5AVAA

Crystal structure of pha-e lectin in complex with bisected glycan
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
238
structure length
238
Chain Sequence
b'ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythroagglutinin
publication title Atomic visualization of a flipped-back conformation of bisected glycans bound to specific lectins
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 47
structure length 238
sequence length 238
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5avaA00
2D6PA 1LOCA 1LHVA 2DYCA 2E6VA 3AYCA 4YW3A 1RITA 3AYDA 1S0CA 1JUIA 3WLUA 4GALA 4R9CA 1S0GA 2VY0A 2RHPA 3D5OA 2ZGKA 4Y1VA 5SV8A 1Q56A 4M3CF 4XHXA 5T55A 3UL2A 3GALA 4XE9A 2W08A 2ZGMA 3N3HA 3V65A 3BOPA 3MEPA 2EXJA 3NV2A 2V5YA 4U2AA 1GLHA 4ZKTB 2A6WA 1PZ8A 1AXZA 3O0WA 1S0IA 2ZGOA 3AP4A 4BM8A 3ZXEA 3R4SA 1KDKA 4C1WA 1G9AA 2GNBA 5GZFA 1ULCA 1W0OA 3AP6A 3V0AB 1UN1A 1QNWA 3FFZA 4FP3A 4FOQA 1ULDA 3RSJA 2R1BA 4XJUA 4YG0A 1HDKA 1ENSA 1LTEA 4BMBA 1VLNA 1O4ZA 2UWCA 1JOJA 1FNZA 1JN2P 2A6YA 2ZHKA 3V64A 4CZSA 2WNEA 2W39A 3AP9A 1UPSA 1ONAA 4PF5A 3WUDA 2JJ6A 4M00A 4Q1RA 2ZMKA 3R4UA 3AZVA 3N7KA 4NO4A 5T50A 2VW1A 3WCSA 5JOXA 4DQAA 1Q8VA 1NLSA 2WSVA 2YY1A 3ZPYA 2WT1A 3WG3A 3T1MA 1G9FA 2EALA 4ATEA 1HKDA 1DZQA 1UX6A 2DVBA 1XQNA 1ULEA 1BKZA 3C2UA 3M3QA 3WG2A 2UWAA 1WUVA 2HYKA 3B00A 3ENRA 4FQ4A 4GA9A 2ZGNA 1MS5A 4XYXA 1DIWA 2NZ9A 3B69A 1SLAA 1MVEA 1YIFA 1LOFA 3CNAA 2PHXA 1O4YA 1LHUA 1LENA 1IKPA 1CESA 2PELA 2Q5TA 3B01A 1V6KA 2AENA 4XBQA 1DQ4A 2YROA 1Z78A 1KITA 2C9AA 1RINA 1W6QA 2GDFA 4ATFA 3VKNA 4Q27A 1BYHA 2CL2A 2R1DA 3POWA 1N1TA 1CR7A 3B3QE 3RS6A 5GZDA 3OYWA 1HLCA 4P9XA 3MPPG 2YXSA 1IS4A 4FPHA 3OPZA 3WDUA 2BQPA 2ZMLA 4P14A 4BOWA 4ISQA 1Q8OA 2E51A 1AF9A 2A6VA 3VKLA 4TZDA 2WLQA 4XXAA 4XOGA 1G8WA 2EXHA 2ZHMA 2LALA 2ZABA 3OJBA 3PVNA 1AXKA 2EAKA 4ITCA 4Y26A 5DUXA 4XJAA 3IN9A 3ILRA 5KXBA 2G4IA 2WT0A 1GANA 1GNZA 3N36A 3USUA 1BJQA 2D6NA 2JECA 1GICA 2GN3A 4YZ5A 4GKXA 5EYYA 1LHNA 1Q8SA 1SBEA 4BPZA 3QLQA 4K1ZA 4UW3A 1DQ6A 3SITA 1AXYA 2DVAA 3BODA 3POYA 1LECA 4LBNA 1QNYA 3U4XA 3FUOA 5JMCA 2C5DA 1ENQA 1U0AA 3NV4A 4TYSA 3UJQA 1QOSA 2A5ZA 2VXRA 3AP5A 1S0FA 3H0OA 3WDYA 1SLBA 3OYWB 1LCLA 1LGNA 5GZCA 2A75A 3V0BB 3AZXA 3WHTA 1VAVA 2PHWA 4YLZA 1C1LA 2AR6A 1W6OA 2D6LX 1R1ZA 2VU9A 1OKQA 3PVEA 4JCKA 4YZ3A 4WZFA 4C1XA 5JDBA 1YYNA 5GLVA 1KDMA 5CAZA 4R9AA 3GNEA 2SBAA 2ARBA 4AGRA 3OBRA 5DXDA 1APNA 4DFSA 1SBFA 3USUB 1DLLA 3A4UA 3ILFA 1YXWA 4XBNA 3UK9A 5JOYA 5GLUA 4WV8A 3V0AA 4DPNA 4FPEA 3WNXA 3ZSJA 1WW7A 1PZ7A 5H9QA 1HQLA 3IKWA 1UKGA 2DU1A 1AX1A 2CWMA 4FPJA 2P37A 1JHNA 2NMNA 3D4KA 4FOWA 1Z0HA 1W6OB 2ERFA 3LSDA 5E8AA 1LGBA 1V6LA 2B7YA 1D0HA 2A7AA 1LJ7A 4P9YA 1AJKA 1LHOA 2NYYA 3FLTA 1CPMA 5DUVA 4Y1XA 4BMEA 2ARXA 1JYIA 2GNDA 1VALA 3SNMA 3OBTA 4LBQA 1KRIA 3KM5A 1D2SA 1H9PA 3SLIA 4BQ1A 1N3QA 5KXEA 1UL9A 1JW6A 3OGGA 3WVJA 4Z8BA 2DV9A 4XZPA 5GZEA 1DGLA 3DUIA 1QDOA 1S1AA 2D3SA 3FUQA 4LBOA 5H9SA 1CQ9A 1JYCA 3M3EA 5DZGA 4KBBA 1DFQA 1F31A 3I4IA 3QCWA 1N3PA 1VIWB 5L73A 2ZGQA 4YM0A 4FPYA 1SCSA 2FHRA 1DQ2A 5T5JA 4Q1PA 5HCAA 4BLIA 4K21A 1FX5A 1W6NA 1GV9A 5IK8A 1MS1A 3AZZA 5F5QA 4HANA 1BZWA 1MR5A 4LBQB 1LU2A 1V6JA 3RG0A 2OW4A 3ZXFA 1LU1A 3AZYA 4XBLA 3WDTA 1G9CA 4Q26A 2ZBJA 1IS3A 3A0NA 5T5PA 3ASIA 1WW5A 1X50A 4M3CA 5GZGA 1W6MB 1IKQA 5DZEA 5JOZA 2PHUA 1AX2A 1LODA 1SFYA 2CYFA 1LOEA 1DHKB 2D6KA 1CPNA 1LOBA 1H30A 1ZA4A 1I1EA 1S0BA 1GZWA 5IK7A 4FPLA 3PVOA 1DQ1A 1MS4A 4FOYA 3AXEA 5T52A 3WDVA 1BQPA 1LEMA 4GXLA 2GN7A 2DURA 1FYUA 2CTVA 4AGGA 5HCFA 3AP7A 1MZ5A 5JOWA 3V0BA 3UJOA 1B09A 3WUCA 1C57A 1JBCA 2NN8A 1W6NB 4YG6A 3LCPA 4YFWA 3POSA 4LBLA 3WG1A 5GLZA 1FV3A 1MVQA 4F83A 5KXDA 3M2MA 5DUUA 2EIGA 4NOTA 4DRRA 2D44A 1WW6A 4FPGA 4M01A 1N3OA 1C1FA 1LOAA 2OUJA 4XHBA 1LOFC 5LK5A 2R0FA 3AYAA 3O5SA 1MS3A 1ULGA 3B9CA 2EF6A 4M3CB 1A8DA 2UURA 2OVUA 5H9RA 4XIOA 2PHRA 1GZWB 5CB7A 1UAIA 1MZ6A 2R0HA 4YG3A 2P3IA 1FAYA 3T2TA 4ISRA 3Q9OA 1DYPA 5IK4A 1MS8A 4UW4A 2D6OX 1V6NA 1RIRA 1GNHA 2W68A 2ZGPA 4PBPA 2GALA 4PQ9A 4LBQD 2GNMA 3M1HA 3ZXKA 2P2KA 5DG2A 3WDXA 2JKBA 1WBFA 1LOGA 4H55A 4YGBA 3FLRA 1AX0A 2NM1A 1LESA 4LBMA 3NV3A 4XJ8A 3WOGA 5IUQA 3NV1A 5EXOA 1AJOA 3INAA 3HMYA 3JU9A 4AVTA 4YM3A 1WW4A 2CY6A 1WLCA 3O0VA 2DVDA 2DUOA 1H9WA 3VKOA 1G9BA 2YMZA 2DU0A 2PHFA 2ZGTA 1F9KA 3KQRA 2D3PA 1YI7A 2DUPA 2WQZC 4XTMA 2YZ4A 1CIWA 2V73A 1WCSA 3VV1A 4XMIA 1UMZA 2ZHNA 3ZSKA 1SLIA 4MYEA 2AH2A 3MW2A 3MW4A 3TB0A 2ES3A 1G9DA 4WVWA 1G86A 4FPOB 4XXPA 5CA6A 3SISA 5FREA 2ZGLA 1UZYA 1OQ1A 2VW2A 4D69A 2AREA 2YV8A 1CJPA 1ZM1A 1UZZA 1WLDA 2VH9A 1FATA 4GWNA 1V00A 3SH3A 4AGVA 1Q8PA 4OZXA 4YW2A 3DGTA 3W58A 1V6OA 2E53A 3N7LA 3VUOA 1DQ5A 1BXHA 3O0XA 5HCBA 1NXD1 2DVFA 1OFSA 4FPFA 5DZFA 4AWDA 4BLJA 4P9WA 3D6EA 4Q2FA 1W6MA 3BIWE 4FVVA 1AZDA 4HL0A 1LEDA 1V6IA 1MS0A 1VAMA 1A78A 1I3HA 2A6XA 2H0BA 2ZKNA 4FQZA 4K1YA 4DRVA 4IQPA 1URXA 2A3WA 4YW5A 3ZYRA 1DYKA 2VUAA 2ZZJA 4SLIA 1QDCA 1S0JA 4XJZA 5E89A 5GLTA 4FP2A 3ZXLA 3T1LA 3I8TA 1GSLA 1PZ9A 4U36A 4CRQA 2DUQA 3ATGA 3VKFC 2WKKA 3APBA 1A3KA 2ZACA 2NP0A 4XDQA 2DWRA 4XIKA 3L2YA 5CNAA 2P3KA 3R05A 4R9DA 1SCRA 5EWSA 5E88A 5GALA 4YM2A 4Q8LA 2PHTA 2D6MA 1HQWA 1GZ9A 2P3JA 1GKBA 1QF3A 3RRDA 1S0DA 2E7QA 2E7TA 1MACA 4Y22A 5T5LA 2EXKA 2DTYA 2SLIA 1ENRA 3M3CA 5CBLA 1GZCA 1W6PA 5FRAA 4YGEA 4R9BA 1LHWA 1QKQA 1QU0A 3IPVA 4W65A 4Y1YA 5EYXA 3WV6A 2JD4A 4Y1UA 4ZXKA 3W59A 1KJRA 3A0KA 3ILNA 4UW5A 1G7YA 1SLTA 4FPCA 3N7MA 5IK5A 1CONA 1EPWA 4Y20A 1DBNA 2P34A 2ENRA 5KXCA 4JRAA 3ZVXA 4XTPA 3FBYA 1KQRA 2ZGUA 4WVVA 2D3RA 3WCRA 5GLWA 2KM2A 3IM0A 2AGSA 3RMXA 2GMPA 1F5FA 2CNAA 3FLPA 5T54A 4M3CE 2ZGRA 5JVVA 1DQ0A 1GBGA 1TEIA 2FMDA 3PJQA 1CVNA 2A70A 4LBKA 5GM0A 3HN1A 5BYNA 4XMAA 3ZYPA 4XILA 1N1YA 4Y22B 4RL7A 1WD4A 1V6MA 2UU8A 1KJLA 1Y7BA 4YM1A 4CTEA 4YZ2A 3AZWA 3ZSMA 3AYEA 1W6PB 4YFZA 2WJSA 5F9TA 3IPVB 4DS0A 1W0PA 4Q8KA 2AUYA 2W52A 2I2SA 2R49A 1FV2A 2NMOA 1IS5A 1FNYA 1ULFA 2DVGA 4ASMB 5DUWA 3BTAA 4JC1A 4Y20B 2GMMA 1CN1A 1S0EA 1WLWA 4Y1ZA 4AYUA 5T5OA 4YZ1A 4AVSA 3HR9A 3IMNA 1QMJA 2OUHA 1QGLA 1N47A 3WG4A 2TEPA 3LSEA 1IOAA 2D43A 1J1TA 3SH5A 1QOOA 1SACA 2XB6C 1GYKA 1Q8QA 2VW0A 2JDZA 4XJ9A 2GMEA 3N35A 2ZAAA 1JXNA 2ZMNA 1N1VA 1YRZA 4UW6A 4XJWA 4I30A 1W6QB 3MW3A 2DTWA 1QOTA 1WBLA 4PBOA 3M3OA 4L8QA 3SH4A 1LULA 2UWBA 2D7FA 2WSUA 3OY8A 2R16A 2JE9A 3AK0A 3N7JA 2ZHLA 4GWMA 5AVAA 2XG3A 3WHUA 3AJZA 1WD3A 2A6ZA 3NWKA 1LGCA 3TAYA 3AX4A 4PCRA 3RQ0A 1IS6A 2JE7A 2EXIA 3AFKA 1C4RA 4FPKA 5GJ6A 4RA0A 2A71A 3VKMA 3WZ1A 4YW1A 1SLLA 3AJYA 5H9PA 5IT6A 3JUUA 3O12A 1AVBA 2AYHA 4K20A 4Y24A 2WT2A 1SLCA 2GNTA 4GKYA 3AXDA 1MS9A 4FOVA 2A3YA 1SBDA 2Z42A 5JLVA 2A3XA 3ZXJA 2ZA9A 3WDWA 4YZ4A 4YGDA 4YW4A 1YO8A 4AVVA 2CWSA 2LTNA 2ZGSA 1N1SA 4LBJA 5DG1A 3ZSLA 4YGCA 3RMYA 3PMEA 3OY8B
chains in the Genus database with same CATH superfamily
2D6PA 4HKWA 2W1SA 1UY1A 3J7NA 3AYDA 5FYTA 1MQTC 4BWOA 2VY0A 4NN0A 2OXBA 4Y1VA 5BNNA 3P6BA 1X8EA 2OIIA 4XHXA 1CAVA 3UL2A 3GM8A 1D2QA 1UCXA 1BMV1 3LEKA 2Z69A 3MEPA 5AVPA 4FFFA 3TOJA 3I3DA 4IV3C 2JG8C 5I0RA 2VZ3A 4U2AA 5FKCA 2RS11 3I49A 1PZ8A 1DGRN 2YGLA 5IVCA 1RJ7A 4XAAA 2ILMA 2HWC2 4X8NA 2J1VA 4D7TA 2XLFA 4CXWA 2QQNA 2RVAA 1SZBA 1Y3TA 2E32A 3PL0A 4SBVA 4AEJA 1OF4A 2Y6HA 3V0AB 3RSJA 3LE0A 4XJUA 1NX9A 1UYZA 1LTEA 3OEBA 4YG0A 4LK7A 3UKTA 3ZYBA 5BNOA 4OHXA 2ZPXA 4XFIA 4A7KA 3VD7A 2RS33 1FNZA 2A6YA 2J1TA 3ROUA 3PU8A 1NY71 2W39A 4LKEA 3WQBA 2CDOA 2JG9A 3ZIWA 1GQPA 1VB2A 4KG0A 5HXMA 4PF5A 2PA7A 1W8HA 4CCOA 3WW4A 1H8TA 2B42B 4HG6B 4XF9A 4FTSA 1JOPA 3N7KA 4DEQA 3FHAA 2VW1A 3NNJA 5JOXA 4KGGA 2MEV3 5FPXA 2RJLA 2JXAA 3T1MA 1QQP3 4AHXA 5JXIA 2FDHA 2PYTA 1BK0A 1DZQA 3NJZA 4QHZA 3ME2A 4IDZA 2VOWA 4EN0A 4RHV2 2UWAA 4FFHA 3KV4A 4XF3A 2ZGNA 2C6SA 3IIIA 5FZAA 2ZCWA 4XYXA 4Z82A 5A7WA 3B5LB 5FYMA 3VDDC 4QU1A 4YVSA 2IVJA 2EIEA 5FJHA 1LOFA 2JDHA 4BB3A 3GBFA 3MLLA 5JPMB 3DXTA 1LENA 2LROA 2BWCA 3B01A 3QOPA 1V6KA 2AENA 4XBQA 2C9AA 4ATFA 4Q27A 3I97A 1VRH3 1BYHA 1H0BA 1POV3 5J48A 3ZFGB 2CL2A 2R1DA 1ODMA 3B3QE 3JBG1 1K12A 1V70A 1XB9A 2R6QA 2VC9A 4UFKA 1OF3A 2VQAA 5FZOA 4AFCA 2YXSA 5DAWA 3R0RA 3ZN6B 4X6QB 4LK6A 3ZN5A 2RM22 2ZMLA 4E2GA 5JZGA 2E51A 2YG0A 3VKLA 3J4UH 4XXAA 1RHI2 2GZWA 1O59A 5CFDA 1A34A 3PUSA 2LALA 3BU0A 4QX1A 4DXRA 5C3RA 4PDWA 4DB5A 4AI8A 4IE5A 5DQ0A 1GANA 4IERA 5C5TA 4HPKA 3HIFA 2JECA 3KF3A 4AEMA 5FZGA 2W0XA 1EAH1 3ABZA 3H50A 4UW3A 5I8YA 4JKKA 1SPPA 3U4XA 3USSA 3WQ7A 5BV6A 3FUOA 1F2NA 5JMCA 3VD4A 1U0AA 3NV4A 1R64A 1Q5OA 1QOSA 4I09A 4FCAA 4TYSA 1O91A 3UJQA 1S0FA 5F37A 3AL6A 1OQDA 1B35A 1PIV2 2A75A 5GZCA 2BFUL 3LEMA 1RMU3 3KV6A 4YLZA 1C1LA 5E16A 2AACA 3ZKYA 3GF6A 1W9YA 3WNKA 4GMP3 3B93A 1A8MA 5KHGA 2VU9A 3PVEA 2WNOA 2J1AA 5JDBA 2J1EA 3VGIA 1Y9MA 2HWE1 4IGOA 4LE4A 1XC6A 4R9AA 4BQ5A 4UT5A 5M0TA 2DCZA 5I0DA 1Q3EA 5DXDA 1APNA 2ZX1A 2Y6LA 3RI9A 2VZVA 4UOJA 2R30A 5C4WC 5JSPA 4BQ2A 2RR12 3NNMA 1UXZA 5FR3A 3HBZA 3UK9A 2R043 4WV8A 2RG4A 5C3OA 3V0AA 4DPNA 1GQHA 3WNXA 2YB7A 3HN3A 1WW7A 4KG8A 2OA2A 4JGYB 1R083 1QJU2 1HQLA 5H9QA 2JWPA 5CU1A 4QU2A 1AX1A 2ZTNA 2WWSA 4MADA 4D6QA 3BGAA 1VBC1 1JHNA 3WR0A 2R063 5JI7A 3D4KA 2X09A 1Z0HA 1W6OB 4B4RA 3UNPA 2XPJA 1LGBA 1EYBA 1D0HA 2YU2A 2ARCA 2XBO1 3OUJA 2P4EA 4J1XA 1AYM3 3MUZ1 2R32A 1PM7A 3O1OA 1PMJX 5DUVA 4Y1XA 4YW6A 1Y9GA 1HJFA 2GNDA 5FOBB 3VHNA 3OBTA 3HNBM 1UOJA 2OZJA 5L19A 4K9SA 5FZ8A 3KM5A 4UBHA 5JR7B 1H9PA 1ZZBA 2PLV1 4QKDA 3ZMOA 1VBA1 1LR5A 1N3QA 4XFGA 1JW6A 1YNAA 3CDZB 4Z8BA 3LKJA 1F8VA 1R1A3 4XZPA 1AR81 4AI9A 4NROA 4QD2A 1DGLA 1RUG1 4Q0QA 1QDOA 1ZX5A 3I2JA 4LBOA 5H9SA 4BM8A 2ZEYA 4AI2A 3I4IA 4LO8A 4BISA 1LAJA 1OD3A 2FDKA 1ENXA 1KGYA 2BTVC 3GZTB 5LB6A 3ZFGA 1NG0A 2JEMA 2XJPA 2Y6GA 1RGSA 4LIVA 3Q8AA 5HCAA 4BLIA 3WF3A 4LIUA 3MIBA 1VB4A 2Y0IA 4K21A 2CGOA 1W6NA 5FY0A 1EPZA 1GV9A 3ZN6A 4Y5SA 1AL21 3O1VA 1YFUA 3UKNA 4JDMA 1XPWA 2XDVA 4HN1A 4XCBA 1JYNA 2HWB2 1W9WA 3AZYA 1G9CA 2HWD3 1UKRA 3U0ZA 3DEMA 1W2UA 4CUAA 3ES4A 2OQ6A 2PHUA 1LODA 2CYFA 4GJYA 1DHKB 2BNOA 4ZZ8A 1UOFA 4QDSA 1W0NA 1CJDA 4RYDA 1MS4A 3KZ4C 1Y9QA 3X29B 3AXEA 2VTXA 5T52A 3WDVA 1VRH2 5A32A 2WL1A 3A23A 1GOGA 3OOXA 2YFUA 3WY6A 2DURA 3NL1A 1RXGA 5HCFA 2WUHA 3AP7A 1UYXA 3BU7A 5FBZA 3UJOA 1B09A 1E5RA 4GH4B 3ZSEA 2XL7A 4LMFA 5IFTA 3MFCA 1NA1A 4LHNA 4XQ4A 3FBMA 3HEIA 3ZFFC 3WNLA 1UD1A 3M2MA 1US3A 2D44A 4FPGA 3TN93 1RUH3 1C1FA 3CJIC 1NLQA 5F32A 2R0FA 3IDBB 3O5SA 5LK7B 1CAXB 2X5IB 2GC0A 2F4PA 2WFF3 4M3CB 3LDBA 2QQOA 1OURA 4CCJA 1XNCA 2PHRA 4XUQA 4KMQA 2R0HA 2P3IA 1FAYA 3EBRA 3I3BA 5C70A 2ZEXA 5BNPC 4YARA 1DYPA 1ZBA1 4XF4A 5IATA 2CGPA 2C24A 2D6OX 2W68A 3S6PA 1OFNA 4LBQD 1RUJ1 3CLPA 3M1HA 3VBUC 3WDXA 4CDQB 2JKBA 1WBFA 4H55A 4COUA 4CDWB 5FZ0A 2D5FA 2VUJA 3MLJA 5FY4A 1XE7A 1F4AA 3FLRA 3ZFEC 1C5IA 4DMIA 1AX0A 2NM1A 4DY3A 4OUMA 2HWF1 4HXCA 5IUQA 1TG7A 2QZ2A 3O0VA 1VBE2 2DVDA 2V4AA 1H9WA 2Z5WA 4CEWB 4ARYA 1G9BA 3HJRA 2WDBA 2HJIA 3NW4A 3UGGA 2OQ7A 2ZGTA 2R042 3BTZA 3MO4A 2YBKA 5IVEA 4AEDC 3LZZA 2BDRA 4IEPA 2UYBA 3W5NA 3T4HB 1L3JA 1R082 4IV1C 1UMZA 2ZHNA 3Q8CA 4CPBD 2JDUA 1HN0A 1HXS1 2CAUA 4MYEA 2AH2A 5I0TA 4WM7B 5DAXA 4QPWA 3NMBA 1VBB3 3SKJE 2KR2A 5LBBA 2E63A 2FQPA 2XONA 2B5HA 3EHKA 1YLLA 1XNTA 4L0PA 1UZYA 3SISA 5JPNB 5LRRA 1ULPA 2ZJCA 3K75B 4XUPA 2YV8A 4XCAA 5F8PA 1RUD1 3KLSA 5FP9A 3TEYA 1ZM1A 2RJKA 2VH9A 1V00A 1S2BA 2JG8A 4IV3A 1Q8PA 5FAXA 1OOPB 3OUIA 1ZZ6A 2Q1FA 4CCCA 5KR7A 2GSYA 5F5IA 1BXHA 1OA4A 3HAGA 4B29A 5LEJA 5FP7A 2VQUA 3T2OA 3HT2A 3HQUA 1X36A 1LKNA 2CDPA 3D6EA 2B9VA 2VTFA 4FSJA 2XXZA 2R7EB 1A78A 2A6XA 2H0BA 1CAWA 3E6BA 5A3PA 4IQPA 3VBRB 1ND2C 3ZYRA 1CZSA 2VUAA 3HOBA 2VUDA 4XJZA 4ORFA 1OH4A 1UOGA 2DCTA 5LA1A 4FP2A 3ZXLA 3T1LA 1PZ9A 3L9JT 3K4DA 1NCQC 4AQSA 1BCXA 2BGPA 5L7OB 1A3KA 4GH4A 3S7IA 4D7YA 2NP0A 2DWRA 5FZHA 3TEWA 3L2YA 5K8SA 1VR3A 2P3KA 4E27A 1SCRA 1WCQA 2Y33A 5E88A 1NCRB 4HOOA 3VZNA 2YBSA 1HJGA 4MXWB 3U14A 4DOUA 1HQWA 4DUVA 2HWD2 4QB1A 4AHYA 1S0DA 1F35A 2E7QA 3OTFA 5DABA 1DZTA 5KHKA 5CFCA 2RS51 2SLIA 3VDDA 3SEEA 1RUI3 1S2EA 5C8CA 5CBLA 1SDDB 5FRAA 4YGEA 1PGL2 1QKQA 3M70A 3SMHA 5EYXA 3WF1A 1XSQA 3NAPC 5CYYA 3THDA 5FZ4A 1IHMA 4E4SA 2WYSA 3JCIA 2IXIA 1JMUB 1SHWB 1WA6X 1W99A 1CONA 3N7MA 5IK5A 4I2OA 3JB4C 3JBG3 3I3QA 4KNCA 4KU8A 2QQPA 4QPGA 5KXCA 3FHIB 4GB32 5CIRA 4XTPA 4BA6A 1KQRA 1JHJA 1W05A 3SXWA 3RMXA 2AGSA 3W20A 1AR93 2GMPA 4BK5A 3NNGA 3BPZA 4RGGA 3HPNA 4QQPA 4CDQA 4Y5TA 3FLPA 2JDPA 5T54A 4CDWA 5FBJA 1GBGA 1CVNA 1RUH2 1NAEA 2ORXA 3HN1A 3OGVA 4LBKA 4XMAA 4E8DA 4NUBA 2IXHA 3GXUA 4Y22B 1GP4A 2R073 3POBA 1DF0A 2JB4A 2WFF2 3DECA 3IDCB 2YC2A 1OI6A 4L11A 3AZWA 4CEWA 3AYEA 5EIYB 1ASJ1 2W46A 1PO22 1EAH3 4QXBA 4DS0A 4OLLA 2P6CA 2N7GA 2DCJA 2X10A 3ZLIA 4CXXA 1EY2A 2FCUA 1S2KA 1CGPA 1FNYA 5DPNA 1GWKA 4HN0A 4JC1A 1QJU3 1AR61 1CN1A 3I54A 4HVRA 4DNYA 3EJKA 4YZ1A 5T5OA 4N53B 2OUHA 4Q4Y1 5LATA 1UWWA 1IOAA 3H3LA 2PFWA 4MGTA 1VBD2 3SH5A 1PK6C 4XZUG 4CEYB 4CCLA 3N35A 3MV01 4IEUA 1V9U1 2XJTA 2H6BA 2QNKA 4YRDA 3AKRA 3WW3A 1AYN2 1YRZA 4UW6A 1W6QB 3DYMA 2DTWA 4CDXB 3K3NA 2VZPA 3M3OA 3QACA 3VZJA 2VBDA 3K46A 2UWBA 2D7FA 3ZXAC 1C28A 2ADDA 2E9QA 5IVBA 2R16A 5AVAA 1UIKA 5LASA 1LGCA 1ZA7A 2B45X 3TAYA 3VBSB 4CP0A 1RVF3 2JE7A 2VNOA 4MO3M 5GJ6A 3VBRA 3PTRB 3GJAA 4EZHA 2A71A 1NKGA 1VBC3 3W5MA 2Y34A 3JUUA 1HW5A 1AVBA 2GU9A 4E9KA 1UMHA 4GKYA 3TNQA 4BJ0A 1BMV2 1L7LA 1OLMA 3E5UA 4AK3A 2RJ2A 5EJ1B 4XF0A 1C8M1 1SBDA 2LS6A 2Z42A 2RS12 4AF9A 4PIYA 1D4M1 2A3XA 2PAKA 3KS7A 4QX5A 3WDWA 5FMDA 5EP9A 2X53S 2QUOA 5FZCA 2VBBA 4WZCA 3G7DA 4LPLA 1VAKA 5DG1A 1VBA3 1JTZX 3SCFA 3ZSLA 3RMYA 1W2AX 3C3VA 2E6VA 4HKLA 2PQQA 3EQEA 3N9PA 5CVRA 3WLUA 5KHJA 4R9CA 1NY72 2ZGKA 3RGBA 5BNQA 4INDA 2Q4SA 1RTVA 1ZRRA 4XW3A 5T55A 5ACA1 2ZGMA 1UXXX 5FYUA 2VNRA 5FZ3A 1PVC1 3BOPA 3DL3A 4HKOA 4OFGA 3V65A 4BH9A 3BUCA 3RZJA 5G04L 3NKGA 3T3YA 4ZKTB 4P5YA 4BE3A 2A6WA 2BBVA 1JS9A 2D93A 3O0WA 4XQDA 3BTYA 1S0IA 4CUBA 2ZGOA 3AP4A 3Q8BA 3G6JB 2GNBA 1HN1A 5A1LA 5F3CA 5GZFA 5AC91 3AP6A 1WCDJ 2VOXA 1QNWA 1E5IA 3FFZA 4RS5C 1ULDA 3THTA 5IVFA 2R1BA 4HONA 4JQTA 2YPJA 4OHZA 2XUEA 2WNVA 1JN2P 5FTTC 2ZHKA 1I9RA 2K0GA 4CZSA 2WNEA 3ZDSA 1UPSA 1ZYBA 2FCTA 1ONAA 4GIQA 3WUDA 4F8AA 5C3QA 2ZX2A 3KVAA 1CX4A 3P5BA 4M00A 3RZLA 5F2WA 2JENA 3AZVA 4LKFA 1ZZ8A 1FMD1 3AMNA 3WCSA 1XNBA 4AI0A 4A2UA 2BEOA 1O3RA 3VBFB 4ZONA 5KHHA 3JBG2 3ZPYA 3KWVA 3WG3A 4YVWC 3VZOA 3AMHA 3VDCA 1HKDA 4OULA 1YFWA 4LJHA 1W3XA 2WAOA 3GZAA 3T2PA 1J58A 3HD8B 1BEV1 3AKTA 2IXLA 4ARXA 3M3QA 5FDBA 2JD9A 3N9QA 1WGPA 1YQ2A 2DDUA 3LQCA 2Q8OA 3OF1A 2HBUA 1MS5A 2XOMA 4R8HA 4Y5Z0 1DYOA 2GH8A 2JIJA 1MPXA 1KEXA 5B2GB 1FI2A 3CJIA 3CJXA 4CEYA 3DPRC 3CNAA 3T09A 1LHUA 2Q5TA 1IKPA 1CESA 1GWMA 2W2IA 3GJBA 3K3OA 3WW1A 2YROA 3D0JA 4FBFA 3J7HA 4MGKE 1W6QA 4CDXA 2YDEA 1EAH2 5FZLA 3POWA 1JI6A 1N1TA 1CR7A 1REDA 2BGOA 3BOWA 3OYWA 1NLRA 2UYAA 3LIGA 3OGSA 1IS4A 1KS5A 5L9VA 4BIFA 2YUEA 4FPHA 1W9FA 3WDUA 1GQGA 2BQPA 3OGRA 4BOWA 2VECA 3JQWA 1Q8OA 3KT7A 4ISQA 4TZDA 3J9SA 3H8UA 4AI3A 5C71A 1RUJ3 3PVNA 2EAKA 1IGOA 1O5LA 2Y6FA 4I02A 4YSFA 1TZOA 2Y26A 5KXBA 3EB7A 4BQ4A 5K7PA 2VMGA 2BP6A 2WT0A 1RUNA 2HWE2 3ZN4A 3ZFEA 1VJ2A 4YW7A 1GMMA 2D6NA 3MGUA 3MV11 5DDJ1 2HWF3 2WQ8A 4YZ5A 4GKXA 5D1IA 1LHNA 4R4XA 2RMU1 4BPZA 5ABJA 1R091 1OLQA 4K1ZA 4LUMA 1DQ6A 2HEYF 4O61A 1LECA 2P17A 1ENQA 5JIAA 3TYJA 3K4AA 1H1IA 1HV0A 4AEDA 2J22A 4B1LA 1DLCA 3CHXA 3AZXA 4JKMA 3WHTA 2PHWA 4QM8A 5FZOB 2QCSB 1VMFA 2PN5A 1HXS3 3PURA 2AR6A 4QX8A 4NPLA 4ZU7A 5JZGB 5JUVA 1VBC2 1R1ZA 2D6LX 2MPFA 4QB2A 1PNFA 3TRSB 4JCKA 1HRI1 1OKQA 4NAOA 5CFDB 5I8TA 1DGWA 5ANNA 3KGZA 1KDMA 4Q4V1 2PAEA 3LA7A 1WMEA 2XBO2 5FPAA 3UGFA 2SBAA 5TSWA 1RUD3 2V5DA 2RDSA 1QJX1 4LITA 5HBAA 4XFAA 5FUPA 4IESA 4TXWA 1RB8G 1SBFA 4BQWA 3J26N 3L2HA 5FJKA 4OQ8A 3T08A 3MPBA 2RR13 4FFGA 4XBNA 5GLUA 2UY8A 3BN6A 5FYSA 1SPPB 2IXJA 2PLV2 1T6GC 3H8OA 1VBA2 3WNMA 2QQLA 5K4LA 4TTGA 2RE9A 3U10A 3PUIA 1AR82 3ZYFA 2DU1A 1RUG2 1B35B 3T2QA 4FPJA 2XKOA 3LEIA 2FDGA 4HFSA 4ASLA 2LRPA 2NMNA 2X8KA 4FOWA 1XE8A 2ERFA 2VO5A 1W39A 1V6LA 3NJXA 4LEJA 2A7AA 1AJKA 3VBFA 1BVVA 3FLTA 1D7PM 1JYIA 4CSWA 1I5PA 1K3IA 4D94A 2MHFA 2WS91 4LHLA 4MX3A 1LB2A 2WZR1 1AL22 3IAPA 5EFUA 2CAVA 4NVPA 1JZ2A 5A7OA 5A3OA 3LDRA 3ZO0B 3OGGA 3WVJA 1RUOA 1VMJA 2DV9A 1O8PA 2VGDA 4K3UA 1PMIA 5GZEA 4B3NA 1ACCA 1GP5A 3DUIA 2D3SA 3FUQA 3TNPB 1K42A 2ET7A 3VDAA 2QZ3A 4QXCA 2RS53 3SCGA 1WA4A 4O9GA 4DO0A 4QPIC 5L73A 4CCKA 5J37A 4YM0A 4EJRA 4FPYA 1OHFA 2XUMA 3NAPA 5FYIA 5I93A 5T5JA 1OUXA 4LUKA 1SQ4A 3FX3A 2DFCA 3LAGA 1W28A 1J59A 2VCCA 1FX5A 3CU7A 4P00B 2BOIA 2WAAA 1RYYA 3KV9A 3RZGA 4AVAA 2VAUA 2VQ0A 2X29A 3NJVA 4HANA 3VBHC 3KCXA 3PUQA 4A41A 1V6JA 1WLTA 2Q30A 2G9ZA 2OW4A 1LU1A 1E5HA 1KXGA 4C90A 4EWEA 2HWB3 1U5YA 4UFHA 4JV4A 3LOIA 2CU5A 1IS3A 3J8F1 1ZRIA 5HI0A 3O1RA 1IKQA 3NSTA 1TNRA 1H30A 1ZA4A 5KC6A 1S0BA 1GZWA 5IK7A 2P6HA 1DQ1A 4MGZE 1H4HA 1L7QA 1JU4A 5CEHA 1ASJ3 1HB2A 2GN7A 1DCSA 3CIHA 3K4ZA 4CCMA 1SMVA 5A33A 4AGGA 2VZTA 2WWJA 3OD4A 3PIGA 2W1WA 4A44A 1ZRFA 5HCHA 2EIBA 3A7QA 4W50A 1ZBA2 1BBT1 1WWYA 1JBCA 3POIA 1W6NB 2XVLA 2Q0AA 3POSA 4LBLA 5LA9A 3GZUC 4E4ZA 5GLZA 5KXDA 5DUUA 4X6RB 1RUJ2 4DRRA 4M01A 4Q4Y3 2OUJA 3AMQA 1PMHX 2ZEWA 2BZDA 1T6BX 2O1QA 3K48A 3HNMA 1ULGA 4FFIA 3B9CA 2EF6A 3N9NA 1A8DA 2UURA 2WN3A 2WZ8A 3NQHA 2HWF2 4OI4A 5EQUA 5FZIA 3KVBA 4F3JA 4PLMA 1XNDA 1JH5A 5FK7A 5J98B 4G4FA 5CB7A 5IJRA 4HVQA 1XYNA 1JZ7A 1HX6A 2LUWA 4QGMA 5A32B 2OPWA 1OSGA 3DKQA 1W8WA 1YQ6A 3H7YA 4N7UA 4BQXA 1MS8A 2CGNA 4UW4A 4HVOA 3DN7A 5F39A 4CU9A 1OVPA 1UO9A 1JYXA 1HXS2 2GALA 4N43B 1VPHA 1NA1B 2GNMA 1EV11 4JX0A 3KGLA 2ZZQA 4NRQA 1YJKA 3P3PA 4COWA 1J1LA 5FO7B 2YBPA 4BQ3A 4E2SA 2DBNA 5J09A 4XJ8A 1US2A 3MHZA 1RUD2 3NV1A 5EXOA 1TVGA 4JGZC 3JU9A 5A7QA 1WW4A 2CY6A 1WLCA 1TME1 4UFLA 3WF4A 1W90A 3B7MA 2DUOA 3VKOA 3VL8A 3IDEA 1VBE3 1C5HA 5FYVA 3WNOA 3ON7A 2PHFA 3POFA 4AQ6A 1F9KA 1YI7A 3LIHA 4WM7C 4XTMA 3SEPA 2HEWF 2YZ4A 1CIWA 2V73A 1WCSA 2WNUC 3E1F1 1NUKA 4IXLA 2QJVA 3ZSKA 4KWLA 1SLIA 2XR4A 2PHLA 1JZ4A 4AFBA 5K9YA 3MW4A 3PUAA 2BFUS 2JDAA 1ALYA 4XAEA 4WVWA 1G86A 4FPOB 4QB6A 5FREA 1H6YA 4LT5A 1OQ1A 2VW2A 1WCUA 3T0AA 1QJEA 4D69A 5FP8A 1OOPC 5ACA3 5FV3A 5DMYA 1PVC3 1UZZA 4QPYA 4Q4W1 4W6WA 2B8MA 4B7EA 3SH3A 3TEZA 4XDOA 1I5ZA 4EWAA 1UYYA 2VXJA 1V6OA 2E53A 4ZS2A 5JXJA 2YU1A 4OHYA 1J3PA 3O0XA 5HPOA 4Z07A 4XFFA 1IPJA 4LLOA 5DZFA 1OFSA 4W6XA 4IE7A 4BLJA 1W8UA 1W2NA 3OG2A 1OC1A 2GP5A 3D3AA 1AZDA 4HL0A 1V6IA 1OLRA 2XVKA 2ZKNA 1I3HA 1NE4A 3SC7X 4DINB 4DRVA 2RS52 3P1IA 4MLOA 3H3ZA 4WVMA 3MYXA 4XQWA 5LBFA 3JD71 5LCWL 3E6CC 1YQ5A 4OHVA 5E89A 4MGIE 3BCWA 1MQTB 4LO5B 4UFMA 5L7OC 2VMIA 3H7JA 1AR71 4JVAA 4R52A 1GSLA 2BVBA 4QWNA 3TWIA 4CRQA 4ZHNA 2J42A 1NCRC 1QJZA 2VZQA 3ZMNA 2HLEA 1CX1A 5L9BA 3QH6A 4XIKA 1QIQA 4IV3B 1O3QA 2JG8B 3R05A 4N9HA 3VBOC 1Q43A 2RDQA 4COZA 5FZBA 4GD4A 1W2OA 3OCPA 1TE1B 3FN9A 1W8OA 2D6MA 4Q8LA 4W6YA 5GALA 3T0BA 3POJA 2E7TA 3ST7A 2JX9A 2AZ5A 3N4MA 2WR9A 1JUHA 2EXKA 2XHNA 4P02B 2C0ZA 3B94A 4FT8A 4A42A 4LO6B 3O1SA 1O8SA 1W6PA 3AFGA 5FO8B 3T0DA 1LHWA 1ND3C 1Z7S1 4W65A 1CAWB 1QEXA 3FJSA 2WO7A 3WV6A 4DUWA 5KHIA 1EUUA 1KJRA 4Y33A 4UW5A 2JDYA 1W8NA 2WFPA 3WP4A 1RJ8A 1ASJ2 5FZ1A 1G7YA 1COV1 1SLTA 2W94A 5JSOA 3RYKA 4AQ2A 3E5XA 3IDAA 3MDPA 4IETA 4S2FA 4GQ7A 4Y20A 3ECQA 5EJZB 2ENRA 1MEC1 3FBYA 3ORJA 2VVDA 4GB33 3WCRA 3ACFA 3BIEA 5GLWA 4N43A 1OT5A 1AR62 2CNAA 4AVCA 4NIDA 2VMCA 1YQ8A 2BRTA 3ES1A 4M3CE 4PQQA 1OUSA 4IEZA 2ZGRA 1TEIA 1AHSA 3PJQA 4Q4Y2 4RR3C 1CD3G 5FY1A 4S2DA 4XILA 2Q1ZB 5FKBA 5FQ0A 2E26A 1UX7A 1OQEA 1V6MA 1WD4A 4HZFA 2NLRA 4JDNA 5CFCB 1W03A 2WIIB 3VDDB 2JB8A 2EVXA 4YZ2A 5DDJ3 3BB6A 4BCUA 1V9U2 3WQ0A 5C8CB 2WJSA 3KT4A 5F7UA 3WW2A 4I3GA 5FUIA 3MIGA 4JRLA 1PO23 1SG3A 5E6HA 4RFRB 5FFOC 2AUYA 1RUE3 4EROA 1ZBE1 2WZPP 1FV2A 1RUC1 5JI9A 4DUXA 4N53C 1U12A 5DUWA 4RHV1 4QPGB 4TWTA 1QY4A 3DYOA 1X9TA 4AYUA 3NNFA 4L2NA 3T30A 5A1FA 2FZ1A 2DFBA 3HR9A 3RJRA 1QGLA 1N47A 3WP3A 2TEPA 2WRAA 2D43A 5EZWA 1HRI3 5FIXA 4WM8C 1VBD3 1RXFA 4CP2A 2VW0A 2JDZA 4HETA 4ZU5A 2Z4FA 5ERLA 3UYJA 4BHPA 3WSOA 2ZAAA 2PAMA 2XWBB 4Q4X3 3AMPA 2PQSA 2KD7A 1N1VA 4L92A 4XJWA 1C8M2 4I30A 4AHWA 1GFF2 1AYN3 1D4M2 1GWLA 4CCDA 5JAXA 4L8QA 2XJUA 1KFXL 1ZREA 3H8RA 4KQ7A 3U78A 1JYVA 3WEZA 5IW0A 2F4LA 3RPQA 1YHFA 3ETQA 1IS6A 1O3SA 3AFKA 1C4RA 3IB3A 4RA0A 3C8XA 2BPA2 2VG9A 5FYCA 5FPUA 4ZPIA 3AJYA 5DAVA 1MQTA 2LW8A 3LFMA 2WT2A 3MIHA 2C4XA 3JB8A 3M7AA 5ACA2 4EN9B 1JZ6A 4HSJA 2I07B 1PVC2 1NZIA 1IPKA 2W1QA 1A6CA 1MS9A 3A22A 4XUOA 5F3GA 2A3YA 1DP0A 5FYZA 4BXSV 2RS13 1HQNA 4YZ4A 1JZ3A 4OZOA 2WC2A 1POV0 2CWSA 1H1AA 2LTNA 4AVBA 2WO3A 5AC92 1YQCA 4AR2A 2BUKA 3PMEA 1J84A 2VZSA 3I3EA 4NPMA 1LHVA 4GWIA 4LKDA 4LHKA 3IIAA 1CIYA 2DYCA 5C9AC 1K5MC 1Y43B 5KC5A 1S0CA 3PIJA 4AQTA 2RHPA 1RL3A 2XQRA 4XE9A 4QQLA 1W8FA 2IZWA 2AEZA 4LULA 4CU8A 4IGQA 3SHRA 1FMD2 1WCKA 2V5YA 1GLHA 3S7EA 4BDVB 1I6XA 1RUF1 2IFWA 3DV8A 3VD9A 2BOJA 3FE5A 4D0QA 3U11A 3MUY1 4C1WA 3ZXEA 1TQ5A 1H2LA 4AG4A 3VBHA 1ULCA 1BEV2 1W0OA 2JDNA 4FP3A 1X7NA 2XQXA 5A7PA 4DZGA 1HDKA 1ENSA 1FPN1 4BMBA 1VLNA 5E1RA 3HWJA 1O4ZA 2UWCA 1XOYA 4JQRA 4QX7A 5BNNC 1W9TA 1H2MA 2QQKA 2XJVA 1H2KA 4QQHA 1PX3A 4E4HA 1SEFA 4GMP0 3VZMA 1CAUB 1M4WA 2JJ6A 3MBWA 5JR2A 4Q1RA 2IWGB 5T50A 3RZHA 5CZKA 5LRSA 1NLSA 2WSVA 3LA3A 5A3NA 4A3ZA 3LOBA 1G9FA 4X8PA 4K8FA 4MVTA 4EYUA 2DVBA 3LA2A 1BBT3 1OA2A 4DXSA 1XQNA 1EP0A 1ULEA 3C2UA 1UPIA 5FYHA 5FXZA 3WG2A 5BNOC 3VDBA 1WUVA 2HYKA 3RJ2X 2GC2A 3B00A 4GA9A 4PHZA 4A7YA 3H8XA 2RS31 2Y38A 3GBWA 2VOVA 3ZR6A 3B69A 1SLAA 2JG9C 2XVGA 4CDUC 5FZ7A 1YIFA 3IAQA 4YWAA 5F5AA 5A70A 5FOJB 1RC6A 2PHXA 4TN7A 1FOD1 3T2TA 1H8TC 2WNVB 3O1TA 1UZVA 2C1FA 4Q29A 1Z78A 1PVXA 5DDJ2 3HQXA 1RINA 4UFJA 3VKNA 2RMU2 3PDQA 2MEV1 1R092 4LOTA 3LPFA 4COVA 2VQTA 2H6CA 1QQP1 4XFHA 5GZDA 5A80A 1RUE2 1O6UA 4ET7A 4NIGA 3MPPG 2VCMA 2OYZA 1X33A 3BYWA 4MGQA 2V4VA 4OUEA 5JWPA 2VM9A 3PJYA 5D8AC 3LGRA 3S5AA 3R4DB 4NRPA 4MOAA 5F6KA 4YVSC 3OJBA 4Y26A 5DUXA 4ITCA 5FMBA 3OGJA 4XJAA 1E5SA 3ILRA 5CADA 3ALQA 1HRI2 2YGMA 2WZEA 2G4IA 2D97A 3K2OA 3AVRA 3N36A 4Q4V2 3USUA 1TNFA 2HWE3 4PLOA 1GICA 5FPVA 3CJIB 1SFNA 2GN3A 1QJX2 1SBEA 4Q4X2 3QLQA 3LPGA 2E7AA 3KV5A 3S30A 1UY0A 2DVAA 3BODA 3POYA 4O9EA 1QNYA 4AI1A 1W9SA 2TUNA 4RQPC 5C4WA 2QQUA 1JOBA 2VXRA 3AP5A 2BNNA 3H0OA 3WDYA 1DG6A 5JZGC 3OYWB 3V0BB 1J83A 2IXCA 4KH9A 4A45A 3D8CA 5LY1A 5CFDC 5F3IA 3EYPA 4NIHA 3H3UA 4G9SB 4PDWC 1KFUL 4ES8A 1UU4A 3KMHA 4YZ3A 4XABA 4V2WA 2ADEA 1HIXA 3B02A 4WZFA 5FMOL 1YYNA 3RWNA 3PUHA 4C1XA 2IXKA 4AZZA 3WXPA 1AL0G 1UU6A 2ARBA 3C7OA 3GNEA 1YC61 2XBO3 3PVBB 1W8TA 1DZRA 2K2SA 4L97A 5K0UC 2A73B 3MI8A 3ZFEB 4CP9B 1DLLA 2WS92 5FPZA 3FMGA 1NQDA 4LQRA 4K6BA 1YXWA 4URTA 2YPDA 3ZKUA 3IBMA 2WZR2 2ZKLA 3WP6A 4BK4A 5JOYA 2O14A 1PO11 4QKFA 5FY5A 3ZSJA 1RMU1 4M0NA 2PLV3 4D8MA 5CG8A 4OHWA 2Z79A 4H7MA 4GMP1 2TBVA 1UKGA 3IKWA 4JAAA 3MICA 4LXLA 4AEDB 4CE8A 3FZ3A 1AR83 3POEA 1RUG3 2P37A 5F5CA 4IV1B 3RNSA 1CAUA 2WQ4A 3R6SA 4A3XA 2FD8A 4LORA 4FTBA 3JD73 3LSDA 5D21A 3EMRA 5A6QA 5CISA 1LHOA 2VNGA 2GAUA 3HBKA 1CPMA 4BMEA 2ARXA 4FAGA 1WMFA 4XACA 1VALA 3SNMA 4MG2A 3RZZA 4LBQA 4D6SA 2R041 1KRIA 4RGAA 2D40A 1D2SA 3LEGA 3VBOA 3ZOIA 2WINB 1AL23 1C8NA 1R081 3VLBB 4BQ1A 1UL9A 4YNIA 2QDRA 5FP4A 4IGPA 3C7GA 2VOKA 2G1MA 1IG0A 4QQOA 4TSVA 3J8F2 1JYCA 2R061 4KBBA 2JE8A 1ZZ9A 4ZXEA 4UAPA 3AMMA 4E4DX 1S4CA 3BPSA 1Z7S3 1ND3A 1AYM1 1JZ5A 4NAMA 1REEA 2FHRA 4QKBA 5EPAA 1ND2B 1DQ2A 2IC1A 5FZ9A 3WX5A 2IUWA 4EN8B 1FT9A 4QX2A 5A3UA 5IK8A 4QHBA 1MS1A 4W8JA 5T3NA 1NCQB 1BZWA 3ZR5A 1BBT2 2VZRA 4PI2A 1R1A1 2XWJB 1VP6A 1UY3A 5EV7A 1HB1A 4Q26A 3HNYM 1POQA 5T5PA 2WO2A 2Z2SB 4NWVA 2V72A 1WW5A 3ZFFA 4NR1A 1W6MB 5DZEA 5JOZA 1YIPA 4OCTA 4RR3A 4KWKA 5I0SA 1NQJA 2QTWB 5A6YA 2VR4A 2D6KA 1CPNA 3ZFGC 2Q8CA 4ZZ5A 2J1UA 4FPLA 4FOYA 3MF6A 2VL4A 5G05L 4QXKA 4EQVA 1OPMA 1M06G 4GXLA 2WO1A 1FYUA 2CTVA 5IAXA 3KQ4B 3NAPB 3OPWA 1S55A 3V0BA 3D0SA 5FUNA 5JOWA 3WT3A 4EE2A 5F1RA 1TMF1 1RUC3 3MIEA 3WUCA 5BNPA 2NN8A 1ZBA3 3LCPA 2HWD1 3WG1A 4TLGA 1W3VA 1FV3A 1MVQA 1VMHA 2O8QA 3TBDA 2BJSA 4JHTA 2EIGA 4NOTA 1EV12 3VN4A 3S5QA 2EIDA 1N3OA 1LOAA 3VBUA 4XHBA 3UGHA 2O0OA 2Q8EA 1UW8A 3AL5A 3AYAA 3I2GA 5J36A 3RYRA 3M3IA 2QQIA 4M0HA 5FXXA 2Y8KA 2OVUA 1ZNPA 5H9RA 4CP9A 4XPVA 4NWWA 1TME2 1GZWB 1LRHA 2F17A 4NMIA 1UAIA 1MZ6A 4YG3A 4O7XA 2OT7A 3Q9OA 1O4TA 1NA1C 2ZOEB 4S2HA 3PTYA 2KXLA 4UFIA 3I7DA 5A7SA 4EN6B 5A33B 3KHCA 1RIRA 1GNHA 4H2AA 1YCIA 2XKPA 2ZGPA 4IV1A 4IUGA 4PQ9A 4AFAA 3TN91 1RUH1 4QM9A 3PHMA 3ZXKA 5DG2A 3O1UA 3RWKX 5A3WA 4ZU4A 3DXUA 1IPSA 2WFF1 2NQYA 3FL7A 4LBMA 1LESA 3NV3A 4R4ZA 2GP3A 1K45A 5DAQA 3WOGA 5IVYA 2P1BA 3INAA 3HMYA 4Q4W2 4AVTA 3MFAA 1PK6B 3ZYGA 4OVEA 1OMIA 2YMZA 2BYVE 4JGYC 3VZLA 3KQRA 3AKSA 3SQOA 2DUPA 4CYDA 4GULA 1PNGA 3VHOA 3VV1A 1FXZA 4XMIA 4PLNA 1DU3D 3CZUA 3GGLA 3MW2A 3Q8EA 1K5MA 2WYFA 2Y60A 4PT6A 3E97A 1G9DA 4XXPA 3LDKA 4H14A 3JD72 5CA6A 2ZGLA 2AEYA 1ND2A 2J7MA 5I0UA 3SCHA 1CJPA 3AVSA 1AR72 1WLDA 2QQVA 1DDLA 4D3WA 1FATA 4GWNA 4ES9A 4OZXA 3DGTA 1NCQA 4IL7A 1RUF3 2W92A 5GKAC 3U1XA 4HLTA 1DQ5A 1PGW1 4XURA 5HCBA 1NXD1 2DVFA 4RD7A 3WP5A 4AWDA 5C3SA 5C7GA 5ISLA 4Z2WA 4UI9L 1IZ3A 3AM2A 4JHZA 4MHUA 4QDQA 4QKNA 3CQOA 4Q2FA 1FPN3 1W6MA 4FVVA 1OBNA 1LEDA 1VAMA 1MS0A 1VBB1 4FQZA 3WNPA 5IVVA 4DIQA 2D5HA 4LR4A 2A3WA 4GJZA 4YW5A 2ZZJA 4P9IA 2XL9A 1NYWA 1Z7S2 4KBZA 4KWUA 3N9LA 2Y0OA 3I8TA 3POGA 3I2OA 5FPLA 3ATGA 5LWBA 5HV0A 3VKFC 1IQDC 4D6RA 4DXZA 1COV2 1VRBA 3APBA 1PX4A 3GDBA 4KI5M 4JTNA 3ZYHA 5FXWA 5CNAA 4R9DA 4D7SA 1MEC2 1PGSA 2K9ZA 5J7MA 5IWFA 4M4PA 2W5FA 2PHTA 4XETA 1GZ9A 1GKBA 3DKWA 2ORZA 4DY5A 1MACA 5T5LA 3PNAA 2G9FA 4RS5B 3WNNA 2DTYA 5DAPA 2VMDA 5FCCA 1ENRA 2G9GA 4CDUA 3M3CA 1GZCA 3HVDA 4V2VA 2GC3A 3IPVA 1FOD3 1GUIA 1ZZ7A 2VE1A 2WWUA 2JD4A 3AC0A 1YFYA 1X9PA 4WVMB 4Y1UA 4FO9A 4ZXKA 3A0KA 2ETEA 3ILNA 2VZOA 3NJYA 1WZXA 3PLQA 3RYPA 5JSRA 4FPCA 2BBAA 4GH4C 5J1XA 3K51A 1YFXA 1STMA 1ZBE2 2P34A 4H3WA 1RUC2 4N9IA 4WVVA 4KU7A 5BPXA 1XNKA 3IM0A 3CBNA 2P3YA 1F5FA 2YYOA 5D8AA 2PHDA 4YVWB 1AR63 4IEYA 5CFCC 2X5IC 1DQ0A 3D82A 1F15A 1RUI1 2A70A 4WBBA 5C8CC 5L9RA 3I59B 3BALA 4RL7A 1Y7BA 3H9AA 3ACLA 2IFRA 4CTEA 4K40A 1YI9A 1PK6A 1QJFA 4HK9A 2JICA 3AB0A 4NHMA 3VL9A 3WQ1A 2VZ1A 4AOCA 1W6PB 4YFZA 3DPRB 1V9U3 5F9TA 4N8MA 1W0PA 2DF7A 4AAPA 4QPGC 2W52A 3MLKA 2DCKA 2I2SA 2R49A 3GBGA 4JKLA 4RQPA 2NPIA 1ULFA 2DVGA 5ANQA 1AR91 4LA3A 1C3HA 5JCTA 4Y20B 3F95A 1HRV1 4QMAA 1S0EA 4CDQC 5BUVA 1WLWA 5CG9A 4Y1ZA 4CDWC 2FDJA 3FHQA 3OSDA 3GYDA 1NXMA 4AVSA 4AAXA 4G3YC 4BZ4A 2H0VA 5LW9A 3WG4A 2VD7A 3LSEA 2R071 2VVFA 1OVSA 2F6BA 4NJ4A 2O8OA 4QGLA 5JXHA 3Q8FA 4CEWC 4XDPA 2GMEA 3CO2A 4XJ9A 5FQ0B 4NIIA 1ZZCA 1JXNA 4PIZA 5FP3A 5K0UA 2ZMNA 4LHSA 3H42B 1QOTA 1C8M3 4NRMA 3KT1A 3SH4A 1LULA 4QXHA 1D4M3 3MIFA 1CZTA 3U4SA 3OY8A 3AK0A 2JE9A 3N7JA 2MNGA 3CKHA 4FXKB 4GWMA 2XG3A 4K7JA 3RDIA 4E2QA 1PO13 3AJZA 1PM4A 4UWDA 4A6SA 3AX4A 4PCRA 3RQ0A 3I2DA 4AXOA 2Y64A 2EXIA 2QDNA 5A7NA 3FFQA 2BU9A 3VKMA 3WZ1A 1XBFA 4YW1A 1UYPA 5H9PA 5IT6A 3O12A 3CMGA 3NO8A 3KCCA 1G6NA 2AYHA 2JDKA 4EZ4A 1AUYA 1SLCA 2GNTA 4Z2AA 4EWDA 3AKPA 2AC1A 3KF5A 4Q0VA 5C33A 3W59A 2VZUA 5JLVA 4META 1QJY1 1RUF2 2ZX0A 1UOBA 2ZA9A 4YGDA 1YO8A 2P5BA 2V09A 2ZXQA 1VE0A 5FY9A 5C6CA 3OB8A 1UU5A 2J1SA 4BXFA 3OY8B 5IYYA 1RVF1 5AC93 3MF9A 4RS5A 2XH6A 1LOCA 3VBRC 1FPN2 4A6OA 3AYCA 4YW3A 1RITA 5FLJA 3CZJA 1JUIA 2BVVA 2ZS6B 4GALA 2W1UA 5L36A 1S0GA 1XE0A 2JDMA 2L9LA 3D5OA 1JYWA 4MHRA 5SV8A 1Q56A 2C26A 4M3CF 4LTAA 3GALA 5BXXA 4QAWA 2VTXJ 2W08A 2YC4A 1DGWX 3N3HA 5F2SA 4NIAA 2XMLA 3UV9A 4PI0A 2EXJA 1D4VB 3NV2A 4LLFA 5LEKA 1FMD3 3GHNA 4QX3A 4IEWA 2VMFA 2XJQA 1KD7A 3QD6A 1HB4A 1AXZA 5A1AA 2FBEA 1G9AA 3R4SA 1KDKA 2TNFA 3H1YA 4YVWA 4IEXA 3I2IA 4IE0A 1UN1A 1XRUA 3HQRA 4FOQA 1BEV3 1OA3A 4FAHA 3ACGA 1X82A 2RS32 3I59A 3MIDA 3VZKA 4YYOA 2ET1A 3W9AA 1JOJA 1BK1A 1O5UA 3V64A 4MZUA 3AP9A 1EUTA 3KSCA 2VUCA 4GZ9A 5IFPA 1FOD2 1DGRA 3DPRA 5FK8A 4ZY9A 4B8EA 4I0WB 2XGXA 2ZMKA 4IE4A 2XHKA 3R4UA 5KWRA 4NO4A 4QPIB 3EO6A 3VHPA 2MEV2 2XLGA 1Q8VA 4DQAA 2YY1A 1XYPA 4ASKA 1MZEA 2FMYA 4HT1T 1QQP2 2WT1A 4Z1VA 4LO7A 4IEVA 2HWC1 2EALA 4HK8A 2CV6A 3ZXDA 4ATEA 4MUVA 1TMF3 1UX6A 4CU7A 1QHDA 2YFZA 1BKZA 5FO9B 3UT0A 3N9OA 4FQ4A 3ENRA 4O65A 3VBHB 3V56A 2WNVC 5FY8A 3IMMA 4W4ZA 1DIWA 2NZ9A 1MVEA 1ULOA 5JXGA 5LA0A 2WLPA 2VCAA 3IT8A 3N9MA 1IG3A 1UNBA 3LB9A 4QDRA 1O4YA 2PELA 4IW3A 5FWEA 3ZYPA 4N90A 1DQ4A 4P9JA 1KITA 3BI3A 2GDFA 1OKOA 2JIGA 2W47A 2EA7A 1O7FA 1IQAA 4QQ2A 2RMU3 3E6DA 1W8ZA 3RS6A 1R093 2XJRA 3SKVA 4CXYA 1ZRDA 1HLCA 4P9XA 3C7HA 1OPOA 3M4FA 2ID4A 5AFBA 4B1MA 5EHDA 3OPZA 4NHLA 5FMCA 4P14A 2BWAA 4LA2A 4YPJA 1AF9A 2A6VA 2WLQA 2WN2A 4XOGA 1G8WA 2EXHA 2ZHMA 2ZABA 4HSLA 2OKXA 3THPA 1AXKA 3W21A 4AEKA 4CEYC 4MH0E 3ZYJB 5LA2A 3EXUA 3IN9A 4A4AA 3ETPA 2DCYA 4Q0PA 2VCBA 1GNZA 3DF0A 3URFA 1U5ZA 1BJQA 4CDXC 4Q4V3 2CSGA 3O14A 5A3MA 5EYYA 1Q8SA 1QJX3 2I74A 3SITA 4F83A 1AXYA 3S57A 4LBNA 5EJ3A 3RZMA 4XUTA 2C5DA 3OBAA 5AFEA 4JGYA 5IAVA 1V0AA 3VBSC 2A5ZA 1UQXA 3T4VA 1SLBA 1PO12 2OX0A 1LCLA 1LGNA 1RMU2 2RM21 5J3UA 1VAVA 4QX0A 5FXVA 3LWCA 4A7ZA 4CU6A 5FWJA 4OI0A 1RHI1 3KB5A 3J7MA 1W6OA 2PMWB 5B4XA 3KD4A 5I91A 1WKYA 4XF1A 1QH7A 1YUDA 4TLFA 5CKMA 1SDWA 4FXGB 4NPRA 5GLVA 5CAZA 1KS4A 4MXVA 1LNSA 4KL1A 5ABJC 2CHHA 4AGRA 3OBRA 1D0GA 4DFSA 3DYPA 3USUB 3A4UA 3KHBA 4XFCA 1H2NA 1XYOA 2WS93 3ILFA 4JGZB 4PF1A 1GR3A 4FPEA 2WZR3 5D2AA 3PMSA 5ABJB 1PIV1 5C4WB 1PZ7A 4LNVA 4JDOA 5FZEA 1W04A 4AE2A 3UESA 4S2GA 3BVCA 4MSVA 2CWMA 2WNUB 4F7ZA 5CKNA 3F2ZA 2R062 3IWZA 5E8AA 2EAAA 3NKTA 3ZPOA 2B7YA 4QPIA 1AYM2 1LJ7A 1OLME 1ST8A 4P9YA 3JZVA 2NYYA 1GZTA 1QWRA 2FDFA 3LD8A 4Q0UA 2RR11 4RN5A 4CP1A 3CEWA 5A6XA 3LFIA 4E8CA 1H8VA 5I8SA 3FWEA 1GOFA 3WINE 5C8WA 4EN7B 5IVJA 5KXEA 1E57A 1R1A2 1QJU1 4FTEA 3CF6E 3J7LA 1S1AA 1CQ9A 3M8LA 3M3EA 5DZGA 1DFQA 1F31A 3J8F3 4LO4B 3QCWA 1N3PA 2QQMA 4MV2A 3GCXA 4B7KA 2PTMA 1VIWB 2QVSB 3VBFC 1BVP1 2ZGQA 4AFDA 1SCSA 2HKXA 1JYTA 4LKSA 4Q1PA 2VMHA 3OBZA 1SFPA 2ZX4A 3VHRA 4B4QA 3I2HA 3AZZA 5F5QA 1TMF2 2EICA 1MR5A 4LBQB 1LU2A 3OPTA 2WA4A 1OH3A 5FLIA 3RG0A 3RI8A 3ZXFA 4XBLA 3WDTA 2ZX3A 2W95A 2ZBJA 3VBOB 4I0AA 4UBGA 3A0NA 1CAXA 2X5IA 3ASIA 3DCQA 2K46A 1X50A 4M3CA 1OD5A 5GZGA 4Z92B 3GCWA 3RFRA 1XU2A 1AX2A 1SFYA 1LOEA 2Y6KA 1LOBA 4QT6A 3UKVA 4UF0B 1I1EA 1W06A 2ZEZA 3PVOA 5B4NA 5FZFA 2GC1A 1BQPA 2HH9A 1LEMA 1ND3B 1Y4WA 3I2KA 3P3NA 2ARAA 4GAZA 2HBTA 4GWJA 4MGYE 3U07A 1XSRA 2WA3A 1MZ5A 1K5JA 1C57A 3O1MA 3OEAA 4YG6A 2HWB1 4YFWA 1HRV3 3TN92 1YWKA 1WW6A 1EV13 1XU1A 2QBXA 3NNLA 1HB3A 1LOFC 5FZKA 5LK5A 2C9KA 1MS3A 3ZFFB 2QQJA 4RR3B 2BNMA 4OYUA 1U5XA 1VRH1 1POV1 4JGZA 4XIOA 5F6LB 2WBKA 1TME3 3BKZA 4NHYA 1NZCA 1REFA 4ISRA 5FYYA 1ODNA 4OMCA 5IK4A 4J25A 4WM7A 5FY7A 2FDIA 1V6NA 2WNUA 3ZIXA 3MZHA 4PBPA 3VD5A 4HBNA 5BNPB 2P2KA 3U37A 1J3QA 1LOGA 2OZ6A 2VULA 4KWJA 3H1WA 4YGBA 3ELNA 2QFEA 2W91A 1U5IA 1O3TA 3VBUB 4NE9A 5SV5A 4KGQA 3O1PA 2ZAHA 5IHRA 1OOPA 4RFT0 1NE6A 4J1WA 2Q8DA 1AJOA 4BU2A 1QXRA 4YM3A 4WM8B 5JMOA 4Q4W3 4I0BA 4Q5OA 5LBEA 2W87A 1WMXA 1QJY3 5FZDA 1UY2A 2DU0A 1PGW2 4LOSA 2D3PA 2WQZC 4XVHA 2HYXA 4QHOA 1B35C 1ZVFA 4COYA 1HV1A 3I2FA 1WMDA 1F4HA 3ZX7A 3B9IA 4ZS3A 3ZM8A 1VBB2 3TB0A 4L99A 2ES3A 2YHJA 3AKQA 4H7LA 1F5JA 3OUHA 2AREA 2QE3A 5KBFA 2Y6JA 5CKQA 4C8DA 4OMDA 3TEXA 5L7OA 5FMOS 4Q0SA 2FCVA 4AW7A 1AR73 1JZ8A 4NHXA 2VOTA 1P8JA 1VBE1 3OD0A 4IEOA 4YW2A 4AGVA 3BTXA 3W58A 1NCRA 1H1MA 3VUOA 2QKDA 3N7LA 4P9LA 4MXWA 3GHMA 4N7IA 5BY5A 3FC0A 4C91A 1JODA 2D98A 4FPFA 4P5HA 4CUGA 3ITQA 4P9WA 1UF2C 2VPVA 3A21A 3BIWE 2UY9A 3RZKA 3C7FA 1NOVA 5HV4A 3I3MA 4K1YA 4LE3A 3ZYIB 4Y4YA 4B4PA 4XUNA 2RV9A 4UF0A 4AL9A 1UMIA 1URXA 5A6ZA 3WD5A 5C9AB 1DYKA 1K5MB 4I3PA 4HMZA 4SLIA 1QDCA 1S0JA 5GLTA 4JZRA 1XNAA 4WVZA 2X05A 1NT0A 4U36A 2DUQA 4URAA 2WKKA 4CPBA 4DXTA 3C7EA 1COV3 2BV4A 2OS2A 2ZACA 3NRUA 4XDQA 2RDNA 1UIJA 4IEQA 4M4RA 4EV0A 2HWC3 5FYBA 5EWSA 4BYYA 1JU3A 1MEC3 2VNVA 1PHMA 4YM2A 5C3PA 2PXJA 2P3JA 1QF3A 3RRDA 5A3TA 4Y22A 4I01A 4RSUA 2B9UA 4UXAA 2B4KA 3CL1A 1RUI2 4MGSA 2GH2A 2B39A 3KCYA 4R9BA 5JIUA 1QU0A 4Y1YA 3QBQA 5A3LA 3S0MA 5BNNB 3RVHA 1CAVB 3ZXGA 4DEVA 4QGNA 4ONUA 2E33A 1L7RA 2VJXA 1EPWA 2VVEA 4AFMA 4XC9A 1DBNA 2XJSA 3QH7A 4JRAA 3ZVXA 1ZBE3 4PIXA 2ZGUA 2VMEA 2D3RA 4XFBA 2B46X 1AR92 1QXPA 2KM2A 3E5QA 3GZEA 4N53A 1MZFA 1HRV2 4C0BA 3THCA 4RHV3 5FZMA 2G19A 1GOHA 2KA3A 3VD3A 2QQWA 2BGCA 5HXVA 5JVVA 1BLZA 2FMDA 5GM0A 5BYNA 5BNOB 4FI9A 4CCNA 2R072 2J1RA 1N1YA 1PGL1 2UU8A 1KJLA 1QH6A 4YM1A 3WF0A 4WM8A 4OQ9A 2JG9B 4BQYA 2WABA 4AHZA 4CDUB 5LY2A 3ZSMA 4JTOA 3IZOA 1GNYA 5FZ6A 1YEWA 1UZ0A 4UYBA 4BIOA 3IPVB 1YJLA 1H8TB 2Q1MA 4PJYA 1CZVA 1UZWA 3ACHA 3U75A 4Q8KA 5FLHA 1BHGA 2IVIB 2HEVF 4GB31 2NMOA 1IS5A 3VBSA 4N43C 2A1XA 4ASMB 1GP6A 2VBPA 1OXCA 3BTAA 2DBIA 4CUCA 5APAA 2GMMA 2LM3A 2RM23 1XJAA 4IE6A 3K77A 4NHKA 4XEZA 1X8MA 2FZ2A 3ZDVA 1RHI3 3IMNA 1UY4A 2ATFA 1QMJA 2E31A 3JQXA 5F3EA 5D8AB 5C5UA 4OI2A 1J1TA 5A7WB 1QOOA 1SACA 2BERA 1GYKA 1Q8QA 2XB6C 2BW8A 4YVSB 2YC0A 5LZ6A 3JXSA 1H4GA 1PO21 3VB9A 3PU3A 5LBCA 4CVUA 3MW3A 1RUE1 1QJY2 1WBLA 2JKXA 4OUSA 4PBOA 5DN2A 2WSUA 4RGKA 3SLIA 3WHUA 4CA9A 5J96B 2ZHLA 4Y4RA 1WD3A 2A6ZA 1PIV3 3NWKA 4RQPB 4P08A 1RVF2 1J3RA 1GU3A 3O7OA 3UETA 4FPKA 1ZRCA 2OPKA 4V1PA 5C9AA 4OI1A 3H1MA 1SLLA 3ACIA 2W3JA 3HT1A 3NVCA 1VBD1 1W2TA 4C0HA 4K20A 4Y24A 1XXNA 1CWPA 4PDWB 2I45A 2RDRA 2W9XA 3AXDA 4L9BA 4Q4X1 4HPKB 1H6XA 3LF7A 4FOVA 4P9GA 1AYN1 1T2XA 2XLAA 3WF2A 4J6GA 3ZXJA 4Y3OA 4YW4A 5K0UB 4AVVA 4CCEA 5FPBA 2ZGSA 1N1SA 4K8RB 4LBJA 4YGCA 1QXJA
chains in the Genus database with same CATH topology
2D6PA 4HKWA 3AYDA 1MQTC 4BWOA 2VY0A 4NN0A 4Y1VA 5BNNA 1X8EA 2OIIA 4XHXA 1CAVA 3UL2A 1D2QA 1UCXA 1BMV1 3MEPA 2Z69A 5AVPA 3TOJA 4IV3C 5I0RA 2JG8C 4U2AA 2RS11 1PZ8A 1DGRN 2YGLA 1RJ7A 2ILMA 2HWC2 4X8NA 4D7TA 2XLFA 1Y3TA 4SBVA 4AEJA 3V0AB 3RSJA 4XJUA 4YG0A 1LTEA 3UKTA 5BNOA 4OHXA 2ZPXA 4XFIA 4A7KA 2RS33 1FNZA 2A6YA 3ROUA 1NY71 2W39A 2JG9A 3ZIWA 4KG0A 1VB2A 4PF5A 2PA7A 3WW4A 1H8TA 2B42B 4XF9A 4FTSA 3N7KA 2VW1A 5JOXA 4KGGA 2MEV3 5FPXA 2RJLA 2JXAA 3T1MA 1QQP3 4AHXA 2PYTA 1DZQA 3NJZA 3ME2A 2VOWA 4EN0A 4RHV2 2UWAA 4XF3A 2ZGNA 2ZCWA 4XYXA 4Z82A 3B5LB 3VDDC 4YVSA 1LOFA 5JPMB 3GBFA 3MLLA 1LENA 2BWCA 3B01A 3QOPA 1V6KA 2AENA 4XBQA 2C9AA 4ATFA 4Q27A 1VRH3 1BYHA 1H0BA 1POV3 5J48A 3ZFGB 2CL2A 2R1DA 3JBG1 3B3QE 1V70A 2R6QA 2VQAA 4AFCA 2YXSA 3R0RA 3ZN6B 4X6QB 3ZN5A 2RM22 2ZMLA 4E2GA 5JZGA 2E51A 3VKLA 3J4UH 4XXAA 1RHI2 2GZWA 5CFDA 2LALA 4PDWA 4DB5A 4AI8A 1GANA 4IERA 4HPKA 3HIFA 2JECA 4AEMA 2W0XA 1EAH1 3H50A 4UW3A 5I8YA 3U4XA 3USSA 3WQ7A 5BV6A 3FUOA 1F2NA 5JMCA 1U0AA 3NV4A 4I09A 1Q5OA 1QOSA 4TYSA 4FCAA 3UJQA 1O91A 1S0FA 1OQDA 1B35A 1PIV2 2A75A 5GZCA 2BFUL 1RMU3 4YLZA 5E16A 1C1LA 3GF6A 4GMP3 3B93A 1A8MA 5KHGA 2VU9A 3PVEA 5JDBA 3VGIA 2HWE1 4LE4A 4R9AA 2DCZA 1Q3EA 5DXDA 1APNA 2ZX1A 3RI9A 2R30A 5C4WC 5JSPA 2RR12 3HBZA 3UK9A 2R043 4WV8A 3V0AA 4DPNA 1GQHA 3WNXA 1WW7A 4KG8A 2OA2A 4JGYB 1R083 1QJU2 1HQLA 5H9QA 5CU1A 4QU2A 1AX1A 2ZTNA 2WWSA 1VBC1 1JHNA 3WR0A 2R063 5JI7A 3D4KA 1Z0HA 1W6OB 4B4RA 2XPJA 1LGBA 1EYBA 1D0HA 2XBO1 4J1XA 1AYM3 2R32A 1PM7A 5DUVA 4Y1XA 2GNDA 5FOBB 3VHNA 3OBTA 2OZJA 5L19A 4K9SA 3KM5A 4UBHA 5JR7B 1H9PA 1ZZBA 2PLV1 3ZMOA 1VBA1 1LR5A 1N3QA 4XFGA 1JW6A 1YNAA 4Z8BA 3LKJA 1F8VA 1R1A3 4XZPA 1AR81 4QD2A 1DGLA 1RUG1 4Q0QA 1QDOA 1ZX5A 4LBOA 5H9SA 4BM8A 4AI2A 3I4IA 4LO8A 1ENXA 2BTVC 3GZTB 3ZFGA 1NG0A 2JEMA 2XJPA 1RGSA 5HCAA 4BLIA 3MIBA 1VB4A 2Y0IA 4K21A 2CGOA 1W6NA 3ZN6A 1EPZA 1GV9A 1AL21 1YFUA 3UKNA 4JDMA 4HN1A 2HWB2 3AZYA 1G9CA 2HWD3 1UKRA 3U0ZA 1W2UA 3ES4A 2PHUA 1LODA 2CYFA 1DHKB 2BNOA 1CJDA 1MS4A 3KZ4C 1Y9QA 3X29B 3AXEA 5T52A 3WDVA 1VRH2 5A32A 2WL1A 3WY6A 2DURA 3NL1A 5HCFA 3AP7A 3BU7A 5FBZA 3UJOA 1B09A 3ZSEA 4GH4B 2XL7A 3MFCA 1NA1A 4LHNA 4XQ4A 3FBMA 3ZFFC 1UD1A 3M2MA 2D44A 4FPGA 3TN93 1RUH3 1C1FA 3CJIC 2R0FA 3IDBB 3O5SA 5LK7B 1CAXB 2X5IB 2GC0A 2F4PA 2WFF3 4M3CB 1XNCA 2PHRA 2R0HA 2P3IA 1FAYA 3EBRA 5BNPC 4YARA 1DYPA 1ZBA1 4XF4A 2CGPA 2D6OX 2W68A 3S6PA 1OFNA 4LBQD 1RUJ1 3CLPA 3M1HA 3VBUC 3WDXA 4CDQB 2JKBA 1WBFA 4H55A 4COUA 4CDWB 2D5FA 2VUJA 3MLJA 1XE7A 3FLRA 3ZFEC 1C5IA 4DMIA 1AX0A 2NM1A 4DY3A 4OUMA 2HWF1 5IUQA 2QZ2A 3O0VA 1VBE2 2DVDA 2Z5WA 1H9WA 4CEWB 1G9BA 2HJIA 3NW4A 2ZGTA 2R042 4AEDC 3LZZA 4IEPA 2UYBA 1L3JA 1R082 4IV1C 1UMZA 2ZHNA 1HXS1 2CAUA 4MYEA 2AH2A 5I0TA 4WM7B 1VBB3 2E63A 2FQPA 2B5HA 3EHKA 1YLLA 3SISA 5JPNB 1UZYA 5LRRA 2ZJCA 2YV8A 1RUD1 3KLSA 1ZM1A 2RJKA 2VH9A 1V00A 1S2BA 2JG8A 4IV3A 1Q8PA 5FAXA 1OOPB 1ZZ6A 2GSYA 1BXHA 1OA4A 3HAGA 4B29A 5LEJA 3HT2A 1X36A 1LKNA 3D6EA 4FSJA 1A78A 2A6XA 2H0BA 1CAWA 3E6BA 4IQPA 3VBRB 1ND2C 3ZYRA 2VUAA 4XJZA 4ORFA 2DCTA 4FP2A 3ZXLA 3T1LA 1PZ9A 3L9JT 1NCQC 4AQSA 1BCXA 5L7OB 1A3KA 4GH4A 3S7IA 4D7YA 2NP0A 2DWRA 3L2YA 5K8SA 1VR3A 2P3KA 4E27A 1SCRA 5E88A 1NCRB 3VZNA 4MXWB 4DOUA 1HQWA 2HWD2 4AHYA 1S0DA 2E7QA 3OTFA 5KHKA 1DZTA 5CFCA 2RS51 2SLIA 3VDDA 1RUI3 5CBLA 5C8CA 1PGL2 5FRAA 4YGEA 1QKQA 3M70A 3SMHA 5EYXA 3NAPC 1IHMA 4E4SA 3JCIA 2IXIA 4I2OA 3N7MA 5IK5A 1CONA 3JB4C 3JBG3 4KNCA 4KU8A 2QQPA 4QPGA 5KXCA 3FHIB 4GB32 5CIRA 4XTPA 4BA6A 1KQRA 3SXWA 3RMXA 2AGSA 1AR93 2GMPA 3BPZA 4RGGA 4QQPA 4CDQA 3FLPA 5T54A 4CDWA 1GBGA 1CVNA 1RUH2 4LBKA 3HN1A 4XMAA 4Y22B 2IXHA 2R073 1DF0A 2WFF2 3IDCB 1OI6A 4L11A 3AZWA 4CEWA 3AYEA 1ASJ1 1PO22 1EAH3 4DS0A 4OLLA 2N7GA 2DCJA 1EY2A 1S2KA 1CGPA 1FNYA 4HN0A 4JC1A 1QJU3 1AR61 1CN1A 3I54A 4HVRA 4DNYA 3EJKA 4YZ1A 5T5OA 4N53B 2OUHA 4Q4Y1 1IOAA 2PFWA 1VBD2 3SH5A 1PK6C 4CEYB 3N35A 4IEUA 1V9U1 2XJTA 2H6BA 2QNKA 4YRDA 3AKRA 3WW3A 1AYN2 1YRZA 4UW6A 1W6QB 4CDXB 2DTWA 3M3OA 3QACA 3VZJA 2UWBA 2D7FA 3ZXAC 1C28A 2E9QA 2R16A 5AVAA 1UIKA 1LGCA 2B45X 3TAYA 3VBSB 4CP0A 1RVF3 2JE7A 2VNOA 5GJ6A 3VBRA 2A71A 1VBC3 3JUUA 1HW5A 1AVBA 2GU9A 4E9KA 4GKYA 3TNQA 1BMV2 3E5UA 4AK3A 4XF0A 1C8M1 1SBDA 2Z42A 2RS12 4AF9A 4PIYA 1D4M1 2A3XA 2PAKA 3KS7A 4QX5A 3WDWA 2X53S 2QUOA 4WZCA 3G7DA 3SCFA 1VAKA 5DG1A 1VBA3 1JTZX 3ZSLA 3RMYA 3C3VA 2E6VA 4HKLA 2PQQA 3EQEA 5CVRA 3WLUA 5KHJA 4R9CA 1NY72 2ZGKA 5BNQA 4INDA 2Q4SA 1RTVA 1ZRRA 4XW3A 5T55A 5ACA1 2ZGMA 4BH9A 2VNRA 3V65A 1PVC1 3BOPA 3DL3A 4HKOA 4OFGA 3NKGA 4ZKTB 4BE3A 2A6WA 2BBVA 2D93A 3O0WA 4XQDA 1S0IA 2ZGOA 3AP4A 3G6JB 2GNBA 5GZFA 5AC91 3AP6A 1WCDJ 2VOXA 1QNWA 3FFZA 4RS5C 3THTA 1ULDA 2R1BA 2YPJA 4OHZA 2WNVA 1JN2P 5FTTC 2ZHKA 1I9RA 2K0GA 4CZSA 2WNEA 3ZDSA 1UPSA 1ZYBA 1ONAA 4GIQA 3WUDA 4F8AA 2ZX2A 4M00A 1CX4A 2JENA 3AZVA 1ZZ8A 1FMD1 3AMNA 3WCSA 1XNBA 4AI0A 4A2UA 2BEOA 1O3RA 3VBFB 5KHHA 3JBG2 3ZPYA 3WG3A 4YVWC 3VZOA 3AMHA 1HKDA 4OULA 1YFWA 3GZAA 1J58A 3HD8B 1BEV1 3AKTA 2IXLA 3M3QA 5FDBA 1WGPA 2Q8OA 3OF1A 1MS5A 4R8HA 4Y5Z0 2GH8A 5B2GB 1FI2A 3CJIA 3CJXA 4CEYA 3DPRC 3CNAA 1LHUA 2Q5TA 1IKPA 1CESA 3WW1A 2YROA 3D0JA 4FBFA 4MGKE 1W6QA 4CDXA 2YDEA 1EAH2 3POWA 1N1TA 1CR7A 1REDA 3BOWA 3OYWA 1NLRA 2UYAA 1IS4A 1KS5A 4BIFA 2YUEA 4FPHA 3WDUA 1GQGA 2BQPA 4BOWA 2VECA 3JQWA 1Q8OA 3KT7A 4ISQA 4TZDA 3J9SA 3H8UA 4AI3A 1RUJ3 3PVNA 2EAKA 1IGOA 1O5LA 4I02A 4YSFA 2Y26A 5KXBA 5K7PA 2VMGA 2WT0A 1RUNA 2HWE2 3ZN4A 3ZFEA 1VJ2A 2D6NA 3MGUA 5DDJ1 2HWF3 4YZ5A 4GKXA 5D1IA 1LHNA 4R4XA 2RMU1 4BPZA 5ABJA 1R091 1OLQA 4K1ZA 4LUMA 1DQ6A 2HEYF 1LECA 2P17A 1ENQA 5JIAA 3TYJA 1H1IA 1HV0A 4AEDA 3AZXA 3WHTA 2PHWA 4QM8A 2QCSB 2PN5A 1HXS3 2AR6A 4ZU7A 5JZGB 1VBC2 1R1ZA 2D6LX 2MPFA 1PNFA 3TRSB 4JCKA 1HRI1 1OKQA 5CFDB 5I8TA 1DGWA 3KGZA 1KDMA 4Q4V1 2PAEA 3LA7A 1WMEA 2XBO2 2SBAA 5TSWA 1RUD3 1QJX1 5HBAA 4XFAA 1RB8G 4IESA 1SBFA 3J26N 3L2HA 3MPBA 2RR13 4XBNA 5GLUA 2UY8A 2IXJA 2PLV2 1T6GC 1VBA2 2RE9A 3U10A 1AR82 2DU1A 1RUG2 1B35B 4FPJA 2XKOA 4HFSA 4ASLA 2NMNA 2X8KA 4FOWA 1XE8A 2ERFA 1W39A 1V6LA 4LEJA 2A7AA 1AJKA 3VBFA 1BVVA 3FLTA 1JYIA 4D94A 2MHFA 2WS91 4LHLA 4MX3A 1LB2A 2WZR1 1AL22 5EFUA 2CAVA 4NVPA 3ZO0B 1RUOA 3OGGA 3WVJA 2DV9A 2VGDA 4K3UA 1PMIA 5GZEA 4B3NA 3DUIA 2D3SA 3FUQA 3TNPB 2ET7A 2QZ3A 3SCGA 2RS53 1WA4A 4O9GA 4QPIC 5L73A 5J37A 4YM0A 4EJRA 4FPYA 1OHFA 2XUMA 3NAPA 5I93A 5T5JA 4LUKA 1SQ4A 3FX3A 2DFCA 3LAGA 1J59A 3CU7A 1FX5A 4AVAA 2VQ0A 2X29A 4HANA 3VBHC 3KCXA 1V6JA 1WLTA 2Q30A 2OW4A 1LU1A 1KXGA 4C90A 4EWEA 2HWB3 1U5YA 4JV4A 3LOIA 1IS3A 3J8F1 5HI0A 1IKQA 3NSTA 1TNRA 1H30A 1ZA4A 5KC6A 1S0BA 1GZWA 5IK7A 1DQ1A 4MGZE 1H4HA 1ASJ3 2GN7A 1SMVA 5A33A 4AGGA 3OD4A 1ZRFA 1ZBA2 1BBT1 1JBCA 1W6NB 2XVLA 2Q0AA 3POSA 4LBLA 4E4ZA 3GZUC 5GLZA 5KXDA 5DUUA 4X6RB 1RUJ2 4DRRA 4M01A 4Q4Y3 2OUJA 3AMQA 2O1QA 3K48A 1ULGA 3B9CA 2EF6A 1A8DA 2UURA 4OI4A 2HWF2 4F3JA 4PLMA 1XNDA 1JH5A 5J98B 4G4FA 5CB7A 4HVQA 1XYNA 1HX6A 2LUWA 4QGMA 5A32B 1OSGA 3H7YA 4N7UA 1MS8A 2CGNA 4UW4A 4HVOA 3DN7A 1HXS2 2GALA 4N43B 1NA1B 2GNMA 1EV11 3KGLA 2ZZQA 1YJKA 3P3PA 4COWA 1J1LA 5FO7B 4E2SA 5J09A 4XJ8A 1RUD2 3NV1A 5EXOA 4JGZC 3JU9A 1WW4A 2CY6A 1WLCA 1TME1 3B7MA 2DUOA 3VKOA 3VL8A 3IDEA 1VBE3 1C5HA 2PHFA 4AQ6A 1F9KA 1YI7A 4WM7C 4XTMA 2HEWF 2YZ4A 1CIWA 2V73A 1WCSA 2WNUC 4IXLA 2QJVA 3ZSKA 4KWLA 1SLIA 2PHLA 4AFBA 5K9YA 3MW4A 2BFUS 1ALYA 4WVWA 1G86A 4FPOB 5FREA 4LT5A 1OQ1A 2VW2A 4D69A 1OOPC 5ACA3 1PVC3 1UZZA 4QPYA 4Q4W1 4W6WA 2B8MA 4B7EA 3SH3A 1I5ZA 4EWAA 1V6OA 2E53A 4OHYA 1J3PA 3O0XA 4Z07A 4XFFA 1IPJA 4LLOA 5DZFA 1OFSA 4W6XA 4BLJA 1AZDA 4HL0A 1V6IA 1OLRA 2XVKA 2ZKNA 1I3HA 1NE4A 4DINB 4DRVA 2RS52 4MLOA 4WVMA 3H3ZA 3MYXA 4XQWA 3E6CC 3JD71 4OHVA 5E89A 4MGIE 3BCWA 1MQTB 4LO5B 5L7OC 2VMIA 3H7JA 1AR71 4JVAA 4R52A 1GSLA 2BVBA 3TWIA 4CRQA 1NCRC 1QJZA