1LHUA

Crystal structure of the n-terminal lg-domain of shbg in complex with estradiol
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
175
structure length
175
Chain Sequence
PAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Steroid Ligands Bind Human Sex Hormone-binding Globulin in Specific Orientations and Produce Distinct Changes in Protein Conformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords SEX HORMONE-BINDING GLOBULIN
total genus 31
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lhuA00
1W6PB 3B9CA 5DUVA 5L73A 2TEPA 1QOOA 1QNWA 3BOPA 2YY1A 3MW4A 4FPJA 1U0AA 2VUAA 4FPKA 2ARXA 3RG0A 3RMYA 3WDXA 5IK4A 4XHXA 1W6PA 1SCRA 2WT2A 2ZMKA 2R49A 4SLIA 2VW0A 5T54A 3M2MA 4XMIA 1LHUA 3ZSLA 1H30A 1LHNA 1QF3A 4FP3A 3T1MA 5EYXA 1V6MA 4YW2A 1SBEA 5BYNA 4XJ9A 4YG0A 1S0CA 4YZ4A 1LODA 4HL0A 3WUDA 1LGCA 1YIFA 4ISQA 1DQ2A 3NV3A 3INAA 4K21A 1Y7BA 3WDVA 4YZ5A 4AYUA 2D6NA 5JOYA 1BYHA 2CWMA 3FLRA 2NZ9A 5DXDA 2EXJA 1AX0A 3KM5A 1APNA 1AXZA 2DUOA 3ILRA 3WDWA 5DZFA 3WZ1A 4FPGA 1GZWA 4AGVA 3AYEA 2A7AA 2NM1A 3QLQA 3QCWA 1SLIA 2AENA 1FNYA 2OVUA 3AJYA 4YM1A 4DS0A 4DFSA 4OZXA 1GKBA 4FPLA 4Q27A 1TEIA 2VU9A 3AXEA 3ILFA 3PMEA 1LGNA 1MS8A 4M3CE 4Q2FA 3VV1A 3FUQA 4FPFA 1FYUA 2CNAA 4GXLA 3Q9OA 4LBQB 3W59A 1DYPA 4XJZA 3SH4A 3ZVXA 2ARBA 5H9PA 3D4KA 1BQPA 1GLHA 2D6KA 3AZWA 2GDFA 4YZ3A 1F5FA 1DFQA 1FATA 2ZGMA 2D3PA 3N35A 3OGGA 4AGGA 4WV8A 1QKQA 2CL2A 1HQLA 1MS9A 1JW6A 2Z42A 4TYSA 2JE9A 3N7JA 3VKNA 2DU0A 1SACA 1G9BA 4WZFA 4YFZA 4L8QA 2WQZC 1AJKA 3N36A 5AVAA 1MS5A 1CVNA 1N47A 2P3KA 1SBFA 2A6VA 2ZGOA 4W65A 4Y1ZA 1LECA 5EYYA 5H9SA 4Y22B 1LEDA 4XOGA 5E8AA 3ZXLA 2KM2A 1LOBA 4BMEA 2ZHKA 3WNXA 4Y1XA 5HCAA 3B3QE 4LBOA 4M3CA 3VKLA 2A6ZA 2A6XA 1DQ6A 3B00A 1V00A 4YZ2A 1G86A 2ZGNA 3V0BA 3JUUA 1S0DA 4UW6A 4NO4A 1QMJA 5GZCA 4DRRA 1UKGA 3TAYA 1G9DA 3R05A 2EXKA 1CIWA 2A3YA 2EXHA 4AGRA 4GWNA 2DTYA 4FPYA 4YW1A 1A3KA 1GYKA 3ZYPA 2ZACA 2I2SA 3AK0A 3AZYA 2A75A 4FOVA 2NN8A 2R0HA 3NWKA 3APBA 1ZM1A 1ULGA 4MYEA 5JMCA 3MW3A 1S0GA 2VW1A 3KQRA 3SH5A 1WCSA 2CTVA 2B7YA 3N3HA 1V6IA 4BLJA 4PBPA 5GLTA 1BJQA 1URXA 1ULDA 1V6JA 3ENRA 1WW7A 3ZXFA 1DGLA 2ERFA 3GALA 2P3JA 1S0BA 3M3QA 5E89A 4P14A 3FBYA 1G9CA 2YZ4A 1W6OA 1DHKB 1MS3A 1LU1A 2AR6A 2E7QA 4YZ1A 1W0OA 4FQZA 5GZGA 4R9BA 3ZXEA 3OBTA 4ISRA 4JRAA 2UURA 4XDQA 4XJAA 4C1XA 1MS1A 1KDMA 1SFYA 1SLCA 1A78A 2ZGLA 3AJZA 3UL2A 5JOWA 2D43A 1PZ8A 3O0XA 1UX6A 3HMYA 2JECA 3OJBA 4D69A 4BPZA 4F83A 2ZGKA 5GM0A 1IS5A 1ZA4A 1G9AA 5DUUA 2NMOA 5FRAA 3WHUA 1WW5A 1KDKA 3DGTA 4XE9A 4ASMB 3R4SA 1S0EA 1IKQA 1PZ9A 3O5SA 1F9KA 2SLIA 3IKWA 3WDUA 2GMPA 3POYA 4H55A 2JJ6A 3WG3A 3L2YA 1ULEA 1AVBA 3LCPA 4JC1A 2DTWA 4PBOA 5CAZA 1AX1A 1GV9A 5T50A 3WG2A 1JN2P 4UW4A 1WBFA 2AYHA 1UZZA 4FPCA 1DZQA 4UW5A 1LEMA 1CONA 2D6LX 2WT1A 2D6MA 4XIOA 1OFSA 4Y24A 2A6YA 1D2SA 1DQ0A 5DG2A 4XBQA 4BLIA 4ATEA 3AZZA 1RITA 1JYCA 2P2KA 2PHXA 2RHPA 1LOAA 1Q8OA 2DYCA 2DVDA 3D5OA 2GN7A 4AVSA 3JU9A 4FOYA 4Q8KA 2R16A 3VKOA 2V5YA 1AX2A 1FV2A 4RA0A 2PHUA 2LALA 1FV3A 1C4RA 1S0JA 2WNEA 3HR9A 5GLUA 3PJQA 3A4UA 5T5PA 2D6PA 1MS4A 4YG3A 2ZMNA 2A5ZA 3VUOA 1CPNA 2OW4A 3LSEA 1GNHA 3AP5A 2AREA 1LENA 5E88A 2A3WA 1W6QA 4Q26A 3WOGA 4I30A 1C1LA 3UJOA 2GMEA 3SLIA 4YG6A 1BXHA 3OBRA 2ES3A 3HN1A 3T1LA 1XQNA 3SNMA 2ZHNA 1VLNA 1IS3A 4GWMA 4Q8LA 4CTEA 5CA6A 1IS4A 2ZKNA 1IS6A 3ZSKA 4FPOB 5JDBA 3VKMA 5T5JA 3V0AA 2R1BA 2W39A 2PELA 4YM2A 2JD4A 4CRQA 1IKPA 1IOAA 2ZZJA 5IK5A 4GKYA 1V6NA 1LOGA 5DUXA 4LBJA 5H9RA 5GLVA 1YXWA 1N1SA 1V6KA 2ZGPA 3BTAA 3I8TA 1LCLA 3PVEA 2DWRA 4P9WA 3T2TA 2ZGSA 3WV6A 3WG4A 1W6MA 3WVJA 1AXYA 1GZ9A 3ZXKA 1NLSA 3MPPG 4PQ9A 1DQ5A 1GICA 2R0FA 4P9YA 5SV8A 1JUIA 1N1YA 1SLAA 1KJLA 2E53A 3WHTA 3WLUA 4XXAA 2V73A 1MZ5A 3FLPA 1RINA 4YW5A 3ZSMA 2ZA9A 4U36A 5GJ6A 2WSUA 2A70A 3H0OA 4LBLA 1MZ6A 1V6OA 4M00A 1AXKA 2D6OX 1W0PA 2GNDA 3NV1A 3V65A 4BM8A 3IM0A 4YM0A 1WW4A 2D3RA 4YGDA 5GALA 4C1WA 3N7LA 5JOZA 4XTPA 4BQ1A 4XILA 1KRIA 3B69A 2E7TA 1W6NA 4U2AA 1JYIA 2GN3A 2ZGTA 3N7KA 4XXPA 3O12A 1DYKA 2ZHLA 3FUOA 2YMZA 1G8WA 1S1AA 1CPMA 4YGCA 4FOWA 4XJWA 3FFZA 3IPVA 4Q1RA 2UWAA 2WKKA 2LTNA 4K20A 4R9DA 1NXD1 4FOQA 2EXIA 5DZGA 1YYNA 2ZMLA 1FX5A 5HCFA 3WG1A 1UN1A 1HLCA 1DBNA 1J1TA 1W6OB 2ZAAA 4YW4A 3UK9A 5F9TA 1ULFA 1SLTA 1PZ7A 3MW2A 4BMBA 1CESA 1BKZA 1X50A 3V0BB 4YLZA 1WD3A 1N3PA 2GMMA 4K1ZA 5F5QA 5GZFA 5HCBA 5KXCA 3AP7A 3ASIA 2CWSA 4ZXKA 2P34A 4RL7A 2DVFA 1VALA 4WVWA 1KQRA 3AP9A 3RQ0A 1YI7A 4XTMA 1HQWA 1LOFC 2ZGQA 3WCSA 1N3QA 2WLQA 4ATFA 1W6MB 2UWBA 2ZBJA 5IK7A 3SH3A 1B09A 2CYFA 1JBCA 3VKFC 1Q8SA 5KXBA 2JE7A 1DQ1A 3I4IA 2EALA 3AYCA 3V64A 1SCSA 2GNTA 3OPZA 1MVQA 2VH9A 1DIWA 3NV2A 1AZDA 5EWSA 5IT6A 1WW6A 3ILNA 1V6LA 3O0WA 2PHWA 4M3CB 2H0BA 4Y1VA 2HYKA 2E6VA 3WCRA 4K1YA 1DQ4A 2D7FA 4R9AA 4UW3A 1CQ9A 1GZCA 4LBKA 3WDTA 1O4ZA 2A6WA 1SLLA 2YROA 1ENSA 3OY8A 3R4UA 3AYAA 5T52A 1GSLA 2OUHA 4GA9A 1LU2A 4AVTA 1F31A 3ZYRA 3IMNA 3BIWE 1HDKA 2EF6A 3AFKA 4XHBA 2FMDA 1GZWB 3SISA 1WLDA 3WUCA 1QDOA 1MR5A 1LOCA 1VIWB 2BQPA 4R9CA 2ZABA 3AZVA 1N1TA 1SBDA 5T5LA 2NP0A 2DURA 1R1ZA 5GLWA 1LOEA 2Q5TA 3N7MA 2UWCA 5CNAA 4DPNA 5KXEA 1I1EA 3AX4A 2WJSA 2VXRA 1LHVA 2ZGUA 4XZPA 2UU8A 2AGSA 1GNZA 3POWA 4LBQA 1Q8PA 3ATGA 4IQPA 1YRZA 5T55A 3RMXA 1KJRA 2EIGA 2ZGRA 3GNEA 1QOSA 5CB7A 4YM3A 3USUB 4XIKA 5JLVA 3O0VA 3POSA 2AH2A 2YV8A 2GNBA 4FPEA 4YGBA 1MACA 1AJOA 2SBAA 5EXOA 4Y26A 1S0IA 4XJUA 1UZYA 1ULCA 4PCRA 4GKXA 5DG1A 5GLZA 1UAIA 3IN9A 3UJQA 4BOWA 1LHWA 3PVNA 4TZDA 2YXSA 1CR7A 5T5OA 1ONAA 1UMZA 1SLBA 3AYDA 3SITA 2ZHMA 2XB6C 5JOXA 1VAVA 1CJPA 4FPHA 2JKBA 1YO8A 2G4IA 2NYYA 3AXDA 3AP4A 3B01A 1OQ1A 3DUIA 1JXNA 4HANA 4KBBA 2AUYA 4M3CF 4M01A 4DQAA 1ENQA 1O4YA 3OYWA 1CN1A 2PHTA 4XYXA 5IUQA 3M3EA 1H9PA 3LSDA 3ZSJA 2FHRA 4Q1PA 5GZDA 3USUA 1FAYA 1MVEA 1Q56A 2DUPA 2P3IA 3MEPA 3RSJA 4JCKA 1RIRA 2OUJA 1EPWA 3TB0A 1G9FA 2VW2A 4P9XA 3RS6A 1LHOA 2P37A 1JHNA 4Y1UA 1LJ7A 3RRDA 1LTEA 4GALA 4XBNA 3AP6A 1WLWA 4LBNA 3W58A 5CBLA 1LULA 4NOTA 3ZPYA 4LBQD 2DVGA 1QU0A 2WSVA 3D6EA 2EAKA 1UPSA 4Y22A 5H9QA 1ENRA 2C5DA 5KXDA 2PHRA 1HKDA 1JOJA 1G7YA 1KITA 1LOFA 1A8DA 3M1HA 4ITCA 2R1DA 1I3HA 3M3CA 4YW3A 1D0HA 4LBMA 1WLCA 1QDCA 1Q8VA 1C57A 4Z8BA 3V0AB 1VAMA 1OKQA 2A71A 1GBGA 5FREA 4PF5A 4Y20A 4XJ8A 5JVVA 2VY0A 4FP2A 2DVBA 2GNMA 1C1FA 2JDZA 2DV9A 3FLTA 3AZXA 4XMAA 3CNAA 2CY6A 2XG3A 4Y20B 3IPVB 5DZEA 2C9AA 3A0KA 1H9WA 3ZXJA 1W6QB 4WVVA 1WUVA 1S0FA 1Z0HA 2DUQA 4CZSA 5LK5A 3C2UA 1WD4A 4AVVA 3OYWB 2W68A 1FNZA 1QNYA 3A0NA 3M3OA 5GZEA 1Z78A 2A3XA 3OY8B 3WDYA 1AF9A 1N1VA 1N3OA 2ENRA 1QGLA 2GALA 1QOTA 4FVVA 1Q8QA 3BODA 2D3SA 5DUWA 4DRVA 4ZKTB 2PHFA 2DU1A 4FQ4A 4XBLA 4Y1YA 3PVOA 2WT0A 4YGEA 4AWDA 1DLLA 1MS0A 1GANA 1LGBA 2D44A 2W52A 2NMNA 3U4XA 2DVAA 1WBLA 2E51A 1UL9A 1BZWA 2W08A 3NV4A 1W6NB 4YFWA 5IK8A 1LESA
chains in the Genus database with same CATH superfamily
4D3WA 1HW5A 4HK9A 3I49A 2TEPA 3CJIB 1QNWA 3MW4A 4FPJA 3WNPA 3J8F2 2BNMA 2ARXA 4FPKA 4JTOA 3RMYA 4QX2A 3WDXA 5CG8A 4XF9A 3EBRA 5KHHA 3GBGA 1TVGA 3GF6A 4BH9A 5FZEA 1LAJA 1LHUA 2VOVA 1H30A 1ZA7A 3ZSLA 2E32A 2Z2SB 1W2AX 1QF3A 4RHV1 5L19A 4XAEA 1GP6A 4H3WA 5J48A 4AEJA 1S0CA 4MGIE 1FI2A 3OTFA 3DYPA 4ISQA 3GDBA 3SXWA 1Y7BA 1RUF1 2C9KA 4K8RB 4JKMA 4NHXA 2QFEA 3ON7A 2CV6A 3MFCA 1YQ8A 1S4CA 2IUWA 5DXDA 4JGYC 3NNLA 1APNA 1NCRB 2OYZA 1C8M1 4FPGA 1GZWA 3RYPA 2NM1A 4IE5A 2AENA 2Y6LA 3MYXA 4OI1A 4DS0A 1SEFA 2L9LA 4O9GA 4XFHA 5FPAA 1PM7A 2VU9A 3AXEA 1GP5A 3ILFA 3E97A 2W1QA 4Q2FA 1H0BA 3E6CC 1VBE1 2VVFA 4ZXEA 5IFPA 4BXSV 1PMIA 5EZWA 1CZSA 4DNYA 4CYDA 3LEIA 4XJZA 1NX9A 3ZVXA 1XNCA 1RMU3 3I2KA 2D6KA 3AZWA 4K9SA 1PO23 3OGGA 2OQ6A 4A7KA 4YSFA 4MO3M 5C8CB 3VBRA 4GMP0 1VBA1 5DAXA 3MF9A 1JW6A 4PQQA 5IHRA 3VKNA 3NQHA 4CU7A 1AR62 1XNBA 1W8ZA 2DU0A 5F32A 5FYZA 2WWUA 1GQHA 4QX8A 1NA1A 1DGWX 2ZGOA 4W65A 1CAXB 5C5TA 1OFNA 1NZIA 1AYM2 1EV13 1PO22 1POQA 1YJLA 2JEMA 3OPTA 3RZJA 1PGL1 5HCAA 4CDUA 2VC9A 3H7YA 3NJVA 4M3CA 5C7GA 5FZ3A 3ACHA 2PMWB 4HK8A 3VKLA 3ZYGA 5T3NA 2XKOA 3B00A 1HB2A 1V00A 2ZEWA 3PUQA 1UW8A 5KHIA 3V0BA 2FDKA 3T2QA 4CP1A 2JENA 3WP4A 5GZCA 1K5MC 1UKGA 3TAYA 3TNPB 5BNPC 2EXKA 4Z2WA 2E9QA 1W8NA 4GWNA 2DTYA 2IXKA 2I45A 5AFBA 4YW7A 1GUIA 1GYKA 1AYN1 5F5AA 4LO4B 1T6GC 1US3A 2UY8A 3AK0A 3J7NA 4FOVA 5FP3A 4GJYA 2R0HA 2B9VA 3NRUA 3NWKA 4PDWC 4N7IA 4OUMA 2GZWA 3RGBA 2OZ6A 2QDRA 2ADEA 4O61A 1UU4A 3KQRA 3OGVA 1RUJ3 3I2IA 4HMZA 4QM9A 4XUOA 1BJQA 1YFYA 2BFUL 2JDMA 3WNXA 1YQ5A 2PLV2 4B29A 4MGQA 1DGLA 1UNBA 2ERFA 3B7MA 3M3QA 2J1AA 1JU4A 2YC0A 5FZCA 5FR3A 3FBYA 2XOMA 3OGJA 2YZ4A 2W3JA 3VBOB 1COV2 1DHKB 3DYOA 1LU1A 3POIA 1W0OA 4CCMA 1CAUB 5GZGA 4R9BA 3ZXEA 4ISRA 4JRAA 1PVXA 4XDQA 4XJAA 3MDPA 4ZZ5A 3KHCA 3OBAA 3UL2A 1PZ8A 3RDIA 5C33A 3OJBA 3VHNA 2R041 4OHZA 5GM0A 1W2NA 3CEWA 3THDA 3ZYIB 1VBA2 1O6UA 4CU8A 5C8WA 4RQPB 5DUUA 1G9AA 2J1UA 2NMOA 5FRAA 1WW5A 2P1BA 3RPQA 4XE9A 3WHUA 4Z2AA 1S0EA 1D7PM 3PU3A 3O5SA 2SLIA 1Z7S3 3CBNA 2GMPA 2UYBA 3IKWA 4X6QB 1VPHA 3L2YA 1ULEA 1AVBA 3WG3A 3WINE 3ZFEA 4DINB 5T50A 4BHPA 2XVGA 4WM7A 4NN0A 4BQ3A 1VP6A 3RZGA 5A1FA 1O5LA 2D6LX 1CONA 1PVC2 2XLAA 2D6MA 4X6RB 3C7OA 4Y24A 2A6YA 4DO0A 1DQ0A 5DG2A 4HG6B 2P2KA 1DU3D 4KI5M 1LOAA 3T0BA 4QPGC 2GN7A 2VOTA 1RUOA 4AVSA 1AR81 2VNOA 3EQEA 2CDOA 3HQRA 4FOYA 3IDBB 3IBMA 4IETA 3O1TA 1FV2A 4RHV3 2BBVA 1HXS2 1X8EA 3I2FA 1MQTA 4QDSA 3T3YA 4AAPA 3PJQA 5FZGA 5C3OA 1JZ4A 3VUOA 3RZZA 4DUXA 1LENA 3FHAA 3FE5A 1W6QA 5FOBB 1ZRDA 2PA7A 1RUC1 2ADDA 4I30A 3GXUA 3TWIA 2GMEA 4DUVA 1GWMA 2YHJA 3VD7A 2ES3A 2VZUA 4YNIA 1TG7A 2R32A 2IVJA 4QX7A 3J8F3 3AMPA 4CTEA 2VECA 5CA6A 1O3SA 1JHJA 4FPOB 3VKMA 3V0AA 2PELA 2BERA 1ZZ9A 2MEV2 4W6YA 2RS31 4LBJA 5H9RA 5GLVA 4EZHA 3I8TA 1AR61 4FFGA 4XFIA 2DWRA 1ZRRA 2JX9A 2XJSA 2VPVA 2BWAA 5K8SA 1EUTA 4XCBA 4Q0SA 3CLPA 2MPFA 3JQXA 1NT0A 5D2AA 3WR0A 4DIQA 3E5UA 5LA0A 2OPWA 1GZ9A 3LEMA 4PQ9A 2JE8A 2DCTA 1VJ2A 1BK0A 4P9YA 2E53A 4PDWA 2OX0A 1MZ5A 1RINA 2LW8A 4I3GA 3ZSMA 3PHMA 3WDWA 1ZZCA 3TN92 2WSUA 1B35A 1NLRA 3GCWA 2HJIA 4JGYB 1MZ6A 4CP9A 4EN9B 5FYBA 1O8SA 2GAUA 2IWGB 3NV1A 1HN0A 1QXPA 5EJ1B 3TRSB 4BJ0A 5FO7B 2XONA 5F3GA 3VBOA 2RMU3 2D3RA 3SEPA 1YQ2A 1S55A 4BQ1A 3RS6A 4MVTA 5A32B 1KRIA 5J96B 3S5QA 1BMV2 2JDNA 2E7TA 1W6NA 3NKTA 2FBEA 4CEYB 2ZGTA 4XXPA 3O12A 1HIXA 5KHKA 1G8WA 5EHDA 4FOWA 1K3IA 5FZKA 4Q1RA 3DECA 2WKKA 3N9NA 1NXD1 2LM3A 2EXIA 1YYNA 1TMF2 2WNVC 2VMHA 2Y64A 3JBG1 1MEC1 5FZ8A 1FX5A 2BTVC 2XUMA 3KZ4C 5L9RA 5L7OB 2VCCA 4TLGA 1UN1A 1O59A 5I0TA 3WG1A 1HLCA 1DBNA 1OPMA 2ZAAA 1E5HA 1JZ8A 3K46A 4QPIA 4IGOA 3WD5A 4BMBA 3CF6E 2GMMA 4K1ZA 2WC2A 1AL21 1HJFA 2G1MA 5HCBA 4O65A 4AAXA 3ASIA 5I0UA 3Q8FA 2VUDA 1IHMA 3I2JA 2VZOA 1PO11 1VALA 2X8KA 4LHSA 4WVWA 4ZXKA 4BE3A 3HPNA 1JUHA 3IAQA 1ZBA1 4JDMA 4AEKA 2RE9A 1HQWA 1LOFC 1RGSA 4IEVA 4NPMA 4Q4V1 5L9VA 4YVSC 2ZAHA 3RYRA 4KG0A 3WCSA 1N3QA 2WLQA 4N43C 3HBKA 2VUJA 2UWBA 4QQPA 4ATFA 3DPRA 3BU7A 2CYFA 4G4FA 1JBCA 1Q8SA 4Q4W1 3AKPA 1DQ1A 3MIFA 2WINB 3TBDA 5JXJA 4JTNA 4CP9B 3N9MA 1SCSA 3W9AA 1O4TA 1QJU2 3D82A 1DIWA 5JSRA 1FMD2 1W8UA 4NAMA 1KEXA 4XFGA 2ZCWA 4RR3C 2VXJA 2ZZQA 5A3UA 3ILNA 1V6LA 4CDUB 5C4WB 4OCTA 5F6LB 4M3CB 4CCNA 3RZMA 2H0BA 2VZPA 4INDA 3AVSA 3WCRA 4XVHA 1RUD1 1CQ9A 1C8NA 4QPGA 2ZEYA 5IAXA 2YROA 4AQSA 5T52A 3SCGA 3SHRA 2W87A 4ES8A 4GA9A 2OUHA 4QX3A 1LU2A 2Y38A 3A22A 4EROA 4F3JA 5FK8A 4LJHA 5FLHA 3IMNA 1U5XA 1QXRA 1F2NA 4ONUA 4XUQA 3WEZA 1FOD2 3AM2A 2AEYA 3ZFGA 2EF6A 1DZTA 3AFKA 4XHBA 4AW7A 2Q1FA 3CQOA 4E9KA 3D0JA 3K48A 3OEAA 3GCXA 3G7DA 1QWRA 4IXLA 1MR5A 3KD4A 1LOCA 2QBXA 4R9CA 2ZABA 3FJSA 2VVEA 3NAPA 1QHDA 5GLWA 4URAA 2Q5TA 3PIJA 1H4GA 3BGAA 3T4VA 4FT8A 1ZBE3 4HN0A 1UY2A 4N43B 3W20A 1H8TC 1LHVA 4I01A 4CCOA 3S57A 1D4VB 2AGSA 2G9GA 5FWEA 4Y4RA 1W28A 4A4AA 2VNVA 4BISA 1C8M3 1CAVA 1ND3C 3Q8AA 2J1TA 2XL7A 1KJRA 1JS9A 2O8QA 1AR92 1HRI1 3GNEA 3RMXA 3VBFB 1ALYA 3H3ZA 4MGSA 4RYDA 4XIKA 5CU1A 1FMD3 1H8TA 4BQ4A 1QJY3 2DCKA 3KSCA 3JCIA 3LEGA 5FYYA 1UZYA 2WUHA 3WW4A 4GKXA 4QXBA 5GLZA 1XNDA 3IN9A 1PIV1 1SPPA 4D8MA 1GFF2 3PVNA 4RD7A 2YG0A 2VZTA 5T5OA 3AYDA 5EQUA 3VBUA 3OD4A 5JOXA 2ZHMA 4I02A 3C7EA 3MI8A 3OCPA 2XXZA 1PHMA 4FPHA 4L11A 2JICA 4LEJA 1QJU1 4HT1T 1YO8A 4G9SB 4HANA 4IDZA 4M3CF 4M01A 1OQ1A 3DUIA 4OUEA 3W5NA 1ASJ2 4G3YC 2GC3A 3O1MA 4DQAA 1ENQA 4Z82A 1R082 1H2LA 1CN1A 3VZOA 4V2WA 2QQLA 1ZYBA 3H8XA 5IVJA 3NNFA 4FTEA 3BIEA 5LRSA 2WNUA 4META 2BVBA 1J3PA 2FHRA 4Q4W3 4QDQA 5GZDA 5CFCB 1MVEA 5KC6A 2K2SA 3RZLA 3LPGA 3HNMA 2OUJA 1W90A 2PQQA 3TB0A 3DL3A 4MGYE 3VBHA 1JHNA 4CXXA 4Y1UA 4QT6A 5KHGA 3BUCA 1LTEA 4GALA 4XBNA 3HVDA 1DYOA 3ZDVA 3AP6A 3W58A 5JMOA 1LULA 3GYDA 2RDSA 1UXZA 2DCJA 2K46A 4NUBA 4L97A 2DVGA 2RDNA 3D6EA 4N43A 2RS12 1NE6A 5H9QA 5KXDA 4OLLA 1UOGA 4P9JA 2YU2A 4HPKB 5FZ0A 1HB4A 1OHFA 2B9UA 4R4XA 5HXVA 3WQBA 1QQP1 1LRHA 4JAAA 1QY4A 3NKGA 1A8DA 3M1HA 3VBFA 1UQXA 2R1DA 1BCXA 3PMSA 3ZN6A 2RS53 1WLCA 1QDCA 3VD9A 2XQXA 5FO8B 3T0AA 1GBGA 5FREA 2NQYA 5A70A 1O8PA 4FFHA 5JVVA 4W6XA 1KS5A 5L7OC 5EJ3A 4CP0A 3AZXA 3CNAA 1WMDA 2CY6A 3WP3A 2VNRA 2ZEXA 2WNVB 4LMFA 3O1RA 5ABJC 1CX1A 4OI4A 3QBQA 4NIHA 3IPVB 4HKLA 3JB4C 1UOJA 4XF3A 5FXWA 3ZYJB 4B7EA 4OQ8A 4Q0PA 1COV3 4EN8B 3VHOA 4NIGA 2IC1A 2RJKA 4HN1A 4OMCA 4WVVA 1RUH3 1S0FA 3AB0A 2EIEA 1RUC2 1WD4A 4EYUA 1O7FA 1FNZA 3KT1A 1NXMA 3M3OA 1T2XA 3SCFA 2XDVA 5HPOA 5EPAA 3OY8B 3AMQA 1VBC1 1Y43B 4IUGA 1EV11 5D8AB 1NY72 4JGZA 1NY71 1RXFA 2QVSB 1Q8QA 4XZUG 3I2HA 4DRVA 2IXLA 2PHFA 2RJLA 2YGLA 4FQ4A 5K0UB 4QKDA 1IPKA 3PVOA 3ROUA 3TEZA 2CGOA 1VB4A 5JZGC 2DCZA 4NHLA 1RUE2 3HT1A 4XUTA 2Y6JA 4LHKA 2DVAA 3D3AA 4QKBA 4N9HA 1W6NB 4TLFA 4YFWA 5IK8A 1TME2 1W6PB 3AMMA 5DUVA 1K42A 3SCHA 3BOPA 4HSJA 1VBB3 3OSDA 3K4ZA 3RG0A 4RGKA 5FZLA 3POJA 5LZ6A 2YPJA 2ZMKA 4AG4A 4KWLA 5FMDA 2VW0A 4AI9A 5T54A 3VBHC 3ST7A 5FYIA 4HLTA 3VBUB 3ZMOA 2WS92 2TNFA 3VBSA 1LHNA 3CZUA 4QPYA 4RS5A 4FP3A 3T1MA 4GWJA 3LKJA 3VDDC 3THPA 5BYNA 3E5XA 3PVBB 3ORJA 4YZ4A 4RSUA 1VE0A 1YIFA 4JZRA 4YZ5A 2RS32 2WYFA 5FQ0B 3ME2A 1W3XA 1J58A 5AC92 4MZUA 5FY0A 2N7GA 3KM5A 5F3EA 1AXZA 1KFXL 2DUOA 2EA7A 2YUEA 4KWUA 4QDRA 3DKQA 4AI2A 1VRH2 1UF2C 1SLIA 1XU1A 1BHGA 3AJYA 5FZHA 4TTGA 3GZAA 3U78A 5C9AB 2CGPA 1WA6X 1U12A 1ODMA 2R072 4MADA 3KV5A 5C5UA 1TME1 4LO6B 1YI9A 1KS4A 2R043 5LY2A 1LGNA 2K0GA 3FX3A 5FUPA 2UYAA 2V4VA 3K51A 2VBPA 3VZNA 1FYUA 3BI3A 4GXLA 2RM21 2WA4A 2WZR3 3CZJA 4V1PA 3AMNA 2YU1A 1H8VA 1I5ZA 3KGZA 3SH4A 1M06G 1QEXA 4MXVA 3ZYHA 4K40A 5FDBA 1GLHA 3MLJA 3ACFA 4YZ3A 5I8SA 2F4PA 3N35A 2HWE3 1POV1 4B1MA 1K5MA 3WQ7A 4QXHA 1BMV1 1QKQA 1SMVA 1HB1A 3S6PA 3T30A 2VBBA 2Z42A 2ZXQA 2JE9A 4EWAA 3LEKA 3N7JA 1SACA 2HWB1 4QX0A 4S2HA 4WZFA 3DYMA 5C8CA 2WQZC 4MOAA 5AVAA 1N47A 4AHWA 3CIHA 2P3KA 1SBFA 3KB5A 4AFAA 4CDWB 5DMYA 2G9FA 4MSVA 4RQPA 1QQP3 5LY1A 1LEDA 5E8AA 4AR2A 4BMEA 1UYZA 1OKOA 2ZHKA 3KHBA 1NA1B 3NAPC 3B3QE 2VMFA 4H7LA 4P9IA 4Y1XA 3SQOA 1QJY2 4LBOA 4QGNA 3LIGA 5FIXA 2A6XA 4NHMA 2VQAA 4YZ2A 1G86A 2ZGNA 3JD71 4RFT0 1RB8G 3J26N 4QPWA 2GP3A 5KBFA 4AGRA 2VQUA 1TNFA 1ZZ6A 1PVC3 2R061 4HETA 2R042 3ZXAC 1OA2A 4CUBA 4OYUA 2MEV1 1HXS1 3AZYA 2Q8OA 4B4PA 1Q43A 1UY3A 5JMCA 4IEQA 3MW3A 4LIVA 3SC7X 2WAAA 4ORFA 4S2FA 3SH5A 1AYN3 2XWJB 1UIJA 1WCSA 2B7YA 3N3HA 1V6IA 1AR73 1VBE2 1W8OA 2Y26A 2AC1A 5GLTA 1W99A 3UETA 1URXA 3CL1A 5A3MA 1YQCA 3ENRA 1ND2B 1JTZX 1PVC1 3GALA 2P3JA 1S2KA 5FZ4A 1HV1A 4E8DA 1G9CA 4IE6A 4CEWA 1Z7S1 4XACA 3WXPA 2AR6A 4FO9A 1W3VA 1JH5A 2RS13 2ORXA 2HWF3 4FSJA 1R081 1X9TA 5JOWA 3ALQA 5IVFA 4AEDA 2D43A 2Z4FA 4JX0A 4CDXB 3BTYA 4D69A 5DDJ1 3DXTA 2DBNA 4I0AA 1AHSA 1KGYA 1SQ4A 4LXLA 1IS5A 1UMHA 3URFA 4A6OA 1ASJ3 2BV4A 2VMCA 3IMMA 4YVWC 1QJX1 3LQCA 1K12A 1W9YA 2B42B 2JDPA 1OPOA 3DGTA 3R4SA 4Q4W2 3IDEA 1F9KA 3QD6A 3WDUA 5CAZA 4PBOA 3LCPA 3WW1A 4JC1A 4QQ2A 4ARXA 1AX1A 1GV9A 2RS11 4PHZA 1POV3 4UW4A 1Y4WA 3JXSA 1WBFA 2R6QA 1UZZA 5I8YA 2F4LA 1E5SA 5C8CC 1DZQA 4PIZA 4I0WB 2WT1A 4UW5A 4AF9A 2ORZA 4LR4A 1OURA 1OFSA 4XIOA 2HWB3 4XBQA 3O1SA 1PO12 4ATEA 4WZCA 1JYCA 1RUH1 2XJVA 3D5OA 2DVDA 1ND3A 1AL22 4CCLA 5I8TA 4FAHA 3LOBA 4LKDA 2J1SA 3KF3A 2G19A 1J83A 4AZZA 1VBD2 1PK6A 3ABZA 4NE9A 5LA1A 3KWVA 3HR9A 2Z79A 1GQPA 1MS4A 3KQ4B 4XFAA 4H7MA 2PLV3 2OW4A 2RS33 1MQTB 3LSEA 5LWBA 2BYVE 3P1IA 3IZOA 5AFEA 5FPLA 2YYOA 2ZKLA 1C1LA 1OA4A 3UJOA 5L7OA 4UI9L 4YG6A 4NHKA 1VBA3 2HWE2 3SNMA 2ZHNA 3HQXA 5F7UA 5JIAA 1FOD3 1W04A 3CMGA 1IS6A 4BQ5A 2YFUA 2W39A 3LPFA 3O1UA 1IKPA 2ZZJA 5IK5A 3DCQA 4E2SA 4XC9A 4QX1A 5FY4A 5CFDA 5BNPA 3BTAA 4EQVA 3TN93 1LCLA 3OUJA 4YW6A 3MV01 1NCRA 2GH8A 2RG4A 1EAH1 2ZPXA 2VMEA 1CGPA 2W1UA 2JD9A 1W2UA 1UU6A 2FDIA 4WBBA 3FBMA 3IB3A 3WNOA 4PIYA 3KF5A 1H1AA 4HZFA 4Y4YA 3ZLIA 4UFIA 2HEYF 4BU2A 1NOVA 2A70A 3H0OA 1V6OA 2DDUA 3C7FA 1W0PA 4E2QA 4YVSB 5FXXA 2FZ2A 3V65A 3WW3A 4KG8A 4MLOA 1HB3A 3ZXGA 5J98B 1OLMA 3LFIA 2X53S 4XTPA 3HQUA 4XILA 1XC6A 2RM23 5FY1A 4DY3A 3LZZA 3B69A 1JYIA 3MO4A 2A73B 4CDQB 1EUUA 3U75A 4A41A 1DYKA 2I07B 2ZHLA 3FUOA 2YMZA 1REFA 4R8HA 5JCTA 3B94A 4XJWA 1BLZA 3D8CA 2VE1A 4Q4Y1 1MEC2 1BBT3 2LTNA 4N7UA 1SPPB 4WM8A 5LEKA 5FYSA 1CZTA 1LR5A 4DXRA 3BU0A 4YVWA 5CEHA 4AK3A 2DBIA 3A23A 4XW3A 4ZONA 4Y33A 3I3EA 4KNCA 2GU9A 4Q0UA 1W6OB 4LLOA 3UK9A 1VRBA 1ULFA 1ZRCA 5DPNA 4GIQA 2QUOA 1CESA 1BKZA 1X50A 2J1RA 2OZJA 3V0BB 1XYPA 4CDQC 1JZ6A 1N3PA 4Q4X3 5F5QA 1QJX3 5CFDB 4LA2A 3AP7A 3E6BA 5BPXA 4B1LA 2CWSA 1ZBA2 3LDRA 3WF1A 3B02A 1W06A 3UGGA 1KQRA 3AP9A 1RUJ1 3WX5A 1DLCA 1GMMA 4H2AA 2JG9A 4XTMA 5FYCA 4CCEA 3WNNA 1Q3EA 2WAOA 3BB6A 3WNLA 1H2KA 2QNKA 1UCXA 2RR13 4FXGB 4R4ZA 2CDPA 1UY0A 2ZBJA 5IK7A 2WO3A 2WFF3 2IXCA 3VHRA 2JE7A 1ZBA3 3ZR6A 1EAH2 1HRV3 3AKQA 2JG8C 3AYCA 4K6BA 4EZ4A 1HXS3 3OPZA 1UO9A 2WFPA 2X5IA 5CZKA 2BNOA 4HPKA 3AFGA 5A1LA 4A3ZA 2Y6KA 3O0WA 2W1SA 2D40A 1DQ4A 4R9AA 3ZIWA 2WO7A 4BIFA 1O4ZA 1OQEA 1VRH3 2A6WA 2XVKA 2Q8CA 4LUKA 4AVCA 1AYM3 1MZFA 2D5FA 3I2OA 1OOPB 4QWNA 1F31A 1Q5OA 1RUC3 3NW4A 3ES4A 1HDKA 4NRMA 1R1A1 2WR9A 3TEYA 2WZR2 4N53A 3BALA 4GQ7A 2X29A 2Y6GA 4XUPA 3WUCA 3MHZA 4Y3OA 2JDUA 3ZFFA 1FMD1 1AR93 5T5LA 1EYBA 1R1ZA 4OVEA 3N7MA 4PT6A 1NLQA 4XAAA 4D0QA 2EICA 3ZIXA 3U0ZA 1I1EA 2KXLA 3HOBA 3AX4A 4LE4A 2UY9A 1U5ZA 2UU8A 1GNZA 3DKWA 1OC1A 4IEZA 1Q8PA 3ATGA 2OKXA 1X9PA 3ETPA 2KA3A 1RC6A 2FZ1A 2YPDA 5T55A 2A1XA 3THTA 3U14A 4A7YA 5CB7A 4YM3A 3USUB 3LGRA 4IGQA 5B2GB 4M4RA 5JLVA 3O0VA 2ETEA 2XBO1 2AH2A 2YV8A 4XFBA 1PNFA 1AJOA 4UWDA 1V9U3 3ZOIA 5EXOA 4CCDA 4JHZA 3NMBA 1PO21 5K4LA 2VR4A 2XKPA 3THCA 5JSPA 1JYXA 5FZ6A 4GH4A 3HD8B 4EJRA 1ONAA 1UMZA 4CP2A 3GHMA 4RGAA 3SITA 5FYMA 2XB6C 1O3TA 5BNQA 2VZSA 2BDRA 4F7ZA 2QQJA 3N9LA 1RUH2 2YBKA 1OVSA 4BK4A 3AXDA 1BEV1 1W9SA 4UF0B 4CXWA 2AUYA 5L36A 3QH7A 1O4YA 3OYWA 5A33B 2EIDA 2PHTA 2LROA 2RDRA 5CG9A 3M3EA 1H9PA 4Q1PA 1BVVA 1FAYA 3MEPA 2P3IA 4OHYA 4KU8A 4JCKA 1RIRA 1EPWA 3K4DA 2VW2A 2RS51 3UV9A 5BY5A 1LJ7A 3LDBA 5EP9A 3RRDA 2JIJA 2FCVA 1WLWA 2J7MA 4NOTA 4WM8C 4NWWA 3W21A 2WSVA 1UPSA 2FCTA 4LO7A 3MV11 1C5HA 4NWVA 3ZN4A 2PHRA 2QQWA 3AKTA 2WWSA 2YDEA 1H2MA 5LA2A 1JOJA 1GNYA 1YFXA 3R0RA 1Y9MA 4NHYA 5AVPA 1BEV2 2JDYA 2PAKA 4ITCA 1I3HA 3M3CA 4Z1VA 4LBMA 4XQDA 3P3NA 1VMJA 3V0AB 4YPJA 3IAPA 1F5JA 2VQ0A 2Q8DA 3IT8A 2XPJA 3AC0A 2QQOA 2WFF1 1ZREA 4Y20A 2B46X 2VY0A 1OF3A 3PUSA 3ZN5A 2DVBA 4XMAA 1C1FA 5FPBA 5FQ0A 3FLTA 4NRQA 5C4WC 3H3UA 4K7JA 3WF4A 1W39A 2XG3A 2RMU2 4DEQA 2HKXA 3I2GA 5C3RA 2RMU1 2O1QA 5C3PA 5A6QA 2BWCA 3HN3A 4QHBA 4MXWA 3A0KA 5JR7B 1W2TA 1WUVA 1MQTC 1X7NA 2OIIA 5LK5A 2W94A 3C2UA 3Q8EA 4OHXA 2FDHA 5A80A 4Y5TA 3OYWB 3VZJA 5BV6A 4LNVA 1H2NA 1D4M2 1K45A 2QCSB 2R073 2XGXA 5LBEA 4E4SA 3J7LA 5FUIA 4M0NA 3QH6A 3WDYA 1C28A 1N1VA 4FCAA 3OG2A 2W5FA 4QD2A 1QOTA 4FVVA 3MBWA 3F2ZA 1JZ7A 3VHPA 3HJRA 5F3IA 1AYN2 4XBLA 4Y1YA 1ND2C 2WT0A 4CEWC 2VCAA 4OHWA 1MS0A 4LKSA 1VBE3 1GOHA 3VGIA 1LGBA 1W8HA 3U4XA 2E51A 2W08A 2WBKA 2WZR1 3NV4A 4CPBA 2JB4A 1LESA 3PJYA 3B9CA 1CD3G 5B4XA 5L73A 3BYWA 2R071 5LW9A 1QOOA 4LE3A 1GZTA 2VUAA 1UXXX 3U11A 1W6PA 2WT2A 2GC1A 2VCBA 2R49A 1W9FA 3I3BA 4SLIA 4WM8B 4ET7A 2DFCA 1R64A 1RUI2 3M2MA 4PLMA 4XMIA 4YVWB 3EB7A 4CEYC 4UFJA 4CCCA 2WNUC 3I7DA 3ECQA 2VCMA 1TME3 3T09A 1SBEA 4XJ9A 1WA4A 1OA3A 3VDCA 4YG0A 1IQAA 1VAKA 1J1LA 1LODA 3MIDA 5FOJB 1LGCA 1VMHA 2ZJCA 3NV3A 3INAA 4K21A 4MG2A 4TN7A 5ACA3 2D6NA 5BNOA 1BYHA 2WYSA 1YFUA 3FLRA 1R1A2 5DAVA 3ILRA 5FXZA 4SBVA 5DZFA 3UT0A 5F2WA 3E1F1 3AYEA 5JIUA 4FXKB 4NIIA 2JDAA 3QCWA 4IERA 4YM1A 2ILMA 4A2UA 1I9RA 2BZDA 1AYM1 1OI6A 1X36A 4FPLA 4JQTA 4V2VA 1CJDA 1TEIA 4RN5A 1RMU1 5IVVA 5FPZA 5FP8A 4OUSA 5KHJA 4LBQB 4AFDA 4B8EA 1GP4A 3H8UA 5ANQA 3W59A 1DYPA 4PDWB 3OBZA 2GC0A 2ZX0A 4DXZA 2XJUA 2WA3A 4OZOA 4QGMA 1WWYA 1YUDA 4JGZB 3WSOA 2YFZA 5DAQA 1IG3A 4CCKA 5BUVA 3U37A 2FQPA 4IEOA 3D4KA 1BQPA 5FZOA 4CXYA 2GDFA 1F5FA 1FATA 2ZGMA 3BVCA 3PDQA 1RUF2 2CAUA 3VBFC 1RTVA 1PIV3 1HQLA 3DEMA 1BEV3 5F37A 3JZVA 3FHQA 4JHTA 5K7PA 1G9BA 1UX7A 3MLKA 4L8QA 5IATA 3R6SA 1MS5A 1CVNA 3ZXDA 1DP0A 5BXXA 1LECA 3KVAA 4Y22B 2W9XA 3PUHA 1PX3A 2J42A 3ZFFC 5M0TA 4D6QA 2KM2A 2QZ2A 4JQRA 1LOBA 2EIBA 5D21A 2HWF1 4CDWA 2E7AA 4ZU4A 4I0BA 1Y3TA 5C9AA 1NCQA 2WO1A 3RYKA 3U07A 4EN0A 2J1EA 4ZU7A 1EPZA 2Y6FA 3JUUA 3L9JT 2JDKA 5ABJB 2C4XA 3AVRA 1QMJA 4DRRA 1H6YA 1G9DA 5APAA 3VBOC 4QHZA 1CIWA 2A3YA 4MV2A 5A7NA 5I93A 4FPYA 3HAGA 2WNUB 3NJYA 4LO8A 3ZYPA 5C6CA 5KC5A 4MX3A 2A75A 1BK1A 2NN8A 3K3OA 1ULGA 1RYYA 5F8PA 5A6YA 5HV0A 3E5QA 4W8JA 1REDA 1F4AA 2BOJA 3H9AA 5FZMA 1I6XA 2CTVA 4Q29A 1RUNA 2P4EA 4BLJA 3MFAA 4QU2A 5FJHA 2WDBA 1JU3A 1ULDA 2MHFA 3ZXFA 2JG9C 1VBD3 2OXBA 1OLME 1S0BA 3NJZA 4FBFA 5E89A 4ASLA 4YZ1A 2E63A 4BK5A 2ZX1A 5FBJA 2PHLA 3OBTA 3OD0A 2UURA 4A6SA 4Z92B 4C1XA 5CFCC 2ARAA 1SFYA 3SMHA 1A78A 4BZ4A 1W8WA 3AJZA 2W0XA 3EJKA 4QXKA 2FDJA 3VDDA 3PIGA 1UX6A 4HKOA 2JECA 4BPZA 4F83A 2QKDA 4CDQA 2VM9A 4UBGA 4CE8A 2D98A 1XU2A 2ATFA 5IVBA 1KXGA 1TE1B 3M8LA 1KDKA 3S30A 4ASMB 1ULPA 1PZ9A 3RJRA 5CKQA 4CUGA 3POYA 4H55A 2JJ6A 4XUNA 3ZFEC 1W9WA 2VVDA 4OI2A 5LATA 2DTWA 3WW2A 5JDBA 3WG2A 2Y60A 3VN4A 3FL7A 5IVYA 4KWJA 2WIIB 4FPCA 2W92A 4LPLA 1LEMA 3I97A 2HWD2 3ZYFA 1UY4A 1D2SA 2B5HA 5E1RA 4AOCA 4COUA 4A7ZA 2XWBB 1R1A3 2IXHA 2PHXA 2RHPA 3JB8A 1Q8OA 4H14A 2YBSA 3C3VA 5A6ZA 1IG0A 4BDVB 1DG6A 3PUAA 1AUYA 2R16A 1B35C 2JIGA 5FYHA 1XJAA 2AEZA 4E4DX 2V5YA 4AL9A 1AX2A 3TEXA 2PHUA 5F1RA 1FV3A 4IV1C 1C4RA 1S0JA 2HEVF 4IEXA 5FTTC 5SV5A 1XNAA 5T5PA 2D6PA 1PGSA 3JQWA 4YG3A 1VMFA 2BUKA 2A5ZA 1PK6B 4B4RA 3LE0A 1G6NA 2Y8KA 4D94A 5FZFA 4HXCA 1GNHA 3AP5A 2AREA 1NCRC 1Y9QA 2A3WA 1L7RA 3M70A 2HYXA 4Q26A 5E88A 1ZRFA 4XURA 4FTSA 4ZS2A 3PTRB 5LCWL 1P8JA 2HWD1 5FP9A 2FD8A 2XL9A 2RR11 1BXHA 3OBRA 4W6WA 5LK7B 1XQNA 4IV3B 3NSTA 3H8OA 2OS2A 4GWMA 3RFRA 4BQWA 3PNAA 4QXCA 3VDDB 3ZSKA 2QQPA 5T5JA 1H1MA 2R1BA 3T2OA 2Z5WA 4CRQA 1JOPA 1IOAA 1XNKA 3SKJE 2VG9A 4J1XA 4XQWA 2BGCA 4GKYA 1VR3A 2G9ZA 4IEWA 1UU5A 5CVRA 5FMOL 1LOGA 5FYVA 4AQ2A 1JYTA 3H3LA 1GWKA 1QJEA 1N1SA 1YXWA 5LASA 4D7SA 4XDOA 3PVEA 2CSGA 5C71A 4ZU5A 2ZGSA 3WV6A 3WG4A 3LA3A 1OUXA 4RR3B 1NCQC 2P3YA 1AXYA 3I3QA 1TQ5A 3ZXKA 1M4WA 1XRUA 1AL23 1GICA 1PIV2 5SV8A 3WLUA 1JUIA 1N1YA 1SLAA 4AQTA 5K9YA 2V73A 3FLPA 4HOOA 1PO13 4YW5A 2YGMA 2E26A 5K0UC 2C6SA 3U4SA 4KMQA 5LBCA 1EAH3 4P08A 1AXKA 2D6OX 1RUD2 1RVF3 1W03A 2P6CA 4Q4V3 4QX5A 2PFWA 5F5IA 3VL8A 3JD72 4BM8A 3KV9A 3IM0A 4LTAA 1AR91 1HRI2 2EAAA 1WW4A 4PI2A 4YM0A 4YGDA 4NIAA 4C1WA 1HRV2 1H8TB 3UNPA 1OF4A 2J1VA 1XE0A 1JODA 1VBB2 2D97A 4UYBA 1W05A 1IZ3A 2B45X 4U2AA 4BCUA 4DMIA 3LFMA 2RV9A 1FT9A 1X33A 2Q1ZB 2D5HA 2ZX4A 3FFZA 5A7QA 4R9DA 2UWAA 4Q4X2 4D6SA 3GZEA 1DGWA 3POEA 1TMF1 1CIYA 2WNVA 3JBG2 5DZGA 3LA7A 5ACA2 2OQ7A 5A3NA 1DCSA 3GZUC 2ZMLA 3KCYA 2ZOEB 3ZSEA 5J7MA 1QJZA 4NJ4A 3Q8CA 5CADA 3MZHA 5HCFA 4O9EA 2VMIA 4YW4A 4XEZA 5C4WA 5AC93 5F9TA 1SLTA 1STMA 1PZ7A 3MW2A 1COV1 2MEV3 1Z7S2 1WD3A 1L3JA 1MEC3 1W8FA 3K2OA 4N90A 5GZFA 4EN7B 5KXCA 1AR72 5DABA 4RL7A 2DVFA 2CHHA 3O1OA 1NQDA 3WF0A 5BNNA 1YI7A 3GGLA 3ZYBA 4M4PA 4MHUA 1SFNA 3T0DA 2HWB2 1F15A 5FZ9A 2ID4A 2PTMA 2RVAA 2ZGQA 5I91A 1W6MB 1JZ2A 2FDFA 2VD7A 5A3TA 2XH6A 2ZX2A 1OXCA 3SH3A 1B09A 5I0DA 4QGLA 4LOTA 3VKFC 3GM8A 5JXIA 2VTXJ 2VMGA 3I4IA 4LITA 2EALA 2F6BA 3AKRA 3NNJA 3V64A 4B7KA 4BYYA 4ZY9A 2GNTA 1MVQA 2VH9A 4AE2A 3NV2A 1D4M1 1WW6A 5CKMA 2OPKA 4QPIB 5KR7A 2P5BA 4E27A 4IL7A 4Y1VA 1CAWA 4GJZA 5IFTA 2HYKA 2E6VA 4AEDC 4C0BA 1WCQA 2D7FA 2F17A 4IV3A 4QPGB 3OPWA 4UAPA 4CU6A 2RDQA 1GZCA 1JOBA 3HT2A 1UKRA 2PN5A 1OQDA 1ENSA 1XBFA 3MIHA 3OY8A 4GMP1 1GSLA 3BTZA 3FFQA 4QB6A 5HCHA 3ACGA 4AVTA 4AEDB 2LRPA 3SKVA 3AMHA 3ZYRA 2WQ8A 5FP4A 1SHWB 5E16A 4BIOA 5A3OA 1GZWB 3SISA 3CDZB 3ZFEB 1WLDA 1R083 5FXVA 5LBBA 1QDOA 4MXWB 2BQPA 1A6CA 1V70A 1ULOA 1GWLA 2XBO3 3WY6A 1GQGA 5JPMB 1SBDA 2VO5A 3DXUA 1ZZBA 2DURA 1NAEA 1WZXA 4QAWA 1V9U1 3NL1A 5JXHA 4X8NA 2VNGA 5KXEA 2H6CA 3GZTB 3ZMNA 2WJSA 5CISA 2ZGUA 4P02B 4X8PA 4XZPA 1WCUA 1ZZ7A 4LIUA 4AI8A 3OB8A 3POWA 3FN9A 3VD4A 4COVA 4IQPA 2IXIA 5JAXA 4QU1A 5J37A 2B8MA 2VAUA 2EIGA 2ZGRA 1UOBA 1QOSA 2HWC1 2XJQA 4IE7A 5CFCA 2P6HA 2YB7A 4NPRA 1MZEA 1UWWA 4AHYA 1AL0G 5A32A 3I3DA 3GBFA 4FPEA 4YGBA 4FI9A 1S2BA 4KBZA 2C24A 4XJUA 4NPLA 1QJU3 1YNAA 4PCRA 1C8M2 5DAWA 3X29B 5FO9B 3UJQA 3TNQA 3I3MA 4BOWA 4TSVA 1LHWA 3BPSA 4TZDA 2YXSA 4Y5SA 1SLBA 4N53C 4NIDA 5F39A 3VBSB 3WT3A 3BOWA 4LO5B 5HBAA 1MPXA 3A21A 1VAVA 1CJPA 2VTXA 4Y5Z0 1HJGA 1YIPA 3G6JB 4FTBA 4UFKA 2G4IA 2NYYA 1UYYA 2VULA 3AP4A 4L9BA 1JXNA 2W2IA 5LB6A 4EE2A 1DGRA 2X09A 5B4NA 4ZHNA 5FPUA 1YCIA 3LSDA 1IPJA 1RJ7A 2BFUS 1Q56A 2DUPA 2VOWA 4O7XA 3IIAA 3POGA 3UKTA 4BXFA 4BQ2A 5FYTA 2JG8B 3MGUA 1G9FA 2QQIA 4P9XA 1VB2A 2B39A 2XBO2 2P37A 3ELNA 2LUWA 3KMHA 4TWTA 5IJRA 1SZBA 3Q8BA 5A1AA 3T2PA 4LBNA 5FKBA 2X5IC 5CBLA 1E5IA 4DEVA 3ZO0B 1QU0A 2QTWB 3WF3A 2IFWA 2EAKA 2JWPA 2WQ4A 4J6GA 3P6BA 3LF7A 1ENRA 3V56A 2WZEA 2C0ZA 4JKLA 4RGGA 1ODNA 2WN2A 1HKDA 2PHDA 4KL1A 1G7YA 1EV12 1LOFA 4UXAA 1LB2A 4YVSA 4BQXA 3J7HA 2Q4SA 3OEBA 5FMOS 1Q8VA 1C57A 1IGOA 1GOGA 2PYTA 3PTYA 1OKQA 5A6XA 3K3NA 1BVP1 2QQMA 4PF5A 4JRLA 5F2SA 1C3HA 5F3CA 2WLPA 4FP2A 2GNMA 2JDZA 2Q0AA 1WLTA 2FCUA 4LLFA 2W46A 4QQOA 4CVUA 5C70A 2IFRA 4Y20B 3MF6A 1SDWA 1PGL2 3ES1A 3VDAA 4GH4B 5DZEA 4OQ9A 3ZXJA 2Q30A 1W6QB 2TUNA 1RHI1 4OMDA 1Z0HA 5JI9A 2DUQA 1CZVA 1RJ8A 4BA6A 4WM7B 4AVVA 2ZTNA 2W68A 1REEA 5ISLA 5A3WA 1ND2A 1Z78A 2HBTA 3ACIA 1TMF3 4RHV2 2A3XA 2PAEA 1AF9A 4I09A 1ST8A 2W47A 3LD8A 5CKNA 4XCAA 2GALA 2OT7A 5FZAA 3RWNA 5DUWA 3BODA 1CWPA 2DU1A 5FYUA 4KU7A 5FCCA 3EMRA 2XHNA 2JG9B 4YGEA 5K0UA 1DLLA 3KCXA 4W50A 3MIGA 1GANA 2VUCA 2ZEZA 5J36A 2W52A 2WS93 2NMNA 5F5CA 4XF1A 1NKGA 1RXGA 1UL9A 1FPN3 2QQUA 1FNYA 3DV8A 1R092 4KH9A 2YY1A 3WQ0A 1U0AA 1YLLA 2XLFA 4JKKA 1A8MA 3HIFA 3NO8A 3KT4A 5IK4A 4XHXA 3I59B 2HWF2 1SCRA 2K9ZA 2VMDA 3UGFA 1YJKA 3M4FA 1NG0A 2RR12 5ANNA 2BPA2 1JYVA 4JGYA 1X82A 2YC2A 4NAOA 5FKCA 3UESA 5A7WA 4AQ6A 4E2GA 5CIRA 1CAVB 5EIYB 5BNOC 1VBC2 2CU5A 2E33A 3K4AA 4XQ4A 1V6MA 5EYXA 4YW2A 5FUNA 1SG3A 1ENXA 2XVLA 5D8AA 3WQ1A 1AR82 4IEPA 5JPNB 2KD7A 3WUDA 4HL0A 4WVMA 1A34A 1DQ2A 1J84A 3WDVA 5GKAC 5FWJA 3EXUA 4AYUA 4LT5A 1TZOA 1OD3A 4D7YA 5IVCA 2CWMA 3OGRA 1QH7A 5JOYA 4D6RA 3RZKA 2NZ9A 4P00B 1FOD1 1ACCA 1AX0A 2EXJA 4AGVA 3WZ1A 2HEWF 3VB9A 2W95A 4CCJA 1VBC3 4AVAA 4XF0A 2A7AA 3QLQA 1VRH1 2OVUA 3KV4A 5DQ0A 1AR83 1L7QA 1LKNA 4DFSA 3DPRC 3POFA 1F8VA 4OZXA 4IV1B 5TSWA 1GKBA 3UGHA 3ITQA 4Q27A 3PMEA 3VV1A 1MS8A 4M3CE 1B35B 1JYWA 3FUQA 3PU8A 1HQNA 2D93A 2IVIB 4FPFA 4AVBA 2CNAA 3Q9OA 1OUSA 3FC0A 4DOUA 5I0SA 1ZRIA 3T08A 1OOPC 3RZHA 3RVHA 2XHKA 1UIKA 1OVPA 2AZ5A 1PM4A 2ARBA 2QQNA 4L0PA 5H9PA 5JZGB 3LA2A 4JGZC 4FFIA 4FFFA 1GR3A 5FZ7A 1DFQA 4AGGA 3I2DA 2BVVA 2D3PA 4RFRB 4B4QA 1FPN2 1QH6A 3H1MA 4XDPA 1R093 4WV8A 5CYYA 1K5MB 3FWEA 4HBNA 2CL2A 1UZWA 1MS9A 1OOPA 4TYSA 2EVXA 1WMFA 3BPZA 4Q4Y2 4E4HA 4YFZA 2DF7A 1AJKA 3N36A 4GZ9A 3DPRB 2A6VA 3N9OA 1J59A 2WZ8A 5LRRA 4QB1A 3QACA 4Y1ZA 3KGLA 1QJFA 2GH2A 4RQPC 5DN2A 4XOGA 5EYYA 5H9SA 3ZXLA 2QE3A 2GC2A 4QQHA 5JUVA 2A6ZA 2J22A 2XMLA 1DQ6A 4Q4Y3 3UKVA 3ZN6B 4CPBD 1XE7A 1S0DA 3WNKA 4UW6A 3TYJA 1ASJ1 2VJXA 4NO4A 4DY5A 4NRPA 3R05A 4JDNA 1UD1A 2EXHA 2Y0IA 3C7HA 3EHKA 5EJZB 5FMBA 4ES9A 3KS7A 1OBNA 4YW1A 3J9SA 1A3KA 2Y33A 3RNSA 4KWKA 2ZACA 5FPVA 4N9IA 4OI0A 1OH4A 2I2SA 5FZOB 3FZ3A 3JD73 3O7OA 1UYPA 2ET7A 4S2GA 2I74A 2QQVA 2AACA 2YC4A 1O3QA 3APBA 1ZM1A 4MYEA 1ZBE2 3RWKX 4GULA 1S0GA 4CDUC 2VZRA 2VW1A 3L2HA 3A7QA 4M0HA 4P5YA 5HXMA 3CKHA 3KVBA 3KT7A 1W8TA 3OUIA 1O3RA 3BTXA 1CX4A 4PBPA 3J4UH 3MPBA 2PXJA 4J25A 5C3SA 3I59A 1V6JA 4IW3A 1WW7A 1ZNPA 3TN91 1UYXA 4B3NA 1NZCA 3IWZA 5A3LA 2FDGA 3M7AA 4P14A 2XLGA 1W6OA 4A45A 1JYNA 1MS3A 2E7QA 4XETA 1XE8A 2CAVA 4C0HA 4LORA 1FPN1 4FQZA 1V0AA 1YEWA 4QHOA 4RS5B 5A7SA 5A7PA 1MS1A 1KDMA 1SLCA 2ZGLA 2QZ3A 2VZQA 2WFF2 3O0XA 5JI7A 3HMYA 4YYOA 2MNGA 2VGDA 1XSRA 2ZGKA 3KV6A 3ZKUA 1ZA4A 2C26A 4GAZA 3ZPOA 2HWD3 4NVPA 4CU9A 5FY7A 4NMIA 4GH4C 5D1IA 4ARYA 1WMXA 1IKQA 1RHI2 3WNMA 3EO6A 4GB31 4CUAA 4EN6B 2WL1A 2DCYA 2GP5A 2VTFA 4ZPIA 3FMGA 3CJIC 1RUE3 4C91A 3PURA 1JN2P 2AYHA 2VL4A 4XABA 3AL5A 1UMIA 1QXJA 2X10A 2VQTA 5FZIA 3HWJA 4JV4A 4BLIA 3USSA 1U5YA 1RITA 3AZZA 4UT5A 5J09A 1QIQA 3LAGA 2DYCA 1AR71 2VOKA 4LK7A 4KGQA 5FY9A 5FPXA 3JU9A 5FBZA 5DDJ2 3HBZA 4FAGA 2BNNA 4HFSA 4Q8KA 3VZLA 3ZKYA 3VKOA 1W9TA 2ARCA 3MICA 3O14A 4RA0A 3B5LB 1FXZA 1NYWA 2LALA 4IESA 1XYOA 2WNEA 1XYNA 3M3IA 3A4UA 5GLUA 4ZS3A 3WF2A 4GWIA 2ZMNA 5FZDA 4J1WA 4NR1A 1CPNA 1RUF3 5JSOA 3J8F1 1H1IA 4GD4A 2XJTA 3WOGA 3RI9A 3VD5A 1OSGA 2WS91 1RMU2 1HV0A 3SLIA 1RUI1 5EFUA 3U1XA 2OA2A 3HN1A 3T1LA 1VLNA 1IS3A 1CAWB 4Q8LA 2BGPA 1OT5A 4AFCA 3BCWA 1IS4A 4MGKE 2ZKNA 4C8DA 4EWEA 2WN3A 3S0MA 2HLEA 3MIBA 4YM2A 2JD4A 4QMAA 5FY8A 4CEYA 3NJXA 1JZ3A 1V6NA 2YBPA 1D4M3 5DUXA 1QJX2 1V6KA 2TBVA 2ZGPA 3VLBB 4AEMA 5A3PA 4OULA 1O5UA 4P9WA 2X05A 4COYA 4BB3A 3T2TA 4LK6A 4A44A 1W6MA 4CUCA 3WVJA 2R7EB 5J3UA 4I2OA 4YARA 3IDAA 4QM8A 1NLSA 3MPPG 1XOYA 1DQ5A 3ACLA 4K3UA 2VZVA 2R0FA 3H1WA 4LOSA 5DAPA 4AFMA 3WHTA 1KJLA 2H0VA 4BQYA 1W0NA 2E31A 4XXAA 3VZMA 1QJY1 2ZA9A 4U36A 2IXJA 1OLQA 4XFCA 5GJ6A 1S2EA 2HWE1 2LS6A 1PK6C 3HEIA 1F4HA 4JDOA 4LBLA 4PLNA 3BKZA 4M00A 4AHXA 2BP6A 2GNDA 2O0OA 2PLV1 5FLJA 3BN6A 4MH0E 4CDXC 3S5AA 3PUIA 3TOJA 1BBT2 1DDLA 1XSQA 5G04L 5JOZA 5GALA 1K5JA 1RUG2 4UF0A 3N7LA 4PF1A 1Y9GA 5LBFA 1H6XA 2O8OA 1YFWA 1WCKA 3OF1A 1WGPA 4DXSA 1OH3A 2BRTA 4QKFA 2JB8A 5BNOB 2GN3A 4WVMB 3ZR5A 3H42B 1PX4A 4QKNA 3N7KA 4UFLA 3WP6A 2BBAA 3QOPA 4CDXA 1VBD1 4YGCA 1S1AA 1CPMA 1J3RA 2V72A 3C8XA 3IPVA 3N9QA 4K20A 4UFHA 4DUWA 2BGOA 2DFBA 3GBWA 4FOQA 2HWC3 5KWRA 1UY1A 5FK7A 3O1VA 1RL3A 2C1FA 1PMHX 4Q4X1 2R30A 1POV0 1AR63 1XPWA 4TXWA 1US2A 3IDCB 1J1TA 1X8MA 2PAMA 5A7OA 4E8CA 3P5BA 1PNGA 5A33A 3B93A 4R52A 5LA9A 1YHFA 3N4MA 4P9LA 4YLZA 2WNOA 3I54A 4ZZ8A 4K8FA 4LUMA 5G05L 5ERLA 1RUG1 3VDBA 2PQSA 2P34A 4S2DA 1TNRA 1SDDB 3ZFGB 4IV3C 3RQ0A 4GB33 2BU9A 3LOIA 5AC91 1J3QA 3ZX7A 2KR2A 2RS52 1RHI3 3F95A 3MUZ1 4HSLA 4COZA 3OOXA 1RUE1 5L9BA 4RR3A 4WVZA 1NE4A 3RI8A 4HVOA 1EY2A 4PJYA 4WM7C 4QB2A 3NAPB 5JXGA 3N9PA 3ZFFB 5KXBA 4N8MA 4CA9A 4LQRA 1IQDC 5FFOC 1DF0A 1V9U2 1RUD3 1RVF2 1KFUL 1U5IA 5JR2A 3IIIA 3ZDSA 1PMJX 3D0SA 1NCQB 1AZDA 4L92A 1EP0A 5EWSA 5IT6A 4LULA 5FLIA 1JI6A 1XXNA 2JXAA 3GJBA 4W4ZA 3WP5A 5IW0A 3ZFGC 2PHWA 1KD7A 3GHNA 5DDJ3 2BOIA 4MGZE 4MGTA 4K1YA 2V5DA 3UYJA 4UW3A 4LBKA 2XQRA 2HWC2 3WDTA 1SLLA 5IWFA 1UOFA 3EYPA 3R4UA 4KQ7A 3AYAA 5FY5A 4JVAA 1OMIA 5HV4A 3W5MA 3AL6A 3LIHA 5LEJA 3CHXA 3S7EA 5FZBA 2JKXA 3BIWE 3C7GA 2XJRA 2QDNA 2JG8A 2WRAA 2FMDA 3DF0A 1RUI3 2O14A 3VD3A 3H8RA 5J1XA 1W2OA 1XB9A 2VZ3A 1ZVFA 3FHIB 3RJ2X 5C9AC 1VIWB 2W1WA 5ACA1 4IEYA 3PLQA 3AZVA 1N1TA 2BEOA 4CSWA 4AI1A 1JZ5A 2NP0A 1NA1C 4YWAA 3SEEA 2WZPP 4DZGA 1LOEA 1OLRA 3PL0A 1D2QA 2UWCA 5CNAA 1LNSA 3ETQA 3K77A 3U10A 1UZVA 4DPNA 2Y0OA 4Z07A 2VXRA 1ND3B 1C5IA 2IZWA 4HVRA 4LBQA 1I5PA 1YRZA 1HRV1 2HH9A 2VBDA 2JDHA 1ZZ8A 5FAXA 1WKYA 4UOJA 2HBUA 4AI0A 4URTA 3POSA 4I3PA 2GNBA 1MACA 2V09A 2SBAA 5FV3A 4Y26A 1S0IA 2RJ2A 3CJIA 5IYYA 4N53B 1ZBE1 1ULCA 5DG1A 3UKNA 5FP7A 3P3PA 1RVF1 1UAIA 2BW8A 4NROA 1SFPA 2Z69A 2Q1MA 4D7TA 1GOFA 1T6BX 1CR7A 3GJAA 1UZ0A 3E6DA 1WMEA 2Y6HA 4PLOA 5FJKA 2WO2A 3CU7A 4ASKA 4LKEA 1HRI3 1HN1A 2XJPA 1CAUA 4MUVA 4OFGA 2JKBA 4QQLA 5A7WB 4CEWB 2NLRA 3KCCA 1PGW2 3B01A 2RM22 3MIEA 3OUHA 4PIXA 5BNNC 3DN7A 4KBBA 3NVCA 4P9GA 5EV7A 5JWPA 4COWA 3B9IA 5BNPB 4UFMA 4XF4A 1YQ6A 4L2NA 1E5RA 2BJSA 2V4AA 3H1YA 4IE0A 4XYXA 5D8AC 5IUQA 3TEWA 3ZSJA 4MHRA 4PI0A 3HNYM 3S7IA 4RS5C 3USUA 5E6HA 3VL9A 3RSJA 4Q0VA 3H7JA 2XR4A 3LWCA 1XNTA 4Q4V2 5IAVA 4XFFA 1LHOA 4Q0QA 3H50A 1DZRA 4HONA 4L99A 2R063 4LHLA 4EV0A 3OGSA 3VBUC 5FMCA 1E57A 1WCDJ 3ZPYA 4LBQD 2CGNA 4CDWC 4Y22A 4LKFA 4HVQA 1YWKA 2C5DA 4C90A 2ZX3A 4YRDA 5HI0A 1QQP2 4KGGA 3O1PA 4LHNA 4IGPA 2ET1A 1JMUB 3K75B 1KITA 2FMYA 5I0RA 3VBRC 3JBG3 5CFDC 4AFBA 4YW3A 1D0HA 5JZGA 4IE4A 4XPVA 4Z8BA 1VAMA 2B4KA 2A71A 4DB5A 5IVEA 1BBT1 1RUJ2 1O91A 3LDKA 4XJ8A 3HNBM 4AHZA 4LA3A 2H6BA 2DV9A 2WWJA 2Y34A 3MLLA 4QPIC 3CO2A 3KLSA 1NUKA 2ZS6B 1CAXA 2NPIA 2QQKA 1L7LA 4P5HA 3VZKA 2VZ1A 3MUY1 3R4DB 3CJXA 4AI3A 4OHVA 1GU3A 1H4HA 2C9AA 4EWDA 3ZM8A 1H9WA 4GB32 4Q5OA 4DXTA 4HKWA 2QJVA 2X5IB 1R091 4A3XA 1ZX5A 3NNMA 4IV1A 4CZSA 1IPSA 3AKSA 4BWOA 5ABJA 3J7MA 1PGW1 1D0GA 1YC61 2W91A 4GMP3 4UBHA 3T4HB 2VOXA 1QNYA 3A0NA 5GZEA 4IEUA 5FZ1A 2WABA 5F6KA 1N3OA 1F35A 3LB9A 4A42A 4F8AA 2ENRA 1QGLA 4AXOA 1DGRN 1HX6A 2D3SA 4ZKTB 1OD5A 3NNGA 2Q8EA 5BNNB 1NQJA 1UPIA 1VBB1 2R062 4AWDA 3POBA 3VBHB 2GSYA 2D44A 5C3QA 4E4ZA 2P17A 1WBLA 3VBSC 1BZWA 3VBRB 2XUEA 1RUG3
chains in the Genus database with same CATH topology
4D3WA 1HW5A 4HK9A 2TEPA 3CJIB 1QNWA 3MW4A 4FPJA 3J8F2 2BNMA 2ARXA 4FPKA 4JTOA 3RMYA 3WDXA 5CG8A 4XF9A 3EBRA 5KHHA 3GBGA 3GF6A 4BH9A 1LHUA 2VOVA 1H30A 3ZSLA 2Z2SB 1QF3A 4RHV1 5L19A 4H3WA 5J48A 4AEJA 1S0CA 4MGIE 1FI2A 3OTFA 4ISQA 3SXWA 1Y7BA 1RUF1 2QFEA 2CV6A 3MFCA 5DXDA 4JGYC 1APNA 1NCRB 2OYZA 1C8M1 4FPGA 1GZWA 3RYPA 2NM1A 4OI1A 2AENA 3MYXA 4DS0A 1SEFA 4O9GA 4XFHA 1PM7A 3AXEA 2VU9A 3ILFA 3E97A 4Q2FA 1H0BA 3E6CC 1VBE1 2VVFA 1PMIA 5EZWA 4DNYA 4CYDA 4XJZA 3ZVXA 1XNCA 1RMU3 2D6KA 3AZWA 4K9SA 1PO23 3OGGA 5C8CB 4A7KA 4YSFA 3VBRA 4GMP0 1VBA1 3MF9A 1JW6A 3VKNA 1AR62 1XNBA 2DU0A 1GQHA 1NA1A 1DGWX 2ZGOA 4W65A 1CAXB 1OFNA 1AYM2 1EV13 1PO22 2JEMA 1YJLA 1PGL1 5HCAA 4CDUA 3H7YA 4M3CA 4HK8A 3VKLA 3ZYGA 5T3NA 2XKOA 3B00A 5KHIA 1V00A 3V0BA 1UW8A 4CP1A 2JENA 3WP4A 5GZCA 1K5MC 1UKGA 3TAYA 3TNPB 5BNPC 2EXKA 4Z2WA 2E9QA 4GWNA 2DTYA 2IXKA 2I45A 5AFBA 1GYKA 1AYN1 4LO4B 1T6GC 2UY8A 3AK0A 4FOVA 2R0HA 3NWKA 4PDWC 4N7IA 4OUMA 2GZWA 2OZ6A 2QDRA 1UU4A 3KQRA 1RUJ3 4HMZA 4QM9A 1BJQA 1YFYA 2BFUL 2PLV2 4B29A 1DGLA 2ERFA 3B7MA 3M3QA 2YC0A 3FBYA 3OGJA 2YZ4A 3VBOB 1COV2 1DHKB 1LU1A 1W0OA 1CAUB 5GZGA 4R9BA 3ZXEA 4ISRA 4JRAA 1PVXA 4XDQA 4XJAA 3MDPA 3UL2A 1PZ8A 3RDIA 5C33A 3OJBA 3VHNA 2R041 4OHZA 5GM0A 3CEWA 3ZYIB 1VBA2 5C8WA 4RQPB 5DUUA 1G9AA 2NMOA 5FRAA 3WHUA 1WW5A 3RPQA 4XE9A 1S0EA 3O5SA 2SLIA 1Z7S3 3IKWA 2GMPA 2UYBA 4X6QB 3WG3A 3ZFEA 3L2YA 1ULEA 1AVBA 4DINB 3WINE 5T50A 4BHPA 2XVGA 4WM7A 4NN0A 1VP6A 1O5LA 2D6LX 1CONA 1PVC2 2XLAA 2D6MA 4X6RB 4Y24A 2A6YA 1DQ0A 5DG2A 2P2KA 1DU3D 1LOAA 4QPGC 2GN7A 1RUOA 4AVSA 1AR81 2VNOA 3EQEA 4FOYA 3IDBB 3IBMA 4IETA 1FV2A 4RHV3 2BBVA 1HXS2 1X8EA 1MQTA 3PJQA 3VUOA 3RZZA 1LENA 3FE5A 1W6QA 5FOBB 1ZRDA 2PA7A 1RUC1 4I30A 3TWIA 2GMEA 2YHJA 2ES3A 4YNIA 2R32A 1O3SA 3J8F3 3AMPA 4CTEA 2VECA 5CA6A 4FPOB 3VKMA 3V0AA 2PELA 1ZZ9A 2MEV2 4W6YA 2RS31 4LBJA 5H9RA 5GLVA 3I8TA 1AR61 4XFIA 2DWRA 1ZRRA 2JX9A 2XJSA 2VPVA 2BWAA 5K8SA 4Q0SA 3CLPA 2MPFA 3JQXA 3WR0A 3E5UA 1GZ9A 4PQ9A 2DCTA 1VJ2A 4P9YA 2E53A 4PDWA 1MZ5A 1RINA 4I3GA 3ZSMA 3PHMA 1ZZCA 3TN92 2WSUA 1B35A 1NLRA 2HJIA 4JGYB 1MZ6A 4EN9B 2GAUA 3NV1A 2IWGB 3TRSB 1QXPA 5FO7B 3VBOA 2RMU3 2D3RA 1S55A 4BQ1A 4MVTA 5A32B 1KRIA 5J96B 1BMV2 2E7TA 1W6NA 3NKTA 2FBEA 4CEYB 2ZGTA 4XXPA 3O12A 1HIXA 5KHKA 1G8WA 4FOWA 4Q1RA 2WKKA 1NXD1 2LM3A 2EXIA 1YYNA 1TMF2 2WNVC 2VMHA 3JBG1 1MEC1 1FX5A 2BTVC 2XUMA 3KZ4C 5L7OB 3WG1A 1UN1A 5I0TA 1HLCA 1DBNA 1OPMA 2ZAAA 4QPIA 3WD5A 4BMBA 3CF6E 2GMMA 4K1ZA 2WC2A 1AL21 5HCBA 3ASIA 5I0UA 1IHMA 4ZXKA 4BE3A 1PO11 1VALA 2X8KA 4WVWA 1JUHA 4JDMA 1ZBA1 4AEKA 2RE9A 1HQWA 1LOFC 1RGSA 4IEVA 4Q4V1 4YVSC 2ZAHA 3RYRA 4KG0A 3WCSA 1N3QA 2WLQA 4N43C 4ATFA 2VUJA 2UWBA 4QQPA 3DPRA 3BU7A 2CYFA 4G4FA 1JBCA 1Q8SA 4Q4W1 3AKPA 1DQ1A 3MIFA 2WINB 3TBDA 4JTNA 3W9AA 1SCSA 1O4TA 1QJU2 3D82A 1DIWA 5JSRA 1FMD2 4XFGA 2ZCWA 4RR3C 2ZZQA 5C4WB 3ILNA 1V6LA 4CDUB 5F6LB 4M3CB 2H0BA 4INDA 3WCRA 1RUD1 1CQ9A 1C8NA 4QPGA 2YROA 4AQSA 5T52A 3SCGA 3SHRA 4ES8A 4GA9A 2OUHA 1LU2A 2Y38A 4EROA 4F3JA 5FLHA 3IMNA 1U5XA 1QXRA 1F2NA 4ONUA 3ZFGA 1FOD2 3AM2A 2EF6A 1DZTA 3AFKA 4XHBA 4AW7A 4E9KA 3D0JA 3K48A 3G7DA 1QWRA 4IXLA 1MR5A 3KD4A 1LOCA 4R9CA 2ZABA 3FJSA 2VVEA 3NAPA 1QHDA 5GLWA 2Q5TA 1H4GA 4FT8A 1ZBE3 4HN0A 4N43B 1H8TC 1LHVA 4I01A 1D4VB 2AGSA 2G9GA 1C8M3 1CAVA 1ND3C 2XL7A 3RMXA 1KJRA 2O8QA 3GNEA 1AR92 1HRI1 3VBFB 1ALYA 3H3ZA 4XIKA 5CU1A 1FMD3 1H8TA 1QJY3 2DCKA 3KSCA 3JCIA 1UZYA 3WW4A 4GKXA 5GLZA 1XNDA 3IN9A 1PIV1 1GFF2 3PVNA 4RD7A 5T5OA 3AYDA 3VBUA 3OD4A 5JOXA 2ZHMA 4I02A 3OCPA 3MI8A 4FPHA 1PHMA 4L11A 2JICA 4LEJA 1QJU1 4HT1T 1YO8A 4G9SB 4HANA 4M3CF 4M01A 1OQ1A 3DUIA 1ASJ2 4G3YC 2GC3A 4DQAA 1ENQA 4Z82A 1R082 1H2LA 1CN1A 3VZOA 1ZYBA 4FTEA 5LRSA 2WNUA 4META 2BVBA 1J3PA 2FHRA 4Q4W3 5GZDA 5CFCB 1MVEA 5KC6A 2K2SA 2OUJA 2PQQA 3TB0A 3DL3A 4MGYE 3VBHA 1JHNA 4Y1UA 4QT6A 5KHGA 1LTEA 4GALA 4XBNA 3AP6A 3W58A 1LULA 3GYDA 2DCJA 4L97A 2DVGA 3D6EA 4N43A 2RS12 1NE6A 5H9QA 5KXDA 4OLLA 4P9JA 4HPKB 1OHFA 2B9UA 4R4XA 5HXVA 1QQP1 1LRHA 4JAAA 1QY4A 3NKGA 1A8DA 3M1HA 3VBFA 2R1DA 1BCXA 3PMSA 3ZN6A 2RS53 1WLCA 1QDCA 5FO8B 1GBGA 5FREA 2NQYA 5JVVA 4W6XA 1KS5A 5L7OC 5EJ3A 4CP0A 3AZXA 3CNAA 1WMDA 2CY6A 3WP3A 2VNRA 2WNVB 5ABJC 4OI4A 3QBQA 3IPVB 4HKLA 3JB4C 4XF3A 4B7EA 3ZYJB 4Q0PA 1COV3 4EN8B 3VHOA 2IC1A 2RJKA 4HN1A 4WVVA 1RUH3 1S0FA 3AB0A 1RUC2 1WD4A 1O7FA 1FNZA 3KT1A 1NXMA 3M3OA 3SCFA 3OY8B 3AMQA 1VBC1 1Y43B 1EV11 5D8AB 1NY72 4JGZA 1NY71 2QVSB 1Q8QA 4DRVA 2IXLA 2YGLA 2PHFA 2RJLA 4FQ4A 5K0UB 1IPKA 3PVOA 3ROUA 2CGOA 1VB4A 5JZGC 2DCZA 4NHLA 1RUE2 3HT1A 4LHKA 2DVAA 4N9HA 1W6NB 4TLFA 4YFWA 5IK8A 1TME2 1W6PB 3AMMA 5DUVA 3SCHA 3BOPA 4HSJA 1VBB3 3RG0A 2YPJA 2ZMKA 4AG4A 4KWLA 2VW0A 5T54A 3VBHC 3ST7A 3VBUB 4HLTA 3ZMOA 2WS92 2TNFA 3VBSA 1LHNA 4QPYA 4RS5A 4FP3A 3T1MA 3LKJA 3VDDC 3THPA 5BYNA 3E5XA 3PVBB 4YZ4A 4RSUA 1YIFA 4YZ5A 2RS32 5FQ0B 3ME2A 1J58A 5AC92 4MZUA 2N7GA 3KM5A 3WDWA 1AXZA 1KFXL 2DUOA 2EA7A 2YUEA 4AI2A 1VRH2 1UF2C 1SLIA 1XU1A 3AJYA 3GZAA 5C9AB 2CGPA 1U12A 2R072 1TME1 4LO6B 1YI9A 1KS4A 2R043 1LGNA 2K0GA 3FX3A 2UYAA 3K51A 3VZNA 1FYUA 4GXLA 2RM21 2WA4A 2WZR3 4V1PA 3AMNA 1H8VA 1I5ZA 3KGZA 3SH4A 1M06G 4MXVA 4K40A 5FDBA 1GLHA 3MLJA 4YZ3A 5I8SA 2F4PA 3N35A 2HWE3 1POV1 1K5MA 3WQ7A 1BMV1 1QKQA 1SMVA 3S6PA 2Z42A 2JE9A 4EWAA 3N7JA 1SACA 2HWB1 4S2HA 4WZFA 5C8CA 2WQZC 5AVAA 1N47A 4AHWA 2P3KA 1SBFA 3KB5A 4AFAA 4CDWB 2G9FA 4MSVA 4RQPA 1QQP3 1LEDA 5E8AA 4BMEA 3NAPC 2ZHKA 3WNXA 1NA1B 4P9IA 3B3QE 4H7LA 4Y1XA 3TN91 1QJY2 4LBOA 4QGNA 2A6XA 4NHMA 2VQAA 4YZ2A 1G86A 2ZGNA 3JD71 4RFT0 1RB8G 3J26N 5KBFA 4AGRA 1TNFA 1ZZ6A 1PVC3 2R061 4HETA 2R042 3ZXAC 1OA2A 2MEV1 1HXS1 3AZYA 2Q8OA 4B4PA 1Q43A 5JMCA 4IEQA 3MW3A 4ORFA 4S2FA 3SH5A 1AYN3 2XWJB 1UIJA 1WCSA 2B7YA 3N3HA 1V6IA 1AR73 1VBE2 2Y26A 5GLTA 1URXA 3CL1A 5A3MA 3ENRA 1ND2B 1JTZX 1PVC1 3GALA 2P3JA 1S2KA 1HV1A 1G9CA 4CEWA 1Z7S1 3WXPA 2AR6A 4FO9A 1JH5A 2RS13 2HWF3 4FSJA 1R081 5JOWA 3ALQA 4AEDA 2D43A 4CDXB 4D69A 5DDJ1 4I0AA 1AHSA 1SQ4A 3URFA 1IS5A 1ASJ3 4YVWC 1QJX1 2B42B 1OPOA 3DGTA 3R4SA 4Q4W2 3IDEA 1F9KA 3QD6A 3WDUA 5CAZA 4PBOA 3LCPA 3WW1A 4JC1A 4QQ2A 1AX1A 1GV9A 2RS11 1POV3 4UW4A 1WBFA 2R6QA 1UZZA 5I8YA 5C8CC 1DZQA 4PIZA 4I0WB 2WT1A 4UW5A 4AF9A 4LR4A 4XIOA 1OFSA 2HWB3 4XBQA 1PO12 4ATEA 4WZCA 1JYCA 1RUH1 2XJVA 3D5OA 2DVDA 1ND3A 1AL22 5I8TA 4FAHA 3LOBA 1VBD2 1PK6A 3HR9A 2Z79A 1MS4A 4XFAA 4H7MA 2PLV3 2OW4A 2RS33 1MQTB 3LSEA 2BYVE 5AFEA 2YYOA 2ZKLA 1C1LA 1OA4A 3UJOA 5L7OA 4YG6A 4NHKA 1VBA3 2HWE2 3SNMA 2ZHNA 3HQXA 5JIAA 1FOD3 1IS6A 2W39A 1IKPA 2ZZJA 5IK5A 4E2SA 5CFDA 5BNPA 3BTAA 3TN93 1LCLA 1NCRA 2GH8A 1EAH1 2ZPXA 1CGPA 1W2UA 1UU6A 4WBBA 3FBMA 4PIYA 4HZFA 1H1AA 4Y4YA 2HEYF 1NOVA 2A70A 3H0OA 1V6OA 1W0PA 4E2QA 4YVSB 2FZ2A 3V65A 3WW3A 4KG8A 4MLOA 3ZXGA 5J98B 2X53S 4XTPA 4XILA 2RM23 4DY3A 3LZZA 3B69A 1JYIA 2A73B 4CDQB 2ZHLA 1DYKA 2I07B 3FUOA 2YMZA 1REFA 4R8HA 5JCTA 3B94A 4XJWA 3D8CA 4Q4Y1 1MEC2 1BBT3 2LTNA 4N7UA 4WM8A 5LEKA 1LR5A 4YVWA 4AK3A 4XW3A 4KNCA 2GU9A 4Q0UA 1W6OB 4LLOA 3UK9A 1ULFA 1ZRCA 4GIQA 2QUOA 1CESA 1BKZA 1X50A 2OZJA 3V0BB 1XYPA 4CDQC 1N3PA 4Q4X3 5F5QA 1QJX3 5CFDB 4LA2A 3AP7A 3E6BA 5BPXA 2CWSA 1ZBA2 3B02A 1KQRA 3AP9A 1RUJ1 3WX5A 2JG9A 4XTMA 1Q3EA 3BB6A 1H2KA 2QNKA 1UCXA 2RR13 4FXGB 4R4ZA 2ZBJA 5IK7A 2WFF3 2IXCA 3VHRA 2JE7A 1ZBA3 1EAH2 1HRV3 3AKQA 3AYCA 2JG8C 4K6BA 1HXS3 3OPZA 2WFPA 2X5IA 2BNOA 4HPKA 3AFGA 3O0WA 2D40A 1DQ4A 4R9AA 3ZIWA 4BIFA 1O4ZA 1OQEA 1VRH3 2A6WA 2XVKA 4LUKA 4AVCA 1AYM3 1MZFA 2D5FA 1OOPB 1F31A 1Q5OA 1RUC3 3NW4A 3ES4A 1HDKA 1R1A1 2WZR2 4N53A 3BALA 4GQ7A 2X29A 3WUCA 3ZFFA 1FMD1 1AR93 5T5LA 1EYBA 1R1ZA 4OVEA 3N7MA 3ZIXA 3U0ZA 1I1EA 2KXLA 3AX4A 4LE4A 2UY9A 1U5ZA 2UU8A 1GNZA 3DKWA 4IEZA 1Q8PA 3ATGA 2KA3A 1RC6A 2FZ1A 5T55A 3THTA 4A7YA 5CB7A 4YM3A 3USUB 3LGRA 5B2GB 5JLVA 3O0VA 2ETEA