1LHUA

Crystal structure of the n-terminal lg-domain of shbg in complex with estradiol
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
175
structure length
175
Chain Sequence
PAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SEX HORMONE-BINDING GLOBULIN
publication title Steroid Ligands Bind Human Sex Hormone-binding Globulin in Specific Orientations and Produce Distinct Changes in Protein Conformation
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lhuA00
1UZZA 1V6OA 1LU2A 3B00A 3LSEA 3BODA 4CTEA 5KXCA 1WD4A 4BOWA 1BZWA 1LGBA 1ULCA 3NWKA 4M3CB 5DZEA 2JECA 4YGEA 4W65A 4RL7A 2GMPA 3NV4A 2BQPA 2YXSA 2PELA 4WV8A 2PHXA 3T1LA 2ZABA 3OJBA 2A70A 1VAMA 3MW2A 3USUA 3V64A 1QU0A 1UAIA 5GJ6A 4CRQA 3M3OA 3VKFC 2D43A 4TZDA 1DFQA 2OW4A 2TEPA 1YYNA 3M2MA 4BM8A 1ENRA 1LU1A 1UKGA 1SLLA 1C57A 2CYFA 1BQPA 2D6KA 1SBFA 2WQZC 1V6MA 1GSLA 2ZMNA 3WG2A 1UL9A 1LULA 3OGGA 5EXOA 2D6PA 3APBA 1QGLA 4P9WA 2VW0A 4Y20B 3AP5A 1VALA 4YM3A 1APNA 3U4XA 2EALA 4UW3A 1SCSA 1DGLA 1N3PA 1GZCA 1FNZA 2GMMA 1DQ1A 2VU9A 1Q8PA 2A6XA 3WVJA 4AGGA 4XTPA 4XJZA 3AYEA 2WKKA 2DTWA 3GALA 1CN1A 5EYYA 2R0FA 3H0OA 4HL0A 3WOGA 2D3SA 1OKQA 2Q5TA 4FP3A 1ONAA 3N3HA 4Y22A 1Y7BA 3FLTA 1LCLA 1FYUA 2VUAA 4BLJA 1WW4A 3M3QA 1QF3A 1RINA 3AJYA 4FOYA 1AJKA 1G9AA 4XJUA 1ULDA 3SITA 1BYHA 4XILA 3I4IA 4M3CA 5DZFA 1MR5A 3SLIA 2LTNA 5CBLA 3AP4A 4ZKTB 3SH5A 1VIWB 1DYPA 2YY1A 3V65A 4NO4A 3WG4A 1AXKA 4P14A 2A7AA 4XOGA 4DPNA 2LALA 1WW7A 3R05A 5H9QA 4D69A 1MS0A 1FATA 1YXWA 5DUXA 4ASMB 3VKMA 3VKNA 1S0CA 4LBQD 1JXNA 1SCRA 2ZZJA 5L73A 2V5YA 4BMBA 1A78A 3ZPYA 1DYKA 3C2UA 2GNDA 1CESA 2P34A 5T54A 5SV8A 1DIWA 1QNWA 3ZSLA 2GNMA 1CPNA 4K21A 3D6EA 3ILFA 4P9XA 2DU0A 2JJ6A 4FPHA 4R9AA 3OY8A 2WSUA 4U36A 4YGDA 4Q26A 1AF9A 1LHVA 3IM0A 2ZBJA 4Y20A 3RMXA 1OFSA 3WDTA 4AVVA 3VUOA 3JU9A 1LEDA 1MZ6A 1SLAA 4GWMA 3AX4A 1O4YA 1WLDA 2R1BA 1CVNA 3AP9A 1N47A 3IPVB 2EF6A 1UMZA 1MACA 1SBEA 4DQAA 1H9PA 1QNYA 1YO8A 4LBNA 4L8QA 3RSJA 3ZXFA 5JOWA 3ZYRA 1YRZA 2CL2A 3L2YA 3HR9A 3KM5A 1V6LA 1D0HA 1LEMA 2R0HA 1HQLA 3AYAA 3SH3A 5F9TA 2E7TA 3LCPA 2DVDA 3VKOA 5GM0A 2EIGA 1WW6A 4XJAA 5GZFA 2EAKA 3FBYA 1JUIA 1RIRA 2ZHLA 1MZ5A 3RMYA 3WDWA 3ZSKA 1JBCA 1RITA 1N3QA 1W6QA 2AUYA 5JLVA 1GBGA 1EPWA 3M3CA 4FVVA 4FPEA 1GKBA 3AK0A 4UW5A 1LECA 1X50A 4FP2A 2UURA 4YM1A 1V6NA 4I30A 5JOZA 3V0BB 2NP0A 1Q8VA 2PHRA 1WW5A 1YIFA 2AENA 4FOVA 5GZEA 3WUCA 4Q1RA 5CB7A 2DTYA 5JOYA 1OQ1A 1DHKB 5IK5A 1BKZA 2HYKA 1PZ9A 3I8TA 3PVOA 2VY0A 4GA9A 2ERFA 3AZXA 4YG6A 1G8WA 1MS4A 1GYKA 3A4UA 2ZMKA 1MS9A 5T5PA 4ATFA 5GZCA 1LTEA 4LBMA 1V6KA 1PZ8A 4GALA 1GICA 1R1ZA 3PJQA 1LOFC 2ZGNA 1N1TA 1IS6A 1G9DA 1JOJA 1LGNA 1U0AA 4C1WA 1V6IA 2D44A 3MW4A 2D6LX 4GKYA 3AFKA 2B7YA 3B3QE 1URXA 4UW6A 2A6WA 3M1HA 1WUVA 4Y26A 5EWSA 5EYXA 1W6NA 5HCAA 2PHFA 5AVAA 1WD3A 3ILRA 1JYIA 1LOFA 2EXIA 3ZXJA 3WDXA 1AXZA 5GLUA 1LGCA 3IKWA 2E6VA 4XJ9A 3DUIA 5T50A 1LOBA 1G9FA 4Y1VA 4YG0A 2ARBA 1CIWA 1IS3A 3OBTA 1HDKA 1F31A 3O5SA 5IUQA 1V6JA 2WSVA 4FOQA 4YGBA 4PBPA 2YMZA 3OBRA 4LBQB 3WLUA 3Q9OA 5E89A 4TYSA 2CNAA 5JDBA 2WT2A 1YI7A 1N1YA 5DG1A 5F5QA 4YFWA 1W6OA 3SISA 4YM0A 3BTAA 1S0JA 3AZVA 4FPYA 4PCRA 4YZ1A 5DZGA 1S0IA 1TEIA 2A6VA 1ENSA 4R9BA 1Z0HA 2W08A 1JW6A 3N7LA 3WCSA 5IT6A 3LSDA 2PHUA 4PF5A 5T52A 2GN3A 3V0AB 3O0VA 2GNTA 3N35A 1W0PA 1S1AA 1S0BA 2DUQA 2E7QA 4XZPA 3UJOA 1G86A 1SBDA 1LOAA 1WLWA 1I3HA 2AYHA 4XTMA 5JVVA 2ZGPA 2G4IA 1JYCA 3PVNA 3TB0A 1V00A 1MVQA 3DGTA 1UZYA 3FLPA 1WBFA 2A71A 3FLRA 2KM2A 3NV3A 1LHUA 4Q8KA 5IK7A 4YZ3A 4KBBA 4XE9A 1F5FA 1NLSA 2DYCA 2E51A 1DQ2A 2FHRA 3N7JA 1KQRA 1SACA 1Q8QA 3W59A 3ZYPA 1QKQA 5DXDA 1HKDA 1S0GA 1KITA 5GLVA 4YW1A 2D6MA 2VH9A 3T1MA 4GWNA 3WDVA 1I1EA 1WBLA 1KDKA 1S0DA 1IKQA 2ZKNA 5T55A 3FUOA 3INAA 5CA6A 1AVBA 4RA0A 1ULFA 1ENQA 4Z8BA 1KJLA 2EXHA 1W6MB 1KDMA 3D4KA 4XYXA 4YFZA 3PVEA 2JE9A 3IMNA 2XG3A 3AXEA 2WJSA 4LBQA 1A3KA 4XMAA 2DVGA 1O4ZA 3ASIA 1ZM1A 4XHXA 4LBOA 2SLIA 4JCKA 5IK4A 2ZHMA 3WV6A 5KXDA 1VAVA 2P3JA 2A6ZA 5JMCA 1MS1A 1CR7A 3IN9A 3AZZA 2P3IA 5GLTA 3RS6A 3PMEA 3D5OA 3R4UA 4BQ1A 2NMNA 5DUUA 1DQ6A 4XXPA 2NZ9A 4ATEA 1AX2A 4Q27A 3UJQA 1BXHA 3V0AA 2A6YA 5GLZA 4AGVA 3O0WA 5GZGA 2JDZA 3OYWB 2ZGQA 2ZGMA 4FQZA 5H9RA 3POSA 3POWA 4F83A 3A0KA 1SLBA 1KRIA 2ZGOA 1ZA4A 2DV9A 3JUUA 1LJ7A 3QCWA 4FPKA 4XJ8A 3B69A 3SH4A 3FUQA 4HANA 4FPFA 1SFYA 5KXBA 2ENRA 2A3XA 2SBAA 4Y1YA 1J1TA 2CWSA 1C1FA 4YZ4A 2AGSA 4M00A 2GALA 4YW4A 4FPCA 2ZACA 1VLNA 4XXAA 2JE7A 2NN8A 4XIKA 2D3PA 1D2SA 3WDYA 2WNEA 3UK9A 4FPLA 1FV2A 1G7YA 4FOWA 3WHTA 5DUVA 4K1YA 4P9YA 4SLIA 4XJWA 1G9CA 3N36A 3RQ0A 2GMEA 5JOXA 1Q56A 1AX0A 3B01A 1F9KA 1HQWA 3TAYA 4ZXKA 3CNAA 4MYEA 2R16A 1QOOA 1GANA 2W68A 4Y22B 1W6MA 3UL2A 4BLIA 4DFSA 1N1VA 1C1LA 2I2SA 3IPVA 2FMDA 4PQ9A 5H9PA 1GV9A 3AXDA 4R9CA 1BJQA 1DQ5A 2PHTA 4FQ4A 3WNXA 4Q2FA 5FREA 4CZSA 2DUOA 4AVTA 1IKPA 3KQRA 2WT0A 3ZVXA 4NOTA 4ITCA 2A5ZA 2DWRA 3ILNA 3VV1A 2YZ4A 1CJPA 3OPZA 2YV8A 4AYUA 4XBQA 2A3YA 3BIWE 4YW2A 1HLCA 4FPOB 2DVBA 1QDOA 3V0BA 1ULEA 3OYWA 4YGCA 1GNZA 3GNEA 4WZFA 3N7MA 4YM2A 4LBKA 2Z42A 3MW3A 4H55A 3ZXKA 3ZSMA 1SLCA 1H9WA 2C9AA 5HCFA 1SLIA 2WLQA 1AJOA 3OY8B 5KXEA 1FAYA 2NMOA 1ULGA 1W6PB 1DQ0A 2CWMA 2GNBA 2CY6A 2VW2A 5T5LA 4C1XA 4FPJA 1LESA 4WVVA 1LOCA 1GZ9A 2H0BA 3NV1A 1UPSA 4XHBA 1S0FA 3WCRA 1N3OA 4Y1ZA 2ZMLA 1QDCA 3SNMA 2EXJA 2W39A 2DURA 3BOPA 1UN1A 3NV2A 2P37A 2AREA 4GXLA 1GZWB 1Z78A 2OVUA 1CQ9A 3ZXLA 2A3WA 1UX6A 2NM1A 2ZGUA 4DRRA 1DBNA 1C4RA 1MVEA 4DRVA 1PZ7A 3HMYA 2UWBA 4YLZA 2ZGKA 2DVAA 2D7FA 4JC1A 3T2TA 1SLTA 1IS5A 1W6QB 2JKBA 2YROA 2P2KA 2ARXA 5DG2A 1CONA 2DUPA 4Q1PA 4YZ2A 2PHWA 3QLQA 2ZA9A 1FX5A 1MS8A 3AZYA 4FPGA 4Y1UA 1S0EA 1W0OA 2AH2A 2OUJA 4Y24A 5DUWA 4BPZA 2D6OX 2NYYA 1KJRA 3MPPG 1NXD1 3B9CA 1LOEA 4PBOA 5HCBA 3WZ1A 4LBJA 5CNAA 4WVWA 2P3KA 1MS3A 5GLWA 3FFZA 5GZDA 2VW1A 3AZWA 2ZHNA 4AVSA 2XB6C 4U2AA 3MEPA 2JD4A 2ZGRA 3AJZA 4XMIA 4M01A 2ZGSA 3WHUA 2DVFA 3M3EA 1DZQA 5LK5A 3ZXEA 4UW4A 1G9BA 4LBLA 3WG1A 2D6NA 1QMJA 4BMEA 1LHNA 4XBLA 2VXRA 3ENRA 2CTVA 1JN2P 2D3RA 3R4SA 4M3CF 1Q8OA 4YG3A 2R1DA 1DQ4A 1IS4A 4DS0A 1W6PA 3WUDA 1B09A 2GN7A 1CPMA 3POYA 3USUB 4XIOA 1LENA 1W6NB 1WCSA 4ISQA 1WLCA 2ZAAA 4YW3A 5T5OA 2ES3A 3ATGA 3N7KA 3AP6A 5H9SA 1GNHA 4AWDA 2A75A 5BYNA 2UWCA 2W52A 3WDUA 2V73A 3RG0A 3W58A 2E53A 1GZWA 1FV3A 3HN1A 1MS5A 4R9DA 1JHNA 2UWAA 2EXKA 3AYDA 3VKLA 5IK8A 4YZ5A 2C5DA 2DU1A 1Q8SA 1QOSA 1DLLA 1AZDA 2ZGTA 5E88A 1N1SA 1LOGA 3O12A 1LHWA 4ISRA 2AR6A 1XQNA 4OZXA 1AX1A 1FNYA 4IQPA 2GDFA 2UU8A 5FRAA 2ZHKA 1LODA 2R49A 3AYCA 4JRAA 3RRDA 2ZGLA 1AXYA 1IOAA 1H30A 2OUHA 1GLHA 5GALA 2WT1A 1A8DA 1QOTA 1W6OB 4XBNA 4XDQA 2RHPA 5E8AA 3AP7A 3O0XA 4GKXA 1LHOA 4M3CE 3ZSJA 4Y1XA 3A0NA 4YW5A 5T5JA 5CAZA 4K1ZA 4Q8LA 3WG3A 4AGRA 4K20A
chains in the Genus database with same CATH superfamily
3K4AA 4CE8A 3IIAA 4IV1A 4QM9A 4ZY9A 3NNLA 3KMHA 3GM8A 4JHTA 4CTEA 4YVWB 2WNUC 1LGBA 2ADDA 2VL4A 4Q4V2 5ABJA 2Q8DA 4A45A 3I2GA 1E57A 3K4ZA 4YGEA 4RR3C 4AEDB 2RJ2A 4BK4A 1U5XA 5A32A 4AF9A 4LO8A 2YXSA 3OD0A 2PHXA 3VN4A 3POJA 2ZABA 4P5HA 2A70A 1VAMA 3VZKA 3WQ1A 3MW2A 3TNPB 3VBFC 4W8JA 5GJ6A 4ZPIA 3VZNA 5ERLA 2D43A 5A80A 4TZDA 2QZ2A 2TEPA 2KR2A 2PAMA 1ND3B 1U12A 5IAXA 4C91A 2UY9A 3AB0A 1PO22 1AL0G 3RJRA 5A3MA 1W06A 2HKXA 3WG2A 1DCSA 1LULA 3OGGA 2D6PA 2K46A 5L9BA 3AP5A 4ZZ8A 4N8MA 4UW3A 4EN9B 3D0JA 1N3PA 4OHWA 4AFCA 3WVJA 2GMMA 3HJRA 4QQPA 5F5AA 5F8PA 5LBBA 3MPBA 3LEMA 2DBNA 2TUNA 5KHIA 2Y6JA 1DGWA 1QHDA 1OHFA 1UU4A 2Q1FA 2VZTA 4QPIB 2XMLA 1Z7S1 2JDYA 1FOD1 1CN1A 2VCAA 5C33A 4N7UA 5DDJ1 5C8CA 3WW4A 5HCHA 1W28A 5LEJA 3E6BA 4Q4V3 1IGOA 1OKQA 1GFF2 3TYJA 4AOCA 4LK6A 5A7SA 2B46X 2QTWB 4CU7A 1UXXX 1RUC2 4A6SA 2BOIA 2PTMA 4BLJA 2V5DA 4LKEA 1RXFA 5DAQA 4FSJA 4XJUA 5KHGA 4TSVA 4YVWA 1ULDA 4NAMA 4IXLA 3SITA 4JZRA 1SPPB 3J7HA 5DZFA 3VBHC 1RUG2 5FZKA 1UYZA 2WC2A 3U37A 2BNNA 3AP4A 3VDCA 2I07B 1WMXA 1W04A 3ES1A 4AEDA 1VIWB 2XUEA 2XLGA 4NO4A 1PO23 3WX5A 1AXKA 2FBEA 4EQVA 1CX1A 4LKDA 2O1QA 5DAVA 1WW7A 2XQRA 2FDJA 5DUXA 2Z4FA 3VKMA 3PTRB 3AM2A 2G9FA 1L7QA 5L73A 3O7OA 5A3WA 4BMBA 3E1F1 5IYYA 1ND3A 2PQSA 2VMCA 1DYKA 4QQHA 1CESA 3LEIA 4CCDA 1RB8G 1DIWA 4EWEA 3OEBA 3FZ3A 3OGRA 3LFMA 4P9XA 2DU0A 3OY8A 4XUNA 3WDTA 1AF9A 3MV01 4GWIA 4N43C 1D4VB 4QHZA 4XQWA 2WS91 3VBOB 4DINB 3KT1A 5BNOC 1WLDA 3VHRA 4MADA 2R1BA 1CVNA 1S2KA 2H0VA 3MGUA 3ZFGB 1KFUL 1CJDA 4DIQA 1NCQB 1AR92 3P3NA 3T2OA 1RUC3 3NQHA 3EXUA 5JOWA 4BXSV 1VBA1 2WL1A 2XKOA 1BBT1 3RSJA 4OHYA 4QPIA 1YRZA 4CDXC 3NJYA 4LOTA 1LEMA 5FZ1A 5BUVA 4B1LA 5F9TA 1RUG3 2E7TA 2DVDA 3LCPA 4A7KA 4YARA 1WA4A 4XJAA 2EAKA 5LCWL 2BPA2 4D7SA 1H4HA 5A1LA 3MI8A 4AHWA 1MZ5A 1JBCA 1REDA 1IPSA 4Z2WA 5JSRA 1EPWA 1KXGA 2Y33A 1PVC3 1YFXA 1LECA 2DCZA 3DV8A 4L97A 4AVBA 3ETQA 4JVAA 4Z1VA 4WM8C 4I30A 1SPPA 1UWWA 4ZZ5A 4HOOA 1QXRA 2XHNA 5IVYA 4Q1RA 4YYOA 4OQ8A 1OQ1A 5C4WC 2B4KA 1DHKB 1BKZA 2J1SA 2HWF2 5J7MA 2HYKA 2QVSB 4PIZA 1OBNA 4KWKA 3MYXA 5FDBA 5AFEA 2BFUS 1SEFA 2FCTA 2YDEA 2LS6A 3B9IA 3UT0A 2RMU2 3A4UA 1RHI1 1YIPA 2WBKA 3RI8A 1MS9A 5LRRA 4XDPA 4LBMA 1O8SA 1V6KA 4XW3A 2VZOA 4COUA 1OOPB 1O7FA 2LW8A 1CAXB 2LRPA 1HB4A 3TBDA 5HV4A 5I8TA 2ID4A 1LOFC 3ACGA 3MDPA 3QOPA 1AR93 1N1TA 4W4ZA 1H4GA 1IHMA 3BYWA 3HT2A 4JAAA 1V6IA 4RHV2 1QJX2 3U14A 2D6LX 4P9JA 2B7YA 5HV0A 3X29B 1URXA 2A6WA 4TYSA 2IVJA 1UY0A 3T2QA 3LKJA 5EJ1B 4CPBD 4GULA 3P6BA 5EQUA 1AXZA 1LGCA 1GOFA 3B02A 3IKWA 3DUIA 5T50A 1LOBA 4YSFA 1G9FA 3EB7A 3BCWA 1CIWA 3PIJA 3MLKA 3OBTA 1J3PA 3O5SA 2QDNA 1PMHX 1V6JA 2WSVA 4YGBA 2W1WA 3OB8A 2HWF3 2VM9A 2YMZA 3F2ZA 3UNPA 2XPJA 1Y9GA 1WWYA 3OBRA 3OF1A 3Q9OA 1UZ0A 3MICA 1D4M1 1W9TA 3IWZA 3N9PA 3DKWA 3NKGA 2RMU3 4LEJA 5JDBA 1SDDB 5L9VA 4KU8A 3ACFA 4CCLA 1S0JA 3J7LA 4TN7A 2JDPA 1TEIA 2A6VA 2F4LA 2AACA 2ZX0A 2DF7A 4H3WA 1UOBA 2R062 3LSDA 3QH6A 4P9IA 3ZIXA 1AL22 5C9AB 2YG0A 1C5HA 1QJX3 4FFHA 4RHV3 2B9VA 2P6HA 5T52A 3ZYJB 2XJPA 4Q4Y1 4GH4C 1IQDC 3HN3A 1W0PA 3POBA 4G9SB 4XQDA 2BFUL 1G86A 1W8NA 4P9LA 1CAXA 4QKNA 1NCRB 2AYHA 4XTMA 3RZMA 3CZUA 1RUD2 3PVNA 3PUHA 3FLPA 3ZOIA 3SEEA 1C8M1 3AKQA 1RVF1 2A71A 3RDIA 1LHUA 4LO6B 4Q8KA 5IK7A 4YZ3A 3FHQA 2WO1A 1ENXA 4R4ZA 4AE2A 3N7JA 5FY8A 4OVEA 1SACA 3ZYPA 4R8HA 3T0DA 4NPRA 4YW1A 4BQWA 5C3SA 4RQPC 3JQXA 1XXNA 3K77A 4FTEA 1WBLA 4DUXA 3HVDA 2QBXA 1X36A 2ZKNA 5CZKA 4B7KA 3B5LB 1OQDA 3EQEA 2W5FA 3NJZA 2VJXA 3MIGA 1M4WA 1ENQA 4LIUA 1KJLA 2EXHA 3PVBB 1KD7A 3VBUA 1PM7A 4YFZA 1H2NA 1E5RA 1X8EA 3PMSA 2X10A 3PL0A 3PVEA 2JIJA 2QQMA 2WABA 5E16A 3C7FA 3U11A 5C8WA 2R063 2DCYA 3TEZA 1ZA7A 4XMAA 5JR2A 1AL23 3HWJA 1PGW1 4XHXA 4O7XA 4CDQC 5CFDC 2SLIA 5C3OA 4QXCA 5JZGA 3WV6A 5KXDA 3LGRA 4Q4W1 1WCKA 3OPTA 5FZGA 4QPWA 2V72A 3AZZA 3PURA 2Y0IA 3THPA 2X8KA 3D5OA 1RUD3 4QPGC 4XF4A 2XVGA 5DUUA 5F39A 5B2GB 5HXMA 4Q27A 1TG7A 2FDIA 1C8NA 1VRH2 1YQ2A 2WNUB 4QKFA 5A3NA 5K8SA 1OXCA 2JG8C 4OLLA 3DYMA 4ARXA 1BEV1 3D8CA 5I0UA 4Q0UA 4RR3B 1NCRA 5H9RA 5A1AA 5HPOA 3T4VA 5J1XA 4COWA 2XQXA 3A0KA 1H2KA 5LEKA 2MHFA 4K3UA 3H8UA 5FY5A 1QJY2 3VBFB 4NIDA 5KXBA 3ECQA 4Y1YA 4ASKA 2C0ZA 3WP5A 1RUI2 5FJKA 1SMVA 1C1FA 3LPFA 4AQTA 1OT5A 1OH3A 3H8RA 3RVHA 2C26A 3TNQA 4CCCA 2NN8A 2BERA 4XIKA 3CZJA 3RWNA 1AYM3 1RMU1 2WNEA 4E8DA 3UK9A 3WHTA 4IEWA 3I2IA 4K1YA 4XJWA 1H1IA 3N36A 2GMEA 2PMWB 2GH2A 2IWGB 5JOXA 1PM4A 1O3QA 4ZXKA 3CNAA 4Y22B 2R16A 3BTYA 5FO8B 1VBE2 1RUOA 1NY71 4QT6A 1N1VA 4GMP3 1YJKA 2I2SA 3IPVA 4XUPA 4D7YA 4Q0QA 4DFSA 5C3RA 3BU0A 5E6HA 4INDA 5H9PA 3AXDA 5C5UA 1AR82 2BVBA 3POFA 3O1PA 1VRH3 4EZ4A 4BISA 2WDBA 2HWC1 4OUEA 5FREA 1W9YA 4AI9A 4QU1A 2DUOA 3ZKUA 4OI0A 5IATA 2WT0A 4LHSA 4XFHA 3PU8A 5EIYB 3FJSA 3WR0A 2W92A 3VV1A 1UZVA 5KHKA 1XOYA 5FTTC 5A6YA 4A4AA 1WZXA 2XBO2 3VBHB 2HWE1 1QJY3 5DQ0A 1JYTA 4A44A 2VZQA 1RUI3 1SFNA 1ULEA 1VBD2 3AL5A 4RR3A 1W9FA 2BTVC 3ZPOA 1YLLA 2BW8A 3N7MA 2Z2SB 4LBKA 3ZXKA 1L3JA 4J1XA 1AJOA 1SZBA 1O91A 5A3PA 2NMOA 5KXEA 4HN0A 1W6PB 2CWMA 3VBFA 5JUVA 4C1XA 4FPJA 1YCIA 1JU4A 1LOCA 4RS5B 2H0BA 3LDRA 1UPSA 3KV5A 3WCRA 4Y1ZA 5JWPA 2GH8A 2W39A 1J3QA 1VBE3 3NV2A 3MUZ1 4DXZA 2QUOA 3VHOA 5C3PA 5C70A 4RGKA 2PHLA 3OGVA 3U78A 2A3WA 2RR12 3WSOA 4N43B 1AR83 2XOMA 4OCTA 2CHHA 2NM1A 4OI4A 5FKCA 1CX4A 2ZGUA 3WQBA 3O1VA 2ZZQA 3WNNA 3TN91 4C0HA 1GZTA 5BNOB 2VNOA 5CEHA 5JXHA 4YLZA 4JC1A 1SLTA 2WZR1 1DP0A 3EYPA 2JKBA 1IZ3A 2ARXA 4CDXB 5FPXA 4NRQA 4YZ2A 1ST8A 1EV11 3QLQA 3AZYA 1FX5A 1MS8A 4JRLA 2Q8OA 4E4ZA 1I5PA 1NA1C 1W9SA 2AH2A 2OUJA 3GXUA 1AR72 3ON7A 1QXJA 4OHZA 1LOEA 5A7OA 1OURA 1Y43B 3WZ1A 1VBD3 2HLEA 2P3KA 1MS3A 2EIEA 2ADEA 3FFZA 5M0TA 3LDKA 3K75B 3LFIA 1F2NA 1UIKA 2H6CA 3ZXGA 2JD4A 4M01A 3I59B 4WM8B 1ODMA 3VBHA 4PI0A 4B4QA 1DGRA 2VOKA 4UW4A 2RJKA 5I0TA 3WG1A 1QMJA 2ZX3A 4LLFA 1LHNA 4WVMB 1G9BA 5C4WB 4LITA 2CTVA 1JN2P 2WA4A 4Y5TA 4IGOA 1XE8A 4M3CF 3ZFFC 1Q8OA 2R1DA 1C5IA 1DQ4A 3KLSA 4DS0A 1H8TC 4DUWA 3KHCA 2JIGA 5CKNA 1W6PA 2RR13 2WR9A 4ONUA 3UKTA 3USUB 2OX0A 4AEJA 4AFDA 3N4MA 1R092 4MX3A 3PDQA 4ES8A 2VZVA 2ZAAA 3LA2A 4YW3A 4HFSA 2ES3A 4DY3A 1EUTA 4O9GA 1LR5A 1GNHA 5AVPA 1MZFA 2WAAA 4LJHA 1RC6A 1BK1A 5K0UA 1W9WA 3RG0A 1J59A 1GQHA 4CXWA 2R071 4HK9A 5APAA 4YVSC 5JI9A 4UOJA 2UY8A 4R9DA 1W39A 2Y6FA 2E63A 2YYOA 1VMJA 2UWAA 3ZN4A 5IK8A 2C5DA 1RJ8A 5BNOA 1AR73 1POQA 1Q8SA 4LHNA 1DLLA 1AZDA 1CIYA 3K51A 4OULA 3VL8A 1N1SA 4CP2A 3LQCA 1LHWA 1XQNA 2OS2A 1AX1A 3M4FA 4IQPA 1OF3A 2GDFA 5JIAA 5FRAA 2ZHKA 1LODA 3M70A 4JRAA 5JR7B 4CDXA 4X6QB 4FAGA 4IEXA 1AXYA 1IOAA 2VTXJ 3OG2A 1GOHA 4FFIA 1LAJA 1MEC2 2DBIA 3GHMA 5LA2A 4AFMA 2CGPA 1F35A 2WT1A 5GALA 3WW1A 4CEWC 5LK7B 4S2DA 4QM8A 1ZBE2 1LHOA 2VULA 4Y1XA 4Z2AA 2AZ5A 5T5JA 5F5IA 4M0NA 4KL1A 4Q8LA 3LIGA 4EV0A 4K20A 5C71A 1AR62 4AFAA 3JD72 2VMGA 1UZZA 1V6OA 1YQCA 2YC0A 3LSEA 3BODA 2GZWA 3P1IA 2VOWA 4WM8A 3RZLA 1DU3D 3KB5A 4LORA 2Y6GA 3M7AA 1JZ6A 4WVMA 2HBUA 2J1TA 5A1FA 2Y6HA 1JYWA 3S6PA 4Z92B 2OZ6A 1TZOA 4RL7A 1R081 5EP9A 3NV4A 3T08A 2BQPA 5FZOB 4HPKB 2P6CA 5FY7A 3IMMA 4WV8A 2NLRA 1UYPA 5D2AA 3USUA 4GH4B 3VDDC 3M3OA 3PTYA 2ZX1A 2OW4A 3OEAA 2GP3A 4BM8A 1POV1 1QJU2 1UKGA 4CP0A 4BIFA 2BWAA 1B35C 4IE0A 1BQPA 1HXS2 1SBFA 1BLZA 1V6MA 2I74A 2WQZC 1GSLA 3PHMA 4UAPA 1XPWA 3J8F2 5IVVA 3H7YA 2C9KA 4LHLA 2J7MA 3KV9A 4Y20B 1MEC3 4CCNA 5FYUA 3IAQA 1C28A 1APNA 1WLTA 3NNJA 3U4XA 4MGYE 2EALA 3GZTB 2RV9A 1O3SA 1DGLA 4Q4X1 3MFCA 1GZCA 4EROA 1Q8PA 3CDZB 1O3RA 3KGLA 4XTPA 1AR63 1VBC2 2C6SA 4RQPB 4CDWA 4KQ7A 4CP9A 4KG8A 3JD73 2D5FA 3NKTA 2RS31 5LA1A 4Q0PA 2DTWA 4LTAA 2R0FA 2WO3A 3D0SA 3H0OA 4HL0A 2P5BA 5FYSA 1UX7A 3WOGA 1GQPA 4FP3A 3LEKA 4XFCA 2RS51 3SKVA 3T3YA 5ACA2 4AW7A 1Y7BA 2Q0AA 5FP9A 2VUAA 4QX3A 2K2SA 4CEYC 2W1SA 1LRHA 5KHHA 4CDQB 3G6JB 5CFDB 4XAEA 1QIQA 3MIBA 4KGGA 1TME2 1HQNA 3I4IA 1MR5A 1NYWA 3KGZA 5CBLA 4BA6A 2R041 1UYYA 1GP5A 2JKXA 1QJU3 3SH5A 1FT9A 1V0AA 4IE7A 4QPGB 2YY1A 5FZ7A 3DYOA 4FCAA 1HXS3 1ULPA 1GWMA 4HPKA 4AAPA 2LALA 3R05A 5H9QA 4DPNA 4D69A 1REFA 3J8F3 2B39A 2JG8B 1BVP1 5FV3A 1SCRA 2CAVA 4GH4A 1SFPA 2V5YA 4IEUA 4JGYA 4PQQA 3C2UA 4GB32 1EAH2 3VBRC 4AEMA 5F1RA 1AYN1 3RWKX 1VBC3 5HI0A 1OQEA 2GNMA 4K21A 3UYJA 4BH9A 4U36A 5FZ4A 2JJ6A 4R9AA 2QE3A 2PQQA 2WSUA 1NQJA 3E97A 1LHVA 3IM0A 4OYUA 1E5IA 4QQOA 1OVSA 4QWNA 1FMD2 4IV3C 4Y20A 3L2HA 4AVVA 3VUOA 4QHBA 3AX4A 3GHNA 1O4YA 4UF0B 3RYRA 5LY1A 3AP9A 4SBVA 3I2JA 5F3EA 2BWCA 4DO0A 1LKNA 4DB5A 1WCUA 3DL3A 1OLQA 1UMZA 3KT7A 4NHKA 4YNIA 4RQPA 4DQAA 5ACA3 1YO8A 3O1TA 4S2GA 3L2YA 3HR9A 1V6LA 5F2SA 2GC1A 1QJEA 3AYAA 3D3AA 1HQLA 3N9NA 4IGPA 5J98B 4L92A 4EZHA 1TME3 3NAPC 4PIXA 4QDRA 3H50A 2EIGA 3EHKA 3KT4A 2CSGA 3FBYA 2VUCA 1RIRA 3RMYA 3WDWA 1RITA 1X7NA 4BHPA 1N3QA 1W6QA 2AUYA 3NJVA 1GBGA 5C5TA 5CISA 1EY2A 4YM1A 1GKBA 3BUCA 5CFDA 5JOZA 3LOBA 1HJGA 1YIFA 2AENA 1K3IA 2B45X 1NE6A 2FMYA 4PDWC 3KCXA 5F3CA 5JSPA 1EPZA 4GB33 1EAH3 4H2AA 4UFIA 5T3NA 1OUSA 4BJ0A 2ERFA 2B42B 3AZXA 3LA7A 1F5JA 1XNBA 1E5HA 4AHZA 2ZMKA 3K2OA 3PUIA 5GZCA 1FMD3 3LEGA 1PO11 1PZ8A 3WW3A 2OQ6A 4IW3A 4META 5FPZA 1GICA 2ET1A 4P9GA 3ZDVA 2R32A 1ZZBA 2QQKA 3G7DA 1IS6A 3I54A 1JOJA 2VBDA 4QB1A 1HRI1 4I02A 1R1A2 3MW4A 4LO4B 1DF0A 4E8CA 3B3QE 1ODNA 3IAPA 4UW6A 4ZS3A 3M1HA 3OTFA 2BU9A 4Y26A 5EWSA 5HCAA 4JGZC 4I3PA 2PHFA 5AVAA 4DMIA 5FYHA 1JYIA 2EXIA 1XBFA 3ZXJA 2EA7A 3WDXA 4I2OA 5GLUA 1OA4A 3KSCA 4NMIA 4XJ9A 5LBCA 2Z69A 3WNPA 1H1AA 4Y1VA 2IXJA 1ZRCA 1KS4A 3AL6A 2WUHA 4ZS2A 2YFUA 1RUF2 4Y5Z0 4OMDA 1RXGA 3NSTA 1UY3A 1VRBA 4KWUA 4FOQA 5LY2A 2BNOA 3K3NA 1C3HA 5A3LA 4AZZA 2BGCA 5F6LB 1H6YA 3DN7A 1OKOA 4PLNA 1PX3A 1X82A 4LBQB 3CHXA 1GMMA 2VUJA 3OCPA 5J09A 3H3LA 4Q5OA 1NA1B 3VD4A 1RTVA 2IXCA 4AVCA 2WT2A 1YI7A 4H14A 5DG1A 4I0AA 2PAEA 3ZN6A 2ARAA 2X5IA 4YM0A 2E26A 3VDAA 1ZVFA 4R9BA 5IT6A 3N7LA 2D93A 2PHUA 2BEOA 1R1A3 1JOPA 3RI9A 1COV1 1X33A 3O0VA 3VZLA 4RGAA 5DPNA 5LW9A 1QWRA 3J26N 2O8OA 3SMHA 1LOAA 3ZFFB 1I3HA 4D3WA 2GU9A 2ZGPA 1BCXA 2G4IA 4CU6A 1UXZA 1V00A 2QCSB 1O59A 1Z7S2 3MBWA 1H8TB 1FOD2 1WBFA 5LRSA 3AC0A 4QX8A 5DDJ2 3NV3A 4XE9A 1F5FA 3URFA 1PVC2 3H7JA 2FHRA 2E51A 1UD1A 5FYYA 5FLJA 2PA7A 1GWLA 4LPLA 1RUF3 2A73B 2C1FA 5A33B 1YEWA 1S0GA 2HWB1 1KITA 2YGLA 2D6MA 2YGMA 4RS5C 1UQXA 4YVSB 1GQGA 2NQYA 3T1MA 3IDBB 1LB2A 5BNQA 2JENA 1ACCA 2OA2A 4IE6A 1QQP1 1VMFA 1HJFA 3KCCA 3INAA 1HRV1 1AVBA 3CJXA 3DECA 4FFGA 4QGLA 5CA6A 2QQVA 1ULFA 5C3QA 1JI6A 2K0GA 2WZEA 3ZN5A 4KWLA 3ZMNA 5LBEA 2JE9A 3IMNA 3AXEA 2VNRA 2WJSA 3Q8BA 3R6SA 4LBQA 1HW5A 2PAKA 4RN5A 2WFF2 3ASIA 1NA1A 2YU1A 4CEWB 5JCTA 3I2OA 4XFIA 3AMHA 4BQ4A 3OUIA 5DN2A 4B8EA 1VAVA 3Q8CA 1MS1A 1TNRA 3HEIA 5A7NA 4BDVB 3RS6A 5IJRA 1IPKA 3K48A 2VTFA 2E33A 1Z7S3 2NMNA 3POGA 1DQ6A 1FOD3 2RS11 5EFUA 5CG9A 2NZ9A 4B3NA 5DDJ3 2WS92 2Q1ZB 1XSQA 5IHRA 3A22A 1XRUA 2MPFA 3ZSEA 5J3UA 3NNFA 4XETA 2ZGQA 4EN8B 5ISLA 2GSYA 3ZFFA 1BBT2 2PLV1 2E9QA 2OXBA 3HD8B 3POSA 1NLRA 5FXWA 4F83A 1OA3A 1SLBA 3E5UA 3EBRA 5IVBA 1ZA4A 4I0WB 4XJ8A 5KHJA 5J37A 1TMF1 4MV2A 3H8XA 4D7TA 4ET7A 1W2TA 2OPWA 4HANA 4B7EA 3VDDB 4FPFA 4JDOA 1CAUB 2A3XA 2NPIA 2E32A 3WXPA 1CWPA 5FCCA 2CGOA 2CWSA 5EV7A 1CZSA 1SG3A 2VOVA 2WO7A 1UCXA 3BU7A 1B35B 2PN5A 2VMIA 2ETEA 4JTNA 4QB2A 4LOSA 5EJ3A 1JZ2A 2JE7A 4GAZA 3RZZA 2WFF3 1G7YA 4FPLA 1QJX1 4SLIA 3VD9A 3JBG1 3NVCA 4RYDA 2JDNA 3RQ0A 2N7GA 4CCJA 5KR7A 3B01A 1F9KA 4OQ9A 4MSVA 4MYEA 3VBOA 1QOOA 2QQLA 3QBQA 3H42B 4NJ4A 4AR2A 2VZPA 3UL2A 2FDKA 1C1LA 2Q8EA 3ZFGA 1RHI2 1NCQA 4I3GA 3LWCA 2WO2A 1A6CA 3RPQA 1UU6A 1GU3A 2PHTA 2WS93 4CEWA 3WNXA 3BGAA 2ARCA 4R52A 5A7QA 2CDPA 2IXKA 1ZYBA 2Y64A 4CZSA 2J42A 4AVTA 3LAGA 4AQ6A 1ZRFA 1BBT3 1OF4A 2WNOA 3FL7A 1QH7A 2YZ4A 4IEVA 4K7JA 3OOXA 4CEYB 4BQ5A 4D6QA 4ZHNA 2EAAA 1WGPA 4X8PA 1NUKA 4AYUA 3GYDA 3HOBA 1ZBA1 3TWIA 1A34A 2RVAA 2A3YA 3A23A 2BNMA 4MH0E 2VZSA 3RGBA 3J7MA 4FXKB 2FDHA 3SXWA 3KHBA 4DY5A 1JODA 3SEPA 4BE3A 4WZFA 4YM2A 4JX0A 4P02B 3H8OA 2J1UA 4IE4A 3ZSMA 1SLCA 4A3XA 2VNGA 4WM7C 1FAYA 1SQ4A 1VE0A 3A21A 4HZFA 4M4RA 5A70A 2GNBA 1CAUA 3PUSA 1GP6A 1NZCA 2DCKA 1VBB1 5F3IA 3VBRB 1B35A 2BOJA 2ZMLA 1OOPA 1QDCA 2JG9C 4LXLA 2XJTA 1D4M2 1RUE1 1UN1A 3C7GA 3ZR6A 4CVUA 4UFHA 1RHI3 2AREA 2WWSA 1GZWB 2OVUA 3DXTA 2W1UA 4GQ7A 4DOUA 3RZKA 1JZ4A 4XFFA 4IV3B 4CDUC 2RG4A 2J1AA 2YUEA 3Q8FA 1DBNA 3I2FA 4DRRA 4DRVA 1JZ3A 3ZM8A 2VAUA 4ZXEA 5B4XA 2ZGKA 4KWJA 2D7FA 4XURA 2FQPA 2GAUA 3SQOA 1IS5A 2RM21 4MZUA 1PIV1 4Q4Y2 4FFFA 4Q1PA 2PHWA 4Y1UA 4QX1A 1Y3TA 1W0OA 2YPDA 3NAPB 3OBZA 5DUWA 2D6OX 4DEQA 1H0BA 1NXD1 3B9CA 4PBOA 2DFBA 1RVF2 3I3BA 2VD7A 3CMGA 4OUMA 5GZDA 4E4SA 2VW1A 4MXWB 2ZHNA 5LB6A 2XH6A 3FN9A 4CEYA 4IEQA 2ZGRA 1PGL1 1OD5A 1VB2A 3WHUA 3KV6A 1AYM2 1NZIA 2DVFA 2VMEA 1DZQA 2ZJCA 2BGPA 2D6NA 4PDWB 1CAVB 1OVPA 2FCVA 2J1EA 3KVAA 5FUNA 2BRTA 1YFWA 2VXRA 2Y26A 3ENRA 4YW7A 1RUH1 2D3RA 1O5LA 1YQ5A 3VBSC 2FZ1A 4AI0A 1J58A 1D4M3 4YG3A 5A6ZA 1IS4A 3LIHA 4I09A 5L7OC 4LUKA 3C3VA 1PK6C 4TXWA 3ORJA 4BQ2A 5C9AA 4L11A 4A41A 1W6NB 3AMMA 3VDBA 4XFAA 3M8LA 4ISQA 3MIHA 4W6YA 5T5OA 5L19A 2VZ1A 4IEPA 3VBRA 3N7KA 1TE1B 3MUY1 3NRUA 5BYNA 3FE5A 1PGW2 3AMNA 4PLMA 2PXJA 1BHGA 1JTZX 5JOYA 1GZWA 3OPWA 4Q4Y3 1MS5A 2FCUA 2W9XA 4IV3A 4Q4W2 4XCBA 4XCAA 2EXKA 1MPXA 4C90A 1W8UA 2DU1A 2ZEYA 4JGZB 4MHRA 2JICA 2ZX4A 4FO9A 4PJYA 4NHYA 5D8AC 1U5ZA 1C8M3 3O12A 1RVF3 1W05A 4N90A 2YU2A 2AR6A 5JI7A 5IFTA 4LT5A 5KC5A 4XUOA 4FBFA 2W0XA 4ZONA 5C7GA 1BEV2 2YBPA 3DCQA 2OUHA 4PI2A 5LA9A 4QKDA 1A8DA 1Q3EA 1W6OB 3KQ4B 4XBNA 4XDQA 5ANNA 5BV6A 4M3CE 2VXJA 4BZ4A 4YW5A 1KGYA 4K1ZA 4NHMA 4ZU5A 4MXWA 2ZCWA 1VBE1 3ZYGA 5FQ0B 5FP7A 3B00A 4B1MA 3BKZA 3VLBB 5KXCA 3ACIA 1ASJ1 2R7EB 4AAXA 1IG0A 1BZWA 4Q0SA 5EHDA 1ULCA 3NWKA 1CAWB 4M3CB 5DZEA 5FZ0A 1CAVA 5FYZA 4HVQA 3WW2A 4NHLA 5BY5A 1XYPA 4GMP0 4W65A 4YRDA 1RMU2 3DEMA 3T0BA 2W91A 5LZ6A 2PELA 3LPGA 4CUCA 3T1LA 1SHWB 3OJBA 3S7EA 3WP3A 1QU0A 4Q4W3 1UAIA 2WNUA 2XBO1 3ACHA 5FUIA 3VKFC 4CRQA 3ZIWA 1DFQA 4Z07A 2WZ8A 3M2MA 1NY72 1PHMA 1LU1A 4KMQA 5CKMA 1SLLA 2R30A 1C57A 3O1OA 5FYBA 3OSDA 4COVA 1IG3A 5EXOA 4EYUA 3MZHA 4P9WA 1BEV3 1VAKA 4W6XA 1VALA 3WF3A 4QMAA 4JGZA 4URAA 1DQ1A 2VU9A 3IIIA 4COZA 4XF1A 4AGGA 5FYMA 1MQTC 1W8FA 3H3ZA 2HWE2 4OFGA 5FWJA 4XJZA 2Z79A 5FZIA 2WA3A 2YFZA 4HVRA 3CLPA 5I8YA 2WKKA 1I6XA 2IXIA 2JWPA 3OBAA 5KC6A 2VVDA 2W95A 3VD5A 1OC1A 4BOWA 1YJLA 1RUJ1 3WF1A 2D3SA 4QB6A 2J22A 2Q5TA 2F4PA 3FC0A 3N3HA 4Y22A 1RMU3 2D40A 1LCLA 1Y4WA 3M3QA 5FQ0A 1W8WA 2XJVA 2YBSA 1RINA 1U5IA 3SCFA 1G9AA 2HWD1 1T2XA 1UO9A 5DAPA 2E7AA 4QQ2A 4XILA 4M3CA 1CAWA 5E1RA 1CD3G 3VZJA 1STMA 3NW4A 4OHXA 5FPUA 5FZCA 3OGSA 4ZKTB 3B93A 4UFKA 3FBMA 4HVOA 3V65A 2RDSA 3OUJA 3B7MA 2Y6KA 4P14A 2GC0A 4NVPA 1P8JA 5FFOC 1W3VA 2VQTA 2HWC3 1MS0A 1OSGA 3TN92 4AL9A 4ASMB 4IEYA 1T6GC 3VKNA 1JYVA 1S0CA 5AC91 3AVSA 5FZMA 1OMIA 5CFCC 2BJSA 1UOJA 3ZMOA 5FPLA 3ZPYA 3EJKA 1EV12 5EZWA 2VBPA 1YUDA 5CYYA 1HB1A 2LM3A 3ZSLA 2HWE3 2VBBA 4IL7A 3ILFA 2BP6A 3POEA 4YGDA 4Q26A 4ASLA 1OFSA 1VJ2A 4CCOA 4C8DA 1MZ6A 1R64A 1SLAA 1R091 3ME2A 5FLIA 1W8HA 3R0RA 3GBWA 1H2MA 4CU8A 1N47A 2ZAHA 4RS5A 1M06G 1DG6A 2EF6A 4Q0VA 3WF0A 4JHZA 1SBEA 3OUHA 3ZXFA 5C6CA 3THDA 1US2A 4A3ZA 3ZYRA 3LDBA 2WN3A 1OPMA 1D0HA 1UIJA 2R0HA 4NWWA 4N43A 5ANQA 3SH3A 3RYKA 4CCEA 5FPBA 3VKOA 3KF5A 4NE9A 4CYDA 1GUIA 5GZFA 1JUIA 3PNAA 5JXJA 4NPMA 3ZSKA 4RGGA 4G3YC 2KXLA 3KWVA 4BIOA 4N7IA 3M3CA 4FVVA 4FPEA 2HEYF 4UFLA 1X50A 4FP2A 2UURA 3TN93 5HXVA 4CUBA 4B29A 3V0BB 2VMFA 1OLME 1Q8VA 1WW5A 4FOVA 4S2FA 3GZAA 2VOXA 2WZR3 3ZXAC 2DTYA 1ZBE1 2WFPA 3N9MA 4P08A 5F5CA 3C8XA 2R072 5FZAA 5IK5A 3JQWA 1ZZ9A 5FPAA 4FTSA 1EV13 4GA9A 4H7MA 4IESA 2WAOA 2OT7A 3W20A 1HV0A 1G8WA 1MS4A 1GYKA 4AG4A 3I59A 4HN1A 4ATFA 5L36A 1H2LA 3NJXA 3I3QA 1NT0A 4AI1A 2IZWA 4GALA 1TVGA 1R1ZA 2GP5A 3PJQA 5C4WA 2QQNA 3AVRA 4E9KA 2OPKA 2VUDA 2ZGNA 4WM7B 3TEWA 2I45A 1LGNA 4C1WA 3P5BA 1PVXA 1F15A 3ZKYA 2VCCA 1H6XA 1V9U1 4E2SA 4L0PA 1WUVA 3I2HA 5EYXA 2WWUA 2XGXA 3R4DB 2ILMA 2JG9B 2JDKA 1ALYA 1WD3A 3ILRA 4LKSA 4LIVA 1LOFA 3I2KA 2AEZA 3E5QA 1F4AA 2VE1A 4NIHA 4HONA 4UBGA 1JYNA 2E6VA 4CDUB 5IW0A 4YG0A 3VHNA 1MZEA 2ARBA 5FBZA 3GZEA 1HDKA 1F31A 1R082 5IUQA 2MEV1 3GJAA 2R073 2P1BA 4KU7A 3EO6A 4IE5A 4NIIA 3ZDSA 5F37A 1ZRRA 4AQSA 2KD7A 1YFUA 1KS5A 5E89A 2XR4A 4CSWA 3T2PA 2XXZA 4NRPA 4JKLA 2IFRA 1N1YA 5A3OA 4YFWA 3SISA 2HEWF 3BTAA 2QQUA 3AZVA 5BXXA 4PCRA 3SHRA 4CUAA 4YZ1A 4AQ2A 2VGDA 4QDSA 4NR1A 4L2NA 4PF1A 2XHKA 3V56A 1J84A 4NRMA 3WCSA 1QY4A 1VMHA 2IC1A 1YQ6A 4Q4X2 5FMCA 4PF5A 3MLLA 3ZFEC 3V0AB 1OLMA 5FR3A 4N53C 3UGHA 1YQ8A 3N35A 3RZGA 1JUHA 1S1AA 1S0BA 2DUQA 1XU1A 4MGTA 1XNDA 3KF3A 1SBDA 3VBSB 4QU2A 3DPRB 4WM7A 2RS32 2Y0OA 1MVQA 4H7LA 1UZYA 5L7OB 3HQUA 2E31A 3EMRA 1PK6B 2ZEZA 3MF9A 4OMCA 3CBNA 5FZOA 2B8MA 4GJYA 4BQXA 2BZDA 1D7PM 4KBBA 4PLOA 4UYBA 3W9AA 1NLSA 2XJSA 3AKSA 1DQ2A 3FX3A 1YFYA 4V1PA 4LE3A 2RS52 3M3IA 5GKAC 3W59A 1QKQA 1R083 5DXDA 3HAGA 1HKDA 2OQ7A 2JG9A 3NMBA 3UGFA 1FPN1 1LNSA 4NN0A 4UFJA 3VBUC 2QZ3A 1BMV1 2UYBA 1QEXA 2VH9A 4GWNA 4LQRA 3WDVA 3ABZA 3LB9A 3S7IA 1S0DA 3WT3A 4CDUA 1I1EA 2QQWA 2JEMA 4QAWA 4QXBA 4HKWA 4XVHA 2R042 5FUPA 1POV3 1W99A 5FZDA 5A7PA 5T55A 5JZGC 3KS7A 5FLHA 1W90A 4RA0A 2G1MA 5D8AB 2FD8A 5FMDA 1W6MB 3D4KA 4XYXA 4Y4YA 5LASA 1OPOA 5FYTA 3H1WA 1A3KA 4L99A 2DVGA 4QXHA 3U0ZA 4UI9L 3ACLA 2WNVC 4Q4X3 4AVAA 4JCKA 1X9PA 3UKNA 2W46A 2CV6A 1AYN2 5FZFA 5A32B 1UOFA 2YC2A 4HSLA 1O6UA 5GLTA 3R4UA 2RS33 2WRAA 1JOBA 4LHKA 4ATEA 1AX2A 4LUMA 4NROA 1BXHA 4M0HA 3V0AA 2A6YA 4NAOA 4CDQA 3O0WA 5GZGA 5IVFA 4XPVA 2RS53 3IBMA 2JDZA 4GWJA 4MGSA 3RZHA 2WINB 2ZTNA 5BNNC 3W5MA 2ZGMA 3J9SA 3USSA 2QQPA 4MGZE 5L7OA 1KRIA 3CKHA 4QPGA 2DV9A 3QCWA 5FBJA 1DYOA 1PK6A 3T30A 3B69A 2DCTA 1ZX5A 3O1SA 1S55A 1SFYA 2DFCA 5FMOS 2DDUA 4YWAA 2Y6LA 5LA0A 2R043 1IPJA 3A7QA 1J1TA 2JG8A 3HT1A 4HETA 1DZRA 4YZ4A 2LUWA 2AGSA 4Q4V1 1REEA 3NNGA 5FOBB 4FPCA 2BDRA 4XZUG 1XE0A 2VZRA 4P5YA 1PNGA 5BNPC 1K45A 5FWEA 2LROA 5C8CB 1UY2A 4ORFA 3PIGA 4P9YA 3WQ0A 4EWDA 5I0SA 1W2OA 1DLCA 3VGIA 1Q56A 2EIDA 5FJHA 1HQWA 5D8AA 1AYN3 2O14A 1NOVA 4HLTA 3WNMA 4QXKA 4ZU7A 1MQTB 1W6MA 5CADA 2EICA 4UF0A 1XNTA 2WYSA 3WINE 2FMDA 1QH6A 4PQ9A 1GV9A 4O61A 1PO21 3MF6A 1PO12 5IVCA 5FZLA 4LR4A 4AFBA 1RUF1 1PMIA 4NOTA 3S0MA 4FTBA 5DAWA 3P3PA 1HRI2 1UMIA 4QQLA 2DWRA 2H6BA 3BPSA 4R4XA 3S30A 4BWOA 3OPZA 2ZEXA 4QDQA 2D97A 4FPOB 4O65A 2DVBA 1QDOA 4XDOA 3RMXA 2Y8KA 3GDBA 2XJUA 4UFMA 4CPBA 2VNVA 4YGCA 1GNZA 3GNEA 4IGQA 1VPHA 5F32A 3MW3A 2C9AA 5HCFA 1SLIA 3OY8B 3I2DA 1RUC1 1ULGA 3HQXA 4JDMA 2CY6A 3ALQA 2GC2A 1K42A 3ROUA 5CFCB 4WVVA 1I9RA 1YNAA 4S2HA 4MHUA 2D98A 1D2QA 1GZ9A 3POIA 4TTGA 5FY1A 3E6DA 3SNMA 1RUG1 4EN7B 4YW6A 5FMOL 2P37A 1Z78A 2FZ2A 1UX6A 1W2UA 1PO13 3OD4A 3ST7A 1C4RA 1NG0A 1PVC1 3BVCA 1MVEA 2VOTA 3CO2A 4A7ZA 1PZ7A 1WCDJ 2DVAA 4PIYA 1MQTA 1HRI3 3WD5A 2VZUA 1COV2 2YROA 3LE0A 5SV5A 4IERA 5DG2A 1CONA 1PGSA 2W3JA 2VZ3A 4LMFA 5EJZB 1Q43A 2ZA9A 4LNVA 4URTA 4Y24A 5CVRA 4GIQA 4MO3M 2NYYA 3FWEA 3H9AA 4LBJA 5CNAA 4WVWA 3K3OA 4IETA 3AMPA 1H1MA 3AZWA 3C7HA 2YPJA 2XB6C 2Y34A 4U2AA 1XE7A 2IXHA 1F4HA 2C24A 4QX7A 4XMIA 1AR91 4MVTA 4OHVA 2W47A 2BBVA 3M3EA 2WFF1 5LK5A 3ZXEA 4KNCA 2HWB2 4LA3A 4LBLA 4BMEA 4E2QA 3ES4A 3CJIC 2XL7A 4XABA 4XBLA 2ET7A 2XDVA 5I8SA 1K5JA 3I97A 5IVJA 2QQJA 5FO7B 5K0UC 1OFNA 3NNMA 1D0GA 1QQP2 4PHZA 3BTZA 2VTXA 1HRV2 2VC9A 1JZ8A 1B09A 2GN7A 1CPMA 3POYA 4XIOA 2RDQA 1ZZ7A 3THCA 5CFCA 5JXGA 1WCSA 2R6QA 3ATGA 2VVFA 2MNGA 3C7EA 5H9SA 4AWDA 4NUBA 2A75A 3DKQA 4FT8A 4X6RB 1VBA2 1JMUB 1O4TA 2UWCA 2V73A 2AC1A 2YBKA 3FHAA 4BQ3A 2E53A 3U07A 1COV3 2HWF1 1H8TA 2QQOA 1KEXA 3N9QA 5F6KA 3VKLA 4JQTA 3PUAA 2RMU1 1UYXA 3DXUA 2RS12 1RUNA 1LOGA 3CF6E 3WNLA 4ISRA 2ZKLA 4OZXA 5FP8A 5A33A 4AI3A 2UU8A 3DYPA 1UKRA 2R49A 2RDRA 5FXZA 4LKFA 3RRDA 1WMDA 2X09A 2ZGLA 1H30A 3ITQA 2HJIA 4HG6B 4YVSA 1XU2A 1WKYA 4Y4RA 2X05A 3Q8AA 2V09A 1ND2C 5D21A 5JPMB 4Q29A 1QOTA 4RHV1 1HIXA 2HWB3 2JDHA 2PLV2 4GKXA 4DXRA 3ZSJA 5LATA 2RE9A 1HN1A 3GF6A 1TMF2 4A6OA 4AGRA 2VQ0A 4DEVA 4CU9A 4GJZA 2IXLA 1QQP3 1LU2A 3F95A 4KG0A 3RZJA 1HRV3 1SDWA 4EWAA 1WD4A 3JXSA 5JAXA 5A3UA 2JECA 3I3MA 3KZ4C 1UMHA 1ULOA 4AEKA 2WZPP 4MG2A 2GMPA 1VBA3 3IZOA 3PJYA 2CU5A 3FFQA 2OKXA 3JBG2 4JKKA 3BN6A 1J1LA 4XF9A 1XNCA 5F3GA 5I0RA 3ZFEB 2OYZA 2ZXQA 3E6CC 2BYVE 2AEYA 4N53B 5G04L 1S4CA 3V64A 1YYNA 3GJBA 2JDMA 1JZ7A 1ENRA 3AKPA 2RS13 4NHXA 2CYFA 2W94A 2D6KA 4IUGA 4CDWC 5FP3A 1RJ7A 2ZMNA 1UL9A 1J83A 2JDUA 3N9OA 3APBA 1QGLA 2R061 1UY1A 2VW0A 3MFAA 3LOIA 1AL21 4M4PA 5FP4A 3VDDA 4YM3A 2PLV3 4LLOA 4MGQA 1SCSA 3WF2A 3VBUB 1FNZA 3L9JT 1WMFA 2A6XA 2XLFA 1X8MA 3D82A 2WQ8A 5EPAA 1IQAA 1JS9A 1TMF3 1ZBA2 3K46A 5FY0A 5FOJB 3MO4A 3BB6A 4Y5SA 2VCMA 3ZYFA 1RUD1 1EP0A 3AYEA 3ETPA 5LBFA 3AKRA 2JX9A 3GALA 5EYYA 2P4EA 5JZGB 4XACA 5K9YA 3ZYHA 2FDFA 1I5ZA 4RD7A 1O5UA 1ONAA 3WY6A 1K5MC 4HK8A 5FY4A 3FLTA 3W5NA 3S5AA 1FYUA 3FHIB 1WW4A 2ZEWA 1QF3A 3CU7A 3VL9A 3WQ7A 2W1QA 3AJYA 3JBG3 1AJKA 4FOYA 2HEVF 3CIHA 2WNVB 1W03A 4LA2A 4HKOA 1BYHA 1VBB2 2IVIB 4B4PA 2BUKA 4ARYA 3VB9A 3SLIA 2LTNA 3QACA 5I93A 1RUE2 4JGYC 1UNBA 3AMQA 4KH9A 3QH7A 4HXCA 4JTOA 4D6RA 3RNSA 1DYPA 1C8M2 5L9RA 3WG4A 3GBGA 3ELNA 3IDEA 2A7AA 1XNAA 4XOGA 4D0QA 5G05L 1AUYA 1FATA 1YXWA 4O9EA 3ZFEA 1RGSA 2XWBB 4LBQD 1OUXA 1JXNA 1AYM1 1GNYA 4N53A 4UT5A 2ZZJA 2RDNA 4COYA 2VCBA 5BNNB 2RM22 2A1XA 2DCJA 1A78A 1KFXL 3S5QA 1PIV2 2GNDA 5T54A 2P34A 4ES9A 2Y38A 4TLGA 5SV8A 1QNWA 4BK5A 2EVXA 1ZBA3 4D6SA 1CPNA 3D6EA 3DPRC 1BK0A 4FPHA 5I0DA 1PNFA 4GMP1 4LULA 2ZBJA 1ZZ8A 4Z82A 3WF4A 5FYIA 3JU9A 1LEDA 5FPVA 4NWVA 1VRH1 1K12A 3I7DA 5IFPA 4GWMA 4AXOA 3O1MA 1CGPA 3HNYM 4GZ9A 3IPVB 1VR3A 3HNBM 2PHDA 4HSJA 1PGL2 1MACA 1W8ZA 3UESA 2XWJB 1H9PA 1QNYA 4LBNA 3HBZA 4L8QA 4DXSA 1HV1A 5BNPB 1L7RA 2RJLA 2CL2A 4D8MA 3KM5A 1ZZ6A 2L9LA 4I0BA 3W21A 3LA3A 1OA2A 1RUH2 1CZVA 1V70A 1VBB3 2G9GA 4QX2A 5CKQA 5JXIA 1WCQA 1QJY1 5GM0A 1RUE3 1WW6A 3FMGA 3TEYA 2VO5A 1RUI1 4MGIE 2ZHLA 4MGKE 3H1YA 1OLRA 5JLVA 4A42A 3SH4A 4UW5A 4IV1C 4AI2A 3AK0A 1TQ5A 2WNVA 3WEZA 1JU3A 1V6NA 3QD6A 4DXTA 1AHSA 2OIIA 2NP0A 2VG9A 2PHRA 5GZEA 3NAPA 3WUCA 1RL3A 5CB7A 2RM23 5ABJC 1W2NA 3O1RA 3MHZA 1PIV3 4XUTA 5CIRA 1PZ9A 3I8TA 3PVOA 2VY0A 1HB3A 4W50A 3SCHA 1NXMA 1XJAA 4FXGB 4QPYA 4YG6A 2VPVA 4A7YA 2G19A 4K6BA 4I01A 4RFRB 5T5PA 1NLQA 1NKGA 1LTEA 4A2UA 1AR81 1UY4A 3CL1A 5BNNA 4PDWA 3AFGA 2BVVA 4LE4A 3ZO0B 1UF2C 1GR3A 1ZZCA 4HMZA 1G9DA 3HBKA 1U0AA 1ZRIA 5FZ3A 5A6XA 2D44A 1NE4A 4GKYA 3AFKA 2O0OA 3ZLIA 4HT1T 4QHOA 2QQIA 5A7WB 2BBAA 1RUH3 5FZ8A 3U1XA 3BOWA 1W6NA 5FK7A 2OZJA 4QX5A 5DAXA 5FY9A 1VBD1 1ASJ2 5BNPA 2Z5WA 3BI3A 4YPJA 1G6NA 2HWC2 3ZXDA 4B4RA 4XFBA 5JPNB 2XLAA 1IS3A 5C8CC 5JIUA 2X5IC 2G9ZA 1US3A 1CZTA 2TBVA 4PBPA 4CCKA 4BB3A 3TEXA 4MUVA 4G4FA 3HQRA 4TWTA 3WLUA 5HBAA 4OI2A 2WIIB 1GWKA 1JH5A 2CNAA 5FIXA 3CQOA 4YVWC 1W3XA 3K4DA 5F5QA 2RR11 2JD9A 3C7OA 3KD4A 4RFT0 1W6OA 4HKLA 2X53S 4N9HA 4BCUA 4FPYA 2F6BA 5DZGA 1S0IA 1VP6A 3KVBA 1ENSA 2WLPA 3PLQA 1Z0HA 2W08A 1JW6A 4AEDC 2HYXA 3JB8A 3UV9A 3J7NA 4K8RB 1XB9A 4IDZA 1E5SA 1OD3A 3I3DA 4JQRA 2GN3A 4TLFA 5FZ6A 3CJIB 1GOGA 2GNTA 5FZ9A 3RJ2X 1BVVA 3VZMA 2HH9A 2E7QA 2BGOA 2ORXA 4IEZA 4L9BA 4XZPA 1WLWA 2J1RA 2VQUA 3UJOA 2IUWA 1ND3C 1NAEA 5JVVA 1AR71 5K0UB 3TB0A 1JYCA 1GP4A 5DABA 3DF0A 4D94A 3DGTA 1ASJ3 3FLRA 2KM2A 1RUJ2 1FI2A 4XF3A 1HX6A 3WNKA 2DYCA 5A7WA 4FAHA 1KQRA 3O1UA 1UZWA 1Q8QA 4OZOA 4W6WA 2C4XA 5FXVA 2O8QA 4Y33A 1YWKA 2WZR2 4JDNA 2WYFA 3MLJA 5GLVA 2XVLA 2ZPXA 2WN2A 3T0AA 3THTA 2HWD2 2QNKA 4BYYA 4N9IA 1XC6A 3GBFA 4AI8A 2XBO3 4QPIC 1KDKA 5FZHA 1IKQA 2QKDA 2CAUA 4NPLA 4CCMA 4QKBA 4EN6B 3FUOA 2W2IA 2JXAA 1UW8A 5DMYA 2JB4A 3MV11 3T09A 4Z8BA 3IDCB 1KDMA 4ZU4A 3PUQA 1UU5A 2ORZA 2XG3A 3IT8A 4E27A 5AC92 1A8MA 1ND2B 3NO8A 1O4ZA 1ZM1A 4LBOA 5FK8A 3H3UA 3KV4A 3U4SA 5IK4A 2ZHMA 3HIFA 1UOGA 2B9UA 1DGRN 1FXZA 2P3JA 2A6ZA 4IEOA 3SCGA 4CP1A 4E4HA 5JMCA 1CR7A 3IN9A 2P3IA 3RFRA 4QGMA 3PMEA 1F8VA 3PU3A 5BPXA 4BQ1A 4XXPA 4XEZA 2PFWA 2XJRA 1X9TA 1RUJ3 3UJQA 2CGNA 2J1VA 3CJIA 4UXAA 3IDAA 3MIFA 2VR4A 5GLZA 4AGVA 5KBFA 1MEC1 4X8NA 1NX9A 1OI6A 3OYWB 4LO5B 5AFBA 5FXXA 1Y9QA 4FQZA 5I91A 1YHFA 3POWA 1ZREA 2HWD3 2YB7A 2ZGOA 2YHJA 3JUUA 4XFGA 1LJ7A 4K8FA 4FPKA 5FZBA 3UGGA 1AR61 5IAVA 1Q5OA 2P17A 3FUQA 1L7LA 5F7UA 4XUQA 3S57A 3HPNA 2ENRA 3JD71 2SBAA 1YC61 2GC3A 3SC7X 3VBOC 4M00A 2GALA 4CDWB 4F3JA 4YW4A 3ZFGC 1W8OA 4CP9B 2ZACA 1O8PA 1NCQC 1W2AX 1VLNA 4XXAA 5B4NA 2D3PA 1D2SA 3I3EA 3WDYA 2D5HA 4XC9A 5FYVA 5AC93 1FV2A 5TSWA 4FOWA 5D1IA 5DUVA 1G9CA 3UKVA 4DNYA 5FZEA 3VHPA 4AHYA 3ZR5A 1AX0A 2VMHA 3TAYA 2VQAA 4K40A 1XYNA 1GANA 2W68A 5FAXA 4F8AA 4BLIA 3CEWA 3JCIA 3OGJA 4MXVA 3TOJA 3WNOA 1QJU1 5J48A 5LWBA 5A6QA 1EYBA 4KI5M 2WWJA 4R9CA 1BJQA 1DQ5A 1HXS1 1ND2A 4CUGA 4FQ4A 4QGNA 4EJRA 2X29A 4E4DX 1R093 5J36A 4EN0A 3BTXA 4NIGA 4Q2FA 3J8F1 3O14A 1IKPA 3KQRA 3ZVXA 4J1WA 3WP6A 3T4HB 1K5MB 3U10A 4ITCA 3U75A 1PMJX 1ZRDA 4HBNA 2XUMA 2A5ZA 1XYOA 3ILNA 4MOAA 4CA9A 1V9U2 1CJPA 2XJQA 5CG8A 4MLOA 2YV8A 2VECA 4P00B 5J96B 4K9SA 4XBQA 5K7PA 1VBC1 1QJZA 3BIWE 3NL1A 4YW2A 2TNFA 5FKBA 4BQYA 4GD4A 1HLCA 2JE8A 4UBHA 4JGYB 4QD2A 3VD3A 3WP4A 2JDAA 3V0BA 2V4AA 3OYWA 4E2GA 1OOPC 1EUUA 2Z42A 4H55A 4OI1A 5JMOA 3BIEA 1H9WA 2KA3A 4RSUA 2WLQA 3I49A 5ACA1 1DQ0A 4XF0A 4Y3OA 2VW2A 5T5LA 2MEV2 3LZZA 1ZBE3 2W87A 1LESA 1TNFA 5JSOA 4JV4A 3IB3A 3NV1A 5K4LA 1W8TA 1TME1 1S0FA 4XHBA 1N3OA 1H8VA 1RYYA 3SKJE 3TRSB 2EXJA 2DURA 3BOPA 3MIEA 5IWFA 4GXLA 4KBZA 1CQ9A 3ZXLA 4J6GA 2IFWA 1PX4A 2Q8CA 2VMDA 4OUSA 4BXFA 3HMYA 2UWBA 4V2VA 3N9LA 3AKTA 3T2TA 4WZCA 4FI9A 2XONA 1W6QB 4UWDA 4LO7A 2P2KA 2UYAA 1V9U3 1HB2A 4J25A 4GB31 1EAH1 2DUPA 1JYXA 1W0NA 4FPGA 3HNMA 2P3YA 1S0EA 4BPZA 3MIDA 1WA6X 4PT6A 1XSRA 2Q30A 2Q4SA 1KJRA 1S2EA 3JZVA 3MPPG 5HCBA 5A3TA 1K5MA 1FMD1 3JB4C 3E5XA 5GLWA 5CU1A 2ZS6B 5KWRA 2FDGA 4AVSA 2ZOEB 3MEPA 4IV1B 3AJZA 2ZGSA 4DZGA 4DUVA 1POV0 4AHXA 1OH4A 3ZYBA 5C9AC 4CXYA 2MEV3 1FPN2 1HN0A 2XKPA 4JKMA 3KCYA 5FMBA 1BMV2 5ABJB 2QDRA 1JZ5A 3BPZA 4XAAA 3R4SA 2QJVA 1VB4A 1NCRC 2B5HA 4WVZA 1QJFA 3GZUC 2Y60A 4C0BA 1DGWX 2Q1MA 2ATFA 4KGQA 2ZX2A 3B94A 3WUDA 1O3TA 1YI9A 3VD7A 3LF7A 1J3RA 3Q8EA 4XQ4A 1LENA 4WBBA 1DDLA 4EE2A 1ZNPA 2WQ4A 2XVKA 3VZOA 5FYCA 1U5YA 1WLCA 2BV4A 2QFEA 2PYTA 3GCWA 1QXPA 3AP6A 1S2BA 1WMEA 4AK3A 3VBSA 2W52A 4V2WA 3WDUA 3H1MA 2JB8A 3W58A 3DPRA 5IVEA 1T6BX 1FV3A 3HN1A 4NIAA 1DZTA 1JHJA 3LD8A 1JHNA 2EIBA 1XNKA 3AYDA 4YZ5A 2V4VA 1QOSA 2CDOA 2ZGTA 5E88A 3ZYIB 4F7ZA 2XL9A 4BU2A 1FNYA 3RYPA 3AYCA 4CXXA 3UETA 1NQDA 2YC4A 3BALA 3ZX7A 2HBTA 1GLHA 3ZN6B 5E8AA 5FO9B 2RHPA 1R1A1 1FPN3 2X5IB 3AP7A 1UPIA 2VVEA 1Y9MA 3J4UH 3GCXA 3A0NA 3O0XA 2F17A 5CAZA 5F2WA 4LK7A 3WG3A 2K9ZA 4QX0A 3GGLA
chains in the Genus database with same CATH topology
3IIAA 4IV1A 4QM9A 3KMHA 4CTEA 4YVWB 2WNUC 1LGBA 4Q4V2 5ABJA 1E57A 4YGEA 4RR3C 4AEDB 5A32A 1U5XA 4AF9A 4LO8A 2YXSA 3OD0A 2PHXA 3VN4A 2ZABA 4P5HA 2A70A 1VAMA 3VZKA 3WQ1A 3MW2A 3TNPB 3VBFC 5GJ6A 3VZNA 2D43A 4TZDA 2QZ2A 2TEPA 2PAMA 1ND3B 1U12A 4C91A 2UY9A 3AB0A 1PO22 1AL0G 3RJRA 5A3MA 2HKXA 3WG2A 1LULA 3OGGA 2D6PA 3AP5A 4UW3A 4EN9B 3D0JA 1N3PA 4OHWA 4AFCA 3WVJA 2GMMA 4QQPA 3MPBA 2TUNA 5KHIA 1DGWA 1QHDA 1OHFA 1UU4A 4QPIB 1Z7S1 1FOD1 1CN1A 5C33A 4N7UA 5DDJ1 5C8CA 3WW4A 5LEJA 3E6BA 4Q4V3 1IGOA 1OKQA 1GFF2 3TYJA 2B46X 1RUC2 2PTMA 4BLJA 4FSJA 4XJUA 5KHGA 4TSVA 4YVWA 1ULDA 3SITA 4IXLA 3VBHC 5DZFA 1RUG2 2WC2A 2BNNA 3AP4A 2I07B 3ES1A 4AEDA 1VIWB 2XLGA 4NO4A 1PO23 3WX5A 1AXKA 2FBEA 2O1QA 1WW7A 5DUXA 3VKMA 3AM2A 2G9FA 5L73A 3O7OA 4BMBA 1ND3A 1DYKA 4QQHA 1CESA 1RB8G 1DIWA 4EWEA 3FZ3A 4P9XA 2DU0A 3OY8A 3WDTA 1AF9A 4N43C 1D4VB 4XQWA 2WS91 3VBOB 4DINB 3KT1A 5BNOC 1WLDA 3VHRA 2R1BA 1CVNA 1S2KA 2H0VA 3MGUA 3ZFGB 1KFUL 1CJDA 1NCQB 1AR92 3P3NA 1RUC3 3EXUA 5JOWA 1VBA1 2WL1A 2XKOA 1BBT1 3RSJA 4OHYA 4QPIA 1YRZA 4CDXC 1LEMA 5BUVA 5F9TA 1RUG3 2E7TA 2DVDA 3LCPA 4A7KA 4YARA 1WA4A 4XJAA 2EAKA 2BPA2 4D7SA 1H4HA 3MI8A 4AHWA 1MZ5A 1JBCA 1REDA 4Z2WA 5JSRA 1EPWA 1KXGA 1PVC3 1YFXA 1LECA 2DCZA 3DV8A 4L97A 4AVBA 3ETQA 4JVAA 4Z1VA 4WM8C 4I30A 1QXRA 4YYOA 4Q1RA 1OQ1A 5C4WC 1DHKB 1BKZA 2HWF2 5J7MA 2HYKA 2QVSB 4PIZA 4KWKA 3MYXA 5FDBA 5AFEA 2BFUS 1SEFA 2YDEA 3B9IA 2RMU2 3A4UA 1RHI1 1YIPA 3RI8A 1MS9A 5LRRA 4LBMA 1V6KA 4XW3A 4COUA 1OOPB 1O7FA 1CAXB 3TBDA 5I8TA 1LOFC 3MDPA 3QOPA 1AR93 1N1TA 1H4GA 1IHMA 3HT2A 4JAAA 1V6IA 4RHV2 1QJX2 2D6LX 4P9JA 2B7YA 3X29B 1URXA 2A6WA 3LKJA 4GULA 1AXZA 1LGCA 3IKWA 3B02A 3DUIA 5T50A 1LOBA 4YSFA 1G9FA 3BCWA 1CIWA 3MLKA 3OBTA 1J3PA 3O5SA 2QDNA 1V6JA 2WSVA 4YGBA 2HWF3 2YMZA 2XPJA 3OBRA 3OF1A 3Q9OA 4TYSA 3MICA 1D4M1 3IWZA 3NKGA 3DKWA 4LEJA 2RMU3 5JDBA 4KU8A 1S0JA 1TEIA 2A6VA 2ZX0A 2DF7A 4H3WA 2R062 3LSDA 3QH6A 4P9IA 3ZIXA 1AL22 5C9AB 4RHV3 1C5HA 1QJX3 5T52A 3ZYJB 2XJPA 4Q4Y1 4GH4C 1W0PA 4G9SB 4XQDA 2BFUL 1G86A 4P9LA 1CAXA 1NCRB 2AYHA 4XTMA 1RUD2 3PVNA 3FLPA 1C8M1 3AKQA 1RVF1 2A71A 3RDIA 1LHUA 4LO6B 4Q8KA 5IK7A 4YZ3A 4AE2A 1ENXA 4R4ZA 3N7JA 4OVEA 1SACA 3ZYPA 4R8HA 4NPRA 4YW1A 4RQPC 3JQXA 1XXNA 4FTEA 1WBLA 1X36A 2ZKNA 4B7KA 3B5LB 1OQDA 3EQEA 3NJZA 3MIGA 1M4WA 1ENQA 1KJLA 2EXHA 3PVBB 1KD7A 3VBUA 1PM7A 4YFZA 1H2NA 1X8EA 3PMSA 3PVEA 5E16A 5C6CA 5C8WA 3U11A 2R063 2DCYA 4XMAA 1AL23 3HWJA 1PGW1 4XHXA 4CDQC 5CFDC 2SLIA 5JZGA 3WV6A 5KXDA 3LGRA 4Q4W1 1WCKA 3AZZA 2Y0IA 3THPA 2X8KA 3D5OA 1RUD3 4QPGC 4XF4A 2XVGA 5DUUA 5B2GB 4Q27A 1C8NA 1VRH2 2WNUB 5K8SA 2JG8C 4OLLA 1BEV1 3D8CA 5I0UA 4Q0UA 4RR3B 1NCRA 5H9RA 4COWA 3A0KA 1H2KA 5LEKA 2MHFA 4K3UA 3H8UA 1QJY2 3VBFB 5KXBA 3ECQA 4Y1YA 2C0ZA 3WP5A 1RUI2 1SMVA 1C1FA 4AQTA 3TNQA 2NN8A 4XIKA 3RWNA 1AYM3 1RMU1 2WNEA 3UK9A 3WHTA 4IEWA 4K1YA 4XJWA 1H1IA 3N36A 2GMEA 2GH2A 2IWGB 5JOXA 1O3QA 4ZXKA 3CNAA 4Y22B 2R16A 5FO8B 1VBE2 1RUOA 1NY71 4QT6A 1N1VA 4GMP3 1YJKA 2I2SA 3IPVA 4D7YA 4DFSA 4Q0QA 4INDA 5H9PA 3AXDA 1AR82 2BVBA 1VRH3 2HWC1 5FREA 2DUOA 4OI0A 2WT0A 4XFHA 3FJSA 3WR0A 3VV1A 5KHKA 5FTTC 2XBO2 3VBHB 2HWE1 1QJY3 1RUI3 1SFNA 1ULEA 1VBD2 4RR3A 2BTVC 1YLLA 2BW8A 3N7MA 2Z2SB 4LBKA 3ZXKA 1L3JA 4J1XA 1AJOA 1O91A 5KXEA 2NMOA 4HN0A 1W6PB 2CWMA 3VBFA 4C1XA 4FPJA 1YCIA 1LOCA 4RS5B 2H0BA 1UPSA 3WCRA 4Y1ZA 5JWPA 2GH8A 2W39A 1J3QA 1VBE3 3NV2A 4DXZA 2QUOA 3VHOA 2PHLA 2A3WA 2RR12 4N43B 1AR83 2NM1A 4OI4A 1CX4A 2ZGUA 2ZZQA 3TN91 4C0HA 5BNOB 2VNOA 4YLZA 4JC1A 1SLTA 2WZR1 2JKBA 1IZ3A 2ARXA 4CDXB 5FPXA 4YZ2A 1EV11 3QLQA 3AZYA 1FX5A 1MS8A 4JRLA 2Q8OA 4E4ZA 1NA1C 2AH2A 2OUJA 1AR72 1QXJA 4OHZA 1LOEA 1Y43B 3WZ1A 1VBD3 2P3KA 1MS3A 3FFZA 1F2NA 1UIKA 2H6CA 3ZXGA 2JD4A 4M01A 3I59B 4WM8B 3VBHA 4B4QA 1DGRA 2VOKA 4UW4A 2RJKA 5I0TA 3WG1A 1QMJA 2ZX3A 4LLFA 1LHNA 4WVMB 1G9BA 5C4WB 2CTVA 1JN2P 2WA4A 3ZFFC 1XE8A 4M3CF 1Q8OA 2R1DA 1C5IA 1DQ4A 3KLSA 4DS0A 1H8TC 1W6PA 2RR13 4ONUA 3UKTA 4AEJA 3USUB 4AFDA 3N4MA 1R092 4MX3A 4ES8A 2ZAAA 4YW3A 3LA2A 4HFSA 2ES3A 4DY3A 4O9GA 1LR5A 1GNHA 5AVPA 1MZFA 1RC6A 1BK1A 5K0UA 3RG0A 1J59A 1GQHA 2R071 4HK9A 4YVSC 5JI9A 2UY8A 4R9DA 1W39A 2YYOA 2E63A 2UWAA 3ZN4A 5IK8A 2C5DA 1RJ8A 5BNOA 1AR73 1Q8SA 4LHNA 1DLLA 1AZDA 3K51A 4OULA 3VL8A 4CP2A 1N1SA 1LHWA 1XQNA 3M4FA 1AX1A 4IQPA 2GDFA 5JIAA 5FRAA 2ZHKA 1LODA 3M70A 4JRAA 5JR7B 4CDXA 4X6QB 4FAGA 4IEXA 1AXYA 1IOAA 1MEC2 3GHMA 4AFMA 2CGPA 5GALA 2WT1A 3WW1A 4CEWC 5LK7B 4S2DA 4QM8A 1ZBE2 1LHOA 2VULA 4Y1XA 2AZ5A 5T5JA 4M0NA 4KL1A 4Q8LA 4EV0A 1AR62 4K20A 4AFAA 3JD72 2VMGA 1UZZA 1V6OA 2YC0A 3LSEA 3BODA 2GZWA 4WM8A 2VOWA 1DU3D 3KB5A 3M7AA 4WVMA 3S6PA 4Z92B 2OZ6A 4RL7A 1R081 3NV4A 2BQPA 4HPKB 4WV8A 2NLRA 3USUA 4GH4B 3VDDC 3M3OA 3PTYA 2ZX1A 2OW4A 4BM8A 1POV1 1QJU2 1UKGA 4CP0A 4BIFA 2BWAA 1B35C 1BQPA 1HXS2 1SBFA 2WQZC 1V6MA 2I74A 3PHMA 1GSLA 3J8F2 3H7YA 4LHLA 4Y20B 1MEC3 1C28A 1APNA 1WLTA 3U4XA 4MGYE 2EALA 3GZTB 1O3SA 1DGLA 4Q4X1 3MFCA 1GZCA 4EROA 1Q8PA 1O3RA 3KGLA 4XTPA 1AR63 1VBC2 4CDWA 4RQPB 4KQ7A 4KG8A 3JD73 2D5FA 3NKTA 2RS31 4Q0PA 2DTWA 4LTAA 2R0FA 3D0SA 3H0OA 4HL0A 3WOGA 4FP3A 4XFCA 2RS51 5ACA2 4AW7A 1Y7BA 2Q0AA 2VUAA 2K2SA 4CEYC 1LRHA 5KHHA 4CDQB 3G6JB 5CFDB 3MIBA 4KGGA 1TME2 1HQNA 3I4IA 1MR5A 1NYWA 3KGZA 5CBLA 4BA6A 2R041 1QJU3 3SH5A 1FT9A 4QPGB 2YY1A 4FCAA 1HXS3 4HPKA 4DPNA 2LALA 3R05A 5H9QA 4D69A 1REFA 3J8F3 2B39A 2JG8B 1BVP1 1SCRA 2CAVA 4GH4A 2V5YA 4IEUA 4JGYA 3C2UA 4GB32 1EAH2 3VBRC 4AEMA 5F1RA 1AYN1 1VBC3 5HI0A 1OQEA 2GNMA 4K21A 4BH9A 4U36A 2JJ6A 4R9AA 2QE3A 2PQQA 2WSUA 1NQJA 3E97A 1LHVA 3IM0A 4QQOA 4Y20A 3RMXA 4AVVA 1FMD2 4IV3C 3L2HA 3VUOA 4QHBA 3AX4A 3GHNA 1O4YA 3RYRA 3AP9A 4SBVA 2BWCA 1LKNA 4DB5A 3DL3A 1OLQA 1UMZA 3KT7A 4NHKA 4YNIA 4RQPA 4DQAA 5ACA3 1YO8A 4S2GA 3L2YA 3HR9A 1V6LA 2GC1A 3AYAA 1HQLA 5J98B 4L92A 1TME3 3NAPC 4PIXA 3H50A 2EIGA 3EHKA 3KT4A 3FBYA 1RIRA 3RMYA 3WDWA 1RITA 1X7NA 4BHPA 1N3QA 1W6QA 2AUYA 1GBGA 1EY2A 4YM1A 1GKBA 5CFDA 5JOZA 3LOBA 1YIFA 2AENA 4PDWC 2B45X 1NE6A 2FMYA 3KCXA 5JSPA 1EPZA 4GB33 1EAH3 5T3NA 2ERFA 2B42B 3AZXA 3LA7A 1F5JA 1XNBA 4AHZA 2ZMKA 5GZCA 1FMD3 1PO11 1PZ8A 3WW3A 4META 5FPZA 1GICA 2ET1A 4P9GA 2R32A 1ZZBA 3G7DA 1IS6A 3I54A 1JOJA 1HRI1 4I02A 1R1A2 3MW4A 4LO4B 1DF0A 3B3QE 4UW6A 3M1HA 3OTFA 4Y26A 5EWSA 5HCAA 4JGZC 4I3PA 2PHFA 5AVAA 4DMIA 1JYIA 2EXIA 3ZXJA 2EA7A 3WDXA 4I2OA 5GLUA 1OA4A 3KSCA 4XJ9A 2Z69A 1H1AA 4Y1VA 2IXJA 1ZRCA 1KS4A 1RUF2 4Y5Z0 3NSTA 4FOQA 2BNOA 1C3HA 5A3LA 2BGCA 5F6LB 3DN7A 4PLNA 1X82A 4LBQB 2VUJA 3OCPA 5J09A 1NA1B 1RTVA 2IXCA 4AVCA 2WT2A 1YI7A 4H14A 5DG1A 4I0AA 2PAEA 3ZN6A 2X5IA 4YM0A 1ZVFA 4R9BA 5IT6A 3N7LA 2D93A 2PHUA 2BEOA 1R1A3 3RI9A 1COV1 1X33A 3O0VA 3VZLA 4RGAA 1QWRA 3J26N 2O8OA 3SMHA 1LOAA 3ZFFB 1I3HA 4D3WA 2GU9A 2ZGPA 1BCXA 2G4IA 5LRSA 1V00A 2QCSB 1Z7S2 1H8TB 1FOD2 1WBFA 5DDJ2 3NV3A 4XE9A 1F5FA 3URFA 1PVC2 3H7JA 2FHRA 2E51A 1UD1A 5FLJA 2PA7A 1RUF3 2A73B 2C1FA 5A33B 1S0GA 2HWB1 1KITA 2YGLA 2D6MA 2YGMA 4RS5C 4YVSB 1GQGA 2NQYA 3T1MA 3IDBB 1LB2A 5BNQA 2JENA 2OA2A 1QQP1 3KCCA 3INAA 1HRV1 1AVBA 3CJXA 5CA6A 4QGLA 1ULFA 2K0GA 3ZN5A 4KWLA 3ZMNA 2JE9A 3IMNA 3AXEA 2VNRA 2WJSA 3R6SA 4LBQA 1HW5A 2PAKA 2WFF2 3ASIA 1NA1A 4CEWB 5JCTA 4XFIA 3AMHA 4B8EA 1VAVA 1MS1A 1TNRA 3RS6A 1IPKA 3K48A 2NMNA 1Z7S3 5EFUA 1DQ6A 1FOD3 2RS11 5CG9A 2NZ9A 4B3NA 5DDJ3 2WS92 2Q1ZB 1XRUA 2MPFA 3ZSEA 5J3UA 4XETA 2ZGQA 4EN8B 2GSYA 3ZFFA 1BBT2 2PLV1 2E9QA 3HD8B 3POSA 1NLRA 4F83A 1OA3A 1SLBA 3E5UA 3EBRA 1ZA4A 4I0WB 4XJ8A 5KHJA 5J37A 1TMF1 4MV2A 4D7TA 4B7EA 4HANA 3VDDB 4FPFA 4JDOA 1CAUB 2A3XA 2NPIA 3WXPA 5FCCA 2CGOA 2CWSA 5EV7A 2VOVA 3BU7A 1UCXA 1B35B 2PN5A 2VMIA 2ETEA 4JTNA 5EJ3A 2JE7A 3RZZA 2WFF3 1G7YA 4FPLA 1QJX1 4SLIA 3JBG1 3NVCA 3RQ0A 2N7GA 3B01A 1F9KA 4MSVA 4MYEA 3VBOA 1QOOA 3QBQA 3UL2A 1C1LA 3ZFGA 1RHI2 1NCQA 4I3GA 3LWCA