4BWOA

The fedf adhesin from entrrotoxigenic escherichia coli is a sulfate- binding lectin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
SAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGNKKCRFTGFEISLRIPPNAQTYPLSSGDLKGSFSLTNKEVNWSASIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F18 FIMBRIAL ADHESIN AC
publication title Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 31
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1210 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bwoA00
4W6XA 4BWOA 4W6YA 4B4QA 4B4PA 4W6WA 4B4RA
chains in the Genus database with same CATH superfamily
5HV4A 3WF3A 2VCMA 5T5PA 1RHI3 3LSEA 4BM8A 2GN3A 1VPHA 2RS32 5A3UA 2VUJA 4I2OA 3NMBA 5I93A 2MEV3 3VBSA 1PGSA 3WNKA 1ND2C 4QT6A 1RUC2 1IS6A 2DTWA 4NVPA 1QOSA 4QQHA 4XE9A 3WG1A 3WQBA 4EYUA 1F31A 2F4PA 2ORZA 2QJVA 2GSYA 4GB31 1QWRA 1SFYA 1QXJA 2H0BA 1S0DA 2BGCA 5L7OB 4IEZA 5LRSA 2DBNA 4XBQA 4N8MA 4XURA 4PCRA 5AFEA 3MW4A 2EIBA 2HBTA 2XOMA 4Y5TA 1CWPA 1OBNA 2R061 3BIWE 5CU1A 1RUNA 1JYVA 4D7YA 3UJOA 2HWD2 4YVWB 4Z07A 3MHZA 5FZ8A 2VZUA 1ZBE2 1Q8PA 4RHV1 3K46A 3S7EA 3BCWA 3AVSA 3WD5A 4Q4W2 3Q8CA 5E89A 3FHIB 3AP7A 2WDBA 3M3OA 4N43B 3EO6A 1D7PM 1QJY3 2LTNA 2RR13 1H8VA 4GD4A 3QD6A 1UNBA 1ZZCA 4LJHA 4LUMA 1FAYA 5CBLA 5BV6A 4AI0A 4XUPA 1SBFA 3WUDA 1XYOA 3DCQA 3S57A 5T52A 3KGZA 2VU9A 3HAGA 5DUUA 4QX2A 1Y43B 1ST8A 1W6MB 3KV9A 3ZXGA 1PK6B 2YU1A 3AL5A 1SCSA 5KXDA 3AB0A 4LLFA 1MVQA 5K0UB 2RS33 5J36A 5K9YA 1JYNA 3CJIA 2RHPA 5L7OA 2D6LX 1HW5A 1R1A2 4J1WA 1AF9A 1RVF3 2YYOA 4CDQC 2DVAA 2JWPA 1W6PA 5FP9A 4IERA 1MS0A 1H1IA 2EXHA 5JXGA 4FOQA 3POGA 1RB8G 3FUOA 3AXEA 1S0IA 1FNYA 2WZEA 5C5UA 3I3DA 1GOGA 1W8ZA 1R093 1GZCA 4OHXA 4Q8KA 4CXWA 2OKXA 3RWNA 3DPRB 2GALA 4ORFA 5BUVA 1BVP1 2D3SA 4C90A 3JBG1 4WVMB 4QWNA 1QU0A 1N47A 4Z1VA 3OY8B 2CSGA 5FPXA 4NUBA 1HIXA 1UD1A 3CJXA 4UWDA 3VKLA 1BYHA 3HN1A 5A3NA 2Z2SB 2W68A 2IXKA 2UWCA 2VZSA 4HFSA 1K5JA 2O8QA 3CU7A 4OI2A 3U78A 2WWJA 2W46A 5T5JA 2Y6LA 5FZOB 4L11A 1LCLA 3AL6A 4JRAA 4MGTA 5FP4A 1E5IA 2K9ZA 4RQPB 1PK6A 5LW9A 1AYN3 1QXPA 3K4ZA 3KV5A 1SMVA 1HB1A 5C70A 2Z5WA 3MFAA 4K21A 4MXVA 1UYZA 5FFOC 4EN7B 4HPKB 1ZBA1 3NAPA 4CDUB 5JR2A 1DQ0A 3ZYFA 4IEWA 4AFMA 2LW8A 3MW2A 2ARBA 3PUSA 1GZ9A 2WAAA 3AXDA 5FZ6A 3CZUA 1DGRN 3B5LB 5EWSA 5J98B 2Q8EA 3OBZA 5HBAA 1YHFA 4QKNA 4BXSV 2ZXQA 5F6KA 2R071 4WZFA 2VZTA 5I0DA 4FTEA 4H3WA 2JDMA 1RYYA 1Z0HA 4WVMA 2HWC2 5GZEA 1BEV2 2C4XA 4L2NA 4LITA 2DU1A 4YGBA 4Q4X2 2EA7A 1XRUA 4NMIA 2XPJA 4AR2A 5AC93 5IHRA 2DCJA 2MNGA 1LNSA 3K48A 1RUJ3 3H42B 3MIDA 3VBRB 4K7JA 4KH9A 2WNVC 5F3CA 4B1LA 1RUH1 3V0BB 2W94A 4WM7C 1EYBA 2OZJA 3RYRA 4KWKA 1DZQA 4QM8A 4OMCA 3D6EA 3I4IA 5J48A 4S2HA 3AP6A 3VBOB 4KBBA 4D69A 4NHYA 1JBCA 4ZONA 1RUF2 2BFUS 2LALA 2VW2A 4MGYE 4HPKA 4QX1A 3WHTA 4CDXB 1HKDA 4YG3A 2V4AA 3IPVB 1U5XA 1GWKA 2CWSA 2VNRA 2WFPA 5EV7A 1LR5A 4LIUA 2WN3A 1HQWA 4OHWA 2YC4A 2C6SA 2WO1A 4LKEA 2WZ8A 4BMEA 1WA4A 4EV0A 1TMF1 3ZFFA 4IQPA 4BYYA 1N1VA 1GQPA 4AQTA 4XXAA 2PTMA 3GZTB 1BXHA 1VMHA 1BHGA 5ACA1 4XF3A 1NX9A 5E8AA 4QGLA 2D6MA 1QY4A 4LO7A 2VOWA 3IIAA 5GJ6A 3WF2A 3H8OA 1QOTA 2OW4A 1A8DA 4UBHA 1C1LA 4QKBA 4HK9A 4XHXA 1HV0A 3LIHA 1HB4A 4UAPA 4YW1A 4RGAA 4CP1A 4NPMA 3FBYA 4CCLA 4O7XA 3VBRA 3BOPA 1UX6A 5F2WA 4COYA 5CG8A 3JCIA 2A6WA 5ABJC 4Q4X3 4GXLA 3ACLA 1CPNA 2P5BA 1CZSA 4Y5SA 4ZU4A 1JOPA 3USUA 4C1WA 2E9QA 2ZEZA 4IESA 2VOVA 3ZYJB 2GNTA 1TME2 4MHUA 2V72A 2P4EA 4QXKA 4V2WA 3N7JA 3ASIA 4KQ7A 5L36A 4CEWB 2OS2A 2D40A 5I8SA 3MYXA 3W21A 2OUHA 3W9AA 1FMD1 4FAHA 1POV0 3VDAA 3H1WA 4FCAA 1Q5OA 4B29A 5LEJA 5FZ7A 1UY0A 4R9CA 4XDQA 3PU8A 4I0AA 1H8TC 4YFZA 1YQ5A 1S2BA 1B35B 3FBMA 1JHJA 4H7MA 2BWCA 1H6XA 4LBQB 2A3WA 3MV01 1CPMA 1MS1A 4B3NA 4ASMB 3BU7A 5A6ZA 1EAH1 2RM21 2RVAA 4Q0UA 5BNPA 2D43A 1ODMA 4FPEA 5F32A 4JGZB 5DDJ1 1OQEA 2ZCWA 2HBUA 4XIOA 1SLAA 2BFUL 3GGLA 4TZDA 1XNDA 4WM8B 3ZLIA 4LO8A 4MHRA 2D6NA 2JG9C 5FZ1A 4P9GA 2LUWA 2J1SA 2OT7A 2YUEA 3I2IA 2QQJA 3N9NA 3MV11 4P9LA 5FKBA 1GQGA 2DU0A 2XJTA 2HWF1 5JIUA 4XHBA 3HMYA 3MDPA 4QXBA 2ADDA 4XUTA 1P8JA 3V56A 1K12A 1JZ6A 5JOZA 2PQQA 4LO5B 4D3WA 1GZWA 4EWEA 2QE3A 2Y6GA 2I45A 2V5DA 1SDDB 5L9RA 3ZFGC 3O1SA 4LULA 3T08A 4A7YA 5T3NA 2WNOA 4LXLA 1Z7S1 4IGOA 2B8MA 4MSVA 2L9LA 1CIWA 2JXAA 3ZN6A 4NAOA 3K4AA 3IKWA 1F5JA 4CDWB 2PMWB 2ORXA 2WA3A 2WNVB 4Q26A 1B35A 2GC0A 5FZCA 1Q43A 4WVZA 4S2DA 1SLCA 3WNLA 4UFHA 2Q5TA 4XF0A 3IDAA 4Y4YA 4DUXA 1V6NA 5D1IA 2VJXA 3GJBA 1PIV1 1JOJA 4UW3A 5FPBA 4PBPA 1E57A 5KHHA 1GSLA 1BVVA 1S0EA 5C9AC 1SEFA 3IWZA 3KT1A 1H6YA 3WCSA 3RFRA 4RHV3 1OA4A 1FPN1 2OPWA 4TSVA 1AR62 3KGLA 1RXGA 1CJPA 3O0WA 1EPZA 3OEAA 1CQ9A 1ND3C 4NE9A 2XXZA 1LOAA 1RIRA 1OXCA 4IE4A 1KGYA 1RUE2 4AZZA 3RZMA 4QPGC 3D8CA 3LE0A 3WR0A 4Q1RA 1MS4A 3I3MA 4DXZA 1PO11 2PHWA 2CY6A 1NA1B 2RMU3 3SNMA 1DZTA 4HN1A 2P1BA 3KQ4B 5FMCA 4ZXEA 3WVJA 1CX1A 2CWMA 3LDRA 1UYYA 2P3JA 4I3PA 1X82A 3W20A 1BCXA 1W3VA 4UYBA 2Z79A 2BYVE 2A73B 1RMU2 2ZGLA 1LESA 3N9LA 3DKQA 3SCHA 5IVJA 4X8NA 5B2GB 3CIHA 2YV8A 3DV8A 4XTMA 5JZGC 4Q27A 4QQPA 3PDQA 4YGCA 3MUY1 3EB7A 3I2GA 1NY71 5CFCC 2WSVA 3GJAA 5ABJB 4A41A 3RQ0A 4JKKA 3B9IA 4LIVA 4ZS2A 4SLIA 3J7LA 4UF0B 2PLV3 2C5DA 5LBEA 3L2YA 3VBFC 2PHLA 1WW4A 3AYCA 3KB5A 4CTEA 2OX0A 3HJRA 3I2FA 4JKLA 1Y7BA 2FDKA 3RZLA 3ILFA 2WQ4A 1PVC1 2R16A 2ZGPA 4A7KA 3JBG3 1FYUA 1SLBA 3DUIA 3V65A 5BNOC 3I2OA 4PI2A 1DDLA 3LA2A 2X5IC 1UKRA 3LAGA 1SLIA 3N9MA 3LOBA 3THPA 4AI3A 4DMIA 1H8TB 2OYZA 2QQPA 4YM0A 2VOXA 4DXRA 1NA1A 1QJU2 3OF1A 1RUE3 4LKSA 2GDFA 1LU2A 1D4M1 2A5ZA 4AEDB 2BGOA 1JMUB 4KMQA 1JODA 5A1LA 2RJKA 4M4RA 2X05A 3RI9A 1ZZ7A 5FXZA 2JG8B 4AEKA 1CN1A 1ZBA3 1VBB1 3M3EA 4A6OA 4BJ0A 5JOXA 2D6PA 4YW2A 1VRH2 1SZBA 1XE7A 2JG9B 2NN8A 2ZGKA 3AJYA 3PNAA 3POWA 2Y6FA 4JTNA 4LO6B 3TN91 4BQXA 2DVFA 4RL7A 1VP6A 1HRV1 2VVFA 1A3KA 4XJWA 3TNPB 3OYWA 3RZJA 4TLFA 1H30A 4D7TA 4UF0A 5C8WA 2CGPA 3J7HA 3KWVA 1LRHA 3R0RA 3V0AA 4K3UA 1IGOA 1UMIA 4Q5OA 1NCQC 1RUI1 2R073 4DUWA 5C3QA 4L0PA 4P5YA 5KHKA 2G9FA 3VBHC 1MZ6A 3ZFGB 1UZVA 2RS11 1VJ2A 4KNCA 3GHMA 5FYBA 3JU9A 3WNPA 2VR4A 4JQRA 1UZZA 4AFCA 2WS91 2ENRA 3IAQA 1CZVA 5F8PA 3WT3A 1WA6X 5DZEA 3ZPOA 1VBA2 1RUH3 1ZZBA 3VGIA 2WSUA 3ETQA 4N53A 4ES8A 1JYIA 5C4WC 2CAVA 2Y33A 4KWLA 4CCMA 2NZ9A 1PZ8A 1VAMA 5F39A 5DABA 1AL0G 3O1OA 1ENQA 3AMPA 5FPUA 1QQP2 1LGBA 1NT0A 2VULA 4XIKA 1GANA 3RYKA 3ZSKA 4BIFA 3PTYA 4BMBA 4BWOA 2VOTA 2VMFA 4LK6A 2D44A 3ZXKA 5CKQA 1VALA 4AGRA 1V6KA 2IXJA 3AZYA 1GBGA 1W9SA 2DBIA 3BB6A 3SHRA 1Q56A 3CQOA 2PXJA 3TEZA 3NWKA 4Z82A 5F3IA 5CG9A 2A6XA 4JHTA 3UKTA 3MLKA 4QDQA 1XNKA 2E53A 4JZRA 5DZFA 2WT1A 2IFRA 4LHSA 1UCXA 3DYMA 5CFCB 2F4LA 1X8EA 4E4DX 3LCPA 2WT2A 3BTYA 2JENA 3UJQA 5C8CC 1JI6A 4LUKA 1PO22 3E97A 1IG0A 2JIGA 1IPJA 3NO8A 4XW3A 4ONUA 5LK5A 3P6BA 4DINB 4E2SA 5C6CA 1JYXA 1W6QB 4UW4A 1Q3EA 4HANA 4XF4A 3VKOA 1WCUA 3AMHA 5A33A 1RJ8A 1OH4A 2J1TA 2R32A 2VUCA 5A70A 3W5MA 2K46A 4FFHA 4OI1A 1G9CA 2R30A 4XETA 1GP4A 2IXCA 5HCHA 1S0JA 3DF0A 2W3JA 4AVCA 5C8CB 2ATFA 5FQ0A 1HQLA 3VBSC 2W52A 3TB0A 2NP0A 2VNOA 1KITA 1VBC2 3NV3A 4AF9A 1AR81 2BUKA 4A42A 1S0CA 1W06A 4MADA 5FDBA 1ASJ2 3JZVA 3OSDA 1CJDA 2F6BA 2G19A 3B93A 4M00A 4Z92B 2WNUB 1COV1 1EAH3 1YI9A 2ZHKA 4YRDA 5I8YA 1Q8SA 4YZ3A 4DRVA 1W05A 5DDJ3 2YHJA 4M0NA 4AQ6A 1XB9A 3ES4A 3ZR6A 1WLWA 2J1AA 2HWE2 4XXPA 1DGWA 2BTVC 4MVTA 3BYWA 3AKSA 4JDNA 1GLHA 2G1MA 3BVCA 3ZIXA 3PU3A 3DKWA 3NNJA 2HWF3 2UWAA 3WP6A 2G9GA 1EV12 3ZYHA 2P34A 2WYSA 1ZBE1 2ZHNA 2ET7A 3DECA 2ZGUA 4Y5Z0 3FLRA 4IV1B 4QGMA 1JN2P 3HEIA 3PMEA 3ZDVA 2R7EB 1O3RA 3UYJA 1RXFA 5FKCA 1Z7S3 5FY5A 1I5PA 4DZGA 4YWAA 1Y9MA 2SLIA 2N7GA 3RYPA 1LGCA 1R082 1NXMA 2WLPA 1QJFA 2WWUA 4X8PA 3KMHA 2DCKA 3T4HB 4L9BA 4AW7A 2BWAA 3MUZ1 4XFIA 4CEYB 5L7OC 1F35A 5L19A 1PIV3 4IE6A 2ZX4A 1VBE3 2DWRA 2GC1A 4HT1T 5CB7A 5LK7B 3KV6A 4Y4RA 2UY8A 4MGQA 5C71A 1J83A 4FTBA 3A21A 2EXKA 2LROA 1ZVFA 3N35A 1HRI1 4GWJA 3J26N 4HONA 5FZEA 2PHDA 4E27A 1ZRFA 2HEYF 5EP9A 3J4UH 3E6DA 3POEA 1JH5A 4AEJA 4AQSA 3VDBA 4DUVA 4K9SA 5JMOA 2FDIA 2WO3A 3OGVA 4FAGA 4QPIB 4URAA 3KVAA 5IATA 2Y0IA 1IQDC 1XQNA 4N43C 4AI9A 4YZ2A 1DGWX 2GC3A 2DVBA 1EV13 3C7HA 2BBVA 1ZA4A 2PQSA 1AXYA 1C4RA 3HNMA 5IYYA 5HXMA 4OFGA 4CXYA 2UY9A 3NJZA 3VKFC 1L7RA 2SBAA 4EJRA 2WFF2 1PK6C 3VZJA 4F8AA 5A3LA 1K5MB 4AVAA 2GMEA 3WQ7A 5FMOS 5K0UC 4AI2A 5FXWA 4CCNA 2FDJA 1UMZA 1ONAA 1SBEA 3C8XA 3NAPC 3PURA 3MPPG 4CEYA 4LK7A 1F4HA 1R083 1RHI2 4IEQA 2BVBA 2ERFA 2ZKLA 1DCSA 3RZHA 2QCSB 3WUCA 2MEV2 2PAEA 3OPWA 4A3ZA 1C57A 1QJX1 3HBKA 3PUAA 4CU7A 3AZXA 3ZFEB 1PVC3 2XGXA 2WT0A 3W59A 3D0SA 2CDPA 1TNRA 2YBPA 4H7LA 4NR1A 1V0AA 3CNAA 4IE7A 2BNOA 4P9XA 5DPNA 4IEXA 2EXJA 2JDPA 3DPRC 3VBSB 2QKDA 4B4RA 4MV2A 5DAVA 4ET7A 3BGAA 2XH6A 4AQ2A 1BBT1 1LOBA 1YQ8A 3H1MA 1LHNA 1D4M3 3DXUA 3RNSA 1RITA 4AEDC 1VBD2 2GP5A 2ZX0A 5FPVA 4W6XA 2ARCA 3D0JA 4RD7A 5DG1A 5BNQA 1C5IA 3KF3A 1B09A 1HJFA 4GMP1 2E7QA 4L99A 1VR3A 1QDCA 4MG2A 2JIJA 5A6QA 5IK7A 2FCUA 4OQ9A 1AR91 5E16A 2BGPA 1W8OA 4IGPA 4IV3A 1OFSA 1NXD1 1DYKA 2BQPA 2YG0A 2Y34A 3P5BA 4JGYB 3AX4A 3TN93 2WRAA 4NPRA 3AP5A 1QJY2 2RR12 4RR3A 3VHPA 1HRV3 4ES9A 4CDUC 5A1FA 2DUOA 3ZXLA 2XBO1 3JD71 2J7MA 1WD3A 1BMV2 2VZ1A 4MH0E 1RUI3 1O6UA 4IEUA 2D3RA 5FYZA 4FP2A 3AFGA 1RUD3 2RS13 2D5FA 3GYDA 4PLNA 1GP5A 2BP6A 3QLQA 2WS93 1RVF2 3IMNA 3RJRA 3KLSA 1DZRA 2O0OA 4UFIA 1ZZ6A 3T2PA 2K2SA 3LEMA 4XFCA 2UURA 4MGIE 5IFPA 5CZKA 3CJIB 1HLCA 4YNIA 4W6YA 5FMOL 4W6WA 1R092 5HCBA 3VBRC 5EXOA 1W6PB 3CO2A 2W92A 3VL8A 2EIDA 4ARXA 3VBUA 4KWUA 3TNQA 1HB2A 3T0DA 2ZACA 1VBD3 2EIGA 3VBOC 4DOUA 5IVFA 2A75A 1EUTA 3OPTA 4JGYA 2QDNA 3RVHA 2HH9A 4CDXC 3AFKA 2UWBA 2DF7A 1EY2A 2YXSA 3ZSEA 4PIYA 3C7OA 5EJ1B 3WXPA 2OVUA 3ENRA 1TME1 3H7JA 4K8FA 4FOYA 4M3CE 4MGZE 3ACHA 1WMDA 4XQ4A 5CYYA 4FOWA 2PHFA 3OGSA 2ZS6B 3E6BA 5J96B 2OQ6A 3MIFA 4MLOA 1AYN2 3RG0A 3ZDSA 2ZAAA 1WMFA 2QBXA 4QX0A 4HKOA 4JAAA 4M3CA 1SBDA 5L73A 3POSA 1W6OB 3ABZA 5GKAC 4RS5A 4Q0QA 3RJ2X 1YQCA 4TTGA 4HBNA 3WF4A 5G04L 3VHNA 1QH6A 1ZA7A 1UL9A 1XBFA 2VOKA 5GM0A 2DVDA 3HWJA 2OPKA 1LU1A 1AX1A 2GH2A 1WZXA 2BNNA 3NAPB 1RUG1 3SC7X 2VZOA 1NCRA 1SPPB 1UZ0A 2JJ6A 3AM2A 4YW3A 1UW8A 5FV3A 3LOIA 4G3YC 3THCA 4CA9A 4HMZA 2W39A 1AR71 4Y1ZA 4Y24A 1H1AA 2C24A 4LLOA 1PGW2 1T6GC 2ZGQA 3ZYGA 2IVJA 2K0GA 1X9TA 5GLZA 5A3MA 1WW6A 5FY1A 4YARA 1HX6A 3WINE 3AKRA 5AC92 3LIGA 2WO2A 4NIIA 2DV9A 1RUJ2 2GMPA 2ZZQA 3PHMA 4CEWC 1N3OA 4FPCA 1WUVA 3N3HA 4GKYA 1PNFA 4PHZA 1ZZ8A 1AR83 1X7NA 3UKNA 1SDWA 2NMNA 1DLLA 1N1TA 4B4QA 2FBEA 2GH8A 5FY8A 1REEA 3AC0A 1COV3 3O1TA 4G4FA 3D3AA 2E26A 1S4CA 1B35C 1YNAA 3INAA 4FPKA 4L92A 3ZXFA 1ENXA 2WZR1 1W6OA 5LA0A 5FZHA 4LKFA 1ULPA 5DG2A 4XABA 2IFWA 1H2MA 3ZSJA 3E5UA 2C1FA 3Q8FA 4LA3A 4CYDA 3ORJA 1O3QA 4CRQA 2VUDA 1BLZA 4P9WA 3HPNA 4EQVA 4JGZC 2V09A 1XE0A 2VO5A 1LEMA 1MS3A 3SQOA 3I7DA 4IUGA 5BY5A 2RG4A 4WM8C 2UU8A 1NLQA 3OGJA 5K7PA 1SPPA 3BUCA 1AL21 1O8PA 4UXAA 5EIYB 5LCWL 4O9EA 2H6BA 2QTWB 3ZFFB 1REFA 3UGFA 1FOD1 2CYFA 2YC2A 2QUOA 4FVVA 4AI1A 5FYSA 4W8JA 3RWKX 1XPWA 1CAUA 3RRDA 2XWJB 1LJ7A 3THDA 4XF9A 2XQXA 3JQWA 4NRMA 3A23A 3M8LA 1H4HA 1QIQA 2XL7A 4UFLA 2GNMA 1F15A 2A71A 4AG4A 1RGSA 1QGLA 4Z2AA 3AMQA 1GR3A 4PIZA 2E32A 3SISA 3ZPYA 1LODA 5CIRA 4E4ZA 1PGL2 4QDSA 2WBKA 1UIJA 4CE8A 4CDWC 1ODNA 1RMU1 2PN5A 3ZYRA 4YG6A 2PYTA 3WOGA 1NYWA 2XQRA 4P14A 2VM9A 2DCTA 2AZ5A 4PDWA 3USUB 5FP3A 1HRI3 2QQVA 3M1HA 4JDOA 4YW7A 4CCDA 2TUNA 3JXSA 1KJLA 5LA9A 4YYOA 4G9SB 2GU9A 2JECA 4CXXA 3HR9A 2YFZA 3PVOA 1DP0A 2A7AA 3O14A 1W0OA 1XJAA 1PZ7A 2CTVA 1WW5A 2XJQA 1W2OA 4HSLA 3ECQA 4XACA 1Q8OA 1C8NA 3N7KA 1FT9A 2JE9A 1DFQA 3KSCA 5JCTA 1OF3A 1NA1C 2X53S 2C26A 1LHVA 4XOGA 2VCAA 2ES3A 3ZSMA 3TOJA 4WV8A 1J59A 1Z78A 2NLRA 4GH4B 4WBBA 5BNPB 4CUBA 5M0TA 2VVEA 5A7WA 4YM1A 3QH7A 1GMMA 2NPIA 3OGGA 2P17A 4FT8A 4Y26A 3AZVA 3O12A 2ZX3A 3OUIA 3POYA 4XJ8A 3WNNA 1H1MA 1OOPA 4HVQA 2DFCA 1CZTA 5FZ0A 4AHWA 1UY3A 4I09A 1WMEA 1UXZA 2ZMLA 3WDWA 4OMDA 1U5ZA 1EP0A 3PIJA 2BNMA 4JTOA 3UESA 4AGGA 3FHQA 2B5HA 5K8SA 4YW4A 1HXS1 1SFPA 2VTXJ 1GOHA 2XVKA 1QJX3 4QXHA 1K42A 4HKWA 2GNBA 5FK7A 1C1FA 4CVUA 2ZA9A 3HN3A 2VMIA 3GZEA 3MZHA 1ND2A 3APBA 5FIXA 1GZWB 3ZYBA 5LATA 2PHXA 1UY4A 2I07B 3ZKYA 4CCCA 2FDFA 5DAXA 3HIFA 4TYSA 3WG3A 1OFNA 3FUQA 1BBT3 1MPXA 4RFRB 3T1MA 3A22A 3IDBB 2QZ2A 1CR7A 3ZN6B 1GV9A 4NIGA 5JPNB 2PA7A 1TQ5A 1PMIA 4E8DA 1C8M1 1OF4A 4BQ4A 4C8DA 2BEOA 3I2KA 4OI0A 2FZ2A 4NHMA 3VHOA 4GMP3 1WBLA 1STMA 4BQYA 4RHV2 3FLPA 4AVTA 2HJIA 1UU4A 2YBKA 2TEPA 4N53C 1AR93 5FUPA 3OUHA 4GH4A 1KRIA 2OXBA 1VBA1 3DGTA 4YM2A 3ME2A 2BVVA 3ZSLA 2JG8C 1ULEA 2QQNA 4NO4A 3GXUA 4IE0A 5FMDA 4P00B 3AP9A 1AYM1 1LOGA 1W6NB 2B4KA 2XBO3 3V64A 1E5HA 1V9U3 2RMU2 3TEXA 1AZDA 4TN7A 5DUXA 2FCTA 4Q0VA 5FJHA 1US3A 3G7DA 5FLIA 5JOYA 2KD7A 3OUJA 4BK5A 2PELA 3B00A 3KHBA 4UFJA 2D98A 1HN0A 1AJOA 4KG0A 2Y6KA 5LBCA 3FHAA 4BLJA 4DQAA 2WUHA 4EWAA 3B01A 3ETPA 1W8FA 4KGGA 2WLQA 4N7UA 2FMDA 3JQXA 1MQTB 1W8NA 2KXLA 2O14A 2ZEYA 4QMAA 4GB33 3B94A 5T5OA 1ZRCA 2QQLA 1UU6A 2PLV2 2JD9A 4LOTA 3VZLA 4ITCA 3TBDA 4A6SA 1X8MA 4XMAA 5DUVA 3AVRA 3H8RA 4HG6B 5FZ4A 4GALA 4AL9A 3ON7A 3AKTA 2O8OA 2C0ZA 2R063 2VMEA 3JBG2 3WW1A 2XKOA 4B7KA 4R4XA 4Q4V1 4JDMA 2WKKA 3FN9A 3R4UA 2D6OX 2PAKA 1W8HA 5IT6A 4NIDA 1OLRA 1PO21 1WLDA 1AJKA 4Y33A 2HWB1 3ZIWA 2ZHMA 5FYMA 2J22A 4QB2A 1W6NA 5IK8A 2B9UA 2VQ0A 1J58A 3NL1A 5KXCA 1ACCA 5GZDA 2W1WA 1MZFA 1POV1 5EFUA 1ULFA 2AEZA 1QHDA 3S6PA 2JE8A 3K4DA 2XVLA 4JVAA 1MR5A 2EVXA 3POBA 3UGHA 1GOFA 1ZBA2 3IDEA 4K6BA 4ZHNA 1LOFC 1GU3A 3WDUA 4BDVB 3RMXA 1U12A 4LBQD 2XL9A 4LE3A 3EJKA 1MQTA 1UQXA 5FYUA 1ASJ1 2VMDA 4AFAA 4BQ3A 5C5TA 4LMFA 1VRBA 3AK0A 4C91A 3ZVXA 2GN7A 5C7GA 1S0BA 2XHKA 2WYFA 1RUG3 4HXCA 1U5YA 3WP4A 4J25A 2RE9A 1W8TA 1DU3D 5A7OA 3LB9A 4UFMA 2R041 1UY1A 2B39A 2R072 3WDYA 1AR73 5FY7A 3OYWB 4QB6A 3F2ZA 4QAWA 3VKMA 2RS51 2IXIA 2FMYA 4LBLA 1NOVA 5H9PA 3RPQA 1GFF2 3V0AB 4Q4Y1 3PUQA 3H3ZA 1CD3G 4X6RB 4CU8A 2BRTA 2VL4A 2JDNA 1XNBA 2R0HA 1LHUA 2VBBA 5CFCA 5F37A 2GNDA 1NQDA 2ARXA 3AYAA 3W58A 1G9BA 2V5YA 1RUH2 4I0BA 1V00A 3JB4C 1JU4A 3HQUA 4FXGB 4W50A 3R4DB 5LASA 1GNHA 4XCAA 1YFUA 1NE4A 3K2OA 3B7MA 4XFAA 3SITA 3WF1A 4UT5A 3LA3A 4R9BA 5A6YA 1X50A 4I30A 1DYOA 1ENSA 1HN1A 4N53B 2IVIB 1LOEA 2WNUC 3NKTA 4B7EA 1VLNA 2XVGA 1CAXA 2J1VA 3S7IA 3SCFA 4NPLA 1UY2A 5F1RA 3I3QA 1N3PA 3H3UA 4Y3OA 5I0TA 2X29A 1UZWA 3LPGA 3M3IA 1I3HA 3KT4A 4NROA 4QDRA 2ETEA 1AL23 2ZKNA 2ZMKA 3IT8A 3PMSA 1ZRIA 4NRQA 5JIAA 4QPYA 1DF0A 2XJVA 5FYHA 5A3WA 4XZPA 1FOD3 2WAOA 4IW3A 1AXZA 1F8VA 1O3SA 3G6JB 1AVBA 5IW0A 1SQ4A 4IEVA 1XXNA 1JUHA 5FZ3A 5JR7B 4A7ZA 1NLSA 3T1LA 3BIEA 1R1ZA 2NQYA 4IV1C 4QKDA 1WCDJ 4C0BA 2JDAA 1ULDA 1O4TA 3U11A 4AYUA 4ZZ8A 4I02A 1R64A 2O1QA 1KD7A 4EWDA 1MS5A 4Q0PA 5IWFA 3ZXJA 4YLZA 4QQ2A 3I97A 3POIA 4IGQA 5DZGA 3ACFA 3N7MA 2AR6A 1N3QA 1QJEA 4LE4A 2W1SA 5FLJA 1DQ5A 5FZ9A 4LHLA 3VKNA 5I91A 2W1QA 4CCKA 2GAUA 1OURA 3VD7A 3SKVA 1QOOA 3ILNA 1LKNA 2G4IA 3OBTA 2B7YA 3CL1A 2DUQA 3ZXEA 4CEYC 4DFSA 1UYXA 4QX3A 4EN6B 1QF3A 1MEC1 3EYPA 2EF6A 3TYJA 1UPSA 2TBVA 1WMXA 4GZ9A 3PVBB 5GLWA 2CDOA 5JSPA 5A33B 2RDSA 4CP9A 4Z8BA 2PHRA 4O65A 3A0NA 4YVSB 2WN2A 4BQ2A 4DEQA 1OC1A 1TMF3 2VE1A 3VB9A 2P37A 3AJZA 5BYNA 4PT6A 1EAH2 2VZVA 5FQ0B 2R6QA 1OPMA 1XYPA 1C5HA 5DDJ2 5ACA3 4QPIC 5FXXA 5BNNA 2IZWA 1V6JA 2X8KA 3B9CA 1OD5A 2PFWA 4XQWA 3OGRA 1WBFA 2OQ7A 3LZZA 1A34A 2E63A 2JEMA 4HSJA 1OKQA 2ZGNA 3WDXA 4EN9B 2HWF2 1WKYA 3NRUA 2PHTA 2JDKA 4L8QA 3IDCB 3SH3A 5FPLA 1J3QA 1O4YA 2WABA 2YC0A 4IV3C 4KU7A 2QFEA 1K5MC 3T2QA 2BBAA 4XF1A 1W3XA 3VD4A 1HXS3 2PAMA 5IVEA 4AI8A 3GBGA 3HQRA 3U4SA 3J8F1 4XJUA 1FATA 2Q8CA 1Z7S2 2JX9A 2EICA 5A3TA 3E1F1 1OUXA 2A3XA 4BK4A 2D3PA 3ZFEC 3VUOA 2A6YA 3GNEA 5FZKA 4M4PA 1ZNPA 3HBZA 4Y1VA 3ZM8A 4YVSA 3PUIA 4CU9A 1FMD3 2W0XA 4LKDA 2VPVA 3WSOA 3HT2A 2WC2A 5SV5A 3I3BA 3H8XA 3MIBA 5GALA 3WW4A 4FPLA 1PIV2 4RN5A 4FPFA 1VBE2 2RS31 2F17A 1C8M3 4MGSA 1YQ6A 1YRZA 4FP3A 4XEZA 1GWLA 3RZZA 3U0ZA 4AEMA 2XHNA 2VH9A 3BTZA 1RUC1 5T50A 4FFFA 4FPOB 2I2SA 2WO7A 3WW2A 5C9AA 2RM23 4OVEA 3UV9A 5IK4A 3M3QA 1JUIA 1ND3A 1TEIA 4TLGA 1KDMA 1PO12 5D8AA 4QPGA 1AYM3 5FLHA 1ZX5A 4JGYC 2W2IA 4FOVA 2DVGA 3KM5A 3NNFA 4Y1YA 2HWD1 5C3PA 2WIIB 1XNCA 1BKZA 4BB3A 4BU2A 5FZBA 3UNPA 1IKQA 4C0HA 4P9YA 5I0SA 5JXHA 3EXUA 3K51A 3GBWA 3U75A 4WVVA 1QMJA 4Q4W1 2J1UA 4K20A 4HZFA 3K75B 1PNGA 1V6IA 4MOAA 4MUVA 5JZGA 2W1UA 1W28A 4E4HA 1OMIA 1T2XA 3IB3A 1IG3A 4FPHA 2QQUA 5JVVA 5ANNA 3NNMA 2GMMA 3S30A 1J3RA 2WR9A 1PVC2 3E5QA 3LD8A 3CJIC 3L2HA 3VBFA 3WW3A 3I49A 5T5LA 5FP8A 4CUAA 1X9PA 4DNYA 1NCRC 1GZTA 4JHZA 1DBNA 3QOPA 4PI0A 3A4UA 4Q4V3 4UW5A 1CAVB 3NQHA 2XKPA 4FBFA 1R1A1 2HWB3 1OQDA 5BNOA 1FPN3 3OB8A 4LPLA 2X5IA 3KV4A 1A8MA 1EUUA 1NAEA 5JSOA 3EQEA 3KS7A 1D4M2 3DYOA 4S2FA 3WG4A 5A1AA 2B46X 1POV3 3MF9A 1CONA 4YGDA 1VB2A 2YU2A 1PO13 1LAJA 2HKXA 3N36A 1RUOA 4A45A 2KR2A 3CMGA 4E4SA 4META 2AEYA 2BPA2 4HVOA 1VBB2 1F2NA 2XMLA 5A80A 2J1EA 3WX5A 3TN92 1H9WA 2Q30A 4IL7A 4BIOA 4ZU7A 4YPJA 1REDA 1HRV2 2E7AA 4FFGA 3GZAA 3IM0A 5FYCA 5G05L 1D0HA 1PMJX 1BK0A 5B4XA 4I0WB 4XAEA 3WHUA 1PVXA 3O7OA 3HNYM 4AAPA 1YFXA 4IV3B 1C28A 4ATEA 4DS0A 4AHXA 1OA3A 2R043 5FZFA 1OQ1A 1RUI2 4HKLA 3NV2A 2ZX1A 1AX0A 1ULGA 4H55A 4RR3B 3MICA 4XUNA 3O1UA 3OEBA 1NZIA 1W8WA 1U5IA 2XJRA 1CIYA 1KDKA 1RUD2 1NCQA 2RS53 2WQZC 1IS5A 2RS12 3IN9A 4YSFA 5LEKA 3MIEA 1CAWA 2EXIA 3VBHA 4Q4Y3 3ZYIB 1CAVA 4A4AA 5I0RA 1UN1A 1W9WA 2WS92 1J1TA 3ZMNA 4XFGA 1ENRA 3FE5A 2LM3A 2BU9A 1W04A 4XPVA 4KBZA 5LBBA 1RC6A 1SG3A 2VQTA 2VCBA 1KXGA 2WNEA 3P3PA 1W99A 4GA9A 4O9GA 1NKGA 3R6SA 1JW6A 5JOWA 1YFWA 2BV4A 5DXDA 5GLTA 2QNKA 5EQUA 1C3HA 2HWC1 1BEV1 2OZ6A 5FY0A 3ST7A 3WQ0A 4ISRA 3AZWA 2EAAA 4L97A 4LO4B 4Q4X1 1OI6A 1W9FA 4DRRA 5FMBA 3I54A 4BQ1A 1X36A 3VBUB 5C33A 1IPKA 4INDA 5DAQA 1WWYA 2YDEA 1VBB3 4MXWA 4HN0A 2R1BA 3OBRA 3PVNA 1H2NA 1W2UA 4PDWC 5FOBB 1OPOA 1IKPA 2V4VA 3W5NA 3H9AA 1YI7A 3MW3A 3T0AA 3LA7A 3VDCA 5FBZA 3X29B 1RUF1 2XWBB 4CCJA 2Y64A 5HCAA 4YGEA 4LBOA 1L7QA 4RSUA 5FOJB 1O4ZA 1SACA 2YGMA 5H9SA 1NE6A 2ZGRA 3ZFFC 4WVWA 4B1MA 2CNAA 4XJZA 1I1EA 3CHXA 1FI2A 3D5OA 5FREA 4XFHA 1W9TA 4M3CB 4RGGA 4XILA 3UT0A 3NJVA 4MZUA 2HEWF 5IVYA 1D2SA 2AACA 2D97A 1MZ5A 3ZN5A 3OOXA 4FXKB 1UXXX 1YXWA 3WNMA 4RS5B 2OUJA 5DMYA 1GKBA 4Q0SA 2ZGMA 4NWVA 3POJA 1XSRA 3LKJA 3DN7A 3OCPA 1PM4A 2IWGB 3MI8A 3OD0A 3Q8BA 4W65A 1UOFA 2XJSA 4WZCA 4OZXA 4XAAA 4CPBD 4GJYA 1OOPC 3TAYA 4D6RA 1NCRB 4CZSA 1G9DA 1MEC3 2VC9A 3H8UA 3LEGA 1IHMA 2VECA 2CGNA 4HK8A 2VZ3A 4LORA 4MYEA 3O0XA 1AR82 1ALYA 3SH5A 2A6ZA 4ZY9A 3T30A 3ALQA 5FXVA 1UOBA 2W9XA 1VIWB 1COV2 3HOBA 3KCYA 4UBGA 2CL2A 4BPZA 5LRRA 1LULA 3O1PA 2HLEA 5CFDB 2ZZJA 5IJRA 2VTFA 2KM2A 3T2TA 4E2GA 5JWPA 2VW1A 4F3JA 3C7EA 4Y20A 2VQAA 2YBSA 2ZPXA 1YIFA 2JKXA 2AUYA 2Y0OA 3WP3A 1WD4A 2ZEXA 4BQWA 4H14A 1BZWA 5LBFA 1YJLA 3UETA 3OPZA 1YQ2A 3GDBA 4QD2A 3PUHA 4GH4C 4GWNA 4JRLA 5A32A 4AFBA 5BNPC 3VZOA 2A70A 4NWWA 3QACA 5LA2A 1QKQA 2W91A 5EYYA 3RMYA 1W03A 3LF7A 3J8F3 2ADEA 2RDQA 2Q1FA 4PQQA 5FCCA 3K77A 4AAXA 4ASKA 2VMGA 1XYNA 3SLIA 5F2SA 1SFNA 5A3PA 2FD8A 1QNYA 4I01A 2RMU1 3P3NA 4N9IA 1XE8A 1CAUB 4LT5A 2R1DA 5CISA 3BTXA 5B4NA 1Q8VA 5F5IA 1CVNA 2ZHLA 2VVDA 1GNYA 1PM7A 2B45X 4OHVA 5CFDA 2ZGOA 2ZGTA 4UOJA 3ROUA 2JDYA 3BPZA 3J7NA 1MS8A 1RUC3 3TEWA 3I3EA 5F5QA 2VD7A 1HV1A 1HRI2 4IE5A 5FUNA 3S0MA 4QQOA 2Q8DA 4HETA 1IZ3A 2VY0A 3NJXA 3QH6A 4F83A 2PLV1 1LENA 3WLUA 3UKVA 4YVWA 1JTZX 4FQ4A 2VNGA 2XLAA 2LRPA 4PDWB 5BPXA 3E6CC 4H2AA 5ISLA 2V73A 5IVCA 4GQ7A 4P9JA 4HL0A 4JX0A 1W90A 5GZGA 5JXIA 2HWD3 3NNGA 2IXHA 4N43A 5AVPA 3LSDA 1JZ7A 1M06G 5KHGA 4AE2A 1ZBE3 4ASLA 3BN6A 2WINB 3N9OA 1AR61 3MPBA 2BDRA 3WEZA 4IEPA 3HNBM 1H2LA 2E31A 2KA3A 3VDDB 4M01A 2JDZA 4AGVA 1KJRA 1RUE1 5EJ3A 3LFIA 4Q4W3 4ISQA 5L9VA 1W2NA 1OT5A 1OH3A 1TG7A 1W6MA 2XUEA 3ZR5A 2JE7A 4XJAA 5JSRA 1LTEA 2JKBA 4R9DA 2GP3A 2DFBA 2FZ1A 1FX5A 1PX3A 5CA6A 5K0UA 1UWWA 3SKJE 5APAA 1MQTC 2W5FA 5A7WB 2Q0AA 4COUA 2TNFA 3LEKA 3BU0A 1QJX2 1DG6A 3HD8B 5EPAA 3IBMA 1OOPB 5FWJA 3O1MA 4OHYA 1OVPA 5C3RA 1YIPA 4FQZA 4QX5A 4BZ4A 1QDOA 2Q1MA 4LQRA 3RI8A 4OI4A 3KF5A 5E6HA 1EPWA 1IS4A 1R1A3 1UIKA 4QPWA 3HQXA 3ITQA 1YC61 2J42A 4IEYA 3T0BA 3DPRA 1BBT2 2AH2A 2ARAA 4YFWA 4AHYA 2C9KA 2AREA 3CZJA 4XFFA 1ND2B 3B69A 1GP6A 1H0BA 1F4AA 2XONA 3DEMA 3Q8EA 1VE0A 3OY8A 4OULA 3WCRA 3IAPA 4OYUA 5JDBA 4A2UA 5H9RA 5FUIA 3WNOA 4D0QA 4AEDA 2P3IA 2XJPA 5FZIA 2A1XA 4COZA 4CUGA 5LB6A 5AVAA 3VDDA 1N1SA 1RTVA 1URXA 4EE2A 3N9PA 1AR92 5FZOA 3VLBB 4NRPA 3GALA 2G9ZA 3MF6A 2EIEA 3GCWA 3ATGA 3N7LA 4FO9A 4PQ9A 4XUOA 4RQPA 4R8HA 5ANQA 5IUQA 4CCEA 4F7ZA 1NLRA 5A7PA 4GWIA 4LBJA 1L7LA 2E7TA 2XBO2 5SV8A 3JD72 2P6HA 4OZOA 5CADA 1QJU1 1V9U2 3ZKUA 1JZ2A 4CDUA 1G9AA 3KHCA 2YMZA 4XFBA 1O5LA 5JPMB 1JHNA 3BALA 5F6LB 4D6SA 5JMCA 1YCIA 3ZXDA 4BLIA 4FPJA 3O0VA 2FCVA 5CAZA 4K1YA 3WY6A 1QXRA 4CP0A 4FI9A 5LZ6A 1WW7A 2QQKA 1VRH1 4LR4A 1OD3A 2Z69A 1XOYA 2Y38A 2JICA 4XDPA 3WNXA 4GB32 3NJYA 5F3EA 1ZRRA 1VAVA 5FK8A 4XJ9A 3T4VA 2MHFA 1MZEA 2H6CA 1US2A 3D4KA 3K3OA 3LPFA 5LA1A 3WG2A 5DAPA 1W8UA 4W4ZA 1S2EA 4GULA 2VZRA 1VB4A 4CP2A 5A3OA 2R062 2NM1A 2HWC3 3SEPA 1BEV3 4CDQB 4NIHA 4FTSA 3GBFA 1D0GA 1WCSA 4QB1A 4AXOA 3V0BA 1QJZA 2QVSB 2E33A 4LTAA 5EJZB 5FY4A 3O1RA 3Q9OA 1N1YA 4YZ1A 3VBOA 5J7MA 2AGSA 1LHOA 3NKGA 2VNVA 1GQHA 4CDXA 2YPDA 1O7FA 3MIGA 2VW0A 3USSA 4NOTA 1CGPA 4Q2FA 2XUMA 3IPVA 2CU5A 2HYXA 5EZWA 4KU8A 4ZS3A 1ULCA 4CUCA 1UOJA 1KS5A 4MGKE 4IDZA 2BJSA 1RUF3 1KFXL 1BJQA 3JD73 3N9QA 4JCKA 1OLQA 1LGNA 5IK5A 3FFQA 3BOWA 1DIWA 1QQP1 5I0UA 4CU6A 4LBMA 4NJ4A 3P1IA 5KHJA 2XR4A 1JS9A 1W9YA 2ET1A 3H0OA 1O8SA 3GZUC 1V6LA 4U36A 5BNNC 4YZ4A 1RUG2 1JZ8A 2B42B 5EHDA 5IVBA 4BE3A 3OG2A 4QX8A 2VTXA 3IMMA 5GLUA 1SLTA 1OHFA 3ELNA 4GAZA 4GIQA 1AR72 5KHIA 4OHZA 4CDQA 1RL3A 2OIIA 5H9QA 3RZGA 4IXLA 5BXXA 4DY3A 1ZYBA 1F9KA 1JOBA 4EROA 2JB4A 2D5HA 5F5CA 2IC1A 3GM8A 3NV1A 2GC2A 3K3NA 1UO9A 1YFYA 1JYTA 3UL2A 5FZAA 1Y9QA 2JD4A 5A7NA 5KXBA 1BQPA 5IAVA 1GWMA 5DUWA 4NN0A 4PBOA 4CEWA 2Q4SA 2LS6A 1ULOA 2DDUA 5DAWA 2BOJA 4ATFA 3BTAA 1UZYA 3C3VA 4OCTA 4PLOA 3ZYPA 1GYKA 1IS3A 1TME3 1JYCA 3B3QE 4Q8LA 4UFKA 4YVSC 2WZPP 2JB8A 3UGGA 3ZOIA 4ZZ5A 5FO9B 2WZR2 3CKHA 3M7AA 4P08A 1S0GA 3AZZA 3S5QA 4DXTA 5TSWA 4LBQA 4WM7B 3I2JA 4XMIA 5FZMA 5T54A 3MEPA 3R05A 1M4WA 3NV4A 1DGRA 1VBE1 3GHNA 1HQNA 1VBC1 2A3YA 4A44A 1O91A 1A78A 3KQRA 2HYKA 4JGZA 4SBVA 4XZUG 1AL22 4ZPIA 1CAXB 4NHXA 1W2AX 3OTFA 3ZMOA 3U1XA 3N4MA 4WM8A 4A3XA 3ZN4A 4EN0A 1D4VB 4QKFA 2P3KA 2X09A 1XNAA 1FOD2 2VZPA 3WQ1A 3D82A 1KS4A 1UX7A 5D8AC 5T55A 1NUKA 5C3OA 1NZCA 2VMCA 4YG0A 3MLLA 3FLTA 2VXRA 4D94A 3LEIA 2HWE1 3AKPA 4GWMA 1O59A 4HLTA 1GUIA 1MS9A 2ZEWA 3MIHA 5I8TA 4AOCA 3U07A 2NMOA 4XYXA 4I3GA 2D93A 3PVEA 4HVRA 4LA2A 3CF6E 1EV11 1XU2A 4CCOA 2RV9A 2H0VA 5J37A 1LOCA 2YROA 5FBJA 1TE1B 1QEXA 4M0HA 4RFT0 1CX4A 5E1RA 5FO8B 3VL9A 1DHKB 3GF6A 3QCWA 3LDKA 4KGQA 2FHRA 1YYNA 4CDWA 2WNVA 4XC9A 3PJYA 4P02B 4KWJA 5FZGA 1YJKA 5J3UA 1Y3TA 1PMHX 4WM7A 3PTRB 3KD4A 1LHWA 2Y6HA 1R081 2DCYA 3CBNA 4V2VA 4OUEA 3FC0A 2WZR3 1O5UA 3NSTA 2W87A 3ACGA 3AMNA 3AYDA 3ES1A 2WQ8A 3GCXA 5FY9A 2R0FA 5JI9A 4URTA 1TMF2 4XBLA 5FPAA 4XVHA 4DB5A 4OLLA 1E5SA 1RINA 4RGKA 3U10A 4FPGA 5JI7A 3M4FA 3ZX7A 3M2MA 4CP9B 1AXKA 3VHRA 5ACA2 4XDOA 1NQJA 1UKGA 4QX7A 1AR63 5KC5A 2EALA 1G7YA 4LHNA 5FRAA 4J1XA 5FYIA 5A7QA 1UOGA 4DEVA 3ILRA 4FSJA 5LWBA 4AHZA 4DIQA 5BNNB 1W39A 3M70A 4YW5A 1OUSA 2VZQA 2YPJA 3JB8A 4AK3A 5GZFA 1MVEA 5FJKA 3WV6A 3MBWA 1DLCA 1HXS2 5CVRA 3SCGA 1G86A 4J6GA 5ABJA 4ZKTB 4Q1PA 1YWKA 1RMU3 4P9IA 4XBNA 5HPOA 4QHOA 2WFF1 1YEWA 1GNZA 1U0AA 4QGNA 3VD9A 1Y9GA 1FMD2 4PF5A 1OSGA 4M3CF 5L9BA 1S55A 4QXCA 1DGLA 1FXZA 1DYPA 5HV0A 1RUD1 1RHI1 2RDNA 4JKMA 5HCFA 2FQPA 4FFIA 1C8M2 4XTPA 5CKNA 2MEV1 1PZ9A 1QNWA 2QDRA 4HOOA 2RDRA 4B4PA 1WCQA 1H8TA 1D2QA 2UYBA 1W0NA 1IQAA 2VBDA 2QQWA 2IUWA 4R52A 4YW6A 2RM22 2VMHA 2VCCA 3C2UA 4JC1A 3FJSA 4DXSA 3BI3A 3S5AA 3EHKA 3O5SA 2ZOEB 3RSJA 3CEWA 2CHHA 3DYPA 4LHKA 1W2TA 3AKQA 4AVSA 4B8EA 4COWA 1V6OA 2JG8A 1AYM2 5HXVA 3WDVA 1AUYA 5C9AB 1Q8QA 2VUAA 2DURA 3L9JT 1QJU3 2MPFA 2WWSA 4OQ8A 2VBPA 2IXLA 2JG9A 2XB6C 4NHKA 1VBD1 1ND3B 2FDGA 2Z42A 4AVVA 2VQUA 2HEVF 5D8AB 4QPGB 1I6XA 2Q8OA 2BERA 3C7GA 4BCUA 4COVA 1FNZA 1APNA 3BKZA 2DCZA 3VZNA 4D6QA 1H2KA 4PJYA 4RR3C 5J1XA 1VRH3 1KQRA 2RJ2A 4PIXA 3MLJA 3I2DA 2DYCA 1AHSA 3E5XA 4KL1A 1JXNA 1QJY1 1TZOA 2RR11 3KVBA 4E2QA 1O3TA 5C3SA 3ZFGA 3BODA 5FYTA 1RJ7A 4FPYA 3T2OA 4AFDA 3KT7A 2ZABA 4BQ5A 2E51A 3FZ3A 4QHBA 2XDVA 1BMV1 5CKMA 5JAXA 5JZGB 5CEHA 1S0FA 2CGOA 3TRSB 1A6CA 5IFTA 1ZREA 1UYPA 5DN2A 1VMFA 3SMHA 5JXJA 3U4XA 3DL3A 3LDBA 1CESA 4Q4V2 1TNFA 3NNLA 3FWEA 2VXJA 1UMHA 1L3JA 5KC6A 2HWB2 1RVF1 1VAKA 2XLGA 1YUDA 1FPN2 5FR3A 3OBAA 3VBFB 1LECA 4E9KA 1VBA3 3LFMA 4R4ZA 2WA4A 3ZO0B 3PIGA 1J1LA 3VBUC 2VAUA 1XNTA 1R091 5BNOB 4EZHA 5FYVA 2X5IB 3CDZB 4MO3M 1JZ5A 4K1ZA 1G9FA 3THTA 1QQP3 3IZOA 3KZ4C 1DQ1A 1HB3A 5E88A 4KG8A 2ZX2A 1LOFA 4ZU5A 4BISA 3HVDA 5LY1A 3WP5A 5AFBA 4E8CA 5KWRA 2ZGSA 2ILMA 2DTYA 4JQTA 4QU2A 4Y1UA 5JLVA 1X33A 1BK1A 1NY72 2CAUA 2R042 1F5FA 4GJZA 4TXWA 5LY2A 4GKXA 1AYN1 3TEYA 1IOAA 1ZZ9A 2QQOA 2YY1A 4TWTA 1SCRA 2RS52 5FWEA 2Y6JA 4RS5C 3DXTA 1FV3A 1KEXA 3LWCA 5DQ0A 3A7QA 3FL7A 4AVBA 1AX2A 3J9SA 4Q4Y2 3I59B 4N90A 3AP4A 4IETA 3UK9A 2XG3A 3AYEA 3FFZA 4Y22B 4LEJA 4DY5A 3PLQA 1OA2A 4LNVA 2PHUA 4BOWA 4Q29A 3H1YA 2UYAA 3U37A 4Z2WA 1K45A 1W6QA 1NCQB 1POQA 4R9AA 5JUVA 2ZMNA 4D8MA 1CAWB 4YZ5A 1DQ2A 3RDIA 3VBHB 1XC6A 2JDHA 1PO23 1TVGA 4QQLA 2EAKA 4DPNA 1OVSA 3PJQA 4X6QB 5FAXA 3ACIA 1T6BX 2P2KA 2AYHA 2I74A 2Q1ZB 1OKOA 1SHWB 1V70A 4C1XA 1PGW1 1UU5A 3RGBA 3NVCA 5F3GA 3TWIA 1YLLA 1JZ3A 1E5RA 3H3LA 2D7FA 4IEOA 4UI9L 2AC1A 5AC91 3H50A 1PX4A 5CFDC 1UF2C 2WNUA 1I5ZA 5FZDA 4OUSA 1RUJ1 4NIAA 4GMP0 3URFA 5C4WB 1VBC3 1FV2A 4V1PA 2BW8A 4K40A 2ID4A 4XCBA 2Y26A 5KR7A 5GLVA 1ASJ3 4LBKA 4U2AA 4BXFA 5HI0A 3WF0A 4D7SA 1G6NA 4XUQA 5A7SA 1ZM1A 3LGRA 3MO4A 3PL0A 4MXWB 4YVWC 5ERLA 5FO7B 4P5HA 3M3CA 1J3PA 4YM3A 4UW6A 5KBFA 1G8WA 3I59A 5A6XA 3A0KA 4Y22A 3O1VA 4PLMA 5D21A 1IPSA 1VMJA 2HWE3 2GZWA 1LB2A 2W08A 5FTTC 2XLFA 2QQMA 3Q8AA 1SLLA 1YO8A 3CLPA 3POFA 5CNAA 3WZ1A 1H4GA 5F7UA 4DO0A 4IV1A 5K4LA 2D6KA 2QZ3A 3H7YA 4BHPA 2ZBJA 4N9HA 1WLCA 3KCXA 1DQ6A 3T09A 3AMMA 4ARYA 3SEEA 5IVVA 1K3IA 1WLTA 1JYWA 5FYYA 3I2HA 1S2KA 2Y8KA 2YGLA 1HDKA 3OD4A 2Y60A 2XJUA 4KI5M 4ZXKA 1DQ4A 2A6VA 2X10A 2P3YA 2WJSA 4K8RB 5FPZA 1JU3A 4LBNA 2AENA 1MEC2 3JUUA 4BA6A 1I9RA 5KXEA 1LEDA 2E6VA 4XQDA 3ZXAC 5C4WA 1GICA 3EMRA 3KCCA 1QH7A 3HT1A 4O61A 5F5AA 4N7IA 3J7MA 4AWDA 2P6CA 2NYYA 1PGL1 1NG0A 3RS6A 1S1AA 3IIIA 1PHMA 1JZ4A 1OLME 2C9AA 2CV6A 4QM9A 2FDHA 2QQIA 3OJBA 2RJLA 2YZ4A 1XU1A 3R4SA 4JV4A 4QHZA 3MGUA 4PF1A 3LQCA 3NW4A 5FP7A 2DUPA 5GZCA 1OLMA 4QPIA 4QU1A 1XSQA 2BOIA 1WCKA 2BZDA 2W95A 4NHLA 3FMGA 1UAIA 2ZJCA 3SH4A 3VZKA 3SXWA 2VGDA 2B9VA 3BPSA 4CSWA 1J84A 3VDDC 1V6MA 2W47A 2VG9A 1H9PA 3VZMA 1W0PA 1Y4WA 4RA0A 4Y20B 3VN4A 5J09A 2JDUA 3WDTA 2OA2A 5FZLA 3B02A 3C7FA 4RQPC 4S2GA 5D2AA 1K5MA 4LOSA 3VD3A 2YFUA 2Z4FA 2J1RA 3J8F2 5F9TA 4CPBA 1UPIA 5C8CA 3QBQA 3RZKA 5A32B 2WL1A 3EBRA 1KFUL 3U14A 2YB7A 3I8TA 4EZ4A 2WFF3 3FX3A 1V9U1 1HJGA 1WGPA 4NAMA 5IAXA 4MX3A 3F95A 3VV1A 4EN8B 1ZRDA 2ZAHA 4OUMA 4Y1XA 4BH9A 5EYXA 3T3YA 1MACA 3ZFEA 3MFCA 4RYDA 2R49A 3VD5A 2ZTNA
chains in the Genus database with same CATH topology
5T5PA 4BM8A 1RHI3 3LSEA 2GN3A 2RS32 2VUJA 4I2OA 5I93A 2MEV3 3VBSA 1PGSA 1ND2C 4QT6A 1RUC2 1IS6A 2DTWA 4NVPA 1QOSA 4QQHA 4XE9A 3WG1A 1F31A 2F4PA 2QJVA 2GSYA 4GB31 1QWRA 1SFYA 1QXJA 2H0BA 1S0DA 2BGCA 5L7OB 4IEZA 5LRSA 4XBQA 4PCRA 5AFEA 3MW4A 3BIWE 2R061 5CU1A 1RUNA 4D7YA 3UJOA 2HWD2 4YVWB 4Z07A 1ZBE2 1Q8PA 4RHV1 3S7EA 3BCWA 3WD5A 4Q4W2 5E89A 3FHIB 3AP7A 3M3OA 4N43B 4X8PA 3EO6A 1QJY3 2LTNA 2RR13 1H8VA 3QD6A 1ZZCA 4LUMA 1FAYA 5CBLA 5BV6A 4AI0A 1SBFA 3WUDA 1XYOA 5T52A 3KGZA 2VU9A 3HAGA 5DUUA 1Y43B 3ZXGA 1W6MB 5KXDA 1PK6B 1SCSA 3AB0A 4LLFA 1MVQA 5K0UB 2RS33 5J36A 5K9YA 3CJIA 2RHPA 5L7OA 2D6LX 1HW5A 1R1A2 4J1WA 1AF9A 1RVF3 2YYOA 4CDQC 2DVAA 1W6PA 4IERA 1MS0A 1H1IA 2EXHA 1RB8G 4FOQA 3FUOA 3AXEA 1S0IA 1FNYA 1R093 1GZCA 4OHXA 4Q8KA 3RWNA 3DPRB 2GALA 4ORFA 5BUVA 1BVP1 2D3SA 4C90A 3JBG1 4WVMB 1QU0A 1N47A 4Z1VA 3OY8B 5FPXA 1HIXA 1UD1A 3CJXA 3VKLA 1BYHA 3HN1A 2Z2SB 2W68A 2IXKA 2UWCA 3WINE 4HFSA 3CU7A 2O8QA 4OI2A 4AEDB 5T5JA 4L11A 1LCLA 4JRAA 2K9ZA 4RQPB 1PK6A 1AYN3 1QXPA 1SMVA 2Z5WA 3MFAA 4K21A 4MXVA 5FFOC 4EN7B 4HPKB 1ZBA1 3NAPA 4CDUB 1DQ0A 4IEWA 4AFMA 3MW2A 2ARBA 1GZ9A 3AXDA 1DGRN 3B5LB 5EWSA 5J98B 5HBAA 1YHFA 5F6KA 2R071 4WZFA 4FTEA 4H3WA 1Z0HA 4WVMA 2HWC2 5GZEA 1BEV2 4L2NA 2DU1A 4YGBA 4Q4X2 2EA7A 1XRUA 2XPJA 5AC93 2DCJA 2MNGA 3K48A 1RUJ3 3MIDA 3VBRB 4K7JA 4KH9A 2WNVC 1RUH1 3V0BB 4WM7C 1EYBA 2OZJA 3RYRA 4KWKA 1DZQA 4QM8A 3D6EA 3I4IA 5J48A 4S2HA 3AP6A 3VBOB 4KBBA 4D69A 1JBCA 1RUF2 2BFUS 2LALA 2VW2A 4MGYE 4HPKA 3WHTA 4CDXB 1HKDA 4YG3A 3IPVB 1U5XA 2VNRA 2CWSA 2WFPA 5EV7A 1LR5A 1HQWA 4OHWA 4BMEA 1WA4A 4EV0A 1TMF1 3ZFFA 4IQPA 4BYYA 1N1VA 4AQTA 4XXAA 2PTMA 3GZTB 1BXHA 5ACA1 4XF3A 5E8AA 4QGLA 2D6MA 1QY4A 4LO7A 2VOWA 3IIAA 5GJ6A 1QOTA 2OW4A 1A8DA 4UBHA 1C1LA 4HK9A 4XHXA 1HV0A 4YW1A 4RGAA 4CP1A 3FBYA 3VBRA 3BOPA 1UX6A 4COYA 5CG8A 3JCIA 2A6WA 5ABJC 4Q4X3 4GXLA 3ACLA 1CPNA 4C1WA 4ZU4A 3USUA 2E9QA 4IESA 2VOVA 3ZYJB 2GNTA 1TME2 4QXKA 3N7JA 3ASIA 4KQ7A 5L36A 4CEWB 5I8SA 2D40A 3W9AA 3MYXA 4FAHA 2OUHA 1FMD1 1POV0 3H1WA 4FCAA 1Q5OA 4B29A 5LEJA 4R9CA 4XDQA 4I0AA 1H8TC 4YFZA 1S2BA 1B35B 3FBMA 4H7MA 2BWCA 4LBQB 2A3WA 4B3NA 1CPMA 1MS1A 4ASMB 3BU7A 1EAH1 2RM21 4Q0UA 5BNPA 2D43A 4FPEA 4JGZB 5DDJ1 1OQEA 2ZCWA 4XIOA 1SLAA 2BFUL 4TZDA 1XNDA 4WM8B 4LO8A 2D6NA 2JG9C 4P9GA 2LUWA 2YUEA 4P9LA 1GQGA 2DU0A 2XJTA 2HWF1 5JIUA 4XHBA 3HMYA 3MDPA 3V56A 5JOZA 2PQQA 4LO5B 4D3WA 1GZWA 4EWEA 2QE3A 2I45A 3ZFGC 4LULA 4A7YA 5T3NA 1Z7S1 2B8MA 4MSVA 1CIWA 2JXAA 3ZN6A 3IKWA 1F5JA 4CDWB 2WA3A 2WNVB 4Q26A 1B35A 2GC0A 1Q43A 4WVZA 4S2DA 1SLCA 2Q5TA 4XF0A 4Y4YA 1V6NA 5D1IA 1PIV1 1JOJA 4UW3A 4PBPA 1E57A 5KHHA 1GSLA 1BVVA 1S0EA 5C9AC 1SEFA 3IWZA 3KT1A 3WCSA 4RHV3 1OA4A 1FPN1 4TSVA 1AR62 3KGLA 1CJPA 3O0WA 1EPZA 1CQ9A 1ND3C 1LOAA 1RIRA 1RUE2 4QPGC 3D8CA 3WR0A 4Q1RA 1MS4A 4DXZA 1PO11 2PHWA 2CY6A 1NA1B 2RMU3 3SNMA 1DZTA 4HN1A 3WVJA 2CWMA 2P3JA 4I3PA 1X82A 1BCXA 2Z79A 2BYVE 2A73B 1RMU2 2ZGLA 1LESA 3SCHA 4X8NA 5B2GB 2YV8A 3DV8A 4XTMA 5JZGC 4Q27A 4QQPA 4YGCA 1NY71 5CFCC 2WSVA 5ABJB 3RQ0A 3B9IA 4SLIA 2PLV3 2C5DA 3L2YA 3VBFC 2PHLA 1WW4A 3AYCA 3KB5A 4CTEA 1Y7BA 3ILFA 2WQ4A 1PVC1 2R16A 2ZGPA 4A7KA 3JBG3 1FYUA 1SLBA 3DUIA 3V65A 5BNOC 1DDLA 3LA2A 2X5IC 1UKRA 3LAGA 1SLIA 3LOBA 3THPA 4AI3A 4DMIA 1H8TB 2OYZA 2QQPA 4YM0A 2VOXA 1NA1A 1QJU2 3OF1A 1RUE3 1LU2A 1D4M1 2A5ZA 2GDFA 2RJKA 3RI9A 1ZZ7A 2JG8B 4AEKA 1CN1A 1ZBA3 1VBB1 3M3EA 5JOXA 2D6PA 4YW2A 1VRH2 1XE7A 2JG9B 2NN8A 2ZGKA 3AJYA 3PNAA 3POWA 4JTNA 4LO6B 3TN91 2DVFA 4RL7A 1VP6A 1HRV1 2VVFA 1A3KA 4XJWA 3TNPB 3OYWA 4TLFA 1H30A 4D7TA 5C8WA 2CGPA 1LRHA 3R0RA 3V0AA 4K3UA 1IGOA 1NCQC 1RUI1 2R073 5KHKA 2G9FA 3VBHC 1MZ6A 3ZFGB 2RS11 1VJ2A 4KNCA 3GHMA 3JU9A 4JQRA 4AFCA 1UZZA 2WS91 2ENRA 3WT3A 5DZEA 1VBA2 1RUH3 1ZZBA 3VGIA 2WSUA 3ETQA 4N53A 4ES8A 1JYIA 5C4WC 2CAVA 4KWLA 2NZ9A 1PZ8A 1VAMA 1AL0G 1ENQA 3AMPA 1QQP2 1LGBA 2VULA 4XIKA 1GANA 3RYKA 3ZSKA 4BIFA 3PTYA 4BMBA 4BWOA 2D44A 3ZXKA 1VALA 4AGRA 1V6KA 2IXJA 3AZYA 1GBGA 3BB6A 3SHRA 1Q56A 3NWKA 4Z82A 5CG9A 2A6XA 3UKTA 3MLKA 5DZFA 1XNKA 2E53A 2WT1A 2IFRA 1UCXA 5CFCB 1X8EA 4E4DX 3LCPA 2WT2A 2JENA 3UJQA 5C8CC 4LUKA 1PO22 3E97A 3NO8A 4XW3A 1IPJA 5LK5A 4DINB 4ONUA 4E2SA 5C6CA 1W6QB 4UW4A 1Q3EA 4HANA 4XF4A 3VKOA 3AMHA 5A33A 1RJ8A 2R32A 4OI1A 1G9CA 2R30A 4XETA 2IXCA 1S0JA 3DF0A 4AVCA 2ATFA 5FQ0A 1HQLA 3VBSC 2W52A 3TB0A 2NP0A 2VNOA 1KITA 1VBC2 3NV3A 4AF9A 1AR81 2BUKA 1S0CA 5FDBA 1ASJ2 3JZVA 1CJDA 2F6BA 3B93A 4M00A 4Z92B 2WNUB 1COV1 1EAH3 1YI9A 2ZHKA 4YRDA 5I8YA 1Q8SA 4YZ3A 4DRVA 5DDJ3 2YHJA 4M0NA 4AQ6A 3ES4A 1WLWA 2HWE2 4XXPA 1DGWA 2BTVC 4MVTA 3AKSA 4JDNA 1GLHA 3ZIXA 3DKWA 2HWF3 2UWAA 3WP6A 2G9GA 1EV12 2P34A 1ZBE1 2ZHNA 2ET7A 2ZGUA 4Y5Z0 3FLRA 4IV1B 4QGMA 1JN2P 3PMEA 1O3RA 1Z7S3 4DZGA 2SLIA 2N7GA 3RYPA 1LGCA 1R082 1NXMA 2WLPA 3KMHA 2DCKA 4L9BA 4AW7A 2BWAA 4XFIA 4CEYB 5L7OC 5L19A 1PIV3 2ZX4A 1VBE3 2DWRA 2GC1A 4HT1T 5CB7A 5LK7B 2UY8A 4FTBA 2EXKA 1ZVFA 3N35A 1HRI1 4E27A 3J26N 1ZRFA 2PHDA 2HEYF 3J4UH 3E6DA 1JH5A 4AEJA 4AQSA 4K9SA 4FAGA 4QPIB 2Y0IA 1XQNA 4N43C 4YZ2A 1DGWX 2GC3A 2DVBA 1EV13 2BBVA 1ZA4A 1AXYA 1C4RA 4OFGA 2UY9A 3NJZA 3VKFC 2SBAA 4EJRA 2WFF2 1PK6C 3VZJA 4F8AA 5A3LA 1K5MB 4AVAA 2GMEA 3WQ7A 5FMOS 5K0UC 4AI2A 5C8CB 1UMZA 1ONAA 1SBEA 3NAPC 3MPPG 4CEYA 1R083 1RHI2 4IEQA 2BVBA 2ERFA 2ZKLA 2QCSB 3WUCA 2MEV2 2PAEA 1C57A 1QJX1 3AZXA 3ZFEB 1PVC3 2XGXA 2WT0A 3W59A 3D0SA 4H7LA 1TNRA 4NR1A 3CNAA 2BNOA 4P9XA 4IEXA 2EXJA 3DPRC 3VBSB 2QKDA 4B4RA 4MV2A 2XH6A 4AQ2A 1BBT1 1LOBA 3H1MA 1LHNA 1D4M3 3RNSA 1RITA 4AEDC 1VBD2 2ZX0A 4W6XA 3D0JA 4RD7A 5DG1A 5BNQA 1C5IA 1B09A 4GMP1 4L99A 2E7QA 1VR3A 1QDCA 5IK7A 1AR91 5E16A 4IV3A 1OFSA 1NXD1 1DYKA 2BQPA 3TN93 4JGYB 3AX4A 4NPRA 4RR3A 3AP5A 1QJY2 2RR12 3VHPA 4ES9A 1HRV3 4CDUC 2DUOA 3ZXLA 2XBO1 3JD71 1WD3A 1BMV2 4MH0E 1RUI3 4IEUA 2D3RA 4FP2A 3AFGA 1RUD3 2RS13 2D5FA 3GYDA 4PLNA 3QLQA 2WS93 1RVF2 3IMNA 3RJRA 3KLSA 1DZRA 2O0OA 1ZZ6A 2K2SA 4XFCA 2UURA 4MGIE 3CJIB 1HLCA 4YNIA 4W6YA 5FMOL 4W6WA 1R092 5HCBA 3VBRC 5EXOA 1W6PB 3CO2A 3VL8A 3VBUA 3TNQA 2ZACA 1VBD3 2EIGA 3VBOC 4DOUA 2A75A 4JGYA 2QDNA 4CDXC 3AFKA 2UWBA 2DF7A 1EY2A 2YXSA 3ZSEA 4PIYA 3WXPA 2OVUA 3ENRA 1TME1 3H7JA 4K8FA 4FOYA 4M3CE 4MGZE 4XQ4A 1WMDA 4FOWA 2PHFA 2ZS6B 3E6BA 5J96B 3MIFA 4MLOA 1AYN2 3RG0A 3ZDSA 2ZAAA 1WMFA 4HKOA 4JAAA 4M3CA 1SBDA 5L73A 3POSA 1W6OB 5GKAC 4RS5A 4Q0QA 3RJ2X 4HBNA 3VHNA 1QH6A 1UL9A 5GM0A 2VOKA 2DVDA 3HWJA 2OPKA 1LU1A 1AX1A 2GH2A 2BNNA 3NAPB 1RUG1 1NCRA 3AM2A 2JJ6A 4YW3A 1UW8A 3LOIA 4G3YC 4HMZA 2W39A 1AR71 4Y1ZA 4Y24A 1H1AA 4LLOA 1PGW2 1T6GC 2ZGQA 3ZYGA 2K0GA 5A3MA 5GLZA 1WW6A 4YARA 1HX6A 3AKRA 5AC92 2DV9A 1RUJ2 2GMPA 2ZZQA 3PHMA 4CEWC 1N3OA 4FPCA 1WUVA 3N3HA 4GKYA 1PNFA 3UKNA 1AR83 1X7NA 1ZZ8A 1SDWA 2NMNA 1DLLA 1N1TA 4B4QA 2FBEA 2GH8A 1REEA 1COV3 4G4FA 1YNAA 1B35C 3INAA 4FPKA 3ZXFA 4L92A 1ENXA 2WZR1 1W6OA 5DG2A 2IFWA 1H2MA 3ZSJA 3E5UA 2C1FA 4LA3A 4CYDA 1O3QA 4CRQA 4P9WA 4JGZC 2V09A 1LEMA 1MS3A 3I7DA 5BY5A 4WM8C 2UU8A 5K7PA 3OGJA 1AL21 4UXAA 4O9EA 2H6BA 3ZFFB 1REFA 1FOD1 2CYFA 2QUOA 4FVVA 4AI1A 1CAUA 3RRDA 2XWJB 1LJ7A 4XF9A 3JQWA 3M8LA 1H4HA 2XL7A 2A71A 2GNMA 4AG4A 1RGSA 1QGLA 3AMQA 1GR3A 4PIZA 3ZPYA 3SISA 4E4ZA 1LODA 5CIRA 1PGL2 1UIJA 4CDWC 1RMU1 2PN5A 3ZYRA 4YG6A 2PYTA 3WOGA 1NYWA 4P14A 2DCTA 2AZ5A 4PDWA 3USUB 1HRI3 3M1HA 4JDOA 2TUNA 1KJLA 4YYOA 4G9SB 2GU9A 2JECA 3HR9A 3PVOA 2A7AA 3O14A 1W0OA 2CTVA 1PZ7A 1WW5A 2XJQA 4HSLA 3ECQA 1Q8OA 1C8NA 3N7KA 1FT9A 2JE9A 1DFQA 3KSCA 5JCTA 1NA1C 2X53S 1LHVA 4XOGA 2ES3A 3ZSMA 3TOJA 4WV8A 1J59A 1Z78A 2NLRA 4GH4B 4WBBA 5BNPB 2VVEA 4YM1A 3QH7A 2NPIA 3OGGA 4FT8A 2P17A 4Y26A 3AZVA 3O12A 2ZX3A 4XJ8A 3POYA 1H1MA 1OOPA 4HVQA 2DFCA 4AHWA 4I09A 1WMEA 2ZMLA 3WDWA 1U5ZA 1EP0A 4JTOA 2BNMA 4AGGA 5K8SA 2B5HA 4YW4A 1HXS1 2XVKA 1QJX3 4HKWA 2GNBA 1C1FA 2ZA9A 2VMIA 3MZHA 1ND2A 3APBA 1GZWB 2PHXA 2I07B 3HIFA 4TYSA 3WG3A 1OFNA 3FUQA 1BBT3 3T1MA 3IDBB 2QZ2A 1CR7A 3ZN6B 1GV9A 5JPNB 2PA7A 1TQ5A 1PMIA 1C8M1 4OI0A 2FZ2A 2BEOA 4NHMA 3VHOA 4GMP3 1WBLA 4RHV2 3FLPA 4AVTA 2HJIA 1UU4A 2TEPA 4N53C 1AR93 4GH4A 1KRIA 1VBA1 3DGTA 4YM2A 3ME2A 2BVVA 3ZSLA 2JG8C 1ULEA 4NO4A 3AP9A 1AYM1 1LOGA 1W6NB 3V64A 2XBO3 1V9U3 2RMU2 1AZDA 5DUXA 4Q0VA 3G7DA 5FLIA 5JOYA 2PELA 3B00A 2D98A 1AJOA 4KG0A 4DQAA 4BLJA 4EWAA 3B01A 4KGGA 2WLQA 4N7UA 2FMDA 3JQXA 1MQTB 2KXLA 4QMAA 4GB33 3B94A 5T5OA 1ZRCA 1UU6A 2PLV2 3VZLA 4ITCA 3TBDA 1X8MA 4XMAA 5DUVA 4GALA 3AKTA 2O8OA 2C0ZA 2R063 3JBG2 3WW1A 2XKOA 4B7KA 4R4XA 4Q4V1 4JDMA 2WKKA 3R4UA 2D6OX 2PAKA 5IT6A 1OLRA 1PO21 1WLDA 1AJKA 3ZIWA 2HWB1 2ZHMA 1W6NA 5IK8A 2B9UA 2VQ0A 1J58A 3NL1A 5KXCA 5GZDA 1MZFA 1POV1 5EFUA 1ULFA 1QHDA 3S6PA 2XVLA 4JVAA 1MR5A 2EVXA 1ZBA2 3IDEA 4K6BA 1LOFC 3WDUA 3RMXA 1U12A 4LBQD 2XL9A 4LE3A 3EJKA 1MQTA 1ASJ1 4AFAA 3AK0A 4C91A 3ZVXA 2GN7A 1S0BA 2XHKA 1RUG3 1U5YA 3WP4A 2RE9A 1DU3D 3LB9A 2R041 2R072 2B39A 3WDYA 1AR73 3OYWB 3VKMA 2RS51 2IXIA 2FMYA 4LBLA 1NOVA 5H9PA 3RPQA 1GFF2 3V0AB 4Q4Y1 3H3ZA 1CD3G 4X6RB 1XNBA 2R0HA 1LHUA 2GNDA 1NQDA 2ARXA 3AYAA 3W58A 1G9BA 2V5YA 1RUH2 4I0BA 1V00A 3JB4C 4FXGB 3R4DB 1GNHA 1YFUA 1NE4A 3B7MA 4XFAA 3SITA 3LA3A 4R9BA 1X50A 4I30A 1ENSA 4N53B 4B7EA 1LOEA 2WNUC 3NKTA 1VLNA 2XVGA 1CAXA 3S7IA 3SCFA 5F1RA 1N3PA 3H3UA 5I0TA 2X29A 3M3IA 1I3HA 3KT4A 5JSOA 2ETEA 1AL23 2ZKNA 2ZMKA 3IT8A 3PMSA 5JIAA 4QPYA 1DF0A 2XJVA 4XZPA 1FOD3 1F8VA 1AXZA 1O3SA 3G6JB 1AVBA 1SQ4A 4IEVA 1XXNA 1JUHA 4A7ZA 5JR7B 1NLSA 3T1LA 1R1ZA 2NQYA 4IV1C 1WCDJ 4C0BA 1ULDA 1O4TA 3U11A 4AYUA 4I02A 2O1QA 1KD7A 4EWDA 1MS5A 4Q0PA 3ZXJA 4YLZA 4QQ2A 5DZGA 3N7MA 2AR6A 1N3QA 4LE4A 5FLJA 1DQ5A 4LHLA 3VKNA 5I91A 2GAUA 1QOOA 3ILNA 1LKNA 2G4IA 3OBTA 2B7YA 3CL1A 2DUQA 3ZXEA 4CEYC 4DFSA 4EN6B 1QF3A 1MEC1 2EF6A 3TYJA 1UPSA 2TBVA 3PVBB 5GLWA 5JSPA 5A33B 4Z8BA 2PHRA 3A0NA 4YVSB 1TMF3 2P37A 3AJZA 5BYNA 1EAH2 5FQ0B 2R6QA 1OPMA 1XYPA 1C5HA 5DDJ2 5ACA3 4QPIC 5BNNA 2IZWA 1V6JA 2X8KA 3B9CA 1OD5A 2PFWA 4XQWA 1WBFA 3LZZA 2E63A 2JEMA 4HSJA 1OKQA 2ZGNA 3WDXA 4EN9B 2HWF2 2PHTA 4L8QA 3IDCB 3SH3A 1J3QA 1O4YA 2YC0A 4IV3C 4KU7A 2QFEA 1K5MC 4XF1A 1HXS3 2PAMA 4AI8A 3GBGA 3J8F1 4XJUA 1FATA 1Z7S2 2JX9A 2A3XA 2D3PA 3ZFEC 3VUOA 2A6YA 3GNEA 1ZNPA 3HBZA 4Y1VA 4YVSA 1FMD3 2W0XA 2VPVA 3HT2A 2WC2A 5SV5A 3MIBA 5GALA 3WW4A 4FPLA 1PIV2 4FPFA 1VBE2 2RS31 1C8M3 4XEZA 1YRZA 4FP3A 3RZZA 3U0ZA 4AEMA 2VH9A 1RUC1 5T50A 4FPOB 2I2SA 3WW2A 5C9AA 2RM23 4OVEA 3UV9A 5IK4A 3M3QA 1JUIA 1ND3A 1TEIA 1KDMA 1PO12 5D8AA 4QPGA 1AYM3 5FLHA 1ZX5A 4JGYC 4FOVA 2DVGA 3KM5A 4Y1YA 2HWD1 2WIIB 1XNCA 1BKZA 1IKQA 4C0HA 4P9YA 5I0SA 3EXUA 3K51A 3GBWA 4WVVA 1QMJA 4Q4W1 4K20A 4HZFA 5JZGA 1PNGA 1V6IA 4MUVA 1OMIA 4FPHA 5JVVA 2GMMA 3S30A 1J3RA 3E5QA 1PVC2 3WW3A 3CJIC 3L2HA 3VBFA 5T5LA 4DNYA 1NCRC 1DBNA 3QOPA 4Q4V3 3A4UA 4UW5A 1CAVB 2XKPA 4FBFA 1R1A1 2HWB3 1OQDA 5BNOA 1FPN3 2X5IA 1A8MA 3EQEA 3KS7A 1D4M2 4S2FA 3WG4A 2B46X 1POV3 3MF9A 1CONA 4YGDA 1VB2A 1PO13 2HKXA 3N36A 1RUOA 4E4SA 4META 2BPA2 4HVOA 1VBB2 1F2NA 3WX5A 3TN92 1H9WA 2Q30A 4IL7A 4BIOA 4ZU7A 1REDA 1HRV2 2E7AA 3GZAA 3IM0A 1D0HA 4I0WB 3WHUA 1PVXA 3O7OA 4ATEA 1YFXA 4IV3B 1C28A 4DS0A 4AHXA 1OA3A 2R043 1OQ1A 1RUI2 4HKLA 3NV2A 2ZX1A 1AX0A 1ULGA 4H55A 4RR3B 3MICA 1U5IA 2XJRA 1RUD2 1KDKA 2RS53 1NCQA 2WQZC 3IN9A 1IS5A 2RS12 4YSFA 5LEKA 3MIEA 1CAWA 2EXIA 3VBHA 4Q4Y3 3ZYIB 1CAVA 5I0RA 1UN1A 2WS92 1J1TA 3ZMNA 4XFGA 1ENRA 3FE5A 2LM3A 4XPVA 1RC6A 3P3PA 1KXGA 2WNEA 4GA9A 4O9GA 3R6SA 1JW6A 5JOWA 1YFWA 5DXDA 5GLTA 2QNKA 1C3HA 2HWC1 1BEV1 2OZ6A 3WQ0A 3ST7A 4ISRA 3AZWA 2EAAA 4L97A 4LO4B 4Q4X1 1OI6A 4DRRA 3I54A 4BQ1A 1X36A 3VBUB 5C33A 1IPKA 4INDA 2YDEA 1VBB3 4MXWA 4HN0A 2R1BA 3OBRA 3PVNA 1H2NA 1W2UA 4PDWC 5FOBB 1OPOA 1IKPA 3H9AA 1YI7A 3MW3A 3LA7A 5FBZA 3X29B 1RUF1 2XWBB 5HCAA 4YGEA 4LBOA 4RSUA 5FOJB 1O4ZA 1SACA 2YGMA 5H9SA 1NE6A 2ZGRA 3ZFFC 4WVWA 2CNAA 4XJZA 1I1EA 1FI2A 3D5OA 5FREA 4XFHA 4RGGA 4M3CB 4XILA 4MZUA 2HEWF 1D2SA 2D97A 1MZ5A 3ZN5A 4FXKB 1YXWA 4RS5B 2OUJA 1GKBA 4Q0SA 2ZGMA 4NWVA 3LKJA 3OD0A 3DN7A 3OCPA 2IWGB 3MI8A 4W65A 2XJSA 4WZCA 4OZXA 1OOPC 3TAYA 1NCRB 4CZSA 1G9DA 1MEC3 3H8UA 1IHMA 2VECA 2CGNA 4HK8A 4MYEA 3O0XA 1AR82 1ALYA 3SH5A 2A6ZA 3ALQA 1VIWB 1COV2 3KCYA 4UBGA 2CL2A 4BPZA 5LRRA 1LULA 5CFDB 2ZZJA 2KM2A 3T2TA 4E2GA 5JWPA 2VW1A 4F3JA 4Y20A 2VQAA 2ZPXA 1YIFA 2Y0OA 2AUYA 3WP3A 1WD4A 4H14A 1BZWA 1YJLA 3OPZA 4QD2A 4GH4C 4GWNA 5BNPC 4JRLA 5A32A 4AFBA 3VZOA 2A70A 4NWWA 3QACA 1QKQA 5EYYA 3RMYA 3J8F3 5FCCA 2VMGA 1XYNA 3SLIA 1SFNA 1QNYA 4I01A 2RMU1 3P3NA 4N9IA 1XE8A 1CAUB 4LT5A 2R1DA 1Q8VA 1CVNA 2ZHLA 2VVDA 1PM7A 2B45X 4OHVA 5CFDA 2ZGOA 2ZGTA 3ROUA 3BPZA 1MS8A 1RUC3 5F5QA 1HV1A 1HRI2 3S0MA 4QQOA 4HETA 1IZ3A 2VY0A 4F83A 3QH6A 2PLV1 1LENA 3WLUA 3UKVA 4YVWA 1JTZX 4FQ4A 2VNGA 2XLAA 4PDWB 5BPXA 3E6CC 2V73A 4GQ7A 4P9JA 4HL0A 5GZGA 2HWD3 2IXHA 4N43A 5AVPA 3LSDA 1M06G 5KHGA 4AE2A 1ZBE3 4ASLA 2WINB 1AR61 3MPBA 4IEPA 3VDDB 1H2LA 2KA3A 4M01A 2JDZA 4AGVA 1KJRA 1RUE1 5EJ3A 4Q4W3 4ISQA 1W6MA 2JE7A 4XJAA 5JSRA 1LTEA 2JKBA 4R9DA 2DFBA 2FZ1A 1FX5A 5CA6A 5K0UA 1MQTC 2Q0AA 4COUA 2TNFA 1QJX2 1DG6A 3HD8B 4OHYA 3IBMA 1OOPB 1YIPA 4FQZA 4QX5A 4BZ4A 1QDOA 2Q1MA 3RI8A 4OI4A 1EPWA 1IS4A 1R1A3 1UIKA 3HQXA 4IEYA 3DPRA 1BBT2 2AH2A 4AHYA 4YFWA 2AREA 4XFFA 1ND2B 3B69A 1H0BA 4OULA 3WCRA 3OY8A 5JDBA 4A2UA 5H9RA 4AEDA 2XJPA 2P3IA 4COZA 5AVAA 3VDDA 1N1SA 1RTVA 1URXA 3VLBB 1AR92 3GALA 3MF6A 3N7LA 3ATGA 4FO9A 4PQ9A 5IUQA 4RQPA 4R8HA 4F7ZA 1NLRA 4LBJA 2E7TA 2XBO2 5SV8A 3JD72 5CADA 1QJU1 1V9U2 4CDUA 1G9AA 2YMZA 4XFBA 1O5LA 5JPMB 1JHNA 3BALA 5F6LB 5JMCA 1YCIA 3ZXDA 4BLIA 4FPJA 3O0VA 5CAZA 4K1YA 3WY6A 1QXRA 4CP0A 1WW7A 1VRH1 4LR4A 2Z69A 2Y38A 2JICA 3WNXA 4GB32 1ZRRA 1VAVA 4XJ9A 2MHFA 1MZEA 2H6CA 3D4KA 3WG2A 4GULA 4CP2A 1VB4A 4CDQB 2R062 2NM1A 2HWC3 4FTSA 1BEV3 3GBFA 1D0GA 1WCSA 4AXOA 3V0BA 1QJZA 2QVSB 4LTAA 3Q9OA 1N1YA 4YZ1A 3VBOA 5J7MA 2AGSA 1LHOA 3NKGA 4CDXA 1GQHA 1O7FA 3MIGA 2VW0A 3USSA 4NOTA 1CGPA 4Q2FA 2XUMA 3IPVA 5EZWA 4KU8A 1ULCA 1KS5A 4MGKE 1RUF3 1KFXL 1BJQA 3JD73 4JCKA 1OLQA 1LGNA 5IK5A 3FFQA 3BOWA 1DIWA 1QQP1 5I0UA