4BWOA

The fedf adhesin from entrrotoxigenic escherichia coli is a sulfate- binding lectin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
SAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGNKKCRFTGFEISLRIPPNAQTYPLSSGDLKGSFSLTNKEVNWSASIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F18 FIMBRIAL ADHESIN AC
publication title Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 31
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1210 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bwoA00
4B4RA 4W6XA 4B4QA 4BWOA 4B4PA 4W6WA 4W6YA
chains in the Genus database with same CATH superfamily
1OA4A 3T2TA 2BW8A 4EJRA 1UN1A 1VBE1 4XF0A 1M06G 3IIAA 5J96B 4AGRA 4Q8LA 2WNVC 3GXUA 1NXD1 1PHMA 4IGPA 3VKOA 2XKPA 5FMBA 4BU2A 5CFDB 4LUKA 5J7MA 2Q0AA 4Q0UA 5I0UA 5JDBA 2Y6FA 2W3JA 3ZYFA 5LY1A 5AVPA 3IDBB 2VOKA 2LROA 5DUVA 2ZGOA 1U5IA 2V72A 4GKYA 2JWPA 4AHZA 2WNUB 1P8JA 2ZHNA 2YMZA 3VL9A 1G9AA 2GC1A 1EUTA 4LQRA 2QQOA 3UETA 2VNVA 1RUG1 1CIYA 5FFOC 5FZ8A 3S57A 1JBCA 4CPBA 1XNCA 5FV3A 4FPOB 1LTEA 4J1WA 4MGKE 3ZXAC 3QOPA 1OSGA 5FMOL 3LSDA 1AX1A 1SZBA 4E27A 1J83A 2RDNA 4QM9A 5A3MA 5B4XA 3I4IA 5A6ZA 3CEWA 4BISA 2JD4A 3AXEA 1DYPA 1HN1A 2VZ3A 3M4FA 3NL1A 1V6LA 3SH5A 3E6CC 3A4UA 3CDZB 1H1IA 2NPIA 2RVAA 2G9FA 2P2KA 4ZY9A 2BGOA 5C3PA 1ULGA 1ULOA 2JENA 5FZ1A 2OKXA 1N3OA 3TBDA 1RC6A 2WLPA 4GMP0 2CSGA 4GJZA 4QX8A 2WUHA 4PQ9A 2O0OA 2JDKA 5D21A 1OOPB 1IS4A 1VBD2 2R1BA 4OMDA 5ACA1 5FMCA 3MV01 1RJ8A 1KJRA 1PGL1 4YSFA 1RL3A 3I2KA 4OI1A 2C5DA 1FXZA 4OHXA 1BKZA 1CZSA 1RITA 5FLIA 1GWKA 3WHTA 3ZSLA 4RYDA 3O1TA 1DLLA 4QPIB 4Q0QA 3CJIA 4UFMA 4WM8C 4DNYA 4GA9A 2VOTA 1LCLA 1GZWA 5AVAA 4RGKA 1JMUB 2Y8KA 2BJSA 5IAVA 4TTGA 1KRIA 2R071 3JB4C 5BNNA 3C7HA 5HPOA 4IV3B 3GZEA 4CCLA 1GQGA 1S0GA 5IFPA 4YZ3A 4YWAA 1BJQA 3I3EA 3ABZA 5K9YA 2QQUA 1O3QA 2YBKA 4GB32 1J3QA 3LKJA 1H4GA 2DBIA 4QHZA 5FMOS 2RS51 5GJ6A 5ABJC 5JI9A 2CGOA 3BI3A 3ZFEA 3FHIB 5DZEA 3THCA 5L7OB 1T6GC 3O1VA 1OMIA 4QX7A 4XZUG 1TME2 3JU9A 5T50A 4XJ9A 1XRUA 4M00A 2XR4A 1RUI2 3Q8BA 4RFRB 4GWIA 3LSEA 2VCCA 3UK9A 2Q8DA 4BH9A 3RZLA 1REDA 3M1HA 2UY8A 2XKOA 4D6RA 3ELNA 1ZZ9A 4XQWA 3WQ1A 5FZHA 2RG4A 2J22A 2J42A 2R041 5A7NA 3ZDSA 2VQAA 2W91A 1J1LA 2BPA2 2CGNA 1WGPA 1NE4A 3D8CA 1PO21 4AHXA 4YVWC 4IL7A 1C5HA 1WWYA 2DUQA 3VD9A 3U78A 3E6DA 3WF0A 4AW7A 3OBTA 3SEPA 2Q8CA 3ZSEA 5J37A 2PHTA 5T3NA 1VR3A 1XXNA 2H0VA 4YVSA 4AI1A 1VLNA 2QKDA 3MIEA 2CL2A 5EYXA 4KG8A 4XFAA 1R1A3 5BNOC 4AI3A 4RR3C 2VNGA 2PHRA 2QQVA 4Q4X1 4P9GA 4CP1A 3ZFFC 2ZAHA 1RUH3 3K3OA 5FP7A 2WNVA 2YYOA 3LGRA 2PLV3 4CDQB 4KWUA 3F2ZA 3OCPA 4QKFA 1VBD1 4XFFA 1XU2A 4NIIA 1VAVA 2ADEA 4L92A 1UZ0A 3OUIA 5FZOB 2B42B 3FFZA 3RDIA 4DPNA 4J25A 5A1FA 5KHJA 5B4NA 3TNQA 4YFWA 2JB4A 1PGW2 4XUNA 1KITA 4N7UA 3NJXA 2G9ZA 2VVEA 5CIRA 1XE8A 3LQCA 5EXOA 1O3RA 1UY0A 1GOHA 1IQDC 2YG0A 4PF5A 2GC0A 3MYXA 2QQKA 5IWFA 5C9AC 5CG8A 2ZX1A 3RWKX 1GNHA 3IDCB 3IMNA 4PLNA 1QJX2 2K46A 1AVBA 3CIHA 4BQXA 3PHMA 4UFLA 1PNFA 2HWB1 1DHKB 4AXOA 5F1RA 4RHV3 1GOGA 4MSVA 4HVQA 3WDTA 5CISA 2RS12 5DQ0A 1S2KA 2VOVA 3ZXLA 5I0TA 3JBG2 3VDDC 3IAPA 2VAUA 1IG0A 4K40A 1OVSA 4HLTA 2CNAA 5JSPA 3I3BA 4UW5A 4XIKA 4IEXA 4I0AA 1HRV2 5KC6A 5C8WA 1O91A 1W9TA 4XE9A 1TME1 2P3JA 2N7GA 4LA2A 4LORA 4ZZ5A 4JZRA 3GHMA 3AP9A 1RUI1 2OX0A 5LBEA 4DUVA 5FK8A 3ZYPA 1GNZA 4LKEA 1W2AX 5FWJA 3PUSA 4LIUA 4QX3A 4P02B 5K7PA 3J8F3 3M3EA 1OA2A 3U14A 2J1UA 4IE4A 1OD3A 3SCFA 3U1XA 5AC93 3OGSA 2ARAA 3C7OA 3EMRA 4XURA 1SACA 1CAVB 2XOMA 1W6MA 3C7FA 3HWJA 4NHMA 2WDBA 4LOSA 1JU4A 4BPZA 1PK6B 3DEMA 4WM8A 4X8NA 5BXXA 4WBBA 3IMMA 1GSLA 3WCRA 3U75A 2BNNA 4IXLA 1FT9A 1J3PA 3N9PA 4FPJA 2WZR2 3WG4A 5FYCA 3VHPA 1CX4A 2GNMA 3ON7A 4ZXEA 3M3IA 2Y6LA 5DAQA 3WD5A 1IHMA 1RMU1 5FYIA 4I0BA 4PT6A 1DDLA 2VXRA 2Y64A 4XDQA 5DAVA 5T54A 3VUOA 2HH9A 2VZVA 1LJ7A 1WW6A 2XJQA 2WAOA 2P34A 2XJSA 3OD0A 4IDZA 4QKNA 4R8HA 1OKQA 2AACA 2OUJA 3MIHA 4QB2A 5EQUA 2YFUA 4OHYA 1NCRC 1ASJ3 3MIBA 5JMOA 1BEV2 2VL4A 4MYEA 2XH6A 3H7JA 1W8ZA 3WY6A 1LOGA 2YV8A 2NMOA 3PIGA 2GC3A 5EJ3A 2VR4A 4LKSA 3KV5A 4S2FA 2QDNA 2R063 2EF6A 2ZGRA 5JCTA 1M4WA 1O59A 4HSJA 4HK9A 4YYOA 4R9CA 1JOJA 1QJX1 2JICA 1POV0 1AYN1 3ACIA 2UURA 2XBO2 2D43A 1YJLA 2WNUC 2FMDA 1UL9A 4YVWA 4R9BA 4XEZA 2AUYA 4DRVA 2ORZA 3G6JB 3V0AA 3MF6A 3O0WA 4LK6A 1YIPA 3HT1A 4X6QB 1KFUL 4LULA 4LO7A 2PHLA 1ACCA 4FPHA 3WNPA 1VBB2 4LLFA 3CMGA 4BMEA 2JB8A 4M3CA 1HB3A 2DTWA 2NYYA 5ANNA 4D94A 3USUA 1NOVA 2VECA 2XJRA 5LEJA 1E5SA 4COVA 3KCYA 4KWLA 2HEYF 4K1ZA 4CSWA 4HKWA 5BNOA 5HCHA 4RR3A 4RS5C 2GP5A 2IFRA 4XF9A 3ZFFA 1QXPA 5LA9A 3N36A 5CKNA 4CDWB 4WVWA 3AKRA 4Q8KA 2MEV3 3T2QA 4HANA 4Z2AA 5IYYA 1WLCA 5A3NA 2QTWB 5IVVA 3WW1A 3V65A 1SLAA 2JE8A 2WL1A 2DTYA 3FLPA 4GWNA 1RUD2 1IPKA 2JDHA 5JXJA 1AL22 2DCYA 4Q5OA 1O5LA 2B9VA 1UU6A 5K0UC 1V6JA 1XNKA 1V6MA 2E6VA 2JDNA 1QXJA 1LHNA 4HFSA 1ZYBA 4QDRA 4UYBA 4AHYA 4C91A 2DVDA 2VZOA 2RJ2A 1URXA 3ZYIB 5I0SA 5J3UA 1UZVA 4QPIC 2JKBA 1BZWA 1PM4A 3VDDA 1NAEA 3ZN6B 3I8TA 1PMIA 2WC2A 3AVRA 4N43C 5L73A 1GP4A 2ZZJA 4P9WA 4AFCA 5J09A 3N9MA 4MADA 1KXGA 3NWKA 4OVEA 4P5YA 1E5IA 1X7NA 2E9QA 3B00A 4P9IA 2FBEA 4OZOA 4G9SB 2YDEA 2WS93 2JG9B 4XQ4A 4SBVA 2WWJA 5JPNB 1XNTA 1SHWB 4NO4A 3BU7A 3OEBA 4LBNA 2DDUA 2RS32 4NVPA 1TNFA 4CU7A 2EAKA 1DG6A 2DFBA 1POV3 1GANA 3BCWA 5FR3A 5FPVA 4Q4Y1 3VDAA 1HLCA 5LCWL 2X5IB 4NMIA 5FUIA 3VKFC 2BTVC 3WP3A 1DYOA 3POYA 2WABA 4M0NA 2YU1A 1VBB1 1Y43B 4LEJA 4L0PA 3SQOA 1D7PM 4XPVA 4Q2FA 1BLZA 3OBRA 4Q26A 2MPFA 4YPJA 4COWA 3ZM8A 1XC6A 2VZSA 3KWVA 1J59A 2ZABA 5GZDA 4O65A 4PBOA 1CAUB 1DU3D 4ZU7A 2A5ZA 4AEKA 1BQPA 4GKXA 3R05A 1OPMA 2W47A 3WF2A 3VBSC 1RUF3 3B93A 2Y6JA 1K12A 5A33A 1W0PA 4Y1UA 2QQNA 3T1LA 1N1YA 2Y6KA 3O7OA 2QQIA 4B1LA 3AKQA 3OPZA 1RUD1 3NRUA 4JDNA 3J7MA 4ITCA 4NPMA 1HXS2 1OFSA 3LEKA 1IZ3A 2R30A 1J84A 2R6QA 1JXNA 3ES1A 4HN1A 3ZYBA 2VBDA 2NQYA 4TYSA 5LRRA 4LBQB 2FDJA 2HWE2 3W59A 3PU8A 5I0RA 4O9EA 2C6SA 5DDJ3 2ILMA 1RYYA 4XJWA 1QDOA 3JB8A 3D3AA 3K2OA 3WP5A 2OQ6A 1UIKA 4XC9A 2WNUA 5IUQA 3WG1A 1W6NB 4COZA 1UXXX 1QJY2 4XFIA 5FLJA 4B4PA 4K8RB 1NY71 2BVVA 1L3JA 3T4VA 3W58A 2P6CA 2VBBA 4IV1B 3T30A 4UW3A 1A8MA 2WFPA 3C8XA 3N9OA 4YNIA 1VAMA 4NOTA 3WXPA 5JOZA 5I0DA 2QZ2A 3GHNA 4OMCA 1S4CA 2JIGA 4K1YA 4Y20B 4LUMA 2WN2A 3PMSA 3NV1A 4W8JA 2Q4SA 4PIXA 3RG0A 2VCBA 4PBPA 1W6OA 5I8YA 1W8FA 3MIFA 1F31A 3RFRA 3LAGA 2HWC1 2WA3A 2ZA9A 3ZSMA 4BLIA 4HG6B 1ONAA 1CWPA 3I59B 3UGHA 4CCJA 3FJSA 3OB8A 4C90A 1JUIA 4UBHA 1UZYA 5C9AB 2W08A 1V6IA 3DXUA 1CZTA 2WLQA 3O1RA 4FBFA 5F9TA 5HBAA 2J1AA 2Q1ZB 1H8TC 4XF1A 5C71A 1CPMA 1OHFA 3FX3A 2D3PA 1VPHA 3ASIA 3PUIA 3URFA 2GNDA 4HK8A 1W3VA 5E1RA 4R4XA 4CCMA 2J1TA 1YC61 1W9YA 3MLLA 4I30A 4FFIA 3X29B 4FSJA 3MDPA 1Y9MA 5DZFA 3HEIA 4RGAA 4PIZA 2BZDA 2QNKA 5K0UA 5F5IA 1DF0A 5GLVA 4DB5A 5BNQA 3E5XA 1R091 5FO8B 2D97A 4CPBD 2WRAA 3VGIA 1RUNA 4Y5SA 1HW5A 4G3YC 1DQ5A 3TN92 4AFAA 1V6OA 1PK6C 4IEOA 4QPIA 2WFF3 3KZ4C 4YZ4A 2HYXA 4BQ1A 5LBCA 3K77A 4LO6B 1J58A 4N43A 1KFXL 1YO8A 5F6KA 3WHUA 3Q8AA 4CDXC 5CFCB 3PLQA 1LODA 2IXIA 4KI5M 4PDWB 1ULCA 1H6YA 1OLRA 1B09A 1V9U3 3AZYA 4Y24A 5DAXA 1IKPA 4MGYE 3M3QA 3WNMA 4AVAA 5HI0A 1GP5A 4MXWA 1SLCA 1WA6X 4C0HA 3JD73 4GXLA 5FUPA 4B1MA 1PO12 1HXS1 1K5MB 4Z1VA 3DYOA 1SDDB 1OVPA 4HETA 3AK0A 2WT1A 4IERA 4NHLA 4BIOA 1HX6A 1RXGA 4W6WA 2HWE1 2VUAA 2YXSA 5L7OA 4RD7A 5H9QA 2D98A 1BYHA 2A1XA 4XETA 2WINB 2EIDA 2KM2A 3V64A 5FP9A 5CADA 4EV0A 1BXHA 4F7ZA 5IJRA 3TRSB 4ZS2A 2IZWA 1PVC3 3H42B 3LPFA 4A7YA 2C9AA 2ZGKA 3A22A 1ZA7A 4NAOA 3ZKYA 4RHV1 3DCQA 1T6BX 2R16A 3ITQA 4A3ZA 3PVOA 4ES8A 2A75A 1CPNA 1NKGA 2RR13 1Y9GA 3LEGA 1R64A 1JOPA 2OPWA 2BFUL 4AVTA 4BZ4A 2V4AA 4AF9A 1LU1A 4OCTA 3FHAA 4JV4A 1GMMA 3TEZA 2WO3A 1GNYA 1G9FA 2DF7A 3VBSA 2P1BA 5F7UA 2TBVA 4OUSA 4F3JA 4BXSV 1NQDA 3BU0A 2XQRA 4HKLA 4UOJA 3U11A 3USSA 1JYXA 4FTEA 2IVJA 4RA0A 4Q4V3 4RQPC 2BV4A 2CV6A 1UQXA 2EA7A 3WQBA 3J8F1 1UW8A 3FUOA 4IEUA 3QBQA 5AC91 5JZGC 4C1XA 4N53B 1UOFA 2KD7A 2Z42A 4QQHA 1RUJ2 1VRH1 1EAH3 5IVJA 4LBJA 1ND3B 2QJVA 4AFBA 2ATFA 4QPGC 1HJFA 1SLBA 4P5HA 5D2AA 3ZXFA 5L19A 1QQP3 1QU0A 5HXMA 3LOBA 3TN91 1GQHA 2Q5TA 5FRAA 3POIA 5FZEA 2VW2A 2B39A 4NWWA 1EY2A 5FQ0B 5FBZA 5DN2A 4W6YA 1VBE2 1AR61 2WWSA 1UU4A 2W2IA 3ACGA 2A70A 1ENQA 2A6ZA 4PCRA 5DAWA 3WDXA 2VUCA 1YIFA 1UY1A 2DCZA 1S2EA 1QF3A 2VW0A 4CU8A 2FZ1A 4Y1YA 2LUWA 1NT0A 2XONA 3WUCA 4D8MA 4TZDA 1Q8VA 4AL9A 2A6XA 4YM2A 3SMHA 2E26A 1W2OA 1OF4A 1WMXA 3WQ0A 1PO11 1WKYA 4ZONA 1ASJ1 1TMF3 3BOPA 4AEDB 3ILRA 1YNAA 3T2OA 1CJDA 4L11A 4Z8BA 2GP3A 4ONUA 1ZRFA 4LPLA 5T5OA 2R061 3FZ3A 1CAXA 2VMGA 2IXLA 3OBZA 1RUG2 1UYPA 4QU2A 1BBT3 5FPUA 1YUDA 4UFJA 2DVBA 5IK7A 3S7EA 3M3CA 1FMD3 3PDQA 2OQ7A 5GLZA 2YROA 4A7KA 3DECA 2HJIA 5D1IA 4YW4A 2NM1A 2RDQA 1W6QB 4Z92B 4XCBA 4YM0A 1R083 1UYYA 1Y7BA 4DQAA 1SBDA 2OZ6A 2W92A 3ZFEC 5C3RA 3ZDVA 3TEYA 3ILNA 4MGQA 1FPN2 1PK6A 2WZEA 3ZIXA 1DQ6A 5A7SA 3DUIA 5FOJB 3HNMA 2P37A 4IE6A 1AR83 3KQRA 1MVQA 5JWPA 3N7MA 1X50A 2VCAA 4CYDA 4TLFA 3JBG3 1VBA3 4QX1A 1F15A 4EE2A 1OUXA 4COUA 3WSOA 2X53S 1SG3A 3NNJA 1UU5A 4FFHA 4AQ6A 1JTZX 5ACA2 3ACFA 4YW7A 1G9BA 2MEV1 3IZOA 1Z7S3 4I09A 1W39A 3RYKA 2CHHA 5JLVA 1YXWA 2VZUA 2IWGB 1KQRA 1O4TA 5I8SA 4CXXA 3POFA 4FPFA 2G4IA 4YVSC 5A70A 2FZ2A 1OI6A 2XVLA 4B8EA 1DZRA 1W9WA 3DPRC 2ZGSA 5F8PA 1SFYA 1G9DA 3UJQA 2JG8B 2UWBA 2WIIB 2R072 1UO9A 4W6XA 3OPWA 5CEHA 2JDMA 5FY9A 5A1LA 4BK5A 3J9SA 1Y3TA 1VMHA 3H3ZA 2Y38A 1US2A 2CYFA 1JHNA 3POEA 2AH2A 1MEC3 4WVMA 1QJU2 2RS52 4PI0A 1YFWA 3S5QA 1W90A 4R9AA 2ZGQA 2K9ZA 4UFIA 4IV1C 1IPJA 4FPKA 1W8OA 2VE1A 1ZZCA 3VBOC 4URTA 4R4ZA 3AL6A 1V6NA 3RSJA 2E53A 3NO8A 1KGYA 5FKBA 1TE1B 2VNRA 5A32B 4EZ4A 4XBLA 2PAMA 3VKMA 3HPNA 2A3YA 1F5JA 1OXCA 2WS91 4INDA 4RQPA 1V70A 4FCAA 1ZX5A 4CCOA 5B2GB 3VZLA 1RHI2 2R042 4GD4A 4AHWA 5C6CA 1JODA 5JUVA 1PO22 4XXAA 3KS7A 2FHRA 1AHSA 1SEFA 5C5UA 1POV1 5JZGA 4YZ1A 4KH9A 5EPAA 3SXWA 1K3IA 4XYXA 5A7WA 4OZXA 4QPGA 5L9BA 4CEWB 4JGZB 4MGTA 5A3OA 1CQ9A 5BUVA 1CX1A 2YU2A 4MVTA 1DQ0A 4JDOA 3AZVA 2TNFA 3M8LA 4M4PA 1FPN1 3AM2A 2MNGA 3OF1A 4JHTA 3KQ4B 1HRI3 4LBKA 5C70A 3LFMA 3O0XA 4KWJA 1V6KA 4CCNA 1SLTA 2VD7A 2OYZA 2KA3A 3BODA 4Q29A 4E4DX 4FVVA 4Q4X2 1D4VB 1WCUA 2PAEA 4EN9B 5CB7A 2RJKA 1RUF1 2Q1FA 4GAZA 2D5FA 3I97A 3BIWE 4LXLA 5J1XA 1O7FA 5FJKA 1LEMA 1NCQB 4M3CE 4XAEA 4Y1VA 2D6NA 3NKTA 1PX3A 2AYHA 2GMMA 4PDWC 2IVIB 4AI0A 1JZ3A 4MXVA 1RUC2 1WMEA 4Z2WA 3T1MA 4N8MA 4O7XA 5FY1A 4P00B 1GYKA 3GJAA 3VBRB 2AENA 2CDPA 1COV3 4NPLA 2KXLA 2WAAA 5FMDA 1IQAA 4ASMB 4C0BA 1C8M3 2HWB2 1C1LA 2BOJA 2J1SA 3PUHA 4E9KA 4OI0A 4X6RB 5JSOA 1W6PA 5K8SA 3RMXA 3ZOIA 2ENRA 4TLGA 4HPKB 1QJU1 2XJUA 1S0BA 5F32A 3IIIA 5FZ6A 2X5IA 3MZHA 4Q4W3 3AP4A 3RWNA 2WQ4A 3DGTA 4UW6A 1ZM1A 1MS9A 4AVVA 4EWDA 1X33A 3KV6A 1Q8QA 1W03A 3VHRA 5JOWA 4AQTA 2VULA 4TSVA 2FDKA 1OA3A 3JCIA 2F6BA 4XHXA 3MPPG 5CZKA 1JHJA 5KC5A 1FATA 1YQ2A 1Q3EA 2GNTA 3C2UA 5LWBA 2RDSA 1RHI1 1XE7A 2EVXA 2Z5WA 1WA4A 3KVAA 3T4HB 1JW6A 2W0XA 3VD4A 3WT3A 4OI2A 2W39A 2ZX2A 2P6HA 3D5OA 1DFQA 5A3WA 3WZ1A 1PM7A 3BALA 1WUVA 2ZAAA 3LDRA 2I45A 2LALA 1HB1A 3RZHA 3AKTA 1MS5A 3E1F1 2LRPA 1UZZA 4HSLA 5L9VA 3PJQA 1WCKA 3LF7A 1AX0A 2D3SA 1XPWA 3DPRA 4N53C 3RI8A 4BWOA 1LOFC 5EP9A 5FZ3A 4YGBA 4B3NA 2RMU1 4FPEA 1E5RA 1NA1C 1HB4A 1RMU2 3H8UA 4IEWA 1KS5A 3VHNA 5C4WC 3U07A 1EV13 4CEYB 3U37A 5FYSA 3NVCA 4GMP3 1NLSA 2OUHA 4IV1A 4AZZA 3FE5A 2ZJCA 5FPXA 2W1WA 1WCQA 3VBOA 3E97A 1BMV1 5APAA 1HQWA 3FUQA 3H3LA 3J4UH 4JKLA 2P5BA 4ATFA 1OUSA 3VDCA 5LEKA 4LBLA 3BTXA 1I3HA 1RUC1 1PZ9A 5CVRA 5FP4A 4CCKA 1OC1A 4XVHA 5FP8A 2JDYA 4CCDA 3T09A 2GNBA 5J98B 3N35A 2BUKA 2LM3A 3VLBB 4LK7A 2D44A 3J7LA 4UW4A 1UCXA 1AYN2 4MX3A 5A80A 1CVNA 4NR1A 4XDOA 5DZGA 5KHKA 1Z78A 2PELA 4ASLA 1PVC1 3GZTB 4UBGA 1SCSA 2CY6A 2AC1A 4BIFA 2ZGUA 4Y26A 1I5PA 2ZX4A 1T2XA 4N9IA 1B35B 3OPTA 2VVFA 2RR11 1W9SA 4EYUA 1FOD3 1JYIA 4PHZA 3VBFC 2GC2A 5D8AB 1D4M3 3LZZA 3UL2A 2V09A 4XFGA 3PVEA 2QDRA 2P3IA 2VTXJ 2EIEA 4NWVA 3WNOA 1NZCA 4Y1ZA 3N3HA 1AF9A 4OQ9A 3AXDA 2XXZA 1W0NA 2ZMNA 1ZBA3 2D5HA 5FCCA 2WO2A 2R1DA 4Q4V1 3BPSA 3AC0A 3O1SA 4GWJA 4AVBA 4XILA 3RJRA 4DFSA 5CFCA 4CRQA 2XL7A 4EQVA 2FMYA 4SLIA 3RGBA 2YUEA 4PDWA 4F83A 2FDHA 1J3RA 2O8OA 4KBZA 5A6QA 1H4HA 1WMDA 1EUUA 4GH4B 2BGPA 5BY5A 4DUXA 1EAH1 2VU9A 4PLOA 2Q1MA 1X36A 3MUY1 2A73B 3NAPB 2ZEWA 4MG2A 2ZEZA 1QQP1 5C8CB 5FYMA 5FLHA 3ZFGB 1GOFA 1OLMA 3PTRB 2HBUA 2X29A 2GN7A 4IGOA 1X8MA 2C26A 1HKDA 3MW4A 3OYWB 1PX4A 4BM8A 5KR7A 2VNOA 2BOIA 4B4RA 1XJAA 3FL7A 3O1UA 1AJOA 1W8UA 1FV3A 3B69A 3HR9A 5EYYA 3VBUB 3H8XA 1WCSA 3HAGA 3KCCA 2BYVE 5FY7A 1AR73 2QVSB 2G9GA 1AR93 3HVDA 2D6PA 4QQPA 1JU3A 4HOOA 2A3XA 2BP6A 2WNEA 3ACLA 4XAAA 3IT8A 3WDVA 4JGYB 4IW3A 4CP0A 1D0GA 4BMBA 3HBKA 5CA6A 4Y22A 5DG2A 1N1VA 5CFDC 1QH6A 1W8NA 1JYWA 2P4EA 2AGSA 2GH2A 4DOUA 4L99A 1O8PA 5FAXA 4I0WB 5BNPB 3RZJA 1AYM3 1RVF3 4IE7A 2A6WA 4NIAA 3LPGA 4ARYA 4UF0B 2ET7A 1NX9A 2NN8A 3PURA 4MGIE 4Q4Y2 2J1RA 3N7KA 5JPMB 2DUOA 1VBC3 3OJBA 1E57A 3MUZ1 1FMD1 3BB6A 1YI7A 5CNAA 5CYYA 1PGSA 2VVDA 4W50A 1W05A 4V2WA 2OW4A 4Y1XA 3ME2A 5I8TA 2BBAA 2PHFA 2XWBB 3J7NA 4N53A 2HWD3 3WLUA 1GR3A 1FAYA 1LOFA 1R081 1ND3A 4RN5A 1LHOA 3MFCA 4QXBA 1A78A 4LHNA 4CEWC 1NA1A 2ID4A 5LA2A 3W20A 1ULPA 1SDWA 4JVAA 2HWF3 1Q43A 5C4WA 4QHOA 4ZHNA 3AZWA 5FXWA 5FQ0A 2XJPA 3VBHB 2VMDA 3UV9A 1MS3A 1PIV3 4YARA 1E5HA 3RQ0A 2DVGA 1LHVA 1YYNA 2QBXA 3K3NA 1XNDA 3M70A 4BYYA 3JQWA 5I93A 2C0ZA 1W0OA 3MIGA 5GLWA 2VZPA 2R0HA 1XYPA 2Y33A 3H9AA 3I54A 3WF1A 1OOPC 2DVAA 4EN8B 3A21A 3EBRA 4WVZA 1FV2A 4PI2A 2RM23 3AX4A 4LOTA 1ALYA 3TNPB 4DY5A 2ZACA 3KD4A 1YWKA 1GICA 1PVXA 5SV8A 4UFKA 2EALA 2XWJB 2CGPA 4LHLA 2OA2A 3PUQA 4H3WA 3S0MA 1NY72 4LHSA 4A42A 1S0JA 2W5FA 2OVUA 3DKQA 3GYDA 1H0BA 2QQPA 2XJTA 1QJZA 4S2HA 1VE0A 2E7QA 3O1OA 1F8VA 1OQEA 1F35A 1KEXA 4IV3C 3IKWA 5G05L 1MEC1 3CU7A 4P14A 3MO4A 2WZPP 4J1XA 4TXWA 4QX0A 4LA3A 4B7KA 5CKMA 4BQYA 1W6QA 3K4ZA 2L9LA 2ZKNA 4EZHA 3VBFA 1UMZA 1QH7A 4IE0A 1H1AA 4YFZA 1ZRIA 2HWC2 1ZBE3 1GU3A 3RYRA 1FX5A 2VTFA 3T0BA 3OOXA 5FXZA 2FDGA 1F4HA 5L7OC 1TNRA 3INAA 3MBWA 3D82A 3ZXKA 4LE4A 1OLQA 3OD4A 2XPJA 5FREA 3NJZA 1UOBA 1WCDJ 3MEPA 4Q27A 1Q8OA 2C9KA 5GLTA 1YQ5A 4QMAA 3U10A 3PL0A 4P08A 4KU8A 5FY0A 2JIJA 2YBPA 4NRQA 4CP2A 3CJIB 3SITA 4AYUA 4EWEA 2PQQA 2XHKA 3MW2A 4GALA 1R092 4LBMA 4PIYA 1UOJA 3B01A 2E7AA 1RTVA 1GZWB 4A45A 4QXCA 2D6OX 2C24A 3SC7X 4QXHA 1QWRA 2Z4FA 1BVVA 2QQWA 2A71A 4ZU4A 1HRI1 3O1MA 2XB6C 4GJYA 5FZ0A 2WNOA 4XTMA 5FK7A 5KXEA 2VZQA 3K51A 1RUE3 1EP0A 1RUH2 3DV8A 1S0DA 5FYVA 1MVEA 3M2MA 2JE7A 4RSUA 3RZGA 4YGCA 3ORJA 3POGA 1UZWA 1AZDA 4CDQC 3BYWA 1OFNA 2AEYA 3SNMA 3NNLA 5HCBA 5LRSA 3ZYHA 5CFDA 3LDBA 2EAAA 2I74A 2MHFA 3FN9A 4NRPA 3WDYA 4FT8A 4FP3A 4B29A 3TB0A 1Q5OA 4EN6B 2B45X 1V0AA 2Y0IA 2UY9A 4X8PA 1SLLA 1MR5A 1NUKA 4A4AA 1COV1 1JYVA 2CU5A 2PA7A 4JTOA 1C8M1 1DLCA 1UY3A 2Y60A 3VDBA 4RHV2 2OIIA 4Z07A 1CESA 1UX6A 3EHKA 3GDBA 5F2WA 2FQPA 4AI9A 3HIFA 3OY8B 5GALA 1BK0A 1R1ZA 5T5PA 1AXYA 3ILFA 2DCJA 4H2AA 3V0BA 4ATEA 2WYSA 1NLQA 4QB6A 2UU8A 3ZYGA 2PHWA 4FOYA 4HXCA 5JAXA 4XUQA 4CEWA 4OLLA 3FC0A 4AI2A 2VZTA 1U12A 2W68A 1CZVA 1V00A 5FO7B 4JKMA 4FTSA 3ZKUA 2CWMA 1VRBA 3KF3A 3R0RA 3CHXA 1UKRA 1TEIA 5G04L 3WP6A 1C57A 1UWWA 1Y4WA 4JRLA 5LA0A 4AQSA 1G9CA 3APBA 3KVBA 3J8F2 2FDIA 1QGLA 3C7EA 3D4KA 5FPAA 4FOQA 2OPKA 4K6BA 3BN6A 5FKCA 1GP6A 1RGSA 4LO5B 4NHXA 1OOPA 5ERLA 5GZFA 5AC92 5HCAA 3P5BA 1VRH2 2VC9A 4XMIA 3CLPA 4LHKA 4XUTA 2VGDA 1LOAA 1LKNA 1ZZ7A 2YPDA 1I5ZA 3WUDA 3ZXDA 1CGPA 4WM7B 3C7GA 5F3EA 1ND2B 1UMHA 1ULDA 1MQTB 4HBNA 5FZIA 3ZPOA 1DGLA 2P17A 4LKDA 4ZS3A 2R043 1MS1A 3MHZA 3D6EA 1XSRA 1F4AA 5JR2A 1H2LA 4OULA 1JZ5A 3T0DA 3RPQA 5JOYA 1R1A1 2VMFA 2H6BA 2WQZC 3VBRA 1AR62 3UNPA 3LCPA 4AI8A 4YGDA 4IV3A 1RUH1 2ERFA 3GBFA 3LA2A 2PLV1 3SH4A 1UIJA 1YEWA 1YI9A 2I07B 2ZMKA 1PZ7A 4GMP1 4BK4A 3AYEA 4HPKA 3U4SA 3I2DA 2WZ8A 1ASJ2 1Q8SA 4D6SA 1YQCA 2ES3A 5IK5A 1ENXA 1MPXA 5FO9B 5KXCA 4MZUA 1J1TA 1HQLA 3U0ZA 3U4XA 3OBAA 1LGCA 2R062 5JMCA 3NNMA 5GZGA 3W5MA 4FFFA 3BTYA 5FBJA 4WZCA 5T5JA 3IWZA 3S7IA 4BQ5A 1VBD3 4Q1PA 3KT4A 1OBNA 3L2YA 5FYYA 1XU1A 2JJ6A 4GZ9A 1CD3G 1X9PA 5E88A 3AZZA 5F37A 5T52A 4LLOA 4WM8B 3KV4A 4V1PA 3EYPA 1UXZA 1IS3A 3ENRA 3ZYRA 4CE8A 4QT6A 1XSQA 3F95A 4FO9A 4GQ7A 4MOAA 3NJVA 2WWUA 4AEJA 3GBWA 5A3LA 2WA4A 1FOD1 3I2GA 2LS6A 3L9JT 2SLIA 4XHBA 5T5LA 3VZNA 3VZMA 1D4M1 4A6SA 5FZ4A 4QD2A 4DO0A 5ABJB 1UYXA 2E7TA 4GB33 3K4DA 4DXRA 2IXJA 2Q30A 4LIVA 4AOCA 4JHZA 2JD9A 5BV6A 2V5YA 4QGLA 3N9LA 2MEV2 1DGRA 4M01A 2DV9A 4DXSA 1ZBA1 4CDQA 4CDWC 3CKHA 1QOOA 3HD8B 5DUXA 5FJHA 4YZ5A 1K5JA 1TME3 2FD8A 4NIDA 2BRTA 5DUUA 1LOEA 1RUI3 4BDVB 5A3TA 1JH5A 1JUHA 3NW4A 3LDKA 2QQLA 2UYAA 4JC1A 4K7JA 4OUMA 4RL7A 5FZOA 5JI7A 4FAGA 4OQ8A 3VD7A 1GV9A 3AB0A 3ZN4A 2OT7A 3AVSA 1A6CA 3QLQA 5F6LB 4YVWB 5FZ7A 3J7HA 2V5DA 5CAZA 1ULEA 2ZTNA 1EYBA 5I91A 5FUNA 3V0AB 3OGJA 3DL3A 2WKKA 3R6SA 3I2OA 5L36A 5LBBA 1YFUA 3WEZA 3OGVA 5EV7A 2GMPA 1C3HA 1ODNA 4MO3M 4QDSA 3VD3A 1UPIA 5EIYB 4LBOA 3HQXA 2QQMA 3E5QA 3T0AA 3USUB 3FBYA 4XFHA 5EZWA 5BYNA 1AR91 1OURA 2BEOA 3MFAA 1DGWX 3FLTA 4Z82A 1SCRA 4NE9A 4CCEA 4NROA 1N1TA 2CAUA 4K21A 2I2SA 2UWAA 1LRHA 2FCTA 1I1EA 3ES4A 1VIWB 1CAWB 2BQPA 1A8DA 1XNBA 2WS92 2VBPA 4M4RA 2O14A 4LO8A 1LAJA 4ZKTB 2ORXA 5A1AA 1LESA 3SHRA 3ZXJA 4CUGA 1DBNA 2JG9C 1AYM1 3NKGA 1RVF1 4YW3A 4A6OA 1DQ1A 1C28A 4META 4IEYA 5KWRA 4YGEA 5JOXA 3KHCA 1WBFA 1AX2A 2PHDA 2W94A 1TQ5A 1Q56A 4MH0E 3IN9A 3ZR6A 2X5IC 1CAVA 4AR2A 5C3SA 1K45A 1LEDA 1QJX3 5IVYA 3S30A 3S6PA 3NV4A 2ZX3A 2HWD1 5LW9A 1O3SA 2VZ1A 3SLIA 3EXUA 3ATGA 5FZLA 3VDDB 5DMYA 1UY4A 4I3PA 4XFBA 3A0NA 2BVBA 4IESA 4W4ZA 2RS13 1US3A 3SKJE 3UESA 4TN7A 1UF2C 4ES9A 4A44A 3BGAA 1AJKA 4JCKA 3UGFA 4D69A 1L7LA 2HWF1 3R4UA 4S2GA 4DS0A 2BDRA 1RUF2 3UKNA 1QIQA 3PVNA 3ZVXA 1RINA 5HXVA 5E16A 1HRV3 1PIV1 3M3OA 5FXVA 3WG2A 5KXDA 3VBUA 4E8DA 1Y9QA 4EROA 4XZPA 1WLDA 2NMNA 5C7GA 3JZVA 2VY0A 3MF9A 2B5HA 4QQOA 2D6KA 3ZLIA 1QOTA 3VHOA 4JGYA 1MS0A 2HYKA 2WBKA 3AMNA 5DDJ2 1XQNA 5JXGA 4QQ2A 4JQRA 3B3QE 3KSCA 3Q8CA 4FPCA 1DGRN 1ENSA 3HN1A 1CONA 3SCHA 1RIRA 3T08A 5IHRA 2AZ5A 2YC0A 2IC1A 4KBBA 5F2SA 4QPWA 5H9SA 1HQNA 3KGLA 4YW5A 2UYBA 4UF0A 4AK3A 3CF6E 1ZRDA 1IS6A 3UKVA 2PXJA 4Y3OA 1DGWA 2BWAA 4QDQA 4QX5A 1LOCA 2BNOA 2O8QA 3BPZA 4IUGA 5F5CA 2R49A 5LA1A 5C5TA 1OLME 4G4FA 2WZR3 3QH7A 2WQ8A 3P3PA 2AREA 4IGQA 4CXYA 2EIGA 3MLJA 5A33B 1VMFA 1YJKA 2R0FA 1NCRB 1HV1A 1Z0HA 3OUHA 4QB1A 4RGGA 3WF4A 4LO4B 1JYNA 1Q8PA 1X82A 1GZCA 4NJ4A 3B7MA 4YZ2A 3EQEA 1DZTA 3OG2A 5F3IA 3VB9A 4XBQA 3ZSKA 2ZEXA 4CDWA 4UAPA 3WDWA 2ETEA 1BEV3 3VBHA 3RI9A 4DRRA 5IK4A 5FZCA 2VCMA 1MZEA 2G19A 3HQRA 1TZOA 4W65A 3WCSA 5A7PA 1YQ8A 5FZFA 2IUWA 3FHQA 3R4SA 4BCUA 4CUAA 2XBO3 1A34A 1W28A 2RMU2 4FTBA 1H9PA 4WM7C 1PMHX 1ND2C 1YFXA 3P1IA 2XUMA 4Q4Y3 1MQTC 2WFF2 4K20A 2QCSB 4O61A 5F39A 3VZOA 4AWDA 5IFTA 5HV4A 3POWA 3AP5A 3AYCA 2D40A 5F5QA 2VMHA 3FLRA 1VBB3 1W6OB 4P9XA 1RUE1 3ZN6A 3I3MA 2XLFA 3CQOA 4RS5B 1V9U2 4CUCA 1BMV2 4HT1T 2C4XA 5CFCC 1DQ4A 3KB5A 4H14A 5A3UA 5J36A 1GFF2 2GH8A 3GALA 3JD72 5A7QA 1XB9A 5F3CA 1H9WA 4LMFA 4U2AA 2BGCA 1VAKA 2JDUA 4L8QA 5FPZA 1KJLA 2TUNA 3KT7A 5LK7B 4IETA 4C8DA 3BKZA 3SEEA 4NUBA 1K5MC 5DDJ1 2FDFA 1ZNPA 3K4AA 5KHGA 3WP4A 4N90A 1AXZA 1X8EA 2JG9A 2DCTA 3B9IA 1PVC2 4CXWA 1H6XA 1WD3A 2GDFA 5K0UB 1RUD3 1K42A 1AUYA 1AL23 2VTXA 1EPWA 1U5ZA 2YC2A 3L2HA 3UJOA 4FI9A 1LNSA 1QNWA 2RJLA 4FXGB 5IAXA 2RR12 3CZJA 1SBEA 2HEWF 3OGRA 2D93A 3AJZA 1REFA 5T55A 1VB2A 4N43B 1O4YA 1W04A 4CDUB 2DUPA 5FZBA 4NAMA 2XG3A 1VALA 3E5UA 1S1AA 2ZGPA 4YM1A 3D0SA 3I3DA 4L97A 2H0BA 1CAUA 5JIAA 3ZXEA 4AGVA 2VH9A 4MXWB 1IPSA 1ZZ6A 4URAA 4B4QA 4UI9L 4FFGA 4HVOA 4Q4V2 1SPPB 1C5IA 4FQZA 3SCGA 5IVFA 2XHNA 2XUEA 4NN0A 5EHDA 4A41A 1OQ1A 2HWC3 2ZEYA 3K75B 3H0OA 5IW0A 4LNVA 1DQ2A 4CU9A 4NHYA 3WW3A 3HMYA 1EAH2 1JN2P 2JECA 4UXAA 3ZO0B 3CZUA 4DY3A 1FNZA 1YRZA 2RS33 5FIXA 2DU1A 1QQP2 1ND3C 4LBQA 4XACA 1HV0A 4LE3A 5E89A 3TEXA 5A3PA 1IGOA 1WLTA 2WFF1 4YW6A 3WNNA 1OH4A 1W6NA 2PN5A 1CN1A 2Y34A 3Q8EA 4H55A 2GU9A 1NG0A 1WMFA 3GZUC 4GWMA 3ZPYA 1HDKA 5DABA 1AL0G 3NMBA 3B9CA 1R093 2V4VA 3JUUA 1QJFA 4QWNA 3VD5A 4K9SA 3WW2A 2W52A 3G7DA 1V9U1 1W2UA 2RV9A 3OY8A 5FTTC 4BXFA 3HNYM 5IVCA 2LW8A 3VBSB 1TVGA 3JD71 4Y20A 1TMF2 4XTPA 2A3WA 2VG9A 3VV1A 5FZAA 1VB4A 3O12A 1N3QA 5KXBA 3DXTA 3ZSJA 5F3GA 1G86A 4AEDC 3I59A 4M0HA 1GKBA 2XLGA 2YGLA 5C3QA 3MPBA 1BBT2 5C9AA 2K0GA 5A7WB 5GZEA 1IS5A 4DZGA 2NP0A 5CKQA 2VUDA 3MI8A 1F5FA 2CDOA 5F5AA 1UOGA 1FMD2 1HXS3 3M7AA 2ZHLA 1LGBA 2PHXA 5EWSA 4LT5A 2YFZA 2HWE3 3LOIA 1BCXA 2E51A 2WO1A 2BERA 4YW1A 5M0TA 2QFEA 1FI2A 1MZFA 1R082 1NLRA 3AKSA 3MICA 1W8HA 2JEMA 1QJY3 4IEZA 2X8KA 2LTNA 2VZRA 1C4RA 3QACA 1ND2A 4WM7A 1BVP1 5LZ6A 1MQTA 5FPLA 2WT2A 3N9NA 1VMJA 4XF3A 1FYUA 1AR82 1LHWA 1OD5A 3MLKA 4KMQA 3JXSA 4ARXA 4U36A 1VBA2 3AFGA 3WV6A 4AFMA 4GB31 4QGMA 1JS9A 1VP6A 3HT2A 1U0AA 4QQLA 4AVSA 3RZZA 5HV0A 2VW1A 3ACHA 2XLAA 3DN7A 4OFGA 3VKNA 3SH3A 1DIWA 1Z7S2 4FOVA 4HONA 2ARCA 4K3UA 2VQ0A 5FZGA 5EJ1B 3WVJA 4A7ZA 2ZBJA 2JXAA 1CAXB 1LOBA 1H8TB 1STMA 1S55A 2XDVA 1D0HA 1K5MA 1UYZA 2YZ4A 4FP2A 2KR2A 4CCCA 5GZCA 4XUPA 4DXTA 1UX7A 2WR9A 4JAAA 2VMIA 3CBNA 1O4ZA 4NRMA 1JYCA 2W87A 5LASA 1O6UA 4FAHA 5DAPA 3FWEA 2ZCWA 1G7YA 1VRH3 1GUIA 2JG8C 3A0KA 2EIBA 3I2FA 3KT1A 4KWKA 4XJUA 3TEWA 3OSDA 5FYZA 5JR7B 1MEC2 3GZAA 3JQXA 2HEVF 3KV9A 4IEVA 4DIQA 1SMVA 1S2BA 1UMIA 3GJBA 3N7JA 4JDMA 3TN93 3AZXA 2JDPA 5IT6A 4IEQA 1O8SA 3AP7A 5JVVA 3WINE 3S5AA 1SBFA 3BTZA 1OKOA 4CDXB 1TMF1 3I2JA 4BLJA 3WNLA 1CIWA 3T3YA 1AR63 4R52A 1S0EA 3AMMA 1LU2A 4HKOA 3HJRA 3VZJA 1W9FA 5SV5A 3RS6A 1ZVFA 4ZZ8A 2B4KA 4DMIA 5EJZB 1BBT1 5ABJA 3RYPA 5CBLA 2VO5A 4KU7A 1N3PA 2C1FA 3BTAA 1EPZA 1WBLA 3HN3A 3LEMA 3POSA 4XABA 1PO13 4YG0A 4CP9B 5JXHA 3I49A 4CTEA 5AFEA 4COYA 3POBA 2Y6GA 2QE3A 4R9DA 3H8OA 3A23A 3PMEA 5LATA 1PGW1 4E8CA 1ZREA 1H8VA 2Y26A 4OHWA 3ST7A 3HQUA 2CAVA 3IPVB 1NXMA 4LITA 5LBFA 1DP0A 2YC4A 4BB3A 3J26N 2ZX0A 1LB2A 3RJ2X 2BNMA 4JGZC 3RNSA 3ALQA 2XL9A 1NYWA 4JRAA 5ISLA 3N9QA 4AFDA 1HRI2 3I3QA 2EXHA 4YM3A 3MIDA 4MHRA 1AR81 4WVMB 3KM5A 2SBAA 2RS11 2DYCA 5E8AA 1WW4A 4LR4A 4N9HA 3JBG1 1VBA1 2Q8EA 2WSUA 3R4DB 3PJYA 4AQ2A 1QNYA 1WW5A 2XVGA 2EXKA 4MV2A 2F4LA 2D3RA 1HRV1 2ZGNA 2R32A 3MGUA 5FY5A 1OPOA 1Z7S1 1ZZBA 1TG7A 4XUOA 4JX0A 2F17A 5FY4A 3V56A 3O1PA 3ETQA 3AMPA 5FYHA 1NCQC 3FBMA 3E6BA 4RQPB 1UD1A 2WN3A 4ZPIA 3WX5A 2ZHMA 1W8WA 4Q1RA 4QPYA 4AEDA 4I02A 1MS8A 4BQ2A 1H2KA 2B8MA 3IDEA 5JZGB 2FCUA 3RVHA 1CAWA 1COV2 3WNKA 3N7LA 2QZ3A 3B02A 4A2UA 2J1VA 3FFQA 5A7OA 1C8M2 4N7IA 4QPGB 3VBRC 3OTFA 5FP3A 2HKXA 1RUJ3 2Y6HA 2ZS6B 4YRDA 2QUOA 4F8AA 3DKWA 4FQ4A 4C1WA 1AXKA 2YB7A 1YLLA 1SLIA 3H1YA 3H1WA 1ULFA 2YBSA 4GULA 2ET1A 4Q4W2 2EXJA 5LY2A 3LEIA 3UT0A 1I9RA 1W3XA 3DF0A 4IEPA 4TWTA 2OXBA 1W2TA 3W21A 1ENRA 2WZR1 1F2NA 1VBE3 4I01A 4QAWA 1NE6A 4XXPA 4OI4A 4FPYA 1O3TA 1I6XA 2O1QA 5CG9A 3WNXA 4I2OA 3PNAA 4P9JA 1XYNA 3UYJA 4CDUC 4E4ZA 1QXRA 3ZMNA 2F4PA 1W8TA 3VKLA 4ZU5A 2CTVA 4NIHA 2AEZA 5FZ9A 1JZ4A 3KF5A 3ZN5A 5KHHA 5C33A 3GBGA 1BEV1 1ZA4A 1S0IA 2ARBA 4E4SA 1HN0A 5GKAC 3SKVA 2ZOEB 1HB2A 3NNFA 3W5NA 2Q8OA 2ZMLA 3NV3A 2X05A 5BNNB 1UKGA 1RUG3 4XF4A 4HVRA 1W6PB 2YHJA 2PYTA 1S0CA 1CR7A 2JKXA 2XMLA 4FPGA 1NZIA 2IFWA 3W9AA 2XBO1 2B7YA 3GCXA 1QMJA 4MHUA 1R1A2 2J7MA 5DG1A 3PUAA 2JG8A 5EFUA 3ROUA 3ZX7A 2JX9A 1BK1A 3THTA 4DEVA 3ZFEB 5IATA 1JZ8A 1JZ6A 2W46A 1C1FA 1EV12 2PLV2 4MLOA 4UFHA 2VOWA 3GNEA 3KLSA 2NLRA 5J48A 3I2IA 1FPN3 4Y4YA 1G8WA 4CEYC 3QD6A 1OH3A 3GM8A 5A6YA 2ARXA 4KG0A 4WZFA 2PTMA 4LKFA 2VJXA 4XCAA 3KMHA 1F9KA 4BJ0A 1SFNA 5FZKA 4D6QA 3BVCA 1PZ8A 2DBNA 5A32A 4XOGA 2E31A 3NV2A 3BIEA 5ACA3 4XMAA 5JIUA 1FNYA 5AFBA 4ISQA 5BPXA 3TOJA 3H7YA 4IQPA 1NCRA 2ZXQA 4DEQA 4XW3A 4QX2A 2D6LX 1G6NA 3AMQA 3IM0A 3LIHA 2ZGTA 4OUEA 4YVSB 1AL21 3AYDA 5ANQA 3DPRB 4QGNA 4UWDA 3O0VA 1RJ7A 5DUWA 1X9TA 3I7DA 4NPRA 3A7QA 4D7TA 3LWCA 4Q4W1 1ZRRA 1QEXA 3VZKA 4JGZA 4Q0PA 1QDCA 1DCSA 2R073 4FPLA 4PJYA 2CWSA 2GZWA 2GMEA 1FOD2 5CU1A 3UKTA 1B35C 2WNVB 1D4M2 3LFIA 1KS4A 2PQSA 3H50A 2A6YA 2Z2SB 2Z69A 2HBTA 5D8AC 1QJU3 2P3YA 2RS53 2XVKA 4J6GA 2W1SA 3VBOB 4D0QA 4KL1A 2YPJA 4FXKB 1ZBA2 5GM0A 2WT0A 4P9YA 5FXXA 3AP6A 4E2SA 4EN0A 2V73A 4XBNA 5IK8A 4BE3A 1NCQA 1XBFA 3GCWA 4JTNA 4RS5A 2XQXA 4D3WA 1RXFA 3POJA 2WSVA 1SFPA 3Q8FA 5HCFA 3DYPA 1H2MA 3QCWA 4KNCA 3C3VA 1RHI3 4HMZA 4GH4C 4QXKA 2RS31 4B7EA 1PO23 3OEAA 1MZ6A 3PIJA 4Y4RA 1RUOA 4XIOA 3NAPC 5IVEA 2WJSA 4AE2A 2D7FA 1ODMA 5C8CC 2QQJA 1YCIA 1UY2A 2ZHKA 3LA7A 1LENA 4MGZE 3ZFGC 5KHIA 3B5LB 3D0JA 4DINB 1EV11 1UNBA 4ZXKA 1C8NA 1AR72 2W1UA 4S2DA 1XNAA 3ZR5A 4YG3A 1AR92 1CJPA 3H3UA 4ASKA 3VBUC 1XYOA 4XQDA 4YLZA 5E6HA 4ORFA 5L9RA 2VUJA 2BU9A 2IXKA 2RMU3 4V2VA 1XOYA 4YG6A 2PAKA 3Q9OA 3PU3A 2A6VA 4Q4X3 4HL0A 5FDBA 1GBGA 1H30A 3PTYA 2W95A 1L7QA 3QH6A 4JGYC 1MZ5A 4E2GA 3NQHA 4PQQA 1W99A 4QU1A 3AJYA 4CDUA 2BWCA 1QHDA 2X10A 3AL5A 1QY4A 3MV11 2IXHA 3OUJA 1DZQA 1A3KA 2E32A 3ECQA 3RRDA 1W2NA 3NJYA 1AYM2 1IOAA 1W6MB 1RVF2 3LIGA 3NNGA 5FYUA 5FZDA 4E2QA 4A3XA 1H1MA 2FCVA 2AR6A 5BNPC 2JE9A 1LHUA 1JYTA 1VBC2 1SPPA 1VJ2A 1RUC3 4KQ7A 5C3OA 3WOGA 1GWLA 4LJHA 5GLUA 4WVVA 2B9UA 4XDPA 2BBVA 4Q0SA 1SQ4A 2GAUA 1KDKA 5FZMA 5JSRA 3B94A 3I2HA 4ISRA 2HWD2 3TAYA 4OYUA 3DYMA 3PVBB 2HWB3 4K8FA 4BQWA 1KDMA 3LB9A 1QJY1 1MACA 3UGGA 3IB3A 3BOWA 2D6MA 5LK5A 3HNBM 1GLHA 2HWF2 4L9BA 4BQ4A 2ZPXA 1U5YA 3VN4A 3WW4A 3IAQA 4Q0VA 2RDRA 2UWCA 4D7SA 3V0BB 1OT5A 1PIV2 1QKQA 4IE5A 4P9LA 4CEYA 4FOWA 4AEMA 4I3GA 4Y22B 1OF3A 3VBHC 4YW2A 3TYJA 4CZSA 4AG4A 1DYKA 2VQTA 5DPNA 2VXJA 4AAPA 4LTAA 2PHUA 4D7YA 3EB7A 2WYFA 1ZRCA 1JZ7A 4EN7B 5JXIA 4CVUA 2RM22 1XE0A 3KCXA 3GGLA 3LD8A 3EJKA 4QKBA 1QJEA 4NIGA 2E63A 3ZIWA 1D2QA 4H7MA 5A6XA 4CU6A 1ZZ8A 2XGXA 2HLEA 2Z79A 3EO6A 1L7RA 2GSYA 1GWMA 4BA6A 2P3KA 1U5XA 3HOBA 3K46A 3AYAA 3IBMA 1KD7A 1PMJX 1YFYA 3K48A 4M3CB 4Y5Z0 4LBQD 4QM8A 1AR71 4JKKA 4AVCA 1POQA 3RMYA 1BHGA 2IXCA 5BNOB 1NA1B 4RR3B 4PF1A 1YHFA 5LB6A 3ZFFB 3H1MA 5C4WB 5H9RA 1B35A 2W1QA 2ZGLA 4GIQA 1ZBE2 1LGNA 2VOXA 1RMU3 2TEPA 1N1SA 4E4HA 5FYBA 5TSWA 5FYTA 2GALA 4H7LA 4QHBA 4QKDA 5D8AA 3WR0A 2ADDA 4ET7A 4M3CF 3HBZA 4MGSA 1HIXA 3P3NA 2K2SA 2VQUA 4MUVA 2DURA 1QOSA 3ZMOA 1GZ9A 4WV8A 1O5UA 5H9PA 3GF6A 1WLWA 1YQ6A 1VBC1 2NZ9A 2GN3A 2EXIA 3WF3A 5IVBA 2E33A 4OHZA 1LECA 3O5SA 2X09A 3KHBA 3ETPA 2R7EB 2BFUS 3SISA 4DUWA 2RE9A 2WO7A 5KBFA 1RB8G 1JZ2A 4O9GA 3AFKA 5K4LA 4OHVA 3IDAA 1AYN3 3LA3A 4GH4A 1WD4A 2VPVA 3BUCA 3CJIC 3RZKA 1NQJA 1H8TA 3WDUA 1PNGA 2DVFA 3H8RA 3AMHA 1IG3A 3CO2A 2RHPA 3NAPA 3CNAA 2ZKLA 5FWEA 2B46X 4BOWA 4XJAA 3N4MA 5BNNC 5C8CA 1GQPA 3NSTA 4HZFA 4JQTA 3ZFGA 1HJGA 4RFT0 4UT5A 2DU0A 2VM9A 2Y0OA 2VMCA 3OYWA 1UPSA 1RUE2 2ZZQA 4XJZA 1GZTA 2J1EA 3VBFB 2G1MA 2PFWA 1UAIA 3WG3A 3WQ7A 3CL1A 3P6BA 2DWRA 4HN0A 4AAXA 2YY1A 1WZXA 3CJXA 5FY8A 2A7AA 3LE0A 1IKQA 1W06A 1OQDA 2DCKA 3THPA 1WW7A 1APNA 4PLMA 2RM21 4CDXA 5DXDA 3O14A 4DXZA 1N47A 1REEA 2OZJA 4Y5TA 3T2PA 2W9XA 3MW3A 1H2NA 2PMWB 5FPBA 3VL8A 3ZYJB 4BHPA 4NHKA 4BQ3A 3OGGA 5BNPA 2YGMA 4KGGA 1D2SA 4Y33A 1LULA 3RZMA 2JDAA 2VMEA 4XJ8A 1PGL2 1RUJ1 3ZXGA 4CA9A 3AKPA 4CP9A 4L2NA 2OS2A 2EICA 4AGGA 2ZGMA 3KGZA 3FMGA 4EWAA 1ST8A 2H6CA 1JOBA 2XJVA 1LR5A 4KGQA 2DFCA 4XFCA 2JDZA 3IPVA 5FOBB 3THDA 1JI6A 1ZBE1 3TWIA 1MS4A 4CUBA 1S0FA
chains in the Genus database with same CATH topology
1OA4A 3T2TA 2BW8A 4EJRA 1UN1A 1VBE1 4XF0A 1M06G 3IIAA 4AGRA 4Q8LA 2WNVC 1NXD1 1PHMA 3VKOA 2XKPA 5CFDB 4LUKA 5J7MA 2Q0AA 4Q0UA 5I0UA 5JDBA 5AVPA 3IDBB 2VOKA 5DUVA 2ZGOA 1U5IA 4GKYA 4AHZA 2WNUB 2ZHNA 2YMZA 3VL9A 1G9AA 2GC1A 1RUG1 5FFOC 1JBCA 1XNCA 4FPOB 1LTEA 4J1WA 4MGKE 3ZXAC 3QOPA 1OSGA 5FMOL 3LSDA 1AX1A 4E27A 4QM9A 5A3MA 3I4IA 3CEWA 2JD4A 3AXEA 1DYPA 3M4FA 3NL1A 1V6LA 3SH5A 3E6CC 3A4UA 1H1IA 2NPIA 2G9FA 2P2KA 1ULGA 2JENA 1N3OA 3TBDA 1RC6A 2WLPA 4GMP0 4PQ9A 2O0OA 1OOPB 1IS4A 1VBD2 2R1BA 5ACA1 1RJ8A 1KJRA 1PGL1 4YSFA 1RL3A 4OI1A 2C5DA 1FXZA 4OHXA 1BKZA 1RITA 3ZSLA 5FLIA 3WHTA 1DLLA 4QPIB 4Q0QA 3CJIA 4WM8C 4DNYA 4GA9A 1LCLA 1GZWA 5AVAA 1KRIA 2R071 3JB4C 5BNNA 4IV3B 1GQGA 1S0GA 4YZ3A 1BJQA 5K9YA 1O3QA 4GB32 1J3QA 3LKJA 1H4GA 5FMOS 2RS51 5GJ6A 5ABJC 2CGOA 3ZFEA 3FHIB 5DZEA 5L7OB 1T6GC 1OMIA 1TME2 3JU9A 5T50A 4XJ9A 1XRUA 4M00A 1RUI2 3LSEA 3UK9A 4BH9A 1REDA 3M1HA 2UY8A 2XKOA 3ELNA 1ZZ9A 4XQWA 3WQ1A 2R041 3ZDSA 2VQAA 1J1LA 2BPA2 2CGNA 1WGPA 1NE4A 3D8CA 1PO21 4AHXA 4YVWC 4IL7A 1C5HA 2DUQA 3E6DA 4AW7A 3OBTA 3ZSEA 5J37A 2PHTA 5T3NA 1VR3A 1XXNA 2H0VA 4YVSA 4AI1A 1VLNA 2QKDA 3MIEA 2CL2A 5EYXA 4KG8A 4XFAA 1R1A3 5BNOC 4AI3A 4RR3C 2VNGA 2PHRA 4Q4X1 4P9GA 4CP1A 3ZFFC 2ZAHA 1RUH3 4CDQB 2WNVA 2YYOA 3LGRA 2PLV3 3OCPA 1VBD1 4XFFA 1XU2A 1VAVA 4L92A 5KHJA 2B42B 3FFZA 3RDIA 4DPNA 3TNQA 4YFWA 1PGW2 1KITA 4N7UA 2VVEA 5CIRA 1O3RA 1XE8A 5EXOA 4PF5A 5CG8A 2GC0A 3MYXA 2ZX1A 1GNHA 3IDCB 3IMNA 4PLNA 1QJX2 1AVBA 3PHMA 1PNFA 2HWB1 1DHKB 4AXOA 5F1RA 4RHV3 4MSVA 4HVQA 3WDTA 2RS12 3ZXLA 1S2KA 2VOVA 5I0TA 3JBG2 3VDDC 4K40A 4HLTA 2CNAA 5JSPA 4UW5A 4XIKA 4IEXA 4I0AA 1HRV2 5KC6A 5C8WA 1O91A 4XE9A 1TME1 2P3JA 2N7GA 4LA2A 3GHMA 3AP9A 1RUI1 3ZYPA 1GNZA 5K7PA 3J8F3 3M3EA 1OA2A 3SCFA 5AC93 1SACA 1CAVB 1W6MA 3HWJA 4NHMA 4BPZA 1PK6B 4X8NA 4WM8A 5BXXA 4WBBA 1GSLA 3WCRA 2BNNA 4IXLA 1FT9A 1J3PA 4FPJA 2WZR2 3WG4A 3VHPA 1CX4A 2GNMA 3M3IA 3WD5A 1IHMA 1RMU1 4I0BA 1DDLA 2VXRA 4XDQA 5T54A 3VUOA 2XJQA 3OD0A 1LJ7A 1WW6A 2XJSA 2P34A 4R8HA 1OKQA 2OUJA 3MIHA 4OHYA 1NCRC 1ASJ3 3MIBA 1BEV2 4MYEA 2XH6A 3H7JA 3WY6A 2YV8A 1LOGA 2NMOA 2GC3A 5EJ3A 4S2FA 2QDNA 2R063 2EF6A 2ZGRA 5JCTA 1M4WA 4HSJA 4HK9A 4YYOA 4R9CA 1JOJA 1QJX1 2JICA 1POV0 1AYN1 2UURA 2XBO2 2D43A 1YJLA 2WNUC 2FMDA 1UL9A 4YVWA 4R9BA 4XEZA 2AUYA 4DRVA 3G6JB 3V0AA 3MF6A 3O0WA 1YIPA 3HT1A 4X6QB 1KFUL 4LULA 4LO7A 2PHLA 4FPHA 1VBB2 4LLFA 4BMEA 4M3CA 2DTWA 2NYYA 4D94A 3USUA 1NOVA 2VECA 2XJRA 5LEJA 4COVA 3KCYA 4KWLA 2HEYF 4K1ZA 4HKWA 5BNOA 4RR3A 4RS5C 2IFRA 4XF9A 3ZFFA 1QXPA 3N36A 4CDWB 4WVWA 3AKRA 4Q8KA 2MEV3 4HANA 1WLCA 3WW1A 3V65A 1SLAA 2WL1A 2DTYA 3FLPA 4GWNA 1RUD2 1IPKA 1AL22 2DCYA 1O5LA 1UU6A 5K0UC 1V6JA 1XNKA 1V6MA 2E6VA 1QXJA 1LHNA 4HFSA 1ZYBA 4C91A 4AHYA 2DVDA 1URXA 3ZYIB 5I0SA 5J3UA 4QPIC 2JKBA 1BZWA 3VDDA 3ZN6B 3I8TA 1PMIA 2WC2A 4N43C 5L73A 2ZZJA 4P9WA 4AFCA 5J09A 1KXGA 3NWKA 4OVEA 1X7NA 2E9QA 3B00A 4P9IA 2FBEA 4G9SB 2YDEA 2WS93 2JG9B 4XQ4A 4SBVA 5JPNB 4NO4A 3BU7A 4LBNA 2RS32 4NVPA 1TNFA 2EAKA 1DG6A 2DFBA 1POV3 1GANA 3BCWA 4Q4Y1 1HLCA 2X5IB 3VKFC 2BTVC 3WP3A 3POYA 4M0NA 4LEJA 1VBB1 1Y43B 4XPVA 4Q2FA 3OBRA 4Q26A 2MPFA 4COWA 1J59A 2ZABA 5GZDA 4PBOA 1CAUB 1DU3D 4ZU7A 2A5ZA 4AEKA 1BQPA 4GKXA 3R05A 1OPMA 3VBSC 1RUF3 3B93A 5A33A 1W0PA 4Y1UA 3T1LA 1N1YA 3O7OA 3AKQA 3OPZA 1RUD1 4JDNA 4ITCA 1HXS2 1OFSA 1IZ3A 2R30A 2R6QA 3ES1A 1JXNA 4HN1A 5JI9A 4TYSA 2NQYA 3W59A 5LRRA 4LBQB 2HWE2 5I0RA 4O9EA 5DDJ3 2ILMA 4XJWA 1QDOA 3JB8A 3WP5A 1UIKA 2WNUA 5IUQA 3WG1A 1W6NB 4COZA 4XFIA 1QJY2 5FLJA 4B4PA 1NY71 2BVVA 1L3JA 3W58A 4IV1B 4UW3A 1A8MA 2WFPA 4YNIA 1VAMA 4NOTA 3WXPA 5JOZA 2QZ2A 3GHNA 4K1YA 4Y20B 4LUMA 3RG0A 3PMSA 3NV1A 2Q4SA 4PIXA 4PBPA 1W6OA 5I8YA 3MIFA 1F31A 3LAGA 2HWC1 2WA3A 2ZA9A 3ZSMA 4BLIA 1ONAA 3I59B 4C90A 3FJSA 1JUIA 4UBHA 1UZYA 5C9AB 2W08A 1V6IA 2WLQA 4FBFA 5F9TA 5HBAA 2Q1ZB 1H8TC 4XF1A 1CPMA 1OHFA 3FX3A 2D3PA 3ASIA 3URFA 2GNDA 4HK8A 5E1RA 4R4XA 3MLLA 4I30A 3X29B 4FSJA 3MDPA 5DZFA 4RGAA 4PIZA 5K0UA 2QNKA 5BNQA 5GLVA 1DF0A 4DB5A 3E5XA 1R091 5FO8B 2D97A 3VGIA 1RUNA 1HW5A 4G3YC 1DQ5A 3TN92 4AFAA 1V6OA 1PK6C 4IEOA 4QPIA 2WFF3 3KZ4C 4YZ4A 4BQ1A 4LO6B 1J58A 4N43A 1KFXL 1YO8A 5F6KA 3WHUA 4CDXC 5CFCB 3PLQA 1LODA 2IXIA 4PDWB 1ULCA 1OLRA 1B09A 1V9U3 3AZYA 4Y24A 1IKPA 4MGYE 3M3QA 4AVAA 5HI0A 4MXWA 1SLCA 4C0HA 3JD73 4GXLA 1PO12 1HXS1 1K5MB 4Z1VA 4BIOA 4HETA 3AK0A 2WT1A 4IERA 4NHLA 1HX6A 4W6WA 2HWE1 2VUAA 2YXSA 5L7OA 4RD7A 5H9QA 2D98A 1BYHA 4XETA 2WINB 2KM2A 3V64A 5CADA 4EV0A 1BXHA 4F7ZA 3TRSB 2IZWA 1PVC3 4A7YA 2C9AA 2ZGKA 4RHV1 2R16A 3PVOA 4ES8A 2A75A 1CPNA 2RR13 2BFUL 4AVTA 4BZ4A 4AF9A 1LU1A 4JV4A 1G9FA 2DF7A 3VBSA 5L19A 2TBVA 4OUSA 4F3JA 1NQDA 4HKLA 3U11A 3USSA 4FTEA 4RA0A 4Q4V3 4RQPC 2EA7A 2CV6A 3J8F1 1UW8A 3FUOA 4IEUA 3QBQA 5AC91 5JZGC 4C1XA 4N53B 2Z42A 4QQHA 1RUJ2 1VRH1 1EAH3 4LBJA 1ND3B 2QJVA 4AFBA 2ATFA 4QPGC 1SLBA 4P5HA 3ZXFA 1QQP3 1QU0A 3LOBA 3TN91 1GQHA 2Q5TA 5FRAA 2VW2A 2B39A 4NWWA 1EY2A 5FQ0B 5FBZA 4W6YA 1VBE2 1AR61 2WWSA 1UU4A 2A70A 1ENQA 2A6ZA 4PCRA 1YIFA 2DCZA 1QF3A 2VW0A 2FZ1A 4Y1YA 2LUWA 3WUCA 4TZDA 1Q8VA 2A6XA 4YM2A 3SMHA 3WQ0A 1PO11 1ASJ1 1TMF3 3BOPA 4AEDB 3ILRA 1YNAA 1ZRFA 1CJDA 4L11A 4Z8BA 4ONUA 5T5OA 2R061 3FZ3A 1CAXA 2VMGA 2IXLA 1RUG2 4QU2A 1BBT3 1YUDA 2DVBA 5IK7A 3S7EA 3M3CA 1FMD3 5GLZA 2YROA 4A7KA 2HJIA 5D1IA 4YW4A 2NM1A 1W6QB 4Z92B 4YM0A 1R083 1Y7BA 4DQAA 1SBDA 2OZ6A 3ZFEC 3ILNA 1FPN2 1PK6A 3ZIXA 1DQ6A 3DUIA 5FOJB 2P37A 1AR83 3KQRA 1MVQA 5JWPA 3N7MA 1X50A 4CYDA 4TLFA 3JBG3 1VBA3 4COUA 2X53S 1UU5A 4AQ6A 1JTZX 5ACA2 1G9BA 2MEV1 1Z7S3 4I09A 1W39A 3RYKA 5JLVA 1YXWA 2IWGB 1KQRA 1O4TA 5I8SA 4FPFA 2G4IA 4YVSC 2FZ2A 1OI6A 2XVLA 4B8EA 1DZRA 3DPRC 2ZGSA 1G9DA 1SFYA 3UJQA 2JG8B 2UWBA 2WIIB 2R072 4W6XA 3J9SA 1Y3TA 3H3ZA 2Y38A 2CYFA 1JHNA 2AH2A 1MEC3 4WVMA 1QJU2 2RS52 1YFWA 4R9AA 2ZGQA 2K9ZA 4IV1C 1IPJA 4FPKA 1ZZCA 3VBOC 4URTA 4R4ZA 1V6NA 3RSJA 2E53A 3NO8A 1TE1B 2VNRA 5A32B 4XBLA 2PAMA 3VKMA 2A3YA 1F5JA 2WS91 4INDA 4RQPA 1V70A 4FCAA 1ZX5A 5B2GB 3VZLA 1RHI2 2R042 4AHWA 5C6CA 1PO22 4XXAA 3KS7A 2FHRA 1AHSA 1SEFA 5JZGA 1POV1 4YZ1A 4KH9A 3SXWA 4XYXA 4OZXA 4QPGA 4CEWB 4JGZB 5BUVA 1CQ9A 4MVTA 1DQ0A 4JDOA 3AZVA 2TNFA 3M8LA 1FPN1 3AM2A 2MNGA 3OF1A 1HRI3 4LBKA 3O0XA 4KWJA 1V6KA 1SLTA 2OYZA 2KA3A 3BODA 4Q29A 4E4DX 4FVVA 4Q4X2 1D4VB 2PAEA 4EN9B 5CB7A 2RJKA 1RUF1 2D5FA 3BIWE 1O7FA 1LEMA 1NCQB 4M3CE 4Y1VA 2D6NA 3NKTA 2AYHA 2GMMA 4PDWC 4AI0A 4MXVA 1RUC2 1WMEA 4Z2WA 3T1MA 1GYKA 3VBRB 2AENA 1COV3 2KXLA 1IQAA 4ASMB 4C0BA 1C8M3 2HWB2 1C1LA 4E9KA 4OI0A 4X6RB 5JSOA 1W6PA 5K8SA 3RMXA 2ENRA 4HPKB 2XJUA 1QJU1 1S0BA 2X5IA 3MZHA 4Q4W3 3AP4A 3RWNA 2WQ4A 3DGTA 4UW6A 1ZM1A 1MS9A 4AVVA 4EWDA 1X33A 1Q8QA 3VHRA 5JOWA 4AQTA 2VULA 4TSVA 1OA3A 3JCIA 2F6BA 4XHXA 3MPPG 5KC5A 1FATA 2GNTA 1Q3EA 3C2UA 1RHI1 1XE7A 2EVXA 2Z5WA 1WA4A 1JW6A 2W0XA 3WT3A 4OI2A 2W39A 2ZX2A 3D5OA 1DFQA 3WZ1A 1PM7A 3BALA 1WUVA 2ZAAA 2I45A 2LALA 3AKTA 1MS5A 1UZZA 4HSLA 3PJQA 1WCKA 1AX0A 2D3SA 3DPRA 4N53C 3RI8A 4BWOA 1LOFC 4YGBA 4B3NA 2RMU1 4FPEA 1NA1C 1RMU2 3H8UA 4IEWA 1KS5A 3VHNA 5C4WC 3U07A 1EV13 4CEYB 3NVCA 4GMP3 1NLSA 2OUHA 4IV1A 3FE5A 2ZJCA 5FPXA 3VBOA 3E97A 1BMV1 1HQWA 3FUQA 3J4UH 4ATFA 5LEKA 4LBLA 1I3HA 1RUC1 1PZ9A 5CVRA 2GNBA 5J98B 3N35A 2BUKA 2LM3A 3VLBB 2D44A 4UW4A 1UCXA 1AYN2 4MX3A 1CVNA 4NR1A 5DZGA 5KHKA 1Z78A 2PELA 4ASLA 1PVC1 3GZTB 4UBGA 1SCSA 2CY6A 4BIFA 2ZGUA 4Y26A 2ZX4A 4N9IA 1B35B 2VVFA 2RR11 1FOD3 1JYIA 3VBFC 2GC2A 5D8AB 1D4M3 3LZZA 3UL2A 2V09A 4XFGA 3PVEA 2QDRA 2P3IA 4NWVA 1NZCA 4Y1ZA 3N3HA 1AF9A 3AXDA 2ZMNA 1ZBA3 2D5HA 5FCCA 4Q4V1 2R1DA 4AVBA 4XILA 3RJRA 4DFSA 5CFCA 4CRQA 2XL7A 2FMYA 4SLIA 2YUEA 4PDWA 4F83A 1J3RA 2O8OA 1H4HA 1WMDA 4GH4B 5BY5A 1EAH1 2VU9A 4PLOA 2Q1MA 1X36A 2A73B 3NAPB 1QQP1 5C8CB 5FLHA 3ZFGB 4NPRA 5LRSA 2X29A 2GN7A 1X8MA 1HKDA 3MW4A 3OYWB 4BM8A 2VNOA 4B4RA 1AJOA 3B69A 1FV3A 3HR9A 3VBUB 5EYYA 1WCSA 3HAGA 3KCCA 2BYVE 2QVSB 1AR73 2G9GA 1AR93 2D6PA 4QQPA 2A3XA 2WNEA 3WDVA 3ACLA 3V0BA 3IT8A 4CP0A 4JGYB 1D0GA 4BMBA 5CA6A 4Y22A 5DG2A 1N1VA 5CFDC 1QH6A 2AGSA 2GH2A 4DOUA 4L99A 5FAXA 4I0WB 5BNPB 1AYM3 1RVF3 2A6WA 2ET7A 4MGIE 2NN8A 5JPMB 4Q4Y2 3N7KA 2DUOA 1VBC3 3OJBA 1E57A 1FMD1 3BB6A 1YI7A 5CNAA 1PGSA 2VVDA 5I8TA 2OW4A 4Y1XA 3ME2A 2PHFA 2XWBB 4N53A 2HWD3 3WLUA 1GR3A 1FAYA 1LOFA 1R081 1ND3A 1LHOA 3MFCA 1A78A 4LHNA 4CEWC 1NA1A 1SDWA 4JVAA 2HWF3 1Q43A 5C4WA 3AZWA 5FQ0A 2XJPA 3VBHB 3UV9A 1MS3A 1PIV3 4YARA 3RQ0A 2DVGA 1LHVA 1YYNA 3M70A 4BYYA 1XNDA 3JQWA 5I93A 2C0ZA 1W0OA 3MIGA 5GLWA 2R0HA 1XYPA 3H9AA 3I54A 1OOPC 2DVAA 4EN8B 3EBRA 4WVZA 1FV2A 2RM23 3AX4A 1ALYA 3TNPB 4DY5A 2ZACA 3KD4A 1YWKA 1GICA 1PVXA 5SV8A 2EALA 2XWJB 2CGPA 4LHLA 2OA2A 4H3WA 3S0MA 1NY72 1S0JA 2OVUA 3GYDA 1H0BA 2QQPA 2XJTA 1QJZA 4S2HA 2E7QA 1F8VA 1OQEA 4IV3C 3IKWA 1MEC1 3CU7A 4P14A 2WZPP 4J1XA 4LA3A 4B7KA 1W6QA 2ZKNA 3VBFA 1UMZA 1QH7A 4YFZA 1H1AA 2HWC2 1ZBE3 3RYRA 1FX5A 5L7OC 1TNRA 3INAA 3D82A 3ZXKA 4LE4A 1OLQA 3OD4A 2XPJA 5FREA 3NJZA 1WCDJ 3MEPA 4Q27A 1Q8OA 5GLTA 4QMAA 3U10A 4KU8A 4CP2A 3CJIB 3SITA 4AYUA 4EWEA 2PQQA 2XHKA 3MW2A 4GALA 1R092 4LBMA 4PIYA 3B01A 2E7AA 1RTVA 1GZWB 2D6OX 1QWRA 1BVVA 2A71A 4ZU4A 1HRI1 2XB6C 4XTMA 5KXEA 3K51A 1RUE3 1EP0A 1RUH2 3DV8A 1S0DA 1MVEA 3M2MA 2JE7A 4RSUA 4YGCA 1AZDA 4CDQC 3SNMA 1OFNA 5HCBA 5CFDA 2EAAA 2I74A 2MHFA 3WDYA 4FT8A 4FP3A 4B29A 3TB0A 1Q5OA 4EN6B 2B45X 2Y0IA 2UY9A 4X8PA 1SLLA 1MR5A 1COV1 2PA7A 4JTOA 1C8M1 4RHV2 2OIIA 4Z07A 1CESA 1UX6A 3EHKA 2FQPA 3HIFA 3OY8B 5GALA 1R1ZA 5T5PA 1AXYA 3ILFA 2DCJA 4ATEA 2UU8A 3ZYGA 2PHWA 4FOYA 5JAXA 4CEWA 4OLLA 3FC0A 4AI2A 1U12A 2W68A 1V00A 5FO7B 4FTSA 2CWMA 3R0RA 1UKRA 1TEIA 3WP6A 1C57A 4JRLA 4AQSA 1G9CA 3APBA 3J8F2 1QGLA 3D4KA 4FOQA 2OPKA 4K6BA 4LO5B 1RGSA 5GZFA 5AC92 1OOPA 5HCAA 1VRH2 4XMIA 3CLPA 4LHKA 2VGDA 1LOAA 1LKNA 1ZZ7A 3WUDA 1I5ZA 3ZXDA 1CGPA 4WM7B 1ND2B 1ULDA 1MQTB 4HBNA 1DGLA 2P17A 2R043 1MS1A 3D6EA 1H2LA 4OULA 3RPQA 5JOYA 1R1A1 2WQZC 2H6BA 3VBRA 1AR62 3LCPA 4AI8A 4YGDA 4IV3A 1RUH1 2ERFA 3GBFA 3LA2A 2PLV1 3SH4A 1UIJA 1YI9A 2I07B 2ZMKA 1PZ7A 4GMP1 3AYEA 4HPKA 3I2DA 1ASJ2 1Q8SA 2ES3A 5IK5A 1ENXA 5FO9B 5KXCA 4MZUA 1J1TA 1HQLA 3U0ZA 3U4XA 1LGCA 2R062 5JMCA 5GZGA 5T5JA 4WZCA 3S7IA 3IWZA 1VBD3 4Q1PA 3KT4A 3L2YA 1XU1A 2JJ6A 1CD3G 5E88A 3AZZA 5T52A 4LLOA 4WM8B 4V1PA 1IS3A 3ENRA 3ZYRA 4QT6A 4GQ7A 4FO9A 4AEJA 3GBWA 5A3LA 2WA4A 1FOD1 3L9JT 4XHBA 5T5LA 2SLIA 3VZNA 1D4M1 5ABJB 4QD2A 2E7TA 4GB33 2IXJA 2Q30A 5BV6A 2V5YA 4QGLA 2MEV2 1DGRA 4M01A 2DV9A 1ZBA1 4CDQA 4CDWC 1QOOA 3HD8B 5DUXA 4YZ5A 1TME3 5DUUA 1LOEA 1RUI3 1JH5A 1JUHA 3NW4A 4JC1A 4K7JA 2UYAA 4OUMA 4RL7A 5JI7A 4FAGA 1GV9A 3AB0A 3ZN4A 1A6CA 3QLQA 5F6LB 4YVWB 5CAZA 1ULEA 2ZTNA 1EYBA 5I91A 3V0AB 3OGJA 3DL3A 2WKKA 3R6SA 5L36A 1YFUA 5EV7A 2GMPA 1C3HA 1UPIA 4LBOA 3HQXA 3E5QA 3USUB 3FBYA 4XFHA 5EZWA 5BYNA 1AR91 2BEOA 3MFAA 1DGWX 3FLTA 4Z82A 1SCRA 1N1TA 2CAUA 4K21A 2I2SA 2UWAA 1LRHA 1I1EA 3ES4A 1VIWB 1CAWB 2BQPA 1A8DA 1XNBA 2WS92 4LO8A 4ZKTB 1LESA 3SHRA 3ZXJA 1DBNA 2JG9C 1AYM1 3NKGA 1RVF1 4YW3A 1DQ1A 1C28A 4META 4IEYA 5KWRA 4YGEA 5JOXA 1WBFA 1AX2A 2PHDA 1TQ5A 1Q56A 4MH0E 3IN9A 2X5IC 1CAVA 1LEDA 1QJX3 3S30A 3S6PA 3NV4A 2ZX3A 2HWD1 1O3SA 3SLIA 3EXUA 3ATGA 3VDDB 4I3PA 4XFBA 3A0NA 2BVBA 4IESA 4ES9A 2RS13 1UF2C 1AJKA 4JCKA 4D69A 2HWF1 3R4UA 4S2GA 4DS0A 1RUF2 3UKNA 3PVNA 3ZVXA 1RINA 5HXVA 5E16A 1HRV3 1PIV1 3M3OA 3WG2A 5KXDA 3VBUA 1Y9QA 4EROA 4XZPA 1WLDA 2NMNA 3JZVA 2VY0A 3MF9A 2B5HA 4QQOA 2D6KA 1QOTA 3VHOA 4JGYA 1MS0A 2HYKA 3AMNA 5DDJ2 1XQNA 4QQ2A 4JQRA 3B3QE 3KSCA 4FPCA 1DGRN 1ENSA 3HN1A 1CONA 3SCHA 1RIRA 2AZ5A 2YC0A 2IC1A 4KBBA 5H9SA 1HQNA 3KGLA 4YW5A 2UYBA 4AK3A 3CF6E 1ZRDA 1IS6A 3UKVA 1DGWA 2BWAA 4QX5A 1LOCA 2BNOA 2O8QA 3BPZA 2R49A 4G4FA 2WZR3 3QH7A 3P3PA 2AREA 2EIGA 3MLJA 5A33B 1YJKA 2R0FA 1NCRB 1HV1A 1Z0HA 4RGGA 4LO4B 1Q8PA 1X82A 1GZCA 3B7MA 4YZ2A 3EQEA 1DZTA 4CDWA 5C9AC 4XBQA 3ZSKA 5KHIA 3WDWA 2ETEA 1BEV3 3VBHA 3RI9A 4DRRA 5IK4A 1MZEA 4W65A 3WCSA 3R4SA 4BCUA 2XBO3 4FTBA 2RMU2 1H9PA 4WM7C 1ND2C 1YFXA 4Q4Y3 2XUMA 1MQTC 2WFF2 4K20A 2QCSB 3VZOA 4AWDA 3POWA 3AP5A 3AYCA 2D40A 5F5QA 2VMHA 3FLRA 1VBB3 1W6OB 4P9XA 1RUE1 3ZN6A 2XLFA 4RS5B 1V9U2 1BMV2 4HT1T 5CFCC 1DQ4A 3KB5A 4H14A 5J36A 1GFF2 2GH8A 3GALA 3JD72 1H9WA 4U2AA 2BGCA 1VAKA 4L8QA 5FPZA 1KJLA 2TUNA 3KT7A 5LK7B 4IETA 1K5MC 5DDJ1 1ZNPA 5KHGA 3WP4A 4N90A 1AXZA 1X8EA 2JG9A 2DCTA 3B9IA 1PVC2 2GDFA 1WD3A 5K0UB 1RUD3 1AUYA 1AL23 1EPWA 1U5ZA 3L2HA 3UJOA 1QNWA 2RJLA 4FXGB 2RR12 1SBEA 2HEWF 2D93A 3AJZA 1REFA 5T55A 1VB2A 4N43B 1O4YA 4CDUB 2DUPA 2XG3A 1VALA 3E5UA 1S1AA 2ZGPA 4YM1A 3D0SA 4L97A 2H0BA 1CAUA 5JIAA 3ZXEA 4AGVA 2VH9A 4MXWB 1ZZ6A 4B4QA 4HVOA 4Q4V2 1C5IA 4FQZA 3SCGA 4NN0A 1OQ1A 2HWC3 3H0OA 4LNVA 1DQ2A 3WW3A 3HMYA 1EAH2 1JN2P 2JECA 4UXAA 3ZO0B 4DY3A 1FNZA 1YRZA 2RS33 2DU1A 1QQP2 1ND3C 4LBQA 1HV0A 4LE3A 5E89A 1IGOA 1WLTA 2WFF1 1W6NA 2PN5A 1CN1A 4H55A 2GU9A 1NG0A 1WMFA 3GZUC 4GWMA 3ZPYA 1HDKA 1AL0G 3B9CA 1R093 3JUUA 3WW2A 4K9SA 2W52A 3G7DA 1V9U1 1W2UA 3OY8A 5FTTC 3VBSB 3JD71 4Y20A 1TMF2 4XTPA 2A3WA 2VG9A 3VV1A 1VB4A 3O12A 1N3QA 5KXBA 3ZSJA 1G86A 4AEDC 3I59A 4M0HA 1GKBA 2XLGA 2YGLA 3MPBA 1BBT2 5C9AA 2K0GA 5GZEA 1IS5A 4DZGA 2NP0A 3MI8A 1F5FA 1FMD2 1HXS3 3M7AA 2ZHLA 1LGBA 2PHXA 5EWSA 4LT5A 3LOIA 2HWE3 1BCXA 2E51A 4YW1A 2QFEA 1FI2A 1MZFA 1R082 1NLRA 3AKSA 3MICA 2JEMA 1QJY3 4IEZA 2X8KA 2LTNA 3QACA 1C4RA 4WM7A 1ND2A 1BVP1 1MQTA 2WT2A 4XF3A 1FYUA 1AR82 1LHWA 1OD5A 3MLKA 4U36A 1VBA2 3AFGA 3WV6A 4AFMA 4GB31 4QGMA 1VP6A 3HT2A 4QQLA 1U0AA 4AVSA 3RZZA 2VW1A 2XLAA 3DN7A 4OFGA 3VKNA 3SH3A 1DIWA 1Z7S2 4FOVA 4K3UA 2VQ0A 4A7ZA 3WVJA 2ZBJA 2JXAA 1CAXB 1LOBA 1H8TB 1S55A 1D0HA 1K5MA 2YZ4A 4FP2A 5GZCA 4JAAA 2VMIA 1O4ZA 1JYCA 4FAHA 3FWEA 2ZCWA 1G7YA 1VRH3 4XJUA 2JG8C 3A0KA 3KT1A 4KWKA 5JR7B 1MEC2 3GZAA 3JQXA 2HEVF 4IEVA 1SMVA 1S2BA 3N7JA 4JDMA 3TN93 3AZXA 5IT6A 4IEQA 3AP7A 3WINE 5JVVA 1SBFA 4CDXB 1TMF1 4BLJA 1CIWA 1AR63 4R52A 1S0EA 3AMMA 1LU2A 4HKOA 3VZJA 5SV5A 3RS6A 1ZVFA 4DMIA 1BBT1 5ABJA 3RYPA 5CBLA 4KU7A 1N3PA