5AVAA

Crystal structure of pha-e lectin in complex with bisected glycan
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
238
structure length
238
Chain Sequence
ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythroagglutinin
publication title Atomic visualization of a flipped-back conformation of bisected glycans bound to specific lectins
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 47
structure length 238
sequence length 238
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5avaA00
2DYCA 5HCAA 2DVGA 4M00A 1N3OA 4U2AA 1LHOA 3AZYA 1OQ1A 1D2SA 5FREA 3SITA 4GWNA 1DQ1A 1VAVA 2ZGRA 1GYKA 1PZ7A 2DVDA 4F83A 3MW4A 1LU2A 1TEIA 4LBQA 1MVEA 4ISQA 1V6JA 1S0DA 1G9AA 5LK5A 4YW4A 4BOWA 5KXBA 2P3IA 2GN3A 4LBQB 4Q1RA 1W6QB 3ZXEA 3WLUA 2FHRA 1DYPA 1LESA 1SLIA 1YRZA 2C5DA 2VY0A 3IPVB 2ARXA 4PBPA 4W65A 2GALA 3WG3A 2CWMA 2PHRA 1SLAA 2PHXA 4M3CB 1IS6A 2ZA9A 3D4KA 1SBDA 3AYEA 1O4YA 1CIWA 4IQPA 4Y20A 5EXOA 1N47A 2A3XA 1UPSA 3OBTA 1GKBA 2EXIA 2R16A 1S0CA 2I2SA 2WNEA 2EXKA 5HCFA 1AF9A 3ILFA 2EF6A 4Y24A 2ZMNA 1SLTA 3OY8A 3WOGA 2A3YA 5IK7A 2OUHA 1FV3A 2A7AA 1G8WA 4FPHA 3HR9A 4FQ4A 2UU8A 4Y26A 3VKNA 2WT2A 1MZ5A 3OBRA 3AP4A 1V00A 3AYCA 1DBNA 1MR5A 1F5FA 1VAMA 2PHFA 3OGGA 2DTWA 3AZZA 1C57A 2NMNA 4ISRA 4XJUA 2DU1A 1NXD1 1WLCA 1KJLA 1WW7A 3VUOA 3INAA 1Q56A 1JYIA 1EPWA 4AVVA 3R4UA 5DUUA 1WD3A 2E7TA 1JW6A 1W0PA 3AXDA 4M01A 4YG0A 1HQWA 4YG6A 2ZGLA 4R9AA 4YFWA 3UJOA 1WLDA 5T5LA 5T5OA 4PBOA 1QU0A 5GALA 1IS5A 1GLHA 2E51A 4AGRA 3IKWA 2AENA 1YO8A 2NYYA 1UAIA 2VXRA 2WSUA 2ZBJA 2ZGKA 1R1ZA 2D6OX 2R49A 1WW5A 1DIWA 3V64A 4AVSA 2HYKA 1N1VA 3TAYA 4TZDA 4FOQA 5DUVA 3N7JA 4R9BA 5EYYA 1MACA 2WKKA 3FUOA 3ENRA 2DTYA 1V6IA 5GLZA 3SLIA 5JOXA 4YGDA 3NV3A 4DRVA 1N3QA 1V6LA 5T52A 2ZHMA 1QDOA 4NO4A 1JHNA 2ZGQA 4DPNA 4ZKTB 3U4XA 2YMZA 2YZ4A 1JUIA 3AYDA 2LALA 1LOBA 1ULDA 3KM5A 5JLVA 1MVQA 1U0AA 1C1LA 5IK8A 3FUQA 1NLSA 2XG3A 1IOAA 3L2YA 1HKDA 4FPOB 1MS3A 3QCWA 5FRAA 1JXNA 1APNA 1S0EA 1W6NA 1BKZA 2A6WA 2ZKNA 2A71A 1DHKB 2W39A 4R9DA 4WVWA 5GLTA 1FYUA 1GNZA 1BYHA 3AP9A 1AX0A 1LECA 1WUVA 2R0HA 4Y22B 2OVUA 1LOCA 1LOEA 2DUPA 1ZA4A 1FAYA 2CNAA 5DZFA 4P14A 4YGBA 3SH4A 4FP2A 5KXCA 2PHUA 3ZYPA 1W6PB 1Q8QA 4FQZA 3M3QA 1C1FA 1RITA 2EAKA 2DUOA 3NV2A 1KRIA 1QDCA 2CTVA 1FX5A 1QGLA 3WDTA 2ZACA 1YYNA 1Q8VA 2D3PA 2ZMKA 4MYEA 1ULCA 1QNYA 1SLCA 1DGLA 3I8TA 3A0NA 1RIRA 1V6MA 3SNMA 2E6VA 3AP5A 4LBQD 5BYNA 1CJPA 2VW0A 3O12A 4ITCA 2AGSA 3D6EA 4LBNA 4M3CF 4YG3A 5IT6A 3V65A 1LCLA 5GLVA 3AZXA 5CAZA 1DFQA 4FPCA 4TYSA 1UZZA 2D6MA 3R05A 2VUAA 4FP3A 3KQRA 1DLLA 2A6ZA 2ENRA 3WCSA 5JOYA 1OKQA 2A6YA 4Q27A 1LOAA 3IMNA 5F9TA 3AX4A 2A6VA 1O4ZA 2W08A 4JCKA 2NN8A 1SBFA 4Q8KA 4GALA 3PJQA 4GKYA 1W6QA 3B00A 4K1ZA 1AX2A 3AFKA 2DURA 4GWMA 4YZ3A 3C2UA 2DVFA 1MS1A 1OFSA 3DGTA 3IPVA 4XJWA 2OUJA 1SLBA 3ZSLA 3BTAA 1VALA 3FBYA 4M3CA 2A70A 3AXEA 4ZXKA 1LGCA 1CR7A 2EALA 1MS4A 1GZCA 4FPJA 5DXDA 5CNAA 3N7LA 2D43A 1WW4A 3H0OA 4HANA 4YW3A 1JBCA 4YZ1A 2YY1A 1H9PA 1AJOA 4XJZA 5L73A 1WW6A 2D6PA 4XTPA 5IK4A 1QMJA 2GNDA 4Y1XA 4XJ8A 2G4IA 2P3KA 3DUIA 2PHWA 3SISA 2EIGA 4I30A 2A6XA 2ZGSA 4XOGA 5T50A 2E53A 2KM2A 3BOPA 3R4SA 5H9QA 4AGGA 1AVBA 4YM1A 3NV1A 3RQ0A 3BODA 4UW5A 3D5OA 5H9SA 1A78A 3A4UA 3POYA 4Q8LA 3LSDA 1LHUA 2WJSA 1DQ0A 2P3JA 3AYAA 3GNEA 3FFZA 2A75A 1BJQA 2D7FA 3AZWA 4GA9A 4UW6A 4XBLA 4YW1A 2ZGOA 2VW2A 5JOZA 4AVTA 2PHTA 3T1LA 3WUCA 3RMYA 3N36A 4PF5A 4GKXA 1CPMA 3VKOA 4XMIA 1YIFA 2C9AA 5DG1A 1UL9A 2GDFA 2JD4A 3PVNA 2JE7A 1S0BA 1JYCA 2B7YA 5KXEA 1Q8SA 2SBAA 1XQNA 3ZVXA 4DQAA 3RG0A 1UZYA 2GMPA 1N1TA 2WT1A 4FOWA 4FPLA 4YW5A 4C1XA 4YZ5A 3WDVA 3USUB 1LOFC 2DVAA 3WUDA 2CL2A 1Q8PA 3ZSKA 3OYWB 3RRDA 3WDYA 2NP0A 4XBQA 1UN1A 4RA0A 1CESA 2AH2A 2DU0A 2E7QA 5H9PA 1ZM1A 4YM0A 2CY6A 4AGVA 4WZFA 3WNXA 2D3SA 2ZAAA 2D6KA 4JC1A 4Y22A 2D3RA 1GZWA 3N35A 2RHPA 4U36A 4YFZA 2WLQA 3M3EA 3O0WA 1V6NA 3VKFC 2P37A 4XHBA 1SBEA 1GZWB 1W6PA 2ZGNA 4Q1PA 3WG1A 1J1TA 4H55A 1W6OB 3V0AB 4Y1ZA 3WDXA 3AJYA 2R1BA 2JKBA 3PVOA 1C4RA 2NZ9A 1AXYA 3PVEA 5GZEA 3ZXJA 4AYUA 5GZGA 2D6LX 1AXZA 2NM1A 2UWCA 2ZGPA 4Q2FA 1ULFA 1KDKA 2WQZC 2A5ZA 3VKMA 5GLWA 3ILRA 2XB6C 1ENRA 2CYFA 3FLRA 3M3CA 4KBBA 3ZXKA 3MEPA 1G86A 1DQ4A 1GANA 1GZ9A 3LSEA 1UMZA 1VIWB 5HCBA 2ZGTA 4XHXA 4XZPA 5CBLA 1HQLA 1SCRA 1F31A 1W6MA 2VW1A 4UW3A 1V6KA 3WG2A 4BMEA 3ZXLA 2ZGUA 2ZHNA 4YGCA 1GNHA 1W6MB 2DUQA 2UWAA 5GJ6A 3JUUA 1GBGA 2R1DA 1IS3A 5JDBA 4YM3A 3O0VA 1QOTA 2CWSA 4LBLA 3NWKA 1S0GA 2V73A 2W68A 3OJBA 2DV9A 2PELA 2EXJA 2GNTA 1QKQA 3MW2A 3Q9OA 3TB0A 4ATEA 1G9DA 3PMEA 1ONAA 4LBJA 4FPKA 3APBA 4Z8BA 2ZHLA 3ZPYA 1LHVA 1YXWA 2GMEA 3W58A 3WG4A 1PZ9A 1KDMA 1X50A 5AVAA 2JDZA 1LODA 1KITA 3A0KA 4XBNA 3ZSMA 4DFSA 1LENA 3LCPA 3UK9A 5GM0A 2ZGMA 1WCSA 1S0IA 1JN2P 5JMCA 1DYKA 1LOFA 2AYHA 4FOVA 3N3HA 4BMBA 4RL7A 5GZFA 3M3OA 4PQ9A 5JOWA 2UURA 1CVNA 3V0BB 1S0JA 5SV8A 3SH3A 1QOSA 3AP7A 3JU9A 1A8DA 4WVVA 1HDKA 1IKQA 2EXHA 4SLIA 1KJRA 5DZEA 1G7YA 1URXA 1D0HA 1DQ2A 1ENSA 4K20A 1QOOA 2D44A 4XTMA 4BPZA 1Q8OA 1SCSA 4YM2A 4XJ9A 1LU1A 2W52A 5IUQA 4XE9A 4BLJA 3AP6A 5H9RA 1CN1A 1LGNA 4JRAA 1LEDA 3OPZA 3AJZA 2ZABA 2A3WA 3POWA 5IK5A 2V5YA 4FVVA 2JE9A 4PCRA 2DWRA 3BIWE 4P9WA 4XJAA 1BXHA 1N1YA 3ATGA 4XXAA 1AJKA 4FPFA 2H0BA 5E88A 1LJ7A 1IS4A 1FNZA 3N7MA 3WDUA 5CA6A 1SFYA 5DUWA 1Z78A 2ERFA 2YROA 3B69A 1ULGA 2P2KA 4Y20B 1WBFA 1VLNA 2GN7A 1WD4A 1G9CA 1QNWA 4LBOA 1Z0HA 1WBLA 1LHWA 1GV9A 2ZZJA 1FATA 4BQ1A 1Y7BA 3OY8B 5F5QA 3WZ1A 4XXPA 5DUXA 5GLUA 2YXSA 1BZWA 5T54A 4FPYA 3ILNA 3POSA 1LTEA 4M3CE 4Y1VA 3MPPG 3WHTA 3IM0A 3RS6A 3B9CA 4D69A 3USUA 2D6NA 4HL0A 3T1MA 1SLLA 1B09A 4Q26A 1LULA 3M1HA 3OYWA 1KQRA 4ASMB 4BM8A 5GZDA 1SACA 4LBKA 4DS0A 2SLIA 3VKLA 1ENQA 1MS9A 2FMDA 1MS0A 1LOGA 4CRQA 2LTNA 2AR6A 5KXDA 3I4IA 2ZHKA 3VV1A 4CTEA 2Q5TA 1H9WA 4OZXA 1QF3A 5T55A 1LHNA 3WVJA 3M2MA 1JOJA 3NV4A 3WV6A 5EWSA 4DRRA 1RINA 3CNAA 2ZMLA 1S0FA 3T2TA 1G9BA 3O0XA 3V0AA 1W6OA 2VH9A 1GICA 1V6OA 4CZSA 1DQ5A 2GMMA 3FLTA 4LBMA 4AWDA 3ASIA 4XYXA 4Y1YA 3ZXFA 1DZQA 1MZ6A 1UX6A 4FPEA 4P9XA 4WV8A 1S1AA 4K21A 3O5SA 3IN9A 4FPGA 5E89A 4UW4A 3WHUA 1MS5A 3RMXA 2AREA 2ES3A 3B3QE 3GALA 3MW3A 4P9YA 5JVVA 4BLIA 1I3HA 5E8AA 1FV2A 2GNBA 5DZGA 3SH5A 3ZSJA 1AZDA 4K1YA 3ZYRA 3WCRA 2Z42A 1W6NB 4YLZA 1DQ6A 4R9CA 1I1EA 1W0OA 4FOYA 3QLQA 4Y1UA 4XILA 1LEMA 2YV8A 1H30A 2JJ6A 1AXKA 2WSVA 1WLWA 3AZVA 4YW2A 3HN1A 1MS8A 2TEPA 5DG2A 3UL2A 1AX1A 4YZ2A 1F9KA 5T5JA 4GXLA 2NMOA 4YGEA 1FNYA 4ATFA 2R0FA 1UKGA 1IKPA 3N7KA 1CQ9A 1A3KA 3RSJA 2WT0A 2BQPA 1ULEA 1PZ8A 1N3PA 5T5PA 2GNMA 2P34A 2VU9A 4YZ4A 1BQPA 4XDQA 4XIKA 1YI7A 5CB7A 5GZCA 2OW4A 4XIOA 4C1WA 2ARBA 1N1SA 3HMYA 4XMAA 3W59A 2JECA 1CONA 2AUYA 3B01A 4NOTA 3WDWA 1G9FA 1HLCA 3V0BA 1LGBA 3AK0A 3FLPA 1CPNA 4L8QA 2UWBA 1GSLA 5EYXA 3UJQA 2DVBA
chains in the Genus database with same CATH superfamily
5HCAA 1HN1A 4M00A 1NZCA 4I0AA 3VBUA 3HOBA 1PIV2 2YFZA 4WBBA 4MGTA 4LHLA 1OF3A 1VAVA 1GYKA 1PIV1 2WFF1 5JIAA 2G1MA 4C0HA 4LBQA 1TEIA 4ISQA 3FMGA 4L99A 3WT3A 4ZU7A 3POGA 2XBO3 4YW4A 5KXBA 5C4WC 2GN3A 4LBQB 1RUJ3 2BYVE 2W87A 4IESA 1DU3D 3ZXEA 4DZGA 2FHRA 1DYPA 4QKDA 2C5DA 4NPMA 3PDQA 2KA3A 3WP6A 1W9YA 5F5AA 4M3CB 4W6WA 3CJXA 3CZJA 1SBDA 1VAKA 2Y6FA 2VVFA 3NVCA 5FY4A 1CIWA 1RGSA 4Y20A 4YARA 4GIQA 4PIZA 5FZ3A 3THPA 3WNPA 3ZYIB 1JZ5A 1CX1A 1N47A 2BZDA 5ACA3 2C0ZA 1J84A 2GC1A 3VL8A 2H6CA 4UI9L 3UNPA 2R063 2KR2A 2OQ7A 2RVAA 3HQXA 1SLTA 3OY8A 2PYTA 5IK7A 3Q8EA 2W3JA 5FP9A 4Z07A 4Y26A 5CKMA 5CZKA 4QAWA 2J1AA 1V00A 1PHMA 3EO6A 1YLLA 2RR11 4RN5A 5CFCA 2PHFA 1MR5A 4XVHA 2UYAA 4QKNA 3NNGA 3S7EA 1NXD1 4E8CA 1WLCA 1EV13 2JG9C 2ZKLA 1OLMA 5A3NA 3VBHA 2WWSA 3VBFA 1JTZX 1EPWA 4GH4C 1JW6A 4HKWA 4YG0A 4YG6A 3ZMNA 3OPTA 2V72A 2VMHA 3ZFGB 4N9HA 1QU0A 4PBOA 1IS5A 2WAOA 1JU4A 1F2NA 2PFWA 2WC2A 3MIEA 2XPJA 2BOIA 1YO8A 2VXRA 4LNVA 4AVBA 1W3XA 2HWF2 4CYDA 1AR91 1F5JA 2I07B 5JMOA 3U0ZA 2XGXA 4FOQA 5DUVA 1VBE2 3IWZA 3N7JA 5EYYA 1VB4A 5FMDA 5JZGB 2WKKA 1IPKA 3FUOA 4I3PA 4XF3A 4AQTA 3KGZA 3KHBA 3NV3A 2AEYA 4BIOA 1VBE1 5M0TA 2ZHMA 4BQ2A 3W5NA 2BFUS 2Y64A 2A73B 1JHNA 2WL1A 1XNCA 4LIVA 1FT9A 4DPNA 5FY5A 3KD4A 5F3CA 4XFAA 3ZXGA 1L7QA 2XH6A 3AYDA 2ZPXA 5F1RA 3RWKX 1MVQA 1C1LA 4CDQC 3BU7A 3FUQA 4FXGB 3LOIA 5C4WA 3JB8A 4FPOB 1WCUA 4D3WA 4EZHA 1O5UA 1XBFA 5A3TA 2FD8A 5C4WB 2CDOA 3T08A 5J1XA 3MLLA 2Z4FA 4AXOA 1LAJA 1ZBE2 3N9QA 1RUI2 3AP9A 1F35A 1QJU3 1Y9MA 1LOEA 2VZSA 2QTWB 3WW1A 2CNAA 1GFF2 3OUJA 5DZFA 1QEXA 3K4AA 4TWTA 4YW6A 3ZYPA 1JYNA 5J3UA 4DOUA 4MXWB 5FZOA 1KFXL 4Z1VA 2I45A 2VZ3A 3OG2A 4L9BA 4QX1A 1QJEA 4K8FA 2EAKA 5FZOB 2VG9A 3WDTA 2K0GA 4JKMA 4ZPIA 5IVCA 1AL0G 4MYEA 3NAPC 1SFNA 1RMU3 1OQDA 3A0NA 4UFJA 3VBRC 4MG2A 4LO8A 1EP0A 3SNMA 2E6VA 4LBQD 3WNMA 3VZJA 4K6BA 4ITCA 2AGSA 2JG9A 2XR4A 2Y33A 2VOTA 4QQLA 2IXLA 4LBNA 4RD7A 4AEJA 1C3HA 4GH4A 4CPBD 3CF6E 1DFQA 4FPCA 4TYSA 2XL9A 4IEVA 4OQ9A 5F37A 3AFGA 1DLLA 4QXCA 4P02B 2B45X 2FDJA 3WQ1A 1PGSA 5F9TA 2XVLA 3GXUA 2QNKA 3WP5A 3GDBA 4LLFA 4MHUA 4FAHA 2W08A 2YC4A 1DG6A 3EXUA 1X8EA 1SBFA 1Z7S1 3MLJA 4X6QB 4IE6A 3PJQA 1VRH1 3I49A 4YWAA 4K1ZA 2WLPA 2VO5A 4A7ZA 1W8ZA 3C2UA 1R64A 5DDJ3 3IPVA 1SLBA 3ZSLA 2ZTNA 1X82A 2A70A 4K9SA 4B4PA 1JOBA 2CGOA 2VCCA 2XWJB 1GZCA 2Q4SA 5FYZA 4CDQA 5CISA 5K0UB 3P3NA 3N7LA 4J1WA 1FXZA 1PIV3 4COVA 1WW4A 1XC6A 1QQP3 4HANA 2ZXQA 4ASLA 3M4FA 1RHI2 3KZ4C 2MPFA 1EAH2 3IZOA 1H9PA 3RI8A 4MVTA 4ASKA 3E1F1 3OCPA 2E7AA 1RHI1 1W8TA 4OUEA 1EAH1 3FHAA 5C8CC 4QM9A 5D8AC 2G4IA 3VBOC 4HXCA 2EIGA 4I30A 5FLIA 2A6XA 1ZZCA 1BVVA 2E53A 2R30A 3W21A 4AG4A 3UGGA 4W8JA 5H9QA 5AFEA 1J1LA 5I0RA 4YM1A 3WW3A 1ALYA 2BWCA 4H14A 4UW5A 5A3PA 2W5FA 4QPGB 4RFRB 5FZLA 4BQ4A 2JWPA 1A78A 3A4UA 3NAPA 3PTYA 3OF1A 4DXRA 3ZDSA 3BKZA 5FY8A 3VBRA 2HWC2 3E97A 1W2NA 4HBNA 4YW7A 3KGLA 2WJSA 3NAPB 5IATA 4LHKA 2PN5A 4RGAA 2OZ6A 3CHXA 2H0VA 2HWC1 2D7FA 3FFZA 3AZWA 5FXZA 4UW6A 2QKDA 4AVTA 1UZVA 3UKVA 2PHTA 3P3PA 3WX5A 2HWE2 4FFHA 1HIXA 2X10A 4GKXA 4XMIA 1AR81 5A7PA 2C9AA 2HWE1 2EIEA 1UL9A 2GDFA 2YU2A 3AKQA 3PVNA 3T0DA 5FR3A 2QDRA 1Q8SA 3I2DA 5BNNC 2O8OA 3ZKYA 4B1MA 1UZYA 2XDVA 4A45A 5JZGC 5F6KA 1RUE1 4C1XA 3MLKA 4K3UA 4HKLA 3WDVA 4NHMA 4OHVA 2D97A 4LA2A 4WM8C 2IC1A 4B4RA 1Q8PA 2CV6A 1NY72 3GJBA 3RRDA 5IVFA 2NP0A 5CEHA 4RA0A 2X53S 3DKQA 2E7QA 2HWF3 1NY71 1ZM1A 3AVRA 3OUHA 5ANNA 2HKXA 4YM0A 5LBEA 5IWFA 2CY6A 2L9LA 4WZFA 3VB9A 4GB32 1JS9A 2ZAAA 2D6KA 4PT6A 4WZCA 2W1SA 3J7MA 4GB31 2OIIA 4YFZA 1XYOA 4P5YA 2XQXA 3VKFC 1QJY2 4XHBA 4Q1PA 4LO7A 3SEPA 3JQWA 2XJSA 1OPMA 4CDUB 1IZ3A 2JG8B 4MSVA 1QJY1 3AJYA 2R1BA 1OLME 4OUMA 1CZVA 5FZHA 4AYUA 4A4AA 3BTXA 5JR7B 4ZU4A 1D4M2 4Q2FA 1UYXA 5LATA 2D98A 1BBT2 4RS5B 5C8CA 1W8HA 1WCKA 5D8AA 1US3A 3VBOA 1ENRA 2CYFA 1KS4A 2R071 1D4M1 3FLRA 3MI8A 3F2ZA 5FUIA 3ZXKA 5L36A 2VZVA 3WEZA 1OBNA 2PA7A 1W0NA 1CZTA 2VMDA 3LQCA 1ZBE3 2ZGTA 1RUI3 3F95A 3ITQA 2WNVC 5CBLA 3CU7A 4CCDA 3WF4A 3POIA 3ZM8A 3ZXLA 2ZHNA 4A44A 3BTYA 3P5BA 3UV9A 5A6ZA 5GJ6A 3UKTA 1CGPA 4N53B 4CCKA 1YFUA 3DXUA 1GBGA 1Q5OA 1W2UA 1H1IA 2GAUA 1QOTA 4UBHA 3AKRA 5ABJC 1HRV2 1S0GA 4AEMA 4M4PA 5G05L 3VN4A 1QH7A 4RYDA 4LBJA 4FPKA 3APBA 3J7LA 3CL1A 1HRV1 3KVBA 4QDRA 4CUGA 2ZHLA 2VNGA 3ZO0B 4E8DA 2GMEA 1TME2 4X8PA 1E5SA 3N9PA 4ZY9A 5AVAA 5IJRA 3ZSMA 1H6XA 4JVAA 1LENA 3ROUA 4DFSA 4OHXA 1TME1 5BNNA 5IHRA 1NCRC 3HNYM 5GM0A 5JZGA 2Y6JA 4JGYC 2ZGMA 5JMCA 5C5UA 5BNNB 3MZHA 1DYKA 2F4PA 4ES9A 4FOVA 3LA7A 1REEA 4AZZA 4BMBA 1G6NA 1US2A 4MUVA 4RL7A 4WM8A 4CXXA 2UURA 3BIEA 2HBUA 4N7IA 1QOSA 2ZOEB 1A8DA 1HDKA 1IKQA 1OD5A 2F17A 4M4RA 4UXAA 2EXHA 4SLIA 1H0BA 4P9JA 1URXA 4AFAA 1D0HA 4UFHA 5FBZA 3R4DB 1ASJ1 1L7LA 1R081 4XF9A 3MV01 5A6XA 2VMIA 1Y9GA 1IPSA 5KHJA 3ACHA 3JXSA 4BLJA 4LJHA 2UY8A 1J3PA 3UT0A 4DB5A 2VNVA 2VXJA 4NIIA 3MFAA 2OPWA 3NL1A 4PI0A 3J8F3 5LCWL 1DZTA 1U5XA 2JE9A 4PCRA 4S2DA 3CZUA 5FPLA 3HBZA 4P9WA 3ZFFC 5FYYA 4XFFA 3U10A 2YGMA 3LEMA 4XXAA 5F39A 1ZVFA 1ND3C 2AEZA 4NVPA 4XAEA 4FT8A 3T0BA 4JHTA 5FZ4A 1IS4A 3USSA 1HB1A 3N7MA 1UOGA 1XE0A 1OHFA 1YJLA 2MNGA 1HB4A 3AMQA 4TN7A 4BU2A 1BK0A 1RHI3 2K46A 2BTVC 1YFXA 3KLSA 3MV11 2WNVA 5CIRA 1G9CA 1Z0HA 3H8XA 1HX6A 1RC6A 2ZZJA 3KV5A 4XUQA 2YBKA 2WNVB 4QQOA 2QQUA 2GP5A 1YIPA 1O5LA 2WNUB 3OGVA 3SCFA 1W8UA 5FQ0A 1GP6A 3ILNA 4IE4A 1LTEA 2VQTA 4IE7A 2CU5A 4HK9A 5JAXA 5ABJA 4Q4Y1 1O3RA 2NLRA 1ZBA3 3AVSA 1QH6A 2JDPA 1MEC2 2HLEA 3B9CA 2RG4A 3IM0A 3LFMA 1X33A 3LF7A 4HL0A 3T1MA 2VZ1A 4IE0A 4CP9A 5I0DA 3OYWA 1WKYA 2XUMA 3WD5A 4EWEA 2Q1FA 3OBZA 4QT6A 5GZDA 5AC93 1UY2A 3JBG3 2VZPA 3IT8A 4IDZA 1XOYA 3C3VA 1MS9A 2FMDA 1MS0A 4XABA 4P5HA 2LTNA 5FPXA 5KXDA 5KHHA 1NCRA 3VV1A 2BJSA 4IV3B 4JGYA 5FTTC 5JSRA 2HWE3 3M2MA 3VZNA 2WYFA 4FFFA 2FZ2A 1JOPA 2ZMLA 1S0FA 4R8HA 5LWBA 2IXCA 1G9BA 5LBBA 2P6HA 4CZSA 5FZEA 2IWGB 4QPYA 4AWDA 4DO0A 1RUG3 4CEWC 1GWKA 1DZQA 1UX6A 5A3WA 3JQXA 1H4GA 1SDDB 4K21A 2JEMA 5E89A 3WHUA 2AREA 2ET1A 5JVVA 4CUBA 5E8AA 4EROA 3W20A 1PO23 2QCSB 4AR2A 4AAPA 3SH5A 5SV5A 4L2NA 3FFQA 2C4XA 2ZX0A 2Z42A 3MIGA 5KR7A 5LASA 1W0OA 3GHMA 4IW3A 4XPVA 5EZWA 2E32A 5JXJA 1ND3A 1PVXA 5FPAA 3K75B 1LEMA 1OVSA 1WA4A 1UKRA 2RS51 5JIUA 1WZXA 4JGZC 1ZRDA 1WLWA 4JDMA 3T3YA 3TWIA 1NE4A 5FZ0A 4E2SA 4QX2A 1KXGA 1HJFA 4AI2A 3UL2A 1AX1A 1J58A 1B35C 4JZRA 1C5IA 4MO3M 5DAPA 1EUUA 1VBB2 1D4M3 2E31A 2NMOA 2QBXA 4J25A 5J7MA 1BBT3 1FNYA 1S4CA 1RUH2 4Y5Z0 1VBB1 1UY0A 4D8MA 4IUGA 1PZ8A 3NJXA 2LUWA 2P34A 2VU9A 1BQPA 4CU9A 3LEGA 1YI7A 4DUXA 1TQ5A 4C1WA 1NKGA 2ARBA 4KWKA 3HMYA 4RGKA 4DINB 4LO5B 4XUTA 4QPWA 2MEV2 3LKJA 5BUVA 2VD7A 1VP6A 2WO2A 3FJSA 4RR3C 3IIAA 3EHKA 3AK0A 2MEV1 3PURA 3CDZB 3L9JT 3UJQA 4H3WA 3THTA 4MGZE 4COYA 4ORFA 4BXSV 2DYCA 5DMYA 1N3OA 3IDCB 5LRSA 3MF9A 1C8NA 4IE5A 1D2SA 2O0OA 5FREA 3SITA 3K46A 1J59A 3MDPA 4KGGA 4UBGA 4O7XA 2ZGRA 4CEYC 2DVDA 1Q3EA 1OUXA 1PM4A 1LU2A 3MW4A 1TME3 1MVEA 2BGOA 2HWD2 1G9AA 5I93A 2ZX2A 4K8RB 1O91A 1WMDA 2P3IA 4XACA 2HWD1 1W6QB 1OVPA 3P1IA 2HYXA 3KWVA 2HWB2 4CEWA 3OGRA 2VY0A 3JZVA 3KQ4B 4PBPA 3WW4A 4CDXC 2XQRA 4HFSA 1QXRA 2HWB1 2PHXA 3EB7A 2XVGA 2WZEA 5FYMA 2QDNA 3D4KA 3S5AA 3MPBA 4NROA 3WSOA 4KNCA 5EXOA 3X29B 1GWMA 5LK7B 4P08A 2A3XA 3LDKA 1PO13 3OD0A 3OBTA 4N8MA 4NMIA 4QU2A 4OHZA 2WO1A 3VDAA 2R16A 1V0AA 2XONA 5FP7A 4NHLA 1XE7A 2EXKA 2XOMA 5HCFA 5JI7A 4NIGA 1RVF3 4Y24A 3WOGA 5LY2A 3U37A 2WO7A 4JGZA 3WF1A 4JDNA 3ZXDA 1G8WA 1W04A 4WVZA 1ZNPA 2WDBA 1B35A 3DYMA 3T2QA 5K9YA 4ISRA 1CAWA 3FX3A 4OI1A 3WNOA 4UF0B 4Q4W2 5BNPB 1XPWA 1H2MA 4AVVA 1YJKA 3R4UA 4OULA 4EN0A 1RXGA 4Q4W1 3UJOA 1PM7A 4CCOA 5A33B 3WINE 4Q0VA 1IPJA 4AGRA 4D6QA 4KU7A 3FHIB 1SFPA 2AENA 3PUQA 3TEXA 2ZGKA 4XFGA 3H1YA 2D6OX 2R49A 3J9SA 1WW5A 4RR3A 4TZDA 3OEAA 3C7OA 5JOXA 3ENRA 3BI3A 3SLIA 1W9TA 4YGDA 3SKJE 2VE1A 4LO4B 3NNJA 4ZXEA 3CO2A 3I2JA 4PJYA 1MEC3 2VMEA 5KBFA 1CD3G 2ZGQA 5FXWA 4ZKTB 2YMZA 4CEYA 1CX4A 2Y0OA 2YZ4A 3PJYA 4HVRA 1JUIA 4DNYA 1X36A 5HXMA 3KM5A 1OF4A 1NLSA 2XG3A 1HKDA 3ES4A 1IG0A 2R6QA 5FY1A 1L3JA 3QCWA 2RDRA 3ON7A 5FK7A 2GC0A 1IG3A 4FCAA 1BKZA 2A6WA 2GZWA 3GGLA 5FUNA 2A71A 2BFUL 4EV0A 4CDXA 3DECA 1FOD3 4QKFA 3ZYJB 3ABZA 4M0NA 2XJTA 3WNNA 1PX4A 3ME2A 1COV3 2DUPA 2Q1ZB 1ZA4A 1AYN2 4GMP1 1CAVB 4AQ6A 4P14A 4FP2A 4QHBA 2OS2A 4FSJA 1AYN1 1W6PB 2Y6KA 5I0SA 1GWLA 4FQZA 3M3QA 5F5CA 1VBA2 4BA6A 1HXS2 1AL22 5AVPA 2G9GA 3KCYA 4RFT0 3NNFA 3K77A 1PVC2 1C5HA 1HXS1 1AL21 1DGLA 3GHNA 3ZFGC 4HPKB 1U5YA 3LOBA 1PVC1 1RIRA 1V6MA 5JI9A 1CJPA 3U4SA 3U14A 3ST7A 3LD8A 2N7GA 1Y43B 1VRBA 2XL7A 4G3YC 4CP0A 3B7MA 1ND2B 5GLVA 2ZX4A 1K3IA 3SC7X 3DN7A 1HV0A 1UZZA 1NQDA 2K9ZA 5HI0A 4AI1A 3R05A 4D94A 3C8XA 5C3RA 1RXFA 2Q8OA 1PGL1 2JDUA 3I59B 2R041 5KWRA 1VBB3 2ENRA 3WCSA 2A6YA 3ZYBA 2A1XA 3LEKA 1BCXA 1RUH3 3WQ0A 4AI8A 2JDHA 2WFF2 4DEQA 2Y6LA 1RL3A 5FDBA 2NN8A 2WAAA 4GALA 2B39A 2WS92 4GKYA 1I5PA 2DURA 2NQYA 5A3OA 3LDRA 4QD2A 2DVFA 4ET7A 2WS91 3DGTA 1UY1A 3MO4A 4CPBA 1PMIA 2IVIB 3BTAA 1VALA 4M3CA 5FJHA 4NIAA 5EFUA 2Q8DA 4HONA 1W3VA 4Y5SA 1ST8A 3EBRA 3ZOIA 1HQNA 3M70A 4FPJA 4LKEA 4E2QA 3TNPB 2PTMA 3H0OA 4AQSA 4FBFA 4KWJA 3LA2A 4H7MA 4NWVA 1H4HA 4AEDB 5CG9A 4Q0UA 4Q4V2 1AJOA 2DFCA 2OXBA 4JRLA 2D6PA 3IDAA 5L73A 4HETA 1U12A 4A41A 1QMJA 2VMGA 5CFDB 4Q4V1 4CU7A 2LROA 4XJ8A 2P3KA 3DUIA 1UOJA 2RR12 4QDQA 3SISA 4AI3A 4B7KA 2HWB3 4ES8A 2ZGSA 4AHZA 4I3GA 2ZEYA 1BEV2 1O4TA 1UXXX 2KM2A 5I0UA 3R4SA 4AGGA 3JD72 3NNMA 1BEV1 3B9IA 3RVHA 5H9SA 4XQWA 2BWAA 3JD71 2J22A 3ZFGA 2W94A 4SBVA 5TSWA 5FO8B 3D82A 4PIXA 5BNQA 4IEUA 1H2LA 1OPOA 1VJ2A 2WABA 2RM21 1AR92 2W0XA 3GNEA 1BJQA 4XBLA 4YW1A 2YPDA 3SMHA 2DCZA 3ZMOA 2X8KA 2VW2A 4COZA 3BUCA 1AR72 3T1LA 3ZR6A 3RMYA 3N36A 5BXXA 4PF5A 2YC2A 4CVUA 5L9RA 1CPMA 4K7JA 1AR71 2JD4A 4GWJA 2SBAA 1XQNA 3DYOA 3ZVXA 4MH0E 1RYYA 1N1TA 1VMJA 3PUHA 4FOWA 4N7UA 5CKQA 4FPLA 2E9QA 4IEYA 4E27A 4YZ5A 5K0UC 1LOFC 2P6CA 2VNRA 3KV9A 4BQXA 5FYTA 3ZSKA 2CDPA 4NAMA 4XCBA 3GBFA 3SCHA 3E5UA 5A1FA 1NAEA 1CAUB 4KQ7A 4XEZA 5FLJA 3H3UA 2BNMA 5LW9A 3UGFA 3GBGA 3D0SA 2D3SA 2ORZA 2W92A 1KEXA 4P9IA 4GULA 4OFGA 4LT5A 1ZA7A 5JUVA 2D3RA 1RUC1 5FY9A 3RPQA 3VBSB 4U36A 1RUF2 4UT5A 1OH3A 3T2OA 2WLQA 2QQWA 3IB3A 2JIJA 4MXWA 3WG1A 2JICA 1RUF1 3V0AB 1EUTA 1W6OB 3DV8A 4Y1ZA 3WDXA 1C4RA 2NZ9A 3KT4A 3PVEA 1GR3A 3HEIA 2NM1A 1AXZA 3T0AA 3ZIWA 2ZX1A 1H8TB 1KDKA 2A5ZA 4QPGC 2VTFA 4P00B 1OURA 1W05A 3ILRA 4NIDA 1C8M3 2XB6C 3M3CA 1IQDC 1BK1A 1XU2A 3RZGA 2PAEA 3RFRA 2DCYA 4B1LA 1K5JA 2G9FA 1YQ8A 5DAWA 1UMZA 4XHXA 4NE9A 1HQLA 3THDA 4PF1A 1AYN3 1HRI2 2VW1A 3WG2A 4EJRA 4AVCA 5I8YA 4LKFA 1P8JA 2ZGUA 2JDKA 2RMU2 3PUSA 1HRI1 4HN0A 2ADDA 4QDSA 2R1DA 5JDBA 1VBA3 2RMU1 1SDWA 4XCAA 1HXS3 1KD7A 4AK3A 1RUNA 1AL23 3K4DA 3T4HB 1W03A 5JXHA 2Q30A 2V73A 4NPRA 3OUIA 2EXJA 5C6CA 1QKQA 1Z7S2 2P1BA 4ATEA 3G6JB 3PMEA 1ONAA 3GCWA 1VRH2 4GAZA 4H2AA 4LORA 4Z8BA 1YEWA 2X5IB 3W58A 5J98B 3WG4A 4N90A 3KVAA 3WY6A 4KH9A 4Q4X2 2QQOA 4J6GA 1UIKA 2BPA2 1JU3A 1WCSA 4MOAA 4Q4X1 2J1TA 5K0UA 1LOFA 3N3HA 2RS32 3M3OA 4PQ9A 5JOWA 4AVAA 1S0JA 5SV8A 3SH3A 3AP7A 3CMGA 4WVVA 3A23A 3RYKA 3S6PA 2RS31 1OFNA 4CDUC 3JB4C 2JG8C 3O7OA 2WFF3 3I3BA 1DQ2A 1ENSA 1OA3A 2D44A 1V9U2 1JZ4A 4RS5C 3T2PA 1ZX5A 3TEWA 4D6SA 2C6SA 2WS93 5IUQA 1V9U1 3EJKA 4OMDA 3ZXAC 1ACCA 1CN1A 1UOFA 1UY4A 1GP4A 4JRAA 3OPZA 4JDOA 2D93A 2A3WA 1PK6C 3OB8A 3RYPA 5JPNB 1QY4A 4NHXA 4XJAA 2Z79A 2UYBA 1BXHA 5LZ6A 3PTRB 4QPGA 2Q8EA 1W8WA 3ZFEB 4XUOA 3BPZA 4N53C 4PDWB 1Z78A 2ERFA 2YROA 2VGDA 1ULGA 1A6CA 3QBQA 5CYYA 4P9LA 1WBFA 2Q0AA 4LBOA 3R0RA 1WBLA 3CIHA 2BRTA 1LHWA 5FO7B 2IXIA 3BN6A 3OBAA 4IEZA 3J7HA 3S57A 2RR13 2KD7A 4HMZA 1AR82 4XXPA 3HAGA 1W06A 4OHYA 2YXSA 3MIDA 4QM8A 1GQGA 1BEV3 2YPJA 3I2GA 2J7MA 3M3IA 3MICA 4IEOA 2AZ5A 4XF0A 4M3CE 2FDGA 5LBCA 1RUE2 2WINB 3I3EA 3WHTA 5HBAA 2LW8A 3VL9A 1CAXB 4Y3OA 4LUMA 3NJYA 2YDEA 3HQRA 5EP9A 1LULA 3M1HA 4Z2AA 5L7OB 4TLFA 3G7DA 1NA1C 5FYSA 3OGSA 2VQAA 2SLIA 5ISLA 2JD9A 1OUSA 2LRPA 3TYJA 1AR93 3HJRA 4CRQA 3I4IA 4CTEA 3H1WA 5KC6A 1ZRRA 3PHMA 3GM8A 3NRUA 3RJ2X 1K42A 1JOJA 3C7HA 3NV4A 3WV6A 2C26A 1VBE3 4A6SA 2WRAA 5EWSA 4S2GA 2HEWF 2VUDA 4OLLA 3T2TA 2J1RA 2VVDA 2B46X 2VH9A 4QHOA 1OQEA 2JG8A 1GICA 4MGIE 4CDUA 1R091 1PNFA 3FLTA 4LBMA 5FZKA 2ET7A 4XYXA 3ZXFA 3WXPA 1M06G 1MZ6A 2VBDA 4RS5A 2ARAA 4LHSA 4P9XA 4WV8A 1S1AA 4F3JA 3O5SA 2R072 4LLOA 1GOFA 3MW3A 3U11A 4P9YA 3TEYA 1I3HA 5FZGA 1I5ZA 5J36A 1GMMA 1FV2A 1POV1 2GNBA 1UW8A 2FBEA 3WF2A 2VZUA 1PK6A 3ZSJA 4QXHA 4EQVA 5JXGA 1NLQA 1GNYA 3I2KA 1UU5A 1HB3A 4CCLA 1VMFA 2VMCA 1DZRA 1W6NB 2Z5WA 4NR1A 4V2WA 3WCRA 4DXZA 1I1EA 4UFLA 5HCHA 1PK6B 4GD4A 3QLQA 2ID4A 5F32A 2YV8A 5J37A 3B93A 4FO9A 2QQJA 4N53A 1TG7A 2WNUC 4AFMA 5FMCA 3CKHA 1RTVA 3AZVA 3HN1A 2NPIA 3H8OA 5DG2A 5FZ1A 5IFPA 1JH5A 1AHSA 3I3MA 3DL3A 1DGWA 4YZ2A 2E26A 1XSQA 4GXLA 4LE4A 2D5FA 5A3MA 4YGEA 3KF3A 1F4HA 5FKBA 4LMFA 4ATFA 4HZFA 4LE3A 3H8RA 2BERA 1A3KA 5FYCA 2WT0A 5FY0A 4EN9B 4BDVB 1UYPA 1X9TA 4AI0A 5T5PA 2GNMA 4YZ4A 3OOXA 1J83A 4XIOA 4IV3C 4XMAA 1N1SA 3W59A 1NUKA 4EWDA 1HRI3 4A2UA 3SEEA 4JQTA 4NRQA 5A7QA 5C8WA 2RMU3 5JSPA 1AR62 4R4XA 3FLPA 4Q0QA 5KHGA 1NA1A 4L8QA 1BMV1 3V56A 5IFTA 3T30A 2VNOA 5F3EA 5FPBA 1AR61 1X7NA 3UYJA 4U2AA 1NA1B 4D7YA 5DABA 3AZYA 4YNIA 2FQPA 5C71A 1OQ1A 5A1AA 2ZJCA 1ASJ2 1R082 3WP4A 4CDWA 4CSWA 5IW0A 1Z7S3 4GWNA 2GH2A 3PL0A 1REDA 1VRH3 2XHKA 4V2VA 5FP8A 5JPMB 4FTSA 2WFPA 4CDWB 4F83A 4CCCA 1V6JA 2QVSB 1RUD2 5G04L 5A7WB 1QWRA 2GC3A 5DAQA 4D7TA 3DPRC 1RUD1 3WLUA 5KC5A 4AFCA 1YRZA 1CIYA 1V70A 2ARXA 2B8MA 2HJIA 2RS33 1BHGA 5FZ7A 2PHRA 1LB2A 1SLAA 1IS6A 2ZA9A 1VBC2 5AFBA 3AYEA 1O4YA 3ES1A 4IQPA 4MGYE 3HNMA 4MX3A 1VBC1 4D7SA 5F5IA 1J3QA 3WNLA 2EXIA 1UYZA 2MHFA 1V9U3 1EAH3 1S0CA 2WNEA 1YNAA 4RQPB 1MZFA 4G4FA 4OHWA 3VDDB 1H2NA 1AF9A 3VGIA 2EF6A 3U75A 5A3LA 2W1UA 1ODNA 4N43A 2A3YA 3SHRA 4BH9A 2WNUA 4FPHA 2E63A 3HR9A 4FQ4A 2YUEA 3VKNA 2WT2A 3BGAA 4N43B 1MZ5A 3OBRA 1SG3A 2BEOA 1VMHA 3DKWA 3LFIA 4LXLA 1DBNA 1F5FA 1VAMA 4Q4Y2 5FPZA 1ZZ7A 4CU8A 2DTWA 3AZZA 2NMNA 4XJUA 2DU1A 2TUNA 4XFIA 1WW7A 3VUOA 3INAA 3B94A 4OVEA 4LK7A 1H1MA 1JYIA 5DUUA 3LEIA 3N9OA 2E7TA 3AXDA 1W0PA 2YFUA 4M01A 2ZGLA 1NLRA 2I74A 3I2FA 1TNRA 2HWC3 4R9AA 4YFWA 5T5LA 5T5OA 3AKSA 4XDOA 4KI5M 1GLHA 1MQTB 2P4EA 2BVVA 4IV3A 3IKWA 4OI0A 4LUKA 4KL1A 3BPSA 2WSUA 4I01A 1OLRA 5DQ0A 3HN3A 3IIIA 1DIWA 3IBMA 4RHV1 1AR83 2HYKA 1N1VA 3TAYA 2IFRA 1U5IA 4R9BA 1RJ7A 1OI6A 3OPWA 5GLZA 3QH7A 3AC0A 5FYVA 3WQBA 4DRVA 1N3QA 4AF9A 3ETPA 1RUE3 5F3GA 2Q8CA 3H3ZA 5CG8A 4BK5A 1DP0A 5A7SA 2BP6A 2DF7A 1K5MB 4AFBA 1NCQB 2LALA 1T6BX 4XETA 5JLVA 3L2YA 2X29A 1IOAA 1FI2A 4MGKE 1MS3A 2FCUA 3DPRA 1JXNA 1APNA 1S0EA 2QQKA 4KWUA 1STMA 3OD4A 4QX5A 3TNQA 5FP3A 2ZKNA 1DHKB 1HN0A 2W39A 2WIIB 3H42B 1NZIA 3DPRB 2QFEA 3LA3A 1PMJX 3CBNA 1XNAA 4GB33 1GNZA 1BYHA 1TNFA 5CVRA 5D2AA 5FZ6A 2RS52 3RGBA 1E5RA 1WUVA 4Y22B 4DY3A 4YVWB 1DCSA 1UU4A 1FAYA 1QJY3 2BNOA 3GCXA 3EMRA 4JX0A 3IAPA 4YGBA 3SH4A 1SZBA 2PHUA 3HIFA 3TRSB 3SCGA 4BWOA 2W9XA 5T3NA 4WM7B 3CJIB 1C1FA 4LA3A 3I2HA 1POV3 2R073 2YYOA 4AL9A 1UCXA 2DUOA 4NJ4A 1QDCA 4AFDA 1QGLA 5FPUA 1KRIA 3ALQA 5EJZB 2BW8A 2ZMKA 3HVDA 3TN92 3W9AA 4AHYA 1QNYA 2YBPA 3I8TA 4OUSA 2FDKA 2VZOA 3ACFA 3FWEA 4NWWA 3TN91 2V4AA 3HNBM 3AP5A 2RE9A 5LA2A 2IUWA 2VW0A 3LWCA 2WZ8A 1JZ7A 3N4MA 5F3IA 1OC1A 4BCUA 2JE8A 2VTXA 4YG3A 5C5TA 2CGPA 3K2OA 4BJ0A 3AZXA 3K51A 2GC2A 3LGRA 3P6BA 2WZR1 1FPN1 2D6MA 1QJX1 3O1SA 1UZ0A 4FP3A 3KQRA 3HD8B 3VD3A 4DEVA 3KMHA 4QQ2A 1LOAA 1DGWX 2P5BA 2XLAA 4LTAA 1HRV3 4JQRA 3AX4A 2A6VA 3POBA 4LIUA 2RJLA 2VOKA 2P3YA 3LAGA 4A3XA 1H1AA 2HH9A 5LY1A 5FZFA 2JB4A 2VZRA 1ZZBA 1W6QA 3N9MA 4QGNA 4YZ3A 3A7QA 3HPNA 1OFSA 4QX7A 5LEKA 2OUJA 1D2QA 5C9AB 5CU1A 4ZONA 3AXEA 4CCNA 4GMP0 1AUYA 4ZXKA 1IGOA 3WQ7A 1MS4A 2EVXA 5E6HA 4XDPA 4C0BA 5FZ8A 5DXDA 3UESA 1UZWA 1OD3A 5I91A 4UFIA 4OI4A 3TOJA 1ASJ3 1F15A 1R083 2GSYA 4YW3A 2ORXA 4BE3A 5F6LB 1JBCA 2BU9A 1OSGA 2YY1A 1WA6X 3ZKUA 4XJZA 2GP3A 4Z92B 3LZZA 2YHJA 1RJ8A 1RUD3 4QPIB 2Y38A 4QGMA 5FFOC 5IK4A 4NPLA 4Y1XA 4OQ8A 4E9KA 4R52A 2R061 2PHWA 3K48A 3B02A 3ZYGA 2QQIA 5T50A 3E5XA 2VTXJ 2XJUA 4FFGA 4R4ZA 4UF0A 5BNPA 4GWIA 2IVJA 1GZTA 2FCVA 2XJRA 1E5IA 1ND2C 1VBC3 4EN8B 3NV1A 3BODA 5F8PA 2OZJA 4EE2A 1OT5A 5A33A 3M8LA 4RSUA 2OPKA 4O9EA 3O1OA 2RV9A 3PUIA 2D40A 3POFA 5IAXA 2P3JA 4EWAA 2A75A 4IETA 3LB9A 2B4KA 4GA9A 4YVSB 2C9KA 5JOZA 1OOPB 5FBJA 1OMIA 5IVEA 4Q0PA 5A32B 5FK8A 2WN3A 3VKOA 1S2EA 2QJVA 2J42A 2ZX3A 2V09A 3AM2A 4Q4Y3 1XNKA 4OZOA 2JE7A 3FE5A 4P9GA 5KXEA 4Q29A 1W9WA 2OX0A 4KMQA 2GMPA 1XE8A 2VECA 3VHPA 2WT1A 2LS6A 2C1FA 4GZ9A 3ZN4A 4UWDA 4B29A 1O3QA 2JDNA 1ZRCA 2RS12 1POQA 3USUB 4DIQA 1XNBA 2FDFA 4XF4A 1DLCA 1F8VA 2RS11 4UFKA 1UN1A 1Y3TA 3MF6A 4W4ZA 1W8OA 1CESA 2BGPA 2J1UA 5FZCA 3U1XA 4GJYA 2J1SA 2DU0A 1DF0A 5C3SA 4AEDC 3BYWA 3KV4A 2VOVA 5APAA 4AGVA 4BQ5A 3WNXA 4JC1A 4IV1C 4Q5OA 4IGQA 1JODA 3PU3A 2VQUA 4I09A 5CFDC 1CAVA 3BALA 2W46A 3M3EA 1W6PA 1QJU1 2FMYA 3D3AA 5K4LA 4TTGA 1T2XA 5GZEA 3PVOA 3HWJA 3VDCA 5BNOB 1AXYA 5C33A 5GZGA 4CP2A 1U5ZA 2UWCA 2ZGPA 5IVBA 2W91A 4ZZ5A 2DFBA 1O3SA 4FTEA 3C7EA 4HPKA 4KBBA 1JZ8A 1RMU2 2W2IA 2YC0A 1GANA 1SHWB 1YHFA 3DEMA 3LSEA 4HG6B 1VIWB 1RMU1 3JCIA 5FLHA 2RS53 5HCBA 2K2SA 1ND2A 5HV4A 3PUAA 1SCRA 1F31A 1W2TA 1W6MA 4META 1V6KA 4UW3A 3RDIA 4BMEA 1QJZA 1PGL2 3FC0A 3PU8A 4YYOA 3NMBA 4YGCA 1GOGA 3I59A 2R042 2BOJA 1GNHA 1W6MB 2DUQA 2DVBA 3I54A 1Y4WA 3OGJA 1QJFA 1JYVA 1SPPB 1IS3A 1X8MA 3KV6A 3O1RA 1UWWA 3L2HA 3WR0A 1KS5A 3O0VA 4LBLA 4I2OA 3OEBA 1OKOA 2HEVF 2DV9A 3Q9OA 3TN93 3MW2A 5C7GA 3WNKA 4L0PA 3KSCA 2F6BA 1OA4A 3PNAA 4ARXA 1UD1A 1VPHA 1KDMA 1X50A 2JDZA 1NXMA 1KITA 2DBNA 2PMWB 4AE2A 1ENXA 2MEV3 4TXWA 4BIFA 5FYBA 4CXYA 1S0IA 1JN2P 4B8EA 5BPXA 3FHQA 3VBSC 4KG0A 1CVNA 4W6XA 3V0BB 4XAAA 3JU9A 1NT0A 5K8SA 3LPFA 3AKTA 4AAXA 2WA4A 5DAXA 1W9SA 5FY7A 3J7NA 1KJRA 1EYBA 5DZEA 1QQP2 3Q8CA 2BV4A 1G7YA 4AEDA 3VBUB 2XMLA 2ZEZA 1QOOA 4IV1A 4V1PA 1H8TC 1ULOA 1VE0A 1QQP1 1SMVA 2VQ0A 4JTOA 4XTMA 4ZS3A 5FIXA 4YM2A 4XJ9A 2PQQA 3KT1A 5CFDA 4BPZA 5C70A 2HWD3 4IV1B 4MHRA 4KWLA 5FJKA 4ARYA 4KBZA 3VLBB 1LGNA 2WWUA 4I0BA 1LEDA 1XSRA 3ZN6A 4BB3A 3AJZA 3IAQA 3ZIXA 1YFYA 2WR9A 2ZABA 5IK5A 2V5YA 4FVVA 3HT1A 2DWRA 2O8QA 4XF1A 3BIWE 3ZN6B 4DXSA 5L9VA 3ATGA 1CJDA 1AJKA 4FPFA 3IDBB 2H0BA 2VUCA 4HVQA 5L9BA 1FNZA 5FZMA 3WDUA 5CA6A 5A80A 5C3QA 3B69A 2P2KA 4X8NA 4Y20B 2RM22 1OA2A 2XKOA 2ZS6B 3H7JA 4DMIA 5LB6A 4IEPA 1NOVA 3NW4A 1GV9A 2Y6GA 4IGPA 5B4NA 5CADA 1LNSA 1EPZA 1FATA 4PLMA 4BQ1A 3OY8B 5F5QA 3ACGA 3LIHA 2X5IC 5DUXA 5IVYA 3WZ1A 5BV6A 5GLUA 5D21A 1BZWA 5T54A 2VCAA 3DF0A 3POJA 4FPYA 4LO6B 4MLOA 4LHNA 3VD7A 4CCEA 5IYYA 2CAVA 1W8FA 5CFCB 1LRHA 1ODMA 4PIYA 5LRRA 1HV1A 2VCMA 3ACIA 2BBAA 3RS6A 4KU8A 4Q4W3 5I8SA 2D6NA 4D69A 1NG0A 1SLLA 5K7PA 4Q26A 1C28A 4AQ2A 2JX9A 3AKPA 4LOTA 3VBHB 4BK4A 3VBFB 4LITA 3O1TA 1SACA 3B5LB 5B2GB 1UF2C 1CAUA 1ENQA 1O3TA 4QKBA 1LOGA 2PXJA 5A7NA 3UETA 2AR6A 1QXJA 2Q5TA 1H9WA 2CSGA 4AHWA 1O6UA 4ZHNA 4OZXA 3AMNA 4FI9A 1QF3A 1RUC2 1LHNA 1W99A 2HWF1 2YGLA 3VBSA 1RUOA 2BDRA 2FDIA 2WUHA 2WA3A 4PLNA 5DN2A 4DRRA 1RINA 4ZS2A 4HKOA 3O0XA 3VZMA 3V0AA 1W6OA 3THCA 1R1A2 4EYUA 2GMMA 5A3UA 3VD9A 4XFBA 4CU6A 3ASIA 5EJ3A 2RS13 1H8TA 3ZFEC 1R1A1 4BHPA 4FPEA 2OYZA 5FOBB 2RJKA 4Z82A 4FPGA 2BUKA 4UW4A 4PDWC 3ZSEA 3B3QE 3GALA 1DDLA 1UO9A 4BLIA 5FWEA 3PMSA 5DZGA 1WCDJ 4AOCA 1AZDA 3ZYHA 3ZYRA 1JMUB 5A7OA 4GMP3 2G9ZA 4O65A 5FMBA 4W50A 4Y1UA 4BISA 1ZBE1 3RNSA 1M4WA 1H30A 1RUI1 1AXKA 2JJ6A 2PHLA 2WSVA 3MIFA 1H2KA 1W2AX 3CEWA 4OCTA 4YW2A 4Y4YA 5FXVA 1MS8A 2Q1MA 2TEPA 4IEXA 3VD5A 4IL7A 3TEZA 1YC61 1F4AA 1VB2A 2VVEA 1GU3A 2AACA 4KG8A 4UYBA 4A42A 5L7OC 1UKGA 5ERLA 1IKPA 1CQ9A 1PVC3 2X5IA 2XHNA 1CZSA 2BQPA 2RDSA 4HN1A 1BLZA 4XDQA 4XIKA 5BY5A 4PI2A 5CB7A 3KF5A 1CONA 2QQNA 4CP1A 3B01A 3WDWA 4OMCA 2JG9B 1HLCA 3MHZA 4L97A 2R043 1LGBA 5FCCA 2QQPA 1CPNA 4XUNA 2UWBA 4GH4B 5FYIA 3WP3A 1IQAA 4OYUA 2HBTA 1W8NA 2DVGA 2JDAA 1LHOA 4BQWA 2XLGA 1FMD2 1YFWA 4YRDA 4UOJA 1DQ1A 1FMD1 1L7RA 1PZ7A 1QXPA 1UMIA 2F4LA 2GH8A 5C3PA 1POV0 4FTBA 1S0DA 5JXIA 5LK5A 2XJVA 3U07A 4BOWA 5DAVA 4AW7A 2RJ2A 4Q1RA 3J8F2 1D0GA 2WWJA 1LESA 1SLIA 3IPVB 3J8F1 3WG3A 3ZFEA 4RGGA 2GALA 4W65A 4TSVA 2CWMA 3BU0A 2XXZA 2TNFA 4PDWA 5FPVA 1E5HA 1VBD2 2FZ1A 4YSFA 4CDQB 4G9SB 4IEQA 3AMHA 1ZRIA 4E2GA 1UPSA 1VBD1 1GKBA 2I2SA 1YQ5A 4Q4V3 3Q8AA 1REFA 3ILFA 5I8TA 2ZMNA 2VZTA 4B7EA 3PIJA 2OUHA 1FV3A 2A7AA 2WQ4A 5E16A 1SQ4A 2UU8A 3A22A 4QX0A 3E6DA 5EJ1B 5FZBA 3AP4A 3I3DA 3AYCA 4IGOA 4NUBA 4ZZ8A 1GOHA 2WNOA 3OGGA 1C57A 1YWKA 4L11A 1CAXA 5J96B 3JD73 1ZBA2 1KJLA 4HSJA 4COWA 2X09A 3N9NA 4EN6B 5L7OA 2WBKA 1YQCA 4D0QA 1Q56A 3D0JA 2PAKA 2QQLA 4BXFA 4AEKA 1WD3A 1ZBA1 3GZTB 2B42B 4HLTA 1HQWA 2RM23 3LPGA 5AC92 2CHHA 3H1MA 1WLDA 3H8UA 3C7GA 3JBG2 4Y4RA 3VBRB 5GALA 2E51A 1YQ2A 5AC91 5EQUA 3PVBB 2NYYA 1UAIA 2B5HA 2ZBJA 3JBG1 3GZUC 3NSTA 1R1ZA 3RZJA 1TVGA 3V64A 3VZOA 2ARCA 4AVSA 2DCKA 1AR73 4CDWC 5IVVA 3IMMA 5E1RA 1A34A 1YUDA 2V4VA 2Y26A 1UQXA 1MACA 3ZX7A 2DTYA 1V6IA 3NJZA 1R092 1WLTA 3N9LA 4LK6A 1JYWA 5T52A 1V6LA 5JR2A 2OT7A 3IDEA 1QDOA 1ULPA 4NO4A 3E6CC 3PLQA 1KFUL 1RUG2 4LKSA 3ZN5A 3U4XA 1EY2A 4FXKB 1RUG1 2W1WA 1LOBA 1ULDA 2FDHA 1U0AA 4XFHA 5IK8A 2V5DA 2PLV2 3A21A 4QMAA 4DXTA 2XJPA 3RZLA 1PO22 5FRAA 2VC9A 3ACLA 3POEA 2PLV1 1W6NA 2P17A 4RQPC 1RUC3 4LULA 3VDDC 4NIHA 1PO21 4QB1A 4WVWA 5GLTA 4E4ZA 3I2OA 1FYUA 2BBVA 5FO9B 2VMFA 1JI6A 5A1LA 1AX0A 3MYXA 1LECA 1SEFA 1UMHA 2R0HA 2OVUA 4EZ4A 1LOCA 2ATFA 1RUF3 2YG0A 5EPAA 2IFWA 4N43C 1R1A3 4YPJA 2QE3A 1D7PM 4Y33A 3KT7A 4S2FA 4F7ZA 2Y34A 1Q8QA 3VD4A 5FP4A 2Z69A 1J3RA 1RITA 1NYWA 4HT1T 1I6XA 3NV2A 4S2HA 2X05A 2CTVA 1FX5A 1XRUA 1ZZ6A 2ZACA 1YYNA 1Q8VA 2D3PA 3GZAA 1BBT1 4NHYA 3MUY1 2C24A 1ULCA 1PX3A 1TMF2 3SXWA 1SLCA 1PGW2 3DCQA 5D8AB 3VBOB 5C8CB 2ADEA 4AHXA 2YBSA 1MQTC 2JDYA 3FN9A 3RZMA 1TMF1 4QQPA 1UYYA 5BYNA 1PGW1 3O12A 1NE6A 3SKVA 3D6EA 3EQEA 5IT6A 4M3CF 2YB7A 3V65A 4XZUG 3ZLIA 1PNGA 3DXTA 1LCLA 5CAZA 2IXJA 1BMV2 1W9FA 4A7KA 1DGRN 2VUAA 4K40A 2VZQA 2A6ZA 1ZREA 5FV3A 4C90A 5JOYA 3O1UA 1OKQA 1QIQA 5J09A 4Q27A 2QQMA 3IMNA 1A8MA 2Y60A 3QOPA 1O4ZA 1K5MC 1NCQC 3BB6A 4JCKA 5A7WA 4XQ4A 3WW2A 1E57A 4INDA 3C7FA 2VM9A 3MIHA 1WMEA 1XNDA 4EN7B 4Q8KA 3B00A 1AX2A 2IXHA 3AFKA 5F2SA 1W39A 4ONUA 4GWMA 4Q4X3 3H50A 2O14A 1MS1A 3LIGA 4NAOA 4XJWA 5B4XA 5KHKA 2VULA 3GF6A 3ECQA 5FZ9A 3FBYA 4BQYA 4MADA 1Q43A 1XYNA 3GYDA 5J48A 1K45A 4YVWC 3VDBA 2EIBA 1LGCA 1CR7A 3VHRA 2EALA 4N9IA 2EICA 5CNAA 4WM8B 4QX8A 4PHZA 3NO8A 1FMD3 2D43A 3CJIC 4WM7C 2LM3A 3Q8BA 4LQRA 4NRPA 3S7IA 1PO12 2BVBA 1H8VA 1O8PA 4RQPA 3VDDA 4YZ1A 3GJAA 1CWPA 1XYPA 3QH6A 4UAPA 1WW6A 3S30A 1PO11 1RVF2 4XTPA 5I0TA 4B3NA 2GNDA 3VHOA 4B4QA 1RVF1 4IXLA 2R7EB 5IAVA 4Z2WA 3VZKA 2JKXA 4R9DA 4IERA 3DYPA 4XOGA 4BZ4A 1BVP1 2JDMA 1X9PA 3BOPA 5FYUA 1AVBA 1W90A 3I2IA 2H6BA 3NNLA 2JXAA 4O9GA 3W5MA 5C3OA 3RQ0A 1T6GC 1VBD3 1LKNA 3BCWA 3D5OA 2WN2A 3MFCA 3S0MA 2BNNA 1OH4A 3POYA 1WGPA 1MQTA 3LSDA 2RDNA 3ORJA 4Q8LA 3GZEA 2WZPP 4FAGA 1LHUA 3AL5A 5ANQA 1DQ0A 3AYAA 2Y6HA 1QHDA 3BVCA 4RHV2 3UKNA 4URAA 4XURA 2WYSA 5A70A 2ZGOA 4CCMA 4QB2A 4LPLA 1S2BA 4NN0A 4W6YA 3URFA 3WUCA 1IHMA 2B9VA 5LA9A 4I02A 5BNPC 1W2OA 1YIFA 5DG1A 1ZZ8A 5FMOL 4LKDA 1O59A 1S0BA 1JYCA 2B7YA 2G19A 5FOJB 5FQ0B 3ETQA 2QQVA 4GQ7A 3O1MA 4MGQA 2VR4A 4DQAA 5C9AC 3RG0A 1WMXA 2XLFA 1K5MA 4MGSA 4QXBA 5ABJB 1NCQA 2DCTA 4YW5A 2J1VA 1MEC1 2DCJA 2DVAA 2IZWA 3CLPA 1WWYA 2CL2A 3NKTA 4OI2A 1ZZ9A 3WUDA 4CP9B 1HW5A 5HXVA 3OYWB 3WDYA 1UOBA 2JIGA 4WVMA 4XBQA 4JHZA 2AH2A 5H9PA 4Q0SA 3AMPA 4WVMB 4E4SA 1TE1B 1NCRB 4Y22A 1FOD2 3RJRA 4JGYB 4QPIC 4YVWA 2XKPA 3J4UH 1GZWA 3N35A 2RHPA 2DBIA 1R093 3O14A 1COV2 1GQHA 1FOD1 5JCTA 3O0WA 2IXKA 4O61A 1V6NA 3VZLA 2P37A 4XUPA 1SBEA 1GZWB 3CJIA 2ZGNA 4WM7A 2O1QA 1COV1 1J1TA 2VAUA 4H55A 2B9UA 5FZAA 4UFMA 3E6BA 2JENA 5JSOA 3AL6A 5CKNA 2VOWA 4IEWA 2JKBA 4C91A 3ZXJA 4QB6A 3CQOA 2D6LX 4CA9A 3MBWA 2D5HA 1ULFA 2WQZC 1YQ6A 3H9AA 3VKMA 3ZPOA 2PLV3 2JB8A 5GLWA 1JZ3A 1DYOA 3MEPA 3I7DA 1G86A 4H7LA 4JAAA 1DQ4A 1GZ9A 4PQQA 1HB2A 3BTZA 4NHKA 1PMHX 4HVOA 3ZFFA 4CUCA 3WF3A 2Z2SB 4ZU5A 5FZIA 4XZPA 4YVSC 1JZ2A 1AYM2 1OOPC 3ZFFB 3MIBA 3RWNA 2WZR2 3GBWA 3U78A 2XVKA 1FPN2 5T5JA 1QJX2 2W95A 5FYHA 1ND3B 1AYM1 5FAXA 3NJVA 2YU1A 3KHCA 2UWAA 1JYTA 1XXNA 3JUUA 5HV0A 3Q8FA 2VCBA 5LEJA 3KCCA 1UNBA 4YM3A 4QWNA 2ZCWA 1JHJA 2CWSA 3NWKA 2W68A 3OJBA 1UY3A 2PELA 1G9DA 2GNTA 3LDBA 3TB0A 1TMF3 4A6OA 2W47A 1RUH1 4LEJA 4D6RA 2CAUA 3ZPYA 1LHVA 1YXWA 5DPNA 1PZ9A 4GJZA 2XBO2 3ZR5A 1LODA 3A0KA 4X6RB 4XBNA 1MZEA 2ILMA 4LR4A 1RUJ2 3LCPA 2Y0IA 1OXCA 3UK9A 5C9AA 1H6YA 5F2WA 2XBO1 1KGYA 3O1PA 4TLGA 1RUJ1 1AR63 2AYHA 5IVJA 2R32A 2ZAHA 5GZFA 4DUVA 1ZYBA 5A6YA 3KS7A 2AC1A 1GUIA 2BGCA 2HEYF 4QQHA 3QD6A 4A3ZA 1NX9A 2VPVA 3AMMA 5BNOC 4F8AA 3H3LA 4K20A 5FKCA 5ACA2 4QPIA 3FBMA 2EAAA 1Q8OA 1SCSA 5ACA1 1LU1A 2FCTA 2W52A 2R062 4CXWA 4XE9A 1D4VB 1UU6A 2PAMA 3AP6A 5H9RA 2TBVA 4DUWA 3RZKA 3RZZA 3POWA 4CUAA 4CCJA 5FWJA 3S5QA 2KXLA 4MXVA 1WCQA 4MV2A 1I9RA 1N1YA 3J26N 3R6SA 4URTA 4CEWB 4HSLA 1OLQA 1EV12 5EV7A 5E88A 1LJ7A 1DGRA 3K3OA 4JTNA 1YI9A 1GQPA 4HK8A 4CE8A 2WQ8A 1SFYA 5DUWA 1EV11 3HQUA 4E4HA 4A7YA 4XFCA 3KCXA 5D1IA 5FMOS 1VLNA 2GN7A 5JWPA 1WD4A 4L92A 4XQDA 1QNWA 4YVSA 4BQ3A 1OOPA 3LE0A 2RDQA 2VBPA 3OTFA 5EHDA 1TZOA 5A32A 4BYYA 1UIJA 1Y7BA 4LOSA 4PLOA 1WMFA 4JGZB 3QACA 1K12A 1XNTA 3H7YA 3T09A 1JUHA 3POSA 4COUA 1B35B 1ZRFA 1O7FA 2ZZQA 3MPPG 1HJGA 4Y1VA 4QX3A 3WF0A 1CAWB 2ZEWA 1JZ6A 3USUA 3FZ3A 1B09A 2CGNA 4QGLA 3UGHA 1KQRA 4ASMB 4BM8A 1UX7A 3ZDVA 4LBKA 4HOOA 4DS0A 3VKLA 4KGQA 4E4DX 2VJXA 4RHV3 4C8DA 4J1XA 3VBUC 3ELNA 2ZHKA 2PQSA 1UXZA 3K3NA 3I97A 2UY9A 4XC9A 2E33A 5T55A 3WVJA 1S55A 1YCIA 1JYXA 4RR3B 1O8SA 3CNAA 5GKAC 4XW3A 1QJU2 2XWBB 4Y5TA 1UPIA 5LA0A 5EIYB 3TBDA 2QZ2A 2Y8KA 3BOWA 1V6OA 5BNOA 1DQ5A 3HT2A 2DDUA 4QU1A 2VUJA 2OQ6A 4Y1YA 3RZHA 3PIGA 5LA1A 2XUEA 2VL4A 2QZ3A 3IN9A 4CEYB 5F7UA 1MS5A 3RMXA 3SQOA 2ES3A 1C8M2 3RI9A 3K4ZA 5HPOA 4QXKA 1LR5A 5KXCA 1C8M1 2GU9A 4K1YA 3M7AA 2XJQA 2EIDA 4YLZA 1DQ6A 4R9CA 2EA7A 3OSDA 4FOYA 4CDXB 5KHIA 1RB8G 2OKXA 1XU1A 4XILA 1S2KA 4NRMA 3O1VA 2J1EA 1SPPA 3NKGA 1VR3A 1NQJA 5LBFA 5CFCC 4M0HA 1F9KA 3T4VA 3I3QA 3HBKA 2VOXA 4DY5A 4MZUA 1VBA1 2R0FA 3VHNA 3VBHC 3N7KA 3RSJA 3VBFC 4I0WB 3E5QA 1XJAA 2ZEXA 3EYPA 1XB9A 1ULEA 5FXXA 1N3PA 3KB5A 4QHZA 3D8CA 5FUPA 2WO3A 3RYRA 1W28A 5GZCA 1GP5A 2OW4A 3ZYFA 2VBBA 1AYM3 2JECA 2WZR3 1MPXA 3AB0A 5DDJ2 2AUYA 4NOTA 1FPN3 1Y9QA 1G9FA 1QJX3 5FZDA 3NQHA 5A6QA 5L19A 2W1QA 4AI9A 4JKKA 2PHDA 3V0BA 2OA2A 5DDJ1 3MUZ1 3FL7A 1GSLA 2QUOA 3MGUA 4FFIA 4JV4A 4JKLA 5EYXA 2ETEA
chains in the Genus database with same CATH topology
5HCAA 4M00A 1NZCA 4I0AA 3VBUA 1PIV2 4WBBA 4LHLA 1VAVA 1GYKA 1PIV1 2WFF1 5JIAA 4C0HA 4LBQA 1TEIA 4ISQA 3FMGA 4L99A 3WT3A 4ZU7A 2XBO3 4YW4A 5KXBA 5C4WC 2GN3A 4LBQB 1RUJ3 2BYVE 4IESA 1DU3D 3ZXEA 4DZGA 2FHRA 1DYPA 2C5DA 3WP6A 2KA3A 4M3CB 4W6WA 3CJXA 1SBDA 1VAKA 3NVCA 2VVFA 1CIWA 1RGSA 4Y20A 4YARA 4GIQA 4PIZA 3THPA 3ZYIB 1N47A 5ACA3 2C0ZA 2GC1A 3VL8A 2H6CA 2R063 3HQXA 1SLTA 3OY8A 2PYTA 5IK7A 4Z07A 4Y26A 1V00A 1PHMA 3EO6A 1YLLA 2RR11 5CFCA 2PHFA 1MR5A 2UYAA 3S7EA 1NXD1 1WLCA 1EV13 2JG9C 2ZKLA 3VBHA 2WWSA 3VBFA 1JTZX 1EPWA 4GH4C 1JW6A 4HKWA 4YG0A 4YG6A 3ZMNA 2VMHA 3ZFGB 4N9HA 1QU0A 4PBOA 1IS5A 2WC2A 2XPJA 1F2NA 2PFWA 3MIEA 4LNVA 1YO8A 2VXRA 4AVBA 2HWF2 4CYDA 1AR91 1F5JA 2I07B 3U0ZA 2XGXA 4FOQA 5DUVA 1VBE2 3IWZA 3N7JA 5EYYA 1VB4A 2WKKA 1IPKA 3FUOA 4I3PA 4XF3A 4AQTA 3KGZA 3NV3A 4BIOA 1VBE1 2ZHMA 2BFUS 2A73B 1JHNA 2WL1A 1XNCA 1FT9A 4DPNA 3KD4A 4XFAA 3ZXGA 2XH6A 3AYDA 2ZPXA 5F1RA 1MVQA 1C1LA 4CDQC 3BU7A 3FUQA 4FXGB 3LOIA 5C4WA 3JB8A 4FPOB 4D3WA 1O5UA 5C4WB 3MLLA 4AXOA 1ZBE2 1RUI2 3AP9A 1QJU3 1LOEA 3WW1A 2CNAA 1GFF2 5DZFA 4TWTA 3ZYPA 5J3UA 4DOUA 4MXWB 1KFXL 4Z1VA 2I45A 4L9BA 4K8FA 2EAKA 2VG9A 3WDTA 2K0GA 1AL0G 4MYEA 3NAPC 1SFNA 1RMU3 1OQDA 3A0NA 3VBRC 4LO8A 1EP0A 3SNMA 2E6VA 4LBQD 3VZJA 4K6BA 4ITCA 2AGSA 2JG9A 4QQLA 5BY5A 2IXLA 4LBNA 4RD7A 4AEJA 1C3HA 4GH4A 3CF6E 1DFQA 4FPCA 4TYSA 2XL9A 4IEVA 3AFGA 1DLLA 2B45X 3WQ1A 1PGSA 5F9TA 2XVLA 2QNKA 3WP5A 4LLFA 4FAHA 2W08A 1DG6A 3EXUA 1X8EA 1SBFA 1Z7S1 3MLJA 4X6QB 3PJQA 1VRH1 4K1ZA 2WLPA 4A7ZA 3C2UA 5DDJ3 3IPVA 1SLBA 3ZSLA 2ZTNA 1X82A 2A70A 4K9SA 4B4PA 2CGOA 2XWJB 1GZCA 2Q4SA 4CDQA 5K0UB 3P3NA 3N7LA 4J1WA 1FXZA 1PIV3 4COVA 1WW4A 1QQP3 4HANA 4ASLA 3M4FA 1RHI2 3KZ4C 2MPFA 1EAH2 1H9PA 3RI8A 4MVTA 3OCPA 2E7AA 1RHI1 1EAH1 5C8CC 4QM9A 5D8AC 2G4IA 3VBOC 2EIGA 4I30A 5FLIA 2A6XA 1ZZCA 1BVVA 2E53A 2R30A 4AG4A 5H9QA 5AFEA 1J1LA 5I0RA 4YM1A 3WW3A 1ALYA 2BWCA 4H14A 4UW5A 4QPGB 1A78A 3A4UA 3NAPA 3PTYA 3OF1A 3ZDSA 3VBRA 2HWC2 3E97A 4HBNA 3KGLA 2WJSA 3NAPB 4LHKA 2PN5A 4RGAA 2OZ6A 3FFZA 2H0VA 2HWC1 2D7FA 3AZWA 4UW6A 2QKDA 4AVTA 3UKVA 2PHTA 3P3PA 3WX5A 2HWE2 1HIXA 4GKXA 4XMIA 1AR81 2C9AA 2HWE1 3AKQA 1UL9A 2GDFA 3PVNA 2QDRA 1Q8SA 3I2DA 5BNNC 2O8OA 5JZGC 1UZYA 5F6KA 1RUE1 4C1XA 3MLKA 4K3UA 4HKLA 3WDVA 4NHMA 4OHVA 2D97A 4LA2A 4WM8C 2IC1A 4B4RA 1Q8PA 2CV6A 1NY72 3RRDA 2NP0A 4RA0A 2X53S 2E7QA 2HWF3 1NY71 1ZM1A 2HKXA 4YM0A 2CY6A 4WZFA 4GB32 2ZAAA 2D6KA 4WZCA 4GB31 2OIIA 4YFZA 1XYOA 3VKFC 1QJY2 4XHBA 4Q1PA 4LO7A 3JQWA 2XJSA 1OPMA 4CDUB 1IZ3A 2JG8B 4MSVA 1QJY1 3AJYA 2R1BA 4OUMA 4AYUA 5JR7B 4ZU4A 1D4M2 4Q2FA 2D98A 1BBT2 4RS5B 5C8CA 1WCKA 5D8AA 3VBOA 1ENRA 2CYFA 1KS4A 2R071 1D4M1 3FLRA 3MI8A 3ZXKA 5L36A 2PA7A 1ZBE3 2ZGTA 1RUI3 2WNVC 5CBLA 3CU7A 3ZXLA 2ZHNA 3UV9A 5GJ6A 3UKTA 1CGPA 4N53B 1YFUA 1GBGA 1Q5OA 1W2UA 1H1IA 2GAUA 1QOTA 4UBHA 3AKRA 5ABJC 1HRV2 1S0GA 4AEMA 3VN4A 1QH7A 4LBJA 4FPKA 3APBA 3CL1A 1HRV1 2ZHLA 2VNGA 3ZO0B 2GMEA 1TME2 4X8PA 5AVAA 3ZSMA 5BNNA 4DFSA 4JVAA 1LENA 3ROUA 4OHXA 1TME1 5JZGA 1NCRC 5GM0A 4JGYC 2ZGMA 5JMCA 5BNNB 3MZHA 1DYKA 2F4PA 4ES9A 4FOVA 3LA7A 1REEA 5JZGB 4BMBA 1G6NA 4MUVA 4RL7A 4WM8A 2UURA 4N7IA 1QOSA 2ZOEB 1A8DA 1HDKA 1IKQA 1OD5A 4UXAA 2EXHA 4SLIA 1H0BA 4P9JA 1URXA 4AFAA 1D0HA 5FBZA 3R4DB 1ASJ1 1R081 4XF9A 2VMIA 5KHJA 4BLJA 2UY8A 1J3PA 4DB5A 3MFAA 3NL1A 3J8F3 1DZTA 1U5XA 2JE9A 4PCRA 4S2DA 3HBZA 4P9WA 3ZFFC 4XFFA 3U10A 2YGMA 4XXAA 1ZVFA 1ND3C 4NVPA 4FT8A 1IS4A 3USSA 3N7MA 1OHFA 1YJLA 2MNGA 3AMQA 1RHI3 2BTVC 1YFXA 3KLSA 5CIRA 2WNVA 1G9CA 1Z0HA 1HX6A 1RC6A 2ZZJA 4QQOA 2WNVB 1YIPA 1O5LA 2WNUB 3SCFA 5FQ0A 3ILNA 1LTEA 4HK9A 5JAXA 5ABJA 4Q4Y1 1O3RA 2NLRA 1ZBA3 3IM0A 1QH6A 3B9CA 1MEC2 4HL0A 1X33A 3T1MA 3OYWA 2XUMA 3WD5A 4EWEA 5GZDA 4QT6A 5AC93 3JBG3 3IT8A 3C3VA 1MS9A 2FMDA 1MS0A 4P5HA 2LTNA 5FPXA 5KXDA 5KHHA 1NCRA 3VV1A 4IV3B 4JGYA 5FTTC 5JSRA 2HWE3 3M2MA 3VZNA 2FZ2A 2ZMLA 1S0FA 4R8HA 2IXCA 1G9BA 4CZSA 2IWGB 4QPYA 4AWDA 1RUG3 4CEWC 1DZQA 1UX6A 3JQXA 1H4GA 4K21A 2JEMA 5E89A 3WHUA 2AREA 2ET1A 5JVVA 5E8AA 4EROA 1PO23 2QCSB 3SH5A 5SV5A 4L2NA 3FFQA 2ZX0A 2Z42A 3MIGA 1W0OA 3GHMA 4XPVA 5EZWA 1ND3A 1PVXA 1LEMA 5JIUA 1WA4A 1UKRA 2RS51 4JGZC 1ZRDA 1WLWA 4JDMA 3TWIA 1NE4A 4E2SA 1KXGA 4AI2A 3UL2A 1AX1A 1J58A 1B35C 1C5IA 5T5JA 5J7MA 1VBB2 1D4M3 2NMOA 1BBT3 1FNYA 1RUH2 4Y5Z0 1VBB1 1PZ8A 2LUWA 2P34A 2VU9A 1BQPA 1YI7A 1TQ5A 4C1WA 4DINB 2ARBA 4KWKA 3HMYA 4LO5B 2MEV2 3LKJA 5BUVA 1VP6A 3FJSA 4RR3C 3IIAA 3EHKA 3AK0A 2MEV1 3L9JT 3UJQA 4H3WA 3THTA 4MGZE 4COYA 4ORFA 2DYCA 1N3OA 3IDCB 5LRSA 3MF9A 1C8NA 1D2SA 2O0OA 5FREA 3SITA 1J59A 3MDPA 4KGGA 4UBGA 2ZGRA 4CEYC 2DVDA 1Q3EA 3MW4A 1LU2A 1TME3 1MVEA 2HWD2 1G9AA 5I93A 2ZX2A 1O91A 1WMDA 2P3IA 2HWD1 1W6QB 2HWB2 4CEWA 2VY0A 3JZVA 4PBPA 3WW4A 4CDXC 4HFSA 1QXRA 2HWB1 2PHXA 2XVGA 2QDNA 3D4KA 3MPBA 4KNCA 5EXOA 3X29B 5LK7B 2A3XA 1PO13 3OD0A 3OBTA 4QU2A 4OHZA 2R16A 4NHLA 1XE7A 2EXKA 5HCFA 5JI7A 1RVF3 4Y24A 3WOGA 4JGZA 3ZXDA 4JDNA 1G8WA 4WVZA 1ZNPA 1B35A 5K9YA 4ISRA 1CAWA 3FX3A 4OI1A 4Q4W2 5BNPB 1H2MA 4AVVA 1YJKA 3R4UA 4OULA 4EN0A 4Q4W1 3UJOA 1PM7A 5A33B 3WINE 4Q0VA 1IPJA 4AGRA 4KU7A 3FHIB 2AENA 2ZGKA 4XFGA 3H1YA 2D6OX 2R49A 3J9SA 1WW5A 4RR3A 4TZDA 5JOXA 3ENRA 3SLIA 4YGDA 4LO4B 3CO2A 4PJYA 1MEC3 5KBFA 1CD3G 2ZGQA 4ZKTB 2YMZA 4CEYA 1CX4A 2Y0OA 2YZ4A 3PJYA 4HVRA 1JUIA 4DNYA 1X36A 3KM5A 1NLSA 2XG3A 1HKDA 3ES4A 2R6QA 1L3JA 3QCWA 2GC0A 4FCAA 1BKZA 2A6WA 2GZWA 2A71A 2BFUL 4EV0A 4CDXA 1FOD3 3ZYJB 4M0NA 2XJTA 3ME2A 1COV3 2DUPA 2Q1ZB 1ZA4A 1AYN2 4GMP1 1CAVB 4AQ6A 4P14A 4FP2A 4QHBA 4FSJA 1AYN1 1W6PB 5I0SA 4FQZA 3M3QA 1VBA2 4BA6A 1HXS2 1AL22 5AVPA 2G9GA 3KCYA 4RFT0 1PVC2 1C5HA 1HXS1 1AL21 1DGLA 3GHNA 3ZFGC 4HPKB 1U5YA 3LOBA 1PVC1 1RIRA 1V6MA 5JI9A 1CJPA 3ST7A 2N7GA 1Y43B 2XL7A 4G3YC 4CP0A 3B7MA 1ND2B 5GLVA 2ZX4A 3DN7A 1HV0A 1UZZA 1NQDA 2K9ZA 5HI0A 4AI1A 3R05A 4D94A 1PGL1 2Q8OA 3I59B 2R041 5KWRA 1VBB3 2ENRA 3WCSA 2A6YA 1BCXA 1RUH3 3WQ0A 4AI8A 2WFF2 1RL3A 5FDBA 2NN8A 4GALA 2B39A 2WS92 4GKYA 2DURA 2NQYA 4QD2A 2DVFA 2WS91 3DGTA 1PMIA 3BTAA 1VALA 4M3CA 5EFUA 3EBRA 1HQNA 3M70A 4FPJA 4E2QA 3TNPB 2PTMA 3H0OA 4AQSA 4FBFA 4KWJA 3LA2A 4H7MA 4NWVA 1H4HA 4AEDB 5CG9A 4Q0UA 4Q4V2 1AJOA 2DFCA 5L73A 4JRLA 2D6PA 4HETA 1U12A 1QMJA 2VMGA 5CFDB 4Q4V1 4XJ8A 2P3KA 3DUIA 3SISA 2RR12 4AI3A 4B7KA 2HWB3 4ES8A 2ZGSA 4AHZA 4I3GA 1BEV2 1O4TA 2KM2A 5I0UA 3R4SA 4AGGA 3JD72 1BEV1 3B9IA 5H9SA 4XQWA 2BWAA 3JD71 3ZFGA 4SBVA 5TSWA 5FO8B 3D82A 4PIXA 5BNQA 4IEUA 1H2LA 1OPOA 1VJ2A 2RM21 1AR92 2W0XA 3GNEA 1BJQA 4XBLA 4YW1A 3ZMOA 3SMHA 2DCZA 2X8KA 2VW2A 4COZA 1AR72 3T1LA 3RMYA 3N36A 5BXXA 4PF5A 1CPMA 4K7JA 1AR71 2JD4A 2SBAA 1XQNA 3ZVXA 4MH0E 4N7UA 1N1TA 4FOWA 4E27A 4FPLA 2E9QA 4IEYA 4YZ5A 5K0UC 1LOFC 2VNRA 3ZSKA 3GBFA 3SCHA 3E5UA 1CAUB 4KQ7A 4XEZA 5FLJA 3H3UA 2BNMA 3GBGA 3D0SA 2D3SA 4P9IA 4GULA 4OFGA 4LT5A 2D3RA 1RUC1 3RPQA 3VBSB 4U36A 1RUF2 2WLQA 3WG1A 4MXWA 2JICA 1RUF1 3V0AB 1W6OB 3DV8A 4Y1ZA 3WDXA 1C4RA 2NZ9A 3KT4A 3PVEA 1GR3A 2NM1A 1AXZA 3ZIWA 2ZX1A 1H8TB 1KDKA 2A5ZA 4QPGC 3ILRA 1C8M3 2XB6C 3M3CA 1BK1A 1XU2A 2PAEA 2DCYA 2G9FA 1UMZA 4XHXA 1HQLA 5I8YA 4EJRA 1AYN3 1HRI2 2VW1A 3WG2A 4AVCA 2ZGUA 2RMU2 1HRI1 4HN0A 2R1DA 5JDBA 1VBA3 2RMU1 1SDWA 1HXS3 1KD7A 4AK3A 1RUNA 1AL23 2Q30A 2V73A 4NPRA 2EXJA 5C6CA 1QKQA 1Z7S2 4ATEA 3G6JB 3PMEA 1ONAA 1VRH2 4Z8BA 2X5IB 3W58A 5J98B 3WG4A 4N90A 3WY6A 4KH9A 4Q4X2 4J6GA 1UIKA 2BPA2 1WCSA 4Q4X1 5K0UA 1LOFA 3N3HA 2RS32 3M3OA 4PQ9A 5JOWA 4AVAA 1S0JA 5SV8A 3SH3A 3AP7A 4WVVA 3RYKA 3S6PA 2RS31 1OFNA 4CDUC 3JB4C 2JG8C 3O7OA 2WFF3 1DQ2A 1ENSA 1OA3A 2D44A 1V9U2 4RS5C 1ZX5A 2WS93 5IUQA 1V9U1 3EJKA 3ZXAC 1CN1A 4JRAA 3OPZA 4JDOA 2D93A 2A3WA 1PK6C 3RYPA 5JPNB 1QY4A 4XJAA 2Z79A 2UYBA 1BXHA 4QPGA 3ZFEB 3BPZA 4N53C 4PDWB 1Z78A 2ERFA 2YROA 2VGDA 1ULGA 1A6CA 3QBQA 4P9LA 1WBFA 2Q0AA