3BVCA

Crystal structure of uncharacterized protein ism_01780 from roseovarius nubinhibens ism
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
203
structure length
203
Chain Sequence
SLSLFVTRLYHAPLSDHGPAIDAEEMESSCYAIAEDDEAGQGWCEENGYPGYTSYASLTDLPWRFPIFADLVKSLDAHVAAFAEDLEFDLDGRALELEDLWINILPEGGSHASHIHPHSVISGTTYVSMPGGTSALKLEDPRHAMMMAAPARRKTARDELRQFIYVTPAVGDVLLWESWLRHEVPMNMSEDDRISVSFNYRWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Ism_01780
publication title Crystal structure of an uncharacterized protein Ism_01780 from Roseovarius nubinhibens.
rcsb
source organism Roseovarius nubinhibens
molecule tags Structural genomics, unknown function
total genus 44
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13759 2OG-FeII_Oxy_5 Putative 2OG-Fe(II) oxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3bvcA01
3DKQA 2HBTA 5EP9A 5LA9A 3NNLA 3OBZA 4NHLA 5M0TA 2Y34A 5DAXA 3GZEA 4XACA 3GJAA 3KT4A 4JZRA 4NHMA 2FCTA 4Q5OA 5EQUA 5DAVA 4BQWA 2HBUA 3OUJA 3MGUA 5LATA 4XABA 2V4AA 5LB6A 5LASA 5HV0A 3KT1A 2G1MA 5L9VA 2RDNA 2Y33A 3BVCA 4MHRA 3OUIA 4NMIA 2FCVA 4XCBA 2RDQA 5IAVA 2RG4A 4KBZA 5LBFA 4NHKA 4BQYA 5IAXA 5IATA 3PL0A 5C5UA 4NHYA 3NNJA 3NNFA 3ITQA 4ZONA 4UWDA 4MHUA 5DAPA 4NAOA 4XC9A 3W20A 2RDRA 4ZPIA 3KT7A 5L9RA 5DAQA 4XAAA 2JIJA 5A3UA 5HV4A 4IW3A 3EMRA 5LBBA 4NHXA 4Y5SA 2OPWA 5L9BA 5DAWA 2A1XA 3OUHA 5LBEA 5EPAA 2G19A 5ERLA 2RDSA 5C5TA 2FCUA 3GJBA 4XCAA 4BQXA 3W21A 3NNMA 4J25A 3HQRA 3HQUA 5LBCA 4Y5TA 2JIGA
chains in the Genus database with same CATH superfamily
4AEDA 1V6MA 2XHNA 1MACA 1UMHA 2A6YA 4QKFA 1NLQA 1QEXA 3Q8EA 2BEOA 4FFGA 1VBD2 4A4AA 5M0TA 4I0BA 2X5IB 5T5LA 3UETA 3SH4A 4FQZA 1W6QB 2PHWA 3LWCA 3UGHA 3WHUA 1LOEA 1VAKA 1JOJA 4ISRA 1UX6A 3ZN6A 3LSDA 4CCDA 4I0WB 1FAYA 4Q5OA 1PO23 4EWAA 3KS7A 2RM22 5BNOC 5A33A 5FOJB 3NVCA 5JMOA 4KQ7A 5A3PA 3KV4A 1H8TA 2ET1A 1O6UA 1VIWB 3IAQA 1TME1 4YG6A 3WF0A 1AF9A 1EAH2 4XW3A 1HQNA 3ZMNA 5C9AB 5EYYA 3W5NA 3CZUA 2B8MA 4QX0A 1H6YA 4QX8A 1DBNA 2ADEA 4O61A 2NQYA 5H9RA 1O5UA 4S2HA 5JOWA 2XVGA 3OBAA 4NMIA 3E6BA 2I74A 2FCVA 1GV9A 3WNNA 1JBCA 2FDGA 5ANQA 1DGWX 4M01A 1KFUL 1MS9A 1Q8SA 3CJIB 3DUIA 3FLPA 4DY3A 3V0AB 2H0VA 2W91A 3BPZA 2XJVA 3OEAA 3NW4A 3VBSB 3RZZA 1B35A 2CY6A 4AQTA 3VDBA 4ZHNA 2XOMA 4MUVA 5C6CA 4LBQD 3ACHA 2B9VA 3RZGA 2ZMNA 3UKTA 1DLCA 1RB8G 2ZGNA 5JMCA 2D6NA 5ABJB 1GOFA 3FFZA 2XJRA 3ECQA 1SBFA 2YPJA 2DVGA 1OUSA 1U0AA 3QACA 3VBRA 2FDJA 1RUH3 1WZXA 3AM2A 1MVQA 3OGSA 5FZGA 5DDJ3 3S30A 4TZDA 3U75A 4LKEA 2XUMA 2ZMLA 3NV3A 1F5JA 3POYA 3MV11 4L11A 5JSRA 3NV4A 1UZVA 2GAUA 2VL4A 3IMNA 5CBLA 1DGRA 1GICA 5LBBA 1ZRFA 2IXHA 1UW8A 2JG9C 2ZAAA 3I3EA 1JW6A 1DF0A 4OZXA 5FKCA 5T54A 5T50A 1YIFA 4CSWA 4RD7A 5FMBA 2QE3A 3OGJA 1NUKA 4BQ2A 4EJRA 3H1MA 2B5HA 4C8DA 2QQKA 3DV8A 5GZDA 1G9CA 5HXMA 1PM7A 1LEDA 4LBNA 1RYYA 1YC61 2F4PA 4ZU5A 1T6GC 1VALA 3I2DA 4QPWA 4YM0A 3AL5A 4FPJA 5B4NA 2QJVA 2YBSA 3BOWA 5GZEA 3OY8B 1CGPA 3GYDA 1KJLA 2VVFA 2XQXA 2ZA9A 4KG8A 1VBA2 2JDUA 3ALQA 5FZ4A 5E1RA 4RL7A 5FZ8A 1GZCA 2DTWA 5I0TA 1N3OA 3NNMA 5IWFA 1ST8A 5K8SA 1RL3A 4N43A 1ZBE3 3B01A 3HQRA 4XFGA 3GZUC 4YW2A 4D8MA 5KWRA 4QX2A 4YG3A 2BYVE 2CAUA 1KGYA 3PMEA 4R9BA 1HQWA 1NT0A 3V56A 1WD4A 1U5YA 2R49A 1XSRA 3ABZA 4N53A 5IK5A 4G9SB 4CZSA 4K21A 3ROUA 4GAZA 2WQZC 1XYPA 3QH6A 3PVBB 1VBC1 4CE8A 3I2HA 2IWGB 3H1YA 2VBBA 1AR61 4LBLA 4Z82A 2AACA 4JDMA 1LHUA 3OPTA 4OUSA 3HN3A 3F95A 4XBQA 5DAVA 5DZEA 3WEZA 5C9AA 2WT1A 4V2WA 3JXSA 2PHUA 4PDWB 1S2KA 2WDBA 3C2UA 1PNGA 2A6VA 4SBVA 1FT9A 3UNPA 3C3VA 4B4QA 3K75B 3UGFA 4OHZA 3E1F1 4YGCA 5HV0A 2RS31 2ATFA 2WN3A 1XNDA 1ENRA 2A6WA 4Q1RA 3MIGA 3AYEA 4IL7A 2VTXA 2PAKA 4HPKA 4W4ZA 2J1RA 3IDAA 3USUB 1YFXA 3CJIA 5C4WC 4J1WA 1ALYA 2RDQA 1NQDA 1QHDA 1HRV1 2W87A 3L2YA 3LQCA 2CWSA 1HJFA 3THCA 3WF3A 2BBVA 4KBZA 2VZRA 2C26A 1DFQA 4XUOA 4A6SA 4NWWA 4Y1VA 5FO8B 3KB5A 3WQ7A 2BGOA 2Q5TA 2VG9A 3HPNA 3POFA 3ZYRA 2OS2A 1R093 5FY8A 3USSA 2PHXA 5DZGA 4YW1A 4B3NA 3C7GA 4XDPA 4RS5C 4UYBA 2WWSA 4LKDA 2X05A 3B9IA 5F1RA 3MIDA 2C9KA 4M3CE 4O65A 3WVJA 1CAVA 3VDDC 3ZSJA 3AFKA 2CGNA 3H7YA 3UESA 1T6BX 2VOVA 3FE5A 4XFFA 5T55A 3O12A 1HXS3 1LR5A 5FTTC 1CPNA 4YW4A 4Q29A 2CL2A 1A78A 1RUE1 2JIJA 4AI0A 5AFBA 1H2LA 4AVVA 5IVEA 4NIGA 3AMPA 4K20A 5IHRA 4Q27A 1YXWA 3Q8FA 4EE2A 1YJLA 1G9AA 2PN5A 4OVEA 1FX5A 2JE9A 5FXWA 5HCBA 4AR2A 2XQRA 3JBG3 1AR62 4PI0A 3R05A 4Q0VA 4AEJA 1VLNA 1DQ0A 1OD3A 2XJSA 2VGDA 2HWF1 4QHOA 5IVFA 3OY8A 2R32A 2JB4A 2TEPA 4OUMA 1URXA 5J36A 3I3MA 4YZ3A 1QKQA 3UKVA 1WCQA 3V0BA 1UX7A 1D0GA 1JZ2A 4CA9A 3IPVA 1V70A 2VMFA 2RS32 1QOSA 2ZEZA 2WL1A 4KG0A 1M4WA 3VD3A 3BTAA 2XLGA 5IVCA 3WG3A 3E6CC 2WS93 1J1TA 5FJKA 3H8XA 4FQ4A 5BNNC 1WBFA 3RYKA 4YLZA 3BCWA 3AKTA 2NLRA 2HWB1 3J8F3 3WW1A 4A2UA 3AZWA 2D3SA 3I3DA 1IPKA 2BZDA 1QMJA 1AR91 1TNRA 4QX3A 4AHYA 1APNA 1N3PA 4BIOA 4CVUA 1LOGA 2HBTA 3D3AA 2R0FA 4JGYC 1CJPA 3LGRA 3LEGA 1SG3A 4RN5A 3AYAA 3T3YA 3INAA 3MF6A 1V6NA 4AF9A 3O0VA 4Q4Y1 4LTAA 1AX0A 1RVF2 2P3IA 4JGZA 1PK6B 2WO3A 5FY5A 4GQ7A 3OF1A 4LA2A 5DAXA 5KR7A 5C70A 4CTEA 1XNCA 2WO1A 3T0AA 2VMCA 1PVC3 4RYDA 5FZLA 4YVSA 5FPAA 5FK8A 4WM8C 2FZ2A 4E2QA 1EPZA 2Z69A 4L0PA 1F31A 1UZWA 1PGSA 2CSGA 3OUJA 5FJHA 1PO22 4LKFA 3VKLA 3ILRA 1WLTA 1AYM1 3KV9A 1IQDC 4RSUA 3VZJA 1OQ1A 3OYWB 1DHKB 1EV13 2D7FA 2VU9A 4CXYA 1Q3EA 1JTZX 1DQ5A 2EXJA 2A71A 1IHMA 1NA1A 4W6XA 4ASKA 1XRUA 3KT1A 3USUA 5A1AA 2MPFA 4CUBA 4L92A 1H4GA 4Y1XA 2YBPA 2EVXA 3HJRA 3ACLA 4MO3M 1K5JA 4AI3A 5CISA 3ME2A 5I0DA 5LA1A 3VUOA 2RMU1 3I4IA 5KHKA 2E6VA 3OOXA 4CU9A 5EHDA 2ZX3A 1TEIA 2VZQA 2XXZA 2VO5A 4XE9A 1NLRA 2MEV3 4MGKE 5K4LA 3ZYPA 4QDSA 3NJVA 1AL21 5J98B 4OQ9A 5I8TA 5FY4A 3U4XA 4CUCA 4HZFA 1OVPA 1RJ8A 2UY9A 4Z1VA 1S1AA 4K40A 1VB4A 3VZNA 4LOSA 2JDYA 1ZRRA 2Y60A 5H9QA 3N9LA 5A7QA 1H0BA 2RS11 4BK5A 5L7OA 4TTGA 3ZXLA 2YC4A 3AKQA 2VCBA 2WINB 4UFMA 4YNIA 5DAQA 1AR81 1OVSA 4CDQC 2YYOA 1H1MA 3MFCA 1UAIA 1RUH2 2FDIA 4NUBA 1HB1A 4QPGC 3D0SA 4KNCA 3PHMA 5DDJ2 1PIV3 1CWPA 1XYNA 3LA2A 5GLUA 1W8OA 4RHV1 4P00B 4NAMA 1GMMA 1YLLA 4CCMA 2F17A 2GH2A 1JZ6A 1AYN3 3BODA 1POV1 1MZEA 5CKMA 3NAPC 1IZ3A 5KBFA 4KWUA 3NV1A 3CKHA 5FZ7A 2VE1A 5JR7B 3LOIA 4DNYA 5FZ1A 2XH6A 1GR3A 3LIHA 2VZTA 3U78A 2EF6A 1DG6A 1OHFA 2V73A 5FKBA 2BJSA 2W1UA 4WV8A 3BTXA 5LZ6A 2AZ5A 1AR72 3HEIA 4DY5A 4DB5A 2ZX2A 3HBKA 1UY3A 3WDWA 3M7AA 1K5MC 4RGGA 4UF0B 1QIQA 4AXOA 4R9CA 4OI1A 1WGPA 2VQAA 4UBGA 5A6YA 5A3NA 1DLLA 1W03A 4LBQA 1R091 5GZGA 1O3RA 4IXLA 5F5CA 1N1VA 4Z07A 2E31A 4J25A 3VD5A 1RINA 1Y43B 4GH4A 1WLWA 1ZBE2 3ETPA 2BFUS 4XXPA 2BW8A 3WDYA 1JHNA 4C0HA 1ASJ2 5FLIA 4N90A 1CAWB 3CQOA 4FPLA 2R061 1PK6A 5CYYA 3MLKA 4GXLA 2D43A 2Q1ZB 4QB6A 4XBLA 3DPRC 1O3QA 1COV3 2ZEWA 5SV5A 4HLTA 1RUI3 4K3UA 1UU6A 3OBRA 4AL9A 4I2OA 2PLV3 3H3LA 1J3RA 4U2AA 1Q8PA 2HWC1 2YZ4A 3DECA 4XFCA 5SV8A 1Z78A 4FCAA 1YQ2A 4ONUA 3QBQA 2KXLA 1K42A 2WNUA 1FPN3 1K45A 2X10A 2FCTA 3JBG1 3AP9A 2GZWA 3PDQA 2HBUA 4CEWC 2EIBA 2QQPA 1DGRN 4M3CA 1QXJA 3WSOA 5GLVA 4CDUC 1U5IA 4K8FA 5LATA 1QJU1 2DCTA 4UFIA 1C8M3 1W2OA 3CZJA 2O8QA 1IPJA 3S57A 4D6SA 5JAXA 1WW5A 2VCMA 5F2SA 2YC0A 3TOJA 4CU8A 2GNTA 4YW6A 4NRMA 2OZ6A 2FDKA 1Y9MA 2WS91 3TEWA 5B2GB 5HXVA 3T1LA 2WQ4A 1PMIA 3Q8AA 3MIHA 5EJ3A 4NR1A 1F2NA 2JJ6A 1MEC3 1CESA 2J1SA 3L2HA 5C33A 4NHYA 5GJ6A 5IVBA 1LCLA 3O1UA 5FMOS 4E8DA 2CWMA 1R092 1SQ4A 2VVEA 3OD0A 1MS1A 4AEMA 5K7PA 5GLWA 5E88A 4AQSA 3NNJA 1OH3A 2XDVA 3KHCA 4XC9A 3WHTA 3ZFGC 4KWJA 2E26A 4YVWA 2UURA 1ZZ9A 4JTNA 1PVC1 2R071 2WIIB 5H9SA 1HKDA 4WVMA 2PYTA 3VZOA 3R4UA 1G9FA 1HXS2 2ZGKA 4BQ3A 3IWZA 4XILA 4JKKA 4MX3A 2RJLA 2JWPA 4AGVA 3AKSA 3DCQA 4IETA 4XFBA 3BIWE 1V9U1 1EP0A 2YV8A 4IW3A 1UKRA 3AMMA 1UKGA 1NY71 4R9AA 4S2FA 5FMOL 4YRDA 1RMU3 1BEV2 1SFPA 2WO7A 2ZPXA 1MQTC 2JG8C 1TMF1 1CR7A 1GNZA 2YFUA 3BALA 3J4UH 2V5YA 5DN2A 2WZPP 3WDXA 3OEBA 1AL0G 3IIIA 4KBBA 3APBA 4YW7A 1FYUA 3IN9A 3ZOIA 3FL7A 4FTSA 2E7QA 4HETA 4XFHA 1CZSA 3T2TA 2DCKA 4LUMA 1O5LA 1S0DA 2OX0A 2VPVA 5FPVA 4FPKA 2CV6A 1Z0HA 3SKJE 1QOTA 5FWJA 3VBOB 4BQXA 4LO5B 5JOZA 1NCQB 2KM2A 2J7MA 5BV6A 2A73B 5C7GA 5FWEA 4AHZA 3N3HA 1CAWA 2RJ2A 4YZ2A 4G4FA 4QGMA 3IZOA 1UMIA 2A3YA 4YZ5A 3ZIWA 1XYOA 4D7YA 1ZBA1 4QPIB 1ENQA 1EY2A 3J8F2 1UY4A 1JUIA 2V09A 3WQBA 5JDBA 4Y20B 5LA9A 4JQRA 4FFHA 5CB7A 5BNPB 4KL1A 3ZFFC 1PZ9A 4NHLA 2DFBA 4O7XA 4XYXA 1ULPA 2QDRA 5JUVA 4FTEA 2VOKA 3ASIA 1PIV1 3T2PA 2J1EA 4E9KA 1XSQA 1IS6A 2WZR3 2B46X 3KMHA 2Y0IA 3SQOA 2NZ9A 2EIDA 3FUQA 5J96B 2NP0A 1BBT1 1XE7A 1SACA 3PJQA 3M2MA 4N9IA 1PVC2 1AYN1 4E8CA 3O5SA 2DF7A 2N7GA 3FN9A 1OFSA 2C24A 3RG0A 3GBGA 5FREA 1IKPA 1YI9A 3HR9A 4XDOA 4CP1A 1NE6A 4Q1PA 1W6MB 2VOTA 3VDCA 2Y8KA 4OI0A 1ZYBA 3GDBA 2YG0A 5C71A 1CAUA 1QGLA 4JDOA 3VN4A 1EV12 4BE3A 1GWLA 3ES4A 3CF6E 2VH9A 2VXRA 2YY1A 5FZ6A 4COUA 3I97A 2R0HA 4WM7B 1AXYA 1N1TA 1SCRA 1YQCA 4AEDC 5JOYA 5A6XA 2XJPA 2K46A 5FO7B 1OOPB 2W2IA 2P1BA 1BYHA 4CCEA 2R043 2PQSA 1F4HA 3SCFA 1ZREA 1WUVA 2VULA 1UCXA 5FY7A 5JWPA 4GWIA 3ORJA 1AXKA 1GNHA 2ID4A 2MEV2 5C5UA 3ELNA 4NPLA 3W9AA 1XE0A 2O14A 5APAA 3WW2A 1LOAA 1RXFA 1COV1 4IEZA 3MIFA 4Z8BA 4QKNA 4CCJA 1RUI1 1REDA 2OUHA 1H8TC 2XL9A 4Y4RA 2EA7A 3ITQA 5DAPA 4UWDA 1ACCA 4DUWA 3VV1A 3HVDA 3W20A 4BLJA 1JZ5A 3KT7A 2WSVA 1Y4WA 3FHAA 4JC1A 3FX3A 3H42B 3O0WA 4W50A 2O8OA 4HSJA 3MIBA 4XAAA 1U5ZA 1IGOA 2WKKA 2YUEA 4GB33 3POGA 1Y9QA 3SNMA 1UIJA 3L9JT 1LECA 1SFYA 4AWDA 1JZ8A 3K46A 4IE5A 1YYNA 5CFCB 3OGGA 1UU4A 4BB3A 5LA2A 2EIEA 4D3WA 4HONA 5KC5A 1AYN2 4XAEA 2FDHA 4P08A 5FYVA 3MV01 5L9BA 1B35C 3AZVA 3I7DA 1LHOA 4XUQA 2FMYA 3S6PA 4ET7A 4BYYA 1ZM1A 2HEYF 4S2DA 2BNMA 2DU1A 2G9FA 4F7ZA 5HCHA 2JD4A 1NCQA 2R1BA 2RDSA 1RUOA 1JZ4A 3ATGA 3ZXFA 2XVKA 3ZFEB 5C8CA 4CDWB 3VBRC 1MEC1 1QJX3 1IS3A 1QJZA 3I8TA 3OSDA 3RSJA 2QBXA 1NCRA 4HVQA 1LB2A 1W8ZA 2AENA 2GU9A 2PHTA 4Q0PA 3P5BA 3M3IA 5FZEA 5F3GA 4OI4A 2MHFA 5JCTA 1W2UA 1LGNA 2KR2A 1YNAA 3S7EA 3QH7A 1GBGA 5A7WB 1W2NA 4GWNA 4Q4V3 2VVDA 1L7LA 4HT1T 4PBPA 1E5SA 1PZ7A 2QQIA 5A3WA 4LBJA 1V6JA 1BVP1 2P3YA 1COV2 1PM4A 1QNYA 1RUJ3 2EXIA 2OVUA 2RJKA 3IB3A 3JD73 3NWKA 2GP3A 3PIJA 2VTFA 4JHTA 1UO9A 3WDUA 2OZJA 2PLV2 1MZ5A 2ARBA 1YO8A 1WD3A 3ILFA 4Q0SA 5A80A 5DQ0A 1W6MA 3EXUA 2ZHNA 4LIVA 1FPN2 1DYPA 1TQ5A 4XHBA 3WP5A 4AFDA 4HSLA 2DDUA 4N43C 2E33A 4IV1B 2DYCA 1LOFA 4WM7A 2WJSA 3LFIA 5FIXA 1CPMA 4LO7A 5LASA 1XNTA 1OOPA 4K7JA 3BI3A 1RVF3 2VZUA 4BDVB 2C0ZA 1C8M2 1WWYA 2CHHA 3M4FA 4IV3B 3RNSA 1ULFA 1VBB3 4N53C 5K0UA 5CAZA 3RMYA 5IJRA 3OUIA 3O1OA 5EYXA 1HIXA 3AZXA 4BIFA 2JE7A 1N3QA 2XUEA 3HAGA 4LO4B 1EPWA 3POJA 5FYBA 3WNOA 1WLCA 1JMUB 2IXJA 3KQ4B 1JI6A 3AZYA 3J7HA 5DZFA 1JYNA 3ZSKA 4LORA 4PJYA 2PHRA 2H0BA 1MEC2 4XF4A 1SCSA 2B9UA 5KHHA 1CQ9A 5LY1A 3TEZA 3I2OA 3ZXAC 5A1FA 5D8AB 1HW5A 2WN2A 2X53S 2C5DA 4FPCA 4KU7A 4COZA 3IMMA 5C9AC 5J7MA 4FI9A 4IEUA 4A42A 4BU2A 3BN6A 1V6LA 1W6PB 1VBA1 5FMDA 3KQRA 1S2BA 5HI0A 1UU5A 3RZLA 4IERA 1GUIA 2IXIA 1X82A 5L9RA 5LRRA 2WNVA 5FV3A 5F39A 3U07A 4XF1A 3NV2A 1AJKA 4LLFA 5L19A 1LULA 1NKGA 3K48A 4FOQA 1SLBA 4FPGA 4KU8A 3VKOA 5JZGB 4CPBD 5LK5A 4QHZA 2WQ8A 3WX5A 4GKYA 2XMLA 2JKXA 4AFAA 3CJIC 5C3QA 4JRLA 5BNOB 1CX4A 3DN7A 3NJZA 3NL1A 4RFT0 3KV6A 4AK3A 2ZGPA 1GYKA 3FBYA 4QXHA 1K3IA 3N9NA 3N7KA 5KHGA 3AB0A 3I2JA 2ET7A 3Q9OA 4UAPA 4C0BA 1RMU2 1WA4A 4IGPA 3DF0A 3JB4C 1AVBA 4JHZA 1V6IA 2ZGMA 3MBWA 4N8MA 1FV3A 4QGNA 4ZZ8A 2LRPA 3R0RA 4LOTA 4M4RA 5T5PA 5ERLA 3OJBA 5I0UA 2A6XA 4YM1A 1DDLA 2ORXA 4BJ0A 4E4DX 5JSOA 4GWJA 4AI1A 2P37A 2PMWB 2HKXA 1WCDJ 2HWE3 4COWA 1BCXA 2PAEA 2ARAA 4UT5A 1XNBA 3I49A 5CNAA 4XFIA 3LOBA 1GP6A 1RUD3 1TE1B 3AMNA 4IEQA 4AAPA 5CG8A 4IGOA 2WWUA 3I54A 4YFWA 1PO13 1SPPB 2YB7A 3LEIA 2JIGA 3WT3A 4CDXC 1ND2A 1XNKA 2GP5A 3D4KA 3S7IA 1HN1A 4I09A 5K9YA 1R64A 1YJKA 3LDRA 4C91A 3O1TA 3VHRA 4HL0A 1STMA 4Y26A 2EAKA 1AR73 1R083 1ENXA 3RQ0A 4PIYA 5GM0A 3SHRA 1DYOA 2BPA2 2I2SA 3B02A 2WZR2 4LIUA 2DBIA 3OGRA 4KI5M 4FPFA 1U12A 5KXDA 3MW3A 4EWEA 4PF1A 2JG9B 5FXZA 2W9XA 5G05L 4AGRA 1ASJ3 1MS8A 3KWVA 4UW3A 4A44A 5IFPA 3O1MA 2QQOA 1CZTA 2VW2A 4QHBA 2Y6FA 1UZYA 2P4EA 3MW2A 5FP9A 4IV3A 2VJXA 3LSEA 2X5IA 3TWIA 2VMHA 3CEWA 1BLZA 1OBNA 4YSFA 1W6QA 3H9AA 5FMCA 1ZRCA 2VBPA 5GLZA 4QPYA 4LK6A 2EXHA 1AJOA 1QJX1 3AMQA 4LKSA 1GSLA 5LRSA 3Q8CA 3JZVA 2LW8A 2G9GA 2HEWF 1AXZA 4FP3A 4JGZC 5FYHA 1A6CA 4P9XA 4PHZA 5IAVA 3WG4A 3ZSLA 2RE9A 5FYIA 1QJY3 1CJDA 4UXAA 5LBFA 4NPRA 2D6PA 2R042 4BQ5A 1W9YA 3B9CA 2XONA 4TWTA 3PIGA 4NVPA 4YVSC 2Z42A 5D21A 3OBTA 1NE4A 4OZOA 1O4TA 1A3KA 1XC6A 3EYPA 4YARA 2Y6GA 3UGGA 4ASLA 2Z2SB 4YYOA 1QJEA 1VAVA 5FOBB 4JCKA 1W2TA 1WMXA 3CDZB 4RGAA 4Q4W3 5JZGA 2I45A 4IDZA 2D3PA 1ONAA 2OQ6A 1NA1C 1SLLA 4A7ZA 4DXTA 3PNAA 4ZXEA 1YEWA 4XJZA 1PGL2 4RQPC 3V0AA 5DABA 2Q8DA 3DXTA 2W68A 4XZUG 1ZRDA 4KGGA 3VBSA 4L97A 2NN8A 4EN7B 3RI9A 3JCIA 1OLMA 2HLEA 4GB32 3VKMA 5JR2A 1NZCA 5CKNA 1UYPA 5ABJA 4UI9L 2AYHA 3B93A 1OPOA 1SHWB 2HYXA 1UOBA 1RVF1 4ATFA 1O91A 3C7OA 5FR3A 4XEZA 2SBAA 1KEXA 4DXRA 4XBNA 2Q8CA 2AR6A 5JXJA 3RPQA 1UMZA 4PLNA 4MVTA 1RUG3 1VP6A 1XB9A 3VD4A 3LFMA 4MGYE 4UFKA 1VJ2A 4KWKA 1HLCA 4P9IA 3N9OA 4INDA 5JOXA 1S0GA 3SXWA 2P34A 3LDKA 5L7OC 1PO21 4EN9B 4LHKA 2WO2A 3JU9A 2O1QA 3JQXA 1QJX2 1UOJA 1DZQA 2VZSA 2R1DA 2AEYA 4DEQA 4LMFA 1DQ2A 4OLLA 5JI7A 4EZHA 1BEV3 2V4VA 4DUXA 4E4ZA 1PNFA 4ZS3A 3NSTA 4RS5B 5EV7A 2Q1MA 2RR13 4CCNA 4DPNA 2PXJA 4AVCA 2NM1A 1WA6X 2Y6HA 2LALA 4NO4A 3MICA 1ZZ7A 3PUHA 4H7LA 4Q4V2 4LHSA 3VDDB 2ZJCA 3M70A 5EIYB 3ZYIB 4U36A 1H9WA 2QQNA 2QZ3A 3GGLA 1C1LA 3PJYA 3TYJA 3MDPA 2CYFA 3SEEA 1OT5A 4BXFA 4EQVA 4Y1UA 3JD72 1CZVA 1RUJ2 1WW7A 3PURA 1W8UA 3OPWA 1DGWA 1UF2C 2P6HA 3TB0A 1REEA 4BLIA 4NIIA 2Z5WA 3O1SA 4YFZA 2Y0OA 5FZAA 5GKAC 2WLPA 1PMHX 4OHYA 4Y5Z0 4AGGA 4LBOA 1V00A 4IEXA 4FOVA 5LY2A 5JVVA 1W6NB 4ORFA 4GH4C 3RGBA 1ZZ8A 3TN93 3U4SA 3AP6A 5F5IA 2DVDA 1RUH1 4DOUA 1PGW2 2W47A 2V72A 5DDJ1 1S0FA 1CAXB 2P6CA 2JDPA 5AC93 1VBB2 4NIAA 3BB6A 1UYYA 4PLMA 4OYUA 3PMSA 3ON7A 1RUD1 4AVBA 2ORZA 4XJUA 3B7MA 1S0EA 4BISA 3AXEA 5I8SA 4PDWA 1GOGA 4RFRB 4LO6B 4GZ9A 1UY0A 4FT8A 5BNNB 2WNUC 2ZHLA 3WD5A 5CA6A 4Q0UA 3SITA 3WV6A 1WW4A 3FUOA 4AVAA 4BOWA 3WW3A 1OKOA 1LGBA 5A7OA 2YHJA 5F8PA 1AR71 4QAWA 4JGYB 4COYA 2R30A 2P3JA 1R081 2W1QA 4Z2WA 2EIGA 4Y3OA 5FY9A 4LK7A 2VR4A 2HWD3 2WZ8A 3PVNA 4DRRA 1BVVA 5IVVA 1W8HA 2VW1A 4FPYA 4EN6B 3W5MA 4LITA 2JDZA 2ZTNA 1AUYA 1LOBA 1JU3A 2DUOA 2X29A 3BU7A 1JU4A 2DCZA 3T08A 3IDBB 2D44A 1A34A 1ZBE1 1FMD3 1Q43A 1UXXX 4AQ6A 3GCXA 5FFOC 1ASJ1 1RUC3 1ULGA 3E5UA 3FBMA 2ZABA 4XFAA 3N7MA 3BU0A 4PCRA 2AC1A 4Y5SA 2VQUA 3UL2A 5FZCA 3CLPA 4IE0A 4OMDA 1VRBA 1WMDA 2IFWA 3HNBM 3OD4A 1XU1A 2XL7A 5J37A 5EFUA 3BKZA 2B42B 4IE4A 1H2NA 3D5OA 1JH5A 3N4MA 1ND3B 1DQ6A 1TG7A 2WA4A 4KMQA 4N9HA 4YVWC 3KM5A 3BUCA 2WYSA 3POEA 1UZZA 4W6YA 4PIXA 4WZFA 3MO4A 3VLBB 1A8DA 4PI2A 3M8LA 2HWE2 4LNVA 3ES1A 4DZGA 5LBCA 1VBE3 1C5IA 1RUD2 3H8UA 4Q4W1 3J7LA 5FYSA 5FZMA 2PHFA 2A75A 2WZEA 3DKQA 4NOTA 2UYBA 4HN0A 1PO12 1H30A 3ZR5A 1Q56A 4CPBA 3H3UA 2JENA 4LE4A 4Y33A 4HKOA 1N47A 1J59A 1IKQA 2AEZA 4QPGB 1R082 1HB2A 3ACFA 3MYXA 1ZA4A 5DUWA 5ACA3 3AKRA 5KXEA 1YCIA 3H0OA 2GMMA 4OQ8A 4NHMA 3WUDA 3MUY1 1OI6A 2DUPA 1W6NA 4CP2A 2CAVA 3ZLIA 3RZHA 2VUDA 2ZKLA 3NAPB 3RZMA 4XXAA 3V64A 2OXBA 3LF7A 2FD8A 3AP4A 2DUQA 2E63A 2G1MA 5L9VA 3I59B 3RWKX 4NIDA 1HXS1 1PX4A 1VRH3 5JPMB 2A6ZA 1S4CA 3LIGA 4TXWA 2D6LX 3O1VA 3H8OA 4LT5A 3RJ2X 5BNQA 4IQPA 2Y6LA 2XJUA 4E4HA 1DZRA 3DEMA 2GC1A 2VUAA 5JXHA 4FXGB 1OFNA 3FLRA 1IG3A 1H6XA 2HYKA 3ZYJB 1BEV1 3ZYGA 5FPBA 3MW4A 3VBFB 3H7JA 3OYWA 4UFJA 1GWKA 2BERA 2WAOA 4WVVA 1QJY2 5FZFA 4YPJA 3WNLA 4DFSA 1W90A 4AQ2A 1UZ0A 1RHI3 2UWBA 2BFUL 1ZZCA 3CNAA 4OFGA 1CX1A 2VZ1A 2IXKA 3LPGA 4QT6A 4DUVA 3HIFA 2PELA 3VZMA 2E7AA 4QQ2A 3NNFA 5L73A 3AX4A 1JYVA 4ZONA 3CMGA 3DPRB 4K1ZA 4OMCA 1JHJA 4HANA 3I2KA 3K3NA 4Q4W2 4XTMA 3FZ3A 3AXDA 1ULEA 2D6OX 3KVAA 4MSVA 3WG2A 3KF3A 2R6QA 2BOJA 1Z7S3 4RGKA 1D4M3 1UYZA 4AW7A 2IVJA 4MGZE 5FUIA 3UT0A 3OTFA 4AI2A 5EZWA 5A3UA 3FJSA 2J42A 5EXOA 4QM9A 4CEWB 3LZZA 3J8F1 3DYMA 2QDNA 1OA3A 2BP6A 4AAXA 1HRI3 2NYYA 5ISLA 4RR3C 4CDUB 3TN91 1JZ3A 2VMDA 2LTNA 3U1XA 3KCXA 4XOGA 4I0AA 4MXVA 2IVIB 3O1RA 1GZWB 2DBNA 1ND3A 1BZWA 2JB8A 2A1XA 4FVVA 4HOOA 5AC91 2JDNA 4XF9A 1RXGA 3B00A 5EPAA 3U14A 3AMHA 3P1IA 4YWAA 1GQHA 1RUG2 1UYXA 4MGSA 1FXZA 5HCAA 4XF3A 4PT6A 2VD7A 1X50A 5GLTA 3VHNA 2ENRA 3PLQA 5CFDB 4L9BA 1W8TA 2DVAA 3ZPYA 1NX9A 3VD7A 4PQ9A 1EV11 4QKBA 4ZS2A 3RWNA 4CUAA 5I91A 2GSYA 3OPZA 2VZPA 1CN1A 2A7AA 3BOPA 4HVOA 1QWRA 5EJZB 1NLSA 4I3GA 4AG4A 3MIEA 4QQOA 2RR12 1WMEA 3HQXA 4ZKTB 3NNLA 2WABA 2JXAA 1GNYA 4UF0A 4MOAA 4E4SA 2OUJA 5FPLA 4YG0A 5I93A 2CGPA 3UKNA 2MEV1 4IGQA 1RGSA 2ZMKA 2PHLA 5CIRA 3KGZA 1NCQC 4CYDA 5IUQA 3WOGA 3S5AA 3I3BA 1O4YA 2J22A 1A8MA 1SFNA 5C8CC 5IFTA 2UWCA 5F3CA 2VTXJ 1JYWA 4GALA 3A7QA 2ZX1A 1X8MA 1NCRC 3AC0A 3P3NA 2BU9A 4NE9A 4B8EA 1CVNA 4HN1A 3JB8A 3I59A 1OSGA 1S0IA 1YRZA 4XTPA 3VHPA 2TBVA 4LPLA 2JG8B 2WFF3 3WNPA 4F8AA 3FHIB 4QXCA 3EO6A 2VAUA 3RS6A 3H8RA 4HKWA 2TNFA 5FY1A 1VMFA 4HBNA 1YHFA 3K3OA 3C7EA 3TN92 2VNVA 4XJ8A 2FZ1A 2ILMA 5AVPA 4DIQA 1W9TA 5DMYA 3M3QA 3HMYA 3R4DB 2IC1A 4GJYA 3LEKA 3VBFA 4P9WA 4XCBA 5FYYA 1W3XA 2D93A 2G4IA 4N7IA 5AC92 5C3OA 2JDMA 5T52A 2D97A 4MLOA 1Q5OA 1RTVA 1RC6A 4Q4X3 4LUKA 2RVAA 2YGMA 5F32A 4YZ4A 4TLGA 1UPSA 4JV4A 2W92A 5FCCA 4HG6B 3SEPA 1US2A 3C8XA 3WNMA 5J09A 2VCAA 3B3QE 1KRIA 2VZVA 1SEFA 1ZA7A 4JAAA 1O59A 5FK7A 3POIA 3W58A 4AFMA 1M06G 1TME3 3M1HA 4D7SA 3ZFFB 4MHUA 4B7EA 2C9AA 3WXPA 1ULOA 5FZ3A 1G7YA 1QQP2 1LOFC 5F6LB 4EN8B 1LOCA 1SDDB 1W3VA 3BGAA 2HWD2 4YM2A 5A6QA 2QKDA 3GCWA 4AZZA 3ZXDA 4XETA 1ULDA 1W6OB 5DG1A 5ANNA 4AI9A 5K0UC 4W6WA 1W8WA 4DO0A 2ZGTA 3LD8A 1FMD2 4AI8A 5HV4A 2YBKA 2BTVC 1RUC2 3EMRA 2A5ZA 3WF2A 3BYWA 3AVSA 1G9BA 3VD9A 3ZMOA 2XJTA 3SH5A 2UYAA 1VRH1 3QCWA 2ZX4A 1EUTA 4PQQA 3WG1A 4I30A 4B4RA 2PLV1 1BXHA 3WP6A 2PA7A 2G19A 2XB6C 1BK0A 1MZ6A 2VC9A 4HVRA 4J1XA 4ZXKA 1W99A 4AEDB 1HQLA 5HPOA 2B39A 5CFDA 1ENSA 1OH4A 2ZGSA 5FZKA 5BPXA 3T4HB 3VB9A 1FPN1 5FLHA 1XBFA 3CHXA 1UY2A 2WNVC 3VL9A 4CEYB 1RHI1 4DXSA 1FOD3 5AFEA 5IT6A 3ZN6B 3O0XA 3KD4A 3DYOA 4GD4A 4AVSA 2QQVA 1C8M1 5A33B 1DIWA 3WDVA 3BPSA 1VBE2 1GU3A 2P5BA 2JICA 3ZPOA 1HV1A 1QF3A 1Z7S1 1GP5A 2QNKA 1SBDA 3M3EA 1W0PA 2WFPA 1E5IA 2Y34A 3VBOA 2W95A 4XPVA 3NMBA 4D6QA 1OF3A 2GN7A 1SLTA 1XE8A 2E51A 3GZEA 4R9DA 2BRTA 5FUNA 2GN3A 4S2GA 2BV4A 3RMXA 4GULA 2WYFA 4XACA 4UW6A 4FPEA 3A0KA 2ZS6B 1D2SA 5ACA2 3CIHA 1JODA 3GXUA 2WA3A 2WSUA 3AVRA 2QQJA 1OA2A 4XVHA 3GZTB 4QPIA 5G04L 3UJQA 4KWLA 4Y20A 1KDKA 2ZKNA 5BNPA 1WCUA 4W8JA 2IXLA 2GH8A 4QDQA 4FPHA 1BQPA 2XVLA 5F2WA 4FSJA 1SMVA 4ASMB 4BM8A 2CNAA 1ND2C 2TUNA 1WKYA 3BVCA 3HOBA 3PU8A 4AHXA 3R6SA 4CXWA 2LS6A 3VBHB 4DXZA 1VRH2 3D0JA 4EROA 3VBRB 2YDEA 1VBC3 1JN2P 1OUXA 4QX5A 2FBEA 2A3WA 3UK9A 5CG9A 1YQ8A 3IDEA 4DQAA 2IXCA 3VZLA 2PHDA 1RMU1 3DYPA 3HNYM 3PL0A 2PAMA 4AFBA 4X8NA 2IFRA 3SC7X 2RHPA 1AHSA 2DCJA 2XPJA 5JSPA 4M00A 4C1WA 1LKNA 1RHI2 5A1LA 5LW9A 4O9EA 2BNOA 4AYUA 5BUVA 3FWEA 4OHVA 3LCPA 2NMNA 3IT8A 3V65A 1BJQA 1KXGA 5LCWL 1W6OA 5I0SA 4ZPIA 2X5IC 4P9YA 1FV2A 5A70A 1LU1A 1SBEA 2IUWA 2UWAA 1VMHA 1YQ6A 4ZU4A 5FO9B 1Z7S2 3PUAA 5BXXA 1D4M2 2WNOA 3VBUB 3WNXA 1QDCA 1ZNPA 4A7KA 2IZWA 1HRV3 3PVOA 1R1A3 5E89A 3WUCA 4QMAA 2C1FA 3QLQA 3NQHA 2ZGOA 2Q8OA 2OPWA 1MR5A 1HRI2 2QCSB 3PUSA 4QQHA 3ZKUA 2VOWA 1ZRIA 5FPZA 3IIAA 3RJRA 2WZR1 3SH3A 1TNFA 3A4UA 4N53B 4Y1YA 4QB2A 4JRAA 4P9LA 4CEYA 1OXCA 1NOVA 1ODNA 4Q4X1 4R4ZA 5JZGC 5FAXA 2VECA 1UOFA 1SZBA 3KGLA 3N7JA 3IKWA 1RUE3 2XLFA 5CFCA 4AHWA 1IS5A 2XBO3 4A7YA 1BMV1 1Q8OA 3VBSC 2QTWB 4BHPA 2Y64A 1BHGA 1XOYA 4P02B 1F8VA 3A21A 5FZOB 3GALA 2E32A 4A3XA 3X29B 4XJWA 4UFLA 1QJFA 1VAMA 5ABJC 5JXGA 1UD1A 1QXRA 2B4KA 1LEMA 1H9PA 3KV5A 1O8SA 3U11A 3ZFEA 4CRQA 2HWF3 4GA9A 4CDWA 1V6KA 1NZIA 4NRPA 3GBWA 2E53A 5DUUA 2R041 2ES3A 3C7HA 1LTEA 5CZKA 1W04A 2RS53 3DKWA 3WQ1A 3U0ZA 1JOBA 3TBDA 4HPKB 4XF0A 5A3MA 4JZRA 5E8AA 2MNGA 2Q8EA 5A7WA 2AGSA 4NWVA 1I1EA 4PLOA 2DTYA 1C4RA 3A23A 1OF4A 5IW0A 5HBAA 4L99A 2ZEXA 3U37A 4MGIE 1YUDA 3WP3A 4HFSA 1AX1A 3VGIA 4NIHA 4GWMA 1QNWA 1QXPA 4Y24A 1W2AX 3C7FA 2ARCA 2HWB3 3KSCA 3VBHA 3ZM8A 2RV9A 2WFF2 3GNEA 4I3PA 1AR93 4TLFA 1PGL1 3K2OA 2YROA 4HK9A 3AP7A 3J26N 4QX1A 4B1MA 1J1LA 1GWMA 3EB7A 2R16A 3AK0A 4FTBA 1CAVB 3SCHA 4Q4Y3 3ZYHA 4DEVA 4GB31 2VUJA 4OULA 2OKXA 4BPZA 2JECA 1LGCA 1FOD1 1K12A 3HNMA 4WBBA 4ARYA 5F6KA 2YC2A 1JYIA 1IQAA 5IK7A 1MS0A 5IATA 2EICA 1OURA 4IEWA 1XJAA 2XHKA 4FPOB 4IV1A 4Q4X2 4YGDA 5KC6A 1DU3D 4X6QB 3AYCA 2J1UA 3J7NA 1AYM3 1YFWA 4CDXB 5IK8A 3HWJA 3IDCB 3LA3A 5C8WA 3SMHA 3N9QA 1BMV2 1RITA 4P5HA 2WLQA 4DINB 1TME2 1S0JA 2D98A 2VBDA 1IOAA 3AL6A 1PVXA 3VBUA 4MYEA 2BBAA 4NPMA 4LLOA 3R4SA 3DXUA 2YXSA 4A3ZA 1OQDA 3V0BB 2RMU3 1FATA 4KGQA 4KH9A 3IPVB 2WT0A 1G9DA 5KXCA 1JUHA 2WRAA 5D2AA 5D8AA 2WAAA 5C3SA 2D5HA 3ST7A 3WF1A 4Q4V1 4XMIA 4E2SA 3VDAA 3G6JB 4PDWC 1DYKA 4BCUA 1AL23 1LENA 1W6PA 1Y3TA 2JDKA 5DUXA 3LA7A 1X7NA 1QOOA 1KS4A 2OW4A 1R1ZA 5BYNA 5FPUA 3QOPA 1WLDA 3JD71 1FNYA 1RUJ1 2A3XA 4MG2A 1ODMA 3KCYA 4TN7A 4QXBA 2VCCA 1JYTA 3WP4A 2BQPA 2RS13 2YU1A 1MPXA 5FXVA 4AOCA 1W39A 3GZAA 4ZY9A 1LHVA 5BNOA 3J9SA 3EHKA 1AR83 4JGZB 4JKLA 1D0HA 3W21A 3ENRA 4XURA 1WCKA 1JYCA 3M3CA 2XWJB 3HT1A 1OMIA 2XWBB 3LEMA 5FZOA 3RDIA 2VUCA 3A0NA 4OI2A 4OHXA 4RHV3 4YVSB 1UN1A 1YQ5A 1VR3A 3HQUA 3EJKA 4Z2AA 4M0HA 1XPWA 1FOD2 3LKJA 1PGW1 3MHZA 4JVAA 2VMIA 2AUYA 2UY8A 1X9TA 1POV3 2NPIA 3B5LB 4Q8LA 1LAJA 4L2NA 1O7FA 1VB2A 1VBB1 3HD8B 2G9ZA 1U5XA 1NAEA 3O14A 3TNQA 1RUNA 1NA1B 4V2VA 3H1WA 4FOWA 4IE6A 4YGBA 1CIYA 2KA3A 4K1YA 4RQPB 4YM3A 5C4WB 1R1A1 2ZGQA 1JXNA 4MV2A 5FZ0A 4FBFA 2E7TA 1OQEA 4MXWB 3E97A 2Y26A 1SPPA 3ZDSA 4XDQA 4AVTA 2ZOEB 4ES9A 1QH7A 4IE7A 2VOXA 5FP3A 3URFA 4A41A 4SLIA 4DS0A 1L7QA 2D40A 2WNEA 2R7EB 3H50A 2V4AA 4BA6A 1W0NA 4HMZA 1E5HA 1GQGA 4FP2A 2R063 2ZXQA 3JUUA 4PBOA 1WMFA 3HN1A 1KQRA 1RJ7A 1HB4A 2CGOA 3ZKYA 2JD9A 2LROA 3ZYFA 2Q1FA 4D0QA 5L7OB 1UIKA 4XQ4A 5EWSA 3BTZA 5C3RA 2B7YA 2HWC3 2XBO1 3ACGA 2J1TA 1WW6A 1HDKA 1PZ8A 1VBC2 2JG9A 3IM0A 1FNZA 1LRHA 2D3RA 2L9LA 4UFHA 4JTOA 4Z92B 2BVBA 4CDXA 1KS5A 4P14A 1X9PA 5FBZA 4ES8A 1O4ZA 2DURA 2HJIA 1VE0A 2W46A 5LK7B 1IS4A 3THPA 3UYJA 3PVEA 1H2KA 1POV0 4QM8A 4XHXA 3RYPA 5FRAA 3K4DA 1QJU3 4HKLA 4NAOA 3THDA 5E6HA 4CUGA 2W1SA 5FPXA 2ARXA 1OPMA 3MPBA 2RS51 2GC2A 1NXMA 1XQNA 1PK6C 2FMDA 3I2FA 1F5FA 5JIAA 1W8NA 1LHNA 1YWKA 2HWE1 3LPFA 2JEMA 4M0NA 1RUF3 2QUOA 5FLJA 3HT2A 3CBNA 1W06A 2LM3A 1OA4A 3OGVA 4CU7A 3GHMA 1PO11 1HRV2 4LBQB 3LB9A 2JDHA 1I3HA 1R1A2 4IEYA 4F83A 4YGEA 2Y38A 4JKMA 1L3JA 2BWCA 1LNSA 3EQEA 4GH4B 5A7NA 3WDTA 3AP5A 1MS3A 1D4VB 4UW5A 2GALA 2WWJA 5DAWA 1QQP3 4BMBA 3PUIA 4Q0QA 3O7OA 2VMEA 5LBEA 3FFQA 1NXD1 4DRVA 2AH2A 4XIOA 1JZ7A 3T0DA 2R073 1NYWA 3NKGA 1C8NA 1LJ7A 1XXNA 5FZHA 2ERFA 2W0XA 4WM8B 5C3PA 3O1PA 2W94A 4IEVA 1W28A 1RUE2 1SDWA 1MS4A 2WNUB 1Y9GA 1CIWA 4QQLA 2XBO2 4D7TA 3I3QA 1PHMA 1V9U3 2BGPA 3G7DA 4M3CB 4BH9A 4EYUA 2XG3A 4BK4A 5JIUA 4FO9A 3RZKA 4QXKA 4R8HA 1TMF3 4RQPA 3OBZA 3T09A 5C4WA 2YMZA 4ARXA 3K4ZA 2OQ7A 4PIZA 3LE0A 4K8RB 5F37A 1QY4A 2DFCA 2HWF2 1ND3C 4O9GA 4LEJA 5FY0A 4MXWA 4L8QA 5CVRA 2VXJA 1QJY1 3CJXA 3WINE 4BXSV 2DVBA 3NJYA 3GJAA 1G86A 3KT4A 2RS52 4QGLA 5TSWA 1I6XA 5EQUA 2K2SA 4RS5A 4CXXA 4QU1A 5FXXA 4EZ4A 2VNRA 2VM9A 4K9SA 3VZKA 3GM8A 1TVGA 4FXKB 3VDDA 3ZXEA 3D8CA 2VQTA 1XNAA 1UY1A 2ZEYA 2HEVF 1LU2A 4WVWA 4XABA 3T4VA 1SLIA 2QFEA 1ZBA3 3WNKA 2QQMA 2HWB2 2CDOA 3DGTA 4WZCA 1H2MA 2C4XA 2Q30A 1P8JA 3ZO0B 1AR92 3FHQA 4D94A 2QQUA 4MHRA 1KITA 1G6NA 3ZVXA 5D1IA 4CDQB 4YVWB 2YU2A 1F15A 2CU5A 1N1YA 1WCSA 2H6CA 4QX7A 3KZ4C 3MFAA 5FQ0B 4Q4Y2 3ZXGA 5CEHA 4MGTA 4X6RB 4Y22B 3ZDVA 5F7UA 4WVMB 4BQYA 4W65A 4OHWA 1BBT3 1QH6A 2J1VA 3E5XA 3MI8A 4A45A 3ZXJA 3IAPA 5A3OA 1NQJA 3K51A 3UJOA 2ETEA 4P9JA 2DU0A 5FP8A 5LEKA 3THTA 3Q8BA 3VL8A 1RUG1 5L36A 1S0CA 1AYM2 4D69A 4CP9B 1DZTA 1Y7BA 1CAXA 2W52A 3N7LA 1ZZBA 3P6BA 3PU3A 4I01A 4XIKA 2F6BA 2RDRA 4FAHA 1I5PA 3D6EA 2CDPA 1W05A 5DG2A 1J84A 1I5ZA 3WLUA 3H3ZA 4P9GA 1AX2A 2YFZA 1HN0A 1K5MB 4OCTA 1IG0A 1O3TA 3U10A 5BNNA 2ZX0A 2YPDA 2ZHKA 1X33A 3OCPA 3VBFC 4B4PA 4UOJA 3WCRA 1POQA 2RMU2 1B09A 3NJXA 2XLAA 5AVAA 1W8FA 4BMEA 3CL1A 2BNNA 2RR11 4TSVA 1BK1A 1HJGA 4NHXA 4JGYA 3ZN5A 3K77A 1OKQA 3KHBA 3TRSB 1JOPA 2OPKA 2ZAHA 1S0BA 2NMOA 3NRUA 1AZDA 1UOGA 1AL22 3P3PA 5IVJA 2EXKA 1SLCA 3NO8A 4GJZA 4XUNA 2DCYA 4M3CF 2XGXA 3ETQA 1HB3A 4G3YC 3AJYA 1F35A 4WM8A 1YFUA 1NG0A 4NN0A 4UBHA 2GC3A 1ULCA 3JQWA 2RS12 4LHLA 4XCAA 1LODA 5HCFA 1HV0A 2VNOA 3POSA 2Z4FA 4QKDA 1AR82 1UXZA 3EBRA 4LE3A 4RA0A 5GALA 3WZ1A 5LEJA 2ZHMA 1C57A 1H1AA 4OUEA 2O0OA 4N7UA 1UPIA 3MLLA 1MVEA 3KF5A 4MGQA 1H8VA 4RHV2 4B29A 4Y5TA 4BQ1A 4LR4A 4CU6A 3D82A 4I02A 1VBD3 5EP9A 5J3UA 3B69A 4IEOA 2ZCWA 1CONA 4LHNA 2BOIA 1RIRA 1OLRA 1CAUB 2W5FA 1I9RA 2Z79A 3N35A 5A32B 5A6ZA 1GQPA 4H55A 4LBMA 2I07B 1REFA 1V0AA 3QD6A 1RUF1 4H3WA 5FUPA 3S5QA 4EN0A 3RZJA 2W08A 1X8EA 1W9WA 4XQWA 5E16A 3T2OA 3KLSA 5LA0A 2RM23 5CFDC 5DPNA 2FQPA 4YW5A 1KDMA 2VW0A 2VZ3A 1YIPA 2K0GA 2OIIA 1EAH3 4RR3B 2VQ0A 1W9FA 1OC1A 1QQP1 1O3SA 1WBLA 4IUGA 2B45X 3HBZA 1ZVFA 3KCCA 5T5JA 5JXIA 2HWD1 1CD3G 4LQRA 4XJ9A 1J3PA 4CDQA 3T30A 2D5FA 2RDNA 4Y1ZA 5DUVA 2Y33A 4QPGA 3ZFGB 5FQ0A 1YI7A 2R062 1KFXL 4Y22A 5J48A 3KVBA 5F3IA 2X8KA 5FP7A 1G8WA 1FMD1 4GMP3 5FZ9A 3ZSEA 1QDOA 1GP4A 1RUC1 2X09A 4XZPA 3VBOC 4C1XA 2H6BA 3NNGA 1GKBA 5T3NA 3RRDA 1OLQA 4NHKA 2HWC2 4YZ1A 1DQ1A 3NAPA 3TNPB 4FAGA 2F4LA 1UQXA 2FHRA 3F2ZA 4FFIA 4NRQA 1KD7A 2HH9A 2Y6KA 4Q2FA 5KHIA 4CP9A 5KXBA 3BTYA 1GANA 3AFGA 3JBG2 5JI9A 1C3HA 2BGCA 4QPIC 1MQTB 2DWRA 1N1SA 3AKPA 1UL9A 1C5HA 1H4HA 5F5AA 4QB1A 2PTMA 2VZOA 1D7PM 5BNPC 2ZZQA 1K5MA 2BDRA 1QJU2 3E5QA 3K4AA 5FZDA 4J6GA 3FLTA 1IPSA 1L7RA 1HX6A 5GZFA 2ZACA 4LULA 4BZ4A 4R4XA 1DCSA 1JYXA 4XMAA 4A6OA 4ATEA 5C8CB 3N36A 1RUF2 1H1IA 1VBE1 3OG2A 2GNDA 3T1MA 2WS92 4HK8A 1NCRB 3PUQA 1E5RA 5KHJA 4P5YA 1JS9A 4ITCA 4ISQA 4PF5A 4Y4YA 3ZSMA 3GBFA 3DPRA 1O8PA 4B7KA 1E57A 5FYZA 1OD5A 3CU7A 3UV9A 5JLVA 2LUWA 4QQPA 1SLAA 3RI8A 4WM7C 5I8YA 1J83A 1VBA3 2J1AA 4YW3A 4GMP0 3M3OA 5ACA1 5A7SA 5C5TA 5DXDA 2FCUA 1OOPC 2D6MA 1VPHA 3AZZA 4WVZA 3MZHA 4CEWA 2VMGA 1DGLA 5CU1A 2R072 4URAA 1ZZ6A 3AYDA 1W0OA 4QD2A 4XUTA 2XJQA 5FYUA 3VKFC 4CDUA 2Q0AA 2W3JA 3PTRB 4H2AA 1GZ9A 1Q8QA 4LO8A 4CCLA 2JKBA 4JX0A 3B94A 3ILNA 4FOYA 2BWAA 1GFF2 5F9TA 1GZWA 4BWOA 5I0RA 5A32A 3N9PA 3RFRA 1W9SA 2Q4SA 2V5DA 4QU2A 1V9U2 3J7MA 5FP4A 1NY72 1X36A 2PFWA 1PX3A 1KJRA 2PQQA 2EALA 1F9KA 1PMJX 5H9PA 3SCGA 2ADDA 1TMF2 1MS5A 2GC0A 4MADA 5CKQA 2WUHA 5IYYA 1T2XA 1C28A 1J58A 3SISA 2W1WA 4X8PA 4E27A 1V6OA 1US3A 4NROA 4C90A 5A3LA 5J1XA 2W39A 5K0UB 4LA3A 4H7MA 4ZU7A 4GIQA 5LWBA 3MUZ1 1UNBA 2JX9A 4RR3A 2ZGLA 4CEYC 1XU2A 3GHNA 3RYRA 3WW4A 2WBKA 4BQWA 5FYTA 5F5QA 2YGLA 4QWNA 5IVYA 2WT2A 2OA2A 3MGUA 1FI2A 4URTA 5T5OA 3TAYA 2JDAA 5CFCC 2ZBJA 3ZFGA 5IK4A 3VKNA 2GMPA 3ACIA 1DQ4A 2BUKA 2XKOA 2DVFA 1H8TB 5LB6A 3ZR6A 4AEKA 2BVVA 2P2KA 4LJHA 1J3QA 1ZBA2 4CCKA 1D4M1 2ZZJA 4EWDA 4B1LA 3TEXA 1F4AA 2QQLA 5FZIA 4IESA 2KD7A 3AJZA 3ZFEC 4UW4A 4CDWC 3ZIXA 1GOHA 4AE2A 1DP0A 4E2GA 3RVHA 2RG4A 2DV9A 2SLIA 2WNVB 4GKXA 4LBKA 5FYCA 2D6KA 4AFCA 1BKZA 1PIV2 4M4PA 2JE8A 5FBJA 1HRI1 2ZGRA 3ZX7A 1D2QA 3LDBA 5IAXA 1MQTA 1S55A 1ZX5A 2JG8A 4DMIA 5A7PA 3NKTA 2UU8A 2VNGA 1QU0A 1BBT2 1VBD1 5EJ1B 4Q8KA 2ZGUA 1S2EA 2C6SA 1LESA 1VMJA 2WR9A 2Y6JA 5FDBA 3S0MA 1B35B 4CCOA 1TZOA 4MH0E 4LXLA 4ZZ5A 5F3EA 3SKVA 4D6RA 2K9ZA 4IEPA 3VBHC 2FDFA 4XJAA 2RM21 3ZN4A 1YFYA 4TYSA 2QZ2A 5FYMA 4COVA 3OB8A 4MZUA 2QQWA 4K6BA 1EAH1 2GNBA 4JDNA 5B4XA 1AR63 3E6DA 4CCCA 3SLIA 4BQ4A 1EYBA 4JQTA 3POWA 4F3JA 3CO2A 4R52A 2EAAA 2GDFA 4FFFA 1MZFA 3N9MA 3W59A 2CTVA 3ZFFA 3T0BA 1OLME 4Q26A 5GZCA 4IV1C 2E9QA 3MF9A 3A22A 4META 1GZTA 1UWWA 4QDRA 2OYZA 4V1PA 3IBMA 4NJ4A 3T2QA 3WY6A 5BY5A 5FZBA 3OUHA 3WR0A 1ND2B 3MLJA 1LHWA 3MEPA 4GMP1 5JPNB 1C1FA 4IV3C 3POBA 1RUI2 2RS33 3LAGA 3BIEA 2GMEA 2VY0A 2P17A 3MPPG 3I2GA 3PTYA 2QVSB 3DL3A 3GJBA 4HXCA 3VHOA 4CP0A 5CADA 5A3TA 3VBUC 3WCSA 4EV0A 3GF6A 3ZXKA 3I2IA 3FMGA 3FC0A 4XUPA 4XQDA 2WC2A 1EUUA 3WQ0A 1Q8VA 2WFF1 2XR4A 1GLHA 4H14A 2GNMA 2AREA 3WF4A 3ZYBA 2P3KA 3TEYA 2OT7A 5D8AC 4N43B 2A70A 2XKPA
chains in the Genus database with same CATH topology
3DKQA 2HBTA 5EP9A 5LA9A 3NNLA 3OBZA 4NHLA 5M0TA 2Y34A 5DAXA 3GZEA 4XACA 3GJAA 3KT4A 4JZRA 4NHMA 2FCTA 4Q5OA 5EQUA 5DAVA 4BQWA 2HBUA 3OUJA 3MGUA 5LATA 4XABA 2V4AA 5LB6A 5LASA 5HV0A 3KT1A 2G1MA 5L9VA 2RDNA 2Y33A 3BVCA 4MHRA 3OUIA 4NMIA 2FCVA 4XCBA 2RDQA 5IAVA 2RG4A 4KBZA 5LBFA 4NHKA 4BQYA 5IAXA 5IATA 3PL0A 5C5UA 4NHYA 3NNJA 3NNFA 3ITQA 4ZONA 4UWDA 4MHUA 5DAPA 4NAOA 4XC9A 3W20A 2RDRA 4ZPIA 3KT7A 5L9RA 5DAQA 4XAAA 2JIJA 5A3UA 5HV4A 4IW3A 3EMRA 5LBBA 4NHXA 4Y5SA 2OPWA 5L9BA 5DAWA 2A1XA 3OUHA 5LBEA 5EPAA 2G19A 5ERLA 2RDSA 5C5TA 2FCUA 3GJBA 4XCAA 4BQXA 3W21A 3NNMA 4J25A 3HQRA 3HQUA 5LBCA 4Y5TA 2JIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKQ A;  2HBT A;  5EP9 A;  5LA9 A;  3NNL A;  3OBZ A;  4NHL A;  5M0T A;  2Y34 A;  5DAX A;  3GZE A;  4XAC A;  3GJA A;  3KT4 A;  4JZR A;  4NHM A;  2FCT A;  4Q5O A;  5EQU A;  5DAV A;  4BQW A;  2HBU A;  3OUJ A;  3MGU A;  5LAT A;  4XAB A;  2V4A A;  5LB6 A;  5LAS A;  5HV0 A;  3KT1 A;  2G1M A;  5L9V A;  2RDN A;  2Y33 A;  3BVC A;  4MHR A;  3OUI A;  4NMI A;  2FCV A;  4XCB A;  2RDQ A;  5IAV A;  2RG4 A;  4KBZ A;  5LBF A;  4NHK A;  4BQY A;  5IAX A;  5IAT A;  3PL0 A;  5C5U A;  4NHY A;  3NNJ A;  3NNF A;  3ITQ A;  4ZON A;  4UWD A;  4MHU A;  5DAP A;  4NAO A;  4XC9 A;  3W20 A;  2RDR A;  4ZPI A;  3KT7 A;  5L9R A;  5DAQ A;  4XAA A;  2JIJ A;  5A3U A;  5HV4 A;  4IW3 A;  3EMR A;  5LBB A;  4NHX A;  4Y5S A;  2OPW A;  5L9B A;  5DAW A;  2A1X A;  3OUH A;  5LBE A;  5EPA A;  2G19 A;  5ERL A;  2RDS A;  5C5T A;  2FCU A;  3GJB A;  4XCA A;  4BQX A;  3W21 A;  3NNM A;  4J25 A;  3HQR A;  3HQU A;  5LBC A;  4Y5T A;  2JIG A; 
#chains in the Genus database with same CATH topology
 4AED A;  1V6M A;  2XHN A;  1MAC A;  1UMH A;  2A6Y A;  4QKF A;  1NLQ A;  1QEX A;  3Q8E A;  2BEO A;  4FFG A;  1VBD 2;  4A4A A;  5M0T A;  4I0B A;  2X5I B;  5T5L A;  3UET A;  3SH4 A;  4FQZ A;  1W6Q B;  2PHW A;  3LWC A;  3UGH A;  3WHU A;  1LOE A;  1VAK A;  1JOJ A;  4ISR A;  1UX6 A;  3ZN6 A;  3LSD A;  4CCD A;  4I0W B;  1FAY A;  4Q5O A;  1PO2 3;  4EWA A;  3KS7 A;  2RM2 2;  5BNO C;  5A33 A;  5FOJ B;  3NVC A;  5JMO A;  4KQ7 A;  5A3P A;  3KV4 A;  1H8T A;  2ET1 A;  1O6U A;  1VIW B;  3IAQ A;  1TME 1;  4YG6 A;  3WF0 A;  1AF9 A;  1EAH 2;  4XW3 A;  1HQN A;  3ZMN A;  5C9A B;  5EYY A;  3W5N A;  3CZU A;  2B8M A;  4QX0 A;  1H6Y A;  4QX8 A;  1DBN A;  2ADE A;  4O61 A;  2NQY A;  5H9R A;  1O5U A;  4S2H A;  5JOW A;  2XVG A;  3OBA A;  4NMI A;  3E6B A;  2I74 A;  2FCV A;  1GV9 A;  3WNN A;  1JBC A;  2FDG A;  5ANQ A;  1DGW X;  4M01 A;  1KFU L;  1MS9 A;  1Q8S A;  3CJI B;  3DUI A;  3FLP A;  4DY3 A;  3V0A B;  2H0V A;  2W91 A;  3BPZ A;  2XJV A;  3OEA A;  3NW4 A;  3VBS B;  3RZZ A;  1B35 A;  2CY6 A;  4AQT A;  3VDB A;  4ZHN A;  2XOM A;  4MUV A;  5C6C A;  4LBQ D;  3ACH A;  2B9V A;  3RZG A;  2ZMN A;  3UKT A;  1DLC A;  1RB8 G;  2ZGN A;  5JMC A;  2D6N A;  5ABJ B;  1GOF A;  3FFZ A;  2XJR A;  3ECQ A;  1SBF A;  2YPJ A;  2DVG A;  1OUS A;  1U0A A;  3QAC A;  3VBR A;  2FDJ A;  1RUH 3;  1WZX A;  3AM2 A;  1MVQ A;  3OGS A;  5FZG A;  5DDJ 3;  3S30 A;  4TZD A;  3U75 A;  4LKE A;  2XUM A;  2ZML A;  3NV3 A;  1F5J A;  3POY A;  3MV1 1;  4L11 A;  5JSR A;  3NV4 A;  1UZV A;  2GAU A;  2VL4 A;  3IMN A;  5CBL A;  1DGR A;  1GIC A;  5LBB A;  1ZRF A;  2IXH A;  1UW8 A;  2JG9 C;  2ZAA A;  3I3E A;  1JW6 A;  1DF0 A;  4OZX A;  5FKC A;  5T54 A;  5T50 A;  1YIF A;  4CSW A;  4RD7 A;  5FMB A;  2QE3 A;  3OGJ A;  1NUK A;  4BQ2 A;  4EJR A;  3H1M A;  2B5H A;  4C8D A;  2QQK A;  3DV8 A;  5GZD A;  1G9C A;  5HXM A;  1PM7 A;  1LED A;  4LBN A;  1RYY A;  1YC6 1;  2F4P A;  4ZU5 A;  1T6G C;  1VAL A;  3I2D A;  4QPW A;  4YM0 A;  3AL5 A;  4FPJ A;  5B4N A;  2QJV A;  2YBS A;  3BOW A;  5GZE A;  3OY8 B;  1CGP A;  3GYD A;  1KJL A;  2VVF A;  2XQX A;  2ZA9 A;  4KG8 A;  1VBA 2;  2JDU A;  3ALQ A;  5FZ4 A;  5E1R A;  4RL7 A;  5FZ8 A;  1GZC A;  2DTW A;  5I0T A;  1N3O A;  3NNM A;  5IWF A;  1ST8 A;  5K8S A;  1RL3 A;  4N43 A;  1ZBE 3;  3B01 A;  3HQR A;  4XFG A;  3GZU C;  4YW2 A;  4D8M A;  5KWR A;  4QX2 A;  4YG3 A;  2BYV E;  2CAU A;  1KGY A;  3PME A;  4R9B A;  1HQW A;  1NT0 A;  3V56 A;  1WD4 A;  1U5Y A;  2R49 A;  1XSR A;  3ABZ A;  4N53 A;  5IK5 A;  4G9S B;  4CZS A;  4K21 A;  3ROU A;  4GAZ A;  2WQZ C;  1XYP A;  3QH6 A;  3PVB B;  1VBC 1;  4CE8 A;  3I2H A;  2IWG B;  3H1Y A;  2VBB A;  1AR6 1;  4LBL A;  4Z82 A;  2AAC A;  4JDM A;  1LHU A;  3OPT A;  4OUS A;  3HN3 A;  3F95 A;  4XBQ A;  5DAV A;  5DZE A;  3WEZ A;  5C9A A;  2WT1 A;  4V2W A;  3JXS A;  2PHU A;  4PDW B;  1S2K A;  2WDB A;  3C2U A;  1PNG A;  2A6V A;  4SBV A;  1FT9 A;  3UNP A;  3C3V A;  4B4Q A;  3K75 B;  3UGF A;  4OHZ A;  3E1F 1;  4YGC A;  5HV0 A;  2RS3 1;  2ATF A;  2WN3 A;  1XND A;  1ENR A;  2A6W A;  4Q1R A;  3MIG A;  3AYE A;  4IL7 A;  2VTX A;  2PAK A;  4HPK A;  4W4Z A;  2J1R A;  3IDA A;  3USU B;  1YFX A;  3CJI A;  5C4W C;  4J1W A;  1ALY A;  2RDQ A;  1NQD A;  1QHD A;  1HRV 1;  2W87 A;  3L2Y A;  3LQC A;  2CWS A;  1HJF A;  3THC A;  3WF3 A;  2BBV A;  4KBZ A;  2VZR A;  2C26 A;  1DFQ A;  4XUO A;  4A6S A;  4NWW A;  4Y1V A;  5FO8 B;  3KB5 A;  3WQ7 A;  2BGO A;  2Q5T A;  2VG9 A;  3HPN A;  3POF A;  3ZYR A;  2OS2 A;  1R09 3;  5FY8 A;  3USS A;  2PHX A;  5DZG A;  4YW1 A;  4B3N A;  3C7G A;  4XDP A;  4RS5 C;  4UYB A;  2WWS A;  4LKD A;  2X05 A;  3B9I A;  5F1R A;  3MID A;  2C9K A;  4M3C E;  4O65 A;  3WVJ A;  1CAV A;  3VDD C;  3ZSJ A;  3AFK A;  2CGN A;  3H7Y A;  3UES A;  1T6B X;  2VOV A;  3FE5 A;  4XFF A;  5T55 A;  3O12 A;  1HXS 3;  1LR5 A;  5FTT C;  1CPN A;  4YW4 A;  4Q29 A;  2CL2 A;  1A78 A;  1RUE 1;  2JIJ A;  4AI0 A;  5AFB A;  1H2L A;  4AVV A;  5IVE A;  4NIG A;  3AMP A;  4K20 A;  5IHR A;  4Q27 A;  1YXW A;  3Q8F A;  4EE2 A;  1YJL A;  1G9A A;  2PN5 A;  4OVE A;  1FX5 A;  2JE9 A;  5FXW A;  5HCB A;  4AR2 A;  2XQR A;  3JBG 3;  1AR6 2;  4PI0 A;  3R05 A;  4Q0V A;  4AEJ A;  1VLN A;  1DQ0 A;  1OD3 A;  2XJS A;  2VGD A;  2HWF 1;  4QHO A;  5IVF A;  3OY8 A;  2R32 A;  2JB4 A;  2TEP A;  4OUM A;  1URX A;  5J36 A;  3I3M A;  4YZ3 A;  1QKQ A;  3UKV A;  1WCQ A;  3V0B A;  1UX7 A;  1D0G A;  1JZ2 A;  4CA9 A;  3IPV A;  1V70 A;  2VMF A;  2RS3 2;  1QOS A;  2ZEZ A;  2WL1 A;  4KG0 A;  1M4W A;  3VD3 A;  3BTA A;  2XLG A;  5IVC A;  3WG3 A;  3E6C C;  2WS9 3;  1J1T A;  5FJK A;  3H8X A;  4FQ4 A;  5BNN C;  1WBF A;  3RYK A;  4YLZ A;  3BCW A;  3AKT A;  2NLR A;  2HWB 1;  3J8F 3;  3WW1 A;  4A2U A;  3AZW A;  2D3S A;  3I3D A;  1IPK A;  2BZD A;  1QMJ A;  1AR9 1;  1TNR A;  4QX3 A;  4AHY A;  1APN A;  1N3P A;  4BIO A;  4CVU A;  1LOG A;  2HBT A;  3D3A A;  2R0F A;  4JGY C;  1CJP A;  3LGR A;  3LEG A;  1SG3 A;  4RN5 A;  3AYA A;  3T3Y A;  3INA A;  3MF6 A;  1V6N A;  4AF9 A;  3O0V A;  4Q4Y 1;  4LTA A;  1AX0 A;  1RVF 2;  2P3I A;  4JGZ A;  1PK6 B;  2WO3 A;  5FY5 A;  4GQ7 A;  3OF1 A;  4LA2 A;  5DAX A;  5KR7 A;  5C70 A;  4CTE A;  1XNC A;  2WO1 A;  3T0A A;  2VMC A;  1PVC 3;  4RYD A;  5FZL A;  4YVS A;  5FPA A;  5FK8 A;  4WM8 C;  2FZ2 A;  4E2Q A;  1EPZ A;  2Z69 A;  4L0P A;  1F31 A;  1UZW A;  1PGS A;  2CSG A;  3OUJ A;  5FJH A;  1PO2 2;  4LKF A;  3VKL A;  3ILR A;  1WLT A;  1AYM 1;  3KV9 A;  1IQD C;  4RSU A;  3VZJ A;  1OQ1 A;  3OYW B;  1DHK B;  1EV1 3;  2D7F A;  2VU9 A;  4CXY A;  1Q3E A;  1JTZ X;  1DQ5 A;  2EXJ A;  2A71 A;  1IHM A;  1NA1 A;  4W6X A;  4ASK A;  1XRU A;  3KT1 A;  3USU A;  5A1A A;  2MPF A;  4CUB A;  4L92 A;  1H4G A;  4Y1X A;  2YBP A;  2EVX A;  3HJR A;  3ACL A;  4MO3 M;  1K5J A;  4AI3 A;  5CIS A;  3ME2 A;  5I0D A;  5LA1 A;  3VUO A;  2RMU 1;  3I4I A;  5KHK A;  2E6V A;  3OOX A;  4CU9 A;  5EHD A;  2ZX3 A;  1TEI A;  2VZQ A;  2XXZ A;  2VO5 A;  4XE9 A;  1NLR A;  2MEV 3;  4MGK E;  5K4L A;  3ZYP A;  4QDS A;  3NJV A;  1AL2 1;  5J98 B;  4OQ9 A;  5I8T A;  5FY4 A;  3U4X A;  4CUC A;  4HZF A;  1OVP A;  1RJ8 A;  2UY9 A;  4Z1V A;  1S1A A;  4K40 A;  1VB4 A;  3VZN A;  4LOS A;  2JDY A;  1ZRR A;  2Y60 A;  5H9Q A;  3N9L A;  5A7Q A;  1H0B A;  2RS1 1;  4BK5 A;  5L7O A;  4TTG A;  3ZXL A;  2YC4 A;  3AKQ A;  2VCB A;  2WIN B;  4UFM A;  4YNI A;  5DAQ A;  1AR8 1;  1OVS A;  4CDQ C;  2YYO A;  1H1M A;  3MFC A;  1UAI A;  1RUH 2;  2FDI A;  4NUB A;  1HB1 A;  4QPG C;  3D0S A;  4KNC A;  3PHM A;  5DDJ 2;  1PIV 3;  1CWP A;  1XYN A;  3LA2 A;  5GLU A;  1W8O A;  4RHV 1;  4P00 B;  4NAM A;  1GMM A;  1YLL A;  4CCM A;  2F17 A;  2GH2 A;  1JZ6 A;  1AYN 3;  3BOD A;  1POV 1;  1MZE A;  5CKM A;  3NAP C;  1IZ3 A;  5KBF A;  4KWU A;  3NV1 A;  3CKH A;  5FZ7 A;  2VE1 A;  5JR7 B;  3LOI A;  4DNY A;  5FZ1 A;  2XH6 A;  1GR3 A;  3LIH A;  2VZT A;  3U78 A;  2EF6 A;  1DG6 A;  1OHF A;  2V73 A;  5FKB A;  2BJS A;  2W1U A;  4WV8 A;  3BTX A;  5LZ6 A;  2AZ5 A;  1AR7 2;  3HEI A;  4DY5 A;  4DB5 A;  2ZX2 A;  3HBK A;  1UY3 A;  3WDW A;  3M7A A;  1K5M C;  4RGG A;  4UF0 B;  1QIQ A;  4AXO A;  4R9C A;  4OI1 A;  1WGP A;  2VQA A;  4UBG A;  5A6Y A;  5A3N A;  1DLL A;  1W03 A;  4LBQ A;  1R09 1;  5GZG A;  1O3R A;  4IXL A;  5F5C A;  1N1V A;  4Z07 A;  2E31 A;  4J25 A;  3VD5 A;  1RIN A;  1Y43 B;  4GH4 A;  1WLW A;  1ZBE 2;  3ETP A;  2BFU S;  4XXP A;  2BW8 A;  3WDY A;  1JHN A;  4C0H A;  1ASJ 2;  5FLI A;  4N90 A;  1CAW B;  3CQO A;  4FPL A;  2R06 1;  1PK6 A;  5CYY A;  3MLK A;  4GXL A;  2D43 A;  2Q1Z B;  4QB6 A;  4XBL A;  3DPR C;  1O3Q A;  1COV 3;  2ZEW A;  5SV5 A;  4HLT A;  1RUI 3;  4K3U A;  1UU6 A;  3OBR A;  4AL9 A;  4I2O A;  2PLV 3;  3H3L A;  1J3R A;  4U2A A;  1Q8P A;  2HWC 1;  2YZ4 A;  3DEC A;  4XFC A;  5SV8 A;  1Z78 A;  4FCA A;  1YQ2 A;  4ONU A;  3QBQ A;  2KXL A;  1K42 A;  2WNU A;  1FPN 3;  1K45 A;  2X10 A;  2FCT A;  3JBG 1;  3AP9 A;  2GZW A;  3PDQ A;  2HBU A;  4CEW C;  2EIB A;  2QQP A;  1DGR N;  4M3C A;  1QXJ A;  3WSO A;  5GLV A;  4CDU C;  1U5I A;  4K8F A;  5LAT A;  1QJU 1;  2DCT A;  4UFI A;  1C8M 3;  1W2O A;  3CZJ A;  2O8Q A;  1IPJ A;  3S57 A;  4D6S A;  5JAX A;  1WW5 A;  2VCM A;  5F2S A;  2YC0 A;  3TOJ A;  4CU8 A;  2GNT A;  4YW6 A;  4NRM A;  2OZ6 A;  2FDK A;  1Y9M A;  2WS9 1;  3TEW A;  5B2G B;  5HXV A;  3T1L A;  2WQ4 A;  1PMI A;  3Q8A A;  3MIH A;  5EJ3 A;  4NR1 A;  1F2N A;  2JJ6 A;  1MEC 3;  1CES A;  2J1S A;  3L2H A;  5C33 A;  4NHY A;  5GJ6 A;  5IVB A;  1LCL A;  3O1U A;  5FMO S;  4E8D A;  2CWM A;  1R09 2;  1SQ4 A;  2VVE A;  3OD0 A;  1MS1 A;  4AEM A;  5K7P A;  5GLW A;  5E88 A;  4AQS A;  3NNJ A;  1OH3 A;  2XDV A;  3KHC A;  4XC9 A;  3WHT A;  3ZFG C;  4KWJ A;  2E26 A;  4YVW A;  2UUR A;  1ZZ9 A;  4JTN A;  1PVC 1;  2R07 1;  2WII B;  5H9S A;  1HKD A;  4WVM A;  2PYT A;  3VZO A;  3R4U A;  1G9F A;  1HXS 2;  2ZGK A;  4BQ3 A;  3IWZ A;  4XIL A;  4JKK A;  4MX3 A;  2RJL A;  2JWP A;  4AGV A;  3AKS A;  3DCQ A;  4IET A;  4XFB A;  3BIW E;  1V9U 1;  1EP0 A;  2YV8 A;  4IW3 A;  1UKR A;  3AMM A;  1UKG A;  1NY7 1;  4R9A A;  4S2F A;  5FMO L;  4YRD A;  1RMU 3;  1BEV 2;  1SFP A;  2WO7 A;  2ZPX A;  1MQT C;  2JG8 C;  1TMF 1;  1CR7 A;  1GNZ A;  2YFU A;  3BAL A;  3J4U H;  2V5Y A;  5DN2 A;  2WZP P;  3WDX A;  3OEB A;  1AL0 G;  3III A;  4KBB A;  3APB A;  4YW7 A;  1FYU A;  3IN9 A;  3ZOI A;  3FL7 A;  4FTS A;  2E7Q A;  4HET A;  4XFH A;  1CZS A;  3T2T A;  2DCK A;  4LUM A;  1O5L A;  1S0D A;  2OX0 A;  2VPV A;  5FPV A;  4FPK A;  2CV6 A;  1Z0H A;  3SKJ E;  1QOT A;  5FWJ A;  3VBO B;  4BQX A;  4LO5 B;  5JOZ A;  1NCQ B;  2KM2 A;  2J7M A;  5BV6 A;  2A73 B;  5C7G A;  5FWE A;  4AHZ A;  3N3H A;  1CAW A;  2RJ2 A;  4YZ2 A;  4G4F A;  4QGM A;  3IZO A;  1UMI A;  2A3Y A;  4YZ5 A;  3ZIW A;  1XYO A;  4D7Y A;  1ZBA 1;  4QPI B;  1ENQ A;  1EY2 A;  3J8F 2;  1UY4 A;  1JUI A;  2V09 A;  3WQB A;  5JDB A;  4Y20 B;  5LA9 A;  4JQR A;  4FFH A;  5CB7 A;  5BNP B;  4KL1 A;  3ZFF C;  1PZ9 A;  4NHL A;  2DFB A;  4O7X A;  4XYX A;  1ULP A;  2QDR A;  5JUV A;  4FTE A;  2VOK A;  3ASI A;  1PIV 1;  3T2P A;  2J1E A;  4E9K A;  1XSQ A;  1IS6 A;  2WZR 3;  2B46 X;  3KMH A;  2Y0I A;  3SQO A;  2NZ9 A;  2EID A;  3FUQ A;  5J96 B;  2NP0 A;  1BBT 1;  1XE7 A;  1SAC A;  3PJQ A;  3M2M A;  4N9I A;  1PVC 2;  1AYN 1;  4E8C A;  3O5S A;  2DF7 A;  2N7G A;  3FN9 A;  1OFS A;  2C24 A;  3RG0 A;  3GBG A;  5FRE A;  1IKP A;  1YI9 A;  3HR9 A;  4XDO A;  4CP1 A;  1NE6 A;  4Q1P A;  1W6M B;  2VOT A;  3VDC A;  2Y8K A;  4OI0 A;  1ZYB A;  3GDB A;  2YG0 A;  5C71 A;  1CAU A;  1QGL A;  4JDO A;  3VN4 A;  1EV1 2;  4BE3 A;  1GWL A;  3ES4 A;  3CF6 E;  2VH9 A;  2VXR A;  2YY1 A;  5FZ6 A;  4COU A;  3I97 A;  2R0H A;  4WM7 B;  1AXY A;  1N1T A;  1SCR A;  1YQC A;  4AED C;  5JOY A;  5A6X A;  2XJP A;  2K46 A;  5FO7 B;  1OOP B;  2W2I A;  2P1B A;  1BYH A;  4CCE A;  2R04 3;  2PQS A;  1F4H A;  3SCF A;  1ZRE A;  1WUV A;  2VUL A;  1UCX A;  5FY7 A;  5JWP A;  4GWI A;  3ORJ A;  1AXK A;  1GNH A;  2ID4 A;  2MEV 2;  5C5U A;  3ELN A;  4NPL A;  3W9A A;  1XE0 A;  2O14 A;  5APA A;  3WW2 A;  1LOA A;  1RXF A;  1COV 1;  4IEZ A;  3MIF A;  4Z8B A;  4QKN A;  4CCJ A;  1RUI 1;  1RED A;  2OUH A;  1H8T C;  2XL9 A;  4Y4R A;  2EA7 A;  3ITQ A;  5DAP A;  4UWD A;  1ACC A;  4DUW A;  3VV1 A;  3HVD A;  3W20 A;  4BLJ A;  1JZ5 A;  3KT7 A;  2WSV A;  1Y4W A;  3FHA A;  4JC1 A;  3FX3 A;  3H42 B;  3O0W A;  4W50 A;  2O8O A;  4HSJ A;  3MIB A;  4XAA A;  1U5Z A;  1IGO A;  2WKK A;  2YUE A;  4GB3 3;  3POG A;  1Y9Q A;  3SNM A;  1UIJ A;  3L9J T;  1LEC A;  1SFY A;  4AWD A;  1JZ8 A;  3K46 A;  4IE5 A;  1YYN A;  5CFC B;  3OGG A;  1UU4 A;  4BB3 A;  5LA2 A;  2EIE A;  4D3W A;  4HON A;  5KC5 A;  1AYN 2;  4XAE A;  2FDH A;  4P08 A;  5FYV A;  3MV0 1;  5L9B A;  1B35 C;  3AZV A;  3I7D A;  1LHO A;  4XUQ A;  2FMY A;  3S6P A;  4ET7 A;  4BYY A;  1ZM1 A;  2HEY F;  4S2D A;  2BNM A;  2DU1 A;  2G9F A;  4F7Z A;  5HCH A;  2JD4 A;  1NCQ A;  2R1B A;  2RDS A;  1RUO A;  1JZ4 A;  3ATG A;  3ZXF A;  2XVK A;  3ZFE B;  5C8C A;  4CDW B;  3VBR C;  1MEC 1;  1QJX 3;  1IS3 A;  1QJZ A;  3I8T A;  3OSD A;  3RSJ A;  2QBX A;  1NCR A;  4HVQ A;  1LB2 A;  1W8Z A;  2AEN A;  2GU9 A;  2PHT A;  4Q0P A;  3P5B A;  3M3I A;  5FZE A;  5F3G A;  4OI4 A;  2MHF A;  5JCT A;  1W2U A;  1LGN A;  2KR2 A;  1YNA A;  3S7E A;  3QH7 A;  1GBG A;  5A7W B;  1W2N A;  4GWN A;  4Q4V 3;  2VVD A;  1L7L A;  4HT1 T;  4PBP A;  1E5S A;  1PZ7 A;  2QQI A;  5A3W A;  4LBJ A;  1V6J A;  1BVP 1;  2P3Y A;  1COV 2;  1PM4 A;  1QNY A;  1RUJ 3;  2EXI A;  2OVU A;  2RJK A;  3IB3 A;  3JD7 3;  3NWK A;  2GP3 A;  3PIJ A;  2VTF A;  4JHT A;  1UO9 A;  3WDU A;  2OZJ A;  2PLV 2;  1MZ5 A;  2ARB A;  1YO8 A;  1WD3 A;  3ILF A;  4Q0S A;  5A80 A;  5DQ0 A;  1W6M A;  3EXU A;  2ZHN A;  4LIV A;  1FPN 2;  1DYP A;  1TQ5 A;  4XHB A;  3WP5 A;  4AFD A;  4HSL A;  2DDU A;  4N43 C;  2E33 A;  4IV1 B;  2DYC A;  1LOF A;  4WM7 A;  2WJS A;  3LFI A;  5FIX A;  1CPM A;  4LO7 A;  5LAS A;  1XNT A;  1OOP A;  4K7J A;  3BI3 A;  1RVF 3;  2VZU A;  4BDV B;  2C0Z A;  1C8M 2;  1WWY A;  2CHH A;  3M4F A;  4IV3 B;  3RNS A;  1ULF A;  1VBB 3;  4N53 C;  5K0U A;  5CAZ A;  3RMY A;  5IJR A;  3OUI A;  3O1O A;  5EYX A;  1HIX A;  3AZX A;  4BIF A;  2JE7 A;  1N3Q A;  2XUE A;  3HAG A;  4LO4 B;  1EPW A;  3POJ A;  5FYB A;  3WNO A;  1WLC A;  1JMU B;  2IXJ A;  3KQ4 B;  1JI6 A;  3AZY A;  3J7H A;  5DZF A;  1JYN A;  3ZSK A;  4LOR A;  4PJY A;  2PHR A;  2H0B A;  1MEC 2;  4XF4 A;  1SCS A;  2B9U A;  5KHH A;  1CQ9 A;  5LY1 A;  3TEZ A;  3I2O A;  3ZXA C;  5A1F A;  5D8A B;  1HW5 A;  2WN2 A;  2X53 S;  2C5D A;  4FPC A;  4KU7 A;  4COZ A;  3IMM A;  5C9A C;  5J7M A;  4FI9 A;  4IEU A;  4A42 A;  4BU2 A;  3BN6 A;  1V6L A;  1W6P B;  1VBA 1;  5FMD A;  3KQR A;  1S2B A;  5HI0 A;  1UU5 A;  3RZL A;  4IER A;  1GUI A;  2IXI A;  1X82 A;  5L9R A;  5LRR A;  2WNV A;  5FV3 A;  5F39 A;  3U07 A;  4XF1 A;  3NV2 A;  1AJK A;  4LLF A;  5L19 A;  1LUL A;  1NKG A;  3K48 A;  4FOQ A;  1SLB A;  4FPG A;  4KU8 A;  3VKO A;  5JZG B;  4CPB D;  5LK5 A;  4QHZ A;  2WQ8 A;  3WX5 A;  4GKY A;  2XML A;  2JKX A;  4AFA A;  3CJI C;  5C3Q A;  4JRL A;  5BNO B;  1CX4 A;  3DN7 A;  3NJZ A;  3NL1 A;  4RFT 0;  3KV6 A;  4AK3 A;  2ZGP A;  1GYK A;  3FBY A;  4QXH A;  1K3I A;  3N9N A;  3N7K A;  5KHG A;  3AB0 A;  3I2J A;  2ET7 A;  3Q9O A;  4UAP A;  4C0B A;  1RMU 2;  1WA4 A;  4IGP A;  3DF0 A;  3JB4 C;  1AVB A;  4JHZ A;  1V6I A;  2ZGM A;  3MBW A;  4N8M A;  1FV3 A;  4QGN A;  4ZZ8 A;  2LRP A;  3R0R A;  4LOT A;  4M4R A;  5T5P A;  5ERL A;  3OJB A;  5I0U A;  2A6X A;  4YM1 A;  1DDL A;  2ORX A;  4BJ0 A;  4E4D X;  5JSO A;  4GWJ A;  4AI1 A;  2P37 A;  2PMW B;  2HKX A;  1WCD J;  2HWE 3;  4COW A;  1BCX A;  2PAE A;  2ARA A;  4UT5 A;  1XNB A;  3I49 A;  5CNA A;  4XFI A;  3LOB A;  1GP6 A;  1RUD 3;  1TE1 B;  3AMN A;  4IEQ A;  4AAP A;  5CG8 A;  4IGO A;  2WWU A;  3I54 A;  4YFW A;  1PO1 3;  1SPP B;  2YB7 A;  3LEI A;  2JIG A;  3WT3 A;  4CDX C;  1ND2 A;  1XNK A;  2GP5 A;  3D4K A;  3S7I A;  1HN1 A;  4I09 A;  5K9Y A;  1R64 A;  1YJK A;  3LDR A;  4C91 A;  3O1T A;  3VHR A;  4HL0 A;  1STM A;  4Y26 A;  2EAK A;  1AR7 3;  1R08 3;  1ENX A;  3RQ0 A;  4PIY A;  5GM0 A;  3SHR A;  1DYO A;  2BPA 2;  2I2S A;  3B02 A;  2WZR 2;  4LIU A;  2DBI A;  3OGR A;  4KI5 M;  4FPF A;  1U12 A;  5KXD A;  3MW3 A;  4EWE A;  4PF1 A;  2JG9 B;  5FXZ A;  2W9X A;  5G05 L;  4AGR A;  1ASJ 3;  1MS8 A;  3KWV A;  4UW3 A;  4A44 A;  5IFP A;  3O1M A;  2QQO A;  1CZT A;  2VW2 A;  4QHB A;  2Y6F A;  1UZY A;  2P4E A;  3MW2 A;  5FP9 A;  4IV3 A;  2VJX A;  3LSE A;  2X5I A;  3TWI A;  2VMH A;  3CEW A;  1BLZ A;  1OBN A;  4YSF A;  1W6Q A;  3H9A A;  5FMC A;  1ZRC A;  2VBP A;  5GLZ A;  4QPY A;  4LK6 A;  2EXH A;  1AJO A;  1QJX 1;  3AMQ A;  4LKS A;  1GSL A;  5LRS A;  3Q8C A;  3JZV A;  2LW8 A;  2G9G A;  2HEW F;  1AXZ A;  4FP3 A;  4JGZ C;  5FYH A;  1A6C A;  4P9X A;  4PHZ A;  5IAV A;  3WG4 A;  3ZSL A;  2RE9 A;  5FYI A;  1QJY 3;  1CJD A;  4UXA A;  5LBF A;  4NPR A;  2D6P A;  2R04 2;  4BQ5 A;  1W9Y A;  3B9C A;  2XON A;  4TWT A;  3PIG A;  4NVP A;  4YVS C;  2Z42 A;  5D21 A;  3OBT A;  1NE4 A;  4OZO A;  1O4T A;  1A3K A;  1XC6 A;  3EYP A;  4YAR A;  2Y6G A;  3UGG A;  4ASL A;  2Z2S B;  4YYO A;  1QJE A;  1VAV A;  5FOB B;  4JCK A;  1W2T A;  1WMX A;  3CDZ B;  4RGA A;  4Q4W 3;  5JZG A;  2I45 A;  4IDZ A;  2D3P A;  1ONA A;  2OQ6 A;  1NA1 C;  1SLL A;  4A7Z A;  4DXT A;  3PNA A;  4ZXE A;  1YEW A;  4XJZ A;  1PGL 2;  4RQP C;  3V0A A;  5DAB A;  2Q8D A;  3DXT A;  2W68 A;  4XZU G;  1ZRD A;  4KGG A;  3VBS A;  4L97 A;  2NN8 A;  4EN7 B;  3RI9 A;  3JCI A;  1OLM A;  2HLE A;  4GB3 2;  3VKM A;  5JR2 A;  1NZC A;  5CKN A;  1UYP A;  5ABJ A;  4UI9 L;  2AYH A;  3B93 A;  1OPO A;  1SHW B;  2HYX A;  1UOB A;  1RVF 1;  4ATF A;  1O91 A;  3C7O A;  5FR3 A;  4XEZ A;  2SBA A;  1KEX A;  4DXR A;  4XBN A;  2Q8C A;  2AR6 A;  5JXJ A;  3RPQ A;  1UMZ A;  4PLN A;  4MVT A;  1RUG 3;  1VP6 A;  1XB9 A;  3VD4 A;  3LFM A;  4MGY E;  4UFK A;  1VJ2 A;  4KWK A;  1HLC A;  4P9I A;  3N9O A;  4IND A;  5JOX A;  1S0G A;  3SXW A;  2P34 A;  3LDK A;  5L7O C;  1PO2 1;  4EN9 B;  4LHK A;  2WO2 A;  3JU9 A;  2O1Q A;  3JQX A;  1QJX 2;  1UOJ A;  1DZQ A;  2VZS A;  2R1D A;  2AEY A;  4DEQ A;  4LMF A;  1DQ2 A;  4OLL A;  5JI7 A;  4EZH A;  1BEV 3;  2V4V A;  4DUX A;  4E4Z A;  1PNF A;  4ZS3 A;  3NST A;  4RS5 B;  5EV7 A;  2Q1M A;  2RR1 3;  4CCN A;  4DPN A;  2PXJ A;  4AVC A;  2NM1 A;  1WA6 X;  2Y6H A;  2LAL A;  4NO4 A;  3MIC A;  1ZZ7 A;  3PUH A;  4H7L A;  4Q4V 2;  4LHS A;  3VDD B;  2ZJC A;  3M70 A;  5EIY B;  3ZYI B;  4U36 A;  1H9W A;  2QQN A;  2QZ3 A;  3GGL A;  1C1L A;  3PJY A;  3TYJ A;  3MDP A;  2CYF A;  3SEE A;  1OT5 A;  4BXF A;  4EQV A;  4Y1U A;  3JD7 2;  1CZV A;  1RUJ 2;  1WW7 A;  3PUR A;  1W8U A;  3OPW A;  1DGW A;  1UF2 C;  2P6H A;  3TB0 A;  1REE A;  4BLI A;  4NII A;  2Z5W A;  3O1S A;  4YFZ A;  2Y0O A;  5FZA A;  5GKA C;  2WLP A;  1PMH X;  4OHY A;  4Y5Z 0;  4AGG A;  4LBO A;  1V00 A;  4IEX A;  4FOV A;  5LY2 A;  5JVV A;  1W6N B;  4ORF A;  4GH4 C;  3RGB A;  1ZZ8 A;  3TN9 3;  3U4S A;  3AP6 A;  5F5I A;  2DVD A;  1RUH 1;  4DOU A;  1PGW 2;  2W47 A;  2V72 A;  5DDJ 1;  1S0F A;  1CAX B;  2P6C A;  2JDP A;  5AC9 3;  1VBB 2;  4NIA A;  3BB6 A;  1UYY A;  4PLM A;  4OYU A;  3PMS A;  3ON7 A;  1RUD 1;  4AVB A;  2ORZ A;  4XJU A;  3B7M A;  1S0E A;  4BIS A;  3AXE A;  5I8S A;  4PDW A;  1GOG A;  4RFR B;  4LO6 B;  4GZ9 A;  1UY0 A;  4FT8 A;  5BNN B;  2WNU C;  2ZHL A;  3WD5 A;  5CA6 A;  4Q0U A;  3SIT A;  3WV6 A;  1WW4 A;  3FUO A;  4AVA A;  4BOW A;  3WW3 A;  1OKO A;  1LGB A;  5A7O A;  2YHJ A;  5F8P A;  1AR7 1;  4QAW A;  4JGY B;  4COY A;  2R30 A;  2P3J A;  1R08 1;  2W1Q A;  4Z2W A;  2EIG A;  4Y3O A;  5FY9 A;  4LK7 A;  2VR4 A;  2HWD 3;  2WZ8 A;  3PVN A;  4DRR A;  1BVV A;  5IVV A;  1W8H A;  2VW1 A;  4FPY A;  4EN6 B;  3W5M A;  4LIT A;  2JDZ A;  2ZTN A;  1AUY A;  1LOB A;  1JU3 A;  2DUO A;  2X29 A;  3BU7 A;  1JU4 A;  2DCZ A;  3T08 A;  3IDB B;  2D44 A;  1A34 A;  1ZBE 1;  1FMD 3;  1Q43 A;  1UXX X;  4AQ6 A;  3GCX A;  5FFO C;  1ASJ 1;  1RUC 3;  1ULG A;  3E5U A;  3FBM A;  2ZAB A;  4XFA A;  3N7M A;  3BU0 A;  4PCR A;  2AC1 A;  4Y5S A;  2VQU A;  3UL2 A;  5FZC A;  3CLP A;  4IE0 A;  4OMD A;  1VRB A;  1WMD A;  2IFW A;  3HNB M;  3OD4 A;  1XU1 A;  2XL7 A;  5J37 A;  5EFU A;  3BKZ A;  2B42 B;  4IE4 A;  1H2N A;  3D5O A;  1JH5 A;  3N4M A;  1ND3 B;  1DQ6 A;  1TG7 A;  2WA4 A;  4KMQ A;  4N9H A;  4YVW C;  3KM5 A;  3BUC A;  2WYS A;  3POE A;  1UZZ A;  4W6Y A;  4PIX A;  4WZF A;  3MO4 A;  3VLB B;  1A8D A;  4PI2 A;  3M8L A;  2HWE 2;  4LNV A;  3ES1 A;  4DZG A;  5LBC A;  1VBE 3;  1C5I A;  1RUD 2;  3H8U A;  4Q4W 1;  3J7L A;  5FYS A;  5FZM A;  2PHF A;  2A75 A;  2WZE A;  3DKQ A;  4NOT A;  2UYB A;  4HN0 A;  1PO1 2;  1H30 A;  3ZR5 A;  1Q56 A;  4CPB A;  3H3U A;  2JEN A;  4LE4 A;  4Y33 A;  4HKO A;  1N47 A;  1J59 A;  1IKQ A;  2AEZ A;  4QPG B;  1R08 2;  1HB2 A;  3ACF A;  3MYX A;  1ZA4 A;  5DUW A;  5ACA 3;  3AKR A;  5KXE A;  1YCI A;  3H0O A;  2GMM A;  4OQ8 A;  4NHM A;  3WUD A;  3MUY 1;  1OI6 A;  2DUP A;  1W6N A;  4CP2 A;  2CAV A;  3ZLI A;  3RZH A;  2VUD A;  2ZKL A;  3NAP B;  3RZM A;  4XXA A;  3V64 A;  2OXB A;  3LF7 A;  2FD8 A;  3AP4 A;  2DUQ A;  2E63 A;  2G1M A;  5L9V A;  3I59 B;  3RWK X;  4NID A;  1HXS 1;  1PX4 A;  1VRH 3;  5JPM B;  2A6Z A;  1S4C A;  3LIG A;  4TXW A;  2D6L X;  3O1V A;  3H8O A;  4LT5 A;  3RJ2 X;  5BNQ A;  4IQP A;  2Y6L A;  2XJU A;  4E4H A;  1DZR A;  3DEM A;  2GC1 A;  2VUA A;  5JXH A;  4FXG B;  1OFN A;  3FLR A;  1IG3 A;  1H6X A;  2HYK A;  3ZYJ B;  1BEV 1;  3ZYG A;  5FPB A;  3MW4 A;  3VBF B;  3H7J A;  3OYW A;  4UFJ A;  1GWK A;  2BER A;  2WAO A;  4WVV A;  1QJY 2;  5FZF A;  4YPJ A;  3WNL A;  4DFS A;  1W90 A;  4AQ2 A;  1UZ0 A;  1RHI 3;  2UWB A;  2BFU L;  1ZZC A;  3CNA A;  4OFG A;  1CX1 A;  2VZ1 A;  2IXK A;  3LPG A;  4QT6 A;  4DUV A;  3HIF A;  2PEL A;  3VZM A;  2E7A A;  4QQ2 A;  3NNF A;  5L73 A;  3AX4 A;  1JYV A;  4ZON A;  3CMG A;  3DPR B;  4K1Z A;  4OMC A;  1JHJ A;  4HAN A;  3I2K A;  3K3N A;  4Q4W 2;  4XTM A;  3FZ3 A;  3AXD A;  1ULE A;  2D6O X;  3KVA A;  4MSV A;  3WG2 A;  3KF3 A;  2R6Q A;  2BOJ A;  1Z7S 3;  4RGK A;  1D4M 3;  1UYZ A;  4AW7 A;  2IVJ A;  4MGZ E;  5FUI A;  3UT0 A;  3OTF A;  4AI2 A;  5EZW A;  5A3U A;  3FJS A;  2J42 A;  5EXO A;  4QM9 A;  4CEW B;  3LZZ A;  3J8F 1;  3DYM A;  2QDN A;  1OA3 A;  2BP6 A;  4AAX A;  1HRI 3;  2NYY A;  5ISL A;  4RR3 C;  4CDU B;  3TN9 1;  1JZ3 A;  2VMD A;  2LTN A;  3U1X A;  3KCX A;  4XOG A;  4I0A A;  4MXV A;  2IVI B;  3O1R A;  1GZW B;  2DBN A;  1ND3 A;  1BZW A;  2JB8 A;  2A1X A;  4FVV A;  4HOO A;  5AC9 1;  2JDN A;  4XF9 A;  1RXG A;  3B00 A;  5EPA A;  3U14 A;  3AMH A;  3P1I A;  4YWA A;  1GQH A;  1RUG 2;  1UYX A;  4MGS A;  1FXZ A;  5HCA A;  4XF3 A;  4PT6 A;  2VD7 A;  1X50 A;  5GLT A;  3VHN A;  2ENR A;  3PLQ A;  5CFD B;  4L9B A;  1W8T A;  2DVA A;  3ZPY A;  1NX9 A;  3VD7 A;  4PQ9 A;  1EV1 1;  4QKB A;  4ZS2 A;  3RWN A;  4CUA A;  5I91 A;  2GSY A;  3OPZ A;  2VZP A;  1CN1 A;  2A7A A;  3BOP A;  4HVO A;  1QWR A;  5EJZ B;  1NLS A;  4I3G A;  4AG4 A;  3MIE A;  4QQO A;  2RR1 2;  1WME A;  3HQX A;  4ZKT B;  3NNL A;  2WAB A;  2JXA A;  1GNY A;  4UF0 A;  4MOA A;  4E4S A;  2OUJ A;  5FPL A;  4YG0 A;  5I93 A;  2CGP A;  3UKN A;  2MEV 1;  4IGQ A;  1RGS A;  2ZMK A;  2PHL A;  5CIR A;  3KGZ A;  1NCQ C;  4CYD A;  5IUQ A;  3WOG A;  3S5A A;  3I3B A;  1O4Y A;  2J22 A;  1A8M A;  1SFN A;  5C8C C;  5IFT A;  2UWC A;  5F3C A;  2VTX J;  1JYW A;  4GAL A;  3A7Q A;  2ZX1 A;  1X8M A;  1NCR C;  3AC0 A;  3P3N A;  2BU9 A;  4NE9 A;  4B8E A;  1CVN A;  4HN1 A;  3JB8 A;  3I59 A;  1OSG A;  1S0I A;  1YRZ A;  4XTP A;  3VHP A;  2TBV A;  4LPL A;  2JG8 B;  2WFF 3;  3WNP A;  4F8A A;  3FHI B;  4QXC A;  3EO6 A;  2VAU A;  3RS6 A;  3H8R A;  4HKW A;  2TNF A;  5FY1 A;  1VMF A;  4HBN A;  1YHF A;  3K3O A;  3C7E A;  3TN9 2;  2VNV A;  4XJ8 A;  2FZ1 A;  2ILM A;  5AVP A;  4DIQ A;  1W9T A;  5DMY A;  3M3Q A;  3HMY A;  3R4D B;  2IC1 A;  4GJY A;  3LEK A;  3VBF A;  4P9W A;  4XCB A;  5FYY A;  1W3X A;  2D93 A;  2G4I A;  4N7I A;  5AC9 2;  5C3O A;  2JDM A;  5T52 A;  2D97 A;  4MLO A;  1Q5O A;  1RTV A;  1RC6 A;  4Q4X 3;  4LUK A;  2RVA A;  2YGM A;  5F32 A;  4YZ4 A;  4TLG A;  1UPS A;  4JV4 A;  2W92 A;  5FCC A;  4HG6 B;  3SEP A;  1US2 A;  3C8X A;  3WNM A;  5J09 A;  2VCA A;  3B3Q E;  1KRI A;  2VZV A;  1SEF A;  1ZA7 A;  4JAA A;  1O59 A;  5FK7 A;  3POI A;  3W58 A;  4AFM A;  1M06 G;  1TME 3;  3M1H A;  4D7S A;  3ZFF B;  4MHU A;  4B7E A;  2C9A A;  3WXP A;  1ULO A;  5FZ3 A;  1G7Y A;  1QQP 2;  1LOF C;  5F6L B;  4EN8 B;  1LOC A;  1SDD B;  1W3V A;  3BGA A;  2HWD 2;  4YM2 A;  5A6Q A;  2QKD A;  3GCW A;  4AZZ A;  3ZXD A;  4XET A;  1ULD A;  1W6O B;  5DG1 A;  5ANN A;  4AI9 A;  5K0U C;  4W6W A;  1W8W A;  4DO0 A;  2ZGT A;  3LD8 A;  1FMD 2;  4AI8 A;  5HV4 A;  2YBK A;  2BTV C;  1RUC 2;  3EMR A;  2A5Z A;  3WF2 A;  3BYW A;  3AVS A;  1G9B A;  3VD9 A;  3ZMO A;  2XJT A;  3SH5 A;  2UYA A;  1VRH 1;  3QCW A;  2ZX4 A;  1EUT A;  4PQQ A;  3WG1 A;  4I30 A;  4B4R A;  2PLV 1;  1BXH A;  3WP6 A;  2PA7 A;  2G19 A;  2XB6 C;  1BK0 A;  1MZ6 A;  2VC9 A;  4HVR A;  4J1X A;  4ZXK A;  1W99 A;  4AED B;  1HQL A;  5HPO A;  2B39 A;  5CFD A;  1ENS A;  1OH4 A;  2ZGS A;  5FZK A;  5BPX A;  3T4H B;  3VB9 A;  1FPN 1;  5FLH A;  1XBF A;  3CHX A;  1UY2 A;  2WNV C;  3VL9 A;  4CEY B;  1RHI 1;  4DXS A;  1FOD 3;  5AFE A;  5IT6 A;  3ZN6 B;  3O0X A;  3KD4 A;  3DYO A;  4GD4 A;  4AVS A;  2QQV A;  1C8M 1;  5A33 B;  1DIW A;  3WDV A;  3BPS A;  1VBE 2;  1GU3 A;  2P5B A;  2JIC A;  3ZPO A;  1HV1 A;  1QF3 A;  1Z7S 1;  1GP5 A;  2QNK A;  1SBD A;  3M3E A;  1W0P A;  2WFP A;  1E5I A;  2Y34 A;  3VBO A;  2W95 A;  4XPV A;  3NMB A;  4D6Q A;  1OF3 A;  2GN7 A;  1SLT A;  1XE8 A;  2E51 A;  3GZE A;  4R9D A;  2BRT A;  5FUN A;  2GN3 A;  4S2G A;  2BV4 A;  3RMX A;  4GUL A;  2WYF A;  4XAC A;  4UW6 A;  4FPE A;  3A0K A;  2ZS6 B;  1D2S A;  5ACA 2;  3CIH A;  1JOD A;  3GXU A;  2WA3 A;  2WSU A;  3AVR A;  2QQJ A;  1OA2 A;  4XVH A;  3GZT B;  4QPI A;  5G04 L;  3UJQ A;  4KWL A;  4Y20 A;  1KDK A;  2ZKN A;  5BNP A;  1WCU A;  4W8J A;  2IXL A;  2GH8 A;  4QDQ A;  4FPH A;  1BQP A;  2XVL A;  5F2W A;  4FSJ A;  1SMV A;  4ASM B;  4BM8 A;  2CNA A;  1ND2 C;  2TUN A;  1WKY A;  3BVC A;  3HOB A;  3PU8 A;  4AHX A;  3R6S A;  4CXW A;  2LS6 A;  3VBH B;  4DXZ A;  1VRH 2;  3D0J A;  4ERO A;  3VBR B;  2YDE A;  1VBC 3;  1JN2 P;  1OUX A;  4QX5 A;  2FBE A;  2A3W A;  3UK9 A;  5CG9 A;  1YQ8 A;  3IDE A;  4DQA A;  2IXC A;  3VZL A;  2PHD A;  1RMU 1;  3DYP A;  3HNY M;  3PL0 A;  2PAM A;  4AFB A;  4X8N A;  2IFR A;  3SC7 X;  2RHP A;  1AHS A;  2DCJ A;  2XPJ A;  5JSP A;  4M00 A;  4C1W A;  1LKN A;  1RHI 2;  5A1L A;  5LW9 A;  4O9E A;  2BNO A;  4AYU A;  5BUV A;  3FWE A;  4OHV A;  3LCP A;  2NMN A;  3IT8 A;  3V65 A;  1BJQ A;  1KXG A;  5LCW L;  1W6O A;  5I0S A;  4ZPI A;  2X5I C;  4P9Y A;  1FV2 A;  5A70 A;  1LU1 A;  1SBE A;  2IUW A;  2UWA A;  1VMH A;  1YQ6 A;  4ZU4 A;  5FO9 B;  1Z7S 2;  3PUA A;  5BXX A;  1D4M 2;  2WNO A;  3VBU B;  3WNX A;  1QDC A;  1ZNP A;  4A7K A;  2IZW A;  1HRV 3;  3PVO A;  1R1A 3;  5E89 A;  3WUC A;  4QMA A;  2C1F A;  3QLQ A;  3NQH A;  2ZGO A;  2Q8O A;  2OPW A;  1MR5 A;  1HRI 2;  2QCS B;  3PUS A;  4QQH A;  3ZKU A;  2VOW A;  1ZRI A;  5FPZ A;  3IIA A;  3RJR A;  2WZR 1;  3SH3 A;  1TNF A;  3A4U A;  4N53 B;  4Y1Y A;  4QB2 A;  4JRA A;  4P9L A;  4CEY A;  1OXC A;  1NOV A;  1ODN A;  4Q4X 1;  4R4Z A;  5JZG C;  5FAX A;  2VEC A;  1UOF A;  1SZB A;  3KGL A;  3N7J A;  3IKW A;  1RUE 3;  2XLF A;  5CFC A;  4AHW A;  1IS5 A;  2XBO 3;  4A7Y A;  1BMV 1;  1Q8O A;  3VBS C;  2QTW B;  4BHP A;  2Y64 A;  1BHG A;  1XOY A;  4P02 B;  1F8V A;  3A21 A;  5FZO B;  3GAL A;  2E32 A;  4A3X A;  3X29 B;  4XJW A;  4UFL A;  1QJF A;  1VAM A;  5ABJ C;  5JXG A;  1UD1 A;  1QXR A;  2B4K A;  1LEM A;  1H9P A;  3KV5 A;  1O8S A;  3U11 A;  3ZFE A;  4CRQ A;  2HWF 3;  4GA9 A;  4CDW A;  1V6K A;  1NZI A;  4NRP A;  3GBW A;  2E53 A;  5DUU A;  2R04 1;  2ES3 A;  3C7H A;  1LTE A;  5CZK A;  1W04 A;  2RS5 3;  3DKW A;  3WQ1 A;  3U0Z A;  1JOB A;  3TBD A;  4HPK B;  4XF0 A;  5A3M A;  4JZR A;  5E8A A;  2MNG A;  2Q8E A;  5A7W A;  2AGS A;  4NWV A;  1I1E A;  4PLO A;  2DTY A;  1C4R A;  3A23 A;  1OF4 A;  5IW0 A;  5HBA A;  4L99 A;  2ZEX A;  3U37 A;  4MGI E;  1YUD A;  3WP3 A;  4HFS A;  1AX1 A;  3VGI A;  4NIH A;  4GWM A;  1QNW A;  1QXP A;  4Y24 A;  1W2A X;  3C7F A;  2ARC A;  2HWB 3;  3KSC A;  3VBH A;  3ZM8 A;  2RV9 A;  2WFF 2;  3GNE A;  4I3P A;  1AR9 3;  4TLF A;  1PGL 1;  3K2O A;  2YRO A;  4HK9 A;  3AP7 A;  3J26 N;  4QX1 A;  4B1M A;  1J1L A;  1GWM A;  3EB7 A;  2R16 A;  3AK0 A;  4FTB A;  1CAV B;  3SCH A;  4Q4Y 3;  3ZYH A;  4DEV A;  4GB3 1;  2VUJ A;  4OUL A;  2OKX A;  4BPZ A;  2JEC A;  1LGC A;  1FOD 1;  1K12 A;  3HNM A;  4WBB A;  4ARY A;  5F6K A;  2YC2 A;  1JYI A;  1IQA A;  5IK7 A;  1MS0 A;  5IAT A;  2EIC A;  1OUR A;  4IEW A;  1XJA A;  2XHK A;  4FPO B;  4IV1 A;  4Q4X 2;  4YGD A;  5KC6 A;  1DU3 D;  4X6Q B;  3AYC A;  2J1U A;  3J7N A;  1AYM 3;  1YFW A;  4CDX B;  5IK8 A;  3HWJ A;  3IDC B;  3LA3 A;  5C8W A;  3SMH A;  3N9Q A;  1BMV 2;  1RIT A;  4P5H A;  2WLQ A;  4DIN B;  1TME 2;  1S0J A;  2D98 A;  2VBD A;  1IOA A;  3AL6 A;  1PVX A;  3VBU A;  4MYE A;  2BBA A;  4NPM A;  4LLO A;  3R4S A;  3DXU A;  2YXS A;  4A3Z A;  1OQD A;  3V0B B;  2RMU 3;  1FAT A;  4KGQ A;  4KH9 A;  3IPV B;  2WT0 A;  1G9D A;  5KXC A;  1JUH A;  2WRA A;  5D2A A;  5D8A A;  2WAA A;  5C3S A;  2D5H A;  3ST7 A;  3WF1 A;  4Q4V 1;  4XMI A;  4E2S A;  3VDA A;  3G6J B;  4PDW C;  1DYK A;  4BCU A;  1AL2 3;  1LEN A;  1W6P A;  1Y3T A;  2JDK A;  5DUX A;  3LA7 A;  1X7N A;  1QOO A;  1KS4 A;  2OW4 A;  1R1Z A;  5BYN A;  5FPU A;  3QOP A;  1WLD A;  3JD7 1;  1FNY A;  1RUJ 1;  2A3X A;  4MG2 A;  1ODM A;  3KCY A;  4TN7 A;  4QXB A;  2VCC A;  1JYT A;  3WP4 A;  2BQP A;  2RS1 3;  2YU1 A;  1MPX A;  5FXV A;  4AOC A;  1W39 A;  3GZA A;  4ZY9 A;  1LHV A;  5BNO A;  3J9S A;  3EHK A;  1AR8 3;  4JGZ B;  4JKL A;  1D0H A;  3W21 A;  3ENR A;  4XUR A;  1WCK A;  1JYC A;  3M3C A;  2XWJ B;  3HT1 A;  1OMI A;  2XWB B;  3LEM A;  5FZO A;  3RDI A;  2VUC A;  3A0N A;  4OI2 A;  4OHX A;  4RHV 3;  4YVS B;  1UN1 A;  1YQ5 A;  1VR3 A;  3HQU A;  3EJK A;  4Z2A A;  4M0H A;  1XPW A;  1FOD 2;  3LKJ A;  1PGW 1;  3MHZ A;  4JVA A;  2VMI A;  2AUY A;  2UY8 A;  1X9T A;  1POV 3;  2NPI A;  3B5L B;  4Q8L A;  1LAJ A;  4L2N A;  1O7F A;  1VB2 A;  1VBB 1;  3HD8 B;  2G9Z A;  1U5X A;  1NAE A;  3O14 A;  3TNQ A;  1RUN A;  1NA1 B;  4V2V A;  3H1W A;  4FOW A;  4IE6 A;  4YGB A;  1CIY A;  2KA3 A;  4K1Y A;  4RQP B;  4YM3 A;  5C4W B;  1R1A 1;  2ZGQ A;  1JXN A;  4MV2 A;  5FZ0 A;  4FBF A;  2E7T A;  1OQE A;  4MXW B;  3E97 A;  2Y26 A;  1SPP A;  3ZDS A;  4XDQ A;  4AVT A;  2ZOE B;  4ES9 A;  1QH7 A;  4IE7 A;  2VOX A;  5FP3 A;  3URF A;  4A41 A;  4SLI A;  4DS0 A;  1L7Q A;  2D40 A;  2WNE A;  2R7E B;  3H50 A;  2V4A A;  4BA6 A;  1W0N A;  4HMZ A;  1E5H A;  1GQG A;  4FP2 A;  2R06 3;  2ZXQ A;  3JUU A;  4PBO A;  1WMF A;  3HN1 A;  1KQR A;  1RJ7 A;  1HB4 A;  2CGO A;  3ZKY A;  2JD9 A;  2LRO A;  3ZYF A;  2Q1F A;  4D0Q A;  5L7O B;  1UIK A;  4XQ4 A;  5EWS A;  3BTZ A;  5C3R A;  2B7Y A;  2HWC 3;  2XBO 1;  3ACG A;  2J1T A;  1WW6 A;  1HDK A;  1PZ8 A;  1VBC 2;  2JG9 A;  3IM0 A;  1FNZ A;  1LRH A;  2D3R A;  2L9L A;  4UFH A;  4JTO A;  4Z92 B;  2BVB A;  4CDX A;  1KS5 A;  4P14 A;  1X9P A;  5FBZ A;  4ES8 A;  1O4Z A;  2DUR A;  2HJI A;  1VE0 A;  2W46 A;  5LK7 B;  1IS4 A;  3THP A;  3UYJ A;  3PVE A;  1H2K A;  1POV 0;  4QM8 A;  4XHX A;  3RYP A;  5FRA A;  3K4D A;  1QJU 3;  4HKL A;  4NAO A;  3THD A;  5E6H A;  4CUG A;  2W1S A;  5FPX A;  2ARX A;  1OPM A;  3MPB A;  2RS5 1;  2GC2 A;  1NXM A;  1XQN A;  1PK6 C;  2FMD A;  3I2F A;  1F5F A;  5JIA A;  1W8N A;  1LHN A;  1YWK A;  2HWE 1;  3LPF A;  2JEM A;  4M0N A;  1RUF 3;  2QUO A;  5FLJ A;  3HT2 A;  3CBN A;  1W06 A;  2LM3 A;  1OA4 A;  3OGV A;  4CU7 A;  3GHM A;  1PO1 1;  1HRV 2;  4LBQ B;  3LB9 A;  2JDH A;  1I3H A;  1R1A 2;  4IEY A;  4F83 A;  4YGE A;  2Y38 A;  4JKM A;  1L3J A;  2BWC A;  1LNS A;  3EQE A;  4GH4 B;  5A7N A;  3WDT A;  3AP5 A;  1MS3 A;  1D4V B;  4UW5 A;  2GAL A;  2WWJ A;  5DAW A;  1QQP 3;  4BMB A;  3PUI A;  4Q0Q A;  3O7O A;  2VME A;  5LBE A;  3FFQ A;  1NXD 1;  4DRV A;  2AH2 A;  4XIO A;  1JZ7 A;  3T0D A;  2R07 3;  1NYW A;  3NKG A;  1C8N A;  1LJ7 A;  1XXN A;  5FZH A;  2ERF A;  2W0X A;  4WM8 B;  5C3P A;  3O1P A;  2W94 A;  4IEV A;  1W28 A;  1RUE 2;  1SDW A;  1MS4 A;  2WNU B;  1Y9G A;  1CIW A;  4QQL A;  2XBO 2;  4D7T A;  3I3Q A;  1PHM A;  1V9U 3;  2BGP A;  3G7D A;  4M3C B;  4BH9 A;  4EYU A;  2XG3 A;  4BK4 A;  5JIU A;  4FO9 A;  3RZK A;  4QXK A;  4R8H A;  1TMF 3;  4RQP A;  3OBZ A;  3T09 A;  5C4W A;  2YMZ A;  4ARX A;  3K4Z A;  2OQ7 A;  4PIZ A;  3LE0 A;  4K8R B;  5F37 A;  1QY4 A;  2DFC A;  2HWF 2;  1ND3 C;  4O9G A;  4LEJ A;  5FY0 A;  4MXW A;  4L8Q A;  5CVR A;  2VXJ A;  1QJY 1;  3CJX A;  3WIN E;  4BXS V;  2DVB A;  3NJY A;  3GJA A;  1G86 A;  3KT4 A;  2RS5 2;  4QGL A;  5TSW A;  1I6X A;  5EQU A;  2K2S A;  4RS5 A;  4CXX A;  4QU1 A;  5FXX A;  4EZ4 A;  2VNR A;  2VM9 A;  4K9S A;  3VZK A;  3GM8 A;  1TVG A;  4FXK B;  3VDD A;  3ZXE A;  3D8C A;  2VQT A;  1XNA A;  1UY1 A;  2ZEY A;  2HEV F;  1LU2 A;  4WVW A;  4XAB A;  3T4V A;  1SLI A;  2QFE A;  1ZBA 3;  3WNK A;  2QQM A;  2HWB 2;  2CDO A;  3DGT A;  4WZC A;  1H2M A;  2C4X A;  2Q30 A;  1P8J A;  3ZO0 B;  1AR9 2;  3FHQ A;  4D94 A;  2QQU A;  4MHR A;  1KIT A;  1G6N A;  3ZVX A;  5D1I A;  4CDQ B;  4YVW B;  2YU2 A;  1F15 A;  2CU5 A;  1N1Y A;  1WCS A;  2H6C A;  4QX7 A;  3KZ4 C;  3MFA A;  5FQ0 B;  4Q4Y 2;  3ZXG A;  5CEH A;  4MGT A;  4X6R B;  4Y22 B;  3ZDV A;  5F7U A;  4WVM B;  4BQY A;  4W65 A;  4OHW A;  1BBT 3;  1QH6 A;  2J1V A;  3E5X A;  3MI8 A;  4A45 A;  3ZXJ A;  3IAP A;  5A3O A;  1NQJ A;  3K51 A;  3UJO A;  2ETE A;  4P9J A;  2DU0 A;  5FP8 A;  5LEK A;  3THT A;  3Q8B A;  3VL8 A;  1RUG 1;  5L36 A;  1S0C A;  1AYM 2;  4D69 A;  4CP9 B;  1DZT A;  1Y7B A;  1CAX A;  2W52 A;  3N7L A;  1ZZB A;  3P6B A;  3PU3 A;  4I01 A;  4XIK A;  2F6B A;  2RDR A;  4FAH A;  1I5P A;  3D6E A;  2CDP A;  1W05 A;  5DG2 A;  1J84 A;  1I5Z A;  3WLU A;  3H3Z A;  4P9G A;  1AX2 A;  2YFZ A;  1HN0 A;  1K5M B;  4OCT A;  1IG0 A;  1O3T A;  3U10 A;  5BNN A;  2ZX0 A;  2YPD A;  2ZHK A;  1X33 A;  3OCP A;  3VBF C;  4B4P A;  4UOJ A;  3WCR A;  1POQ A;  2RMU 2;  1B09 A;  3NJX A;  2XLA A;  5AVA A;  1W8F A;  4BME A;  3CL1 A;  2BNN A;  2RR1 1;  4TSV A;  1BK1 A;  1HJG A;  4NHX A;  4JGY A;  3ZN5 A;  3K77 A;  1OKQ A;  3KHB A;  3TRS B;  1JOP A;  2OPK A;  2ZAH A;  1S0B A;  2NMO A;  3NRU A;  1AZD A;  1UOG A;  1AL2 2;  3P3P A;  5IVJ A;  2EXK A;  1SLC A;  3NO8 A;  4GJZ A;  4XUN A;  2DCY A;  4M3C F;  2XGX A;  3ETQ A;  1HB3 A;  4G3Y C;  3AJY A;  1F35 A;  4WM8 A;  1YFU A;  1NG0 A;  4NN0 A;  4UBH A;  2GC3 A;  1ULC A;  3JQW A;  2RS1 2;  4LHL A;  4XCA A;  1LOD A;  5HCF A;  1HV0 A;  2VNO A;  3POS A;  2Z4F A;  4QKD A;  1AR8 2;  1UXZ A;  3EBR A;  4LE3 A;  4RA0 A;  5GAL A;  3WZ1 A;  5LEJ A;  2ZHM A;  1C57 A;  1H1A A;  4OUE A;  2O0O A;  4N7U A;  1UPI A;  3MLL A;  1MVE A;  3KF5 A;  4MGQ A;  1H8V A;  4RHV 2;  4B29 A;  4Y5T A;  4BQ1 A;  4LR4 A;  4CU6 A;  3D82 A;  4I02 A;  1VBD 3;  5EP9 A;  5J3U A;  3B69 A;  4IEO A;  2ZCW A;  1CON A;  4LHN A;  2BOI A;  1RIR A;  1OLR A;  1CAU B;  2W5F A;  1I9R A;  2Z79 A;  3N35 A;  5A32 B;  5A6Z A;  1GQP A;  4H55 A;  4LBM A;  2I07 B;  1REF A;  1V0A A;  3QD6 A;  1RUF 1;  4H3W A;  5FUP A;  3S5Q A;  4EN0 A;  3RZJ A;  2W08 A;  1X8E A;  1W9W A;  4XQW A;  5E16 A;  3T2O A;  3KLS A;  5LA0 A;  2RM2 3;  5CFD C;  5DPN A;  2FQP A;  4YW5 A;  1KDM A;  2VW0 A;  2VZ3 A;  1YIP A;  2K0G A;  2OII A;  1EAH 3;  4RR3 B;  2VQ0 A;  1W9F A;  1OC1 A;  1QQP 1;  1O3S A;  1WBL A;  4IUG A;  2B45 X;  3HBZ A;  1ZVF A;  3KCC A;  5T5J A;  5JXI A;  2HWD 1;  1CD3 G;  4LQR A;  4XJ9 A;  1J3P A;  4CDQ A;  3T30 A;  2D5F A;  2RDN A;  4Y1Z A;  5DUV A;  2Y33 A;  4QPG A;  3ZFG B;  5FQ0 A;  1YI7 A;  2R06 2;  1KFX L;  4Y22 A;  5J48 A;  3KVB A;  5F3I A;  2X8K A;  5FP7 A;  1G8W A;  1FMD 1;  4GMP 3;  5FZ9 A;  3ZSE A;  1QDO A;  1GP4 A;  1RUC 1;  2X09 A;  4XZP A;  3VBO C;  4C1X A;  2H6B A;  3NNG A;  1GKB A;  5T3N A;  3RRD A;  1OLQ A;  4NHK A;  2HWC 2;  4YZ1 A;  1DQ1 A;  3NAP A;  3TNP B;  4FAG A;  2F4L A;  1UQX A;  2FHR A;  3F2Z A;  4FFI A;  4NRQ A;  1KD7 A;  2HH9 A;  2Y6K A;  4Q2F A;  5KHI A;  4CP9 A;  5KXB A;  3BTY A;  1GAN A;  3AFG A;  3JBG 2;  5JI9 A;  1C3H A;  2BGC A;  4QPI C;  1MQT B;  2DWR A;  1N1S A;  3AKP A;  1UL9 A;  1C5H A;  1H4H A;  5F5A A;  4QB1 A;  2PTM A;  2VZO A;  1D7P M;  5BNP C;  2ZZQ A;  1K5M A;  2BDR A;  1QJU 2;  3E5Q A;  3K4A A;  5FZD A;  4J6G A;  3FLT A;  1IPS A;  1L7R A;  1HX6 A;  5GZF A;  2ZAC A;  4LUL A;  4BZ4 A;  4R4X A;  1DCS A;  1JYX A;  4XMA A;  4A6O A;  4ATE A;  5C8C B;  3N36 A;  1RUF 2;  1H1I A;  1VBE 1;  3OG2 A;  2GND A;  3T1M A;  2WS9 2;  4HK8 A;  1NCR B;  3PUQ A;  1E5R A;  5KHJ A;  4P5Y A;  1JS9 A;  4ITC A;  4ISQ A;  4PF5 A;  4Y4Y A;  3ZSM A;  3GBF A;  3DPR A;  1O8P A;  4B7K A;  1E57 A;  5FYZ A;  1OD5 A;  3CU7 A;  3UV9 A;  5JLV A;  2LUW A;  4QQP A;  1SLA A;  3RI8 A;  4WM7 C;  5I8Y A;  1J83 A;  1VBA 3;  2J1A A;  4YW3 A;  4GMP 0;  3M3O A;  5ACA 1;  5A7S A;  5C5T A;  5DXD A;  2FCU A;  1OOP C;  2D6M A;  1VPH A;  3AZZ A;  4WVZ A;  3MZH A;  4CEW A;  2VMG A;  1DGL A;  5CU1 A;  2R07 2;  4URA A;  1ZZ6 A;  3AYD A;  1W0O A;  4QD2 A;  4XUT A;  2XJQ A;  5FYU A;  3VKF C;  4CDU A;  2Q0A A;  2W3J A;  3PTR B;  4H2A A;  1GZ9 A;  1Q8Q A;  4LO8 A;  4CCL A;  2JKB A;  4JX0 A;  3B94 A;  3ILN A;  4FOY A;  2BWA A;  1GFF 2;  5F9T A;  1GZW A;  4BWO A;  5I0R A;  5A32 A;  3N9P A;  3RFR A;  1W9S A;  2Q4S A;  2V5D A;  4QU2 A;  1V9U 2;  3J7M A;  5FP4 A;  1NY7 2;  1X36 A;  2PFW A;  1PX3 A;  1KJR A;  2PQQ A;  2EAL A;  1F9K A;  1PMJ X;  5H9P A;  3SCG A;  2ADD A;  1TMF 2;  1MS5 A;  2GC0 A;  4MAD A;  5CKQ A;  2WUH A;  5IYY A;  1T2X A;  1C28 A;  1J58 A;  3SIS A;  2W1W A;  4X8P A;  4E27 A;  1V6O A;  1US3 A;  4NRO A;  4C90 A;  5A3L A;  5J1X A;  2W39 A;  5K0U B;  4LA3 A;  4H7M A;  4ZU7 A;  4GIQ A;  5LWB A;  3MUZ 1;  1UNB A;  2JX9 A;  4RR3 A;  2ZGL A;  4CEY C;  1XU2 A;  3GHN A;  3RYR A;  3WW4 A;  2WBK A;  4BQW A;  5FYT A;  5F5Q A;  2YGL A;  4QWN A;  5IVY A;  2WT2 A;  2OA2 A;  3MGU A;  1FI2 A;  4URT A;  5T5O A;  3TAY A;  2JDA A;  5CFC C;  2ZBJ A;  3ZFG A;  5IK4 A;  3VKN A;  2GMP A;  3ACI A;  1DQ4 A;  2BUK A;  2XKO A;  2DVF A;  1H8T B;  5LB6 A;  3ZR6 A;  4AEK A;  2BVV A;  2P2K A;  4LJH A;  1J3Q A;  1ZBA 2;  4CCK A;  1D4M 1;  2ZZJ A;  4EWD A;  4B1L A;  3TEX A;  1F4A A;  2QQL A;  5FZI A;  4IES A;  2KD7 A;  3AJZ A;  3ZFE C;  4UW4 A;  4CDW C;  3ZIX A;  1GOH A;  4AE2 A;  1DP0 A;  4E2G A;  3RVH A;  2RG4 A;  2DV9 A;  2SLI A;  2WNV B;  4GKX A;  4LBK A;  5FYC A;  2D6K A;  4AFC A;  1BKZ A;  1PIV 2;  4M4P A;  2JE8 A;  5FBJ A;  1HRI 1;  2ZGR A;  3ZX7 A;  1D2Q A;  3LDB A;  5IAX A;  1MQT A;  1S55 A;  1ZX5 A;  2JG8 A;  4DMI A;  5A7P A;  3NKT A;  2UU8 A;  2VNG A;  1QU0 A;  1BBT 2;  1VBD 1;  5EJ1 B;  4Q8K A;  2ZGU A;  1S2E A;  2C6S A;  1LES A;  1VMJ A;  2WR9 A;  2Y6J A;  5FDB A;  3S0M A;  1B35 B;  4CCO A;  1TZO A;  4MH0 E;  4LXL A;  4ZZ5 A;  5F3E A;  3SKV A;  4D6R A;  2K9Z A;  4IEP A;  3VBH C;  2FDF A;  4XJA A;  2RM2 1;  3ZN4 A;  1YFY A;  4TYS A;  2QZ2 A;  5FYM A;  4COV A;  3OB8 A;  4MZU A;  2QQW A;  4K6B A;  1EAH 1;  2GNB A;  4JDN A;  5B4X A;  1AR6 3;  3E6D A;  4CCC A;  3SLI A;  4BQ4 A;  1EYB A;  4JQT A;  3POW A;  4F3J A;  3CO2 A;  4R52 A;  2EAA A;  2GDF A;  4FFF A;  1MZF A;  3N9M A;  3W59 A;  2CTV A;  3ZFF A;  3T0B A;  1OLM E;  4Q26 A;  5GZC A;  4IV1 C;  2E9Q A;  3MF9 A;  3A22 A;  4MET A;  1GZT A;  1UWW A;  4QDR A;  2OYZ A;  4V1P A;  3IBM A;  4NJ4 A;  3T2Q A;  3WY6 A;  5BY5 A;  5FZB A;  3OUH A;  3WR0 A;  1ND2 B;  3MLJ A;  1LHW A;  3MEP A;  4GMP 1;  5JPN B;  1C1F A;  4IV3 C;  3POB A;  1RUI 2;  2RS3 3;  3LAG A;  3BIE A;  2GME A;  2VY0 A;  2P17 A;  3MPP G;  3I2G A;  3PTY A;  2QVS B;  3DL3 A;  3GJB A;  4HXC A;  3VHO A;  4CP0 A;  5CAD A;  5A3T A;  3VBU C;  3WCS A;  4EV0 A;  3GF6 A;  3ZXK A;  3I2I A;  3FMG A;  3FC0 A;  4XUP A;  4XQD A;  2WC2 A;  1EUU A;  3WQ0 A;  1Q8V A;  2WFF 1;  2XR4 A;  1GLH A;  4H14 A;  2GNM A;  2ARE A;  3WF4 A;  3ZYB A;  2P3K A;  3TEY A;  2OT7 A;  5D8A C;  4N43 B;  2A70 A;  2XKP A; 
#chains in the Genus database with same CATH homology
 3DKQ A;  2HBT A;  5EP9 A;  5LA9 A;  3NNL A;  3OBZ A;  4NHL A;  5M0T A;  2Y34 A;  5DAX A;  3GZE A;  4XAC A;  3GJA A;  3KT4 A;  4JZR A;  4NHM A;  2FCT A;  4Q5O A;  5EQU A;  5DAV A;  4BQW A;  2HBU A;  3OUJ A;  3MGU A;  5LAT A;  4XAB A;  2V4A A;  5LB6 A;  5LAS A;  5HV0 A;  3KT1 A;  2G1M A;  5L9V A;  2RDN A;  2Y33 A;  3BVC A;  4MHR A;  3OUI A;  4NMI A;  2FCV A;  4XCB A;  2RDQ A;  5IAV A;  2RG4 A;  4KBZ A;  5LBF A;  4NHK A;  4BQY A;  5IAX A;  5IAT A;  3PL0 A;  5C5U A;  4NHY A;  3NNJ A;  3NNF A;  3ITQ A;  4ZON A;  4UWD A;  4MHU A;  5DAP A;  4NAO A;  4XC9 A;  3W20 A;  2RDR A;  4ZPI A;  3KT7 A;  5L9R A;  5DAQ A;  4XAA A;  2JIJ A;  5A3U A;  5HV4 A;  4IW3 A;  3EMR A;  5LBB A;  4NHX A;  4Y5S A;  2OPW A;  5L9B A;  5DAW A;  2A1X A;  3OUH A;  5LBE A;  5EPA A;  2G19 A;  5ERL A;  2RDS A;  5C5T A;  2FCU A;  3GJB A;  4XCA A;  4BQX A;  3W21 A;  3NNM A;  4J25 A;  3HQR A;  3HQU A;  5LBC A;  4Y5T A;  2JIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...