1LHUA

Crystal structure of the n-terminal lg-domain of shbg in complex with estradiol
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
175
structure length
175
Chain Sequence
PAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Steroid Ligands Bind Human Sex Hormone-binding Globulin in Specific Orientations and Produce Distinct Changes in Protein Conformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords SEX HORMONE-BINDING GLOBULIN
total genus 31
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lhuA00
3AYCA 3M3QA 4YW5A 1VLNA 2EXHA 4Y26A 1ULGA 5T5LA 3WDWA 5LK5A 4YLZA 4LBMA 4M3CF 2D6NA 4JC1A 4W65A 3DUIA 2V73A 2JD4A 1AF9A 2NN8A 2V5YA 2DU0A 3BTAA 3WCRA 3ZXKA 5DG1A 4FPLA 1HQLA 1MZ6A 4FOWA 2JE7A 4UW6A 1V00A 4TYSA 5DG2A 3WVJA 2A6WA 3D4KA 3VV1A 2NM1A 4DFSA 5T52A 3WCSA 3ZYPA 1SLLA 1RINA 5GJ6A 1Q8VA 4PBPA 4M3CA 4K1ZA 1WD3A 1MS3A 4GKXA 4U2AA 2EALA 2R0HA 4FPFA 4Q1PA 2NYYA 3M2MA 3JU9A 2OVUA 1G9DA 2BQPA 1CJPA 2EAKA 4LBQB 4M3CB 4GXLA 2YXSA 5FRAA 1LOGA 2YMZA 1WW5A 2A71A 4XTPA 3RRDA 4TZDA 4ZXKA 3H0OA 1CR7A 1JXNA 1S0JA 3WUDA 2WT0A 2P3IA 1LGCA 3ILFA 2YY1A 1UAIA 3PVNA 2A7AA 3AP4A 4XJ9A 2EXIA 3INAA 4YGDA 5EYYA 3WDXA 3WUCA 3ZXEA 4D69A 2GNDA 4U36A 3MW2A 4FPEA 1TEIA 4BLJA 1LOFC 3I4IA 1LHNA 3M3OA 2E7TA 4XDQA 4BLIA 2DU1A 1GZWB 2FHRA 2ZMNA 3IN9A 3WOGA 1LEDA 2CWMA 1ENRA 1O4YA 1ZA4A 2VW1A 1LHWA 5T5OA 1G7YA 4Y1ZA 3SITA 1AJOA 4YM3A 3FLRA 1N3OA 4Q2FA 1N3PA 1JUIA 1MS0A 1W0OA 2ZKNA 2AR6A 3V65A 1I3HA 2ZHNA 3VKFC 2WNEA 4ITCA 5E89A 5KXCA 1MS9A 1BKZA 2D3PA 3O5SA 4FQZA 1HDKA 1UZYA 5CBLA 2TEPA 2E7QA 2DYCA 3B9CA 4Y20A 1OQ1A 3Q9OA 4PBOA 2GMMA 1GICA 2G4IA 2AENA 5JOYA 4HANA 4WVVA 1S0FA 2D3RA 2JKBA 4WVWA 2NMNA 4FOYA 1GLHA 3D5OA 5H9SA 4UW4A 1CESA 2OUHA 3AJZA 4FP2A 3WDVA 1UKGA 2EXKA 3ZSLA 2XG3A 3AYDA 1SLBA 5H9RA 3NV1A 2VH9A 1KJLA 1G9BA 2A75A 5E88A 1PZ7A 4PF5A 1N47A 1LJ7A 2PHWA 3LSEA 3OBRA 4XJWA 2P3JA 1C4RA 2ZACA 4FPGA 1PZ9A 2P37A 1F31A 3FBYA 3N7JA 1A78A 4Y22B 1UN1A 4XHXA 2CTVA 2R16A 3AJYA 1X50A 1LULA 4XJUA 3FUOA 5DZGA 5BYNA 3ZSJA 4XYXA 1FV3A 1V6IA 1V6OA 3M3EA 3N7MA 4DPNA 1GBGA 4KBBA 1JW6A 1GNHA 1LOBA 1PZ8A 1NXD1 1LTEA 1WW6A 2DUPA 2W68A 5T55A 1JYIA 2AH2A 2DUOA 3AXDA 3SISA 2E51A 1SBEA 5GLWA 2A3YA 4GKYA 5GLZA 3AZYA 1GZ9A 3A0KA 3USUA 1WLCA 2WKKA 1W6PA 1LHOA 5DXDA 3NV3A 4YZ2A 1DYKA 1OFSA 1S0CA 5AVAA 3AZVA 4XIOA 1ULCA 2PHRA 3UK9A 1U0AA 4BQ1A 4AYUA 4P9XA 1WLWA 3QLQA 1OKQA 4YGBA 3APBA 1LCLA 4XBQA 4CRQA 3AP5A 3FUQA 2PHXA 3GNEA 1AX1A 5CB7A 3OY8B 2D43A 3N7LA 5DUWA 1SFYA 2EIGA 1QU0A 5DZEA 1VIWB 4RL7A 1SLCA 5L73A 2R49A 4Y1YA 2ES3A 4AGVA 4M00A 1G9AA 4XBLA 1JHNA 4XMAA 5HCFA 2ZHLA 4XHBA 2AYHA 2EXJA 4K20A 3SH3A 4YGEA 1N1VA 2R1DA 4GALA 1MVEA 3IM0A 4YZ4A 5FREA 4BMEA 1WD4A 1FNZA 3B3QE 1FV2A 1WCSA 3IPVA 1CN1A 1SBDA 1Z0HA 3B00A 4BM8A 2P2KA 2ZGUA 1QOSA 3OYWA 5SV8A 2A6XA 3RMXA 1C57A 1IS6A 1YXWA 2DVDA 2SBAA 1DQ4A 4FOQA 3RQ0A 1Q8SA 3AP6A 4BOWA 3WLUA 4XILA 1DYPA 1WW4A 1QKQA 1IS4A 2DUQA 5T5JA 3VKOA 3W58A 2GMPA 1SCRA 3QCWA 1ENQA 5H9QA 1JBCA 1W0PA 1LESA 1W6QB 1QF3A 3M3CA 4XJZA 4Y22A 3ZYRA 3ZSMA 2UWBA 2JE9A 2UU8A 1QOOA 3B01A 1AJKA 4YFZA 2P34A 1YO8A 1WBFA 1BZWA 1D2SA 1EPWA 3V64A 4YW1A 2WT2A 3D6EA 2HYKA 1BXHA 1HLCA 2DVAA 4FVVA 4YW4A 1IKQA 1HQWA 5GZDA 3WG2A 2R1BA 5JMCA 2ARXA 4XXAA 3RG0A 3B69A 4WZFA 4WV8A 1BQPA 1SLIA 4YFWA 3ZVXA 5GZEA 2VU9A 4C1XA 2GNTA 3I8TA 3POYA 4Y1XA 1DQ6A 2W39A 4FOVA 2E6VA 3WZ1A 1CONA 1C1FA 2WSVA 4DS0A 3AX4A 5E8AA 2WSUA 3NWKA 3GALA 1LU1A 1W6NA 2YV8A 1FYUA 4LBKA 5EYXA 1CPNA 3ILNA 5GZFA 4K21A 3UJQA 3T2TA 3WDUA 4YG3A 2WJSA 4AVTA 2LTNA 4YM1A 2D7FA 4UW3A 3WG1A 1AVBA 3OY8A 2DVBA 3PMEA 5H9PA 3AYAA 2ZHMA 2DTWA 3WNXA 1GANA 3R05A 3WHUA 1GV9A 1KITA 1SACA 1QDOA 2WT1A 2VY0A 3OBTA 5EXOA 1G9CA 2ZABA 3FLPA 2RHPA 2GNMA 1WUVA 2D6OX 3PJQA 3CNAA 4Q8LA 3PVOA 4YM2A 1XQNA 4GWNA 5DUUA 2NMOA 3L2YA 3VKLA 2PHTA 2GDFA 5HCAA 2CWSA 4Y20B 4YW2A 3UL2A 1SBFA 1O4ZA 1UMZA 1QNYA 1V6NA 3MW3A 1DQ2A 4Y1VA 2CL2A 3MPPG 5CA6A 1UPSA 3OJBA 4PCRA 1LHVA 5KXDA 2ARBA 2ZMKA 1W6MA 5DUXA 4CZSA 2DURA 2ZGRA 3AXEA 2NP0A 4CTEA 3AZZA 3HR9A 3RSJA 1G9FA 2D6PA 2AGSA 3ZXJA 1BJQA 2W08A 2R0FA 2CYFA 1AXKA 1QOTA 3MW4A 1QGLA 3RS6A 2ZGOA 4XJAA 3O0WA 2ERFA 1UL9A 2ZGSA 4LBJA 1V6LA 4FP3A 4LBQA 1VALA 1W6QA 2DVFA 1Z78A 2JJ6A 2NZ9A 3FFZA 1AXYA 4H55A 1YIFA 2A3XA 4RA0A 1VAMA 2E53A 3IMNA 3OGGA 4Q27A 4XJ8A 1VAVA 1I1EA 3USUB 3U4XA 2ZAAA 3SNMA 1MS5A 1KRIA 5JVVA 1V6MA 3V0BB 4BPZA 5JOWA 1N1SA 5JOZA 1V6JA 4NOTA 1N1TA 2VXRA 2D3SA 2ZGQA 1KDKA 1ENSA 2EF6A 5EWSA 4BMBA 1N3QA 3BODA 2VUAA 4FPHA 4I30A 1MVQA 1QNWA 1DZQA 2A6YA 1S0EA 5IK4A 1GNZA 4LBQD 2PHFA 4YM0A 1ULDA 3VKMA 4P9WA 3WG4A 1DLLA 5IUQA 1DHKB 2DTYA 3AK0A 1ULFA 1ULEA 4YZ5A 1LENA 1FATA 1A8DA 2ZGMA 4Q8KA 4HL0A 3UJOA 1S0DA 1AX0A 1QDCA 5IT6A 2D6LX 5GZGA 3O0XA 1Q8OA 3N36A 2PELA 4FPKA 2A70A 2VW0A 3AP7A 1Q8QA 2GMEA 2GN3A 2D44A 5DZFA 3VKNA 2VW2A 2CNAA 5GLUA 2YZ4A 3ASIA 2WQZC 2D6MA 3NV4A 5GLVA 1JN2P 1H9PA 1SCSA 4P9YA 4C1WA 3OPZA 2UWAA 5HCBA 3TAYA 5JDBA 1ONAA 4XMIA 4SLIA 2GN7A 1KQRA 2B7YA 3FLTA 4R9BA 3POSA 5GALA 3LSDA 4Y1UA 3M1HA 2SLIA 1DIWA 3KQRA 1Y7BA 3WV6A 5F5QA 2A3WA 2A6ZA 1YYNA 2Q5TA 2UWCA 2ZGTA 3N7KA 4ASMB 2ZBJA 4XIKA 1N1YA 3T1LA 5IK7A 1S1AA 3R4SA 2AUYA 4R9DA 5T5PA 2OUJA 3ZXLA 4ZKTB 1GZCA 4M01A 1BYHA 1Q56A 4YG0A 4DQAA 1MS4A 1GYKA 4ISRA 1C1LA 4XZPA 1IS5A 1LOAA 2I2SA 3HN1A 5GM0A 5JLVA 1LOEA 2FMDA 5CNAA 1LOCA 4YGCA 1R1ZA 3V0AA 1W6OA 4DRVA 1LEMA 4IQPA 3V0BA 1DQ0A 2W52A 2ENRA 4AVSA 1JYCA 1ZM1A 1URXA 2Z42A 1LODA 3AFKA 3V0AB 2D6KA 1W6NB 1DBNA 3C2UA 3O0VA 4JCKA 1YRZA 3ENRA 1DQ1A 3O12A 3TB0A 3ATGA 2A6VA 3ILRA 4UW5A 3BOPA 4Q26A 3ZPYA 1RITA 1DFQA 5T54A 1IKPA 3IKWA 2YROA 5JOXA 1WW7A 4XXPA 4AWDA 5IK5A 3MEPA 1NLSA 5GZCA 2AREA 3WG3A 2DV9A 1V6KA 1G8WA 1G86A 1RIRA 2ZGPA 1FX5A 1A3KA 4F83A 2ZA9A 4JRAA 1JOJA 1W6MB 3N3HA 5GLTA 1LU2A 4XE9A 1CIWA 1FNYA 3AYEA 2P3KA 1KJRA 3POWA 1DQ5A 2XB6C 1D0HA 2JDZA 4OZXA 5DUVA 4FPJA 2LALA 1MS1A 4XTMA 1FAYA 2CY6A 4LBOA 3PVEA 2GNBA 2GALA 4AGGA 1WBLA 4Y24A 4LBLA 2UURA 3AZWA 1HKDA 4XBNA 1GKBA 1W6OB 4LBNA 3HMYA 4R9CA 1Q8PA 2KM2A 1AXZA 4R9AA 3JUUA 4FPYA 2ZHKA 1DGLA 1LGNA 4YG6A 3NV2A 4YZ3A 3WDTA 4M3CE 4P14A 1GZWA 4NO4A 4MYEA 2ZZJA 2A5ZA 1UZZA 1IS3A 1YI7A 1CVNA 4Z8BA 1CPMA 3LCPA 1LGBA 3R4UA 1QMJA 3WHTA 2C9AA 4YZ1A 1B09A 1W6PB 1WLDA 4GWMA 1S0IA 2ZGLA 3KM5A 4YW3A 5CAZA 2C5DA 1S0BA 3OYWB 1J1TA 1SLAA 2WLQA 1S0GA 3WDYA 4DRRA 2PHUA 3T1MA 1KDMA 3IPVB 5IK8A 1MZ5A 1MACA 3DGTA 4ISQA 1CQ9A 4K1YA 3N35A 2DWRA 3RMYA 4FPCA 1F9KA 2ZGNA 2JECA 3A0NA 1LHUA 1LOFA 3AP9A 4GA9A 1F5FA 1LECA 3W59A 4AVVA 4ATEA 1AZDA 1MR5A 5KXEA 3SH5A 4L8QA 1AX2A 4PQ9A 2ZMLA 3A4UA 3ZXFA 4FPOB 4FQ4A 5KXBA 1IOAA 2ZGKA 1APNA 2OW4A 1H9WA 4AGRA 1GSLA 3VUOA 5T50A 1SLTA 4Q1RA 2DVGA 4ATFA 3ZSKA 2H0BA 4XOGA 3SH4A 5F9TA 3AZXA 1MS8A 3SLIA 1UX6A 3BIWE 1H30A
chains in the Genus database with same CATH superfamily
4IE6A 1W9TA 4LOSA 2BGCA 1UOGA 1HRI3 1OVSA 3RZHA 4NRMA 3J7NA 3PTYA 1WWYA 3ZFGC 5A6YA 3OUJA 2D6NA 2Z79A 4MLOA 5FZ1A 3DUIA 5FJKA 2XLAA 3KCYA 3BTAA 3PHMA 1WCQA 1ZZCA 5DG1A 1C8M3 4FOWA 3WW4A 1DZTA 5FY4A 3D4KA 1E57A 3VV1A 2VQTA 1H8TC 1ZRCA 3R0RA 3VZLA 2RS12 3WCSA 5F6LB 5C4WB 5EPAA 5FOBB 4FFHA 1ND2B 5FPXA 5EHDA 5GJ6A 3U10A 4ET7A 3WQ0A 1RUF3 4HKOA 2FCVA 2Q8OA 4PBPA 3ELNA 3O1OA 1RJ7A 2O1QA 1YWKA 4B7EA 5IVBA 3TYJA 2EALA 4CDUA 1ZBE1 3M2MA 5A3LA 4PIXA 2WA3A 4OUMA 1G9DA 3AMHA 1CJPA 1CAUA 4LBQB 1EV12 1K5MC 2YXSA 4M3CB 1LNSA 4CDQA 5CG9A 1JMUB 3VD4A 1QJU1 1QH6A 2VTXA 3SKVA 4WVMB 3GDBA 3RYPA 4ZXKA 1CR7A 4YVSA 2IUWA 1O6UA 2P3IA 3KHCA 2OQ6A 3ILFA 2E7AA 2IZWA 4IESA 4AXOA 1RTVA 1AYM3 5IFPA 4M4RA 2GNDA 4BQYA 4QGNA 3MW2A 1K5MB 1TEIA 3U37A 1LOFC 2C26A 3I4IA 1ZZ7A 5I0UA 1ULPA 4P08A 2DU1A 1UY0A 3LA7A 2WAAA 5A6ZA 1FPN3 4Q4X2 4A4AA 2CWMA 3Q8BA 3LD8A 4N7IA 4RHV1 2VOWA 1C3HA 1S4CA 4HSJA 1VRH3 4Y1ZA 3I2DA 2JDYA 4HPKA 5BNOC 2VZSA 5I8YA 3NKTA 1N3PA 3S5AA 3HOBA 5FLJA 2ZKNA 4P9GA 4QPIC 1QJZA 5C4WC 2WNEA 2KD7A 3CO2A 4XUPA 1W8OA 2V4VA 4FQZA 3MI8A 1UZYA 5CBLA 1ZBA2 1UIKA 2E7QA 5CVRA 1OQ1A 1OBNA 2P1BA 4GB33 1GICA 3BTYA 2G4IA 4A3XA 3PIGA 2JG8B 5FUIA 2BNNA 4Y5TA 2JKBA 2EVXA 4W8JA 5FY9A 5K9YA 3LA2A 4WVWA 5I0SA 3DYPA 3TN91 2F6BA 2RR11 5DABA 3MBWA 3D5OA 3LDBA 5H9SA 1VBE3 1RHI2 3OGJA 4JGZB 2XWBB 1IZ3A 3HAGA 2VVDA 1UKGA 3O1SA 1AR73 1JOBA 2VH9A 4LO5B 4PF5A 3VB9A 1NX9A 4XJWA 3LSEA 5BPXA 4IEZA 4ARYA 2VBPA 4CEWB 4KL1A 2ZACA 1AYN3 5J36A 1RB8G 2TBVA 3DV8A 5FZMA 3ZXGA 1GNYA 1A78A 4I01A 1LB2A 1UN1A 4XHXA 3SCHA 3KT1A 4JRLA 1X50A 4V1PA 3K3OA 4XJUA 5DZGA 1SPPB 3PVBB 4NN0A 4QQ2A 4DOUA 1FV3A 4QMAA 4CEWC 1V6IA 5FIXA 5FYHA 3M3EA 3WSOA 3LFIA 4MGYE 2BOJA 2WINB 1HB1A 3UGGA 2QQKA 4AF9A 2WRAA 5LBCA 5EJ3A 1VBD3 1PGW1 1UU4A 1ASJ1 5BV6A 4MGKE 2B42B 1DGRA 3ZR6A 2DUOA 3AXDA 4UF0B 4KWUA 1CAWA 3J8F3 3CF6E 5FJHA 3ACLA 1SBEA 5GLWA 5GLZA 3GZEA 2VZ3A 3AZYA 1GZ9A 3CZUA 3PUHA 4N43A 1VMHA 2GC2A 1LHOA 5DXDA 3NV3A 1A8MA 1S0CA 1RUC2 5JSPA 4ZS2A 2XGXA 1JYWA 1DDLA 2QQNA 4K40A 1OF4A 1OKQA 2D5FA 1UOJA 1ACCA 2IFRA 2R042 3LE0A 1ZRRA 4XVHA 2GAUA 4JQTA 1ZZBA 3MUY1 4OI0A 1ZBE3 3JB4C 3WP4A 3GM8A 4I0WB 1GZTA 1P8JA 3QACA 1O5UA 3FJSA 4AEMA 4R8HA 4ES9A 4L2NA 4RQPA 4RL7A 4Z2AA 4E4HA 2ES3A 1RUF1 3H7JA 5ACA2 2CV6A 4NIAA 4EV0A 4K20A 4QKBA 4BYYA 4YGEA 4K9SA 2ZS6B 1D0GA 1ZVFA 1UKRA 4GALA 5FREA 3ZFFB 1FV2A 1WCSA 2X10A 1OOPA 1Z0HA 3A21A 2A73B 2FZ2A 1HJGA 1CX4A 4QX8A 3F2ZA 3WEZA 2B9UA 1AHSA 4J25A 3OB8A 2DVDA 4X8NA 4DXRA 1DQ4A 4FOQA 3AMMA 5C8CB 1Q8SA 1SEFA 3MIEA 1VBB3 1W9WA 2W87A 1PK6C 1R1A2 2EIDA 5EJZB 4BOWA 3MUZ1 4G3YC 1NT0A 5F3CA 4NAMA 1DYPA 2BP6A 2BV4A 1ND3C 2DUQA 4UF0A 2BFUL 3VKOA 3W58A 1DF0A 1GWLA 4E8CA 4C91A 4QGMA 3I3DA 4MG2A 4Z1VA 2PN5A 3QCWA 4ASLA 2Y64A 1XYNA 1CAVA 1NKGA 1W6QB 1W0PA 1XNAA 3T09A 2HWB2 3M3CA 4BQXA 4RYDA 2UWBA 1OUSA 1UPIA 1QOOA 1BMV1 4COUA 1WBFA 1EAH1 5F3IA 1D2SA 3K4ZA 4DUVA 5AFEA 1BXHA 3MLKA 2ZX4A 3FHAA 4BIFA 1DZRA 5LY1A 1SLIA 2JICA 4I3PA 5IVJA 1UYPA 3POYA 3BGAA 4Y4RA 1QXPA 4FOVA 4LA2A 2G9GA 3UNPA 4N9IA 3JBG1 1L7RA 3POEA 1W8ZA 4UBGA 1UX7A 3GZUC 3WQ7A 1H1IA 1SQ4A 1PK6B 1JU4A 4DS0A 1YQ2A 2JIJA 5FWJA 5JXGA 2K0GA 3TWIA 1GWMA 1R082 2BERA 2YV8A 3UJQA 2Y6FA 3RZKA 3B02A 1UNBA 3H3UA 3K48A 3T2TA 3ZFEB 3BU7A 3NW4A 2WJSA 3POJA 4XFGA 1VBA2 2D7FA 3E6DA 1AVBA 3OY8A 1ZRFA 1XNDA 2P6CA 5KHIA 4DMIA 2WDBA 1HXS3 2ZHMA 2VOTA 3K75B 3WNXA 4HN1A 2WT1A 3OBTA 1NQJA 1VBC3 5A7WA 5HCHA 2VQAA 2ZABA 1H1MA 4QU1A 4XURA 5IVVA 3THDA 1OC1A 3RZZA 5FXWA 2D6OX 3KMHA 3CNAA 3PJQA 4XF4A 5EFUA 3VGIA 4D94A 4YM2A 1XQNA 4CEYB 4GWNA 5BUVA 4BCUA 3LKJA 1VBB1 2CWSA 3CJIB 3ON7A 1SBFA 2HWF2 3KB5A 1O4ZA 1UMZA 4J1WA 2RM21 4D6SA 2IXHA 1DQ2A 5CA6A 3NJYA 5A3WA 1UPSA 4LO8A 5A6QA 3E5UA 2VAUA 4Y5SA 1F2NA 5KXDA 2X29A 2XJQA 5DUXA 3ST7A 3H3ZA 3ZN4A 3BB6A 1HB3A 4BU2A 2HWE2 3OF1A 5FZCA 3ZIXA 1OFNA 1BJQA 2CGNA 3MIBA 4MX3A 3WP5A 1E5RA 2R0FA 3OPWA 4IDZA 1AXKA 1OQEA 4Q4W2 4DO0A 4E9KA 3CMGA 3GBWA 1I6XA 4X8PA 3O0WA 4NAOA 2VG9A 5AC93 5A7OA 2ADEA 1V6LA 5L7OC 1CAUB 4H55A 4LBQA 2NZ9A 4M3CA 4RA0A 5C3SA 3JXSA 2A3XA 4XZUG 5BY5A 4JAAA 3OGGA 4CA9A 4Q27A 2QQOA 5C8CC 1JU3A 5CKQA 3VZJA 1WLTA 4B4RA 1UY2A 1O3RA 1MS5A 3GZAA 3AKSA 3IZOA 1GP5A 5JVVA 4NIIA 3WINE 3WNPA 4Y3OA 4EWAA 5BNQA 3V0BB 4JKMA 3U78A 5JOWA 3IDBB 4XFBA 5JUVA 2ZGQA 5IAVA 2OZJA 3LAGA 3I2GA 1N3QA 2P17A 2Q8EA 4FPHA 4I30A 1BK0A 5C3OA 1GOFA 2A6YA 4RS5B 5FPVA 1XBFA 4YARA 4NWVA 1UIJA 2XBO2 3I54A 1VBD1 1XNKA 1ALYA 1DHKB 2DTYA 4M0HA 4YZ5A 1LENA 1FATA 4LHLA 4HL0A 3U0ZA 2JXAA 5FZ9A 2B39A 5IT6A 2D6LX 1RYYA 3O0XA 5BNPA 2LUWA 3JB8A 4O7XA 4A6OA 2MEV1 2VNGA 1Q8QA 2GMEA 4Q29A 1PX3A 2GN3A 5C7GA 5DZFA 5LASA 3JQWA 3PU3A 2E26A 4IE7A 1HB4A 3THCA 3K4DA 4C1WA 5FP9A 5JDBA 1ONAA 3B93A 1H2KA 1L7LA 1US3A 4WM7C 4ASKA 1KQRA 2B7YA 4R9BA 3POSA 4Y1UA 4BIOA 3SQOA 1FXZA 5F5QA 2A3WA 1GU3A 4GJYA 4W6WA 2Q5TA 4WVMA 5DDJ2 4XQDA 3WF1A 1N1YA 5IK7A 4JKLA 1FT9A 4LKSA 4CCCA 2QQUA 1RUJ1 2QTWB 5D8AC 5T5PA 3VZKA 4ARXA 4DNYA 3M8LA 3LDRA 3ZXLA 4DB5A 1GZCA 4M01A 4N90A 4PLMA 1BYHA 4YG0A 3H3LA 2HYXA 1GYKA 1SPPA 3H1MA 4OHVA 1C1LA 1E5SA 1RUJ3 1BEV3 4PF1A 5A32B 2VGDA 1OXCA 2YG0A 2XPJA 4E2SA 1QEXA 1ZRDA 3MV01 3TOJA 2JENA 1DG6A 1LOCA 3UKNA 4CUCA 3V0AA 1LEMA 3DXTA 4MO3M 1W2TA 3THPA 4F8AA 2ENRA 1AR91 1IQDC 1W90A 2Z42A 3ZFEA 3AFKA 3H8OA 1T2XA 1NOVA 4DINB 1K45A 2D6KA 3LOBA 3C2UA 5JCTA 4UWDA 3O12A 4GH4C 4JGZA 5FMOS 3ILRA 1TNFA 4UW5A 4CXYA 1QXJA 2JDKA 4UFKA 2LW8A 5FCCA 5T54A 1UXZA 3IKWA 3AM2A 4MHUA 5F8PA 4K6BA 2YROA 4QB6A 3I2OA 2XHNA 1JZ8A 1RMU2 2AREA 1K12A 3FHIB 1O91A 2HEWF 2MEV3 1FOD2 4RGKA 1RUD1 4TXWA 4AI3A 3PL0A 2ZA9A 2QNKA 3HIFA 4KH9A 2R071 1LU2A 2XJPA 3EBRA 3NJXA 5K0UA 2P3KA 1WA6X 2J1SA 1YIPA 2PQSA 3AVRA 3OEAA 1MQTA 4S2HA 1NA1B 2JDZA 3S30A 4MZUA 3VBOA 3PUQA 4RR3B 1SFNA 1UMIA 2LALA 3D82A 5C6CA 4Y24A 1W39A 2UURA 5FY8A 4XBNA 4LBNA 1J84A 4IGOA 5CYYA 3TEWA 1Q8PA 2BNMA 2VMDA 4DEVA 2YPDA 1CX1A 1EUTA 3JUUA 2ZHKA 4S2FA 4YVWB 1DGLA 2W2IA 4DUXA 1QQP2 2HLEA 3E5XA 4MVTA 3DPRB 2IC1A 3PDQA 4M3CE 2JG8C 4O61A 1NUKA 1BVVA 2ZZJA 2DCKA 3HJRA 2BW8A 1IS3A 2BDRA 2H0VA 1CVNA 2PLV3 3J7HA 4JDOA 3WQBA 5BNNC 2CAVA 3K51A 5ERLA 2PFWA 4FXKB 1B09A 1W6PB 1TNRA 3NVCA 2J7MA 5JXJA 1RUE2 4E2GA 4B4PA 2QQLA 1S0GA 5FK8A 1H2NA 1NY71 3MDPA 1R092 3FZ3A 4IEUA 4ISQA 5IVFA 4QX1A 1AR61 3FE5A 5AC91 1QH7A 1YFWA 4FPCA 1F9KA 1S2BA 2R6QA 4GA9A 1W0NA 1LOFA 1VBC2 1F5FA 1LECA 3KD4A 1M06G 4OHWA 3SH5A 1WMEA 1AX2A 4JGYA 2YBSA 3A4UA 2Q30A 4KWLA 1CIYA 2FQPA 4FQ4A 5JSOA 5IJRA 3GHNA 4PDWB 3UGFA 2G19A 2Y38A 1SLTA 2DVGA 2OPKA 5F9TA 1QJY2 2PA7A 1O4TA 5J98B 4ZS3A 3TRSB 3RVHA 5LY2A 5JIUA 4LBMA 2OPWA 2VNRA 2XXZA 2Y0OA 4M3CF 4EJRA 4LQRA 4W65A 2VOXA 3AVSA 2V73A 5A1AA 5FDBA 1KEXA 2JD4A 1AF9A 2NN8A 2WYSA 2DU0A 3RWNA 3WCRA 2H6CA 3ZXKA 5F39A 5BNPB 4FPLA 2XQRA 5FZFA 5I0TA 5L36A 3WF4A 1VBC1 2ARAA 3VLBB 5DG2A 3FBMA 5ABJB 1W2OA 1AR62 5T52A 3HT1A 1UW8A 1OUXA 3KCCA 1NY72 3E6CC 5L7OA 5A3TA 3K77A 1C5HA 2VZUA 2VNOA 1DGWX 3VHOA 4GJZA 1MS3A 1TE1B 4IERA 3KV5A 4GKXA 3JD73 4U2AA 2IXIA 4Q1PA 2NYYA 2Q4SA 3JU9A 4CPBA 5FPAA 4LTAA 2XJSA 2FCUA 5FRAA 4WM7A 4GMP1 1WW5A 1UCXA 4N8MA 4UYBA 3JBG3 4QD2A 4XTPA 3RRDA 4LKEA 3KWVA 3LGRA 2XL7A 1RXGA 1V9U3 5JXIA 2J42A 5JZGB 3WUDA 4OMDA 1NA1C 4QQPA 1LGCA 1H1AA 3MHZA 1OLME 2A7AA 4XJ9A 3ZXEA 5JR2A 1GOGA 4QDSA 2V5DA 2RJKA 4KNCA 4DUWA 3D0JA 2JWPA 1Z7S2 4XDQA 4BLIA 1ND3A 1NCQA 2Q1ZB 2X5IA 4HKWA 5F37A 5D1IA 2O8QA 3T2OA 1ENRA 2YFUA 1ZA4A 3W9AA 5KR7A 2KA3A 1QJY1 4HVOA 4C0BA 1AJOA 1YJKA 1XSQA 3ZSEA 1FOD1 4Q2FA 4CP9A 1JUIA 3P6BA 3KHBA 3VKFC 4OCTA 4OI4A 4OQ9A 1YHFA 4AHXA 5C3RA 5CIRA 3K46A 2WZ8A 4LEJA 2BWCA 5E89A 1JYXA 3NAPC 5CG8A 4NHLA 2WR9A 5IWFA 1BKZA 3O5SA 1HDKA 5HV0A 2TEPA 3EO6A 1OA2A 2RDNA 4X6RB 5K0UB 3CJIA 5J37A 2OYZA 5ABJA 2O8OA 2XKOA 2AENA 5LCWL 3C7HA 1S0FA 3KGZA 4UAPA 5FY5A 1U12A 4AQSA 4W6XA 2CAUA 4NHKA 5DAQA 1W8HA 4HOOA 1GLHA 1NCRB 1POV0 1E5IA 3ZFFC 1ZBA1 4FCAA 5FPZA 1OOPC 3AJZA 1UWWA 2CHHA 2OQ7A 2RMU2 4HG6B 1COV1 2EXKA 4I09A 3WDVA 4A45A 3BKZA 1KJLA 2A75A 3POFA 4A2UA 5B2GB 4BHPA 5LA1A 3OBRA 4RFT0 2P3JA 3FC0A 1EP0A 4FPGA 4YVWA 4XFAA 4IW3A 4GZ9A 2NLRA 4Y22B 3U75A 4Y4YA 2YGMA 1J3RA 2CTVA 5FKBA 3ABZA 1IPJA 2R16A 5FY0A 3I3EA 1FMD1 1XPWA 1JH5A 4N53B 2JIGA 4BB3A 4JGYB 3ZSJA 4Q4Y2 4XYXA 2Z69A 1CD3G 3RYKA 4AI8A 1XYPA 4CXXA 3GF6A 4CUAA 3BTZA 4NPLA 1VE0A 2V72A 2VE1A 1GNHA 3H9AA 4IEYA 3CL1A 4Q0UA 1WW6A 2W68A 2WZPP 3J8F1 1UO9A 2WNVA 1ASJ3 1AR82 2JDNA 4IV3B 2R7EB 3G6JB 5FLHA 5LBBA 3WNNA 1QJU2 4ONUA 5LEJA 4HXCA 3VDBA 1OFSA 2WZR1 4IV1A 5CISA 2PHRA 5CZKA 1J83A 3F95A 4ZU7A 1K5JA 4BQ1A 4AYUA 1BLZA 3ZYIB 4P9XA 3QLQA 5CKNA 1PVC3 2W1UA 1LCLA 2C0ZA 2W94A 3ZDVA 1TME2 3IIAA 1JUHA 4MH0E 2PHXA 2HWC3 3HQUA 4BDVB 1AX1A 5CB7A 4Q0PA 3OY8B 4CDQC 2D43A 3ZIWA 1SFYA 3J7MA 3MO4A 1SDWA 4AI1A 3AKQA 5DZEA 5FWEA 4DXSA 1KS4A 2QE3A 3RPQA 2R49A 4Y1YA 2C4XA 1JHNA 2RV9A 5GKAC 4KMQA 4PIYA 5FQ0A 1O8SA 2N7GA 2BGOA 2R1DA 3TN93 1LRHA 1ZREA 2RS51 5FUNA 2ZX1A 1WD4A 2P6HA 1YFYA 1SBDA 5DDJ1 1TQ5A 2GP5A 2QZ3A 2P2KA 3VBFC 1QOSA 5SV8A 4NVPA 2IVIB 1C57A 1UXXX 4AVBA 4TTGA 1IS6A 4G4FA 1R093 1W2NA 3AB0A 2SBAA 4FAHA 2E33A 3WY6A 4ZONA 2WYFA 1HRV2 2WBKA 2RMU1 2PQQA 5FXVA 2YHJA 3S0MA 5J48A 3MICA 2Y0IA 1J3QA 3OGVA 4MSVA 4UXAA 3NKGA 2LM3A 1HX6A 2W47A 1WZXA 5T5JA 1VB4A 1ZZ9A 3W5NA 3DYOA 1PHMA 1SCRA 3WNKA 5B4NA 4RHV3 3ZSMA 4BQWA 3UYJA 3JCIA 5HV4A 2VZQA 1H6XA 2VOKA 3ACHA 3NNFA 1UOFA 3DYMA 1AJKA 3WD5A 4E27A 1YO8A 5DMYA 1BZWA 4P9JA 3T0AA 1O3TA 2AEYA 2FDKA 1EPWA 1CAXB 4OI1A 2JG9A 5CFDC 5GZDA 3RZMA 4KI5M 4GWJA 1AYM1 4YW4A 3ZX7A 2R1BA 3RG0A 3B69A 4WZFA 1W04A 1BQPA 4WV8A 5GZEA 4QQHA 4C1XA 2GNTA 3T2PA 4BXFA 4HMZA 4MGQA 2VCAA 1CONA 2ZKLA 2VNVA 4S2GA 4LPLA 3VBHA 1Z7S1 1AL23 3ECQA 5JR7B 3GALA 4CDWC 3NSTA 5A70A 1OKOA 1Y3TA 4IUGA 1FYUA 1FMD2 4LBKA 1CPNA 4LKFA 2FDHA 4K21A 5C5TA 3A7QA 3D3AA 5LBEA 2BTVC 4IEOA 3WG1A 4QX2A 2DVBA 3NJZA 1AL0G 3PMEA 2VZVA 3RNSA 1CZSA 2LRPA 1GANA 2JDHA 3CQOA 2AC1A 1SACA 4J1XA 1C8M1 1G9CA 1POV3 2VMIA 2QJVA 4H14A 4BH9A 4ZY9A 2ADDA 2GNMA 5F5IA 1D4M2 1WUVA 3ZMOA 4FTEA 1UF2C 5A80A 2PHDA 2HWD2 3T30A 2QCSB 5FZLA 3N9LA 3L2YA 1WMXA 2VUCA 1HRI1 2YU2A 2GDFA 4GH4B 5HCAA 1EAH2 3ALQA 4FFIA 1W2AX 2QQVA 5F3GA 4YW2A 1PX4A 5FYSA 2JX9A 3UL2A 3N4MA 4IGPA 4YVSC 5E1RA 4AQ2A 2ZTNA 4BE3A 3GHMA 3T2QA 4NIHA 2VM9A 4LXLA 3LIGA 3AL5A 3D0SA 3OBAA 1NE6A 3U11A 2ZMKA 3VHPA 3ZOIA 1W6MA 2B9VA 4CDUC 4CXWA 5L9VA 3AXEA 1VBB2 1OLRA 2YBKA 1IPSA 1RUG1 2W91A 4UBHA 4CDXA 4CTEA 1H2LA 2D6PA 4LO7A 1X8MA 2W08A 4PI2A 3C7OA 1R1A1 5BXXA 5CFCA 1RUI2 4V2VA 3USSA 1ENXA 3RS6A 4ZXEA 5LRSA 3B5LB 4YW7A 3U4SA 3I3QA 1UYZA 2OKXA 2VCBA 3LEGA 2JJ6A 3FFZA 2ETEA 4MGSA 4XMAA 1AXYA 4DIQA 5C4WA 4XJ8A 2HH9A 3WT3A 4C8DA 3V56A 2JG8A 1RUI1 2Q0AA 2ZAAA 4QQLA 3ORJA 1SG3A 5FZHA 3SNMA 3USUB 3KLSA 3WP6A 5JZGC 1KRIA 4K8FA 5JWPA 1N1SA 4UFIA 1QHDA 2YBPA 3MIHA 4AEDB 2VXRA 5LWBA 2D3SA 1RUG2 1KDKA 1MPXA 3NQHA 1ENSA 1HN0A 2XLGA 4K3UA 3BODA 4YSFA 4Q0VA 2WUHA 1OH4A 1S0EA 3PMSA 3NNLA 3VBUA 5IK4A 2HEVF 1XOYA 3I59B 1HRI2 2R30A 3EB7A 2WFF1 4GAZA 1DLLA 1ULFA 1R083 1ULEA 2XUMA 4XFHA 4AK3A 2OT7A 5CEHA 2WQ8A 1D4M1 4WM8A 1PNGA 2WFF2 3N9PA 5A1LA 3UJOA 1AX0A 4Q4Y3 1OD3A 3CDZB 3RJ2X 1UZWA 2OA2A 4YRDA 4MHRA 1D4VB 4LUKA 1CAVB 4FPKA 3AP7A 3ZYGA 3C3VA 3IDCB 4QXCA 3VKNA 1W06A 3RZJA 5GLUA 2V09A 5D2AA 3KF3A 1H9PA 4P9YA 1JS9A 1VRH2 4KG0A 3ZXAC 2UWAA 1RUH3 1YQ6A 4XMIA 4SLIA 3TBDA 1XXNA 2VQ0A 1TMF3 4C0HA 5C9AA 1BBT1 1GUIA 2WWUA 3M1HA 2WN3A 4QXKA 1DIWA 4XAEA 3MLJA 3LFMA 2OZ6A 1HB2A 3VDDA 1O7FA 4QPGC 1QJEA 1MEC3 2A6ZA 2UWCA 4ASMB 4IEWA 2JG9C 5HPOA 2XVGA 1RMU1 3T1LA 5FZDA 2WNOA 2HWC2 2KR2A 1AYM2 3KCXA 3R4SA 2AUYA 3VBRB 1AUYA 1YQ5A 4ZKTB 3I7DA 3BIEA 2QQPA 3LQCA 3PU8A 4Q4W3 2XL9A 3SKJE 3THTA 4DQAA 1NZIA 4ISRA 5FZ6A 3RFRA 5AC92 1IS5A 2I2SA 1MQTB 1VBE2 3AFGA 3HN1A 4IE5A 5DPNA 2FMDA 1AR92 1YQ8A 2Y6JA 3V0BA 2C6SA 1RUE1 3J26N 1HV0A 2VJXA 4Z82A 4IETA 1W9FA 2W52A 3FX3A 4XFFA 1ZM1A 4B7KA 2BGPA 3KVAA 2HWD1 1LODA 2XJRA 4K8RB 3UT0A 1XSRA 1YNAA 3V0AB 1W6NB 4A3ZA 4ES8A 1Y9GA 2RJ2A 3ATGA 1HRV1 3HEIA 5FPLA 3S7IA 3ZYJB 4CCLA 4XF3A 1PIV3 1MZEA 3URFA 3OGSA 2X5IC 2CU5A 1QQP1 1RVF3 5KHHA 1W9SA 3MEPA 5CU1A 3DKQA 3QH7A 5I91A 1G8WA 2GH8A 1RIRA 2HEYF 1QJX3 3IWZA 1A3KA 3VBRC 1PO13 2RS52 1JOJA 4RHV2 3OUIA 4AFMA 1CIWA 3AYEA 4H7LA 4AEDC 4OVEA 3WNOA 2XOMA 4AHWA 4D7TA 1DQ5A 2JG9B 1D0HA 1BVP1 2RJLA 3B7MA 3LEMA 3N9MA 1UZVA 2W46A 3QD6A 1I9RA 4XFIA 4LBOA 3PVEA 4CCMA 1WBLA 2VMGA 1XE7A 1GKBA 2UY8A 2XQXA 4CP1A 2IXLA 2RG4A 3HMYA 1RUD2 2XONA 4HETA 2KM2A 3Q8FA 2ET7A 4FPYA 5FOJB 5IATA 4D7SA 4B3NA 2JB4A 4YZ3A 5FO8B 1GZWA 2DBIA 4NO4A 5J1XA 1UZZA 2VPVA 4CDQB 1YI7A 5A3NA 1JZ5A 2WZR2 1JI6A 5JMOA 1ZBE2 1LGBA 1CZVA 1QMJA 3IMMA 3LCPA 3R4UA 1U5IA 3KGLA 4HVRA 4YZ1A 2X05A 2RR12 3FFQA 3KS7A 4GWMA 1S0IA 1TG7A 2EIEA 3KM5A 1AR81 1VMJA 3OYWB 1E5HA 1O5LA 3DPRA 4COWA 1X36A 2WLQA 2XUEA 2XVKA 4DRRA 4UFMA 3U07A 3IPVB 3NJVA 5G05L 3DGTA 1CQ9A 4COYA 2DWRA 1O59A 1TVGA 1CJDA 1XE0A 3A0NA 3GCXA 1HN1A 5EV7A 4JTOA 3ROUA 4XF9A 3C7GA 1UD1A 5E16A 4L8QA 4QHBA 4D3WA 2ZX2A 4RQPB 3FL7A 2ZMLA 5KWRA 1EY2A 2HWD3 1DLCA 4FFGA 1NLRA 3BPSA 1F35A 4J6GA 3S57A 5KC5A 2R043 5T50A 4Q1RA 1RUNA 4ATFA 1UY4A 3ZSKA 2DFCA 4E8DA 2WQ4A 2JEMA 4M4PA 2H0BA 3AZXA 4LA3A 2VMHA 1S55A 3SLIA 1UX6A 3VBSB 2C9KA 1S2KA 2VOVA 3OGRA 3AYCA 4FSJA 5FZKA 2EXHA 4Y26A 1ULGA 5T5LA 3MLLA 2P5BA 5DAXA 2HWB3 1OLMA 2ARCA 5LK5A 3WDWA 4AAXA 3VBHB 3CJIC 4CVUA 2YPJA 5LA9A 2V5YA 2K46A 5A7QA 1S2EA 3M4FA 4QGLA 4UFJA 5FBJA 4MADA 2VTXJ 2YC4A 1MZ6A 5A33A 1RMU3 4LE4A 3MFAA 3O1VA 1TME1 1UU5A 4QQOA 1Y9MA 4EE2A 1V00A 1H8TA 1NLQA 1WCUA 2A6WA 3P3NA 4Y5Z0 2NM1A 4DFSA 4WVZA 4KBZA 4RR3A 2GSYA 5LRRA 3ZYPA 1SLLA 3DXUA 4O9EA 3SXWA 1RINA 1F15A 3MF9A 3OD4A 4JV4A 1Q8VA 2HJIA 3OTFA 4AEDA 1H2MA 3RYRA 3O1RA 2F4LA 1H0BA 3AKRA 1RUH1 5ANNA 1WD3A 3ZXDA 2ZAHA 1GQPA 1ZRIA 2BEOA 2GP3A 2WS91 4NIDA 4COZA 5C9AB 2R0HA 4FPFA 3MFCA 2OVUA 2BQPA 4GXLA 4B1MA 4QU2A 3H42B 2YMZA 4XC9A 5FFOC 3WQ1A 1SZBA 4XUQA 4TZDA 1VJ2A 4PI0A 1OHFA 4FTSA 1S0JA 2WA4A 5FAXA 2AZ5A 1UAIA 4YGDA 4D69A 2EXIA 3UESA 5EYYA 1W2UA 2VR4A 3WW3A 5A3MA 5G04L 4EQVA 1R081 1BK1A 3PJYA 3GBGA 2B5HA 3M3OA 1KFXL 4QWNA 4WM8C 2FDGA 5CKMA 2GC1A 4I2OA 2FHRA 2CDPA 2ZMNA 3IN9A 3WOGA 4W4ZA 4Z92B 1V70A 2VW1A 3FN9A 3SHRA 5K7PA 5FZ8A 4IEXA 1G7YA 2WWSA 5T5OA 3SITA 3TEXA 1COV2 1N3OA 1OQDA 4D7YA 2HWF3 3VBUB 1MS0A 4F7ZA 3NNJA 2AR6A 4CDUB 3OD0A 1I3HA 2W5FA 2ZHNA 3NNMA 3V65A 3SC7X 3CLPA 4QPIA 4A42A 2R063 4QPYA 5HI0A 4ITCA 1MS9A 3PIJA 1OH3A 4H3WA 3WF0A 5J7MA 3T08A 1OPMA 4AFBA 3WW2A 2VBDA 2HWE3 4HPKB 2DYCA 3B9CA 1X82A 1YI9A 4BJ0A 4D8MA 2VC9A 3KZ4C 5C9AC 4PBOA 4AR2A 1O3QA 4FBFA 4NRQA 1GR3A 4YYOA 3IAPA 2YDEA 4LT5A 4LUMA 4QAWA 3UKVA 3S7EA 3I2FA 4FOYA 4OYUA 2OX0A 4EWEA 4PLOA 2BJSA 2ILMA 2Y60A 3KT7A 4Q4V3 3U14A 4E4DX 3MPBA 4CCNA 4ZZ8A 1XE8A 3ZPOA 3I2IA 3WX5A 3ZSLA 2XG3A 3AYDA 1SLBA 3NV1A 4B4QA 1G9BA 5E88A 3CHXA 1PZ7A 3ZN6A 1N47A 2PHWA 4N53C 4JGYC 4OLLA 1BBT2 2P37A 1F31A 2C1FA 3FBYA 5ANQA 5IAXA 1VBA1 2E31A 3ZFGB 4OQ8A 2UYBA 2ZEYA 2LROA 1GP6A 3AJYA 1QJFA 3VZNA 5KHGA 3BU0A 3C7EA 5BYNA 3TNQA 1DGWA 2XBO3 3VBUC 4A7YA 5JPMB 1OA4A 1V6OA 5C8WA 3RGBA 4DPNA 4NPMA 5L7OB 1LOBA 1PZ8A 1WGPA 2PYTA 1NXD1 1LTEA 1ND2C 3CBNA 4CU8A 2J22A 2BZDA 4LJHA 1JYIA 3ZFEC 3AC0A 2WIIB 2VBBA 3VDCA 4QHOA 2WO3A 1SHWB 2VMFA 2E51A 3NMBA 1QJX2 4GKYA 4OFGA 4HFSA 1C8NA 5LB6A 3USUA 2W1QA 1WLCA 4UT5A 2WKKA 4QXBA 1RUC1 1PGL2 1DYKA 3CKHA 1AL21 4XW3A 3QH6A 1Z7S3 1ULCA 3UK9A 2XWJB 2I45A 1U0AA 1BMV2 1ZX5A 1WLWA 4YGBA 3VD3A 2XHKA 1UU6A 3E6BA 4AOCA 3AP5A 1DYOA 5I0DA 4AHYA 1PGW2 3VBOC 2PMWB 5C70A 1W8UA 1ZYBA 2BOIA 2BFUS 5DUWA 5FYBA 2EIGA 1JYNA 1WCKA 1QU0A 4HK9A 4E4ZA 1XNBA 1NYWA 3VBFB 2Q8CA 1G9AA 3K3NA 4M00A 4NMIA 1KGYA 1BHGA 4JDNA 4WM8B 5HCFA 5I8SA 2DBNA 4XHBA 2V4AA 3SH3A 2P4EA 4CCEA 2J1AA 2QQWA 3IM0A 3B3QE 3I2HA 2XMLA 3P1IA 4HN0A 2FDFA 1CN1A 4N43B 4NHMA 5FKCA 4AFCA 4E4SA 5A3UA 4IEVA 2Z2SB 4CEYA 2WO2A 4JQRA 4QKFA 2A6XA 2ID4A 2IWGB 3OEBA 2FD8A 1ST8A 2RS13 3FWEA 5D8AB 2JD9A 1HJFA 5E6HA 3GXUA 3VHRA 5IVEA 3AP6A 2Y26A 5ACA1 3N9OA 2RS31 4CU6A 2MHFA 3WLUA 3J9SA 4XILA 1WW4A 1R091 1QKQA 1IS4A 3NO8A 4TWTA 1VP6A 3T4HB 4EN8B 3GYDA 4LULA 4Q5OA 1EV13 4NR1A 2W95A 5H9QA 1OF3A 2R041 3J4UH 3MIFA 1LESA 1NAEA 3ZYRA 1QF3A 5CADA 1F4HA 3PUIA 1HV1A 4LNVA 1YC61 3B01A 1F5JA 4P9IA 5FYMA 3ETQA 3ES1A 1C8M2 1NA1A 4S2DA 3GJAA 3VBOB 3VZMA 2WFPA 1PO23 2HYKA 4FVVA 2JE8A 4XF0A 2QUOA 3HNBM 5HXVA 3IDEA 3WG2A 1LR5A 4YFWA 4LHKA 3ZVXA 5LK7B 2WNUA 5F2WA 1XB9A 4FI9A 1FPN2 1HQNA 4Q4X3 1DQ6A 4XUTA 4Y1XA 5FZGA 1ASJ2 1AR83 2E6VA 3OCPA 4ORFA 5A7NA 5K8SA 2RE9A 4P5HA 1C1FA 5T3NA 1JYVA 2Y6KA 4Q4X1 5JAXA 5BNOB 5F6KA 2D40A 1LU1A 3ZKYA 4NROA 5EYXA 1L7QA 3ILNA 3H8XA 1PMJX 3BVCA 3RI8A 3JZVA 3WDUA 3WF3A 4YG3A 5I93A 5KC6A 5LEKA 2LTNA 4YM1A 2TNFA 3OOXA 4HKLA 4AFDA 2Z5WA 2XKPA 2F4PA 3AYAA 1KD7A 3SCGA 3WHUA 1KITA 1EV11 5EXOA 5A3PA 3LDKA 2J1UA 1KS5A 4A44A 3RI9A 3IAQA 1OSGA 3FLPA 5I8TA 4FXGB 2CDOA 2UYAA 4HT1T 3H1YA 1YLLA 1X33A 3HBKA 5FZ4A 1RHI3 1W3VA 2NMOA 2VVFA 1NQDA 3VKLA 1PO11 2PHTA 1YEWA 3ZFFA 4QX5A 4I02A 4Y20B 3M3IA 5FYYA 1QNYA 1H6YA 2RS11 2X5IB 3MW3A 2CL2A 4Y1VA 4PCRA 4CYDA 4LLOA 5J09A 2JDPA 5K4LA 1B35B 4URTA 1HRV3 2NP0A 5FR3A 3W21A 1C28A 3AZZA 4QPWA 5FYVA 3RSJA 1J3PA 1VB2A 2AGSA 4OHZA 2RDSA 3EMRA 1ULOA 2R062 1M4WA 4QT6A 4A7ZA 2CYFA 4CCDA 3MW4A 1QGLA 4I3GA 2PHLA 2VECA 1RUE3 3RZLA 4O65A 4RR3C 3ZLIA 3O7OA 2BRTA 2ERFA 1UL9A 2ZGSA 4LBJA 2PTMA 3W20A 4FP3A 1VALA 1W6QA 3CEWA 1YIFA 1VAMA 1VR3A 2E53A 3BALA 4JHTA 4TN7A 4MGTA 4M0NA 3VBSA 2IFWA 4LE3A 4Q4W1 3U4XA 3AMNA 1V6MA 1YQCA 2IXCA 5CFCB 2Y6HA 3O1PA 1J58A 4AHZA 2NQYA 5JOZA 1V6JA 1N1TA 1GQGA 4META 2QDRA 4OHYA 4CDXB 3BCWA 4BMBA 2EF6A 1RUC3 4AL9A 3J7LA 2VUAA 1PK6A 3LB9A 5FZOA 4BXSV 5FBZA 4RD7A 1MVQA 1QJY3 1YJLA 4EZ4A 4GQ7A 1K42A 4GMP0 1YFXA 1KFUL 1GNZA 4LBQD 2I07B 1BBT3 2PHFA 5BNNA 1NXMA 4YM0A 5FZIA 3POBA 2VULA 3VKMA 4P9WA 3EXUA 4B8EA 5IUQA 5A7PA 4RSUA 4CDXC 1V9U2 1A8DA 1VBD2 2ZGMA 2XBO1 2VD7A 1U5ZA 1S0DA 1ZZ8A 1Y43B 1OURA 2VUDA 3J8F2 1V9U1 5A33B 3AL6A 3HBZA 4DZGA 2PELA 2A70A 2VW0A 3AKTA 4GMP3 1NE4A 2A1XA 3I3BA 2JDUA 2VW2A 2CNAA 4Q4Y1 2WNVB 5C5UA 2H6BA 3ASIA 5GLVA 1D4M3 1JN2P 1SCSA 4QPGB 3JD71 1X8EA 2XVLA 3L2HA 4GIQA 3WNMA 5HCBA 3VD7A 1WMFA 3FLTA 4NE9A 3VZOA 1QY4A 5GALA 3AMPA 1OLQA 2Y33A 3KQRA 3WXPA 3WV6A 2G9FA 2PXJA 4IV3A 3Q8EA 1I5ZA 4W6YA 2BU9A 5FMOL 2ZGTA 5FK7A 5TSWA 2FBEA 3VL8A 2JDAA 3D8CA 3DL3A 3LEIA 2FZ1A 4GD4A 2UY9A 4AEJA 4ZZ5A 2QFEA 4R9DA 4OZOA 4LK7A 2OXBA 1Q56A 1RUI3 2AACA 4LR4A 5FMDA 1G6NA 5C33A 1LOAA 3UGHA 2I74A 1LOEA 1EYBA 4D6RA 2VZRA 4YGCA 1W6OA 4DRVA 2ZCWA 1JYCA 1R1A3 1XC6A 3KQ4B 1F8VA 1WMDA 2QVSB 5AVPA 5FYCA 4AQTA 1DBNA 1REFA 3GZTB 5LBFA 3TB0A 1DQ1A 4LIVA 4LORA 2A6VA 4IEQA 2FDIA 2ZEZA 4CUGA 1UYYA 1NCRA 3BOPA 3KV4A 3ZN5A 1DFQA 4EROA 1IKPA 2ZX0A 3I59A 4L11A 3HT2A 3OUHA 2B46X 3IIIA 5IK5A 1CAWB 5GZCA 2DV9A 1V6KA 3B9IA 1G86A 3E1F1 3NL1A 1FX5A 5FP4A 4AI9A 3GGLA 1W6MB 5GLTA 1F4AA 3TNPB 1W05A 1FNYA 3L9JT 4TLFA 3ZMNA 1JZ7A 2VCCA 5EIYB 2YC2A 1RUF2 5A32A 4EZHA 5FUPA 3BTXA 4XTMA 1X9PA 2CY6A 2JKXA 2PLV1 2WS93 2GALA 4EN9B 3X29B 4AGGA 4LBLA 3AZWA 1PO22 1W6OB 1XJAA 3TEZA 3ME2A 1GP4A 4R9CA 3S5QA 3M70A 3ZO0B 4DXTA 1W8NA 1VRBA 2J1VA 1W03A 3R4DB 4CCKA 4KGGA 4YG6A 2WWJA 4RFRB 4A41A 1TME3 2ZEXA 3A23A 4MYEA 1JOPA 3LZZA 4Z8BA 1CPMA 3CIHA 2C9AA 4CP0A 2J1RA 2EICA 4PHZA 1RXFA 5KHJA 4CEYC 4B29A 1LAJA 4YW3A 5C3QA 2BUKA 2C5DA 3KSCA 4LHNA 1J1TA 1SLAA 2DCTA 2QQJA 4LO6B 4IV3C 2WC2A 2VZPA 3T1MA 1MACA 4QHZA 2Y6GA 4EN0A 2ZGNA 4AVVA 5ABJC 5KXEA 3W59A 4EN7B 3IBMA 1AZDA 2X8KA 1W8WA 4PQ9A 3VBSC 1IPKA 3ZXFA 4QX7A 2X09A 5IYYA 4JZRA 4YVWC 5KXBA 1PVXA 2ZGKA 1APNA 5FO7B 2CSGA 1GSLA 1AR93 1W8TA 4NHXA 4AGRA 4HVQA 4MUVA 3VDAA 3VUOA 1ND2A 2EAAA 3CJXA 3DF0A 1JZ6A 1WA4A 3P3PA 3ZM8A 3SH4A 3OPTA 4INDA 1MS8A 1RL3A 3BIWE 5F32A 2PAMA 1H30A 2WO1A 3P5BA 5FZAA 3U1XA 1W9YA 3HN3A 4CEWA 4QPGA 1PMIA 3M3QA 4YW5A 1VLNA 1STMA 4QDRA 1OPOA 3ZDSA 1EUUA 1RHI1 2DCYA 4FFFA 4YLZA 3SMHA 4CCJA 4JC1A 4Z07A 3LPFA 1JODA 1OD5A 3UETA 4TSVA 1T6BX 4IE0A 4JKKA 5CFDB 1HQLA 4L0PA 1DGRN 5APAA 1HIXA 2L9LA 2JE7A 4UW6A 4TYSA 3WVJA 3PNAA 4XCBA 4HZFA 2RS53 2Y34A 4PT6A 4BQ5A 4BQ3A 5FMCA 5FTTC 4UI9L 3RDIA 3I2KA 5HBAA 1W28A 1REEA 4JX0A 4JHZA 3GCWA 3LIHA 1SMVA 5A1FA 4PDWA 3PURA 3ZR5A 4K1ZA 5JI9A 1W3XA 5FYUA 4KWJA 5FLIA 1GMMA 2E9QA 2EAKA 1AL22 3DCQA 4OUEA 5FP7A 2WNUB 1LOGA 3POIA 2O14A 2A71A 4OI2A 2ATFA 3NAPB 4CDWA 4CUBA 2E32A 4HBNA 4Q0SA 4W50A 5KBFA 3MYXA 1QJX1 1BCXA 4IGQA 5FZBA 3H0OA 1JXNA 4IXLA 2WT0A 4DY3A 5LZ6A 5A7SA 2WN2A 2WZR3 2YU1A 2YY1A 4NRPA 3PVNA 5FZ3A 3AP4A 3WDXA 3INAA 3OG2A 3WUCA 1PIV1 1PO21 4U36A 2R072 3RJRA 2GC3A 4FPEA 4BLJA 4XETA 1LHNA 2E7TA 2JB8A 1GZWB 1U5YA 4BISA 1CGPA 1CWPA 1LEDA 1O4YA 4AEKA 1RUOA 4MOAA 1LHWA 1OOPB 4QDQA 3VN4A 4KGQA 4JVAA 1NZCA 4YM3A 3FLRA 2XR4A 4LKDA 4AG4A 2WAOA 1W0OA 4FT8A 4XDPA 4XF1A 5C8CA 2GC0A 4Y33A 4XACA 1VAKA 1FMD3 4QKDA 4EN6B 2RS33 1REDA 5KXCA 1OMIA 5ACA3 1GFF2 2D3PA 1X9TA 3DKWA 1UYXA 5LA0A 2CGPA 5IVCA 4NIGA 2ZXQA 4Y20A 4F3JA 2BPA2 3Q9OA 2GMMA 2PAKA 4MXWB 4AE2A 1PM4A 2B4KA 3FHQA 1IG0A 4HANA 5JOYA 4WVVA 5ISLA 3BI3A 2D3RA 1MEC1 4LHSA 4R4ZA 1ZZ6A 2NMNA 2ZX3A 4QB1A 1UZ0A 4R4XA 1RUJ2 5F5AA 1I5PA 2OS2A 1TMF1 2G9ZA 4NJ4A 4UW4A 5JSRA 1CESA 2OUHA 2X53S 2XJTA 4FP2A 4PIZA 4AZZA 3VDDC 5H9RA 4YVSB 4C90A 1LJ7A 1MZFA 4H7MA 2FCTA 1C4RA 1PZ9A 1POQA 3HQXA 4FO9A 2F17A 1CZTA 3N7JA 4WZCA 2YYOA 1K5MA 5FV3A 1ZA7A 1W99A 3C8XA 1LULA 4PDWC 3FUOA 3IB3A 5FYTA 2VMEA 4PLNA 4R52A 1FOD3 2MEV2 3N7MA 1GBGA 4KBBA 1JW6A 1UOBA 3B94A 2NPIA 2ZOEB 4GWIA 4WM7B 4CPBD 2WFF3 2DCZA 2DUPA 4HLTA 5T55A 3EJKA 2E63A 2O0OA 3FMGA 3WNLA 2AH2A 4XCAA 2DF7A 1V0AA 3SISA 1SDDB 3WR0A 5IHRA 2A3YA 3A0KA 4L9BA 3T3YA 1W6PA 1B35C 4UFLA 4KWKA 4YZ2A 3QBQA 5AVAA 4AQ6A 4LO4B 3AZVA 4XIOA 5JXHA 1XU2A 2RVAA 5D8AA 2Y6LA 3M7AA 3Q8AA 2WS92 3APBA 4XBQA 1RUH2 2AEZA 4CRQA 1VBA3 3T0DA 4TLGA 5FYZA 3MZHA 5B4XA 3FUQA 2GU9A 3HD8B 2BBAA 4NPRA 4WBBA 3GNEA 5FZ0A 1RC6A 1HXS2 4QM9A 3SEPA 4AI0A 3N9QA 5BNNB 2W0XA 3N7LA 2G1MA 1VIWB 5FZEA 4QKNA 1SLCA 5L73A 4AAPA 3AKPA 5FXZA 3KT4A 4AGVA 5FXXA 4XBLA 5M0TA 2YUEA 4Q4V1 2ZHLA 2AYHA 2EXJA 3I97A 4CP9B 4FAGA 1N1VA 1L3JA 1DP0A 1MVEA 4YZ4A 3PUSA 4GH4A 4JGZC 4BMEA 1FNZA 3IPVA 3K2OA 4P9LA 3B00A 4BM8A 4G9SB 2ZGUA 5LA2A 3OYWA 4RS5A 3RMXA 5A6XA 3HWJA 1QWRA 1YXWA 5FMBA 2HWE1 3VD5A 2FMYA 3RQ0A 3TEYA 3ZYFA 5K0UC 2R061 1TMF2 1IHMA 4DEQA 3EYPA 4MV2A 1A6CA 1MQTC 3OSDA 3C7FA 5IFTA 2RM22 4Q0QA 4B1LA 2DDUA 5SV5A 4EYUA 2HWF1 2QQIA 2VTFA 1MEC2 3NAPA 1DU3D 1POV1 2GMPA 4QB2A 1ENQA 3I3MA 3VHNA 2BNOA 1JBCA 5HXMA 2VZOA 4Y22A 4GULA 4XJZA 4P5YA 1NCRC 1UMHA 1H4HA 4CE8A 2JE9A 2UU8A 5IW0A 5F1RA 4YFZA 2P34A 5F7UA 3O1MA 3ZN6B 4IE4A 4MGZE 3DPRC 2HBUA 1PO12 1D2QA 4YW1A 3V64A 2IXKA 2WT2A 5BNPC 3D6EA 1ZNPA 1HLCA 2DVAA 3BN6A 5JMCA 2YC0A 1IKQA 1HQWA 1AR63 4SBVA 5DAPA 2ARXA 4XXAA 3ZFGA 4DXZA 1PNFA 2ORZA 1U5XA 2VU9A 2DFBA 3I8TA 1Q5OA 1XRUA 4IL7A 2W39A 5EZWA 1SFPA 3MIDA 4AW7A 3WZ1A 3BUCA 2YFZA 3A22A 3KVBA 4KG8A 1QXRA 4JTNA 2PAEA 4YPJA 2VQUA 3VBHC 2WSVA 3AX4A 5E8AA 2WSUA 3NWKA 4L97A 4CP2A 3H1WA 4LOTA 1W6NA 4E2QA 1NCQB 1PIV2 2WLPA 4MXVA 3JBG2 4XDOA 5GZFA 1OVPA 3EHKA 4QX0A 1RVF2 4AVTA 3ZYHA 2VXJA 1FI2A 4MXWA 4UW3A 5J96B 4BQ4A 3RZGA 4A7KA 1XNCA 5H9PA 3SEEA 2DTWA 3E97A 1JZ4A 3R05A 1GV9A 4AI2A 1QDOA 4OHXA 2VY0A 5JI7A 4RGGA 4BK5A 2HKXA 5D21A 1NCQC 1R64A 3O14A 2RHPA 3LWCA 3DEMA 3LA3A 1K3IA 3PVOA 4Q8LA 2ZEWA 3N9NA 2D98A 4XPVA 1XU1A 5DUUA 2HWB1 1WKYA 2R073 2WABA 2BYVE 2YB7A 2RMU3 4QX3A 1RUD3 2QBXA 2P3YA 2ZJCA 4I0AA 1NG0A 1V6NA 1AYN1 2VVEA 2OIIA 3MPPG 1W8FA 2Q1MA 3CU7A 3OJBA 2D93A 5C71A 1LHVA 2VL4A 4P00B 4QPIB 5DDJ3 2ARBA 1AR71 4UFHA 5FZOB 4CZSA 1EPZA 2DURA 2ZGRA 3Q8CA 1JTZX 3HR9A 4V2WA 1G9FA 2VMCA 1VBE1 4LMFA 4ZU4A 4BWOA 3ZXJA 2RR13 4HSLA 1Q43A 3GBFA 3I2JA 4YW6A 2D97A 2RS32 1QOTA 4PJYA 5CFCC 2J1TA 1WCDJ 3SCFA 5A7WB 4Z2WA 2ZGOA 4XJAA 1TZOA 1BEV2 3LF7A 4RGAA 1PM7A 2RDRA 2ET1A 4JDMA 1H8VA 4GB31 2DVFA 4P14A 1Z78A 4HONA 2HWC1 4NUBA 4BK4A 1BEV1 1OT5A 3IMNA 1VAVA 1I1EA 2XLFA 2R32A 1O3SA 1PMHX 1PVC1 3MIGA 4N7UA 3R6SA 2HBTA 5JZGA 1OA3A 4BPZA 4NOTA 2VO5A 1YCIA 5JPNB 5EWSA 3IT8A 4LITA 3ZKUA 3DN7A 4O9GA 3IDAA 1VRH1 1QNWA 1DZQA 4BZ4A 4URAA 1JZ2A 3CZJA 3GJBA 4LIUA 1FPN1 2CGOA 5L9RA 3LEKA 1ULDA 2MNGA 1C5IA 4QM8A 3WG4A 3ETPA 3AK0A 1JZ3A 5C3PA 1UY1A 5FQ0B 5KHKA 2XJVA 2FDJA 2LS6A 2K2SA 2Q1FA 4XQ4A 1ND3B 3BPZA 4Q8KA 2WNVC 3NRUA 2WO7A 1XYOA 3H7YA 1QDCA 3QOPA 5GZGA 5CFDA 2IXJA 1Q8OA 3ES4A 1O8PA 4P02B 3N36A 5EQUA 3HVDA 1RGSA 1QJU3 3W5MA 4IEPA 2VUJA 2D44A 4DY5A 3UV9A 1QQP3 1RVF1 2YZ4A 3NV4A 2WQZC 2D6MA 3HQRA 2K9ZA 5FY7A 2QQMA 3LPGA 5J3UA 1JHJA 1QIQA 3AMQA 3MF6A 1PVC2 1YUDA 3ACIA 2PLV2 3OPZA 1COV3 4IV1B 2KXLA 3TAYA 2GN7A 3UKTA 2XH6A 2BBVA 1ZBA3 2VZ1A 3ACGA 5JIAA 3LSDA 3K4AA 2SLIA 4GB32 5DQ0A 1Y7BA 4I0BA 5FP3A 1VMFA 4RQPC 2QZ2A 3EQEA 3HNYM 4AFAA 4KU7A 5AFBA 1YYNA 3O1UA 3N7KA 4ZPIA 3KV9A 5F2SA 2ZBJA 4XIKA 1GQHA 4BA6A 1H4GA 5FYIA 2QDNA 5EJ1B 2ZPXA 4CU7A 1S1AA 3H50A 3TN92 2OUJA 2VZTA 2ORXA 5DN2A 4XUOA 3DECA 3G7DA 1PGSA 1AR72 1Y9QA 1MS4A 2BVBA 3VBFA 5IVYA 2EIBA 4ZU5A 4XZPA 2VCMA 2W3JA 4X6QB 2B45X 1AYN2 4OULA 5GM0A 4A6SA 5JLVA 1OI6A 3T0BA 2EA7A 5CNAA 2RDQA 2GH2A 1R1ZA 4IQPA 1DQ0A 1UY3A 3H8UA 4HK8A 4AVSA 4NWWA 3ZYBA 2ZZQA 4QXHA 1URXA 3I49A 4RS5C 2Z4FA 4NHYA 4XFCA 1LKNA 3VD9A 4COVA 3O0VA 4JCKA 1YRZA 3ENRA 1A34A 4ZHNA 3BYWA 4OMCA 1PGL1 4AVAA 3ZPYA 4LK6A 4Q26A 1RITA 3HPNA 3T4VA 4L92A 3E5QA 5EP9A 4IV1C 4XEZA 1WW7A 5JOXA 4XXPA 4AWDA 2RM23 4L99A 2WL1A 1NLSA 3WG3A 4MGIE 4CU9A 3VBRA 1DCSA 2ZGPA 4N9HA 4KU8A 4XABA 1Y4WA 3KF5A 5LATA 4JRAA 5F5CA 3N3HA 1B35A 4F83A 1UQXA 4XE9A 2WZEA 1XNTA 1KJRA 2BWAA 3POWA 4Q4V2 2XB6C 3ACFA 3PTRB 4OZXA 1CAXA 5DUVA 4FPJA 4OUSA 1MS1A 2QKDA 1FAYA 3H8RA 1KXGA 5FZ7A 5LW9A 2GNBA 1ODMA 5FY1A 4YWAA 1ODNA 2IVJA 3JD72 1HKDA 2Y8KA 1RJ8A 1JYTA 1HXS1 1IG3A 1AXZA 4R9AA 3POGA 4H2AA 5DAWA 3NNGA 5FPUA 4RN5A 2GZWA 1LGNA 3NV2A 1YFUA 3WDTA 2W92A 2B8MA 2BVVA 1T6GC 3JQXA 3KV6A 3WF2A 4CDWB 2C24A 3MV11 2A5ZA 3S6PA 3HNMA 1US2A 4D0QA 2W9XA 4XUNA 3MGUA 2W1WA 3WHTA 4UOJA 2Q8DA 4BQ2A 2WNUC 4CSWA 1WLDA 5DAVA 5I0RA 4AVCA 3VL9A 1D7PM 2ZGLA 5CAZA 2MPFA 1S0BA 3VDDB 2XJUA 1HW5A 1J59A 3WDYA 4XAAA 4EWDA 2PHUA 1KDMA 5IK8A 3BOWA 5BNOA 1MZ5A 4PQQA 2TUNA 3LOIA 1IGOA 4K1YA 3N35A 5FPBA 3RMYA 3WP3A 1H8TB 2JECA 1LHUA 3AP9A 2JDMA 1X7NA 1GOHA 1Q3EA 2YGLA 1EAH3 1MR5A 3RWKX 3PLQA 2DCJA 2XDVA 4XQWA 5L9BA 4ATEA 5F3EA 4N53A 2W1SA 3PUAA 4FPOB 5A3OA 1GWKA 1VPHA 3ITQA 1RUG3 1IQAA 1IOAA 3OBZA 2OW4A 1H9WA 4N43C 4YNIA 5FO9B 4K7JA 3WW1A 4LLFA 4FTBA 4KQ7A 4XOGA 4D6QA 5L19A 2D5HA 4CCOA 3O1TA 1J1LA 2J1EA 5FP8A
chains in the Genus database with same CATH topology
2BGCA 1HRI3 3PTYA 3ZFGC 2D6NA 2Z79A 4MLOA 3DUIA 2XLAA 3KCYA 3BTAA 3PHMA 1ZZCA 5DG1A 1C8M3 4FOWA 3WW4A 1DZTA 3D4KA 1E57A 3VV1A 1H8TC 1ZRCA 3R0RA 3VZLA 2RS12 3WCSA 5F6LB 5C4WB 5FOBB 1ND2B 5FPXA 3U10A 5GJ6A 3WQ0A 1RUF3 4HKOA 2Q8OA 4PBPA 3ELNA 1RJ7A 2O1QA 1YWKA 4B7EA 3TYJA 2EALA 4CDUA 1ZBE1 3M2MA 5A3LA 4PIXA 2WA3A 4OUMA 1G9DA 3AMHA 1CJPA 1CAUA 4LBQB 1EV12 1K5MC 2YXSA 4M3CB 5CG9A 4CDQA 1QJU1 1QH6A 4WVMB 3RYPA 4ZXKA 1CR7A 4YVSA 2P3IA 4IESA 3ILFA 2E7AA 2IZWA 4AXOA 1RTVA 1AYM3 2GNDA 4QGNA 3MW2A 1K5MB 1TEIA 1LOFC 3I4IA 1ZZ7A 5I0UA 2DU1A 3LA7A 1FPN3 4Q4X2 2CWMA 4N7IA 4RHV1 2VOWA 1C3HA 4HSJA 1VRH3 4Y1ZA 3I2DA 4HPKA 5BNOC 5I8YA 3NKTA 1N3PA 5FLJA 2ZKNA 4P9GA 4QPIC 1QJZA 5C4WC 2WNEA 3CO2A 4FQZA 3MI8A 1UZYA 5CBLA 1ZBA2 1UIKA 2E7QA 5CVRA 1OQ1A 4GB33 1GICA 2G4IA 4A3XA 2JG8B 2BNNA 2JKBA 2EVXA 5K9YA 3LA2A 4WVWA 5I0SA 3TN91 2F6BA 2RR11 3D5OA 5H9SA 1VBE3 1RHI2 3OGJA 4JGZB 2XWBB 1IZ3A 3HAGA 2VVDA 1UKGA 1AR73 4LO5B 2VH9A 4PF5A 4CEWB 5BPXA 4XJWA 3LSEA 4IEZA 4KL1A 2ZACA 1AYN3 5J36A 1RB8G 2TBVA 3DV8A 3ZXGA 4I01A 1A78A 1LB2A 1UN1A 4XHXA 3SCHA 3KT1A 4JRLA 1X50A 4V1PA 4XJUA 5DZGA 3PVBB 4NN0A 4QQ2A 4DOUA 1FV3A 4QMAA 4CEWC 1V6IA 3M3EA 4MGYE 2WINB 4AF9A 5EJ3A 1VBD3 1PGW1 1UU4A 1ASJ1 5BV6A 4MGKE 2B42B 1DGRA 2DUOA 3AXDA 1CAWA 3J8F3 3CF6E 3ACLA 1SBEA 5GLWA 5GLZA 4N43A 3AZYA 1GZ9A 2GC2A 1LHOA 5DXDA 3NV3A 1A8MA 1S0CA 1RUC2 5JSPA 2XGXA 1DDLA 4K40A 1OKQA 2D5FA 2IFRA 2R042 1ZRRA 2GAUA 1ZZBA 4OI0A 1ZBE3 3JB4C 3WP4A 4I0WB 3QACA 1O5UA 3FJSA 4AEMA 4R8HA 4ES9A 4L2NA 4RQPA 4RL7A 2ES3A 1RUF1 3H7JA 5ACA2 2CV6A 4EV0A 4K20A 4BYYA 4YGEA 4K9SA 2ZS6B 1D0GA 1ZVFA 1UKRA 4GALA 5FREA 3ZFFB 1FV2A 1WCSA 1OOPA 1Z0HA 2A73B 2FZ2A 1CX4A 2B9UA 1AHSA 4X8NA 2DVDA 1DQ4A 4FOQA 3AMMA 5C8CB 1Q8SA 1SEFA 3MIEA 1VBB3 1PK6C 1R1A2 4BOWA 4G3YC 1DYPA 1ND3C 2DUQA 2BFUL 3VKOA 3W58A 1DF0A 4C91A 4QGMA 4Z1VA 2PN5A 3QCWA 4ASLA 1XYNA 1CAVA 1W6QB 1W0PA 2HWB2 3M3CA 2UWBA 1UPIA 1QOOA 1BMV1 4COUA 1WBFA 1EAH1 1D2SA 5AFEA 1BXHA 3MLKA 2ZX4A 4BIFA 1DZRA 1SLIA 2JICA 4I3PA 3POYA 1QXPA 4FOVA 4LA2A 2G9GA 4N9IA 3JBG1 4UBGA 3GZUC 3WQ7A 1H1IA 1SQ4A 1PK6B 4DS0A 2K0GA 3TWIA 1R082 2YV8A 3UJQA 3B02A 3ZFEB 3H3UA 3K48A 3T2TA 3BU7A 3NW4A 2WJSA 4XFGA 1VBA2 2D7FA 3E6DA 1AVBA 3OY8A 1ZRFA 1XNDA 5KHIA 4DMIA 1HXS3 2ZHMA 3WNXA 4HN1A 2WT1A 3OBTA 1NQJA 1VBC3 2VQAA 2ZABA 1H1MA 3RZZA 3VGIA 2D6OX 3KMHA 3CNAA 3PJQA 4XF4A 5EFUA 4D94A 4YM2A 1XQNA 4CEYB 4GWNA 5BUVA 4BCUA 3LKJA 1VBB1 2CWSA 3CJIB 1SBFA 2HWF2 3KB5A 1O4ZA 1UMZA 4J1WA 2RM21 2IXHA 1DQ2A 5CA6A 1UPSA 4LO8A 3E5UA 1F2NA 5KXDA 2X29A 2XJQA 5DUXA 3ST7A 3H3ZA 3ZN4A 3BB6A 2HWE2 3OF1A 3ZIXA 1OFNA 1BJQA 2CGNA 3MIBA 4MX3A 3WP5A 2R0FA 4E9KA 1AXKA 1OQEA 4Q4W2 3GBWA 1I6XA 4X8PA 3O0WA 5AC93 2VG9A 1V6LA 5L7OC 1CAUB 4H55A 4LBQA 2NZ9A 4M3CA 4RA0A 2A3XA 5BY5A 4JAAA 3OGGA 5C8CC 4Q27A 3VZJA 1WLTA 4B4RA 1O3RA 1MS5A 3GZAA 3AKSA 5JVVA 3WINE 4EWAA 3V0BB 5BNQA 5JOWA 3IDBB 4XFBA 2ZGQA 2OZJA 3LAGA 1N3QA 2P17A 4FPHA 4I30A 2A6YA 4RS5B 4YARA 4NWVA 1UIJA 2XBO2 3I54A 1VBD1 1XNKA 1ALYA 1DHKB 2DTYA 4M0HA 4YZ5A 1LENA 1FATA 4LHLA 4HL0A 3U0ZA 2JXAA 2B39A 5IT6A 2D6LX 3O0XA 5BNPA 2LUWA 3JB8A 2MEV1 2VNGA 1Q8QA 2GMEA 4Q29A 2GN3A 5DZFA 3JQWA 4C1WA 5JDBA 1ONAA 3B93A 1H2KA 4WM7C 1KQRA 2B7YA 4R9BA 3POSA 4Y1UA 4BIOA 1FXZA 5F5QA 2A3WA 4W6WA 2Q5TA 4WVMA 5DDJ2 4XQDA 1N1YA 5IK7A 1FT9A 3VZKA 1RUJ1 5T5PA 5D8AC 4DNYA 3M8LA 3ZXLA 4DB5A 1GZCA 4M01A 4N90A 4PLMA 1BYHA 4YG0A 1GYKA 3H1MA 4OHVA 1C1LA 1RUJ3 1BEV3 5A32B 2VGDA 2XPJA 4E2SA 1ZRDA 3TOJA 2JENA 1DG6A 1LOCA 3UKNA 3V0AA 1LEMA 3THPA 4F8AA 2ENRA 1AR91 2Z42A 3ZFEA 3AFKA 1NOVA 4DINB 2D6KA 3LOBA 3C2UA 5JCTA 3O12A 4GH4C 4JGZA 5FMOS 3ILRA 1TNFA 4UW5A 1QXJA 5FCCA 5T54A 3IKWA 3AM2A 4K6BA 2YROA 1RMU2 2AREA 3FHIB 1O91A 2HEWF 2MEV3 1FOD2 4AI3A 1RUD1 2ZA9A 2QNKA 3HIFA 4KH9A 2R071 1LU2A 2XJPA 3EBRA 5K0UA 2P3KA 1YIPA 1MQTA 4S2HA 1NA1B 2JDZA 3S30A 4MZUA 3VBOA 4RR3B 1SFNA 2LALA 3D82A 5C6CA 4Y24A 1W39A 2UURA 4XBNA 4LBNA 1Q8PA 2BNMA 3JUUA 2ZHKA 4S2FA 4YVWB 1DGLA 1QQP2 3E5XA 4MVTA 3DPRB 2IC1A 4M3CE 2JG8C 1BVVA 2ZZJA 2DCKA 2BW8A 1IS3A 2H0VA 2PLV3 1CVNA 4JDOA 5BNNC 2CAVA 3K51A 2PFWA 4FXKB 1B09A 1W6PB 1TNRA 3NVCA 1RUE2 4E2GA 4B4PA 1S0GA 1H2NA 1NY71 3MDPA 1R092 3FZ3A 4IEUA 4ISQA 1AR61 3FE5A 5AC91 1QH7A 1YFWA 4FPCA 1F9KA 1S2BA 2R6QA 4GA9A 1LOFA 1VBC2 5ABJA 1F5FA 1LECA 3KD4A 1M06G 4OHWA 3SH5A 1WMEA 1AX2A 4JGYA 3A4UA 2Q30A 4KWLA 2FQPA 4FQ4A 3GHNA 4PDWB 2Y38A 1SLTA 2DVGA 2OPKA 5F9TA 1QJY2 2PA7A 1O4TA 5J98B 3TRSB 5JIUA 4LBMA 2VNRA 2Y0OA 4EJRA 4M3CF 4W65A 2VOXA 5FDBA 2V73A 2JD4A 1AF9A 2NN8A 3RWNA 2DU0A 3WCRA 2H6CA 3ZXKA 5BNPB 4FPLA 5I0TA 5L36A 1VBC1 3VLBB 5DG2A 3FBMA 5ABJB 1AR62 5T52A 3HT1A 1UW8A 3KCCA 3E6CC 1NY72 5L7OA 1C5HA 2VNOA 1DGWX 3VHOA 1MS3A 1TE1B 4IERA 4GKXA 3JD73 4U2AA 2IXIA 4Q1PA 2NYYA 2Q4SA 3JU9A 4LTAA 2XJSA 5FRAA 4WM7A 4GMP1 1WW5A 1UCXA 3JBG3 4QD2A 4XTPA 3RRDA 3LGRA 2XL7A 1V9U3 5JZGB 3WUDA 1NA1C 4QQPA 1LGCA 1H1AA 2A7AA 4XJ9A 3ZXEA 2RJKA 4KNCA 3D0JA 1Z7S2 4XDQA 4BLIA 1ND3A 1NCQA 2Q1ZB 2X5IA 4HKWA 5D1IA 2O8QA 1ENRA 1ZA4A 3W9AA 2KA3A 1QJY1 4HVOA 4C0BA 1AJOA 1YJKA 3ZSEA 1FOD1 4Q2FA 1JUIA 3VKFC 4OI4A 1YHFA 4AHXA 5CIRA 4LEJA 2BWCA 5E89A 3NAPC 5CG8A 4NHLA 1BKZA 3O5SA 1HDKA 2TEPA 3EO6A 1OA2A 4X6RB 5K0UB 3CJIA 5J37A 2OYZA 2O8OA 2XKOA 2AENA 1S0FA 3KGZA 1U12A 4AQSA 4W6XA 2CAUA 4NHKA 1GLHA 1NCRB 1POV0 3ZFFC 1ZBA1 4FCAA 5FPZA 3AJZA 1OOPC 2RMU2 3WDVA 1COV1 2EXKA 4I09A 1KJLA 2A75A 4A2UA 5B2GB 4BHPA 3OBRA 4RFT0 2P3JA 3FC0A 1EP0A 4FPGA 4YVWA 4XFAA 2NLRA 4Y22B 4Y4YA 2YGMA 1J3RA 2CTVA 1IPJA 2R16A 1FMD1 1JH5A 4N53B 4JGYB 3ZSJA 4Q4Y2 4XYXA 2Z69A 1CD3G 3RYKA 4AI8A 1XYPA 3GF6A 1GNHA 3H9AA 4IEYA 3CL1A 4Q0UA 1WW6A 2W68A 2WZPP 3J8F1 2WNVA 1ASJ3 1AR82 4IV3B 3G6JB 5FLHA 1QJU2 4ONUA 5LEJA 1OFSA 2WZR1 4IV1A 2PHRA 4ZU7A 4BQ1A 4AYUA 3ZYIB 4P9XA 3QLQA 1PVC3 1LCLA 2C0ZA 1TME2 3IIAA 1JUHA 4MH0E 2PHXA 2HWC3 1AX1A 5CB7A 4Q0PA 3OY8B 4CDQC 2D43A 3ZIWA 1SFYA 1SDWA 4AI1A 3AKQA 5DZEA 1KS4A 2QE3A 3RPQA 2R49A 4Y1YA 1JHNA 5GKAC 4PIYA 5FQ0A 2N7GA 2R1DA 3TN93 1LRHA 1ZREA 2RS51 2ZX1A 1WD4A 1YFYA 1SBDA 5DDJ1 1TQ5A 2QZ3A 2P2KA 3VBFC 1QOSA 5SV8A 4NVPA 4AVBA 1C57A 1IS6A 4G4FA 1R093 3AB0A 2SBAA 4FAHA 3WY6A 1HRV2 2RMU1 2PQQA 2YHJA 3S0MA 5J48A 3MICA 2Y0IA 1J3QA 4MSVA 4UXAA 3NKGA 2LM3A 1HX6A 5T5JA 1VB4A 1ZZ9A 1PHMA 1SCRA 4RHV3 3ZSMA 3JCIA 2VOKA 1AJKA 3WD5A 4E27A 1YO8A 1BZWA 4P9JA 1O3TA 1EPWA 1CAXB 4OI1A 2JG9A 5CFDC 5GZDA 4YW4A 1AYM1 3ZX7A 2R1BA 3RG0A 3B69A 4WZFA 4WV8A 1BQPA 5GZEA 4QQHA 4C1XA 2GNTA 4HMZA 1CONA 2ZKLA 4S2GA 3VBHA 1Z7S1 1AL23 3ECQA 5JR7B 3GALA 4CDWC 3NSTA 1Y3TA 1FYUA 1FMD2 4LBKA 1CPNA 4K21A 2BTVC 4IEOA 3WG1A 2DVBA 3NJZA 1AL0G 3PMEA 3RNSA 1GANA 1SACA 4J1XA 1C8M1 1G9CA 1POV3 2VMIA 2QJVA 4H14A 4BH9A 2GNMA 4FTEA 1D4M2 1WUVA 3ZMOA 1UF2C 2PHDA 2HWD2 2QCSB 3L2YA 1HRI1 2GDFA 4GH4B 5HCAA 1EAH2 3ALQA 4YW2A 3UL2A 3N4MA 2JX9A 4YVSC 5E1RA 4AQ2A 2ZTNA 4BE3A 3GHMA 3U11A 3D0SA 3VHPA 1NE6A 4CDUC 2ZMKA 1W6MA 3AXEA 1VBB2 1OLRA 1RUG1 4CDXA 4UBHA 4CTEA 1H2LA 2D6PA 4LO7A 1X8MA 2W08A 1R1A1 5BXXA 5CFCA 1RUI2 3USSA 1ENXA 3RS6A 5LRSA 3B5LB 2JJ6A 3FFZA 2ETEA 4XMAA 1AXYA 5C4WA 4XJ8A 3WT3A 3V56A 2JG8A 1RUI1 2Q0AA 2ZAAA 4QQLA 3SNMA 3USUB 3WP6A 5JZGC 3KLSA 1KRIA 4K8FA 5JWPA 1N1SA 4AEDB 1QHDA 3MIHA 2VXRA 2D3SA 1RUG2 1KDKA 1ENSA 4K3UA 2XLGA 3BODA 4YSFA 4Q0VA 1S0EA 3PMSA 5IK4A 3VBUA 2HEVF 3I59B 1HRI2 2R30A 2WFF1 1DLLA 1ULFA 1R083 1ULEA 2XUMA 4XFHA 4AK3A 1D4M1 4WM8A 1PNGA 2WFF2 3UJOA 1AX0A 4Q4Y3 3RJ2X 2OA2A 4YRDA 1D4VB 4LUKA 1CAVB 4FPKA 3AP7A 3ZYGA 3C3VA 3IDCB 3VKNA 5GLUA 2V09A 1H9PA 4P9YA 1VRH2 4KG0A 3ZXAC 2UWAA 1RUH3 4XMIA 4SLIA 3TBDA 1XXNA 2VQ0A 1TMF3 4C0HA 5C9AA 1BBT1 4QXKA 3M1HA 1DIWA 3MLJA 2OZ6A 3VDDA 1O7FA 4QPGC 1MEC3 2A6ZA 2UWCA 4ASMB 4IEWA 2JG9C 2XVGA 1RMU1 3T1LA 2HWC2 1AYM2 3KCXA 3R4SA 2AUYA 3VBRB 1AUYA 4ZKTB 3I7DA 2QQPA 4Q4W3