1C5IA

Hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGDFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Hydrogen bonding and catalysis: a novel explanation for how a single amino acid substitution can change the pH optimum of a glycosidase.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 50
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1999-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c5iA00
3AKQA 3VL9A 3LB9A 3RI9A 1XYNA 4IXLA 2Z79A 1TE1B 5EJ3A 1XNKA 3VGIA 4H7MA 1QH7A 1XNBA 1M4WA 3VHOA 2QZ3A 2D97A 5K7PA 1OA4A 4XQDA 2VULA 1HV0A 2DCKA 3LGRA 4HK9A 1OA2A 3AMQA 1XXNA 2NLRA 2DFBA 3VZNA 1UU4A 1OLRA 3B5LB 2JEMA 2VUJA 4S2HA 3WP5A 4S2FA 3WY6A 4HKLA 3M4FA 3WXPA 3AMNA 1BK1A 1REDA 3RI8A 1XNDA 1XYPA 3MFAA 3WQ1A 2C1FA 2BWCA 1OLQA 1REFA 1KS4A 2DCZA 1H0BA 2QZ2A 2B46X 3AKSA 5K9YA 4HKWA 2DFCA 3VZLA 1C5IA 1NLRA 3HD8B 4XQWA 4S2DA 1XYOA 3ZSEA 1C5HA 2BW8A 2DCJA 1AXKA 1XNCA 3WP6A 1HV1A 1REEA 3VL8A 1OA3A 1IGOA 3VZOA 3WQ0A 1PVXA 3WR0A 2B42B 5HXVA 3MF9A 1H8VA 1UU5A 2NQYA 3AMHA 1BCXA 1T6GC 2DCYA 2VGDA 3AMPA 3AKRA 4XQ4A 3VZJA 1UKRA 3MFCA 3VHPA 4HKOA 3VLBB 2BVVA 1F5JA 1H1AA 1UU6A 4NPRA 2D98A 1H4GA 3O7OA 3AMMA 3VHNA 3VZMA 3B7MA 1H4HA 3AKPA 4XPVA 4S2GA 4HK8A 3WP3A 1ENXA 3VZKA 2BWAA 2JICA 3WT3A 1W2UA 2VG9A 3AKTA 3WX5A 2F6BA 1HIXA 1KS5A 3MF6A 3WP4A 1BVVA 1YNAA 2JENA 1QH6A 2B45X 3WQ7A 3EXUA
chains in the Genus database with same CATH superfamily
2FDGA 1YFYA 2D6KA 3NNJA 4FPOB 4XF9A 3RJ2X 2W2IA 3FC0A 4FAHA 3BI3A 1IQDC 5IHRA 1JZ6A 1AYM3 2HWD2 1COV1 1LHVA 1LOFC 3LOIA 3ACIA 2Y38A 1SFNA 1AR63 5FIXA 1VBD3 3GYDA 3RZHA 3D3AA 2QQVA 1QIQA 2BZDA 2WNUC 5EJ3A 4ZU5A 4AEDC 1EY2A 5A80A 1AL22 4GKYA 4D69A 1VP6A 1JH5A 4L11A 3OPZA 3ZMOA 4DIQA 4IQPA 4DEVA 5CFDB 4AXOA 2WO7A 3NAPA 4B7EA 5H9PA 2MNGA 2BGOA 4R4ZA 2CYFA 1F4HA 2GNMA 4CP9B 1NQDA 3B9IA 3LGRA 4JZRA 1MS3A 3VD7A 1TME2 2VPVA 5FPZA 2G4IA 4MXWB 2OUHA 3OEAA 1M06G 4N9HA 5KXDA 3HNBM 1S2BA 1W2AX 3MW3A 1IQAA 4LKSA 4J25A 4CZSA 4Y20A 1GOHA 4X6QB 1WLWA 1V6KA 2VTFA 1NCRB 4UOJA 5EJ1B 5IATA 4FTBA 3SCFA 4LT5A 1F35A 1VBC2 4JDOA 4MYEA 2W94A 5T5LA 3ITQA 3JB4C 4IL7A 3DPRA 4QQHA 2J1RA 4OFGA 5JOWA 4LE4A 2VW1A 4LHNA 4HVQA 5JMCA 4DUWA 1W03A 3RRDA 1RMU3 4QKDA 2VCCA 3J7MA 4XQWA 4BYYA 1K5JA 2DVFA 2H0VA 4TXWA 1W8HA 3OF1A 5FMOS 3MPPG 3VBUC 4A45A 2J1UA 1YFXA 4Y33A 2B5HA 3Q8EA 3NNLA 1Y9GA 3J8F1 1OXCA 3UKVA 2LW8A 1OBNA 2ZEYA 3PIJA 3PUQA 3U78A 5SV5A 4CEWC 3ZIWA 1QJEA 3CMGA 4PT6A 4EJRA 4QHOA 1FMD2 2HEYF 2MPFA 4PJYA 1XE7A 2JDMA 2MEV1 1SBDA 2UWAA 3HQRA 1MPXA 3M3IA 2Y6KA 4XF1A 5LA2A 4BZ4A 5J7MA 1FI2A 2P2KA 4IE4A 1RUC3 2WFPA 4CEYB 1AR61 2EVXA 4AQ2A 4AVBA 4URTA 5BNPB 3PNAA 2VGDA 4QX2A 1QJX1 5BNOB 1QF3A 1W04A 2P3IA 1QXJA 4BOWA 1RUJ1 2ZEXA 1QJZA 2ETEA 1S4CA 1WZXA 2V5DA 2CGNA 2GC3A 1I6XA 4PF1A 4Q1RA 5IVEA 1UZVA 1H1AA 2BVVA 1QY4A 5FZEA 1HX6A 1ODMA 4MGZE 2XJTA 4XOGA 1QQP2 3AMMA 1HXS1 2BQPA 1UY2A 3ECQA 1S1AA 2HJIA 2A3YA 1UXXX 4KG8A 3ZSMA 4Q4X2 3B3QE 3LDKA 1ZVFA 3JBG2 2E32A 1WMFA 1HRV2 2XMLA 4F3JA 2YBSA 3VD4A 2E51A 3TRSB 4EQVA 4HK8A 5J1XA 2NM1A 4CCOA 1C1LA 1OQEA 1UMIA 1V9U2 1V6NA 1ZA7A 3MLJA 1LRHA 5JR7B 4NROA 3BTZA 1CAVB 1UYPA 4EN9B 4FP3A 3B94A 1NA1A 2P6HA 4JVAA 2YDEA 4BWOA 2WBKA 3HVDA 1VBE3 5KHIA 3HT2A 4HSJA 2LROA 2PQQA 4GD4A 4JCKA 5DN2A 4EN6B 2OQ7A 3LB9A 3DL3A 4FFFA 4Q4W2 1ND3A 1HQNA 2BFUL 1YLLA 2G19A 4HLTA 5LA9A 5JMOA 2Z42A 4OUSA 5FMCA 3PMSA 2C5DA 2B39A 3BOPA 4WVZA 1POV0 3ZFGA 3MEPA 1SMVA 2WO1A 3J7LA 4IV1C 5DAWA 4TYSA 5A7PA 2PTMA 1AR93 2PFWA 1JU4A 4H3WA 4H7MA 4Y5SA 4XUQA 3KHCA 3HJRA 1OOPC 4YGBA 1EYBA 2WO2A 3OG2A 3IB3A 3S6PA 4D7TA 1SBEA 1BQPA 3N9NA 1GNYA 3FHIB 2VULA 5CVRA 4YW7A 4EROA 1G7YA 2G9ZA 3CLPA 4NUBA 2VJXA 2XLGA 1VRBA 1Z7S3 4XMIA 1W6QB 2UY9A 1D4M2 3E5UA 5EWSA 4NRPA 1H2NA 2X5IC 5CU1A 2EIEA 3FBMA 1W9SA 3M4FA 3HOBA 3U07A 1ULGA 3CKHA 3HN1A 3OUHA 1XNDA 4LEJA 5F37A 4EE2A 1S0JA 2C1FA 3IDEA 1VB4A 4AI2A 5A6QA 3H8OA 1G8WA 5F3EA 3OBRA 2R1DA 4CU9A 1F15A 2O8QA 1S0CA 1YI7A 5LZ6A 3AP6A 4AGVA 1E57A 4RHV1 4ZU4A 2QQWA 1JUIA 1FMD1 3KVBA 2VZVA 1G9CA 1OT5A 2RJKA 3HEIA 3OCPA 3H9AA 1ULFA 4IEXA 5C4WC 3B00A 3ZN5A 4CDWA 4AVSA 5GZEA 2G9GA 2Q5TA 1GWMA 3K46A 4XAAA 5CG8A 2ZGNA 4K20A 5FZOB 5C3SA 4QDSA 1ND2C 4L8QA 1BKZA 4A6OA 3I3BA 2ARAA 3AVRA 2BOJA 4LO8A 1DYKA 3LEGA 3NNFA 1SDWA 4RR3B 5HXVA 4A7ZA 3WNXA 4QPWA 3MF9A 3WSOA 2E7QA 3LD8A 4A2UA 2VL4A 1TNRA 2EXJA 3ENRA 4GJYA 2WKKA 1B35A 3I59A 2A6ZA 2Y6JA 3KT7A 3VBSC 4ET7A 5AC93 4XJWA 1TVGA 1RTVA 4WM7A 2ZGMA 4PQQA 1R082 1ZBE3 5ANNA 3JD71 4LBJA 2R30A 3ZFEB 3N35A 4PQ9A 4RGGA 2VOKA 2BTVC 4LOTA 1VLNA 2RM23 1HB4A 1RUE2 4MXVA 1GWKA 2B4KA 2H6CA 2WWJA 3N9PA 1H2KA 4NHXA 4BQ3A 3AKPA 4G3YC 1J1TA 1RUI2 4N43B 1A34A 1I5PA 1DZRA 3LEIA 4W4ZA 3ZXLA 3BGAA 2ZBJA 4AK3A 2V4AA 4COVA 5JPMB 3PVNA 4DRRA 1YEWA 3I3QA 5KHJA 1W9FA 3IDCB 3VDDA 4I09A 1XE8A 2XVLA 1PNGA 1X7NA 2XXZA 3NKGA 3BU7A 1V70A 4LA3A 5FKCA 4BMEA 4E8CA 4Z2WA 1LOCA 4LORA 4CDQB 1NAEA 1WCKA 5GLTA 4J6GA 3ZKUA 1CZSA 2RS52 4QPIB 4AVTA 4RR3A 3E1F1 5A3TA 4Z92B 1MZFA 1ASJ2 3SEEA 5L36A 4I2OA 1YO8A 5BY5A 2Y6LA 4CU6A 4MGTA 2LALA 5FZ1A 3GF6A 1DCSA 1STMA 4IV3B 4Y1ZA 3VGIA 1I9RA 2UU8A 5DQ0A 5I0UA 1SPPA 1D4M1 2DTYA 1QH7A 3BPSA 4LBQA 1R1A2 2A3XA 3E5XA 3HBKA 5DDJ2 2Q8OA 1QMJA 2A73B 1J3QA 2R1BA 1A6CA 1DQ0A 2WQ8A 2EA7A 1OQ1A 2D40A 1OA2A 2HH9A 4FAGA 1ALYA 1DQ5A 1OI6A 2DFBA 4QKBA 4QU1A 4AVVA 4EV0A 4UFIA 1OMIA 5FBJA 2HWF2 3IIIA 1EPZA 1PM7A 1ZBE1 2MHFA 4AF9A 4AR2A 3MIFA 3WP5A 1PGW1 2AZ5A 2HWB1 1YHFA 4WVMB 3WXPA 1G9BA 3NRUA 3VBFC 1UY4A 5JZGB 5FYIA 4NWWA 2ZEWA 3I7DA 4P02B 5FZBA 1AX1A 4E2QA 4IEZA 1Q43A 4JRAA 5H9RA 2QZ2A 5LB6A 3VN4A 3APBA 4ASMB 1LAJA 1GZWA 3I3MA 1SLLA 1MEC2 2R061 5FZHA 3NV4A 2WNUB 5F5AA 1W2OA 2VZ1A 4AEDB 4C1WA 3O0VA 3L2YA 1S0GA 2ZEZA 1LOAA 3WUDA 4AG4A 4E9KA 2BGPA 2DWRA 3WP6A 4LITA 4I0AA 1FNZA 4L9BA 5FJKA 1FV3A 2W87A 2GP5A 1AYN3 2ZS6B 4IEUA 2VNGA 1PK6A 4FPEA 4ZXEA 4MVTA 4GB33 2FMYA 3S57A 1H8VA 1VR3A 3VBHC 3W5NA 5T5JA 2WFF1 1BYHA 1LKNA 4Y24A 1QNWA 1RUE1 5F39A 5FY1A 3AC0A 3NAPC 4YZ2A 4M3CB 5JPNB 5FZ8A 4HN0A 5DMYA 1X9PA 2E63A 5IT6A 1JZ7A 4XBQA 3PURA 2XHNA 4DQAA 2D3PA 3LDBA 4PCRA 5FLJA 3DUIA 3BIWE 2YU1A 1JUHA 1RGSA 5J48A 1TZOA 1D0GA 2GMMA 1UN1A 5IWFA 1W2NA 3OEBA 2J1AA 1DQ2A 3SH3A 1WCSA 4QXHA 3ZN6B 4XPVA 4JHTA 2JG8A 4LIUA 5C8CA 3H7YA 3NWKA 2C9AA 4YGCA 5FZ6A 3VBOA 1OSGA 3DPRC 3LWCA 3VBUB 1ZRRA 1PO23 2FQPA 3CL1A 3EJKA 4HVOA 2RS51 5FXVA 5IK5A 3W59A 1UMZA 1AL0G 2C6SA 4CEWB 4ITCA 2W9XA 5EYYA 3WX5A 2A6XA 2VQUA 3IBMA 2BYVE 4QT6A 3KT1A 2D44A 1BVVA 3GALA 3KF5A 5FR3A 1QH6A 3ZO0B 3ZR5A 4Q29A 4U36A 1UOJA 2OS2A 4KH9A 5ABJC 3EQEA 5CB7A 4L97A 4B8EA 2ARCA 5C3OA 1VRH3 1IKPA 2XWJB 3WF3A 3RMYA 4QX3A 3I8TA 1XYNA 3ST7A 5EV7A 4XXPA 3LKJA 5BYNA 4FTEA 3KQ4B 3Q8AA 3JXSA 3MO4A 1HKDA 2EIGA 3ACHA 5FPXA 4NIHA 4NIDA 3GZTB 3ZSKA 1AYN1 5I93A 3PVOA 2HWF1 3BTYA 3GDBA 2ZGSA 3EBRA 3FE5A 2L9LA 3ZPYA 5IVFA 1PVC2 3AFGA 4NO4A 4QX5A 4MOAA 1OF3A 2HEWF 4QB1A 4AFDA 4AEKA 4E4SA 2QVSB 2WA3A 5L73A 1OPOA 4X6RB 1QXPA 2HWC2 2ZACA 4HKLA 3K4DA 2YPDA 3VKOA 4RD7A 3IWZA 4OI4A 5A1AA 3GXUA 2VZOA 3LSDA 1LTEA 4ZZ5A 1W05A 3T1LA 2BWCA 3EB7A 2GAUA 2V72A 2Z4FA 4WV8A 2TEPA 2XQRA 4HT1T 1LU2A 2KD7A 3GHMA 4EWDA 1QJU2 4M01A 3ZYHA 1ENSA 3QCWA 4IV1B 5FYBA 3WG4A 1S0IA 1TNFA 2VTXA 3CJIA 1KFUL 3U1XA 1CAUA 5A3LA 1S0DA 1ND3C 2EXHA 4O61A 5FYUA 1OOPB 1W6NB 1VIWB 1YJLA 1ZBA1 3B9CA 4UAPA 4OUMA 4LO5B 3IN9A 5T54A 3ZFGC 2VM9A 3PTRB 1WD4A 5E6HA 4DXSA 1SZBA 4OMDA 4HZFA 2AUYA 4BLIA 3OY8A 3WCRA 4FQZA 3DECA 1BCXA 4NHKA 3C7GA 3ZN4A 5IVVA 5LA1A 2JDAA 5CG9A 4FXGB 2X5IB 3LA3A 4P9WA 5A1LA 2VBDA 5KXBA 1BMV1 4R9AA 3VD5A 1HN0A 4E2SA 3MHZA 3VHPA 1BEV3 2EAKA 5I0TA 5C71A 2ET7A 3KCYA 1HB2A 3PU3A 2QQMA 2D98A 3NMBA 1X33A 4FPFA 4WZCA 1PIV2 2DUPA 2XJVA 4DO0A 4RA0A 1UMHA 2PHTA 4FI9A 3SLIA 4QQOA 3WNMA 4B3NA 4MO3M 4YM1A 2YC4A 1POV3 4YW2A 2VZTA 2PELA 2HWE1 2RE9A 3MIBA 5F8PA 5JVVA 4LULA 4OYUA 2JD4A 5C4WB 2WZR2 1O4TA 2VXJA 5GZDA 3WHTA 1RUNA 1ZRCA 3IPVA 3OUJA 3VBRC 3NW4A 3HMYA 5K0UA 3TEYA 1ND2B 4NN0A 4M00A 3M3QA 1AR71 1AX2A 3SHRA 3F2ZA 2BU9A 3DCQA 3TN93 2FDIA 4K21A 4IE7A 1GR3A 1H1IA 2B45X 4OMCA 2RS32 3OGGA 2VMGA 2JE9A 4JTNA 4CDWC 2JDHA 3KV4A 2FDJA 1HLCA 4LLFA 1U5ZA 3N4MA 4AYUA 3RZKA 2P34A 1W0PA 1YQ8A 3H3UA 3UKTA 4XDOA 3MIDA 5FPAA 4LQRA 5FMOL 1YFWA 3CZUA 4AVCA 1YJKA 2R49A 4FP2A 1FPN2 1K5MA 4XYXA 1UAIA 4RS5C 4F8AA 1PX4A 1W28A 3IAPA 5ACA3 4FOVA 4E4HA 1B35C 2JKXA 5FQ0B 1APNA 2GDFA 3ZPOA 1RXFA 4WM7C 2HWC1 1PNFA 3N3HA 3BB6A 1CAWA 2VW0A 1QXRA 4FPJA 1RXGA 2OW4A 4JHZA 2WSVA 3A23A 1WCUA 4L0PA 3RFRA 1TMF1 3MV11 1DG6A 2QCSB 2WS92 4BISA 2R041 2IVIB 5KHGA 2PLV3 2YC0A 1RHI1 1AR83 3O1SA 3R05A 1AVBA 4S2FA 3T0AA 2WQZC 3FX3A 3G7DA 3PJQA 1YFUA 5D2AA 5JWPA 3ABZA 4TSVA 2H0BA 3RI8A 1HRI3 2ORXA 3IIAA 3WQ1A 1JYNA 2OUJA 2WAOA 3UJOA 4CUBA 3FWEA 4PLMA 2LUWA 5FREA 3VDDC 4LLOA 2CU5A 4IGPA 5FZFA 2W46A 5EXOA 4TZDA 5IFTA 3FHQA 2A71A 4NIIA 5A70A 4IEQA 2GALA 3FHAA 5HCBA 3VBSA 2W08A 3WW4A 1W8FA 5EP9A 3TEWA 5I8TA 4H14A 4BHPA 1LR5A 2VVDA 2CDPA 3AP5A 1IG0A 3BCWA 3T3YA 3PJYA 3D6EA 2VTXJ 4Y1XA 1Y4WA 4A4AA 3MDPA 3VL8A 5E88A 1OFNA 2GNTA 3K51A 1BVP1 3VZOA 3AX4A 3C7HA 5A7QA 1FOD1 3QD6A 1J58A 3KWVA 3U37A 4YFWA 5A3UA 5LATA 1LHWA 4LBQD 3U14A 1Z78A 3U0ZA 1C8M3 1GKBA 4K1ZA 3TEZA 4LBLA 2RR11 4AEMA 3INAA 3SMHA 4IEYA 3UGHA 2Q30A 4U2AA 3VDCA 1YIPA 4DY3A 4HKOA 3VBFB 2D6MA 1F5JA 1F9KA 2R6QA 2XWBB 1COV3 2DVAA 3USUB 2RS12 3AK0A 1J59A 1RJ8A 2E31A 2JX9A 1BK0A 1H4GA 4LOSA 4XF0A 3O7OA 3I54A 4BIOA 5FP9A 1X82A 5A7WB 1KEXA 1F2NA 3QOPA 5FLIA 3VDAA 2YBPA 1QJY2 1SCRA 3ZDVA 3RYPA 4HOOA 3M3EA 4LBMA 1IPSA 1HJFA 4KWUA 1JYCA 1XRUA 2PLV1 5FPVA 1WMXA 4CCMA 1W9TA 4UYBA 1G9DA 1ULDA 1YQ6A 4XF4A 5FPUA 3LA7A 1J84A 3GBGA 4JDMA 1RUH2 2OZJA 2W92A 2ZGUA 1J83A 4IEPA 2W1SA 2YY1A 5L7OA 1JOPA 3MZHA 1DGWX 4XABA 3NAPB 2VNVA 5FRAA 1YWKA 4UW3A 1R093 3P3PA 3QBQA 2KM2A 4KU8A 3URFA 5CADA 2ZGKA 3CEWA 5BPXA 4QXCA 1U5IA 3RYRA 1PK6C 5FZAA 4CSWA 4Y4RA 4EWEA 4IEVA 4Q4Y3 3MLLA 4XUNA 3ACGA 4TTGA 4KI5M 3ZXKA 4YM2A 4PDWA 5FYYA 2QQPA 2JXAA 3HBZA 4Y20B 3T2OA 5F9TA 5KXEA 1TQ5A 3GZUC 3WZ1A 3SKJE 1PZ9A 5FV3A 1RVF1 3GGLA 4AQTA 1AYM2 1C8M1 3ZOIA 3J8F3 1HV0A 2B8MA 3DPRB 3N9MA 3SH5A 4BXSV 1IS3A 1SLIA 3DXTA 3POJA 5B2GB 5J3UA 5JI9A 2VBPA 3ME2A 1Q3EA 1VBD2 5FZ4A 4XZUG 1VBA1 4OHWA 2XBO1 5JXGA 4LUMA 2MEV3 2XJUA 1EAH1 2VZSA 2JG8C 3K4ZA 5C8CC 3MI8A 3VBOC 3IZOA 1IKQA 4QPGC 3WW2A 4FCAA 2JG9A 1QJX3 3IKWA 5IK4A 1XYPA 4CYDA 2RDRA 1RUJ3 5DUUA 2XJPA 4QGLA 3OGVA 4YG3A 3VBHA 1Y9MA 3KV5A 3IMNA 2DFCA 5HBAA 1POQA 4CU8A 2XOMA 4I3PA 4LPLA 1MQTA 2BUKA 1W8WA 5JXIA 2W91A 4GH4C 4BLJA 1OKQA 1HXS3 4LKDA 1RB8G 1OUXA 2OVUA 5EJZB 2WN2A 3VD3A 3H1YA 3A0KA 2RHPA 1KD7A 2DCJA 2VZ3A 3Q8FA 3ZLIA 1OHFA 2P37A 2RMU1 4R8HA 1BZWA 4WZFA 3WDUA 1DYOA 2VO5A 1REEA 2IXHA 3GZAA 4B1MA 2Q8CA 1PO11 1DLCA 2WZPP 5DAVA 3FN9A 3ORJA 4Q27A 1RMU2 1R091 3D4KA 5A6XA 3BN6A 5E8AA 1RUOA 1PGSA 3D5OA 1NQJA 2VOWA 2JE7A 1ZA4A 1R64A 2UY8A 4Q4Y1 4XQ4A 5D21A 1AX0A 4KU7A 4AFAA 1QJY1 4H7LA 3UETA 3O1TA 1LGCA 2A3WA 4A7KA 4WM8A 1JYVA 4DXZA 2YGLA 2BV4A 5DZEA 5FYZA 1O7FA 4DRVA 3SCGA 1RUC2 5ABJA 2GH2A 2QKDA 1NA1B 2RJLA 3GJAA 4UW6A 4IETA 3V0AA 3RNSA 1IHMA 4KL1A 3ZM8A 2HYXA 2W3JA 4ZS2A 4E4DX 1ND3B 4RFRB 3CF6E 5FO9B 1BBT1 3K4AA 3MIGA 2BWAA 2QDRA 3LFMA 1QNYA 5LBBA 4CP2A 1IOAA 4IE5A 5IVYA 2C4XA 3ZFGB 1O8SA 1UO9A 3IM0A 4GWIA 2ET1A 2VECA 5FWEA 2F6BA 3M8LA 4IE0A 3WP4A 2WN3A 3KCCA 3CJIC 4XURA 4AGRA 2ZX3A 2DURA 3N9OA 4CDXC 1WKYA 2GZWA 1V00A 2DVDA 3ZXFA 5C3RA 2HYKA 2Y26A 3WNOA 1UZYA 3NV2A 1HJGA 3WW3A 2X10A 4JC1A 4GAZA 1MS1A 4QX7A 4XDPA 4YRDA 5F6LB 4COYA 2XUMA 4D6QA 3V64A 1U5YA 3T2PA 1Y7BA 2ZXQA 3ZKYA 2FZ1A 1KFXL 1LENA 1VBE2 2VOXA 1VAKA 2FMDA 4RHV3 3CO2A 4DINB 5A3MA 4GKXA 1FMD3 3U10A 1DDLA 1M4WA 4Q4V2 2DBNA 2GC2A 5C5TA 4MX3A 2HWD1 2VUDA 4CXWA 4CDUA 4IW3A 1QOTA 2DF7A 2DV9A 1G9FA 1UD1A 1ZRDA 4HETA 1WCQA 1A3KA 1AL21 1AR92 3B5LB 3DF0A 3T4HB 1GANA 4AHXA 2A75A 2VXRA 3K2OA 5GJ6A 4ZU7A 1V6MA 2VNOA 5BXXA 5GZFA 3UV9A 1H6XA 1QQP3 1RUG2 3KVAA 4CDWB 1WA4A 3NV1A 2OKXA 1JHNA 2V09A 1TME1 4NWVA 1LNSA 1H2LA 4Q4X3 3MICA 3AKSA 4QQLA 5K0UC 3HR9A 1Z7S2 3JD73 3A22A 4R9BA 1HRV3 1VE0A 4LO7A 4QXBA 3O12A 1WW6A 4JKMA 4OULA 4OZOA 5KHHA 2G9FA 2I07B 5I8SA 2WJSA 3OGRA 4N53A 3QACA 1VBC1 1NCQA 2K0GA 4XAEA 1OPMA 4V1PA 1JHJA 3BVCA 1B35B 3I59B 4C0BA 5JOYA 2BVBA 2X8KA 5BNNA 3EYPA 4WM7B 2ZGRA 1SLTA 3V56A 1W3XA 1K5MC 1SG3A 3ZSLA 3VDBA 1Y3TA 2JDZA 1O3SA 5FYMA 1KDMA 1OLME 3WDWA 4FFIA 4BK5A 4QWNA 4DUVA 4M3CE 3KGLA 2DCYA 2V73A 4QM9A 3NNGA 5IAVA 2A1XA 4ES9A 5DZFA 3VBRA 5FOBB 1OURA 1U5XA 1IPKA 3AZXA 3WQBA 5DAQA 1W6OA 4JX0A 2W52A 3TNPB 2FHRA 1W8UA 3VDDB 3VHNA 4CVUA 2CGPA 3SCHA 2J1SA 1A8MA 2GMEA 1AUYA 2ADDA 3BTAA 3SNMA 3OGJA 2AACA 4LKFA 3LEKA 5KC5A 1BXHA 3MLKA 3O0WA 1D4M3 3AYDA 4S2GA 5AC92 1ZX5A 4H2AA 1N1YA 1LGNA 1IS6A 2HEVF 4RS5A 5GZCA 1YQ5A 1QQP1 2RM22 4CCCA 1LECA 4YG6A 4ASLA 4Q4X1 1US3A 1KS5A 4RQPA 3JBG1 5T5PA 1OUSA 3L2HA 4V2WA 3S5AA 1HRV1 1SPPB 4PBPA 1WCDJ 4LBQB 1F8VA 2R072 2HWB3 2W1WA 3M2MA 4K1YA 1V9U1 5ANQA 4YM3A 5LRSA 2R32A 1DIWA 3VHRA 3VKMA 2XHKA 3R4DB 4XCAA 2Z79A 5C8CB 1GZTA 3ROUA 1GOGA 4XFGA 1EP0A 2F4PA 2BNNA 4LIVA 5FO8B 1LEDA 1MVEA 5FY7A 1UOBA 1KXGA 1UY3A 2R063 3K48A 4YW1A 4Q4W1 1XNBA 3O14A 3WINE 3USSA 5FY5A 2QZ3A 2B7YA 4CRQA 2P5BA 5FZMA 4XF3A 1U0AA 2FDKA 4HVRA 4HK9A 4C91A 1VB2A 3WCSA 4RL7A 3LAGA 1UOFA 1V0AA 3RDIA 1F4AA 5IAXA 5J37A 1OLRA 5E89A 3SXWA 2GP3A 3ACLA 4FO9A 2YB7A 3S30A 1GZWB 3H8UA 4FFHA 2A6YA 4S2HA 5F6KA 3SH4A 5JXJA 2OT7A 3LPGA 4I02A 4L92A 4AEJA 3EO6A 2WFF3 2VMIA 1RUE3 3WF1A 3ATGA 1CN1A 3AMNA 1REDA 2HBTA 1GICA 2JIJA 4A3XA 2ADEA 1RUI3 4D6SA 1CJDA 2QDNA 5FMBA 1NLQA 2V5YA 3HT1A 3O5SA 1NLRA 2QQUA 1GV9A 1PHMA 1PK6B 1XYOA 3ZXDA 1LHUA 4X8NA 1I5ZA 1SCSA 2WZEA 5FFOC 5AVAA 2Y8KA 5L7OC 2DU1A 2E7AA 3VKNA 1W9YA 5K4LA 4RGAA 1X9TA 1GYKA 4PF5A 4XFCA 4B4QA 1AHSA 5D8AA 1T2XA 2RS53 4BIFA 3THCA 1X36A 5CFCC 5EHDA 4SLIA 4PDWC 3C8XA 1ZM1A 4HFSA 5FP7A 5B4XA 5LK5A 3DGTA 4ARXA 1ZREA 1V6OA 3NJYA 2PXJA 3R4UA 5J98B 1V6JA 2JG8B 1BJQA 2P3KA 2XJQA 5A33A 3ZYFA 2EIBA 3VZJA 5A3PA 1O8PA 3VBOB 2TBVA 4CCLA 1MS9A 3MFCA 5FWJA 2XQXA 5JSOA 4DNYA 2OPWA 4NRMA 4XILA 4GZ9A 4AI3A 4NJ4A 3B01A 3I2FA 3I2HA 5IW0A 1UZWA 1YXWA 4P9XA 4GB32 5F2SA 4YNIA 2YPJA 4N8MA 4BM8A 3PUHA 4YW4A 2BGCA 3AYCA 2Y6FA 1RITA 1YUDA 2Y34A 4A44A 1N1SA 5FYVA 1ULCA 2GC1A 4SBVA 5B4NA 2JG9C 5IVBA 1SDDB 2BJSA 1CWPA 2HWF3 5FYSA 1R081 1YRZA 2WSUA 4Y4YA 1GMMA 2EF6A 5F5IA 4A41A 3HAGA 3U4SA 1DHKB 5APAA 3WF4A 2R071 4CTEA 4YW6A 1NT0A 4Q8LA 4UT5A 1MQTC 3S7EA 4LXLA 4XJ8A 3TWIA 3GBWA 1W8ZA 1RUI1 3AM2A 4KG0A 2WNOA 5DUWA 4XTPA 3Q8CA 1VAVA 1W6MA 2FCTA 2RVAA 2AREA 3N7MA 4DFSA 4DXRA 1RUF2 4QX1A 1PO22 3POFA 1UZZA 4GA9A 4W65A 2IWGB 5J96B 2V4VA 1O4YA 1L7RA 3CZJA 2CNAA 2PHXA 3NSTA 4BCUA 2ZGPA 2F4LA 3ES1A 5FYCA 1URXA 4YVWA 4QPGA 2QQJA 5HI0A 2GU9A 1PGL2 5T5OA 1E5IA 4IEOA 3MUY1 5FAXA 4CU7A 4DMIA 1ASJ1 3U11A 2WYFA 4TN7A 4OHZA 3KD4A 4XJZA 3SQOA 1VRH2 4Y22A 4XJUA 2WWSA 3AJZA 2DCKA 2VH9A 3WHUA 4EWAA 3NQHA 4WM8C 1ZBA3 2ZTNA 4GH4A 4QMAA 4CCKA 2I45A 4NR1A 3JQXA 2CSGA 4URAA 2ID4A 3RZLA 3DKWA 4CA9A 1H8TA 1CAXA 1JW6A 1R1A1 4INDA 5TSWA 1PZ7A 5DDJ1 1RINA 3AFKA 4FPLA 1NE6A 3CJIB 5EQUA 1NOVA 1CAUB 2C9KA 2EALA 2CGOA 5FPLA 4AVAA 2TUNA 4K8FA 5HPOA 4CUGA 1JN2P 2ZJCA 2ZKLA 3A0NA 5JCTA 1CGPA 1CZVA 1KDKA 1R1ZA 1XU1A 1VALA 4NMIA 3ON7A 4GWNA 5C5UA 3W5MA 2OPKA 2K2SA 3OY8B 2YU2A 4D7YA 2ARXA 2E6VA 1NY72 3E6CC 4TLFA 4HN1A 2PHWA 1OLMA 4JKKA 4HPKA 3FFQA 5F3GA 3POWA 3N7LA 5DAXA 2HWE3 4QHZA 1HDKA 2JD9A 5SV8A 1OA3A 4XC9A 1IG3A 4M0NA 1WW4A 4LKEA 2CL2A 2D93A 4YWAA 1MEC1 4IE6A 2VMCA 4YGDA 3LSEA 2E7TA 3BYWA 4QHBA 4XEZA 1UU5A 4OVEA 5LWBA 5LEKA 3MW2A 3WF2A 1AR73 1XOYA 3ZR6A 4FXKB 3H0OA 3FBYA 4YG0A 4XTMA 4CDUC 1NCRC 5A32A 5DUVA 3A4UA 3H1WA 5LW9A 3I2JA 4IGQA 4LMFA 5LRRA 3VLBB 4ARYA 2D43A 3CNAA 2BBVA 5E1RA 1ULPA 3Q9OA 3IPVB 4CDXA 1W0NA 5FOJB 1DQ4A 3VZMA 1DF0A 5K0UB 2NN8A 3S0MA 4OQ8A 1D0HA 1GZ9A 1H4HA 3K3NA 4JGZA 3RMXA 5F3CA 4Z1VA 2XONA 2NMNA 1EUTA 4NOTA 4R9CA 2BBAA 3CJXA 5FP3A 1K42A 2Y0OA 1QGLA 5FK7A 4MADA 3WOGA 3I49A 1BEV2 2HWC3 2DU0A 2ZMLA 4LO6B 4LUKA 1RUF1 4K9SA 2XH6A 1UOGA 5CEHA 3WG2A 1UKGA 1EUUA 5C3PA 1D4VB 3T30A 3PHMA 5FP8A 4YW5A 4N53C 1AF9A 1UX6A 1K5MB 1F31A 1HIXA 1NCQC 1TMF3 1YYNA 1P8JA 2P3YA 2R043 2YGMA 1YNAA 3NL1A 4LA2A 1PMHX 3HPNA 1UZ0A 1LEMA 1RHI3 4NPLA 3WQ7A 1XBFA 5JUVA 4Z07A 4HL0A 1QEXA 2VCAA 3C3VA 3C7OA 3KMHA 4UFJA 4JQRA 4PI2A 3J7NA 1LJ7A 4AZZA 3SEPA 3WDVA 5BNNC 2EXKA 1EV12 1MACA 1CAWB 3B02A 4M4RA 5C9AA 4FBFA 2GNBA 1W6PA 1WLDA 2QQIA 2ILMA 1UXZA 4QDQA 4EYUA 5LCWL 1Q8VA 1JYTA 2QUOA 5J36A 1VBB2 2R7EB 3PVEA 4XVHA 5GLUA 3PLQA 3P3NA 1LU1A 1NUKA 4COWA 3AL5A 3KV9A 2I74A 4JGYA 3VHOA 1HB3A 1VMFA 2FBEA 3TOJA 3WNKA 4AOCA 4NVPA 4XHBA 3ZFFA 4NE9A 3A7QA 3QLQA 4AI8A 2X53S 2LTNA 2XKPA 3AMQA 2QJVA 2DBIA 1WW5A 1FOD3 1W9WA 2IXLA 2WRAA 3E6BA 2WNVA 4TLGA 4UBHA 5EFUA 5C70A 5JR2A 4YZ4A 3VBSB 2WR9A 4JRLA 2ZZJA 3H3LA 2VMEA 5FCCA 1FV2A 1JXNA 1PM4A 2CWMA 3DYPA 5JXHA 4LE3A 2VUCA 2RR13 1PVC1 1BK1A 3M3CA 4GJZA 4YVSC 2O1QA 1WA6X 4K40A 5FUPA 5J09A 2XKOA 4NIAA 2EAAA 4LJHA 5HCAA 1XB9A 2YMZA 2DCZA 4I0WB 3O1MA 4XUPA 3THTA 3AVSA 3VZLA 4XETA 1RUD2 2YZ4A 4IUGA 1O91A 3ILFA 3HD8B 1CPNA 3OB8A 1Q8PA 2D6PA 4G9SB 5JSRA 4RQPC 4C8DA 2SBAA 1AR82 4W6XA 5T52A 2PA7A 2ZKNA 2VVEA 1WLTA 1UY0A 5KBFA 4PIZA 4OHYA 4LK6A 1XNCA 1RJ7A 1HRI2 2WT0A 4KWLA 3C7FA 3CQOA 3FL7A 4FPKA 1Z0HA 3D82A 4YM0A 1WGPA 1ONAA 2VUAA 3WDTA 3ASIA 1QJU1 2IXIA 3T4VA 4QAWA 4OI2A 5FZ3A 2PHUA 2ES3A 1Q8SA 1QOOA 4P9LA 1OFSA 4JAAA 3WG1A 3KHBA 1E5RA 3OYWA 2FCVA 5EZWA 4DY5A 3O0XA 2RJ2A 1OKOA 5L9VA 1FPN3 1VMJA 2X09A 4UF0A 4CCJA 4YZ1A 4OI1A 4BQ1A 3RPQA 5JLVA 3LIHA 2OIIA 3LDRA 1UY1A 3JUUA 4JTOA 4F83A 3RG0A 4E8DA 3HIFA 5ERLA 1SLAA 3WD5A 5EPAA 4B4RA 2WC2A 2GSYA 2PMWB 4OQ9A 5HXMA 2XR4A 3B7MA 1UPSA 3BU0A 3M1HA 1CX1A 2N7GA 1G86A 1ZZCA 1GQHA 4P08A 3RZGA 2WS93 4P9YA 5FZKA 3ZYIB 4BJ0A 2PQSA 5L7OB 1TG7A 5CBLA 5L9BA 1RVF3 2ZHLA 2CDOA 4MGQA 4AHZA 1PIV1 3RVHA 2JICA 1D2QA 3E5QA 4A3ZA 4XFIA 3E97A 1MR5A 2Q1FA 5FUNA 2WT2A 1VBA3 2XBO3 1Q5OA 2ZPXA 3J7HA 4BA6A 3ZYGA 3K75B 1CIYA 1EAH3 2JENA 2PAMA 5AFEA 4PDWB 2UYBA 1VBB1 1DGRN 4ASKA 2WZR1 5DG1A 2YFZA 2AEYA 5FP4A 2CV6A 2Y0IA 2UURA 4N7IA 5D8AC 4QQPA 5IYYA 4BQ2A 4KWJA 3EHKA 4XE9A 3HN3A 3OUIA 3LIGA 1UYYA 4AI1A 1JMUB 5HV0A 4RFT0 5G04L 2XLAA 4FQ4A 1UNBA 2B9UA 2XVKA 3N9QA 4P9IA 4QX8A 3ZFEC 3WEZA 2PN5A 3MUZ1 1MZEA 2RS31 1OQDA 1LOBA 3IMMA 4BE3A 2JDNA 2VVFA 4CCEA 1YCIA 3AXEA 3V0BA 2RG4A 4Z82A 2NP0A 4XFBA 1B09A 2JG9B 2RMU3 5I0RA 3ZVXA 1XE0A 5AFBA 1ULEA 5K8SA 3D8CA 2ZA9A 4LBOA 2W0XA 3PIGA 4PLOA 5H9QA 2Q8DA 1FPN1 1Q56A 2Y6HA 3VBHB 5KC6A 1PO13 1O3RA 4YW3A 1MQTB 2A7AA 1JYXA 2WUHA 1ZRIA 1DQ1A 3WDXA 2NPIA 4L99A 1BLZA 2VW2A 3FFZA 4CDQC 5JOZA 2LRPA 3O1PA 4YFZA 4FOWA 4QPIC 1W90A 3VV1A 3J8F2 2ZGQA 3MBWA 4Z8BA 5CFCA 3CU7A 4ZHNA 1QJY3 1O4ZA 1SBFA 4A7YA 4W8JA 4HKWA 4I01A 2P6CA 5T50A 1OH3A 3UESA 2WS91 3ES4A 5CKQA 1C57A 4PBOA 4RSUA 3NJXA 3WLUA 3NJZA 5L9RA 5A6YA 1G9AA 1W8TA 2DYCA 2JB4A 3T08A 1V6IA 2Z2SB 1C5HA 4NIGA 1AR62 4QKNA 1CVNA 2WINB 1QJX2 3I2GA 1HV1A 1NZIA 3H42B 1RUJ2 2QBXA 2WT1A 4E27A 4Q0PA 5GLVA 3SITA 3ZMNA 5I0DA 2J22A 5F32A 2ZX1A 1BBT3 1A78A 2WZ8A 1US2A 2D5HA 4G4FA 4WM8B 4YVWC 5FDBA 1I1EA 1CPMA 2IXCA 3T0BA 3ZXGA 2VOTA 3X29B 3AZZA 1HXS2 1OVSA 2A6VA 3LZZA 5GM0A 3PVBB 3W58A 4AE2A 1ZZ6A 4KMQA 4UFLA 5ABJB 1T6GC 3T2TA 5HCHA 1ACCA 2W68A 3V0AB 4KGQA 1UX7A 3A21A 4FPCA 5LK7B 2FD8A 4META 2B9VA 4UW4A 3KQRA 5CYYA 1UF2C 4KBBA 1C1FA 1UU6A 2JECA 2WLQA 2Y60A 3GCWA 4NPRA 4MGKE 5FY9A 2OA2A 1H8TC 3RSJA 1W39A 5I8YA 5IVJA 1O6UA 3AXDA 4P14A 1SHWB 1TEIA 2WYSA 5A7NA 3NVCA 1JZ4A 3TNQA 2LS6A 1YQCA 2AH2A 3EMRA 1YIFA 1GP6A 3PUAA 4MLOA 4UFHA 3IDBB 4M4PA 3WP3A 2HWD3 4O7XA 2RS11 2GN7A 1LULA 2EXIA 3DYOA 3B69A 1U12A 3P1IA 2WDBA 2J1EA 1J3RA 5FZDA 4KBZA 1AL23 1RIRA 3MF6A 4P9JA 1JZ2A 4YPJA 2C0ZA 1VAMA 4Y1VA 5IUQA 4BXFA 1OVPA 3AKQA 4F7ZA 3VL9A 4OHVA 4GMP1 4PI0A 4GXLA 2SLIA 1SLCA 3PU8A 2PHRA 2ZCWA 4CDUB 1GZCA 4Q0QA 2BRTA 1TME3 5FY4A 3FUQA 3BKZA 1WLCA 4IXLA 1GU3A 5LASA 3QH7A 1RUH1 1TE1B 4FFGA 5KR7A 5FBZA 4PLNA 1W2TA 1FAYA 2YFUA 2FCUA 2A6WA 4HXCA 1RYYA 4Y3OA 5CNAA 4B1LA 5I91A 1MS5A 1VBC3 3K77A 4NAMA 3BTXA 2IFRA 2Q8EA 1LB2A 2QQNA 4XQDA 1GUIA 2JJ6A 2Q0AA 4O9GA 3AL6A 2LM3A 2W95A 2NLRA 1NLSA 2ZHMA 4ZONA 2VE1A 5FJHA 1ZZ8A 3VZNA 4B29A 4M3CF 4C1XA 2VUJA 4OUEA 4JGZC 1GOFA 2JB8A 4RHV2 5CFDA 3O1UA 1S2KA 4N53B 5LY2A 1NCQB 1W8NA 2BDRA 4IESA 2WA4A 4PIYA 4XJ9A 1AYM1 2IZWA 5C33A 2ARBA 5CISA 1AJKA 4CP9A 3KF3A 1AZDA 1J1LA 1N3PA 3OBAA 5EIYB 5JDBA 3H8XA 1OLQA 3HNYM 4MXWA 1REFA 3OPTA 1VBD1 4CE8A 2B46X 2WABA 4LTAA 5BNNB 4LBKA 4ZY9A 1LGBA 1L7QA 1DGWA 5EYXA 3IAQA 2TNFA 3U75A 1NCRA 4KGGA 3ZYBA 2D5FA 4HANA 4AFMA 5M0TA 4A6SA 1XNTA 1MZ5A 4LHSA 1AXKA 1GFF2 2WL1A 4AWDA 3ACFA 3I4IA 3VBRB 5BNQA 5C9AC 5T3NA 2OXBA 2VCBA 1NXD1 3JD72 2VY0A 1W6OB 3ZYRA 4YGEA 4MGSA 2QFEA 2E53A 4UW5A 4C90A 3GHNA 5GLWA 2ZX0A 3ZYJB 2D7FA 4NHMA 1SFYA 4QD2A 4LK7A 2D6LX 4JGYC 3JBG3 3OSDA 2W1UA 4GWJA 4XIKA 1UIKA 3ZFFC 5I0SA 5JSPA 3IDAA 1XPWA 3I2IA 3TBDA 2X29A 1NX9A 4NAOA 1PMIA 1SEFA 2P3JA 1W99A 4YVSB 1V9U3 2AYHA 4Q4V3 4BQ5A 4DOUA 4YSFA 5LEJA 1RMU1 2E9QA 2VBBA 4RS5B 1KJLA 3LEMA 3RZMA 1E5SA 2WNVC 3BUCA 1H2MA 4CEYA 2VQTA 4FVVA 4IEWA 5BNPA 5BNOA 2WAAA 1O3TA 2WIIB 2Y6GA 1MVQA 2E33A 3PTYA 4RQPB 4P5YA 2XB6C 4XZPA 2DTWA 4Q4W3 2ZMKA 3ILRA 3DV8A 4I0BA 1WBLA 1K45A 5DG2A 3T1MA 1NZCA 4PIXA 2VQ0A 5DABA 3LOBA 4HSLA 1UIJA 2XJRA 3WT3A 3Q8BA 4BK4A 1RUG3 3UNPA 1RUC1 3M3OA 3B93A 5DXDA 2DUQA 2J1VA 1PZ8A 3H50A 1S55A 3LFIA 3BALA 4QB2A 4XCBA 4Y5Z0 1AXZA 4HMZA 3O1RA 3MYXA 4IERA 1EPWA 5LY1A 3LA2A 2EIDA 4WVWA 4AHWA 2BNOA 4AGGA 3JB8A 4BPZA 1FNYA 1CAVA 1SFPA 2UWCA 4XMAA 5F5QA 5FZIA 5LBEA 2RV9A 3R4SA 3LCPA 2J1TA 3NKTA 1Y9QA 2ZMNA 3BOWA 3K3OA 4LBNA 4EZ4A 4NPMA 3FLRA 4YVSA 1ZBE2 4Q0VA 5FY0A 5HCFA 3I2DA 1PGW2 1VJ2A 2W5FA 4MHRA 3J4UH 2QNKA 2XG3A 3P6BA 2HWB2 1K3IA 5FPBA 4BH9A 2Y64A 4WVVA 1CX4A 2O8OA 4X8PA 4CUAA 1VPHA 1NYWA 1XXNA 1J3PA 1DFQA 5F1RA 1UU4A 3WW1A 3WNNA 3O1VA 3I97A 1OH4A 1VBE1 2O0OA 1ZYBA 4RN5A 2UWBA 3CBNA 2XVGA 2D3RA 4ISQA 4XDQA 3PL0A 3QH6A 4Q4V1 2R062 5F3IA 5JOXA 3ILNA 3H8RA 1Q8OA 1RC6A 2ORZA 4ZXKA 3WDYA 4QQ2A 3N7JA 3MW4A 4E2GA 3PMEA 1X8EA 5D1IA 4IDZA 2DDUA 2VMFA 4OHXA 1H0BA 1W6QA 1N1VA 4YZ3A 1FX5A 1AR91 2ATFA 5D8AB 4CP0A 2ZAAA 4LNVA 1PX3A 4Q26A 1L7LA 4YLZA 2BNMA 1JBCA 1SLBA 2CY6A 1BHGA 2YC2A 2WFF2 2ZGLA 5FZ7A 1RUG1 1YC61 2BW8A 2GN3A 3AP4A 5LA0A 3CIHA 5A33B 3KM5A 4CPBA 1LHNA 1JOBA 1ULOA 1R083 2E26A 4COUA 1Z7S1 3NO8A 1NXMA 3POIA 5DAPA 4AHYA 1CZTA 2IXKA 2R073 3WR0A 4MSVA 3OD0A 5IK7A 1KGYA 1QJFA 2GH8A 2JIGA 2PAKA 5A7OA 4AL9A 1N1TA 1IZ3A 3WNPA 5G05L 1H30A 4MGYE 3S7IA 4OI0A 5DZGA 3UK9A 5GZGA 2EICA 1X50A 5FZOA 1GQGA 1CD3G 4XACA 2OZ6A 2D6OX 4QX0A 2WWUA 1QKQA 5FZLA 3R6SA 1C4RA 3RWNA 2IFWA 2QE3A 3WV6A 4EN8B 5H9SA 1Y43B 1W3VA 2YXSA 2ZHNA 1JOJA 4BB3A 3BIEA 3ZXEA 3N36A 4YYOA 2PAEA 2C26A 1WUVA 4HG6B 1UYXA 1W6MB 3CDZB 3KS7A 5A3WA 1XC6A 1WWYA 1ASJ3 3H7JA 3ZSJA 4ZKTB 2FZ2A 2GNDA 1ENXA 1CIWA 1DLLA 2PHDA 3P5BA 1H9WA 3RWKX 1D2SA 3RYKA 2YROA 4J1WA 2BERA 4LO4B 4O9EA 1SQ4A 3OGSA 4P00B 4Q8KA 1V6LA 4DPNA 3WF0A 3AKTA 4QDRA 3TEXA 2JDYA 4GMP0 1LOGA 4N43A 2CTVA 4YVWB 2R0HA 4QPGB 5AC91 2YYOA 1ODNA 1LCLA 3UGGA 1R1A3 1XJAA 2NZ9A 1AYN2 4OLLA 5A7SA 5DDJ3 1DGRA 1HQLA 2Z5WA 1UWWA 4UWDA 2QQKA 4Y22B 1DZTA 3HNMA 3GZEA 2RM21 4XXAA 4ES8A 3ELNA 5FMDA 4P5HA 4GH4B 3ETQA 2C24A 1W06A 1DYPA 3AJYA 2K46A 1XQNA 4CDQA 1ST8A 2R0FA 1UPIA 2PYTA 2VMHA 1H8TB 4QPIA 1CAXB 1ENRA 4QKFA 3WG3A 4D8MA 3TB0A 3UKNA 4CP1A 2IC1A 4DZGA 1KRIA 1E5HA 2X05A 4AQSA 4IGOA 1GNHA 2DUOA 1XSQA 2OYZA 1JYIA 3AZVA 2VZRA 1KITA 3POEA 4EN0A 5LBFA 1JYWA 4IV3A 3AZWA 1OD5A 2I2SA 4B4PA 4QGNA 3N7KA 2JEMA 3GBFA 1WD3A 4GWMA 1MEC3 4Q5OA 5FZGA 5JIUA 2XGXA 1D7PM 5GLZA 3PDQA 5FZ9A 1H6YA 3LE0A 4L2NA 2D6NA 4K7JA 1MS0A 4HPKB 1QWRA 5F2WA 3KZ4C 1KS4A 2VNRA 1ZBA2 2YHJA 1YI9A 3OOXA 5K9YA 2VZQA 3DEMA 1HW5A 1OF4A 2BFUS 3HWJA 4FPHA 2P1BA 2PHLA 4N7UA 2RDQA 2ZABA 1ZZ7A 5LBCA 3WVJA 1ZZBA 4RGKA 2RDSA 3WUCA 4AW7A 4WVMA 4N90A 4DEQA 4FOQA 1GWLA 2A5ZA 5FTTC 4HBNA 5JZGA 5FYHA 2CAVA 3ZX7A 2VOVA 5A32B 4N9IA 1BMV2 2IVJA 2YV8A 3AP7A 1IGOA 1LOFA 1AXYA 2AEZA 4K6BA 4FSJA 1RUF3 1GBGA 2A70A 4MUVA 1ZZ9A 4BMBA 5A3OA 4CDXB 3AYEA 2WNUA 2YG0A 3OBZA 2NQYA 3KCXA 1KQRA 4AEDA 1JZ5A 3KT4A 3W21A 4R52A 4JGZB 3F95A 2F17A 1S0BA 1RL3A 3H3ZA 2JDKA 3FLPA 3NNMA 2NMOA 5FK8A 2HWE2 4R4XA 1UKRA 3I3DA 4ISRA 2XPJA 5FY8A 2FDFA 3THPA 4XUTA 2VCMA 3VD9A 4JV4A 5IFPA 1FT9A 3W9AA 5FXZA 1H1MA 2KA3A 5CFDC 4D94A 4LR4A 3JU9A 1VMHA 2JDPA 1I3HA 3VKFC 4M3CA 2AGSA 1AR72 3KB5A 4BQ4A 4JDNA 5T55A 4JKLA 4I30A 3LF7A 1PMJX 3CHXA 4XUOA 5C3QA 5C7GA 3C2UA 2HBUA 2OQ6A 4QPYA 4AI9A 3KLSA 2WQ4A 1DZQA 1JI6A 3POGA 4GB31 1C28A 3J26N 4CCNA 4ORFA 1HQWA 5C9AB 1W6PB 2VG9A 3D0SA 3AP9A 3E6DA 4MH0E 3S5QA 3ZN6A 1DBNA 4GIQA 2KR2A 2ERFA 1OD3A 3NV3A 3VB9A 4ATEA 1A8DA 2Q4SA 1O5UA 1QDOA 3D0JA 3J9SA 3VBUA 2P17A 4OCTA 5A3NA 3ZYPA 1LESA 4JGYB 3RI9A 1JTZX 2BOIA 1PVC3 3HQXA 4Q0UA 3MPBA 3ZFFB 2D3SA 3DKQA 2VMDA 3LQCA 5CAZA 5FXXA 4CEWA 4B7KA 2QQOA 3UYJA 5IVCA 3ETPA 1L3JA 1DGLA 4BQWA 1C8NA 1XNKA 2VAUA 1TMF2 2WNVB 3FZ3A 3KV6A 1JU3A 2R042 1H9PA 2JDUA 3DYMA 1N47A 3UL2A 1RHI2 1PO21 1WW7A 1NA1C 3OJBA 5K7PA 4XFAA 1QOSA 4A42A 5FUIA 1W8OA 5GKAC 4FOYA 5F7UA 2VU9A 4E4ZA 4D6RA 4Y5TA 1QJU3 5IK8A 4CEYC 1PGL1 2WO3A 3ZFEA 5BNPC 2WLPA 5BNOC 1ENQA 3WY6A 4UI9L 4CXYA 5E16A 1CESA 4NHYA 2Z69A 3FMGA 1F5FA 1C3HA 1GP5A 1VRH1 5FXWA 3JZVA 3MFAA 2UYAA 5IJRA 2AENA 3AB0A 3TN92 4JQTA 1CR7A 1GLHA 3SISA 4AQ6A 1T6BX 2W39A 5CIRA 1FOD2 3W20A 1YQ2A 3OBTA 3O1OA 3UT0A 2GC0A 1UW8A 1N3OA 2ZZQA 4BDVB 1KJRA 5FYTA 4K3UA 2BP6A 4TWTA 3ZSEA 2W47A 3N9LA 5KXCA 2NYYA 3FLTA 2K9ZA 3OYWB 4DXTA 2RR12 3POYA 2OX0A 3RQ0A 4BQXA 2CAUA 4YARA 4UF0B 2VC9A 4MV2A 3HQUA 1S0EA 3TYJA 2R16A 3WQ0A 5ACA2 2ZAHA 5JIAA 1PVXA 1PIV3 3U4XA 1Q8QA 1N3QA 4IV1A 4W6YA 4EZHA 1EV13 4KQ7A 3RS6A 4J1XA 2CHHA 1NY71 5CKMA 4AAPA 4D7SA 1IPJA 1GQPA 2ENRA 2J7MA 3AMPA 2XUEA 1MS8A 2VR4A 3AKRA 1FATA 1OOPA 1W6NA 3DXUA 5FKBA 4NHLA 2XJSA 4COZA 4FTSA 1VBB3 2YBKA 2BPA2 1W0OA 2WZR3 4Y1UA 3FJSA 2PLV2 3R0RA 5DPNA 1FYUA 1K12A 1UCXA 4Q2FA 3M7AA 2QTWB 4MHUA 5CA6A 4ZPIA 1ZNPA 2YUEA 1XNAA 2DCTA 3GNEA 2X5IA 3H1MA 1GP4A 1IS4A 3KSCA 1JODA 2RS33 3GM8A 2ZX2A 3GCXA 3OPWA 4CUCA 4P9GA 2G1MA 3SC7X 4AAXA 3POSA 1CQ9A 4QB6A 4ZZ8A 4I3GA 2XL9A 5JI7A 1GSLA 4YZ5A 2CWSA 3ZXJA 4AFCA 1UQXA 1JZ8A 3JQWA 4QXKA 1RUD3 2Q1ZB 3EXUA 4CPBD 4XBNA 3L9JT 1JS9A 4UXAA 5C4WA 5C6CA 4Y1YA 1BEV1 3ZIXA 2QQLA 5BV6A 4XIOA 3V0BB 4OZXA 1RVF2 4FPYA 4GQ7A 4ZS3A 4DS0A 3VUOA 2RDNA 1LHOA 1C8M2 2BEOA 2W1QA 3ZXAC 3BODA 1JZ3A 4MG2A 1ND2A 4PHZA 5FZ0A 3LPFA 2AR6A 4MGIE 4D0QA 5BUVA 4FT8A 1VBA2 4Q1PA 2VZPA 2XBO2 2IUWA 1NKGA 2JKBA 4D3WA 1POV1 4FPGA 4NRQA 1EAH2 2Y33A 5FLHA 2FDHA 3AYAA 3I3EA 1COV2 1XU2A 2ZHKA 5F5CA 4AI0A 3ZDSA 2D97A 4LHKA 1XSRA 1OA4A 3FUOA 1EV11 4AFBA 2ZOEB 2DVBA 4RR3C 5FZCA 3PUIA 4C0HA 5CFCB 4Y26A 1AJOA 2JWPA 2VD7A 2ZGTA 4XJAA 3TN91 5A1FA 2Q1MA 2HKXA 1S0FA 5A6ZA 5KHKA 5FQ0A 4BQYA 1NE4A 4GULA 4H55A 1NG0A 4XBLA 4K8RB 3SKVA 1SACA 4QU2A 3THDA 3I2OA 4BU2A 4Z2AA 4UFKA 2RMU2 2VZUA 1DQ6A 4M0HA 5ISLA 4W6WA 4KNCA 1C5IA 2O14A 3UGFA 3POBA 1CJPA 3PUSA 1PO12 4UFMA 4W50A 1LODA 4LHLA 5ACA1 4N43C 4S2DA 1CONA 3MV01 3T09A 1R092 2JE8A 3T2QA 4CXXA 3WNLA 1UL9A 1FXZA 4QGMA 1O59A 3KGZA 4CCDA 4UBGA 3JCIA 4Q4Y2 3MIHA 4QM8A 3OTFA 3VKLA 1LOEA 4XFFA 1RUD1 5GALA 2RS13 1UYZA 2WNEA 3UJQA 4DUXA 2B42B 1G6NA 3AZYA 1AR81 2H6BA 4RYDA 2AC1A 3AMHA 4DB5A 5KWRA 5FO7B 3T0DA 3GJBA 1OC1A 4ATFA 4XFHA 4XW3A 1HRI1 5JAXA 1MS4A 4GALA 3OD4A 3TAYA 5HV4A 4GMP3 4O65A 2MEV2 2XDVA 1ZRFA 5C8WA 2DVGA 3IT8A 4IV3C 4V2VA 5CKNA 3MGUA 4HONA 4MZUA 1BBT2 1QHDA 5AVPA 1S2EA 2ZGOA 1HB1A 3MIEA 4KWKA 1X8MA 2J42A 2VQAA 2IXJA 1GNZA 1QDCA 3G6JB 5DUXA 1RUH3 2HLEA 4Q0SA 1WBFA 5L19A 3V65A 2P4EA 4ONUA 3M70A 3ALQA 3C7EA 1O5LA 1WMDA 3DN7A 4XHXA 1DP0A 3NJVA 3VBFA 4R9DA 3USUA 3VZKA 2XL7A 1WMEA 3RGBA 3RZJA 1O3QA 2KXLA 4WBBA 4EN7B 1W2UA 5CZKA 1QU0A 2PHFA 2XLFA 3BPZA 5A7WA 1MZ6A 1DU3D 3RJRA 2GMPA 3RZZA 2ZX4A 1IS5A 1HN1A 5JZGC 3I2KA
chains in the Genus database with same CATH topology
1YFYA 2D6KA 4FPOB 4XF9A 3RJ2X 4FAHA 3FC0A 1AYM3 2HWD2 1COV1 1LHVA 1LOFC 3LOIA 2Y38A 1SFNA 1AR63 1VBD3 3GYDA 2WNUC 5EJ3A 4ZU5A 4AEDC 1EY2A 1AL22 4GKYA 4D69A 1VP6A 1JH5A 4L11A 3OPZA 3ZMOA 4IQPA 5CFDB 4AXOA 3NAPA 4B7EA 5H9PA 2MNGA 4R4ZA 2CYFA 2GNMA 1NQDA 3B9IA 3LGRA 1MS3A 1TME2 2VPVA 5FPZA 2G4IA 4MXWB 2OUHA 1M06G 4N9HA 5KXDA 1S2BA 3MW3A 1IQAA 4CZSA 4Y20A 4X6QB 1WLWA 1V6KA 1NCRB 4FTBA 3SCFA 4LT5A 4JDOA 1VBC2 4MYEA 5T5LA 4IL7A 3JB4C 3DPRA 4QQHA 4OFGA 5JOWA 4LE4A 2VW1A 4LHNA 4HVQA 5JMCA 3RRDA 1RMU3 4XQWA 4BYYA 2H0VA 2DVFA 3OF1A 5FMOS 3MPPG 3VBUC 1YFXA 2B5HA 3J8F1 3UKVA 5SV5A 4CEWC 3ZIWA 4EJRA 1FMD2 2HEYF 2MPFA 4PJYA 1XE7A 2MEV1 2UWAA 1SBDA 3M3IA 4XF1A 4BZ4A 5J7MA 1FI2A 2P2KA 1RUC3 2WFPA 4CEYB 1AR61 2EVXA 4AQ2A 4AVBA 4URTA 5BNPB 3PNAA 2VGDA 5BNOB 1QJX1 1QF3A 2P3IA 4BOWA 1QXJA 1RUJ1 1QJZA 2ETEA 2CGNA 2GC3A 1I6XA 4Q1RA 2BVVA 1H1AA 1QY4A 1HX6A 4MGZE 2XJTA 4XOGA 1QQP2 3AMMA 1HXS1 2BQPA 3ECQA 1S1AA 2HJIA 2A3YA 4KG8A 3ZSMA 4Q4X2 3B3QE 1ZVFA 3JBG2 1WMFA 1HRV2 4F3JA 2E51A 3TRSB 4HK8A 2NM1A 1C1LA 1OQEA 1V9U2 3MLJA 1V6NA 1LRHA 5JR7B 1CAVB 4EN9B 4FP3A 3B94A 1NA1A 4JVAA 2YDEA 4BWOA 5KHIA 1VBE3 3HT2A 4HSJA 2PQQA 4JCKA 4EN6B 3LB9A 3DL3A 4Q4W2 1ND3A 1HQNA 2BFUL 1YLLA 4HLTA 2Z42A 4OUSA 3PMSA 2C5DA 2B39A 3BOPA 4WVZA 1POV0 3ZFGA 3MEPA 1SMVA 4IV1C 4TYSA 2PTMA 1AR93 2PFWA 4H3WA 4H7MA 1OOPC 4YGBA 1EYBA 3S6PA 4D7TA 1SBEA 1BQPA 3FHIB 2VULA 5CVRA 4EROA 1G7YA 3CLPA 2XLGA 1Z7S3 4XMIA 1W6QB 2UY9A 1D4M2 3E5UA 5EWSA 1H2NA 2X5IC 5CU1A 3FBMA 3M4FA 3U07A 1ULGA 3HN1A 1XNDA 4LEJA 1S0JA 2C1FA 3IDEA 1VB4A 4AI2A 1G8WA 3OBRA 2R1DA 2O8QA 1S0CA 1YI7A 3AP6A 4AGVA 1E57A 4RHV1 4ZU4A 1JUIA 1FMD1 1G9CA 2RJKA 3OCPA 3H9AA 1ULFA 4IEXA 5C4WC 3B00A 3ZN5A 4CDWA 4AVSA 5GZEA 2G9GA 2Q5TA 5CG8A 2ZGNA 4K20A 1ND2C 4L8QA 1BKZA 4LO8A 1DYKA 4A7ZA 4RR3B 1SDWA 5HXVA 3WNXA 3MF9A 4A2UA 2E7QA 1TNRA 2EXJA 3ENRA 2WKKA 1B35A 3I59A 2A6ZA 3KT7A 3VBSC 5AC93 4XJWA 1RTVA 4WM7A 2ZGMA 1R082 1ZBE3 3JD71 4LBJA 2R30A 3ZFEB 3N35A 4PQ9A 4RGGA 2VOKA 2BTVC 1VLNA 2RM23 1RUE2 4MXVA 2H6CA 1H2KA 3AKPA 4G3YC 1J1TA 1RUI2 4N43B 1DZRA 3ZXLA 2ZBJA 4AK3A 4COVA 5JPMB 3PVNA 4DRRA 5KHJA 3IDCB 3VDDA 4I09A 1XE8A 2XVLA 1PNGA 1X7NA 3NKGA 3BU7A 1V70A 4LA3A 4BMEA 4Z2WA 1LOCA 4CDQB 1WCKA 5GLTA 4J6GA 2RS52 4QPIB 4AVTA 4RR3A 4Z92B 1MZFA 1ASJ2 5L36A 4I2OA 1YO8A 5BY5A 2LALA 3GF6A 4IV3B 4Y1ZA 3VGIA 1I9RA 2UU8A 5I0UA 1D4M1 2DTYA 1QH7A 4LBQA 1R1A2 2A3XA 3E5XA 5DDJ2 2Q8OA 1QMJA 2A73B 1J3QA 2R1BA 1A6CA 1DQ0A 2EA7A 1OQ1A 2D40A 1OA2A 4FAGA 1ALYA 1DQ5A 1OI6A 2DFBA 4AVVA 4EV0A 1OMIA 2HWF2 1EPZA 1PM7A 1ZBE1 2MHFA 4AF9A 3MIFA 3WP5A 1PGW1 2AZ5A 2HWB1 1YHFA 4WVMB 3WXPA 1G9BA 3VBFC 5JZGB 4NWWA 3I7DA 1AX1A 4E2QA 4IEZA 1Q43A 4JRAA 5H9RA 2QZ2A 3VN4A 3APBA 4ASMB 1GZWA 1SLLA 1MEC2 2R061 3NV4A 2WNUB 4AEDB 4C1WA 3O0VA 3L2YA 1S0GA 4AG4A 1LOAA 3WUDA 4E9KA 2DWRA 3WP6A 4I0AA 1FNZA 4L9BA 1FV3A 1AYN3 2ZS6B 4IEUA 2VNGA 1PK6A 4FPEA 4MVTA 4GB33 2FMYA 1H8VA 1VR3A 3VBHC 5T5JA 2WFF1 1BYHA 1LKNA 4Y24A 1QNWA 1RUE1 4YZ2A 3NAPC 4M3CB 5JPNB 4HN0A 2E63A 5IT6A 4XBQA 4DQAA 2D3PA 4PCRA 5FLJA 3DUIA 3BIWE 1JUHA 1RGSA 5J48A 1D0GA 2GMMA 1UN1A 1DQ2A 3SH3A 1WCSA 3ZN6B 4XPVA 2JG8A 5C8CA 3H7YA 3NWKA 2C9AA 4YGCA 3VBOA 1OSGA 3DPRC 3LWCA 3VBUB 1ZRRA 1PO23 2FQPA 3CL1A 3EJKA 4HVOA 2RS51 5IK5A 3W59A 1UMZA 1AL0G 4CEWB 4ITCA 5EYYA 3WX5A 2A6XA 3IBMA 2BYVE 4QT6A 3KT1A 2D44A 1BVVA 3GALA 1QH6A 3ZO0B 4Q29A 4U36A 4KH9A 5ABJC 3EQEA 5CB7A 4L97A 4B8EA 1VRH3 1IKPA 2XWJB 3RMYA 3I8TA 1XYNA 3ST7A 5EV7A 4XXPA 3LKJA 5BYNA 4FTEA 1HKDA 2EIGA 5FPXA 3GZTB 3ZSKA 1AYN1 5I93A 3PVOA 2HWF1 2ZGSA 3EBRA 3FE5A 3ZPYA 1PVC2 3AFGA 4NO4A 4QX5A 2HEWF 4AFDA 4AEKA 4E4SA 2QVSB 2WA3A 5L73A 1OPOA 4X6RB 1QXPA 2HWC2 2ZACA 4HKLA 3VKOA 4RD7A 3IWZA 4OI4A 3LSDA 1LTEA 3T1LA 2BWCA 2GAUA 4WV8A 2TEPA 4HT1T 1LU2A 3GHMA 4EWDA 1QJU2 4M01A 1ENSA 3QCWA 4IV1B 3WG4A 1S0IA 1TNFA 3CJIA 1KFUL 1CAUA 5A3LA 1S0DA 1ND3C 2EXHA 1OOPB 1W6NB 1VIWB 1YJLA 1ZBA1 3B9CA 4OUMA 4LO5B 3IN9A 5T54A 3ZFGC 1WD4A 4HZFA 2AUYA 4BLIA 3OY8A 3WCRA 4FQZA 1BCXA 4NHKA 3ZN4A 5CG9A 4FXGB 2X5IB 3LA3A 4P9WA 5KXBA 1BMV1 4R9AA 4E2SA 3VHPA 1BEV3 2EAKA 5I0TA 2ET7A 3KCYA 2D98A 4WZCA 1X33A 4FPFA 1PIV2 2DUPA 2XJVA 4RA0A 2PHTA 3SLIA 4QQOA 4B3NA 4YM1A 1POV3 4YW2A 2PELA 2HWE1 2RE9A 3MIBA 5JVVA 4LULA 2JD4A 5C4WB 2WZR2 1O4TA 5GZDA 3WHTA 1RUNA 1ZRCA 3IPVA 3VBRC 3NW4A 3HMYA 5K0UA 1ND2B 4NN0A 4M00A 3M3QA 1AR71 1AX2A 3SHRA 3TN93 4K21A 1GR3A 1H1IA 2B45X 4CDWC 2RS32 3OGGA 2VMGA 2JE9A 4JTNA 1HLCA 4LLFA 1U5ZA 3N4MA 4AYUA 2P34A 1W0PA 3H3UA 3UKTA 3MIDA 5FMOL 1YFWA 4AVCA 1YJKA 2R49A 4FP2A 1FPN2 1K5MA 4XYXA 1UAIA 4RS5C 4F8AA 5ACA3 4FOVA 1B35C 5FQ0B 1APNA 2GDFA 4WM7C 2HWC1 1PNFA 3N3HA 3BB6A 1CAWA 2VW0A 1QXRA 4FPJA 2OW4A 2WSVA 1TMF1 1DG6A 2QCSB 2WS92 2R041 5KHGA 2PLV3 2YC0A 1RHI1 1AR83 3R05A 1AVBA 4S2FA 2WQZC 3FX3A 3G7DA 3PJQA 1YFUA 5JWPA 4TSVA 2H0BA 3RI8A 1HRI3 3IIAA 3WQ1A 2OUJA 3UJOA 3FWEA 4PLMA 2LUWA 5FREA 3VDDC 4LLOA 5EXOA 4TZDA 2A71A 4IEQA 2GALA 3VBSA 5HCBA 3WW4A 2W08A 5I8TA 4H14A 4BHPA 1LR5A 2VVDA 3AP5A 3BCWA 3PJYA 3D6EA 4Y1XA 3MDPA 3VL8A 5E88A 1OFNA 2GNTA 3K51A 1BVP1 3VZOA 3AX4A 1FOD1 3QD6A 1J58A 4YFWA 1LHWA 4LBQD 1Z78A 3U0ZA 1C8M3 1GKBA 4K1ZA 4LBLA 2RR11 4AEMA 3INAA 3SMHA 4IEYA 2Q30A 4U2AA 1YIPA 4DY3A 4HKOA 3VBFB 2D6MA 2XWBB 1F5JA 1F9KA 2R6QA 1COV3 2DVAA 3USUB 2RS12 3AK0A 1J59A 1RJ8A 2JX9A 1H4GA 4XF0A 3O7OA 3I54A 4BIOA 1X82A 1F2NA 3QOPA 5FLIA 1QJY2 1SCRA 3RYPA 3M3EA 4LBMA 1JYCA 1XRUA 2PLV1 1ULDA 4XF4A 3LA7A 3GBGA 4JDMA 1RUH2 2OZJA 2ZGUA 4IEPA 2YY1A 5L7OA 3MZHA 1DGWX 3NAPB 3URFA 5FRAA 1YWKA 4UW3A 1R093 3P3PA 3QBQA 2KM2A 4KU8A 5CADA 2ZGKA 3CEWA 5BPXA 1U5IA 3RYRA 1PK6C 4EWEA 4IEVA 4Q4Y3 3MLLA 3ZXKA 4YM2A 4PDWA 2QQPA 2JXAA 3HBZA 4Y20B 5F9TA 5KXEA 1TQ5A 3GZUC 3WZ1A 1PZ9A 1RVF1 4AQTA 1AYM2 1C8M1 3J8F3 1HV0A 2B8MA 3DPRB 3SH5A 5B2GB 1IS3A 1SLIA 5J3UA 5JI9A 3ME2A 1Q3EA 1VBD2 1VBA1 4OHWA 2XBO1 4LUMA 2MEV3 2XJUA 1EAH1 2JG8C 5C8CC 3MI8A 3VBOC 1IKQA 4QPGC 3WW2A 4FCAA 2JG9A 1QJX3 3IKWA 5IK4A 1XYPA 4CYDA 1RUJ3 5DUUA 2XJPA 4QGLA 4YG3A 3VBHA 3IMNA 2DFCA 5HBAA 4I3PA 1MQTA 2BUKA 4GH4C 4BLJA 1OKQA 1HXS3 1RB8G 2OVUA 3H1YA 3A0KA 2RHPA 1KD7A 2DCJA 1OHFA 2P37A 2RMU1 4R8HA 1BZWA 4WZFA 3WDUA 1REEA 2IXHA 3GZAA 1PO11 2WZPP 4Q27A 1RMU2 1R091 3D4KA 5E8AA 1RUOA 1PGSA 3D5OA 1NQJA 2VOWA 2JE7A 1ZA4A 2UY8A 4Q4Y1 4XQ4A 1AX0A 4KU7A 4AFAA 1QJY1 4H7LA 1LGCA 2A3WA 4A7KA 4WM8A 4DXZA 2YGLA 5DZEA 1O7FA 4DRVA 3SCGA 1RUC2 5ABJA 2GH2A 2QKDA 1NA1B 2RJLA 4UW6A 4IETA 3V0AA 3RNSA 1IHMA 4KL1A 4E4DX 1ND3B 3CF6E 5FO9B 1BBT1 3MIGA 2BWAA 2QDRA 4CP2A 1QNYA 1IOAA 3ZFGB 3IM0A 2ET1A 2VECA 2F6BA 3M8LA 3WP4A 3KCCA 4AGRA 3CJIC 2ZX3A 2DURA 4CDXC 2GZWA 1V00A 2DVDA 2HYKA 2Y26A 1UZYA 3NV2A 3WW3A 5F6LB 4JC1A 4COYA 1MS1A 4YRDA 5C6CA 2XUMA 3V64A 1U5YA 1Y7BA 2FZ1A 1KFXL 1LENA 1VBE2 2VOXA 1VAKA 2FMDA 4RHV3 3CO2A 4DINB 5A3MA 4GKXA 1FMD3 3U10A 1DDLA 1M4WA 4Q4V2 2GC2A 4MX3A 2HWD1 4CDUA 1QOTA 2DF7A 2DV9A 1G9FA 1UD1A 1ZRDA 4HETA 1A3KA 1AL21 1AR92 3B5LB 3DF0A 1GANA 2A75A 2VXRA 5GJ6A 4ZU7A 1V6MA 2VNOA 5BXXA 5GZFA 3UV9A 1QQP3 1RUG2 4CDWB 1WA4A 3NV1A 1JHNA 2V09A 1TME1 4NWVA 4Q4X3 1H2LA 3MICA 3AKSA 4QQLA 5K0UC 3HR9A 1Z7S2 3JD73 4R9BA 1HRV3 4LO7A 3O12A 1WW6A 4OULA 5KHHA 2G9FA 2I07B 5I8SA 2WJSA 4N53A 3QACA 1VBC1 1NCQA 2K0GA 1OPMA 4V1PA 1B35B 3I59B 4C0BA 5JOYA 2BVBA 2X8KA 5BNNA 4WM7B 2ZGRA 1SLTA 3V56A 1K5MC 3ZSLA 1Y3TA 2JDZA 1O3SA 1KDMA 3WDWA 4M3CE 3KGLA 2DCYA 2V73A 4QM9A 4ES9A 5DZFA 3VBRA 5FOBB 1U5XA 1IPKA 3AZXA 1W6OA 2W52A 3TNPB 2FHRA 3VDDB 3VHNA 2CGPA 3SCHA 1A8MA 2GMEA 1AUYA 3BTAA 3SNMA 3OGJA 5KC5A 1BXHA 3MLKA 3O0WA 1D4M3 3AYDA 4S2GA 5AC92 1ZX5A 1N1YA 1LGNA 1IS6A 2HEVF 4RS5A 5GZCA 1QQP1 2RM22 1LECA 4YG6A 4ASLA 4Q4X1 1KS5A 4RQPA 3JBG1 5T5PA 3L2HA 1HRV1 4PBPA 1WCDJ 4LBQB 1F8VA 2R072 2HWB3 3M2MA 4K1YA 1V9U1 4YM3A 5LRSA 2R32A 1DIWA 3VHRA 3VKMA 2XHKA 3R4DB 2Z79A 3ROUA 4XFGA 1EP0A 2F4PA 2BNNA 5FO8B 1LEDA 1MVEA 1G9DA 3K48A 1KXGA 2R063 4YW1A 3WINE 4Q4W1 1XNBA 3O14A 3USSA 2QZ3A 2B7YA 4CRQA 4XF3A 1U0AA 4HVRA 4HK9A 4C91A 1VB2A 3WCSA 4RL7A 3LAGA 3RDIA 5J37A 1OLRA 5E89A 3SXWA 3ACLA 4FO9A 3S30A 1GZWB 3H8UA 5F6KA 2A6YA 4S2HA 3SH4A 4I02A 4L92A 4AEJA 3EO6A 2WFF3 2VMIA 1RUE3 3ATGA 1CN1A 3AMNA 1REDA 1GICA 4A3XA 1RUI3 1CJDA 2QDNA 2V5YA 3HT1A 3O5SA 1NLRA 1GV9A 1PHMA 1PK6B 1XYOA 3ZXDA 1LHUA 4X8NA 1I5ZA 1SCSA 5FFOC 5AVAA 5L7OC 2DU1A 2E7AA 3VKNA 4RGAA 1GYKA 4PF5A 4XFCA 4B4QA 1AHSA 5D8AA 2RS53 4BIFA 1X36A 5CFCC 4SLIA 4PDWC 1ZM1A 4HFSA 5LK5A 1ZREA 3DGTA 1V6OA 3R4UA 5J98B 1V6JA 2JG8B 1BJQA 2P3KA 2XJQA 5A33A 5C8CB 3VZJA 3VBOB 2TBVA 1MS9A 3MFCA 5JSOA 4DNYA 4XILA 4AI3A 3B01A 1YXWA 4P9XA 4GB32 4YNIA 2YPJA 4BM8A 4YW4A 2BGCA 3AYCA 1RITA 1YUDA 1N1SA 1ULCA 2GC1A 4SBVA 2JG9C 2HWF3 1R081 1YRZA 2WSUA 4Y4YA 2EF6A 3HAGA 1DHKB 4CTEA 2R071 4Q8LA 1MQTC 3S7EA 4XJ8A 3TWIA 3GBWA 5DUWA 1RUI1 3AM2A 4KG0A 4XTPA 1VAVA 1W6MA 2AREA 3N7MA 4DFSA 1RUF2 1PO22 1UZZA 4GA9A 4W65A 2IWGB 5J96B 1O4YA 2CNAA 2PHXA 3NSTA 4BCUA 2ZGPA 3ES1A 1URXA 4YVWA 4QPGA 5HI0A 2GU9A 1PGL2 5T5OA 4IEOA 5FAXA 4DMIA 1ASJ1 3U11A 4OHZA 3KD4A 4XJZA 1VRH2 4Y22A 4XJUA 2WWSA 3AJZA 2DCKA 2VH9A 3WHUA 4EWAA 4WM8C 1ZBA3 2ZTNA 4GH4A 4QMAA 2I45A 4NR1A 3JQXA 3DKWA 1H8TA 1CAXA 1JW6A 1R1A1 4INDA 5TSWA 1PZ7A 5DDJ1 1RINA 3AFKA 4FPLA 1NE6A 3CJIB 1NOVA 1CAUB 2EALA 2CGOA 4AVAA 2TUNA 4K8FA 1JN2P 2ZJCA 2ZKLA 3A0NA 5JCTA 1CGPA 1KDKA 1R1ZA 1XU1A 1VALA 4GWNA 2OPKA 2K2SA 3OY8B 4D7YA 2ARXA 2E6VA 1NY72 3E6CC 4TLFA 4HN1A 2PHWA 4HPKA 3FFQA 3POWA 3N7LA 2HWE3 1HDKA 5SV8A 1OA3A 4M0NA 1WW4A 2CL2A 2D93A 1MEC1 4YGDA 3LSEA 2E7TA 4QHBA 4XEZA 1UU5A 4OVEA 5LEKA 3MW2A 1AR73 4FXKB 3H0OA 3FBYA 4YG0A 4XTMA 4CDUC 1NCRC 5A32A 5DUVA 3A4UA 3H1WA 5LRRA 3VLBB 2D43A 3CNAA 2BBVA 5E1RA 3Q9OA 3IPVB 4CDXA 5FOJB 1DQ4A 3VZMA 1DF0A 5K0UB 2NN8A 3S0MA 1D0HA 1GZ9A 1H4HA 4JGZA 3RMXA 4Z1VA 2NMNA 4R9CA 4NOTA 3CJXA 2Y0OA 1QGLA 3WOGA 1BEV2 2HWC3 2DU0A 2ZMLA 4LO6B 4LUKA 1RUF1 4K9SA 2XH6A 3WG2A 1UKGA 1D4VB 3PHMA 4YW5A 4N53C 1AF9A 1UX6A 1K5MB 1F31A 1HIXA 1NCQC 1TMF3 1YYNA 2R16A 2YGMA 2R043 3NL1A 1YNAA 4LA2A 1LEMA 1RHI3 3WQ7A 4Z07A 4HL0A 3C3VA 3KMHA 4JQRA 5BNNC 1LJ7A 3WDVA 2EXKA 1EV12 1MACA 1CAWB 3B02A 5C9AA 4FBFA 2GNBA 1W6PA 1WLDA 2ILMA 1Q8VA 2QUOA 5J36A 1VBB2 3PVEA 5GLUA 3PLQA 3P3NA 1LU1A 4COWA 2I74A 4JGYA 3VHOA 2FBEA 3TOJA 4NVPA 4XHBA 3ZFFA 3QLQA 4AI8A 2X53S 2LTNA 2XKPA 3AMQA 2QJVA 1WW5A 1FOD3 2IXLA 3E6BA 4UBHA 5EFUA 2WNVA 4YZ4A 3VBSB 4JRLA 2ZZJA 5FCCA 1FV2A 1JXNA 2CWMA 4LE3A 2RR13 1PVC1 1BK1A 3M3CA 4YVSC 2O1QA 4K40A 5J09A 2XKOA 2EAAA 5HCAA 2YMZA 2DCZA 4I0WB 3THTA 3VZLA 4XETA 1RUD2 2YZ4A 1O91A 3ILFA 3HD8B 1CPNA 4G9SB 1Q8PA 2D6PA 5JSRA 4RQPC 2SBAA 1AR82 4W6XA 5T52A 2PA7A 2ZKNA 2VVEA 1WLTA 4OHYA 5KBFA 4PIZA 1XNCA 1RJ7A 1HRI2 2WT0A 4KWLA 4FPKA 1Z0HA 3D82A 4YM0A 1WGPA 1ONAA 2VUAA 3WDTA 3ASIA 1QJU1 2IXIA 4OI2A 2PHUA 2ES3A 1Q8SA 1QOOA 4P9LA 1OFSA 4JAAA 3WG1A 3OYWA 5EZWA 4DY5A 3O0XA 1FPN3 4YZ1A 4OI1A 4BQ1A 3RPQA 5JLVA 2OIIA 3JUUA 4JTOA 4F83A 3RG0A 3HIFA 1SLAA 3WD5A 4B4RA 2WC2A 2GSYA 3B7MA 1UPSA 3M1HA 2N7GA 1G86A 1ZZCA 1GQHA 2WS93 4P9YA 3ZYIB 5L7OB 5CBLA 1RVF3 2ZHLA 4AHZA 1PIV1 2JICA 1D2QA 3E5QA 4XFIA 3E97A 1MR5A 2WT2A 1VBA3 2XBO3 1Q5OA 2ZPXA 4BA6A 3ZYGA 5AFEA 1EAH3 2JENA 2PAMA 4PDWB 2UYBA 1VBB1 1DGRN 2WZR1 5DG1A 2CV6A 2Y0IA 2UURA 4N7IA 5D8AC 4QQPA 4KWJA 3EHKA 4XE9A 4AI1A 4RFT0 2XLAA 4FQ4A 2XVKA 2B9UA 4P9IA 3ZFEC 2PN5A 1MZEA 2RS31 1OQDA 1LOBA 4BE3A 2VVFA 1YCIA 3AXEA 3V0BA 4Z82A 2NP0A 4XFBA 1B09A 2JG9B 2RMU3 5I0RA 3ZVXA 5AFBA 1ULEA 5K8SA 3D8CA 2ZA9A 4LBOA 2W0XA 5H9QA 4PLOA 3ZXFA 5KC6A 1FPN1 1Q56A 3VBHB 1PO13 1O3RA 4YW3A 1MQTB 2A7AA 1DQ1A 3WDXA 2NPIA 4L99A 2VW2A 4CDQC 3FFZA 5JOZA 4YFZA 4FOWA 4QPIC 3VV1A 3J8F2 2ZGQA 4Z8BA 5CFCA 3CU7A 1QJY3 1O4ZA 1SBFA 4A7YA 4HKWA 4I01A 5T50A 2WS91 3ES4A 1C57A 4PBOA 4RSUA 3WLUA 3NJZA 1G9AA 2DYCA 1V6IA 2Z2SB 1C5HA 1AR62 1CVNA 2WINB 1QJX2 1HV1A 1RUJ2 2WT1A 4E27A 4Q0PA 5GLVA 3SITA 3ZMNA 2ZX1A 1BBT3 1A78A 2D5HA 4YVWC 4G4FA 4WM8B 5FDBA 1I1EA 1CPMA 2IXCA 3ZXGA 1O3QA 3X29B 3AZZA 1HXS2 2A6VA 3LZZA 5GM0A 4AE2A 3PVBB 3W58A 1ZZ6A 5ABJB 1T6GC 3T2TA 2W68A 3V0AB 4KGQA 4FPCA 5LK7B 4META 4UW4A 3KQRA 1UF2C 4KBBA 1C1FA 1UU6A 2JECA 2WLQA 4NPRA 4MGKE 2OA2A 1H8TC 3RSJA 1W39A 5I8YA 3AXDA 4P14A 1TEIA 3NVCA 3TNQA 2AH2A 4MLOA 1YIFA 3IDBB 3WP3A 2HWD3 2RS11 2GN7A 1LULA 2EXIA 3B69A 1U12A 1J3RA 1AL23 1RIRA 3MF6A 4P9JA 2C0ZA 1VAMA 4Y1VA 5IUQA 3AKQA 4F7ZA 3VL9A 4OHVA 4GMP1 4GXLA 2SLIA 1SLCA 2PHRA 2ZCWA 4CDUB 1GZCA 4Q0QA 1TME3 3FUQA 1WLCA 4IXLA 3QH7A 1RUH1 1TE1B 5FBZA 4PLNA 1FAYA 5I91A 2A6WA 5CNAA 1MS5A 1VBC3 2IFRA 1LB2A 4XQDA 2JJ6A 2Q0AA 4O9GA 2LM3A 2ZHMA 2NLRA 1NLSA 4B29A 3VZNA 1ZZ8A 4M3CF 4C1XA 2VUJA 4JGZC 4RHV2 5CFDA 1S2KA 4N53B 1NCQB 4IESA 4PIYA 2WA4A 4XJ9A 1AYM1 2IZWA 5C33A 2ARBA 5JDBA 1AJKA 1AZDA 1J1LA 1N3PA 1OLQA 4MXWA 1REFA 1VBD1 2B46X 5BNNB 4LTAA 4LBKA 1LGBA 1DGWA 5EYXA 2TNFA 1NCRA 4KGGA 2D5FA 4HANA 4AFMA 1MZ5A 1AXKA 1GFF2 2WL1A 4AWDA 3I4IA 3VBRB 5BNQA 5C9AC 5T3NA 1NXD1 3JD72 2VY0A 1W6OB 3ZYRA 4YGEA 2QFEA 2E53A 4UW5A 4C90A 3GHNA 5GLWA 2ZX0A 3ZYJB 2D7FA 4NHMA 1SFYA 4QD2A 2D6LX 4JGYC 3JBG3 5I0SA 4XIKA 1UIKA 3ZFFC