69A 1OF3A 2RDRA 4QGNA 3N4MA 4AQTA 3ZFGC 4IEWA 2JDYA 3K48A 5K0UB 1AR82 4QMAA 4RS5C 2JG8C 3KT1A 1RUI1 1GOGA 1KEXA 3K3NA 3MW3A 3KGZA 2PA7A 1DGRA 1D4M1 3KM5A 3OJBA 3MZHA 3E6CC 4R9DA 3ST7A 1X9PA 1YXWA 3VL9A 5IVVA 1UYZA 2ZZQA 3N3HA 5T5PA 5C70A 5KWRA 1UYYA 1WCUA 3PJQA 5FZ4A 4BA6A 2ZGOA 5FJKA 2D6LX 3SCFA 2YROA 1WWYA 4S2FA 2ES3A 1RUJ3 3KF5A 2N7GA 1UX7A 4FPKA 2JIJA 2GU9A 4H7MA 3T4HB 4DS0A 2Q8DA 3VHPA 5LY2A 2VVEA 3VZJA 1NE6A 1PO21 4AVTA 4CDUB 4DRVA 1OH4A 3WNNA 2VZRA 2VZ3A 3K75B 3VBUA 4LR4A 5GLUA 2G19A 2XJSA 4I01A 3VHRA 2WRAA 2J1TA 1CAWB 1NCRC 1RUD1 4LHLA 4YFZA 4GJYA 2AENA 4HKLA 5BXXA 1CAVB 4CXXA 2VCMA 4NE9A 4XTPA 3VN4A 1OFSA 3ZVXA 1PNFA 4UW3A 4IW3A 5FPLA 5FWEA 4N43C 3THCA 2ZJCA 4GWMA 1FNZA 5EFUA 4YARA 2WZR3 3MIDA 1HB3A 2L9LA 1ULPA 3PDQA 4Y20A 4CE8A 5FLHA 4EN9B 1SCRA 1VMJA 4Q0VA 5FV3A 4XIKA 3VZLA 1JOBA 1OA2A 1C1LA 4ZHNA 5LBBA 3WG2A 3GHMA 4XDOA 4H3WA 1UKRA 2FCTA 1G9AA 4GWNA 4QGMA 5M0TA 3UV9A 1LU1A 3B5LB 4RQPA 3T2TA 3RYRA 5FZIA 5J1XA 1QJX2 5A32A 4KGQA 4PDWB 1U5IA 2GZWA 2YGLA 1QXPA 1GOFA 3TEXA 5IYYA 1ZBE1 3GBFA 3T2OA 1WCKA 2VQTA 1LECA 4FXGB 4IGPA 3USSA 1GICA 4P08A 5DG2A 4JKLA 1B35A 1DQ2A 1QJFA 1W3VA 2GH8A 2JDAA 3PLQA 4Z2AA 5FYIA 4H2AA 4P9GA 2W1SA 3ECQA 3AM2A 1H1IA 4G3YC 3WCSA 5FMOS 1T2XA 3LEMA 4LE3A 2F4PA 1RUI3 3ZYJB 5A7WA 4B29A 1D4M3 1RMU1 5FPVA 2WQZC 5AC92 5KHKA 4QPIB 2ET7A 3WW3A 2C0ZA 4YM2A 1O5UA 1KXGA 2IXHA 4XCAA 3T0AA 5KR7A 1I6XA 2CAUA 2B9VA 3UJQA 2PXJA 5F5AA 2XHNA 4C0HA 1VBE2 2VJXA 1MS1A 3E5XA 3JBG2 3R4DB 3VKLA 1CN1A 1SMVA 3Q8FA 5JR2A 3ASIA 4FXKB 2WO7A 4DXSA 2GC1A 2BZDA 5FQ0B 2VUAA 3VDDB 1JZ5A 4ASMB 3WSOA 2WS91 1YWKA 1PO23 2Z5WA 3VZMA 1OKQA 1FPN1 2A6VA 2VBPA 3WDXA 4AYUA 1E5SA 4XF1A 3PNAA 4RHV1 4KBZA 1MVEA 3I3BA 4QHZA 2JG9B 3ZFGA 5SV5A 1DGWA 1Q5OA 3PVNA 4CU8A 2NP0A 1RUD3 4RGGA 4XC9A 5A6XA 3KT4A 2BEOA 2JG8A 2JICA 4RS5A 5HXVA 1WMXA 3S5QA 4JQRA 3RWNA 4M3CA 4BIOA 5FKCA 1C8NA 2W08A 4JRAA 2ORZA 2C9KA 2QQVA 2R041 2VXJA 5L9BA 3S0MA 3VDBA 3V0BA 4MG2A 3RQ0A 1PK6C 1JUHA 3OGSA 5GLWA 3VBOB 3ZXLA 5FBZA 5HCFA 1O8PA 5CBLA 5J7MA 5LA0A 3M2MA 1AR61 3A21A 3MF6A 1BK1A 1E5IA 4ZXEA 1RUF2 1LHNA 1ENRA 1PVC1 4E2GA 3ZXAC 3I2KA 2PHRA 2RHPA 4NPLA 1K3IA 4COWA 1VP6A 5D2AA 2J1VA 3BOWA 3FFQA 3TBDA 1NAEA 1QJY3 1XU2A 1ZNPA 2BRTA 4WM8C 1YFWA 1NUKA 1ZBE3 3IMMA 3W20A 1REFA 4LPLA 1OHFA 2GNMA 2HYKA 4CUCA 3IIIA 3U1XA 4ISQA 4A7ZA 1NCRA 2E7AA 4WM7C 4YVWB 4PQQA 5FR3A 3BI3A 3HD8B 3IZOA 4IESA 3LWCA 4QXHA 4NRPA 1MS9A 4XZPA 1O4ZA 1SPPB 3PVBB 5IVYA 4B7KA 4BZ4A 4OHZA 2X8KA 4N43A 4QB2A 4R52A 1MEC2 4PHZA 1RMU3 2AGSA 2JE8A 4Y4YA 5FYTA 1LAJA 1VBD1 2Y6JA 4MOAA 2DUOA 2FQPA 2VZPA 4Q2FA 4PI0A 5C9AB 3GZTB 4QPGB 4NHYA 2GMEA 1FMD2 3POGA 4QX5A 1ZRIA 1RUG3 4AVVA 5AFEA 1UX6A 4UFMA 1LEMA 3I7DA 2WL1A 3HNYM 3PU3A 4MGSA 2ZHNA 3B69A 4QKNA 1F5FA 4LK7A 4I0WB 4R9AA 4XBQA 4F7ZA 5FUNA 3O7OA 2D7FA 2IFRA 3FMGA 1Q8SA 2QQJA 4G9SB 5A33B 1W0OA 1OXCA 5A7QA 2WS93 4WVWA 5C6CA 1FPN3 3A22A 2D40A 3MIBA 4J1XA 4NHKA 4XUTA 3DV8A 4YW7A 4CUGA 4RHV3 3T1MA 3BVCA 2IVJA 1W05A 5FZ7A 2DCTA 2J1AA 1WW7A 1W6PA 2R30A 3OF1A 1QEXA 3C7FA 4AOCA 3B7MA 1PO13 4AAXA 4ATFA 4DMIA 2FDHA 4BDVB 1YQ2A 1N1VA 1WLTA 4XZUG 2QFEA 4FOWA 4NRMA 4IV1C 2HYXA 5IVBA 4MO3M 2HWE2 3PMEA 2R043 2VULA 2X5IB 3VHOA 2X09A 1O3RA 5DXDA 5LRSA 3WDUA 2BBVA 5FWJA 1OQ1A 3TRSB 1FYUA 5EXOA 2PAMA 3JZVA 1PM4A 3FE5A 4UT5A 1XJAA 5DQ0A 3LKJA 4ZS2A 4ASLA 2XJUA 1AR63 1IQAA 2HWB1 2CGNA 3VGIA 3QLQA 4QT6A 3JXSA 3NV3A 1PVC3 1QU0A 5GM0A 1OPOA 1HXS2 3HNMA 2D43A 4IEYA 4MGQA 3H8UA 4QX8A 1W9TA 3U10A 2BOJA 4CDQC 2BNMA 5KXDA 2BBAA 2C6SA 2ZMNA 3ZYFA 3NRUA 5LW9A 3RYPA 2LM3A 2OZJA 4JGYB 4DEQA 1BCXA 4TSVA 2BVBA 3ZN4A 4QD2A 2WNUC 1OURA 3IMNA 3MICA 4QPYA 2VW1A 4FOVA 2XVGA 2PQSA 1APNA 1N47A 1O6UA 1AX2A 4M01A 4COVA 1ZRDA 1F2NA 1U12A 1OF4A 2DU0A 2PFWA 2QQIA 4K8RB 4XF4A 4UW6A 4E2SA 3ABZA 4HOOA 4YZ2A 1PK6A 3G6JB 1Y9QA 1H4HA 1V6OA 5FZHA 2BQPA 1XPWA 1BLZA 3EQEA 4L99A 4ONUA 4UFLA 4XBLA 2PHWA 2OQ7A 3CU7A 3INAA 4X6RB 4XE9A 4YFWA 3UKVA 1EAH1 3X29B 1VBB1 1JYTA 1QQP1 4UI9L 4ES8A 5CVRA 2R16A 3A4UA 3N7LA 4XETA 2DF7A 1AR92 3VBHC 2BGCA 3WNMA 5F6KA 2V73A 3V64A 4OHWA 4YVSB 3U4SA 4LQRA 3SC7X 3N7JA 5FY0A 4Z8BA 4NHMA 4WM8A 4LIUA 5LCWL 3IPVB 3AP7A 3NO8A 3T1LA 3WNLA 2GP3A 4AI1A 1W2TA 1ENQA 4CEWB 4R9CA 1XYPA 4AEDB 1DGWX 4WM7A 4Y1XA 2P17A 1ODNA 1LOGA 2YBPA 2BVVA 5BNPB 1DCSA 1E57A 2EF6A 4Q4X2 3GZUC 3W5NA 2JDNA 2RM22 1YI9A 2XLGA 5JMCA 4GQ7A 4U2AA 1PIV1 1NKGA 1QOSA 3FZ3A 3VKMA 1R1A2 3HQUA 1O5LA 5LZ6A 1LODA 2DCJA 5DUVA 3ZFFC 3BOPA 2VMGA 1BMV2 2R073 5EHDA 3PMSA 5ISLA 1ND3B 2ZS6B 4FCAA 4AVCA 2FDIA 5FMBA 4Q27A 1W0PA 1O7FA 4NMIA 2Y0OA 3MPPG 2G9GA 2HWB3 2D3SA 1UU5A 2RVAA 2WBKA 3WNXA 3C8XA 2JX9A 3ACLA 1AYN1 3OGRA 2WZ8A 4Q4W1 3AMHA 3WD5A 5KC6A 4XJ8A 5A3LA 3LF7A 4LO4B 1DQ1A 2D6PA 2B39A 1H1MA 5I8TA 1Z78A 5K7PA 1H8TC 3RZKA 2EXJA 1OUXA 5IVJA 2RJLA 1H6XA 4RR3B 5HCHA 3U37A 3IWZA 3HT1A 1AR72 3GGLA 4EQVA 5HCAA 3FFZA 1AJKA 1SZBA 4LK6A 4QM8A 1POV0 4NIDA 5I8YA 1K5MB 4BWOA 5FZAA 4PF1A 2Q8EA 5KXCA 2Q1ZB 1BEV3 1G6NA 4IV1A 5FZ6A 5FZOB 3UYJA 1UYPA 4Y5TA 4P9IA 1XRUA 2ZEXA 2YU1A 3CJIC 4NIHA 3VBSA 3RZMA 4GJZA 5L19A 2ZGNA 2J42A 2JDHA 3O0VA 5DZGA 2P6HA 1DGRN 1DBNA 1EYBA 4WBBA 5CFCB 1EAH3 1EV12 1VBB3 1QQP3 2EVXA 2VCAA 2W0XA 1BBT2 2WWUA 3LFIA 3SCGA 5I93A 2CV6A 4FFHA 5FJHA 3PVOA 2UYAA 4AK3A 3MHZA 4P5HA 4CDQA 2R1DA 2W47A 2WQ4A 5I91A 1Z7S1 2GH2A 3W59A 3DPRC 3NWKA 4BLJA 1OVPA 1VIWB 4HSJA 3PUSA 4MUVA 4TXWA 4QX0A 3RZZA 4NVPA 3THTA 3T09A 3WW4A 5J3UA 4KBBA 4HBNA 1XE8A 4LORA 3SITA 5I0SA 4D3WA 5JXHA 3AX4A 5FYMA 1VRH2 2WNUA 1DQ5A 1KDKA 1I9RA 1Q8PA 3GJBA 3RJRA 1JUIA 2Q30A 2EALA 2QKDA 2VMEA 2JB8A 3POYA 4HPKA 4QQOA 3IB3A 5CKMA 2DVBA 2VTFA 1JYIA 1OBNA 2A3WA 2QBXA 2GN3A 4LNVA 3MIGA 1RHI1 1HJGA 3FWEA 4XJZA 3C7EA 3NNFA 4GKYA 2VQAA 1JYVA 2YFUA 1G9DA 1REEA 2QTWB 4LJHA 3AP9A 1K42A 2QQWA 4LO6B 1PZ9A 2HWC1 5C8CC 1ZVFA 2HWD1 3N9LA 1NZCA 1XNTA 3GHNA 4DFSA 5IFPA 3O1OA 1W2AX 5FXWA 1PZ7A 2BPA2 2MHFA 3ES4A 1LU2A 1UZZA 5ERLA 2VOXA 3VBHA 4QHOA 1DQ0A 4AGVA 1V00A 3ZXEA 3LEKA 3FJSA 1AYN3 4YZ5A 2P3IA 4Q4W3 1QJZA 3WT3A 3EBRA 4AZZA 3JD71 1W6QA 2LW8A 4E8CA 2JJ6A 5A7OA 3FLPA 3QACA 4IUGA 1CAUA 5K8SA 2ZOEB 1J1TA 2A70A 2EAAA 2I74A 3KHCA 4D6QA 4MXWB 3JB8A 5FUPA 3S7EA 1S0GA 2YV8A 4P9YA 5BNNB 1QXJA 3RI9A 1ODMA 3BTXA 4K20A 4LXLA 1CPNA 2VU9A 4AWDA 1RIRA 1SACA 1RUE3 1NLQA 4KWUA 1VB4A 3ZFFA 4OQ9A 2VMIA 3RFRA 2ZKLA 1V6KA 3I2IA 4Q1RA 2X29A 4KI5M 4Y1UA 3RZJA 2NPIA 5FCCA 5FFOC 1PGSA 1POV1 3OBZA 1CESA 1QMJA 5JIAA 3WG3A 3BODA 1ND2B 2ILMA 4CXYA 4N7UA 2Q1MA 3D5OA 5FYCA 4C8DA 4FPFA 1IS5A 1XU1A 5FZKA 3ELNA 4D94A 1R083 1N1TA 3SH5A 1L7QA 1AL0G 2KD7A 3POFA 4MADA 2Q8CA 2VY0A 4LBMA 1QWRA 2IFWA 2P2KA 4QB1A 1H2KA 1H8TA 2WFF2 1TNFA 1LHUA 1EPWA 3AYEA 4M3CE 2VUCA 2JKXA 2OVUA 3FBMA 2LS6A 5CB7A 4SBVA 3RZGA 3H1WA 2VE1A 1COV1 2XL7A 4XAEA 1GWKA 1RUC1 3APBA 5DAPA 3KCYA 3SNMA 3T0DA 3EJKA 4FPJA 5ABJB 3POBA 4URTA 2VQUA 5KHGA 4P5YA 2E51A 2TUNA 3CJIA 1RHI3 5FY4A 2D93A 1ASJ2 3BIWE 2ARAA 1OOPB 3AKRA 2HWC3 5CG8A 2WAOA 2HWD3 1RJ7A 4CP9B 4CYDA 2XUMA 3C7OA 1OC1A 2HWF2 2YZ4A 5LA9A 2ZPXA 1PNGA 1UOGA 4FOYA 2C1FA 4ATEA 4GB32 3ILRA 3OOXA 5CG9A 4ORFA 1R1ZA 3ORJA 3DPRA 4HFSA 3OUJA 1KITA 2RJ2A 5A6QA 4XOGA 2H6BA 3JD73 3O5SA 1PMHX 4JTNA 4Q4Y2 2HLEA 2R062 4XYXA 1R092 4KNCA 2ZX0A 3POSA 1YQCA 2BWCA 3J7LA 3ZFEC 1NA1C 4CCJA 5A6ZA 4LBJA 2OQ6A 4N9HA 4CVUA 2E33A 1FNYA 4QQPA 3T2PA 5JLVA 3PU8A 4YLZA 3K46A 1ST8A 3Q8EA 4MLOA 3HJRA 3SKJE 1FOD2 2EIEA 4QM9A 1DYPA 4ZONA 3SEEA 3I49A 5GLVA 3VUOA 5FP3A 5F5QA 4HG6B 4H55A 4CA9A 2DCKA 4XQWA 2QQKA 3E5UA 3RVHA 4NO4A 3VZKA 1O3TA 4C90A 3VKFC 4J6GA 5C8CA 3H8XA 5FP8A 2IXCA 3O12A 1A3KA 5FZLA 5FPAA 4DEVA 4DIQA 5E88A 1SBDA 2RS53 3ZYRA 4XF3A 3S57A 5DAQA 4IERA 4FP2A 1GV9A 1POV3 2A6ZA 4L8QA 3N9PA 1YFXA 2DTYA 2DVFA 4B1LA 5IHRA 5HXMA 2V5DA 2EXHA 3PTRB 4Y22A 3OEAA 1W6NB 3KQRA 3AVRA 4R8HA 2WWJA 4MHUA 3ENRA 1C5HA 2JE9A 4U36A 1X50A 3MIEA 2NMNA 4N90A 3WW2A 4ARYA 4LUMA 2VMDA 1CZVA 2GN7A 1IS6A 1HRV2 4IETA 5K0UC 5FKBA 1COV3 1TMF1 2VNRA 4LO5B 1TG7A 3H3ZA 1VLNA 3RMXA 2EIDA 2VTXJ 1X7NA 1RUC3 4FQ4A 4FI9A 4IDZA 2WINB 2QQLA 5C7GA 1QJU3 1YFYA 1HV0A 1U5YA 3ZPYA 3OPTA 1NT0A 3I97A 4DUXA 2XPJA 2E6VA 1ZRCA 1DU3D 5LWBA 4OVEA 3AJYA 3P3NA 3OBAA 2BGOA 2WYFA 4Y1VA 5FZ0A 5FUIA 2XJVA 1T6GC 4Q4V1 4GH4B 4IV3B 4XJWA 2VM9A 2RMU1 4CTEA 1BJQA 3ZXDA 1E5RA 1LCLA 3H8OA 3M3CA 1AYM2 1I5PA 4HKWA 1UZ0A 2H0VA 2Y26A 4PIYA 4CDUC 5FOBB 3OBRA 2OX0A 1CGPA 5FZBA 1HW5A 1UOJA 4B4PA 1L7LA 2RDQA 2AACA 3JCIA 1CD3G 5LBCA 3TN92 2YYOA 3BUCA 4FTBA 3FC0A 1QJU2 1UIJA 2VAUA 1QNWA 2XG3A 1LHVA 4FPCA 3MW4A 1LOBA 2LTNA 4AVSA 1LB2A 3S5AA 1SLTA 2ID4A 3H50A 1VBA1 2QDNA 3T30A 4XMIA 1RXFA 5FYUA 1UZWA 1TQ5A 4Z07A 2VZ1A 1SLIA 2VO5A 4GA9A 4HN0A 2AYHA 4DXRA 3ZR6A 3VD4A 3O1TA 3H7JA 3RYKA 3E6BA 5APAA 5FZCA 1X8MA 4LBOA 4LLOA 3ZPOA 3NV4A 4YNIA 4BQ5A 3WF0A 1AF9A 4IQPA 1XE0A 4OFGA 1WW4A 1QXRA 3IDBB 3L2HA 3HBKA 1S2EA 3CNAA 4GKXA 4PDWC 5I0UA 3PHMA 4QX2A 1URXA 5T54A 3MIFA 3QBQA 2A71A 4INDA 4XCBA 5G04L 3CHXA 3SH3A 5JI9A 2X05A 3B94A 3IN9A 3ZFEA 3H1MA 1NA1A 4HXCA 1TNRA 3OGJA 4DOUA 3KVAA 3TEWA 2FMYA 3ZKYA 1HRI2 1YIPA 2ZHLA 3J8F1 4FVVA 1TMF3 3ZN5A 4BQ1A 4B8EA 1YHFA 2B46X 4PJYA 1VBE1 3H3LA 4MHRA 2NZ9A 2ZEZA 2LUWA 1Q3EA 1LNSA 4LHSA 4QPIC 2RV9A 4XPVA 1EUUA 1UU6A 3TEYA 5F2WA 4EE2A 1CPMA 3V0AB 3L9JT 5A7SA 4Q8KA 4YPJA 1CONA 3H1YA 4Q26A 5JSPA 4N53B 2B4KA 3SMHA 3ZSJA 3B93A 2PHXA 4IEPA 2W91A 4AFAA 4F3JA 1CZSA 4Q4V3 5HV4A 4LITA 1DQ4A 2RMU3 4QHBA 3POEA 2XWBB 4KWKA 1EP0A 3WY6A 2PHLA 4YZ4A 3VDDC 3ACFA 1SLLA 2WNVB 4XILA 4IEQA 5EJ1B 3UL2A 2XHKA 3K4AA 4ZY9A 1KFXL 2ZHKA 2XBO1 3K2OA 3OY8A 4KG0A 4HVRA 1G86A 3VD7A 3WVJA 5FRAA 2JG9C 3ZYBA 1MS0A 2ARBA 2NYYA 3GYDA 5K0UA 3RS6A 5HPOA 4RL7A 4LTAA 4BQ3A 1W28A 1UPIA 4JHZA 3WDVA 3WUCA 1FV3A 4UW4A 1RUF1 1GZWB 2DCZA 3VBRB 2I07B 4EZHA 1VBA3 2RG4A 3ATGA 4UBGA 4COYA 3EB7A 2FZ2A 3OSDA 1RUJ2 3VBOC 4OHYA 2GSYA 1H2NA 2Z42A 4XDQA 4Y4RA 4W8JA 4BB3A 1C8M1 5LEKA 3V0AA 2V4VA 3AMMA 3NNLA 5IK5A 1UY0A 1TME1 4PQ9A 4EWEA 2RS31 4FO9A 3VBFB 2W9XA 5IWFA 5JUVA 1U5XA 4LKFA 3SEPA 3MO4A 2V5YA 3I2DA 4MVTA 4CCNA 4CDUA 1GP4A 2HEVF 2ZGQA 4KU7A 2G4IA 3DN7A 1HB4A 4HLTA 3WW1A 4CUAA 1MEC1 1HQWA 4LKDA 4XJUA 1VBC1 2WZR2 1A6CA 1CAWA 2GALA 3CKHA 4YVWC 2VMFA 1H8VA 3I59B 2XR4A 4PF5A 4Z1VA 1CAVA 2IXKA 3OUHA 4A4AA 3USUB 4OMCA 2XDVA 3J8F3 1OMIA 1J83A 4W4ZA 5GALA 1C57A 1X9TA 1G9CA 3KZ4C 2DURA 3RNSA 1O8SA 2QZ3A 5C4WB 4NPMA 1NY71 4HK9A 1UY2A 5E6HA 1DG6A 5C9AC 4QPGC 3UNPA 4WVVA 3GZAA 2FZ1A 5LRRA 1X33A 2GNBA 4MZUA 2XJTA 3B01A 4NIAA 1JYWA 5DMYA 4JX0A 5FZMA 2XOMA 3WLUA 3MBWA 3K4ZA 4XFFA 2YHJA 5JVVA 1H9WA 5FPUA 5IVEA 4PDWA 2WAAA 4OCTA 1SFYA 2CNAA 4P9JA 4DB5A 1RUI2 4LE4A 5EIYB 5F7UA 5JXGA 4EZ4A 3M3OA 1D4M2 2OXBA 2XBO3 1K5JA 1DDLA 2Y64A 1V70A 4AL9A 1H9PA 2W3JA 4BISA 1DF0A 2ZGPA 2C4XA 5FY5A 1DZTA 1W9WA 2VZSA 1UY4A 4P02B 4TYSA 2ZX4A 4NN0A 3GBGA 1CWPA 5CFDB 3ZOIA 4S2HA 5DZEA 4PLMA 5GZFA 2BU9A 3AMNA 4QPIA 3U07A 3UKTA 4L0PA 5GZCA 1S0IA 1YI7A 1QHDA 2X5IC 1HXS1 1YJLA 1MZEA 2FHRA 3E5QA 2GC0A 3H42B 5EYYA 3WNPA 5J96B 2VZUA 1ZZ6A 1JBCA 2WNOA 4IEVA 1C8M3 1AJOA 1PO22 3CF6E 2CU5A 4Y1YA 4AHYA 4YRDA 5ANNA 1WCDJ 1UY3A 2W95A 3GBWA 1H1AA 3UESA 2RS33 4QKDA 5FP7A 1LOCA 1QY4A 1NQJA 1SLCA 1ZM1A 4FPGA 3O1VA 1GMMA 1RUD2 3VDDA 4KH9A 5C8WA 5FQ0A 3O1PA 3WDYA 1C28A 1UXXX 4MX3A 4LOTA 4GMP0 1WCQA 5T50A 1X36A 2YY1A 1AL21 4JGYC 1D2SA 1RL3A 2ZX1A 4BCUA 1XSQA 1DLCA 4SLIA 2JG9A 3POJA 4TWTA 4W65A 4XHXA 1VBC3 4RGKA 3EXUA 4K7JA 4OUMA 2QQOA 4K9SA 2EXKA 4QB6A 5DAXA 3LEIA 1YC61 2WWSA 1JZ8A 1GBGA 1QKQA 1LKNA 2W1WA 3VBOA 3VDCA 4CDXB 1UIKA 2DVDA 4I3GA 5FLIA 4BXFA 3ALQA 3WR0A 4D6SA 4DNYA 4F83A 3VV1A 2ZTNA 3LFMA 1QJY2 3THDA 5AVPA 1ZBE2 5C3OA 4YM1A 1PGW1 1ULEA 4DQAA 3KT7A 2CTVA 3I2OA 1OH3A 1RJ8A 3MLKA 4Y3OA 4YVSC 4Q4X1 2G9FA 3WQ7A 5JAXA 4P9LA 3P1IA 5FZ3A 3ZXFA 5KHHA 2SBAA 1OQEA 3HQXA 1HIXA 2DVAA 5A6YA 3J7NA 4D69A 4YG6A 4CEWC 1RMU2 3FUQA 3HMYA 2DTWA 2IXIA 3AKSA 1NOVA 3F2ZA 4W6XA 4N9IA 2WIIB 4YVWA 1JOJA 3TAYA 2A6WA 5BNPC 2VW2A 1ULFA 1SPPA 3A7QA 3N9OA 4XJ9A 1NQDA 2WN3A 1RUG2 4K1ZA 5L73A 3WF2A 1F15A 4GALA 2O1QA 3GZEA 2R7EB 3VBSC 2AEYA 2E31A 1JH5A 3LGRA 4BE3A 1RUNA 1RUH1 2QJVA 5C9AA 4QPGA 3K3OA 1A78A 1RVF1 3OUIA 4JQTA 1ND3C 4NIIA 3OYWB 1W0NA 4GAZA 1JZ3A 1TZOA 2WS92 4MSVA 4V2VA 1FPN2 2D5FA 3RZLA 2PAKA 4ISRA 5D8AB 1LENA 1TEIA 3JB4C 4RHV2 4XFHA 5EV7A 2J22A 2FDGA 4TN7A 3V65A 5D21A 3CBNA 5A33A 1PO12 2FDJA 2QQUA 1HB1A 1ULOA 2JDKA 4ES9A 3WZ1A 4XF9A 4OZXA 2B7YA 4COZA 3ZDSA 1AL23 4OI0A 2R042 2ZMKA 2F4LA 2YBKA 4RR3C 4YGBA 4HKOA 1A34A 3AYCA 1J59A 1O59A 1QH7A 2XXZA 3FHQA 3K51A 4RSUA 1H6YA 1KGYA 1W3XA 2VPVA 3G7DA 4CP0A 4ZU7A 1ZX5A 2B5HA 2JDMA 1PM7A 1SG3A 3N9QA 1K5MC 4FTEA 1WD3A 3GALA 3SH4A 1AR62 1ENSA 4XHBA 1VBD3 5GZDA 3CDZB 1BBT1 1JHJA 2PLV1 4UW5A 4GMP1 2X5IA 1PVC2 2YUEA 3UT0A 1WGPA 3ROUA 3SXWA 3PIJA 4Q8LA 1LRHA 1LGCA 4FAGA 4QDQA 1WW5A 4O9EA 3UETA 5CFCC 4M0NA 3VKOA 1EPZA 4IE7A 1IKQA 1WZXA 4XMAA 5E8AA 3NJVA 5FREA 3WF1A 1GP5A 3W9AA 1IOAA 1JI6A 1YO8A 2CWSA 2MPFA 1LHWA 4MGZE 2VECA 4IL7A 1RB8G 1WMDA 4K3UA 1OQDA 4QQHA 4JGYA 4EWAA 1Y9GA 1ZRRA 2W2IA 4HSLA 1H0BA 4YSFA 1E5HA 2KM2A 5DPNA 3HPNA 4C91A 1ZYBA 3R0RA 1XE7A 4XXAA 1CAXB 2OUJA 2IXJA 1W6OB 5TSWA 1IQDC 2BUKA 2E63A 2R49A 3J7MA 4IEXA 3K77A 4NJ4A 3SCHA 1KRIA 2D6MA 4KGGA 1GKBA 2D3PA 1FT9A 3LEGA 1CJPA 1GLHA 4K21A 1GZ9A 3ZO0B 1ZA4A 3KVBA 3WG4A 1RUH3 4E4HA 1PZ8A 2ARCA 2PN5A 4AGGA 1RVF3 2JB4A 3LSDA 5CNAA 4NAOA 5IVFA 2AZ5A 3FN9A 5FK8A 3M3EA 3E97A 1PX3A 4UYBA 3D0JA 1NXD1 1UMZA 1S0EA 5T3NA 3ITQA 4E8DA 1BHGA 4HT1T 2A75A 2VZOA 4YVSA 5FMDA 2W5FA 5FPBA 2UY8A 1UKGA 2VR4A 5DG1A 1JYXA 3IPVA 1KS5A 1JZ6A 1S2BA 1GYKA 2BDRA 4CEWA 3O1RA 2A5ZA 4FPHA 3I3QA 1XSRA 2VL4A 4AFCA 4AEDA 5BNOB 1JHNA 1X8EA 2DV9A 5BNPA 1K12A 1ULCA 2R072 4RD7A 5BNNC 3N7KA 4HMZA 5J37A 2YXSA 2O8OA 5FPZA 5LBEA 4KMQA 1MR5A 4MV2A 2HWB2 1RYYA 1HQLA 2K2SA 2W52A 2PLV3 5FZGA 4GMP3 2YGMA 4B7EA 5GKAC 1VMHA 2QVSB 1S4CA 5IUQA 5FO8B 1ND3A 1SBEA 4GULA 1SEFA 1S0FA 1KD7A 4MH0E 1V6NA 3N36A 4FSJA 3MPBA 4B4RA 4CRQA
chains in the Genus database with same CATH topology
1ND2C 2VOKA 3V56A 1LGNA 4OLLA 2OUHA 5DDJ1 4OI4A 5JR7B 1BEV2 3LOIA 1VAKA 5H9PA 4R4XA 4RR3A 1O91A 1MS5A 3KB5A 4UXAA 2I45A 5IK7A 1JXNA 4NR1A 4LBLA 3VL8A 1BKZA 1PIV3 2RS11 3ZXJA 1K5MA 1DZRA 1EAH2 3RJ2X 1VBB2 5ABJC 1QQP2 2QCSB 4LO8A 2HWF1 4S2DA 1ZREA 4JV4A 4AHWA 3QH7A 4ITCA 1OOPC 1J3PA 1OPMA 2P37A 1SFNA 3RMYA 1SLBA 5CFCA 1I3HA 2O0OA 3FLRA 1V6IA 2D6NA 1NCQB 1AXYA 5GZGA 3LCPA 5A3MA 1CX4A 3MFAA 4AXOA 1C4RA 5DUUA 2JEMA 4LBQB 3VZOA 3UJOA 2TBVA 2UY9A 5CAZA 4JCKA 3NKTA 4FPYA 1YYNA 4OUSA 4K40A 3ZSMA 2CWMA 1BVVA 2RR11 1UD1A 1D2QA 3AKQA 3HBZA 3POWA 2LALA 3M7AA 2ZGKA 1NXMA 1F9KA 1W6MB 1DHKB 4LHNA 4WVZA 3L2YA 2PHTA 3VZNA 4E2QA 1AYN2 1HDKA 1Q8QA 1IGOA 4Q4W2 3LZZA 1S1AA 2HKXA 2DUQA 2PHDA 2Y0IA 2WLQA 3QD6A 2E9QA 3WINE 1N1SA 1Z7S3 1LOFC 3D6EA 3MIHA 4Y26A 2ET1A 5DDJ3 3CLPA 1RUE2 3AZYA 1C1FA 5JWPA 1ZZ7A 5CA6A 4MXWA 5BNNA 3FHIB 1PGL1 5DZFA 3SHRA 1GQGA 2RS13 4ZKTB 2XJPA 3D8CA 3RRDA 4AQSA 3ETQA 3PVEA 3NAPB 4OI1A 2BWAA 4D7SA 1V9U1 1R082 4JRLA 3BTAA 3OTFA 4GH4C 4IV3C 4YGCA 3M1HA 2UURA 4LA3A 5ACA1 5HBAA 1ND2A 2EXIA 1WMEA 4JTOA 3AKTA 1WW6A 3AZXA 1MQTB 3NJZA 2OYZA 3ZN6B 4AHXA 3U11A 3FLTA 1UZYA 1ULGA 4CDWB 3TB0A 4YG3A 3KGLA 1RHI2 2MEV1 4KWLA 3AZVA 3D82A 1ZBA1 1N3OA 2RR13 2BTVC 2HWC2 1M06G 2ZA9A 1LJ7A 4I3PA 2HWD2 2K9ZA 1A8DA 5ABJA 4LBNA 3S6PA 1DYKA 2WA3A 1MS3A 4Z2WA 1BYHA 3VHNA 2AR6A 3NAPA 4BHPA 1WLWA 1S0BA 1OOPA 4L9BA 5D1IA 2GMPA 4BYYA 3HR9A 3JD72 4TZDA 1KS4A 3WOGA 1SCSA 2DFCA 4G4FA 1L3JA 2VOWA 1AR81 5GLTA 4OULA 2OA2A 2D98A 3THPA 1Y7BA 4PBPA 1PMIA 1WBLA 2CGPA 4YZ3A 1XYNA 3IT8A 2XLFA 2R32A 2WLPA 1LULA 3HIFA 3ZIXA 2B42B 2R1BA 1ZZ9A 3IM0A 1QH6A 2OW4A 5L7OB 1OD5A 4YGEA 4CEYB 3I4IA 3SISA 1N1YA 4WVMB 5BNQA 5CIRA 2OZ6A 4YW3A 5BV6A 4BMBA 4Q0PA 1WA4A 2RS52 2Q4SA 1KQRA 2WZPP 1EY2A 3NKGA 5JZGB 3WUDA 1MZ6A 1V9U3 4N53C 5JPMB 1XQNA 1QDOA 3SLIA 3M70A 4YG0A 1S2KA 1YLLA 4FPOB 5FLJA 4MYEA 5ACA3 1LOFA 4Y5Z0 3J9SA 2GC3A 4JAAA 1HX6A 1COV2 2WNVC 1DFQA 4JGZB 1W6NA 1BZWA 4LT5A 4C0BA 1RUC2 4XEZA 3ZMOA 2CGOA 4CZSA 1RUJ1 3LB9A 5T5JA 5JOYA 4NWWA 2MEV3 4DXZA 3NL1A 2UU8A 2UYBA 2ZACA 1ZBA3 4S2GA 3VBRC 4AI8A 4AQ2A 4LA2A 1QJX1 3B9CA 3DGTA 4YZ1A 1G7YA 1A8MA 1ZZCA 2BFUL 2Q0AA 1H4GA 3WDTA 3VBFC 1VR3A 4C1WA 4GH4A 4IV3A 2BW8A 4ZXKA 2F6BA 1AR83 4QXKA 2OPKA 4XFGA 2YDEA 4RA0A 5AC91 1NG0A 2O8QA 3DUIA 2I2SA 4LHKA 3ZSLA 4CP2A 3AMPA 1RINA 3RI8A 3JBG1 2VG9A 3AYAA 3VBUB 5JIUA 2Y38A 4JVAA 2H6CA 5FO9B 4NOTA 3TNQA 4KU8A 3R4SA 3OGGA 2XGXA 5C4WC 2WA4A 3HN1A 4HVOA 2JENA 1WUVA 2NLRA 1O4YA 3KS7A 5T55A 1LTEA 4I09A 1LEDA 1UF2C 3GF6A 4Y20B 3AYDA 1GZCA 2HEYF 4XFBA 2A6YA 4IEOA 1G8WA 1CQ9A 1TMF2 1VJ2A 4LUKA 3R6SA 4CP1A 5T5LA 2CL2A 1YCIA 2XVKA 1VALA 4JC1A 4RQPB 1VAMA 3WG4A 2EA7A 5EWSA 1LOAA 4E9KA 4B3NA 3JUUA 4L97A 2QQPA 5A32B 1NYWA 3RSJA 3EO6A 2WSUA 1JW6A 1F5JA 2VNGA 5CFDC 2PQQA 4ES8A 1V6MA 5LK5A 2YPJA 4FTSA 1B35B 4Q4V2 1DGLA 2RMU2 3KSCA 1QJX3 4Q29A 4NPRA 3ME2A 1AHSA 2GAUA 3J4UH 3MYXA 4N53A 1VAVA 1Q8VA 5JSOA 4K1YA 5JOWA 2JXAA 1RITA 2KA3A 2WT0A 1Y3TA 4WZCA 1YFUA 4AG4A 1LR5A 2ZKNA 1FI2A 2W39A 4AHZA 4AI3A 4FP3A 2YC0A 5T52A 2WNVA 2ZGLA 5DUXA 4XFAA 5AC93 4YW2A 3OD0A 3M8LA 3R05A 3AJZA 4JDMA 1VBA2 4QQLA 4A7YA 4N7IA 3C3VA 4DRRA 2Q8OA 1FMD1 5IK8A 1VB2A 1M4WA 1YUDA 2ATFA 3LA2A 1VBE3 3JBG3 3ZIWA 1QJY1 5SV8A 2VNOA 4HN1A 3IBMA 5FO7B 1GZWA 1I5ZA 1OA4A 2NN8A 3VBRA 3ZYGA 4PBOA 3ZFGB 3AZZA 4CDXC 4AF9A 2VGDA 4OHXA 1OI6A 2A7AA 1XYOA 2JG8B 4RS5B 1F8VA 1OLQA 4X8PA 1CIWA 4M3CB 1ONAA 2C5DA 2UWCA 4I02A 4Y24A 5B2GB 2IWGB 3VBFA 1OSGA 3I8TA 3V0BB 5AVAA 4FPEA 4RGAA 3O0XA 4M0HA 4AGRA 1I1EA 3MLLA 3AXDA 4C1XA 1ALYA 3J8F2 1RUG1 2HWE1 3M4FA 2QNKA 4IEZA 1MS4A 3LA7A 3TYJA 1XXNA 4L92A 5C33A 3I59A 1IKPA 2R0HA 4PLNA 3USUA 1Y43B 2AH2A 4EV0A 1RUF3 4GXLA 4IEUA 3I54A 2Z79A 3WHTA 4JDOA 4O9GA 1NCRB 5C4WA 3WG1A 3WQ0A 1KDMA 3JQXA 3PJYA 3QH6A 1PO11 1TME3 3CJXA 4N43B 1SDWA 2A3XA 2WC2A 2XBO2 1RGSA 4Q0UA 5D8AC 3VKNA 4ZU4A 4KQ7A 3H0OA 2RJKA 3BCWA 1S55A 2UWBA 3A0KA 1ZZ8A 5KHJA 4E4ZA 1MEC3 3IDEA 4R9BA 4X6QB 2BNOA 4QGLA 4J1WA 2JKBA 3H9AA 2PELA 2EIGA 1FMD3 1N3QA 1C8M2 5CFDA 5J98B 3AP5A 1AR91 3WDWA 4M3CF 1TME2 2RS32 5HCBA 1FV2A 4Z92B 1W6PB 3LAGA 1Q56A 3B02A 2QDRA 5HI0A 3VLBB 1ZRFA 3A0NA 2RE9A 3TOJA 4FPLA 1YRZA 1KJRA 4FOQA 1W39A 2WT1A 4EWDA 4MXVA 1S0DA 4AFDA 1VBC2 5FPXA 2RM21 1UW8A 5EJ3A 4K6BA 1ULDA 1R1A1 1ZZBA 4FBFA 2E7TA 4AEDC 1MS8A 2HWE3 4XFCA 2H0BA 2D44A 4YW1A 3WHUA 4OI2A 2ARXA 2WNEA 1BMV1 2PTMA 1BXHA 1S0JA 4I0BA 2VQ0A 3JQWA 5LEJA 1NY72 2ZAAA 2HEWF 1GSLA 2TNFA 2VVFA 1HLCA 4A2UA 3CO2A 1HXS3 4CDXA 3OD4A 2XJRA 3J26N 2A73B 4L2NA 2CY6A 2XJQA 1O4TA 5F6LB 2B45X 3MDPA 1RC6A 1MZ5A 4MGYE 2DFBA 2JDZA 1FXZA 3LA3A 4Q1PA 4AW7A 1PK6B 1AR71 5CU1A 3AB0A 1LOEA 3S7IA 2FBEA 1S0CA 2P3JA 1AZDA 5H9SA 1HV1A 4HZFA 4Y1ZA 2R071 3DF0A 1G9BA 2VXRA 3EHKA 4HL0A 1IPKA 4PIZA 1SLAA 3QOPA 3RDIA 5BNOC 4AVBA 5KXEA 3LOBA 1QDCA 4WM8B 1EV11 4E4DX 3R4UA 3AMQA 3MF9A 1GFF2 2ZGUA 1FX5A 1AR93 4WM7B 1DQ6A 1H30A 4WV8A 1PHMA 3JU9A 3CEWA 3ZSKA 1KFUL 2WSVA 5BUVA 1O3SA 1OFNA 3BPZA 3OYWA 2DYCA 5FMOL 4I2OA 4EN7B 3ZMNA 1VRH1 1BEV1 2AREA 5D8AA 1AL22 4E27A 1JTZX 4AEMA 4BMEA 3P3PA 2K0GA 4Q4X3 2JECA 5GZEA 2VMHA 2ZZJA 2RM23 4D7YA 4V1PA 3ZXKA 4M00A 3E6DA 3IIAA 5I0TA 2IZWA 2XWJB 1R1A3 4YM0A 2R0FA 1REDA 3U4XA 5J48A 1VBD2 1J1LA 5FOJB 1F31A 1LESA 1WMFA 5BY5A 4FT8A 1UU4A 4HETA 3B00A 5JOXA 4XBNA 1PVXA 1D4VB 3AK0A 3BU7A 4EN8B 4AFMA 2ERFA 4R4ZA 1PGW2 3ILNA 4PIXA 3D0SA 2D6KA 4LULA 4OHVA 4HVQA 5KXBA 1BVP1 3RPQA 2BNNA 1WLDA 4IV1B 1SBFA 5L36A 1NCQC 1AR73 3VBSB 2ZAHA 5JOZA 2JD4A 3KCCA 3WXPA 3UKNA 4XQDA 5J36A 4LLFA 2VVDA 5T5OA 2PAEA 1DZQA 4I30A 3DL3A 3NSTA 1IHMA 3ES1A 1AX0A 2VUJA 4ZU5A 3KCXA 4CDQB 1CAXA 5BYNA 1W6OA 1RUH2 4QU2A 4AFBA 1RVF2 1EV13 1BBT3 3O14A 3MW2A 3AKPA 2WNUB 4HANA 3WCRA 2P34A 2ZHMA 3NVCA 1NLSA 4NWVA 1H2LA 1X82A 1GR3A 5H9QA 1IS3A 3RG0A 4HPKB 3H7YA 2WFF1 2QZ2A 5H9RA 2ZX3A 3M3IA 4XTMA 1RUE1 2DWRA 1VRH3 1AXKA 1ENXA 5LK7B 1Q8OA 2PYTA 5KHIA 3AP4A 3C2UA 4H14A 2DU1A 1C3HA 4P9XA 4K8FA 4BM8A 2C9AA 3VBHB 1ASJ1 5F9TA 3KD4A 5BNOA 3ZXGA 2PLV2 2EAKA 4NHLA 4UBHA 2NQYA 3ZX7A 1IS4A 5FAXA 4PCRA 3TWIA 3OBTA 4XW3A 1R081 4EJRA 1W6QB 1J3QA 3HAGA 1CAUB 1UPSA 3NAPC 2KXLA 4GB31 4EROA 3AFKA 2VH9A 1WCSA 2Z2SB 4D7TA 1U5ZA 1BQPA 5CADA 4P14A 5JDBA 4W6YA 4Q4Y1 2R061 3WP3A 3Q9OA 1R091 1SQ4A 4GIQA 4LBKA 4YM3A 1GANA 3ZFFB 2QE3A 1QOTA 1AX1A 2D6OX 1RTVA 3KMHA 1MQTC 2XVLA 1JYCA 3URFA 1FOD1 3WP5A 1AVBA 5F1RA 4KL1A 2QUOA 3W58A 1PIV2 5JPNB 4CDWC 3CL1A 2HJIA 1HQNA 3ZSEA 1B09A 3WQ1A 4DY5A 1LHOA 2R6QA 2B9UA 4Q0QA 5KBFA 4BIFA 1MACA 4H7LA 3U0ZA 2E53A 5JSRA 1H8TB 2ZCWA 1OLRA 1NLRA 5FDBA 2GC2A 1D0GA 4YYOA 4AQ6A 1D0HA 2BFUS 2ZMLA 2BYVE 2GMMA 2WJSA 4BPZA 3AFGA 1MZFA 1O3QA 1W2UA 4AI0A 4B4QA 4XIOA 1WD4A 2E7QA 1UCXA 2JE7A 2WFF3 3N7MA 2PHFA 5K9YA 2ZABA 3CJIB 4BH9A 1NCQA 1HRV1 5DUWA 4EN0A 3WP4A 2ZGSA 4LBQA 3S30A 3DKWA 4A3XA 1WLCA 2D3RA 2RS51 3B9IA 4AE2A 2ETEA 5L7OC 1ASJ3 1YIFA 1DLLA 4CEYC 3AXEA 3DPRB 3MEPA 3M3QA 3IKWA 1H2MA 2V09A 2XKPA 4FQZA 2IXLA 2HWF3 4Q0SA 2OIIA 2DCYA 1AYM1 1W6MA 4DINB 3D4KA 4PLOA 1V6LA 3AZWA 1Z7S2 1C5IA 4GB33 4W6WA 5JZGC 1CVNA 4META 2A6XA 1QNYA 4KWJA 1FATA 4HK8A 2R063 4Q4Y3 5DDJ2 1R093 3TN91 1V6JA 3UK9A 1QJU1 4X8NA 4XXPA 2CAVA 2DUPA 5C8CB 4WZFA 2VW0A 4JGZC 2Q5TA 4XJAA 1FOD3 2NMOA 1J58A 4BOWA 5EYXA 2RS12 4A7KA 1NE4A 5JI7A 1XNDA 4Y22B 2A3YA 5FTTC 4YGDA 1WBFA 2XL9A 4QQ2A 3BB6A 3OPZA 4EN6B 1Q43A 3GNEA 5E16A 2VOVA 1U0AA 4DPNA 4P9WA 1UL9A 2GNDA 2X53S 3MLJA 2TEPA 5E1RA 4I0AA 4BLIA 1GNHA 4Z82A 4XQ4A 2ZBJA 2GNTA 4AI2A 1AXZA 2ENRA 3HWJA 1HRI1 1HRV3 3O0WA 4MGKE 1UN1A 3ZN6A 1MQTA 2IC1A 3MGUA 4YW4A 3TNPB 2RR12 4CDWA 5EZWA 5GLZA 4JDNA 4FAHA 3FBYA 2WFPA 3WP6A 2XB6C 2P3KA 4COUA 4YW5A 3WX5A 3MI8A 4F8AA 3KLSA 1Z0HA 2FMDA 5GJ6A 3PTYA 3FUOA 5JCTA 5I0RA 3VBUC 1IZ3A 1TE1B 3BALA 3N35A 2AUYA 1QF3A 2MNGA 4AEKA 2XKOA 1AYM3 2ZGRA 3AP6A 5I8SA 3B3QE 4XFIA 1UAIA 1DIWA 1GNZA 2DVGA 2XH6A 2D97A 3ZYIB 3TN93 3ZYPA 3MFCA 5BPXA 4DY3A 1CJDA 1YNAA 4AVAA 4L11A 2WT2A 4DZGA 1GQHA 2W68A 1PGL2 1MVQA 2YMZA 2ZGMA 4RQPC 1CR7A 2PHUA 4LEJA 5L7OA 4MGIE 4TLFA 5AFBA 1J3RA 4CEYA 1OA3A 1YJKA 1V9U2 1QGLA 4RFT0 4WVMA 1HKDA 3NV1A 4E4SA 3FX3A 3ZFEB 3OCPA 1NA1B 1B35C 2GDFA 2WKKA 2NM1A 2ZGTA 3NV2A 1KJLA 5ACA2 2XLAA 5JZGA 3LSEA 5J09A 1N3PA 3HT2A 4LO7A 4IXLA 4AEJA 5KC5A 2CYFA 2WZR1 4KG8A 3IDCB 2B8MA 1LGBA 5IT6A 1HRI3 3QCWA 1FAYA 1XNKA 4LBQD 2MEV2 4JGZA 1JN2P 1ZBA2 2UWAA 2D5HA 1G9FA 5IK4A 3NW4A 1RUOA 1QOOA 3H3UA 2SLIA 1IPJA 3ILFA 1XNBA 5E89A 2ZX2A 4XF0A 1XNCA 3OY8B 3WV6A 1AUYA 2Z69A 4QGNA 3N4MA 4AQTA 3ZFGC 4IEWA 3K48A 5K0UB 1AR82 4QMAA 4RS5C 2JG8C 3KT1A 1RUI1 3MZHA 3MW3A 3KGZA 2PA7A 1DGRA 1D4M1 3KM5A 3OJBA 3E6CC 4R9DA 3ST7A 1YXWA 3VL9A 2ZZQA 3N3HA 5T5PA 5KWRA 3PJQA 4BA6A 2ZGOA 2D6LX 3SCFA 2YROA 4S2FA 2ES3A 1RUJ3 2N7GA 4FPKA 2GU9A 4H7MA 4DS0A 3VHPA 3VZJA 2VVEA 1NE6A 1PO21 4AVTA 4CDUB 4DRVA 3VBUA 4LR4A 5GLUA 2XJSA 4I01A 3VHRA 1CAWB 1NCRC 1RUD1 4LHLA 4YFZA 2AENA 4HKLA 5BXXA 1CAVB 3VN4A 4XTPA 1OFSA 3ZVXA 1PNFA 4UW3A 4N43C 2ZJCA 4GWMA 1FNZA 5EFUA 4YARA 2WZR3 3MIDA 4Y20A 4EN9B 5FLHA 1SCRA 4Q0VA 4XIKA 3VZLA 1OA2A 1C1LA 3WG2A 3GHMA 4H3WA 1UKRA 1G9AA 4GWNA 4QGMA 3UV9A 1LU1A 3B5LB 4RQPA 3T2TA 3RYRA 1QJX2 5A32A 4KGQA 4PDWB 1U5IA 2YGLA 2GZWA 1QXPA 1ZBE1 3GBFA 1WCKA 3USSA 1LECA 4FXGB 1GICA 5DG2A 1B35A 1DQ2A 3PLQA 2GH8A 4P9GA 3ECQA 3AM2A 1H1IA 4G3YC 3WCSA 5FMOS 4LE3A 2F4PA 1RUI3 3ZYJB 4B29A 1D4M3 1RMU1 2WQZC 5AC92 5KHKA 4QPIB 2ET7A 3WW3A 2C0ZA 4YM2A 1O5UA 1KXGA 2IXHA 1I6XA 2CAUA 4C0HA 3UJQA 1VBE2 1MS1A 3E5XA 3JBG2 3R4DB 3VKLA 1CN1A 1SMVA 3ASIA 4FXKB 2GC1A 5FQ0B 2VUAA 3VDDB 4ASMB 2WS91 1YWKA 1PO23 2Z5WA 3VZMA 1OKQA 1FPN1 2A6VA 3WDXA 4AYUA 4XF1A 3PNAA 4RHV1 1MVEA 2JG9B 3ZFGA 5SV5A 1DGWA 1Q5OA 3PVNA 2NP0A 1RUD3 4RGGA 3KT4A 2BEOA 2JG8A 2JICA 4RS5A 5HXVA 4JQRA 3RWNA 4M3CA 4BIOA 1C8NA 2W08A 4JRAA 2R041 3S0MA 3V0BA 3RQ0A 1PK6C 1JUHA 5GLWA 3ZXLA 3VBOB 5FBZA 5HCFA 5CBLA 5J7MA 3M2MA 1AR61 3MF6A 1BK1A 1RUF2 1LHNA 1ENRA 1PVC1 4E2GA 3ZXAC 2PHRA 2RHPA 4COWA 1VP6A 3BOWA 3FFQA 3TBDA 1XU2A 1QJY3 1ZNPA 4WM8C 1YFWA 1ZBE3 1REFA 1OHFA 2GNMA 2HYKA 4ISQA 4A7ZA 1NCRA 2E7AA 4WM7C 4YVWB 3HD8B 4IESA 3LWCA 1MS9A 4XZPA 1O4ZA 3PVBB 4B7KA 4BZ4A 4OHZA 2X8KA 4N43A 4R52A 1MEC2 1RMU3 2AGSA 4Y4YA 1VBD1 2DUOA 2FQPA 4Q2FA 5C9AB 3GZTB 4QPGB 4QX5A 2GMEA 1FMD2 5AFEA 4AVVA 1RUG3 1UX6A 1LEMA 3I7DA 2WL1A 2ZHNA 3B69A 1F5FA 4I0WB 4R9AA 4XBQA 4F7ZA 3O7OA 2D7FA 2IFRA 3FMGA 1Q8SA 4G9SB 5A33B 1W0OA 2WS93 4WVWA 5C6CA 1FPN3 2D40A 3MIBA 4J1XA 4NHKA 3DV8A 4RHV3 3T1MA 2DCTA 1WW7A 1W6PA 2R30A 3OF1A 3B7MA 1PO13