5AVAA

Crystal structure of pha-e lectin in complex with bisected glycan
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
238
structure length
238
Chain Sequence
ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic visualization of a flipped-back conformation of bisected glycans bound to specific lectins
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords Erythroagglutinin
total genus 47
structure length 238
sequence length 238
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5avaA00
1A8DA 3WUDA 1ULDA 5H9QA 4ZKTB 3BODA 1W6QB 1RIRA 3O12A 2D3SA 3L2YA 3WDWA 4GALA 2E6VA 2DUQA 2UU8A 2NMOA 5GM0A 1WD4A 3PMEA 2FHRA 3KM5A 2ZGNA 3D4KA 5LK5A 2PHTA 3VKLA 1KJRA 2GDFA 3R4SA 4GXLA 4GKXA 4M3CF 1O4ZA 3WDYA 1GNHA 1KDMA 1C57A 1XQNA 1AJOA 1ULEA 3VKOA 3AP7A 3ZXFA 1S0GA 2Q5TA 2GNMA 2YMZA 1SLLA 5E8AA 4DRRA 1DYKA 3WDVA 2DTWA 4YZ2A 2D3RA 2R1BA 1H9PA 3O0XA 3A4UA 3R05A 2V73A 2GMPA 5GZGA 2CY6A 4C1WA 2XG3A 4YM0A 1QKQA 4C1XA 1TEIA 3UK9A 2ZHMA 4YGDA 2D7FA 5KXBA 3SISA 1MS8A 4FVVA 1KDKA 5JLVA 4FP3A 4FPFA 4M00A 4Q26A 2A3YA 4KBBA 2D6OX 1FATA 5DG2A 5GZEA 1VAVA 4Q8KA 3WVJA 1JYIA 2CYFA 1WW6A 1YO8A 4JRAA 4R9CA 1SACA 3FFZA 4PBPA 2ZGTA 1GZ9A 2EF6A 2DV9A 1LGNA 1WLCA 1UKGA 1IS4A 1W6NB 3PVEA 1PZ8A 4R9BA 5DXDA 3WLUA 2D6MA 3A0KA 4BM8A 5CAZA 2I2SA 5GLTA 4RA0A 4YGCA 4Y1YA 1WBLA 1AZDA 2SLIA 1AXKA 1LHOA 4WV8A 3SLIA 2JD4A 3INAA 3ILRA 2P37A 2ZGUA 2R1DA 3BTAA 1LOEA 2UWAA 3AJZA 1S1AA 3ZSJA 3MW4A 1GYKA 1O4YA 2ZGMA 1DFQA 3NWKA 2JECA 5DZGA 3O0WA 1ENRA 1QNYA 3N35A 4WVVA 3UJOA 3WG4A 5T55A 2NN8A 2ZMNA 3JU9A 1A78A 3V0BB 4FQ4A 1WW4A 3IMNA 4LBQB 1QOOA 3ASIA 2WQZC 1JUIA 5T52A 2GMEA 2A6WA 2UWBA 1GANA 4YFWA 4BMEA 5CA6A 2DVGA 1X50A 2DVDA 2DVBA 2P3KA 4BLJA 3SITA 3HN1A 1N3PA 1MVQA 2FMDA 4LBQD 1LGCA 1UX6A 4PBOA 2BQPA 2D6LX 2ERFA 4Q27A 1KITA 2D3PA 3I4IA 1PZ7A 5H9PA 3WG1A 4AGGA 2P3IA 2AREA 3HR9A 5CNAA 4CTEA 1G86A 4PQ9A 2TEPA 4K1ZA 2DTYA 2ZGKA 1WLDA 3N7LA 1G9FA 2DUPA 4U36A 3APBA 3RQ0A 5FREA 1UPSA 1ONAA 2E7QA 1JHNA 5DUWA 2W68A 2OW4A 1DLLA 3ZVXA 1LHNA 3T1LA 1OFSA 4YGBA 4Q1PA 3WOGA 4AGRA 1W6PB 1SBEA 2C9AA 3R4UA 3ZYRA 1D2SA 1BXHA 1LOAA 1S0IA 1UL9A 1W6PA 2AH2A 1LENA 2E7TA 3N7JA 1URXA 1GZWB 3NV2A 4JCKA 5EXOA 1BZWA 5H9SA 1MR5A 3ENRA 2GN3A 1AX2A 4ISQA 1LULA 1UZZA 3AZWA 4JC1A 2OUJA 3V64A 1LESA 3M3QA 4YZ1A 1R1ZA 1SCSA 2A7AA 1N1YA 2PHRA 4M3CA 4BOWA 2JE7A 1C4RA 2R49A 5FRAA 3CNAA 3AJYA 3UJQA 3SH4A 2VH9A 2VXRA 1IOAA 3KQRA 5HCAA 4M01A 4FOYA 2JE9A 1Z78A 1KJLA 1UMZA 3AYAA 1C1FA 5AVAA 5IK8A 2DUOA 2VU9A 3N3HA 3O0VA 4IQPA 2DVFA 5EWSA 2A5ZA 4CZSA 1LU2A 1FYUA 1GKBA 1DBNA 1QNWA 3USUB 2ZKNA 3OJBA 1G9DA 1V6IA 1WBFA 3W59A 2VY0A 1F9KA 1SBFA 1ENSA 3OBRA 5GLWA 2ZGRA 4L8QA 2VW2A 3N7KA 1Q8VA 4Y1UA 1QOSA 4LBQA 3SNMA 1S0FA 4YW3A 2WT0A 4XHXA 3AYDA 1Q8PA 2GNBA 3BOPA 1SLBA 1LEDA 3ZSMA 1IKPA 4XBLA 1ULCA 2UURA 3WDXA 2NMNA 1S0JA 3WCRA 2NYYA 1BYHA 1QGLA 2WSUA 3MEPA 3B69A 5EYXA 5DG1A 1W6NA 4HL0A 2H0BA 2LTNA 4ATFA 5IK5A 4P9XA 3TAYA 1FV3A 1J1TA 1ZM1A 4TYSA 3AXEA 4Y24A 1CONA 2YROA 1AJKA 5KXEA 2EAKA 3OYWA 3AYCA 3RS6A 2WKKA 5F9TA 2ARBA 3HMYA 5GJ6A 1GBGA 4YM3A 1DQ1A 1W0OA 2UWCA 3WDTA 2PELA 1VAMA 2AYHA 3AYEA 3ZPYA 3DUIA 2CWMA 1CVNA 4FPEA 4XIKA 5F5QA 1G8WA 1FNYA 1S0EA 1JOJA 3Q9OA 1LU1A 2D6NA 2C5DA 1JXNA 4XJUA 1LGBA 3V65A 4DQAA 4GWMA 2CNAA 1Y7BA 1V6LA 4FOVA 3MW2A 2JJ6A 1DQ5A 4W65A 2XB6C 1DQ2A 2A75A 2OVUA 3ZXJA 2DVAA 2DYCA 2R0FA 1S0DA 4Y22B 3V0AA 1WW5A 2ZHNA 3AZXA 5CB7A 3JUUA 5JOYA 4YG6A 2WT2A 2PHXA 5BYNA 1WW7A 1N3QA 3OGGA 2A3XA 3SH3A 2CL2A 1AF9A 2GNDA 3M1HA 2D6KA 1V6MA 2D43A 1N1VA 1ULFA 3WHTA 1CESA 3W58A 4PF5A 3N36A 4CRQA 3U4XA 3M3OA 1APNA 1YI7A 2AGSA 3B00A 4XBQA 3SH5A 3ZSKA 1DQ6A 4K20A 4LBKA 4XIOA 1YXWA 1MACA 1W6QA 1VALA 1V6KA 2ZGSA 4XJWA 4TZDA 4FOQA 3PVNA 1ULGA 4RL7A 5E89A 4YFZA 1V6OA 3PVOA 3WHUA 3UL2A 1V6NA 1GZCA 3FUOA 3RMXA 2ZGQA 5JOZA 1IS6A 3LSEA 5DUVA 2EIGA 1W6OB 1MZ6A 3NV4A 3IM0A 1LODA 4XJAA 3FBYA 3FUQA 3PJQA 2W39A 4XOGA 4P14A 1MS5A 5T54A 4YG0A 1SLAA 4FPGA 2YY1A 5GZCA 2JDZA 1GSLA 2ES3A 1ZA4A 4YZ5A 1HDKA 3M2MA 2YV8A 3ZXLA 1RITA 1AX1A 4AWDA 1MS9A 1CPNA 4SLIA 1WCSA 3ATGA 4AYUA 1FX5A 3V0AB 1BQPA 2ZABA 4M3CE 2DU0A 2GN7A 2ZACA 1CN1A 4H55A 4XZPA 5KXCA 3GNEA 1AVBA 2NP0A 1JYCA 2G4IA 1GZWA 4XMAA 5JDBA 4AVSA 3QLQA 5IUQA 1QF3A 1IKQA 4GA9A 5GLZA 5IK4A 4XBNA 3OY8B 4DPNA 4ZXKA 2AUYA 4XILA 1VIWB 2WLQA 3M3EA 5GALA 2AR6A 2B7YA 3FLTA 4ISRA 3VKNA 4BPZA 4XXAA 4YGEA 1DGLA 1DQ0A 3M3CA 1N3OA 3C2UA 5DUXA 5L73A 1I1EA 3IPVA 5IK7A 3AFKA 1N1TA 4XTMA 1AX0A 3AX4A 5T5PA 5HCBA 1U0AA 1SLTA 4YW1A 2RHPA 4YZ4A 1G9CA 1CPMA 1LOBA 1WD3A 3AZZA 1GLHA 3B01A 4DS0A 1LOCA 4LBJA 3RRDA 3AXDA 3IKWA 5JOWA 4AGVA 1MS1A 3IPVB 3TB0A 3A0NA 5JMCA 3OPZA 2DWRA 2VW1A 2PHUA 3QCWA 1SBDA 1LHWA 5GZFA 3ZXEA 1I3HA 4FOWA 1Q56A 3RSJA 1C1LA 3D5OA 3GALA 1CJPA 2GMMA 1SLCA 3D6EA 3WV6A 2D44A 4K1YA 1W0PA 3WNXA 1DQ4A 2NM1A 1KQRA 3AP5A 3VV1A 3ILNA 1HLCA 1MS4A 1QOTA 4FPJA 4LBMA 1LECA 4XJ9A 5EYYA 2EXKA 3ZYPA 3B3QE 3AK0A 3POSA 3N7MA 1IS5A 1N1SA 4MYEA 4Y1XA 2A6XA 1CIWA 4XDQA 4YLZA 4FP2A 1V00A 2WJSA 1V6JA 1LJ7A 4Q2FA 2ZHKA 3MPPG 5JVVA 2VW0A 3T2TA 4AVVA 1CQ9A 4Q8LA 2NZ9A 1HKDA 2PHWA 4D69A 2YZ4A 4ITCA 2A6ZA 1H9WA 4BQ1A 4ASMB 4HANA 2V5YA 5GLVA 1DIWA 1MS0A 2ZA9A 3AP4A 4XE9A 2ZGLA 3H0OA 2ZHLA 3V0BA 1VLNA 1YRZA 2GALA 5T50A 1F5FA 4I30A 3WZ1A 1W6OA 2ZGOA 1LOFC 5CBLA 4XYXA 1D0HA 1G9BA 1LCLA 1LOGA 1DYPA 3FLPA 1SCRA 4YG3A 1LHUA 4AVTA 2ARXA 5KXDA 1G9AA 3RG0A 2EXHA 2A3WA 3ILFA 3OYWB 1GV9A 4NO4A 4XXPA 5E88A 2ZGPA 3IN9A 2D6PA 4UW3A 5HCFA 4F83A 2E51A 2ZMLA 3WG3A 2ZAAA 4DRVA 2W08A 4YW4A 4BMBA 1H30A 1A3KA 4Y26A 1UAIA 3NV1A 3DGTA 1S0BA 3WG2A 2A6YA 4LBLA 2ZMKA 2VUAA 4XJZA 3NV3A 4YW5A 2W52A 1OKQA 2A6VA 2ENRA 1HQLA 4PCRA 3T1MA 1DHKB 3MW3A 4Y1VA 3ZXKA 3POYA 1PZ9A 2EXJA 2P2KA 1NXD1 4UW4A 5DZFA 4ATEA 1OQ1A 1FNZA 2P34A 3AP6A 3USUA 3LCPA 1JN2P 1NLSA 4XTPA 4Z8BA 3VUOA 2AENA 1F31A 1QMJA 2R16A 1MS3A 2PHFA 1Q8SA 4XMIA 4LBNA 4Y1ZA 4FPHA 1QDOA 4OZXA 3O5SA 3ZSLA 2WT1A 1QU0A 4YW2A 3B9CA 5T5OA 2JKBA 2CTVA 1LOFA 1Z0HA 3VKMA 4FPYA 4M3CB 4FPKA 1BJQA 3WCSA 3I8TA 4Y20B 3VKFC 1YYNA 4FPOB 1AXYA 3AZVA 1G7YA 4YZ3A 4Y20A 1B09A 2GNTA 1UN1A 4FQZA 1ENQA 4LBOA 5T5JA 2ZBJA 2WSVA 1W6MB 1LEMA 3WDUA 1Q8OA 1HQWA 2A71A 5DZEA 2LALA 1W6MA 4Q1RA 1WUVA 2A70A 1RINA 2EALA 4UW6A 3BIWE 1FV2A 2KM2A 1SLIA 1GNZA 2WNEA 2Z42A 3RMYA 4GWNA 4Y22A 2CWSA 1CR7A 4YM1A 2EXIA 4P9WA 2HYKA 4BLIA 5T5LA 1LTEA 1LHVA 1AXZA 2E53A 4XHBA 4NOTA 4YM2A 3LSDA 1IS3A 4R9DA 4FPCA 3AZYA 5IT6A 1MVEA 4WVWA 4DFSA 1EPWA 1JBCA 3AP9A 1QDCA 4UW5A 1FAYA 5H9RA 1UZYA 1WLWA 1N47A 5GZDA 2P3JA 2DURA 1BKZA 1DZQA 1MZ5A 2SBAA 5SV8A 2OUHA 4XJ8A 2DU1A 4K21A 3OY8A 5JOXA 2ZZJA 3POWA 5GLUA 3WUCA 4WZFA 1Q8QA 1GICA 2R0HA 4FPLA 4P9YA 3OBTA 4U2AA 5DUUA 1KRIA 1SFYA 2YXSA 4GKYA 4R9AA 1YIFA 3FLRA 1S0CA 1JW6A
chains in the Genus database with same CATH superfamily
1XPWA 1PIV2 1VBE3 2W5FA 1ULDA 3WUDA 4ZKTB 4RGKA 1RXGA 1W6QB 2QQNA 5DDJ1 3O12A 4CXWA 5FPAA 4TLFA 2VR4A 2E6VA 2GH2A 3AKSA 5FY7A 3ZIWA 5KHKA 2VZQA 1OQDA 1WD4A 5FPVA 3D4KA 2VE1A 4UBGA 5FZ9A 2VZPA 3R4SA 4HMZA 5LZ6A 2I45A 2XJTA 4S2FA 3BU0A 2R071 2QQIA 4R52A 2MEV3 3AP7A 4Q0VA 3OB8A 3ZXFA 1S0GA 4RS5A 3AMMA 4DRRA 1SLLA 4TLGA 3AMNA 4P9IA 1DYKA 3NJYA 1SDDB 2DTWA 2X5IC 4IW3A 5C4WA 4DUWA 3LOBA 5L7OC 1C5IA 1OSGA 5FZ8A 3LA3A 4L0PA 2IXKA 1QJY3 4FFHA 3O0XA 4QB2A 1ODNA 3A4UA 4CCLA 4EQVA 2V73A 2GMPA 2W95A 3I59B 4AF9A 3USSA 4YM0A 1W9FA 1QKQA 4QGNA 4EN6B 5IYYA 1WCDJ 4MOAA 1KDKA 3ZDVA 5JLVA 4FP3A 4FPFA 4M00A 4AHZA 4GQ7A 1SPPB 4KBBA 1FATA 3ZMOA 1ASJ3 3WVJA 4DOUA 1JYIA 4A44A 1O5UA 3MO4A 3FFZA 3RDIA 2H0VA 3DL3A 1OBNA 1GZ9A 1IHMA 5FDBA 1W9WA 4UFIA 1POV3 1ALYA 4I02A 1O91A 4QX7A 5FZBA 1PZ8A 3RZHA 3A0KA 2YU1A 3P6BA 4WM8C 5GLTA 5C9AA 4LA3A 1AZDA 4TXWA 1JOBA 1LHOA 3PUQA 3OPWA 1GNYA 3MDPA 2OT7A 2W46A 5F6LB 3BTAA 3S7EA 1MEC2 3ZSJA 1NA1A 4A45A 3MW4A 2ZGMA 2IUWA 4RQPA 1PVC1 3NVCA 3IIAA 1GQHA 3IDBB 4JGYC 5J48A 2G9ZA 3UJOA 5JZGB 4UF0A 2OQ6A 2QDRA 4XABA 2ZMNA 3JU9A 4UFMA 4FQ4A 5F1RA 5FYYA 1NLRA 5C8CC 3TEZA 2C6SA 2WQ8A 3ASIA 4CP0A 1C28A 4D94A 1YUDA 3TEWA 2XHKA 5FPXA 4MH0E 4DUVA 4YFWA 1VBB2 2WABA 5CA6A 1CZTA 4HVQA 5KHIA 1X50A 2ZX2A 1JZ8A 4I2OA 2P3KA 2TNFA 1JOPA 1O4TA 3SITA 4BLJA 4LBQD 1COV1 5DQ0A 4C0HA 1UX6A 5KC6A 1CGPA 2D6LX 2D3PA 3I4IA 3BOWA 5FZEA 3WG1A 3CHXA 3HR9A 2A1XA 2XVKA 3I97A 5CNAA 2WS93 3VBUB 4PQ9A 2HBUA 2TEPA 2DTYA 3VDDC 1LKNA 3VBFC 4BB3A 4HKOA 4CP9B 1AUYA 3N7LA 2DUPA 5AC91 5A7OA 1HRI2 1H1MA 2ZX4A 5FREA 3EYPA 4E4DX 5FKCA 2E7QA 1JHNA 2VNGA 5DUWA 2W68A 4FFFA 3OUHA 3ZVXA 5A3NA 5LB6A 5KWRA 2E31A 3W21A 4B4PA 1DYOA 1W6PB 2B8MA 3KCXA 1AYN3 2VQAA 2VOTA 2ZPXA 2E7TA 1BXHA 1UL9A 1S0IA 2RR13 1W6PA 3J7LA 4QDSA 3W20A 1K5JA 2HKXA 3ACLA 2HBTA 3HQRA 1XU1A 4INDA 3K4AA 3HN3A 5JSPA 3BU7A 2W2IA 4PLMA 1PIV1 2CHHA 5EXOA 4MX3A 4R4ZA 5FUIA 1RL3A 5A33A 2GN3A 2WAOA 1LULA 2JDKA 4AFBA 2ATFA 4IV3B 3MGUA 2G19A 5C8CB 2BTVC 4OI1A 2VUJA 4YZ1A 3MUY1 1R1ZA 2Y6HA 5KR7A 2A7AA 1EAH1 1NZIA 2RM22 2JDPA 4M3CA 2J7MA 3UJQA 2WNUB 1W8UA 2VH9A 4BHPA 2E26A 3AKTA 4URTA 5BV6A 5FZ4A 2CDOA 1MQTA 4FOYA 5E16A 3AYAA 2R072 1C1FA 5IK8A 2DUOA 3N3HA 5FAXA 5I93A 3POGA 4FFGA 4IQPA 1DLCA 4I3PA 1LU2A 2LM3A 3WNKA 1GR3A 1UNBA 3GJAA 3PURA 3NJZA 4QB6A 3TYJA 3O1OA 4BYYA 1WCQA 1PMHX 2D97A 2ZX3A 3H9AA 1W8HA 3URFA 2VW2A 3N7KA 5CFCC 3WSOA 3LGRA 1NLQA 2N7GA 4AFCA 4XEZA 5A1AA 2Z69A 1SDWA 3MIGA 3C7OA 1Y9MA 5C3OA 1RUD1 3SNMA 3K77A 1CIYA 3NNLA 4RS5B 5FWEA 3BTXA 1Y3TA 2GNBA 3KV6A 3O7OA 3BOPA 4CCKA 2GC3A 1V9U3 4PHZA 3ZXDA 3WNMA 1EYBA 4XBLA 4AAPA 1ULCA 1H6XA 2WO1A 1XJAA 2HEYF 2R7EB 3OUJA 4M0NA 4XUQA 3K2OA 1KFXL 5ANNA 1SZBA 1VRBA 2W87A 4OVEA 1A8MA 4JAAA 4QX8A 4HL0A 4XF3A 5FP3A 5FZKA 1RUG3 4FI9A 4IDZA 5D1IA 4NIIA 2DFBA 3MYXA 3GCWA 2K0GA 2OIIA 1GQPA 4K9SA 5B2GB 3VL9A 3VBRB 3SKVA 2WFF1 4Q0PA 3I59A 2BERA 3RS6A 1UY0A 1HIXA 2WKKA 4E2SA 4IEWA 1W28A 1DQ1A 1W0OA 2QBXA 4B8EA 3HNMA 1PVC2 3MZHA 1TMF1 1YFWA 4XIKA 1S0EA 2YGMA 1LU1A 1QXJA 3J9SA 4XJUA 1JXNA 3POJA 3EHKA 4QKDA 2JIGA 5KHHA 4DQAA 1VPHA 5KC5A 2CNAA 5A3WA 3BB6A 5FO9B 5J1XA 1X9PA 1T2XA 3ZLIA 3A22A 4PLNA 4IL7A 1DQ2A 3ZXJA 1E5HA 5K0UA 4PF1A 3WW4A 2Y6JA 5FQ0B 4L2NA 4Q4W2 5J7MA 2WT2A 4PDWA 5BYNA 4LT5A 1IQAA 4HOOA 2HWE3 2OPWA 1S2EA 1RB8G 3MF6A 5A3UA 4X6RB 2A3XA 2B45X 1RHI1 5F6KA 2CL2A 2VTFA 3ME2A 3WHTA 3ZKUA 4EN8B 3U75A 3ZSEA 3B00A 3M8LA 5FUPA 4LBKA 3S7IA 3U11A 2WO7A 1MACA 1VALA 2YBPA 2ZGSA 4ZU7A 3SC7X 2EA7A 4BQ2A 2TBVA 1W2AX 4HLTA 1ULGA 4RL7A 5J3UA 2GAUA 3RMXA 1ND2A 4WZCA 1IS6A 5CADA 4GH4C 5DUVA 2RS31 3ZYIB 5I0RA 1W6OB 4QQLA 3HD8B 4GMP3 3NV4A 3IM0A 4Z2WA 1LODA 5DAWA 2VNRA 3PJQA 3GJBA 5CFDB 1MS5A 5ANQA 2XLAA 2Q1FA 5FTTC 3RYRA 1UOBA 4FPGA 4N7UA 2JDZA 4YZ5A 1HN1A 4YVSA 3H8XA 2BVVA 2WNUA 2YV8A 1AX1A 1MS9A 4XQWA 1WCSA 2LS6A 4AYUA 1FX5A 1QJU2 4ZHNA 4LKDA 3RZMA 3O1TA 3PLQA 2DU0A 3V56A 2GN7A 2ZACA 1CN1A 1M06G 1UU6A 5KXCA 3GZEA 4IETA 5LWBA 3ETQA 1AVBA 2RDQA 5FYCA 3VDDA 1WA6X 2HWF3 5JXIA 2JICA 1NCRB 3T4VA 5JDBA 5FMOS 1NCRA 4RD7A 5FKBA 5J36A 5IK4A 3OY8B 3VBSA 2ET1A 4DPNA 3FN9A 4ZXKA 1X8MA 4QX1A 1VIWB 1HV0A 2H6CA 2WLQA 2AR6A 4XDOA 5GALA 3VKNA 1JYWA 4XXAA 2AZ5A 4UT5A 1N3OA 3C2UA 2Y33A 3L9JT 4GULA 1CX4A 3IPVA 4RS5C 5FP8A 2FZ1A 4LO6B 5T5PA 4DEQA 1U0AA 5FOJB 2Y0IA 2QJVA 4YW1A 2RHPA 1AR62 4CCMA 1CPMA 1ZBE2 4B4RA 1ZRRA 3ORJA 3S30A 1XE0A 3AZZA 1XNCA 1GLHA 4BQXA 2RS53 1ZX5A 3IPVB 5EQUA 5JMCA 5FP7A 2RS12 2O1QA 5EP9A 3QCWA 4C90A 3ZXEA 1OI6A 1I3HA 4JQTA 1Q56A 1RUI3 1C1LA 3T0AA 4RFT0 4IEZA 3UETA 2HWF1 3LD8A 3WP4A 1ZZ9A 2D44A 4CDXC 1W0PA 3DECA 4DXRA 3AP5A 1ZZCA 1MS4A 2P3YA 2YUEA 3T08A 3I2HA 3ZFGB 1HN0A 5EYYA 4MHRA 2EXKA 3ZYPA 2J1AA 3POSA 3N7MA 1GP5A 1PGW1 1IS5A 4D7SA 1JI6A 1JZ6A 2A6XA 1CIWA 3GXUA 1B35B 3MIFA 1V00A 4NE9A 4TN7A 4AFDA 4D7YA 2WJSA 4OYUA 1HXS1 4CU7A 3WQBA 2J22A 1Q3EA 1OD3A 4GB33 5JVVA 3RZGA 2HWB3 3ZR5A 2OZ6A 3KLSA 2YC0A 1UPIA 5EJ1B 5K0UB 1HKDA 5AC93 1SPPA 3I7DA 5FY1A 4ITCA 4AI3A 2A6ZA 2R6QA 5GLVA 1M4WA 2RMU3 2BNNA 4XQ4A 4H14A 1YRZA 2GALA 5T50A 2R063 1F5FA 4AE2A 3K3NA 3W5MA 1ZA7A 3WF4A 1D0HA 3IDCB 3JBG1 4OI4A 1G9BA 1DYPA 4E9KA 3HEIA 5C4WC 1TME1 3AC0A 2WWUA 4AVTA 4XCAA 5C9AB 3CJIB 1W2UA 2JG9C 4CUGA 2A3WA 3QBQA 3NQHA 5K8SA 1QXRA 4OUEA 4XXPA 4YZ2A 1DGRN 3IN9A 5DAPA 3ZYBA 1X36A 5LATA 2Q0AA 4Y26A 5FPZA 1UAIA 4LHNA 4COUA 3POBA 4ZONA 3CJIA 2JDMA 4BIOA 1H8TC 4LBLA 2ZMKA 5BNOB 3DN7A 3GBWA 2W52A 2ENRA 4TSVA 4OCTA 2JDUA 1PK6B 1R081 4LHKA 3CZUA 5I0DA 2Q8CA 3MW3A 3X29B 2VL4A 2EXJA 2DCKA 1W90A 3ETPA 3KT7A 2J1SA 1GUIA 5DZFA 1QQP1 5A1LA 1BEV3 3H7YA 4BQ5A 3I2IA 5JR2A 2VZUA 3TN93 4NPRA 4DB5A 5FZIA 4LIUA 4XTPA 4A6OA 2AENA 4MGSA 3POFA 3ZSLA 2RJKA 4EN0A 4TWTA 4OZXA 3O5SA 2B4KA 2VMCA 2QKDA 3B9CA 2ZEXA 5T5OA 3IIIA 1U5ZA 1UYPA 5E1RA 5JWPA 3HQXA 3U0ZA 3VKMA 2Z5WA 4OUMA 4M3CB 3WCSA 4Y20B 1JZ2A 3SEPA 1OH3A 1OKOA 2F4LA 2XUMA 1HX6A 3AKRA 3JXSA 4LULA 4Y20A 2ADEA 1PX4A 1UN1A 4OHXA 4FQZA 2Q8EA 4AVBA 2ZBJA 1DGWA 2XJUA 1W6MB 1LEMA 4DXTA 1HQWA 4QHBA 4GH4A 1QJX1 4CVUA 1QIQA 3OBAA 1RUG1 1FOD1 1R093 3I2DA 1GQGA 1FOD2 1RUH1 1F2NA 2X09A 4OHZA 4E8DA 1FV2A 1ULOA 1SLIA 2WNEA 1RUJ1 4Y22A 2CWSA 1W3XA 4CXYA 2JDHA 4P9WA 4LUKA 4OHVA 2IFRA 4BLIA 1I6XA 2WFF3 2VVFA 4PI0A 2E53A 4XHBA 2EIEA 3TN92 4R9DA 3K4ZA 4CDQB 4A2UA 5JZGC 4WVWA 4DFSA 3IDEA 5CFCA 1EPWA 3AP9A 1J3PA 1QDCA 2QTWB 3KS7A 4Z2AA 3GZAA 3TEXA 2WUHA 2DURA 4NAMA 5E6HA 4ZZ5A 3ACFA 1OHFA 5FYSA 1VE0A 2QQKA 4XJ8A 3UKVA 3OY8A 3VBSB 4WZFA 4V2VA 4HPKA 2R0HA 4CEWA 1UOGA 4MGZE 3J8F3 4FPLA 4N9IA 1FMD2 2VCAA 1ODMA 1T6GC 1EAH2 2QCSB 3JD73 1YJKA 5CZKA 5FZ1A 3C3VA 3LEMA 3FE5A 2WO3A 1SFYA 3LF7A 4GKYA 1VAKA 3CDZB 1H1IA 5SV5A 3CZJA 5L36A 1YIFA 5J37A 1OURA 3SXWA 1FPN2 2NLRA 3IAQA 1A8DA 3DV8A 5JI7A 5F3CA 2VGDA 2FD8A 2VZ1A 4QXKA 5DAQA 2Q1MA 1VB2A 1STMA 1UY3A 5DAVA 1OT5A 2LROA 3B9IA 4J1WA 3KM5A 2ZGNA 1HJFA 4BDVB 5LK5A 2PHTA 1EUTA 3VKLA 1KJRA 2BGCA 2GDFA 4GXLA 4GKXA 4X8NA 5EPAA 4CP1A 1DGRA 4KWLA 1O4ZA 4M3CF 5F5IA 3OD4A 4EROA 4NPLA 5FK7A 2RMU2 4NAOA 3VZJA 5I8SA 1AJOA 1ULEA 1VB4A 4WVMB 4Y4YA 5B4XA 3VKOA 5BNOC 2P6CA 2HWC2 4H7LA 2GNMA 3VBHB 3WDVA 4I0WB 2WA3A 1D4M1 4QPIA 2D3RA 4GAZA 2R1BA 4MSVA 4LR4A 5EJ3A 4KGQA 5GZGA 1CJDA 5HV0A 1JZ7A 4XFBA 5C3SA 4ES8A 4BK4A 3KQ4B 2YC4A 4IEUA 4C1XA 5DABA 4LNVA 2D7FA 4YGDA 5FK8A 5G05L 1MS8A 4B29A 5FZ0A 4N43A 5IW0A 1YIPA 1CAUA 1RXFA 2FMYA 4LITA 2A3YA 3JBG3 1Y9GA 5DG2A 1HRV3 5GZEA 1DZRA 1VAVA 4XACA 1PO13 4IE4A 2ZKLA 2ZX1A 4JRAA 1RUI1 1SACA 4QB1A 2Q4SA 4R4XA 4WVMA 3R0RA 1RUI2 3WX5A 3HJRA 2PLV2 1UKGA 1IS4A 4FTSA 4QX3A 2VM9A 3WLUA 1ZRFA 5LBFA 2RS52 4RA0A 4YGCA 1RUD2 3MFCA 5FYMA 2IXHA 2VBBA 4Q4X1 5FXWA 5JZGA 4JGYA 2P5BA 3INAA 2P37A 3POEA 1PO21 4COWA 5A3LA 5L9VA 4ARYA 3WEZA 1UY1A 1Y9QA 2VQ0A 4A7ZA 1O4YA 2Y26A 4S2HA 5IJRA 4IV1A 3NWKA 3O0WA 4DNYA 3HBZA 5FY5A 3VBHC 4LO5B 5T55A 2WA4A 1NX9A 3B94A 3RZJA 1F35A 1OC1A 3BGAA 3U4SA 3IMNA 1VMFA 3OGJA 4IV3C 3GDBA 1QOOA 3RWKX 2FCVA 1RUF3 4EZHA 5LK7B 3OUIA 2GMEA 4OHYA 1BVVA 3DPRB 4COYA 4LE4A 2UWBA 4BMEA 4L99A 2DVDA 3MLLA 2DVBA 1EY2A 3OEAA 1E57A 3T30A 5CFCB 1CX1A 3HN1A 5FZ3A 1QJU3 1PO22 2BQPA 4Q27A 2D5HA 2C24A 2VULA 4QMAA 3T3YA 2P3IA 2AREA 2WNVB 5I0SA 3ZFFA 2WZ8A 1G86A 1X82A 4BU2A 3W5NA 2ZJCA 1WMDA 1K5MB 4NUBA 5ACA1 1G9FA 1K5MC 2MEV1 1UYZA 1COV2 1POV1 5TSWA 5A7NA 3KWVA 3PL0A 1IG0A 1ZBE1 3ECQA 1W2OA 3PUAA 5C71A 5ISLA 2OW4A 3WP6A 2R30A 1UY2A 3J7NA 1V0AA 4QQOA 4RR3B 3WOGA 4AGRA 1QJU1 3ZYRA 2C9AA 1UWWA 4ZXEA 2ZAHA 4FXKB 1K5MA 4AQ6A 1LENA 1R1A2 3TRSB 1GP6A 5C8WA 3N7JA 1URXA 1GZWB 2Y34A 1IZ3A 3NSTA 4QWNA 4COVA 4YSFA 5FYIA 2DF7A 2ZOEB 3MLJA 5JPNB 5JCTA 1MR5A 4D8MA 1CZSA 3AL6A 4XUNA 1UXZA 4JC1A 4YW7A 3V64A 3VD9A 5EJZB 3LDKA 1N1YA 4S2GA 2DBIA 4AZZA 2JE7A 2V4VA 3AKPA 3CNAA 2JG8C 3AJYA 4S2DA 4BZ4A 1VBD3 1IOAA 2JD9A 3CIHA 2GH8A 4M01A 1W8FA 3GF6A 1UMZA 3TEYA 2VU9A 1EV13 2BYVE 2E33A 3GCXA 1TG7A 1UO9A 5EWSA 2A5ZA 3KV9A 4Q4V3 4QX5A 4CZSA 1RUOA 1DBNA 3USUB 2JG8A 2W3JA 4NMIA 3OJBA 5JR7B 2ETEA 3ST7A 3W59A 4E2GA 3QH6A 4N53C 1OVPA 4AR2A 5DDJ3 2ZGRA 1PVC3 2OA2A 4EN9B 2I07B 1RUF2 3MHZA 4CU8A 4XDPA 1UX7A 4E4SA 1Q8VA 4FXGB 1XRUA 2J1EA 3U14A 1YCIA 5FYTA 4PJYA 1PM7A 3JCIA 3PDQA 4CCCA 2XVGA 3A23A 2PN5A 2JENA 3KT1A 1QOSA 4UXAA 1JH5A 4AHXA 4AI2A 2ET7A 3AYDA 1Q8PA 1RUG2 1IKPA 5HI0A 3VBOA 1BK1A 4OUSA 5A3OA 4HZFA 3GHNA 2NMNA 4XPVA 3WCRA 5FY8A 4XFFA 2NQYA 1YQ6A 3B69A 5F3IA 4MVTA 1HXS2 2H0BA 5IK5A 1YFUA 1RUD3 4P9XA 2H6BA 5FYUA 2BFUL 2PHDA 3P1IA 1ZM1A 4TYSA 2IXJA 1ND3C 3ROUA 1AJKA 2PLV3 3E5UA 4JRLA 4OMDA 3OYWA 1S55A 2OYZA 1YWKA 5A70A 2QQMA 2ZS6B 5ABJB 2XBO3 4N43B 4AI9A 2AEZA 1EPZA 4URAA 1CVNA 3MIBA 3O1VA 1FNYA 3JBG2 4JDNA 3Q9OA 2D6NA 3TNPB 3SCFA 3T0DA 4LKFA 2VOWA 3JB4C 2RM21 3E1F1 4QDRA 4FOVA 4FT8A 1EV12 4IGOA 4YYOA 1NQJA 4W65A 3VHNA 5LW9A 2XB6C 3NW4A 2A75A 2XR4A 1LAJA 1KD7A 2DVAA 4A6SA 3VD3A 4Y22B 3HIFA 1VBD2 4DIQA 5JOYA 2Q8OA 4J25A 4NVPA 1WW7A 3MV01 4JGZB 4EJRA 4EWEA 4QPGA 3JD71 1U12A 3SH3A 4QGLA 1AF9A 1Q5OA 3M1HA 2OX0A 1N1VA 1QH6A 1ULFA 4IEXA 2EAAA 4PF5A 2RJ2A 2AACA 2W1SA 3N36A 1YNAA 3PVBB 4MXWB 5IATA 1APNA 3ZSKA 1OQEA 4XBQA 1YQ5A 3SH5A 1DQ6A 4XIOA 3ZFGC 4XJWA 1KEXA 3THCA 1R1A3 4FOQA 4TZDA 2RR12 4CEWB 2MHFA 3PVNA 3ZN4A 1PM4A 5D8AC 1V6OA 3PVOA 4JDMA 4F7ZA 5JOZA 5K9YA 3H50A 2VZTA 5DPNA 1J58A 1O7FA 2EIGA 5KHGA 4Q0UA 1MZ6A 2BUKA 1XNBA 4JX0A 4JTNA 4LK7A 4LMFA 4LTAA 4XJAA 4P14A 4XF4A 4BISA 4YVSB 2RJLA 1EAH3 3JD72 1GSLA 2ES3A 5F5CA 5FP9A 4IERA 4CA9A 5HPOA 3J8F2 1HDKA 2WS92 1QJY1 3M2MA 4K7JA 1XOYA 4LLFA 5C33A 3ZXLA 3AMHA 3J8F1 5A7WB 3R6SA 4IGQA 1CPNA 2PQQA 4AWDA 4CDUC 3VZOA 4QDQA 2WNVA 5K0UC 2XKPA 2YFUA 3O1UA 4KL1A 1L7QA 4GJZA 2VTXJ 1NUKA 2HYXA 3CMGA 1VBC1 2YDEA 3HPNA 1JYCA 2X29A 4B3NA 1GZWA 4XMAA 5IVEA 2FDGA 4O9EA 3T09A 2UYAA 3CKHA 2WC2A 3BPSA 3NO8A 3PNAA 1QJX3 1JYXA 1QF3A 1IKQA 4GA9A 1AL22 5A7PA 3BTZA 4EZ4A 2QUOA 4L92A 4LQRA 2FCUA 3PJYA 3SEEA 4TTGA 4XILA 4LOTA 2QQLA 4YGEA 3M3CA 3JB8A 1AR91 2JXAA 5FZFA 5L73A 5IK7A 1N1TA 3VBUC 4XFIA 3AX4A 1MEC3 1ZBA1 4YW6A 1SLTA 5FBZA 2ILMA 3RYKA 4YZ4A 3GM8A 1G9CA 1ZVFA 3HBKA 1WD3A 3B01A 4QQHA 1LOCA 3NRUA 3RZZA 3DPRC 3IKWA 5JOWA 1MS1A 4IV1C 1RUH2 3A0NA 4GD4A 1W05A 1C8M1 2DWRA 2PYTA 2VW1A 3NKGA 3OOXA 4KH9A 4QKNA 3ZX7A 1F15A 1OOPA 4ZS3A 3RSJA 2PAEA 4QQ2A 1CJPA 1PMJX 2GP3A 2GMMA 3D6EA 3VBRC 3WV6A 3BUCA 1PO12 5D21A 5A1FA 1ASJ2 3CJIC 1HRV2 2J1TA 2V72A 1BEV2 3W9AA 5FO8B 5I8YA 1RMU3 5HXVA 3ZYGA 3H1WA 4HKWA 3B3QE 2UY9A 3NL1A 1B35A 4BQ3A 2XHNA 2E9QA 1RHI2 3Q8AA 1TNFA 4B1LA 1AR71 2F17A 2RMU1 1WKYA 2CGOA 3HVDA 3KGZA 1XNDA 2Y6GA 4UFLA 3WNNA 2ZHKA 4QM9A 1QJFA 3IBMA 4PI2A 3SCGA 3C7GA 4QHZA 1CQ9A 4Q8LA 3RJRA 3ZN5A 2RG4A 4D69A 4LUMA 1PNGA 5FZHA 2YZ4A 4P9LA 2PA7A 4BQ1A 4ASMB 2V5YA 1RTVA 1MS0A 2ZA9A 4JQRA 5LBBA 2ZHLA 3I54A 5G04L 1PO11 2IXIA 2WNOA 4I30A 3WZ1A 5CBLA 1PGL1 4XYXA 1JZ3A 4YVWC 3I2OA 4XF9A 5CU1A 1LOGA 4MXWA 1RVF1 5FXXA 5HV4A 3BTYA 1WCUA 3GZTB 4AEDA 2R062 3OYWB 4NO4A 5FZCA 3VHPA 4L11A 4XCBA 1D7PM 5HCFA 2E51A 2KA3A 3F2ZA 5A3MA 1FPN3 3NNFA 2W08A 1XSQA 1O3RA 1K3IA 3JQXA 4HK9A 1U5YA 4YNIA 2WBKA 3VBUA 1ST8A 3O1SA 2WFPA 1GWKA 3KVBA 3NV1A 4NWVA 3WG2A 4A4AA 1FMD3 2A6YA 4XJZA 2Z4FA 4QPGB 3NV3A 4YW5A 3OPTA 5JIAA 2FDHA 2LW8A 1OVSA 1NCQB 1RHI3 4Z92B 4XFGA 1E5IA 2DDUA 3ELNA 1DHKB 2HWE1 2RS11 3ZXKA 1ND3A 1UCXA 2WWJA 2AEYA 2QE3A 1NXD1 1RMU2 5JUVA 4H3WA 1CWPA 2MNGA 1K12A 2EICA 1L7LA 2P34A 3PU3A 3LCPA 5LA2A 1T6BX 4IE7A 1LR5A 4A41A 3Q8BA 2WFF2 4UI9L 4BQWA 2R16A 4Y1ZA 1MS3A 2PHFA 1Q8SA 3KV5A 4AI8A 1QDOA 4LO8A 2KD7A 2JG9A 4QT6A 4D3WA 4YARA 1OXCA 4KBZA 1TVGA 1RUH3 4RQPC 1FOD3 1R091 4Q4X3 2B42B 1LOFA 2CTVA 1Z0HA 5LBCA 3I2GA 1PMIA 4FPKA 4D6QA 2ZEYA 3BALA 3UKTA 4JZRA 1JYNA 1AXYA 4OLLA 1G7YA 4XETA 2Y64A 3TBDA 1OA3A 2VJXA 4AQSA 3OGVA 5IVYA 1ENQA 5BPXA 2WSVA 1Q8OA 2A71A 4QPYA 1MZFA 4W6YA 4FAHA 3J7MA 4Q1RA 4XFAA 5I8TA 2JG8B 1W8TA 1RINA 2EALA 1SFPA 1F5JA 1Z7S1 1HB1A 2KM2A 2E63A 3H7JA 3ZOIA 3ACHA 2IXCA 1VRH1 4YPJA 1ZBA2 3AB0A 2E32A 1CR7A 1BCXA 1DZTA 2C26A 1VMHA 1AL23 2EXIA 3S5QA 1QJX2 1U5IA 2RVAA 1AXZA 2XL7A 4BIFA 4CDWC 1IS3A 5C3QA 4FPCA 3E5QA 4CYDA 1UYYA 2ARCA 4UBHA 2VZOA 1JS9A 3D0SA 4L97A 2CU5A 4M4RA 4UW5A 2VC9A 2YBKA 2P3JA 1C5HA 3ABZA 1DZQA 5FZOB 1XYNA 2SBAA 5IFTA 4N53B 2DU1A 3I49A 1Y43B 5JOXA 3PTYA 3D3AA 5GLUA 3WUCA 5BNNC 1QXPA 1CAVB 1GICA 1Q8QA 4IEYA 5CVRA 4GZ9A 5F8PA 4P9YA 4HG6B 3FJSA 1YFXA 4U2AA 3GHMA 1KRIA 2W0XA 2W94A 3ZMNA 4CP2A 1VJ2A 5FZOA 5LA0A 3WR0A 5H9QA 3BODA 2IVIB 4NRMA 1X8EA 3ZYJB 3RI8A 3OGRA 3FHQA 1VBB1 4M4PA 2ZTNA 4FBFA 1I5ZA 2IVJA 3FWEA 5GM0A 3TOJA 1R1A1 4XW3A 3VB9A 1NT0A 3D0JA 2XBO1 1GNHA 2QQJA 1A34A 1KDMA 4M0HA 4LO7A 1JTZX 4LK6A 5FZ7A 3U37A 1OLMA 3MUZ1 4D6SA 2ZX0A 4JKKA 2LRPA 3WQ7A 5FJHA 5FMCA 2Q5TA 2YMZA 2CSGA 1WWYA 3JZVA 2WZR1 4GB31 1AYN1 1SHWB 2FQPA 2HWB2 2PAKA 2R061 3UGFA 3N9MA 2WZR2 2VNOA 3I2FA 4GB32 4ONUA 3EQEA 4CXXA 3E6CC 1VBC2 3R05A 4HBNA 2CY6A 2XG3A 3G6JB 4CDXB 1TEIA 1W3VA 3MI8A 5I0TA 3SISA 3ZKYA 4FVVA 4K8RB 3LIHA 2X05A 5C9AC 2ARAA 3VDCA 1D0GA 2R32A 2XH6A 3CF6E 3RVHA 1OA2A 3LEIA 4WM8B 3NMBA 2XBO2 1WW6A 1W39A 1J1LA 4FFIA 5FPLA 5CIRA 1W8WA 4PBPA 5F2SA 3CL1A 3WQ0A 2EF6A 3AVRA 1NAEA 1LGNA 1NQDA 1WLCA 5A33B 4I0BA 5CEHA 1W6NB 5CAZA 2I2SA 5I0UA 1W9TA 4K6BA 3IZOA 5LEJA 1WBLA 1HXS3 1AXKA 2WDBA 2VO5A 2GZWA 3SLIA 1QEXA 1POV0 3ILRA 2R1DA 1LOEA 2JKXA 3AJZA 3OF1A 5FYZA 1S1AA 1GU3A 1CAXA 4CEYB 2RS51 2VMEA 5JPMB 1GYKA 3CJXA 1V9U2 4K40A 4UYBA 1AR61 1DFQA 3MV11 2JECA 5DZGA 5IHRA 5D2AA 1ZRCA 1ENRA 1QNYA 2O8OA 2VOKA 2I74A 2XUEA 3WG4A 2WZEA 2NN8A 3L2HA 1RUE1 2FDIA 1A78A 1ZZ7A 4FTEA 1H0BA 2JB4A 3EB7A 3MFAA 1YLLA 4LBQB 4IGPA 5CG9A 1J59A 2WQZC 3E6BA 3E97A 5FMOL 1WLTA 1VMJA 3A7QA 5DDJ2 3KCYA 2HWF2 3H8OA 2A6WA 1GANA 1O8SA 1HB3A 4MGIE 4UFJA 3VBRA 1TME2 2DVGA 5F3GA 3ES4A 3WQ1A 2RR11 1MPXA 1N3PA 1MVQA 4Q4V2 4MUVA 3DYMA 4PBOA 3ZFFC 4Q4V1 3VHOA 3NJXA 2ERFA 5F39A 3RWNA 1D4M2 1KITA 5H9PA 1PZ7A 1OPMA 1UOJA 2Y0OA 3DXUA 3R4DB 3BPZA 4OZOA 4CTEA 1ACCA 4K1ZA 4MG2A 4Q29A 1IQDC 1WLDA 3KSCA 4LORA 1AYM2 4CSWA 2KXLA 3QD6A 4OQ8A 5FY0A 4KI5M 4U36A 4AG4A 2YYOA 2BBVA 4EWAA 1ONAA 1UPSA 2WS91 3N9OA 4MLOA 4O7XA 1DLLA 4QX2A 1LHNA 5L7OB 3I3BA 4QQPA 5LCWL 1OFSA 3OGSA 4CU6A 1HB2A 4YGBA 1SBEA 5FLIA 4OULA 3SCHA 4XC9A 1W99A 3SMHA 2AH2A 1GP4A 1UY4A 3DKQA 1NOVA 5A6QA 3VBFA 2BVBA 4EYUA 4MADA 2VZSA 5FUNA 5H9SA 5FLHA 3PUHA 3ENRA 4HKLA 1RUNA 1AX2A 1QJEA 1XU2A 3F95A 4LLOA 4O61A 1IGOA 1UZZA 4NIDA 1ND2C 3OD0A 1JZ4A 2BZDA 1PX3A 1SCSA 2XPJA 2PHRA 1COV3 3LAGA 2HWE2 2R49A 1ZYBA 2XJVA 1ULPA 4KWJA 4LKEA 3KQRA 1GOHA 3AFGA 5HCAA 2JE9A 1KJLA 3H3UA 4Q0SA 4E4ZA 5AVAA 4NHLA 1K42A 2B39A 2RDNA 3WD5A 4I09A 1PO23 2DVFA 2XGXA 4QU2A 1QNWA 1FYUA 1GKBA 1HRI1 3IAPA 4F3JA 2DCTA 2ZKNA 5ABJA 1G9DA 5AVPA 1VBB3 4JHTA 5FZAA 1F9KA 5FP4A 1ENSA 5GLWA 2X8KA 5FY9A 5FQ0A 3LEKA 3VLBB 4COZA 4YRDA 3JQWA 3DPRA 2WRAA 5BY5A 3QH7A 4AAXA 3Q8CA 4A42A 5DMYA 4Y1UA 4KMQA 5BUVA 5A80A 2UYBA 2K46A 3T2OA 4CCOA 1NA1B 1OOPC 2Y60A 1MQTC 4MGQA 1S0FA 3POIA 4YW3A 4JV4A 4I3GA 1PK6A 4QPIC 4FO9A 4JVAA 4OFGA 1LEDA 3AMPA 3LKJA 3KCCA 4DZGA 4Z1VA 2WYSA 4KGGA 2WZPP 4N90A 3LQCA 5BNOA 2OZJA 2NYYA 4P9GA 2WSUA 4HXCA 5EYXA 1OH4A 1O3SA 5DG1A 5APAA 5A32A 2VOVA 1W6NA 1VR3A 1OFNA 4Y4RA 4FAGA 4UAPA 4XZUG 3OTFA 3TAYA 1FV3A 1J1TA 3VDAA 1SQ4A 4Y24A 2YROA 3ZYFA 3BKZA 4AOCA 1REFA 4A3XA 4IESA 4CDQA 2QQOA 5F9TA 3HMYA 3WDTA 5FYBA 3H8RA 2PELA 3AYEA 4HVRA 4AFMA 4CUBA 3N4MA 3DUIA 5F7UA 2JWPA 5F5QA 5A6YA 1JOJA 2BOIA 3KMHA 5FY4A 1ASJ1 1UF2C 4AI1A 2C5DA 2ID4A 4MZUA 3NNJA 1RUE3 4GWMA 1CAWB 1L3JA 3ZIXA 3E6DA 2VBDA 3MW2A 2YGLA 3N9PA 4Z07A 4ZZ8A 3NNGA 2XONA 2R073 4MGKE 3AVSA 3E5XA 5IVFA 2ZHNA 3O1MA 5CB7A 4YG6A 3THTA 2PHXA 5J09A 4YWAA 1NA1C 2HWC3 1N3QA 4CEWC 3OGGA 1CZVA 2BRTA 1W8OA 3RGBA 2GNDA 4HVOA 1V6MA 1H8TB 2XJQA 5IWFA 3VBSC 4PT6A 4CDUA 4QX0A 3ZFGA 1NZCA 2Y6LA 3DXTA 3M3OA 4CRQA 1VBE1 1W04A 2BNMA 2VQUA 5C8CA 4K20A 4LPLA 3IDAA 4META 3VD7A 4E8CA 1QY4A 4X8PA 5FZGA 2R041 1NE6A 1W6QA 2PAMA 5DAXA 1US2A 3KZ4C 2IFWA 2JDAA 4LHLA 1AYN2 3J26N 4KU7A 1OLQA 3LE0A 4QU1A 3UL2A 3EMRA 1PVXA 3WF3A 1O3TA 3LSEA 2JG9B 1OD5A 4MXVA 5BXXA 2VNVA 2BW8A 2PLV1 2J1RA 3FBYA 3FUQA 4XOGA 2Z2SB 4B4QA 1YQ2A 4YVSC 2Q8DA 5A7QA 5T54A 4NIGA 1YQCA 1JODA 3H1MA 1XC6A 4EWDA 4LIVA 3G7DA 1UMHA 4G9SB 2DCYA 3UGGA 1XSRA 1RUC1 4XAAA 5DN2A 1XE8A 4BWOA 3V0AB 4WM7A 3LFIA 5L7OA 3C7EA 2GC2A 2ZABA 4HPKB 4M3CE 4PLOA 2X5IA 4H55A 1RVF3 4CCJA 1G6NA 3ACIA 5FMBA 5BNNB 5JI9A 3WINE 2NP0A 1BVP1 2G4IA 3FX3A 2DCJA 1Z7S2 4AVSA 2VUCA 1Q43A 5IUQA 1W2NA 4IUGA 3LPFA 2BP6A 4XBNA 4CCDA 3ZYHA 5C4WB 4P9JA 4QPWA 4BCUA 3HOBA 1UU5A 2AUYA 1JUHA 4BPZA 2B7YA 4ISRA 2X10A 1DGLA 1FXZA 1UIKA 1R092 2QZ2A 2D40A 5F37A 4EE2A 2YU2A 3VHRA 3AFKA 2GC0A 4XTMA 5J98B 1RUC2 3DEMA 1AX0A 3HT1A 2XOMA 2C0ZA 3SQOA 1J3QA 1A6CA 1TZOA 4Q4Y1 4Y5SA 4BJ0A 1O8PA 1W2TA 1AL0G 1BBT1 1LOBA 4PIXA 1AR92 4B1MA 3ZPOA 4BQ4A 5FFOC 3AXDA 3RFRA 1ZZ8A 5C5UA 2EIBA 2VAUA 1S2BA 4Q4Y3 3TB0A 5GZFA 1KS4A 1LHWA 4GMP0 4W6XA 5FYVA 4NRQA 1BMV2 4FOWA 3VDBA 5A6ZA 3D5OA 2ORXA 2AC1A 3GALA 3RNSA 5FYHA 1GWMA 1ZRDA 3WNXA 2ZCWA 2NM1A 2BPA2 1KQRA 3AMQA 1O3QA 3PIGA 4CPBD 1HLCA 2OS2A 2WYFA 3I3DA 3M4FA 4KWUA 4FPJA 3KT4A 3ZR6A 2W1WA 1LECA 5FJKA 4XAEA 3ZXGA 3Q8FA 4QAWA 3ZFEC 1C3HA 1RJ7A 4IV3A 2XVLA 1N1SA 1XNTA 4Y1XA 4XDQA 4FP2A 2G9GA 3CU7A 1WZXA 3CQOA 4KQ7A 4ES9A 4Q2FA 3MPPG 2VW0A 4GJYA 2ZEZA 3N9QA 1H4HA 2BDRA 2P17A 2PHWA 4YVWA 5EIYB 4AVCA 2VVDA 2XMLA 2K9ZA 2BGOA 1H9WA 1CAWA 1QQP2 1V9U1 2VCMA 2RE9A 1DIWA 4HANA 3AP4A 4XE9A 4XQDA 2P1BA 3H0OA 2YPJA 3DKWA 3B5LB 5F2WA 1W6OA 2YG0A 1LOFC 5A7WA 4AQTA 1LCLA 2WL1A 1OA4A 3FLPA 1SCRA 1QWRA 2A73B 4YG3A 4ZU5A 5LY2A 2ARXA 5KXDA 4ARXA 2B9VA 1G9AA 4GH4B 2EXHA 3PHMA 3ILFA 4N43C 4QKBA 3VGIA 2WINB 2D6PA 1WMXA 2ZZQA 3WG3A 2IXLA 4NJ4A 2ZAAA 4DRVA 1GWLA 4DY5A 5JAXA 4YW4A 2BWAA 1XXNA 3VD5A 2XLFA 1A3KA 1F4HA 5AC92 1GZTA 4WVZA 3HWJA 2RDSA 3DGTA 3RZKA 1S0BA 3TNQA 5ACA3 4F8AA 4PIYA 1W9YA 4PCRA 3M3IA 4KU8A 2JE8A 4CDQC 5AFEA 5FMDA 2BBAA 5F32A 4JGZC 3WNOA 2VZ3A 4CDWB 2VZRA 4D0QA 1C8M2 2XQXA 1PZ9A 1UOFA 4NWWA 1DU3D 4ATEA 1W8NA 2ADDA 4KG0A 4CE8A 2TUNA 5FXVA 1OOPB 1JN2P 1NLSA 3H3LA 2D5FA 3B7MA 3VUOA 1D2QA 4HT1T 1F31A 1ZZBA 3OEBA 4XMIA 1RUF1 1HJGA 1O59A 3CLPA 3I3EA 4RR3A 2QQPA 4N53A 1JYVA 2RS13 3MIEA 4IE0A 2JKBA 3H1YA 1J3RA 2GC1A 2BEOA 2JIJA 4CUAA 1AR72 1HW5A 1JHJA 4FPYA 3IMMA 4BQYA 1BJQA 4PQQA 1OLRA 1ZBE3 3DF0A 2C9KA 5FPUA 1AR63 3AKQA 3PIJA 3VZMA 5IAXA 2OPKA 4P08A 4YZ3A 1B09A 2GNTA 1H2NA 3LFMA 4NHKA 4B7KA 5T5JA 4OI0A 4P5YA 5FCCA 2DFCA 5DZEA 2LALA 4ZS2A 2Q1ZB 1LRHA 2VG9A 5K4LA 3ZM8A 1WUVA 3RZLA 3ZN6B 1AR73 2GP5A 3C7FA 2A70A 3THPA 3LWCA 1GOFA 3P3PA 2Z42A 1GNZA 1MZEA 4GWNA 3PUIA 4AHWA 1W9SA 1H1AA 1P8JA 2HYKA 2V4AA 4HFSA 3NAPC 2WN2A 1LTEA 4X6QB 4NOTA 4YM2A 2WN3A 3PMSA 5FPBA 3AZYA 5JXJA 3QACA 4JGYB 1MVEA 1UD1A 1WMEA 4CCEA 1JBCA 1S4CA 2YC2A 1UZYA 1N47A 4RHV2 5GZDA 5FR3A 3U78A 4PDWC 2CGNA 2WLPA 3DCQA 1BKZA 1V70A 3ITQA 2YBSA 4V2WA 5A3PA 3P3NA 3EO6A 2FCTA 4K21A 2FDFA 2UY8A 2ZZJA 3MBWA 3POWA 2Y6FA 4CUCA 4QXHA 3UT0A 5ACA2 3OBTA 1D4VB 1PGL2 1MEC1 4HK8A 1SMVA 4R9AA 3H3ZA 4DXZA 3FLRA 1S0CA 3NKTA 3WF2A 3D8CA 1RC6A 2HH9A 4IEPA 1RIRA 3WW2A 2D3SA 3L2YA 1R082 3WDWA 5JSRA 3LB9A 4GALA 4C0BA 2DUQA 3FC0A 3B93A 4RGAA 3RPQA 3GYDA 3AM2A 2UU8A 2NMOA 4XFHA 3VZNA 1ND2B 1RGSA 3PMEA 2FHRA 5M0TA 4A7YA 1CAXB 4MO3M 5FBJA 4CEYA 1WCKA 4Y5Z0 4ASKA 2PXJA 2E7AA 2W91A 3WDYA 1UZVA 5D8AB 3WNLA 1HRV1 3C8XA 2FDJA 1C57A 4IE5A 4CP9A 4QKFA 1XQNA 1YJLA 1O5LA 1XB9A 1JU4A 1UZ0A 3H42B 5E8AA 2RDRA 1H8TA 4NHXA 4O65A 4Q4W3 4G4FA 3ES1A 5EZWA 4E27A 2FDKA 5FWJA 1Y4WA 1W06A 2F4PA 3HQUA 4HONA 1H9PA 3NJVA 4C1WA 1W0NA 1US3A 3C7HA 4XF0A 4JDOA 4Q0QA 2CAUA 4P02B 5LBEA 4FTBA 5CKQA 3UK9A 1EUUA 1IPJA 2ZHMA 3LA2A 5KXBA 3VDDB 3SHRA 2HWB1 4IEQA 4AK3A 1RJ8A 3ZO0B 5CISA 4Q26A 2D6OX 4IE6A 2XWBB 4Q8KA 5C5TA 2CYFA 4R9CA 1TMF3 1YO8A 4W50A 3T4HB 3ON7A 2ZGTA 3BIEA 1SG3A 5JMOA 2R043 1LB2A 4DUXA 2DV9A 4B7EA 1YEWA 5BNQA 3PVEA 5DXDA 4R9BA 2D6MA 4BM8A 4KG8A 3T0BA 5ABJC 1GOGA 4Y1YA 1YI9A 2SLIA 4AQ2A 3GBGA 2WR9A 4WV8A 2HEVF 2JD4A 4K3UA 2KR2A 5BNPB 2ZGUA 3ZDSA 2OQ7A 3K3OA 3UKNA 4LHSA 1F8VA 2UWAA 4GWJA 3UGHA 3ZXAC 2O8QA 4LJHA 4HSJA 4LEJA 1UU4A 2VMFA 5IVJA 1U5XA 3BCWA 4HN0A 2X5IB 3CO2A 3N35A 4WVVA 3I2KA 2IZWA 1JMUB 5JIUA 4P5HA 4MGYE 4XURA 3V0BB 5A6XA 3VKFC 2QDNA 1WW4A 1H2LA 1TE1B 5L9BA 3WXPA 2DCZA 2QNKA 1JUIA 1H6YA 3P5BA 4R8HA 5T52A 5JXGA 4E2QA 2W92A 2QVSB 5C70A 4D7TA 1X9TA 2VMDA 1RVF2 2VMGA 3KF3A 4FCAA 4QPGC 1BEV1 4UF0B 3OCPA 3S6PA 1JZ5A 4Z82A 1RUJ3 2FMDA 2HLEA 4Y3OA 2XXZA 1LGCA 4RR3C 1PNFA 2XJSA 3I2JA 2P4EA 2VMIA 2VQTA 1POQA 1UKRA 4AGGA 1OPOA 2WO2A 5HCHA 4DINB 1KGYA 3EJKA 3RI9A 2ZGKA 4RHV1 1FMD1 1CAVA 4ZU4A 5L19A 1AR83 2L9LA 3MPBA 2RM23 1HV1A 2QFEA 2YB7A 3APBA 3GGLA 2HWD2 2MPFA 1WA4A 3OSDA 1DF0A 3RQ0A 4PIZA 1BBT2 1IPSA 2HWD1 5CKNA 2BOJA 3VBOC 1EP0A 5FO7B 3T1LA 4O9GA 2YFZA 4Q1PA 2CDPA 1NCRC 4XUPA 4FSJA 3R4UA 4OHWA 4Q4W1 3WT3A 1D2SA 4PDWB 1LOAA 3VZLA 3ALQA 4AEKA 3K46A 2Z79A 1KS5A 1NKGA 3NV2A 2O0OA 4JCKA 1BZWA 2RS33 3NAPA 3FZ3A 3KB5A 4ISQA 4J6GA 2B9UA 3AZWA 4KWKA 2OUJA 3LEGA 1LESA 3M3QA 2HWD3 5C3PA 1HRI3 4BOWA 4ZPIA 1AR82 1C4RA 5FRAA 1H4GA 3SH4A 1BK0A 1CAUB 2VXRA 5IVBA 3IT8A 4AXOA 5HBAA 2CGPA 2YHJA 1Z78A 2GU9A 4MV2A 1I5PA 3O0VA 1TQ5A 2V09A 5BNPC 1RUE2 2IWGB 3K48A 4W8JA 4NIAA 3PUSA 2J1UA 4J1XA 4AHYA 5JXHA 4C8DA 1WMFA 3RYPA 3I3MA 1V6IA 1WBFA 1ENXA 3K51A 4YVWB 1ND3B 2QQVA 2VY0A 3OBRA 1SBFA 3KD4A 3UESA 2PFWA 4ASLA 3MIHA 2B5HA 4L8QA 3KV4A 2Y8KA 4EV0A 4NHMA 2ZEWA 1OUXA 2D98A 3LOIA 3MF9A 4QXCA 4W4ZA 3BI3A 3CBNA 3HAGA 5A32B 1EV11 4LBQA 4QXBA 2EIDA 2WT0A 4XHXA 3GBFA 4K8FA 2OKXA 1SLBA 3ZSMA 2O14A 2XJRA 4JGZA 2UURA 3WDXA 4BA6A 4XFCA 3VL8A 1PGSA 1S0JA 3U10A 1BYHA 3PU8A 3T2QA 3O1RA 1QGLA 3MEPA 1DP0A 3EXUA 3K4DA 4OI2A 2ZXQA 4ATFA 2LTNA 1SFNA 1H8VA 2BGPA 4AEJA 4AEMA 2V5DA 5F3EA 2W1QA 5FZMA 1X33A 3AXEA 1VP6A 1CONA 1IPKA 5KXEA 1SEFA 2EAKA 5B4NA 3AYCA 1AL21 2IC1A 4GMP1 4HSLA 2ARBA 5GJ6A 1GBGA 4YM3A 2UWCA 3U1XA 1OLME 1VAMA 2AYHA 2BU9A 5EHDA 2XKOA 3ZPYA 1XYOA 2CWMA 4ET7A 4FPEA 2VXJA 1G8WA 2X53S 3CEWA 4RGGA 3KHCA 3BYWA 3VZKA 1LGBA 5F5AA 3V65A 1LNSA 2WNUC 1NE4A 1V6LA 1Y7BA 4UOJA 2BV4A 4Y5TA 2JJ6A 1DQ5A 1DGWX 2VD7A 5HXMA 3IB3A 1FT9A 5CYYA 1IG3A 2QQWA 3FBMA 4RSUA 5LEKA 3VBHA 2OVUA 1QJY2 3THDA 3WP3A 3WW1A 2DYCA 2R0FA 1S0DA 5ERLA 3V0AA 1WW5A 3AZXA 2G9FA 1UYXA 3JUUA 3J7HA 1PK6C 3DYOA 3PTRB 5BNNA 4C91A 4DO0A 2MEV2 1H2MA 5A3TA 1OF3A 3MLKA 2D6KA 3HNBM 5FOBB 2D43A 4QM8A 3UV9A 3WNPA 5LY1A 1CESA 3W58A 4CDWA 1NY72 1ZREA 3U4XA 3TN91 2AGSA 1YI7A 2RS32 4JKMA 3O14A 2VOXA 4I0AA 3VBOB 4N7IA 2NPIA 2OXBA 1YXWA 4KNCA 4BE3A 3ZN6A 3I3QA 5CG8A 1V6KA 1R64A 4LA2A 4NN0A 3IWZA 2PMWB 4OMCA 4YFZA 2VUDA 5E89A 5FXZA 1R083 3WHUA 5FIXA 1V6NA 1GZCA 3FUOA 2QQUA 2ZGQA 4LO4B 4BXFA 4HETA 3S0MA 4IXLA 2XLGA 1PIV3 1VBE2 4DY3A 1H2KA 1BBT3 4GWIA 4WM7B 2GSYA 2BWCA 1YC61 4UFHA 2W1UA 4IV1B 4LKSA 2W39A 1BHGA 4D6RA 2VPVA 4YG0A 1AYM3 3OBZA 1SLAA 1REDA 2YY1A 3KVAA 4NROA 5CFDC 5GZCA 5LRSA 1ZA4A 4CCNA 1E5RA 2VZVA 1RITA 1YFYA 1D4M3 4SLIA 4AFAA 3ATGA 1OUSA 4I01A 1XYPA 1AYM1 1BQPA 1RUJ2 1UMIA 4RN5A 1RYYA 4RHV3 1F4AA 1TME3 1YQ8A 4XZPA 5D8AA 3GNEA 4V1PA 1O6UA 3KHBA 4SBVA 1XE7A 5L9RA 2VCCA 5AFBA 3MICA 4Y33A 1K45A 3QLQA 3QOPA 5FV3A 4N9HA 5GLZA 4CEYC 2Y6KA 4G3YC 1J83A 3LA7A 1HQNA 3B02A 3LDRA 3M3EA 4H7MA 4GIQA 4HN1A 3FLTA 5IFPA 4ORFA 1DQ0A 2PTMA 4E4HA 5DUXA 2W47A 4DMIA 1I1EA 3BN6A 2J42A 4A7KA 4RFRB 4JKLA 1MQTB 3H8UA 5HCBA 1DDLA 2JDNA 2PHLA 4N8MA 3ZFFB 4XVHA 2FZ2A 1RMU1 2XWJB 3NNMA 2VBPA 2CV6A 4DS0A 4LBJA 1UZWA 4IEOA 3RRDA 2XQRA 4AGVA 3N9NA 3EBRA 3OPZA 2PHUA 1SBDA 2R042 2WAAA 3WW3A 1ZZ6A 2J1VA 2JEMA 2WWSA 4IEVA 4ZY9A 4CU9A 4AEDC 1SLCA 1TMF2 1FI2A 4K1YA 1YHFA 1DQ4A 3VV1A 3ILNA 4W6WA 1QOTA 3WF0A 4LBMA 2Q30A 4XJ9A 3FL7A 4A3ZA 1VRH3 2HEWF 4NHYA 3AK0A 2CAVA 1VBA3 2QZ3A 5FZ6A 4MYEA 3KGLA 4NR1A 4YLZA 1ZNPA 5C7GA 4QGMA 1VBC3 3WP5A 5JSOA 1V6JA 1BLZA 1LJ7A 1J84A 2VVEA 2WZR3 3LPGA 4H2AA 3J4UH 3T2TA 4AVVA 4AI0A 4BXSV 1VBD1 5FZLA 4RYDA 2NZ9A 5I91A 1XNKA 3FHIB 4LOSA 5IVCA 1ZRIA 1HB4A 3A21A 3DYPA 3BVCA 4QD2A 5KBFA 1WGPA 2JDYA 1B35C 2Y38A 2ZGLA 3V0BA 4XF1A 1UQXA 1VLNA 1UW8A 2BJSA 4DEVA 1OMIA 2ZGOA 4AVAA 1LHUA 2G1MA 4UWDA 3RG0A 3LIGA 3VN4A 5T3NA 1GV9A 5E88A 4F83A 2ZGPA 4UW3A 1NY71 2ZMLA 5BNPA 5C3RA 4AL9A 1QQP3 3ZFEA 1XBFA 1I9RA 1TNRA 4BMBA 1H30A 2VTXA 4JHZA 5IVVA 5K7PA 4WBBA 3M70A 3ACGA 3S57A 3UNPA 1UXXX 2VUAA 3AL5A 5IAVA 1OKQA 2A6VA 4QHOA 1DG6A 1HQLA 2C1FA 2XJPA 3FFQA 3K75B 1C8NA 3SKJE 3T1MA 5GKAC 2HWC1 1VBA2 4Y1VA 2BFUS 4AW7A 5LA9A 3POYA 1NYWA 1VRH2 2P2KA 1VBA1 4UW4A 4DXSA 1OQ1A 1DCSA 1FPN1 4QPIB 4XUTA 4XUOA 3TWIA 1FNZA 2XL9A 3O1PA 3AP6A 4L9BA 3USUA 2YPDA 4MHUA 3T2PA 4MGTA 2PQSA 4Z8BA 3ZFEB 1QMJA 2WIIB 1NG0A 1S2KA 4FPHA 4LBNA 4P00B 1UIJA 3RJ2X 2VMHA 1ZBA3 2WT1A 1QU0A 4YW2A 5EFUA 4Q4Y2 2RV9A 2JB8A 4AEDB 5C6CA 4NRPA 3UYJA 2LUWA 3VBFB 1AR93 5LRRA 1OF4A 3I8TA 2JX9A 2WNVC 1YYNA 4FPOB 3OG2A 5CKMA 2VCBA 3KF5A 3AZVA 5EV7A 4BH9A 2K2SA 3VD4A 1PHMA 1QH7A 4NIHA 1AR81 5LASA 2WQ4A 4LBOA 4RQPB 1BMV1 2DBNA 2EVXA 1NXMA 1RUC3 3FHAA 3WDUA 4LXLA 5FLJA 4JTOA 1W6MA 3GZUC 5CFDA 3D82A 2F6BA 4CPBA 1L7RA 1QHDA 4Q4X2 2D93A 1E5SA 4UW6A 3BIWE 3S5AA 2P6HA 2BNOA 3RMYA 1NCQA 4WM7C 3NAPB 4YM1A 4OQ9A 4WM8A 1REEA 3WY6A 4EN7B 3MIDA 5T5LA 2C4XA 4NPMA 1LHVA 1AHSA 1GMMA 1Z7S3 3LSDA 1NCQC 5IT6A 1KFUL 3HNYM 2VECA 4CDXA 5H9RA 1FAYA 1QJZA 1W8ZA 1WLWA 5A7SA 4BK5A 1PGW2 5KHJA 2B46X 1C8M3 1MZ5A 1KXGA 5SV8A 1X7NA 2OUHA 3HT2A 2W9XA 3N9LA 4Q5OA 5FZDA 3U07A 2ORZA 2XDVA 1JU3A 1XNAA 4UFKA 5LA1A 3WF1A 5DUUA 3FMGA 2FBEA 2YXSA 1GFF2 3M7AA 1CD3G 4LE3A 4CDUB 3LDBA 1W03A 2HJIA 1JW6A 5J96B 3LZZA 1JYTA 3Q8EA
chains in the Genus database with same CATH topology
1PIV2 1VBE3 3WUDA 1ULDA 4ZKTB 1W6QB 5DDJ1 3O12A 4TLFA 3ZIWA 2E6VA 2GH2A 3AKSA 5KHKA 1OQDA 1WD4A 3D4KA 4UBGA 3R4SA 4HMZA 2I45A 2XJTA 4S2FA 2R071 4R52A 2MEV3 3AP7A 4Q0VA 3ZXFA 1S0GA 4RS5A 3AMMA 4DRRA 1SLLA 3AMNA 4P9IA 1DYKA 2X5IC 2DTWA 3LOBA 5C4WA 5L7OC 1C5IA 1OSGA 3LA3A 2IXKA 1QJY3 3O0XA 3A4UA 2V73A 2GMPA 4AF9A 3I59B 3USSA 4YM0A 1QKQA 4QGNA 4EN6B 1WCDJ 1KDKA 5JLVA 4FP3A 4FPFA 4M00A 4AHZA 4GQ7A 4KBBA 1FATA 3ZMOA 1ASJ3 3WVJA 4DOUA 1JYIA 1O5UA 3FFZA 3RDIA 2H0VA 3DL3A 1GZ9A 1IHMA 5FDBA 1POV3 1ALYA 4I02A 1O91A 1PZ8A 3A0KA 4WM8C 5GLTA 5C9AA 4LA3A 1AZDA 1LHOA 3MDPA 5F6LB 3BTAA 3S7EA 1MEC2 3ZSJA 1NA1A 3MW4A 2ZGMA 4RQPA 1PVC1 3NVCA 3IIAA 1GQHA 3IDBB 4JGYC 5J48A 3UJOA 5JZGB 2QDRA 2ZMNA 3JU9A 4FQ4A 5F1RA 1NLRA 5C8CC 3ASIA 4CP0A 1C28A 4D94A 1YUDA 2XHKA 5FPXA 4MH0E 4YFWA 1VBB2 5CA6A 5KHIA 4HVQA 2ZX2A 1X50A 4I2OA 2P3KA 2TNFA 4BLJA 1O4TA 3SITA 4LBQD 1COV1 4C0HA 1UX6A 5KC6A 1CGPA 2D6LX 2D3PA 3I4IA 3BOWA 3WG1A 3VBUB 3HR9A 2XVKA 5CNAA 2WS93 4PQ9A 2TEPA 2DTYA 3VDDC 1LKNA 3VBFC 4HKOA 1AUYA 3N7LA 2DUPA 5AC91 1HRI2 1H1MA 2ZX4A 5FREA 4E4DX 2E7QA 1JHNA 2VNGA 5DUWA 2W68A 3ZVXA 5KWRA 4B4PA 1W6PB 2B8MA 3KCXA 1AYN3 2VQAA 2ZPXA 2E7TA 1BXHA 1UL9A 1S0IA 2RR13 1W6PA 2HKXA 3ACLA 1XU1A 4INDA 5JSPA 3BU7A 4PLMA 5EXOA 1PIV1 4MX3A 4R4ZA 1RL3A 5A33A 2GN3A 1LULA 4AFBA 2ATFA 4IV3B 3MGUA 5C8CB 2BTVC 4OI1A 2VUJA 4YZ1A 1R1ZA 2A7AA 1EAH1 2RM22 4M3CA 3UJQA 2WNUB 2VH9A 4BHPA 5BV6A 3AKTA 4URTA 1MQTA 4FOYA 5E16A 3AYAA 2R072 1C1FA 5IK8A 2DUOA 3N3HA 5FAXA 5I93A 4IQPA 4I3PA 1LU2A 2LM3A 1GR3A 3NJZA 3TYJA 4BYYA 2D97A 2ZX3A 3H9AA 3URFA 2VW2A 3N7KA 5CFCC 3LGRA 2N7GA 4AFCA 4XEZA 2Z69A 1SDWA 3MIGA 1RUD1 3SNMA 4RS5B 1Y3TA 2GNBA 3O7OA 3BOPA 2GC3A 1V9U3 3ZXDA 1EYBA 4XBLA 1ULCA 2HEYF 4M0NA 1KFXL 4OVEA 1A8MA 4JAAA 4HL0A 4XF3A 1RUG3 5D1IA 2DFBA 3MYXA 2K0GA 2OIIA 4K9SA 5B2GB 3VL9A 3VBRB 2WFF1 4Q0PA 3I59A 3RS6A 1HIXA 2WKKA 4E2SA 4IEWA 1DQ1A 1W0OA 4B8EA 1PVC2 3MZHA 1TMF1 1YFWA 4XIKA 1S0EA 2YGMA 1LU1A 1QXJA 3J9SA 4XJUA 1JXNA 3EHKA 5KHHA 4DQAA 5KC5A 2CNAA 5FO9B 3BB6A 4PLNA 4IL7A 1DQ2A 3ZXJA 5K0UA 3WW4A 5FQ0B 4L2NA 4Q4W2 5J7MA 2WT2A 4PDWA 5BYNA 4LT5A 1IQAA 2HWE3 1RB8G 3MF6A 4X6RB 2A3XA 2B45X 1RHI1 5F6KA 2CL2A 3ME2A 3WHTA 4EN8B 3ZSEA 3B00A 3M8LA 4LBKA 3S7IA 3U11A 1MACA 1VALA 2ZGSA 4ZU7A 2EA7A 2TBVA 4HLTA 1ULGA 4RL7A 5J3UA 2GAUA 3RMXA 1ND2A 4WZCA 1IS6A 5CADA 4GH4C 5DUVA 2RS31 3ZYIB 5I0RA 1W6OB 4QQLA 3HD8B 4GMP3 3NV4A 3IM0A 4Z2WA 1LODA 2VNRA 3PJQA 5CFDB 1MS5A 2XLAA 3RYRA 4FPGA 4N7UA 2JDZA 4YZ5A 4YVSA 2BVVA 2WNUA 2YV8A 1AX1A 1MS9A 4XQWA 1WCSA 4AYUA 1FX5A 1QJU2 3PLQA 2DU0A 3V56A 2GN7A 2ZACA 1CN1A 1M06G 1UU6A 5KXCA 4IETA 3ETQA 1AVBA 3VDDA 2HWF3 2JICA 1NCRB 5JDBA 5FMOS 1NCRA 4RD7A 5J36A 5IK4A 3OY8B 3VBSA 2ET1A 4DPNA 4ZXKA 1X8MA 1VIWB 1HV0A 2H6CA 2WLQA 2AR6A 5GALA 3VKNA 4XXAA 2AZ5A 1N3OA 3C2UA 3L9JT 4GULA 1CX4A 3IPVA 4RS5C 2FZ1A 4LO6B 5T5PA 5FOJB 1U0AA 2Y0IA 2QJVA 4YW1A 2RHPA 1AR62 1CPMA 1ZBE2 4B4RA 1ZRRA 3S30A 3AZZA 1XNCA 1GLHA 2RS53 1ZX5A 3IPVB 5JMCA 2RS12 2O1QA 3QCWA 4C90A 3ZXEA 1OI6A 1I3HA 1Q56A 1RUI3 1C1LA 4RFT0 4IEZA 2HWF1 3WP4A 1ZZ9A 2D44A 4CDXC 1W0PA 3AP5A 1ZZCA 1MS4A 2YUEA 3ZFGB 5EYYA 2EXKA 3ZYPA 3POSA 3N7MA 1PGW1 1IS5A 4D7SA 2A6XA 1CIWA 1B35B 3MIFA 1V00A 4AFDA 4D7YA 2WJSA 1HXS1 1Q3EA 4GB33 5JVVA 2HWB3 2OZ6A 3KLSA 2YC0A 1UPIA 5K0UB 1HKDA 5AC93 3I7DA 4ITCA 4AI3A 2A6ZA 2R6QA 5GLVA 1M4WA 2RMU3 2BNNA 4XQ4A 4H14A 1YRZA 2GALA 5T50A 2R063 1F5FA 4AE2A 1D0HA 3IDCB 3JBG1 4OI4A 1G9BA 1DYPA 4E9KA 5C4WC 1TME1 4AVTA 5C9AB 3CJIB 1W2UA 2JG9C 2A3WA 3QBQA 5K8SA 1QXRA 4YZ2A 4XXPA 1DGRN 3IN9A 1X36A 2Q0AA 4Y26A 5FPZA 1UAIA 4LHNA 4COUA 3CJIA 4BIOA 1H8TC 4LBLA 2ZMKA 5BNOB 3DN7A 3GBWA 2W52A 2ENRA 4TSVA 4LHKA 1PK6B 1R081 3MW3A 3X29B 2EXJA 2DCKA 3KT7A 5DZFA 1QQP1 1BEV3 3H7YA 3TN93 4NPRA 4DB5A 4XTPA 2AENA 3ZSLA 2RJKA 4EN0A 4TWTA 4OZXA 3O5SA 2QKDA 3B9CA 5T5OA 5E1RA 1U5ZA 5JWPA 3HQXA 3U0ZA 3VKMA 2Z5WA 4OUMA 4M3CB 3WCSA 4Y20B 3AKRA 2XUMA 1HX6A 4LULA 4Y20A 1UN1A 4OHXA 4FQZA 4AVBA 2ZBJA 1DGWA 2XJUA 1W6MB 1LEMA 1HQWA 4QHBA 4GH4A 1QJX1 1RUG1 1FOD1 1R093 3I2DA 1GQGA 1FOD2 1RUH1 1F2NA 4OHZA 1FV2A 2WNEA 1SLIA 1RUJ1 4Y22A 2CWSA 4P9WA 4LUKA 4OHVA 2IFRA 4BLIA 1I6XA 2WFF3 2VVFA 4XHBA 2E53A 3TN92 4R9DA 5JZGC 4CDQB 4A2UA 4WVWA 4DFSA 3IDEA 5CFCA 1EPWA 3AP9A 1J3PA 1QDCA 3KS7A 3GZAA 2DURA 1OHFA 4XJ8A 3UKVA 3OY8A 3VBSB 4WZFA 4CEWA 4HPKA 2R0HA 4N9IA 4MGZE 3J8F3 4FPLA 1FMD2 1T6GC 1EAH2 2QCSB 3JD73 1YJKA 3C3VA 3FE5A 1SFYA 4GKYA 1VAKA 5SV5A 1H1IA 5L36A 1YIFA 5J37A 3SXWA 1FPN2 2NLRA 1A8DA 3DV8A 5JI7A 2VGDA 4QXKA 2Q1MA 1VB2A 3B9IA 4J1WA 3KM5A 2ZGNA 5LK5A 2PHTA 3VKLA 1KJRA 2BGCA 2GDFA 4GXLA 4GKXA 4X8NA 4CP1A 1DGRA 4KWLA 1O4ZA 4M3CF 4EROA 3OD4A 2RMU2 3VZJA 5I8SA 1AJOA 1ULEA 1VB4A 4WVMB 4Y4YA 3VKOA 5BNOC 2HWC2 4H7LA 2GNMA 3VBHB 3WDVA 4I0WB 2WA3A 1D4M1 4QPIA 2D3RA 4MSVA 2R1BA 4LR4A 5EJ3A 4KGQA 5GZGA 1CJDA 4XFBA 4ES8A 4C1XA 4IEUA 4LNVA 2D7FA 4YGDA 1MS8A 4B29A 4N43A 1YIPA 1CAUA 2FMYA 2A3YA 3JBG3 5DG2A 5GZEA 1HRV3 1DZRA 1VAVA 1PO13 2ZKLA 2ZX1A 4JRAA 1RUI1 1SACA 4R4XA 2Q4SA 4WVMA 3R0RA 1RUI2 3WX5A 2PLV2 1UKGA 1IS4A 4FTSA 3WLUA 1ZRFA 2RS52 4RA0A 4YGCA 1RUD2 3MFCA 2IXHA 5JZGA 4Q4X1 4JGYA 3INAA 2P37A 1PO21 4COWA 5A3LA 1Y9QA 2VQ0A 4A7ZA 1O4YA 2Y26A 4S2HA 4IV1A 3NWKA 3O0WA 4DNYA 3HBZA 3VBHC 4LO5B 5T55A 2WA4A 3B94A 3IMNA 3OGJA 4IV3C 1QOOA 5LK7B 1RUF3 2GMEA 4OHYA 1BVVA 3DPRB 4COYA 4LE4A 2UWBA 4BMEA 4L99A 2DVDA 3MLLA 2DVBA 1EY2A 1E57A 5CFCB 3HN1A 1QJU3 1PO22 2BQPA 4Q27A 2D5HA 2VULA 4QMAA 2P3IA 2AREA 2WNVB 5I0SA 3ZFFA 1G86A 1X82A 2ZJCA 1WMDA 1K5MB 5ACA1 1G9FA 1K5MC 2MEV1 1COV2 1POV1 5TSWA 1ZBE1 3ECQA 2OW4A 3WP6A 2R30A 4RR3B 4QQOA 4AGRA 3WOGA 1QJU1 3ZYRA 2C9AA 2ZAHA 4FXKB 1K5MA 4AQ6A 1LENA 1R1A2 3TRSB 5C8WA 1O3SA 3N7JA 1URXA 1GZWB 3NSTA 1IZ3A 4YSFA 4COVA 2DF7A 2ZOEB 3MLJA 5JPNB 5JCTA 1MR5A 4JC1A 3V64A 1N1YA 4S2GA 2JE7A 3AKPA 3CNAA 2JG8C 3AJYA 4S2DA 4BZ4A 1VBD3 1IOAA 2GH8A 4M01A 3GF6A 1UMZA 2VU9A 1EV13 2BYVE 5EWSA 2A5ZA 4Q4V3 4QX5A 4CZSA 1RUOA 1DBNA 3USUB 2JG8A 3OJBA 5JR7B 2ETEA 3ST7A 3W59A 4E2GA 3QH6A 4N53C 5DDJ3 2ZGRA 1PVC3 2OA2A 4EN9B 2I07B 1RUF2 4E4SA 1Q8VA 4FXGB 1XRUA 1YCIA 4PJYA 1PM7A 3JCIA 2XVGA 2PN5A 2JENA 3KT1A 1QOSA 4UXAA 1JH5A 4AHXA 4AI2A 2ET7A 3AYDA 1Q8PA 1RUG2 1IKPA 5HI0A 3VBOA 1BK1A 4OUSA 4HZFA 3GHNA 2NMNA 4XPVA 3WCRA 4XFFA 2NQYA 3B69A 4MVTA 1HXS2 2H0BA 5IK5A 1YFUA 1RUD3 4P9XA 2H6BA 2BFUL 2PHDA 1ZM1A 4TYSA 2IXJA 1ND3C 3ROUA 1AJKA 2PLV3 3E5UA 4JRLA 3OYWA 1S55A 2OYZA 1YWKA 2ZS6B 5ABJB 2XBO3 4N43B 1EPZA 1CVNA 3MIBA 1FNYA 3JBG2 4JDNA 3Q9OA 2D6NA 3TNPB 3SCFA 2VOWA 3JB4C 2RM21 4FOVA 4FT8A 1EV12 4YYOA 1NQJA 4W65A 3VHNA 2XB6C 3NW4A 2A75A 1KD7A 2DVAA 4Y22B 3HIFA 1VBD2 5JOYA 2Q8OA 4NVPA 1WW7A 4JGZB 4EJRA 4EWEA 4QPGA 3JD71 1U12A 3SH3A 4QGLA 1AF9A 1Q5OA 3M1HA 1N1VA 1QH6A 1ULFA 4IEXA 2EAAA 4PF5A 3N36A 1YNAA 3PVBB 4MXWB 1APNA 3ZSKA 1OQEA 4XBQA 3SH5A 1DQ6A 4XIOA 3ZFGC 4XJWA 4TZDA 1R1A3 4FOQA 2RR12 4CEWB 2MHFA 3PVNA 3ZN4A 5D8AC 1V6OA 3PVOA 4JDMA 4F7ZA 5JOZA 5K9YA 3H50A 1J58A 1O7FA 2EIGA 5KHGA 4Q0UA 1MZ6A 2BUKA 1XNBA 4XJAA 4JTNA 4LTAA 4P14A 4XF4A 4YVSB 2RJLA 1EAH3 3JD72 1GSLA 2ES3A 4IERA 3J8F2 1HDKA 2WS92 1QJY1 3M2MA 4K7JA 5C33A 4LLFA 3ZXLA 3AMHA 3J8F1 4AWDA 3R6SA 1CPNA 2PQQA 4CDUC 3VZOA 2WNVA 5K0UC 2XKPA 4KL1A 1VBC1 2YDEA 1JYCA 2X29A 4B3NA 1GZWA 4XMAA 4O9EA 2UYAA 3PNAA 2WC2A 3NO8A 1QJX3 1QF3A 1IKQA 4GA9A 1AL22 2QUOA 4L92A 3PJYA 4XILA 4YGEA 3M3CA 3JB8A 1AR91 2JXAA 5L73A 5IK7A 1N1TA 3VBUC 4XFIA 3AX4A 1MEC3 1ZBA1 1SLTA 5FBZA 2ILMA 3RYKA 4YZ4A 1G9CA 1ZVFA 1WD3A 3B01A 4QQHA 1LOCA 3RZZA 3DPRC 3IKWA 5JOWA 1MS1A 4IV1C 1RUH2 3A0NA 4KH9A 2PYTA 1C8M1 2DWRA 2VW1A 3NKGA 3ZX7A 1OOPA 3RSJA 2PAEA 4QQ2A 1CJPA 2GMMA 3VBRC 3D6EA 3WV6A 1PO12 1ASJ2 3CJIC 1HRV2 1BEV2 3W9AA 5FO8B 5I8YA 1RMU3 5HXVA 3ZYGA 3H1WA 4HKWA 3B3QE 2UY9A 3NL1A 1B35A 2E9QA