3BVCA

Crystal structure of uncharacterized protein ism_01780 from roseovarius nubinhibens ism
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
203
structure length
203
Chain Sequence
SLSLFVTRLYHAPLSDHGPAIDAEEMESSCYAIAEDDEAGQGWCEENGYPGYTSYASLTDLPWRFPIFADLVKSLDAHVAAFAEDLEFDLDGRALELEDLWINILPEGGSHASHIHPHSVISGTTYVSMPGGTSALKLEDPRHAMMMAAPARRKTARDELRQFIYVTPAVGDVLLWESWLRHEVPMNMSEDDRISVSFNYRWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein Ism_01780
publication title Crystal structure of an uncharacterized protein Ism_01780 from Roseovarius nubinhibens.
rcsb
source organism Roseovarius nubinhibens
total genus 44
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13759 2OG-FeII_Oxy_5 Putative 2OG-Fe(II) oxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3bvcA01
4NMIA 3KT7A 5A3UA 5LBCA 3EMRA 3MGUA 4Q5OA 4Y5SA 4ZPIA 2JIGA 5EQUA 4JZRA 5DAQA 4NHXA 2HBTA 3GJBA 4XC9A 3OBZA 5IATA 4NHYA 5DAXA 5LA9A 5EP9A 2V4AA 2A1XA 5IAVA 3HQRA 4NHKA 4XCAA 4KBZA 2JIJA 4IW3A 3ITQA 3HQUA 3PL0A 4XABA 5LBBA 3OUIA 3NNJA 3KT1A 3NNMA 4XCBA 5HV0A 5LB6A 2HBUA 3NNFA 4ZONA 3GJAA 5C5UA 5LBFA 3OUHA 5C5TA 2RDNA 5DAPA 4XACA 3W20A 4UWDA 5DAVA 4BQYA 3DKQA 2RG4A 2RDRA 5M0TA 2Y34A 5LATA 2FCTA 2Y33A 3GZEA 4NHLA 2RDQA 5EPAA 5LASA 2RDSA 3W21A 5LBEA 4J25A 2G1MA 4Y5TA 5IAXA 4BQWA 2OPWA 5L9VA 3KT4A 2FCVA 4NAOA 2G19A 4BQXA 4MHRA 3OUJA 2FCUA 5HV4A 4XAAA 4NHMA 5L9RA 3NNLA 5L9BA 3BVCA 5ERLA 5DAWA 4MHUA
chains in the Genus database with same CATH superfamily
1RXGA 2WQZC 2QKDA 3B3QE 1OA3A 3JCIA 2WLPA 3D0JA 4PBPA 2FD8A 2VJXA 4YVWC 4IETA 3WEZA 5F6KA 3SH4A 1I1EA 3H1YA 3KCCA 4OZOA 3T0BA 4CP9B 3FFZA 1OVSA 4QX5A 3KF5A 3VZNA 3IIAA 4EN9B 2PTMA 3SH5A 2DU0A 1QXPA 2MPFA 2DUQA 3RI8A 2OX0A 1LESA 4I3GA 3I97A 1C4RA 5DABA 1OLQA 1TQ5A 1MZFA 2VZPA 4TXWA 2C24A 3AJYA 3NAPC 1DGWA 2IFWA 2QZ3A 2B39A 2VTFA 4JCKA 3I59A 1NAEA 2OZ6A 4QQ2A 3WQ0A 4AVVA 3OGRA 4AZZA 3O1UA 5E88A 1YFUA 1LOBA 2XHKA 1HQWA 1FV3A 5FQ0B 3SXWA 3VLBB 1BVP1 1RGSA 4NAMA 3AP9A 1O4ZA 4IV1B 3PL0A 4OVEA 3ZYHA 4XABA 4URTA 1LKNA 2BDRA 2DV9A 4NRPA 3OPZA 1GQHA 2HWC2 2PLV3 5HCHA 1V9U2 2VD7A 3SCFA 1UX6A 2R073 1LHUA 3URFA 4LNVA 1HRI2 1HRV1 4IEVA 2JECA 5F6LB 5FJHA 1WW4A 2AREA 2Q8OA 3T1MA 1UWWA 3N9LA 4RD7A 2EXKA 5JSPA 4NIGA 3J8F3 3IDBB 3N3HA 1V6KA 1RUE2 1OH3A 2RR13 1PNGA 1UXXX 3NNFA 4GMP0 5F3CA 1URXA 4MSVA 5FP9A 2XKOA 3MICA 3RMYA 5LBFA 1AJKA 4Q4Y1 4YVWA 4JGYC 3HN1A 4CCCA 4LEJA 4LT5A 2G9FA 1YIFA 1R093 2WO7A 3TBDA 1AVBA 3FE5A 3RQ0A 2WT0A 1K5JA 1VBA1 2R6QA 3N7JA 1UKGA 1Q43A 2GSYA 2JWPA 1D2SA 1SLIA 5FYMA 1GP4A 1OKOA 1OSGA 4QM8A 1ST8A 1IG3A 3M4FA 3ZXJA 2Y33A 4RA0A 3RWKX 3NAPA 4WVMB 1EUUA 1APNA 2HJIA 5ANQA 3W21A 4ASKA 5EIYB 4C0BA 1SZBA 4KU8A 3OY8A 1UIKA 1UX7A 3FBMA 5FO7B 1N1VA 4LBNA 4Z2AA 1VRH3 1TZOA 5CBLA 4QB1A 1BYHA 2WFF1 3I3QA 4AAXA 4XXPA 3RNSA 3DEMA 2VM9A 1QJY3 1YEWA 2Z79A 4OHVA 5JSOA 2WS92 3D5OA 4XF1A 2GC0A 4DIQA 1PGSA 1EAH2 4MLOA 4QB6A 1WD3A 1DF0A 4R9CA 4AI9A 1QJU1 3WQBA 4A6SA 3HT2A 4XFBA 2VVDA 4R8HA 2GAUA 1ZREA 4NWVA 4RGKA 2VVEA 3HNBM 4R9DA 2PELA 3O0XA 1SLBA 1HQNA 2XMLA 5CYYA 1RUI2 2VPVA 4QXKA 1JI6A 2A3XA 3FX3A 1LGCA 3PUAA 5EFUA 2AGSA 4HLTA 1GWMA 1N1TA 1QNWA 5FUIA 3SISA 1QXJA 3B94A 1SBDA 2H0BA 3MIDA 5EV7A 2PA7A 2V4VA 4W6XA 5JWPA 3C7EA 5C6CA 2Y26A 4RR3B 1QEXA 5JPMB 4YG6A 1HXS3 1W2OA 5FPAA 3IMNA 5C3RA 1XJAA 3ZXKA 3IT8A 2Y6KA 4AFMA 3ZXEA 1OF4A 4CEYA 1XBFA 5FP4A 5C33A 5C71A 2BYVE 5A7WA 1J3RA 3IN9A 3C8XA 3SH3A 1FPN3 1STMA 3J7LA 4LLFA 3VB9A 2BWCA 2Y6JA 1W8ZA 1ASJ1 2DYCA 2WAAA 4XFHA 3BN6A 1LODA 2V4AA 3VHRA 3BIWE 1MVQA 1RJ7A 1W6QA 3EB7A 5EJ1B 4AVAA 4EROA 4W4ZA 5FMCA 3VD9A 1S0JA 4GQ7A 1WA4A 3WNXA 1H2MA 3HQRA 3GYDA 5FXWA 4RN5A 1ND3B 2ZOEB 1VBC1 3IIIA 5IW0A 3BYWA 1RVF2 4IEWA 2D3PA 2QJVA 5F7UA 1UYZA 2F4PA 5FBZA 2QCSB 4AEJA 1W6NA 2XJUA 2WYFA 3FLTA 4Y20A 2AEYA 1ZVFA 4CP0A 4BLJA 1JYTA 1KXGA 4A3ZA 4ATFA 2MHFA 3O14A 3NNJA 4QQOA 4QXBA 3ACHA 3N7LA 2PXJA 3POWA 4COUA 3BOPA 4IE5A 2RJ2A 3WF0A 3KF3A 2WZEA 5FZ1A 2XJPA 3WP4A 4FPFA 2CU5A 4CU9A 2RM22 1GBGA 2D43A 4YW7A 4QU2A 2WL1A 2JD9A 1OI6A 2YY1A 1FT9A 1YJLA 3D4KA 3L9JT 4GAZA 4K3UA 1RMU2 4Y24A 2X8KA 2DFCA 1RITA 3W5MA 3THPA 4AEDC 5IVVA 5C5TA 3ACLA 2IC1A 2YV8A 4N43B 1MS4A 1HJGA 5FUPA 2HWD1 3ZOIA 5FTTC 4R4ZA 2OYZA 4CEWA 5JPNB 1IOAA 2OT7A 1W05A 2D40A 5FK8A 1LJ7A 1VBB1 2BGCA 5T50A 3VBRC 1TMF3 1W6PA 4CDWB 3N4MA 1QJX1 5M0TA 2PHDA 3VBUC 3S0MA 2BFUS 3VKNA 3I2HA 3KHBA 2DURA 5DUUA 1QMJA 3B7MA 2Y6LA 4LO6B 5DPNA 1BMV1 4CDQA 3U37A 4D6QA 1JZ7A 4Q4V2 2HWE1 2C6SA 2VECA 5LEJA 1F31A 4BIFA 5A6ZA 2QVSB 1A8MA 1NKGA 3B00A 4FPOB 5A3LA 1D0GA 2B7YA 3OBRA 3OYWB 2VW0A 1NXMA 2QQOA 4N7IA 5CKMA 4GH4A 1MR5A 2XBO1 4PBOA 4QKDA 3SLIA 1J59A 1CAXB 1H9PA 2G19A 2DFBA 3LPGA 1BEV2 1RUC1 2QQVA 3AC0A 2SBAA 3PU8A 4BK5A 4CE8A 1IG0A 1S1AA 2RS31 1ND2A 4AOCA 5FXXA 4XOGA 4QHBA 2XXZA 1UIJA 3WNLA 5LA0A 3IPVB 1W2UA 5CNAA 3T0AA 5T5PA 5K8SA 3O0WA 3ECQA 1EV12 4F3JA 4HKLA 3JBG1 5FUNA 2WZ8A 3POYA 4GWNA 1XYPA 2JKBA 5HCFA 4AEDA 3QBQA 3CIHA 4YW2A 5FY1A 1RUH2 1V6JA 4FPEA 2Q8EA 3TNPB 4C1XA 1QXRA 2WNUC 1ZBE2 1OD5A 1R1ZA 4GB32 1OPOA 2XJVA 1P8JA 4JDMA 4Y33A 1MS8A 2BNMA 3UKNA 2WNVC 3VD4A 3PTYA 4LK7A 1OQ1A 4M0HA 5FPLA 4EWDA 4K1YA 1O4TA 4FBFA 5DAQA 5KHGA 1JUHA 3LOBA 4FPJA 1JBCA 5C4WC 4OI2A 5D2AA 3VBUA 3WDUA 1UU5A 3OBZA 1QIQA 1AR92 1C5IA 1XQNA 2BGPA 3POIA 4FXKB 5J48A 2B46X 1CAVB 2IXKA 1CPMA 5EP9A 4W6YA 3SHRA 4PT6A 2KM2A 3SCGA 4Q0SA 4RFT0 3WCRA 1LOCA 5D1IA 4XURA 1O3RA 3LAGA 3ZYGA 1ULOA 1SMVA 4JGYB 4LHNA 5ACA2 3NV4A 2C9AA 3VN4A 3HNMA 5GZEA 2WQ8A 3TEWA 3JQWA 2FDHA 1SDWA 4AG4A 1K42A 5E8AA 2JDUA 1W6OA 4BDVB 3HQUA 2OQ6A 5F32A 3USSA 3RRDA 2D6MA 3OUIA 4R52A 2JICA 3ILRA 1LU2A 3WNMA 2W0XA 3P3PA 4OULA 2P3YA 3E97A 3VZKA 1ULPA 3K48A 3H9AA 1UZWA 4FP3A 5A32B 1W6QB 4L92A 2NP0A 2NM1A 2VNGA 1F2NA 3I3EA 2PFWA 4PIZA 5FZ7A 3VL9A 4I30A 1AX2A 1LHWA 3AB0A 3PNAA 2XLGA 4CCJA 4ZONA 5FDBA 4XFAA 4M3CB 2Q8DA 5I0DA 4QD2A 3LSEA 3OPTA 4OHXA 2RDNA 4B7EA 4YG3A 1D4VB 1W6NB 4OHZA 1TNFA 5C4WA 3K77A 4GIQA 1DQ4A 2HWC3 2ZEYA 5F1RA 2E7TA 4XVHA 4FTEA 1VBD3 5FZIA 1YYNA 4AF9A 4LBKA 1HRI3 5FMDA 2VW1A 4JTOA 2YBKA 1NOVA 1PO11 2C9KA 3OF1A 3HOBA 3RZHA 1TNRA 3KHCA 5JXJA 2TEPA 3ASIA 3MIGA 3JD71 5LASA 4CCNA 5JAXA 1H4GA 5LWBA 5BYNA 3VKOA 4OI0A 2WWUA 3MFCA 5CISA 2AZ5A 3FMGA 1MACA 2XB6C 4QX3A 4DXZA 3USUB 1C1FA 2BNOA 1UYPA 2DF7A 1XPWA 1AR81 4LIUA 3NJXA 1AXZA 1YJKA 3ENRA 2RMU1 2W1UA 3RYKA 5A7PA 3V64A 4A6OA 5IWFA 3CF6E 3DPRA 5AFEA 1W6PB 3WDYA 5K4LA 2Q5TA 4DXRA 1COV2 1WMXA 2J1RA 2R041 2VG9A 1QQP1 3NV3A 5DDJ2 5G05L 2YBSA 5BNPA 4XAAA 1OC1A 3ZYIB 2WN3A 2YU1A 3NNGA 4YRDA 2XG3A 3W5NA 2JE8A 4AI2A 2VXJA 3PHMA 4C0HA 4EZ4A 1J1LA 2AENA 4RL7A 4XUNA 5T55A 1S55A 3FHAA 4AVCA 5AC91 3RDIA 1AYN1 3VZLA 4V2VA 3ZO0B 5C8CB 3T08A 4ZXKA 2VZVA 4HVOA 4BWOA 2WS93 2WIIB 2R30A 4HL0A 1YHFA 3ZSMA 5IVEA 4OMDA 5GZFA 4DO0A 5BNOC 1LAJA 1ASJ2 1NCQC 2ARAA 3WNNA 1X33A 2XVLA 4YM0A 5I8YA 3LFMA 3RYRA 3ZFFC 4B29A 1GKBA 3NWKA 3D3AA 3HN3A 1EPZA 4H7LA 3ELNA 3KGLA 3OSDA 4AEDB 3OOXA 4MYEA 4XTMA 3ALQA 1OOPC 2K0GA 1BKZA 3TNQA 1AXKA 2KR2A 4YGCA 1H9WA 3K75B 4ZHNA 3VBRB 3ZFGC 1RL3A 1UZZA 3P6BA 2ZHKA 2P2KA 2BTVC 1GUIA 1O5LA 1POQA 3VBUB 2VZSA 5FZ9A 2EAAA 2RS12 1X9TA 4LBQD 1W3VA 3ZN6A 4Z92B 2BWAA 2ERFA 1KGYA 5KHJA 5CFCC 3FHIB 1C8M1 3U11A 2Z2SB 3JXSA 3RS6A 3RMXA 1OURA 1VMJA 5LCWL 3ZR6A 1ENSA 3HPNA 1W9WA 3EYPA 4P00B 2ZGPA 4E4ZA 4CXXA 4QPGA 1J1TA 2XONA 2ZGMA 4LR4A 2X09A 3GCWA 3PMEA 1LTEA 3A21A 1NUKA 5DAPA 2A3WA 5CADA 3LEIA 2ET7A 1RUF1 3HR9A 3PIGA 1W6OB 3OG2A 4TLFA 4TZDA 1JTZX 5E89A 1DCSA 2YDEA 1JH5A 3NQHA 4MGIE 4WM7B 1ULCA 3QCWA 5FZ6A 1NCQA 5EHDA 3VBOC 3EHKA 4R9AA 3CZJA 1W9FA 3ILNA 5GLVA 4NHLA 1A6CA 2RDQA 1ONAA 2KD7A 2IUWA 2RM23 4Q1RA 3DYPA 2WKKA 3QLQA 2EALA 1I5ZA 4FFHA 2OIIA 4X6RB 4BQ4A 5JI9A 4KWKA 1RMU3 2WNUB 1OOPA 1RUJ3 1SG3A 1W0PA 1JMUB 4NRQA 3BIEA 2ATFA 3FLPA 1XE8A 3EBRA 2WNVB 3UESA 1ODMA 2OPWA 3AMPA 2J1SA 2XBO2 4CUBA 5JOWA 3BTXA 4KBBA 4TWTA 3ZFGA 4EN6B 1RUC2 4BIOA 4XXAA 5C4WB 4IEXA 3PVEA 4QAWA 4FPLA 3FUOA 1H4HA 5F5IA 3WQ7A 1G9AA 3AVSA 2CAUA 2RS32 1E5HA 1OUXA 2O8QA 2QQLA 3LA7A 2AYHA 3VZJA 1ZBA3 2ZMKA 1Q5OA 1AXYA 4CZSA 2VBPA 1BLZA 4C1WA 2CDOA 3H8RA 2KA3A 1A8DA 1LNSA 3HVDA 1NQDA 4Q4V3 4UI9L 4QHOA 5FJKA 4HVQA 5J37A 5DAWA 3AXEA 1MQTA 5IFPA 3GXUA 4CP1A 5ABJC 2C1FA 1ZA7A 2B9UA 4CXYA 2ORZA 3ZSKA 1UYYA 1PMJX 1JUIA 1JXNA 1DYKA 2Y0IA 5DUXA 1GSLA 5FY5A 5BXXA 1BEV3 2ZGKA 2R0FA 3VD3A 5I93A 3BTYA 5LBCA 3EMRA 2ZEZA 4K1ZA 3VGIA 4BQ2A 4W65A 3VBOA 3NJYA 3MV01 5H9SA 1XNKA 5IK7A 2A6YA 3H8XA 3AFKA 1HV0A 4P9JA 4CTEA 1PZ7A 3VDDC 4FT8A 4YFWA 5CG9A 1TME2 3TN91 3B5LB 5DAXA 1EV13 3ORJA 1KJRA 4XFGA 4AI3A 4Q8LA 5GZGA 1ULFA 4FTSA 4UXAA 1PMIA 2IXIA 4CPBA 4ZKTB 5JZGC 3S7IA 2BERA 3MIFA 4I2OA 1FATA 4GB33 4IV3C 4XPVA 2E53A 3OGJA 4XFIA 5E1RA 4LE4A 1S0DA 2EICA 1G8WA 1ZRRA 4IE4A 5FQ0A 3ITQA 3SKJE 2HWF3 1VPHA 1MEC2 1QGLA 4QPYA 3K3NA 1FAYA 2EIEA 2JDMA 1AR93 4HKOA 4IV1A 3I2IA 4YZ1A 2W95A 5A33B 5LK5A 2XGXA 1WW5A 2VZ1A 5JI7A 5K9YA 1MS5A 2GNBA 5FYZA 3AZYA 4FPKA 4YZ4A 3I49A 5ACA3 2ZGUA 2P5BA 2HBUA 1U5XA 1AR71 4NROA 4LBJA 1HN0A 3ACIA 4P9WA 2XH6A 2E51A 4LQRA 4PQQA 1PO22 1NY71 4BZ4A 1JOBA 4L99A 3LZZA 5FZLA 3WT3A 3M70A 1LOEA 2GN3A 3ZYRA 4BQYA 4CDUB 1CONA 3I8TA 4GD4A 2YG0A 1UOJA 2WZR3 3VDDA 4M01A 3AP4A 3NJZA 2Y60A 3VKMA 2RHPA 1PO12 2WT1A 3BOWA 3M3QA 3R4SA 5F2SA 2DVGA 1WMDA 3ILFA 4QB2A 1D0HA 5FBJA 3PVNA 3NRUA 3JD72 1XNTA 4MGTA 1DGRN 1SLAA 1W2NA 1GOHA 2RDSA 3MUY1 1H8VA 1VBE3 1R081 4R9BA 3VBFC 4WVMA 1ULGA 4KL1A 5F8PA 4Q0VA 3IMMA 2VQAA 4INDA 3I2GA 4JVAA 1PK6C 4XJ9A 1UQXA 3IB3A 4Q29A 3OB8A 3ZXAC 2GZWA 3BPZA 5JLVA 2BOIA 5BNOB 1CR7A 1ND3C 1NCQB 3OPWA 3IWZA 2JD4A 2R042 1UW8A 3CQOA 4IE6A 4YGDA 4QX2A 3KWVA 3ZFFB 1NLRA 4NIIA 1FOD3 1Z7S3 2AH2A 3DXTA 2UWBA 4PF5A 4QX0A 1D4M1 4QPWA 1DIWA 3D0SA 2G4IA 1SLLA 4GALA 4ITCA 2RS53 3KV9A 4YW1A 2VOWA 1S4CA 3H7YA 3DF0A 3IBMA 4LKFA 4IERA 5ERLA 1MVEA 3ZFGB 4ISQA 2XQRA 3D8CA 2Y8KA 3JUUA 2R061 3KT7A 4RR3A 1WLDA 1DZRA 2IXLA 1AR63 4Q5OA 1CJDA 2CHHA 4XUTA 4Y5SA 5EQUA 3T30A 5CFCB 1COV3 4E4DX 5DDJ3 2HBTA 4QXHA 3SCHA 3I2KA 2ZHMA 4XJAA 2DCTA 2XPJA 3CHXA 4FPYA 4NHYA 1UY1A 4HN0A 1UMIA 2XDVA 3VBFA 5FP7A 4CDWC 2CYFA 2VZ3A 1BXHA 2XL7A 4KQ7A 3BUCA 3ZPYA 1OXCA 3AVRA 2JG9C 2VE1A 1RUG3 3OEAA 3H1WA 3WNPA 5C3SA 3ON7A 5CU1A 3GHNA 1CESA 4BB3A 4ES8A 5H9RA 5T52A 2DVDA 1KJLA 3BB6A 1QKQA 1ND3A 1PGW2 2JIJA 1A3KA 1W0NA 3SEPA 1GYKA 3VBOB 3KD4A 3VKFC 5FP3A 2EXJA 2P4EA 3MBWA 2ZKLA 3OGGA 4G4FA 3WHTA 4ET7A 2ZJCA 4JV4A 4L8QA 4SLIA 5F37A 1G9CA 1REDA 2WYSA 1S0IA 1SHWB 2YC2A 1O3TA 4XIOA 4AYUA 2VUAA 1CGPA 3LE0A 3M3IA 4XHXA 3Q9OA 3AP6A 2XVKA 4MXVA 2WLQA 2B45X 1FI2A 4UFKA 1IS4A 3RZKA 1Y7BA 4DXSA 3OTFA 2VMEA 2OKXA 5F9TA 5FYBA 2GMPA 5BY5A 4D8MA 2BZDA 4K9SA 3K2OA 5BNQA 4COZA 1Y9QA 5CVRA 2XR4A 1QWRA 1UZVA 3G6JB 4HPKA 3ZX7A 5F39A 2Y6GA 1AYM1 4ZXEA 3W20A 5KC6A 1GZTA 5L36A 4HONA 5FRAA 4EE2A 4N43A 2RS13 3MYXA 3GNEA 5C3OA 1YFYA 2ET1A 2RDRA 4N9IA 2A5ZA 3A22A 5JOZA 3KV5A 2G9ZA 3LQCA 3P1IA 1UPIA 2A6WA 2JDNA 5DUVA 4CDXC 2Q4SA 5A7SA 3CBNA 1PVC1 4LA3A 4CDWA 5FZHA 3APBA 5ABJB 1OLRA 1V6OA 4OFGA 4QKBA 3R4UA 4Y1XA 4AI1A 5FKBA 3OBTA 4AEKA 2D6PA 1OVPA 1SEFA 4XAEA 3UKTA 3AYAA 4W6WA 3ST7A 2GNTA 2BOJA 3MLLA 4PDWC 4ASMB 1BBT1 3NMBA 4UOJA 2JG8C 4XQWA 5G04L 5FYIA 5L7OC 3V0AA 3BTAA 1LENA 2DU1A 3OYWA 3U78A 5EJ3A 1CIWA 3VDDB 3Q8FA 1H1AA 4RHV2 1CAXA 1S0CA 4EJRA 1JHJA 2PAEA 2X10A 3PUSA 5FZOA 2WZR1 4BH9A 5CEHA 1XRUA 2WQ4A 1W8NA 2RJKA 2Y6HA 3CL1A 3KB5A 3RGBA 2ZMNA 4QM9A 3ZSLA 1QOOA 4FAHA 2LALA 3THDA 4X8PA 1VALA 1ZZ8A 1PNFA 4AQTA 2YHJA 1L7LA 2DCZA 5JZGB 2IXCA 3O1MA 3IPVA 5ANNA 2ZHLA 3ZPOA 2PAKA 3DL3A 2BRTA 3VL8A 4IV3B 3WF1A 3UKVA 1R1A2 4JDNA 2WUHA 2D6LX 2K2SA 2E7AA 2C26A 4QQLA 2OXBA 1AL21 1YI9A 4BJ0A 5HI0A 2BBVA 1DG6A 4IEOA 3WW4A 1ALYA 5IUQA 2D44A 2W91A 3N9OA 1DU3D 1WGPA 3WCSA 1MS3A 2DUOA 1MS9A 3DECA 1OD3A 2GNMA 4XF4A 4ZS3A 3C2UA 3PUHA 2P6CA 5CAZA 4XIKA 4YZ2A 2LS6A 4Q4W2 3M2MA 4S2HA 4CCMA 3ATGA 4ZU4A 3ZDSA 1QOTA 4B4RA 1CAVA 1RUD1 3H42B 5T54A 1IPSA 2NMNA 3WDXA 2W1SA 3Q8EA 4NR1A 1GANA 4K8RB 4Q4X1 5EJZB 2WA4A 1GNZA 2JG8A 1FNZA 4JGYA 2QBXA 2VU9A 4AFAA 2LROA 2GC3A 1W2TA 2MEV2 1IS6A 1U5ZA 2W08A 3KLSA 3TRSB 4CXWA 3N7MA 3HJRA 4CU8A 2HYXA 5I0TA 4GJZA 1AR61 1FV2A 1NX9A 1K3IA 4MH0E 4Z8BA 1IQDC 5LBBA 3N9QA 4DEQA 3K4DA 1HQLA 4Q26A 1TME3 4LKSA 3W9AA 1BCXA 1RHI2 1UKRA 1OLME 3KT1A 2XKPA 3F95A 3J7NA 4AK3A 1DQ5A 3VBFB 1O59A 2XHNA 4B3NA 3KV6A 2WRAA 3LA3A 2DTYA 3CZUA 4ZZ5A 5A32A 1X82A 2F4LA 2VQTA 3S5QA 1PIV2 2QQJA 3A7QA 1E57A 4MGYE 1ZRCA 4LBLA 1EP0A 4UAPA 1UL9A 1PK6B 1NQJA 2C4XA 1RUG1 2VAUA 2Y0OA 2EXIA 1AX1A 2QQKA 1W9TA 2HWB2 2XJQA 5KXDA 1O91A 4XACA 4M3CA 2VTXJ 3C7FA 3AKQA 2ZGOA 4HMZA 5C8CC 1CVNA 4CCDA 4FVVA 5DN2A 4GMP3 1XOYA 1OBNA 3BCWA 1H1MA 1QH6A 4P9XA 4WZCA 3WP3A 4L9BA 2CNAA 2GC1A 1POV0 3J7MA 3PMSA 3RWNA 1T6GC 4JRLA 3IAQA 1JZ2A 3ETPA 1D7PM 1SLCA 3GZEA 1QHDA 4I0WB 4YZ3A 3AMNA 2RJLA 3WG3A 4LLOA 4Z1VA 1V70A 2WDBA 4Y1UA 4G9SB 1AX0A 3A4UA 3S5AA 1NXD1 5FYYA 2EVXA 3RJRA 4EYUA 2YC0A 1SFNA 1PO23 1YQ5A 4HPKB 4C91A 4NO4A 2EIDA 1JYXA 3H3UA 3USUA 1O3SA 4BQXA 2VBDA 2XL9A 1Q8SA 1XYOA 3WV6A 1OFSA 3KM5A 2E9QA 1KDMA 1SPPB 1MZ5A 1W39A 2QQMA 1XE0A 5FCCA 2VZTA 1KD7A 1VB4A 2HEVF 3RI9A 4CU7A 1G9DA 4LO8A 1LHVA 2PLV1 2VQ0A 4E4SA 4CUAA 2JG9B 4QPIB 4HFSA 2R071 5JIAA 1N3PA 4OHWA 4RFRB 5IT6A 1A78A 2CGOA 2NMOA 2EXHA 5IVJA 1US2A 3J8F1 2HEWF 2WO1A 2VMCA 3U07A 4BMEA 2CGPA 4IEYA 2RR11 3GZTB 1FMD2 4BE3A 5C8CA 2R062 3V0AB 4AQ2A 4NMIA 1ZYBA 5A3UA 3RVHA 3WP5A 4A7YA 1REFA 2JIGA 2D6OX 5FAXA 5FK7A 1ZZCA 5FZOB 1CWPA 1GLHA 1R091 2UU8A 2VUDA 3MW2A 4XC9A 2VOVA 2BV4A 4A2UA 5IATA 1WBLA 1OQDA 2VR4A 3HD8B 3K4ZA 4WM7C 5LA9A 1F15A 4DMIA 5FZMA 2ILMA 1WW6A 3POBA 1ENXA 4RQPC 1W2AX 1PM4A 4Y4RA 1I5PA 5BV6A 2BNNA 2QFEA 1GZCA 1F4AA 2LW8A 4YPJA 3AMMA 1V6MA 1YC61 4HK8A 5T5LA 1VRH1 4L97A 1DLCA 1EYBA 2WJSA 4Y1ZA 5A80A 4FSJA 5FO9B 4KWLA 1QJY1 3VBRA 4CDXB 2ZXQA 3A0NA 3I3BA 4HANA 4Z2WA 2WFPA 3MF9A 1QDOA 4LO5B 2XLFA 3PUIA 3M7AA 4J1XA 4B4PA 4GA9A 4CP2A 5CG8A 3GCXA 5F3EA 2O0OA 1AHSA 2VY0A 4JKMA 2E26A 3BU7A 1OH4A 1W06A 3MUZ1 2VMHA 2JXAA 4TN7A 1C3HA 4PDWB 2YMZA 1IKPA 3S30A 2JG8B 5L7OB 4ARYA 3RZJA 4D7SA 2WNEA 4ZS2A 3I4IA 1ACCA 2GN7A 3OUHA 3OD0A 5DAVA 2ZGTA 1FYUA 3CJXA 1HXS1 5FZBA 2H0VA 3SKVA 2VOXA 3T3YA 1JN2P 2BGOA 3J9SA 1ZRDA 3I7DA 3ZYBA 4CU6A 4H55A 4WM7A 4IEQA 2ENRA 5LATA 2F6BA 4PQ9A 2N7GA 1XNBA 2QZ2A 1FPN1 3NV2A 2J1TA 3H3LA 1HRV2 1JZ4A 1G86A 4PHZA 4WM8C 5GLZA 3TEXA 4EWEA 1RUOA 4AE2A 4UFMA 3VBHC 5LBEA 4UF0B 2A7AA 4Y5TA 2HYKA 4BHPA 1HV1A 4JGZB 4AVSA 2BPA2 2WNUA 5KXCA 2JDAA 1W9YA 4Q4Y2 1YFWA 1WLTA 2BQPA 2YGLA 2R0HA 2W1WA 4QQHA 4Y5Z0 2WNVA 3WY6A 5C9AB 2FCVA 4I01A 3SMHA 4Y4YA 3TEYA 5JXHA 1G7YA 3E6CC 4MO3M 1Z0HA 1VBA2 3WNKA 2QNKA 2AUYA 3OUJA 3VZOA 5LRSA 4I0AA 1V9U3 4IESA 3AFGA 1US3A 3ZR5A 5HV4A 3AYEA 1FNYA 2Z69A 1GOFA 1TVGA 1H2KA 3NO8A 2XJTA 3B69A 3D6EA 1JZ6A 3JB8A 3MPPG 4LULA 1RUE3 5KXEA 2I07B 4D7YA 5C3QA 3B93A 3WQ1A 1QNYA 4UFIA 1JYIA 3N36A 5CKNA 5IK4A 4I0BA 1O8SA 1LHOA 4UW6A 2WFF2 3NJVA 3O1SA 2VOTA 2XOMA 2QQIA 3KVAA 1PGL1 1UY3A 4RHV3 4A44A 2ES3A 3T2PA 4LBOA 3KQ4B 4YNIA 4JZRA 4DY3A 1Q8PA 5FZEA 3ZMOA 2D98A 4BXSV 2PQQA 4YM3A 1QJU2 1ZZBA 4XE9A 5DQ0A 5FWJA 4UW4A 4S2DA 4CDUC 5A1AA 1C28A 2P3KA 2VQUA 1W0OA 1MZEA 4Z07A 3MV11 1TMF1 4WM8A 5E6HA 1GP5A 2HKXA 1YCIA 1RUD2 4KGGA 5SV8A 1YO8A 3VDBA 2PQSA 3MPBA 3OEBA 3ZKUA 3JB4C 4UW5A 4F7ZA 5DXDA 4GJYA 3ZSJA 3RG0A 3FFQA 1S2EA 1GICA 1RIRA 2W5FA 2ZAAA 1CZVA 3MW4A 4H2AA 5CIRA 5ISLA 4KH9A 4DUWA 1OA4A 2MNGA 4RSUA 1UXZA 1N47A 4K20A 5LW9A 2B8MA 1EAH3 1GWKA 3A0KA 3LEGA 5GLTA 2VO5A 1G6NA 1H0BA 4PCRA 4Q4W3 2LUWA 4M00A 4CCEA 5C70A 1RUI3 1XC6A 1W6MB 5IJRA 3LDBA 5A33A 2V09A 1JU3A 2I45A 5A3MA 5LY1A 2B9VA 3I2DA 3N9NA 3SQOA 4KGQA 4M0NA 1ZZ6A 2RVAA 1HDKA 2A70A 2DBNA 1VBC2 2MEV3 4E8DA 1YQ6A 1QJFA 1IS3A 2CAVA 2FQPA 5H9PA 1BZWA 3GBFA 3DXUA 4FPGA 1G9FA 4FO9A 1SFPA 4IDZA 3T1LA 3DKQA 1SBEA 3WLUA 1RHI3 3AMQA 3E1F1 4CDUA 5TSWA 2GMEA 5H9QA 3IDAA 5L73A 3THTA 3T4HB 3NSTA 3NKTA 4XZPA 1YQ2A 4ISRA 1GZWA 5FZFA 4HXCA 4PI0A 4Q27A 1PIV3 1SFYA 1W8OA 4CPBD 1RC6A 4HN1A 2CGNA 2VVFA 2D93A 1H8TC 3FC0A 2HH9A 2W3JA 2HWB3 3MLKA 4W8JA 2FDFA 3O1RA 2ZCWA 5JCTA 1RVF3 2A73B 1SBFA 3GBWA 1XE7A 2ZX3A 1MS0A 3KT4A 4TTGA 2EA7A 2HWD2 3TYJA 4META 3LGRA 4YM2A 2UWAA 1UNBA 5J96B 2WA3A 5EWSA 3OGSA 1NA1B 4P14A 5BNOA 2V5DA 1NE4A 1O8PA 1VBB2 3IDEA 3Q8BA 3U75A 1Y9MA 1DGRA 3VHNA 3WDWA 1QJX2 1N3OA 5A3TA 5J3UA 1LEDA 2XLAA 5A6XA 2HEYF 2H6BA 3ZFFA 2R072 5LEKA 4CCOA 2YB7A 4RQPB 3ZIXA 4UBGA 4E2SA 1BMV2 1YLLA 4XEZA 5FXVA 3MFAA 2HWE2 4XYXA 4BOWA 4B8EA 5GALA 4XDQA 2ADDA 2TNFA 2RR12 5FY7A 2GC2A 3G7DA 1LB2A 4S2FA 4Y3OA 2ZA9A 5J09A 2W92A 1ZX5A 1DP0A 4FOQA 1UPSA 1RUNA 3VBSB 2ZX1A 5T3NA 4NHXA 4GWJA 4B1LA 1C8NA 3GJBA 5FZDA 1YXWA 2HWC1 5CFCA 2WNOA 2VNRA 1S0EA 2JX9A 1LRHA 2JKXA 4JKLA 3T2OA 1VBD1 4NOTA 1W90A 1Y9GA 4K7JA 3MF6A 4BU2A 3HMYA 1HRI1 5FPVA 1SCSA 1OHFA 3I2OA 1LOFC 2JB8A 1GNYA 1H8TA 1TE1B 3JBG2 1BVVA 1NCRB 1RINA 1X9PA 4UFJA 1AF9A 4C90A 4HKWA 3LF7A 2YZ4A 4MADA 3ZVXA 1FMD3 1SDDB 3HQXA 3CMGA 4A41A 4XDOA 4XCAA 1VLNA 2XWJB 4QGMA 4SBVA 2WO2A 1ZZ7A 3V0BB 4HG6B 4MV2A 3WVJA 3S6PA 2W1QA 4AI8A 2FHRA 4QKNA 5BNNC 2YPJA 3JZVA 4XQ4A 4Y22B 2WWJA 4WM8B 4JC1A 5FIXA 3O1PA 3VBHB 4AAPA 3WF2A 4GWIA 4XJ8A 4AGRA 3D82A 4E8CA 4LO4B 4A42A 3RZMA 3GALA 1X8MA 2R1BA 1QOSA 2VULA 1DQ0A 3AXDA 3KCYA 4IE0A 1IPKA 5AVPA 1RUH3 3HIFA 4NPRA 1SLTA 4AHXA 4MGQA 3UJOA 1W99A 4AQSA 1ZBE3 5C7GA 3MZHA 4P5YA 4EN8B 4QXCA 4DZGA 1KFXL 2IWGB 1QU0A 2OS2A 1JZ8A 2G9GA 2WS91 5FMBA 5FZKA 2I74A 2A6ZA 5APAA 1UN1A 1U12A 4KWJA 3WG4A 4PIXA 4AGVA 1RTVA 4KG0A 2CV6A 2FCTA 3KZ4C 4FFGA 3POJA 1LOFA 1WCUA 4E2QA 1HB4A 1RUI1 4F8AA 5LY2A 3AKSA 2UURA 5ABJA 5J7MA 1J83A 3DUIA 4XFCA 2VZQA 5FY8A 1GOGA 1MPXA 1XNCA 4B1MA 2OZJA 2VZOA 2PHFA 3ACGA 5FYHA 3RFRA 4P9GA 3BGAA 3PVOA 3BI3A 5EXOA 2WN2A 5FLIA 3L2YA 4WVVA 1LEMA 3I3MA 2A6XA 4BQ5A 2WO3A 3RZLA 3CEWA 3J7HA 3O7OA 4BK4A 2WSVA 4ASLA 1X50A 4QGLA 4ORFA 3RJ2X 1F5FA 5D8AB 2WSUA 1I9RA 2W47A 4XBNA 2X5IC 1GZWB 1HRV3 1KS4A 3ZXDA 3N9MA 4HZFA 3KV4A 5I8SA 2FBEA 2W94A 4XBQA 1W8WA 2W68A 3GZUC 2D3SA 3MHZA 5B2GB 3ROUA 1U5IA 2VBBA 1IGOA 5L9BA 3W58A 3KSCA 5JZGA 2ZZJA 2DCJA 1PZ8A 4IEPA 4IV3A 4IUGA 3EXUA 4FPHA 1AR82 2NZ9A 1IZ3A 1XYNA 3FBYA 4X8NA 1Q8QA 5BUVA 2RMU2 4OMCA 1VBA3 3CU7A 5A6YA 2DVBA 4COVA 4A7ZA 4HETA 1UOBA 4CUCA 3E6DA 1AUYA 4FOWA 4YYOA 4OUEA 4LHKA 5FZ0A 2JDZA 3RPQA 3NKGA 5FYTA 3VHPA 1QQP2 1TMF2 5GZDA 1UY4A 2W39A 5I8TA 1VAKA 3ES4A 2A1XA 3KCXA 3ZLIA 3WXPA 4E9KA 1LOAA 3I2JA 3HWJA 2RM21 4LK6A 4XF9A 4ATEA 5AC92 1AYN2 2WFF3 4XUQA 3ZFEC 2QE3A 1K5MC 2Y6FA 1RMU1 4LE3A 1ENQA 1RUJ1 1BK0A 3E5UA 3DKWA 5DZEA 1WCSA 2PHXA 4G3YC 3GZAA 3LDRA 4H7MA 4YLZA 5IK8A 3H50A 3U4XA 3ZN5A 1T2XA 2Q8CA 1SACA 3ZMNA 5IVCA 5LZ6A 5IK5A 1V6IA 1CAWA 1K45A 1CIYA 3WOGA 1LULA 4YVSC 3NNMA 1VAVA 1ZBA1 4XDPA 5KR7A 1H8TB 4XCBA 1O4YA 2X05A 5F5QA 4BMBA 4PLNA 1PX4A 4Q4V1 4MGKE 4MGZE 1PHMA 3C7OA 3BU0A 4NE9A 4QPIC 2Q1MA 4LOTA 1H2LA 3WR0A 4AHZA 1PK6A 4OUSA 4UT5A 1X8EA 4JTNA 3KQRA 3RZZA 1BEV1 2ZTNA 3QACA 4P02B 1CAUA 1F35A 3AL6A 1J3QA 4N53B 3EJKA 1ASJ3 3J26N 1XSRA 1HIXA 2ETEA 2GP3A 3CLPA 2QTWB 4P08A 2YC4A 2NLRA 5FLJA 3VZMA 1XXNA 2ARBA 4D0QA 1C8M2 4ZY9A 4GXLA 1W9SA 5FYCA 5FY9A 4O9GA 2P1BA 1EV11 1S2KA 5JR7B 1K5MA 1FXZA 3THCA 4KG8A 1UF2C 1O3QA 2LM3A 3T2QA 5IAXA 3GDBA 4N9HA 3UT0A 1JZ3A 3K4AA 1ZBE1 4MOAA 1RUF2 2VNVA 1GU3A 4GB31 3WG2A 3S7EA 4NUBA 5FOJB 4QGNA 3JU9A 4UYBA 1GFF2 2FDIA 1PM7A 1PX3A 2HWF1 1QF3A 2WINB 4LBQB 3IAPA 4LBMA 3N7KA 1SPPA 4YVSA 3T4VA 4YW5A 4EZHA 2XJRA 1OPMA 1AR91 5FYVA 4LUMA 3M3OA 4AFDA 3AP7A 2OA2A 5F3IA 5LA2A 1CZSA 2VH9A 2JG9A 4QPIA 1ODNA 5DMYA 2E6VA 4O9EA 1W04A 2YYOA 3ZXLA 1OMIA 1XNDA 3UETA 3X29B 5ACA1 3FWEA 4A3XA 2HWD3 1Y3TA 1Z78A 2CWSA 2BEOA 2YROA 1I3HA 1Y43B 5BNNB 1W8FA 4XMIA 1VBB3 1PVXA 1O6UA 1QJX3 3LEMA 4W50A 3MIEA 5LA1A 3LDKA 4OCTA 3I54A 3VD7A 4AVTA 1HX6A 1VBD2 3DCQA 4P9YA 5J1XA 4MZUA 3TWIA 3WDTA 3O1OA 4BQ3A 2NYYA 4TLGA 3U1XA 4A4AA 2GMMA 1LR5A 1VAMA 4HK9A 4DB5A 3GHMA 3JQXA 2HWE3 1CJPA 4Y26A 3BALA 1NLQA 4GZ9A 4D3WA 4IQPA 2V72A 5FR3A 5JXIA 1VBE1 2J1EA 4K40A 3E5QA 4IEUA 4NPMA 4YZ5A 4AHWA 2XBO3 1RB8G 4LIVA 3PVBB 1RUC3 4JGZC 2J7MA 1Q8OA 4COWA 4QMAA 2YFUA 2FZ2A 2RS33 4AXOA 3LSDA 4KMQA 4LORA 4LKDA 4UFLA 1U5YA 4DQAA 5C9AC 4CEYC 4URAA 3H7JA 1Y4WA 1SQ4A 3O5SA 3QD6A 1PZ9A 1AL0G 1WMEA 3IDCB 5DUWA 3TN92 4CDXA 5IFTA 2KXLA 3ZN4A 5JSRA 1OKQA 3AKRA 4EN7B 4N7UA 3ACFA 4PI2A 3KVBA 4JKKA 5A7NA 2D97A 1REEA 1EPWA 3JBG3 3ZYJB 1FOD1 1Z7S1 1IPJA 2JJ6A 5K0UC 2Z42A 2VZUA 3INAA 1VJ2A 1D2QA 2A75A 3A23A 1F9KA 4RGAA 5B4XA 1UOFA 3PLQA 5FZ8A 4NIHA 5I0RA 3MIHA 3RSJA 3GJAA 4PDWA 2P3IA 2EF6A 2XUEA 3BTZA 1C1LA 2RS51 2WWSA 5KWRA 5L7OA 2W87A 1LU1A 2VCAA 4Q2FA 4FOVA 3U10A 5I0SA 2XQXA 4XF3A 4FFFA 5K7PA 2P34A 3AZWA 1LOGA 4ZU7A 2X5IB 1WD4A 1KEXA 4FXGB 2IZWA 2BVVA 1CAWB 1COV1 4P9LA 5DDJ1 1J84A 3OD4A 3KS7A 3NVCA 2DUPA 5FZCA 3NL1A 4A45A 2BJSA 3UGFA 4F83A 2Q1ZB 3LB9A 2OVUA 5FMOS 5KBFA 3K46A 4EWAA 4AI0A 1HJFA 5JOYA 4Y1VA 2TBVA 5HCBA 5HXVA 4CCKA 2IVJA 2ZBJA 4COYA 4EV0A 3FZ3A 3ZYFA 1AR72 2CDPA 4UF0A 4AL9A 3LKJA 3O1VA 2X29A 2ZAHA 4JGZA 1NT0A 2P6HA 4BM8A 1NY72 4NWWA 3SITA 1O7FA 4NAOA 3WUDA 3LFIA 4FFIA 1CAUB 1UCXA 5C9AA 1MEC3 5CB7A 3OCPA 4CEWC 2J1VA 2D5HA 2WABA 1ULDA 3FUQA 4FAGA 3H0OA 4OQ9A 3P3NA 5T5OA 1VE0A 2UYBA 3HBKA 4KNCA 4UW3A 2V5YA 4BQ1A 4D6SA 3WF4A 4Q1PA 5K0UA 1MZ6A 5F5AA 1WCKA 4AFCA 1R082 4FI9A 3GM8A 3ZFEB 1K5MB 5FZ4A 3C3VA 4CDQC 1OT5A 1ULEA 2RE9A 4MXWB 4PLOA 1JHNA 3WDVA 2VOKA 2ZABA 3C7GA 2PN5A 1B35C 2PHTA 4QX7A 5JVVA 5IVFA 2ZPXA 4GH4C 3SC7X 1UMZA 3VD5A 2JDHA 1S0BA 4FTBA 4L2NA 3T2TA 4YVSB 3LD8A 2RS11 2ZEWA 1PO13 1ND2C 2A3YA 3LIHA 1H2NA 4LTAA 2B4KA 1IS5A 1OF3A 1EY2A 2ADEA 5FZ3A 3JD73 4V2WA 4YW4A 1D4M2 3AL5A 5FREA 5JR2A 1LGNA 4EQVA 3PTRB 4OLLA 3I59B 2ZX4A 2GALA 1DZQA 4Q0UA 2ZHNA 2E33A 4Q8KA 3R0RA 4KU7A 5HPOA 3WUCA 4IGQA 2CY6A 1RUJ2 1AR83 1DQ6A 2FMYA 1LGBA 3LEKA 2W52A 2GH2A 2UWCA 4QDQA 4DPNA 5C8WA 2RMU3 1UD1A 1DYOA 2Q1FA 2YBPA 1WA6X 3POFA 4CVUA 4H14A 4OYUA 4XHBA 2OUJA 5JMCA 2YPDA 2R043 5IVYA 3WD5A 2GU9A 1I6XA 1QQP3 5FPXA 4QKFA 1YRZA 5SV5A 2VMFA 4XETA 5D21A 1UU6A 5FMOL 2FDJA 1VB2A 1NYWA 1NA1C 1ZBA2 2FMDA 4DRRA 3OBAA 5IVBA 2ZKNA 1W6MA 3DGTA 2ZACA 1GP6A 1ENRA 1CN1A 1SCRA 1X7NA 3K51A 5FP8A 1ZA4A 1AYN3 5AC93 5HV0A 2D6KA 2OQ7A 2B42B 2YGMA 3N35A 1B35A 1UOGA 5EZWA 4LA2A 3PUQA 5FY4A 4YVWB 3Q8AA 1KFUL 3H3ZA 1QH7A 5FKCA 4DOUA 2J42A 1V6LA 2WR9A 3K3OA 1S0GA 5EYYA 1W8UA 1JOPA 2IVIB 2ZZQA 3PIJA 4AR2A 4DRVA 4NN0A 3PU3A 4FPCA 2WAOA 4AFBA 3I3DA 3LWCA 5AVAA 4BISA 2DWRA 3MDPA 1O5UA 4L0PA 2W2IA 2VXRA 3VBSC 5FFOC 3AP5A 3NAPB 3P5BA 1C5HA 3AZXA 1XB9A 1WLWA 3UNPA 4YWAA 4AEMA 2IXHA 1LCLA 5EPAA 2JEMA 1POV3 2QUOA 3OY8B 4UFHA 5L19A 3HBZA 4YW3A 2DVAA 3ZYPA 2G1MA 1JU4A 5AFBA 1GQPA 1W8TA 4E2GA 3O12A 1DGWX 1WMFA 1WBFA 2XJSA 3MIBA 1RJ8A 2AC1A 2QQNA 3AK0A 4AW7A 1HB3A 4BQWA 1NCRC 4FCAA 4U2AA 3E6BA 1NZIA 1AYM2 4LHSA 1HW5A 1KDKA 5A7QA 4DEVA 3AM2A 4OQ8A 3MW3A 4P9IA 3CJIC 4MX3A 1LHNA 1DBNA 1U0AA 2HWF2 2GNDA 2IXJA 2PHWA 1M4WA 5JOXA 4KWUA 4CA9A 1C8M3 1NA1A 4XUOA 1WCQA 2K46A 1AZDA 1W8HA 1WZXA 3OJBA 1TME1 4QT6A 1PVC2 2J1UA 4O7XA 1R64A 3BPSA 5A70A 2AR6A 1ZNPA 2NN8A 2ZMLA 4Z82A 5I91A 4ES9A 3R6SA 3NNLA 4HSJA 2D5FA 4PLMA 4RQPA 5JUVA 2FZ1A 2YFZA 4FP2A 1CZTA 2J1AA 2CSGA 1OUSA 3R4DB 5DZFA 1EUTA 1RUF3 4QX8A 4XZUG 5A3NA 5DG2A 1BBT2 3WHUA 2UYAA 4B7KA 3L2HA 5LRRA 1Q3EA 1GV9A 2SLIA 4CEYB 4RGGA 5A7WB 3V65A 3ZSEA 1MEC1 4S2GA 2BFUL 3DPRC 2ZGQA 4GMP1 1ZZ9A 2WZR2 3VBSA 5FO8B 3B02A 3RZGA 1W3XA 2PMWB 2Y64A 3IZOA 1WUVA 2PHUA 2R7EB 3MO4A 4PF1A 2JDYA 5DZGA 5K0UB 5BNPC 5LK7B 4C8DA 2E32A 2XWBB 4HOOA 4LHLA 4Q0PA 3VKLA 1G9BA 3GGLA 3J4UH 1VBE2 2C0ZA 4AGGA 2DCYA 5A3PA 5IAVA 1NCRA 3WINE 2YXSA 4HT1T 1XU1A 3C7HA 4GKYA 2JE7A 4YM1A 1AL22 3EQEA 3B9IA 4NPLA 1PO21 3CJIA 2VC9A 3POSA 3POEA 1HN1A 4Y20B 4XQDA 2BVBA 4IW3A 3AYCA 3FLRA 5FLHA 5KXBA 3ZIWA 1N1YA 1J58A 2VMDA 3WW3A 4AQ6A 3V0BA 3VDAA 4RS5C 1X36A 5JMOA 2QQPA 5FOBB 5FZAA 3R05A 2VZRA 2IFRA 4U36A 4Y22A 3MLJA 1Q56A 1FOD2 1Z7S2 5D8AC 4JQTA 5F3GA 3VBHA 2D3RA 2E63A 1DFQA 4XBLA 2VUJA 1R1A3 5LB6A 2W46A 1DLLA 4Q4X2 2RS52 4KI5M 4JHTA 5HXMA 1YNAA 3WSOA 4BPZA 2ZEXA 4YARA 3AMHA 4K21A 4CEWB 2OUHA 2PHRA 4CYDA 1JODA 3M3CA 3H8OA 4I09A 3KMHA 1AR62 5CKQA 1YIPA 1XU2A 2JDKA 2X53S 2ZGLA 4OI4A 5GLWA 3TN93 2OW4A 1UZ0A 1GQGA 4IXLA 2A6VA 1NLSA 3H8UA 4PJYA 1UY2A 4CDQB 3GBGA 5EYXA 5GJ6A 3WP6A 2QQWA 1W28A 4K6BA 2VW2A 3MEPA 4WVZA 2DVFA 4GKXA 1B35B 4FQZA 3UV9A 4LUKA 1RUG2 5BPXA 4QPGC 4NJ4A 4GH4B 1F5JA 1WWYA 4DNYA 4JAAA 4EN0A 4OZXA 3AKTA 2VCBA 3WZ1A 4MHRA 3S57A 2CL2A 2BP6A 1ND2B 2UY8A 3UL2A 3Q8CA 4RS5A 2EAKA 4YFZA 1AJOA 1T6BX 1H30A 2BUKA 3BKZA 3UGGA 3N9PA 3GF6A 3M8LA 1JYCA 5D8AA 2UY9A 2DBIA 4NHMA 2LRPA 1ZRIA 1OQEA 3AZVA 4QQPA 4D7TA 4M3CE 5JDBA 5L9RA 1VR3A 4O65A 4PIYA 2W9XA 1AR73 1POV1 4R4XA 2D6NA 1F4HA 1DDLA 3HT1A 3UYJA 1S0FA 4YSFA 2XUMA 1VMFA 1YWKA 3DYMA 3LPFA 1RXFA 2P37A 3LA2A 5GLUA 1PGW1 1RYYA 2ORXA 3MGUA 2VNOA 4K8FA 4BLIA 4D69A 4ZPIA 3VUOA 2CWMA 2ZX2A 4XJWA 2ARXA 2V73A 2P17A 4X6QB 5CFDC 3HAGA 3PJYA 1UYXA 2Q30A 1VRBA 1F8VA 2PLV2 3WG1A 3CO2A 4Y1YA 4N53C 1R083 3O0VA 4NIAA 3T09A 4JQRA 3LCPA 1GZ9A 4QDSA 1JYWA 1S2BA 1N3QA 1MQTC 3OGVA 2FDKA 5A6QA 3J8F2 2WT2A 1DGLA 1PMHX 2GDFA 2O8OA 1OFNA 2R16A 5FYUA 1XNAA 5A3OA 2EIGA 1JW6A 4N8MA 1GWLA 5FYSA 2VTXA 1ZRFA 1HKDA 4KBZA 1N1SA 1IHMA 4E27A 1K12A 2CTVA 1QJZA 4IL7A 4ZU5A 5T5JA 4AVBA 1R092 3AZZA 4V1PA 5FPUA 4RYDA 1VMHA 4YW6A 3H1MA 3WW2A 1CX4A 5KHKA 4ONUA 1V0AA 5FPBA 1V9U1 3QH7A 1D4M3 4JX0A 2AACA 2EIBA 4MVTA 2GH8A 4LJHA 3AJZA 5HCAA 2FDGA 4BCUA 2QDRA 1L7QA 2H6CA 4DXTA 2JENA 4YG0A 4XJZA 2ZGRA 1JZ5A 3ZKYA 4CUGA 1RUE1 4TSVA 3WW1A 5C5UA 2O14A 2R063 4BA6A 3CJIB 4DINB 4UBHA 3B9CA 2WZPP 4DFSA 1VRH2 2DTWA 4UWDA 1GNHA 1H6XA 2YU2A 2YUEA 1LECA 3F2ZA 1JS9A 4XUPA 1QJY2 5E16A 5CFDA 5CZKA 4MG2A 2RG4A 4RHV1 3SNMA 2O1QA 4L11A 4MUVA 2Z5WA 3VDCA 1HLCA 4LO7A 4IV1C 4YGBA 3B01A 4N53A 4LOSA 3U14A 1GMMA 1KS5A 1QDCA 4CSWA 3HNYM 3E5XA 1VP6A 4GWMA 2VMGA 3TOJA 2WC2A 4HVRA 1TEIA 1E5IA 2E7QA 5FV3A 1NG0A 2R1DA 3U0ZA 1R1A1 5GM0A 3ZXFA 4BXFA 2OPKA 2LTNA 1OA2A 4LKEA 4XF0A 2BU9A 3RYPA 2K9ZA 3DPRB 1YUDA 5KHHA 1HXS2 4AWDA 5FWEA 4XFFA 1MS1A 1UO9A 1EAH1 4XTPA 3V56A 2D7FA 4LITA 5FXZA 4CP9A 4DY5A 5BNPB 2L9LA 3DN7A 3DV8A 2DDUA 3FL7A 4LBQA 2NPIA 1FPN2 4OI1A 4Q4W1 4NVPA 4I3PA 5KHIA 2JB4A 4D94A 5GZCA 4O61A 1GR3A 2DCKA 2JDPA 4QHZA 5I0UA 1QJEA 3PDQA 2A71A 5JXGA 4WVWA 1H6YA 2VL4A 3FN9A 3DYOA 2ZX0A 4XILA 1OLMA 3POGA 1AYM3 1A34A 5DG1A 1YI7A 4MHUA 1WCDJ 5IYYA 4M4PA 1ZM1A 4XW3A 2MEV1 2E31A 2WBKA 3AYDA 4NRMA 4DUXA 3O1TA 1BK1A 1BHGA 4RS5B 5F2WA 1UY0A 5CA6A 4ZZ8A 3TAYA 4BYYA 5J98B 5BNNA 2Q0AA 3WX5A 4Q0QA 2PHLA 2VMIA 1YQ8A 1PVC3 3ETQA 3NV1A 1RHI1 4H3WA 4QDRA 4XMAA 4E4HA 5J36A 1KITA 1J3PA 3SEEA 1UU4A 1JYVA 1DZTA 2HLEA 3AX4A 3TEZA 2PYTA 2NQYA 2ZS6B 5B4NA 1DHKB 1Q8VA 3KGZA 3QH6A 3HEIA 1PIV1 3NW4A 1BBT3 1WW7A 4NHKA 3ZXGA 4FOYA 1YQCA 4Q4Y3 3U4SA 4JRAA 3AKPA 2VGDA 1NZCA 5F5CA 2R32A 4I02A 2HWB1 3UGHA 3WF3A 1PGL2 1RVF1 2RV9A 1CD3G 1TG7A 3ME2A 1FX5A 3LIGA 4HBNA 4HSLA 4M4RA 4N90A 4RR3C 3IKWA 3CDZB 4TYSA 3EO6A 4A7KA 1JYNA 4IE7A 5A7OA 3ZN6B 2BBAA 5FPZA 4CCLA 4IGPA 3W59A 2VUCA 4M3CF 5JIUA 4CRQA 1DYPA 2ID4A 4MGSA 3WNOA 1HB1A 4J6GA 4JHZA 2ZGNA 5IHRA 3ZDVA 3FJSA 4LXLA 1DQ1A 3FHQA 3QOPA 4LMFA 2Y38A 2R49A 4QPGB 1BQPA 3MI8A 1JOJA 4QX1A 5A3WA 3I2FA 1E5RA 3T0DA 1AL23 1WLCA 4IEZA 3UJQA 4JDOA 1KQRA 1QY4A 2ARCA 2TUNA 3M3EA 2GP5A 4WZFA 4DUVA 5C3PA 1V00A 2I2SA 2ZGSA 3BODA 4QU1A 3PJQA 4P5HA 3TB0A 3VV1A 1UAIA 1L3JA 1QJU3 2VCCA 4WBBA 3M1HA 4LPLA 4YGEA 4AHYA 2X5IA 4J1WA 4IGOA 2Y34A 5GKAC 3UK9A 4D6RA 5A1LA 4OUMA 4NIDA 2BW8A 4GULA 1VIWB 1RUD3 1H1IA 5FZGA 5FY0A 1NE6A 1OOPB 4J25A 1UMHA 4Q4X3 3IM0A 1YFXA 1E5SA 4ARXA 1HB2A 2QDNA 1C57A 4B4QA 1V6NA 3ES1A 5A1FA 4XJUA 4OHYA 1FMD1 5L9VA 4FQ4A 1KRIA 1BJQA 1CX1A 5CFDB 3PURA 2XVGA 2VCMA 4WV8A 4N43C 1M06G 1IKQA 2AEZA 3ABZA 3ZM8A 1B09A 2F17A 5HBAA 2FCUA 1L7RA 2J22A 1CQ9A 2P3JA 1DQ2A 2JE9A 2Z4FA 4QWNA 5KC5A 1MQTB 2QQUA 4DS0A 3CNAA 2C5DA 1UZYA 3LOIA 1IQAA 3CKHA 2B5HA 1WKYA 3ZFEA 1CPNA 1W03A 1XSQA 1VBC3 3VHOA 3BVCA 2PAMA 4MXWA 1RUH1
chains in the Genus database with same CATH topology
4NMIA 3KT7A 5A3UA 5LBCA 3EMRA 3MGUA 4Q5OA 4Y5SA 4ZPIA 2JIGA 5EQUA 4JZRA 5DAQA 4NHXA 2HBTA 3GJBA 4XC9A 3OBZA 5IATA 4NHYA 5DAXA 5LA9A 5EP9A 2V4AA 2A1XA 5IAVA 3HQRA 4NHKA 4XCAA 4KBZA 2JIJA 4IW3A 3ITQA 3HQUA 3PL0A 4XABA 5LBBA 3OUIA 3NNJA 3KT1A 3NNMA 4XCBA 5HV0A 5LB6A 2HBUA 3NNFA 4ZONA 3GJAA 5C5UA 5LBFA 3OUHA 5C5TA 2RDNA 5DAPA 4XACA 3W20A 4UWDA 5DAVA 4BQYA 3DKQA 2RG4A 2RDRA 5M0TA 2Y34A 5LATA 2FCTA 2Y33A 3GZEA 4NHLA 2RDQA 5EPAA 5LASA 2RDSA 3W21A 5LBEA 4J25A 2G1MA 4Y5TA 5IAXA 4BQWA 2OPWA 5L9VA 3KT4A 2FCVA 4NAOA 2G19A 4BQXA 4MHRA 3OUJA 2FCUA 5HV4A 4XAAA 4NHMA 5L9RA 3NNLA 5L9BA 3BVCA 5ERLA 5DAWA 4MHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NMI A;  3KT7 A;  5A3U A;  5LBC A;  3EMR A;  3MGU A;  4Q5O A;  4Y5S A;  4ZPI A;  2JIG A;  5EQU A;  4JZR A;  5DAQ A;  4NHX A;  2HBT A;  3GJB A;  4XC9 A;  3OBZ A;  5IAT A;  4NHY A;  5DAX A;  5LA9 A;  5EP9 A;  2V4A A;  2A1X A;  5IAV A;  3HQR A;  4NHK A;  4XCA A;  4KBZ A;  2JIJ A;  4IW3 A;  3ITQ A;  3HQU A;  3PL0 A;  4XAB A;  5LBB A;  3OUI A;  3NNJ A;  3KT1 A;  3NNM A;  4XCB A;  5HV0 A;  5LB6 A;  2HBU A;  3NNF A;  4ZON A;  3GJA A;  5C5U A;  5LBF A;  3OUH A;  5C5T A;  2RDN A;  5DAP A;  4XAC A;  3W20 A;  4UWD A;  5DAV A;  4BQY A;  3DKQ A;  2RG4 A;  2RDR A;  5M0T A;  2Y34 A;  5LAT A;  2FCT A;  2Y33 A;  3GZE A;  4NHL A;  2RDQ A;  5EPA A;  5LAS A;  2RDS A;  3W21 A;  5LBE A;  4J25 A;  2G1M A;  4Y5T A;  5IAX A;  4BQW A;  2OPW A;  5L9V A;  3KT4 A;  2FCV A;  4NAO A;  2G19 A;  4BQX A;  4MHR A;  3OUJ A;  2FCU A;  5HV4 A;  4XAA A;  4NHM A;  5L9R A;  3NNL A;  5L9B A;  3BVC A;  5ERL A;  5DAW A;  4MHU A; 
#chains in the Genus database with same CATH topology
 1RXG A;  2WQZ C;  2QKD A;  3B3Q E;  1OA3 A;  3JCI A;  2WLP A;  3D0J A;  4PBP A;  2FD8 A;  2VJX A;  4YVW C;  4IET A;  3WEZ A;  5F6K A;  3SH4 A;  1I1E A;  3H1Y A;  3KCC A;  4OZO A;  3T0B A;  4CP9 B;  3FFZ A;  1OVS A;  4QX5 A;  3KF5 A;  3VZN A;  3IIA A;  4EN9 B;  2PTM A;  3SH5 A;  2DU0 A;  1QXP A;  2MPF A;  2DUQ A;  3RI8 A;  2OX0 A;  1LES A;  4I3G A;  3I97 A;  1C4R A;  5DAB A;  1OLQ A;  1TQ5 A;  1MZF A;  2VZP A;  4TXW A;  2C24 A;  3AJY A;  3NAP C;  1DGW A;  2IFW A;  2QZ3 A;  2B39 A;  2VTF A;  4JCK A;  3I59 A;  1NAE A;  2OZ6 A;  4QQ2 A;  3WQ0 A;  4AVV A;  3OGR A;  4AZZ A;  3O1U A;  5E88 A;  1YFU A;  1LOB A;  2XHK A;  1HQW A;  1FV3 A;  5FQ0 B;  3SXW A;  3VLB B;  1BVP 1;  1RGS A;  4NAM A;  3AP9 A;  1O4Z A;  4IV1 B;  3PL0 A;  4OVE A;  3ZYH A;  4XAB A;  4URT A;  1LKN A;  2BDR A;  2DV9 A;  4NRP A;  3OPZ A;  1GQH A;  2HWC 2;  2PLV 3;  5HCH A;  1V9U 2;  2VD7 A;  3SCF A;  1UX6 A;  2R07 3;  1LHU A;  3URF A;  4LNV A;  1HRI 2;  1HRV 1;  4IEV A;  2JEC A;  5F6L B;  5FJH A;  1WW4 A;  2ARE A;  2Q8O A;  3T1M A;  1UWW A;  3N9L A;  4RD7 A;  2EXK A;  5JSP A;  4NIG A;  3J8F 3;  3IDB B;  3N3H A;  1V6K A;  1RUE 2;  1OH3 A;  2RR1 3;  1PNG A;  1UXX X;  3NNF A;  4GMP 0;  5F3C A;  1URX A;  4MSV A;  5FP9 A;  2XKO A;  3MIC A;  3RMY A;  5LBF A;  1AJK A;  4Q4Y 1;  4YVW A;  4JGY C;  3HN1 A;  4CCC A;  4LEJ A;  4LT5 A;  2G9F A;  1YIF A;  1R09 3;  2WO7 A;  3TBD A;  1AVB A;  3FE5 A;  3RQ0 A;  2WT0 A;  1K5J A;  1VBA 1;  2R6Q A;  3N7J A;  1UKG A;  1Q43 A;  2GSY A;  2JWP A;  1D2S A;  1SLI A;  5FYM A;  1GP4 A;  1OKO A;  1OSG A;  4QM8 A;  1ST8 A;  1IG3 A;  3M4F A;  3ZXJ A;  2Y33 A;  4RA0 A;  3RWK X;  3NAP A;  4WVM B;  1EUU A;  1APN A;  2HJI A;  5ANQ A;  3W21 A;  4ASK A;  5EIY B;  4C0B A;  1SZB A;  4KU8 A;  3OY8 A;  1UIK A;  1UX7 A;  3FBM A;  5FO7 B;  1N1V A;  4LBN A;  4Z2A A;  1VRH 3;  1TZO A;  5CBL A;  4QB1 A;  1BYH A;  2WFF 1;  3I3Q A;  4AAX A;  4XXP A;  3RNS A;  3DEM A;  2VM9 A;  1QJY 3;  1YEW A;  2Z79 A;  4OHV A;  5JSO A;  2WS9 2;  3D5O A;  4XF1 A;  2GC0 A;  4DIQ A;  1PGS A;  1EAH 2;  4MLO A;  4QB6 A;  1WD3 A;  1DF0 A;  4R9C A;  4AI9 A;  1QJU 1;  3WQB A;  4A6S A;  3HT2 A;  4XFB A;  2VVD A;  4R8H A;  2GAU A;  1ZRE A;  4NWV A;  4RGK A;  2VVE A;  3HNB M;  4R9D A;  2PEL A;  3O0X A;  1SLB A;  1HQN A;  2XML A;  5CYY A;  1RUI 2;  2VPV A;  4QXK A;  1JI6 A;  2A3X A;  3FX3 A;  1LGC A;  3PUA A;  5EFU A;  2AGS A;  4HLT A;  1GWM A;  1N1T A;  1QNW A;  5FUI A;  3SIS A;  1QXJ A;  3B94 A;  1SBD A;  2H0B A;  3MID A;  5EV7 A;  2PA7 A;  2V4V A;  4W6X A;  5JWP A;  3C7E A;  5C6C A;  2Y26 A;  4RR3 B;  1QEX A;  5JPM B;  4YG6 A;  1HXS 3;  1W2O A;  5FPA A;  3IMN A;  5C3R A;  1XJA A;  3ZXK A;  3IT8 A;  2Y6K A;  4AFM A;  3ZXE A;  1OF4 A;  4CEY A;  1XBF A;  5FP4 A;  5C33 A;  5C71 A;  2BYV E;  5A7W A;  1J3R A;  3IN9 A;  3C8X A;  3SH3 A;  1FPN 3;  1STM A;  3J7L A;  4LLF A;  3VB9 A;  2BWC A;  2Y6J A;  1W8Z A;  1ASJ 1;  2DYC A;  2WAA A;  4XFH A;  3BN6 A;  1LOD A;  2V4A A;  3VHR A;  3BIW E;  1MVQ A;  1RJ7 A;  1W6Q A;  3EB7 A;  5EJ1 B;  4AVA A;  4ERO A;  4W4Z A;  5FMC A;  3VD9 A;  1S0J A;  4GQ7 A;  1WA4 A;  3WNX A;  1H2M A;  3HQR A;  3GYD A;  5FXW A;  4RN5 A;  1ND3 B;  2ZOE B;  1VBC 1;  3III A;  5IW0 A;  3BYW A;  1RVF 2;  4IEW A;  2D3P A;  2QJV A;  5F7U A;  1UYZ A;  2F4P A;  5FBZ A;  2QCS B;  4AEJ A;  1W6N A;  2XJU A;  2WYF A;  3FLT A;  4Y20 A;  2AEY A;  1ZVF A;  4CP0 A;  4BLJ A;  1JYT A;  1KXG A;  4A3Z A;  4ATF A;  2MHF A;  3O14 A;  3NNJ A;  4QQO A;  4QXB A;  3ACH A;  3N7L A;  2PXJ A;  3POW A;  4COU A;  3BOP A;  4IE5 A;  2RJ2 A;  3WF0 A;  3KF3 A;  2WZE A;  5FZ1 A;  2XJP A;  3WP4 A;  4FPF A;  2CU5 A;  4CU9 A;  2RM2 2;  1GBG A;  2D43 A;  4YW7 A;  4QU2 A;  2WL1 A;  2JD9 A;  1OI6 A;  2YY1 A;  1FT9 A;  1YJL A;  3D4K A;  3L9J T;  4GAZ A;  4K3U A;  1RMU 2;  4Y24 A;  2X8K A;  2DFC A;  1RIT A;  3W5M A;  3THP A;  4AED C;  5IVV A;  5C5T A;  3ACL A;  2IC1 A;  2YV8 A;  4N43 B;  1MS4 A;  1HJG A;  5FUP A;  2HWD 1;  3ZOI A;  5FTT C;  4R4Z A;  2OYZ A;  4CEW A;  5JPN B;  1IOA A;  2OT7 A;  1W05 A;  2D40 A;  5FK8 A;  1LJ7 A;  1VBB 1;  2BGC A;  5T50 A;  3VBR C;  1TMF 3;  1W6P A;  4CDW B;  3N4M A;  1QJX 1;  5M0T A;  2PHD A;  3VBU C;  3S0M A;  2BFU S;  3VKN A;  3I2H A;  3KHB A;  2DUR A;  5DUU A;  1QMJ A;  3B7M A;  2Y6L A;  4LO6 B;  5DPN A;  1BMV 1;  4CDQ A;  3U37 A;  4D6Q A;  1JZ7 A;  4Q4V 2;  2HWE 1;  2C6S A;  2VEC A;  5LEJ A;  1F31 A;  4BIF A;  5A6Z A;  2QVS B;  1A8M A;  1NKG A;  3B00 A;  4FPO B;  5A3L A;  1D0G A;  2B7Y A;  3OBR A;  3OYW B;  2VW0 A;  1NXM A;  2QQO A;  4N7I A;  5CKM A;  4GH4 A;  1MR5 A;  2XBO 1;  4PBO A;  4QKD A;  3SLI A;  1J59 A;  1CAX B;  1H9P A;  2G19 A;  2DFB A;  3LPG A;  1BEV 2;  1RUC 1;  2QQV A;  3AC0 A;  2SBA A;  3PU8 A;  4BK5 A;  4CE8 A;  1IG0 A;  1S1A A;  2RS3 1;  1ND2 A;  4AOC A;  5FXX A;  4XOG A;  4QHB A;  2XXZ A;  1UIJ A;  3WNL A;  5LA0 A;  3IPV B;  1W2U A;  5CNA A;  3T0A A;  5T5P A;  5K8S A;  3O0W A;  3ECQ A;  1EV1 2;  4F3J A;  4HKL A;  3JBG 1;  5FUN A;  2WZ8 A;  3POY A;  4GWN A;  1XYP A;  2JKB A;  5HCF A;  4AED A;  3QBQ A;  3CIH A;  4YW2 A;  5FY1 A;  1RUH 2;  1V6J A;  4FPE A;  2Q8E A;  3TNP B;  4C1X A;  1QXR A;  2WNU C;  1ZBE 2;  1OD5 A;  1R1Z A;  4GB3 2;  1OPO A;  2XJV A;  1P8J A;  4JDM A;  4Y33 A;  1MS8 A;  2BNM A;  3UKN A;  2WNV C;  3VD4 A;  3PTY A;  4LK7 A;  1OQ1 A;  4M0H A;  5FPL A;  4EWD A;  4K1Y A;  1O4T A;  4FBF A;  5DAQ A;  5KHG A;  1JUH A;  3LOB A;  4FPJ A;  1JBC A;  5C4W C;  4OI2 A;  5D2A A;  3VBU A;  3WDU A;  1UU5 A;  3OBZ A;  1QIQ A;  1AR9 2;  1C5I A;  1XQN A;  2BGP A;  3POI A;  4FXK B;  5J48 A;  2B46 X;  1CAV B;  2IXK A;  1CPM A;  5EP9 A;  4W6Y A;  3SHR A;  4PT6 A;  2KM2 A;  3SCG A;  4Q0S A;  4RFT 0;  3WCR A;  1LOC A;  5D1I A;  4XUR A;  1O3R A;  3LAG A;  3ZYG A;  1ULO A;  1SMV A;  4JGY B;  4LHN A;  5ACA 2;  3NV4 A;  2C9A A;  3VN4 A;  3HNM A;  5GZE A;  2WQ8 A;  3TEW A;  3JQW A;  2FDH A;  1SDW A;  4AG4 A;  1K42 A;  5E8A A;  2JDU A;  1W6O A;  4BDV B;  3HQU A;  2OQ6 A;  5F32 A;  3USS A;  3RRD A;  2D6M A;  3OUI A;  4R52 A;  2JIC A;  3ILR A;  1LU2 A;  3WNM A;  2W0X A;  3P3P A;  4OUL A;  2P3Y A;  3E97 A;  3VZK A;  1ULP A;  3K48 A;  3H9A A;  1UZW A;  4FP3 A;  5A32 B;  1W6Q B;  4L92 A;  2NP0 A;  2NM1 A;  2VNG A;  1F2N A;  3I3E A;  2PFW A;  4PIZ A;  5FZ7 A;  3VL9 A;  4I30 A;  1AX2 A;  1LHW A;  3AB0 A;  3PNA A;  2XLG A;  4CCJ A;  4ZON A;  5FDB A;  4XFA A;  4M3C B;  2Q8D A;  5I0D A;  4QD2 A;  3LSE A;  3OPT A;  4OHX A;  2RDN A;  4B7E A;  4YG3 A;  1D4V B;  1W6N B;  4OHZ A;  1TNF A;  5C4W A;  3K77 A;  4GIQ A;  1DQ4 A;  2HWC 3;  2ZEY A;  5F1R A;  2E7T A;  4XVH A;  4FTE A;  1VBD 3;  5FZI A;  1YYN A;  4AF9 A;  4LBK A;  1HRI 3;  5FMD A;  2VW1 A;  4JTO A;  2YBK A;  1NOV A;  1PO1 1;  2C9K A;  3OF1 A;  3HOB A;  3RZH A;  1TNR A;  3KHC A;  5JXJ A;  2TEP A;  3ASI A;  3MIG A;  3JD7 1;  5LAS A;  4CCN A;  5JAX A;  1H4G A;  5LWB A;  5BYN A;  3VKO A;  4OI0 A;  2WWU A;  3MFC A;  5CIS A;  2AZ5 A;  3FMG A;  1MAC A;  2XB6 C;  4QX3 A;  4DXZ A;  3USU B;  1C1F A;  2BNO A;  1UYP A;  2DF7 A;  1XPW A;  1AR8 1;  4LIU A;  3NJX A;  1AXZ A;  1YJK A;  3ENR A;  2RMU 1;  2W1U A;  3RYK A;  5A7P A;  3V64 A;  4A6O A;  5IWF A;  3CF6 E;  3DPR A;  5AFE A;  1W6P B;  3WDY A;  5K4L A;  2Q5T A;  4DXR A;  1COV 2;  1WMX A;  2J1R A;  2R04 1;  2VG9 A;  1QQP 1;  3NV3 A;  5DDJ 2;  5G05 L;  2YBS A;  5BNP A;  4XAA A;  1OC1 A;  3ZYI B;  2WN3 A;  2YU1 A;  3NNG A;  4YRD A;  2XG3 A;  3W5N A;  2JE8 A;  4AI2 A;  2VXJ A;  3PHM A;  4C0H A;  4EZ4 A;  1J1L A;  2AEN A;  4RL7 A;  4XUN A;  5T55 A;  1S55 A;  3FHA A;  4AVC A;  5AC9 1;  3RDI A;  1AYN 1;  3VZL A;  4V2V A;  3ZO0 B;  5C8C B;  3T08 A;  4ZXK A;  2VZV A;  4HVO A;  4BWO A;  2WS9 3;  2WII B;  2R30 A;  4HL0 A;  1YHF A;  3ZSM A;  5IVE A;  4OMD A;  5GZF A;  4DO0 A;  5BNO C;  1LAJ A;  1ASJ 2;  1NCQ C;  2ARA A;  3WNN A;  1X33 A;  2XVL A;  4YM0 A;  5I8Y A;  3LFM A;  3RYR A;  3ZFF C;  4B29 A;  1GKB A;  3NWK A;  3D3A A;  3HN3 A;  1EPZ A;  4H7L A;  3ELN A;  3KGL A;  3OSD A;  4AED B;  3OOX A;  4MYE A;  4XTM A;  3ALQ A;  1OOP C;  2K0G A;  1BKZ A;  3TNQ A;  1AXK A;  2KR2 A;  4YGC A;  1H9W A;  3K75 B;  4ZHN A;  3VBR B;  3ZFG C;  1RL3 A;  1UZZ A;  3P6B A;  2ZHK A;  2P2K A;  2BTV C;  1GUI A;  1O5L A;  1POQ A;  3VBU B;  2VZS A;  5FZ9 A;  2EAA A;  2RS1 2;  1X9T A;  4LBQ D;  1W3V A;  3ZN6 A;  4Z92 B;  2BWA A;  2ERF A;  1KGY A;  5KHJ A;  5CFC C;  3FHI B;  1C8M 1;  3U11 A;  2Z2S B;  3JXS A;  3RS6 A;  3RMX A;  1OUR A;  1VMJ A;  5LCW L;  3ZR6 A;  1ENS A;  3HPN A;  1W9W A;  3EYP A;  4P00 B;  2ZGP A;  4E4Z A;  4CXX A;  4QPG A;  1J1T A;  2XON A;  2ZGM A;  4LR4 A;  2X09 A;  3GCW A;  3PME A;  1LTE A;  3A21 A;  1NUK A;  5DAP A;  2A3W A;  5CAD A;  3LEI A;  2ET7 A;  1RUF 1;  3HR9 A;  3PIG A;  1W6O B;  3OG2 A;  4TLF A;  4TZD A;  1JTZ X;  5E89 A;  1DCS A;  2YDE A;  1JH5 A;  3NQH A;  4MGI E;  4WM7 B;  1ULC A;  3QCW A;  5FZ6 A;  1NCQ A;  5EHD A;  3VBO C;  3EHK A;  4R9A A;  3CZJ A;  1W9F A;  3ILN A;  5GLV A;  4NHL A;  1A6C A;  2RDQ A;  1ONA A;  2KD7 A;  2IUW A;  2RM2 3;  4Q1R A;  3DYP A;  2WKK A;  3QLQ A;  2EAL A;  1I5Z A;  4FFH A;  2OII A;  4X6R B;  4BQ4 A;  5JI9 A;  4KWK A;  1RMU 3;  2WNU B;  1OOP A;  1RUJ 3;  1SG3 A;  1W0P A;  1JMU B;  4NRQ A;  3BIE A;  2ATF A;  3FLP A;  1XE8 A;  3EBR A;  2WNV B;  3UES A;  1ODM A;  2OPW A;  3AMP A;  2J1S A;  2XBO 2;  4CUB A;  5JOW A;  3BTX A;  4KBB A;  4TWT A;  3ZFG A;  4EN6 B;  1RUC 2;  4BIO A;  4XXA A;  5C4W B;  4IEX A;  3PVE A;  4QAW A;  4FPL A;  3FUO A;  1H4H A;  5F5I A;  3WQ7 A;  1G9A A;  3AVS A;  2CAU A;  2RS3 2;  1E5H A;  1OUX A;  2O8Q A;  2QQL A;  3LA7 A;  2AYH A;  3VZJ A;  1ZBA 3;  2ZMK A;  1Q5O A;  1AXY A;  4CZS A;  2VBP A;  1BLZ A;  4C1W A;  2CDO A;  3H8R A;  2KA3 A;  1A8D A;  1LNS A;  3HVD A;  1NQD A;  4Q4V 3;  4UI9 L;  4QHO A;  5FJK A;  4HVQ A;  5J37 A;  5DAW A;  3AXE A;  1MQT A;  5IFP A;  3GXU A;  4CP1 A;  5ABJ C;  2C1F A;  1ZA7 A;  2B9U A;  4CXY A;  2ORZ A;  3ZSK A;  1UYY A;  1PMJ X;  1JUI A;  1JXN A;  1DYK A;  2Y0I A;  5DUX A;  1GSL A;  5FY5 A;  5BXX A;  1BEV 3;  2ZGK A;  2R0F A;  3VD3 A;  5I93 A;  3BTY A;  5LBC A;  3EMR A;  2ZEZ A;  4K1Z A;  3VGI A;  4BQ2 A;  4W65 A;  3VBO A;  3NJY A;  3MV0 1;  5H9S A;  1XNK A;  5IK7 A;  2A6Y A;  3H8X A;  3AFK A;  1HV0 A;  4P9J A;  4CTE A;  1PZ7 A;  3VDD C;  4FT8 A;  4YFW A;  5CG9 A;  1TME 2;  3TN9 1;  3B5L B;  5DAX A;  1EV1 3;  3ORJ A;  1KJR A;  4XFG A;  4AI3 A;  4Q8L A;  5GZG A;  1ULF A;  4FTS A;  4UXA A;  1PMI A;  2IXI A;  4CPB A;  4ZKT B;  5JZG C;  3S7I A;  2BER A;  3MIF A;  4I2O A;  1FAT A;  4GB3 3;  4IV3 C;  4XPV A;  2E53 A;  3OGJ A;  4XFI A;  5E1R A;  4LE4 A;  1S0D A;  2EIC A;  1G8W A;  1ZRR A;  4IE4 A;  5FQ0 A;  3ITQ A;  3SKJ E;  2HWF 3;  1VPH A;  1MEC 2;  1QGL A;  4QPY A;  3K3N A;  1FAY A;  2EIE A;  2JDM A;  1AR9 3;  4HKO A;  4IV1 A;  3I2I A;  4YZ1 A;  2W95 A;  5A33 B;  5LK5 A;  2XGX A;  1WW5 A;  2VZ1 A;  5JI7 A;  5K9Y A;  1MS5 A;  2GNB A;  5FYZ A;  3AZY A;  4FPK A;  4YZ4 A;  3I49 A;  5ACA 3;  2ZGU A;  2P5B A;  2HBU A;  1U5X A;  1AR7 1;  4NRO A;  4LBJ A;  1HN0 A;  3ACI A;  4P9W A;  2XH6 A;  2E51 A;  4LQR A;  4PQQ A;  1PO2 2;  1NY7 1;  4BZ4 A;  1JOB A;  4L99 A;  3LZZ A;  5FZL A;  3WT3 A;  3M70 A;  1LOE A;  2GN3 A;  3ZYR A;  4BQY A;  4CDU B;  1CON A;  3I8T A;  4GD4 A;  2YG0 A;  1UOJ A;  2WZR 3;  3VDD A;  4M01 A;  3AP4 A;  3NJZ A;  2Y60 A;  3VKM A;  2RHP A;  1PO1 2;  2WT1 A;  3BOW A;  3M3Q A;  3R4S A;  5F2S A;  2DVG A;  1WMD A;  3ILF A;  4QB2 A;  1D0H A;  5FBJ A;  3PVN A;  3NRU A;  3JD7 2;  1XNT A;  4MGT A;  1DGR N;  1SLA A;  1W2N A;  1GOH A;  2RDS A;  3MUY 1;  1H8V A;  1VBE 3;  1R08 1;  4R9B A;  3VBF C;  4WVM A;  1ULG A;  4KL1 A;  5F8P A;  4Q0V A;  3IMM A;  2VQA A;  4IND A;  3I2G A;  4JVA A;  1PK6 C;  4XJ9 A;  1UQX A;  3IB3 A;  4Q29 A;  3OB8 A;  3ZXA C;  2GZW A;  3BPZ A;  5JLV A;  2BOI A;  5BNO B;  1CR7 A;  1ND3 C;  1NCQ B;  3OPW A;  3IWZ A;  2JD4 A;  2R04 2;  1UW8 A;  3CQO A;  4IE6 A;  4YGD A;  4QX2 A;  3KWV A;  3ZFF B;  1NLR A;  4NII A;  1FOD 3;  1Z7S 3;  2AH2 A;  3DXT A;  2UWB A;  4PF5 A;  4QX0 A;  1D4M 1;  4QPW A;  1DIW A;  3D0S A;  2G4I A;  1SLL A;  4GAL A;  4ITC A;  2RS5 3;  3KV9 A;  4YW1 A;  2VOW A;  1S4C A;  3H7Y A;  3DF0 A;  3IBM A;  4LKF A;  4IER A;  5ERL A;  1MVE A;  3ZFG B;  4ISQ A;  2XQR A;  3D8C A;  2Y8K A;  3JUU A;  2R06 1;  3KT7 A;  4RR3 A;  1WLD A;  1DZR A;  2IXL A;  1AR6 3;  4Q5O A;  1CJD A;  2CHH A;  4XUT A;  4Y5S A;  5EQU A;  3T30 A;  5CFC B;  1COV 3;  4E4D X;  5DDJ 3;  2HBT A;  4QXH A;  3SCH A;  3I2K A;  2ZHM A;  4XJA A;  2DCT A;  2XPJ A;  3CHX A;  4FPY A;  4NHY A;  1UY1 A;  4HN0 A;  1UMI A;  2XDV A;  3VBF A;  5FP7 A;  4CDW C;  2CYF A;  2VZ3 A;  1BXH A;  2XL7 A;  4KQ7 A;  3BUC A;  3ZPY A;  1OXC A;  3AVR A;  2JG9 C;  2VE1 A;  1RUG 3;  3OEA A;  3H1W A;  3WNP A;  5C3S A;  3ON7 A;  5CU1 A;  3GHN A;  1CES A;  4BB3 A;  4ES8 A;  5H9R A;  5T52 A;  2DVD A;  1KJL A;  3BB6 A;  1QKQ A;  1ND3 A;  1PGW 2;  2JIJ A;  1A3K A;  1W0N A;  3SEP A;  1GYK A;  3VBO B;  3KD4 A;  3VKF C;  5FP3 A;  2EXJ A;  2P4E A;  3MBW A;  2ZKL A;  3OGG A;  4G4F A;  3WHT A;  4ET7 A;  2ZJC A;  4JV4 A;  4L8Q A;  4SLI A;  5F37 A;  1G9C A;  1RED A;  2WYS A;  1S0I A;  1SHW B;  2YC2 A;  1O3T A;  4XIO A;  4AYU A;  2VUA A;  1CGP A;  3LE0 A;  3M3I A;  4XHX A;  3Q9O A;  3AP6 A;  2XVK A;  4MXV A;  2WLQ A;  2B45 X;  1FI2 A;  4UFK A;  1IS4 A;  3RZK A;  1Y7B A;  4DXS A;  3OTF A;  2VME A;  2OKX A;  5F9T A;  5FYB A;  2GMP A;  5BY5 A;  4D8M A;  2BZD A;  4K9S A;  3K2O A;  5BNQ A;  4COZ A;  1Y9Q A;  5CVR A;  2XR4 A;  1QWR A;  1UZV A;  3G6J B;  4HPK A;  3ZX7 A;  5F39 A;  2Y6G A;  1AYM 1;  4ZXE A;  3W20 A;  5KC6 A;  1GZT A;  5L36 A;  4HON A;  5FRA A;  4EE2 A;  4N43 A;  2RS1 3;  3MYX A;  3GNE A;  5C3O A;  1YFY A;  2ET1 A;  2RDR A;  4N9I A;  2A5Z A;  3A22 A;  5JOZ A;  3KV5 A;  2G9Z A;  3LQC A;  3P1I A;  1UPI A;  2A6W A;  2JDN A;  5DUV A;  4CDX C;  2Q4S A;  5A7S A;  3CBN A;  1PVC 1;  4LA3 A;  4CDW A;  5FZH A;  3APB A;  5ABJ B;  1OLR A;  1V6O A;  4OFG A;  4QKB A;  3R4U A;  4Y1X A;  4AI1 A;  5FKB A;  3OBT A;  4AEK A;  2D6P A;  1OVP A;  1SEF A;  4XAE A;  3UKT A;  3AYA A;  4W6W A;  3ST7 A;  2GNT A;  2BOJ A;  3MLL A;  4PDW C;  4ASM B;  1BBT 1;  3NMB A;  4UOJ A;  2JG8 C;  4XQW A;  5G04 L;  5FYI A;  5L7O C;  3V0A A;  3BTA A;  1LEN A;  2DU1 A;  3OYW A;  3U78 A;  5EJ3 A;  1CIW A;  3VDD B;  3Q8F A;  1H1A A;  4RHV 2;  1CAX A;  1S0C A;  4EJR A;  1JHJ A;  2PAE A;  2X10 A;  3PUS A;  5FZO A;  2WZR 1;  4BH9 A;  5CEH A;  1XRU A;  2WQ4 A;  1W8N A;  2RJK A;  2Y6H A;  3CL1 A;  3KB5 A;  3RGB A;  2ZMN A;  4QM9 A;  3ZSL A;  1QOO A;  4FAH A;  2LAL A;  3THD A;  4X8P A;  1VAL A;  1ZZ8 A;  1PNF A;  4AQT A;  2YHJ A;  1L7L A;  2DCZ A;  5JZG B;  2IXC A;  3O1M A;  3IPV A;  5ANN A;  2ZHL A;  3ZPO A;  2PAK A;  3DL3 A;  2BRT A;  3VL8 A;  4IV3 B;  3WF1 A;  3UKV A;  1R1A 2;  4JDN A;  2WUH A;  2D6L X;  2K2S A;  2E7A A;  2C26 A;  4QQL A;  2OXB A;  1AL2 1;  1YI9 A;  4BJ0 A;  5HI0 A;  2BBV A;  1DG6 A;  4IEO A;  3WW4 A;  1ALY A;  5IUQ A;  2D44 A;  2W91 A;  3N9O A;  1DU3 D;  1WGP A;  3WCS A;  1MS3 A;  2DUO A;  1MS9 A;  3DEC A;  1OD3 A;  2GNM A;  4XF4 A;  4ZS3 A;  3C2U A;  3PUH A;  2P6C A;  5CAZ A;  4XIK A;  4YZ2 A;  2LS6 A;  4Q4W 2;  3M2M A;  4S2H A;  4CCM A;  3ATG A;  4ZU4 A;  3ZDS A;  1QOT A;  4B4R A;  1CAV A;  1RUD 1;  3H42 B;  5T54 A;  1IPS A;  2NMN A;  3WDX A;  2W1S A;  3Q8E A;  4NR1 A;  1GAN A;  4K8R B;  4Q4X 1;  5EJZ B;  2WA4 A;  1GNZ A;  2JG8 A;  1FNZ A;  4JGY A;  2QBX A;  2VU9 A;  4AFA A;  2LRO A;  2GC3 A;  1W2T A;  2MEV 2;  1IS6 A;  1U5Z A;  2W08 A;  3KLS A;  3TRS B;  4CXW A;  3N7M A;  3HJR A;  4CU8 A;  2HYX A;  5I0T A;  4GJZ A;  1AR6 1;  1FV2 A;  1NX9 A;  1K3I A;  4MH0 E;  4Z8B A;  1IQD C;  5LBB A;  3N9Q A;  4DEQ A;  3K4D A;  1HQL A;  4Q26 A;  1TME 3;  4LKS A;  3W9A A;  1BCX A;  1RHI 2;  1UKR A;  1OLM E;  3KT1 A;  2XKP A;  3F95 A;  3J7N A;  4AK3 A;  1DQ5 A;  3VBF B;  1O59 A;  2XHN A;  4B3N A;  3KV6 A;  2WRA A;  3LA3 A;  2DTY A;  3CZU A;  4ZZ5 A;  5A32 A;  1X82 A;  2F4L A;  2VQT A;  3S5Q A;  1PIV 2;  2QQJ A;  3A7Q A;  1E57 A;  4MGY E;  1ZRC A;  4LBL A;  1EP0 A;  4UAP A;  1UL9 A;  1PK6 B;  1NQJ A;  2C4X A;  1RUG 1;  2VAU A;  2Y0O A;  2EXI A;  1AX1 A;  2QQK A;  1W9T A;  2HWB 2;  2XJQ A;  5KXD A;  1O91 A;  4XAC A;  4M3C A;  2VTX J;  3C7F A;  3AKQ A;  2ZGO A;  4HMZ A;  5C8C C;  1CVN A;  4CCD A;  4FVV A;  5DN2 A;  4GMP 3;  1XOY A;  1OBN A;  3BCW A;  1H1M A;  1QH6 A;  4P9X A;  4WZC A;  3WP3 A;  4L9B A;  2CNA A;  2GC1 A;  1POV 0;  3J7M A;  3PMS A;  3RWN A;  1T6G C;  4JRL A;  3IAQ A;  1JZ2 A;  3ETP A;  1D7P M;  1SLC A;  3GZE A;  1QHD A;  4I0W B;  4YZ3 A;  3AMN A;  2RJL A;  3WG3 A;  4LLO A;  4Z1V A;  1V70 A;  2WDB A;  4Y1U A;  4G9S B;  1AX0 A;  3A4U A;  3S5A A;  1NXD 1;  5FYY A;  2EVX A;  3RJR A;  4EYU A;  2YC0 A;  1SFN A;  1PO2 3;  1YQ5 A;  4HPK B;  4C91 A;  4NO4 A;  2EID A;  1JYX A;  3H3U A;  3USU A;  1O3S A;  4BQX A;  2VBD A;  2XL9 A;  1Q8S A;  1XYO A;  3WV6 A;  1OFS A;  3KM5 A;  2E9Q A;  1KDM A;  1SPP B;  1MZ5 A;  1W39 A;  2QQM A;  1XE0 A;  5FCC A;  2VZT A;  1KD7 A;  1VB4 A;  2HEV F;  3RI9 A;  4CU7 A;  1G9D A;  4LO8 A;  1LHV A;  2PLV 1;  2VQ0 A;  4E4S A;  4CUA A;  2JG9 B;  4QPI B;  4HFS A;  2R07 1;  5JIA A;  1N3P A;  4OHW A;  4RFR B;  5IT6 A;  1A78 A;  2CGO A;  2NMO A;  2EXH A;  5IVJ A;  1US2 A;  3J8F 1;  2HEW F;  2WO1 A;  2VMC A;  3U07 A;  4BME A;  2CGP A;  4IEY A;  2RR1 1;  3GZT B;  1FMD 2;  4BE3 A;  5C8C A;  2R06 2;  3V0A B;  4AQ2 A;  4NMI A;  1ZYB A;  5A3U A;  3RVH A;  3WP5 A;  4A7Y A;  1REF A;  2JIG A;  2D6O X;  5FAX A;  5FK7 A;  1ZZC A;  5FZO B;  1CWP A;  1GLH A;  1R09 1;  2UU8 A;  2VUD A;  3MW2 A;  4XC9 A;  2VOV A;  2BV4 A;  4A2U A;  5IAT A;  1WBL A;  1OQD A;  2VR4 A;  3HD8 B;  3K4Z A;  4WM7 C;  5LA9 A;  1F15 A;  4DMI A;  5FZM A;  2ILM A;  1WW6 A;  3POB A;  1ENX A;  4RQP C;  1W2A X;  1PM4 A;  4Y4R A;  1I5P A;  5BV6 A;  2BNN A;  2QFE A;  1GZC A;  1F4A A;  2LW8 A;  4YPJ A;  3AMM A;  1V6M A;  1YC6 1;  4HK8 A;  5T5L A;  1VRH 1;  4L97 A;  1DLC A;  1EYB A;  2WJS A;  4Y1Z A;  5A80 A;  4FSJ A;  5FO9 B;  4KWL A;  1QJY 1;  3VBR A;  4CDX B;  2ZXQ A;  3A0N A;  3I3B A;  4HAN A;  4Z2W A;  2WFP A;  3MF9 A;  1QDO A;  4LO5 B;  2XLF A;  3PUI A;  3M7A A;  4J1X A;  4B4P A;  4GA9 A;  4CP2 A;  5CG8 A;  3GCX A;  5F3E A;  2O0O A;  1AHS A;  2VY0 A;  4JKM A;  2E26 A;  3BU7 A;  1OH4 A;  1W06 A;  3MUZ 1;  2VMH A;  2JXA A;  4TN7 A;  1C3H A;  4PDW B;  2YMZ A;  1IKP A;  3S30 A;  2JG8 B;  5L7O B;  4ARY A;  3RZJ A;  4D7S A;  2WNE A;  4ZS2 A;  3I4I A;  1ACC A;  2GN7 A;  3OUH A;  3OD0 A;  5DAV A;  2ZGT A;  1FYU A;  3CJX A;  1HXS 1;  5FZB A;  2H0V A;  3SKV A;  2VOX A;  3T3Y A;  1JN2 P;  2BGO A;  3J9S A;  1ZRD A;  3I7D A;  3ZYB A;  4CU6 A;  4H55 A;  4WM7 A;  4IEQ A;  2ENR A;  5LAT A;  2F6B A;  4PQ9 A;  2N7G A;  1XNB A;  2QZ2 A;  1FPN 1;  3NV2 A;  2J1T A;  3H3L A;  1HRV 2;  1JZ4 A;  1G86 A;  4PHZ A;  4WM8 C;  5GLZ A;  3TEX A;  4EWE A;  1RUO A;  4AE2 A;  4UFM A;  3VBH C;  5LBE A;  4UF0 B;  2A7A A;  4Y5T A;  2HYK A;  4BHP A;  1HV1 A;  4JGZ B;  4AVS A;  2BPA 2;  2WNU A;  5KXC A;  2JDA A;  1W9Y A;  4Q4Y 2;  1YFW A;  1WLT A;  2BQP A;  2YGL A;  2R0H A;  2W1W A;  4QQH A;  4Y5Z 0;  2WNV A;  3WY6 A;  5C9A B;  2FCV A;  4I01 A;  3SMH A;  4Y4Y A;  3TEY A;  5JXH A;  1G7Y A;  3E6C C;  4MO3 M;  1Z0H A;  1VBA 2;  3WNK A;  2QNK A;  2AUY A;  3OUJ A;  3VZO A;  5LRS A;  4I0A A;  1V9U 3;  4IES A;  3AFG A;  1US3 A;  3ZR5 A;  5HV4 A;  3AYE A;  1FNY A;  2Z69 A;  1GOF A;  1TVG A;  1H2K A;  3NO8 A;  2XJT A;  3B69 A;  3D6E A;  1JZ6 A;  3JB8 A;  3MPP G;  4LUL A;  1RUE 3;  5KXE A;  2I07 B;  4D7Y A;  5C3Q A;  3B93 A;  3WQ1 A;  1QNY A;  4UFI A;  1JYI A;  3N36 A;  5CKN A;  5IK4 A;  4I0B A;  1O8S A;  1LHO A;  4UW6 A;  2WFF 2;  3NJV A;  3O1S A;  2VOT A;  2XOM A;  2QQI A;  3KVA A;  1PGL 1;  1UY3 A;  4RHV 3;  4A44 A;  2ES3 A;  3T2P A;  4LBO A;  3KQ4 B;  4YNI A;  4JZR A;  4DY3 A;  1Q8P A;  5FZE A;  3ZMO A;  2D98 A;  4BXS V;  2PQQ A;  4YM3 A;  1QJU 2;  1ZZB A;  4XE9 A;  5DQ0 A;  5FWJ A;  4UW4 A;  4S2D A;  4CDU C;  5A1A A;  1C28 A;  2P3K A;  2VQU A;  1W0O A;  1MZE A;  4Z07 A;  3MV1 1;  1TMF 1;  4WM8 A;  5E6H A;  1GP5 A;  2HKX A;  1YCI A;  1RUD 2;  4KGG A;  5SV8 A;  1YO8 A;  3VDB A;  2PQS A;  3MPB A;  3OEB A;  3ZKU A;  3JB4 C;  4UW5 A;  4F7Z A;  5DXD A;  4GJY A;  3ZSJ A;  3RG0 A;  3FFQ A;  1S2E A;  1GIC A;  1RIR A;  2W5F A;  2ZAA A;  1CZV A;  3MW4 A;  4H2A A;  5CIR A;  5ISL A;  4KH9 A;  4DUW A;  1OA4 A;  2MNG A;  4RSU A;  1UXZ A;  1N47 A;  4K20 A;  5LW9 A;  2B8M A;  1EAH 3;  1GWK A;  3A0K A;  3LEG A;  5GLT A;  2VO5 A;  1G6N A;  1H0B A;  4PCR A;  4Q4W 3;  2LUW A;  4M00 A;  4CCE A;  5C70 A;  1RUI 3;  1XC6 A;  1W6M B;  5IJR A;  3LDB A;  5A33 A;  2V09 A;  1JU3 A;  2I45 A;  5A3M A;  5LY1 A;  2B9V A;  3I2D A;  3N9N A;  3SQO A;  4KGQ A;  4M0N A;  1ZZ6 A;  2RVA A;  1HDK A;  2A70 A;  2DBN A;  1VBC 2;  2MEV 3;  4E8D A;  1YQ6 A;  1QJF A;  1IS3 A;  2CAV A;  2FQP A;  5H9P A;  1BZW A;  3GBF A;  3DXU A;  4FPG A;  1G9F A;  4FO9 A;  1SFP A;  4IDZ A;  3T1L A;  3DKQ A;  1SBE A;  3WLU A;  1RHI 3;  3AMQ A;  3E1F 1;  4CDU A;  5TSW A;  2GME A;  5H9Q A;  3IDA A;  5L73 A;  3THT A;  3T4H B;  3NST A;  3NKT A;  4XZP A;  1YQ2 A;  4ISR A;  1GZW A;  5FZF A;  4HXC A;  4PI0 A;  4Q27 A;  1PIV 3;  1SFY A;  1W8O A;  4CPB D;  1RC6 A;  4HN1 A;  2CGN A;  2VVF A;  2D93 A;  1H8T C;  3FC0 A;  2HH9 A;  2W3J A;  2HWB 3;  3MLK A;  4W8J A;  2FDF A;  3O1R A;  2ZCW A;  5JCT A;  1RVF 3;  2A73 B;  1SBF A;  3GBW A;  1XE7 A;  2ZX3 A;  1MS0 A;  3KT4 A;  4TTG A;  2EA7 A;  2HWD 2;  3TYJ A;  4MET A;  3LGR A;  4YM2 A;  2UWA A;  1UNB A;  5J96 B;  2WA3 A;  5EWS A;  3OGS A;  1NA1 B;  4P14 A;  5BNO A;  2V5D A;  1NE4 A;  1O8P A;  1VBB 2;  3IDE A;  3Q8B A;  3U75 A;  1Y9M A;  1DGR A;  3VHN A;  3WDW A;  1QJX 2;  1N3O A;  5A3T A;  5J3U A;  1LED A;  2XLA A;  5A6X A;  2HEY F;  2H6B A;  3ZFF A;  2R07 2;  5LEK A;  4CCO A;  2YB7 A;  4RQP B;  3ZIX A;  4UBG A;  4E2S A;  1BMV 2;  1YLL A;  4XEZ A;  5FXV A;  3MFA A;  2HWE 2;  4XYX A;  4BOW A;  4B8E A;  5GAL A;  4XDQ A;  2ADD A;  2TNF A;  2RR1 2;  5FY7 A;  2GC2 A;  3G7D A;  1LB2 A;  4S2F A;  4Y3O A;  2ZA9 A;  5J09 A;  2W92 A;  1ZX5 A;  1DP0 A;  4FOQ A;  1UPS A;  1RUN A;  3VBS B;  2ZX1 A;  5T3N A;  4NHX A;  4GWJ A;  4B1L A;  1C8N A;  3GJB A;  5FZD A;  1YXW A;  2HWC 1;  5CFC A;  2WNO A;  2VNR A;  1S0E A;  2JX9 A;  1LRH A;  2JKX A;  4JKL A;  3T2O A;  1VBD 1;  4NOT A;  1W90 A;  1Y9G A;  4K7J A;  3MF6 A;  4BU2 A;  3HMY A;  1HRI 1;  5FPV A;  1SCS A;  1OHF A;  3I2O A;  1LOF C;  2JB8 A;  1GNY A;  1H8T A;  1TE1 B;  3JBG 2;  1BVV A;  1NCR B;  1RIN A;  1X9P A;  4UFJ A;  1AF9 A;  4C90 A;  4HKW A;  3LF7 A;  2YZ4 A;  4MAD A;  3ZVX A;  1FMD 3;  1SDD B;  3HQX A;  3CMG A;  4A41 A;  4XDO A;  4XCA A;  1VLN A;  2XWJ B;  4QGM A;  4SBV A;  2WO2 A;  1ZZ7 A;  3V0B B;  4HG6 B;  4MV2 A;  3WVJ A;  3S6P A;  2W1Q A;  4AI8 A;  2FHR A;  4QKN A;  5BNN C;  2YPJ A;  3JZV A;  4XQ4 A;  4Y22 B;  2WWJ A;  4WM8 B;  4JC1 A;  5FIX A;  3O1P A;  3VBH B;  4AAP A;  3WF2 A;  4GWI A;  4XJ8 A;  4AGR A;  3D82 A;  4E8C A;  4LO4 B;  4A42 A;  3RZM A;  3GAL A;  1X8M A;  2R1B A;  1QOS A;  2VUL A;  1DQ0 A;  3AXD A;  3KCY A;  4IE0 A;  1IPK A;  5AVP A;  1RUH 3;  3HIF A;  4NPR A;  1SLT A;  4AHX A;  4MGQ A;  3UJO A;  1W99 A;  4AQS A;  1ZBE 3;  5C7G A;  3MZH A;  4P5Y A;  4EN8 B;  4QXC A;  4DZG A;  1KFX L;  2IWG B;  1QU0 A;  2OS2 A;  1JZ8 A;  2G9G A;  2WS9 1;  5FMB A;  5FZK A;  2I74 A;  2A6Z A;  5APA A;  1UN1 A;  1U12 A;  4KWJ A;  3WG4 A;  4PIX A;  4AGV A;  1RTV A;  4KG0 A;  2CV6 A;  2FCT A;  3KZ4 C;  4FFG A;  3POJ A;  1LOF A;  1WCU A;  4E2Q A;  1HB4 A;  1RUI 1;  4F8A A;  5LY2 A;  3AKS A;  2UUR A;  5ABJ A;  5J7M A;  1J83 A;  3DUI A;  4XFC A;  2VZQ A;  5FY8 A;  1GOG A;  1MPX A;  1XNC A;  4B1M A;  2OZJ A;  2VZO A;  2PHF A;  3ACG A;  5FYH A;  3RFR A;  4P9G A;  3BGA A;  3PVO A;  3BI3 A;  5EXO A;  2WN2 A;  5FLI A;  3L2Y A;  4WVV A;  1LEM A;  3I3M A;  2A6X A;  4BQ5 A;  2WO3 A;  3RZL A;  3CEW A;  3J7H A;  3O7O A;  4BK4 A;  2WSV A;  4ASL A;  1X50 A;  4QGL A;  4ORF A;  3RJ2 X;  1F5F A;  5D8A B;  2WSU A;  1I9R A;  2W47 A;  4XBN A;  2X5I C;  1GZW B;  1HRV 3;  1KS4 A;  3ZXD A;  3N9M A;  4HZF A;  3KV4 A;  5I8S A;  2FBE A;  2W94 A;  4XBQ A;  1W8W A;  2W68 A;  3GZU C;  2D3S A;  3MHZ A;  5B2G B;  3ROU A;  1U5I A;  2VBB A;  1IGO A;  5L9B A;  3W58 A;  3KSC A;  5JZG A;  2ZZJ A;  2DCJ A;  1PZ8 A;  4IEP A;  4IV3 A;  4IUG A;  3EXU A;  4FPH A;  1AR8 2;  2NZ9 A;  1IZ3 A;  1XYN A;  3FBY A;  4X8N A;  1Q8Q A;  5BUV A;  2RMU 2;  4OMC A;  1VBA 3;  3CU7 A;  5A6Y A;  2DVB A;  4COV A;  4A7Z A;  4HET A;  1UOB A;  4CUC A;  3E6D A;  1AUY A;  4FOW A;  4YYO A;  4OUE A;  4LHK A;  5FZ0 A;  2JDZ A;  3RPQ A;  3NKG A;  5FYT A;  3VHP A;  1QQP 2;  1TMF 2;  5GZD A;  1UY4 A;  2W39 A;  5I8T A;  1VAK A;  3ES4 A;  2A1X A;  3KCX A;  3ZLI A;  3WXP A;  4E9K A;  1LOA A;  3I2J A;  3HWJ A;  2RM2 1;  4LK6 A;  4XF9 A;  4ATE A;  5AC9 2;  1AYN 2;  2WFF 3;  4XUQ A;  3ZFE C;  2QE3 A;  1K5M C;  2Y6F A;  1RMU 1;  4LE3 A;  1ENQ A;  1RUJ 1;  1BK0 A;  3E5U A;  3DKW A;  5DZE A;  1WCS A;  2PHX A;  4G3Y C;  3GZA A;  3LDR A;  4H7M A;  4YLZ A;  5IK8 A;  3H50 A;  3U4X A;  3ZN5 A;  1T2X A;  2Q8C A;  1SAC A;  3ZMN A;  5IVC A;  5LZ6 A;  5IK5 A;  1V6I A;  1CAW A;  1K45 A;  1CIY A;  3WOG A;  1LUL A;  4YVS C;  3NNM A;  1VAV A;  1ZBA 1;  4XDP A;  5KR7 A;  1H8T B;  4XCB A;  1O4Y A;  2X05 A;  5F5Q A;  4BMB A;  4PLN A;  1PX4 A;  4Q4V 1;  4MGK E;  4MGZ E;  1PHM A;  3C7O A;  3BU0 A;  4NE9 A;  4QPI C;  2Q1M A;  4LOT A;  1H2L A;  3WR0 A;  4AHZ A;  1PK6 A;  4OUS A;  4UT5 A;  1X8E A;  4JTN A;  3KQR A;  3RZZ A;  1BEV 1;  2ZTN A;  3QAC A;  4P02 B;  1CAU A;  1F35 A;  3AL6 A;  1J3Q A;  4N53 B;  3EJK A;  1ASJ 3;  3J26 N;  1XSR A;  1HIX A;  2ETE A;  2GP3 A;  3CLP A;  2QTW B;  4P08 A;  2YC4 A;  2NLR A;  5FLJ A;  3VZM A;  1XXN A;  2ARB A;  4D0Q A;  1C8M 2;  4ZY9 A;  4GXL A;  1W9S A;  5FYC A;  5FY9 A;  4O9G A;  2P1B A;  1EV1 1;  1S2K A;  5JR7 B;  1K5M A;  1FXZ A;  3THC A;  4KG8 A;  1UF2 C;  1O3Q A;  2LM3 A;  3T2Q A;  5IAX A;  3GDB A;  4N9H A;  3UT0 A;  1JZ3 A;  3K4A A;  1ZBE 1;  4MOA A;  1RUF 2;  2VNV A;  1GU3 A;  4GB3 1;  3WG2 A;  3S7E A;  4NUB A;  5FOJ B;  4QGN A;  3JU9 A;  4UYB A;  1GFF 2;  2FDI A;  1PM7 A;  1PX3 A;  2HWF 1;  1QF3 A;  2WIN B;  4LBQ B;  3IAP A;  4LBM A;  3N7K A;  1SPP A;  4YVS A;  3T4V A;  4YW5 A;  4EZH A;  2XJR A;  1OPM A;  1AR9 1;  5FYV A;  4LUM A;  3M3O A;  4AFD A;  3AP7 A;  2OA2 A;  5F3I A;  5LA2 A;  1CZS A;  2VH9 A;  2JG9 A;  4QPI A;  1ODN A;  5DMY A;  2E6V A;  4O9E A;  1W04 A;  2YYO A;  3ZXL A;  1OMI A;  1XND A;  3UET A;  3X29 B;  5ACA 1;  3FWE A;  4A3X A;  2HWD 3;  1Y3T A;  1Z78 A;  2CWS A;  2BEO A;  2YRO A;  1I3H A;  1Y43 B;  5BNN B;  1W8F A;  4XMI A;  1VBB 3;  1PVX A;  1O6U A;  1QJX 3;  3LEM A;  4W50 A;  3MIE A;  5LA1 A;  3LDK A;  4OCT A;  3I54 A;  3VD7 A;  4AVT A;  1HX6 A;  1VBD 2;  3DCQ A;  4P9Y A;  5J1X A;  4MZU A;  3TWI A;  3WDT A;  3O1O A;  4BQ3 A;  2NYY A;  4TLG A;  3U1X A;  4A4A A;  2GMM A;  1LR5 A;  1VAM A;  4HK9 A;  4DB5 A;  3GHM A;  3JQX A;  2HWE 3;  1CJP A;  4Y26 A;  3BAL A;  1NLQ A;  4GZ9 A;  4D3W A;  4IQP A;  2V72 A;  5FR3 A;  5JXI A;  1VBE 1;  2J1E A;  4K40 A;  3E5Q A;  4IEU A;  4NPM A;  4YZ5 A;  4AHW A;  2XBO 3;  1RB8 G;  4LIV A;  3PVB B;  1RUC 3;  4JGZ C;  2J7M A;  1Q8O A;  4COW A;  4QMA A;  2YFU A;  2FZ2 A;  2RS3 3;  4AXO A;  3LSD A;  4KMQ A;  4LOR A;  4LKD A;  4UFL A;  1U5Y A;  4DQA A;  5C9A C;  4CEY C;  4URA A;  3H7J A;  1Y4W A;  1SQ4 A;  3O5S A;  3QD6 A;  1PZ9 A;  1AL0 G;  1WME A;  3IDC B;  5DUW A;  3TN9 2;  4CDX A;  5IFT A;  2KXL A;  3ZN4 A;  5JSR A;  1OKQ A;  3AKR A;  4EN7 B;  4N7U A;  3ACF A;  4PI2 A;  3KVB A;  4JKK A;  5A7N A;  2D97 A;  1REE A;  1EPW A;  3JBG 3;  3ZYJ B;  1FOD 1;  1Z7S 1;  1IPJ A;  2JJ6 A;  5K0U C;  2Z42 A;  2VZU A;  3INA A;  1VJ2 A;  1D2Q A;  2A75 A;  3A23 A;  1F9K A;  4RGA A;  5B4X A;  1UOF A;  3PLQ A;  5FZ8 A;  4NIH A;  5I0R A;  3MIH A;  3RSJ A;  3GJA A;  4PDW A;  2P3I A;  2EF6 A;  2XUE A;  3BTZ A;  1C1L A;  2RS5 1;  2WWS A;  5KWR A;  5L7O A;  2W87 A;  1LU1 A;  2VCA A;  4Q2F A;  4FOV A;  3U10 A;  5I0S A;  2XQX A;  4XF3 A;  4FFF A;  5K7P A;  2P34 A;  3AZW A;  1LOG A;  4ZU7 A;  2X5I B;  1WD4 A;  1KEX A;  4FXG B;  2IZW A;  2BVV A;  1CAW B;  1COV 1;  4P9L A;  5DDJ 1;  1J84 A;  3OD4 A;  3KS7 A;  3NVC A;  2DUP A;  5FZC A;  3NL1 A;  4A45 A;  2BJS A;  3UGF A;  4F83 A;  2Q1Z B;  3LB9 A;  2OVU A;  5FMO S;  5KBF A;  3K46 A;  4EWA A;  4AI0 A;  1HJF A;  5JOY A;  4Y1V A;  2TBV A;  5HCB A;  5HXV A;  4CCK A;  2IVJ A;  2ZBJ A;  4COY A;  4EV0 A;  3FZ3 A;  3ZYF A;  1AR7 2;  2CDP A;  4UF0 A;  4AL9 A;  3LKJ A;  3O1V A;  2X29 A;  2ZAH A;  4JGZ A;  1NT0 A;  2P6H A;  4BM8 A;  1NY7 2;  4NWW A;  3SIT A;  1O7F A;  4NAO A;  3WUD A;  3LFI A;  4FFI A;  1CAU B;  1UCX A;  5C9A A;  1MEC 3;  5CB7 A;  3OCP A;  4CEW C;  2J1V A;  2D5H A;  2WAB A;  1ULD A;  3FUQ A;  4FAG A;  3H0O A;  4OQ9 A;  3P3N A;  5T5O A;  1VE0 A;  2UYB A;  3HBK A;  4KNC A;  4UW3 A;  2V5Y A;  4BQ1 A;  4D6S A;  3WF4 A;  4Q1P A;  5K0U A;  1MZ6 A;  5F5A A;  1WCK A;  4AFC A;  1R08 2;  4FI9 A;  3GM8 A;  3ZFE B;  1K5M B;  5FZ4 A;  3C3V A;  4CDQ C;  1OT5 A;  1ULE A;  2RE9 A;  4MXW B;  4PLO A;  1JHN A;  3WDV A;  2VOK A;  2ZAB A;  3C7G A;  2PN5 A;  1B35 C;  2PHT A;  4QX7 A;  5JVV A;  5IVF A;  2ZPX A;  4GH4 C;  3SC7 X;  1UMZ A;  3VD5 A;  2JDH A;  1S0B A;  4FTB A;  4L2N A;  3T2T A;  4YVS B;  3LD8 A;  2RS1 1;  2ZEW A;  1PO1 3;  1ND2 C;  2A3Y A;  3LIH A;  1H2N A;  4LTA A;  2B4K A;  1IS5 A;  1OF3 A;  1EY2 A;  2ADE A;  5FZ3 A;  3JD7 3;  4V2W A;  4YW4 A;  1D4M 2;  3AL5 A;  5FRE A;  5JR2 A;  1LGN A;  4EQV A;  3PTR B;  4OLL A;  3I59 B;  2ZX4 A;  2GAL A;  1DZQ A;  4Q0U A;  2ZHN A;  2E33 A;  4Q8K A;  3R0R A;  4KU7 A;  5HPO A;  3WUC A;  4IGQ A;  2CY6 A;  1RUJ 2;  1AR8 3;  1DQ6 A;  2FMY A;  1LGB A;  3LEK A;  2W52 A;  2GH2 A;  2UWC A;  4QDQ A;  4DPN A;  5C8W A;  2RMU 3;  1UD1 A;  1DYO A;  2Q1F A;  2YBP A;  1WA6 X;  3POF A;  4CVU A;  4H14 A;  4OYU A;  4XHB A;  2OUJ A;  5JMC A;  2YPD A;  2R04 3;  5IVY A;  3WD5 A;  2GU9 A;  1I6X A;  1QQP 3;  5FPX A;  4QKF A;  1YRZ A;  5SV5 A;  2VMF A;  4XET A;  5D21 A;  1UU6 A;  5FMO L;  2FDJ A;  1VB2 A;  1NYW A;  1NA1 C;  1ZBA 2;  2FMD A;  4DRR A;  3OBA A;  5IVB A;  2ZKN A;  1W6M A;  3DGT A;  2ZAC A;  1GP6 A;  1ENR A;  1CN1 A;  1SCR A;  1X7N A;  3K51 A;  5FP8 A;  1ZA4 A;  1AYN 3;  5AC9 3;  5HV0 A;  2D6K A;  2OQ7 A;  2B42 B;  2YGM A;  3N35 A;  1B35 A;  1UOG A;  5EZW A;  4LA2 A;  3PUQ A;  5FY4 A;  4YVW B;  3Q8A A;  1KFU L;  3H3Z A;  1QH7 A;  5FKC A;  4DOU A;  2J42 A;  1V6L A;  2WR9 A;  3K3O A;  1S0G A;  5EYY A;  1W8U A;  1JOP A;  2IVI B;  2ZZQ A;  3PIJ A;  4AR2 A;  4DRV A;  4NN0 A;  3PU3 A;  4FPC A;  2WAO A;  4AFB A;  3I3D A;  3LWC A;  5AVA A;  4BIS A;  2DWR A;  3MDP A;  1O5U A;  4L0P A;  2W2I A;  2VXR A;  3VBS C;  5FFO C;  3AP5 A;  3NAP B;  3P5B A;  1C5H A;  3AZX A;  1XB9 A;  1WLW A;  3UNP A;  4YWA A;  4AEM A;  2IXH A;  1LCL A;  5EPA A;  2JEM A;  1POV 3;  2QUO A;  3OY8 B;  4UFH A;  5L19 A;  3HBZ A;  4YW3 A;  2DVA A;  3ZYP A;  2G1M A;  1JU4 A;  5AFB A;  1GQP A;  1W8T A;  4E2G A;  3O12 A;  1DGW X;  1WMF A;  1WBF A;  2XJS A;  3MIB A;  1RJ8 A;  2AC1 A;  2QQN A;  3AK0 A;  4AW7 A;  1HB3 A;  4BQW A;  1NCR C;  4FCA A;  4U2A A;  3E6B A;  1NZI A;  1AYM 2;  4LHS A;  1HW5 A;  1KDK A;  5A7Q A;  4DEV A;  3AM2 A;  4OQ8 A;  3MW3 A;  4P9I A;  3CJI C;  4MX3 A;  1LHN A;  1DBN A;  1U0A A;  2HWF 2;  2GND A;  2IXJ A;  2PHW A;  1M4W A;  5JOX A;  4KWU A;  4CA9 A;  1C8M 3;  1NA1 A;  4XUO A;  1WCQ A;  2K46 A;  1AZD A;  1W8H A;  1WZX A;  3OJB A;  1TME 1;  4QT6 A;  1PVC 2;  2J1U A;  4O7X A;  1R64 A;  3BPS A;  5A70 A;  2AR6 A;  1ZNP A;  2NN8 A;  2ZML A;  4Z82 A;  5I91 A;  4ES9 A;  3R6S A;  3NNL A;  4HSJ A;  2D5F A;  4PLM A;  4RQP A;  5JUV A;  2FZ1 A;  2YFZ A;  4FP2 A;  1CZT A;  2J1A A;  2CSG A;  1OUS A;  3R4D B;  5DZF A;  1EUT A;  1RUF 3;  4QX8 A;  4XZU G;  5A3N A;  5DG2 A;  1BBT 2;  3WHU A;  2UYA A;  4B7K A;  3L2H A;  5LRR A;  1Q3E A;  1GV9 A;  2SLI A;  4CEY B;  4RGG A;  5A7W B;  3V65 A;  3ZSE A;  1MEC 1;  4S2G A;  2BFU L;  3DPR C;  2ZGQ A;  4GMP 1;  1ZZ9 A;  2WZR 2;  3VBS A;  5FO8 B;  3B02 A;  3RZG A;  1W3X A;  2PMW B;  2Y64 A;  3IZO A;  1WUV A;  2PHU A;  2R7E B;  3MO4 A;  4PF1 A;  2JDY A;  5DZG A;  5K0U B;  5BNP C;  5LK7 B;  4C8D A;  2E32 A;  2XWB B;  4HOO A;  4LHL A;  4Q0P A;  3VKL A;  1G9B A;  3GGL A;  3J4U H;  1VBE 2;  2C0Z A;  4AGG A;  2DCY A;  5A3P A;  5IAV A;  1NCR A;  3WIN E;  2YXS A;  4HT1 T;  1XU1 A;  3C7H A;  4GKY A;  2JE7 A;  4YM1 A;  1AL2 2;  3EQE A;  3B9I A;  4NPL A;  1PO2 1;  3CJI A;  2VC9 A;  3POS A;  3POE A;  1HN1 A;  4Y20 B;  4XQD A;  2BVB A;  4IW3 A;  3AYC A;  3FLR A;  5FLH A;  5KXB A;  3ZIW A;  1N1Y A;  1J58 A;  2VMD A;  3WW3 A;  4AQ6 A;  3V0B A;  3VDA A;  4RS5 C;  1X36 A;  5JMO A;  2QQP A;  5FOB B;  5FZA A;  3R05 A;  2VZR A;  2IFR A;  4U36 A;  4Y22 A;  3MLJ A;  1Q56 A;  1FOD 2;  1Z7S 2;  5D8A C;  4JQT A;  5F3G A;  3VBH A;  2D3R A;  2E63 A;  1DFQ A;  4XBL A;  2VUJ A;  1R1A 3;  5LB6 A;  2W46 A;  1DLL A;  4Q4X 2;  2RS5 2;  4KI5 M;  4JHT A;  5HXM A;  1YNA A;  3WSO A;  4BPZ A;  2ZEX A;  4YAR A;  3AMH A;  4K21 A;  4CEW B;  2OUH A;  2PHR A;  4CYD A;  1JOD A;  3M3C A;  3H8O A;  4I09 A;  3KMH A;  1AR6 2;  5CKQ A;  1YIP A;  1XU2 A;  2JDK A;  2X53 S;  2ZGL A;  4OI4 A;  5GLW A;  3TN9 3;  2OW4 A;  1UZ0 A;  1GQG A;  4IXL A;  2A6V A;  1NLS A;  3H8U A;  4PJY A;  1UY2 A;  4CDQ B;  3GBG A;  5EYX A;  5GJ6 A;  3WP6 A;  2QQW A;  1W28 A;  4K6B A;  2VW2 A;  3MEP A;  4WVZ A;  2DVF A;  4GKX A;  1B35 B;  4FQZ A;  3UV9 A;  4LUK A;  1RUG 2;  5BPX A;  4QPG C;  4NJ4 A;  4GH4 B;  1F5J A;  1WWY A;  4DNY A;  4JAA A;  4EN0 A;  4OZX A;  3AKT A;  2VCB A;  3WZ1 A;  4MHR A;  3S57 A;  2CL2 A;  2BP6 A;  1ND2 B;  2UY8 A;  3UL2 A;  3Q8C A;  4RS5 A;  2EAK A;  4YFZ A;  1AJO A;  1T6B X;  1H30 A;  2BUK A;  3BKZ A;  3UGG A;  3N9P A;  3GF6 A;  3M8L A;  1JYC A;  5D8A A;  2UY9 A;  2DBI A;  4NHM A;  2LRP A;  1ZRI A;  1OQE A;  3AZV A;  4QQP A;  4D7T A;  4M3C E;  5JDB A;  5L9R A;  1VR3 A;  4O65 A;  4PIY A;  2W9X A;  1AR7 3;  1POV 1;  4R4X A;  2D6N A;  1F4H A;  1DDL A;  3HT1 A;  3UYJ A;  1S0F A;  4YSF A;  2XUM A;  1VMF A;  1YWK A;  3DYM A;  3LPF A;  1RXF A;  2P37 A;  3LA2 A;  5GLU A;  1PGW 1;  1RYY A;  2ORX A;  3MGU A;  2VNO A;  4K8F A;  4BLI A;  4D69 A;  4ZPI A;  3VUO A;  2CWM A;  2ZX2 A;  4XJW A;  2ARX A;  2V73 A;  2P17 A;  4X6Q B;  5CFD C;  3HAG A;  3PJY A;  1UYX A;  2Q30 A;  1VRB A;  1F8V A;  2PLV 2;  3WG1 A;  3CO2 A;  4Y1Y A;  4N53 C;  1R08 3;  3O0V A;  4NIA A;  3T09 A;  4JQR A;  3LCP A;  1GZ9 A;  4QDS A;  1JYW A;  1S2B A;  1N3Q A;  1MQT C;  3OGV A;  2FDK A;  5A6Q A;  3J8F 2;  2WT2 A;  1DGL A;  1PMH X;  2GDF A;  2O8O A;  1OFN A;  2R16 A;  5FYU A;  1XNA A;  5A3O A;  2EIG A;  1JW6 A;  4N8M A;  1GWL A;  5FYS A;  2VTX A;  1ZRF A;  1HKD A;  4KBZ A;  1N1S A;  1IHM A;  4E27 A;  1K12 A;  2CTV A;  1QJZ A;  4IL7 A;  4ZU5 A;  5T5J A;  4AVB A;  1R09 2;  3AZZ A;  4V1P A;  5FPU A;  4RYD A;  1VMH A;  4YW6 A;  3H1M A;  3WW2 A;  1CX4 A;  5KHK A;  4ONU A;  1V0A A;  5FPB A;  1V9U 1;  3QH7 A;  1D4M 3;  4JX0 A;  2AAC A;  2EIB A;  4MVT A;  2GH8 A;  4LJH A;  3AJZ A;  5HCA A;  2FDG A;  4BCU A;  2QDR A;  1L7Q A;  2H6C A;  4DXT A;  2JEN A;  4YG0 A;  4XJZ A;  2ZGR A;  1JZ5 A;  3ZKY A;  4CUG A;  1RUE 1;  4TSV A;  3WW1 A;  5C5U A;  2O14 A;  2R06 3;  4BA6 A;  3CJI B;  4DIN B;  4UBH A;  3B9C A;  2WZP P;  4DFS A;  1VRH 2;  2DTW A;  4UWD A;  1GNH A;  1H6X A;  2YU2 A;  2YUE A;  1LEC A;  3F2Z A;  1JS9 A;  4XUP A;  1QJY 2;  5E16 A;  5CFD A;  5CZK A;  4MG2 A;  2RG4 A;  4RHV 1;  3SNM A;  2O1Q A;  4L11 A;  4MUV A;  2Z5W A;  3VDC A;  1HLC A;  4LO7 A;  4IV1 C;  4YGB A;  3B01 A;  4N53 A;  4LOS A;  3U14 A;  1GMM A;  1KS5 A;  1QDC A;  4CSW A;  3HNY M;  3E5X A;  1VP6 A;  4GWM A;  2VMG A;  3TOJ A;  2WC2 A;  4HVR A;  1TEI A;  1E5I A;  2E7Q A;  5FV3 A;  1NG0 A;  2R1D A;  3U0Z A;  1R1A 1;  5GM0 A;  3ZXF A;  4BXF A;  2OPK A;  2LTN A;  1OA2 A;  4LKE A;  4XF0 A;  2BU9 A;  3RYP A;  2K9Z A;  3DPR B;  1YUD A;  5KHH A;  1HXS 2;  4AWD A;  5FWE A;  4XFF A;  1MS1 A;  1UO9 A;  1EAH 1;  4XTP A;  3V56 A;  2D7F A;  4LIT A;  5FXZ A;  4CP9 A;  4DY5 A;  5BNP B;  2L9L A;  3DN7 A;  3DV8 A;  2DDU A;  3FL7 A;  4LBQ A;  2NPI A;  1FPN 2;  4OI1 A;  4Q4W 1;  4NVP A;  4I3P A;  5KHI A;  2JB4 A;  4D94 A;  5GZC A;  4O61 A;  1GR3 A;  2DCK A;  2JDP A;  4QHZ A;  5I0U A;  1QJE A;  3PDQ A;  2A71 A;  5JXG A;  4WVW A;  1H6Y A;  2VL4 A;  3FN9 A;  3DYO A;  2ZX0 A;  4XIL A;  1OLM A;  3POG A;  1AYM 3;  1A34 A;  5DG1 A;  1YI7 A;  4MHU A;  1WCD J;  5IYY A;  4M4P A;  1ZM1 A;  4XW3 A;  2MEV 1;  2E31 A;  2WBK A;  3AYD A;  4NRM A;  4DUX A;  3O1T A;  1BK1 A;  1BHG A;  4RS5 B;  5F2W A;  1UY0 A;  5CA6 A;  4ZZ8 A;  3TAY A;  4BYY A;  5J98 B;  5BNN A;  2Q0A A;  3WX5 A;  4Q0Q A;  2PHL A;  2VMI A;  1YQ8 A;  1PVC 3;  3ETQ A;  3NV1 A;  1RHI 1;  4H3W A;  4QDR A;  4XMA A;  4E4H A;  5J36 A;  1KIT A;  1J3P A;  3SEE A;  1UU4 A;  1JYV A;  1DZT A;  2HLE A;  3AX4 A;  3TEZ A;  2PYT A;  2NQY A;  2ZS6 B;  5B4N A;  1DHK B;  1Q8V A;  3KGZ A;  3QH6 A;  3HEI A;  1PIV 1;  3NW4 A;  1BBT 3;  1WW7 A;  4NHK A;  3ZXG A;  4FOY A;  1YQC A;  4Q4Y 3;  3U4S A;  4JRA A;  3AKP A;  2VGD A;  1NZC A;  5F5C A;  2R32 A;  4I02 A;  2HWB 1;  3UGH A;  3WF3 A;  1PGL 2;  1RVF 1;  2RV9 A;  1CD3 G;  1TG7 A;  3ME2 A;  1FX5 A;  3LIG A;  4HBN A;  4HSL A;  4M4R A;  4N90 A;  4RR3 C;  3IKW A;  3CDZ B;  4TYS A;  3EO6 A;  4A7K A;  1JYN A;  4IE7 A;  5A7O A;  3ZN6 B;  2BBA A;  5FPZ A;  4CCL A;  4IGP A;  3W59 A;  2VUC A;  4M3C F;  5JIU A;  4CRQ A;  1DYP A;  2ID4 A;  4MGS A;  3WNO A;  1HB1 A;  4J6G A;  4JHZ A;  2ZGN A;  5IHR A;  3ZDV A;  3FJS A;  4LXL A;  1DQ1 A;  3FHQ A;  3QOP A;  4LMF A;  2Y38 A;  2R49 A;  4QPG B;  1BQP A;  3MI8 A;  1JOJ A;  4QX1 A;  5A3W A;  3I2F A;  1E5R A;  3T0D A;  1AL2 3;  1WLC A;  4IEZ A;  3UJQ A;  4JDO A;  1KQR A;  1QY4 A;  2ARC A;  2TUN A;  3M3E A;  2GP5 A;  4WZF A;  4DUV A;  5C3P A;  1V00 A;  2I2S A;  2ZGS A;  3BOD A;  4QU1 A;  3PJQ A;  4P5H A;  3TB0 A;  3VV1 A;  1UAI A;  1L3J A;  1QJU 3;  2VCC A;  4WBB A;  3M1H A;  4LPL A;  4YGE A;  4AHY A;  2X5I A;  4J1W A;  4IGO A;  2Y34 A;  5GKA C;  3UK9 A;  4D6R A;  5A1L A;  4OUM A;  4NID A;  2BW8 A;  4GUL A;  1VIW B;  1RUD 3;  1H1I A;  5FZG A;  5FY0 A;  1NE6 A;  1OOP B;  4J25 A;  1UMH A;  4Q4X 3;  3IM0 A;  1YFX A;  1E5S A;  4ARX A;  1HB2 A;  2QDN A;  1C57 A;  4B4Q A;  1V6N A;  3ES1 A;  5A1F A;  4XJU A;  4OHY A;  1FMD 1;  5L9V A;  4FQ4 A;  1KRI A;  1BJQ A;  1CX1 A;  5CFD B;  3PUR A;  2XVG A;  2VCM A;  4WV8 A;  4N43 C;  1M06 G;  1IKQ A;  2AEZ A;  3ABZ A;  3ZM8 A;  1B09 A;  2F17 A;  5HBA A;  2FCU A;  1L7R A;  2J22 A;  1CQ9 A;  2P3J A;  1DQ2 A;  2JE9 A;  2Z4F A;  4QWN A;  5KC5 A;  1MQT B;  2QQU A;  4DS0 A;  3CNA A;  2C5D A;  1UZY A;  3LOI A;  1IQA A;  3CKH A;  2B5H A;  1WKY A;  3ZFE A;  1CPN A;  1W03 A;  1XSQ A;  1VBC 3;  3VHO A;  3BVC A;  2PAM A;  4MXW A;  1RUH 1; 
#chains in the Genus database with same CATH homology
 4NMI A;  3KT7 A;  5A3U A;  5LBC A;  3EMR A;  3MGU A;  4Q5O A;  4Y5S A;  4ZPI A;  2JIG A;  5EQU A;  4JZR A;  5DAQ A;  4NHX A;  2HBT A;  3GJB A;  4XC9 A;  3OBZ A;  5IAT A;  4NHY A;  5DAX A;  5LA9 A;  5EP9 A;  2V4A A;  2A1X A;  5IAV A;  3HQR A;  4NHK A;  4XCA A;  4KBZ A;  2JIJ A;  4IW3 A;  3ITQ A;  3HQU A;  3PL0 A;  4XAB A;  5LBB A;  3OUI A;  3NNJ A;  3KT1 A;  3NNM A;  4XCB A;  5HV0 A;  5LB6 A;  2HBU A;  3NNF A;  4ZON A;  3GJA A;  5C5U A;  5LBF A;  3OUH A;  5C5T A;  2RDN A;  5DAP A;  4XAC A;  3W20 A;  4UWD A;  5DAV A;  4BQY A;  3DKQ A;  2RG4 A;  2RDR A;  5M0T A;  2Y34 A;  5LAT A;  2FCT A;  2Y33 A;  3GZE A;  4NHL A;  2RDQ A;  5EPA A;  5LAS A;  2RDS A;  3W21 A;  5LBE A;  4J25 A;  2G1M A;  4Y5T A;  5IAX A;  4BQW A;  2OPW A;  5L9V A;  3KT4 A;  2FCV A;  4NAO A;  2G19 A;  4BQX A;  4MHR A;  3OUJ A;  2FCU A;  5HV4 A;  4XAA A;  4NHM A;  5L9R A;  3NNL A;  5L9B A;  3BVC A;  5ERL A;  5DAW A;  4MHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...