4BWOA

The fedf adhesin from entrrotoxigenic escherichia coli is a sulfate- binding lectin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
SAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGNKKCRFTGFEISLRIPPNAQTYPLSSGDLKGSFSLTNKEVNWSASIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords F18 FIMBRIAL ADHESIN AC
publication title Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
total genus 31
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1210 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bwoA00
4B4QA 4BWOA 4B4PA 4W6XA 4B4RA 4W6WA 4W6YA
chains in the Genus database with same CATH superfamily
2DYCA 1S4CA 3A7QA 2XBO3 1VRH2 3A21A 3QACA 1UKGA 1YUDA 4LBMA 1EPWA 1LODA 1V6LA 4O9EA 3NJVA 3LPGA 3V64A 3ACIA 4AI3A 1Q8OA 1C1LA 3F95A 5F7UA 4KI5M 1AL21 1GZWA 1LJ7A 1LHVA 1H8TA 4OHWA 2OX0A 3VKLA 2WRAA 1YFUA 3BOWA 5IK5A 3ZR6A 1O3TA 2SLIA 2YROA 4FPJA 2RMU1 3JB4C 4FAHA 3H7YA 2ZXQA 2NP0A 3RZGA 4LPLA 3PUHA 3ZYRA 1YJKA 2ZGUA 1YQCA 3ACGA 4QPGC 5DDJ3 1CIWA 4UFLA 2X29A 3WSOA 3VD5A 1YIPA 2YGMA 1SBEA 3WNLA 4ATEA 3K4AA 4TSVA 1POV0 2BTVC 5IAVA 4BQ1A 3ZYGA 1YQ2A 2XR4A 4YVWC 2WO3A 1SDDB 2ZBJA 4QX2A 5J48A 3RDIA 3HIFA 3OOXA 1CGPA 4L99A 1QJEA 3H3ZA 3ACFA 3WG3A 2WFPA 1G9FA 4TLFA 1YCIA 4XF1A 1AL22 1H6YA 1ZRRA 2CV6A 4MLOA 5JI7A 4BJ0A 4YZ3A 4NHYA 5CEHA 4KG0A 3AP4A 5F37A 3OUHA 3NV2A 3MICA 2HWB1 2AUYA 3OBTA 4UFJA 3VBUB 5BNOA 1YI7A 5DAWA 1AR73 1LEDA 4YW7A 5T55A 1AR91 4QX7A 4A41A 4F83A 2R1BA 5A3TA 3VDCA 3IMMA 1OPOA 3U75A 3UL2A 1KXGA 1W6QB 4S2HA 5F6LB 2GZWA 1CX1A 1IKQA 4JC1A 1XU1A 2XOMA 2AZ5A 4JHTA 4C1WA 3I2JA 5ANQA 1NE4A 3WDXA 2Y38A 1AJOA 1H8VA 5KC6A 4AHXA 2XLGA 3I3QA 4COVA 4YARA 2H6CA 1GP4A 4RS5B 2VMIA 2VC9A 2HWB2 4W6WA 4UW4A 2PLV1 2VCAA 3IBMA 2OUJA 2XL9A 3ZYJB 1QOTA 2GN3A 4IGOA 5HI0A 3O1MA 1PGL1 2WNUA 4L11A 2Y0OA 2OW4A 1OFNA 2D44A 1AR92 5FKCA 3O1OA 3M7AA 5DMYA 2V5YA 2ET7A 3FFQA 3RWKX 3D6EA 4LO5B 1VB4A 1ZRCA 1ULGA 3DKWA 1O4TA 2Z4FA 4IE7A 5KR7A 4D0QA 5C4WC 2XXZA 4PLMA 5F9TA 2ZMLA 4FOQA 2EIGA 4Y1VA 3HQXA 1Q8VA 1ENSA 1JMUB 5T50A 1GSLA 4EN7B 5HXVA 4FI9A 3TYJA 5IVVA 1QIQA 2JIJA 4XTPA 2XKOA 1S0FA 3VV1A 2TUNA 5IVEA 3KWVA 2RM21 2PLV2 2JG9B 3PUSA 3R4DB 1YIFA 3NWKA 4KNCA 1GV9A 5FRAA 5FZKA 1PGL2 5EXOA 2WNEA 2R30A 1YWKA 2NQYA 1F8VA 1J3RA 2RDSA 3PUAA 2YUEA 3TOJA 2B9VA 2HWC2 1O7FA 3IDAA 2WNVB 4QX8A 1YO8A 5D21A 4NRQA 4D94A 1G9DA 1DG6A 3PVEA 4LBQA 4AI1A 1UXZA 5EHDA 5KHKA 5F2WA 3GNEA 3IT8A 2DURA 3VBUA 3EQEA 4ZS2A 3GZAA 1JYIA 1DQ5A 1H8TC 2FQPA 4Q4Y1 2GSYA 4LKEA 5HCFA 4R9BA 1RHI1 2ZX4A 4BZ4A 2HBTA 3TB0A 4AEMA 2RM22 1W8TA 5G04L 4XHBA 4QHOA 5E16A 4D69A 3BPZA 4FOYA 3JD71 1DQ4A 3QD6A 3ZDVA 5BNNB 5JOXA 4N9IA 3NV1A 4JHZA 1QH7A 1SLIA 1QJU2 1AHSA 2VL4A 3HWJA 4RS5A 5T5OA 3RYKA 3B02A 5LEKA 5F32A 3Q8AA 1S0GA 2VUCA 4XDQA 1GOFA 2RS32 1C4RA 4XE9A 1RUI2 3AVRA 3ZSKA 5FZDA 1R091 1WGPA 5KC5A 4YRDA 1OH3A 4IXLA 3FL7A 4MVTA 3VBRA 4COZA 1HV1A 1FI2A 1RHI2 4O7XA 5BNOC 4CU6A 3FUQA 1GUIA 5D8AC 5KXDA 4CP0A 4HVOA 3K46A 3WF0A 3AP5A 4K40A 2ZMNA 2ZHKA 3AP6A 4IEQA 4GALA 2QQPA 4YW6A 1NX9A 3JD72 2G9GA 4KG8A 5IVJA 4GULA 1F5FA 1VMJA 2MEV2 4Q8LA 2QQWA 1L3JA 1AR82 3V0AA 3VKMA 2DBNA 3ZXJA 5H9RA 4BXFA 4FT8A 4I02A 1JYXA 4QD2A 4JDNA 1QQP2 1OLME 4UBGA 4IEZA 3IZOA 2ZMKA 4CDUA 1Z7S1 4A7KA 1TNFA 1R092 3WNMA 2WNVA 2XLAA 3E5QA 5H9SA 2ZGKA 2BP6A 1QJX1 3WQ7A 4PQQA 2WNUC 1VBD3 2BGPA 3ON7A 2GNMA 3POGA 2R32A 2VZSA 4QHZA 3SCFA 3ZN4A 1QDOA 4WVVA 1W2OA 3Q8BA 1IKPA 1D4M1 2XGXA 3LSDA 1WCSA 2NM1A 4MV2A 1JZ7A 4MADA 2BNMA 3EB7A 5FZ0A 1V00A 1W2AX 4FPEA 5FMBA 5C7GA 1W03A 1YRZA 2QBXA 2WUHA 3PHMA 1NAEA 1W06A 5DUVA 4XF4A 1RIRA 1W3VA 2Y64A 3U4SA 4CDXB 1TMF1 1QJX2 1XNCA 4ORFA 4FFHA 1W6MB 3C7HA 1MVQA 4UBHA 1V6OA 1VBE3 2PAKA 3KB5A 5LY2A 5A7WA 3AZWA 4R8HA 3ME2A 5DAVA 4NIIA 5JOYA 3GCXA 3WNOA 2OXBA 3GXUA 1ZRDA 1TME1 2LALA 1E57A 1CPNA 1WW7A 3GZEA 3VBUC 3CL1A 3OPZA 2OPKA 3ZYFA 1J3QA 3SKVA 1E5SA 1VIWB 2W68A 1QJY3 1GYKA 3PMSA 1PMJX 2JE8A 4HANA 4KU7A 4MXWB 4ES8A 3BTXA 2W5FA 5DZGA 2CAVA 5L9BA 1C8NA 4FCAA 4FPKA 3VBHA 4P08A 3RJRA 3I7DA 4K7JA 3RRDA 4BLJA 4CDWB 4XURA 3HVDA 4Y1UA 2PXJA 5IK8A 1TMF2 3KHCA 4S2DA 4HXCA 2BQPA 4A6SA 1W8UA 2QJVA 3T2TA 4OHVA 5CG9A 2BWCA 4LBQD 4DFSA 2NYYA 3MIBA 3O7OA 2K9ZA 1TME2 4RS5C 3VGIA 2GDFA 2ZHNA 1HB1A 3SEEA 1V6JA 3AKTA 1W0PA 1HRV2 5IW0A 1AUYA 3WLUA 3MV11 1HDKA 1UW8A 1JU4A 4NHMA 2FZ2A 4YZ2A 1A8DA 3T1MA 3VBRC 1W8WA 4BQ3A 2W9XA 2KA3A 1CAUB 1PVC3 4V1PA 2VECA 2VVDA 2CWMA 1BQPA 3ECQA 4WM7C 1RUG3 2BW8A 2L9LA 4BE3A 4A7ZA 2R041 1US3A 3KMHA 4JGYB 3WF3A 4FTSA 1GOHA 1ZBE1 3ALQA 4W6XA 4XCBA 3FBMA 2UWCA 3H0OA 3UK9A 4BQWA 5SV8A 5LZ6A 3RZKA 2CGPA 1KD7A 3KM5A 4V2WA 3NJZA 2R16A 1D4VB 1WWYA 1N1TA 4BMEA 1BEV1 4Y1ZA 2RG4A 3KCYA 1UY1A 1GZTA 3OEAA 3FWEA 4Q4X1 5FPZA 4CDUC 1H0BA 1QWRA 3H9AA 3LPFA 4LOTA 2WNVC 2LUWA 1SEFA 1XE8A 3M3IA 4Q0VA 4DUXA 1A8MA 2D6PA 2NLRA 2R063 3VD9A 4IE5A 4AAPA 4DINB 5BNPA 3ROUA 4PDWB 4DO0A 2IXCA 4PIXA 1SLCA 1UAIA 1KDMA 5CB7A 5L9VA 3NV3A 4GB33 2QQKA 1NCRA 3NNGA 1KQRA 2R042 2X5IC 1FXZA 2KM2A 3N9QA 4X6QB 1FOD3 4MXWA 3T09A 1DZRA 3NMBA 5A3UA 3NQHA 1LU1A 3I2GA 3NJYA 2D6NA 5F3CA 1W0OA 2VNVA 3B9CA 3K2OA 4TYSA 4CVUA 1R083 4W8JA 3VZKA 2HYXA 4LO7A 2ARBA 2C5DA 2HWF1 3ZFEA 5K0UC 1BEV2 1W8FA 1NOVA 4J1XA 4AHZA 1XNKA 4Q4X2 3VZLA 4NE9A 1WMEA 3HBZA 3MW4A 4PIZA 3OYWB 5FZAA 5FZ3A 4XQDA 1JHJA 1TQ5A 3O0VA 4NIGA 2ZACA 4Z07A 3HN3A 2BGCA 4Q1PA 4TN7A 2BOJA 4HPKA 5FUIA 2VNRA 4NWWA 1K12A 3OPTA 4U2AA 5A7SA 5AFEA 3USSA 1CAUA 2FDKA 2QFEA 2CDPA 5JOWA 5GZGA 1W39A 4N8MA 4AXOA 2ZGLA 2ORXA 1SPPA 3AXDA 2XBO1 4AVVA 5FOJB 1F9KA 5J3UA 3O5SA 2W46A 5FREA 2EAAA 3AMNA 4JGYA 1EYBA 3VBHC 3CNAA 2JE9A 2GC3A 1ZNPA 3C7OA 4MYEA 5GKAC 1XE0A 1XSQA 2ZAAA 4CUGA 4WBBA 3MO4A 3R0RA 4MGIE 2WWSA 5LB6A 4NRMA 3T08A 1OOPC 3QH7A 3VHPA 5CISA 2WZR3 1STMA 4WVZA 4IV1A 3KCXA 1G9AA 4XETA 4IETA 3ZKYA 4BISA 1CAVA 3GHNA 2H6BA 4HONA 3RZMA 5KHIA 2YC0A 3WT3A 3THTA 3VDBA 5CFDB 1VBB3 3FLPA 2VCMA 1ST8A 4LLFA 3ZFFA 2V5DA 4LK7A 2EXKA 5B4XA 1BZWA 1TG7A 2XVLA 4E2GA 4I2OA 1W2NA 2XH6A 1ULCA 1RUE1 1DDLA 1UY4A 3MIHA 5CAZA 1UCXA 4LHNA 1RITA 1ND3A 5FP4A 1LHWA 2WYSA 3VN4A 3GYDA 2JB4A 3PJYA 5FKBA 2XHKA 5CBLA 4XXPA 1WCQA 5C33A 1O3RA 1VBA1 1XSRA 5B2GB 1EV12 2B9UA 4AFMA 4EYUA 1MR5A 5IFPA 1CN1A 1S0DA 5FFOC 2E26A 2ZEXA 1AR71 3ZSJA 4BA6A 4E2QA 1PZ8A 2W1QA 3M2MA 4HFSA 3WNKA 2QKDA 5C8CB 1F2NA 2W1WA 2Q8DA 4XF0A 3VL9A 4AF9A 4Y5SA 2JICA 5FY9A 3LIGA 2GP5A 1EP0A 1GICA 1ENQA 1PO23 3GGLA 4P02B 3B3QE 1D0HA 3M70A 2Z2SB 3EBRA 5DZEA 1RUE2 4INDA 5CIRA 2C26A 3KQRA 3VBFC 1OQDA 4XMIA 5FZIA 4LITA 2DDUA 3ST7A 2PQQA 2O14A 3WINE 4MUVA 5BNPC 5A7PA 4Y3OA 4EZ4A 3CQOA 4D8MA 2X53S 1S2EA 2WWUA 1PX4A 1CZVA 1NCRC 1VBA2 1XNAA 2HLEA 1ASJ3 4B4QA 2RS53 2PYTA 2A7AA 1ULPA 4Q0QA 3RZJA 4Q26A 1ZA4A 4I0AA 2WT2A 1FPN1 2BGOA 3FC0A 3BTAA 4Y24A 2QQNA 1ODNA 5FUNA 1ZZ8A 1LENA 2VVFA 2P3YA 2J42A 3K4DA 4K9SA 1U5IA 4UW6A 4N90A 5DZFA 3ZFEC 2RJLA 3N7MA 3N9OA 5IFTA 4Z92B 3I2IA 1VMHA 2JJ6A 2W1SA 4IEWA 5ABJB 2WLPA 1CZSA 2W3JA 4C0HA 1AYM3 4LORA 1W99A 2FCUA 3VZMA 3FZ3A 4AGGA 4AQ6A 1MS0A 1SQ4A 4L92A 1JOJA 4A44A 4JGZB 3U78A 2VW2A 5CFDA 4ZONA 5J36A 1LB2A 3VBOC 4AWDA 1X7NA 5ACA2 1O4YA 2ZTNA 3KF5A 2ZPXA 4CEWB 2GC0A 2JG8A 4HZFA 5LA2A 2AEZA 1FPN2 5L19A 1ENXA 2A3WA 3ES4A 2RDRA 4B4RA 4Q0UA 2C0ZA 1V9U3 1DCSA 4QQHA 5IK7A 4RYDA 1HN1A 5A3PA 5DAXA 3WF1A 4P9LA 4ZY9A 3N9NA 1E5RA 4QU2A 1EUTA 3WHTA 2YBSA 1LGCA 5JDBA 2D98A 3J7NA 1HW5A 4XZUG 5HCBA 3OGVA 4EV0A 4CU8A 1GWKA 1J1LA 4IV1C 3S5QA 4DUWA 1QOOA 4YZ1A 3K4ZA 3W5NA 4XC9A 4HMZA 3OGSA 1W9YA 1DYPA 1Q5OA 4TXWA 1YQ5A 2W08A 5EP9A 3HN1A 2PA7A 2YC4A 3POEA 4GA9A 3ZFFC 4TZDA 2BBVA 3ZIXA 1H30A 2NZ9A 3X29B 1Q8SA 3GBFA 1OF3A 1BJQA 1AYN1 4KU8A 2GAUA 5IATA 2D97A 1NY71 2XVGA 2LW8A 5HCHA 1A34A 5JZGB 4UW3A 5FR3A 1ND3C 1S0CA 4HK9A 4Y33A 5EYXA 3UNPA 1B35B 4ISRA 4GZ9A 2F17A 1U0AA 3MEPA 1F35A 2ZOEB 4I3PA 4IV3A 3KLSA 3MPPG 1VJ2A 2BNNA 5L36A 3AZYA 1H1MA 3C7FA 4M4PA 4CTEA 5ABJA 5LA0A 1XOYA 1UMHA 4RQPB 2PMWB 1QOSA 1BMV1 1R64A 2C9AA 2KR2A 2PELA 5IUQA 5C5UA 3VDAA 4OI0A 4K20A 5E6HA 3AKQA 3RYRA 2E53A 1AYN2 3J26N 2UYAA 3VDDA 2A75A 3TEXA 3OG2A 2B8MA 4B29A 4NIHA 1PK6B 4YW3A 1OC1A 1O91A 1UZVA 3ZFGB 1H1IA 5FYIA 2D43A 4QKFA 5FJKA 1OVPA 3S0MA 3JQXA 3I3MA 1ZBA2 4Y26A 2IWGB 1N1SA 3A22A 3LDRA 1EAH3 2E7TA 4UOJA 2VZPA 5FY0A 3FHIB 2RR13 4LXLA 4QPIA 5FZGA 4YFWA 3OGJA 4MG2A 4GH4B 1W9TA 4QKBA 5BXXA 1COV3 4UYBA 4ARXA 1IOAA 1LOBA 1UQXA 2RHPA 5CVRA 1JS9A 4BXSV 1H4HA 4PLOA 4HVQA 1NYWA 1KDKA 1OBNA 2DVDA 2G9ZA 1HB3A 1UOFA 1HV0A 1MZ5A 5A6ZA 1RVF1 3PVOA 3V65A 4QU1A 3ZYHA 5DG1A 2A3YA 1UX7A 2W2IA 4YLZA 4NHKA 1ZM1A 4Q27A 3E5XA 1LR5A 4CCCA 3MLLA 2RS13 2GP3A 2P34A 3KS7A 4IGQA 1KGYA 5FZLA 4YVSA 5BPXA 4WM8A 3OBRA 3DV8A 3HT1A 2B42B 4R9AA 1W90A 5FMDA 3PL0A 4XEZA 2JG8C 2GH8A 4EZHA 2HWE1 4ATFA 4Z1VA 1PMHX 3TN93 2D5HA 3U07A 2YU1A 5FP7A 1B35A 2HWD3 4D7YA 1G6NA 4CCOA 2FD8A 2OPWA 2ADEA 3DL3A 4BQYA 4E9KA 4R4ZA 1RVF2 1HIXA 3JZVA 2Y33A 4XBLA 2OVUA 4AHWA 1G8WA 3O0WA 2DCTA 2CY6A 2JDNA 4QXBA 2LRPA 5BY5A 1OD5A 1QJY1 4RQPA 4GMP3 2A73B 5LCWL 5FZBA 1BXHA 2FMYA 3B00A 4YYOA 2JIGA 3AYCA 3IM0A 4IEXA 2D3SA 5IHRA 1J59A 4A3XA 4AVCA 3RWNA 1S2BA 1C28A 5HBAA 1RXGA 4UW5A 4URAA 3PJQA 3H3LA 2HWE2 3JBG3 5LY1A 2GMMA 3WNNA 2UYBA 1WW5A 4XXAA 2PHWA 2EXHA 3WF4A 4QQOA 1YLLA 2Z42A 5FZOB 3VKFC 1OVSA 4FOWA 2VMCA 3GZUC 3ZXFA 4IGPA 4YM1A 4A3ZA 3VKOA 3OSDA 1W04A 5F6KA 3DPRA 1APNA 3KD4A 2ZJCA 3RMXA 3KT1A 3O1SA 1PIV3 1NT0A 1GLHA 5T5JA 2QTWB 1RUD3 2GH2A 4IV3C 1RYYA 2X10A 4KMQA 1OXCA 4QM9A 3AK0A 3AJYA 5AC93 1B09A 3EHKA 3POYA 4D6SA 2V4AA 3BVCA 4DEQA 2VUJA 2TBVA 2CNAA 2CYFA 1DZQA 3AFGA 4BYYA 4X8PA 3FHAA 4BIOA 1RMU3 1RUG1 4GAZA 4Q1RA 3N3HA 2ES3A 2WNOA 2PN5A 3G7DA 4KBBA 5JMOA 2ZX0A 5FZEA 4P9WA 3VDDC 2WKKA 5A3OA 3RS6A 1JOPA 1RINA 1SG3A 3CJIA 3VD3A 4CP9B 4ZU7A 2XWJB 4HVRA 4M3CB 4QKDA 4NIAA 1WMFA 3OY8B 5EFUA 1H6XA 1Q43A 4JAAA 5FOBB 3K3OA 3LFIA 4NPMA 5HCAA 1PNFA 2WC2A 3ILNA 4RHV3 1C8M3 2ZAHA 4QPYA 3AMQA 4QPIC 1SMVA 4XJWA 4AEJA 1CONA 1X8EA 2CGNA 2Y34A 5GM0A 2VG9A 1WLDA 2JE7A 2BWAA 2J1AA 3N9LA 4GB31 2KD7A 4HSJA 4LJHA 4M3CE 4UXAA 4TTGA 3ZN6B 1FOD1 4Y5TA 3W59A 1GFF2 2RMU2 4ZU4A 4CUBA 2WYFA 3THDA 3NNMA 1QJZA 4AHYA 2N7GA 2OKXA 2R0HA 1W6OB 4B1MA 2G4IA 2DCJA 1R081 4H7MA 2XJVA 2VR4A 5LK5A 3CF6E 4LKSA 3MPBA 4OI4A 1UZ0A 1Q8PA 2MHFA 2IZWA 2OZJA 4YVSC 5IVYA 3N4MA 4NAOA 4WM8C 2XKPA 5J7MA 1AZDA 1HRI1 2R49A 3BI3A 1KITA 3TEZA 1XNBA 2JXAA 1H2KA 4KGQA 5A3MA 2VNGA 1DGWX 3BU7A 3KT4A 1AX0A 4FQ4A 4JQTA 2ZGSA 1I3HA 3I2FA 1FOD2 1OI6A 1K5MB 1NZCA 3ZN5A 3POIA 2VJXA 3H42B 4C90A 1GKBA 1ZZ9A 2G19A 3RPQA 1VPHA 3ZOIA 1PX3A 1MS9A 5JXHA 4UWDA 4P5HA 1ENRA 1GU3A 2A6WA 3LGRA 1WLWA 3ZXKA 2WS93 2W52A 3GHMA 5B4NA 2RDQA 2Z5WA 3A0KA 2CAUA 5J09A 3POSA 3AL5A 2YGLA 1HRI2 1UPSA 4EN6B 2JKXA 3D4KA 1UIJA 4CP9A 1MS5A 4MHUA 5A3WA 5CKNA 4LO8A 3MZHA 3OY8A 4COUA 1IS6A 1JI6A 5FMOS 2Q0AA 3LEMA 1D0GA 5C8WA 4CPBA 5LASA 4GQ7A 5F3EA 3ZO0B 2WO2A 2QQLA 3HQRA 1W8NA 4AGVA 3M3CA 4YM3A 1QXJA 2GU9A 2O0OA 3CKHA 3DPRC 3Q8CA 4CEYB 4COWA 2ZEWA 3MW3A 5DG2A 5LBEA 5CADA 1IGOA 3WDTA 1BVP1 4DNYA 3VD7A 1SACA 3ZXEA 2VQTA 3J9SA 3K51A 4U36A 2WFF3 2C1FA 2Q8EA 1NLRA 2XG3A 5FK7A 4QPWA 4UAPA 2W94A 4DOUA 1DYKA 4K3UA 2PHFA 4KBZA 1W9FA 3WG2A 4BU2A 4JTNA 5BNQA 1SCRA 4FPYA 2CL2A 4WZFA 3ETQA 1VB2A 1W6QA 4HKLA 5FWEA 1N3PA 5F3IA 1RXFA 3CJIC 2R071 2JECA 1UYPA 3IDEA 4O61A 2QDNA 2XMLA 1MEC3 5DAPA 5K7PA 5FYHA 3KQ4B 1LAJA 5A3NA 4XUTA 1FMD1 3NNJA 4L9BA 4XFIA 2YDEA 3ZMOA 1QEXA 4HOOA 1BBT3 1DLCA 2VBDA 2SBAA 2YZ4A 4IW3A 5KHHA 5T54A 2XL7A 3MFAA 3PDQA 4FFFA 1AJKA 5EJZB 3BTYA 2QNKA 3N7KA 4BHPA 2W91A 3E6DA 5A70A 3JQWA 3O1UA 4Q4Y2 4XABA 2RS51 1D2SA 4OMCA 5C3SA 1W6NB 4RGGA 5FO7B 1P8JA 1RUC1 1CAXB 2EIEA 4N53B 4AW7A 2P2KA 3WW2A 1JZ8A 3U14A 3J8F1 3D8CA 1FX5A 1WLCA 5F5IA 5KHJA 1OKOA 2R072 1S0JA 2VMFA 3CHXA 4CUCA 2VH9A 2ATFA 1RJ7A 5I0SA 4JX0A 4LA3A 4FOVA 1HXS1 3DXUA 5DUUA 4OHYA 5GZDA 1FMD2 3W58A 1XE7A 3LIHA 1LHUA 3C7EA 3AJZA 4DUVA 3PVNA 4V2VA 1JHNA 1US2A 1KFUL 2JG9A 4AI9A 4X6RB 4M0HA 4XFBA 4XAEA 2WQZC 3WVJA 5T52A 1RUF3 1DU3D 2CHHA 3ILFA 4DY3A 5DPNA 3FJSA 1Y9GA 1RUC2 1KFXL 2WA4A 3P6BA 1GANA 3R05A 1GNHA 3U1XA 4CU7A 1LESA 3BGAA 3WX5A 3J8F2 3PTYA 3ZXAC 4FBFA 2TEPA 4YNIA 1HLCA 1PO11 3FHQA 4MHRA 3M8LA 2D3PA 3KZ4C 1CJDA 3H8OA 1HXS2 2VPVA 2Z79A 3E6BA 4DMIA 4ASMB 2BVBA 3ZDSA 3POFA 1VP6A 2YXSA 1DQ2A 4LE3A 2EXJA 3H8UA 5FJHA 4FPFA 1AX1A 2JWPA 3LDKA 2QCSB 2CWSA 2A1XA 2ZGPA 3OTFA 4CZSA 3TEWA 5F39A 4ISQA 4CXYA 1LECA 1POQA 5FZ6A 1Z7S2 5JVVA 5BNNA 3N9PA 2FMDA 4LNVA 5F1RA 2VUDA 3WD5A 4D7SA 5FZMA 1IHMA 4ONUA 1AR61 2VOXA 3LWCA 1JBCA 3NNFA 4PJYA 4KWLA 1PNGA 4RFRB 2VZQA 2VZRA 3WDVA 3CMGA 3VZNA 1PO12 4A4AA 5A6YA 1LGNA 2ZGQA 5A1FA 5CU1A 5CZKA 4AL9A 3IWZA 1QNYA 1D4M2 2JKBA 1Y7BA 1OLQA 1UYYA 2J1UA 3HOBA 1H9WA 4LHKA 4N53A 4QM8A 5FYUA 4EN0A 1MZEA 1UXXX 3U10A 3PUQA 3IAPA 1CAWB 1OLMA 2GC1A 2Y8KA 3KV5A 4LO4B 4NHLA 1RUJ3 5FP3A 3TAYA 5JLVA 1DQ6A 1K45A 3GF6A 4I0WB 4A42A 1PZ9A 1W8ZA 2WN2A 3E97A 2ZGRA 4YW2A 1YFXA 4Q8KA 2I2SA 5FTTC 4E4DX 1CJPA 3SH3A 5GLZA 1O3QA 2D6KA 1RUH3 4LHSA 4IERA 1POV3 2OUHA 4QKNA 1G9BA 2AREA 1JZ5A 1AR62 5CYYA 4GWJA 4XW3A 1J58A 5CFCB 4CCNA 3AZXA 2E63A 1S0IA 1EY2A 4FQZA 5GLVA 4JVAA 4MZUA 2I74A 4LT5A 1I5ZA 1NCQB 1H2LA 2VZ1A 4XUNA 1GZCA 1UOBA 4AVBA 1JYNA 1BKZA 1S0BA 3DYMA 1LOEA 2HBUA 3IPVB 4Z8BA 1EAH1 3IB3A 4AE2A 4CSWA 3MUZ1 2XJSA 1Y4WA 3DGTA 4DRRA 1LKNA 5G05L 5BYNA 3I49A 2V4VA 4YW4A 5FZCA 1V6MA 1Y9MA 4OULA 1UY2A 4XHXA 3VZOA 1JTZX 1SFPA 3TBDA 2ZZJA 5KWRA 4NUBA 3B9IA 1DF0A 1NQJA 2QVSB 2WO1A 5JPNB 3FBYA 4XOGA 2AEYA 2W0XA 3SLIA 3OUJA 3I4IA 4ITCA 3GJAA 5IAXA 4QGMA 2JG9C 4CDXA 1V70A 2RS11 1EUUA 4OZXA 1W6MA 1CVNA 2IFWA 4D6QA 4EROA 3AMHA 5EJ1B 3T0DA 3WDWA 3FFZA 1FV2A 5FCCA 1GNYA 3CDZB 3WW4A 1N3QA 5A7NA 4AQ2A 2A71A 5K4LA 4E8CA 4BQ2A 5I8YA 3TN91 2C9KA 3M3EA 2R6QA 3ZSMA 2LROA 3ZYBA 2JDHA 2HWD1 3AMMA 1CAWA 2ID4A 4NWVA 2HYKA 5HV0A 2XQRA 5FV3A 4Y22B 1UY0A 1ZBE2 3O1RA 4H2AA 2DU0A 4AK3A 1DHKB 2O1QA 2WWJA 4QDQA 1OF4A 4CDWA 4HLTA 3LOBA 2E31A 3DKQA 4PIYA 4LOSA 3DCQA 1HQLA 4META 4NROA 1YYNA 4O9GA 4QB1A 4M4RA 2P5BA 5ERLA 2WO7A 4Q4V1 4CE8A 3U11A 2RVAA 2EIBA 4YZ4A 2OS2A 5BNNC 4XQWA 2P3KA 4C8DA 4FP3A 4L97A 5FUPA 4UT5A 2PFWA 3O0XA 3P3NA 3JBG1 2PHTA 5FPVA 3TN92 3SC7X 4GXLA 1ALYA 1WW6A 3AZVA 3CJXA 2HWB3 1KJLA 4EE2A 2HWD2 5C3PA 1MZFA 3OEBA 5FLJA 2XPJA 1MQTB 1WCUA 3P1IA 4IEOA 4IE4A 1HB4A 4XJAA 1AR93 2BEOA 5JXJA 3MLKA 3WUDA 1YXWA 4N53C 2QQUA 1HB2A 3H3UA 4QX5A 2JENA 3CBNA 1RUD1 3OF1A 4RR3B 1GWMA 1OFSA 5A3LA 4ZZ5A 2HWF2 1OHFA 3HNYM 4P9YA 4Y4RA 1GP6A 1SBDA 4Q4V2 1KRIA 1SFYA 3O1VA 1BCXA 2YYOA 4D7TA 1Q56A 1AXYA 1RMU1 4CDQB 3JBG2 3O12A 5F5AA 2QE3A 4XVHA 3LKJA 3PNAA 4CU9A 2QDRA 1KEXA 4XDOA 2PLV3 3UKTA 3MHZA 5FYBA 1N3OA 2DFCA 3ACLA 4CUAA 1HJGA 2DU1A 5DDJ1 3WP3A 4IEVA 2HWC3 4B7KA 2J7MA 2PAEA 2PHDA 1RJ8A 5AVAA 4PDWA 2I07B 4MXVA 4MGKE 2XBO2 4IQPA 4N43B 4RHV1 3T4VA 3VL8A 3WOGA 3ZXDA 3NAPB 5EPAA 4K8RB 4BPZA 2VO5A 4FO9A 4YW1A 4YZ5A 1X8MA 2JDAA 2OT7A 2X8KA 3D0SA 2NMNA 4FAGA 5FZ7A 2GN7A 1GQGA 2ADDA 3P5BA 4P14A 3I2HA 1UMIA 1UKRA 1WMDA 1YJLA 2FCVA 3SXWA 3I2KA 4PF5A 1O8PA 2H0VA 2RM23 1I1EA 1AF9A 2YG0A 5EWSA 3J7LA 4CCKA 4R4XA 4TLGA 2IXIA 2VZVA 4GWNA 5JXGA 5DDJ2 3C8XA 4CP1A 1X9TA 3UKNA 4CDXC 3VLBB 2D6MA 2OQ7A 3OYWA 2QQMA 1UYZA 3S7IA 1ZRIA 1QJU3 3P3PA 2IC1A 2WDBA 3SCGA 3NVCA 2RS33 4HKOA 4MH0E 3A23A 1NLQA 1RUI3 3TRSB 4EQVA 4IUGA 1UD1A 4JTOA 5C9AB 2FZ1A 3VD4A 3AVSA 4CXXA 4PHZA 2K0GA 5FY8A 2WZPP 3TNQA 2VBBA 2BJSA 1PGSA 1F4HA 2DV9A 4LR4A 3SMHA 4BCUA 1AR72 4H3WA 4OLLA 1S55A 3JD73 2CTVA 1BK0A 4CDWC 4EN8B 3BODA 1ND2B 3BUCA 2WS91 5CNAA 3I97A 5A6XA 2E7AA 2MEV3 1UX6A 1AR83 4KWUA 2AH2A 1MS8A 3FX3A 3DECA 3KVBA 4H7LA 1J1TA 1W2TA 5T5LA 2NMOA 1QQP3 4W4ZA 3WW3A 3ZSEA 1PM4A 1XRUA 1QHDA 1R093 1NA1B 3B7MA 3C3VA 4QQPA 2JD9A 2YV8A 4JV4A 4XQ4A 5JSRA 3VB9A 4AGRA 1UZYA 1F15A 1LNSA 1DYOA 3MF9A 3NAPA 4QDSA 1XU2A 1R1ZA 1BYHA 3QBQA 2P6CA 4S2GA 4BLIA 3KF3A 3HNMA 4R9DA 2GMPA 4RFT0 5FK8A 3GDBA 1Y43B 5F5CA 1MS1A 2YMZA 3ASIA 5L73A 4JKMA 4JGYC 4YGDA 2ZABA 2XJQA 3SITA 1ULOA 2Q8CA 4DXTA 4ZKTB 2VMHA 3LCPA 2B39A 5FZ4A 4JRLA 4BDVB 5C8CA 4FPHA 5FMOL 3OD0A 2WZ8A 4QPGB 1LOCA 1YC61 3MIDA 5FPAA 3UGGA 4AI0A 1XB9A 1WD4A 2D3RA 1W9WA 5H9QA 4XFHA 1QH6A 3N9MA 1TVGA 1L7LA 4ZZ8A 4RL7A 3T0AA 4AR2A 4LUMA 4YVWB 4BK4A 5I8TA 1K42A 1PM7A 5C9AA 1MEC1 4A7YA 2VU9A 1AL0G 1XXNA 4PDWC 3J7MA 3MDPA 1LTEA 3WZ1A 4LKDA 3N35A 3PIJA 3LEGA 1VAKA 2A6YA 2G1MA 4MGQA 3WXPA 3H7JA 4Q0PA 2IVIB 3WG4A 1F31A 3L2HA 1LOFA 3IIAA 3ITQA 5IYYA 4PF1A 4B7EA 1QMJA 2ZKLA 1WA4A 4CCDA 1IPKA 3OGRA 3WDUA 1M4WA 2BRTA 3QH6A 5FYSA 1LOGA 1ND2A 2VCBA 2VQUA 3OBZA 3NSTA 2FHRA 1H4GA 3KV4A 2ZX3A 5I91A 2BOIA 2B5HA 1TMF3 2ZGTA 3UETA 2HH9A 3IN9A 3QOPA 5LATA 3M1HA 5C5TA 4XIKA 3TNPB 5TSWA 3W21A 1LHNA 3URFA 3AKPA 1YQ6A 3H8RA 4JGZA 2Y60A 2ZCWA 1UOJA 4OFGA 5LRRA 1TME3 3BPSA 3L9JT 1W05A 3KV6A 3IKWA 1NY72 3NRUA 2WJSA 4PCRA 3ZIWA 1HRV3 1OH4A 4CEWA 2A6VA 3M3OA 3CEWA 3I3BA 1W28A 3LF7A 3SH4A 3AXEA 5AVPA 4LULA 4KGGA 3SISA 2NN8A 2WBKA 3CZJA 4NR1A 3WY6A 2ARAA 3VZJA 2YBKA 4MX3A 3Q9OA 1I5PA 2P6HA 1H1AA 1VBD1 4P9IA 4AQTA 2V73A 3I3DA 1BMV2 2Y6KA 4XJ8A 5C4WB 2ORZA 4KH9A 4QGNA 1FNZA 1MPXA 3LE0A 3WR0A 2F4PA 2YY1A 4XAAA 3WUCA 2VZTA 1V0AA 1C3HA 1OD3A 2A5ZA 3MUY1 1UMZA 4L8QA 5C6CA 4YGEA 2F6BA 4XYXA 3SHRA 4A45A 5CFDC 5GLWA 5FWJA 3ZPOA 3FUOA 3B69A 5HV4A 1T2XA 2DCZA 3U0ZA 4LHLA 4F3JA 5JIAA 4YG0A 2PHLA 3PU3A 3NAPC 1A6CA 4QB2A 3WNPA 3ENRA 1CQ9A 4XFCA 4BB3A 1CZTA 2RJ2A 2ILMA 3LEIA 1VBE1 2R043 4DRVA 5JZGA 3BKZA 1UF2C 2UURA 1VBD2 5C70A 3B94A 3RZZA 3N7JA 3WCRA 3SCHA 1GZWB 3HEIA 3WQ0A 4AAXA 5JSPA 1H8TB 4PI2A 1XJAA 4FFIA 3R4SA 4MO3M 1U5XA 4EWDA 1BEV3 1OKQA 1DGRA 4AVAA 2BNOA 4Q4X3 5C8CC 3KGLA 1IPSA 1RUJ1 5GZCA 3BIWE 4IE0A 1UZZA 3MLJA 1PZ7A 2R1DA 2JX9A 4Q0SA 1W3XA 2BUKA 2H0BA 4I01A 4YSFA 1LHOA 3NL1A 2KXLA 3LB9A 4CXWA 2WAOA 4X8NA 1WA6X 1RUH1 5IVFA 1PK6A 2VD7A 1POV1 1JYCA 3ZFGA 1QY4A 1JUIA 3PVBB 1YEWA 4XFFA 5C9AC 1VBE2 5FZ8A 1X33A 5E89A 1ZA7A 3H50A 2EALA 4GKXA 2BDRA 2P37A 3POWA 2WL1A 1DGWA 1OSGA 4GH4A 1LOFC 4M3CF 1UOGA 1O5LA 1YFWA 2LTNA 1D7PM 1W6PB 2R7EB 3OBAA 1F5JA 4GD4A 2EICA 4JCKA 5SV5A 3T2PA 5BNOB 5I0TA 5M0TA 5D8AB 1QJY2 2PHRA 2YBPA 5LK7B 4ASKA 1DZTA 2AYHA 3HNBM 1HKDA 1PVC1 2VW0A 1QXPA 4QQLA 1UU5A 1PHMA 2YC2A 2YFZA 3ZPYA 5ABJC 1LULA 5JR7B 3JXSA 1RUH2 1T6BX 2QQJA 1ODMA 1JOBA 2XDVA 4JGZC 4LEJA 1K5JA 2BYVE 2QZ2A 4LLOA 2AENA 2DUPA 5LBCA 2EA7A 2Q4SA 2VM9A 2MPFA 2XHNA 2XJUA 3AYDA 1ZZ6A 4OUEA 4SLIA 5DAQA 3RNSA 3UYJA 4BH9A 1JN2P 1M06G 4XACA 3UV9A 4CEWC 4XFGA 1MS3A 4BIFA 3RVHA 3ZYIB 1OT5A 4UFKA 1JZ4A 3MIFA 1WCKA 1XYPA 3GCWA 2WNUB 4AI2A 3LA7A 3OGGA 2A6XA 4DPNA 4LBLA 1CR7A 2RV9A 3H1YA 1JZ3A 1PVC2 2R061 2VZ3A 2XUMA 1J83A 1W0NA 3I2OA 5KBFA 3MW2A 1EV13 3APBA 2XJTA 1VMFA 2A70A 5ISLA 1RUG2 3UJOA 3D3AA 2D5FA 2J1RA 3I54A 4P9GA 2B46X 1NUKA 4QWNA 5IVBA 2ETEA 1Y3TA 5A1LA 2C24A 4W50A 5IK4A 3A4UA 3EO6A 2EAKA 3UJQA 3L2YA 2FDHA 1DQ0A 4MGZE 4Y1YA 3MF6A 4W6YA 3NKGA 1RUE3 1ULFA 5ANNA 5A1AA 1DGLA 3KVAA 5LBFA 5FZOA 4QQ2A 3W9AA 2R062 4IESA 4YG6A 5GALA 1VBA3 2PTMA 3CLPA 4AI8A 5FO8B 5JZGC 1QXRA 2EF6A 1R1A3 3BYWA 1KJRA 4LBQB 1W6PA 1RGSA 4LUKA 5DXDA 1B35C 1O8SA 1UWWA 2LS6A 2XVKA 1NXD1 4GB32 5FAXA 3VKNA 4BQ5A 2ZZQA 3WNXA 1J84A 5D8AA 4XBQA 4RD7A 4OQ8A 2C4XA 1SHWB 2VZOA 2VBPA 3DEMA 1JYVA 3IDBB 4JKLA 5FQ0B 3HQUA 2Q8OA 4DXSA 3BB6A 4IDZA 1R082 4PBOA 4QDRA 4RQPC 1NXMA 5EQUA 1V6IA 2DUOA 1LU2A 2V72A 5FY4A 1FAYA 1U5YA 3R6SA 2HKXA 3B01A 4COYA 3W5MA 1Z0HA 3ZR5A 3BIEA 3AB0A 1RTVA 2EXIA 1PK6C 5CKQA 3ZFGC 5C3RA 1G86A 2VMEA 2AR6A 1BK1A 4M3CA 5GLTA 5ACA3 5FBZA 4CRQA 5DN2A 2WZR1 3BU0A 1VBC3 3BOPA 3ETPA 1FPN3 1TE1B 1QDCA 1GWLA 1HQWA 4NJ4A 3RI9A 1VBB1 1HN0A 4GH4C 4P9XA 1O4ZA 2B7YA 2HWC1 2DVFA 2WT0A 4Y5Z0 4SBVA 3VBRB 4PT6A 3UKVA 1GBGA 3PLQA 5A6QA 5JPMB 2FDIA 1NLSA 2VOWA 3ZN6A 2WT1A 2FBEA 4WM7B 5EYYA 3WP6A 3GALA 1N1YA 5I8SA 4BWOA 5E8AA 3PURA 3OD4A 4HKWA 3I8TA 3RZLA 4QXHA 1DIWA 1W6OA 1FYUA 4LTAA 4RSUA 4HBNA 3M4FA 4YFZA 3V0AB 3ELNA 3QCWA 3PTRB 4YWAA 2WZR2 1MZ6A 5FLIA 1CD3G 3BN6A 2C6SA 4D6RA 4MOAA 1TNRA 4FXKB 4RN5A 4NAMA 3NKTA 4CDUB 4XFAA 3MV01 3WG1A 4AYUA 1FNYA 1IS3A 1VAMA 1VBB2 4FPLA 4IEYA 2OYZA 1WW4A 1CX4A 2ENRA 4AFCA 1PO21 1ACCA 3CIHA 1T6GC 4HG6B 5JMCA 3LDBA 4UF0B 2JB8A 1QJU1 1LGBA 4G3YC 3KHBA 4IEUA 4NRPA 3F2ZA 2P3IA 2RS31 3MBWA 3B93A 4JZRA 1K5MA 1RUI1 2X5IB 1ONAA 2A6ZA 1OA3A 4DS0A 4E27A 5FQ0A 1GOGA 4E4ZA 4L2NA 1U5ZA 1UNBA 1ASJ1 1ZZBA 1OQEA 4MGSA 5F8PA 3WCSA 4DZGA 5EIYB 2ZEZA 3AP7A 3ZYPA 5T5PA 3JCIA 1GQPA 2J1SA 2FCTA 2OA2A 2TNFA 1GZ9A 5F2SA 3T2QA 4H55A 5K0UB 3DXTA 4HL0A 5A32B 5J37A 1NZIA 1VALA 2HEWF 1WCDJ 2MNGA 2VULA 2MEV1 2Q1ZB 1UPIA 1L7RA 1AYN3 1AR81 1WLTA 1A3KA 1PO22 1SFNA 1GQHA 2O8OA 3KCCA 1C5IA 1XNTA 3ORJA 4K6BA 4ASLA 5FDBA 1SZBA 4WZCA 4AVSA 2IXLA 5AFBA 1AYM1 4QXCA 5A7WB 5T3NA 1V6KA 1ZBA3 1I9RA 1REEA 1QQP1 3K3NA 1SLBA 2Y26A 4EWEA 3O1TA 2Y6JA 3OJBA 4CEYA 2DVGA 2JDYA 1WMXA 2E33A 4BOWA 4D3WA 2JDPA 1ASJ2 4OHXA 2RS52 3K48A 4F8AA 3MYXA 5FYYA 2VW1A 3KGZA 3SEPA 5D2AA 3CO2A 2F4LA 1NG0A 2VUAA 4WM7A 5F3GA 2XB6C 3PU8A 1AVBA 2BVVA 3WDYA 5I0DA 2ZX2A 3VBHB 1IQDC 2OQ6A 1V9U1 2YPJA 2R0FA 2Q1FA 1REDA 2WQ8A 2VY0A 1K3IA 1IS5A 1X9PA 1OOPB 3E5UA 1AYM2 4Q4W3 5FYVA 4QAWA 1WBLA 4RA0A 2ZA9A 2ZHLA 5FIXA 4NO4A 3LZZA 3LSEA 1D2QA 3FN9A 1WKYA 1ZX5A 4JDOA 4Y1XA 4YG3A 3ZX7A 2IFRA 3MIGA 1UZWA 4UF0A 5FZFA 3RG0A 5JWPA 4FFGA 1J3PA 4LO6B 1X36A 4HT1T 4YPJA 1JZ2A 5FY1A 2B45X 4Q5OA 5I93A 3AC0A 5CFCA 5FY7A 2DTYA 2QQOA 2X5IA 3MI8A 4WVMB 2WLQA 3AKRA 5LA1A 4OMDA 2BFUS 1RVF3 1V9U2 4QX0A 4Z2AA 3HT2A 3VHNA 3ILRA 4AFDA 2QQIA 1UU6A 3MFCA 4ES9A 5CG8A 1CESA 1H2MA 4GKYA 2JDZA 2Y6GA 1W6NA 4YW5A 3V0BB 2ZHMA 1O6UA 1CAXA 5FP9A 5GLUA 5K0UA 2JDMA 3D5OA 2VOKA 5GZEA 3VBSB 1L7QA 5A32A 3T2OA 5FYZA 4XJ9A 5FXZA 4BK5A 5JOZA 5JAXA 2WA3A 4CPBD 5LW9A 1XPWA 3S7EA 4HK8A 4OI1A 2HWE3 5I0RA 1H2NA 2EVXA 5FPXA 3VHRA 2XWBB 1WUVA 2J1TA 2Y6LA 1JYWA 1O59A 3VBFB 4BMBA 3QLQA 2Z69A 5BNPB 4HN1A 4EWAA 5K8SA 1SLLA 2VOVA 4QX3A 4CCMA 1NCRB 1SDWA 1HRV1 1K5MC 4XIOA 2K46A 1VRH3 2W87A 4YM0A 3WQ1A 4KQ7A 5KXEA 1N47A 3FMGA 2Y0IA 2FDFA 2XLFA 1MS4A 2YFUA 2RR11 3HJRA 4OHZA 2IVJA 3RYPA 3ABZA 3WF2A 1OLRA 2D7FA 2IXHA 2YU2A 1COV1 5FYCA 1XQNA 3I3EA 3LA3A 4IEPA 4K8FA 2E51A 5FYMA 3T30A 3ZFEB 1OOPA 4G9SB 3OCPA 1BHGA 4OYUA 4R9CA 2WSUA 3JU9A 2XUEA 3KT7A 3POBA 4UFMA 2PHXA 4J25A 4AZZA 2E32A 1XBFA 5LRSA 1UU4A 4W65A 4ZS3A 2WR9A 4G4FA 3VBOB 3UESA 1NE6A 4RGAA 4HPKB 4Q2FA 4NHXA 4NPRA 4CEYC 1EAH2 2JEMA 2P4EA 3ZVXA 4AVTA 1EPZA 1YFYA 4WVMA 3GM8A 3N36A 1ZREA 2RR12 1OA2A 4PI0A 1SPPB 3J7HA 1QJFA 3K77A 1AL23 1QNWA 1COV2 1A78A 3H1MA 5EJ3A 4BQXA 3V0BA 3WP5A 2IUWA 4OZOA 4N9HA 5APAA 2W92A 1YI9A 2RMU3 3RFRA 2GC2A 5A7QA 3VBSA 3G6JB 2CSGA 5IT6A 3EXUA 5J96B 4NN0A 4FPGA 2YPDA 3WW1A 2XONA 2OIIA 4CA9A 1IZ3A 1G9CA 4M00A 3KSCA 2W47A 1KS5A 2GNBA 3A0NA 2GALA 4P5YA 4A2UA 4MGTA 4FTBA 3USUB 4IV1B 3S30A 3LD8A 4IL7A 4NVPA 1CAVB 1DQ1A 2RS12 4GMP1 2ZGOA 2WQ4A 4LBOA 3VBFA 2AC1A 3INAA 3ZFFB 3AP9A 1UO9A 2BV4A 3OPWA 2GNTA 3NV4A 2UY8A 2ERFA 2ZS6B 5BUVA 3THPA 1NCQA 3MGUA 4E8DA 5CFCC 5CKMA 2VMDA 2XJPA 2ZGMA 3IPVA 4XJZA 1O5UA 2W1UA 1ND3B 2K2SA 4LKFA 3EYPA 3POJA 3RQ0A 3ZXGA 5FXVA 1ZRFA 4S2FA 1W8HA 4ZXKA 1S0EA 4AEKA 5L9RA 2VNOA 1IPJA 1PIV1 1DGRN 5JSOA 4F7ZA 1SLTA 1LOAA 2ARCA 5DUWA 3ZM8A 4PBPA 3UT0A 1UN1A 3OB8A 1HRI3 2E7QA 2IXKA 3JB8A 5AC91 1DP0A 2DVBA 2WN3A 3BALA 4H14A 2Y6FA 1OURA 3KV9A 3RMYA 1YHFA 5FLHA 3TWIA 4DXZA 1GR3A 2VTXA 3MIEA 3BCWA 2RDNA 2ZX1A 3VBOA 5C3OA 1RL3A 3C2UA 5E88A 3S57A 2WIIB 4UFIA 5J1XA 5L7OB 2G9FA 2D93A 1OUXA 2UWAA 4J6GA 1SBFA 5KHGA 4NOTA 3IAQA 1OMIA 4OVEA 3BTZA 4NMIA 3AYEA 5K9YA 1C5HA 3M3QA 4KWJA 1PIV2 2XJRA 1RUD2 1C8M1 2HEVF 4I3GA 4JRAA 5JI9A 3AM2A 3THCA 4RGKA 2DTWA 1WBFA 3ES1A 2YHJA 4HETA 4A6OA 5AC92 1QU0A 2BERA 2VAUA 1N1VA 4Y22A 5GJ6A 1EV11 4FSJA 4E4HA 5JIUA 1RMU2 3USUA 5CA6A 1CIYA 4GMP0 2AACA 4LBJA 2V09A 3CZUA 2VGDA 1LCLA 4AFBA 1DLLA 2BBAA 2ET1A 3LAGA 1Z78A 2QUOA 5FYTA 2WZEA 3EMRA 1F4AA 3VUOA 4XJUA 3SKJE 4LBNA 4FTEA 4PLNA 4JKKA 3GZTB 1S2KA 3H1WA 4FP2A 1Y9QA 2Q1MA 5D1IA 1HX6A 4ZPIA 2JG8B 4WV8A 5LA9A 3V56A 2DCYA 1C8M2 4N7IA 1E5IA 2JDKA 4RHV2 1OUSA 4GIQA 2CU5A 4AEDB 5HXMA 1MQTA 5FZHA 4CCJA 5I0UA 1Q3EA 2A3XA 1W8OA 2DBIA 3ZKUA 2X09A 2Q30A 4Q4Y3 4XUPA 1ZVFA 4UI9L 4XUOA 1R1A1 4CP2A 3FE5A 4JQRA 4YGCA 1JW6A 5IJRA 3ZSLA 1RHI3 5FZ1A 3VBSC 1OA4A 4L0PA 4GWIA 4RR3A 5HPOA 5J98B 3RSJA 1BVVA 3JUUA 4ZHNA 3T0BA 2GMEA 1U12A 2J1VA 2R073 1MVEA 2UWBA 4FVVA 1JZ6A 3SNMA 4EN9B 1JH5A 1XYOA 2DVAA 1FMD3 3AMPA 4Y20B 4CDQA 5A33B 1RUOA 1PMIA 4B8EA 4LMFA 2UY9A 5LWBA 5DABA 1XNDA 1C1FA 2LM3A 3I2DA 5L7OA 5IVCA 3AZZA 1GP5A 1HJFA 1VAVA 4XZPA 5JCTA 3Q8EA 2XQXA 1NCQC 5DQ0A 3LA2A 5F5QA 3U37A 3J4UH 5A7OA 3DYPA 2VMGA 5ACA1 2D6LX 4K1ZA 1R1A2 3E6CC 1VBC1 2VQAA 3HR9A 1DBNA 4N43A 3B5LB 1RUC3 3I59B 2Y6HA 2P1BA 3AX4A 3J8F3 5FBJA 4IV3B 4YGBA 4QGLA 3HD8B 4AOCA 4K21A 2P17A 4DY5A 1HXS3 1KS4A 1WD3A 4XF9A 2RJKA 2ZEYA 4XTMA 2WS92 4XDPA 5DUXA 2DWRA 2HEYF 2J22A 1W2UA 3DYOA 2WFF1 4P00B 3AKSA 3RGBA 1LRHA 4KL1A 4EJRA 5JXIA 1WZXA 4HSLA 4BM8A 4B4PA 2CGOA 4OQ9A 3LEKA 3VDDB 3CU7A 4DXRA 4DEVA 1Z7S3 2J1EA 4CCEA 1IG3A 1YQ8A 1VBC2 2HJIA 4QT6A 1QJX3 3EJKA 5IWFA 3PIGA 4E2SA 2EIDA 4UFHA 4AEDA 1UY3A 3IDCB 1PO13 1UL9A 4QPIB 1X82A 5LBBA 2B4KA 3N7LA 2WAAA 2UU8A 2QZ3A 1NQDA 3IIIA 4OCTA 5FXWA 2VE1A 3AL6A 3GBWA 4AQSA 1D4M3 4GWMA 1SCSA 5FY5A 1BBT1 2WFF2 5FPBA 1QGLA 3FLRA 4AFAA 1RB8G 1BLZA 2VZUA 4IE6A 4YM2A 4CCLA 2VXJA 5JR2A 3LFMA 3HBKA 4KWKA 4XCAA 1C57A 1I6XA 3PMEA 1X50A 4TWTA 3T4HB 4HN0A 4ET7A 2D40A 4Y20A 5A33A 2X05A 4DIQA 3UGHA 5C71A 5KXBA 2CDOA 2GNDA 1IS4A 1HQNA 4QB6A 4XF3A 1JYTA 4OUMA 4I0BA 1AR63 3D0JA 2JD4A 2ZKNA 4YVSB 4WM8B 5FP8A 5FXXA 3NNLA 4URTA 2ARXA 2WABA 3RI8A 1MEC2 4Q29A 4Y4YA 5KXCA 3C7GA 1ZZ7A 1NA1A 2OZ6A 1RUNA 3DN7A 3ACHA 3AFKA 5FPLA 4XPVA 1BBT2 1ZBA1 1MQTC 3I59A 1GMMA 5FZ9A 4MGYE 4FXGB 2WSVA 2E6VA 2P3JA 3NO8A 1OQ1A 2W95A 1RUF1 4ZXEA 2RE9A 3HPNA 2BZDA 4RR3C 2ZGNA 2VOTA 3HAGA 1SLAA 3NW4A 1FATA 3K75B 2BU9A 4FPOB 3U4XA 4LBKA 2IXJA 2VXRA 1O3SA 4CDQC 5BV6A 4QHBA 3T1LA 4QPGA 4O65A 4M01A 3WP4A 4B3NA 1JXNA 5L7OC 3H8XA 1VE0A 4Q4W1 3FLTA 4Z2WA 5EZWA 3WHUA 4LE4A 4YVWA 4BQ4A 5H9PA 3TEYA 2VQ0A 2JDUA 4DQAA 1RUF2 5FPUA 5LEJA 4E4SA 1PGW1 3DPRB 4N43C 4ZU5A 3T3YA 1DFQA 3D82A 1JU3A 4DB5A 3GJBA 1V6NA 1IG0A 1UIKA 2PAMA 4PQ9A 3WQBA 1PVXA 4LIUA 1RC6A 5E1RA 1JODA 1ZYBA 3O1PA 1XC6A 1YNAA 1ZBE3 5JUVA 3WV6A 1QF3A 1S1AA 2O8QA 5A80A 1ULDA 3UGFA 3RZHA 1LEMA 4LK6A 2WINB 1AX2A 1CPMA 1FT9A 3ZMNA 2VCCA 4LA2A 2W39A 4J1WA 4NIDA 3AYAA 2DUQA 4Q4W2 3LOIA 2VVEA 4QXKA 5C3QA 4C91A 4ARYA 1GNZA 3CJIB 1NKGA 3WEZA 1AXKA 1PGW2 4MSVA 1ULEA 3DF0A 4LIVA 3E1F1 3SH5A 4M0NA 1MACA 4AEDC 2I45A 4Z82A 4R52A 1G7YA 1CWPA 2YB7A 1XYNA 2BFUL 2FDGA 3DUIA 1REFA 3ATGA 3RJ2X 5EV7A 1URXA 1JUHA 2FDJA 4B1LA 2PQSA 1AXZA 3O14A 3LQCA 4GJZA 2E9QA 5GZFA 2VTFA 3R4UA 4XUQA 4JDMA 2VTXJ 3PUIA 4OUSA 4C0BA 3ZXLA 4LQRA 1VRH1 2NPIA 1TZOA 4K1YA 2HWF3 1H9PA 3IMNA 4XBNA 4NPLA 3SQOA 3W20A 3S5AA 4Q4V3 2BPA2 2Q5TA 1IQAA 2PHUA 1E5HA 2D6OX 4I30A 1RUJ2 4XMAA 1ND2C 3S6PA 2QQVA 4CYDA 2DF7A 1ZZCA 4QX1A 4WVWA 5C4WA 3ZLIA 3NJXA 3GBGA 2AGSA 5FMCA 1VLNA 2DFBA 1Q8QA 1OPMA 4N7UA 3OUIA 4QMAA 5FO9B 4AG4A 4GJYA 2DCKA 1TEIA 4P9JA 4OI2A 4XILA 4I09A 1FV3A 3Q8FA 1VR3A 1NA1C 1VRBA 4FPCA 1W9SA 4C1XA 1UYXA 3VHOA 1QKQA 3HMYA
chains in the Genus database with same CATH topology
2DYCA 2XBO3 1VRH2 3QACA 1UKGA 1YUDA 4LBMA 1EPWA 1LODA 1V6LA 4O9EA 3V64A 4AI3A 1Q8OA 1C1LA 1AL21 1GZWA 1LJ7A 1LHVA 1H8TA 4OHWA 3VKLA 1YFUA 3BOWA 5IK5A 1O3TA 2SLIA 2YROA 4FPJA 2RMU1 3JB4C 4FAHA 3H7YA 2NP0A 3ZYRA 1YJKA 2ZGUA 4QPGC 5DDJ3 1CIWA 2X29A 1YIPA 2YGMA 1SBEA 4ATEA 4TSVA 1POV0 2BTVC 4BQ1A 3ZYGA 4YVWC 2ZBJA 5J48A 3RDIA 3HIFA 1CGPA 4L99A 3H3ZA 3WG3A 2WFPA 1G9FA 4TLFA 1YCIA 4XF1A 1AL22 1ZRRA 2CV6A 4MLOA 5JI7A 4YZ3A 4KG0A 3AP4A 3NV2A 3MICA 2HWB1 2AUYA 3OBTA 3VBUB 5BNOA 1YI7A 1AR73 1LEDA 5T55A 1AR91 4F83A 2R1BA 1OPOA 3UL2A 1KXGA 1W6QB 4S2HA 5F6LB 2GZWA 1IKQA 4JC1A 1XU1A 2AZ5A 4C1WA 1NE4A 3WDXA 2Y38A 1AJOA 1H8VA 5KC6A 4AHXA 2XLGA 4COVA 4YARA 2H6CA 4RS5B 2VMIA 4W6WA 2HWB2 4UW4A 2PLV1 3IBMA 2OUJA 2XL9A 3ZYJB 1QOTA 2GN3A 5HI0A 1PGL1 2WNUA 4L11A 2Y0OA 2OW4A 1OFNA 2D44A 1AR92 3M7AA 2V5YA 2ET7A 3FFQA 1ZRCA 3D6EA 4LO5B 1VB4A 1ULGA 3DKWA 1O4TA 5C4WC 5F9TA 4PLMA 2ZMLA 4FOQA 2EIGA 4Y1VA 3HQXA 1Q8VA 1ENSA 5T50A 1GSLA 4EN7B 5HXVA 3TYJA 4XTPA 2XKOA 1S0FA 3VV1A 2TUNA 2RM21 2PLV2 2JG9B 4KNCA 3R4DB 1YIFA 3NWKA 5FRAA 1GV9A 1PGL2 5EXOA 2WNEA 2R30A 1YWKA 2NQYA 1F8VA 1J3RA 2YUEA 3TOJA 2HWC2 1O7FA 2WNVB 1YO8A 4D94A 1G9DA 1DG6A 3PVEA 4LBQA 4AI1A 5KHKA 3GNEA 3IT8A 2DURA 3VBUA 3EQEA 3GZAA 1JYIA 1DQ5A 1H8TC 2FQPA 4Q4Y1 2GSYA 5HCFA 4R9BA 1RHI1 2ZX4A 4BZ4A 3TB0A 4AEMA 2RM22 4XHBA 5E16A 4D69A 3BPZA 4FOYA 3JD71 1DQ4A 3QD6A 5BNNB 5JOXA 4N9IA 3NV1A 1QH7A 1SLIA 1QJU2 1AHSA 3HWJA 4RS5A 5T5OA 3RYKA 3B02A 5LEKA 1S0GA 4XDQA 2RS32 1C4RA 4XE9A 1RUI2 3ZSKA 1R091 1WGPA 5KC5A 4YRDA 4IXLA 4MVTA 3VBRA 4COZA 1HV1A 1FI2A 1RHI2 5BNOC 3FUQA 5D8AC 5KXDA 4CP0A 4HVOA 3AP5A 4K40A 2ZMNA 2ZHKA 3AP6A 4IEQA 4GALA 2QQPA 3JD72 2G9GA 4KG8A 4GULA 1F5FA 2MEV2 4Q8LA 3V0AA 1L3JA 1AR82 3VKMA 3ZXJA 5H9RA 4FT8A 4I02A 4QD2A 4JDNA 1QQP2 4UBGA 4IEZA 2ZMKA 4CDUA 1Z7S1 4A7KA 1TNFA 1R092 2WNVA 2XLAA 3E5QA 5H9SA 2ZGKA 1QJX1 3WQ7A 2WNUC 1VBD3 2GNMA 2R32A 3SCFA 3ZN4A 1QDOA 4WVVA 1IKPA 1D4M1 2XGXA 3LSDA 1WCSA 2NM1A 4MV2A 2BNMA 1V00A 4FPEA 1YRZA 3PHMA 4XF4A 1RIRA 4CDXB 1TMF1 1QJX2 1XNCA 4ORFA 1W6MB 4UBHA 1MVQA 1V6OA 1VBE3 2PAKA 3KB5A 3AZWA 4R8HA 3ME2A 5JOYA 1ZRDA 1TME1 2LALA 1E57A 1CPNA 1WW7A 3VBUC 3CL1A 3OPZA 2OPKA 1J3QA 1VIWB 4HANA 2W68A 1QJY3 1GYKA 3PMSA 4KU7A 4MXWB 4ES8A 5DZGA 2CAVA 1C8NA 4FCAA 4FPKA 3VBHA 3RJRA 3I7DA 4K7JA 3RRDA 4BLJA 4CDWB 5IK8A 4Y1UA 1TMF2 4S2DA 2BQPA 2QJVA 3T2TA 4OHVA 5CG9A 2BWCA 4LBQD 4DFSA 2NYYA 3MIBA 3O7OA 2K9ZA 1TME2 4RS5C 3VGIA 2GDFA 2ZHNA 1V6JA 3AKTA 1W0PA 1HRV2 3WLUA 1AUYA 1HDKA 1UW8A 2FZ2A 4NHMA 4YZ2A 1A8DA 3T1MA 3VBRC 2KA3A 1CAUB 1PVC3 4V1PA 2VECA 2VVDA 2CWMA 1BQPA 3ECQA 4WM7C 1RUG3 2BW8A 4BE3A 4A7ZA 2R041 3KMHA 4JGYB 4FTSA 1ZBE1 3ALQA 4W6XA 3UK9A 3FBMA 2UWCA 3H0OA 5SV8A 2CGPA 1KD7A 3KM5A 3NJZA 2R16A 1D4VB 4BMEA 1N1TA 1BEV1 4Y1ZA 3KCYA 4Q4X1 4CDUC 5FPZA 3FWEA 1H0BA 1QWRA 3H9AA 2WNVC 2LUWA 1SEFA 1XE8A 3M3IA 4Q0VA 1A8MA 2D6PA 2NLRA 2R063 4DINB 5BNPA 3ROUA 4PDWB 2IXCA 4PIXA 1SLCA 1UAIA 1KDMA 5CB7A 3NV3A 4GB33 1NCRA 1KQRA 2R042 2X5IC 1FXZA 2KM2A 4X6QB 1FOD3 4MXWA 1DZRA 1LU1A 2D6NA 1W0OA 3B9CA 4TYSA 1R083 3VZKA 4LO7A 2ARBA 2C5DA 2HWF1 3ZFEA 5K0UC 1BEV2 1NOVA 4J1XA 4AHZA 1XNKA 4Q4X2 3VZLA 1WMEA 3HBZA 3MW4A 4PIZA 3OYWB 4XQDA 1TQ5A 3O0VA 2ZACA 4Z07A 2BGCA 4Q1PA 4HPKA 2VNRA 4NWWA 4U2AA 5AFEA 3USSA 1CAUA 2QFEA 5JOWA 5GZGA 1W39A 4AXOA 2ZGLA 3AXDA 2XBO1 4AVVA 5FOJB 1F9KA 5J3UA 3O5SA 5FREA 2EAAA 3AMNA 4JGYA 1EYBA 3VBHC 3CNAA 2JE9A 2GC3A 1ZNPA 4MYEA 5GKAC 2ZAAA 4WBBA 3R0RA 4MGIE 2WWSA 1OOPC 3QH7A 3VHPA 2WZR3 4WVZA 4IV1A 3KCXA 1G9AA 4XETA 4IETA 1CAVA 3GHNA 2H6BA 5KHIA 2YC0A 3WT3A 3THTA 5CFDB 1VBB3 3FLPA 4LLFA 3ZFFA 2EXKA 1BZWA 2XVLA 4E2GA 4I2OA 2XH6A 1ULCA 1RUE1 1DDLA 5CAZA 3MIHA 1UCXA 4LHNA 1RITA 1ND3A 1LHWA 3VN4A 3GYDA 3PJYA 5CBLA 2XHKA 1O3RA 5C33A 1VBA1 5B2GB 1EV12 2B9UA 4AFMA 1MR5A 1CN1A 1S0DA 5FFOC 1AR71 3ZSJA 4BA6A 4E2QA 1PZ8A 3M2MA 4HFSA 2QKDA 5C8CB 1F2NA 4XF0A 3VL9A 4AF9A 2JICA 1EP0A 1GICA 1ENQA 1PO23 3B3QE 1D0HA 3M70A 2Z2SB 3EBRA 5DZEA 1RUE2 4INDA 5CIRA 3KQRA 3VBFC 1OQDA 4XMIA 3ST7A 3WINE 2PQQA 5BNPC 4MUVA 2X53S 1NCRC 1VBA2 1ASJ3 4B4QA 2RS53 2PYTA 2A7AA 4Q0QA 4Q26A 1ZA4A 4I0AA 2WT2A 1FPN1 3FC0A 3BTAA 4Y24A 1ZZ8A 1LENA 2VVFA 4K9SA 1U5IA 4UW6A 4N90A 5DZFA 3ZFEC 2RJLA 3N7MA 4Z92B 2JJ6A 4IEWA 5ABJB 2WLPA 4C0HA 1AYM3 4AGGA 4AQ6A 3VZMA 3FZ3A 1MS0A 1SQ4A 4L92A 1JOJA 4JGZB 2VW2A 5CFDA 5J36A 1LB2A 3VBOC 4AWDA 1X7NA 5ACA2 1O4YA 2ZTNA 2ZPXA 4CEWB 2GC0A 2JG8A 4HZFA 1FPN2 5L19A 1ENXA 2A3WA 3ES4A 4B4RA 4Q0UA 2C0ZA 1V9U3 4QQHA 5IK7A 4P9LA 3WHTA 4QU2A 1LGCA 5JDBA 2D98A 1HW5A 5HCBA 4EV0A 4YZ1A 1J1LA 4IV1C 1QOOA 4HMZA 1DYPA 1Q5OA 2W08A 3HN1A 2PA7A 3ZFFC 4GA9A 2BBVA 4TZDA 3ZIXA 1H30A 2NZ9A 3X29B 1Q8SA 3GBFA 1BJQA 1AYN1 4KU8A 2GAUA 2D97A 1NY71 2XVGA 5JZGB 4UW3A 1ND3C 1S0CA 4HK9A 5EYXA 1B35B 4ISRA 1U0AA 3MEPA 2ZOEB 4I3PA 4IV3A 3KLSA 3MPPG 1VJ2A 2BNNA 5L36A 3AZYA 1H1MA 4CTEA 5ABJA 4RQPB 1QOSA 1BMV1 2C9AA 2PELA 5IUQA 4OI0A 4K20A 3AKQA 3RYRA 2E53A 1AYN2 3J26N 2UYAA 3VDDA 2A75A 2B8MA 4B29A 1PK6B 4YW3A 3ZFGB 1O91A 1H1IA 2D43A 3S0MA 3JQXA 1ZBA2 4Y26A 2IWGB 1N1SA 1EAH3 2E7TA 3FHIB 2RR13 4QPIA 4YFWA 3OGJA 4GH4B 5BXXA 1COV3 1IOAA 1LOBA 5CVRA 2RHPA 1H4HA 4PLOA 4HVQA 1NYWA 1KDKA 2DVDA 1HV0A 1MZ5A 1RVF1 3PVOA 3V65A 5DG1A 2A3YA 4YLZA 4NHKA 1ZM1A 4Q27A 3E5XA 1LR5A 3MLLA 2RS13 2P34A 3KS7A 4YVSA 5BPXA 4WM8A 3OBRA 3DV8A 3HT1A 2B42B 4R9AA 4XEZA 2JG8C 2GH8A 2HWE1 4ATFA 4Z1VA 3TN93 2D5HA 3U07A 1B35A 2HWD3 4D7YA 1G6NA 3DL3A 4E9KA 4R4ZA 1RVF2 1HIXA 3JZVA 4XBLA 2OVUA 4AHWA 1G8WA 3O0WA 2DCTA 2CY6A 5BY5A 1OD5A 1QJY1 4RQPA 4GMP3 2A73B 1BXHA 2FMYA 3B00A 4YYOA 3AYCA 3IM0A 4IEXA 2D3SA 1J59A 4A3XA 4AVCA 3RWNA 1S2BA 1C28A 5HBAA 4UW5A 3PJQA 3JBG3 2HWE2 2GMMA 2UYBA 1WW5A 4XXAA 2PHWA 2EXHA 4QQOA 1YLLA 2Z42A 3VKFC 4FOWA 3GZUC 3ZXFA 4YM1A 3VKOA 5F6KA 3DPRA 1APNA 3KD4A 2ZJCA 3RMXA 3KT1A 1PIV3 5T5JA 1GLHA 1RUD3 2GH2A 4IV3C 4QM9A 3AK0A 3AJYA 5AC93 1B09A 3EHKA 3POYA 2VUJA 2TBVA 2CNAA 2CYFA 1DZQA 3AFGA 4BYYA 4X8PA 4BIOA 1RMU3 1RUG1 4Q1RA 3N3HA 2ES3A 2PN5A 3G7DA 4KBBA 2ZX0A 4P9WA 3VDDC 2WKKA 3RS6A 1RINA 4ZU7A 3CJIA 2XWJB 4HVRA 4M3CB 1WMFA 3OY8B 5EFUA 1Q43A 4JAAA 5FOBB 1PNFA 2WC2A 3ILNA 4RHV3 1C8M3 2ZAHA 4QPYA 3AMQA 4QPIC 1SMVA 4XJWA 4AEJA 1CONA 1X8EA 2CGNA 5GM0A 2VG9A 1WLDA 2JE7A 2BWAA 4GB31 4HSJA 4M3CE 4UXAA 4XXPA 5DUVA 5BNQA 3ZN6B 1FOD1 3W59A 1GFF2 2RMU2 4ZU4A 1QJZA 4AHYA 2N7GA 2R0HA 1W6OB 2G4IA 2DCJA 1R081 4H7MA 2XJVA 5LK5A 3CF6E 4OI4A 3MPBA 1Q8PA 2MHFA 2IZWA 2OZJA 4YVSC 3N4MA 4WM8C 2XKPA 5J7MA 1AZDA 1HRI1 2R49A 1KITA 1XNBA 2JXAA 1H2KA 4KGQA 5A3MA 2VNGA 1DGWX 3BU7A 3KT4A 1AX0A 4FQ4A 2ZGSA 1I3HA 1FOD2 1OI6A 1K5MB 1NZCA 3ZN5A 4C90A 1GKBA 1ZZ9A 3RPQA 1MS9A 4P5HA 1ENRA 2A6WA 3LGRA 1WLWA 3ZXKA 2WS93 2W52A 3GHMA 2Z5WA 3A0KA 2CAUA 5J09A 3POSA 2YGLA 1HRI2 1UPSA 4EN6B 3D4KA 1UIJA 1MS5A 4LO8A 3MZHA 3OY8A 4COUA 1IS6A 5FMOS 2Q0AA 1D0GA 5C8WA 4GQ7A 3ZO0B 4AGVA 3M3CA 4YM3A 1QXJA 2GU9A 2O0OA 3DPRC 4CEYB 4COWA 5DG2A 3MW3A 5CADA 1IGOA 3WDTA 1BVP1 4DNYA 1SACA 3ZXEA 3J9SA 3K51A 4U36A 2WFF3 2C1FA 1NLRA 2XG3A 4DOUA 1DYKA 4K3UA 2PHFA 3WG2A 4JTNA 1SCRA 4FPYA 2CL2A 4WZFA 3ETQA 1VB2A 1W6QA 4HKLA 1N3PA 3CJIC 2R071 2JECA 3IDEA 2QDNA 1MEC3 5K7PA 1FMD1 4L9BA 4XFIA 2YDEA 3ZMOA 1BBT3 2YZ4A 5KHHA 2SBAA 5T54A 5CFCB 2XL7A 3MFAA 1AJKA 2QNKA 3N7KA 4BHPA 3E6DA 3JQWA 4Q4Y2 2RS51 1D2SA 1W6NB 4RGGA 5FO7B 1RUC1 1CAXB 4N53B 4AW7A 2P2KA 3WW2A 3J8F1 3D8CA 1FX5A 1WLCA 5KHJA 2R072 1S0JA 2VH9A 2ATFA 1RJ7A 5I0SA 4OHYA 4LA3A 4FOVA 1HXS1 5DUUA 5GZDA 1FMD2 3W58A 1XE7A 1LHUA 3AJZA 3PVNA 1JHNA 1KFUL 2JG9A 4X6RB 4M0HA 4XFBA 2WQZC 3WVJA 5T52A 1RUF3 1DU3D 3ILFA 4DY3A 3FJSA 2WA4A 1RUC2 1KFXL 3R05A 1GANA 1GNHA 1LESA 3WX5A 4FBFA 3J8F2 3PTYA 3ZXAC 2TEPA 4YNIA 1HLCA 1PO11 3M8LA 2D3PA 3KZ4C 1CJDA 1HXS2 2VPVA 2Z79A 3E6BA 4DMIA 4ASMB 2BVBA 3ZDSA 1VP6A 2YXSA 1DQ2A 4LE3A 2EXJA 3H8UA 4FPFA 1AX1A 2QCSB 2CWSA 2ZGPA 3OTFA 4CZSA 4ISQA 1LECA 1Z7S2 5JVVA 5BNNA 4LNVA 2FMDA 5F1RA 3WD5A 4D7SA 1IHMA 4ONUA 1AR61 2VOXA 3LWCA 1JBCA 4PJYA 4KWLA 1PNGA 3WDVA 3VZNA 1PO12 1LGNA 2ZGQA 5CU1A 3IWZA 1QNYA 1D4M2 2JKBA 1Y7BA 1OLQA 4LHKA 4N53A 1H9WA 4EN0A 4QM8A 1MZEA 3U10A 4LO4B 1CAWB 2GC1A 4NHLA 3TAYA 5JLVA 1RUJ3 1DQ6A 3GF6A 4I0WB 1PZ9A 3E97A 2ZGRA 4YW2A 1YFXA 4Q8KA 2I2SA 5FTTC 4E4DX 1CJPA 3SH3A 5GLZA 1O3QA 2D6KA 1RUH3 4IERA 1POV3 2OUHA 1G9BA 2AREA 1AR62 4XW3A 1J58A 3AZXA 2E63A 1S0IA 1EY2A 4FQZA 5GLVA 4JVAA 4MZUA 2I74A 4LT5A 1I5ZA 1NCQB 1H2LA 1GZCA 4AVBA 1BKZA 1S0BA 3IPVB 1LOEA 4Z8BA 1EAH1 4AE2A 2XJSA 3DGTA 4DRRA 1LKNA 5BYNA 4YW4A 1V6MA 4OULA 4XHXA 3VZOA 1JTZX 3TBDA 5KWRA 2ZZJA 3B9IA 1DF0A 1NQJA 2QVSB 5JPNB 3FBYA 4XOGA 2W0XA 3SLIA 4ITCA 3I4IA 4QGMA 2JG9C 4CDXA 1V70A 2RS11 4OZXA 1W6MA 1CVNA 2IFWA 4EROA 3AMHA 3WDWA 3FFZA 1FV2A 5FCCA 4AQ2A 3WW4A 1N3QA 2A71A 5I8YA 3TN91 3M3EA 2R6QA 3ZSMA 2HWD1 3AMMA 1CAWA 4NWVA 2HYKA 4Y22B 1ZBE2 2DU0A 4AK3A 1DHKB 2O1QA 4CDWA 3LOBA 4HLTA 4PIYA 4META 1HQLA 1YYNA 4O9GA 4Q4V1 3U11A 4YZ4A 5BNNC 4XQWA 2P3KA 4FP3A 4L97A 2PFWA 3O0XA 3P3NA 3JBG1 2PHTA 3TN92 4GXLA 1ALYA 1WW6A 3AZVA 3CJXA 2HWB3 1KJLA 2HWD2 1MZFA 5FLJA 2XPJA 1MQTB 4XJAA 4IEOA 1AR93 2BEOA 3MLKA 3WUDA 1YXWA 4N53C 3H3UA 4QX5A 2JENA 1RUD1 3OF1A 4RR3B 5A3LA 1OFSA 5I0RA 2HWF2 1OHFA 4P9YA 1SBDA 4Q4V2 1KRIA 1SFYA 1BCXA 2YYOA 4D7TA 1Q56A 1AXYA 1RMU1 4CDQB 3JBG2 3O12A 2QE3A 3LKJA 3PNAA 2QDRA 2PLV3 3UKTA 1N3OA 2DFCA 3ACLA 2DU1A 5DDJ1 3WP3A 4IEVA 2HWC3 4B7KA 2PAEA 2PHDA 1RJ8A 5AVAA 4PDWA 2I07B 4MXVA 4MGKE 2XBO2 4IQPA 4N43B 4RHV1 3WOGA 3VL8A 3ZXDA 3NAPB 4BPZA 4FO9A 4YW1A 4YZ5A 1X8MA 2X8KA 3D0SA 2NMNA 4FAGA 2GN7A 1GQGA 4P14A 1UKRA 1WMDA 1YJLA 3SXWA 4PF5A 2H0VA 2RM23 1I1EA 1AF9A 5EWSA 4R4XA 2IXIA 4GWNA 5DDJ2 4CP1A 3UKNA 4CDXC 3VLBB 2D6MA 3OYWA 3S7IA 1QJU3 3P3PA 2IC1A 3SCGA 3NVCA 2RS33 4HKOA 4MH0E 1RUI3 3TRSB 5C9AB 1UD1A 4JTOA 2FZ1A 2K0GA 2WZPP 3TNQA 1PGSA 2DV9A 4LR4A 3SMHA 4BCUA 1AR72 4H3WA 4OLLA 1S55A 3JD73 2CTVA 4CDWC 4EN8B 3BODA 1ND2B 2WS91 5CNAA 2E7AA 2MEV3 1UX6A 1AR83 2AH2A 1MS8A 3FX3A 4H7LA 1J1TA 5T5LA 2NMOA 1QQP3 3WW3A 3ZSEA 1XRUA 1QHDA 1R093 1NA1B 3B7MA 3C3VA 4QQPA 4XQ4A 2YV8A 4JV4A 5JSRA 4AGRA 1UZYA 3MF9A 3NAPA 1XU2A 1R1ZA 1BYHA 3QBQA 4S2GA 4BLIA 4R9DA 2GMPA 4RFT0 1Y43B 1MS1A 2YMZA 3ASIA 5L73A 4JGYC 4YGDA 2ZABA 2XJQA 3SITA 4ZKTB 2VMHA 3LCPA 2B39A 4JRLA 5C8CA 4FPHA 5FMOL 3OD0A 4QPGB 1LOCA 3MIDA 4AI0A 2D3RA 1WD4A 5H9QA 4XFHA 1QH6A 4RL7A 4LUMA 4YVWB 5I8TA 1PM7A 5C9AA 1MEC1 4A7YA 2VU9A 1AL0G 1XXNA 4PDWC 3MDPA 3WZ1A 1LTEA 3N35A 1VAKA 2A6YA 3WXPA 3H7JA 4Q0PA 3WG4A 1F31A 3L2HA 1LOFA 3IIAA 4B7EA 1QMJA 2ZKLA 1WA4A 1IPKA 3WDUA 1M4WA 3QH6A 1LOGA 1ND2A 3NSTA 2FHRA 1H4GA 2ZX3A 5I91A 2B5HA 1TMF3 2ZGTA 3IN9A 3QOPA 3M1HA 4XIKA 3TNPB 5TSWA 1LHNA 3URFA 3AKPA 4JGZA 2ZCWA 4OFGA 5LRRA 1TME3 3L9JT 3IKWA 1NY72 2WJSA 4PCRA 3ZIWA 1HRV3 4CEWA 2A6VA 3M3OA 3SH4A 3AXEA 5AVPA 4LULA 4KGGA 3SISA 2NN8A 4NR1A 3WY6A 3VZJA 4MX3A 3Q9OA 1H1AA 1VBD1 4P9IA 4AQTA 2V73A 1BMV2 4XJ8A 5C4WB 4KH9A 4QGNA 1FNZA 3WR0A 2F4PA 2YY1A 3WUCA 1C3HA 2A5ZA 1UMZA 4L8QA 5C6CA 4YGEA 2F6BA 4XYXA 3SHRA 5CFDC 5GLWA 3FUOA 3B69A 2DCZA 3U0ZA 4LHLA 4F3JA 5JIAA 4YG0A 2PHLA 3NAPC 1A6CA 3ENRA 1CQ9A 4XFCA 5JZGA 2ILMA 1VBE1 2R043 4DRVA 1UF2C 2UURA 1VBD2 3B94A 3RZZA 3N7JA 3WCRA 3SCHA 1GZWB 3WQ0A 5JSPA 1H8TB 3R4SA 1U5XA 4EWDA 1BEV3 1OKQA 1DGRA 4AVAA 2BNOA 4Q4X3 5C8CC 3KGLA 5GZCA 1RUJ1 3BIWE 1UZZA 3MLJA 1PZ7A 2R1DA 2JX9A 4Q0SA 2BUKA 4YSFA 2H0BA 4I01A 1LHOA 3NL1A 2KXLA 3LB9A 4X8NA 1RUH1 1PK6A 1POV1 1JYCA 3ZFGA 1QY4A 1JUIA 3PVBB 4XFFA 5C9AC 1VBE2 1X33A 5E89A 3H50A 2EALA 4GKXA 2P37A 3POWA 2WL1A 1DGWA 1OSGA 4GH4A 1LOFC 4M3CF 1O5LA 1YFWA 2LTNA 1W6PB 4JCKA 5SV5A 1F5JA 5BNOB 5I0TA 5D8AB 1QJY2 2PHRA 5LK7B 1DZTA 2AYHA 1HKDA 1PVC1 2VW0A 1QXPA 4QQLA 1UU5A 1PHMA 3ZPYA 5ABJC 1LULA 5JR7B 1RUH2 4JGZC 4LEJA 2BYVE 2QZ2A 4LLOA 2AENA 2DUPA 2EA7A 2Q4SA 2MPFA 2XJUA 3AYDA 1ZZ6A 4SLIA 3RNSA 4BH9A 1JN2P 1M06G 3UV9A 4CEWC 4XFGA 1MS3A 4BIFA 3ZYIB 3MIFA 1WCKA 1XYPA 2WNUB 4AI2A 3LA7A 3OGGA 2A6XA 4DPNA 4LBLA 1CR7A 3H1YA 1PVC2 2R061 2XUMA 5KBFA 3MW2A 1EV13 3APBA 2XJTA 2A70A 1RUG2 3UJOA 2D5FA 3I54A 4P9GA 2B46X 2ETEA 1Y3TA 5IK4A 3A4UA 3EO6A 2EAKA 3UJQA 3L2YA 1DQ0A 4MGZE 4Y1YA 3MF6A 4W6YA 3NKGA 1RUE3 1ULFA 1DGLA 4QQ2A 3W9AA 2R062 4IESA 4YG6A 5GALA 1VBA3 2PTMA 3CLPA 4AI8A 5FO8B 5JZGC 1QXRA 2EF6A 1R1A3 4LBQB 1KJRA 4LUKA 1W6PA 1RGSA 5DXDA 1B35C 2XVKA 4GB32 3VKNA 1NXD1 5FAXA 2ZZQA 3WNXA 5D8AA 4XBQA 4RD7A 3IDBB 5FQ0B 2Q8OA 3BB6A 1R082 4PBOA 4RQPC 1NXMA 1V6IA 2DUOA 1LU2A 1FAYA 1U5YA 3R6SA 2HKXA 3B01A 4COYA 1Z0HA 3AB0A 1RTVA 1PK6C 2EXIA 3ZFGC 1G86A 2AR6A 1BK1A 4M3CA 5GLTA 5ACA3 5FBZA 4CRQA 2WZR1 1VBC3 3BOPA 1FPN3 1TE1B 1QDCA 1HQWA 3RI9A 1VBB1 4P9XA 4GH4C 1O4ZA 2WT0A 2B7YA 2DVFA 2HWC1 4Y5Z0 4SBVA 3VBRB 3UKVA 1GBGA 3PLQA 5JPMB 1NLSA 2VOWA 3ZN6A 2WT1A 2FBEA 4WM7B 5EYYA 3WP6A 3GALA 1N1YA 5I8SA 4BWOA 5E8AA 3OD4A 4HKWA 3I8TA 1DIWA 1W6OA 1FYUA 4LTAA 4RSUA 4HBNA 3M4FA 4YFZA 3V0AB 3ELNA 3QCWA 2WZR2 1MZ6A 5FLIA 1CD3G 1TNRA 4FXKB 3NKTA 4CDUB 4XFAA 3WG1A 4AYUA 1FNYA 1IS3A 1VAMA 1VBB2 4FPLA 4IEYA 2OYZA 1WW4A 1CX4A 2ENRA 4AFCA 1PO21 1T6GC 5JMCA 1QJU1 1LGBA 4G3YC 4IEUA 2P3IA 2RS31 3B93A 1K5MA 1RUI1 2X5IB 1ONAA 2A6ZA 1OA3A 4DS0A 4E27A 5FQ0A 4E4ZA 4L2NA 1U5ZA 1ASJ1 1ZZBA 1OQEA 3WCSA 4DZGA 3AP7A 3ZYPA 5T5PA 3JCIA 2OA2A 2TNFA 1GZ9A 4H55A 5K0UB 4HL0A 5A32B 5J37A 1VALA 2HEWF 1WCDJ 2MNGA 2VULA 2MEV1 2Q1ZB 1UPIA 1AYN3 1AR81 1PO22 1WLTA 1A3KA 2O8OA 1SFNA 1GQHA 3CEWA 3KCCA 1C5IA 4K6BA 4ASLA 5FDBA 4WZCA 4AVSA 2IXLA 5AFBA 1AYM1 5T3NA 1V6KA 1ZBA3 1I9RA 1REEA 1QQP1 1SLBA 2Y26A 4EWEA 3OJBA 4CEYA 2DVGA 4BOWA 4D3WA 1ASJ2 4OHXA 2RS52 3K48A 4F8AA 3MYXA 2VW1A 3KGZA 3CO2A 1NG0A 2VUAA 4WM7A 2XB6C 1AVBA 2BVVA 3WDYA 2ZX2A 3VBHB 1V9U1 2YPJA 2R0FA 1REDA 2VY0A 1IS5A 1OOPB 3E5UA 1AYM2 4Q4W3 1WBLA 4RA0A 2ZA9A 2ZHLA 4NO4A 3LZZA 3LSEA 1D2QA 1ZX5A 4Y1XA 4JDOA 4YG3A 3ZX7A 2IFRA 3MIGA 3RG0A 5JWPA 1J3PA 4LO6B 1X36A 4HT1T 2B45X 5I93A 5CFCA 2DTYA 2X5IA 3MI8A 4WVMB 2WLQA 3AKRA 2BFUS 1RVF3 1V9U2 3HT2A 3VHNA 3ILRA 4AFDA 3MFCA 1UU6A 5CG8A 4ES9A 1CESA