5AVAA

Crystal structure of pha-e lectin in complex with bisected glycan
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
238
structure length
238
Chain Sequence
ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic visualization of a flipped-back conformation of bisected glycans bound to specific lectins
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords Erythroagglutinin
total genus 47
structure length 238
sequence length 238
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5avaA00
2EIGA 1JXNA 3RQ0A 1IOAA 3IPVA 1CQ9A 3AZXA 4GWMA 3PJQA 1WW5A 3V0BB 1LU1A 3QLQA 4Y20A 1CESA 4ITCA 2CWMA 2KM2A 1I1EA 3SH4A 1SACA 1Q8SA 4DFSA 4AYUA 4NO4A 3AX4A 5FREA 2Q5TA 1C57A 3ZXFA 2P2KA 2VUAA 1MZ6A 3ILRA 2PHRA 1AXZA 4YG6A 2DUOA 2GN7A 5DZEA 2OW4A 3M3EA 4ZXKA 4Y22A 1FATA 2NYYA 4FPJA 3TB0A 2NP0A 3KM5A 2AYHA 1AX1A 2DU0A 4CTEA 1LGCA 1XQNA 3WDVA 1FNZA 4FPEA 1LOFA 3I4IA 1AVBA 4WV8A 3WG3A 5H9SA 4PCRA 4YGEA 3W59A 1ULGA 3RMYA 1LOCA 2ZGKA 1SLAA 2R0HA 2GMEA 1JN2P 5T50A 3AP4A 1N1SA 3OBTA 2A75A 1CVNA 3USUB 1W6PA 2A71A 1BQPA 3OYWB 2NMOA 3ZXEA 1LHNA 3POWA 2R49A 3RS6A 4LBLA 4K20A 3R4UA 1ZM1A 4GA9A 5DG2A 5LK5A 1G9AA 1F5FA 2ZBJA 5E8AA 3LSDA 4TYSA 1LHUA 5HCBA 1DIWA 4XILA 4XXPA 2ZHLA 2DVGA 2ZZJA 4FPHA 2ZKNA 2JECA 2W68A 5E89A 4DRVA 4XHXA 2WT0A 2PHTA 5CBLA 1WUVA 5JOYA 3R4SA 2WSVA 1W6QB 1YYNA 1AF9A 1G7YA 1GICA 5GLWA 1QNWA 1HQWA 4JRAA 4Y1YA 5T52A 5JOWA 2VY0A 2A3WA 4U2AA 4UW5A 3ZXKA 3POYA 2ZHKA 3O5SA 5GM0A 1LCLA 3H0OA 4FOYA 1N1TA 3D4KA 2TEPA 1LJ7A 4YZ2A 2R1BA 4JCKA 3AYAA 4BQ1A 4ZKTB 1KITA 3RRDA 4YLZA 3ZXJA 2DVFA 3POSA 3MW4A 4XJ9A 4AVSA 1UAIA 4YM2A 2DV9A 1LENA 2A3YA 4D69A 2VW2A 1KDMA 3VKLA 1JOJA 1C1FA 1DQ6A 3NV2A 1ENQA 1N1YA 1FYUA 3ZXLA 2UWCA 1QGLA 4PBPA 3FLTA 4YM0A 5EYXA 4Q2FA 1V6IA 2WQZC 1AJKA 1AX0A 2C9AA 3TAYA 1Z78A 2FMDA 2NMNA 4K21A 4W65A 2ZACA 4UW3A 5EXOA 1W6MA 1IKPA 5IK8A 2E7QA 1BXHA 2VW1A 1S1AA 5JDBA 3WCSA 2PHUA 5IK4A 1HLCA 1UX6A 1W6NA 2D7FA 4XIKA 4PQ9A 3M1HA 5T55A 2UWBA 2PHFA 2LALA 1RIRA 1EPWA 2V73A 3N7KA 1ULCA 3WG2A 3GALA 1PZ7A 5IK7A 1MACA 3AJZA 5E88A 1Z0HA 2GDFA 3WUDA 3VKMA 2A7AA 4FQZA 5CB7A 1R1ZA 1SBEA 2DURA 4AVVA 1ZA4A 3BIWE 3BTAA 4NOTA 3ZSJA 3MW2A 4Y1VA 2AR6A 2DVDA 2R0FA 1UN1A 3WOGA 4FVVA 2WSUA 2W08A 2ZGUA 4I30A 4XIOA 3FUQA 4MYEA 3UK9A 2WT2A 1QMJA 4LBNA 3ZYPA 1G9CA 2P3IA 1FV2A 3WLUA 1PZ8A 1V6JA 1VIWB 1RINA 3B01A 1GSLA 1ULFA 1UMZA 4YFZA 3MEPA 4YGDA 3PVNA 1WW4A 1LTEA 5KXBA 2WLQA 4XYXA 3SLIA 4ISQA 2JD4A 3AZYA 1DZQA 1YO8A 2YY1A 5GZFA 1HDKA 1DBNA 2DYCA 2OVUA 1S0BA 2XB6C 3WHTA 5DUVA 3DUIA 2AGSA 1CR7A 2JKBA 4GXLA 4YW3A 5SV8A 4TZDA 4M3CE 2CTVA 2AUYA 2WT1A 1GYKA 3O12A 2I2SA 3B3QE 4WVVA 1UL9A 1V00A 2ZGLA 2P34A 4BMEA 2GNTA 4KBBA 2ZGRA 4RL7A 3WVJA 1IS3A 1DQ4A 4R9DA 3HMYA 1LGNA 2OUJA 4YM1A 5EWSA 1W6QA 2V5YA 2EXHA 1WD3A 5GZDA 1DGLA 4HANA 4PF5A 1AX2A 1B09A 4FPKA 5T54A 4F83A 3WG4A 2CY6A 1VAVA 5GZGA 5T5OA 1YI7A 3MPPG 1FAYA 1SCRA 1S0FA 4Q1PA 4YW5A 4ASMB 1LEMA 1UZYA 5T5LA 1CPNA 2D3RA 1DYKA 1Q56A 5JOZA 2R1DA 3WHUA 3AZWA 2G4IA 2ZA9A 2P3JA 1WBLA 3USUA 4Z8BA 5GLZA 3FUOA 2NZ9A 4FPGA 2GNBA 1VLNA 3ZSMA 1KQRA 2D6PA 3ZSLA 3O0VA 3VV1A 5IT6A 3HR9A 1QNYA 4XTPA 5T5JA 4C1XA 5HCFA 4YW2A 2P3KA 4Y24A 3T2TA 1Y7BA 2YMZA 1WW7A 1V6LA 2ZMKA 3B9CA 4ISRA 4XJUA 4OZXA 5CAZA 5EYYA 4Q27A 2EF6A 4LBMA 3WZ1A 2ES3A 1LOEA 2ERFA 4LBKA 3AP5A 1QKQA 4DQAA 5L73A 4GKXA 3UJOA 1QF3A 3N36A 2NN8A 2RHPA 3AYDA 1Q8OA 3I8TA 3UJQA 3M3OA 4BLIA 1WLCA 3AXDA 3ENRA 3HN1A 4IQPA 1GANA 2D44A 1UKGA 2E51A 3WDXA 2DVAA 1SCSA 3N3HA 4AVTA 2VH9A 4P9WA 4YGCA 1HKDA 5DUXA 2BQPA 2ZMNA 1MZ5A 2WKKA 1MS9A 2ENRA 3WDYA 4FOVA 4C1WA 1W6PB 5GLUA 3T1MA 2D6LX 3V0AA 1JYCA 1FV3A 1OKQA 1LGBA 3B69A 4FP2A 1LEDA 1A8DA 1URXA 1YXWA 3OGGA 1ONAA 1RITA 4GWNA 2VXRA 3JU9A 3ZVXA 3INAA 1X50A 1DYPA 4BLJA 3VKOA 3B00A 2A5ZA 4L8QA 3O0XA 1GV9A 3V0BA 2DUQA 4Y22B 5HCAA 1SLCA 3D5OA 1APNA 1C4RA 1GNZA 1NXD1 4PBOA 4XJAA 4YG0A 4M00A 3WCRA 3C2UA 4M3CA 2UWAA 2ZHNA 3UL2A 3OBRA 1BZWA 3WDTA 5JLVA 1OQ1A 3A0KA 4YGBA 4LBQD 1H9WA 1IS4A 1QDOA 1ULEA 3M3QA 1WCSA 3M2MA 4XBQA 4YG3A 2A6WA 2FHRA 1G8WA 1WD4A 2GMMA 4XDQA 2EXJA 1N3PA 1SLLA 5KXDA 2ZGOA 1KJRA 3LSEA 1DQ0A 1QU0A 3AK0A 3V0AB 4XHBA 3OJBA 4FPYA 4P9XA 1AXKA 1UPSA 2D6NA 1I3HA 1DHKB 2A70A 3VKFC 1F31A 2VW0A 1JW6A 1MS8A 3WNXA 3NWKA 1AZDA 4YW1A 3BOPA 4BOWA 4XBNA 3IMNA 1WLWA 1N3QA 3CNAA 3AJYA 1O4YA 1J1TA 3WDUA 3VUOA 1C1LA 2EXKA 3N7MA 1MS4A 4Y1XA 5AVAA 3O0WA 1GZWA 2DTYA 3WG1A 4Q8LA 2AENA 1GZCA 1W6NB 4Y1ZA 4ATEA 1G9DA 1DFQA 1CONA 3WDWA 2WNEA 3WV6A 3OY8B 4YW4A 4YZ3A 2CL2A 1LECA 3V64A 1SLBA 3T1LA 2EAKA 2E7TA 1S0CA 1DQ5A 2A6ZA 4FPFA 4M01A 3AP9A 2YV8A 5KXEA 3NV3A 1VAMA 3SITA 2ARXA 2GNDA 4XZPA 4GALA 1LODA 1LHOA 3SH5A 1FNYA 2VU9A 1MR5A 5GJ6A 4AGGA 3RMXA 4AGRA 4BPZA 1Q8PA 2JDZA 5F9TA 1G86A 3ZSKA 1KDKA 4H55A 5IK5A 5JVVA 1H30A 3GNEA 5H9RA 4XXAA 5GALA 3ZPYA 3PVEA 4R9BA 3Q9OA 3IKWA 4Q1RA 1JYIA 3BODA 3PVOA 1LHWA 1O4ZA 4Y20B 2DWRA 1JBCA 3IPVB 4YZ5A 3OPZA 4HL0A 2GN3A 3ILNA 5H9QA 4FQ4A 1LHVA 4LBJA 4FP3A 3OY8A 1GBGA 3RSJA 3SISA 1Q8QA 2CYFA 3U4XA 1FX5A 4YZ4A 2EALA 4FOQA 2W39A 1LOAA 1MS0A 3AYCA 1LU2A 4XJWA 4BMBA 4LBOA 1BYHA 3FLRA 3PMEA 3AZVA 5GZCA 3D6EA 4XJZA 5DUUA 4FOWA 3IM0A 4FPLA 1JHNA 1D2SA 2DTWA 3KQRA 1WBFA 5GZEA 2ZGMA 4FPCA 5KXCA 2GNMA 1MVEA 4YM3A 1SBFA 2GMPA 2OUHA 2ZGQA 3AYEA 4AGVA 4SLIA 4M3CB 2ZGTA 4JC1A 4YFWA 2JJ6A 1V6MA 1Q8VA 4P14A 2SBAA 3NV1A 4ATFA 1SLIA 1KJLA 5CNAA 3L2YA 1MVQA 1N47A 3SH3A 3OYWA 3AXEA 3JUUA 1LOBA 3N7JA 1TEIA 1S0EA 2H0BA 1SBDA 1GLHA 1W0OA 2CNAA 3QCWA 1CJPA 5DG1A 2ZAAA 5CA6A 2HYKA 4BM8A 2DUPA 1GKBA 2ZGPA 1G9FA 1W6MB 2E53A 2ZABA 1F9KA 1ENSA 2ARBA 1BKZA 2D3PA 3N35A 2GALA 4XE9A 1N3OA 2D6OX 1LOFC 1DQ2A 5JMCA 3M3CA 1PZ9A 4CRQA 3RG0A 1S0JA 3ASIA 4R9CA 1LOGA 4UW4A 1SFYA 2YROA 1N1VA 2D43A 3MW3A 5DZGA 4XTMA 1AJOA 1CIWA 1S0IA 4P9YA 5T5PA 1W0PA 3ZYRA 3APBA 3AP7A 3FBYA 1IS5A 2A6YA 3LCPA 1MS1A 3R05A 5DZFA 2B7YA 2Z42A 1U0AA 3A0NA 1CN1A 3V65A 5FRAA 1LULA 1S0GA 1GNHA 1UZZA 4R9AA 1HQLA 5H9PA 3VKNA 1LESA 1KRIA 1ENRA 3AFKA 4XMAA 2PHXA 4Y1UA 3WUCA 2JE9A 4Q8KA 1QDCA 1GZ9A 1V6OA 2UU8A 4U36A 4UW6A 4LBQA 1IKQA 5GLVA 5BYNA 1YIFA 2AREA 4YZ1A 2PELA 1WLDA 2DU1A 3IN9A 3FLPA 1WW6A 2C5DA 4LBQB 4WVWA 3FFZA 1MS3A 4Q26A 4XBLA 4FPOB 3AZZA 3AP6A 5F5QA 1A78A 2XG3A 1QOSA 3N7LA 2ZHMA 2AH2A 4DS0A 2D3SA 1H9PA 5IUQA 1MS5A 1G9BA 4AWDA 3SNMA 5DXDA 1GZWB 2D6KA 2YXSA 2R16A 1JUIA 2ZGNA 2DVBA 1IS6A 2W52A 2A6XA 1D0HA 1S0DA 2CWSA 2JE7A 2NM1A 3DGTA 2A3XA 4M3CF 2LTNA 3A4UA 2EXIA 1QOOA 1ULDA 1CPMA 1BJQA 4XOGA 4DRRA 4K1YA 2YZ4A 2ZGSA 2SLIA 4RA0A 3ILFA 3W58A 1DLLA 1QOTA 1W6OB 2A6VA 4K1ZA 1YRZA 1OFSA 1SLTA 2UURA 4CZSA 1V6KA 1NLSA 5GLTA 2ZMLA 4DPNA 2D6MA 5JOXA 1VALA 1W6OA 2E6VA 1A3KA 1AXYA 4WZFA 3ATGA 2P37A 4XJ8A 4XMIA 1DQ1A 2WJSA 4GKYA 4Y26A 5DUWA 1V6NA 2PHWA 3NV4A
chains in the Genus database with same CATH superfamily
5IVCA 4P5HA 4L92A 5HBAA 3PJQA 4CU8A 3KLSA 3QLQA 4Y20A 4EQVA 3KCYA 5FK7A 2JG8C 3VBOC 5EFUA 5A3MA 2JXAA 4E27A 3ELNA 3SH4A 4AYUA 3UT0A 3PVBB 4QPIA 4EJRA 3VBUA 5FREA 2Q5TA 1C57A 4XZUG 5JSOA 4NE9A 1O3QA 4HKOA 2X5IC 5FLJA 3THTA 1AXZA 3OUHA 1ZRRA 2VZPA 4JKKA 1P8JA 3HN3A 4MX3A 5FXZA 1ND2C 1BK0A 1RUC3 1WMFA 3EHKA 1C28A 1EAH2 4ZXKA 4FPJA 4ORFA 3TB0A 5BXXA 2E32A 3ZFFA 1LGCA 1FNZA 1XNAA 2HH9A 3I4IA 3AM2A 5H9SA 4YGEA 3W59A 3JB4C 3RMYA 1R092 1UNBA 2VAUA 4IERA 2ZGKA 1SLAA 3EO6A 5T50A 3MIBA 1RVF3 5CFDA 3OBTA 2A75A 5DAWA 1CVNA 3RJRA 1SDDB 2FBEA 4N90A 3NNLA 2FDHA 3POWA 3RS6A 2JICA 1AR72 3IWZA 4KG8A 4FFIA 1H6XA 4H7LA 4K20A 3CZUA 3R4UA 4GA9A 2UY9A 4UBGA 5K4LA 4CCCA 4LE3A 5JIUA 1DIWA 2DVGA 2ZZJA 1JUHA 3LQCA 5BNNC 3P3PA 4XHXA 4FTSA 1KD7A 3VB9A 3TEYA 1QJU2 5K9YA 3WNOA 5A1FA 1QNWA 4JRAA 2A3WA 2ARAA 1M06G 2ZHKA 1LCLA 5C4WA 1N1TA 2YPJA 1L3JA 1HQNA 5L9VA 2XGXA 4ZONA 2W92A 1KITA 3RRDA 4XUQA 3MW4A 1UAIA 4IL7A 1CWPA 3CJIB 4D69A 3VKLA 1OA4A 5L7OA 1VE0A 3B93A 1C1FA 4Z1VA 3N9QA 5FZCA 4OQ9A 3NV2A 2K46A 1FPN2 2HEWF 2E63A 2WRAA 1ZVFA 2P1BA 1L7LA 5E1RA 1OOPB 4CEWB 4WM7B 1KEXA 4QGMA 4Q4Y2 2VTXJ 2G1MA 2NMNA 4K21A 3K4ZA 4PLNA 4DOUA 4RS5C 1D4M3 2JDHA 1ULOA 2VW1A 4LT5A 5FK8A 2PHUA 2VNGA 1RHI1 1HX6A 1X9PA 1XSQA 1W06A 3TYJA 4IGOA 2LALA 3JD73 1UD1A 3JXSA 2BWAA 1ULCA 2Z2SB 3DF0A 3D0SA 1JYTA 1H0BA 1NY71 1XYOA 1Z0HA 2PAEA 1W99A 5E88A 3WUDA 1REEA 2A7AA 5FO7B 2QFEA 4Q4Y1 2PQQA 4Y4YA 1RUF1 3MW2A 4MXVA 4Y1VA 1XNCA 2R0FA 3VBRB 5L36A 1UN1A 3Q8EA 2P17A 4Q4V3 1H8TB 4DEQA 2WSUA 2ZGUA 2GH8A 3FUQA 4MYEA 5K0UA 5LK7B 2QQIA 2WT2A 1QMJA 4LBNA 1BCXA 4QB1A 2P3IA 1FV2A 1SEFA 1PZ8A 3ZYPA 2OA2A 4EWDA 3PUIA 3JBG1 4KL1A 2WO7A 3PVNA 2YU2A 3C7HA 3K2OA 1PK6B 1S2BA 4CCLA 4A44A 2DCKA 5J3UA 5FZLA 2OVUA 3UNPA 5F5IA 1OUXA 3DUIA 5DDJ1 3IIAA 3OBZA 4ET7A 4ZZ8A 1CR7A 2JKBA 4QQLA 3UGFA 3WF2A 4J1WA 5FZKA 4CCOA 3H8XA 5SV8A 4YRDA 2HWC1 4PLOA 2V09A 2CTVA 2AUYA 2YFZA 1DGRN 4QQ2A 4HK8A 1A34A 2IZWA 2X05A 4D7SA 2Y33A 3QD6A 4BMEA 2RR13 4GWIA 1COV3 3KGZA 4ZPIA 5KC5A 4HVQA 3KGLA 2EXHA 3KHCA 2ORZA 2KA3A 2R073 3GGLA 2PMWB 4HANA 2CV6A 4C8DA 1QY4A 1AX2A 3GBFA 3MF9A 5FY0A 5T54A 3O1PA 5T5OA 1VMJA 2WNVB 1X82A 4OZOA 5JUVA 4MXWA 2WZEA 5I8SA 3TEZA 2HBTA 5IVEA 1CZVA 3KQ4B 4ASMB 5BNPC 3D8CA 5T5LA 2JIGA 1Q56A 1UMHA 3R4DB 4YNIA 5FYSA 4EN8B 4Y3OA 2G4IA 4P9JA 3IB3A 1WBLA 4Y5Z0 4BE3A 2WZR1 1ND3B 4ZU5A 3RYKA 1W9YA 2GNBA 1VLNA 1GQGA 4K8RB 1VJ2A 1PVXA 2VPVA 2XUEA 3ZSMA 1MEC3 3VV1A 4BQXA 4N43B 5IT6A 4JQRA 1H8VA 2BZDA 5A3TA 3JBG3 1F4AA 2P3KA 4Y24A 5CG9A 3IDCB 4TLGA 1WW7A 2RS51 2RDNA 3MLKA 1O8PA 3U10A 2RMU1 4D7TA 1RUJ2 5EYYA 2EF6A 3WZ1A 1HN0A 4NHYA 3HBZA 2ERFA 3AP5A 3J26N 2UYAA 2WN3A 2LW8A 4GKXA 3UJOA 5HXVA 3ECQA 2WNVA 2PAMA 3AYDA 5FY9A 4MHRA 1WLCA 1POV3 2QQNA 3O7OA 3ENRA 4CDQC 3BPZA 3WQ0A 5FP9A 1R1A1 3LB9A 3NRUA 2DVAA 2Z69A 3IMMA 1CAXA 1E5IA 1HB2A 4EN0A 1T6GC 4QQPA 3H50A 3E5XA 4K40A 4G4FA 2PLV2 5DUXA 1UCXA 3AKPA 1COV1 1YQ6A 3WF3A 5SV5A 2WBKA 4PIXA 5C8CB 4FOVA 2FQPA 4AHWA 1H4HA 1RTVA 3T1MA 1DDLA 5A3NA 3QH6A 1LNSA 1OKQA 4J1XA 2VVDA 3B69A 4FP2A 5FZ7A 3J7LA 4FSJA 1URXA 1YXWA 3OGGA 1BK1A 1NLQA 4A6SA 2Z79A 4NAOA 1UOBA 5CIRA 3JU9A 5FQ0A 3N9NA 3CHXA 3VKOA 1QJZA 2A5ZA 3B00A 4K9SA 4L8QA 4NRPA 3V0BA 4KMQA 1SLCA 4XETA 2WQ8A 1PVC3 3POBA 4PBOA 2MPFA 3FN9A 4PI0A 4OI1A 4PLMA 1OD5A 3C2UA 4PDWC 3HT1A 2UWAA 2ZHNA 3UL2A 3BI3A 4AVAA 1UMIA 4AW7A 5ERLA 3OGRA 1OQ1A 1RUE2 1H9WA 5C8WA 1AL22 1UZVA 4CEYB 1H8TA 1J3QA 2YBKA 1G8WA 4ZS2A 4B7EA 4KGGA 5I0SA 2F17A 5C3QA 4JDNA 4JGZC 4Q4W2 1PVC1 5BNNB 4BH9A 4JTOA 3GZTB 4A7YA 3V0AB 1OUSA 3O1SA 3S0MA 4XQWA 5LA0A 1CX1A 1UPSA 3I97A 1NOVA 4AQ6A 3AMPA 4GH4C 5FZAA 1W28A 1XNKA 2VW0A 3I3DA 4AOCA 1C5HA 3NWKA 4BOWA 3CBNA 3BOPA 3DXUA 2G9FA 3IMNA 1WLWA 3NKTA 1ZBA2 4HPKB 3AJYA 5FO9B 5IVVA 5FPVA 5DAVA 4BWOA 3VUOA 1C1LA 3JB8A 1MS4A 1U5ZA 4UYBA 4RS5B 1VBC1 2IXHA 3MIHA 4BQ3A 1RB8G 1UO9A 2K9ZA 2AENA 5LA9A 4ATEA 5K8SA 5JXJA 1DFQA 1CONA 1SFNA 1ZNPA 2UY8A 1G9DA 1MZEA 1GWMA 1W8UA 2JG8A 4PHZA 3POIA 5FUIA 3U75A 4GIQA 1LECA 3V64A 4QU1A 2WNUC 5I8YA 1HRI2 3ZFEB 1RUC2 1SDWA 3ZDSA 5CKMA 3MIGA 2VE1A 5KXEA 1C8M1 2ARXA 1E5SA 2UYBA 4AEMA 5LY1A 3ZMOA 5I93A 2YBPA 1BMV1 2XLAA 1E57A 3PHMA 4SBVA 5FYYA 4EN6B 4RQPC 4IEYA 1DYOA 2TBVA 4COUA 4E4SA 2HKXA 3FHQA 2QJVA 1H30A 1W04A 1ST8A 3GNEA 4OHWA 4AF9A 3LDBA 4GB32 3HNYM 3KV6A 1VBD2 2NQYA 3H9AA 3IKWA 4Q1RA 3BODA 1W8OA 2J42A 5AC92 3FJSA 4CPBA 1FT9A 5A32A 1OHFA 4O9GA 1HB1A 3ZKUA 2GN3A 5H9QA 3GBWA 5D1IA 4GMP0 3M3IA 2O8QA 2BRTA 4FP3A 4HBNA 5A6YA 3RSJA 3U4XA 2WR9A 3HJRA 3E97A 1IQDC 1OVSA 1FPN1 4PIYA 4Q4W1 4CDXA 5ACA2 1LU2A 3UYJA 2JDMA 3WSOA 3PMEA 1QQP2 2DCTA 3MV11 4FOWA 2VZ1A 4Z2WA 1WGPA 1RUOA 1QJFA 4HSJA 1WZXA 3T2PA 3D82A 1CGPA 5K7PA 4OULA 1ACCA 4I3PA 1NCQB 1MVEA 4YM3A 1SBFA 1WCQA 2VOVA 2ZGQA 3AYEA 3FX3A 3HVDA 1HRV3 2W2IA 5JPMB 5A3WA 5LA1A 4JC1A 2HEVF 2VG9A 1RMU2 2RMU2 1MEC2 2JJ6A 1HV1A 4IEOA 5JSPA 3S30A 4NHLA 5FPUA 4P14A 3VBOA 5FUPA 5C9AB 5DABA 1SZBA 4QHZA 1MVQA 3SH3A 4N53C 3I54A 4A41A 4MO3M 3JUUA 3N7JA 1IGOA 1T2XA 3TN93 3DPRA 3TEXA 1EV11 1SBDA 5D8AB 1CJPA 5EPAA 3S57A 1REFA 2HYKA 3OSDA 5FQ0B 1GKBA 4B4RA 4XF4A 1W6MB 3KMHA 2JG9C 5FYZA 4YVSB 1WMXA 3N35A 2ZX2A 2EA7A 4JGYB 3R6SA 3MLLA 4IE7A 3QBQA 1KFXL 1N3OA 1PO13 1ZZCA 3DKQA 2OPWA 1RUH3 1OH4A 2HWE3 2H6BA 1OFNA 1Z7S1 3J8F3 3ZR5A 1EV13 1S0JA 3ASIA 1W05A 1LOGA 2HWF3 2JWPA 4UW4A 5K0UC 2D43A 3ACHA 2FDKA 1W3XA 5DZGA 1RUH2 1AJOA 2BEOA 1ND2A 1UKRA 1AYN3 5T5PA 3VD7A 2ADDA 3APBA 3AP7A 1IS5A 5DZFA 1PNFA 1MS1A 5JI7A 2RVAA 3OGVA 5KHHA 1W0NA 4LHSA 4Q4V2 1WCUA 2YHJA 4YSFA 5FRAA 1GNHA 3GM8A 2BNOA 1UZZA 5H9PA 2W1QA 5T3NA 4E4HA 1FMD3 3DEMA 3WUCA 2PHXA 3POJA 3ES4A 1QDCA 3LDRA 2UU8A 2BTVC 3MBWA 4U36A 4UW6A 4NPRA 3LOBA 4GMP1 1ND3A 1NE4A 2WABA 5A32B 3CEWA 4TXWA 3OPTA 4JGYA 5FMOS 1WW6A 4L11A 4IGQA 4WVWA 4NIAA 3TNQA 1BMV2 4GJZA 4E2GA 2BFUS 1ZA7A 1ZZ7A 3B7MA 1VBB2 3HBKA 4HLTA 4AR2A 1ODNA 3WNLA 3TBDA 2EICA 4K8FA 1A78A 1CZSA 3N7LA 3VDAA 4DS0A 3LOIA 4LJHA 3PIGA 4AZZA 1ZRCA 3SNMA 5DXDA 1JOBA 3BOWA 1TMF1 5CG8A 4QM8A 5J98B 2RR12 4OHYA 2DVBA 5LASA 2IXJA 4HKWA 2JE7A 1D0HA 1S0DA 3A4UA 2EXIA 1CPMA 4FCAA 3K48A 1BBT2 1RUG2 4EE2A 1YQ5A 4HN0A 3K51A 1J84A 1G6NA 4QX1A 2I07B 4MOAA 5ISLA 2XBO2 4Y4RA 1DLLA 4K1ZA 4CZSA 5C70A 2OIIA 1OFSA 2HYXA 4N53B 1K12A 5FYTA 1NLSA 1PK6C 2ZMLA 2D6MA 3PJYA 1VALA 2GP3A 3NO8A 2Y0OA 3OEAA 4FT8A 4XFBA 3TWIA 2PHLA 1A3KA 1AXYA 3ATGA 4XJ8A 4D6QA 3FL7A 4Y26A 4UFLA 1JZ7A 2EIGA 2C26A 1IOAA 2RJLA 3D3AA 4GWMA 1R64A 1JZ3A 2R30A 2WINB 1LU1A 5I0UA 2BW8A 1LKNA 1X7NA 2CWMA 1I1EA 1Q8SA 2YGMA 3JBG2 2JD9A 4W6WA 1AL21 2NLRA 4YYOA 3ZFGB 3AX4A 5C3OA 1OC1A 4ZU4A 4AFCA 4FTBA 5CFCA 4IV1C 3GHMA 4UBHA 3KS7A 3KVAA 3W20A 3W5MA 3J4UH 3OBAA 4YG6A 1RUNA 2DUOA 1XNBA 4ZHNA 1XE0A 1FATA 2NYYA 4UFKA 2AYHA 4GH4A 5FZ1A 4WZCA 4AEJA 2A1XA 3E1F1 1YFXA 1LOFA 3TEWA 1AVBA 4H14A 4P02B 1VBD1 2VOXA 1NA1B 1YHFA 3AMHA 4PCRA 5DAQA 4N7IA 5JSRA 1LOCA 1KS4A 5FYCA 1JS9A 4AEDC 4CDWA 2GMEA 4QU2A 1POQA 1JN2P 4Q5OA 1NXMA 5JR2A 3B5LB 2XVLA 1N1SA 1KFUL 4H7MA 1QJU1 1MQTA 4RQPB 4MV2A 1W6PA 2A71A 3USUB 2HWB3 3EXUA 4Z92B 4LBLA 4IE0A 1VBA2 3MIFA 1ZM1A 1W8WA 2ZBJA 4DINB 3AMQA 3GCWA 2P6HA 4TYSA 1LHUA 5FLHA 5HCBA 3LEMA 1BVP1 2TUNA 2ZHLA 2ZKNA 3K3NA 1H1AA 1TE1B 2JECA 2W68A 2VNOA 5EIYB 2VCMA 1US2A 4DRVA 4BQYA 4XABA 3WW4A 1DZRA 5FZ4A 2WZPP 3T0BA 4TLFA 3BTYA 3BU0A 1K5MA 4DY5A 4UI9L 3ETQA 1W6QB 1YYNA 1G7YA 2VMGA 2CDOA 3T30A 2R041 3ZXKA 3UETA 3WNPA 4KG0A 4DIQA 5FZMA 5FYHA 4FOYA 2V4AA 4LLFA 1H4GA 2ZZQA 3FMGA 5HPOA 3DV8A 5A6ZA 4MGZE 1WCDJ 1ZBE2 4BQ1A 4ZKTB 1CD3G 1PO11 3HQRA 1SMVA 2A3YA 4PT6A 3NAPB 4OUSA 5I0TA 1DQ6A 1SHWB 4XPVA 2RDSA 1FYUA 3ZXAC 2R6QA 4CDXC 4HG6B 4NIHA 1XJAA 4BXFA 3C8XA 2D93A 1OLMA 3FLTA 4JGZA 5EYXA 1QJY2 4C91A 4AHZA 4E2QA 3L9JT 4LIUA 2JE8A 4E8DA 2HWE2 3J8F2 4AEKA 5FCCA 3RDIA 1Z78A 2AZ5A 4K7JA 2HWF2 5TSWA 3S5QA 5FZ9A 2ZACA 4MG2A 5B2GB 1TME1 4HETA 5IK8A 5CYYA 2E7QA 1BXHA 3WY6A 5LW9A 4TTGA 2D5HA 4HMZA 1UX6A 4V2WA 2D7FA 4RFT0 1C3HA 1UY4A 3MHZA 3M1HA 3SMHA 2XWBB 3JZVA 2WNUB 2PHFA 2GAUA 2V73A 5FZDA 3SKJE 1H1MA 2RDRA 2WAAA 5B4XA 4O9EA 1UYYA 1PIV1 1JZ4A 4CSWA 2V5DA 3VKMA 1Q5OA 2E9QA 4QPGA 2HJIA 4KU7A 3NMBA 5CB7A 3ZFFB 1R1ZA 4DY3A 1SBEA 2DURA 4A7ZA 2GZWA 3BIWE 1D4M1 1OI6A 2VMFA 4QX3A 5L19A 3LA7A 2ZS6B 2ZKLA 3MGUA 3ON7A 4FVVA 2QQWA 5DDJ2 2W08A 4GULA 4I30A 5F32A 2I74A 3UK9A 1QXRA 3O1OA 2BNNA 1G9CA 2CGOA 2XL9A 3B01A 1RINA 5JIAA 1GSLA 2ARCA 4AI0A 1ULFA 4WVZA 1FOD3 3A22A 2FDIA 1R1A2 4A7KA 4YFZA 4OHZA 1PO23 3EBRA 1LTEA 4OHVA 5KXBA 1PGL1 3LEKA 4OUMA 4RQPA 5FZ8A 4UF0B 4XYXA 5ANNA 3SLIA 4ISQA 2JD4A 3AZYA 1R1A3 4XURA 3FHIB 1DZQA 2YY1A 3I3BA 3WHTA 3N9OA 2RS32 2JIJA 2VMIA 2AGSA 4LHNA 5C8CA 4E2SA 4YW3A 4TZDA 4E8CA 4N43C 1RUG3 1W2UA 2WT1A 3RGBA 1GYKA 1VBE2 3H8UA 2OKXA 3VHRA 2I2SA 1H2NA 1Y4WA 1V00A 2R072 2ZGLA 5FBJA 3MI8A 1PX3A 1E5HA 1JODA 2C6SA 2GNTA 4KBBA 1XXNA 4RL7A 2BJSA 1EPZA 1IS3A 4NWWA 3HMYA 1D7PM 2OUJA 4NRQA 3WINE 3HNBM 2XWJB 3OTFA 1RHI2 2V5YA 3OGSA 3ACFA 4CYDA 1OMIA 2GU9A 2Q1FA 4PF5A 4IE4A 4FPKA 1HRV2 5FPLA 3THPA 5BUVA 2CY6A 5FZEA 2Y6LA 2W0XA 4I0AA 3MPPG 4WM8C 1SCRA 5JZGC 1R081 3T2QA 1F8VA 1ZREA 4Q1PA 4YW5A 2DCZA 1UZYA 2AC1A 3FE5A 4CDWB 2D3RA 1K5MC 1DYKA 1YQ2A 2VCAA 2Y34A 4LKFA 4IE6A 1SFPA 3WHUA 4A2UA 3TOJA 2P3JA 1MQTB 3USUA 1CZTA 4Z8BA 5G04L 4BB3A 1AR82 4A4AA 3KF5A 3ZR6A 2VZ3A 5T5JA 1W9WA 4C1XA 4YW2A 5EV7A 1FOD1 2JG8B 1OQDA 5FOBB 2VZUA 4RR3B 2ZMKA 5E16A 4XJUA 2J1UA 4CA9A 4QXHA 4Q27A 3WX5A 1HJFA 3CJXA 4RS5A 1LOEA 4URTA 1GP6A 4AL9A 2IC1A 4LBKA 1NCQC 4FO9A 4CDUB 3VZJA 2WZR3 5L73A 4AE2A 2JB4A 2F4PA 1VBA3 1XE7A 1Q8OA 5F2WA 4BLIA 3M3OA 1JZ2A 1DU3D 3PTRB 4KWLA 3TNPB 4S2FA 3AXDA 3S7IA 4IQPA 3LA3A 4Y5TA 1UU4A 1GANA 1QWRA 3WXPA 3URFA 2E51A 4H3WA 2DBIA 2VQUA 1SCSA 4IDZA 5DQ0A 2ZX3A 3DN7A 4KGQA 4PDWB 3UKTA 4AVTA 4DXTA 5JXHA 2Y0IA 3RWKX 3WR0A 1MZ5A 5JI9A 2W46A 2JDPA 2WKKA 1O5UA 2ENRA 4NPLA 3WDYA 2VVFA 1RUD3 4XUTA 4C1WA 2VCCA 2N7GA 1W6PB 5GLUA 4RHV1 1UOFA 1HB4A 3WW2A 1JYCA 5ABJA 2J1TA 2Z5WA 1RUD2 1VB2A 2W95A 3VBUB 4O7XA 4CDUC 2Q8EA 1UIKA 2DCJA 4UT5A 4TN7A 2OS2A 4BU2A 5L9BA 1FXZA 4QWNA 5FZHA 3O0XA 2G9GA 2DUQA 4CEYC 1R082 4Y22B 3ZX7A 4TWTA 1UQXA 1C4RA 2XBO1 2QBXA 1IHMA 4M3CA 4MGQA 5ABJC 1UY2A 1NQDA 3PUHA 1KGYA 2HBUA 5JLVA 1QEXA 5CADA 2B9UA 4YGBA 3M3QA 3NJVA 4D94A 4XCBA 4BISA 2BOJA 2FHRA 1W9TA 2XJVA 1O8SA 1DLCA 3IIIA 4XDQA 3T0DA 4OCTA 3MPBA 2VZSA 3LSEA 3SQOA 1QU0A 5C3RA 4LNVA 4B4QA 4FPYA 2HWC3 4P9XA 4V1PA 1RXFA 3ZYGA 4QKBA 1I3HA 5JPNB 1DHKB 4B8EA 5L7OC 4P5YA 4OUEA 4CP0A 3L2HA 5F5CA 3WNXA 3BYWA 4YW1A 3SKVA 2JX9A 3MV01 4CUBA 4RYDA 2BVVA 2NPIA 5BPXA 3WDUA 5C6CA 3QACA 4LUMA 1ZRDA 4XW3A 1W2TA 4Q0UA 5FYBA 5KHIA 3QOPA 4I0WB 2DTYA 2VULA 1UZWA 2YBSA 3Q8AA 1W6NB 4Y1ZA 3WEZA 1ASJ3 3LPFA 3MF6A 3H3ZA 1XU1A 2ZX0A 4PQQA 4X6QB 3WDWA 2IWGB 2VZVA 3ZN5A 5J1XA 5FZOA 4Q4X2 1SLBA 2VZRA 3T1LA 4DXZA 1VP6A 2BDRA 2EAKA 2E7TA 3P6BA 1S0CA 4AI3A 5CKNA 3IZOA 1DQ5A 1MEC1 2A6ZA 4M01A 1X33A 3AP9A 4M0HA 1VAKA 2GC2A 2QTWB 3NV3A 3PUQA 3Q8FA 4NWVA 4OYUA 3ETPA 4X8NA 4EZ4A 1IQAA 3AMMA 4QDRA 1LODA 1LHOA 2VQTA 2VU9A 4LOTA 3VBSB 4AGGA 2IXKA 3RMXA 3DKWA 3K4AA 5IVJA 3PU8A 1YIPA 2JDZA 5LRRA 4X6RB 2HWF1 2VZTA 2VJXA 1IG0A 4MH0E 5IK5A 1S4CA 3WP6A 3O1UA 3HQXA 1UOGA 4G3YC 4KWUA 2RS53 2K0GA 4FAHA 2XLFA 4Q0PA 1O3SA 3PVOA 5JMOA 2FZ1A 5FP8A 2B5HA 4Y20B 3S6PA 2RS52 1PGSA 5FXXA 2WIIB 4HL0A 1ZYBA 2WS92 3ILNA 1XNTA 3HAGA 3ITQA 3PUSA 3DYPA 2W3JA 1V9U3 4LBJA 4XFCA 5LZ6A 1OLQA 1Q8QA 2FDGA 4YZ4A 1ZBE1 2BERA 2C24A 2EALA 4D3WA 2YPDA 4FOQA 1MS0A 1V9U2 3OD0A 4GMP3 2E7AA 4LBOA 5KWRA 4BXSV 5F1RA 1BYHA 3ZFEC 3AZVA 1X9TA 1B35C 4GB31 5GZCA 3B9IA 1ODMA 1US3A 2MEV3 5DUUA 5J36A 3IM0A 3THDA 2IUWA 3H3LA 1YJKA 1D2SA 3AKRA 2DTWA 4IESA 4JHZA 4EN7B 3H8RA 2XJUA 3KV4A 2ZGMA 3LZZA 5A7WA 4LHKA 2OUHA 1RC6A 1LR5A 4BYYA 1FPN3 2GP5A 4LEJA 1AYM2 1UIJA 4L9BA 5C9AA 3RPQA 1OPOA 1W9SA 4DO0A 1SLIA 1ZRIA 2B8MA 1PK6A 3GZEA 1OQEA 1FI2A 2H0BA 1PMJX 1GLHA 1OH3A 3KF3A 4N9IA 2W1UA 3OUJA 1W0OA 3WNKA 3QCWA 1XU2A 2RM22 1CAWB 5DG1A 2QUOA 3BTZA 2X53S 2DUPA 2F6BA 4BM8A 2YB7A 2ZGPA 1G9FA 4F8AA 3VD9A 4KNCA 1ENSA 2Y8KA 1BKZA 4D6RA 4B7KA 3VBRC 4I0BA 2VBBA 5FFOC 1JTZX 3H1WA 1V70A 4QHOA 4AQ2A 2BGOA 2D6OX 1B35B 5F3GA 4Z07A 5JMCA 5A3PA 3NL1A 3TN91 1VBC2 5LY2A 4CRQA 4P00B 1NX9A 5EJ1B 2VUCA 1SFYA 1WLTA 2PYTA 3UKVA 4XTMA 1V9U1 1S2KA 1VBC3 4XFHA 1JU3A 4P9YA 1HRI3 1FMD2 1W0PA 3LCPA 5BV6A 4AVCA 4D8MA 3GJAA 4OHXA 3IDEA 2R32A 2XH6A 3VBRA 1NCRA 5F8PA 3DPRC 1LULA 1OLRA 5FZ0A 4XFFA 5A3UA 1WKYA 5LCWL 4AHYA 4JV4A 4K3UA 1BHGA 3SCHA 3N9PA 1CAVA 4Y1UA 4Q8KA 4I09A 3RFRA 2X09A 4QX7A 3OB8A 1OT5A 2VNVA 1NUKA 1DZTA 3T3YA 4NJ4A 2ZCWA 3KCCA 3HQUA 4DMIA 2BPA2 1YFYA 1QH7A 3CF6E 1WLDA 2DU1A 2C5DA 1H6YA 4LBQB 2EIDA 1MS3A 3FFZA 4JZRA 2BYVE 1O5LA 3MO4A 4FPOB 4LO7A 1BBT1 2ID4A 5APAA 4ZY9A 5F5QA 4RR3A 4ZZ5A 1QJX1 2Y26A 1J83A 1F35A 1JYNA 3KHBA 3J7HA 3KVBA 3LF7A 2VM9A 3ZFGC 1MS5A 1G9BA 4AXOA 2C1FA 4AWDA 3HD8B 4ARYA 2D6KA 4MGYE 1COV2 4CUAA 2R16A 2QVSB 2ZGNA 3VBUC 5KBFA 4OQ8A 4XDOA 2LTNA 4QGLA 1PO21 3IT8A 4QPGB 4OVEA 1YQ8A 3VBSA 4EYUA 1AR71 3F2ZA 5CFCC 5LWBA 1UWWA 2X29A 5HV4A 4RA0A 3LAGA 1TMF2 3OPWA 2R043 2WWJA 5KHGA 1S2EA 2A6VA 3N9MA 2UURA 2ZEWA 5GLTA 2YFUA 4QAWA 4NHXA 5JOXA 1TMF3 4BK5A 5C33A 4IW3A 5EJZB 2XL7A 3ZYHA 3VHNA 3O1MA 5FY4A 1NKGA 2ADEA 4BQ4A 4EV0A 1JXNA 2OPKA 1CQ9A 2D5FA 3AZXA 1EAH1 3HPNA 5L9RA 1WW5A 3VBFA 4CUCA 5LB6A 1CESA 4BJ0A 1AR63 3J7NA 4PJYA 5KHJA 1UU6A 2WNUA 2W87A 4IEUA 4H2AA 1VRH2 3ZXFA 2VUAA 1MZ6A 2WL1A 2DFBA 3I2KA 3NAPA 3RNSA 5FWJA 5LBFA 3M3EA 4FAGA 2XKPA 2WZR2 3VL8A 2NP0A 3KM5A 4P08A 1M4WA 2DU0A 5EQUA 4CTEA 1XQNA 3WDVA 2ETEA 4FPEA 3VDBA 3KD4A 4O61A 1PMHX 1QXJA 2JEMA 1ULGA 5DN2A 3ROUA 3A7QA 3USSA 1L7QA 2WWUA 1TME2 4R4ZA 4BHPA 2R0HA 3GHNA 3AP4A 4HN1A 3I3QA 1CAXB 3NAPC 2VL4A 4Z82A 1NE6A 3AVSA 1HXS2 3VDDA 4IEWA 3OUIA 1BQPA 3OYWB 3WT3A 4JVAA 1ND3C 4AFDA 1GOHA 3ST7A 5DG2A 5LK5A 1G9AA 5E8AA 4LHLA 4XILA 2MEV2 4IV3C 4IEQA 1PGW2 3I2DA 3DL3A 4IV1A 4ZS3A 4LULA 5E89A 1PNGA 5FKBA 3ACIA 3M70A 3I59B 2LUWA 2WT0A 4RN5A 4XFAA 5CZKA 5CFDC 2PHTA 1JOPA 2J1VA 2VR4A 2XJSA 4MVTA 5CBLA 2WO1A 1WUVA 1UY0A 5IAXA 3I3MA 3N4MA 2BU9A 3R4SA 4CDXB 4LUKA 1GICA 4D0QA 3ME2A 4YWAA 5GLWA 4Y1YA 2GC0A 4XQDA 4B3NA 2RJ2A 4JGYC 1VPHA 4UW5A 3MIEA 3POYA 4YVSA 3HT2A 2IFWA 1RUI1 4MSVA 5JWPA 3O1RA 5I0DA 1J1LA 1LJ7A 4JCKA 4B4PA 4X8PA 3AYAA 2VMCA 4YLZA 1NCRB 2DVFA 3POSA 4AQSA 4AVSA 4QT6A 2AEYA 4NRMA 4YM2A 4CP9A 4RHV3 1JOJA 4XF3A 5EP9A 3H42B 1XBFA 3UV9A 4DB5A 3FWEA 2XHNA 3MLJA 5CVRA 2VTFA 1T6BX 1HRI1 2UWCA 2RS12 3C7FA 4IXLA 4OLLA 4YM0A 5LA2A 3BKZA 1I9RA 3K77A 3LFIA 3H1MA 2WQZC 4Y33A 1AJKA 2P5BA 1AX0A 2C9AA 2OQ6A 3TAYA 2RS13 1K5MB 4W65A 3I2HA 4PI2A 4FXKB 4W6YA 1Y9GA 5FJKA 4LO6B 5IWFA 2DBNA 5FPAA 1S1AA 2BBAA 1CAWA 3G6JB 3WCSA 1C8M2 1HLCA 2VVEA 4QKDA 4UXAA 4XIKA 5IK4A 4GAZA 4CE8A 2ZPXA 2GSYA 3TRSB 1EPWA 2E31A 5HXMA 2GC3A 3KT7A 2QQUA 3HNMA 3ZOIA 1EY2A 2O14A 5IK7A 1MACA 1XSRA 3FBMA 3AJZA 1XC6A 2XONA 1NA1C 3ALQA 4FQZA 1GQHA 4F7ZA 4S2DA 1JZ6A 4V2VA 1UZ0A 2VOWA 2YGLA 3GYDA 3BTAA 2XOMA 1ZZ9A 2DVDA 3AL6A 4WBBA 1K3IA 2RS31 2ET1A 2B42B 3HWJA 4LO8A 4XIOA 4AI8A 2YC4A 4CCDA 3BB6A 3FZ3A 3WLUA 3NQHA 1V6JA 1VIWB 5A7OA 3B02A 3T4VA 5GKAC 3LDKA 1W90A 5K0UB 2P6CA 1UOJA 4Y5SA 4YGDA 1NA1A 2BFUL 2GH2A 3GZUC 4IV3B 3VGIA 1AR73 2WDBA 1AR92 5M0TA 2J1AA 4A3XA 1OA3A 2WLQA 3I2IA 5BNQA 1YO8A 4KU8A 3ZN6A 1DBNA 5A7SA 3OF1A 5FXVA 1S0BA 4WM7A 5HV0A 5DUVA 1Y9QA 3OGJA 5FY1A 2Q4SA 1F2NA 2HWB1 4RD7A 4M3CE 4QM9A 1GMMA 4W50A 3O12A 5FTTC 3B3QE 4WVVA 1UL9A 4AAXA 1JYWA 1XRUA 2Y60A 4RGAA 4XFGA 5FPZA 2P34A 4NN0A 2E26A 4O65A 3SXWA 2JDNA 4HXCA 1AR81 1DQ4A 2PQSA 4R9DA 5C9AC 4JHTA 1LGNA 3LFMA 5J7MA 4CXYA 1J59A 1ENXA 1F4HA 1W8TA 3BIEA 1DGRA 5C7GA 1DGLA 2LROA 1B09A 2Y64A 4EROA 3U4SA 3V56A 3R0RA 3VZNA 5GZGA 2KD7A 2Q1MA 1TZOA 5F2SA 2QQVA 4KI5M 3T2OA 4F3JA 1AL23 3JQWA 1DG6A 1LEMA 3LEIA 1YFWA 1UY3A 2CAUA 5A3OA 5JOZA 1OPMA 4Q4X1 1O4TA 3EQEA 5IHRA 1OD3A 1VRH1 3ZM8A 2ZA9A 2FD8A 4PIZA 5GLZA 2XVKA 4LPLA 2NZ9A 3IDBB 4FPGA 2QCSB 4YVWC 3I3EA 3LD8A 3OOXA 2D6PA 3H7JA 2HWD1 1GUIA 3HR9A 1D4M2 4XTPA 1PO12 3ABZA 4QB2A 2CDPA 3KSCA 5F7UA 2QQPA 3GDBA 4IE5A 3T2TA 3U78A 2YMZA 4AK3A 2ORXA 3PMSA 5D2AA 2XLGA 1V6LA 5CAZA 3B9CA 3PUAA 3B94A 4OZXA 1GR3A 4Q4V1 4LBMA 3ZDVA 4CUGA 4XUNA 5CISA 2ES3A 3VBHC 1YUDA 5FMOL 3ACGA 4KWJA 1IZ3A 4B1LA 4DQAA 3N36A 1ND2B 2NN8A 2RHPA 3G7DA 2W47A 3I8TA 4EWEA 1ASJ1 2ILMA 1J58A 1UW8A 2Y6FA 2HWD2 1VB4A 3HN1A 3KZ4C 4Q0SA 4MADA 1UKGA 3AMNA 4NIDA 3WDXA 1BLZA 2HWE1 3J8F1 5DDJ3 2LS6A 2EAAA 2W91A 4P9WA 2BQPA 2ZMNA 4IV3A 4NIGA 1MS9A 2J1EA 3E5QA 2TNFA 4RFRB 4AEDA 2D6LX 1DCSA 5CKQA 4DUVA 2D98A 2R7EB 3VBHB 1FV3A 3C7GA 3ZFGA 4COYA 3RZLA 2XXZA 4BDVB 2CU5A 1A8DA 1ONAA 1RITA 1MPXA 4MUVA 2VXRA 2R062 1JI6A 2VXJA 1X50A 4BLJA 4E9KA 5ACA3 2YG0A 1GV9A 5IAVA 1W2NA 5HCAA 2R063 4RHV2 3D5OA 4XJAA 2XJRA 3SCFA 1NXD1 4YG0A 5C3PA 1JYXA 4JRLA 4L0PA 4M00A 4XACA 2IXCA 2YC0A 2ZX1A 2XR4A 3OBRA 2PTMA 2W5FA 4QDSA 3RI9A 3RJ2X 3A0KA 1IS4A 1ULEA 4QPYA 2L9LA 2W1WA 1AL0G 1WCSA 1W2OA 2HWC2 2WNOA 3M2MA 1QQP3 4YG3A 3S5AA 2A6WA 2KXLA 4HT1T 1WD4A 2GMMA 5FPBA 5LBCA 2Q1ZB 2EXJA 1RMU3 1K5JA 1QXPA 4LOSA 1DQ0A 1DP0A 1YLLA 2IXLA 4I3GA 4GD4A 2BP6A 5FP7A 3LPGA 1AXKA 1BEV3 2D6NA 4XF9A 5F37A 5AFBA 3HEIA 5FYMA 1QJX3 1F31A 3VKFC 4AQTA 4YARA 1POV0 1MS8A 3AL5A 3I2FA 3ZSEA 4XBNA 4AG4A 3CNAA 1W8HA 4FBFA 1O4YA 1HIXA 4HZFA 1CAUA 5C3SA 2RV9A 3FHAA 5A80A 1PIV3 3WQ1A 2EXKA 3N7MA 4BK4A 5FXWA 4QD2A 4YW7A 4RR3C 2WN2A 3M4FA 1GZWA 3WG1A 3U37A 2XQXA 3K4DA 1GZCA 4GQ7A 2VC9A 5JCTA 3I7DA 1BEV1 3WV6A 1VMHA 2PFWA 3Q8CA 4YZ3A 4CEWC 4MHUA 2CL2A 2Z4FA 4BQ5A 3LE0A 4QPIC 5A1AA 4MGTA 2QQKA 3K46A 2B4KA 3JD72 4R4XA 4HOOA 5FOJB 4I2OA 4FPFA 4GH4B 1UU5A 5HCHA 3S7EA 1VAMA 1UYXA 1RJ7A 5BNPA 3VDDC 1UPIA 3C7EA 4NAMA 4Q0QA 1FNYA 4XUOA 4OMCA 1TME3 4AGRA 3IDAA 3ZSKA 5KC6A 5FYIA 1KDKA 5CFDB 1OOPA 4L2NA 4IEVA 3RZKA 3CJIA 4NHMA 5GALA 3ZPYA 3PVEA 2JB8A 4R9BA 3KT4A 1IPJA 3GF6A 3LIGA 1JYIA 5A33A 1LHWA 1O4ZA 2LRPA 4QXKA 3NJZA 1OKOA 2DWRA 4ES9A 1PVC2 3IPVB 3OPZA 2JDYA 2JENA 1RVF1 1OVPA 1VBB3 1VMFA 1Y9MA 2CYFA 3ZN4A 1FX5A 1ZZBA 2JDAA 1EP0A 5FWEA 2W39A 1LOAA 1QJEA 3VBSC 3DCQA 3AYCA 2Q30A 2QDNA 2VBPA 2C0ZA 4XJWA 4BMBA 3VDCA 3FLRA 4I02A 2RE9A 3KCXA 3D6EA 4J25A 4XJZA 4XFIA 3SCGA 3ACLA 4D6SA 4R8HA 4FPLA 1JHNA 2X8KA 3RZGA 1WBFA 2FMYA 3NVCA 3PL0A 2VMDA 3MDPA 4FPCA 5BNOA 1NZIA 1OOPC 4YVSC 1VBB1 5KXCA 2GNMA 1LAJA 4SLIA 2ET7A 2ZGTA 3WF0A 3POEA 3AKSA 2WFF3 2YDEA 2SBAA 1O91A 4ATFA 1KJLA 5CNAA 4BA6A 3KT1A 3DYOA 1N47A 4ARXA 3OYWA 3AXEA 3BN6A 5EZWA 3D0JA 1S0EA 3RI8A 3WQ7A 4BZ4A 4QHBA 3W9AA 2CNAA 3CDZB 4A45A 4WVMB 5I8TA 2YU1A 3WP5A 5CA6A 1HN1A 1XYPA 1MQTC 2ZAAA 3DPRB 1Y43B 4FXGB 4R52A 2VUJA 2ZABA 2ZOEB 4WM8B 3DXTA 2ARBA 2D3PA 1PM7A 2GALA 1C8M3 1L7RA 4N8MA 4XE9A 2Y6GA 2ZAHA 1HJGA 1LOFC 1DQ2A 1O7FA 1Q43A 4BIFA 1EAH3 3SC7X 5BNOC 1PGL2 3CKHA 4QQHA 1D0GA 5FYVA 3RG0A 4CCNA 1PM4A 2VOTA 5FDBA 1IPKA 3ZYJB 5LBEA 1X8EA 1N1VA 3MW3A 4QXCA 4Q4X3 2VOKA 3E6BA 4RSUA 1OXCA 1S0IA 3CU7A 2JG9A 5ACA1 4JAAA 3PURA 2A6YA 3BGAA 5J48A 3CO2A 2Z42A 1RVF2 4QPGC 1NT0A 1NCQA 1U5YA 4UOJA 1I5PA 4R9AA 3IAPA 3KV9A 1ALYA 4CU7A 1QIQA 1KRIA 1ENRA 3GCXA 3AFKA 2E33A 4XMAA 4JGZB 2JE9A 1GZ9A 3MICA 5DMYA 1VBD3 3AFGA 3BTXA 1O3TA 5FR3A 1WCKA 2OX0A 1IKQA 2PLV3 2WC2A 5AC93 2AREA 3RVHA 5BYNA 1I5ZA 5JAXA 1RMU1 2PELA 1YC61 2J1SA 5F3IA 3FLPA 1F15A 2V4VA 1QJU3 5IFTA 2BWCA 2RDQA 4Q26A 4XBLA 3AZZA 3AP6A 1GWLA 1XOYA 2WS93 2P3YA 5F3EA 1U5XA 4OI4A 3UESA 2D3SA 3RYPA 4CDUA 5IUQA 5D8AA 2PHDA 4AVBA 4UFHA 2BUKA 3RZZA 3SHRA 4MGSA 1QJY1 2XHKA 3T4HB 3U1XA 3ZIXA 2A73B 3ZFFC 3VZKA 3E6DA 3M7AA 1BEV2 4AHXA 2CWSA 5CEHA 3BVCA 2A3XA 4M4PA 1TQ5A 1QJX2 1QOOA 5DAPA 1ULDA 5FJHA 1UYZA 5FZGA 4XOGA 5KHKA 4OI0A 2YZ4A 4UFIA 4UWDA 2ZGSA 2FZ2A 4K6BA 4XEZA 3C7OA 2HLEA 1YRZA 1D4VB 1SLTA 2RMU3 3OD4A 4MXWB 4XVHA 5IW0A 1RGSA 2XMLA 3I2OA 1ZBE3 4DUWA 1W6OA 3MFAA 2E6VA 4WZFA 4E4DX 2P37A 4Q4Y3 4WM8A 1CAVB 3ZYFA 3PLQA 1DQ1A 2WJSA 1YI9A 3BU7A 4GKYA 3TN92 1J3PA 1EUTA 1CX4A 3NV4A 3RQ0A 4HPKA 3IPVA 4KQ7A 3NSTA 3V0BB 3VD5A 1RUI3 1ULPA 1YCIA 4ITCA 1WA4A 2KM2A 1RJ8A 2JDUA 1SACA 1CAUB 3RZMA 4DFSA 1YEWA 4NO4A 3E5UA 3JCIA 5F6KA 3T0AA 4LA3A 1AYN2 4QX8A 2P2KA 3ILRA 4DEVA 2J22A 4QB6A 3GXUA 5IVBA 1WWYA 2PHRA 5DAXA 1OBNA 1TNFA 2DF7A 2GN7A 2JKXA 5DZEA 2OW4A 4DNYA 4Y22A 2QE3A 3VZLA 1AX1A 4YPJA 2QQJA 1PX4A 1TVGA 3A21A 3P3NA 4LIVA 2W9XA 4WV8A 4J6GA 5A7QA 3WG3A 5F39A 4CEYA 2X5IB 1WMDA 3ZYIB 2BNMA 3H1YA 3NKGA 3WD5A 5BNPB 4DZGA 3A23A 2P4EA 4CCJA 4HVOA 2IVIB 1GFF2 3NNJA 4BQ2A 3ZXEA 4DUXA 2NMOA 1LHNA 2JDKA 2VMEA 3WNMA 2OZJA 2R49A 2WWSA 3DECA 4LKEA 4IETA 3MFCA 3CL1A 1F5FA 4M4RA 3LSDA 5ANQA 1NCRC 4GB33 4XXPA 2XVGA 1JYVA 4FPHA 1YQCA 2VD7A 4ASKA 1JMUB 2VZQA 2ZEXA 2XUMA 1R083 2QKDA 4INDA 3PIJA 2O1QA 2CGNA 1RUE1 1UX7A 5JOYA 3DYMA 1VBE3 2WSVA 4UAPA 5A3LA 1AF9A 2RJKA 5F6LB 3WW1A 3WF4A 5T52A 1HQWA 4QGNA 1R091 5JOWA 2VY0A 4LLOA 4U2AA 4UFJA 1Y3TA 3O5SA 5GM0A 3H0OA 3U14A 3IAQA 3MYXA 3D4KA 2TEPA 1ZBA1 1U12A 4YZ2A 2R1BA 4IEXA 3ZYBA 1O59A 2ZTNA 3LA2A 5C4WB 1NZCA 3ZXJA 4G9SB 4XJ9A 3ZFEA 3WP3A 2DV9A 1LENA 1SQ4A 1KDMA 2VW2A 1TG7A 2XBO3 3F95A 4XDPA 4QKNA 1BVVA 1E5RA 3CMGA 1ENQA 1RHI3 1N1YA 1X8MA 3ZXLA 1DGWA 2VNRA 4M0NA 1QGLA 4PBPA 4OMDA 1W39A 5AVPA 2EIBA 4Q2FA 1V6IA 1H2KA 2YUEA 1A8MA 3H3UA 1LRHA 3BCWA 2FMDA 4HKLA 4ONUA 1AUYA 3VBHA 1XB9A 4I01A 4OI2A 2QZ3A 4UW3A 1W8NA 4S2GA 5J37A 5EXOA 1W6MA 1IKPA 5FZ6A 1ASJ2 1NAEA 5JDBA 5C4WC 1ZZ6A 2Y6HA 4TSVA 1HW5A 1W6NA 5A1LA 1AR62 4PQ9A 1NG0A 4WM7C 5T55A 2UWBA 4QPIB 1RIRA 3KWVA 5FLIA 4KWKA 5FMBA 2WAOA 3N7KA 5FZOB 3U11A 3O14A 3WG2A 5FZBA 2DDUA 1PZ7A 3GALA 4LK6A 2GDFA 2QNKA 4XCAA 1YJLA 1EV12 4AVVA 4HSLA 2HWB2 1ZA4A 2WA3A 4NOTA 3ZSJA 4LKDA 5G05L 5IFPA 2AR6A 2WO3A 3ZKYA 3WOGA 4KH9A 1UY1A 4LA2A 2XJTA 4UFMA 3THCA 4FFFA 5I0RA 4LORA 1AR61 2CHHA 2Q8DA 2WZ8A 4UF0A 4N7UA 2WYFA 1UMZA 3AKTA 5A33B 3MEPA 1REDA 2VECA 1WW4A 3SEPA 3CQOA 4EZHA 4CDWC 4WVMA 5GZFA 1H2LA 1HDKA 4FTEA 2DYCA 1IPSA 3QH7A 2XB6C 3JQXA 2BV4A 4P9IA 4CU6A 4GXLA 4LXLA 4BQWA 2FDFA 3HIFA 3UGHA 1C5IA 1O6UA 1RUD1 4AI9A 1RUF2 4OFGA 1H8TC 5KR7A 4CEWA 5FUNA 4URAA 2VQ0A 2Q0AA 2Q8OA 1DF0A 4XQ4A 2WNVC 2BGPA 2ZGRA 4W8JA 3WVJA 5A6XA 3LWCA 4PDWA 1O3RA 1CJDA 2WA4A 2WUHA 4YM1A 5EWSA 2VZOA 1W6QA 5AC91 3ORJA 5IVYA 2EIEA 1WD3A 2J1RA 2WO2A 5GZDA 4CCKA 1OURA 4Q4W3 5HI0A 4QX0A 4CP9B 4F83A 3WG4A 1AHSA 5BNOB 1VAVA 5F3CA 1YI7A 1BBT3 5B4NA 1FAYA 2G9ZA 5A70A 1S0FA 5AFEA 4IUGA 4XAEA 5DPNA 2B46X 2OZ6A 2VQAA 3ZIWA 1ZBA3 1CPNA 4E4ZA 1QQP1 2RM23 2R1DA 3AZWA 1AYN1 3H7YA 4QPWA 4JQTA 1STMA 1YFUA 2G19A 1RL3A 3JD71 1RYYA 3FUOA 4LK7A 1KQRA 3FFQA 3ZSLA 4COZA 1V0AA 3O0VA 3U0ZA 1QNYA 2FCUA 4CXXA 5FP4A 5JZGA 5HCFA 3O1TA 3I49A 3AVRA 2BVBA 3O1VA 2FDJA 1Y7BA 3EMRA 4A42A 1FMD1 1DGWX 1NY72 4JTNA 1X36A 2WFPA 2OT7A 4ISRA 4LO4B 4JKMA 3VBFC 3PTYA 4CDQB 3UKNA 3POFA 2V72A 1ZX5A 1QKQA 1RXGA 3W21A 1QF3A 4QKFA 5FZFA 4YW6A 3UJQA 2X10A 1FOD2 3AKQA 1RUJ3 3P1IA 1H2MA 2J7MA 1GQPA 3LGRA 2Y6JA 4AFMA 4AFBA 4Q29A 4ZU7A 1R093 2QQLA 4YVWB 2D44A 1PGW1 4LO5B 5BY5A 4L97A 3N3HA 4META 4COVA 3ZXDA 4DXSA 4LITA 2VH9A 4N53A 1KS5A 4YGCA 1HKDA 5FZ3A 5F5AA 3IBMA 2FCVA 2RG4A 2WQ4A 1RUG1 4LKSA 1VRBA 2H0VA 1LB2A 2R071 3H8OA 3RYRA 3V0AA 4B1MA 1OLME 3ZN6B 4GZ9A 1PHMA 1LGBA 3RWNA 1AR93 2O8OA 4S2HA 1LEDA 1ZZ8A 3FC0A 4JKLA 2RR11 2VBDA 3LIHA 5J09A 1OF4A 3N9LA 4GWNA 2QZ2A 4CP2A 1W8ZA 5EJ3A 3ZVXA 3INAA 4NROA 4EN9B 4CVUA 1DYPA 2H6CA 2IVJA 3VBFB 1YNAA 5E6HA 3AC0A 4GWJA 1APNA 3BPSA 1GNZA 3PU3A 4AI2A 3RZHA 3M8LA 3K3OA 3WCRA 2YYOA 4AAPA 2DCYA 1CIYA 2XJQA 4QMAA 1GP4A 1BZWA 1GP5A 1NQJA 3GJBA 3UGGA 3WDTA 1W8FA 5FAXA 3VLBB 3K75B 2PA7A 4LBQD 1W3VA 4W4ZA 1QDOA 2CAVA 3GZAA 4FI9A 4A6OA 5L7OB 4XBQA 4Z2AA 1OSGA 2RS11 1K45A 1A6CA 2MHFA 1AYM3 1N3PA 5FZIA 1SLLA 2MEV1 1J3RA 1RUH1 3NW4A 2ZGOA 1KJRA 2QQOA 5KXDA 1RUE3 1UYPA 2PXJA 3AK0A 4XHBA 3EB7A 3OJBA 3ZXGA 1AR83 1F5JA 1PIV2 4HK9A 5C8CC 5FPXA 1GWKA 3J9SA 4QQOA 4N43A 2A70A 2C4XA 3I59A 1JW6A 5A6QA 1AZDA 3KB5A 2VCBA 1N3QA 3EYPA 4CU9A 1NLRA 4AEDB 1QJY3 1J1TA 2VTXA 1I6XA 4HVRA 2FCTA 5AVAA 4Y1XA 4NMIA 3O0WA 1Z7S2 4QXBA 4C90A 2PAKA 4LMFA 2XQRA 5LATA 1JU4A 1JZ8A 3I2GA 4NHKA 5JXIA 5FBZA 4Q8LA 2HEYF 4IV1B 2ATFA 3WF1A 1POV1 4RGGA 2WNEA 4MGIE 3OY8B 4YW4A 4BCUA 1ZRFA 4LE4A 2AACA 1WMEA 5FO8B 1IG3A 2LM3A 3MIDA 2BGCA 4MLOA 1GOGA 4Q0VA 3OG2A 2B45X 4ASLA 5LEJA 2YV8A 4JDOA 3T08A 3WP4A 2B39A 3PDQA 3SITA 3U07A 4COWA 2GNDA 3MUZ1 4XZPA 4GALA 4LQRA 3SH5A 3VZOA 3ZPOA 1MR5A 5GJ6A 5FP3A 1Q8PA 5FY5A 3ZLIA 4BPZA 4CCMA 1G86A 3T09A 2CSGA 4C0BA 5F9TA 3BUCA 2D97A 4B29A 2HWD3 4H55A 3C3VA 3NNFA 5JVVA 4A3ZA 1H1IA 5H9RA 4NUBA 4XXAA 4DXRA 1JH5A 2XPJA 3Q9OA 2CGPA 1XYNA 2IFRA 1RUJ1 3KV5A 1B35A 1PO22 3VBOB 1OA2A 1QH6A 1JBCA 4YZ5A 5FY7A 3NNGA 3P5BA 4FQ4A 3SEEA 5FIXA 1LHVA 3OY8A 1GBGA 2OYZA 2XDVA 2OXBA 3SISA 2VGDA 1W9FA 3MUY1 2JG9B 2RS33 5C5UA 3OCPA 2F4LA 5ABJB 2ZEYA 3CIHA 1PMIA 4KBZA 4JDMA 3J7MA 2BBVA 4CCEA 5D8AC 1UF2C 1EYBA 2EVXA 3GBGA 1OF3A 4XAAA 3MZHA 3LEGA 4PF1A 3KQRA 3LKJA 3WW3A 2WFF2 5GZEA 2ZJCA 5C5TA 3CJIC 2X5IA 2GMPA 4AGVA 2W94A 2WYSA 4M3CB 5IYYA 2B9VA 4FFHA 2R042 5D21A 3I2JA 3NJXA 4QX5A 5EHDA 5A7WB 4AI1A 4YFWA 4AFAA 1V6MA 3WQBA 2K2SA 4MZUA 5A7NA 2WLPA 5FMDA 3CZJA 5FY8A 1Q8VA 4BIOA 3NJYA 3NV1A 3VL9A 1GZTA 3L2YA 4YVWA 1YWKA 4ES8A 2ZX4A 1LOBA 4GJYA 1TEIA 5J96B 3ES1A 4IGPA 1AYM1 1RUC1 4ZXEA 2MNGA 1UXZA 2E53A 2VUDA 1VBA1 1JHJA 1F9KA 4HFSA 3ZO0B 4LR4A 2C9KA 1W2AX 2WFF1 3CLPA 2KR2A 3VD3A 1AR91 5FKCA 3M3CA 1MZFA 1PZ9A 2BOIA 2IXIA 4NPMA 4W6XA 4R9CA 4CDQA 3RZJA 2YROA 4MGKE 4C0HA 2RM21 2O0OA 2D40A 5FV3A 2DFCA 2AEZA 1CIWA 1VRH3 2PN5A 4XC9A 1GU3A 4P9GA 2ZEZA 3FBYA 3R05A 4XF0A 3ZYRA 4CXWA 1W03A 1SPPB 2B7YA 3VN4A 1U0AA 4LTAA 4XUPA 3A0NA 1CN1A 1TNRA 5CU1A 3OEBA 3V65A 4QDQA 2Q8CA 1U5IA 1XPWA 1S0GA 4EWAA 1HQLA 5IJRA 3HOBA 5JR7B 3VKNA 1LESA 5IATA 5BNNA 1JZ5A 3PNAA 4FFGA 1HV0A 5IVFA 4IEZA 4IEPA 4L99A 1K42A 2W1SA 1V6OA 1XE8A 1GOFA 2YC2A 2VMHA 3Q8BA 4LBQA 5GLVA 2GC1A 1YIFA 1WA6X 4NVPA 2XJPA 4YZ1A 4CPBD 3IN9A 5FYUA 5LRSA 1HXS3 4RGKA 4NIIA 5JZGB 1KXGA 1S55A 3BALA 5I91A 2I45A 2OQ7A 2XG3A 3POGA 1HB3A 1QOSA 1RUF3 1SG3A 2AH2A 2ZHMA 4HONA 5CFCB 3VD4A 3E6CC 2VO5A 3EJKA 1H9PA 5JXGA 4CP1A 1UXXX 1HRV1 5FMCA 3X29B 1GZWB 3VHPA 2YXSA 1D2QA 3ZMNA 1C8NA 2PLV1 5A7PA 1JUIA 1EUUA 1SPPA 3VHOA 1IS6A 2W52A 2A6XA 3WNNA 2NM1A 3DGTA 1GNYA 1HXS1 2Y6KA 4M3CF 1NYWA 1VBE1 1BJQA 4DRRA 5C71A 4K1YA 5LEKA 2QDRA 2SLIA 2QQMA 2WS91 3AB0A 1Q3EA 3W5NA 3ILFA 3W58A 1QOTA 1W6OB 2XKOA 5LBBA 3VDDB 1QHDA 1V6KA 1Z7S3 4DPNA 2ZXQA 1RUI2 4XF1A 3NNMA 4QX2A 2R061 1VR3A 4NR1A 4XMIA 4N9HA 3VZMA 5DUWA 1XNDA 4P9LA 1V6NA 2PHWA 4D7YA 4JX0A 2Y38A
chains in the Genus database with same CATH topology
4P5HA 4L92A 5HBAA 3PJQA 3KLSA 3QLQA 4Y20A 3KCYA 2JG8C 3VBOC 5EFUA 5A3MA 2JXAA 4E27A 3ELNA 3SH4A 4AYUA 3PVBB 4QPIA 4EJRA 3VBUA 5FREA 2Q5TA 1C57A 5JSOA 1O3QA 4HKOA 2X5IC 5FLJA 3THTA 1AXZA 1ZRRA 4MX3A 1ND2C 3EHKA 1RUC3 1WMFA 1C28A 1EAH2 4ZXKA 4FPJA 4ORFA 3TB0A 5BXXA 3ZFFA 1LGCA 1FNZA 3I4IA 3AM2A 5H9SA 4YGEA 3W59A 3JB4C 3RMYA 1R092 4IERA 2ZGKA 1SLAA 3EO6A 5T50A 3MIBA 1RVF3 5CFDA 3OBTA 2A75A 1CVNA 3RJRA 2FBEA 4N90A 3POWA 3RS6A 2JICA 1AR72 3IWZA 4KG8A 4H7LA 4K20A 3R4UA 4GA9A 4UBGA 2UY9A 4LE3A 5JIUA 1DIWA 2DVGA 2ZZJA 1JUHA 5BNNC 3P3PA 4XHXA 4FTSA 1KD7A 1QJU2 5K9YA 1QNWA 4JRAA 2A3WA 1M06G 2ZHKA 1LCLA 5C4WA 1N1TA 2YPJA 1L3JA 1HQNA 2XGXA 1KITA 3RRDA 3MW4A 1UAIA 4IL7A 3CJIB 4D69A 3VKLA 1OA4A 5L7OA 3B93A 1C1FA 4Z1VA 3NV2A 1FPN2 2HEWF 2E63A 1ZVFA 5E1RA 1OOPB 4CEWB 4WM7B 4QGMA 4Q4Y2 2NMNA 4K21A 4PLNA 4DOUA 4RS5C 1D4M3 2VW1A 4LT5A 2VNGA 2PHUA 1RHI1 1HX6A 3TYJA 2LALA 3JD73 1UD1A 2BWAA 1ULCA 2Z2SB 3DF0A 3D0SA 1H0BA 1NY71 1XYOA 1Z0HA 2PAEA 5E88A 3WUDA 1REEA 2A7AA 5FO7B 2QFEA 4Q4Y1 2PQQA 4Y4YA 1RUF1 3MW2A 4MXVA 4Y1VA 1XNCA 2R0FA 3VBRB 5L36A 1UN1A 2P17A 4Q4V3 1H8TB 2WSUA 2ZGUA 2GH8A 3FUQA 4MYEA 5K0UA 5LK7B 2WT2A 3N4MA 1QMJA 4LBNA 1BCXA 3ZYPA 2P3IA 1FV2A 1SEFA 1PZ8A 2OA2A 4EWDA 3JBG1 4KL1A 3PVNA 1PK6B 1S2BA 2DCKA 5J3UA 2OVUA 3DUIA 5DDJ1 3IIAA 1CR7A 2JKBA 4QQLA 4J1WA 5SV8A 4YRDA 2HWC1 4PLOA 2V09A 2CTVA 2AUYA 1DGRN 4QQ2A 4HK8A 2IZWA 4D7SA 3QD6A 4BMEA 2RR13 1COV3 3KGZA 5KC5A 4HVQA 3KGLA 2EXHA 2KA3A 2R073 4HANA 2CV6A 1QY4A 1AX2A 3GBFA 3MF9A 5T54A 5T5OA 2WNVB 1X82A 4MXWA 5I8SA 4ASMB 5BNPC 3D8CA 5T5LA 1Q56A 3R4DB 4YNIA 4EN8B 2G4IA 4P9JA 1WBLA 4Y5Z0 4BE3A 2WZR1 1ND3B 4ZU5A 3RYKA 2GNBA 1VLNA 1GQGA 3ZSMA 1VJ2A 1PVXA 2VPVA 1MEC3 3VV1A 5IT6A 4N43B 4JQRA 1H8VA 3JBG3 2P3KA 4Y24A 5CG9A 3IDCB 1WW7A 2RS51 3MLKA 3U10A 2RMU1 4D7TA 1RUJ2 5EYYA 2EF6A 3WZ1A 3HBZA 2ERFA 3AP5A 3J26N 2UYAA 4GKXA 3UJOA 5HXVA 3ECQA 2WNVA 2PAMA 3AYDA 1WLCA 1POV3 3O7OA 3ENRA 4CDQC 3BPZA 3WQ0A 1R1A1 3LB9A 2DVAA 2Z69A 1CAXA 4EN0A 1T6GC 4QQPA 3H50A 3E5XA 4K40A 4G4FA 2PLV2 5DUXA 1UCXA 3AKPA 1COV1 5SV5A 4PIXA 5C8CB 4FOVA 2FQPA 4AHWA 1H4HA 1RTVA 3T1MA 1DDLA 3QH6A 4J1XA 1OKQA 3B69A 2VVDA 4FP2A 4FSJA 1URXA 1YXWA 3OGGA 1BK1A 2Z79A 5CIRA 3JU9A 5FQ0A 3VKOA 1QJZA 2A5ZA 3B00A 4K9SA 4L8QA 3V0BA 1SLCA 4XETA 1PVC3 4PBOA 2MPFA 4OI1A 4PLMA 1OD5A 3C2UA 4PDWC 3HT1A 2UWAA 2ZHNA 3UL2A 4AVAA 4AW7A 1OQ1A 1RUE2 1H9WA 5C8WA 1AL22 4CEYB 1H8TA 1J3QA 1G8WA 4B7EA 4KGGA 5I0SA 4JDNA 4JGZC 4Q4W2 1PVC1 5BNNB 4BH9A 4JTOA 3GZTB 4A7YA 3V0AB 3S0MA 4XQWA 1UPSA 1NOVA 4AQ6A 3AMPA 4GH4C 1XNKA 2VW0A 1C5HA 3NWKA 4BOWA 3BOPA 2G9FA 3IMNA 1WLWA 3NKTA 1ZBA2 4HPKB 3AJYA 5FO9B 4BWOA 3VUOA 1C1LA 3JB8A 1MS4A 1U5ZA 4RS5B 1VBC1 2IXHA 3MIHA 1RB8G 2K9ZA 2AENA 4ATEA 5K8SA 1G9DA 1DFQA 1CONA 1SFNA 1ZNPA 2UY8A 1MZEA 2JG8A 4GIQA 1LECA 3V64A 2WNUC 5I8YA 1HRI2 3ZFEB 1RUC2 1SDWA 3ZDSA 3MIGA 5KXEA 1C8M1 2ARXA 2UYBA 4AEMA 3ZMOA 5I93A 1BMV1 2XLAA 1E57A 3PHMA 4SBVA 4EN6B 4RQPC 4IEYA 2TBVA 4COUA 4E4SA 2HKXA 2QJVA 1H30A 3GNEA 4OHWA 4AF9A 4GB32 1VBD2 2NQYA 3H9AA 3IKWA 4Q1RA 3BODA 5AC92 3FJSA 1FT9A 5A32A 1OHFA 4O9GA 2GN3A 5H9QA 3GBWA 5D1IA 4GMP0 3M3IA 2O8QA 4FP3A 4HBNA 3U4XA 3RSJA 3E97A 4PIYA 4Q4W1 1FPN1 4CDXA 5ACA2 1LU2A 3PMEA 1QQP2 2DCTA 4FOWA 4Z2WA 1WGPA 1RUOA 4HSJA 3D82A 1CGPA 5K7PA 4OULA 4I3PA 1NCQB 1MVEA 4YM3A 1SBFA 2ZGQA 2VOVA 3AYEA 3FX3A 1HRV3 5JPMB 4JC1A 2HEVF 2VG9A 1RMU2 2RMU2 1MEC2 2JJ6A 1HV1A 4IEOA 5JSPA 3S30A 4NHLA 4P14A 3VBOA 5C9AB 1MVQA 3SH3A 4N53C 3I54A 3JUUA 3N7JA 1IGOA 3TN93 3DPRA 1EV11 1SBDA 5D8AB 1CJPA 1REFA 2HYKA 5FQ0B 1GKBA 4B4RA 4XF4A 1W6MB 3KMHA 2JG9C 4YVSB 3N35A 2ZX2A 2EA7A 4JGYB 3R6SA 3MLLA 3QBQA 1KFXL 1N3OA 1PO13 1ZZCA 1RUH3 2HWE3 1OFNA 1Z7S1 2H6BA 3J8F3 1EV13 1S0JA 3ASIA 2HWF3 1LOGA 4UW4A 5K0UC 2D43A 5DZGA 1RUH2 1AJOA 2BEOA 1ND2A 1UKRA 1AYN3 5T5PA 3APBA 3AP7A 1IS5A 5DZFA 1PNFA 1MS1A 5JI7A 5KHHA 4Q4V2 4YSFA 2YHJA 5FRAA 1GNHA 2BNOA 1UZZA 5H9PA 5T3NA 1FMD3 3WUCA 2PHXA 3ES4A 1QDCA 2UU8A 2BTVC 4U36A 4UW6A 4NPRA 3LOBA 4GMP1 1ND3A 1NE4A 5A32B 3CEWA 4JGYA 5FMOS 1WW6A 4L11A 4WVWA 3TNQA 1BMV2 4E2GA 2BFUS 1ZZ7A 3B7MA 1VBB2 4HLTA 3TBDA 4K8FA 1A78A 3N7LA 4DS0A 3LOIA 1ZRCA 3SNMA 5DXDA 3BOWA 1TMF1 5CG8A 4QM8A 5J98B 2RR12 4OHYA 2DVBA 2IXJA 4HKWA 2JE7A 1D0HA 1S0DA 3A4UA 2EXIA 1CPMA 4FCAA 3K48A 1BBT2 1RUG2 4HN0A 3K51A 1G6NA 2I07B 2XBO2 1DLLA 4K1ZA 4CZSA 2OIIA 1OFSA 4N53B 1NLSA 1PK6C 2ZMLA 2D6MA 3PJYA 1VALA 3NO8A 4FT8A 2Y0OA 4XFBA 3TWIA 2PHLA 1A3KA 1AXYA 3ATGA 4XJ8A 4Y26A 2EIGA 1IOAA 2RJLA 4GWMA 2R30A 2WINB 1LU1A 5I0UA 2BW8A 1LKNA 1X7NA 2CWMA 1I1EA 1Q8SA 2YGMA 3JBG2 4W6WA 4YYOA 1AL21 2NLRA 3ZFGB 3AX4A 4ZU4A 4AFCA 4FTBA 5CFCA 4IV1C 3GHMA 4UBHA 3KS7A 3J4UH 4YG6A 1RUNA 2DUOA 1XNBA 1FATA 2NYYA 2AYHA 4GH4A 4WZCA 4AEJA 1YFXA 1LOFA 1AVBA 4H14A 1VBD1 2VOXA 1NA1B 1YHFA 3AMHA 4PCRA 4N7IA 5JSRA 1LOCA 1KS4A 4CDWA 4AEDC 2GMEA 4QU2A 1JN2P 1NXMA 3B5LB 2XVLA 1N1SA 1KFUL 4H7MA 1QJU1 1MQTA 4RQPB 4MV2A 1W6PA 2A71A 3USUB 2HWB3 3EXUA 4Z92B 4LBLA 1VBA2 3MIFA 1ZM1A 2ZBJA 4DINB 3AMQA 4TYSA 5FLHA 1LHUA 5HCBA 1BVP1 2TUNA 2ZHLA 2ZKNA 1H1AA 1TE1B 2JECA 2W68A 2VNOA 4DRVA 3WW4A 1DZRA 2WZPP 4TLFA 1K5MA 4DY5A 3ETQA 1W6QB 1YYNA 1G7YA 2VMGA 2R041 3ZXKA 4KG0A 4FOYA 4LLFA 1H4GA 2ZZQA 3FMGA 3DV8A 4MGZE 1WCDJ 1ZBE2 4BQ1A 4ZKTB 1CD3G 1PO11 1SMVA 2A3YA 3NAPB 4OUSA 5I0TA 1DQ6A 4XPVA 1FYUA 3ZXAC 2R6QA 4CDXC 2D93A 3FLTA 4C91A 4JGZA 5EYXA 1QJY2 4AHZA 4E2QA 3L9JT 2HWE2 3J8F2 4AEKA 5FCCA 3RDIA 1Z78A 2AZ5A 4K7JA 2HWF2 5TSWA 2ZACA 5B2GB 1TME1 4HETA 5IK8A 2E7QA 1BXHA 3WY6A 2D5HA 4HMZA 1UX6A 2D7FA 4RFT0 1C3HA 3M1HA 3SMHA 2XWBB 3JZVA 2WNUB 2PHFA 2GAUA 2V73A 1H1MA 4O9EA 1PIV1 3VKMA 1Q5OA 2E9QA 4QPGA 2HJIA 4KU7A 5CB7A 3ZFFB 4DY3A 1R1ZA 1SBEA 2DURA 4A7ZA 2GZWA 3BIWE 1D4M1 1OI6A 5L19A 3LA7A 2ZS6B 2ZKLA 3MGUA 4FVVA 5DDJ2 3UK9A 2W08A 4GULA 4I30A 2I74A 1QXRA 2BNNA 1G9CA 2CGOA 2XL9A 3B01A 1RINA 5JIAA 1GSLA 4AI0A 1ULFA 4WVZA 1FOD3 1R1A2 4A7KA 4YFZA 4OHZA 1PO23 3EBRA 1LTEA 4OHVA 5KXBA 1PGL1 4OUMA 4RQPA 4XYXA 3SLIA 4ISQA 2JD4A 3AZYA 1R1A3 3FHIB 1DZQA 2YY1A 3WHTA 2RS32 2VMIA 2AGSA 4LHNA 5C8CA 4E2SA 4YW3A 4TZDA 4N43C 1RUG3 1W2UA 2WT1A 3VHRA 1GYKA 1VBE2 3H8UA 2I2SA 1H2NA 1V00A 2R072 2ZGLA 3MI8A 2GNTA 4KBBA 1XXNA 4RL7A 1EPZA 1IS3A 4NWWA 3HMYA 2OUJA 3WINE 3OTFA 2XWJB 4CYDA 1RHI2 2V5YA 1OMIA 2GU9A 4PF5A 4FPKA 1HRV2 3THPA 5BUVA 2CY6A 2W0XA 4I0AA 3MPPG 4WM8C 1SCRA 5JZGC 1R081 1F8VA 1ZREA 4Q1PA 4YW5A 2DCZA 1UZYA 3FE5A 4CDWB 2D3RA 1K5MC 1DYKA 3WHUA 4A2UA 3TOJA 2P3JA 1MQTB 3USUA 4Z8BA 1AR82 4C1XA 5T5JA 4YW2A 5EV7A 1FOD1 2JG8B 1OQDA 5FOBB 4RR3B 2ZMKA 5E16A 4XJUA 4Q27A 3WX5A 3CJXA 4RS5A 1LOEA 4URTA 2IC1A 4LBKA 1NCQC 4FO9A 4CDUB 3VZJA 2WZR3 5L73A 4AE2A 2F4PA 1VBA3 1XE7A 1Q8OA 4BLIA 3M3OA 1DU3D 4KWLA 3TNPB 4S2FA 3AXDA 3S7IA 4IQPA 3LA3A 3WXPA 1UU4A 1GANA 1QWRA 3URFA 2E51A 4H3WA 1SCSA 2ZX3A 3DN7A 4KGQA 4PDWB 3UKTA 4AVTA 2Y0IA 3WR0A 1MZ5A 5JI9A 2WKKA 1O5UA 2ENRA 3WDYA 2VVFA 1RUD3 4C1WA 2N7GA 1W6PB 5GLUA 4RHV1 3WW2A 1JYCA 5ABJA 2Z5WA 3VBUB 1RUD2 1VB2A 4CDUC 1UIKA 2DCJA 1FXZA 3O0XA 2G9GA 2DUQA 4CEYC 1R082 4Y22B 3ZX7A 4TWTA 1C4RA 2XBO1 1IHMA 4M3CA 5ABJC 1NQDA 5JLVA 5CADA 2B9UA 4YGBA 3M3QA 4D94A 2FHRA 2XJVA 4XDQA 3MPBA 3LSEA 1QU0A 4LNVA 4B4QA 4FPYA 2HWC3 4P9XA 4V1PA 3ZYGA 1I3HA 5JPNB 1DHKB 4B8EA 5L7OC 4CP0A 3L2HA 3WNXA 4YW1A 2JX9A 5C6CA 2BVVA 2NPIA 5BPXA 3WDUA 3QACA 4LUMA 1ZRDA 4XW3A 4Q0UA 5KHIA 3QOPA 4I0WB 2DTYA 2VULA 1W6NB 4Y1ZA 1ASJ3 3MF6A 4X6QB 3H3ZA 1XU1A 2ZX0A 3WDWA 2IWGB 3ZN5A 4Q4X2 1SLBA 3T1LA 4DXZA 1VP6A 2EAKA 2E7TA 1S0CA 4AI3A 1DQ5A 1MEC1 2A6ZA 4M01A 1X33A 3AP9A 4M0HA 1VAKA 2GC2A 3NV3A 4NWVA 4X8NA 1IQAA 3AMMA 1LODA 1LHOA 2VU9A 3VBSB 4AGGA 2IXKA 3RMXA 3DKWA 1YIPA 2JDZA 5LRRA 4X6RB 2HWF1 5IK5A 4MH0E 3WP6A 3HQXA 4G3YC 2RS53 2K0GA 4FAHA 2XLFA 4Q0PA 1O3SA 3PVOA 2FZ1A 2B5HA 4Y20B 3S6PA