4BWOA

The fedf adhesin from entrrotoxigenic escherichia coli is a sulfate- binding lectin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
b'SAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGNKKCRFTGFEISLRIPPNAQTYPLSSGDLKGSFSLTNKEVNWSASIYVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F18 FIMBRIAL ADHESIN AC
publication title Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 31
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1210 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bwoA00
4B4PA 4BWOA 4B4RA 4W6YA 4W6WA 4W6XA 4B4QA
chains in the Genus database with same CATH superfamily
5J3UA 2VU9A 4KG8A 1MQTC 2VO5A 4H3WA 1A8MA 3O1OA 4Z8BA 4YW3A 5CVRA 5ACA3 4XBLA 2HEWF 4ISRA 4M3CF 4OI0A 1H8VA 3IDAA 5FPVA 1ENRA 5FZMA 2AEYA 5JLVA 3B69A 2JX9A 3FBMA 4L11A 1IPJA 5EP9A 2WYSA 5G05L 5ABJC 1KITA 4HK8A 3VZJA 4QGNA 4NAOA 1C8NA 1D4VB 3FHQA 3OUHA 3ZFGC 2B45X 5EWSA 4LBQD 5C33A 1V6OA 4L99A 2ZHLA 3N4MA 1FPN2 1QH7A 3RYRA 1H8TB 1DGRN 1LOGA 2WNVA 5F37A 4O65A 3UKTA 1QJX1 2RR13 3ZFFB 1JYTA 1US3A 2ZTNA 4NOTA 3MUY1 2R042 4RR3C 3A0KA 4HK9A 5EYXA 1QJU1 2E32A 1S4CA 4K1ZA 1ZBE2 3AMHA 3P5BA 4Q4V1 2J1RA 5FIXA 4FSJA 4W6YA 5JI9A 3OF1A 5HV0A 1RITA 1U5ZA 4IL7A 5F2SA 4XDPA 2FCUA 5D8AA 1AXYA 1W6OB 3H42B 3WY6A 4LOSA 4CP0A 4RN5A 1XNKA 1JZ3A 1HQLA 4M3CE 4CU7A 4X6QB 4ASLA 1OLRA 1RIRA 5BY5A 1FXZA 1SFPA 4XXPA 1OT5A 5T52A 5B2GB 3PURA 5JIUA 4F83A 3EO6A 5FKCA 1S0EA 4OHZA 2WT0A 2VL4A 2KD7A 5JZGC 2LROA 2NPIA 3TB0A 2WNVB 4CDQB 1VR3A 4ZU7A 1OBNA 2Z4FA 3OGRA 2WIIB 2P3KA 3I4IA 3K46A 5D2AA 4CXYA 4QDRA 2CL2A 3WDYA 1IKPA 2CDPA 2WO2A 3QCWA 3VL8A 2CAVA 2WT2A 4CCCA 1HN0A 1U5IA 3QH7A 4CDUA 3FZ3A 1DHKB 2VVDA 2DFCA 5D8AB 1MEC3 1ZRRA 2XL7A 1A8DA 3GHMA 4GWIA 4AHWA 3AC0A 3FHIB 4LBKA 5FY4A 3JD73 3TN91 2E26A 1TNRA 2VPVA 4A3ZA 4JGZB 2VMDA 5EJZB 3WP6A 3Q8BA 1LHVA 1RUNA 1KRIA 5J48A 2ZKLA 5C3QA 2ZPXA 2IWGB 2YYOA 1O4YA 2RMU3 1LOCA 1GQPA 4YM0A 1SLTA 2FDJA 3ZXFA 2WLPA 3N9QA 1W8WA 4PIYA 3AMMA 5F5CA 4GWNA 3ZYRA 3NMBA 3A4UA 4N7IA 4XZPA 2P4EA 3VKOA 4E2GA 1S55A 2JDPA 2WABA 1JW6A 4CDXC 5JPMB 4CEWA 4COWA 4QQLA 2ZEZA 3GBFA 2Y26A 2RR12 4DRVA 3CU7A 2EXJA 1HXS3 1D0GA 3C7OA 2C4XA 4CDUB 5FYZA 1Z7S1 2RV9A 3MI8A 1NA1A 5E89A 5T5LA 3W9AA 5JUVA 4QQHA 5BUVA 2RM21 1J59A 1HB3A 4J1WA 4IE0A 4RS5B 1KDKA 5FBJA 4AGVA 1E5IA 2VULA 1FNYA 3AVRA 3VLBB 1ULOA 1H4GA 1PO13 1Y9QA 1UMHA 3MPPG 1VALA 3AP6A 2FDIA 1BKZA 3RZMA 4CPBD 2DWRA 2UURA 1G9FA 1I3HA 1ALYA 4M00A 4A42A 5GZFA 2YB7A 3MHZA 3QACA 4OQ8A 4Q4W3 3VBRA 1UY2A 2IVIB 1IG3A 2ZHMA 2ZXQA 5T5PA 3PU3A 4CEYA 3JBG3 3LFIA 4MO3M 3MIGA 4IXLA 1JS9A 1RVF1 1N1YA 4J6GA 1YFUA 2UY9A 4IE5A 1MACA 3VKFC 5EJ3A 1G9DA 2XH6A 2RJLA 5KHKA 1NA1B 3BB6A 4LBQB 3SEPA 1KFXL 1D7PM 2GAUA 1O59A 2MHFA 3ZM8A 1IGOA 1RUF3 2VBPA 1GOHA 1PHMA 4QXKA 5BNQA 2YBSA 5C7GA 1MEC2 2EIBA 1BBT3 2FZ1A 3PVOA 1C28A 4QGLA 1LGCA 3JD72 4CYDA 1OI6A 4DEQA 2VECA 1PO21 4QX5A 5J36A 1XSRA 1RUD1 2WWJA 1X82A 3UGGA 2UWCA 4DB5A 4XJAA 3ZN5A 3VD7A 1K3IA 2RMU2 1NLSA 3WNPA 5A3NA 4I3GA 3GCWA 3UV9A 1RUH3 3VBRB 3NKTA 3OGJA 4MADA 3RZJA 2XPJA 4I0BA 2XLAA 4LT5A 1CAUA 3T4HB 4CDWB 3NNGA 1EPWA 3M70A 4IV3A 1TQ5A 4JHTA 3O0XA 1U5XA 4XETA 4DNYA 4EYUA 4LEJA 2KA3A 4BA6A 1CVNA 2AACA 3MFAA 4MGYE 2W9XA 4CDQC 1BEV1 3A0NA 4LO4B 1HXS2 1X36A 5F5QA 5KHGA 3ITQA 2VW1A 2EIDA 1CR7A 1ULFA 3CF6E 4OI2A 3VKLA 3UNPA 1E57A 4B1LA 2VW2A 2Q4SA 2BW8A 4Q0UA 1NAEA 3N9PA 1GLHA 2XKPA 2WS91 1UX6A 2O0OA 2VD7A 4HETA 1XB9A 1NY72 4XIOA 3RI9A 2E53A 2HWD1 1PO12 5F3EA 2WBKA 3B02A 3I2OA 3CLPA 1IS6A 2GC0A 2ZGKA 3NV1A 5EXOA 1RHI2 4JGZC 1AR81 1PVXA 4TLGA 3POEA 4LLFA 3HN3A 1GQGA 4XAAA 5J7MA 1H30A 3B93A 3NAPB 1VP6A 4IGPA 4XBQA 1U0AA 4GD4A 2PHUA 1VMJA 4LLOA 2IVJA 4ITCA 1LOAA 1B09A 2PLV3 5F5AA 3ZXLA 1FX5A 1OLQA 1PK6A 4XCAA 4WVVA 2J42A 3B7MA 3AZZA 1T6GC 2TBVA 3JBG2 3POWA 4WM7C 3UJOA 4BPZA 2GC1A 3NNMA 4AEJA 5A32A 1MPXA 1QOSA 2DVDA 4Y1ZA 1WMDA 2OA2A 5FKBA 2PHDA 3WF2A 3WF1A 3CHXA 2D6MA 2WL1A 1CESA 3SITA 2HWF3 1OURA 1JUIA 1RUF2 5T5OA 1F8VA 5JOXA 2W5FA 2EF6A 4A7KA 1QOTA 1BBT2 1W9SA 4YZ3A 2YXSA 3ZSKA 5IATA 3FJSA 3AX4A 2R1BA 3MIHA 3PL0A 4NROA 4V2VA 4XYXA 4XZUG 4ZS2A 4RS5C 1SPPA 2I07B 2VNGA 2WZR1 3C2UA 4UW3A 3DCQA 1OMIA 3HT1A 5JXJA 2VOXA 3CZJA 2JECA 2V73A 3UK9A 1TZOA 1F15A 5H9SA 3WDWA 3QH6A 1KD7A 4LO7A 1QU0A 1LHUA 1RUH2 1OH4A 1O4TA 2CAUA 2E7AA 3NJXA 3VBHB 4DQAA 5CBLA 4K8FA 3ACGA 4JX0A 4K9SA 2HH9A 3QLQA 4XJWA 4TWTA 5C4WA 1RINA 5J37A 4BE3A 3ILRA 3LPGA 2C9KA 5KHHA 3I97A 5IVVA 5FK7A 3TRSB 2P1BA 1R64A 1UPSA 2VTFA 1VBA3 3GBGA 5JMOA 3RYKA 4AAPA 3ZPYA 1XBFA 1Q3EA 1C3HA 1MS8A 1CD3G 2DCJA 3ELNA 2R0HA 2ZA9A 4L8QA 3HQXA 5KXCA 2ZAAA 2OW4A 2BVVA 2HBUA 4XMIA 4Y3OA 3WZ1A 3WF3A 4C0HA 2QBXA 1FAYA 1W2OA 5CAZA 1S2KA 4YLZA 4W50A 1PNFA 4FPCA 1QNWA 3GHNA 4N53C 1DYPA 3OY8A 2LTNA 1NKGA 4ZU4A 4YVSA 2Y6KA 2ES3A 4NHKA 1G9CA 4P9JA 4K21A 5FV3A 1Q56A 3TAYA 5FLIA 1H2NA 1DG6A 3M3IA 4BQ1A 4FPJA 4DXRA 1NQDA 2YUEA 2ERFA 4BH9A 2BNNA 2DURA 3ZN4A 1L7QA 2J1UA 2QKDA 1QNYA 2XJRA 3MICA 4CU8A 2PLV2 5L7OC 1DP0A 3SLIA 3JUUA 1Q8VA 5EJ1B 4CDWC 5DDJ2 3T2PA 3I3BA 3K3OA 4YFZA 1ZREA 3NW4A 3KV6A 4W8JA 2P17A 4MSVA 2HWF2 3GJBA 3ZYFA 3KSCA 1JTZX 4DXZA 1H2LA 2WFF3 3K3NA 4GWJA 3LKJA 4FPHA 5AVPA 4AFBA 3JB4C 2AUYA 1HRV1 1OPOA 2WO1A 2OUJA 3N9NA 5IVFA 4GIQA 2OKXA 2ADEA 2YU1A 5IFPA 2QQVA 1SBFA 5KR7A 3EB7A 5JCTA 4BHPA 2BP6A 2YC2A 4Q4Y3 2XQXA 4OHVA 4YVSB 1ASJ3 3E5UA 2EXIA 1UY4A 4BQ2A 4UWDA 3K4AA 1JZ2A 4UW4A 4B4QA 3RQ0A 2FQPA 2D3PA 2BGPA 4Y5SA 3NAPC 3WSOA 5A6YA 2FDHA 1M4WA 3AL5A 4D7YA 2AC1A 2C5DA 2EAKA 4E4SA 3B01A 5IVEA 5F3GA 2C1FA 1X8EA 4FPLA 4GALA 2RS33 4XHBA 5A3PA 5FXWA 1O3SA 1GICA 1B35A 3K48A 2NN8A 5CB7A 3WNMA 4LKSA 3JU9A 1N3PA 2D40A 4R4ZA 1ZVFA 4NIIA 3PVNA 2ZMKA 4LHNA 4N43A 5BNOC 2A6VA 3THTA 3HNYM 4LKDA 3TEWA 1GFF2 4MGZE 4Q0QA 2RS13 3PNAA 4WV8A 1JU4A 3SEEA 1A34A 3N7MA 4L97A 3H9AA 1AXZA 5F8PA 4J1XA 5LCWL 1LOFC 1O6UA 1O91A 1UNBA 1DYKA 3J7NA 2YBPA 3E1F1 2B46X 2ZGRA 2ZZJA 4LBJA 5I0RA 3VBHC 4QPIA 2ATFA 5CFDB 1QWRA 4E4ZA 3IN9A 4NWWA 3ZSEA 4XUQA 5EV7A 1DQ1A 3AFGA 4XUTA 4I2OA 1B35B 2WNUB 4IEYA 4K1YA 3WD5A 2A6YA 2EIEA 4R9BA 4COZA 2W68A 4ZONA 2O8OA 2BYVE 2B39A 2A3WA 2VCCA 3P1IA 4AL9A 3JQXA 4PHZA 4N43B 3AL6A 3TWIA 5I0UA 2E31A 1YFYA 2YC4A 1JBCA 3J8F1 2PHTA 1QJFA 5HXMA 5JSPA 2IZWA 3KQ4B 1YQ8A 4GMP0 4QQPA 4RL7A 3ZX7A 4CCJA 3MLLA 5FZFA 2D3SA 1SLBA 1ASJ2 3OYWB 3NV3A 5FLHA 5FPAA 2RG4A 2W95A 2I74A 2D93A 3LA2A 4PDWA 4Z07A 1IKQA 5L36A 2G4IA 3WP5A 2HYXA 3LB9A 5A1FA 1CGPA 4QPIB 2BEOA 3MIFA 1CJPA 3WVJA 5JOZA 4INDA 2PYTA 1MZ6A 1XE7A 3RWNA 2ZHKA 4MG2A 4G3YC 1LODA 4LJHA 1SBDA 4IEOA 2Q8OA 4NN0A 1ZM1A 2X8KA 1GQHA 4XFHA 2BBVA 1NCRA 2XL9A 1O8SA 1WW6A 1G86A 4QGMA 1X7NA 2E6VA 2F6BA 1UY3A 4D6RA 1ULPA 4QKDA 3KHBA 3H8OA 3KV5A 3WNNA 5CEHA 5K0UC 5FY9A 1UZWA 5JR7B 3C8XA 4BXFA 4FAHA 1TNFA 4XFGA 3PTYA 4FP2A 1GKBA 1CQ9A 1XPWA 2RS12 4Y1UA 5FYCA 1OD3A 1QJY3 3P3NA 3WUDA 4K3UA 5AFEA 4NHXA 1SBEA 4IEXA 2EA7A 3BTXA 2IFRA 4DXTA 3BCWA 5C8CA 1YIFA 5ANQA 5JXHA 4E27A 4QPGA 1EV12 1H0BA 3WV6A 1NG0A 1XU2A 2VZVA 3CMGA 4XXAA 2OVUA 1ST8A 2J7MA 3WP3A 1FPN1 2HWC3 1UYPA 1CJDA 1FATA 1NCRB 3JCIA 4LE3A 1GV9A 1MQTA 3CJXA 4FTSA 3VN4A 1AHSA 1YHFA 4MXWA 1X9TA 4YW1A 2VUAA 5H9QA 3T1LA 2Y0IA 5LW9A 1Y9GA 3MV11 4HL0A 1HQWA 4LTAA 1AYN1 2EICA 1RUJ1 2XONA 1PGL2 4LO8A 3RJRA 4F8AA 1LEDA 4L92A 2WO7A 2Z79A 2O1QA 1JZ7A 4YG6A 1YYNA 3RWKX 1PX4A 5FJKA 5ABJA 2XXZA 4BXSV 5FWJA 1W8OA 1G6NA 1XNTA 1VRH3 2PAEA 3KQRA 3BI3A 1YJLA 3LA7A 1CWPA 4IW3A 3ZFGA 3M1HA 3K75B 2W46A 5FOBB 3DKQA 3O5SA 5LEKA 3TBDA 5KXDA 5C8CB 2O8QA 3N7JA 3WUCA 1S0DA 4QPGB 4QD2A 2GNBA 2GP5A 1FOD3 4UOJA 4YARA 1JZ5A 1H1MA 1PGSA 3KGLA 3N9LA 3UESA 4RQPC 4JDMA 3WOGA 1HB4A 1NOVA 4QX1A 4GB32 2XVGA 4RR3A 2H6CA 5DUUA 2PQQA 3ILFA 1POQA 1HRI3 5J96B 4RGKA 1NXD1 4NVPA 4P9IA 1U5YA 1BJQA 2J1TA 5IW0A 5CFDC 5FUIA 1T2XA 4QPYA 1XXNA 1V6IA 1V9U3 3L9JT 4Y1VA 4AI9A 2XLFA 3MLKA 4QDSA 1YNAA 2WNUC 1VBC3 4H14A 2ZHNA 3MW3A 3MO4A 4EJRA 1VBD2 5ABJB 2D98A 4PLMA 3ZFEB 1OPMA 1GR3A 3ZFGB 3UKNA 3LD8A 3ETPA 4PLOA 4YW6A 1UYXA 5JZGA 5FZAA 3MUZ1 3UJQA 4P9WA 1QJY2 1OQ1A 5DUWA 4C0BA 4EWEA 3A21A 3AP5A 3GJAA 1SDWA 1RGSA 3PIJA 4N9HA 4RR3B 1W05A 4LUMA 3KT7A 4S2HA 4CP9B 4FOQA 2R1DA 5IAVA 2UWBA 4BK4A 2R30A 3AZYA 2VUDA 4Q8KA 3WNXA 1RJ7A 3KLSA 3ZSLA 2ZGMA 5A7SA 1O5UA 1OVPA 3AKQA 5E88A 2ZCWA 5FPBA 3ASIA 4MHUA 3KD4A 2W39A 1VAMA 3FLPA 1DCSA 3PMSA 5F1RA 3FUQA 3LIGA 5L73A 2DF7A 3I2HA 3KCYA 3GDBA 3TEXA 4AF9A 3WW2A 3OJBA 1X9PA 5FUNA 3SH5A 2GALA 3DV8A 5D1IA 1R093 1ZNPA 2V09A 3BVCA 4IQPA 2NP0A 4Y22A 5JZGB 1RMU3 1HLCA 2JD9A 3JXSA 1AX1A 1R082 1RUG1 2O14A 5A80A 4CZSA 3I54A 2QTWB 4JTNA 4CDXA 4OUSA 4HPKA 3RFRA 1VE0A 1RYYA 2XJPA 4XW3A 4YVWB 2HWB1 3K51A 5EPAA 3RSJA 5AC93 5LY2A 5FZ1A 2B8MA 2Y6JA 3E6CC 5LA0A 1CAWB 4IGQA 5JIAA 3WCSA 1OA4A 2IXIA 2KM2A 2Q1ZB 3OBRA 4MUVA 5FY5A 4KNCA 2F4LA 5K4LA 1W2AX 3V0BB 2JG9C 3IBMA 2Y0OA 1YJKA 2WA4A 3ZXJA 1C8M3 2DYCA 4M3CA 5FREA 1VB4A 3GCXA 4DFSA 1F31A 1OF4A 1ZZ6A 2Z2SB 3PUAA 4S2GA 3WQ7A 2XBO3 2UWAA 3K77A 1OUXA 1VBC2 2DCZA 3AZVA 4E8DA 2DUOA 1WCSA 4O9GA 4Y22B 3NJZA 1T6BX 1Q43A 4H55A 4OHWA 3MYXA 5JXIA 1DF0A 1HKDA 3JD71 4KL1A 4YM2A 4I09A 2AEZA 5IVBA 3B3QE 3I2FA 1FMD3 1YC61 2VZRA 4XFAA 1AR63 4AI2A 5FZ9A 5GZCA 1VLNA 4CDXB 4CP1A 4PF1A 4HPKB 1REFA 1PIV1 3APBA 1AR71 2RMU1 2XVLA 4JTOA 2WN3A 4MVTA 4XAEA 3D82A 1QEXA 1NXMA 4FFGA 3OBAA 4GA9A 3OGGA 3BTAA 2ZX2A 5FZOA 4OI1A 3CKHA 2PAKA 1Y4WA 1SFYA 4HOOA 5FAXA 3UKVA 1UMZA 3WG4A 3I59B 2YBKA 3GF6A 3WNOA 3C7GA 5E6HA 5FZ0A 2X10A 1VBE2 1W2NA 2JB8A 4V1PA 1KS5A 3HT2A 4A6OA 5IVJA 3FWEA 2HWE1 4Y5Z0 3AYDA 4BU2A 3ES4A 4GKYA 5JR2A 2Y6LA 1HXS1 4ASMB 5GLZA 4DUWA 4D6QA 1S0BA 4FO9A 5A3UA 4XF3A 4IE4A 1ZRDA 1CN1A 1W6OA 1BHGA 2FZ2A 3VHRA 3HAGA 3LQCA 1R092 3ZMNA 1GZCA 3N9MA 4CCMA 1K42A 3OOXA 4FQZA 1RMU2 4I0AA 4Y4RA 4ES9A 3ZFEC 4ARYA 3ACLA 5FZOB 5GZDA 3FLTA 5LZ6A 1RHI1 5JI7A 2LRPA 5AC92 3SC7X 1WW7A 3J7HA 4WM8C 1GANA 3SCGA 1KS4A 2J1VA 1PVC1 3LDRA 4ZXKA 4CDQA 2NYYA 2BWCA 3H7JA 4MGIE 1TMF2 4UW5A 3POJA 4U2AA 1YI9A 1WCUA 3OGVA 4Q4X3 3VBOC 1DQ5A 3LEGA 3AKTA 5LBBA 3HQRA 4QMAA 2QUOA 3WW3A 1LB2A 3AP7A 4HBNA 4IEVA 2RVAA 3KVBA 1C8M2 1IZ3A 2ZMLA 2D3RA 1POV0 2KXLA 4Y24A 2TUNA 5T5JA 2XOMA 4C1XA 4CSWA 4Z82A 3TOJA 2XBO2 4RHV3 4PQ9A 1RUF1 2CDOA 4BMBA 4JGZA 3SQOA 4BQYA 1YQCA 3SNMA 1Q8PA 3BIWE 2BFUL 2QZ2A 5FYBA 5CZKA 4KU7A 2A7AA 3BN6A 3W21A 1AR62 1OA2A 3LSDA 3LGRA 3OEAA 3GBWA 1RXGA 4M01A 4A3XA 2VVFA 1HW5A 2BOIA 1GUIA 4TN7A 4WM7A 3S7EA 1XE8A 4PIXA 3VZOA 1RUH1 3WQBA 5C3SA 1EAH1 1DU3D 4L0PA 4EROA 1NLRA 2D6PA 1K5JA 2DUQA 2Y6HA 4YVWC 3T0AA 4E4HA 1DZRA 3NL1A 1YWKA 4NHYA 3FX3A 4EN0A 1NE4A 1AL23 2VTXA 1BMV2 1JHNA 5JXGA 1AX0A 1QJZA 4R8HA 1J3QA 5EFUA 1O3TA 3EJKA 1UYYA 1ZA7A 5F3IA 3POYA 1SLLA 4FP3A 5GM0A 4RSUA 4YZ2A 2VR4A 4RS5A 3S57A 1STMA 3U14A 5ACA2 3ZXAC 2ZS6B 3ZXGA 2B42B 2P3JA 3R4DB 5D21A 5ANNA 4MGTA 1H4HA 2P3YA 3AYAA 3CL1A 4FFIA 4M4RA 1C5HA 4EN6B 1GZWA 1PX3A 2OPWA 4IE7A 4B7KA 2A70A 4FFFA 2EXHA 3V56A 1AR93 3O7OA 2WKKA 4WM7B 2R063 5DUVA 4AEDC 3QD6A 3ZXKA 5FDBA 2WSVA 2EAAA 4G4FA 4NRQA 4JRAA 3ACHA 3MW4A 3CO2A 3GXUA 5F3CA 1GU3A 1COV3 3EQEA 1NUKA 3VUOA 4LA3A 1D2SA 4BJ0A 4OCTA 4AGGA 2Y34A 5FZKA 2ZMNA 2EALA 5DMYA 1D2QA 4GULA 2HKXA 4LBQA 4D8MA 2W1SA 3GZUC 4YW2A 4AVCA 5DDJ1 4WVWA 5DAWA 1RB8G 5LBEA 1W6PA 4UF0A 5B4NA 1DLLA 1GOFA 4ZPIA 3RVHA 5BNPB 1L7LA 4RHV2 3ZVXA 3O0WA 3BTYA 1S0JA 4M0NA 1GZWB 5BXXA 3FUOA 2YROA 5FZGA 4BIOA 3PUHA 3W5MA 1W2TA 1UX7A 2JJ6A 3U37A 3FN9A 1KDMA 1SHWB 5ERLA 2LW8A 4BOWA 1DFQA 1NLQA 5DG1A 3PJYA 1ZZ9A 3SXWA 1EY2A 5L7OA 1SACA 3E5XA 3VBUB 5L9BA 5FK8A 5B4XA 4MGSA 4CDWA 2XB6C 1CZVA 4YFWA 2Z5WA 1QF3A 2XHKA 3DXTA 3I3EA 4QU2A 5BPXA 5CG9A 2QVSB 4LK7A 1HJFA 2HYKA 1PGW1 1P8JA 5AFBA 5DABA 1PNGA 3CJIB 2XWBB 1AL22 3R05A 2P6CA 4KU8A 4ARXA 1W6PB 2WUHA 3KGZA 4B1MA 4UF0B 4AI1A 4YW5A 1QJX3 3ME2A 4AI3A 2VOTA 1KQRA 2RHPA 4N53B 1WWYA 4OUEA 3WX5A 1J3PA 5KXEA 3L2HA 4QXCA 1QJU3 1YLLA 3C7HA 5FRAA 1XC6A 2R32A 4I30A 4Q4V3 3WNLA 2JB4A 4HFSA 2C6SA 3R4UA 5L7OB 1QQP1 2RDSA 1UOJA 3POBA 4Q29A 3NAPA 2R062 4QHBA 3ZYBA 1M06G 2YC0A 1IS4A 1LOBA 4LOTA 1ACCA 4LNVA 1RUOA 3Q8FA 3POGA 2FDKA 4OZOA 2JE8A 1JOBA 3CEWA 2ORZA 4AVAA 4BYYA 4GMP1 2P6HA 3OBTA 1I5PA 3MIEA 4XBNA 3BTZA 3SCFA 2VCAA 3LIHA 4QM9A 5HCFA 1DYOA 1YQ6A 2V4VA 3LEMA 5JDBA 1O3RA 4IV1C 4E8CA 1K5MC 2CGPA 1QMJA 4KWUA 4Y5TA 1AYM1 2KR2A 2VE1A 1SCSA 4A4AA 3ZKUA 2DBIA 1UPIA 2HLEA 3QBQA 3TNQA 2JKBA 3ZR6A 2OUHA 2BZDA 1W39A 4BIFA 3HJRA 1AF9A 3O1SA 2ZACA 4NJ4A 3M3CA 3FFQA 3MIBA 4QX3A 4M0HA 4IERA 2XJUA 3WDTA 2JE7A 2E9QA 4WZCA 3D8CA 3KZ4C 1LOFA 3DKWA 1ENSA 3TN93 1QOOA 1EP0A 4Q4W2 1U12A 1MVQA 5IK4A 1REEA 4XHXA 2K2SA 4WVMB 3VBHA 3M8LA 4P9YA 1TG7A 2W08A 1XNBA 4CPBA 3TEZA 3DUIA 1MS0A 3BU7A 3MPBA 2JENA 2WWSA 3DYOA 3VB9A 3OEBA 5FP4A 1XNDA 4JGYB 2DBNA 1W8UA 4HT1T 4XABA 2CU5A 1UXXX 2VQAA 2P5BA 4PF5A 3AMQA 4YW7A 3P6BA 3WQ1A 5BNOB 5C71A 2VGDA 1LEMA 4FPKA 5FYYA 4OUMA 5IFTA 4OHYA 3LAGA 1QJX2 4QXHA 3HEIA 5FBZA 2LS6A 2SBAA 3RPQA 3LPFA 4PI2A 1GWLA 4BDVB 4CTEA 1OD5A 1Z7S3 2OXBA 4QDQA 1QJU2 1WLWA 2WJSA 2HEVF 3VBSB 4KI5M 5BNPC 4FOWA 4JDNA 4AYUA 1ZBA1 4KWLA 5AVAA 2RM23 2YMZA 4ORFA 2QQKA 4Q4V2 2DCTA 1N1VA 1ZA4A 5EIYB 2VAUA 3O14A 4Q0SA 3RZHA 4EWAA 1JH5A 3IDEA 4KGQA 1LJ7A 2RS11 4GWMA 2EIGA 5FMBA 4Z1VA 3I3MA 1N3QA 2A75A 1GSLA 1Q8QA 4HSLA 4XFIA 5F6KA 3WHUA 1WGPA 2GNTA 3VBUC 2ARCA 4JV4A 5FMCA 2YFZA 2QQOA 4MOAA 1EV11 1UOBA 2BRTA 4AEKA 4DMIA 3WXPA 2VZQA 3T4VA 4JCKA 4V2WA 1RJ8A 4E2SA 4AHXA 4R9AA 1XOYA 1ULGA 2ZABA 3CJIC 3D3AA 3S0MA 1D4M3 1RVF3 4KG0A 1TME1 3G7DA 2XGXA 4HKWA 1OKOA 5I0SA 1BVP1 1ENXA 2QQUA 1UOGA 1W04A 1MZFA 4UYBA 3SH3A 4R9DA 4YZ5A 5L19A 3LCPA 4YG0A 1PGL1 3RZLA 4QT6A 3MEPA 4R52A 2AYHA 3CDZB 3I2DA 2CWSA 3HVDA 2DU0A 3PLQA 1DZQA 1WUVA 4JDOA 3TN92 5K9YA 2JDNA 4AAXA 4TTGA 3H8RA 1PO23 2VZOA 1X8MA 2ZGLA 1LNSA 3DF0A 3LE0A 3T2TA 4P9GA 4UI9L 2A71A 5LY1A 4LQRA 3AMNA 5LEJA 4X6RB 1UU6A 2Q0AA 2EVXA 2JDMA 4AR2A 2A6ZA 1KXGA 5A7PA 1HIXA 4GB31 3WDXA 3KWVA 4RA0A 5K0UB 5A70A 2QCSB 1I6XA 3RRDA 4F3JA 3VZNA 3PIGA 1HN1A 3Q8CA 5A1LA 4FPGA 4XJ9A 1XYOA 2V72A 2XKOA 1YIPA 4C91A 1YFXA 1REDA 1G7YA 1ZRFA 1OSGA 3SHRA 1ZZ8A 2PHRA 1RUC1 2JDHA 1AL0G 1ULEA 1VBD1 5I8TA 3ILNA 3ZXDA 1JOJA 3ZMOA 2RM22 3O1TA 1CX1A 4DS0A 4LBNA 1J1LA 1GZ9A 4CXWA 5J1XA 4H7MA 1UQXA 1W8ZA 1W0OA 2WC2A 4RQPA 1N1TA 2HWD3 2ZGTA 1AZDA 1J1TA 3HWJA 2E33A 1XYNA 5FTTC 1FYUA 2WQ8A 1UZVA 2WRAA 3OBZA 3WG1A 4FXGB 2JIJA 2XJSA 4QX8A 2VZSA 1OUSA 2LM3A 4YGBA 3WHTA 1US2A 4FCAA 3RDIA 3I2GA 5CFDA 4MH0E 3O12A 4YM1A 4AHZA 1FI2A 1HX6A 4R9CA 1OQDA 2YU2A 5LBCA 1VAKA 4AWDA 1VBA2 3H3LA 2XUEA 5IK7A 4JGYC 1EYBA 2WNUA 3B5LB 2W1WA 4BQ3A 2GN3A 1C1FA 1ULCA 4Q26A 1TEIA 4K40A 1D4M2 1RVF2 4UFKA 2GC2A 4TSVA 2C24A 2BJSA 5IK5A 3PMEA 1PMHX 4P14A 4GH4C 1GP6A 4CU9A 1OXCA 4XEZA 3JB8A 2WT1A 5J98B 2JEMA 2VG9A 3H3ZA 4IV3C 5CKNA 3SMHA 3RMXA 2PELA 4FPYA 1R1A1 3VKMA 3OYWA 4RQPB 2BFUS 3VBSC 3I2KA 5EHDA 1NCQB 1OHFA 1JZ8A 3ON7A 5GLWA 2OQ6A 1R081 4IEZA 4XIKA 2Q8DA 5DPNA 5HBAA 1PO22 2D44A 2R073 1DZTA 4YWAA 2IC1A 2YPJA 3GZAA 2WZR3 2BV4A 2VZUA 4OYUA 1OFNA 4YYOA 1VAVA 1E5RA 3MBWA 3B9CA 5FZ7A 1YUDA 3OPTA 1S0IA 2XJTA 1S0FA 3CNAA 5C8WA 1G9BA 4NAMA 3PU8A 1W0PA 2D6NA 4CP2A 1YCIA 1RUI1 2WFF2 4I3PA 5J09A 1BYHA 1OOPB 2XG3A 1I5ZA 5E1RA 5GJ6A 1VMFA 1ND2C 1W6QA 2RJ2A 1Z78A 2NZ9A 4AQ2A 3EMRA 2Q8EA 3KM5A 4IGOA 2CYFA 2XWJB 3IPVA 4MXVA 3KCXA 3N7LA 5SV5A 4Q4Y2 3GM8A 4CCOA 4DY5A 4JZRA 4NRPA 2VZ3A 3INAA 1S2BA 4GZ9A 4UBHA 2P2KA 1OLMA 2W1QA 2CGOA 5IK8A 2HWD2 1QKQA 5LBFA 3Q8EA 4PBOA 3S6PA 1UF2C 1HDKA 2YFUA 5A3OA 3U07A 3VL9A 5LA1A 5CG8A 1H9PA 1UKGA 5I8YA 3VDDB 5F7UA 3RZGA 1J3RA 3THCA 3ABZA 3VHOA 2NQYA 2ID4A 2ILMA 2JG9A 3DEMA 4YRDA 4AVBA 3NKGA 1UL9A 3OSDA 4D6SA 4YZ1A 2RS32 1GWMA 1H1AA 2UU8A 2VJXA 4YGDA 3HNBM 2WWUA 1VBE1 2JD4A 5A7OA 5LWBA 1W6QB 3USUB 2R49A 2UY8A 3LOIA 1WMEA 3IPVB 5FO8B 4SLIA 1NE6A 3R6SA 2WSUA 4KWJA 2JDZA 4DPNA 3ES1A 2ZGNA 1YO8A 2XUMA 3MZHA 1XQNA 2F17A 2JG8B 2OIIA 4DY3A 5KHIA 2W3JA 4BCUA 2GP3A 1GWKA 2ZGPA 1HRV3 2QQJA 1OFSA 4NHLA 2BNMA 3D0SA 4OULA 3OD0A 1JXNA 1POV1 2GMMA 1APNA 2R072 4K6BA 4HN0A 1V6NA 4UAPA 4QKFA 1QXJA 3D4KA 4AW7A 1LU2A 3BODA 2JG9B 1VPHA 4EN9B 1W3XA 5AC91 2PN5A 1C57A 1XNAA 4FFHA 4YGCA 2ARAA 4IESA 4UFMA 2VMIA 2XLGA 5SV8A 5KHJA 3IDBB 1JYWA 3D6EA 4YSFA 3C3VA 1TMF1 4PBPA 5T50A 2OX0A 2R041 5FLJA 3T0DA 3BYWA 1OH3A 4TZDA 5T54A 2J1AA 4QWNA 2WQ4A 3EHKA 3UGHA 1ZBE1 5FJHA 2RDRA 1D0HA 1ENQA 4JKLA 2A3YA 2BOJA 5FP7A 1XE0A 1Y43B 1EPZA 1RUE3 2SLIA 4AI0A 4Y4YA 3ZFEA 2ZGSA 3WT3A 4HONA 1BLZA 1JN2P 3D0JA 3NRUA 5C70A 2ZJCA 3OB8A 4Z2AA 2GC3A 4CUCA 4NIHA 4X8PA 3SKJE 1BK0A 3ZYPA 4CCDA 4QKBA 5FZIA 4WM8A 3I7DA 3ZN6A 5FZ3A 2QQPA 1NCQC 2DVBA 4NIDA 4OFGA 1R1ZA 3ZYHA 5FO9B 2K0GA 3Q9OA 5M0TA 3VBOA 2MEV3 4D7SA 4CP9A 5DG2A 4XUOA 1OLME 1JHJA 1Y9MA 4Y33A 3BU0A 1AX2A 1VBB3 4Q27A 4XTPA 1A6CA 2NLRA 2QDNA 4WZFA 1NZIA 4ASKA 3X29B 2CY6A 3ETQA 2UYAA 3I2IA 3RZZA 4BZ4A 4LBLA 2ETEA 4IEUA 4QU1A 2MPFA 2W47A 1BMV1 1SFNA 4S2DA 2D6KA 1DBNA 2JICA 3BOPA 2X09A 1MS1A 1OOPC 1WD4A 2YY1A 4ZU5A 5JOYA 1UAIA 5ACA1 4J25A 3B00A 3BALA 4KBBA 1IG0A 3ECQA 2VZ1A 3HQUA 4K20A 2FDGA 1J58A 4OMCA 4YW4A 4WM8B 3VBFC 4BQ4A 4HVQA 3EBRA 2NM1A 3ZN6B 3ZR5A 3NQHA 3J8F3 4KH9A 3WLUA 3VBOB 4YVWA 2RE9A 1LR5A 3LWCA 5F2WA 1AUYA 2XHNA 5DZFA 1LOEA 2HWC2 2ZX1A 5A6QA 4Q8LA 3M7AA 1CAWA 2YZ4A 2ET7A 3ZYJB 3DGTA 5A3WA 4XQ4A 2V5YA 2Q1MA 3TYJA 2K9ZA 2RR11 3VDDC 2A73B 3PDQA 3PUQA 3AZWA 3BGAA 4XFFA 2XJVA 2ORXA 1UCXA 5C3RA 3V0BA 2JKXA 5IWFA 4QHOA 3MGUA 3VHNA 3J7LA 2BQPA 4P5YA 3DL3A 5FZ4A 2ZX0A 1IS5A 4NPLA 5DN2A 1I1EA 3AJZA 4Q2FA 3MLJA 1DIWA 2VC9A 1RUE2 1SZBA 1IOAA 2PFWA 1BQPA 3AP9A 1VRH2 1LU1A 1AXKA 3RMYA 3U78A 5KC6A 4AEDA 3HBKA 1JODA 3M2MA 4P02B 5TSWA 2PA7A 2E7QA 3G6JB 4C8DA 2ZOEB 3ST7A 2JG8C 3IM0A 4AQ6A 1FOD2 2BU9A 5LK5A 1JZ4A 1OF3A 4QX2A 4XF1A 2Y6FA 3AP4A 1LRHA 1UXZA 1V6MA 3ZYIB 2MEV2 1HRI2 3I59A 3PUIA 3ORJA 3VKNA 3PTRB 4Y26A 2N7GA 1VBB2 3OTFA 5I8SA 4AI8A 3NVCA 2NMOA 1PZ9A 5FR3A 1VB2A 5EZWA 5BNNB 3I2JA 1UY1A 1V9U2 1YXWA 4OZXA 1AL21 5CFCB 1FPN3 3I49A 4AQSA 1UD1A 3LF7A 1MEC1 3NV2A 4XURA 2V5DA 2J1SA 2PHFA 4ES8A 4EN8B 2OT7A 1GNZA 1J83A 3CZUA 1W6MB 4AEDB 1ODNA 5FMDA 4LULA 1Q8OA 2P34A 4H7LA 1AYN3 3WR0A 4YNIA 1RUJ3 1JMUB 1VRBA 3LEIA 5T55A 3W58A 4BB3A 1Y7BA 4HN1A 2PXJA 5GZGA 1HV1A 1S0GA 4EZHA 3V64A 5GLUA 2NMNA 3UGFA 3PJQA 5G04L 3S5AA 2ENRA 1W99A 3H7YA 1XSQA 5FZ8A 2WLQA 4DXSA 2Q30A 1QDCA 1W9YA 5LASA 2B9VA 4QKNA 2X5IC 3BKZA 3A7QA 3PHMA 4B4PA 1Z0HA 2Y33A 3AYCA 5DAVA 2PAMA 5FZ6A 4XPVA 5JSOA 2W0XA 3WQ0A 2BNOA 4FXKB 4QQOA 1Q5OA 3KB5A 2VQ0A 5HCAA 4FOVA 4JKMA 5FYIA 4NO4A 3AMPA 1NY71 4NRMA 1PO11 2GMPA 4HG6B 2GNMA 4FOYA 4AFAA 4ZHNA 5IJRA 5K7PA 4SBVA 4ATFA 4QB1A 2LUWA 1XRUA 2LALA 2WZ8A 3VD3A 4LXLA 2VCMA 2VMFA 4XDOA 4Q4W1 5DQ0A 1H1IA 3ZLIA 3H0OA 4N8MA 5C9AC 2R7EB 2VNVA 1IQDC 4O61A 4YM3A 1CIYA 1HJGA 2AR6A 2A1XA 3JBG1 4AK3A 4C1WA 1CAXB 1PMIA 1E5SA 2DVGA 3HPNA 2WAOA 4IV1A 1K5MA 2DCKA 3FLRA 2OQ7A 2BWAA 2RS53 3JZVA 4UT5A 5HI0A 2XQRA 2CWMA 1YI7A 4NR1A 5LRSA 2QQLA 2QE3A 2W91A 4ZY9A 2VM9A 4CCLA 3TNPB 1C4RA 5E16A 1N1SA 3D5OA 1BBT1 3ZSMA 2B7YA 5A3LA 1W0NA 4N7UA 1FMD2 1KFUL 1CZSA 1RC6A 4XF0A 5KXBA 2ADDA 3KVAA 4HSJA 2IUWA 1AYN2 1ND3C 2AH2A 4OHXA 1RUJ2 2Q8CA 1MZ5A 1IS3A 2CSGA 1WCQA 3POSA 1MVEA 2CHHA 2YV8A 4GAZA 3KS7A 4AZZA 1YFWA 3UT0A 4AOCA 5HPOA 1RUG3 2VXJA 3DYMA 5A3MA 4QB6A 2PHXA 1GYKA 4XJ8A 4IV1B 4Z92B 1K5MB 1NT0A 4P00B 2WNEA 2VY0A 4L2NA 3ZKYA 1QGLA 2HWB3 4CU6A 2VMGA 4IEPA 2QQNA 1UU4A 2PTMA 3ZIWA 1E5HA 1N47A 2ZGQA 1EUUA 5IVYA 2P37A 2Y8KA 4QX0A 3KF5A 4YPJA 5BNNC 2WZEA 1MS3A 1F9KA 3AZXA 3IAQA 5BNPA 4E2QA 4NPRA 3U11A 4EN7B 1LULA 3WDUA 5CFCC 4BQ5A 5APAA 1MS4A 3OCPA 2GH8A 3BUCA 1C5IA 4JVAA 1TVGA 4BK5A 3KV9A 3DPRC 1UZYA 4OQ9A 3TEYA 3MFCA 5A3TA 1MS5A 4TYSA 2PHLA 4UFHA 3VBUA 1H2KA 3S30A 5FPLA 2JIGA 3VDAA 1RL3A 2VNRA 3NSTA 2GMEA 3PUSA 4CCEA 4EE2A 4Z2WA 4W4ZA 1OVSA 3AFKA 4U36A 3UYJA 4A41A 3THDA 4D0QA 2PLV1 4BLIA 4Q4X2 1PIV3 3HBZA 3O1RA 1O4ZA 1AR73 2G9FA 3H1YA 5FWEA 4CUBA 4EV0A 4PT6A 3CJIA 4MGQA 4B7EA 2RS52 5FZBA 5FXZA 2X05A 3IIAA 4LE4A 3HNMA 1DQ4A 3VDBA 4MX3A 1S0CA 2HWF1 3OUIA 4NIAA 1SLIA 3AXEA 1K45A 3Q8AA 4WVZA 2VTXJ 3W20A 4AVVA 1LESA 4N53A 5K8SA 3WINE 4KBZA 4IE6A 1IQAA 2D43A 4B29A 1DQ6A 1F5FA 1F35A 2HWE3 3B94A 4UXAA 3RZKA 3AKPA 4XF9A 1KGYA 3K4ZA 2W87A 3AXDA 1H6YA 5IUQA 1KJLA 3KMHA 1LTEA 5JMCA 3QOPA 1QHDA 3VZKA 2BERA 2Y60A 3ZSJA 3N36A 4C90A 1JI6A 4LIVA 3OPWA 4MGKE 5FP3A 1CAVA 3ZOIA 1ZZBA 1RUG2 2VVEA 3WF0A 4DZGA 2ZAHA 5C5UA 3POIA 4EZ4A 4XDQA 3KV4A 4MYEA 1RHI3 3J7MA 3VZMA 1HV0A 1UIJA 2R6QA 4HKLA 5A7NA 2HWB2 4NPMA 4UFJA 3LA3A 3E5QA 3THPA 1PVC3 4GXLA 1VBA1 4W6WA 2WYFA 4CEWB 2VMEA 3WW4A 3ALQA 1YQ2A 1UYZA 1WLTA 4F7ZA 4B3NA 1CPNA 5FMOL 1D4M1 2ZEXA 2DDUA 3U75A 4A7ZA 1H8TC 3BPSA 3RNSA 2W52A 3VD4A 1QJEA 1MR5A 1G8WA 1CIWA 3HD8B 1AJOA 5JOWA 3H1MA 1AR92 4LO5B 3ZFFC 4G9SB 4COUA 2HEYF 3DYPA 4COYA 2D5HA 3SKVA 5GLVA 2W2IA 5L9VA 1W8TA 1CAVB 4WVMA 2GDFA 3SISA 1COV2 2A5ZA 3T1MA 2GH2A 5I0TA 5FOJB 3PVBB 3U1XA 5ISLA 3LFMA 5FUPA 3K4DA 4NUBA 2ZKNA 4JGYA 1PIV2 2OS2A 2BPA2 1AR72 4LA2A 4CRQA 4XACA 3O1UA 2VOVA 2DU1A 4DUXA 5FPXA 1WKYA 1W8HA 1EAH3 4HANA 4QX7A 4GH4A 5FZCA 3WG3A 2IXLA 4A7YA 4E9KA 5BNOA 2VZPA 3RI8A 1ZYBA 2RDNA 4CEYB 5EQUA 1UW8A 4AFCA 4Y1XA 2WFF1 4QM8A 3SH4A 1GBGA 4ZXEA 4FTEA 4JQRA 2XVKA 1JUHA 1W8FA 1GP5A 2VZTA 2WNVC 5T3NA 2HWE2 3VBSA 1H6XA 1URXA 4AHYA 2F4PA 4Y1YA 2GNDA 1BZWA 4Q4Y1 2XR4A 2IXKA 1ASJ1 2WAAA 3IIIA 1SCRA 2R0FA 4LHSA 4IETA 3W5NA 4XCBA 1GMMA 2CTVA 2VMHA 3HIFA 4LBOA 2EXKA 1VIWB 3ACFA 5HXVA 2IXHA 2JDKA 3UETA 5D8AC 4HXCA 5IHRA 3OPZA 3HOBA 4HKOA 2G1MA 2B9UA 4GKXA 1WD3A 2QNKA 4GH4B 4DOUA 3ZO0B 1ND2A 2WR9A 3KCCA 3VHPA 1JYXA 1JZ6A 1CAUB 1LHOA 3M4FA 2H0VA 2RS31 3NO8A 2H0BA 1PVC2 4IV3B 2DUPA 4IUGA 4DINB 4QXBA 3UL2A 3OUJA 4QQ2A 1CPMA 3AKSA 4P9XA 4XFBA 2JDAA 3I3QA 4ATEA 2VOWA 1IPSA 3AVSA 3H3UA 1BCXA 3M3QA 5DDJ3 1A78A 3GNEA 3NNJA 4JRLA 5L9RA 1ZZCA 2DVFA 4ISQA 5CADA 2GN7A 4N9IA 3U4SA 5DAXA 1SDDB 2HJIA 1K12A 1SMVA 2IXJA 2QJVA 1QH6A 4UW6A 4CDUC 3NNFA 2E7TA 4O9EA 2AZ5A 2D7FA 2ZGUA 4LR4A 4META 4OMDA 3WCRA 4AVTA 4NWVA 2R071 4OVEA 4HMZA 2DCYA 2VQTA 4P9LA 4YG3A 5DZEA 3V65A 1XU1A 3O1PA 1S2EA 2IXCA 1ND2B 1YRZA 1O5LA 3I3DA 5KC5A 1QIQA 1RTVA 5K0UA 1UIKA 2D6OX 1LCLA 2ZEWA 1EAH2 3CBNA 3HN1A 3FFZA 1PK6B 1FNZA 1Q8SA 1GNHA 1LHNA 3IZOA 3EXUA 1O3QA 3J26N 2J22A 4NHMA 1ZRIA 1W06A 3GZEA 5A32B 4KMQA 5DAQA 1JOPA 4CEWC 5CISA 4GJYA 2W1UA 2AREA 3POFA 2E63A 4OLLA 4EWDA 4UBGA 3F2ZA 1RUD3 1NA1C 2VBDA 4OI4A 5A7QA 3LSEA 4QAWA 1SQ4A 2UYBA 2FCTA 1W90A 1WBFA 5HV4A 2RJKA 1DQ0A 1SPPB 4AG4A 5FYHA 3C7EA 1V6JA 3WF4A 5LATA 1QQP3 3IB3A 5FY7A 5GZEA 1CX4A 1OA3A 1OKQA 3T09A 1X33A 3H1WA 3V0AA 5GKAC 1OC1A 5CYYA 3ZIXA 1H2MA 4R4XA 4RFRB 1BVVA 3U0ZA 4XVHA 1BEV3 4ONUA 2QQWA 4GMP3 1UWWA 3VBRC 1LGBA 3MF9A 5C4WB 4XC9A 4B4RA 1Z7S2 2PMWB 5FYTA 4ET7A 4CEYC 3URFA 3FMGA 3C7FA 3VV1A 2OZJA 2OYZA 4N90A 4IDZA 2A6WA 1W9FA 2WS93 4KWKA 3VZLA 4DIQA 5A1AA 1AYM3 2Y38A 3CIHA 5FP8A 5C3OA 4Q5OA 2D5FA 1NCQA 3NJYA 3WEZA 4BWOA 2BBAA 1QJY1 4IEWA 4D69A 3ACIA 3T2QA 2XDVA 3DECA 1JU3A 3N35A 5LK7B 1DGWX 3J9SA 3J4UH 1AR83 2Z42A 3B9IA 3RGBA 1X50A 4AEMA 2V4AA 3AB0A 5IT6A 1ULDA 2ZEYA 3AM2A 5CA6A 5FPZA 1DLCA 1UOFA 1CONA 1WA4A 3OY8B 4URAA 1W9WA 2FMDA 1LKNA 2DTWA 4GJZA 1V00A 2HWC1 3LEKA 3V0AB 2DFBA 4XQDA 5HCBA 2YHJA 2OPKA 1OOPA 1UN1A 1UO9A 4XJZA 5DAPA 2YDEA 2XJQA 5F32A 1PGW2 1W6NA 2MNGA 4MV2A 4E4DX 4WBBA 3MDPA 4Q0PA 5JWPA 3VBFA 5CU1A 1XJAA 2X29A 5LA2A 4PI0A 1GZTA 1RUE1 1V70A 1LGNA 1UZ0A 1WLCA 5FYUA 3ZYGA 1VRH1 2AENA 4I01A 1QXRA 2WZPP 1V0AA 1UU5A 2FD8A 4RYDA 1PZ7A 2JDYA 1RUD2 1S1AA 2BTVC 2CGNA 2BVBA 5DZGA 5FXXA 4XUNA 1W9TA 1W3VA 3GZTB 1ZBA3 4RGAA 1FOD1 3NV4A 3VD9A 3VDDA 3PVEA 4DRRA 5JAXA 1ODMA 2QFEA 3IDCB 1FV3A 1WCKA 4FPFA 1QQP2 2QZ3A 4K8RB 4A44A 1TE1B 2DVAA 2MEV1 1HRI1 5JSRA 1F2NA 4LUKA 1WMFA 3ATGA 1LENA 4Q1RA 3CQOA 3ENRA 1PM4A 3OGSA 5E8AA 1VBB1 4XILA 2D97A 5LA9A 2BGCA 1W6NB 5LRRA 3T2OA 1XNCA 3USUA 1BEV2 2WO3A 5GALA 1EV13 4FVVA 1V9U1 4AE2A 4JHZA 3VBFB 5A6XA 4LKEA 1VBC1 3EYPA 1YQ5A 4FI9A 4B8EA 1L7RA 1PK6C 3H8UA 1JYIA 1IHMA 1JYCA 4KQ7A 2JG8A 2VBBA 2WS92 3A23A 1XYPA 2Q1FA 4XTMA 4CVUA 1AYM2 1TME3 2C0ZA 2ZZQA 3GGLA 2X53S 4Y20A 5FYSA 4L9BA 1SLAA 5DUXA 5H9PA 4DO0A 3U10A 4COVA 2WNOA 1GNYA 1SEFA 3WDVA 3KHCA 1AR82 5I91A 2VNOA 3O1MA 2G19A 3A22A 3P3PA 4FPEA 4A45A 4PLNA 1QXPA 2C9AA 4AFDA 4LKFA 2B4KA 1UZZA 3RYPA 1DDLA 5FYMA 2WFPA 4KGGA 2H6BA 2FDFA 1LAJA 3N3HA 3KF3A 2C26A 1W03A 2PHWA 4RD7A 4AGRA 3BIEA 4URTA 5IVCA 2ZX4A 2JE9A 4GB33 5FY0A 3RS6A 4XMAA 4A2UA 1VMHA 3IMNA 3ZXEA 1KJRA 4ZZ5A 4JAAA 5C4WC 2BGOA 3AJYA 1R091 3MW2A 2GU9A 5A33A 5JPNB 3HMYA 3DN7A 2ARBA 3FL7A 4Y20B 1RMU1 2FMYA 4W6XA 2BDRA 1QDOA 3MF6A 4TLFA 3E6BA 1W28A 5F6LB 5IYYA 2WZR2 4FBFA 2YGLA 1RUC3 1VBD3 3WNKA 4HZFA 5C3PA 1ZBA2 2JDUA 4ZS3A 1HB2A 4MLOA 3KT4A 4RGGA 2VUJA 3JQWA 4XOGA 4MZUA 2X5IA 3FBYA 3L2YA 4X8NA 2ZBJA 4PDWB 5FYVA 3ZPOA 3IKWA 4ZKTB 3LZZA 2QQIA 4YVSC 3VDCA 5FY1A 3WP4A 5FQ0A 1C8M1 1MS9A 1AVBA 1ZX5A 2VXRA 3VGIA 3DXUA 2ZX3A 2WA3A 2XBO1 5F39A 5A33B 4M4PA 3WG2A 1RXFA 2W94A 5FMOS 1WBLA 4YGEA 5LB6A 1UKRA 4LMFA 2E51A 2G9ZA 1NQJA 1FMD1 1GP4A 1N3OA 1TME2 1AR61 3R0RA 3S7IA 1VJ2A 1L3JA 5KWRA 4LBMA 5JVVA 2YPDA 5C9AA 1J84A 4CXXA 2A3XA 5FXVA 3LDBA 4LITA 3E6DA 5FY8A 2QQMA 2BUKA 5FFOC 1H9WA 4P5HA 1R1A3 2X5IB 2ZGOA 4LK6A 3H8XA 4A6SA 2VUCA 5IAXA 2D6LX 2GZWA 4AQTA 1R083 4O7XA 4MHRA 1GOGA 4HVOA 4BLJA 5FQ0B 2HBTA 1SG3A 2VW0A 3T08A 4BQXA 2YGMA 4AXOA 4JQTA 4BQWA 1DGLA 4XJUA 4CUGA 1LHWA 2A6XA 4UFIA 2WDBA 2YG0A 4XF4A 4XUPA 3M3EA 2XMLA 5DXDA 3AK0A 1ND3A 2P3IA 1RUI3 1O8PA 5H9RA 1MQTB 4IEQA 3RG0A 2B5HA 2DTYA 2IFWA 4CUAA 4MXWB 2FHRA 4QB2A 4TXWA 1HRV2 3RJ2X 5C5TA 4HVRA 5C9AB 5I0DA 1UY0A 2ARXA 4D3WA 4FQ4A 1CZTA 5HCHA 5CKQA 1BXHA 1B35C 1FT9A 3USSA 1HB1A 4CE8A 1NZCA 4XQWA 1RUC2 1WZXA 1YEWA 3H50A 4NMIA 5CKMA 3O0VA 1DGWA 1SLCA 1C1LA 3NJVA 4UFLA 4N43C 4DEVA 2VCBA 2WQZC 2JWPA 2I2SA 2OZ6A 4Q1PA 1FV2A 1WW5A 4Q4X1 2I45A 4I02A 5BNNA 5F9TA 2GSYA 2R16A 4K7JA 2TEPA 2ET1A 4FT8A 5CFCA 2CNAA 2RS51 3FHAA 1G9AA 4Q0VA 3FE5A 1ND3B 4RHV1 4D94A 2TNFA 3K2OA 4PJYA 3GYDA 3DPRA 4QPIC 1VBE3 1W6MA 5FZHA 5A7WA 2CV6A 1ZZ7A 3N7KA 3SCHA 4NIGA 2FBEA 1OQEA 5FZDA 2Z69A 1EUTA 2L9LA 3VD5A 1QY4A 3LOBA 5FZLA 4NE9A 3IMMA 1F4HA 1V6LA 2QDRA 4CCNA 3IWZA 5C6CA 1MZEA 2WINB 3FC0A 3GALA 2WN2A 2VMCA 2Y6GA 3BOWA 4P08A 4BISA 1R1A2 4EQVA 1ZRCA 4ZZ8A 2Q5TA 4S2FA 1HQNA 3E97A 3NWKA 1POV3 2AGSA 2JXAA 3ZDSA 3MV01 1WCDJ 1PZ8A 3N9OA 3ROUA 3T3YA 1JYNA 1V6KA 3IT8A 3W59A 1WLDA 4CCKA 5F5IA 4PDWC 4LHKA 3F95A 4I0WB 2PQSA 4QPWA 4XE9A 4AFMA 3DPRB 5A7WB 3IAPA 4LIUA 3T0BA 1ONAA 1TMF3 2R043 1DGRA 3LDKA 2G9GA 2FCVA 1IPKA 1KEXA 1RUI2 1WW4A 3AKRA 4LHLA 5FCCA 1ZBE3 4PQQA 1JYVA 3WW1A 4CA9A 1DQ2A 3R4SA 5FZEA 4JC1A 3J8F2 1NCRC 1WMXA 4FPOB 1A3KA 1BK1A 3OD4A 1NYWA 4JKKA 4PIZA 1AR91 4FAGA 2R061 1I9RA 3U4XA 1PM7A 5BYNA 5KBFA 3BPZA 1PMJX 5CNAA 1UMIA 3T30A 1O7FA 5I93A 1W2UA 5FP9A 4FTBA 1COV1 1NX9A 1AJKA 5FPUA 1F5JA 1F4AA 3KT1A 4XFCA 1CAXA 3S5QA 4QHZA 3AYEA 1W8NA 4LO6B 2J1EA 2RDQA 3ZDVA 4D7TA 2W92A 4BM8A 4GQ7A 4HLTA 4AVSA 3M3OA 4W65A 5GLTA 3O1VA 4RFT0 3MIDA 4PCRA 1H8TA 1LECA 2VQUA 3NNLA 5FO7B 5BV6A 2K46A 3HR9A 5C8CC 4H2AA 4QPGC 4BMEA 2DV9A 5A6ZA 1Y3TA 3OG2A 4LPLA 3I8TA 2VH9A 3ZFFA 2VOKA 5EYYA 4DUVA 4LORA 1WA6X 4M3CB 5CIRA 2Y64A 4YZ4A
chains in the Genus database with same CATH topology
5J3UA 2VU9A 4KG8A 1MQTC 4H3WA 1A8MA 4Z8BA 4YW3A 5CVRA 5ACA3 4XBLA 2HEWF 4ISRA 4M3CF 4OI0A 1H8VA 1ENRA 5JLVA 3B69A 2JX9A 3FBMA 4L11A 1IPJA 5ABJC 1KITA 4HK8A 3VZJA 4QGNA 1C8NA 1D4VB 3ZFGC 5C33A 3N4MA 2B45X 5EWSA 4LBQD 1V6OA 4L99A 2ZHLA 1FPN2 1QH7A 3RYRA 1H8TB 1DGRN 1LOGA 2WNVA 3UKTA 1QJX1 2RR13 3ZFFB 2ZTNA 4NOTA 2R042 4RR3C 3A0KA 4HK9A 5EYXA 1QJU1 4K1ZA 1ZBE2 3AMHA 4FSJA 4Q4V1 4W6YA 5JI9A 3OF1A 1RITA 1U5ZA 4IL7A 5D8AA 1AXYA 1W6OB 3WY6A 4CP0A 1XNKA 1HQLA 4M3CE 4X6QB 4ASLA 1OLRA 1RIRA 5BY5A 1FXZA 4XXPA 5JIUA 5T52A 5B2GB 4F83A 3EO6A 1S0EA 4OHZA 2WT0A 5JZGC 2NPIA 3TB0A 2WNVB 4CDQB 1VR3A 4ZU7A 2WIIB 2P3KA 3I4IA 2CL2A 3WDYA 1IKPA 3QCWA 3VL8A 2CAVA 2WT2A 1U5IA 3QH7A 4CDUA 3FZ3A 1DHKB 2VVDA 2DFCA 5D8AB 1MEC3 1ZRRA 2XL7A 1A8DA 3GHMA 4AHWA 3FHIB 4LBKA 3JD73 3TN91 1TNRA 2VPVA 4JGZB 3WP6A 1RUNA 1LHVA 1KRIA 5J48A 2ZKLA 2ZPXA 2IWGB 2YYOA 1O4YA 2RMU3 1LOCA 4YM0A 3ZXFA 1SLTA 2WLPA 4PIYA 3AMMA 4GWNA 3ZYRA 4N7IA 3A4UA 4XZPA 3VKOA 4E2GA 1S55A 1JW6A 4CDXC 5JPMB 4CEWA 4COWA 4QQLA 3GBFA 2Y26A 2RR12 4DRVA 3CU7A 2EXJA 1HXS3 1D0GA 4CDUB 1Z7S1 5E89A 3MI8A 1NA1A 3W9AA 5T5LA 4QQHA 5BUVA 2RM21 1J59A 4J1WA 4RS5B 1KDKA 4AGVA 2VULA 1FNYA 3VLBB 1H4GA 1PO13 1Y9QA 3MPPG 1VALA 3AP6A 1BKZA 2DWRA 2UURA 1G9FA 1I3HA 1ALYA 4M00A 5GZFA 3QACA 4Q4W3 3VBRA 2ZHMA 5T5PA 4CEYA 3JBG3 3MIGA 4IXLA 1RVF1 1N1YA 4J6GA 1YFUA 2UY9A 1G9DA 1MACA 3VKFC 5EJ3A 2XH6A 2RJLA 5KHKA 1NA1B 3BB6A 4LBQB 1KFXL 2GAUA 2MHFA 1IGOA 1RUF3 1PHMA 4QXKA 5BNQA 1MEC2 1BBT3 2FZ1A 3PVOA 1C28A 4QGLA 1LGCA 3JD72 4CYDA 1OI6A 2VECA 1PO21 4QX5A 5J36A 1RUD1 1X82A 4DB5A 2UWCA 4XJAA 3ZN5A 2RMU2 1NLSA 4I3GA 3UV9A 1RUH3 3VBRB 3NKTA 3OGJA 2XPJA 4I0BA 2XLAA 4LT5A 1CAUA 4CDWB 1EPWA 3M70A 4IV3A 1TQ5A 4XETA 3O0XA 1U5XA 4DNYA 4LEJA 2KA3A 4BA6A 1CVNA 3MFAA 4MGYE 4CDQC 1BEV1 3A0NA 4LO4B 1HXS2 1X36A 5F5QA 5KHGA 2VW1A 1CR7A 1ULFA 3CF6E 4OI2A 3VKLA 1E57A 2VW2A 2Q4SA 2BW8A 4Q0UA 1GLHA 2XKPA 2WS91 1UX6A 2O0OA 4HETA 3RI9A 1NY72 4XIOA 2E53A 2HWD1 1PO12 3B02A 3CLPA 1IS6A 2GC0A 2ZGKA 3NV1A 5EXOA 1RHI2 4JGZC 1AR81 1PVXA 4LLFA 1GQGA 5J7MA 1H30A 3B93A 3NAPB 1VP6A 4XBQA 1U0AA 2PHUA 4LLOA 4ITCA 4AVBA 1LOAA 1B09A 2PLV3 3ZXLA 1FX5A 1OLQA 1PK6A 4WVVA 3B7MA 3AZZA 1T6GC 2TBVA 3JBG2 3POWA 4WM7C 3UJOA 4BPZA 2GC1A 4AEJA 5A32A 2DVDA 1QOSA 4Y1ZA 1WMDA 2OA2A 2PHDA 2D6MA 2WL1A 1CESA 3SITA 2HWF3 1JUIA 1RUF2 5T5OA 1F8VA 5JOXA 2EF6A 4A7KA 1QOTA 1BBT2 4YZ3A 2YXSA 3ZSKA 3FJSA 3AX4A 2R1BA 3MIHA 4XYXA 4RS5C 2I07B 2VNGA 2WZR1 3C2UA 4UW3A 1OMIA 3HT1A 2VOXA 3UK9A 2JECA 2V73A 3WDWA 5H9SA 3QH6A 1KD7A 4LO7A 1QU0A 1LHUA 1RUH2 1O4TA 2CAUA 2E7AA 4DQAA 3VBHB 5CBLA 4K8FA 4K9SA 3QLQA 4XJWA 4TWTA 5C4WA 1RINA 5J37A 4BE3A 3ILRA 5KHHA 3TRSB 1UPSA 1VBA3 3GBGA 3RYKA 3ZPYA 1Q3EA 1C3HA 1MS8A 1CD3G 2DCJA 3ELNA 2R0HA 2ZA9A 4L8QA 3HQXA 5KXCA 2ZAAA 2OW4A 2BVVA 4XMIA 4C0HA 3WZ1A 1FAYA 5CAZA 1S2KA 4YLZA 1PNFA 4FPCA 1QNWA 3GHNA 4N53C 1DYPA 3OY8A 2LTNA 4ZU4A 4YVSA 2ES3A 4NHKA 1G9CA 4P9JA 4K21A 3TAYA 1Q56A 4BQ1A 5FLIA 1H2NA 1DG6A 3M3IA 4FPJA 1NQDA 2YUEA 2ERFA 4BH9A 2BNNA 2DURA 3ZN4A 2QKDA 1QNYA 2XJRA 3MICA 2PLV2 5L7OC 3SLIA 3JUUA 1Q8VA 4CDWC 5DDJ2 4YFZA 1ZREA 3NW4A 2P17A 4MSVA 2HWF2 4DXZA 3KSCA 1JTZX 1H2LA 2WFF3 3LKJA 4FPHA 5AVPA 4AFBA 3JB4C 2AUYA 1HRV1 1OPOA 2OUJA 4GIQA 1SBFA 5JCTA 4BHPA 4Q4Y3 4OHVA 4YVSB 1ASJ3 3E5UA 2EXIA 4UW4A 4B4QA 3RQ0A 2FQPA 2D3PA 3NAPC 1M4WA 4D7YA 2C5DA 2EAKA 4E4SA 3B01A 2C1FA 1X8EA 4FPLA 4GALA 2RS33 4XHBA 1O3SA 1GICA 1B35A 3K48A 2NN8A 5CB7A 3JU9A 1N3PA 2D40A 4R4ZA 1ZVFA 3PVNA 2ZMKA 4LHNA 4N43A 5BNOC 2A6VA 3THTA 1GFF2 4MGZE 4Q0QA 2RS13 3PNAA 4WV8A 3N7MA 4L97A 3H9AA 1AXZA 4J1XA 1LOFC 1O91A 1DYKA 2B46X 2ZGRA 2ZZJA 4LBJA 5I0RA 3VBHC 4QPIA 2ATFA 5CFDB 1QWRA 4E4ZA 3IN9A 4NWWA 3ZSEA 5EV7A 1DQ1A 3AFGA 4I2OA 1B35B 2WNUB 4IEYA 4K1YA 3WD5A 2A6YA 4R9BA 4COZA 2W68A 2O8OA 2BYVE 2B39A 2A3WA 3JQXA 4N43B 3TWIA 5I0UA 1YFYA 1JBCA 3J8F1 2PHTA 5JSPA 2IZWA 4GMP0 4QQPA 4RL7A 3MLLA 2D3SA 1SLBA 1ASJ2 3OYWB 3NV3A 5FLHA 5L36A 2I74A 2D93A 3LA2A 4PDWA 4Z07A 1IKQA 2G4IA 3WP5A 3LB9A 1CGPA 4QPIB 2BEOA 3MIFA 1CJPA 3WVJA 5JOZA 4INDA 2PYTA 1MZ6A 1XE7A 3RWNA 2ZHKA 4G3YC 1LODA 1SBDA 4IEOA 2Q8OA 4NN0A 1ZM1A 2X8KA 1GQHA 4XFHA 2BBVA 1NCRA 2XL9A 1WW6A 1G86A 4QGMA 1X7NA 2E6VA 2F6BA 5K0UC 5JR7B 4FAHA 1TNFA 4XFGA 3PTYA 4FP2A 1GKBA 1CQ9A 2RS12 4Y1UA 1QJY3 3P3NA 3WUDA 4K3UA 5AFEA 1SBEA 4IEXA 2EA7A 2IFRA 3BCWA 5C8CA 1YIFA 4E27A 4QPGA 1EV12 1H0BA 3WV6A 1NG0A 1XU2A 4XXAA 2OVUA 3WP3A 1FPN1 2HWC3 1CJDA 1FATA 1NCRB 3JCIA 4LE3A 1GV9A 1MQTA 3CJXA 4FTSA 3VN4A 1AHSA 1YHFA 4MXWA 4YW1A 5H9QA 2VUAA 3T1LA 2Y0IA 4HL0A 4LTAA 1HQWA 1AYN1 1RUJ1 1PGL2 4LO8A 3RJRA 4F8AA 1LEDA 4L92A 2Z79A 2O1QA 4YG6A 1YYNA 5ABJA 1G6NA 3KQRA 1VRH3 2PAEA 1YJLA 3LA7A 3ZFGA 3M1HA 5FOBB 3O5SA 5LEKA 3TBDA 5KXDA 5C8CB 2O8QA 3N7JA 3WUCA 1S0DA 4QPGB 4QD2A 2GNBA 1FOD3 4YARA 1H1MA 1PGSA 3KGLA 4RQPC 4JDMA 3WOGA 1NOVA 4GB32 2XVGA 4RR3A 2H6CA 5DUUA 2PQQA 3ILFA 1HRI3 5J96B 1NXD1 4NVPA 4P9IA 1U5YA 1BJQA 5CFDC 4QPYA 1XXNA 1V6IA 1V9U3 3L9JT 4Y1VA 2XLFA 3MLKA 1YNAA 2WNUC 1VBC3 4H14A 2ZHNA 3MW3A 4EJRA 1VBD2 5ABJB 2D98A 4PLMA 3ZFEB 1OPMA 1GR3A 3ZFGB 3UKNA 4PLOA 5JZGA 3UJQA 4P9WA 1QJY2 1OQ1A 5DUWA 4C0BA 4EWEA 3AP5A 1SDWA 1RGSA 4N9HA 4RR3B 4LUMA 3KT7A 4S2HA 4FOQA 2R1DA 2UWBA 2R30A 3AZYA 4Q8KA 3WNXA 1RJ7A 3KLSA 3ZSLA 2ZGMA 1O5UA 3AKQA 5E88A 2ZCWA 3ASIA 3KD4A 2W39A 1VAMA 3FLPA 3PMSA 5F1RA 3FUQA 5L73A 2DF7A 3KCYA 4AF9A 3WW2A 3OJBA 3SH5A 2GALA 3DV8A 5D1IA 1R093 1ZNPA 2V09A 4IQPA 2NP0A 4Y22A 5JZGB 1RMU3 1HLCA 1AX1A 1R082 1RUG1 4CZSA 3I54A 4JTNA 4CDXA 4OUSA 4HPKA 2XJPA 4XW3A 4YVWB 2HWB1 3K51A 3RSJA 5AC93 2B8MA 3E6CC 1CAWB 5JIAA 3WCSA 1OA4A 2IXIA 2KM2A 2Q1ZB 3OBRA 4MUVA 4KNCA 3V0BB 2JG9C 3IBMA 2Y0OA 1YJKA 2WA4A 3ZXJA 1C8M3 2DYCA 4M3CA 5FREA 1VB4A 4DFSA 1F31A 1ZZ6A 2Z2SB 4S2GA 3WQ7A 2XBO3 2UWAA 1VBC2 2DCZA 3AZVA 2DUOA 1WCSA 4O9GA 4Y22B 3NJZA 4H55A 1Q43A 4OHWA 3MYXA 1DF0A 1HKDA 3JD71 4KL1A 4YM2A 4I09A 3B3QE 4XFAA 1FMD3 4AI2A 1AR63 5GZCA 1VLNA 4CDXB 4CP1A 4HPKB 1REFA 1PIV1 3APBA 1AR71 2RMU1 2XVLA 4JTOA 4MVTA 3D82A 1NXMA 4GA9A 3OGGA 3BTAA 2ZX2A 4OI1A 5FAXA 2PAKA 3UKVA 1SFYA 1UMZA 3WG4A 3I59B 3GF6A 1VBE2 4V1PA 1KS5A 3HT2A 3FWEA 2HWE1 4Y5Z0 3AYDA 3ES4A 4GKYA 1HXS1 4ASMB 5GLZA 1S0BA 4FO9A 4XF3A 1ZRDA 1CN1A 1W6OA 2FZ2A 3VHRA 3HAGA 1R092 3ZMNA 1GZCA 4FQZA 1RMU2 4I0AA 4ES9A 3ZFEC 3ACLA 5GZDA 3FLTA 1RHI1 5JI7A 5AC92 1WW7A 4WM8C 1GANA 3SCGA 1KS4A 4CDQA 1PVC1 4ZXKA 2NYYA 2BWCA 3H7JA 4MGIE 1TMF2 4UW5A 4U2AA 1YI9A 4Q4X3 3VBOC 1DQ5A 3AKTA 4QMAA 2QUOA 3WW3A 1LB2A 3AP7A 4HBNA 4IEVA 1C8M2 1IZ3A 2ZMLA 2D3RA 1POV0 2KXLA 4Y24A 2TUNA 5T5JA 4C1XA 4Z82A 3TOJA 2XBO2 4RHV3 4PQ9A 1RUF1 4BMBA 4JGZA 3SNMA 1Q8PA 3BIWE 2BFUL 2QZ2A 4KU7A 2A7AA 1AR62 1OA2A 3LSDA 3LGRA 3GBWA 4M01A 4A3XA 2VVFA 1HW5A 4WM7A 3S7EA 1XE8A 4PIXA 3VZOA 1RUH1 1EAH1 1DU3D 4EROA 1NLRA 2D6PA 2DUQA 4YVWC 1DZRA 3NL1A 1YWKA 3FX3A 4EN0A 1NE4A 1AL23 1BMV2 1JHNA 1AX0A 1QJZA 4R8HA 1J3QA 5EFUA 1O3TA 3EJKA 3POYA 1SLLA 4FP3A 5GM0A 4RSUA 4YZ2A 4RS5A 5ACA2 3ZXAC 2ZS6B 3ZXGA 2B42B 2P3JA 3R4DB 1H4HA 3AYAA 3CL1A 1C5HA 4EN6B 1GZWA 4B7KA 2A70A 2EXHA 3V56A 1AR93 3O7OA 2WKKA 4WM7B 2R063 5DUVA 4AEDC 3QD6A 3ZXKA 5FDBA 2WSVA 2EAAA 4G4FA 4JRAA 3MW4A 3CO2A 1COV3 3EQEA 3VUOA 4LA3A 1D2SA 4AGGA 2ZMNA 2EALA 1D2QA 4GULA 2HKXA 4LBQA 3GZUC 4YW2A 4AVCA 5DDJ1 4WVWA 1RB8G 1W6PA 1DLLA 5BNPB 4RHV2 3ZVXA 3O0WA 1S0JA 4M0NA 1GZWB 5BXXA 3FUOA 2YROA 4BIOA 2JJ6A 1KDMA 4BOWA 1DFQA 5DG1A 3PJYA 1ZZ9A 3SXWA 1EY2A 5L7OA 1SACA 3E5XA 3VBUB 4CDWA 2XB6C 4YFWA 2Z5WA 1QF3A 2XHKA 4QU2A 5BPXA 5CG9A 2QVSB 2HYKA 1PGW1 5AFBA 1PNGA 3CJIB 2XWBB 1AL22 3R05A 4KU8A 1W6PB 3KGZA 4AI1A 4YW5A 1QJX3 3ME2A 4AI3A 1KQRA 2RHPA 4N53B 3WX5A 1J3PA 5KXEA 3L2HA 1QJU3 1YLLA 5FRAA 2R32A 4I30A 4Q4V3 4HFSA 3R4UA 5L7OB 1QQP1 4Q29A 3NAPA 2R062 4QHBA 1M06G 2YC0A 1IS4A 1LOBA 4LNVA 1RUOA 3CEWA 4AVAA 4GMP1 3OBTA 3MIEA 4XBNA 3SCFA 4QM9A 5HCFA 5JDBA 1O3RA 4IV1C 1K5MC 2CGPA 1QMJA 1AYM1 1SCSA 1UPIA 3QBQA 3TNQA 2JKBA 2OUHA 1W39A 4BIFA 1AF9A 2ZACA 3M3CA 3FFQA 3MIBA 4M0HA 4IERA 2XJUA 3WDTA 2JE7A 2E9QA 4WZCA 3D8CA 3KZ4C 1LOFA 3DKWA 1ENSA 3TN93 1QOOA 1EP0A 4Q4W2 1U12A 1MVQA 5IK4A 1REEA 4XHXA 2K2SA 4WVMB 3VBHA 3M8LA 4P9YA 2W08A 1XNBA 3DUIA 1MS0A 3BU7A 3MPBA 2JENA 2WWSA 1XNDA 4JGYB 4HT1T 2VQAA 4PF5A 3AMQA 3WQ1A 5BNOB 2VGDA 1LEMA 4FPKA 4OUMA 4OHYA 3LAGA 1QJX2 5FBZA 3RPQA 2SBAA 4CTEA 1OD5A 1Z7S3 1QJU2 1WLWA 2WJSA 2HEVF 3VBSB 5BNPC 4FOWA 4JDNA 4AYUA 1ZBA1 4KWLA 5AVAA 2RM23 2YMZA 4ORFA 4Q4V2 2DCTA 1N1VA 1ZA4A 3O14A 4Q0SA 4EWAA 1JH5A 3IDEA 4KGQA 1LJ7A 2RS11 4GWMA 2EIGA 4Z1VA 1N3QA 2A75A 1GSLA 1Q8QA 4HSLA 4XFIA 5F6KA 3WHUA 1WGPA 2GNTA 3VBUC 4JV4A 1EV11 4AEKA 4DMIA 3WXPA 4JCKA 1RJ8A 4E2SA 4AHXA 4R9AA 1ULGA 2ZABA 3CJIC 3S0MA 1D4M3 1RVF3 4KG0A 1TME1 3G7DA 2XGXA 4HKWA 5I0SA 1BVP1 1ENXA 1MZFA 3SH3A 4R9DA 4YZ5A 5L19A 3LCPA 4YG0A 1PGL1 4QT6A 3MEPA 4R52A 2AYHA 3I2DA 2CWSA 2DU0A 3PLQA 1DZQA 1WUVA 4JDOA 3TN92 5K9YA 1PO23 1X8MA 2ZGLA 3DF0A 3T2TA 4P9GA 2A71A 3AMNA 5LEJA 4X6RB 1UU6A 2Q0AA 2EVXA 2A6ZA 1KXGA 1HIXA 4GB31 3WDXA 4RA0A 5K0UB 2QCSB 1I6XA 3RRDA 4F3JA 3VZNA 4FPGA 4XJ9A 1XYOA 2XKOA 1YIPA 4C91A 1YFXA 1REDA 1G7YA 1ZRFA 1OSGA 3SHRA 1ZZ8A 2PHRA 1RUC1 1AL0G 1ULEA 1VBD1 5I8TA 3ILNA 3ZXDA 1JOJA 3ZMOA 2RM22 4DS0A 4LBNA 1J1LA 1GZ9A 4H7MA 1W0OA 2WC2A 4RQPA 1N1TA 2HWD3 2ZGTA 1AZDA 1J1TA 3HWJA 1XYNA 5FTTC 1FYUA 3WG1A 4FXGB 2XJSA 2LM3A 4YGBA 3WHTA 4FCAA 3RDIA 5CFDA 4MH0E 3O12A 4YM1A 4AHZA 1FI2A 1HX6A 4R9CA 1OQDA 1VAKA 4AWDA 1VBA2 5IK7A 4JGYC 1EYBA 2WNUA 3B5LB 2GN3A 1C1FA 1ULCA 4Q26A 1TEIA 4K40A 1D4M2 1RVF2 2GC2A 4TSVA 5IK5A 3PMEA 4P14A 4GH4C 4XEZA 3JB8A 2WT1A 5J98B 2JEMA 2VG9A 3H3ZA 4IV3C 3SMHA 3RMXA 2PELA 4FPYA 1R1A1 3VKMA 3OYWA 4RQPB 2BFUS 3VBSC 1NCQB 1OHFA 5GLWA 4IEZA 1R081 5HBAA 4XIKA 1PO22 2D44A 2R073 1DZTA 2IC1A 2YPJA 3GZAA 2WZR3 1OFNA 4YYOA 1VAVA 3B9CA 1YUDA 1S0IA 2XJTA 1S0FA 3CNAA 5C8WA 1W0PA 2D6NA 4CP2A 1YCIA 1RUI1 2WFF2 4I3PA 5J09A 1BYHA 1OOPB 2XG3A 1I5ZA 5E1RA 5GJ6A 1ND2C 1W6QA 1Z78A 2NZ9A 4AQ2A 3KM5A 2CYFA 2XWJB 3IPVA 4MXVA 3KCXA 3N7LA 5SV5A 4Q4Y2 4DY5A 3INAA 1S2BA 4UBHA 2P2KA 2CGOA 5IK8A 2HWD2 1QKQA 4PBOA 3S6PA 1UF2C 1HDKA 3U07A 3VL9A 5CG8A 1H9PA 1UKGA 5I8YA 3VDDB 1J3RA 3VHOA 2NQYA 2ILMA 2JG9A 4YRDA 3NKGA 1UL9A 4YZ1A 2RS32 1H1AA 2UU8A 4YGDA 1VBE1 2JD4A 1W6QB 3USUB 2R49A 2UY8A 3LOIA 1WMEA 3IPVB 5FO8B 4SLIA 1NE6A 3R6SA 2WSUA 4KWJA 2JDZA 4DPNA 3ES1A 2ZGNA 1YO8A 2XUMA 3MZHA 1XQNA 2JG8B 2OIIA 4DY3A 5KHIA 4BCUA 2ZGPA 1HRV3 1OFSA 4NHLA 2BNMA 3D0SA 4OULA 3OD0A 1JXNA 1POV1 2GMMA 1APNA 2R072 4K6BA 4HN0A 1V6NA 4AW7A 1QXJA 3D4KA 1LU2A 3BODA 2JG9B 4EN9B 5AC91 2PN5A 1C57A 4YGCA 4IESA 2VMIA 2XLGA 5SV8A 5KHJA 3IDBB 3D6EA 4YSFA 3C3VA 1TMF1 4PBPA 5T50A 2R041 5FLJA 4TZDA 5T54A 2WQ4A 3EHKA 1ZBE1 1D0HA 1ENQA 2A3YA 1Y43B 1EPZA 1RUE3 2SLIA 4AI0A 4Y4YA 3ZFEA 2ZGSA 3WT3A 1JN2P 3D0JA 2ZJCA 2GC3A 4X8PA 3ZYPA 4WM8A 3I7DA 3ZN6A 2QQPA 1NCQC 2DVBA 4OFGA 1R1ZA 5FO9B 2K0GA 3Q9OA 3VBOA 2MEV3 4D7SA 5DG2A 1AX2A 1VBB3 4Q27A 4XTPA 1A6CA 2NLRA 2QDNA 4WZFA 3X29B 2CY6A 3ETQA 2UYAA 3RZZA 4BZ4A 4LBLA 2ETEA 4IEUA 2MPFA 1BMV1 1SFNA 4S2DA 2D6KA 1DBNA 2JICA 3BOPA 1MS1A 1OOPC 1WD4A 2YY1A 4ZU5A 5JOYA 1UAIA 5ACA1 3B00A 3BALA 4KBBA 3ECQA 4K20A 1J58A 4YW4A 4WM8B 3VBFC 4HVQA 3EBRA 2NM1A 3ZN6B 3J8F3 4KH9A 3WLUA 3VBOB 4YVWA 2RE9A 1LR5A 3LWCA 1AUYA 5DZFA 1LOEA 2HWC2 2ZX1A 5HI0A 4Q8LA 3M7AA 1CAWA 2YZ4A 2ET7A 3ZYJB 3DGTA 4XQ4A 2V5YA 2Q1MA 3TYJA 2K9ZA 2RR11 3VDDC 2A73B 4XFFA 3AZWA 3V0BA 2XJVA 1UCXA 3MGUA 3VHNA 2BQPA 3DL3A 2ZX0A 1IS5A 1I1EA 3AJZA 4Q2FA 3MLJA 1DIWA 1RUE2 1IOAA 2PFWA 1BQPA 3AP9A 1VRH2 1LU1A 1AXKA 3RMYA 5KC6A 4AEDA 3M2MA 5TSWA 2PA7A 2E7QA 3G6JB 2ZOEB 3ST7A 2JG8C 3IM0A 4AQ6A 1FOD2 5LK5A 4XF1A 3AP4A 1LRHA 1V6MA 3ZYIB 2MEV2 1HRI2 3I59A 3VKNA 4Y26A 2N7GA 1VBB2 3OTFA 5I8SA 4AI8A 3NVCA 2NMOA 1PZ9A 1VB2A 5EZWA 5BNNB 1V9U2 1YXWA 4OZXA 1AL21 5CFCB 1FPN3 4AQSA 1UD1A 1MEC1 3NV2A 2PHFA 4ES8A 4EN8B 1GNZA 4AEDB 1W6MB 4LULA 1Q8OA 2P34A 4H7LA 1AYN3 3WR0A 4YNIA 1RUJ3 5T55A 3W58A 1Y7BA 4HN1A 5GZGA 1HV1A 1S0GA 3V64A 5GLUA 2NMNA 3PJQA 2ENRA 3H7YA 2WLQA 2Q30A 1QDCA 2X5IC 3PHMA 4B4PA 1Z0HA 3AYCA 2PAMA 4XPVA 5JSOA 2W0XA 3WQ0A 2BNOA 4FXKB 4QQOA 1Q5OA 3KB5A 2VQ0A 5HCAA 4FOVA 4NO4A 3AMPA 1NY71 1PO11 2GMPA 4AFAA 2GNMA 4FOYA 5K7PA 4SBVA 4ATFA 2LUWA 1XRUA 2LALA 4Q4W1 1H1IA 3H0OA 5C9AC 4YM3A 2AR6A 3JBG1 4AK3A 4C1WA 1CAXB 1PMIA 2DVGA 4IV1A 1K5MA 2DCKA 3FLRA 2BWAA 2RS53 3JZVA 2CWMA 1YI7A 4NR1A 5LRSA 2QE3A 3TNPB 1C4RA 5E16A 1N1SA 3D5OA 1BBT1 3ZSMA 2B7YA 5A3LA 4N7UA 1FMD2 1KFUL 4XF0A 1RC6A 5KXBA 4HSJA 1AYN2 1ND3C 2AH2A 4OHXA 1RUJ2 1MZ5A 1IS3A 3POSA 1MVEA 2YV8A 3KS7A 1YFWA 1RUG3 5A3MA 2PHXA 1GYKA 4XJ8A 4IV1B 4Z92B 1K5MB 2WNEA 2VY0A 4L2NA 1QGLA 2HWB3 2VMGA 4IEPA 1UU4A 2PTMA 3ZIWA 1N47A 2ZGQA 2P37A 5BNNC 1MS3A 1F9KA 3AZXA 5BNPA 4E2QA 4NPRA 3U11A 4EN7B 1LULA 3WDUA 5CFCC 1MS4A 3OCPA 2GH8A 1C5IA 4JVAA 3DPRC 1UZYA 3MFCA 1MS5A 4TYSA 2PHLA 3VBUA 1H2KA 3S30A 1RL3A 2VNRA 3NSTA 2GMEA 4Z2WA 1G9BA 3AFKA 4U36A 2PLV1 4BLIA 4Q4X2 1PIV3 3HBZA 1O4ZA 1AR73 2G9FA 3H1YA 4EV0A 3CJIA 4B7EA 2RS52 3IIAA 4LE4A 1DQ4A 4MX3A 1S0CA 2HWF1 1SLIA 3AXEA 4WVZA 4AVVA 1LESA 4N53A 5K8SA 3WINE 1IQAA 2D43A 4B29A 1DQ6A 1F5FA 2HWE3 3B94A 4UXAA 3AKPA 4XF9A 3AXDA 5IUQA 1KJLA 3KMHA 1LTEA 5JMCA 3QOPA 1QHDA 3VZKA 4C90A 3ZSJA 3N36A 4MGKE 1CAVA 1ZZBA 1RUG2 2VVEA 4DZGA 2ZAHA 4XDQA 4MYEA 1RHI3 3VZMA 1HV0A 1UIJA 2R6QA 4HKLA 2HWB2 3LA3A 3E5QA 3THPA 1PVC3 4GXLA 1VBA1 4W6WA 4CEWB 3WW4A 3ALQA 1WLTA 4F7ZA 4B3NA 1CPNA 5FMOL 1D4M1 4A7ZA 1H8TC 3RNSA 2W52A 1MR5A 1G8WA 1CIWA 3HD8B 1AJOA 5JOWA 3H1MA 1AR92 4LO5B 3ZFFC 4G9SB 4COUA 2HEYF 4COYA 2D5HA 5GLVA 1CAVB 4WVMA 2GDFA 3SISA 1COV2 2A5ZA 3T1MA 2GH2A 5I0TA 5FOJB 3PVBB 2ZKNA 4JGYA 1PIV2 2BPA2 1AR72 4LA2A 4CRQA 2VOVA 2DU1A 5FPXA 1EAH3 4HANA 3WG3A 4GH4A 4A7YA 4E9KA 2IXLA 5BNOA 3RI8A 1ZYBA 4CEYB 4AFCA 1UW8A 4Y1XA 2WFF1 4QM8A 3SH4A 1GBGA 4FTEA 4JQRA 2XVKA 1JUHA 2WNVC 5T3NA 2HWE2 3VBSA 1URXA 4AHYA 2F4PA 4Y1YA 2GNDA 1BZWA 4Q4Y1 2IXKA 1ASJ1 1SCRA 2R0FA 4IETA 2CTVA 2VMHA 3HIFA 4LBOA