1C5IA

Hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGDFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Hydrogen bonding and catalysis: a novel explanation for how a single amino acid substitution can change the pH optimum of a glycosidase.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 50
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1999-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c5iA00
3VZOA 3AMNA 1YNAA 1C5HA 4S2HA 2DCJA 3MFCA 2BVVA 1BK1A 4XQ4A 1IGOA 3B5LB 3WT3A 3VZKA 4HKWA 2B46X 1XNKA 2B45X 2D98A 1T6GC 1H4GA 2F6BA 2VGDA 4S2GA 1XYNA 2DFBA 2C1FA 4XQDA 3WX5A 1HV1A 1OLQA 3WXPA 3EXUA 3MF6A 3WP4A 1UKRA 4HK8A 1QH7A 5EJ3A 3VHOA 3VZJA 1H8VA 3VZLA 3AMQA 3M4FA 2NQYA 3AKTA 1UU4A 1UU5A 4HK9A 1NLRA 4S2FA 3RI9A 1UU6A 5K9YA 2QZ2A 4HKOA 1XYOA 3B7MA 3WQ7A 4S2DA 2JICA 1QH6A 2NLRA 2VUJA 3VZNA 2VG9A 2Z79A 3VGIA 2JENA 2DCYA 3VL9A 1M4WA 3VZMA 1OA4A 3O7OA 4XQWA 3VLBB 3AKRA 3WP6A 1H4HA 1BCXA 4H7MA 1XNCA 2D97A 1XNDA 2BWAA 2BWCA 3AMHA 5HXVA 1AXKA 3AKPA 3VHPA 5K7PA 2QZ3A 1H0BA 3AKSA 1XNBA 1OA2A 1REFA 2VULA 1XXNA 1OLRA 3WQ0A 2B42B 2BW8A 1TE1B 1HIXA 3AMPA 1XYPA 3MFAA 1W2UA 3WQ1A 3WY6A 3LB9A 1KS5A 2DCKA 3HD8B 3AMMA 3MF9A 4IXLA 3WP5A 3WR0A 3ZSEA 1C5IA 1F5JA 3LGRA 4HKLA 1H1AA 3WP3A 2DCZA 1REDA 1HV0A 1REEA 3VL8A 3RI8A 3AKQA 2JEMA 4XPVA 1PVXA 1OA3A 1BVVA 4NPRA 2DFCA 1KS4A 1ENXA 3VHNA
chains in the Genus database with same CATH superfamily
2VNGA 4EV0A 2G9FA 2RS11 4LO7A 3FHQA 3W9AA 2DVDA 1ZZ6A 1CAWB 3AYEA 1C5HA 2XLAA 1VB2A 1X9PA 2GP3A 2ZX0A 5KXEA 4Y1VA 3LIHA 2HWB1 5A32B 3FLTA 3T4HB 4EROA 4Q1PA 3FLPA 2AEZA 3OGGA 4XJAA 3D6EA 5FO8B 1R1ZA 1HXS1 5FZEA 2OIIA 4AEJA 1SPPB 1W6MB 4META 4AVVA 4P9WA 2XQXA 3B02A 4P9YA 1Q8OA 5F6LB 1H6XA 4K20A 4Y22B 4BM8A 1V6IA 1ZBE3 2WZR2 3TB0A 5A7SA 4NHYA 1YUDA 1Q8VA 2YU2A 3T30A 1VBE3 3CNAA 3OPZA 2ZGSA 3WNKA 5KHHA 3NMBA 1VBB2 3NJYA 4MGSA 1HLCA 4PF1A 4AVTA 3H8UA 4XABA 3MUZ1 5FZDA 4BOWA 1G9BA 2WS93 4HPKA 4XVHA 2ID4A 2KR2A 5FYTA 3U1XA 5JDBA 2JKBA 3RRDA 2CGPA 2WYFA 1RJ8A 1UY4A 3WQBA 1V70A 3NL1A 4YG6A 1DGWX 3MIDA 1UMZA 4CP2A 2R041 5JOZA 1K42A 1L7QA 3C8XA 3CEWA 5C71A 4MHRA 3EYPA 1AX0A 3NRUA 3LZZA 1OA4A 4QX1A 1W6NA 2QQWA 4UWDA 1KDMA 4AEMA 2W1UA 4EN0A 4CVUA 2KM2A 2Y6FA 2EIDA 3WZ1A 2Q5TA 5CZKA 2XBO1 5F2WA 4ASKA 3BTYA 2BVBA 2IVIB 1RL3A 2JDPA 2YPDA 2B9UA 4UW4A 4YSFA 2WNUA 2LS6A 1XNDA 2BBAA 3HQRA 2BWAA 1PVC3 1QQP3 3OYWA 1WMEA 5JIAA 3H3UA 3VKLA 2WC2A 3NV1A 4QAWA 3CO2A 3RSJA 1QJX2 1ZRIA 2P1BA 3Q9OA 2FZ1A 3HBKA 1YFXA 5FK7A 1I6XA 3VBOC 2WJSA 4IV3C 5L7OC 4ORFA 2MEV2 1F8VA 4N90A 4A44A 5A3UA 5DUWA 3USUA 1XOYA 4CCOA 2R16A 4LHNA 2XPJA 3ZSKA 2H6BA 4DNYA 4OMDA 2XLFA 5HCBA 1OOPC 1YFWA 1KFUL 1SLLA 2DF7A 4DXSA 1WD4A 2W08A 4QHZA 2X09A 4Q4X3 3MLKA 5F3IA 3TNPB 4E4SA 4JQTA 3U14A 5A33B 3GF6A 3JXSA 4BZ4A 1X82A 4OLLA 1DQ1A 5AVPA 3BTZA 1RVF2 4XAEA 2IZWA 3VL8A 3O1UA 4OHXA 2ADDA 1YQ6A 4KG0A 4XBNA 3K75B 4OUEA 1LULA 1UZVA 4TYSA 5C8WA 1OQEA 2YY1A 4MHUA 1YJLA 1ENXA 3VHNA 2GZWA 1QJY2 1NE4A 1AYN1 4GWMA 3A4UA 5DG2A 1KJRA 3MHZA 3J7LA 2QFEA 1ZRRA 1D2SA 2F4LA 2ZGUA 2ZACA 2CV6A 5AC92 1JODA 1OUXA 4NPMA 3UGHA 1QEXA 3O1SA 2Y34A 1SLIA 1V6OA 3RVHA 1J1LA 1O4ZA 1VRH2 4UFIA 5LA1A 1HB1A 3CQOA 1XE8A 5CFCC 4LA2A 4IEWA 5LRRA 2CDOA 3SH5A 2CYFA 5CKNA 4ASMB 1W6NB 1D4VB 2VOTA 3NAPA 1J3QA 3I7DA 2OZJA 1LKNA 1IS3A 1H9PA 1L7RA 1GU3A 4JGYC 5F5CA 2EAAA 3SKVA 3UT0A 2WZR3 2XLGA 4ZXEA 3AZVA 1K3IA 5I8TA 2A3YA 1H2NA 2X8KA 3PDQA 2WZPP 2WNUB 2GN3A 3O1RA 3PJQA 2BOIA 4Q8LA 4H3WA 2PFWA 4L9BA 1IS6A 4Z07A 2Y6JA 4BB3A 1VBB3 3HWJA 3K4AA 4NO4A 3TYJA 5FRAA 3VZJA 3TEWA 4TSVA 5FPXA 3V64A 4NR1A 3HT2A 4LKSA 3AC0A 4N43C 1H2MA 4LBJA 4GXLA 3ZFEA 3DV8A 3MPPG 4BK4A 1UU5A 2X29A 5JMOA 2DU1A 3N7JA 5K0UC 3AZYA 4AQ2A 1YXWA 4RN5A 2HWE1 2Z5WA 4QU1A 3USUB 1W0NA 1AL0G 2PAEA 5FYHA 4PIXA 1UY3A 5FMCA 1NCQB 4OI4A 2VUJA 1VJ2A 1YCIA 1URXA 4KBBA 1AR63 1YQ5A 3UL2A 3VGIA 1C4RA 2A7AA 1W90A 2JENA 3GNEA 4B4QA 4XJWA 2VMFA 2TEPA 3KCYA 4COVA 4Y5Z0 5FLHA 2WAOA 3P1IA 4YM3A 1MEC1 2W91A 5G05L 1ZBA2 3I54A 4YGBA 4AFBA 3UV9A 4M3CA 4L2NA 1FPN1 1VBA2 2MNGA 3FHAA 4Q5OA 5FREA 2QNKA 3K3NA 3PJYA 1GYKA 1J1TA 1RMU2 2VZSA 4OZXA 2UY8A 2JB4A 2BWCA 2IXCA 3VBSB 4XXAA 1CONA 1GNHA 3AP6A 5K7PA 1W2OA 1IOAA 2D3RA 2H0BA 3APBA 2NN8A 2P2KA 4AF9A 5KR7A 2CWSA 1O6UA 4IL7A 5FXZA 5C70A 3AZZA 2WA3A 3UESA 3HQUA 3WUDA 2MEV3 2BRTA 3ETQA 1SCSA 4YVSB 3IKWA 5FZFA 4NN0A 1BMV1 4KG8A 1UNBA 4Q2FA 4QHOA 4XMIA 3FMGA 1BBT2 4JKMA 5BNOC 5GKAC 1Q56A 4EE2A 2RS31 1FATA 4CU6A 5JXIA 4Z1VA 1TNFA 1AF9A 1H1IA 5IATA 4JTOA 2JDUA 3BOWA 3C7OA 3ZPYA 2WL1A 1OPOA 2A73B 1OT5A 3LGRA 2E9QA 1PO22 4PIYA 3I3MA 4A7KA 3B9CA 3SQOA 4CXWA 5DAPA 5JSRA 5D8AA 1WMFA 3HN3A 4FPGA 4WM8C 3GM8A 3IAPA 5FXVA 4DEVA 5GZGA 2MPFA 1PM7A 2E63A 5CKMA 1S0JA 2ADEA 2B39A 2D6LX 2JEMA 5D1IA 5FYZA 4D7TA 3BU0A 5F6KA 2C5DA 1PGL2 4ZHNA 3CJIB 2WLPA 5J37A 4FTBA 5A6XA 3S0MA 4OHYA 3FBYA 1AYM1 3G7DA 2RMU1 1QJY3 4GA9A 3ZFEB 4E4HA 2BBVA 5EIYB 3POSA 1WWYA 4I0BA 4U36A 1DCSA 4CDUC 4DRRA 5C33A 1H30A 2OPWA 2W92A 4AHZA 5HI0A 3AXEA 2AZ5A 5KXBA 1LGBA 4AAPA 1NA1B 1X8MA 4XHBA 1JZ3A 2WQZC 4YZ4A 1VRH3 1LTEA 2AGSA 2JDMA 3KQ4B 3NQHA 5FZIA 2YMZA 4XDPA 1W8FA 1IPJA 5A7QA 4YW7A 1QMJA 2RDNA 2F6BA 3KHCA 4QX5A 5I0TA 2DFBA 4GAZA 2C1FA 3D0SA 1RUC1 3M7AA 5FYVA 1PZ7A 2WWSA 2JDYA 1IPSA 3I2GA 2W94A 3RZLA 2HWD2 4LBLA 1PNGA 5A7NA 1QH7A 4FPKA 4JC1A 1CZSA 1DLLA 4QQ2A 5C8CC 1Q43A 2ENRA 3LOIA 4ISRA 2E7TA 1S4CA 2HBTA 3CF6E 5F5IA 2WSUA 4CEWA 5JPMB 3EMRA 3MBWA 5A1FA 5CU1A 1E57A 2CDPA 1LAJA 2BUKA 3ILFA 1UYPA 3V0AB 2QQVA 3MIBA 1ALYA 3VZNA 1WCUA 3OD4A 1S1AA 4AEDA 3T0AA 4UF0A 4A6OA 3JBG2 2D6OX 4CU7A 4CDXC 4QQLA 5KC6A 1SQ4A 3NO8A 1Y3TA 2P3YA 2ZGLA 1GZTA 2PHRA 3GZTB 3O7OA 4GB32 1ND3C 5LASA 1LU1A 3C7FA 4F3JA 4QKDA 3DEMA 5LK7B 4EN7B 2JG9C 3TEYA 1VBA3 4EQVA 1NY71 2EICA 3WW1A 2WR9A 1RMU3 2I45A 1RIRA 4Q4V1 5IVEA 4P9GA 3JQXA 3ME2A 2FMYA 3AMHA 2ZGTA 2O0OA 1WLCA 3AKPA 4E4ZA 5JXHA 4CCJA 1Q5OA 1RUJ2 3AKSA 4RFRB 4OQ9A 4LPLA 2D5FA 4Y24A 1OA2A 1EAH1 1GP5A 4Q0VA 5GLVA 3RZZA 3ZR6A 5IVJA 2ZX1A 4EZ4A 3PUQA 2HWC2 2IFRA 3TEXA 3WOGA 3I2DA 2BYVE 1IS4A 2VCAA 4GMP0 4I0AA 1BBT3 3LWCA 3VBUB 3ZMNA 3H50A 2WT0A 3A21A 4DXRA 3WY6A 3RWKX 3TEZA 1LOCA 2P3KA 3WNLA 3PUIA 2BGCA 3AP4A 3PUAA 2P6HA 2B7YA 3ZSEA 2IVJA 1SFYA 5A3LA 4MGIE 3WP3A 1BEV2 3PMSA 5CFDB 1W99A 4IETA 1ZM1A 1W2AX 2A6ZA 2ZGPA 2WN2A 3GHMA 2BFUL 3WG1A 2O1QA 1Q8PA 3BIEA 5T50A 3OG2A 1RHI2 1YC61 1DQ4A 2W87A 4Q0UA 2ZHNA 4I01A 1BVVA 4PDWC 4E2QA 1NCRB 1PGSA 3LEGA 1IG3A 3VBHA 4UT5A 3SEPA 3IDEA 3EBRA 3KV4A 4MXVA 3I2OA 1O3TA 5FFOC 1RUD1 4DUWA 1LOBA 1WBLA 3ACHA 2BNMA 1O3RA 1LEMA 4RHV3 1HN0A 1GZWB 3LD8A 5LY1A 4GMP3 3ZYPA 1LGCA 3FHIB 3GBGA 3B3QE 3LAGA 4QPIC 4HVQA 1IGOA 1YFYA 1RXFA 4AEDB 2X5IA 2B46X 5DDJ1 3H42B 3OJBA 1HW5A 1XNKA 3ZOIA 4CEYB 5F39A 4FTEA 3LDBA 1VBD1 3THTA 5ABJA 4LMFA 2CSGA 4OI1A 1W8TA 1S0GA 2YC4A 4HG6B 1P8JA 1W8HA 1PX3A 5ACA1 2FMDA 3EQEA 4JRLA 2HWD3 3LSDA 1TMF1 3PMEA 3POBA 3WDTA 4CDQC 2JXAA 2VMEA 1FV3A 4D0QA 4JRAA 4XFBA 2GSYA 3IWZA 1A8DA 3NWKA 4HK9A 4FFFA 1QDCA 1UAIA 4FPEA 1OXCA 1DYKA 2WZEA 2JD9A 2J7MA 4B3NA 2VL4A 4H2AA 1LECA 3N9OA 3WVJA 4OUSA 4QKNA 2VVDA 1R1A1 1SMVA 1XSRA 3N7KA 4LBMA 1AXZA 4JKKA 1JHNA 1YLLA 1ZZ7A 5EJZB 5JZGC 2Z79A 3JBG3 3M3EA 2E7QA 4HANA 4LKDA 2ZGNA 1UOFA 3BI3A 4AYUA 4LNVA 1PO12 5A7OA 4B1LA 3EB7A 2B8MA 2P5BA 4FOVA 3HJRA 4GB33 5IUQA 2VOWA 2ZGQA 5LA9A 2WNVC 4XFFA 2A71A 2VCBA 5FO9B 2VUCA 1UPSA 4NHXA 1OH4A 3DXUA 4IEQA 1D2QA 1R091 3MEPA 5FUNA 5C3QA 1H8TA 4HN0A 1VP6A 3OY8A 2VMIA 2JG8C 3WW3A 1RUJ3 4P00B 3K3OA 4BQ5A 4DB5A 4DIQA 3VBHB 2JDAA 4IEZA 4ARXA 4BLJA 3D4KA 4B7KA 2HWC3 1MZEA 1TME1 3GGLA 1NLQA 1WW6A 2JE9A 2ZTNA 3P6BA 4O9EA 2OZ6A 2EVXA 1QJU2 4LHKA 3AL5A 2W52A 3JU9A 1O5LA 4DUXA 2BFUS 2BPA2 1WLTA 2FD8A 1BZWA 2HYKA 4IQPA 3J7MA 2XONA 3WR0A 1ND2B 2VW1A 1AX1A 2EXJA 5FZGA 1V0AA 2QQOA 1ZX5A 2DVFA 2GNBA 2SBAA 1AR71 2AR6A 3AVSA 3BGAA 1BEV3 3PVBB 5DABA 3PNAA 2VZOA 4FCAA 1HV0A 2VU9A 4XBQA 3A0NA 3E6DA 3RPQA 1RHI3 2ZGOA 3LA3A 4Q4W1 4Z8BA 4XPVA 3ZFFA 2GC1A 2GMEA 1NX9A 2FDHA 4ZU4A 4YZ2A 1Z78A 2QQNA 3KMHA 4GQ7A 1XU2A 5GM0A 1PGW2 5JI7A 5E1RA 4IDZA 4XW3A 3AX4A 2A3XA 2J1UA 1LGNA 3BB6A 4MGYE 3S57A 3FJSA 4RGKA 3DPRA 5F37A 4Q0PA 1E5IA 3EO6A 2R32A 2RJLA 3D0JA 3LA2A 1I5ZA 4XOGA 5G04L 2WDBA 1VB4A 3IN9A 4RD7A 2GC3A 3MPBA 5D21A 4AI3A 5A1LA 1XC6A 2QQJA 4KGQA 2K9ZA 4Y1XA 1OBNA 4I0WB 4AFMA 3PVEA 3VKNA 4AZZA 4NRPA 4GIQA 3I49A 3P3NA 3GCXA 2F17A 1XQNA 1GNYA 2YU1A 3J7NA 3O0VA 2EIGA 2FCUA 3WX5A 2XHNA 1CPMA 1HV1A 5CA6A 4LORA 4PIZA 3WF0A 1UYYA 4FP2A 2XJQA 3U75A 2WKKA 4INDA 4BDVB 1VBC1 2FQPA 5LK5A 4MYEA 3L2YA 2VUDA 4AFCA 1FMD2 3OY8B 3WW4A 4WBBA 1V9U1 4JKLA 5C4WA 5LW9A 5DUVA 4YNIA 2B9VA 2J1AA 1Y43B 3U07A 3WG4A 1COV2 4Y26A 1GQHA 5I0DA 2RE9A 1F4AA 1H6YA 3ZYIB 2DYCA 4PHZA 1TQ5A 4IE0A 3LFIA 1LR5A 3VDAA 2JICA 3S7IA 1VALA 2BP6A 2HWF2 1AL23 1OSGA 4AI8A 1KEXA 4YVWC 3VD5A 3KGZA 1ASJ1 1EP0A 2ZZQA 1PO13 4Y1UA 4ZZ5A 1S0EA 2ZX2A 4LJHA 4F8AA 4P9LA 4DMIA 1YIFA 1LNSA 3AKRA 3IIAA 4IE6A 4CCNA 1W6PA 2XL9A 4E2GA 3KVBA 5JOXA 2EF6A 4EN8B 3E1F1 2YFZA 2ARCA 3A7QA 4YZ3A 3ZFFB 4LHLA 1JYNA 5JPNB 4RS5B 4MZUA 5DAWA 4AW7A 1NXD1 2OXBA 2CU5A 4OI2A 3WHTA 2RDQA 2QZ3A 2W46A 4QKBA 1TNRA 4FQZA 1XNBA 2WABA 4YLZA 1DZTA 2ILMA 1XXNA 5FY1A 4GZ9A 1K5MC 3AM2A 5FZ0A 2HH9A 4B8EA 3K2OA 1HRV1 5C9AC 2YC0A 2VZQA 1MS4A 2BW8A 4C0BA 1WW7A 1HIXA 4NMIA 3VV1A 1QJU3 1RUF1 2VBBA 3DPRB 4KI5M 1POV0 4XURA 4AVCA 4FPYA 3POEA 2RS12 3QH7A 2UY9A 5BY5A 3UYJA 1POQA 1ZA4A 3MLLA 1RYYA 5JR2A 1IKPA 2JG8A 2CGOA 2FHRA 2XXZA 2ZMNA 4GH4A 4LKFA 4MO3M 5FMBA 1JN2P 4LE4A 4NE9A 4HKLA 4WM7A 1O8SA 3LFMA 1REDA 4JHZA 1N3OA 5IJRA 4Q4Y1 5FYCA 3WNOA 1HXS2 2ORXA 5L36A 4X8PA 2NPIA 4P08A 5E89A 3CJXA 2PMWB 2DBNA 3CIHA 4K21A 2HLEA 2XJTA 1TG7A 5GZDA 4HXCA 2SLIA 2PA7A 1U5YA 4QPGB 3VD4A 4Y4RA 1NCQC 4MXWA 4P9IA 3GHNA 4ZXKA 2E6VA 1US2A 4JQRA 5CNAA 4PBOA 4FFHA 1POV3 4XHXA 4W8JA 2NM1A 1SEFA 1FNYA 3W59A 4B4PA 5J48A 2GU9A 1VAMA 1PZ8A 3AVRA 3CDZB 1HQNA 1SLBA 1UN1A 4MGQA 2GMPA 3RQ0A 4QKFA 5IFTA 5T5PA 4ZZ8A 2WAAA 1XPWA 1LESA 2X53S 2ZKNA 3PLQA 4XCBA 2Y26A 3IBMA 4XQDA 4OULA 4QGLA 1ULPA 1ZBE1 3VBSC 1C57A 5C5TA 1EUTA 1OLQA 4NIGA 3ZFGA 1B35A 3HNMA 5F5QA 1VBE1 5LA0A 1O4YA 2DU0A 1H2LA 1KQRA 4CP9A 2XBO2 1Q8SA 1UOGA 3OUHA 2MHFA 5LATA 5KHGA 1RUI3 4YVSC 2XWJB 1F31A 2WS91 1COV3 1IZ3A 4PT6A 3AB0A 3MW2A 3PU3A 2QZ2A 1XBFA 3FFZA 3IPVB 3Q8CA 4LUKA 5T54A 1O3QA 4AFDA 3O5SA 3OEBA 1HQWA 2Q1MA 4LBOA 4OI0A 3PTRB 3FN9A 4IUGA 2HWF3 2NMOA 4L97A 3MI8A 4COWA 1QGLA 5A80A 3P3PA 1CR7A 4IE4A 2N7GA 1UZ0A 1BJQA 4XJUA 1B09A 1J3PA 2VAUA 4XF0A 5GLTA 3ZDSA 4WM7B 2GMMA 5FK8A 1S2KA 2P17A 3CJIC 1W2TA 5FJKA 3WF2A 2JECA 4EN9B 1JU3A 4FOQA 4J1XA 3MIGA 1PVC1 1QQP1 3WNMA 4CU8A 1HKDA 2QDRA 3UJOA 5A70A 1W6QB 3JB4C 1JZ4A 1I1EA 5C3OA 4K8FA 1CX4A 4Q27A 4MGTA 3PURA 4BQ2A 3WLUA 1N1TA 1H0BA 4LBQD 4DFSA 3LCPA 1GICA 2G9ZA 3LQCA 3MUY1 3OSDA 1D0GA 1NA1C 2RJ2A 2VMHA 4JDMA 5FZMA 3WQ0A 1OVPA 2RVAA 3RZGA 5FKBA 3KGLA 1M06G 3A0KA 4QX2A 1DF0A 3BN6A 4BQYA 1SBEA 4AOCA 1HB3A 2VCMA 2NZ9A 3I97A 4ES9A 5FQ0A 1OHFA 1AYN2 5BNQA 2C26A 2RS13 4JGZC 4Q4X1 1W3VA 5CEHA 1DYPA 1YYNA 1FI2A 2WRAA 3LSEA 4KU8A 4CTEA 3AMMA 5K4LA 3B01A 3VBRB 4KU7A 2ZMKA 5FTTC 3I3QA 4AI0A 1W04A 5LBCA 1QNWA 1WCKA 1WZXA 1CAXB 2DUPA 2D6PA 3OF1A 2AC1A 5BYNA 1NLSA 1UPIA 3BYWA 3AK0A 1NXMA 2DCTA 1YFUA 5C9AA 1HB2A 4FI9A 4KWUA 1GP4A 3RI8A 1FOD2 3RJRA 5FZ4A 2OYZA 2WFF1 2Q8EA 3O1MA 3SCGA 4CUGA 2DFCA 1JZ5A 4LULA 3QOPA 2Q0AA 2RV9A 3RZHA 1PMJX 3VZOA 3AFKA 1UMHA 1QJFA 2QJVA 4YARA 2W1QA 3NW4A 4CU9A 4MV2A 5LZ6A 1XU1A 2D3SA 1GR3A 4A3ZA 2VJXA 1GBGA 1U0AA 4PBPA 4XTPA 3E5XA 3BPZA 2PELA 4OHWA 4QXHA 5T5OA 1D7PM 5APAA 2DBIA 4AL9A 4EZHA 4FOWA 3OGVA 2R072 2Y6HA 1PIV2 3POYA 5H9PA 1H4GA 2VGDA 2Z2SB 3ACIA 2PHFA 2XJUA 3UETA 1OURA 3VBFA 4CP1A 1RUG2 2WZR1 1GOHA 1QOOA 2C9AA 4RQPA 2VECA 1DHKB 4XDQA 4RR3A 3ZR5A 2FZ2A 4I3PA 4YPJA 1GZCA 1VBB1 2ZAAA 5IW0A 3S30A 4HPKB 2ZEYA 1UYXA 4PJYA 4QX7A 4ZU7A 4FPFA 3UK9A 1MVQA 4BU2A 1DQ0A 3ILNA 4DQAA 2V09A 3F95A 4HBNA 2JIGA 4AEKA 1MQTC 2QQMA 1LRHA 4XUOA 5KHJA 4CDWA 2P3IA 3VBUC 1W28A 5A1AA 2I07B 4YGDA 3U78A 2NYYA 1WMXA 5K8SA 1D0HA 1UQXA 2YGLA 3PU8A 1MZ5A 1AR61 4NAMA 4LA3A 5BNPC 3CU7A 1OUSA 3KVAA 1RUNA 2RM22 3HQXA 3I2HA 1BMV2 1F5FA 3VDBA 3ZXGA 2IXIA 3ZPOA 4BIFA 1X7NA 5CFDC 5CVRA 1QDOA 2IXHA 2DTWA 4F83A 3OYWB 1US3A 3M3CA 5F8PA 3VD7A 3W21A 3TRSB 2OS2A 2QUOA 1BCXA 1CIWA 3V0BA 1X50A 4XTMA 2E51A 1NCRC 4XFCA 4GALA 2D97A 1JYCA 1U5IA 1SZBA 4E4DX 2UU8A 3AYDA 2R6QA 4ZY9A 4BMBA 1AUYA 2ETEA 1AVBA 5FZCA 4XZPA 1HRI2 2MEV1 2WYSA 3JUUA 4AQSA 2Y6KA 1EPWA 4NJ4A 2DVGA 3GCWA 4XYXA 4LLOA 2VQ0A 4RGGA 4CEYC 1W03A 2ZOEB 1AYN3 2WT2A 5JR7B 2XWBB 3X29B 4TXWA 3URFA 1ULFA 2OA2A 3BCWA 2W1WA 4B7EA 3I4IA 2VC9A 1Q3EA 4LT5A 3LDRA 2VQUA 1NT0A 2PAKA 4LO4B 3N36A 4A6SA 3WHUA 1UMIA 4QDSA 4XIKA 1JUIA 2J42A 2J22A 1QJX3 4Y5SA 2GNMA 3JCIA 5FYIA 1UXXX 4WVMA 2WO3A 1OKQA 4RR3B 1UOJA 1D4M2 1FOD3 1GSLA 5BV6A 1PVXA 4ISQA 1A34A 4HFSA 3THCA 5JSOA 1KS4A 4PF5A 3ITQA 5FV3A 1QJY1 1NQJA 1UYZA 3GBFA 1S0CA 2JDNA 1Y7BA 4XJ9A 2RDRA 2Q8DA 5IVVA 2HJIA 1DFQA 2XB6C 2LM3A 1OFSA 3NNGA 5DZFA 4A4AA 1RB8G 2LUWA 4L92A 4QPYA 4GKYA 3KS7A 1JMUB 2Z4FA 3FC0A 4NRMA 1G9DA 4QB1A 4BWOA 3B5LB 2HEYF 3HN1A 3VBOA 3NAPB 4QDRA 5HXMA 4IV3A 3OPTA 5FJHA 2FDIA 2Z69A 5L7OA 2YB7A 4IV1C 1RVF3 3ZYHA 5L19A 2R073 1PIV3 2ZX3A 2KA3A 1ZYBA 5FP7A 1W9FA 1F15A 2RHPA 1RUG3 3MYXA 3OEAA 2PXJA 2J1RA 4Y3OA 3SCHA 1QIQA 4OFGA 1OLME 2VW0A 4AVAA 2W1SA 1OOPA 3V0BB 5DUXA 1DQ6A 5FAXA 2VMGA 5FY8A 3N7LA 4QM8A 2TNFA 5JAXA 1AHSA 2ZA9A 4KMQA 2EXHA 2IXLA 2VZVA 3CLPA 2YC2A 4BPZA 1QF3A 3AMQA 5AC93 3MZHA 2AENA 1S0DA 5DAXA 3V65A 1EV12 3HMYA 4JCKA 5KXCA 4WV8A 5FZ9A 1UW8A 1C8NA 4DZGA 1QXRA 1RUE2 5FKCA 5DQ0A 4M01A 3WDVA 2NLRA 1EAH2 4V2WA 1ND2C 3BPSA 3JZVA 3N9QA 3ABZA 4Q0QA 5FPVA 5FY7A 2WSVA 2X05A 2VO5A 3RNSA 1PMHX 2RM23 4NIAA 4CCKA 3DGTA 1PM4A 1WA6X 1V00A 4GJYA 4M3CB 5F3EA 4LBQA 1JZ6A 3BKZA 1ZVFA 3KCXA 1VMFA 2Y6LA 3VLBB 4EYUA 2I2SA 1GLHA 1PK6C 3ZYFA 3BU7A 4QQOA 1VBA1 1VE0A 5FZ6A 2XL7A 1RMU1 4ARYA 1XNCA 4URTA 1JYWA 4K6BA 2WINB 1NUKA 4WVMB 5CFCA 3VB9A 2D6KA 1G8WA 3INAA 2V4AA 2D6NA 2D7FA 3AYAA 5A6ZA 4BMEA 3KF3A 5BNPA 1AR92 3DF0A 4LEJA 3AJZA 5EV7A 4JGYA 1HRI3 3RMYA 1UY2A 2PHUA 1S2BA 2D43A 3PUSA 1UO9A 2WT1A 4N53C 4RYDA 5DZEA 3U37A 4PCRA 2NP0A 3SKJE 1GP6A 2BEOA 1T2XA 4FPCA 2C4XA 1BBT1 5BNNC 3UJQA 2KD7A 3N35A 4FPJA 3SMHA 1RUD2 3VBOB 2GN7A 3POFA 4BQXA 3NV3A 1YI9A 2QQUA 3H1MA 4N43A 5BPXA 3LB9A 1ZBA3 3ZKYA 5L7OB 4Y5TA 4C1XA 5EYYA 5K0UA 3FUOA 5D8AB 4LKEA 4BQ3A 5GLWA 1C5IA 1LOFC 4R52A 4TZDA 1VAKA 4R4ZA 2VQAA 2WNOA 2EIEA 2XJVA 3HAGA 5DDJ2 5E8AA 1RGSA 3D82A 3KM5A 4QPWA 1OOPB 1NYWA 1OH3A 5I8SA 3T0BA 3VDDC 1LB2A 2R062 1D4M3 3FBMA 1PGL1 2VD7A 4FP3A 1OD3A 5DAVA 1LJ7A 5HCFA 1TZOA 3NKTA 4GWIA 4CUAA 5KC5A 4NPRA 1ZZCA 4IE5A 1AR82 1OPMA 5IK7A 3U0ZA 1GNZA 3HPNA 1IHMA 3U4SA 1DIWA 4AGVA 3ROUA 4NIHA 5GZCA 4O61A 5F3CA 2PHXA 4M4RA 4RHV1 3NJXA 4PQ9A 2K46A 4GMP1 2XKPA 4N7UA 1W8UA 1BK1A 1CVNA 1LU2A 2YBKA 2ZXQA 4JHTA 1QXJA 3WDUA 1PO23 4YG3A 1JYTA 2VBPA 3OGSA 5EZWA 3DCQA 1C8M2 3OUJA 2B45X 2H6CA 5IVBA 4XFHA 5T5JA 4QXKA 4K8RB 5I93A 2QKDA 2WUHA 4M0HA 2LROA 4CUCA 1YI7A 4S2GA 4LLFA 1W8WA 3DN7A 4YWAA 3MW3A 1MS1A 1G9CA 2CAUA 5BNOA 4TWTA 1HJFA 4NAOA 2YUEA 2QCSB 3HVDA 3WEZA 5FOJB 2QQKA 4G9SB 5DUUA 2HWD1 1YQ8A 4H7LA 4QGMA 3LF7A 4H14A 4MG2A 1R082 3TAYA 3KV5A 3FLRA 1BYHA 3H3LA 1GOFA 4CEWB 3Q8FA 4XAAA 1FAYA 1GZ9A 3M4FA 4MOAA 1Z7S2 3AKTA 3BALA 4Q26A 5FYUA 4YGEA 4NHLA 1EV13 4BLIA 4WM8A 1X36A 4UF0B 3CHXA 1RUE3 2YFUA 1J59A 3GXUA 3PHMA 4SLIA 1DZQA 3SXWA 5JUVA 2FBEA 1CAVA 3GYDA 5BXXA 1V6LA 3JBG1 2VG9A 3NVCA 4PI2A 4GD4A 3WW2A 2QQIA 1CZTA 1JI6A 1W05A 2V5DA 1M4WA 1OQ1A 2ET7A 2QQLA 3IT8A 4Y1YA 4GB31 4CDUA 5K0UB 2WA4A 4IEXA 2CY6A 1Y9QA 2LW8A 1OF3A 1CAUA 3T3YA 2XJSA 4JX0A 2DUOA 4H7MA 4JDNA 4NPLA 2EXKA 5FZ8A 1DGLA 4CXXA 3IDAA 2QE3A 2Q8OA 3RMXA 2UURA 3H9AA 3TWIA 4C91A 4MGKE 5FZOA 1AR72 2ZBJA 2ZKLA 1AR93 3KV9A 4HSJA 1LHVA 4WZFA 4BIOA 2HWC1 2YV8A 2RS52 4UFJA 4YW4A 1CGPA 2Y0OA 2P6CA 1RINA 3ZXFA 3RZMA 4KQ7A 1I9RA 1STMA 4MX3A 4XFAA 3WG3A 3IIIA 4YFWA 3MFAA 1W2UA 1RUD3 1UX6A 4UBGA 3KWVA 5C8CA 4ATEA 4UW6A 4COYA 1WA4A 2XQRA 4UYBA 1W2NA 3MF9A 4IXLA 1LHOA 4IEOA 1SBDA 1H2KA 3OD0A 3N9LA 3RG0A 5F1RA 1BEV1 3ZN6A 1BXHA 1JZ8A 1YIPA 4HETA 1AX2A 2FDKA 1DG6A 1H1MA 5FZAA 3RJ2X 5BNOB 1JYXA 1APNA 5J09A 1RHI1 1HX6A 4I2OA 3KF5A 1ZZBA 2R063 3QD6A 2PQSA 1SFPA 3CKHA 4CDXA 2EAKA 2YROA 3R6SA 3UGGA 1OA3A 5BNNA 1UKGA 3RZKA 3SC7X 1O3SA 4Y33A 1AR83 1W0OA 1ND3A 1BQPA 1YHFA 4Q1RA 3ZXKA 3VD9A 4UOJA 4ZS2A 1G9FA 4DS0A 3AMNA 2JG9A 3J26N 3O1OA 4BK5A 4YM2A 4YW5A 4YM1A 2X5IB 2LTNA 3SCFA 1W39A 2W2IA 2I74A 4Y20A 2C24A 4J25A 4EWEA 1G6NA 2OVUA 1MZ6A 4AAXA 5ABJB 4NROA 3GZEA 1G9AA 2W39A 1CWPA 3JD72 1LHUA 2R49A 1C8M3 2R1DA 1VIWB 1MS0A 3ZIXA 2WO7A 3IMNA 2R30A 2ZGMA 3ON7A 1T6GC 3SH4A 2C9KA 5IT6A 3HIFA 1AXYA 2PLV2 4CCEA 3KCCA 1CAUB 4YFZA 4W4ZA 5JWPA 3LOBA 4PI0A 2GC0A 4DUVA 4XJ8A 1T6BX 2RDSA 5JOYA 5DPNA 4W6XA 1R083 3H8RA 4AVBA 4CA9A 1C3HA 4XJZA 3G6JB 4M00A 4XUTA 3TNQA 3J8F2 1Z7S3 2NQYA 5IAVA 2RR11 1NLRA 1RUH2 1EY2A 5FPLA 5H9RA 4NHKA 4E9KA 3O1PA 1JH5A 4LOTA 4PDWA 1AL21 1SFNA 1VLNA 4ZS3A 3VBRC 3VKMA 5FPZA 4ET7A 2DCYA 1PO11 4L99A 1DBNA 2OUHA 1EUUA 3H7YA 4XQWA 4BQ1A 1LENA 2QVSB 3WG2A 1ZNPA 4MUVA 3ACGA 3Q8AA 1H8TB 3ILRA 5LBBA 3WP6A 2FCTA 4QPIA 1VMJA 4AHWA 3NNMA 4A7YA 3CBNA 3K51A 2JDKA 2Q1ZB 5H9SA 4XBLA 3F2ZA 4GJZA 4D6SA 1OMIA 3NJVA 2QQPA 2C6SA 1SDWA 2IXJA 1QOTA 3DECA 2XOMA 1REFA 2ZHKA 5I0SA 2RS53 2VY0A 5AVAA 1ULOA 4ZONA 3HEIA 2Y60A 3N7MA 4AE2A 5B4NA 5CYYA 1W6OA 1ENSA 3LDKA 2VH9A 2E26A 3OBRA 1K45A 5DAQA 5EJ1B 3UKVA 2DV9A 1XYPA 3KZ4C 4XE9A 3WV6A 3ZVXA 4CDQA 2OT7A 2OUJA 4NWVA 5FMDA 1CJPA 4LQRA 1FNZA 1QKQA 4QDQA 3WD5A 1GWKA 3WNNA 2DWRA 2XHKA 4GWJA 2R1BA 3KT1A 3WP5A 1HN1A 5E16A 4IEYA 5FYSA 1Y4WA 5C6CA 2BERA 2QTWB 5LBEA 3VDCA 3ZN4A 1N47A 2ORZA 4H55A 4U2AA 4C8DA 3TN92 5HPOA 3T2TA 2ZHLA 3MV11 4FPLA 5JZGA 1UZZA 1YWKA 1UX7A 2VMCA 3AKQA 4JV4A 4FT8A 3VKFC 2A6YA 5HV0A 2JDZA 2QBXA 4Q29A 1IG0A 2AREA 4R4XA 4FSJA 1J3RA 2WFPA 2WNVA 1MS9A 2XGXA 3AP7A 4EWAA 2PAMA 4X8NA 4D8MA 2R0HA 3LPFA 1MPXA 2DDUA 2BZDA 2YG0A 3J4UH 4L0PA 3D5OA 1LOAA 3LA7A 5H9QA 3DKQA 4Q8KA 2LALA 4XFGA 3RYKA 1GMMA 2BNOA 3ZSLA 4PDWB 1POV1 4KH9A 5FMOL 5A3TA 2DURA 2AEYA 2HWB2 3JD73 1CAWA 2WNUC 1I5PA 4YW6A 2HKXA 5J98B 5IWFA 5FZ7A 2EA7A 4CXYA 3QBQA 4KNCA 5F2SA 2XVKA 1DQ5A 1S55A 2VVFA 4AG4A 2PLV3 2V72A 4IESA 4IGPA 3NNFA 4HMZA 1W3XA 3BUCA 1SPPA 1W6MA 3ATGA 3FUQA 5C4WB 3ST7A 3HR9A 3WCRA 5B2GB 5KHKA 3AL6A 1CPNA 4JAAA 3MF6A 5I0RA 5JSPA 1IQAA 4FO9A 4K40A 4XUPA 2Y64A 3JQWA 4FTSA 2O8OA 5FPAA 1SLAA 1RUI1 1G7YA 1KJLA 2VVEA 3J8F3 1YRZA 1COV1 1NZIA 1QQP2 3IAQA 3T08A 4BCUA 1RUH3 1UY1A 5K9YA 3RI9A 3OUIA 4HKOA 2PQQA 1JBCA 3BOPA 3PIJA 3A23A 1JUHA 1ODNA 2BJSA 2VPVA 4LITA 4S2DA 4WZCA 3RFRA 3ZN5A 4B4RA 3THPA 3H7JA 2HWF1 3POJA 3THDA 3OBZA 2A1XA 5FP8A 4OUMA 1IS5A 2R042 3OPWA 4YZ5A 3VHRA 2V5YA 2ZPXA 1C1FA 5FP9A 5LRSA 4P14A 2CGNA 1W6PB 4RA0A 2JJ6A 4YW3A 1UIKA 5FR3A 3E6CC 1FMD3 4A3XA 1ST8A 4Q4X2 4QQPA 1MS8A 4CSWA 2VTXJ 4EJRA 1GANA 4R9BA 2E32A 3J9SA 5EP9A 1FV2A 5J96B 2KXLA 1K12A 5FY4A 2YBPA 4IEPA 3RYPA 4AXOA 5HXVA 1DDLA 4D7SA 5FY9A 3VHPA 3ASIA 4DO0A 2J1EA 2OQ7A 3CZJA 3DYOA 4QB2A 4A42A 1NE6A 3DYPA 3O1VA 3I3DA 3Q8BA 1ZA7A 3OTFA 2VULA 5IVFA 4QHBA 3VD3A 2A3WA 2V73A 1CIYA 2WFF2 1YQCA 4M0NA 5FIXA 1C1LA 4FFGA 3IZOA 1LCLA 1JOPA 3NAPC 3POGA 4W65A 3POWA 3ZYBA 2W3JA 2VOVA 4UXAA 5EQUA 2JG8B 1O4TA 4GH4B 3WQ1A 2D6MA 3QACA 1NKGA 2OX0A 4FXGB 5JIUA 5IAXA 2A75A 2XG3A 2ARXA 3GBWA 2WO1A 5FZ3A 1F5JA 3RWNA 4OCTA 3K4DA 1RJ7A 3ZFEC 5A33A 5I91A 3TN93 5KBFA 2GH8A 3H0OA 4K1YA 1W0PA 2B4KA 4YVWA 3W58A 2QDNA 1JZ2A 2ZABA 1UD1A 4QT6A 4NRQA 4E8CA 4G4FA 1O5UA 4MXWB 4CCMA 1WW4A 2IC1A 5FMOS 1QWRA 3KLSA 1L7LA 5A7PA 5GALA 2BOJA 4P9XA 5LCWL 3C2UA 4XC9A 1ENRA 1H9WA 1JXNA 5SV8A 3S5QA 1DGWA 4EN6B 3DXTA 4YW2A 2VTXA 5F3GA 1Z0HA 2VOXA 1XB9A 5FCCA 3IDBB 5FBZA 2VZRA 5FBJA 5A6YA 5C3SA 2A5ZA 4UI9L 5A3OA 4WVVA 1CESA 3FFQA 2HWB3 2PN5A 1W9WA 3N9MA 4LIVA 4UFMA 3OBAA 3ECQA 1GV9A 1K5MA 1GUIA 1WMDA 2WIIB 4OMCA 2BGOA 1HXS3 1B35B 1JW6A 3AZWA 5GJ6A 3ZFGB 3H8XA 1AR62 1XYNA 4LBKA 1OC1A 4Y4YA 4AFAA 1W9YA 4CP9B 4N9IA 3MW4A 3EXUA 2VE1A 5FUPA 4Z2AA 2Q8CA 4AGGA 1U5XA 1ZRFA 5CADA 1FX5A 2GALA 2Z42A 1UKRA 2ZS6B 3VHOA 3T1LA 3R0RA 3UGFA 1EPZA 1VMHA 2CNAA 2VNVA 3AYCA 2WO2A 4KBZA 5FWEA 3SITA 4Q0SA 5J3UA 2G1MA 3NSTA 2TUNA 4Z2WA 1J84A 1E5SA 3B7MA 3WQ7A 5EXOA 4ITCA 2HWE2 5E6HA 2D40A 2DVBA 2BNNA 3AFGA 2CTVA 4O65A 1MS5A 3MDPA 4LO5B 2R043 4XILA 5D2AA 5D8AC 2ES3A 3H8OA 2Q1FA 2ET1A 3POIA 5DXDA 1NCQA 3T4VA 2D5HA 5A6QA 2PTMA 1ULGA 1F4HA 1A8MA 3MO4A 3WSOA 3FL7A 2CL2A 3OB8A 3N3HA 5FP3A 1A3KA 1MEC2 5BUVA 4UFLA 2WBKA 2XBO3 4K9SA 5ERLA 5CG9A 3PVOA 3WF1A 4D69A 2JKXA 3M3QA 1FPN2 4NOTA 1F2NA 2IFWA 4M3CF 2Y33A 3ACLA 4YVWB 4ASLA 4YYOA 4BISA 4QXBA 3ACFA 3ZXAC 1QU0A 4AHYA 3UNPA 4FPOB 4BE3A 1N3QA 4KWJA 5DMYA 5F32A 1QJZA 3T2QA 3AP5A 3OGJA 1DZRA 3ZYRA 3S5AA 1IKQA 3M3IA 3VBSA 3ZLIA 4IGQA 5FQ0B 2WFF3 1WD3A 2B42B 3GZAA 1I3HA 1CX1A 5F9TA 4IGOA 2WQ8A 3NNJA 2G4IA 1WLDA 4UW3A 3JB8A 5LB6A 3WDYA 4YVSA 2Q30A 2RS32 5HBAA 5L9BA 1UIJA 1QOSA 1UF2C 1VPHA 2DCKA 2EXIA 1K5MB 4AQTA 5C9AB 1JOJA 2AACA 2BGPA 1DP0A 1RTVA 2JB8A 4GULA 1PHMA 1H1AA 4M3CE 4PQQA 2VNOA 2E31A 5HCHA 4JDOA 3I2JA 1DGRN 1QJX1 5A7WA 3NJZA 5A3PA 3IB3A 4F7ZA 4CEWC 2H0VA 5LEJA 1FOD1 3CZUA 4MADA 5E88A 1JZ7A 1OKOA 5GLUA 4FPHA 2XKOA 1GQPA 5FUIA 4XACA 2WLQA 3OGRA 4XF9A 2VNRA 3MLJA 3NKGA 4AEDC 2BTVC 3ZSJA 2PHLA 1AYM2 4XDOA 2ZMLA 2RMU2 1YNAA 3CJIA 3P5BA 4D3WA 3U11A 4TLFA 3WDWA 4P5YA 3ZYJB 1X33A 2IXKA 3PL0A 1E5RA 1KRIA 5IYYA 5DZGA 1DYOA 1R64A 1GKBA 3HOBA 2HEWF 5EHDA 3VBFB 3W5MA 5GLZA 4AWDA 1RVF1 1NA1A 1XSQA 3BIWE 2R071 1PIV1 4N8MA 3N4MA 5T52A 1GQGA 5AFEA 5CIRA 4RQPB 3E6BA 2R7EB 3B9IA 1RUG1 3B00A 3WUCA 1QXPA 2P4EA 4A45A 3K48A 1PX4A 1RUC2 4JGZA 3NV4A 3O0XA 4XF1A 5LEKA 1X9TA 2A70A 4KWKA 4K3UA 5EJ3A 4CDWB 2HBUA 2CHHA 2BDRA 4QM9A 3J7HA 5LY2A 4C1WA 5AC91 4AI9A 4K1ZA 5JXJA 1WCDJ 5F5AA 4G3YC 1VRH1 2OKXA 4S2FA 3KT7A 1XJAA 1CQ9A 2E33A 5JOWA 5C3PA 2HWE3 1KXGA 3LPGA 4CPBD 3T0DA 4LXLA 4XUNA 3R05A 4QD2A 3ZO0B 3MICA 1C28A 1GFF2 2VUAA 5FZKA 2J1TA 2RM21 3ZM8A 5KHIA 4RFT0 3SEEA 3V0AA 1JOBA 2A6XA 4R9DA 2J1SA 4QU2A 1OF4A 4J1WA 1MZFA 3RDIA 1ZREA 2ZZJA 3VBHC 5AFBA 1BKZA 4COUA 1MEC3 1H4HA 5A7WB 1CN1A 2YGMA 1TEIA 4R8HA 5IK4A 2JDHA 2UYBA 2VZUA 1FPN3 1NY72 3CMGA 3KT4A 1NQDA 3KD4A 1NOVA 3E97A 4Q4V2 1LHNA 4RSUA 5TSWA 5FY0A 4AQ6A 1HJGA 1HRI1 5C5UA 4Z92B 2TBVA 2X5IC 1KFXL 3D8CA 1UY0A 1EYBA 1ULEA 2W47A 4ZU5A 4B1MA 2VOKA 3ES4A 4XXPA 5ABJC 4XCAA 2WN3A 4NUBA 4OYUA 1TE1B 2W5FA 3H1WA 3K77A 4P5HA 3O0WA 1BVP1 2XH6A 1UXZA 3VUOA 4HSLA 1Y9MA 1NAEA 3BODA 5KWRA 5HCAA 2E7AA 2EIBA 5F7UA 2RS33 1ZBA1 3HBZA 4R9CA 4RHV2 5CB7A 4MVTA 1MQTA 4UFKA 1KS5A 2P37A 4LR4A 3VBUA 2XVLA 4X6QB 1KD7A 4AHXA 5FWJA 3KHBA 3GJAA 2DCZA 3I59A 4RGAA 3SNMA 2VXJA 1D4M1 2P34A 4JGZB 3L9JT 4YM0A 3V56A 1OLMA 1QHDA 5CFDA 3PIGA 4XIOA 4M4PA 1GWMA 4AGRA 2ZX4A 3IDCB 1O8PA 1YJKA 4O7XA 3B69A 4DXTA 1AYM3 3FE5A 2W0XA 2RMU3 2GH2A 3ORJA 1AZDA 2AH2A 5JCTA 1NCRA 1QJEA 4FOYA 4XETA 3C3VA 4IV3B 2A6WA 3LE0A 4W6YA 4FQ4A 1L3JA 3I2IA 4YGCA 1OD5A 3M3OA 3N9PA 4MH0E 4FVVA 5LBFA 1PO21 3RGBA 1DLCA 2YHJA 5DG1A 3VZKA 1SDDB 3H3ZA 2YPJA 1FT9A 1GZWA 5CG8A 1RUOA 1ZRDA 1S0FA 1H8TC 2JIJA 2E53A 3U10A 5CAZA 1JYVA 2D98A 2GC2A 2Q4SA 2WWUA 1O91A 1VBD2 4JZRA 1SHWB 3IMMA 4OHZA 5T55A 3R4SA 4CEYA 5IVYA 4FAGA 5A3MA 4QX3A 2ERFA 2PHDA 1RUC3 4HT1T 1YQ2A 3QLQA 5FYMA 3C7HA 5ACA2 4BH9A 4TN7A 3WF3A 3ZIWA 5FZ1A 3ENRA 1TMF2 1NZCA 4UW5A 4YG0A 3B93A 2V4VA 2HYXA 1SBFA 2OW4A 1BHGA 1EV11 1LOEA 1HDKA 1SG3A 4MSVA 3VKOA 3ES1A 1UU6A 4HVRA 4CCDA 4CRQA 3FZ3A 2VZ1A 5JMCA 3MV01 3ELNA 3HNYM 1RUE1 1XYOA 4TLGA 4NHMA 3LEKA 2D93A 2XJPA 4PLMA 3WNXA 2NMNA 4LBQB 1R1A2 3FWEA 5FDBA 1CD3G 3OBTA 4FXKB 1U5ZA 1SLTA 3K46A 3VL9A 1FYUA 3ZFFC 1MQTB 2VZTA 4RS5C 4A2UA 1V6MA 4LUMA 4AI1A 1J58A 2VXRA 3QCWA 5CFCB 4KL1A 3GALA 4D7YA 3I59B 2DUQA 4HVOA 4I30A 4NIIA 4A41A 5BNPB 1ZRCA 1MS3A 5ANQA 4IEVA 4AK3A 4SBVA 4JGYB 1R092 2FDFA 4IV1A 4Q4V3 1V6KA 4ZKTB 1AR91 3DPRC 4DOUA 4XF3A 3ZX7A 1PNFA 3MIEA 4EWDA 2JE8A 4HZFA 5I8YA 1QNYA 1EAH3 3O14A 1QY4A 3ZXLA 1TME2 2VZ3A 2JX9A 3VN4A 4N43B 3AMPA 1E5HA 4CP0A 4AI2A 4A7ZA 4AVSA 3ZYGA 4PLNA 3LKJA 3T2PA 2VBDA 4DINB 1JTZX 3EJKA 3BTXA 5FO7B 4D6QA 2AUYA 3CL1A 3WF4A 3HD8B 2ZGRA 4C90A 2VR4A 3BTAA 5FPBA 1TVGA 5C4WC 3T09A 1A78A 1LOGA 4QPGC 2D3PA 5EWSA 4LBNA 3WINE 4ATFA 1RUJ1 1ND2A 2XJRA 3HNBM 2LRPA 5CISA 2R061 1IPKA 2UWBA 4OQ8A 4BHPA 4P02B 5L9VA 1OFNA 2C0ZA 4Q4W2 1AR81 3L2HA 4XFIA 3U4XA 2DVAA 1DGRA 4J6GA 2A6VA 4UFHA 3SHRA 5LA2A 2VW2A 5EFUA 1Q8QA 1UOBA 5EYXA 1PK6A 1OQDA 2O8QA 1XNAA 1XE7A 4LIUA 4QQHA 5ANNA 2O14A 2AYHA 2PHTA 3ETPA 4DEQA 1ZZ9A 3MFCA 1ZZ8A 1KGYA 1RXGA 3TBDA 1J83A 2BVVA 3WT3A 3SLIA 2JWPA 2RR12 3KQRA 5L73A 2PYTA 4HKWA 4OZOA 1ACCA 3ZXJA 3W20A 1C8M1 2ARAA 3I2FA 5M0TA 4KGGA 4D94A 5C7GA 1IQDC 1N1SA 4WVWA 5DDJ3 4N53A 2IUWA 2RJKA 4QX0A 5A3NA 1AL22 1S2EA 2CAVA 2ARBA 1VBD3 2WQ4A 3KV6A 4Z82A 2K0GA 4R9AA 4DXZA 5CBLA 4D6RA 3I8TA 3M1HA 4PLOA 2ZGKA 3Q8EA 4AR2A 5FZHA 3WXPA 2UWCA 4CPBA 1N1VA 1R081 4XUQA 5ACA3 5IK8A 1VBC2 5J7MA 3WP4A 4IV1B 4JTNA 1TMF3 4WM8B 1H8VA 1Z7S1 1LOFA 1UZWA 1V9U2 3DYMA 1AJKA 4E2SA 2BU9A 3GDBA 1XRUA 3KSCA 4COZA 3PUHA 4LK6A 4LHSA 1CAVB 4GH4C 4ONUA 4HN1A 5I0UA 2YYOA 3C7GA 1W9SA 3VDDA 4NWWA 5FPUA 3EHKA 3T1MA 3USSA 2X10A 3H1YA 4WM7C 3PTYA 5C3RA 4LO6B 1WUVA 2Y6GA 4CDUB 5J36A 5ISLA 1WCSA 1R1A3 3I3BA 3S7EA 1W8ZA 1KDKA 1VR3A 4IEUA 4RL7A 4BQWA 2YDEA 1ASJ2 1JU4A 3VZMA 1W8NA 4DY5A 1FXZA 2ZEWA 5CKQA 2VQTA 3C7EA 5LWBA 2ZAHA 3UKNA 1BLZA 5KXDA 2L9LA 2Y8KA 5FZOB 2EALA 3AJYA 1SACA 5FLJA 4C0HA 3B94A 1HB4A 4V1PA 4LTAA 1R093 5FY5A 3IM0A 4B29A 4E27A 2VMDA 2W9XA 1UL9A 2RG4A 1K5JA 3R4DB 4KWLA 4P9JA 1N1YA 3O12A 4BYYA 1PK6B 1WLWA 4GKXA 2RS51 4RS5A 1OLRA 1DQ2A 1V6NA 3LEIA 3LIGA 3MIFA 2XR4A 1KITA 1S0IA 5FOBB 1TME3 5C8CB 2J1VA 2ZCWA 4L11A 5HV4A 1CJDA 1HRV2 1RC6A 1N3PA 2BQPA 1MVEA 3A22A 1WKYA 4LK7A 1W8OA 1RUF2 4N9HA 4CE8A 4N7IA 1B35C 3ZFGC 3NV2A 3S6PA 1OI6A 5FZLA 3RS6A 3ZN6B 4O9GA 3FX3A 1ONAA 2UYAA 3K4ZA 4QWNA 1YEWA 4N53B 2UWAA 1LHWA 5DN2A 3MIHA 4OHVA 5L9RA 3O1TA 1O59A 2FDJA 4CDXB 1AR73 5BNNB 2XMLA 3LEMA 2G9GA 2FCVA 1REEA 2B5HA 4QX8A 1ND3B 2Y38A 2VM9A 1UCXA 5IK5A 4Q4Y2 4NIDA 1U12A 3AXDA 4Q4W3 1GWLA 2YZ4A 4LO8A 3T2OA 2JG9B 5JXGA 1PZ9A 5FZBA 2ZEXA 1QJU1 2XVGA 1LEDA 1NG0A 5B4XA 4XZUG 3ZSMA 3ZXEA 3OOXA 4Y20B 1GOGA 5IVCA 4HL0A 1ENQA 3HT1A 4LE3A 4XMAA 3VDDB 2YBSA 4BA6A 4QPGA 1RUI2 4S2HA 3PVNA 5FXWA 4FAHA 2DCJA 1YO8A 2VCCA 4L8QA 2WNEA 4XQ4A 3WCSA 2RR13 3JD71 4XF4A 1G86A 2GAUA 1O7FA 1SLCA 2OQ6A 1ULCA 1F9KA 1AJOA 3DL3A 4FFIA 1F35A 4FBFA 4MLOA 1ULDA 1RITA 3M8LA 2OPKA 2PLV1 1A6CA 3R4UA 4K7JA 2IWGB 4W6WA 3RYRA 1X8EA 1WW5A 1WGPA 5T3NA 5EPAA 1ZBE2 5T5LA 1PGW1 3BVCA 1SCRA 3QH6A 1VBC3 1VBE2 3NNLA 4HK8A 5FYBA 5FYYA 3J8F1 1JS9A 1V9U3 3VZLA 2ZEZA 1LODA 3KB5A 1MACA 1RUH1 1UU4A 3MGUA 4V2VA 4HLTA 4W50A 2WS92 2FDGA 1V6JA 1W06A 3OCPA 2PHWA 3I2KA 4HONA 2XUMA 1DU3D 5JI9A 4YZ1A 1HQLA 3WDXA 1QH6A 4DY3A 1VAVA 2W68A 5A32A 3DKWA 4QB6A 3IPVA 3W5NA 2K2SA 2GP5A 2W95A 4IW3A 4BJ0A 3ZMOA 1W9TA 2ATFA 1ASJ3 2R0FA 4QPIB 1WBFA 4YW1A 4IE7A 3D3AA 3UKTA 4E8DA 4WVZA 2VTFA 4XEZA 1FMD1 5JVVA 5GZFA 3TOJA 4I02A 4QGNA 4Y22A 5J1XA 1Y9GA 2JE7A 4OVEA 1S0BA 4I09A 4I3GA 4DPNA 2GNTA 1UWWA 2WWJA 2CWMA 1PVC2 2WZ8A 4TTGA 4CYDA 4CUBA 1AXKA 4HOOA 1PMIA 4DRVA 4MGZE 2VZPA 3GJBA 1W6OB 1W6QA 3ZXDA 2P3JA 5SV5A 5IHRA 3E5QA 2G19A 1BK0A 4CCLA 5FP4A 4CDQB 4CZSA 3ALQA 4IERA 4GWNA 1XE0A 3ZDVA 1XNTA 1HRV3 2GNDA 2XUEA 4BQ4A 2JD4A 3VBFC 3GZUC 3M2MA 2GDFA 2BV4A 4NVPA 2XDVA 2ZHMA 1OVSA 1UZYA 4LOSA 4QXCA 1MR5A 1RUF3 4X6RB 4Y1ZA 3SH3A 4ES8A 3RZJA 4RQPC 1JHJA 3M70A 4YRDA 4RR3C 4UAPA 5FLIA 3SISA 4ZPIA 4BXFA 2HEVF 2DTYA 1CZVA 2F4PA 5FXXA 4BXSV 5JZGB 5A3WA 4UBHA 3WNPA 5GZEA 5JLVA 2Y0IA 3TN91 1VRBA 2ZJCA 4QMAA 4JVAA 3N9NA 3AP9A 4URAA 3VBRA 4CDWC 5IFPA 1JYIA 2YXSA 3I3EA 3E5UA 4Q4Y3 3ZKUA 2WNVB 1CAXA 1WCQA 4CCCA 1ODMA 3AZXA 2D44A 3DUIA
chains in the Genus database with same CATH topology
2VNGA 4EV0A 2G9FA 2RS11 4LO7A 3W9AA 2DVDA 1ZZ6A 1CAWB 3AYEA 1C5HA 2XLAA 1VB2A 2ZX0A 5KXEA 4Y1VA 2HWB1 5A32B 3FLTA 4EROA 4Q1PA 3FLPA 3OGGA 4XJAA 3D6EA 5FO8B 1R1ZA 1HXS1 4AEJA 2OIIA 1W6MB 4META 4AVVA 4P9WA 3B02A 4P9YA 1Q8OA 5F6LB 4K20A 4Y22B 4BM8A 1V6IA 1ZBE3 2WZR2 3TB0A 1YUDA 1Q8VA 1VBE3 3CNAA 3OPZA 2ZGSA 5KHHA 1VBB2 1HLCA 4AVTA 3H8UA 4BOWA 1G9BA 2WS93 4HPKA 5JDBA 2JKBA 3RRDA 2CGPA 1RJ8A 1V70A 3NL1A 4YG6A 1DGWX 3MIDA 1UMZA 4CP2A 2R041 5JOZA 3CEWA 1AX0A 3LZZA 1OA4A 1W6NA 1KDMA 4AEMA 4EN0A 2KM2A 3WZ1A 2Q5TA 2XBO1 2BVBA 1RL3A 2B9UA 4UW4A 4YSFA 2WNUA 1XNDA 3OYWA 2BWAA 1PVC3 1QQP3 5JIAA 1WMEA 3VKLA 3H3UA 5C33A 2WC2A 3NV1A 3CO2A 3RSJA 1QJX2 3Q9OA 2FZ1A 3VBOC 1YFXA 1I6XA 2WJSA 4IV3C 5L7OC 4ORFA 2MEV2 1F8VA 4N90A 5DUWA 3USUA 2R16A 4LHNA 2XPJA 3ZSKA 2H6BA 4DNYA 2XLFA 5HCBA 1OOPC 1YFWA 1KFUL 1SLLA 2DF7A 1WD4A 2W08A 4Q4X3 3MLKA 3TNPB 4E4SA 5A33B 3GF6A 4BZ4A 1X82A 4OLLA 1DQ1A 5AVPA 1RVF2 2IZWA 3VL8A 4OHXA 4KG0A 4XBNA 1LULA 4TYSA 1OQEA 2YY1A 1YJLA 1ENXA 3VHNA 2GZWA 1QJY2 1NE4A 1AYN1 4GWMA 3A4UA 5DG2A 1KJRA 2QFEA 1ZRRA 1D2SA 2ZGUA 2ZACA 2CV6A 5AC92 1SLIA 1V6OA 1J1LA 1O4ZA 1VRH2 1XE8A 5CFCC 4LA2A 4IEWA 5LRRA 3SH5A 2CYFA 4ASMB 1W6NB 1D4VB 3NAPA 1J3QA 3I7DA 2OZJA 1LKNA 1IS3A 1H9PA 4JGYC 2EAAA 2WZR3 2XLGA 5I8TA 3AZVA 2A3YA 1H2NA 2X8KA 2WZPP 2WNUB 2GN3A 3PJQA 4Q8LA 4H3WA 2PFWA 4L9BA 1IS6A 4Z07A 1VBB3 3HWJA 4NO4A 3TYJA 5FRAA 3VZJA 4TSVA 5FPXA 3V64A 4NR1A 3HT2A 4N43C 1H2MA 4LBJA 4GXLA 3ZFEA 3DV8A 3MPPG 1UU5A 2X29A 2DU1A 3N7JA 5K0UC 3AZYA 4AQ2A 1YXWA 2HWE1 2Z5WA 3USUB 2PAEA 1AL0G 4PIXA 1NCQB 4OI4A 2VUJA 1VJ2A 1YCIA 1URXA 4KBBA 1AR63 3UL2A 3VGIA 1C4RA 2A7AA 2JENA 3GNEA 4B4QA 4XJWA 2TEPA 3KCYA 4COVA 4Y5Z0 5FLHA 4YM3A 1MEC1 4AFBA 1ZBA2 3I54A 4YGBA 3UV9A 4M3CA 4L2NA 1FPN1 1VBA2 2MNGA 5FREA 2QNKA 3PJYA 1GYKA 1J1TA 1RMU2 4OZXA 2UY8A 2BWCA 2IXCA 3VBSB 4XXAA 1CONA 1GNHA 3AP6A 5K7PA 1IOAA 2D3RA 2H0BA 3APBA 2NN8A 2P2KA 4AF9A 2CWSA 4IL7A 3AZZA 2WA3A 3WUDA 2MEV3 3ETQA 1SCSA 4YVSB 3IKWA 1BMV1 4NN0A 4KG8A 4Q2FA 4XMIA 3FMGA 1BBT2 5BNOC 5GKAC 1Q56A 2RS31 1FATA 4Z1VA 1TNFA 1AF9A 1H1IA 4JTOA 3BOWA 3ZPYA 2WL1A 1OPOA 2A73B 3LGRA 2E9QA 1PO22 4PIYA 4A7KA 3B9CA 5JSRA 5D8AA 1WMFA 4FPGA 4WM8C 5GZGA 2MPFA 1PM7A 2E63A 1S0JA 2JEMA 2B39A 2D6LX 5D1IA 4D7TA 5F6KA 2C5DA 1PGL2 3CJIB 2WLPA 5J37A 4FTBA 3S0MA 4OHYA 3FBYA 1AYM1 3G7DA 2RMU1 1QJY3 4GA9A 3ZFEB 2BBVA 3POSA 4I0BA 4CDUC 4U36A 4DRRA 1H30A 5HI0A 4AHZA 3AXEA 2AZ5A 5KXBA 1LGBA 1NA1B 1X8MA 4XHBA 2WQZC 4YZ4A 1VRH3 1LTEA 2AGSA 2YMZA 1IPJA 1QMJA 2F6BA 4QX5A 5I0TA 2DFBA 2C1FA 3D0SA 1RUC1 3M7AA 1PZ7A 2WWSA 2HWD2 4LBLA 1PNGA 1QH7A 4FPKA 4JC1A 1DLLA 4QQ2A 5C8CC 1Q43A 2ENRA 3LOIA 4ISRA 2E7TA 3CF6E 5JPMB 2WSUA 4CEWA 5CU1A 1E57A 2BUKA 3ILFA 3V0AB 3MIBA 1ALYA 3VZNA 3OD4A 1S1AA 4AEDA 3JBG2 2D6OX 4CDXC 4QQLA 5KC6A 1SQ4A 3NO8A 1Y3TA 2ZGLA 3GZTB 3O7OA 2PHRA 3RYPA 4GB32 1ND3C 1LU1A 4F3JA 5LK7B 4EN7B 2JG9C 1VBA3 1NY71 3WW1A 1RMU3 2I45A 1RIRA 4Q4V1 4P9GA 3JQXA 3ME2A 2FMYA 3AMHA 2ZGTA 2O0OA 1WLCA 3AKPA 4E4ZA 1Q5OA 1RUJ2 3AKSA 2D5FA 4Y24A 1OA2A 1EAH1 4Q0VA 5GLVA 3RZZA 2ZX1A 2HWC2 2IFRA 3WOGA 3I2DA 2BYVE 1IS4A 4GMP0 4I0AA 1BBT3 3LWCA 3VBUB 3ZMNA 3H50A 2WT0A 3WY6A 1LOCA 2P3KA 2BGCA 3AP4A 2B7YA 3ZSEA 1SFYA 5A3LA 4MGIE 3WP3A 1BEV2 3PMSA 5CFDB 4IETA 1ZM1A 2A6ZA 2ZGPA 3GHMA 2BFUL 3WG1A 2O1QA 1Q8PA 5T50A 1RHI2 1DQ4A 4Q0UA 2ZHNA 4I01A 1BVVA 4PDWC 4E2QA 1NCRB 1PGSA 3VBHA 3IDEA 3EBRA 4MXVA 1O3TA 5FFOC 1RUD1 1LOBA 1WBLA 2BNMA 1O3RA 1LEMA 4RHV3 1GZWB 4GMP3 3ZYPA 1LGCA 3FHIB 3GBGA 3B3QE 3LAGA 4QPIC 4HVQA 1IGOA 1YFYA 4AEDB 2X5IA 2B46X 5DDJ1 3OJBA 1HW5A 1XNKA 4CEYB 4FTEA 3THTA 1VBD1 5ABJA 4OI1A 1S0GA 5ACA1 2FMDA 3EQEA 4JRLA 2HWD3 3LSDA 1TMF1 3PMEA 3WDTA 4CDQC 2JXAA 1FV3A 4JRAA 4XFBA 2GSYA 3IWZA 1A8DA 3NWKA 4HK9A 1QDCA 1UAIA 4FPEA 1DYKA 4B3NA 1LECA 3WVJA 4OUSA 2VVDA 1R1A1 1SMVA 4LBMA 3N7KA 1AXZA 1JHNA 1YLLA 1ZZ7A 5JZGC 2Z79A 3JBG3 3M3EA 2E7QA 4HANA 2ZGNA 4AYUA 4LNVA 1PO12 2B8MA 4FOVA 5IUQA 4GB33 2VOWA 2ZGQA 2WNVC 4XFFA 2A71A 5FO9B 1UPSA 4IEQA 1D2QA 1R091 3MEPA 1H8TA 4HN0A 1VP6A 3OY8A 2VMIA 2JG8C 3WW3A 1RUJ3 4DB5A 3VBHB 4IEZA 4BLJA 3D4KA 4B7KA 2HWC3 1MZEA 1TME1 2ZTNA 1WW6A 2JE9A 4O9EA 2OZ6A 2EVXA 1QJU2 4LHKA 2W52A 3JU9A 1O5LA 2BFUS 2BPA2 1WLTA 1BZWA 2HYKA 4IQPA 3WR0A 1ND2B 2VW1A 1AX1A 2EXJA 1ZX5A 2DVFA 2GNBA 2SBAA 1AR71 2AR6A 3PVBB 1BEV3 3PNAA 4FCAA 1HV0A 2VU9A 4XBQA 3A0NA 3E6DA 3RPQA 1RHI3 2ZGOA 3LA3A 4Q4W1 4Z8BA 4XPVA 3ZFFA 2GC1A 2GMEA 4ZU4A 4YZ2A 1Z78A 3KMHA 4GQ7A 1XU2A 5GM0A 1PGW2 5JI7A 5E1RA 4XW3A 3AX4A 2A3XA 1LGNA 3BB6A 4MGYE 3FJSA 3DPRA 4Q0PA 3EO6A 2R32A 2RJLA 3D0JA 3LA2A 1I5ZA 4XOGA 1VB4A 3IN9A 4RD7A 2GC3A 3MPBA 4AI3A 4Y1XA 4KGQA 2K9ZA 4I0WB 4AFMA 3PVEA 3VKNA 4GIQA 3P3NA 1XQNA 3O0VA 3WX5A 2EIGA 5CA6A 1CPMA 1HV1A 4PIZA 4FP2A 2XJQA 2WKKA 4INDA 1VBC1 2FQPA 5LK5A 4MYEA 3L2YA 4AFCA 1FMD2 3OY8B 3WW4A 4WBBA 1V9U1 5C4WA 5DUVA 4YNIA 1Y43B 3U07A 3WG4A 1COV2 4Y26A 1GQHA 2RE9A 3ZYIB 2DYCA 1TQ5A 1LR5A 2JICA 3S7IA 1VALA 2HWF2 1AL23 1OSGA 4AI8A 4YVWC 3KGZA 1ASJ1 1EP0A 2ZZQA 1PO13 4Y1UA 1S0EA 2ZX2A 4F8AA 4P9LA 4DMIA 1YIFA 3AKRA 3IIAA 1W6PA 2XL9A 4E2GA 5JOXA 2EF6A 4EN8B 4YZ3A 3ZFFB 4LHLA 5JPNB 4RS5B 4MZUA 4AW7A 1NXD1 3WHTA 4OI2A 2QZ3A 1TNRA 4FQZA 1XNBA 4YLZA 1DZTA 2ILMA 1XXNA 1K5MC 3AM2A 4B8EA 1HRV1 5C9AC 2YC0A 1MS4A 2BW8A 4C0BA 1WW7A 1HIXA 3VV1A 1QJU3 1RUF1 3DPRB 1POV0 4AVCA 4FPYA 2RS12 3QH7A 2UY9A 5BY5A 3MLLA 1ZA4A 1IKPA 2JG8A 2CGOA 2FHRA 2ZMNA 4GH4A 1JN2P 4LE4A 4HKLA 4WM7A 1REDA 1N3OA 4Q4Y1 1HXS2 5L36A 4X8PA 2NPIA 5E89A 3CJXA 4K21A 2XJTA 5GZDA 2SLIA 2PA7A 1U5YA 4QPGB 1NCQC 4MXWA 4P9IA 3GHNA 4ZXKA 2E6VA 4JQRA 5CNAA 4PBOA 1POV3 4XHXA 2NM1A 1SEFA 1FNYA 3W59A 4B4PA 5J48A 2GU9A 1VAMA 1PZ8A 1HQNA 1SLBA 1UN1A 2GMPA 3RQ0A 5T5PA 2X53S 1LESA 2ZKNA 3PLQA 2Y26A 3IBMA 4XQDA 4OULA 4QGLA 1ZBE1 3VBSC 1C57A 1OLQA 3ZFGA 1B35A 5F5QA 1VBE1 1O4YA 2DU0A 1H2LA 1KQRA 2XBO2 1Q8SA 2MHFA 5KHGA 1RUI3 4YVSC 2XWJB 1F31A 2WS91 1COV3 1IZ3A 3AB0A 3MW2A 2QZ2A 3IPVB 3FFZA 5T54A 4LUKA 1O3QA 4AFDA 3O5SA 4OI0A 1HQWA 2Q1MA 4LBOA 2HWF3 2NMOA 4L97A 3MI8A 4COWA 1QGLA 3P3PA 1CR7A 2N7GA 1BJQA 4XJUA 1B09A 1J3PA 4XF0A 5GLTA 3ZDSA 4WM7B 2GMMA 1S2KA 2P17A 3CJIC 2JECA 4EN9B 4FOQA 4J1XA 3MIGA 1PVC1 1QQP1 1HKDA 2QDRA 3UJOA 1W6QB 3JB4C 1I1EA 4K8FA 1CX4A 4Q27A 3WLUA 1N1TA 1H0BA 4LBQD 4DFSA 3LCPA 1GICA 1D0GA 1NA1C 4JDMA 2VMHA 3WQ0A 3KGLA 1M06G 3A0KA 1DF0A 1SBEA 2NZ9A 4ES9A 5FQ0A 1OHFA 1AYN2 5BNQA 2RS13 4JGZC 4Q4X1 1DYPA 1YYNA 1FI2A 4KU8A 3LSEA 4CTEA 3AMMA 3B01A 3VBRB 4KU7A 2ZMKA 5FTTC 4AI0A 1QNWA 1WCKA 1CAXB 2DUPA 2D6PA 3OF1A 5BYNA 1NLSA 1UPIA 3AK0A 1NXMA 2DCTA 1YFUA 5C9AA 3RI8A 1FOD2 3RJRA 2OYZA 2WFF1 3SCGA 2DFCA 4LULA 3QOPA 2Q0AA 3VZOA 3AFKA 2QJVA 4YARA 3NW4A 4MV2A 1XU1A 2D3SA 1GR3A 1GBGA 1U0AA 4PBPA 4XTPA 3E5XA 3BPZA 2PELA 4OHWA 5T5OA 4FOWA 2R072 1PIV2 3POYA 5H9PA 1H4GA 2VGDA 2Z2SB 2PHFA 2XJUA 3VBFA 4CP1A 1RUG2 2WZR1 2C9AA 1QOOA 4RQPA 2VECA 1DHKB 4XDQA 4RR3A 2FZ2A 4I3PA 1GZCA 1VBB1 2ZAAA 3S30A 4HPKB 4PJYA 4ZU7A 4FPFA 3UK9A 1MVQA 1DQ0A 3ILNA 4DQAA 2V09A 4AEKA 4HBNA 5KHJA 1MQTC 1LRHA 4CDWA 2P3IA 3VBUC 2I07B 4YGDA 2NYYA 5K8SA 1D0HA 2YGLA 1MZ5A 1AR61 4LA3A 5BNPC 3CU7A 1RUNA 2RM22 3HQXA 1BMV2 1F5FA 3ZXGA 2IXIA 5CFDC 4BIFA 1X7NA 5CVRA 1QDOA 2IXHA 2DTWA 4F83A 3OYWB 3M3CA 3TRSB 2QUOA 1BCXA 1CIWA 3V0BA 1X50A 4XTMA 2E51A 1NCRC 4XFCA 4GALA 2D97A 1JYCA 1U5IA 4E4DX 2UU8A 3AYDA 2R6QA 4BMBA 1AUYA 2ETEA 1AVBA 4XZPA 1HRI2 2MEV1 3JUUA 4AQSA 1EPWA 2DVGA 4XYXA 4LLOA 2VQ0A 4RGGA 4CEYC 2ZOEB 1AYN3 2WT2A 5JR7B 2XWBB 3X29B 3URFA 1ULFA 2OA2A 3BCWA 4B7EA 3I4IA 1Q3EA 4LT5A 2PAKA 4LO4B 3N36A 3WHUA 4XIKA 1JUIA 1QJX3 2GNMA 3JCIA 4WVMA 1OKQA 4RR3B 1D4M2 1FOD3 1GSLA 5BV6A 1PVXA 4ISQA 4HFSA 5JSOA 1KS4A 4PF5A 1QJY1 1NQJA 3GBFA 1S0CA 1Y7BA 4XJ9A 2HJIA 1DFQA 2XB6C 2LM3A 1OFSA 5DZFA 1RB8G 2LUWA 4L92A 4QPYA 4GKYA 3KS7A 1G9DA 3FC0A 4BWOA 3B5LB 2HEYF 3HN1A 3VBOA 3NAPB 4IV3A 2Z69A 5L7OA 4IV1C 1RVF3 5L19A 2R073 1PIV3 2ZX3A 2KA3A 1ZYBA 2RHPA 1RUG3 3MYXA 3SCHA 4OFGA 2VW0A 4AVAA 1OOPA 3V0BB 5DUXA 1DQ6A 5FAXA 2VMGA 3N7LA 4QM8A 2TNFA 5JAXA 1AHSA 2ZA9A 2EXHA 2IXLA 3CLPA 4BPZA 1QF3A 3AMQA 5AC93 3MZHA 2AENA 1S0DA 3V65A 1EV12 3HMYA 4JCKA 5KXCA 4WV8A 1UW8A 1C8NA 4DZGA 1QXRA 1RUE2 4M01A 3WDVA 2NLRA 1EAH2 1ND2C 4Q0QA 3JZVA 2WSVA 3RNSA 2RM23 3DGTA 1V00A 4M3CB 4LBQA 1ZVFA 3KCXA 3VLBB 2I2SA 1GLHA 1PK6C 3BU7A 4QQOA 1VBA1 2XL7A 1RMU1 1XNCA 4URTA 4K6BA 2WINB 4WVMB 5CFCA 2D6KA 1G8WA 3INAA 2D6NA 2D7FA 3AYAA 4BMEA 5BNPA 1AR92 3DF0A 4LEJA 3AJZA 5EV7A 4JGYA 1HRI3 3RMYA 2PHUA 1S2BA 2D43A 4N53C 2WT1A 5DZEA 4PCRA 2NP0A 2BEOA 4FPCA 1BBT1 5BNNC 3UJQA 3N35A 4FPJA 3SMHA 1RUD2 3VBOB 2GN7A 3NV3A 1YI9A 3H1MA 4N43A 5BPXA 3LB9A 1ZBA3 5L7OB 4C1XA 5EYYA 5K0UA 3FUOA 5D8AB 5GLWA 1C5IA 1LOFC 4R52A 4TZDA 1VAKA 4R4ZA 2VQAA 2XJVA 3HAGA 5DDJ2 5E8AA 1RGSA 3D82A 3KM5A 1OOPB 1NYWA 5I8SA 3VDDC 1LB2A 2R062 1D4M3 3FBMA 1PGL1 4FP3A 5HCFA 1LJ7A 3NKTA 5KC5A 4NPRA 1ZZCA 1AR82 1OPMA 5IK7A 3U0ZA 1GNZA 1IHMA 1DIWA 4AGVA 3ROUA 5GZCA 2PHXA 4RHV1 4PQ9A 4GMP1 2XKPA 4N7UA 1BK1A 1CVNA 1LU2A 1QXJA 3WDUA 1PO23 4YG3A 5EZWA 1C8M2 2B45X 2H6CA 4XFHA 5T5JA 4QXKA 5I93A 2QKDA 4M0HA 1YI7A 4S2GA 4LLFA 3DN7A 3MW3A 1MS1A 1G9CA 2CAUA 5BNOA 4TWTA 2YUEA 2QCSB 5FOJB 4G9SB 5DUUA 2HWD1 4H7LA 4QGMA 4H14A 1R082 3TAYA 3FLRA 1BYHA 4CEWB 1FAYA 1GZ9A 3M4FA 1Z7S2 3AKTA 3BALA 4Q26A 4YGEA 4NHLA 1EV13 4BLIA 4WM8A 1X36A 1RUE3 1J59A 3PHMA 4SLIA 1DZQA 3SXWA 2FBEA 1CAVA 3GYDA 5BXXA 1V6LA 3JBG1 2VG9A 3NVCA 3WW2A 1M4WA 1OQ1A 2ET7A 3IT8A 4Y1YA 4CDUA 4GB31 5K0UB 2WA4A 4IEXA 2CY6A 1Y9QA 1CAUA 2XJSA 2DUOA 4H7MA 4JDNA 2EXKA 1DGLA 2QE3A 2Q8OA 3RMXA 2UURA 3H9AA 3TWIA 4C91A 4MGKE 1AR72 2ZBJA 2ZKLA 1AR93 4HSJA 1LHVA 4WZFA 4BIOA 2HWC1 2YV8A 2RS52 4YW4A 1CGPA 2Y0OA 1RINA 3ZXFA 4KQ7A 1I9RA 4MX3A 4XFAA 3WG3A 4YFWA 3MFAA 1W2UA 1RUD3 1UX6A 4UBGA 5C8CA 4ATEA 4UW6A 4COYA 1WA4A 3MF9A 4IXLA 1LHOA 4IEOA 1SBDA 1H2KA 3OD0A 3RG0A 5F1RA 1BEV1 3ZN6A 1BXHA 1YIPA 4HETA 1AX2A 1DG6A 1H1MA 5BNOB 3RJ2X 1APNA 5J09A 1RHI1 1HX6A 4I2OA 1ZZBA 2R063 3QD6A 4CDXA 2EAKA 2YROA 3R6SA 5BNNA 1OA3A 1O3SA 1UKGA 1AR83 1W0OA 1ND3A 1BQPA 1YHFA 4Q1RA 3ZXKA 1G9FA 4DS0A 3AMNA 2JG9A 3J26N 4YM2A 4YW5A 4YM1A 2X5IB 2LTNA 3SCFA 1W39A 2I74A 4Y20A 4EWEA 1G6NA 2OVUA 1MZ6A 5ABJB 1G9AA 2W39A 3JD72 1LHUA 2R49A 1C8M3 2R1DA 1VIWB 1MS0A 3ZIXA 3IMNA 2R30A 2ZGMA 1T6GC 3SH4A 5IT6A 3HIFA 1AXYA 2PLV2 3KCCA 1CAUB 4YFZA 5JWPA 3LOBA 2GC0A 4XJ8A 5JOYA 4W6XA 1R083 4AVBA 1C3HA 4XJZA 3G6JB 4M00A 3TNQA 3J8F2 1Z7S3 2NQYA 2RR11 1NLRA 1RUH2 1EY2A 5H9RA 4NHKA 4E9KA 1JH5A 4PDWA 1AL21 1SFNA 1VLNA 3VBRC 3VKMA 5FPZA 2DCYA 1PO11 4L99A 1DBNA 2OUHA 3H7YA 4XQWA 4BQ1A 1LENA 2QVSB 3WG2A 1ZNPA 4MUVA 1H8TB 3ILRA 3WP6A 4QPIA 4A7YA 4AHWA 3K51A 2Q1ZB 5H9SA 4XBLA 2QQPA 1OMIA 1SDWA 2IXJA 1QOTA 1REFA 2ZHKA 5I0SA 2RS53 2VY0A 5AVAA 3N7MA 4AE2A 1W6OA 1ENSA 3OBRA 2VH9A 3UKVA 3ZVXA 2DV9A 1XYPA 3KZ4C 4XE9A 3WV6A 4CDQA 2OUJA 4NWVA 1CJPA 1FNZA 1QKQA 3WD5A 2DWRA 2XHKA 3WP5A 2R1BA 3KT1A 5E16A 4IEYA 5C6CA 3ZN4A 1N47A 4H55A 4U2AA 3TN92 3T2TA 2ZHLA 4FPLA 5JZGA 1UZZA 1YWKA 3AKQA 4JV4A 4FT8A 3VKFC 2A6YA 2JDZA 4Q29A 2AREA 4R4XA 4FSJA 1J3RA 2WFPA 2WNVA 1MS9A 2XGXA 3AP7A 4EWAA 2PAMA 4X8NA 2R0HA 3J4UH 5H9QA 3D5OA 1LOAA 3LA7A 4Q8KA 2LALA 4XFGA 3RYKA 2BNOA 3ZSLA 4PDWB 1POV1 4KH9A 5FMOL 2DURA 2HWB2 3JD73 1CAWA 2WNUC 5J98B 2HKXA 2EA7A 3QBQA 4KNCA 2XVKA 1DQ5A 1S55A 2VVFA 4AG4A 2PLV3 4IESA 4HMZA 3FUQA 1W6MA 3ATGA 5C4WB 3ST7A 3HR9A 3WCRA 5B2GB 5KHKA 1CPNA 4JAAA 3MF6A 5I0RA 5JSPA 1IQAA 4FO9A 4K40A 3JQWA 4FTSA 2O8OA 1SLAA 1RUI1 1G7YA 1KJLA 2VVEA 3J8F3 1YRZA 1COV1 1QQP2 4BCUA 1RUH3 5K9YA 3RI9A 4HKOA 2PQQA 1JBCA 3BOPA 4WZCA 1JUHA 4S2DA 2VPVA 3ZN5A 4B4RA 3THPA 3H7JA 2HWF1 4OUMA 1IS5A 2R042 4YZ5A 3VHRA 2V5YA 2ZPXA 1C1FA 5LRSA 4P14A 2CGNA 1W6PB 4RA0A 2JJ6A 4YW3A 1UIKA 3E6CC 1FMD3 4A3XA 4Q4X2 4QQPA 1MS8A 4EJRA 1GANA 4R9BA 3J9SA 1FV2A 5J96B 2KXLA 4AXOA 4IEPA 1DDLA 5HXVA 4D7SA 3VHPA 3ASIA 1NE6A 3OTFA 2VULA 4QHBA 2A3WA 2V73A 2WFF2 4M0NA 1C1LA 4W65A 1LCLA 3NAPC 3POWA 2VOVA 4UXAA 2JG8B 1O4TA 4GH4B 3WQ1A 2D6MA 3QACA 4FXGB 5JIUA 2A75A 2XG3A 2ARXA 3GBWA 1F5JA 3RWNA 1RJ7A 3ZFEC 5A33A 5I91A 3TN93 5KBFA 2GH8A 3H0OA 4K1YA 1W0PA 3W58A 4YVWA 2QDNA 2ZABA 1UD1A 4QT6A 4G4FA 1O5UA 4MXWB 1WW4A 2IC1A 5FMOS 1QWRA 3KLSA 5GALA 4P9XA 3C2UA 1ENRA 1H9WA 1JXNA 5SV8A 4EN6B 1DGWA 4YW2A 5FBZA 1Z0HA 2VOXA 5FCCA 3IDBB 2A5ZA 4WVVA 1CESA 3FFQA 2HWB3 2PN5A 3ECQA 1GV9A 1K5MA 1WMDA 2WIIB 3AZWA 1HXS3 1B35B 1JW6A 5GJ6A 3ZFGB 1AR62 1XYNA 4LBKA 4Y4YA 4AFAA 4N9IA 3MW4A 3EXUA 4AGGA 1U5XA 1ZRFA 5CADA 1FX5A 2GALA 2Z42A 1UKRA 2ZS6B 3VHOA 3T1LA 3R0RA 1EPZA 2CNAA 3AYCA 3SITA 4Q0SA 5J3UA 3NSTA 2TUNA 4Z2WA 3B7MA 3WQ7A 5EXOA 4ITCA 2HWE2 2D40A 2DVBA 2BNNA 3AFGA 2CTVA 1MS5A 3MDPA 4LO5B 2R043 4XILA 5D8AC 2ES3A 2ET1A 5DXDA 1NCQA 2D5HA 2PTMA 1ULGA 1A8MA 2CL2A 3N3HA 1A3KA 1MEC2 5BUVA 2XBO3 4K9SA 5CG9A 3PVOA 4D69A 4YVWB 3M3QA 1FPN2 4NOTA 1F2NA 2IFWA 4M3CF 3ACLA 4ASLA 4YYOA 3ZXAC 4AHYA 1QU0A 4FPOB 4BE3A 1N3QA 4KWJA 1QJZA 3AP5A 3OGJA 1DZRA 3ZYRA 1IKQA 3M3IA 3VBSA 5FQ0B 2WFF3 1WD3A 2B42B 3GZAA 1I3HA 5F9TA 2G4IA 1WLDA 4UW3A 3JB8A 3WDYA