5AVAA

Crystal structure of pha-e lectin in complex with bisected glycan
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
238
structure length
238
Chain Sequence
ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Erythroagglutinin
publication title Atomic visualization of a flipped-back conformation of bisected glycans bound to specific lectins
pubmed doi rcsb
total genus 47
structure length 238
sequence length 238
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5avaA00
3BOPA 4BPZA 4YZ1A 3AZVA 5IK5A 5DZFA 3WHTA 1UAIA 4XJUA 1GYKA 2TEPA 2ERFA 2ZAAA 1AVBA 3NV3A 3OPZA 3VV1A 4H55A 3VKLA 1V6OA 3QLQA 4UW3A 2P37A 3O12A 5DXDA 1DQ1A 3PVNA 4KBBA 3IN9A 5KXDA 4YZ4A 5EXOA 1ENQA 2DUPA 2R0FA 1QNYA 1DYPA 3RMYA 2ZACA 3VKOA 3ZSMA 3T2TA 5IK8A 1AXZA 2GMPA 1ONAA 2E7QA 2A6VA 4Y26A 4FPLA 5LK5A 2CWMA 2R1DA 3A0KA 1CONA 1WBLA 4BQ1A 1FV3A 2WLQA 5GZFA 1S1AA 1U0AA 1KDMA 2ZZJA 3AYCA 3NV1A 3DUIA 5EWSA 4GALA 3IKWA 4XJWA 1WW4A 3SITA 4YW5A 4R9CA 4YG0A 2VXRA 3JUUA 1VAMA 1S0FA 1C1LA 4YM1A 4YW2A 2DU1A 3M3QA 5DUUA 1KRIA 4DS0A 1IKQA 2ZHKA 3CNAA 3R4SA 2WT2A 1LHOA 5DZEA 3ILNA 3WG1A 1YIFA 1JHNA 2UWAA 3NV4A 3V0AA 1HLCA 1I1EA 1O4YA 3FLRA 3O0WA 2AGSA 3SH5A 3SISA 1WD4A 2ZA9A 5AVAA 4YG3A 3FBYA 1UMZA 3BIWE 1LOCA 1LHVA 2DYCA 1LCLA 5F9TA 2A75A 4C1WA 2YXSA 4YLZA 1S0GA 4AVVA 1GICA 2ZGKA 2PHTA 4DFSA 3R05A 4Y1VA 1VLNA 2A5ZA 4U36A 3B69A 4P9YA 4XHBA 4YW1A 1MR5A 4ISQA 2NMNA 3OY8A 2WKKA 5JDBA 4FPGA 1WLCA 1UX6A 1WCSA 2ZMNA 4W65A 4Y22B 1ENRA 4YFWA 1G7YA 2JECA 1F5FA 3PMEA 4HL0A 5T5JA 1DQ6A 1JBCA 1W6QB 1Z0HA 2HYKA 1CPNA 1GKBA 4CZSA 5GZEA 2B7YA 3A4UA 4ISRA 3V0BA 4BMEA 1SLAA 1GLHA 2D44A 4XXPA 3WUCA 2GN3A 3OJBA 1KJRA 3HMYA 1TEIA 4ITCA 2EF6A 1LJ7A 2ZKNA 2VW1A 3O0XA 2A6WA 3VUOA 2UURA 3ASIA 4YGDA 3SH4A 1DBNA 2LTNA 3MW3A 3UL2A 3WCSA 1CPMA 5HCAA 1ULEA 1BQPA 2PHXA 3ILRA 2D6NA 1MVQA 1GSLA 2Z42A 4PBOA 2VW0A 3USUB 5CA6A 1GZWB 4ATEA 5CAZA 5BYNA 1WUVA 1G8WA 4XE9A 1LOEA 4PF5A 4YG6A 1AX2A 5IUQA 1Q8QA 1C57A 2D7FA 3AZXA 1VIWB 4R9AA 4XYXA 3I4IA 2DTWA 3ZYRA 1SBFA 1W6OA 1BXHA 1G86A 4FQZA 4LBKA 4LBQA 1H30A 3WDTA 4Y1YA 4BLIA 2ZHLA 3ZSJA 5FRAA 1MS5A 4FPFA 3AP5A 1IS3A 5E89A 4YW3A 3D6EA 3LSEA 3RMXA 2GMMA 1G9BA 1FNYA 2A70A 1X50A 4P9WA 1V6LA 2ZGPA 3M2MA 4AWDA 2DV9A 2EXKA 2XG3A 2ZGQA 2GNBA 2ZGOA 4FP2A 2YROA 4LBQD 5EYXA 3KQRA 4FOVA 4WVWA 1WW5A 1JYCA 2AUYA 1W6NA 2R0HA 1MS8A 1R1ZA 1WW7A 3WV6A 3N7MA 1NLSA 1QKQA 1H9PA 1KITA 3OYWB 4Q1RA 4IQPA 4XDQA 4XOGA 3T1LA 1GBGA 2WSVA 4AVSA 4K20A 1B09A 5FREA 3IPVB 1AF9A 1FX5A 1OFSA 2D3RA 2P3KA 2A6YA 2GNDA 1ZM1A 2PELA 4LBLA 4LBNA 1LTEA 2VUAA 1MACA 1CVNA 4NO4A 2BQPA 1BYHA 2EXHA 3AX4A 2ZGMA 5IT6A 4Q1PA 4XJAA 2SBAA 1AZDA 3WDUA 3WDYA 2OW4A 3RG0A 1W6PA 1V00A 1UKGA 3M3EA 3SLIA 3V0AB 2PHUA 1DFQA 1LODA 1AXKA 2WJSA 1MS3A 4Y20A 5JOXA 4Y24A 1GZCA 1A78A 3M1HA 5HCFA 5DG1A 1Z78A 1JUIA 1WLWA 3B00A 2PHWA 4GWMA 1QOSA 5SV8A 2PHFA 4K1YA 3ZVXA 3LCPA 2ZGUA 1G9CA 1QNWA 1VALA 5F5QA 1S0JA 4M00A 2DURA 1LGCA 2CWSA 4FPCA 1AX1A 3UJOA 4JRAA 1CR7A 2AYHA 5T50A 4M3CB 5GLTA 5CBLA 2AENA 1O4ZA 2WSUA 3JU9A 3OY8B 1QDOA 3WDVA 1LEDA 1KDKA 5GM0A 2D6OX 3B9CA 5DUWA 5H9RA 1ULDA 1J1TA 2VU9A 1LOAA 3ENRA 5JOWA 2W39A 3POSA 3AYEA 4Z8BA 4Q26A 2DUQA 3V0BB 2D3SA 3TAYA 5DUXA 1KJLA 2D6MA 3A0NA 4Q8LA 3V64A 5KXCA 2DWRA 2ZGSA 3O5SA 3OBRA 5T55A 4WZFA 4CTEA 3AXEA 2DVGA 2R49A 4FOQA 2D6LX 3MPPG 1Q8PA 2A71A 3N7LA 4FQ4A 4UW6A 3GNEA 1VAVA 1LOGA 1JYIA 1SCRA 1LU1A 3RRDA 4XXAA 3D4KA 2ZMLA 5JOYA 2NN8A 3UJQA 4YGCA 2A3YA 3ZXJA 1W6MB 2DTYA 2FHRA 1G9AA 1G9FA 4AGRA 4XJZA 5H9QA 4XTMA 4RA0A 4D69A 4XBQA 3RSJA 1WW6A 5H9SA 2EIGA 2FMDA 1Q8VA 2ENRA 2R16A 3ZXEA 5KXBA 1UZZA 5T5LA 1YRZA 4LBQB 2CNAA 1SLBA 1N1YA 2E6VA 1PZ8A 1ENSA 4GKYA 4FPYA 1KQRA 3WVJA 3ZSKA 2P2KA 2JE9A 1LEMA 1ULCA 5E8AA 4M3CE 2NM1A 3SH3A 1DQ2A 1SFYA 3NV2A 3AZWA 3VKMA 4BMBA 4Y1UA 2WT1A 1QGLA 1S0IA 2DVFA 1HQWA 1V6MA 4JCKA 2AR6A 3AK0A 2A6ZA 5EYYA 3ZXFA 5KXEA 2WT0A 2E7TA 1MS1A 5E88A 4FPOB 3WDWA 4DQAA 1GANA 3FLTA 1Y7BA 3WHUA 3AP7A 1SLIA 4FPEA 2ZGNA 1OKQA 3N7KA 4WV8A 1IS4A 1CJPA 1GNHA 5GJ6A 1G9DA 1LECA 2GN7A 3PVOA 1JW6A 2R1BA 3MEPA 3WCRA 1DGLA 4XILA 4TZDA 2I2SA 3B01A 1FYUA 2W08A 1SACA 2JE7A 2DVDA 4XBLA 1LHUA 4FVVA 1QF3A 4UW4A 2A3XA 2ZABA 3WLUA 1MVEA 3T1MA 3ZXLA 4Y22A 3ZYPA 2ARBA 4PBPA 1GNZA 4R9DA 1CESA 3B3QE 2DVAA 3AJYA 1W6QA 5DZGA 4DPNA 1ULFA 1YI7A 2ZGRA 3C2UA 5DUVA 1UN1A 4K1ZA 1HQLA 2CYFA 1QOOA 2GALA 1MS4A 3AZZA 4Y20B 2SLIA 1SBEA 3WNXA 1HDKA 4BLJA 2EXIA 3HR9A 1AJKA 4K21A 4Y1ZA 1W0PA 2GDFA 3W59A 2Q5TA 3IMNA 3Q9OA 4R9BA 1SLTA 2GNMA 3NWKA 3MW4A 4MYEA 2ZGTA 3DGTA 3USUA 4DRRA 1LOBA 1Q56A 1QU0A 1NXD1 2PHRA 3AXDA 1DQ0A 2C9AA 2VY0A 4ATFA 4U2AA 4LBJA 1APNA 3WDXA 3TB0A 3MW2A 4YFZA 4SLIA 2CL2A 3M3CA 3KM5A 1I3HA 4FOWA 4XBNA 2GMEA 3O0VA 2GNTA 3AP6A 1W0OA 4Y1XA 3GALA 2UU8A 4XJ8A 1QOTA 4YM2A 3PJQA 1S0EA 3W58A 2DUOA 4BOWA 2OUJA 4ZKTB 4YGEA 3UK9A 1N1TA 1LGNA 4FPHA 4P9XA 4PQ9A 2W52A 3OGGA 4L8QA 2YMZA 1AXYA 1AX0A 2W68A 2JKBA 2CTVA 2UWCA 2WQZC 1N47A 2XB6C 1BKZA 3WG4A 2D6KA 3OYWA 1WBFA 1S0CA 1PZ7A 3ZSLA 2VH9A 1IS5A 1DHKB 2CY6A 3IPVA 5JVVA 3R4UA 1A3KA 2ZBJA 4Q27A 1SLCA 1S0BA 3APBA 3N36A 5T5PA 2P3JA 1UPSA 4TYSA 2ZHNA 3WZ1A 1JXNA 1ZA4A 2V5YA 3H0OA 4GA9A 4P14A 5JMCA 2EAKA 1LENA 1C1FA 1DYKA 1N3OA 4AVTA 5DG2A 1N3QA 2P3IA 2JDZA 4FOYA 4XMIA 3INAA 5T52A 2A6XA 1LHNA 5GZGA 4Q8KA 4YM0A 1AJOA 4FP3A 5GLUA 5T5OA 3IM0A 3L2YA 3WG3A 2DU0A 4LBOA 3VKFC 2D3PA 1LOFA 3AP4A 4RL7A 2DVBA 3AZYA 2ZHMA 1SLLA 2OVUA 3D5OA 4HANA 1MZ5A 3ILFA 3PVEA 5H9PA 3U4XA 4XZPA 2JJ6A 1W6OB 2EALA 1A8DA 2AH2A 2KM2A 2RHPA 1D0HA 3BODA 5GLZA 3RQ0A 5T54A 1QMJA 4YZ5A 1SCSA 4M3CA 5GZCA 2WNEA 3QCWA 3LSDA 1V6IA 4ASMB 2OUHA 3N3HA 4XJ9A 1FAYA 1FNZA 1GV9A 1LULA 1OQ1A 1SBDA 4GWNA 4ZXKA 3ZXKA 3AFKA 3AJZA 4FPJA 3SNMA 1GZ9A 4AYUA 4I30A 1URXA 1Q8OA 3HN1A 1RINA 1IS6A 2YZ4A 1MS9A 1W6NB 1EPWA 4YGBA 2NYYA 3POYA 2LALA 3AYDA 2AREA 4DRVA 2C5DA 1MS0A 2NZ9A 2UWBA 5JLVA 5JOZA 1Q8SA 3WG2A 2D6PA 4AGGA 2VW2A 1JN2P 1V6NA 3POWA 4XTPA 1QDCA 2A3WA 3OBTA 4F83A 1DZQA 2D43A 3V65A 1N1VA 4M01A 2EXJA 2YV8A 1MZ6A 5L73A 3I8TA 4M3CF 4XHXA 4WVVA 1YO8A 2NP0A 2ES3A 1ULGA 3BTAA 4FPKA 1YXWA 3FUQA 2ZGLA 1W6MA 1H9WA 2A7AA 2ZMKA 1FATA 1W6PB 5HCBA 1UZYA 1WD3A 2JD4A 4GXLA 4GKXA 4YM3A 1CIWA 3N7JA 1XQNA 3M3OA 3FLPA 1DLLA 1BZWA 1BJQA 1PZ9A 2G4IA 4NOTA 3WUDA 2YY1A 1IKPA 3AP9A 3ATGA 1LGBA 4JC1A 4PCRA 4Q2FA 4LBMA 4YZ3A 1N3PA 1V6JA 5CNAA 1WLDA 4XMAA 2E51A 3ZPYA 1UL9A 2E53A 1LESA 2H0BA 1IOAA 1JOJA 2V73A 1DQ5A 3WOGA 1RITA 1FV2A 2P34A 1YYNA 3AYAA 1RIRA 4UW5A 3VKNA 5GZDA 1GZWA 1V6KA 5CB7A 1C4RA 1N1SA 1S0DA 4OZXA 4XIOA 4XIKA 2ARXA 4YW4A 4AGVA 4CRQA 5IK4A 5IK7A 1D2SA 1F31A 3RS6A 1DQ4A 3FFZA 1CQ9A 1LHWA 1LU2A 2NMOA 5GLWA 5GALA 4YZ2A 1LOFC 4BM8A 3FUOA 3N35A 5GLVA 4C1XA 1DIWA 1F9KA 1CN1A 1HKDA
chains in the Genus database with same CATH superfamily
2FZ1A 2RV9A 2WWSA 4KGQA 1XRUA 1BEV1 1O3QA 2QE3A 3AZVA 1RUF2 1ZZ9A 4PDWC 1HN1A 2ADDA 3J8F1 4XJUA 3CDZB 3NV3A 3TEXA 3ZIWA 4CEWB 4ES8A 4IV1A 2IXKA 3PTRB 1E5IA 4OULA 2VVDA 3O12A 4IV3A 2RMU2 2Q8DA 1DQ1A 4COZA 1SZBA 1BCXA 1QXRA 5JI7A 5C9AC 5GKAC 5BNPA 4YZ4A 2QQIA 1ENQA 1EV13 2WWJA 3AVRA 5LZ6A 3WEZA 5IK8A 3BN6A 5FQ0A 5M0TA 1H4GA 1ONAA 3K4DA 4G9SB 4FXKB 4IUGA 5LK5A 3MO4A 4AFMA 3A0KA 4A41A 1CONA 1WBLA 1HXS2 4OHZA 2PTMA 3JD72 1KDMA 2ZZJA 2JB4A 3AYCA 4WZCA 5CFCA 3NV1A 3DUIA 2JIGA 2J1UA 5FBZA 4XJWA 2R071 1UW8A 4AK3A 3SITA 1OLME 3KT7A 1UY1A 4R9CA 3HD8B 1W03A 2VXRA 3JUUA 5C7GA 2JDAA 3PJYA 4LO6B 3E6CC 1B35B 4CP0A 3EO6A 4MGIE 4OLLA 4DS0A 2NLRA 3V0AA 4B1LA 1HLCA 3P5BA 3H9AA 3FLRA 3ZOIA 1I1EA 3O0WA 4PF1A 1J1LA 4IEZA 4Q0SA 4YVWA 3WP6A 1OF4A 4Y5TA 2XMLA 1ZREA 1JS9A 3S5QA 3VHPA 4B4QA 1LCLA 3MIEA 4RSUA 1GU3A 1HRI1 5LCWL 2FCUA 5FY4A 3POGA 4PLOA 4UFIA 5TSWA 3KHCA 3O1TA 4YW7A 1GICA 3POBA 4XFIA 3BPSA 1JTZX 4FTSA 4IL7A 3KV9A 3B69A 4KG8A 3J7MA 3LEIA 4P9YA 1NY71 1OH4A 3DCQA 5IYYA 4NRMA 5CFDA 2NMNA 3T2OA 3HNMA 5JDBA 2P3YA 3DYPA 4CDWC 3PTYA 2ZMNA 4NPMA 5T54A 2WABA 4FFFA 2A1XA 2I45A 2XDVA 2BERA 1MQTB 3VBHC 1ZVFA 2VECA 2VMHA 3ME2A 5HCHA 2VCCA 4CXWA 4ISRA 2ZXQA 1POV3 1M4WA 4UFKA 3V0BA 4BMEA 1H4HA 1W8OA 5A1AA 1WCDJ 2LW8A 1KJRA 2PHDA 1NCRB 5A3NA 2VQTA 1TEIA 1LJ7A 2NQYA 5A3TA 1OUSA 3VUOA 2BBVA 1GQHA 3W9AA 2LTNA 2QVSB 1ND3B 4MGQA 5FKBA 3UL2A 5I0RA 2W5FA 2XONA 3PURA 3MHZA 3VZKA 1W0NA 2JEMA 4Q4W3 4QWNA 2QCSB 3DECA 1LRHA 2GC2A 4DUXA 3PU3A 3MF9A 4QKDA 3O1SA 2ZX0A 3USUB 3SXWA 1IG0A 1TVGA 2PYTA 4MH0E 3LZZA 5FYVA 3TYJA 1VBD1 5FZDA 1JYNA 2XGXA 3K51A 4HVRA 5IUQA 4XYXA 1ZZ6A 1SQ4A 1OC1A 1SG3A 1VIWB 2ET1A 1AR71 1RJ7A 3ZYRA 1W9SA 1X82A 3BCWA 2BVVA 5FIXA 3SQOA 2WO7A 4BLIA 4LITA 1H8TB 2VOVA 2VZUA 2QQLA 1OPOA 2ZHLA 5FMOS 2QQNA 2VOTA 2OS2A 4IGQA 4YW3A 1O59A 1RMU1 2GU9A 2WN3A 3B7MA 3RWKX 1V9U2 1BEV3 5J1XA 4J25A 2XOMA 5L7OA 2GMMA 5L36A 1JZ6A 3PL0A 3J8F3 5A7WA 5FFOC 3TRSB 2VL4A 3VBRA 2ZGOA 2WAAA 2YROA 5EYXA 3C8XA 1GQPA 4WM8C 1W6NA 4QGLA 3WV6A 3RI9A 2RS51 1BEV2 3AMHA 3N7MA 2FQPA 3OGVA 1CZTA 1H9PA 1W9TA 4HVOA 2DCTA 4IQPA 2CAVA 4XDQA 4XOGA 1IQAA 4K7JA 1IGOA 4ZU5A 3G6JB 3I3QA 3URFA 3P3NA 3NQHA 4K20A 3VDDC 5FREA 3I2GA 1I5PA 2D3RA 1D4M1 4TSVA 2PELA 3UETA 2E63A 1CVNA 3MBWA 3ZYHA 2BQPA 2CDOA 5FYYA 1OQDA 1RXGA 3CJIC 4LQRA 3WDUA 5FXWA 3WDYA 4BH9A 2OW4A 2ORZA 4BYYA 4KNCA 2WL1A 4R52A 3LPGA 1TNRA 3EHKA 2PHUA 1HJGA 1GOFA 4J1WA 1DFQA 4LXLA 5CU1A 3LPFA 4MLOA 4KL1A 4YVSA 1KFUL 5FLIA 5A6QA 2QQMA 4Y20A 4E4SA 3AM2A 3CZUA 1QXPA 1JYTA 1A78A 3D3AA 3M1HA 3OD0A 5DG1A 2R072 1CJDA 4M4PA 3ZVXA 1GUIA 1L7QA 2QKDA 4K1YA 2QQUA 3WR0A 5J96B 1NAEA 3U37A 2RM21 2OX0A 2V72A 1H6XA 2JDMA 4GJZA 3GCWA 5IW0A 2HWF1 1OI6A 3UYJA 4AAPA 5E16A 3UJOA 1HRI3 4BK4A 3CHXA 4JRAA 4XUTA 5LA0A 1K5MC 4FFHA 2IXIA 3T08A 5FZ1A 4ZONA 3W5NA 3OY8B 1BLZA 2CV6A 3AKRA 3B9CA 1ULDA 1LOAA 2XVKA 1HRI2 4MHUA 4WM8A 2W39A 3POSA 3RWNA 4N7IA 4EQVA 1OKOA 1HJFA 2ARCA 3VL8A 3RDIA 2VM9A 4D3WA 3IAQA 5I0DA 1KJLA 5BPXA 2ZOEB 4KGGA 4QPGB 1XYNA 4Q8LA 4CP9A 4DB5A 3H42B 2MEV2 3VDDA 1W8UA 2HLEA 2ZGSA 2XHNA 3O5SA 2HWD2 3OBRA 4JKLA 3H7JA 5T55A 4CTEA 2R49A 4FOQA 3LQCA 4IEXA 2A71A 4LMFA 2WBKA 4OCTA 3N7LA 4ONUA 4ZU7A 3GNEA 4ASLA 4Q0QA 4QGNA 1SCRA 4XCBA 1JYIA 1LU1A 4XXAA 3CEWA 5JOYA 2NN8A 3UJQA 4OI4A 4URAA 2A3YA 1IPKA 4GWIA 1TG7A 4QB1A 4P5YA 3ZN5A 4O9GA 2D5HA 2MHFA 4LUKA 4D69A 4BQWA 2DCZA 4CDQB 1RUOA 4AEKA 2FDIA 1VBA2 3ZO0B 1VBD3 1SLBA 1C28A 2NPIA 1PZ8A 3FN9A 3VZNA 2AZ5A 3NW4A 4GJYA 3ZSKA 3ALQA 4NWWA 3NVCA 5CG9A 1AR73 2Y6JA 3ZMNA 4AVBA 5T3NA 2WNVB 5F6KA 4QT6A 4B7EA 5BNNB 1SPPB 1C8NA 2WT1A 3GJAA 4CCCA 2BJSA 3AMQA 4R4XA 1PO11 4OUEA 1UNBA 4QHZA 4XCAA 2JE8A 5EYYA 4AI3A 2GH8A 4FXGB 2WT0A 1RMU3 1MS1A 2Q1MA 3M4FA 5F3EA 5FDBA 1GANA 2WUHA 4Q0UA 3SMHA 2VCAA 3WHUA 1HB3A 1J59A 4W8JA 2HKXA 2ZGNA 3N7KA 3WQ7A 4C0BA 2GN7A 3PVOA 1JW6A 2VMEA 3ACGA 4CCMA 1CWPA 1VRH2 2C24A 3VHOA 4XILA 4TZDA 1HB2A 3PUQA 1OQEA 1QY4A 3B01A 2B46X 2X5IB 4P08A 3T2PA 3WNOA 2JE7A 2RS53 3LE0A 4UW4A 3Q8FA 4LO7A 4CUBA 3AMNA 1MVEA 1OA4A 4IV3B 3T1MA 1VBC2 2BGCA 1J58A 2ARBA 3NAPC 1GNZA 3ZYBA 4A6SA 4R9DA 1HB1A 4QHOA 4CYDA 1D4M3 2RS31 4V2VA 5DZGA 3TOJA 5BNPB 1OPMA 2WYFA 1EP0A 1YQ5A 3C2UA 4TLGA 1ULPA 3TEWA 2RS52 4K1ZA 5FQ0B 4AEMA 1ZRDA 2CYFA 2J22A 1RUE2 3J7HA 1OVPA 2SLIA 5D8AB 4AQSA 4CEWC 1XYPA 3WNLA 3WNXA 3B5LB 1D4M2 3PMSA 4K21A 5CEHA 1JZ8A 2W1WA 5CFCB 2R061 4FTEA 4JQTA 2ILMA 1X7NA 1XE0A 1YQ6A 2Q5TA 3IMNA 4R9BA 4RYDA 4A7ZA 4E4DX 2BVBA 2BFUL 5FO7B 3LIHA 5F5AA 1YC61 1QU0A 2PHRA 3K2OA 1NXD1 5L9RA 3AXDA 1DQ0A 3KVBA 4L97A 4LBJA 2QDRA 4E27A 2OZJA 3AKPA 4H7LA 1GP4A 3WDXA 1WCKA 1T6GC 3ETQA 2HWF3 2CL2A 4XBNA 1PGW1 1I3HA 3KM5A 3B93A 3LFIA 4CPBD 2GZWA 2VMFA 2GNTA 1K3IA 3DYMA 5DDJ3 1O91A 4A45A 4BK5A 3KCYA 5IVCA 3CU7A 4D7SA 2VQUA 4R8HA 5HI0A 5JIAA 1JI6A 2RM22 1S0EA 4QX2A 1JU3A 4XVHA 2HWF2 1C8M1 4C0HA 1B35C 1RB8G 5FR3A 3MV11 2W52A 3OGGA 4L99A 4L8QA 3FE5A 1NOVA 2W68A 5A3PA 2CTVA 2OIIA 5CFDB 4XFFA 2BU9A 2V4VA 1RUNA 5JI9A 1LB2A 4NIHA 1BKZA 2UYBA 3LKJA 3WG4A 4XF1A 1SEFA 4CP1A 5F32A 1UD1A 3LOIA 1WBFA 2QUOA 1ZBA1 4NHYA 1JOBA 3I3MA 3NNFA 1DHKB 3IPVA 2CY6A 5C6CA 3R4DB 1QJX1 3MIDA 1IPJA 1OFNA 1XBFA 2EIDA 3APBA 3OCPA 4KWJA 1W2AX 3WD5A 4XETA 4Z2AA 2ORXA 4BQ3A 1F35A 2ZHNA 1NUKA 3D8CA 2G1MA 1F4HA 4OMDA 4YNIA 5JMCA 3MICA 3PUAA 4N9IA 1DYKA 1SFNA 4OI1A 1N3QA 3D0JA 1LNSA 4FOYA 3INAA 1MQTC 5T52A 4MHRA 2A6XA 3DN7A 4I3GA 4W6XA 2C9KA 5GLUA 2Z4FA 3IM0A 4YRDA 2QDNA 1Q43A 4LBOA 4HLTA 1NCRC 3AP4A 2VVFA 4DUWA 1PO13 1MZ5A 1ND3C 3PVEA 3WNMA 4AQ2A 1LR5A 3U4XA 2JJ6A 4CE8A 5FY5A 4I02A 3WT3A 2W9XA 4CU6A 2KM2A 3U1XA 5C33A 1B35A 1FMD1 4M3CA 1UZVA 1IPSA 3QCWA 3USSA 3LD8A 4FT8A 4EWDA 5EPAA 1PM4A 1RXFA 5L7OB 4AQ6A 4CCNA 1FNZA 1QIQA 1OQ1A 5A7WB 1R1A1 2VNOA 3AFKA 3MF6A 3P6BA 4D6SA 2XPJA 4I30A 1URXA 1VBE3 2PQQA 3VBRB 1KS4A 3EJKA 4NN0A 2QZ3A 1P8JA 4Z82A 1RINA 3FFQA 1MS9A 1W6NB 1H8TC 2P6HA 4YGBA 3POYA 3AYDA 2AREA 2RS33 4ZPIA 2WDBA 5K0UB 2C6SA 1RUI2 1WWYA 2NZ9A 2YHJA 2VD7A 1EYBA 1Q8SA 3WG2A 1PX4A 5CVRA 2ETEA 1JN2P 5A3MA 1OURA 4BE3A 4QQHA 4LO4B 3T30A 1DZQA 2D43A 4S2DA 4N43A 1UYPA 3V65A 5B2GB 2K2SA 1R64A 3C7HA 2EXJA 5F37A 5FPVA 1S2EA 5L73A 4XHXA 4M3CF 1YO8A 2R063 5A70A 1F15A 4JKKA 4CUCA 1MQTA 2XHKA 5FZBA 1FATA 1WD3A 2JD4A 5JXHA 4LPLA 4HFSA 1JYVA 3FLPA 1UMIA 2WS91 4YVSB 2G4IA 5KR7A 1NCRA 3AP9A 1IKPA 3CZJA 4JC1A 1E5RA 1QJY2 4UWDA 3NJYA 4KBZA 1IZ3A 1ND3A 5FMCA 3DXTA 5DAVA 5FO8B 3IDEA 1LESA 2B45X 4JGZB 3ZYFA 1EUTA 1JOJA 1AR91 5C8WA 2XLFA 2DDUA 5APAA 5B4NA 2PMWB 4HK8A 1ZYBA 1QJU1 1DGWX 4JZRA 4TLFA 4XFGA 3IWZA 1J3QA 3CIHA 4A3XA 4ZS3A 1U12A 1ZX5A 4XQDA 2XL7A 1L7LA 4CRQA 1C8M3 1PGW2 3E6DA 4YSFA 1CGPA 2PAMA 1CQ9A 2YGLA 3K3OA 3KVAA 5GALA 4CCJA 4LA2A 1LOFC 4BM8A 2VUDA 4IEPA 2GC3A 3BOPA 3E5QA 4MXVA 4AVAA 2D93A 3NJVA 2TEPA 2VQ0A 1AVBA 1MEC1 2EIBA 2RDNA 3JQXA 4Q0PA 3UKNA 3X29B 3KT1A 4CP9B 3VKLA 1ZBA3 4UW3A 5I91A 3LEMA 4HSLA 2ZX3A 1QJX3 4KBBA 5I8TA 3ZKUA 4RN5A 2IUWA 4FFIA 2DUPA 4IE4A 4Q4Y1 4B4RA 4LO5B 1QNYA 3I97A 4AFDA 3RMYA 1GWKA 1HX6A 4XQWA 5DQ0A 3PLQA 1ZBA2 1UYYA 1PO21 3MIHA 4NE9A 1FV3A 4AL9A 1TQ5A 2WLQA 4QPGC 2FDKA 4Y4RA 1U0AA 4B29A 2X09A 5LEJA 4JGYA 3IKWA 5D2AA 3BIEA 1DDLA 2JDNA 3AFGA 2IXHA 1E57A 2EA7A 1CD3G 2TBVA 1A6CA 5FLJA 1BBT1 1REDA 5A7QA 2VZ1A 2XJUA 4HKLA 4AFAA 2ZKLA 1AL21 5LBCA 3VHRA 2ZHKA 3U10A 3R4SA 3AKTA 3H1WA 3NMBA 4LTAA 3ILNA 4XC9A 1JHNA 1E5SA 4EYUA 3OBZA 1FMD3 3TN91 5AVAA 4YG3A 3FBYA 4JAAA 4CDQC 2OKXA 2W94A 2DYCA 4CU9A 5EHDA 1R1A3 4QXKA 1COV1 3TWIA 3VBOB 3AKSA 1NG0A 1UOBA 4SBVA 2PXJA 2VZSA 4AVVA 2ZGKA 5I0UA 2WNVC 2R043 4UYBA 5FJKA 2PHTA 4BDVB 3W5MA 4HT1T 4DFSA 3R05A 2D5FA 3FHAA 3GBWA 5BNNC 2A5ZA 5C3QA 4QAWA 4XHBA 1W06A 2RG4A 3CQOA 2DFBA 3MI8A 3MIGA 3OY8A 2WKKA 4ISQA 4TXWA 2UY9A 5A7NA 4QKNA 1UX6A 3ZXJA 1ZRIA 2BDRA 2IFRA 1F5FA 4HL0A 1DQ6A 1Z0HA 2HYKA 3VD9A 1GKBA 1XSQA 2GSYA 2VAUA 5GZEA 2QTWB 1VBB1 3HPNA 5KWRA 3WNPA 1GLHA 2D44A 2VXJA 3DYOA 4XXPA 2GN3A 2X5IC 3HMYA 2ZKNA 3GM8A 1WZXA 2A6WA 4XFCA 4AI1A 4OHYA 1PIV2 2I74A 2P6CA 3ACIA 3ASIA 3QACA 1UY4A 3ABZA 3J7LA 1CPMA 5HCAA 1YHFA 4IV3C 2VULA 2WS93 4HKWA 1BQPA 5DAXA 4IEWA 2PHXA 3ILRA 4IE0A 4QX5A 2PLV2 2ZCWA 3PDQA 5BNPC 5JR2A 3O1UA 2Z42A 4PBOA 3N9MA 1ASJ2 1VR3A 4NPRA 5CA6A 4BQ5A 3WX5A 1GZWB 2RDQA 3DKQA 4IE6A 1AR93 4QM9A 1O7FA 5D8AC 4GQ7A 3R0RA 2WS92 5LA1A 4PF5A 1QJU3 1AX2A 2VJXA 1Q8QA 3AZXA 3D0SA 3OUJA 4PT6A 4R9AA 4CDQA 3I4IA 2E26A 2DTWA 4QXHA 4DY3A 5CFCC 1JZ4A 2Y60A 4OHWA 1W6OA 3CO2A 1TME1 3WDTA 4AEJA 2EIEA 4I0AA 3UKTA 1W8FA 3ZSJA 3HQRA 5FZAA 4DY5A 3H3ZA 3PUSA 1MS5A 4FPFA 2HEVF 4L2NA 5E89A 4OZOA 2FDJA 2WNVA 4JHTA 5FYMA 5FUPA 3ZFFA 5FOBB 4CDUA 3WP5A 5FZEA 4A2UA 5J3UA 4JKMA 2YC2A 4P5HA 4NIIA 3U11A 1X8EA 2ZGPA 4QHBA 1MEC3 1V0AA 3GHNA 3M2MA 4QQPA 2G19A 2DV9A 2EXKA 3MIFA 5A3OA 5A3WA 4CU8A 2BPA2 3HQUA 4WVWA 1WW5A 3OUHA 4KU7A 4LLFA 4Y5SA 2OQ6A 4GWJA 3UGHA 1NLSA 4Q4Y3 4Q1RA 1O3RA 5FMBA 3T1LA 2WSVA 1MEC2 3IPVB 1FX5A 2X5IA 2XLGA 1PO23 5FYTA 2JKXA 1AYN1 1AL0G 1J83A 3M7AA 1MACA 1ZRRA 4Q4Y2 4CVUA 1H2NA 1WCQA 4ZU4A 4XJAA 5CFDC 2PA7A 1AZDA 5F2WA 1VB2A 3DKWA 3RG0A 1V00A 3IMMA 3M3EA 2W87A 4META 3SLIA 4D94A 1BBT3 2YDEA 3OD4A 1J3RA 2RE9A 5EP9A 4LE3A 1LODA 3OEBA 1AXKA 2WJSA 2XVGA 4Q4X1 5FV3A 1AL23 3SC7X 1CAUB 1CIYA 3K3NA 1TMF3 5D8AA 4ZZ5A 3P3PA 2VNRA 4TWTA 3ACLA 1VJ2A 1JUIA 3NNJA 3T3YA 2XJSA 1EV12 3B00A 4Y3OA 5FZLA 3TN93 2BRTA 1G9CA 4B8EA 5C3PA 3HNYM 2W91A 1AYM1 2UY8A 1T2XA 5KHKA 1DGWA 2DURA 2VNVA 2JDKA 1LGCA 1AX1A 5FPZA 1COV3 3O1MA 5T50A 1UO9A 4M3CB 5AC91 3J26N 2YPJA 4E4HA 5CBLA 4B1MA 4GMP3 3JU9A 3MUY1 2XKOA 1QDOA 3SCGA 3TN92 1OA3A 2PAEA 2YGMA 5C3SA 3LDRA 1LEDA 4IERA 2QJVA 1KDKA 4H3WA 5CZKA 4W4ZA 4LIUA 3WQ0A 1A8MA 4HXCA 3B9IA 4MUVA 4AHWA 4CEYB 1NT0A 4Q26A 5FCCA 1COV2 1Y43B 2D3SA 1PX3A 4UI9L 4MOAA 4LKFA 3NKGA 3A0NA 3BYWA 4LORA 5DAPA 3V64A 4BJ0A 5KXCA 3ZYJB 2OXBA 2DWRA 5IWFA 3Q8AA 5FXXA 1UY2A 1VBB3 4LKDA 4PIZA 2DVGA 3T0BA 3LA7A 2D6LX 4UBGA 2N7GA 3MPPG 1Q8PA 5FO9B 5L7OC 1IQDC 1PNGA 4GB33 2C26A 4N43B 3RYRA 1LOGA 4EV0A 2WA3A 2XJRA 3RRDA 2VTFA 3VBRC 3ZDSA 3D4KA 2WAOA 1US3A 4LHKA 2XJVA 1VBB2 3RGBA 2WNOA 3JBG1 4A4AA 2VOXA 3AKQA 1STMA 5L9VA 4XJZA 5K0UC 2VTXA 3RSJA 1WW6A 2EIGA 3M70A 4XF9A 1Q8VA 3ZXEA 2R16A 3B02A 1L3JA 4G4FA 4LBQB 2CNAA 3GDBA 2WIIB 1ENSA 4GKYA 3KGZA 4FPYA 4RR3A 3VGIA 4AFBA 5CG8A 2QQVA 1OOPA 1RL3A 1LEMA 4XURA 1C3HA 4M3CE 5KHIA 5JZGA 4BMBA 3VKMA 1RVF1 3AZWA 1TME3 5IVEA 4Y1UA 1S0IA 2VNGA 4HOOA 1HQWA 2QBXA 2FDFA 2JG9A 5LY1A 4X8PA 3VD3A 2A6ZA 4CCOA 4R4ZA 5E88A 4DQAA 4YVSC 1Y7BA 1YEWA 4FPEA 1RTVA 4Q4W2 1GZTA 1IS4A 1GNHA 1ZBE1 4QX3A 3WF0A 1W8TA 4JGZC 3RFRA 3WCRA 5LA2A 3KV6A 1PMIA 3THDA 4PLMA 2X53S 4N8MA 1FYUA 2XKPA 3I2FA 2DCJA 4NIDA 1LHUA 4QB2A 4XDPA 1W9WA 4Y5Z0 3D82A 4ZHNA 3S57A 4FTBA 1S4CA 3ZYPA 3LOBA 3LEGA 3CBNA 4PBPA 1XYOA 1AYN3 4MXWA 1W6QA 4DPNA 1ULFA 1SDWA 2ZGRA 3WP3A 4YW6A 1DZRA 4A44A 1ZZ8A 1HQLA 3A21A 2GALA 1QH7A 3Q8CA 3KT4A 5ERLA 4D8MA 4E4ZA 5AFBA 3KV4A 5DMYA 2BTVC 1SBEA 4BLJA 3J8F2 1U5ZA 2WFF3 4Y1ZA 4E2GA 2MNGA 3WY6A 4JGYB 1W0PA 4P00B 2GDFA 2Y6KA 4Q4X3 3S6PA 3KF3A 4JDMA 1XNBA 2ZEXA 1SLTA 4QQ2A 4JX0A 2XWBB 2GC0A 3MW4A 4MYEA 3THTA 4RGAA 4W50A 1LOBA 3PVBB 1XU2A 2VZRA 4U2AA 3AB0A 1OLQA 1APNA 3ZXAC 1AYM3 1DLCA 3OF1A 4Q4X2 4YFZA 3M3CA 5ANNA 5LASA 3O0VA 3T0AA 3AP6A 3U4SA 3PHMA 4Y1XA 3GALA 4C8DA 3TNPB 5AC93 1HB4A 2UU8A 1YIPA 1QOTA 3ZXDA 5LK7B 3W58A 1X36A 3ZPOA 4OI0A 1YJKA 2OUJA 2VCMA 4JGZA 4IE5A 2PN5A 4OFGA 2RR13 3KWVA 4EZHA 4BISA 3UK9A 2J1RA 4FPHA 2BEOA 2Q8EA 2YMZA 4DO0A 1AX0A 3ZM8A 5DDJ1 4D7TA 1AR63 2WQZC 3K48A 4COUA 3GBFA 5FP8A 5FXZA 1R081 1FI2A 1QXJA 2RJLA 5FZOB 1LAJA 3OYWA 1UF2C 1Y4WA 2WNUA 1JYXA 3VBOC 2VQAA 2VH9A 1YLLA 4BA6A 5C8CA 1IS5A 3W20A 2VE1A 1A3KA 4UXAA 3N36A 1PVC1 3OB8A 5A7OA 5T5PA 3JBG3 4TYSA 3HAGA 4X8NA 1JXNA 1QWRA 3H0OA 1NE4A 1WCUA 4P14A 2EAKA 2RS11 1NY72 1LENA 2X10A 1C1FA 4AVTA 3BB6A 4XMIA 2VOKA 4XF0A 5F3IA 1LHNA 4A6OA 4Q8KA 2WZR1 3QH7A 1FOD1 1AJOA 1ALYA 1OF3A 3S7EA 4LA3A 2JWPA 2QQOA 3L2YA 3C7FA 4O65A 2DU0A 3SCFA 3UGFA 4Z92B 3WP4A 1RVF3 3QBQA 2C0ZA 4UF0A 1I9RA 2DVBA 1Y9GA 2Z79A 2ZHMA 4MG2A 4HANA 2GAUA 3CL1A 1YQ2A 4XZPA 1M06G 1W6OB 1OLRA 2B9UA 2VMDA 4TTGA 1RUH1 4JV4A 4H14A 5GLZA 1RVF2 1NQDA 1QMJA 1S2KA 2YBSA 1ZBE3 4RHV1 1PK6A 1W8ZA 3LSDA 3WW3A 3ZFFB 4KI5M 5A3UA 2FCTA 5FZCA 3H3LA 3WW4A 4CDUB 3N3HA 1SBDA 4GWNA 4K40A 1VBD2 3IZOA 3SNMA 2D97A 3ZXKA 1GZ9A 5F2SA 1T6BX 1U5YA 3RZKA 1IS6A 1AR72 1FPN1 2B8MA 4LHSA 2ZEZA 3PUIA 5F5CA 4N9HA 5LA9A 2O1QA 2LALA 3VBUA 2RJ2A 2WA4A 2C5DA 3VBOA 4DRVA 3RZGA 1MS0A 4CCDA 2K0GA 1NX9A 3CMGA 4A7YA 4EE2A 3POJA 1CX4A 1NCQA 4AGGA 2F17A 2VW2A 4UFLA 1PGL1 2JXAA 1RMU2 1O6UA 2IVJA 3ETPA 3ZN6A 4XTPA 4BIOA 3OBTA 4F83A 2FCVA 1VBE1 3I8TA 3LIGA 1EAH1 5ACA1 3BTAA 2CGPA 4HONA 1YXWA 3FUQA 2HBTA 5F5IA 1PMHX 5CIRA 1H9WA 2ZMKA 5FWJA 2KD7A 5FZ8A 5HCBA 1NYWA 2ID4A 2HBUA 5K0UA 1QEXA 3M3OA 2W0XA 4F7ZA 4A7KA 2H6CA 1RGSA 1PZ9A 4NOTA 1LGBA 3MUZ1 5I8SA 4Q2FA 5F3CA 4YZ3A 1N3PA 1V6JA 2PHLA 4M0HA 5CNAA 4A3ZA 1WLDA 3E97A 5E1RA 4XMAA 2E51A 4BQ4A 1DGRN 4MZUA 4P9LA 4P9JA 5JCTA 3NRUA 4S2FA 1IOAA 3I3EA 4I0BA 2E32A 1YYNA 2BYVE 2IZWA 3AYAA 3BALA 4RQPA 5FYBA 1RIRA 1REEA 3LWCA 1GZWA 2HYXA 1EUUA 4MV2A 2WWUA 3TEZA 4AGVA 1S0DA 3MDPA 3V56A 2AACA 1SFPA 1UCXA 2ARXA 5IK4A 3VDCA 1KS5A 4K6BA 2YU1A 1F31A 3RS6A 1LHWA 2NMOA 5GLVA 1DIWA 3BUCA 1F9KA 2JDYA 4UBHA 1HKDA 4LO8A 1Y9QA 1W39A 4BPZA 4YZ1A 5IK5A 4QDQA 2GP3A 3WHTA 4OYUA 1UAIA 2VBPA 1GYKA 1R083 2ERFA 2ZAAA 1XE7A 3GHMA 4NHKA 3SEPA 2XJTA 4BQYA 3VV1A 4H55A 2XR4A 1GQGA 1V6OA 2Y6HA 2YFZA 3QLQA 3QOPA 5CKQA 5DXDA 3POFA 4FFGA 4COVA 3T2QA 3PVNA 5DDJ2 1GWMA 5KXDA 2R0FA 3IDBB 4UFJA 3O1RA 1PVC3 5IAVA 3ZSMA 2RVAA 1AXZA 2GMPA 4B7KA 4CEYC 2YG0A 2RS13 1JU4A 4IGOA 4FPLA 4EN8B 2W2IA 2X8KA 2CWMA 2HWE1 4E9KA 5J36A 4QDSA 1DGRA 4I09A 4GAZA 1W28A 2WZR3 3HJRA 1FOD3 3OOXA 5CISA 4HPKA 1WW4A 3ZIXA 4INDA 2RS12 3GZAA 4KQ7A 4CUGA 1HRV3 4AQTA 5IVJA 1S0FA 4N43C 4Q4V1 4RR3B 1OOPB 2VBBA 1IHMA 4YM1A 4YW2A 5BNQA 5DUUA 1IKQA 3WG1A 4FI9A 5JZGB 1BK1A 1YIFA 4AHXA 1RUH3 4HN1A 1MZFA 1YCIA 5FZ7A 4DMIA 5FJHA 2JG9B 3SISA 1CAUA 2ZA9A 4NROA 4RHV3 3VL9A 4CP2A 4GZ9A 1UMZA 4L9BA 4DXZA 1LKNA 3BIWE 1LOCA 4NAOA 1LHVA 3A22A 5FYHA 4XUOA 2A75A 3KGLA 2ATFA 2YXSA 2IVIB 2BOJA 4P9IA 1H0BA 1GR3A 2VZPA 1NQJA 4N53B 4RHV2 1FPN3 1R091 2E7AA 2OT7A 4YW1A 1PO12 2RJKA 3AVSA 3K46A 5FPLA 4W65A 4NJ4A 4PQQA 4YFWA 1ENRA 1G7YA 2JECA 5T5JA 3VBSB 4MXWB 1W6QB 4ARXA 1POQA 4CEYA 2YU2A 1UOJA 1BK0A 1GOGA 1SLAA 2R041 1EAH3 5ACA3 1HQNA 3ST7A 3RYKA 1OHFA 3OJBA 3JCIA 3WUCA 4AEDA 5JUVA 4MVTA 1US2A 2EF6A 2BNOA 1WMEA 4FCAA 2YFUA 3O0XA 4XFHA 2UURA 4NIAA 4OVEA 1CAWA 5DABA 1ACCA 3SH4A 3MW3A 3H1MA 3WCSA 3S0MA 1H8VA 1ODMA 3J7NA 1VBE2 4DUVA 1RJ8A 1Z7S1 4QMAA 2HEWF 2BBAA 3T09A 5FZ9A 1UU5A 1EAH2 1MVQA 4OQ8A 2VW0A 2RS32 3I2KA 4GIQA 1X9TA 3JB8A 5FMDA 4DNYA 1W3VA 1NXMA 3I2OA 5CAZA 3HQXA 2ZX4A 1AR81 2JDPA 1OBNA 2BGPA 3FJSA 4IETA 4JQRA 1LOEA 4L11A 5BYNA 4YG6A 5LBFA 3O7OA 4LULA 2D7FA 2J1VA 3T0DA 4JGYC 1VB4A 1SBFA 4UT5A 4FQZA 4LBQA 1G86A 4LBKA 1H30A 2R062 4Y1YA 3AC0A 3K4AA 2YBPA 3ZFGA 5C70A 1HW5A 2DCYA 2K9ZA 2ZS6B 1IS3A 1O4TA 1KEXA 1MZEA 5IFPA 5F7UA 5FPBA 1FNYA 2A70A 1X50A 2YUEA 4HK9A 4K8RB 4LJHA 4P9WA 3WW1A 5HBAA 3BU7A 1O5LA 5JSRA 2ZGQA 2CDPA 4J6GA 1XPWA 2BFUS 4FOVA 1JYCA 2R0HA 1MS8A 1R1ZA 2UYAA 4Z1VA 3GF6A 1UU6A 5F6LB 4NHMA 1QKQA 3IBMA 3OYWB 3FC0A 4WVZA 3ZFEB 2WNUB 4LK7A 4CPBA 2XH6A 1B09A 5C8CB 3THPA 1AF9A 1OFSA 3LDBA 1C8M2 4O9EA 4AHYA 2A6YA 4D7YA 1ZM1A 3GJBA 5JR7B 2HWE3 4LBLA 2VUAA 4BQ2A 4NO4A 3AX4A 1UXXX 4A42A 3LEKA 4P02B 1XNAA 5LRRA 1W6PA 3E5UA 1UKGA 3NO8A 2WO3A 3N9OA 4B3NA 2FBEA 5IVYA 2ZZQA 4OQ9A 4Q4V3 3SKJE 4KH9A 5C3RA 3KZ4C 4AI9A 5FK7A 5JOXA 2WZEA 1GZCA 4X6RB 3PU8A 5HCFA 1QJX2 1DZTA 4BQXA 4UF0B 4WM7B 3HT1A 2PHWA 4GWMA 2PFWA 1SMVA 4KG0A 5SV8A 3LCPA 1RUF1 2ARAA 4BIFA 4IEYA 1GFF2 4Q4V2 4CCLA 5F5QA 2LM3A 4M00A 2CWSA 1I6XA 4FPCA 4XAAA 5FZ4A 4NR1A 4Z2WA 1CR7A 2AYHA 2H0VA 3BTXA 1TMF1 5BXXA 1PK6B 1O4ZA 2WSUA 3OUIA 3WDVA 1MPXA 4XPVA 5D1IA 1R093 2Y34A 2VR4A 5A6YA 2D6OX 5DUWA 5H9RA 1H2MA 1J1TA 4Z8BA 1VP6A 2WINB 3FZ3A 1O5UA 2ZPXA 1HXS1 4XUQA 3TAYA 4MGTA 5DUXA 4ZZ8A 3VBUB 3LB9A 1CX1A 5FZIA 3GZEA 2ZEWA 2IFWA 4GMP1 5LY2A 3VDAA 3WXPA 3TEYA 1FMD2 3ACFA 1NCQB 3AXEA 3ZFFC 3GGLA 4LIVA 4PLNA 3CF6E 3L2HA 4CDUC 3ZN6B 3NSTA 4FQ4A 2AC1A 2J1EA 1C5IA 1VAVA 4JDOA 1R1A2 4LKSA 4O7XA 3EBRA 3BGAA 4LK6A 5FZOA 1Z7S3 2HH9A 3GXUA 4S2GA 1G6NA 2FHRA 1G9AA 2R042 2YB7A 3KSCA 4ZY9A 5KC6A 3LFMA 4XACA 5H9QA 4RA0A 3I2HA 4HZFA 5C5UA 4AI8A 3HNBM 1OMIA 1KGYA 2ENRA 2ZTNA 3H3UA 1YQCA 4BB3A 1UZZA 5KXBA 5SV5A 3PIGA 1AR83 1JOPA 3K75B 4GB31 4OI2A 4XEZA 1Z7S2 2E9QA 1KQRA 4PI0A 3WVJA 2QQPA 1XNDA 2BW8A 3RZLA 4QX8A 3SH3A 1VAKA 3KV5A 4ORFA 4EN7B 1NKGA 3NV2A 4GMP0 3GZUC 1XB9A 4V1PA 1QGLA 4RQPB 2W95A 5KHJA 1JODA 4XFBA 4XW3A 4JCKA 5IATA 1BMV1 1KD7A 3JXSA 4FPOB 1W05A 2VPVA 3VD5A 3FLTA 4IXLA 3I3DA 3WDWA 4BZ4A 4PIYA 3AP7A 2X05A 2A73B 1YUDA 2VVEA 1OKQA 2WR9A 2QFEA 4IEUA 5JWPA 1CJPA 4UOJA 5FY7A 1ND2A 1LECA 4QB6A 5GJ6A 1K42A 3IB3A 1UYZA 1XNKA 1YFYA 2I2SA 2Q8CA 1UY0A 3A23A 1AR92 5JAXA 3DEMA 1SACA 3BKZA 2DVDA 3DPRA 3LA2A 5FZKA 3JZVA 4RS5B 3W21A 3QH6A 1QJU2 1ZA7A 3B94A 3KLSA 2ZABA 4PI2A 3WLUA 3ZXLA 4E8CA 3KS7A 4EWAA 4Y22A 4ARYA 1CESA 3B3QE 3K4ZA 1EY2A 1RUJ1 2TUNA 4D0QA 5JIUA 5CADA 1A34A 1RUG1 1WLTA 1IG3A 2BV4A 5DUVA 1UN1A 1UZ0A 2WLPA 4K3UA 5FMOL 1QOOA 5JSPA 2J1AA 3AZZA 3OG2A 3OGJA 5FLHA 4IDZA 4QXCA 3VBFB 5C71A 3HR9A 2R30A 5LBBA 2Y0OA 3OGSA 4D6RA 3DF0A 3SHRA 3TNQA 3W59A 3Q9OA 4HPKB 5ISLA 2GNMA 3NWKA 1JZ3A 2JD9A 4RD7A 3AMMA 1D4VB 2ZGTA 3DGTA 1Q56A 1V9U1 5C4WA 3BPZA 4ATFA 1XXNA 5FPXA 1RUF3 4JTOA 1GNYA 4ZXEA 2JG8A 2H6BA 1UIJA 2YC4A 3TB0A 3VB9A 1NA1A 4COWA 4LLOA 3H8XA 1PO22 1W04A 2WFF1 4FOWA 4O61A 3WF3A 2RMU3 2GMEA 3WNNA 2IXJA 2FDHA 1XC6A 3IDAA 5DAWA 5J09A 1ZRFA 4XJ8A 1OT5A 4K9SA 1UU4A 2IWGB 3KHBA 4NMIA 4TN7A 3PJQA 3ROUA 5A1LA 1PNFA 4NAMA 4YGEA 4RR3C 1OXCA 1BBT2 1OOPC 2W92A 3I59A 5BNOB 1N1TA 1LGNA 4P9XA 1AL22 3ELNA 5JZGC 1HXS3 1TMF2 1TNFA 1W8NA 3JD73 4RGGA 3C7OA 4IW3A 3VD4A 2JKBA 5K7PA 3U75A 5JPMB 3ORJA 3CLPA 2JG9C 2L9LA 2HEYF 3VD7A 2KA3A 4NIGA 1Q3EA 2J42A 2YC0A 2D6KA 5AVPA 5IJRA 4DOUA 2J1SA 2J7MA 1E5HA 2FZ2A 1I5ZA 1O3TA 1W9FA 2VZ3A 2RR11 1S0CA 2EAAA 4Y4YA 4LEJA 5F3GA 5C5TA 3MLJA 3G7DA 1RHI1 3R4UA 4Q27A 2ZBJA 1SLCA 1S0BA 4N53C 2X29A 4AEDB 1XJAA 1DG6A 2P3JA 1VMHA 3WZ1A 5K9YA 2B5HA 1ZA4A 3GYDA 2XBO1 4QPIA 2V5YA 1AR61 5DPNA 1CAWB 1HV1A 2WRAA 4GA9A 4KWUA 2R32A 4AVCA 5I0SA 1DP0A 5EZWA 3BTZA 1GP6A 1N3OA 5FTTC 1K45A 2BP6A 1HIXA 1K12A 2JDZA 3VBSC 3BI3A 2BWAA 5GZGA 3E1F1 3N9LA 3RJ2X 3VN4A 4FP3A 1WMXA 4MX3A 4CDXB 4FAGA 5A1FA 4GH4A 5CKMA 5FYSA 4RL7A 3AZYA 3AMPA 2B39A 1VPHA 4GB32 5LEKA 3ILFA 2MPFA 4HN0A 5H9PA 4PDWA 2WQ4A 2MEV1 2O8OA 5KHHA 2PAKA 5KHGA 2HWD1 2RHPA 1D0HA 1U5XA 1XOYA 5CYYA 3RQ0A 3ZFGB 1SCSA 2DF7A 4YZ5A 5EIYB 4Z07A 5JXIA 1NLRA 5C9AA 5HV4A 2OUHA 1BMV2 4XJ9A 1FAYA 4ZXKA 3KMHA 4MGYE 3AJZA 4AYUA 4EROA 3WW2A 1Q8OA 2VC9A 3F2ZA 3HN1A 4DXRA 1V70A 5J37A 3S5AA 3I7DA 3EQEA 3H8UA 1XSRA 1TME2 5FPAA 1RUJ3 2UWBA 5FOJB 5JLVA 1AUYA 1RUG3 2D6PA 3C3VA 1VBA1 4IEQA 4N53A 2B42B 3P1IA 1V6NA 1OUXA 5LWBA 2QZ2A 2BOIA 4F3JA 3HT2A 3POEA 3UESA 5C3OA 2LRPA 5L9BA 1N1VA 4M01A 1X33A 5KC5A 3RZZA 1RUJ2 4WVVA 2ES3A 2WC2A 4FPKA 3WQBA 1RUG2 1W6MA 3VBSA 1W6PB 3RNSA 4ZS2A 4QM8A 5EQUA 4YM3A 1CIWA 5HXMA 3N7JA 3NJZA 3ZFEC 2WNUC 1XQNA 3SCHA 1K5JA 1V9U3 4YWAA 3MLKA 1BZWA 1DLLA 5IHRA 5C8CC 4I3PA 2YY1A 1KXGA 1X9PA 3KCXA 4DEQA 4LBMA 5BY5A 2OZ6A 3OBAA 5LATA 3GCXA 1J3PA 1AYN2 1VRH1 4DXTA 4OMCA 1UL9A 1OD5A 3EYPA 2H0BA 5AFEA 3IT8A 4CCEA 2FDGA 5A32A 1FV2A 5JMOA 2Z2SB 4UW5A 3VKNA 1J84A 2Y26A 5GZDA 1YWKA 1VBC1 2P1BA 3FMGA 1C4RA 3JQWA 4XIKA 4XIOA 2WFF2 5DN2A 4CDWA 4F8AA 5IK7A 1Y3TA 1W90A 1DQ4A 2JB8A 3VBHA 5GLWA 2OPWA 3H7YA 3FUOA 3N35A 3VZLA 4WM7C 3N9QA 3O1OA 4LHNA 2D40A 3I2JA 1RUE1 2JDHA 1H1MA 2VZVA 4PJYA 5HV0A 5CKNA 5DZFA 1AYM2 3FBMA 3OPZA 4HKOA 1BVP1 5FZGA 2P37A 2EVXA 2W1SA 2CSGA 1ZRCA 1PK6C 1CAVA 1RHI3 3IN9A 4NRPA 5JXGA 3I2IA 3Q8BA 5AC92 2R073 5EXOA 2V4AA 3ZR6A 4NWVA 1OSGA 4LT5A 1DYPA 3U78A 2ZACA 3VKOA 3T2TA 2XBO3 1F4AA 1QJFA 3OSDA 2E7QA 2A6VA 2RR12 4N90A 2OQ7A 4Y26A 2R1DA 4BQ1A 1RHI2 3ZFEA 5GZFA 1S1AA 4EJRA 3VBUC 1UX7A 5FPUA 5EWSA 4FSJA 4GALA 1NCQC 5FY0A 2WO2A 2XBO2 4UAPA 3H1YA 1AR62 4ASKA 4YW5A 3K77A 4RFT0 4YG0A 1DF0A 3C7EA 1UOFA 1VAMA 1C1LA 2VG9A 4QX0A 2BNNA 5K8SA 2DU1A 2O0OA 3M3QA 4Q5OA 2G9FA 2Q8OA 5DZEA 3CNAA 1WKYA 2WT2A 1LHOA 2C4XA 4JDNA 4AZZA 4DXSA 1OVSA 2MEV3 2UWAA 3IDCB 3NV4A 1XNCA 5EFUA 2VMGA 1O4YA 2HWD3 5FUIA 5FZ6A 3SH5A 2AGSA 3JBG2 1WD4A 5FP3A 2XJQA 3RPQA 4GD4A 2F6BA 4LKEA 1HRV1 3MLLA 5F9TA 4WM7A 2VZOA 5ABJA 4C1WA 5A6ZA 2G9GA 3LGRA 3R6SA 2Q30A 4YLZA 1ND2B 4OUMA 1S0GA 4YARA 4BWOA 4Q29A 4RFRB 5A33A 4Y1VA 1VLNA 1H1AA 4RQPC 4U36A 5FZ3A 4C91A 3DPRB 4NHXA 1MR5A 2E31A 2TNFA 3CJIA 5FUNA 1VBA3 2ZEYA 5FY8A 1F5JA 1WLCA 4FPGA 1WCSA 4Y22B 5FYCA 3WNKA 5KXEA 3PMEA 2FD8A 3MZHA 1JBCA 4CZSA 1CPNA 2B7YA 2P17A 3A4UA 3KF5A 2ZJCA 3H50A 1ZBE2 2Y64A 1ULOA 2YPDA 4HETA 4AXOA 4COYA 2BNMA 4LNVA 4K8FA 2VOWA 4CA9A 4ITCA 4QXBA 5JPNB 1KRIA 5F1RA 2VW1A 3HWJA 5EJZB 3VLBB 3WINE 4RS5C 4YGDA 2XL9A 5FXVA 3CKHA 1DBNA 2XUEA 4HSJA 2JENA 4QD2A 5A80A 1ULEA 3VZJA 4AHZA 3LDKA 3MPBA 2CGOA 2D6NA 1YFWA 2VBDA 1GSLA 1ZZCA 1K5MA 4UFMA 4XABA 3TBDA 3POIA 1VRH3 3MYXA 5C4WB 3NJXA 4ATEA 1GOHA 2IXCA 1BVVA 2VCBA 2LROA 2VUJA 1W8HA 2JG8B 1WUVA 1G8WA 4IEOA 4M0NA 4XE9A 1NA1B 3NNLA 2GP5A 5FP7A 3S30A 4BXSV 3RZMA 3VBFC 1C57A 4H2AA 1NE6A 1GMMA 1L7RA 2PQSA 4JHZA 4QX1A 4XF4A 1VBC3 5IVBA 1YQ8A 3OGRA 2IXLA 5BUVA 5K4LA 4E2SA 1BXHA 3ACHA 2XJPA 1RUI1 2GH2A 1PGSA 2XUMA 4NHLA 5JXJA 1AHSA 2Q1ZB 5FRAA 3N4MA 2VTXJ 3AP5A 1OH3A 4IV1B 3HN3A 1SDDB 1RUE3 3D6EA 3I59B 3LSEA 3MFCA 2GC1A 1BHGA 2VUCA 3RMXA 1G9BA 1YFUA 1CAXA 1V6LA 4CXXA 3BVCA 4AWDA 1ENXA 4QKBA 2XG3A 1XNTA 2GNBA 4FP2A 4LBQD 5I8YA 1VRBA 3KQRA 4QX7A 4XQ4A 5FZMA 3UT0A 1YFXA 2AUYA 2Y0IA 1WW7A 3IAPA 1UKRA 3PIJA 4AOCA 2WZ8A 2R7EB 1KITA 5A3LA 1D0GA 1GBGA 4AVSA 2JX9A 4QU1A 1UXZA 5F8PA 4HVQA 5BNOC 1QJY1 1UWWA 3O1VA 2P3KA 2VZTA 2GNDA 3KCCA 5DAQA 4EZ4A 4LBNA 4RS5A 1LTEA 5E6HA 4JVAA 3FWEA 4OHVA 5J7MA 4AAXA 2EXHA 1BYHA 4QPIB 4EN9B 3DV8A 2ZGMA 5IT6A 3ECQA 4Q1PA 1ODNA 1QQP1 1XE8A 4CSWA 2SBAA 3RVHA 2F4PA 1UPIA 2RM23 3MGUA 5FZFA 2HWC1 4XUPA 1WMFA 3OPWA 1R082 4WVMA 3V0AB 3LF7A 4IGPA 1MS3A 4YVWB 2WZPP 1X8MA 4KU8A 4GH4B 4Y24A 2DCKA 5J48A 5FAXA 3VBFA 3ZMOA 4AEDC 1Z78A 1WLWA 3WQ1A 2ZX2A 5L19A 1PVC2 3GBGA 3PNAA 1O8SA 1QOSA 2PHFA 2ZAHA 4IEVA 4QPWA 1RC6A 5BV6A 1JUHA 1W2NA 2ZGUA 3ZX7A 2BZDA 4MGZE 3RZHA 1PHMA 1OLMA 1QNWA 5LW9A 1VALA 4PDWB 4I01A 1S0JA 4IESA 4FAHA 1TZOA 4D6QA 1W99A 3HIFA 3ZN4A 2DBNA 4HG6B 5GLTA 3J9SA 1S55A 1ZZ7A 2AENA 1FOD2 2WZR2 3NAPA 3F95A 4CDXC 5C9AB 3WSOA 4H7MA 4BU2A 4DRRA 5JSOA 4FBFA 1VMFA 5GM0A 5G04L 3BOWA 1HRV2 2CU5A 1W8WA 2VU9A 3ENRA 1PM7A 5JOWA 3V0BB 3AYEA 3MFAA 2DUQA 5FYIA 4L92A 3BU0A 1CZSA 2B4KA 3JB4C 4CEWA 2D6MA 2G9ZA 3KQ4B 2WN2A 1UMHA 2WYSA 3N9NA 1RUH2 3OTFA 5BNOA 3ZFGC 4WZFA 2J1TA 3QD6A 2Y6GA 2Y8KA 2QNKA 4AR2A 5FYUA 1SHWB 4C90A 3ZXGA 2LUWA 2WQ8A 4LUMA 4UW6A 1H2LA 4HBNA 2QQWA 2ZMLA 1QJEA 3MIBA 4LOSA 2Q1FA 4YGCA 1W6MB 2DTYA 3I54A 2FMYA 3SEEA 1G9FA 3OPTA 4AGRA 1FPN2 2F4LA 3M3IA 4XTMA 4XBQA 2V09A 2Q4SA 5H9SA 1NZCA 3RJRA 5KBFA 2FMDA 4FO9A 4X6QB 2W47A 1UQXA 4V2WA 1JH5A 3J4UH 5T5LA 1YRZA 2E6VA 1N1YA 5LBEA 3O1PA 1PGL2 3T4HB 3NNGA 3THCA 4AW7A 2P2KA 2JE9A 1ULCA 4QGMA 5E8AA 1EPZA 2NM1A 4YYOA 1DQ2A 1SFYA 2Q0AA 5A32B 3DL3A 5ACA2 1RUI3 1WA6X 2DVFA 2RDSA 1V6MA 4PHZA 5FY9A 2AR6A 2Y38A 4CDXA 3ZDVA 3AK0A 1OA2A 3ZXFA 4CUAA 3UNPA 2E7TA 1UZWA 4CDWB 1JZ2A 1S2BA 4MADA 1NLQA 1SLIA 4XUNA 5I0TA 3VBHB 2VGDA 4EN6B 1RYYA 4WV8A 1HN0A 2QQJA 2V5DA 1G9DA 4DIQA 2R1BA 5IVFA 4QQOA 3MEPA 5G05L 1DGLA 1QHDA 4NRQA 2Y6LA 2D98A 2W08A 1PIV1 4XBLA 2LS6A 4FVVA 1QF3A 5F39A 2A3XA 5J98B 2OPKA 3WF1A 2PLV1 1PMJX 5IVVA 1YNAA 1QJY3 1ZZBA 1CAVB 1ASJ1 4QU2A 3ITQA 4CXYA 1ZNPA 2DVAA 2IC1A 3AJYA 3ZYGA 1YI7A 5EJ1B 2VMCA 1HV0A 5ANQA 4DEVA 2WO1A 2BGOA 1CZVA 4HMZA 1QQP3 4XDOA 1MS4A 4Y20B 5FBJA 2HWB1 5FKCA 2HWC3 1DYOA 1HDKA 2HJIA 2EXIA 1AJKA 1JYWA 2XQRA 3AL6A 1RUC1 4QDRA 1QQP2 4S2HA 1RUD1 1TE1B 3USUA 4EWEA 2C1FA 3E6BA 3WF2A 3H8OA 2HWC2 2C9AA 2VY0A 4QPYA 5EV7A 1GWLA 3VZOA 2W1QA 1W2OA 3MW2A 3A7QA 4BHPA 4SLIA 3C7GA 2BWCA 2YBKA 5FP4A 3LA3A 2VZQA 4BCUA 2HWE2 4I0WB 2VMIA 2W46A 1REFA 1W0OA 4BXFA 1JHJA 3PUHA 5ABJC 3DXUA 4WM8B 1H8TA 3ZYIB 2EICA 4MO3M 3ZR5A 2E33A 4YM2A 5ABJB 4BOWA 2DUOA 4ZKTB 3RZJA 3GZTB 2YYOA 2Z5WA 3VDDB 4ES9A 4XFAA 4NUBA 3FX3A 5FY1A 3N9PA 3U07A 1UYXA 4PQ9A 5A33B 1W9YA 2RMU1 3EB7A 1AXYA 2XXZA 3NL1A 3VDBA 5FK8A 5B4XA 5LRSA 1DU3D 2UWCA 4MGKE 3UKVA 5IAXA 2KXLA 3CJIB 1N47A 3WF4A 2XB6C 4KWKA 3OEAA 3NKTA 3HVDA 3IIAA 5IFTA 2O8QA 5FZHA 2K46A 5HPOA 1VMJA 1D7PM 1W3XA 4Q0VA 5A7SA 3E5XA 4ET7A 3IIIA 1PZ7A 4NVPA 5D21A 1WGPA 3ZSLA 4DINB 1ND2C 5JVVA 4E8DA 3VZMA 1JZ7A 4AFCA 4XAEA 3JD71 3O14A 1NZIA 1EV11 1F2NA 1WA4A 4JTNA 1UPSA 1H2KA 1R092 2W1UA 1XU1A 3DPRC 3ES4A 3CJXA 4LHLA 3U0ZA 1Y9MA 1WMDA 3RI8A 3L9JT 5DG2A 2P3IA 4NPLA 2W3JA 1K5MB 4AI0A 1JMUB 4YM0A 3HOBA 3VHNA 4AE2A 1ST8A 4W6YA 2Z69A 5T5OA 2ZX1A 3WG3A 2R6QA 4XF3A 5HXVA 3VKFC 1FT9A 2OYZA 2D3PA 5FYZA 1LOFA 1C5HA 1QH6A 2BUKA 4JRLA 4LOTA 3T4VA 3ZSEA 1SLLA 2RDRA 2OVUA 3D5OA 3KB5A 4N7UA 4Y33A 3MV01 4DZGA 2AEYA 4I2OA 2P5BA 2EALA 1A8DA 2AH2A 3BODA 4LE4A 4XZUG 2CAUA 1QJZA 4UFHA 2CHHA 4M4RA 5C4WC 5GZCA 2WNEA 5EJ3A 1V6IA 4ASMB 2P4EA 2JICA 2KR2A 2JG8C 5LB6A 1GV9A 1LULA 3I49A 1NA1C 1CAXB 1PIV3 2B9VA 4IE7A 1AR82 4FPJA 2XLAA 2CGNA 3I2DA 4LR4A 1D2QA 3ZLIA 5A7PA 3SKVA 2PLV3 3KD4A 2YZ4A 3HBKA 4WBBA 1H1IA 1EPWA 1H6YA 3Q8EA 1ASJ3 2NYYA 1W2TA 4QPGA 3UV9A 2JIJA 5JOZA 4IV1C 3FL7A 1F8VA 3UGGA 4OHXA 4AI2A 3LAGA 2I07B 4CU7A 1YJLA 3FHQA 3POWA 1QDCA 2A3WA 2DFCA 2HWB3 2Y33A 1JZ5A 4W6WA 2DBIA 1POV1 2YV8A 1MZ6A 1O3SA 4CCKA 2VO5A 1W2UA 4PIXA 4E2QA 1ULGA 4YPJA 2NP0A 1PVXA 3H8RA 1RUC3 2ZGLA 4QQLA 1UIKA 2A7AA 4OUSA 2QQKA 3RYPA 3ZKYA 5I93A 1UZYA 4GXLA 3ES1A 4G3YC 4GKXA 1VE0A 1RUD3 4MSVA 3U14A 1U5IA 3FHIB 2HWB2 4WVMB 1BJQA 5FZ0A 3WUDA 4Q4W1 3ATGA 3AL5A 3HEIA 2XWJB 1DCSA 4PCRA 5FWEA 4L0PA 1RUC2 2ADEA 3EXUA 4MGSA 3ZPYA 5A6XA 2JDUA 2E53A 1FXZA 2XQXA 4QPIC 1GP5A 1O8PA 1RUD2 2V73A 1UOGA 1DQ5A 4P9GA 3WOGA 1RITA 3HBZA 4J1XA 1SPPA 2P34A 5BNNA 2ET7A 3BTYA 4RGKA 4B4PA 2AEZA 3NNMA 3S7IA 2Y6FA 2OA2A 1V6KA 5CB7A 4AF9A 1N1SA 4OZXA 3I3BA 4GULA 4YW4A 1POV0 2O14A 4YVWC 3NAPB 4KWLA 4GH4C 1D2SA 4EN0A 1UY3A 1Q5OA 3FFZA 1LU2A 1YI9A 3M8LA 4AG4A 4QKFA 4YZ2A 5FP9A 3EMRA 4URTA 1OD3A 4C1XA 2XVLA 4KMQA 1CN1A 2WFPA 1KFXL 3ON7A
chains in the Genus database with same CATH topology
2FZ1A 4KGQA 2WWSA 1XRUA 1BEV1 1O3QA 2QE3A 3AZVA 1RUF2 1ZZ9A 4PDWC 4XJUA 3J8F1 4ES8A 4CEWB 3NV3A 3ZIWA 4IV1A 2IXKA 4OULA 2VVDA 3O12A 4IV3A 2RMU2 1DQ1A 4COZA 5JI7A 1BCXA 1QXRA 5C9AC 5GKAC 5BNPA 4YZ4A 1ENQA 1EV13 5IK8A 5FQ0A 1H4GA 1ONAA 4G9SB 4FXKB 5LK5A 4AFMA 3A0KA 1CONA 1WBLA 1HXS2 4OHZA 2PTMA 3JD72 1KDMA 2ZZJA 3AYCA 4WZCA 5CFCA 3NV1A 3DUIA 5FBZA 4XJWA 2R071 1UW8A 4AK3A 3SITA 3KT7A 4R9CA 3HD8B 2VXRA 3JUUA 3PJYA 3E6CC 4LO6B 1B35B 4CP0A 3EO6A 4MGIE 4OLLA 4DS0A 2NLRA 3V0AA 1HLCA 1I1EA 3H9AA 3FLRA 3O0WA 1J1LA 4IEZA 4Q0SA 4YVWA 3WP6A 1ZREA 3VHPA 4B4QA 1LCLA 3MIEA 4RSUA 1HRI1 4PLOA 5TSWA 1GICA 4XFIA 1JTZX 4FTSA 4IL7A 3B69A 4KG8A 4P9YA 1NY71 5CFDA 2NMNA 5JDBA 4CDWC 3PTYA 2ZMNA 5T54A 2I45A 3VBHC 1MQTB 1ZVFA 2VECA 2VMHA 3ME2A 4ISRA 3V0BA 1POV3 1M4WA 4BMEA 1H4HA 1WCDJ 2PHDA 1KJRA 1NCRB 1TEIA 1LJ7A 2NQYA 2BBVA 3VUOA 1GQHA 3W9AA 2LTNA 2QVSB 1ND3B 3UL2A 5I0RA 3VZKA 2JEMA 4Q4W3 2QCSB 1LRHA 2GC2A 3MF9A 2ZX0A 3USUB 3SXWA 2PYTA 4MH0E 3LZZA 3TYJA 1VBD1 2XGXA 3K51A 4HVRA 5IUQA 4XYXA 1ZZ6A 1SQ4A 1VIWB 2ET1A 1AR71 1RJ7A 3ZYRA 1X82A 3BCWA 2BVVA 4BLIA 1H8TB 2VOVA 2ZHLA 1OPOA 5FMOS 4YW3A 1RMU1 2GU9A 3B7MA 1V9U2 1BEV3 5L7OA 2GMMA 5L36A 3J8F3 5FFOC 3TRSB 3VBRA 2ZGOA 2YROA 5EYXA 4WM8C 1W6NA 4QGLA 3WV6A 3RI9A 2RS51 1BEV2 3AMHA 3N7MA 2FQPA 4LLFA 1H9PA 5K0UA 5ABJC 4HVOA 2DCTA 4IQPA 2CAVA 4XDQA 4XOGA 1IQAA 4K7JA 1IGOA 4ZU5A 3G6JB 3URFA 3VDDC 3P3NA 4K20A 5FREA 2D3RA 1D4M1 4TSVA 2PELA 2E63A 1CVNA 2BQPA 1OQDA 4BH9A 3CJIC 3WDUA 3WDYA 4BYYA 2OW4A 4KNCA 2WL1A 4R52A 1TNRA 3EHKA 2PHUA 4J1WA 1DFQA 5FLIA 5CU1A 4MLOA 4KL1A 4YVSA 1KFUL 4Y20A 4E4SA 3AM2A 1QXPA 1A78A 3M1HA 3OD0A 5DG1A 2R072 1CJDA 3ZVXA 2QKDA 4K1YA 3WR0A 5J96B 2RM21 2HWF1 1OI6A 5E16A 3UJOA 1HRI3 4JRAA 1K5MC 2IXIA 3OY8B 2CV6A 3AKRA 3B9CA 1ULDA 1LOAA 2XVKA 1HRI2 4WM8A 2W39A 3POSA 3RWNA 4N7IA 3VL8A 3RDIA 4D3WA 1KJLA 5BPXA 2ZOEB 4KGGA 4QPGB 1XYNA 4Q8LA 4DB5A 3VDDA 2MEV2 2ZGSA 3O5SA 3OBRA 5T55A 2HWD2 3H7JA 4CTEA 2R49A 4FOQA 4IEXA 2A71A 3N7LA 4ONUA 3GNEA 4ASLA 4Q0QA 4QGNA 1SCRA 1JYIA 1LU1A 4XXAA 3CEWA 5JOYA 2NN8A 3UJQA 4OI4A 2A3YA 1IPKA 3ZN5A 4O9GA 2D5HA 2MHFA 4LUKA 4D69A 2DCZA 4CDQB 1RUOA 4AEKA 1VBA2 3ZO0B 1VBD3 1SLBA 1C28A 2NPIA 1PZ8A 3VZNA 2AZ5A 3NW4A 3ZSKA 3ALQA 4NWWA 3NVCA 5CG9A 1AR73 3ZMNA 4AVBA 5T3NA 2WNVB 5F6KA 4QT6A 4B7EA 5BNNB 1C8NA 2WT1A 3AMQA 4R4XA 1PO11 5EYYA 4AI3A 2GH8A 4FXGB 2WT0A 1RMU3 1MS1A 2Q1MA 3M4FA 5FDBA 1GANA 4Q0UA 3SMHA 3WHUA 1J59A 2HKXA 2ZGNA 3N7KA 3WQ7A 4C0BA 2GN7A 3PVOA 1JW6A 1VRH2 3VHOA 4XILA 4TZDA 1OQEA 1QY4A 3B01A 2B46X 2X5IB 2JE7A 2RS53 4UW4A 4LO7A 3AMNA 1MVEA 1OA4A 4IV3B 3T1MA 1VBC2 2BGCA 1J58A 2ARBA 3NAPC 1GNZA 4R9DA 5BNPB 4CYDA 1D4M3 2RS31 5DZGA 3TOJA 1OPMA 1EP0A 3C2UA 2RS52 4K1ZA 5FQ0B 4AEMA 1ZRDA 2CYFA 1RUE2 2SLIA 5D8AB 4AQSA 4CEWC 1XYPA 3WNXA 3B5LB 1D4M2 3PMSA 4K21A 5CFCB 2R061 4FTEA 2ILMA 1X7NA 2Q5TA 3IMNA 4E4DX 4R9BA 4A7ZA 2BVBA 2BFUL 5FO7B 4DRRA 1QU0A 2PHRA 1NXD1 3AXDA 1DQ0A 4L97A 4LBJA 2QDRA 4E27A 2OZJA 3AKPA 4H7LA 3WDXA 1WCKA 1T6GC 3ETQA 2HWF3 2CL2A 4XBNA 1PGW1 1I3HA 3KM5A 3B93A 2GZWA 2GNTA 5DDJ3 1O91A 3KCYA 3CU7A 4D7SA 4R8HA 5HI0A 5JIAA 2RM22 1S0EA 2HWF2 1C8M1 4C0HA 1B35C 1RB8G 2W52A 3OGGA 4L99A 4L8QA 3FE5A 1NOVA 2W68A 2CTVA 2OIIA 5CFDB 4XFFA 1RUNA 5JI9A 1LB2A 1BKZA 2UYBA 3LKJA 3WG4A 4XF1A 1SEFA 4CP1A 1UD1A 3LOIA 1WBFA 2QUOA 1ZBA1 1DHKB 3IPVA 2CY6A 5C6CA 3R4DB 1QJX1 3MIDA 1IPJA 1OFNA 3APBA 3OCPA 4KWJA 3WD5A 4XETA 2ZHNA 3D8CA 4YNIA 5JMCA 3MICA 4N9IA 1DYKA 1SFNA 4OI1A 1N3QA 3D0JA 4FOYA 3INAA 1MQTC 5T52A 2A6XA 3DN7A 4I3GA 4W6XA 5GLUA 3IM0A 4YRDA 2QDNA 1Q43A 4LBOA 4HLTA 1NCRC 3AP4A 2VVFA 1PO13 1MZ5A 1ND3C 3PVEA 4AQ2A 1LR5A 3U4XA 2JJ6A 4I02A 3WT3A 2KM2A 5C33A 1B35A 1FMD1 4M3CA 3QCWA 3USSA 4FT8A 4EWDA 5L7OB 4AQ6A 1FNZA 1OQ1A 1R1A1 2VNOA 3AFKA 3MF6A 2XPJA 4I30A 1URXA 1VBE3 2PQQA 3VBRB 1KS4A 3EJKA 4NN0A 2QZ3A 4Z82A 1RINA 3FFQA 1MS9A 1W6NB 1H8TC 4YGBA 3POYA 3AYDA 2AREA 2RS33 5K0UB 1RUI2 2NZ9A 2YHJA 1EYBA 1Q8SA 3WG2A 5CVRA 2ETEA 1JN2P 5A3MA 4BE3A 4QQHA 4LO4B 1DZQA 2D43A 4S2DA 4N43A 3V65A 5B2GB 2K2SA 2EXJA 5L73A 4XHXA 4M3CF 1YO8A 2R063 1MQTA 2XHKA 1FATA 1WD3A 2JD4A 4HFSA 3FLPA 2WS91 4YVSB 2G4IA 1NCRA 3AP9A 1IKPA 4JC1A 1QJY2 1IZ3A 1ND3A 5FO8B 3IDEA 1LESA 2B45X 4JGZB 1JOJA 1AR91 5C8WA 2XLFA 4HK8A 1ZYBA 1QJU1 1DGWX 4TLFA 4XFGA 3IWZA 1J3QA 4A3XA 1U12A 1ZX5A 4XQDA 2XL7A 4CRQA 1C8M3 1PGW2 3E6DA 4YSFA 1CGPA 2PAMA 1CQ9A 2YGLA 5GALA 4LA2A 1LOFC 4BM8A 4IEPA 2GC3A 3BOPA 3E5QA 4MXVA 4AVAA 2D93A 2TEPA 2VQ0A 1AVBA 1MEC1 3UKNA 3JQXA 4Q0PA 3X29B 4ZU7A 3KT1A 3VKLA 1ZBA3 4UW3A 5I91A 4HSLA 4KBBA 2ZX3A 1QJX3 5I8TA 2DUPA 4Q4Y1 4B4RA 4LO5B 1QNYA 4AFDA 3RMYA 1HX6A 4XQWA 3PLQA 1ZBA2 1PO21 3MIHA 1FV3A 1TQ5A 2WLQA 4QPGC 1U0AA 4B29A 5LEJA 4JGYA 3IKWA 1DDLA 3AFGA 2IXHA 1E57A 2EA7A 1CD3G 2TBVA 1A6CA 5FLJA 1BBT1 1REDA 4AFAA 2XJUA 4HKLA 2ZKLA 1AL21 3VHRA 2ZHKA 3U10A 3R4SA 3AKTA 3H1WA 4LTAA 3ILNA 1JHNA 1FMD3 3TN91 5AVAA 4YG3A 3FBYA 4JAAA 4CDQC 2DYCA 1R1A3 4QXKA 1COV1 3TWIA 3VBOB 3AKSA 1NG0A 4SBVA 4AVVA 2ZGKA 5I0UA 2WNVC 2R043 2PHTA 4HT1T 4DFSA 3R05A 2D5FA 5BNNC 3GBWA 2A5ZA 4XHBA 4ISQA 2DFBA 3MI8A 3MIGA 3OY8A 2WKKA 2UY9A 1UX6A 3ZXJA 2IFRA 1F5FA 4HL0A 1DQ6A 1Z0HA 2HYKA 1GKBA 2GSYA 5GZEA 1VBB1 5KWRA 1GLHA 2D44A 4XXPA 2GN3A 2X5IC 3HMYA 2ZKNA 4XFCA 2A6WA 4AI1A 4OHYA 1PIV2 2I74A 3ASIA 3QACA 5HCAA 1CPMA 1YHFA 4IV3C 2VULA 2WS93 4HKWA 1BQPA 4IEWA 2PHXA 3ILRA 4QX5A 2PLV2 2ZCWA 5BNPC 2Z42A 4PBOA 1ASJ2 1VR3A 4NPRA 5CA6A 3WX5A 1GZWB 1AR93 4QM9A 1O7FA 5D8AC 4GQ7A 3R0RA 2WS92 4PF5A 1QJU3 1AX2A 3D0SA 1Q8QA 3AZXA 4R9AA 4CDQA 3I4IA 2DTWA 4DY3A 5CFCC 4OHWA 4AEJA 1W6OA 3CO2A 1TME1 3WDTA 4I0AA 3UKTA 3ZSJA 4DY5A 3H3ZA 1MS5A 4FPFA 2HEVF 4L2NA 5E89A 2WNVA 5FOBB 3ZFFA 4CDUA 3WP5A 4A2UA 5J3UA 4P5HA 3U11A 1X8EA 2ZGPA 4QHBA 1MEC3 3GHNA 3M2MA 4QQPA 2DV9A 2EXKA 3MIFA 2BPA2 4WVWA 1WW5A 4KU7A 1NLSA 4Q4Y3 4Q1RA 1O3RA 3T1LA 2WSVA 1MEC2 3IPVB 1FX5A 2X5IA 2XLGA 1PO23 1AYN1 1AL0G 3M7AA 1MACA 1ZRRA 4Q4Y2 1H2NA 4ZU4A 5CFDC 4XJAA 2PA7A 1AZDA 1VB2A 3DKWA 3RG0A 1V00A 3M3EA 4META 3SLIA 4D94A 1BBT3 2YDEA 3OD4A 1J3RA 2RE9A 4LE3A 1LODA 1AXKA 2WJSA 2XVGA 4Q4X1 1AL23 1CAUB 5D8AA 1TMF3 3P3PA 2VNRA 4TWTA 3ACLA 1VJ2A 1JUIA 2XJSA 1EV12 3B00A 3TN93 1G9CA 4B8EA 5KHKA 1AYM1 2UY8A 1DGWA 2DURA 1LGCA 1AX1A 5FPZA 1COV3 5T50A 4M3CB 5AC91 3J26N 2YPJA 5CBLA 4GMP3 3JU9A 2XKOA 1QDOA 3SCGA 3TN92 1OA3A 2PAEA 2YGMA 1LEDA 4IERA 2QJVA 1KDKA 4H3WA 3WQ0A 1A8MA 3B9IA 4MUVA 4AHWA 4CEYB 4Q26A 5FCCA 1COV2 1Y43B 2D3SA 3NKGA 3A0NA 3V64A 5KXCA 3ZYJB 2DWRA 1VBB3 4PIZA 2DVGA 3LA7A 2D6LX 4UBGA 2N7GA 3MPPG 1Q8PA 5FO9B 5L7OC 1PNGA 4GB33 4N43B 3RYRA 1LOGA 4EV0A 2WA3A 2XJRA 3RRDA 3VBRC 3ZDSA 3D4KA 4LHKA 1VBB2 3JBG1 2VOXA 3AKQA 4XJZA 5K0UC 3RSJA 1WW6A 2EIGA 3M70A 4XF9A 1Q8VA 3ZXEA 2R16A 3B02A 1L3JA 4G4FA 4LBQB 2CNAA 2WIIB 1ENSA 4GKYA 3KGZA 4FPYA 4RR3A 3VGIA 4AFBA 5CG8A 1OOPA 1RL3A 1LEMA 1C3HA 4M3CE 5JZGA 4BMBA 3VKMA 1RVF1 3AZWA 1TME3 4Y1UA 1S0IA 2VNGA 1HQWA 2JG9A 4X8PA 2A6ZA 4R4ZA 5E88A 4DQAA 4YVSC 1Y7BA 4FPEA 1RTVA 4Q4W2 1IS4A 1GNHA 1ZBE1 4JGZC 3WCRA 1PMIA 4PLMA 2X53S 1FYUA 2XKPA 2DCJA 1LHUA 4Y5Z0 3D82A 4FTBA 3ZYPA 3LOBA 4PBPA 1XYOA 1AYN3 4MXWA 1W6QA 4DPNA 1ULFA 1SDWA 2ZGRA 3WP3A 1DZRA 1ZZ8A 1HQLA 2GALA 1QH7A 3KT4A 4E4ZA 5AFBA 2BTVC 1SBEA 4BLJA 3J8F2 1U5ZA 2WFF3 4Y1ZA 4E2GA 2MNGA 3WY6A 4JGYB 1W0PA 2GDFA 4Q4X3 3S6PA 4JDMA 1XNBA 1SLTA 4QQ2A 2XWBB 2GC0A 3MW4A 4MYEA 3THTA 4RGAA 1LOBA 3PVBB 1XU2A 4U2AA 3AB0A 1OLQA 1APNA 3ZXAC 1AYM3 3OF1A 4Q4X2 4YFZA 3M3CA 3O0VA 3AP6A 3PHMA 4Y1XA 3GALA 3TNPB 5AC93 2UU8A 1YIPA 1QOTA 3ZXDA 5LK7B 3W58A 1X36A 4OI0A 1YJKA 2OUJA 4JGZA 4OFGA 2PN5A 2RR13 3UK9A 4FPHA 2BEOA 2YMZA 1AX0A 5DDJ1 4D7TA 1AR63 2WQZC 3K48A 4COUA 3GBFA 1R081 1FI2A 1QXJA 2RJLA 3OYWA 1UF2C 2WNUA 3VBOC 2VQAA 2VH9A 1YLLA 4BA6A 5C8CA 1IS5A 1A3KA 4UXAA 3N36A