1C5IA

Hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGDFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Hydrogen bonding and catalysis: a novel explanation for how a single amino acid substitution can change the pH optimum of a glycosidase.
pubmed doi rcsb
source organism Bacillus circulans
total genus 50
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1999-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c5iA00
1BCXA 3M4FA 4S2FA 1REEA 1XNKA 3RI8A 3WX5A 3LGRA 1XNCA 3MFCA 5HXVA 1M4WA 3WP4A 3WY6A 1H4GA 1T6GC 5K9YA 1F5JA 3VZOA 2QZ3A 3VZLA 3VHOA 1HV0A 1OLRA 1H4HA 3VZJA 2C1FA 5K7PA 2BWAA 2BVVA 4H7MA 2VUJA 1YNAA 3AMNA 4IXLA 3AKQA 1BVVA 2JEMA 1KS4A 1H1AA 3VZKA 1OA4A 4S2GA 1ENXA 1BK1A 3WQ7A 2B46X 1XYOA 1XNBA 2NLRA 1UU4A 3AMHA 3VHNA 4HKWA 4S2DA 2JENA 1XXNA 2Z79A 3MF6A 3WR0A 2DCJA 2NQYA 1OLQA 1HIXA 1UU5A 1REFA 4HK9A 4XPVA 1PVXA 5EJ3A 1QH7A 2VG9A 4HKLA 1NLRA 1XYPA 3AKRA 3MFAA 3EXUA 4XQWA 3VL8A 3WP5A 4HKOA 3O7OA 1IGOA 2F6BA 3AKSA 3B5LB 3WP3A 2B42B 1UKRA 2D98A 4XQDA 3AMMA 4HK8A 3LB9A 1C5HA 4NPRA 1UU6A 2BW8A 4S2HA 3B7MA 3WQ1A 1OA3A 3HD8B 3WT3A 2DCYA 3VZMA 3WXPA 1REDA 3RI9A 2JICA 2QZ2A 2VULA 3VL9A 2DCZA 1KS5A 1TE1B 3VLBB 1QH6A 1H0BA 1C5IA 2D97A 3MF9A 3ZSEA 1XNDA 2VGDA 3AMQA 3VZNA 1XYNA 3WP6A 1H8VA 3VGIA 2DFCA 3WQ0A 1AXKA 2DFBA 3AMPA 2BWCA 3AKPA 3VHPA 2B45X 1OA2A 2DCKA 1W2UA 1HV1A 3AKTA 4XQ4A
chains in the Genus database with same CATH superfamily
1CAWA 1JUHA 4IDZA 2R30A 3R6SA 1RUJ1 1MVEA 4QGMA 2IVIB 2VE1A 3A23A 3LGRA 4YZ5A 2FMYA 2DV9A 1ZZCA 2PQSA 3I54A 2ZHLA 2A6YA 5KR7A 4BOWA 5JWPA 3LSEA 1O59A 1BKZA 3ZYPA 1QY4A 3WP4A 2R49A 3ES1A 5H9PA 1VIWB 3BTAA 3RVHA 1F5JA 1PVC2 4R9AA 1EAH3 2GN3A 3GF6A 4YVSA 4WBBA 3ELNA 3M7AA 4R9CA 1LHUA 4A45A 2WINB 5J96B 5DUXA 3VZJA 2E7QA 1ND3A 3KCCA 2WFPA 3KHBA 4H7MA 1QQP1 4QX0A 1QF3A 2EIEA 3POGA 4FBFA 3LFMA 5CFCC 1N47A 2Y6GA 5C33A 3HNYM 2B7YA 5IYYA 3UV9A 1J1LA 1MS1A 2GH2A 4D6RA 2B46X 2BU9A 5EQUA 2AACA 2XUMA 1S0JA 5FZKA 3RMYA 2J1UA 2OA2A 3VBHC 2QQVA 1WD4A 4PBOA 4COYA 4E4SA 3O1SA 5DMYA 1W6QB 1XC6A 2DF7A 4B7KA 5CADA 1XQNA 2WYFA 1PHMA 3ZMNA 1EPWA 1W2TA 1MS3A 1W6PA 2UYBA 4NWWA 5FPXA 4BJ0A 5FP7A 2CDPA 3IIAA 5FXXA 5CFCB 3DEMA 4Q0PA 2VNOA 1V6KA 3PUHA 4Z82A 3ZO0B 1WZXA 5FBZA 1DYKA 5I0DA 2DURA 3I2DA 5LY2A 3NNLA 1ULDA 2YY1A 3VUOA 4I3GA 4XXAA 3QOPA 4UFLA 5HCFA 4CCNA 4E8CA 3N9LA 1JXNA 2R7EB 5DAWA 2NYYA 4DRRA 2PAMA 2D5FA 2ILMA 4JKMA 1C5HA 4YVSC 1R092 2P4EA 3WT3A 2WJSA 3V64A 3N4MA 3LQCA 1CAWB 4Q4V1 5L9RA 4GKYA 1S2KA 1X50A 1H30A 4CUCA 3CKHA 1CAVB 1IS5A 1WCSA 3QACA 4QQOA 2WQZC 4HXCA 4LO5B 4CDWA 1DYPA 5FUIA 1W0NA 3N9PA 3VBUB 5ACA2 2PN5A 4AR2A 1QQP3 4ET7A 1HJFA 1H0BA 5ABJA 5C8WA 1RUG2 3BTYA 5K0UA 1WLTA 2Q1ZB 2YUEA 3M1HA 5FZMA 3VV1A 3ZSEA 4E4ZA 5FK7A 2BNOA 4FFIA 4BMBA 2IXJA 1U5IA 2FDJA 4R52A 2VCBA 4AI0A 1XNTA 1GWLA 2VCMA 5BNQA 3WF4A 1C1LA 4UT5A 4NJ4A 3NNGA 2VL4A 4QXBA 1FI2A 1W8TA 2HWC3 4CPBD 4AOCA 4D6QA 1X33A 1OA2A 4QHBA 3H7YA 1RUF2 4JRAA 1DLCA 5J09A 4CXYA 1XU2A 4IE7A 3ZDSA 1GZTA 3HPNA 5CG8A 3WEZA 2GALA 2WLQA 4AFMA 2RS52 4N43A 4DEQA 2MHFA 1PVC1 4M3CA 5E16A 1W6PB 2ZBJA 3GCWA 3ZMOA 4YZ2A 2TNFA 5LBEA 2HWE3 4FQZA 3HN3A 4PT6A 5JSPA 1A6CA 3VKOA 4M0NA 3G6JB 2B9VA 2E6VA 3P3PA 5EP9A 2JDUA 2XKPA 3F2ZA 5HBAA 4RS5B 3WSOA 3HT1A 4BA6A 4CDWC 2W9XA 1HRI1 3TB0A 2J22A 4DS0A 4OCTA 3NQHA 2MEV1 4LA2A 2VTXJ 1TMF1 3FHQA 4ONUA 5FPZA 4AVVA 3TN92 5KXEA 1YCIA 5HPOA 3H8UA 5ABJC 5K0UC 4EN9B 1KITA 3QH6A 2WA4A 1H1AA 1WW6A 2VQAA 1I6XA 1WMXA 4CRQA 1AUYA 1SPPA 1WCDJ 3FUOA 1YLLA 2GMMA 2ZMLA 5JLVA 3SCFA 3WD5A 2J1RA 3WCRA 2WO3A 2W2IA 1UIJA 4I0AA 1WLDA 5DABA 4AL9A 4BQWA 1OC1A 5I8SA 4YARA 1FX5A 1C8M1 1LU2A 1Q8OA 1XPWA 2C9AA 4FXGB 3T4VA 4CDWB 4GALA 3SC7X 2OIIA 3RG0A 5FQ0A 3LEMA 3RYRA 3ST7A 1CZSA 2UY8A 1GZ9A 4WM7A 1XBFA 3PJQA 3T08A 4FTEA 5ABJB 1H6YA 2YYOA 5F39A 3BU0A 4Y1YA 3EO6A 2PAEA 1ALYA 4HK9A 3OYWA 3DYMA 2YU2A 1R1ZA 2R062 4COWA 2VNGA 4N43C 1C8NA 4QX2A 4OVEA 3AZXA 3VL8A 1ENRA 4NHKA 1DG6A 1UYPA 5IK7A 1ZBA2 3RZMA 1R091 2W3JA 4NHXA 3IAQA 2JE7A 1R081 1OD5A 4EQVA 4OI1A 3THPA 4V2VA 1NXMA 1S0DA 3LDBA 2WNUA 3PUSA 3M3OA 4DZGA 3B7MA 2QDNA 1OA3A 3K46A 3OY8A 1DCSA 2O8QA 4N8MA 4Y1VA 2P3YA 4OUMA 1REDA 1RMU1 4QXCA 4XILA 3BIWE 2E33A 2XXZA 4DFSA 4RHV1 1Z7S1 1RUG1 2EXIA 4NHLA 3SKVA 1HRI3 3TEXA 2R32A 4M3CB 4PCRA 5AC93 2MEV3 2JD4A 3AP5A 1TMF3 2ZA9A 1OH4A 4BLJA 1CJDA 4XFAA 1JODA 4AI2A 1C5IA 2WWUA 2CDOA 5ANQA 3PIGA 3RPQA 3I2JA 4HVQA 4AK3A 5A3WA 1QDOA 5EV7A 2FDFA 1IS6A 2Y6HA 3WP6A 2XWBB 3OD4A 5FP4A 4Z92B 1OF3A 3UJOA 4LK7A 5GLUA 4Z07A 2B8MA 3P6BA 3WG4A 4KU7A 1Q5OA 2VNRA 1AR62 1ZZ9A 2DFBA 5FXVA 1RUF1 4RFRB 1C8M3 5FZCA 3U1XA 2UWCA 5JXIA 4FPFA 5T55A 1G9BA 1SPPB 5D21A 4Z2AA 5DPNA 2VAUA 4ATEA 2R0FA 5C3PA 3ZYHA 1MS5A 1BCXA 3T2TA 3N9QA 1LR5A 3NV4A 4MZUA 4UW6A 4E2SA 1W6NA 3K2OA 2VZSA 3OGRA 2OYZA 2IXLA 4C1WA 2XL7A 4OUSA 4BQXA 4TLFA 3GM8A 3SLIA 2ZAHA 4QGLA 5FQ0B 4GB32 4FPYA 4L2NA 5IVVA 1GQGA 1VBE3 3MI8A 2VVEA 4IV1A 1R083 3CZJA 4XURA 3WY6A 3RZHA 2WNVA 4CUGA 5IVJA 5FMOL 3OYWB 4ZKTB 3POBA 5FO8B 5D2AA 2P2KA 4E4HA 5LWBA 1QJFA 4YZ1A 2Z2SB 1R1A3 5A3TA 5F32A 1MS9A 1COV1 1RMU3 1PX3A 2WS92 4MYEA 5T5JA 4RHV3 2CWSA 1PMJX 1W90A 3Q8AA 5F3CA 1Z7S3 4LBOA 3C8XA 3D4KA 4JVAA 4OZXA 3PUIA 1KS4A 5I8YA 1W8HA 3JD73 4AEJA 3OY8B 4WZCA 4DEVA 4FTSA 2ZZQA 5GZCA 1LGNA 4DUWA 3UGHA 4XXPA 1S55A 1YO8A 3NV2A 1FOD3 1SG3A 3CO2A 4XFBA 2EA7A 5J7MA 3H8RA 1UKGA 1WCQA 2RJKA 5I91A 2C0ZA 1GQPA 1KFXL 3IB3A 2DCJA 3POWA 1HIXA 1LU1A 1LOFA 2JECA 1SDWA 5DZGA 1RUH2 1ZBA1 4Y24A 4MVTA 1UIKA 2DU1A 1YXWA 2ZGLA 3MIDA 3OTFA 4NRMA 3UYJA 1SLAA 2AREA 3KMHA 1QXJA 2WA3A 3N7LA 1YHFA 3IBMA 4JKKA 4LQRA 3K4AA 4IV1C 4KL1A 3SMHA 5K8SA 2WNVC 5DN2A 3WNNA 3NO8A 2BFUS 1GP4A 4NHYA 2VMIA 4ZY9A 5LK7B 1KDKA 2WFF3 1UZVA 1H2NA 3QLQA 5SV5A 1X7NA 1Y7BA 1NE4A 1RXFA 3N9NA 5C71A 1W6NB 1LKNA 4BK5A 1LODA 1SZBA 4IQPA 1HB3A 4XUNA 4GWMA 4BWOA 1RUOA 3MLKA 2E51A 2C4XA 3MO4A 2JE9A 1COV3 2P3KA 1OURA 2WZR3 4RR3A 4V1PA 4IV1B 2J1AA 1MACA 2A1XA 5ANNA 4OULA 1AL0G 2QKDA 4XFGA 1AR61 2ZGTA 5LB6A 5EJZB 3ETPA 4LO7A 1W8ZA 2IXHA 3HN1A 1W0PA 1HQNA 4CDUA 1MEC1 1O4ZA 2GNBA 4Y26A 2DFCA 3I3EA 3J8F3 2FDHA 1MZ6A 2UURA 3GGLA 2SLIA 1MS4A 5L7OC 4Q4X3 5JZGA 2VC9A 2PHLA 5G05L 3ZSMA 1LOFC 3PDQA 4XW3A 3I59B 4DO0A 2FZ2A 2GSYA 1ZNPA 3EMRA 2PELA 1W06A 3HMYA 2JG8B 3ZFEA 1H2KA 1Q8PA 2NMOA 2ZGUA 1VBA2 2IWGB 4HFSA 4PHZA 5KHJA 1UXXX 2W1UA 4GB31 4Q4Y2 5J98B 3TAYA 4QQ2A 5FYUA 1K5JA 2XLGA 4TZDA 4EN7B 1AX2A 3CHXA 1LULA 3ZN5A 3C7FA 2P6CA 4W6WA 5A7WA 1CD3G 2QQPA 2L9LA 3INAA 5C9AA 5C3SA 2Q8OA 5L7OB 5JOWA 4Q2FA 4DXRA 2VMEA 4QB1A 4Y5TA 2PHDA 2WS91 3KGLA 1FXZA 1BHGA 1GBGA 4Y33A 2RJLA 5GLTA 2CY6A 3D8CA 3VKMA 4D3WA 5HV4A 4QKNA 3RZZA 4RR3C 5K7PA 4ZXKA 2GN7A 3M3CA 4XFHA 5DZFA 4YGCA 3BGAA 2BVVA 1UZ0A 3WF2A 3AL5A 2RJ2A 2YB7A 3AXEA 3KT1A 3PVBB 5J1XA 4NRPA 2NMNA 3AVSA 2HWF2 2C6SA 2Q30A 2BRTA 4XZUG 1OA4A 4C8DA 4CU6A 4HZFA 1QMJA 3OBZA 1GZCA 4L97A 4FTBA 2HWD2 4GWJA 3WQ7A 1YUDA 4C0BA 4CDUC 3VKNA 1VB2A 2NLRA 2JB8A 3LA2A 3HEIA 3AB0A 3BOPA 4HKWA 4CZSA 1IG3A 2XGXA 4GWNA 5JZGC 4N9HA 1ZBE2 4E4DX 1MEC3 3MGUA 1NAEA 2F4LA 1W05A 4RR3B 3ZDVA 5FO9B 5I0RA 3IDEA 1MZFA 5EFUA 1XXNA 2DVAA 3ZFEC 4AVTA 4D7YA 3AZZA 4XZPA 5CYYA 1AR81 4HL0A 5FZIA 4A7KA 3SH3A 1BBT2 4YVWB 2PHUA 1OPOA 3ZOIA 1VBC2 2GP3A 2V72A 2WZ8A 3I2KA 4NAOA 2VOXA 4YLZA 3VBFA 4CDUB 4HOOA 3U4XA 1YFUA 3IT8A 4JC1A 2DWRA 3MFAA 5FYTA 5KC6A 5C9AC 2DUOA 2ZHNA 1BYHA 3JU9A 5JZGB 1DGRN 1LCLA 2F6BA 5GKAC 1WW5A 2NZ9A 1JZ4A 2W1QA 4XF3A 5EWSA 3ZFEB 3ZFFA 5KC5A 1PMHX 1W6OA 4HK8A 2P37A 4LE3A 1CPMA 1UMZA 3LDRA 4UFMA 1QJY1 1NY72 3ZXAC 3IKWA 2HWB2 2DCYA 2RDRA 4DXZA 5FKBA 3RI9A 1G9AA 1I1EA 1FT9A 1GNHA 2A3YA 2V4VA 3MV11 4YZ4A 4M3CE 3T0AA 4BIFA 4OHXA 1WBFA 4Q5OA 2GNDA 1GICA 3ZIXA 5A7WB 5IAXA 4L8QA 3VBUC 3VDDC 5C9AB 2RR11 4META 4O61A 1HQLA 3J7NA 5C3QA 4P5HA 4AYUA 1N3QA 5D1IA 2WBKA 3AK0A 2D97A 3IZOA 5JR2A 1HW5A 1XNDA 4GH4B 1UOGA 2O14A 3IDAA 3ETQA 2EAAA 5FZGA 4AQ2A 2W94A 2P34A 3ABZA 5HCBA 5T3NA 1GP5A 1TNFA 1AX0A 4UBGA 1RITA 1CAXA 4LJHA 4R4ZA 3AYDA 2D44A 2ZPXA 2E31A 3WG3A 4AVAA 4Q4Y1 2QQNA 5FP9A 1HXS3 1SLLA 3SEEA 5BXXA 4YM2A 3VDDB 2EIBA 3ILFA 4H2AA 2UWBA 1EAH2 3VBFC 3UT0A 3Q8FA 5I0SA 1AR83 3ZYRA 1UN1A 4XJZA 1YI7A 1ZRFA 2DYCA 4S2FA 4ASKA 1HRV3 2BQPA 4IETA 4XHXA 1W2OA 4AHZA 2QNKA 1XSQA 3ALQA 3S0MA 5CAZA 4NIDA 3ZFFC 5I0UA 5FPUA 1TVGA 5FPLA 2BNMA 4LITA 3HOBA 1HDKA 4YRDA 1H4GA 4AGVA 3ZPYA 4I30A 4P9IA 1Z0HA 2W1SA 3VBFB 3BTZA 1KRIA 1QJY3 3Q8EA 4J1WA 3THTA 2X29A 3MPBA 2FDGA 5DUUA 4XJUA 4B7EA 4Y1ZA 3O1PA 1O3RA 5JOYA 2HWD1 4CP9A 4YZ3A 3N7KA 4IE6A 2VUAA 3KQRA 3O0VA 1U5XA 1W6OB 2ZHKA 2B4KA 2N7GA 2RR13 1LOEA 3CBNA 3POFA 3ZXJA 4QHOA 5DAXA 3O1VA 1ZBE1 3IDCB 2BPA2 4JX0A 1JOBA 1VMHA 1YJKA 2JKBA 4FPCA 4CCEA 5F6KA 2H6CA 3CJIB 4DPNA 1AR73 5FZ6A 4CDQA 5D8AA 4MV2A 2VXJA 1V6MA 4QU2A 4Y1UA 1QNYA 4N90A 2X05A 1VBC1 3IMNA 5J48A 3WOGA 3PVEA 5L73A 1OLQA 4BQ3A 1DHKB 2HEYF 1NLSA 1WCKA 4WVWA 1UOFA 3GZUC 1PIV1 4XPVA 5CIRA 3AJYA 2H0VA 1I5PA 5FK8A 3VBSA 5EYYA 4GD4A 5IFTA 1V6LA 4YFWA 4DB5A 3KV6A 4OHVA 1JYXA 1UPSA 1IKQA 3JQWA 5FZOA 5FYHA 3WCSA 3E5QA 1CAXB 2RS13 4LHSA 5A6ZA 2GZWA 1NY71 3WP3A 1QQP2 4LHNA 5JPMB 2WWSA 2HWB1 2PQQA 4NO4A 4QD2A 2SBAA 4JZRA 3FLTA 5FFOC 4UOJA 1UAIA 3MIHA 2VQTA 1VR3A 5IATA 1H9WA 3VZMA 1G9FA 1ENQA 1YIFA 2WYSA 2WO2A 4ATFA 2VUCA 4MG2A 1Q8SA 4GA9A 2BBAA 3ACGA 5IVFA 4TLGA 4CDXA 1TZOA 3A0KA 3RWKX 3KT7A 4XIKA 4FI9A 1O7FA 2AGSA 3O14A 2UY9A 2QFEA 2DVDA 3A4UA 3A7QA 1DQ0A 4ITCA 3W21A 3AP7A 3WDYA 4QB2A 4CDQC 4JGZA 5B4XA 3I2IA 5A7QA 3TYJA 1UPIA 3W5NA 5F2SA 3NKGA 4FXKB 1M06G 4ISQA 3IDBB 1L7LA 3HQRA 3DECA 2AYHA 1UF2C 4XAAA 2CU5A 1NX9A 1F15A 2RV9A 3BVCA 2HWE2 1IOAA 3U11A 5BNOB 1W3XA 4H3WA 1C1FA 3VBSC 2B45X 2LUWA 1J58A 3LEIA 1AXZA 1MS0A 2PHRA 1S0IA 1R64A 3EHKA 4OQ9A 5JIUA 3WQ1A 3ZSJA 1PGL2 1PIV3 1REEA 2E32A 2QVSB 2VZ1A 3AP6A 4XFFA 2W1WA 3RI8A 3VKFC 4CDQB 4ES9A 2BUKA 5F5QA 3WX5A 3TEWA 3LDKA 4N53B 4RA0A 1CONA 4FPJA 3U75A 1CWPA 2D6MA 5GALA 4XMAA 5FUNA 3ME2A 5EXOA 5A1AA 2OQ7A 3NAPA 4KWUA 4I3PA 4JCKA 4YYOA 2JKXA 1NLQA 1UO9A 3VBSB 1XOYA 4JDMA 4LLFA 2LRPA 2QQUA 2DUPA 2VUDA 3BYWA 1D4VB 3DXTA 5FZOB 1UY2A 1Q8QA 1HV0A 1T6BX 3N9OA 3UETA 3ZYJB 4CDXC 1QOTA 1WCUA 1XU1A 2FHRA 3AVRA 3OGGA 2WQ4A 1DGLA 4UFHA 4GZ9A 4J1XA 3Q9OA 5KBFA 2EXHA 1BVVA 4BZ4A 5FYBA 5FO7B 2WWJA 4CPBA 4OI0A 3BN6A 4JGZC 1W8FA 3EJKA 4DINB 1WMDA 1CAVA 4UW5A 4Y4RA 4TN7A 1UU4A 1MQTB 2Y0IA 2XBO1 4BXSV 3VBUA 3JB4C 5B2GB 4W8JA 2J1EA 3MZHA 4L99A 2MNGA 5FJKA 2JENA 4CDXB 5E6HA 3DKQA 4KBBA 2V73A 5FYIA 1CQ9A 1K3IA 4ARYA 4PI2A 2OVUA 1X8EA 2R041 3M8LA 4FPLA 4NUBA 1V0AA 4IGOA 3H7JA 2Z79A 1ULFA 1JZ7A 5LEJA 1LAJA 2PA7A 2TUNA 2WSVA 4LXLA 4BDVB 2OS2A 2O0OA 1GMMA 1UX6A 2ET7A 2ORZA 2YDEA 3HT2A 4JGZB 1DQ5A 1S4CA 1QH7A 1OKQA 1W8UA 2R071 3MIGA 5H9SA 2IZWA 1H1MA 1DIWA 1YWKA 3MLJA 3UGFA 5A6QA 3X29B 3AZVA 5IVYA 2EAKA 4ZXEA 3WP5A 1HRI2 3SXWA 5AC92 4M01A 2MEV2 1GKBA 1TMF2 3NAPC 5A7OA 4P9YA 3HR9A 2WN2A 3NRUA 5L19A 3JBG3 5KXBA 4W65A 1HN0A 3R05A 4LHKA 1OF4A 5CFDC 1EPZA 3RJ2X 3T1LA 1UU6A 3BCWA 2G9ZA 3MW2A 3MIFA 2G1MA 1XSRA 2KR2A 2VW1A 3HNBM 4MGKE 1FNYA 2VOTA 5GZDA 2HWC1 3DF0A 4ZS3A 1RHI3 4CEWB 5CG9A 5K4LA 3KB5A 3IIIA 4W50A 3O1RA 1C8M2 1KS5A 3L9JT 1O8PA 4AEKA 3V65A 1NA1A 3I4IA 3NAPB 5BV6A 1GFF2 1J3QA 1O5LA 3ROUA 1NZCA 5BUVA 1CVNA 2XVLA 4RS5A 1WW7A 5CFDB 4IEPA 3L2YA 3FFZA 2P5BA 3H3LA 3KQ4B 4P14A 1NCRA 1S2EA 4X6QB 5DG2A 3WW4A 4F83A 1F8VA 5JI7A 2HWE1 1UZYA 2JDKA 4Y22A 3U07A 4MGSA 1ZRDA 3GZTB 4GWIA 1SFYA 2XBO3 4OLLA 1VBE2 3ATGA 5DAPA 1R082 4HPKB 3T0DA 4URTA 1PGL1 3VHPA 2DTYA 1SBDA 3DCQA 1V6JA 5F1RA 5DZEA 2R043 4BU2A 1C28A 3W59A 2OQ6A 5GZGA 2D6PA 1R1A2 2FCTA 2XJVA 3T2PA 2ZGSA 4ORFA 4XQ4A 1WMFA 5GZFA 4QPWA 2FD8A 1RMU2 1LENA 3KCXA 4UF0B 2R073 4MXVA 1DQ1A 1N1SA 4RHV2 1BZWA 5EIYB 4AHWA 1Z7S2 2JDHA 4LBJA 5EHDA 4LBLA 4FFGA 4B4PA 2WZPP 2XQXA 1AHSA 3WNMA 4CUBA 3JD72 4XDOA 2O8OA 1RUD3 5BNPA 3UK9A 4QKFA 1ULCA 2XB6C 1NQJA 4MGYE 3CMGA 1FOD2 3ACIA 3CNAA 1F31A 4U2AA 1UNBA 5E88A 1RB8G 3HVDA 5LASA 3WDUA 1NA1C 2CYFA 4QDSA 3T1MA 2QBXA 5FZEA 4FOQA 3KM5A 3C2UA 4IGQA 5FZ8A 4RS5C 2ZGNA 4QHZA 4GXLA 4LKFA 1VMJA 1NCRC 3RYPA 1PNGA 2WNOA 3DXUA 1F5FA 1WLWA 4J6GA 4IEXA 4Q8LA 1UXZA 1BK1A 5F5AA 4D7TA 2WSUA 3VHNA 4I0BA 4DMIA 3SEPA 3VD7A 2AENA 5F7UA 1BMV1 5FDBA 1O4YA 3NNJA 1NA1B 2R16A 5GLWA 3D5OA 2WFF2 3S7IA 2W0XA 2VZTA 3VD5A 2Y6KA 3JUUA 1YRZA 1OT5A 3DYOA 3AZWA 4X8NA 1S0GA 1NCRB 2EXKA 4KH9A 1V70A 4AQTA 3IPVB 4NR1A 2D3PA 1EYBA 4Y22B 4P9LA 3CL1A 3T3YA 4ASLA 4FCAA 3VN4A 5FZLA 1VBB1 3POYA 1NOVA 1COV2 1W9YA 2WZR2 4OHYA 1JZ8A 5BNPC 2R1BA 4FOVA 4PI0A 1FMD3 4I09A 4ZZ5A 2B42B 3M3EA 5C5TA 2IXKA 4KWJA 1EY2A 5F9TA 5HCAA 1UMHA 3HIFA 4PBPA 4YFZA 2VO5A 2EXJA 3E6DA 5EZWA 3GCXA 4A3XA 4F7ZA 4Z8BA 3J8F2 2A6ZA 2Y6FA 4K1ZA 4Q26A 2XVGA 2I07B 5DG1A 1QOOA 3VL9A 3N9MA 2JE8A 4CEYA 3DPRA 4Q4X2 5FZ0A 2PTMA 4QB6A 4JGYA 2D3RA 3WHTA 2YC0A 4CP0A 4EN8B 4M4PA 5BNPB 2YPDA 5FWEA 5FYCA 3WDTA 2D93A 2EALA 4AFBA 2ID4A 5FYMA 1OPMA 4EV0A 3ECQA 3WINE 3ZSKA 1RUNA 2HBUA 4QQLA 1K5MA 2ZEWA 1VAKA 4MLOA 5FMDA 1LEDA 1VBE1 1H6XA 3UKVA 3FN9A 1ULOA 2XHKA 1VPHA 2BFUL 3E6CC 5AVPA 1APNA 5ERLA 1DQ2A 1D2QA 1R1A1 4KU8A 3TNQA 2ZGRA 3V56A 2ZGQA 1LEMA 3S57A 4R9BA 2AEYA 3DV8A 2DCTA 2X5IC 4JHTA 2XLAA 4Q1RA 4YG6A 2JDMA 5DDJ1 3PHMA 3LKJA 1QJX1 2WC2A 1QXPA 3JD71 4P9JA 3WUCA 5AFBA 5FR3A 2JIGA 2A6XA 3GBGA 4AI1A 5TSWA 3PJYA 3AJZA 3WNKA 2KD7A 1LOAA 3I3BA 3J7LA 1VBB3 5I0TA 3LIGA 2CGNA 2E7AA 1FOD1 4BHPA 1QXRA 3LF7A 4LOTA 4AI9A 3E6BA 2X5IB 5DXDA 2BGPA 4A7ZA 2MPFA 4CEYC 1DQ4A 3DPRC 5LA0A 3OEAA 5ISLA 4TYSA 3H42B 4JGYC 3UKTA 1MEC2 4XABA 1K42A 3UL2A 3E5UA 1S1AA 3BALA 4KBZA 3DUIA 3N7JA 1IZ3A 1HJGA 1IPJA 1VAVA 5FPBA 4YW4A 3W9AA 1WBLA 4AEDA 3AMNA 4GMP3 4JAAA 1K5MC 3SKJE 2JEMA 1DFQA 3KWVA 1AL21 4XBLA 4CU7A 3D82A 1POV3 3B9IA 3FWEA 2XL9A 3ZYBA 5C8CA 1N1TA 5JMOA 2WFF1 2XKOA 2IFWA 4K40A 3ZXDA 4CEYB 3DPRB 1O6UA 4JGYB 3VD4A 2HLEA 2ZXQA 2Q1MA 1S0BA 3B69A 4CUAA 3WG1A 1YFXA 4I2OA 2VPVA 2CAVA 1U12A 1AR93 2RMU1 1K5MB 4TSVA 1UU5A 3ACFA 4ZONA 4PQQA 1REFA 3NL1A 5BPXA 2WZR1 4HT1T 2UU8A 4OMDA 1X36A 2Y34A 2YV8A 1PVXA 2VD7A 2YBKA 3DN7A 1UL9A 3IM0A 1PO21 2OZ6A 1BK0A 1OUSA 3SCHA 1EUUA 1GUIA 5DDJ3 1QJX3 3I59A 3D0SA 4KWKA 2BNNA 2Y0OA 3O7OA 3ENRA 1S0CA 2PHXA 2JG8A 3ZXKA 4XDQA 3T0BA 3ZKYA 4HETA 4OMCA 2LS6A 2VZ3A 3J8F1 4IE5A 3MIEA 4NPRA 1CX4A 4V2WA 1LOCA 2WT1A 3M3IA 4Q4X1 4I02A 3UNPA 4FOYA 3HD8B 2Y38A 3USUA 1JU3A 1RUI1 3WXPA 2H6BA 1CR7A 1OFNA 3OUJA 4B29A 4CP1A 4W6XA 4AEDC 1D0HA 1GP6A 5L7OA 3OSDA 2ORXA 3VDAA 1EV13 2Y6JA 3LA7A 1HXS2 1VALA 4IERA 2CGPA 2ZKNA 2VMCA 2VZVA 1AF9A 1I3HA 2QCSB 1AR82 4HMZA 2VMDA 2YHJA 4UYBA 5BY5A 1AJKA 2XDVA 5C8CC 2VZRA 1D7PM 1HRV2 3RQ0A 1AL23 2GC2A 1U0AA 4YW6A 4CU9A 2XJSA 1WGPA 5FY9A 2ZKLA 3AC0A 1OOPB 5FWJA 4AEDB 3IMMA 1IPSA 5EJ1B 2IC1A 2ZABA 2Q4SA 4YPJA 3AKPA 5FY0A 2EICA 4X8PA 1Q8VA 4R9DA 2QUOA 5JVVA 3OUIA 3BB6A 2DCKA 1QJEA 1RC6A 2RMU3 1QJY2 4RL7A 4XF1A 5C4WA 3RJRA 1NXD1 4FAGA 4N7IA 3N3HA 3GNEA 1BXHA 3FMGA 3KF3A 4IV3A 4Q0QA 5C8CB 1W99A 3WF1A 1ZRCA 3ZVXA 2ZJCA 2VOWA 4K1YA 1RIRA 1IHMA 2JG8C 3RZJA 1ZA4A 4PLNA 1PO23 1SMVA 2HEWF 2AEZA 1ZX5A 3I3QA 4XDPA 2RR12 3FLRA 3SHRA 3BI3A 2XUEA 5C7GA 4FFHA 3FX3A 3PUAA 3QH7A 5IK4A 2PLV1 3RDIA 3FJSA 5FMCA 4CCKA 3LE0A 1AR72 2ARAA 2XVKA 1L3JA 3VHOA 4AHYA 4XJ8A 4XF0A 1RUI3 1F9KA 3K75B 3ZFGC 2OKXA 4XUPA 4AAPA 4PIZA 1YNAA 3S6PA 4GMP0 1BMV2 4EE2A 2RM23 1A78A 1Y43B 3AKQA 2FZ1A 3LOBA 3KV9A 2NN8A 1A8MA 2YGLA 2XHNA 1JHNA 4LORA 3USUB 1SLIA 4D69A 4Q0SA 4XF9A 3SITA 1ZZ8A 1POV0 1E5RA 4NMIA 1ULPA 1CESA 3I3MA 3W20A 2RS12 1HB4A 1RUC3 3SH5A 1XE0A 4UFJA 4YGBA 4HVRA 3ZXLA 4AFDA 4QQHA 1JZ2A 1GNZA 2EIDA 4A7YA 5FIXA 2HH9A 3ZFGB 1RL3A 3NV1A 3TRSB 2YFZA 1QWRA 5C4WC 3TEZA 4GH4A 5LRSA 2XQRA 1OQDA 3O5SA 5FLJA 4IV3C 4FPOB 1LOBA 3GZEA 1IQAA 1FYUA 2NM1A 3GZAA 4LHLA 1UWWA 2VG9A 1NZIA 3H3UA 1LJ7A 4NIIA 1H8TA 2BOIA 2OUHA 1NLRA 1WMEA 3R0RA 1J3PA 4UBHA 3VDDA 3WLUA 4BH9A 4EZHA 5CBLA 3OG2A 1ZVFA 3K51A 3M3QA 3OGSA 2D98A 4LO8A 4JRLA 2QDRA 3J9SA 2ZX4A 5C4WB 2GU9A 3LB9A 4OI2A 3OOXA 1DDLA 4O65A 4ZPIA 1WW4A 4IV3B 3CZUA 4CCLA 5FZ3A 5L9VA 2PLV3 3MBWA 5BNNA 2I45A 1HXS1 3OEBA 4XMIA 1SCSA 1MPXA 1NG0A 3OBTA 4WVVA 3ZR6A 5GLZA 4UFKA 2BV4A 4BQ1A 4LA3A 3VD3A 4BISA 4LUMA 5FZHA 4LBNA 3KHCA 1JZ6A 1HRV1 1JN2P 5A3PA 1YEWA 3U37A 5LW9A 1QNWA 4FOWA 4ZU7A 1QHDA 5L9BA 2A5ZA 5I93A 4L11A 2VTXA 3EB7A 1TME1 3MF9A 4QAWA 3T2QA 1PIV2 2PAKA 4IGPA 1GWKA 2JIJA 1LESA 4YGEA 5FZAA 5IT6A 3WW2A 3VGIA 4AFCA 5IVEA 3H8OA 3UJQA 4GH4C 4LO6B 2BWCA 2PMWB 1A8DA 3OBRA 4UAPA 5IUQA 4CCMA 5FCCA 3ZR5A 5KHIA 4QM8A 5FYSA 3CJIA 1W9WA 3OPTA 3E5XA 4K6BA 1H8TC 3RS6A 4FT8A 2RS33 3NKTA 3E1F1 5IWFA 1JBCA 4W6YA 1LHNA 2ZCWA 3DGTA 4YW2A 4AI8A 1Y9GA 4JDNA 4U36A 5APAA 3WDVA 3POJA 3UKNA 4IEZA 1UYXA 1AXYA 3HNMA 4D8MA 4YVWA 2A75A 1SCRA 3AFKA 1AR71 4TWTA 5F5CA 4H7LA 3A22A 4RGAA 4JHZA 4DUXA 2A70A 3NV3A 4LBMA 5BNNC 1FAYA 1CZTA 1V9U3 1G9DA 3BODA 4XAEA 2DVBA 2K46A 1DZQA 2XJTA 3CDZB 3GYDA 4F3JA 1H8TB 3K48A 2VBPA 2R6QA 3ACLA 2YBSA 1RVF3 3NMBA 4IE4A 2C1FA 2R1DA 5I8TA 2BWAA 1Q3EA 4CCCA 2ZAAA 3BPSA 4BQYA 1OKOA 4H14A 5T5LA 4G9SB 3ZPOA 1JZ5A 4KG8A 1Q56A 1XB9A 4Y3OA 2Y33A 2ZGMA 2RS11 5T5PA 2ZX1A 5FLIA 1ENXA 4Z1VA 1WUVA 5BNNB 5FZDA 4CSWA 1TME3 2YGMA 4RGKA 2PHTA 4QT6A 4BLIA 1WA6X 3MW3A 4OHZA 4EJRA 3JBG2 4PLMA 2LTNA 1D2SA 1WLCA 2RG4A 4QDQA 1IS4A 5E8AA 2A3WA 5LY1A 3CJIC 3RWNA 1A34A 2V5DA 1G86A 4HONA 4KGQA 4XTMA 3OPZA 1J84A 3WNXA 4AI3A 3CEWA 2BOJA 4LE4A 1RHI2 2E53A 2UYAA 2ERFA 4O7XA 4WV8A 4AF9A 1MZ5A 3AKRA 3LZZA 1OUXA 4YVWC 2RDNA 5BNOA 3V0BA 4Q8KA 3R4DB 1IGOA 4LIUA 1OQ1A 2KA3A 5LCWL 1OMIA 4E2QA 5EYXA 3BIEA 3B00A 3OJBA 4KI5M 1UZZA 1YFYA 2FMDA 2PHFA 2BW8A 2Z69A 1HLCA 1V6IA 4NROA 1KGYA 1O8SA 2BYVE 4Q4W3 5GM0A 5JOZA 4AVSA 4PDWB 1QIQA 2CWMA 2W91A 4RD7A 3ITQA 5C5UA 4C0HA 2XBO2 4GQ7A 1K12A 1N3OA 1OLME 2ARCA 4XBNA 3K4DA 5EPAA 3D0JA 1SLBA 5CZKA 4AQ6A 2R042 4UXAA 1TE1B 4D94A 4FP2A 2YBPA 2W87A 5J36A 3HQXA 2VZPA 2R072 2A71A 4YW5A 1ULEA 3H8XA 3N7MA 3QCWA 4FO9A 3PLQA 2F4PA 4XUQA 2VU9A 3ZYFA 2VZUA 3KVBA 3FLPA 1KEXA 1DYOA 1GLHA 5FZ9A 1QJU1 1RUD2 1PO11 4RFT0 2AR6A 4RGGA 5A3LA 3F95A 5HXMA 1IS3A 1TNRA 4Z2WA 5A3MA 3A0NA 4EROA 1MQTA 2XMLA 4XF4A 5IVCA 1JI6A 1OVPA 3B01A 3PU8A 3R4UA 4D6SA 4CCJA 5FOBB 4Y20A 2HKXA 4BPZA 3V0AB 1O3QA 3NWKA 2HWC2 3POSA 4FVVA 5BNOC 1DGWX 3LFIA 3OCPA 2G9FA 4QX1A 3FHIB 5JI9A 1PGSA 3IN9A 3G7DA 4O9EA 5A32B 2ET1A 4O9GA 2DUQA 4N53A 2R0HA 3OF1A 2P17A 1M4WA 2AC1A 4MUVA 1HX6A 5F8PA 2Y8KA 2HYXA 3GJAA 5CNAA 5FREA 1SBFA 3SNMA 1BEV3 1A3KA 5LRRA 1NUKA 5JXGA 5FZBA 4LOSA 3V0BB 3N36A 2QQWA 5H9RA 1ND2A 5CKMA 2D6OX 3KV4A 3NJYA 3TBDA 3NJXA 1SQ4A 1W9SA 3LOIA 2PXJA 3RRDA 1YJLA 2ZEZA 1YYNA 1H2LA 3C3VA 5JUVA 3ZN4A 1S2BA 1FV3A 4ARXA 3KSCA 4CEWA 1H1IA 2J7MA 2CAUA 3OBAA 4W4ZA 2D43A 2K0GA 1W2AX 3JBG1 2QQMA 3PL0A 4M4RA 4YG3A 2D7FA 5JSOA 2J1TA 2B5HA 1AYM1 3DYPA 4FQ4A 3WNOA 5CKQA 1FMD2 1RJ8A 3MIBA 2BZDA 4B1MA 4E9KA 5A7SA 5CEHA 4XVHA 1RHI1 5CFDA 1MQTC 3KF5A 3POIA 4MSVA 1QJU3 1PO13 2FCVA 4MGTA 1HKDA 1YQ6A 2I74A 1Y9MA 3PU3A 4ZS2A 1LGBA 3H1WA 3AXDA 4HKLA 3HQUA 2D40A 1F35A 4HPKA 5KWRA 3GHMA 2WN3A 4CU8A 4N53C 3FHAA 1SEFA 1XE8A 2ZTNA 3JZVA 3VBRA 2Q8DA 3AKSA 4ZU4A 4YW1A 3VB9A 1K45A 5DUWA 4CA9A 4K8FA 1ASJ1 1H2MA 2Q8CA 3HAGA 5FY5A 4ZHNA 2VJXA 1VRH3 1JMUB 3I97A 4UF0A 3NNMA 4S2HA 4RQPB 5FBJA 4GJYA 3RYKA 4Y20B 3LPFA 5JXJA 1F4HA 2HEVF 1X9PA 1B35A 2BVBA 2WAOA 1VBD1 4QU1A 1JYNA 4IUGA 1AYN1 1ND2C 1YQCA 4QM9A 2WNEA 3I2FA 4XCAA 3LWCA 1UYZA 2YXSA 2WQ8A 4XE9A 3Q8BA 4LNVA 3T09A 4CEWC 1Y4WA 2VR4A 4AHXA 3WDXA 2K2SA 2X53S 5JOXA 4QXKA 1TG7A 4A3ZA 1UZWA 1KD7A 4MGZE 4NAMA 1UOJA 1RUD1 1XYNA 3GXUA 2E9QA 3HBZA 3LSDA 3E97A 1VB4A 1CJPA 2VM9A 3PURA 2W08A 1H8VA 4MGQA 4MHRA 1VBB2 5FUPA 1AYM3 3AZYA 1RGSA 1ND2B 2V4AA 2G19A 4B3NA 2XJUA 5KHHA 2A3XA 4YW7A 4DY5A 4E8DA 4QX3A 3QBQA 4ES8A 2J1VA 3KLSA 3ZXGA 3H50A 4B4QA 4IEUA 2Q1FA 1QGLA 5JR7B 1D4M1 3VBRC 4QPYA 4FPGA 5GLVA 1DBNA 3ZLIA 4XHBA 5B4NA 1MR5A 1CAUB 1JTZX 2VH9A 5FP8A 3OPWA 1JOJA 5KHGA 1UYYA 4AVCA 2VOKA 3GBWA 1PZ8A 5J37A 3IPVA 1EP0A 1GR3A 3EBRA 2I2SA 4QWNA 5CKNA 1SLCA 2VMGA 1B35C 1ASJ3 2FCUA 4YW3A 5K9YA 3VZOA 2QZ3A 4CYDA 4A6OA 5FXZA 2W5FA 3I8TA 1OBNA 1OVSA 1W6MA 3PMSA 4D7SA 3U0ZA 1OLRA 1VBD3 2ZMKA 3TEYA 1TEIA 3VBRB 5FYZA 1FPN1 2DU0A 3EQEA 1AYN3 1JOPA 4RSUA 1AR92 2VUJA 3OB8A 1VLNA 3LIHA 4AAXA 5T50A 4A44A 3AP4A 4Y5SA 1UQXA 3H0OA 2XPJA 1ZM1A 1O91A 4MH0E 3J7HA 3VBHB 3VZKA 1G8WA 1RUJ3 2TBVA 3TNPB 1FMD1 1WKYA 1B35B 3WHUA 3FL7A 1XYOA 2JB4A 3EYPA 4P9GA 3AMHA 2Y60A 2JDAA 5DDJ2 5FOJB 1QJX2 1PGW1 3THCA 1IKPA 4LO4B 4BQ4A 3L2HA 4XJ9A 4DUVA 3VBOA 4I01A 3NSTA 2HJIA 1O5UA 1ND3C 2WT0A 3J26N 4JKLA 3PVOA 2VVFA 3TWIA 3WVJA 3O1OA 3A21A 1ZZ7A 5A3NA 3KD4A 4QPIA 2H0BA 2GNTA 1V00A 4WZFA 5KXDA 2XONA 4R4XA 4COVA 2BGOA 3RGBA 3ZM8A 4NVPA 4XQWA 3WZ1A 1EV12 3H9AA 5C6CA 1UMIA 1D4M3 2IXCA 3MW4A 4HKOA 1SFNA 4YVSB 4CXXA 2WO7A 1OHFA 3B5LB 1GOFA 1HB2A 1RUE1 2Q5TA 4XC9A 5FJHA 1ND3B 4A6SA 1AL22 1QU0A 2OW4A 4LKSA 5LK5A 2E7TA 2TEPA 5C70A 3ZSLA 2QZ2A 1JH5A 1GOGA 2E63A 1DQ6A 2VULA 3ACHA 3KGZA 3SQOA 2DCZA 3MV01 5LATA 2GC3A 5A3UA 4LBQA 3S5QA 1POQA 1FPN3 5FZ7A 2X5IA 3FC0A 2RMU2 3MEPA 1T2XA 2GAUA 1ACCA 3FUQA 1XRUA 1ZZ6A 2OUJA 4XEZA 5LBCA 1GU3A 1N1VA 2KXLA 5F37A 4A41A 2Z4FA 4LT5A 3AMQA 1W6MB 2ZEYA 4EWDA 4HG6B 2WIIB 2GMPA 3VBOC 5IJRA 2Y6LA 1PO22 4DIQA 4MHUA 1I9RA 1JYCA 4EN0A 4SBVA 4XOGA 3MICA 1OSGA 1UOBA 2LM3A 5IVBA 3THDA 2WL1A 4QPIC 4JTNA 1LTEA 2V5YA 3BU7A 3C7GA 4OFGA 4Q4V3 3FE5A 4YG0A 5JIAA 1W2UA 4CP2A 4Y1XA 4AFAA 4TTGA 2QJVA 4GMP1 1RUI2 3DKWA 4OHWA 1N1YA 4Q29A 3VBOB 5FY8A 4UFIA 3APBA 1AVBA 2RM22 2EF6A 1POV1 5FV3A 1W39A 2PFWA 3MFCA 3KZ4C 4NPLA 4RYDA 4XETA 2XJPA 1RYYA 2D6KA 2OX0A 3P1IA 3WDWA 2FDIA 1JUIA 2ZACA 1FNZA 3OGVA 1JHJA 1QJZA 1RUE3 4QPIB 3I2HA 2O1QA 1E5HA 2HYKA 3O0WA 3ZYIB 3FZ3A 1P8JA 1RUC2 1AR91 2IXIA 2VCCA 5A1LA 1OH3A 3K3OA 2DBIA 5K0UB 5BYNA 3UESA 2EVXA 4LULA 3WV6A 1NYWA 4DXTA 1CIYA 2CL2A 2JDPA 3LCPA 2JWPA 4IXLA 5FYYA 2QE3A 5IHRA 1RXGA 4S2GA 5A6YA 1VJ2A 2V09A 4EZ4A 1W3VA 1XNBA 3T2OA 4BM8A 1ODMA 4LKDA 2VVDA 4ASMB 5CA6A 1D0GA 4F8AA 3QD6A 1PVC3 5IAVA 2UWAA 3D6EA 2K9ZA 3ORJA 1OLMA 4PF5A 4LBQB 3O12A 1J3RA 1LECA 3VDBA 5ACA1 2IFRA 2WDBA 4WVMA 3NJVA 4N43B 3AYEA 3AL6A 4P5YA 1ONAA 4FP3A 1EV11 2PLV2 4Q0UA 5LBFA 3PMEA 2W46A 5LEKA 1RINA 1ZREA 1OOPA 1W2NA 3K3NA 4CCOA 3S7EA 2XLFA 1L7RA 3HBKA 1JYTA 4UWDA 1S0FA 2BEOA 3UGGA 4BMEA 2A6VA 3H1YA 3C7HA 4OUEA 3GHNA 4K8RB 2Z42A 3RMXA 1QKQA 3AX4A 4GJZA 3B9CA 5IFPA 4WM7C 3BPZA 2QQLA 4LBQD 1VAMA 4KGGA 2WT2A 3FBYA 2ZEXA 2ZMNA 3U14A 3USSA 4B4RA 2JICA 2PHWA 3MUY1 1CPNA 1X9TA 1X82A 1OD3A 1C4RA 2WLPA 3WW1A 5JCTA 5FLHA 3RZKA 1F2NA 2RS51 1QEXA 5JXHA 2A7AA 3JQXA 2B39A 3NVCA 3AYCA 3BUCA 4AEMA 1ZRRA 2VXRA 1GYKA 1OQEA 2BGCA 2VZOA 3OGJA 4QXHA 1AZDA 2WAAA 4WM8A 5LZ6A 2RS32 2WNUC 4URAA 2GMEA 5L36A 4WM7B 4IEOA 5FY7A 1R093 1MS8A 2W95A 3K77A 4K3UA 2JJ6A 4NE9A 5JDBA 3PTRB 1SLTA 2YMZA 3I49A 2OPKA 2VZQA 2J42A 3JXSA 1KFUL 4NN0A 1AXKA 3AMPA 4HVOA 4YM1A 3TN91 4XBQA 2A73B 3MHZA 1U5YA 2OPWA 1S0EA 1AJOA 2YC4A 2D6NA 1V9U2 3DL3A 4YM3A 1Q43A 5ACA3 2VOVA 3OD0A 1OOPC 3C7EA 5FZFA 4P9WA 1BJQA 3M70A 2RM21 3H1MA 2WNUB 1RVF2 1RUG3 1SACA 2WRAA 1O4TA 2WZEA 4LTAA 2C9KA 1XNKA 1UW8A 1W8WA 1PK6A 3ILNA 5FRAA 3ZFGA 3LAGA 5JPNB 4FAHA 3MYXA 4AGRA 2E26A 3ON7A 5HXVA 5T54A 4J25A 4B1LA 4WVMB 1RUC1 5C3OA 2WABA 2FDKA 2YC2A 4Y4YA 4IEYA 1B09A 1T6GC 4QX5A 1UY3A 1TME2 4D0QA 2RDSA 4NIGA 4LKEA 3OUHA 1YFWA 4K20A 4DQAA 2R061 1RUF3 1US2A 3AYAA 3HJRA 5F5IA 1PZ9A 1PM7A 4IESA 5FPVA 1H4HA 2PYTA 3SH4A 5HCHA 1LGCA 1W04A 4BXFA 3GDBA 1NE6A 2AUYA 1LRHA 4WM8C 1IQDC 2RS53 1W03A 4GULA 2Y26A 3AM2A 1YIPA 2VNVA 3MLLA 1GQHA 2CV6A 4OI4A 5LA9A 2ZX3A 1W9TA 4BYYA 4KMQA 4XYXA 1C3HA 3ZIWA 5G04L 4A4AA 1IPKA 4KG0A 4IL7A 3ASIA 1SHWB 1LHOA 3URFA 4PJYA 5FTTC 1IG0A 2VBDA 2ZZJA 4YWAA 5A3OA 3KV5A 3ZN6A 4M00A 4XJWA 3P5BA 5GJ6A 2ARBA 1DF0A 5CISA 3CQOA 3TN93 4WM8B 4Q4W2 2ZX0A 1DP0A 3WF0A 3WNLA 5A1FA 1PK6C 3ZKUA 4CE8A 5FY4A 2VQ0A 1PMIA 1NCQA 5HI0A 2WNVB 2JDYA 1CZVA 4HN1A 2CHHA 2XJRA 1GSLA 2DBNA 2OXBA 3ZYGA 4HBNA 4Q0VA 4A42A 4AGGA 2VQUA 3SCGA 3ZXEA 1AX1A 4QDRA 1N3PA 2VW0A 1WD3A 2D6LX 4JTOA 1KJRA 3GJBA 5LBBA 4MX3A 5A7PA 1ZRIA 4IEWA 2P3IA 4M0HA 3CJXA 1PK6B 1ZZBA 1L7QA 2R063 1XJAA 2BERA 2RS31 4ZU5A 1W0OA 1QDCA 3I2OA 4BK4A 2BJSA 1QOSA 1ZBA3 2VCAA 4MXWA 3CIHA 1LNSA 1PZ7A 3VLBB 1QH6A 2ZGPA 2ATFA 1F4AA 5CVRA 1Y3TA 2C24A 2W39A 2LALA 1G9CA 3S5AA 2RVAA 1E5IA 1V9U1 2W92A 5HV0A 1G6NA 2JXAA 4OQ8A 3WQ0A 4WVZA 5FMOS 4GKXA 4YM0A 4K7JA 3BTXA 4TXWA 4UW4A 1DGRA 1E57A 1RVF1 2ES3A 3LEKA 3NJZA 2BTVC 1DU3D 1WWYA 4XUTA 2BDRA 2BP6A 3PTYA 4OZOA 1NCQC 1BEV2 1PM4A 1EUTA 1ZYBA 4BQ5A 1PX4A 2Y64A 4LBKA 4XCBA 1LHVA 1DGWA 4KWLA 4MO3M 4N9IA 4P02B 2NP0A 1CGPA 4QKBA 1FATA 1ZA7A 2GDFA 3RNSA 5F6LB 3ZN6B 2VECA 4Q27A 2YG0A 3RZLA 3PNAA 1U5ZA 1W8NA 2ARXA 2JDZA 4K9SA 4QPGA 4L0PA 1AR63 5JSRA 1NQDA 1ST8A 4UI9L 5A33A 1RJ7A 4BQ2A 1RUH1 3TOJA 4PF1A 4LK6A 4KQ7A 1GANA 2QQJA 3CU7A 1NCQB 2WR9A 3ILRA 5E89A 4E27A 5J3UA 4EN6B 3VZLA 4XFIA 1DLLA 3RFRA 2IUWA 2WUHA 1LB2A 4BB3A 3PIJA 1JYIA 1QJU2 1UY4A 1PO12 3CF6E 4G4FA 3PUQA 5A80A 3J7MA 1BLZA 5IW0A 1CIWA 4GB33 4PDWA 3WQBA 1I5ZA 1LOGA 4AG4A 2LROA 1KJLA 4P00B 4QQPA 2NPIA 4COZA 4IW3A 2VBBA 2QQKA 1Z78A 4AWDA 2DDUA 5H9QA 4CXWA 4Q4W1 3W5MA 4JQTA 4GIQA 1UY1A 3S30A 5JAXA 1VMFA 3KT4A 4MXWB 2WS93 2YZ4A 1VRH2 2QQIA 4BE3A 2XR4A 4Q1PA 3LA3A 1MZEA 3NW4A 1YQ8A 3P3NA 4NHMA 4QX7A 4Y5Z0 4AW7A 4C90A 2D3SA 3VD9A 4A2UA 4AVBA 5EJ3A 3B02A 2G4IA 2ZOEB 3MUZ1 3D3AA 1OXCA 1PNFA 3EXUA 4PLOA 2QTWB 4QPGC 1OI6A 4IE0A 4PIXA 3K4ZA 5F3IA 4IEVA 4DY3A 3KS7A 1H9PA 5DQ0A 3VHRA 3WG2A 1URXA 4R8HA 1JZ3A 1W28A 1BVP1 1UKRA 2LW8A 3IAPA 4XIOA 2F17A 4XQDA 5FKCA 3AMMA 4NIAA 4DNYA 3V0AA 4JV4A 1GZWA 3N35A 4XFCA 5DAVA 5A6XA 4HSLA 2YPJA 1VBA1 4NIHA 3Q8CA 1NT0A 4NOTA 1AYM2 1RUH3 3GALA 3VKLA 4C91A 5A32A 4FPHA 2P3JA 2XH6A 4GAZA 4N7UA 1ULGA 4L92A 2VMHA 4BIOA 4MADA 3ZX7A 4QPGB 2DTWA 4PDWC 4COUA 5IK8A 1GWMA 1UD1A 2XJQA 1RTVA 2W47A 3W58A 1V6NA 2Z5WA 1HN1A 3U10A 4EWAA 2VMFA 3ES4A 3FBMA 3GBFA 4HSJA 1KQRA 2XWJB 2ZX2A 4FPEA 4EWEA 5A33B 3WF3A 1UX7A 2B9UA 2XG3A 2VGDA 1XE7A 3LPGA 4PQ9A 5SV8A 1WA4A 3VZNA 4AZZA 4LIVA 5AVAA 4LPLA 2ZHMA 4INDA 2EIGA 2P6HA 4XTPA 5JMCA 2DVFA 4IEQA 3RZGA 3WW3A 2IVJA 1SDDB 4NPMA 3HWJA 4I0WB 5FXWA 1CX1A 1BEV1 3JB8A 4QX8A 4CCDA 1ASJ2 5DUVA 2W68A 3AFGA 2HWF1 3U4SA 2JG9A 3ZXFA 5IK5A 1J83A 2AH2A 5CU1A 4FSJA 5F3EA 3AKTA 2GC0A 2ZGKA 3ZFFB 1VBD2 3M4FA 4FFFA 5FYVA 2RHPA 4X6RB 1XNAA 2JX9A 1AYN2 5T52A 4DOUA 5M0TA 2X09A 3U78A 2D5HA 3POEA 1YC61 1XNCA 3T4HB 2OZJA 1KXGA 4QKDA 3LEGA 5E1RA 2CGOA 5FPAA 1JS9A 3O1MA 3KVAA 1RUJ2 1J1TA 2KM2A 2GP5A 1JYWA 4L9BA 4BCUA 1HB1A 4AE2A 1BBT1 3B94A 2FBEA 1ODNA 1VP6A 3MDPA 4H55A 4JDOA 4QGNA 3AP9A 1VBA3 2CNAA 1W8OA 4HANA 2W52A 4DRVA 4YGDA 1O3TA 4Q4Y3 1SBEA 2VY0A 4LEJA 4ISRA 2XOMA 1FV2A 2ENRA 2J1SA 2WO1A 4OYUA 2ADEA 5FMBA 3JCIA 1J59A 4RQPA 4LUKA 4DXSA 1C57A 3IWZA 1V6OA 1GZWB 1DZTA 4M3CF 5FZ1A 1Y9QA 1LHWA 5LA1A 2HBTA 5FP3A 3NNFA 4HLTA 2CTVA 2A6WA 3CLPA 5A70A 1G7YA 1D4M2 1US3A 2P1BA 2Q0AA 1JW6A 1VRH1 4S2DA 2VTFA 3WNPA 1E5SA 1YQ5A 3LD8A 3C7OA 4RN5A 1JU4A 2X10A 2G9GA 2JG9C 3B3QE 5F3GA 4XJAA 3MF6A 1OFSA 1MVQA 3WR0A 1DZRA 1SFPA 2NQYA 5F2WA 3J4UH 4YSFA 2WKKA 2HWF3 3B93A 3VDCA 1NKGA 3I7DA 4P9XA 2DVGA 3RSJA 4PIYA 4XUOA 4HN0A 2HWD3 2X8KA 3MPPG 5FZ4A 5LA2A 4AQSA 1O3SA 5FY1A 1CN1A 1W9FA 1XYPA 1VRBA 2QQOA 4LMFA 5C3RA 5KHKA 1FPN2 2GNMA 5D8AC 1ZBE3 1UY0A 1ENSA 1GOHA 2JD9A 4MGIE 5DAQA 5T5OA 5AC91 3BOWA 2JG9B 3BKZA 3SISA 4MOAA 1EAH1 4CP9B 2C26A 2RDQA 2YFUA 5FAXA 4K21A 5A7NA 4B8EA 1HQWA 1GNYA 1JYVA 2ETEA 1BBT3 1CAUA 3M2MA 2Q8EA 4LLOA 4NWVA 1PGW2 1VBC3 1UCXA 2CSGA 3O0XA 2GC1A 4G3YC 4KNCA 4RQPC 3WUDA 4YNIA 4XACA 3O1UA 3T30A 4E2GA 1W6QA 3FFQA 2ZGOA 5KXCA 4Q4V2 1VE0A 5D8AB 5CB7A 2BBVA 2ZS6B 4CVUA 2RE9A 1STMA 5CFCA 2OT7A 2C5DA 4JQRA 3PVNA 1TQ5A 2YU1A 5GZEA 4FPKA 1X8MA 4AXOA 2HWB3 2ADDA 2JDNA 1YI9A 4LR4A 2GH8A 3R4SA 1BQPA 1YQ2A 3KCYA 3VBHA 4NRQA 4SLIA 2AZ5A 4P08A 4C1XA 1RUE2 4EYUA 3I2GA 4UW3A 3O1TA 4QMAA 2VW2A 2FQPA 5AFEA 1HV1A 1KDMA 4CTEA 4ZZ8A 3H3ZA 3I3DA 2YROA 1GV9A
chains in the Genus database with same CATH topology
1CAWA 1JUHA 2R30A 3R6SA 1RUJ1 1MVEA 4QGMA 3LGRA 4YZ5A 2FMYA 2DV9A 1ZZCA 3I54A 2ZHLA 2A6YA 4BOWA 5JWPA 3LSEA 1BKZA 3ZYPA 1QY4A 3WP4A 2R49A 3ES1A 5H9PA 1VIWB 3BTAA 1F5JA 1PVC2 4R9AA 1EAH3 2GN3A 3GF6A 4YVSA 4WBBA 3ELNA 3M7AA 4R9CA 1LHUA 5J96B 2WINB 5DUXA 3VZJA 2E7QA 1ND3A 3KCCA 2WFPA 4H7MA 1QQP1 1QF3A 4FBFA 5CFCC 1N47A 5C33A 2B7YA 3UV9A 1J1LA 1MS1A 2GH2A 2B46X 2XUMA 1S0JA 3RMYA 3VBHC 2OA2A 4E4SA 1WD4A 4PBOA 4COYA 1W6QB 2DF7A 4B7KA 5CADA 1XQNA 1PHMA 3ZMNA 1EPWA 1MS3A 1W6PA 2UYBA 4NWWA 5FPXA 3IIAA 5CFCB 4Q0PA 2VNOA 1V6KA 4Z82A 3ZO0B 5FBZA 1DYKA 2DURA 3I2DA 1ULDA 2YY1A 3VUOA 4I3GA 4XXAA 3QOPA 5HCFA 1JXNA 2NYYA 4DRRA 2PAMA 2D5FA 2ILMA 1C5HA 4YVSC 1R092 3WT3A 2WJSA 3V64A 3N4MA 1CAWB 4Q4V1 4GKYA 1S2KA 1X50A 1H30A 1CAVB 1IS5A 1WCSA 3QACA 4QQOA 2WQZC 4LO5B 4CDWA 1DYPA 3VBUB 5ACA2 2PN5A 1QQP3 1H0BA 5ABJA 5C8WA 1RUG2 5K0UA 1WLTA 2Q1ZB 2YUEA 3M1HA 3ZSEA 3VV1A 4E4ZA 2BNOA 4BMBA 2IXJA 1U5IA 4R52A 4AI0A 5BNQA 1C1LA 1FI2A 2HWC3 1X33A 1OA2A 4QHBA 3H7YA 1RUF2 4JRAA 5J09A 1XU2A 3ZDSA 5CG8A 2GALA 2WLQA 4AFMA 2RS52 4N43A 2MHFA 1PVC1 4M3CA 5E16A 1W6PB 2ZBJA 3ZMOA 4YZ2A 2TNFA 2HWE3 4FQZA 5JSPA 1A6CA 3VKOA 4M0NA 3G6JB 2E6VA 3P3PA 5HBAA 2XKPA 4RS5B 4BA6A 3HT1A 4CDWC 1HRI1 3TB0A 4DS0A 5AC91 4LA2A 2MEV1 5FPZA 1TMF1 4ONUA 4AVVA 3TN92 5KXEA 1YCIA 3H8UA 5ABJC 5K0UC 4EN9B 1KITA 3QH6A 2WA4A 1H1AA 1WW6A 2VQAA 1I6XA 4CRQA 1AUYA 1WCDJ 3FUOA 1YLLA 2GMMA 2ZMLA 5JLVA 3SCFA 3WD5A 3WCRA 1UIJA 4I0AA 1WLDA 5I8SA 4YARA 1FX5A 1C8M1 1LU2A 1Q8OA 2C9AA 4FXGB 4CDWB 4GALA 2OIIA 3RG0A 5FQ0A 3RYRA 3ST7A 2UY8A 1GZ9A 4WM7A 4FTEA 3PJQA 5ABJB 2YYOA 4Y1YA 3EO6A 2PAEA 1ALYA 4HK9A 3OYWA 1R1ZA 2R062 4COWA 2VNGA 4N43C 1C8NA 4OVEA 3AZXA 3VL8A 1ENRA 4NHKA 1DG6A 5IK7A 1ZBA2 1R091 2JE7A 1R081 1OD5A 4OI1A 3THPA 1NXMA 1S0DA 2WNUA 3M3OA 4DZGA 3B7MA 2QDNA 1OA3A 3OY8A 2O8QA 4Y1VA 4OUMA 1REDA 1RMU1 4XILA 3BIWE 4DFSA 4RHV1 1Z7S1 1RUG1 2EXIA 4NHLA 1HRI3 2R32A 4M3CB 4PCRA 5AC93 2MEV3 2JD4A 3AP5A 1TMF3 2ZA9A 4BLJA 1CJDA 4XFAA 4AI2A 1C5IA 3RPQA 4HVQA 4AK3A 1QDOA 5EV7A 1IS6A 3WP6A 2XWBB 3OD4A 4Z92B 3UJOA 5GLUA 4Z07A 2B8MA 3WG4A 1AR62 4KU7A 1Q5OA 2VNRA 1ZZ9A 2DFBA 1RUF1 1C8M3 2UWCA 4FPFA 5T55A 1G9BA 4ATEA 2R0FA 1MS5A 1BCXA 3T2TA 1LR5A 3NV4A 4MZUA 4UW6A 1W6NA 2OYZA 2IXLA 4C1WA 2XL7A 4OUSA 4TLFA 3SLIA 2ZAHA 4QGLA 5FQ0B 4GB32 4FPYA 4L2NA 1GQGA 1VBE3 3MI8A 2VVEA 4IV1A 1R083 3WY6A 2WNVA 5FMOL 3OYWB 4ZKTB 5FO8B 2P2KA 4YZ1A 2Z2SB 1R1A3 1MS9A 1COV1 1RMU3 2WS92 4MYEA 5T5JA 4RHV3 2CWSA 1Z7S3 4LBOA 4JVAA 3D4KA 4OZXA 1KS4A 5I8YA 3JD73 4AEJA 3OY8B 4WZCA 4FTSA 2ZZQA 5GZCA 1LGNA 4XXPA 1S55A 1YO8A 3NV2A 1FOD3 3CO2A 4XFBA 2EA7A 5J7MA 1UKGA 2RJKA 5I91A 2C0ZA 1KFXL 2DCJA 3POWA 1HIXA 1LU1A 1LOFA 2JECA 1SDWA 5DZGA 1RUH2 1ZBA1 4Y24A 4MVTA 1UIKA 2DU1A 1YXWA 2ZGLA 3MIDA 3OTFA 1SLAA 2AREA 3KMHA 1QXJA 2WA3A 3N7LA 1YHFA 3IBMA 4IV1C 4KL1A 3SMHA 5K8SA 2WNVC 3NO8A 2BFUS 2VMIA 5LK7B 1KDKA 2WFF3 5SV5A 1H2NA 3QLQA 1X7NA 1Y7BA 1NE4A 1W6NB 1LKNA 1LODA 4BWOA 4IQPA 4GWMA 1RUOA 3MLKA 2E51A 2JE9A 1COV3 2P3KA 2WZR3 4RR3A 4V1PA 4IV1B 1MACA 4OULA 1AL0G 2QKDA 4XFGA 1AR61 2ZGTA 4LO7A 2IXHA 3HN1A 1W0PA 1HQNA 4CDUA 1MEC1 1O4ZA 2GNBA 4Y26A 2DFCA 3J8F3 1MZ6A 2UURA 5L7OC 2SLIA 1MS4A 4Q4X3 5JZGA 2PHLA 3ZSMA 1LOFC 4XW3A 3I59B 2FZ2A 2GSYA 1ZNPA 3HMYA 2PELA 2JG8B 3ZFEA 1H2KA 1Q8PA 2NMOA 2ZGUA 1VBA2 2IWGB 4HFSA 5KHJA 4GB31 4Q4Y2 5J98B 3TAYA 4QQ2A 2XLGA 4TZDA 4EN7B 1AX2A 1LULA 3ZN5A 4W6WA 1CD3G 2QQPA 5C9AA 3INAA 2Q8OA 5L7OB 5JOWA 4Q2FA 2PHDA 2WS91 3KGLA 1FXZA 1GBGA 2RJLA 5GLTA 2CY6A 3D8CA 3VKMA 4D3WA 3RZZA 4RR3C 5K7PA 4ZXKA 2GN7A 3M3CA 4XFHA 5DZFA 4YGCA 2BVVA 3PVBB 3KT1A 3AXEA 2NMNA 2HWF2 2Q30A 1OA4A 4HZFA 1QMJA 1GZCA 4L97A 2HWD2 3WQ7A 4C0BA 1YUDA 4CDUC 3VKNA 1VB2A 2NLRA 3LA2A 3AB0A 3BOPA 4HKWA 4CZSA 2XGXA 4GWNA 5JZGC 4N9HA 1ZBE2 4E4DX 1MEC3 3MGUA 4RR3B 5FO9B 5I0RA 3IDEA 1MZFA 5EFUA 1XXNA 2DVAA 3ZFEC 4AVTA 4D7YA 3AZZA 4XZPA 1AR81 4HL0A 4A7KA 3SH3A 1BBT2 2PHUA 1OPOA 1VBC2 4YLZA 2VOXA 3VBFA 4CDUB 3U4XA 1YFUA 3IT8A 4JC1A 2DWRA 3MFAA 5KC6A 5C9AC 2DUOA 2ZHNA 1BYHA 3JU9A 5JZGB 1DGRN 1LCLA 2F6BA 5GKAC 1WW5A 2NZ9A 4XF3A 5EWSA 3ZFEB 3ZFFA 5KC5A 1W6OA 4HK8A 2P37A 4LE3A 1CPMA 1UMZA 1QJY1 1NY72 3ZXAC 3IKWA 2DCYA 2HWB2 4DXZA 3RI9A 1G9AA 1I1EA 1FT9A 1GNHA 2A3YA 4YZ4A 4BIFA 4M3CE 4OHXA 1WBFA 3ZIXA 2GNDA 1GICA 4L8QA 5C9AB 3VDDC 2RR11 4META 1HQLA 4P5HA 4AYUA 1N3QA 5D1IA 3AK0A 2D97A 1HW5A 1XNDA 4GH4B 3ETQA 2EAAA 4AQ2A 2P34A 5HCBA 5T3NA 1TNFA 1AX0A 4UBGA 1RITA 1CAXA 4R4ZA 3AYDA 2D44A 2ZPXA 4AVAA 3WG3A 4Q4Y1 3VDDB 1HXS3 1SLLA 5BXXA 4YM2A 3ILFA 2UWBA 1EAH2 3VBFC 5I0SA 1AR83 3ZYRA 1UN1A 4XJZA 1YI7A 1ZRFA 2DYCA 4S2FA 1HRV3 2BQPA 4IETA 4XHXA 4AHZA 2QNKA 3ALQA 3S0MA 5CAZA 3ZFFC 5I0UA 2BNMA 1HDKA 4YRDA 1H4GA 4AGVA 3ZPYA 4I30A 4P9IA 1Z0HA 3VBFB 1KRIA 1QJY3 4J1WA 3THTA 2X29A 3MPBA 5DUUA 4XJUA 4B7EA 4Y1ZA 1O3RA 5JOYA 2HWD1 4YZ3A 3N7KA 2VUAA 3KQRA 3O0VA 1U5XA 1W6OB 2ZHKA 2N7GA 2RR13 3ZXJA 1LOEA 1ZBE1 3IDCB 1YJKA 2JKBA 4FPCA 5F6KA 2H6CA 3CJIB 4DPNA 1AR73 4CDQA 5D8AA 4MV2A 1V6MA 4QU2A 4Y1UA 1QNYA 4N90A 1VBC1 3IMNA 5J48A 3WOGA 3PVEA 5L73A 1OLQA 1DHKB 2HEYF 1NLSA 1WCKA 4WVWA 3GZUC 4XPVA 1PIV1 5CIRA 4YVWB 3AJYA 2H0VA 3VBSA 5EYYA 1V6LA 4YFWA 4DB5A 4OHVA 1UPSA 1IKQA 3JQWA 3WCSA 3E5QA 1CAXB 2RS13 2GZWA 1NY71 3WP3A 1QQP2 4LHNA 5JPMB 2WWSA 2HWB1 2PQQA 4NO4A 4QD2A 2SBAA 5FFOC 3FLTA 1UAIA 3MIHA 1VR3A 1H9WA 3VZMA 1G9FA 1ENQA 1YIFA 4ATFA 1Q8SA 4GA9A 4CDXA 3A0KA 3KT7A 4XIKA 1O7FA 2AGSA 3O14A 2UY9A 2QFEA 2DVDA 3A4UA 1DQ0A 4ITCA 3WDYA 3AP7A 4CDQC 4JGZA 3TYJA 1UPIA 3NKGA 4FXKB 1M06G 4ISQA 3IDBB 2AYHA 1UF2C 2HWE2 1IOAA 3U11A 5BNOB 4H3WA 1C1FA 3VBSC 2B45X 2LUWA 1J58A 1AXZA 1MS0A 2PHRA 1S0IA 3EHKA 5JIUA 3WQ1A 3ZSJA 1PGL2 1PIV3 1REEA 3AP6A 2QVSB 4XFFA 3VKFC 4CDQB 3RI8A 4ES9A 2BUKA 5F5QA 3WX5A 4RA0A 1CONA 4FPJA 2D6MA 5GALA 4XMAA 3ME2A 5EXOA 3NAPA 4I3PA 4JCKA 4YYOA 3VBSB 4JDMA 4LLFA 2DUPA 1D4VB 1Q8QA 1HV0A 3ZYJB 4CDXC 1QOTA 1XU1A 2FHRA 3OGGA 2WQ4A 1DGLA 4J1XA 3Q9OA 5KBFA 2EXHA 1BVVA 4BZ4A 5FO7B 4OI0A 4JGZC 3EJKA 4DINB 1WMDA 1CAVA 4UW5A 1UU4A 1MQTB 2Y0IA 2XBO1 3VBUA 3JB4C 5B2GB 3MZHA 4L99A 2MNGA 2JENA 4CDXB 4KBBA 2V73A 1CQ9A 1BMV2 2OVUA 1X8EA 2R041 3M8LA 4FPLA 3H7JA 2Z79A 1ULFA 5LEJA 2PA7A 2TUNA 2WSVA 2O0OA 2ET7A 1UX6A 3HT2A 4N53B 2YDEA 4JGZB 1DQ5A 2R071 1QH7A 1OKQA 3MIGA 5H9SA 2IZWA 1H1MA 1DIWA 1YWKA 3MLJA 3X29B 3AZVA 2EAKA 3WP5A 1HRI2 3SXWA 5AC92 4M01A 2MEV2 1GKBA 1TMF2 3NAPC 4P9YA 3HR9A 5L19A 3JBG3 5KXBA 4W65A 3R05A 4LHKA 5CFDC 1EPZA 3RJ2X 3T1LA 1UU6A 3BCWA 3MW2A 3MIFA 2VW1A 4MGKE 1FNYA 5GZDA 2HWC1 3DF0A 1RHI3 4CEWB 5CG9A 3KB5A 1C8M2 1KS5A 3L9JT 4AEKA 3V65A 1NA1A 3I4IA 3NAPB 5BV6A 1GFF2 1J3QA 1O5LA 3ROUA 1NZCA 5BUVA 1CVNA 2XVLA 4RS5A 1WW7A 5CFDB 4IEPA 3L2YA 3FFZA 4P14A 3VBUC 4X6QB 4F83A 1NCRA 5DG2A 3WW4A 5KXCA 1F8VA 5JI7A 2HWE1 1UZYA 4Y22A 3U07A 1ZRDA 3GZTB 1SFYA 2XBO3 4OLLA 1VBE2 3ATGA 1R082 4HPKB 4URTA 1PGL1 3VHPA 2DTYA 1SBDA 5F1RA 1V6JA 5DZEA 2R043 1C28A 3W59A 5GZGA 2D6PA 1R1A2 2XJVA 2ZGSA 4ORFA 4XQ4A 1WMFA 5GZFA 1RMU2 1LENA 3KCXA 2R073 4MXVA 1DQ1A 1N1SA 4RHV2 1BZWA 4AHWA 1Z7S2 4LBJA 4LBLA 4B4PA 2WZPP 1AHSA 3JD72 2O8OA 1RUD3 5BNPA 3UK9A 1ULCA 2XB6C 1NQJA 4MGYE 1FOD2 3CNAA 1F31A 4U2AA 5E88A 1RB8G 3WDUA 1NA1C 2CYFA 3T1MA 4FOQA 3KM5A 3C2UA 4RS5C 2ZGNA 4GXLA 1NCRC 3RYPA 1PNGA 4J6GA 1F5FA 1WLWA 4Q8LA 4IEXA 1BK1A 4D7TA 2WSUA 3VHNA 4I0BA 4DMIA 1BMV1 2AENA 5FDBA 1O4YA 1NA1B 2R16A 5GLWA 3D5OA 2WFF2 3S7IA 2W0XA 3JUUA 1YRZA 3AZWA 4X8NA 1S0GA 1NCRB 2EXKA 4KH9A 1V70A 4AQTA 3IPVB 4NR1A 2D3PA 1EYBA 4Y22B 4P9LA 3CL1A 4ASLA 4FCAA 3VN4A 1VBB1 3POYA 1NOVA 1COV2 2WZR2 4OHYA 5BNPC 2R1BA 4FOVA 1FMD3 4I09A 2B42B 3M3EA 2IXKA 4KWJA 1EY2A 5F9TA 5HCAA 3HIFA 4PBPA 4YFZA 2EXJA 3E6DA 5EZWA 4A3XA 4F7ZA 4Z8BA 3J8F2 2A6ZA 4K1ZA 5DG1A 4Q26A 2XVGA 2I07B 3VL9A 1QOOA 4CEYA 3DPRA 4Q4X2 2PTMA 4JGYA 2D3RA 3WHTA 2YC0A 4CP0A 4EN8B 5BNPB 3WDTA 2D93A 2EALA 4AFBA 4EV0A 1OPMA 3ECQA 3WINE 3ZSKA 1RUNA 4QQLA 1K5MA 1VAKA 4MLOA 1LEDA 1VBE1 3UKVA 2XHKA 2BFUL 3E6CC 5AVPA 1APNA 1DQ2A 1D2QA 1R1A1 4KU8A 3TNQA 2ZGRA 3V56A 2ZGQA 1LEMA 4R9BA 3DV8A 2DCTA 2X5IC 2XLAA 4Q1RA 4YG6A 5DDJ1 3PHMA 3LKJA 1QJX1 2WC2A 1QXPA 3JD71 4P9JA 3WUCA 5AFBA 2A6XA 3GBGA 4AI1A 5TSWA 3PJYA 3AJZA 1LOAA 1VBB3 5I0TA 2CGNA 2E7AA 1FOD1 4BHPA 1QXRA 3E6BA 2X5IB 5DXDA 4A7ZA 2MPFA 4CEYC 1DQ4A 3DPRC 4TYSA 4JGYC 3UKTA 1MEC2 3UL2A 3E5UA 1S1AA 3BALA 3DUIA 3N7JA 1IZ3A 3W9AA 1IPJA 1VAVA 4AEDA 4YW4A 1WBLA 3AMNA 4GMP3 4JAAA 1K5MC 2JEMA 1DFQA 1AL21 4XBLA 3D82A 1POV3 3B9IA 3FWEA 2XL9A 5C8CA 1N1TA 2WFF1 2XKOA 2IFWA 4K40A 3ZXDA 4CEYB 3DPRB 4JGYB 2Q1MA 1S0BA 3B69A 4I2OA 3WG1A 1YFXA 2VPVA 2CAVA 1U12A 1AR93 2RMU1 1K5MB 4TSVA 1UU5A 4E2SA 1REFA 3NL1A 5BPXA 2WZR1 4HT1T 2UU8A 1X36A 2YV8A 1PVXA 3DN7A 1UL9A 3IM0A 1PO21 2OZ6A 3SCHA 5DDJ3 1QJX3 3I59A 3D0SA 4KWKA 2BNNA 2Y0OA 3O7OA 3ENRA 1S0CA 2PHXA 2JG8A 3ZXKA 4XDQA 4HETA 3J8F1 3MIEA 4NPRA 1CX4A 1LOCA 2WT1A 3M3IA 4Q4X1 4I02A 4FOYA 3HD8B 2Y38A 3USUA 1RUI1 3WXPA 2H6BA 1CR7A 1OFNA 4B29A 4CP1A 4W6XA 4AEDC 1D0HA 5L7OA 1EV13 3LA7A 1HXS2 1VALA 4IERA 2CGPA 2ZKNA 1AF9A 1I3HA 2QCSB 1AR82 4HMZA 2YHJA 5BY5A 1AJKA 5C8CC 1HRV2 3RQ0A 1AL23 2GC2A 1U0AA 2XJSA 1WGPA 2ZKLA 1OOPB 4AEDB 2IC1A 2ZABA 2Q4SA 3AKPA 4X8PA 1Q8VA 4R9DA 2QUOA 5JVVA 3BB6A 2DCKA 4RL7A 2RMU3 1RC6A 1QJY2 4XF1A 5C4WA 3RJRA 1NXD1 4FAGA 4N7IA 3N3HA 3GNEA 1BXHA 3FMGA 4IV3A 4Q0QA 5C8CB 1ZRCA 3ZVXA 2ZJCA 2VOWA 4K1YA 1RIRA 1IHMA 2JG8C 1ZA4A 4PLNA 1PO23 1SMVA 2HEWF 1ZX5A 3SHRA 2RR12 3FLRA 3FX3A 3QH7A 5IK4A 2PLV1 3RDIA 3FJSA 1AR72 2XVKA 1L3JA 3VHOA 4AHYA 4XJ8A 4XF0A 1RUI3 1F9KA 3ZFGC 4PIZA 1YNAA 3S6PA 4GMP0 2RM23 1A78A 1Y43B 3AKQA 2FZ1A 3LOBA 2NN8A 1A8MA 2YGLA 1JHNA 4D69A 3USUB 1SLIA 4Q0SA 4XF9A 3SITA 1ZZ8A 1POV0 1CESA 2RS12 1RUC3 3SH5A 3ZXLA 4AFDA 4YGBA 4HVRA 4QQHA 1GNZA 4A7YA 3ZFGB 1RL3A 3NV1A 3TRSB 1QWRA 5C4WC 4GH4A 5LRSA 1OQDA 5FLJA 4IV3C 4FPOB 1LOBA 1IQAA 1FYUA 2NM1A 3GZAA 4LHLA 2VG9A 3H3UA 1LJ7A 1H8TA 2OUHA 1NLRA 1WMEA 3R0RA 1J3PA 4UBHA 3VDDA 3WLUA 4BH9A 5CBLA 1ZVFA 3K51A 3M3QA 2D98A 4LO8A 4JRLA 2QDRA 3J9SA 2ZX4A 5C4WB 2GU9A 3LB9A 4OI2A 1DDLA 1WW4A 4IV3B 2PLV3 5BNNA 2I45A 1HXS1 4XMIA 1SCSA 1NG0A 3OBTA 4WVVA 5GLZA 4BQ1A 4LA3A 4LUMA 4LBNA 1HRV1 1JN2P 1QNWA 4FOWA 4ZU7A 1QHDA 5I93A 2A5ZA 4L11A 3MF9A 1TME1 1PIV2 2PAKA 1LESA 4YGEA 5IT6A 3WW2A 3VGIA 4AFCA 3UJQA 4GH4C 4LO6B 2BWCA 3OBRA 1A8DA 5IUQA 5FCCA 5KHIA 4QM8A 3CJIA 3E5XA 4K6BA 1H8TC 3RS6A 4FT8A 2RS33 3NKTA 1JBCA 4W6YA 1LHNA 2ZCWA 3DGTA 4YW2A 4AI8A 4JDNA 4U36A 3WDVA 3UKNA 4IEZA 1AXYA 4YVWA 2A75A 1SCRA 3AFKA 1AR71 4TWTA 4H7LA 4RGAA 2A70A 3NV3A 4LBMA 5BNNC 1FAYA 1V9U3 1G9DA 3BODA 2DVBA 2XJTA 1DZQA 3GYDA 4F3JA 1H8TB 3K48A 2R6QA 3ACLA 1RVF3 2C1FA 2R1DA 5I8TA 2BWAA 1Q3EA 2ZAAA 4H14A 5T5LA 4G9SB 4KG8A 1Q56A 2ZGMA 2RS11 5T5PA 2ZX1A 5FLIA 1ENXA 4Z1VA 1WUVA 5BNNB 1TME3 2YGMA 2PHTA 4QT6A 4BLIA 3MW3A 4OHZA 4EJRA 3JBG2 4PLMA 2LTNA 1D2SA 1WLCA 5E8AA 1IS4A 2A3WA 3CJIC 3RWNA 1G86A 4KGQA 4XTMA 3OPZA 3WNXA 4AI3A 3CEWA 4LE4A 1RHI2 2E53A 2UYAA 2ERFA 4WV8A 4AF9A 1MZ5A 3AKRA 3LZZA 4YVWC 5BNOA 3V0BA 4Q8KA 3R4DB 1IGOA 1OQ1A 2KA3A 1OMIA 4E2QA 5EYXA 3B00A 3OJBA 1UZZA 1YFYA 2FMDA 2PHFA 2BW8A 2Z69A 1HLCA 1V6IA 2BYVE 4Q4W3 5JOZA 5GM0A 4AVSA 4PDWB 2CWMA 4RD7A 4C0HA 2XBO2 4GQ7A 1N3OA 4XBNA 3D0JA 1SLBA 4AQ6A 2R042 4UXAA 1TE1B 4D94A 4FP2A 5J36A 3HQXA 2R072 2A71A 4YW5A 1ULEA 3N7MA 3QCWA 4FO9A 3PLQA 2F4PA 2VU9A 3FLPA 1GLHA 1QJU1 1RUD2 1PO11 4RFT0 2AR6A 4RGGA 5A3LA 1IS3A 1TNRA 4Z2WA 5A3MA 3A0NA 4EROA 1MQTA 4XF4A 3B01A 5FOBB 3R4UA 3V0AB 4Y20A 2HKXA 4BPZA 1O3QA 3NWKA 2HWC2 3POSA 4FVVA 5BNOC 1DGWX 3OCPA 2G9FA 3FHIB 5JI9A 1PGSA 3IN9A 3G7DA 4O9EA 5A32B 2ET1A 4O9GA 2DUQA 4N53A 2R0HA 3OF1A 2P17A 1M4WA 4MUVA 1HX6A 5CNAA 5FREA 1SBFA 3SNMA 1BEV3 1A3KA 5LRRA 3V0BB 3N36A 5H9RA 1ND2A 2D6OX 3TBDA 1SQ4A 3LOIA 3RRDA 1YJLA 1YYNA 1H2LA 3C3VA 3ZN4A 1S2BA 1FV3A 3KSCA 4CEWA 1H1IA 2CAUA 2D43A 2K0GA 3JBG1 5JSOA 4YG3A 2D7FA 2B5HA 1AYM1 4FQ4A 1FMD2 1RJ8A 3MIBA 4E9KA 1RHI1 5CFDA 1MQTC 4MSVA 1QJU3 1PO13 1HKDA 2I74A 1LGBA 3H1WA 3AXDA 4HKLA 2D40A 4HPKA 5KWRA 3GHMA 4N53C 1SEFA 1XE8A 2ZTNA 3JZVA 3VBRA 3AKSA 4ZU4A 4YW1A 5DUWA 4K8FA 1ASJ1 1H2MA 3HAGA 1VRH3 3RYKA 4S2HA 4RQPB 4Y20B 2HEVF 1B35A 2BVBA 1VBD1 1AYN1 1ND2C 4QM9A 2WNEA 3LWCA 2YXSA 4XE9A 4LNVA 4CEWC 4AHXA 3WDXA 2K2SA 2X53S 5JOXA 4QXKA 1KD7A 4MGZE 1RUD1 1XYNA 3HBZA 2E9QA 3LSDA 3E97A 1VB4A 1CJPA 2W08A 1H8VA 1VBB2 1AYM3 3AZYA 1RGSA 1ND2B 4B3NA 2XJUA 5KHHA 2A3XA 4DY5A 4ES8A 3QBQA 3KLSA 3ZXGA 3H50A 4B4QA 4IEUA 1QGLA 5JR7B 1D4M1 3VBRC 4QPYA 4FPGA 5GLVA 1DBNA 4XHBA 1MR5A 1CAUB 1JTZX 2VH9A 5KHGA 1JOJA 4AVCA 2VOKA 3GBWA 1PZ8A 5J37A 3IPVA 1EP0A 1GR3A 3EBRA 2I2SA 1SLCA 2VMGA 1B35C 1ASJ3 5K9YA 4YW3A 3VZOA 2QZ3A 4CYDA 3I8TA 3PMSA 3U0ZA 1W6MA 4D7SA 1OLRA 1VBD3 2ZMKA 1TEIA 3VBRB 1FPN1 2DU0A 3EQEA 1AYN3 4RSUA 1AR92 2VUJA 1VLNA 5T50A 3AP4A 2XPJA 3H0OA 1ZM1A 1O91A 4MH0E 3VBHB 3VZKA 1G8WA 1RUJ3 2TBVA 3TNPB 1FMD1 1B35B 3WHUA 1XYOA 4P9GA 3AMHA 5DDJ2 5FOJB 1QJX2 1PGW1 1IKPA 4LO4B 3L2HA 4XJ9A 3VBOA 4I01A 3NSTA 2HJIA 1O5UA 1ND3C 2WT0A 3J26N 3PVOA 2VVFA 3TWIA 3WVJA 1ZZ7A 3KD4A 4QPIA 2H0BA 2GNTA