1NA1C

The structure of hrv14 when complexed with pleconaril
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
236
structure length
236
Chain Sequence
b'GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
molecule tags Virus
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
total genus 39
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1na1C00
1RVF1 1RUD1 5CFCA 3JBG1 5CFDC 1POV0 2WWSA 1VRH2 5BNNB 3TN92 1PVC2 4GH4A 4CDXA 1RUH2 4WM8A 4CDWB 1HRV2 4GMP1 2RMU1 1D4M1 1RMU2 2Y26A 1OOPB 1RUJ1 1VBC2 1AYN2 5L7OC 1AR71 4Y5Z0 1PGW2 1VBB2 3FBMA 1RUG2 1RUF1 2HWC1 1VBE1 3ZFEC 1V9U2 1MEC2 2RS32 1FMD2 4CEYC 3IDEA 2WS92 4CDUB 4YVSB 5GKAC 5DDJ3 3M8LA 1AR82 3VBFA 2QQPA 2R073 2FZ1A 5AC92 1ND3A 4CDQB 1OPOA 1NOVA 1M06G 2RS52 1RUC1 4FTBA 3VBRC 4Q4Y2 4RR3A 2HWE1 4RR3B 2R062 3CJIB 4IV1A 1E57A 3VBUC 3VDDC 5CFCC 4RS5B 2RS53 5J96B 2HWB1 2RS13 1B35C 1X33A 1BBT2 1RUH1 1PGL2 1HRV3 1RUG3 3VBHC 2X5IB 1D4M2 2HWD1 1VBE3 1FPN2 2HWF1 1QJX3 1W39A 4CEWB 3JB8A 1ASJ2 3J8F3 4Q4V2 1AR62 1K5MA 3JD73 1VBC1 2XPJA 1R091 1K5MB 2HWF3 1Z7S1 1ZBA3 1HXS3 2HWD3 3ZFGA 5LK7B 1H8TC 2RM22 3ZXAC 2R071 1PIV2 2R042 4GB31 1ZBA1 1ZBE3 4Q4V3 1AR63 1TME1 4Q4X2 4QPGA 1AR91 5JZGA 4WM8B 2BFUS 4GH4B 1OHFA 1H8TA 1HRI1 2PLV3 5AC91 1QJU2 1R1A2 1ND2A 2RR12 1EV13 4Q4W2 2X5IC 3VBRA 2XBO1 4QPIC 2RS33 1PO12 1BEV1 3VBSB 2PLV2 1QJU3 1R1A3 2R061 3NAPA 3VBUA 3VDDA 2WFF2 3ZFFC 1WCDJ 2ZAHA 3CJIC 4YVSA 1VBC3 3HAGA 2WLPA 1RMU3 4GH4C 1RHI3 1EAH1 1POV1 3VBHB 2RM23 4Q4Y3 1ZBE2 1R081 1TMF3 5FMOS 2RM21 4QPIA 3VBOB 5C9AC 1POV3 1FOD2 2R072 4CEWA 3ZFEA 1RUF2 2HWC2 1AR83 1ND2C 3NAPC 1EV11 1AYM1 5DDJ2 4GB32 4WM7A 1HRI3 1VB2A 3J8F1 4IV3C 3JD72 4RS5A 1VAKA 2R063 4JGYB 1OOPC 5C9AA 1C8M3 3VBHA 2RR11 4YVSC 3VBSC 1B35B 4EJRA 4CDWC 3DPRB 3TN93 1PO11 1EAH3 1BEV2 4FSJA 1RHI1 4RR3C 1RUD3 1VBD1 5BNNC 2RS12 1RMU1 1RUI3 2WFF1 4CEWC 3CJIA 4IV1B 5A33A 3LOBA 1AYN1 4PDWC 2VQ0A 1QQP2 1PGW1 1QJX1 1VBD3 5BNPB 1RUD2 1NA1B 1C8NA 1RUG1 3TN91 2RS31 5BNOC 2XBO3 1R083 1TMF1 1V9U3 4RS5C 1QQP3 4Z92B 1Z7S3 1ASJ1 1NA1C 1VBB3 1R093 5BNPC 3VBSA 1GFF2 1VBA1 1RUJ2 5A32B 1AR93 1FMD3 1NY72 2DF7A 5ABJB 1EV12 1AL0G 1VB4A 4WM7B 4GB33 1V9U1 2R041 4QPGB 5ABJA 3ZFGB 1MQTC 1NCQA 5D8AC 3ZFGC 1IHMA 1HXS1 1COV3 1PO21 1RUE1 4GMP3 5ACA1 1RVF2 5J98B 2WZR2 1NCQB 4RHV2 4CDXB 5CFDB 1RUI1 2WFF3 1VRH1 1RUF3 2HWC3 2X5IA 1RHI2 1RVF3 2HWF2 1HRV1 5JZGC 5A32A 1TME3 1RB8G 3ZFFB 4Q4V1 3VBFC 1ASJ3 1AL22 1COV1 1PO23 1R092 5ACA3 1QQP1 2IZWA 1CJDA 4CEYA 4FTSA 1BMV1 2BUKA 4JGYC 3VBUB 1X36A 3VDDB 4CDUC 4AEDB 2RMU3 4WM7C 5C4WA 1AUYA 1BBT1 4SBVA 5ABJC 3JBG2 1TMF2 5C8CA 1PVC1 5K0UA 1NA1A 4IV1C 4FTEA 1ND3C 1FPN1 2RMU2 1MQTA 1NCQC 5D8AA 2ZZQA 5C9AB 1NY71 1QJY3 4CDQA 4N53A 1AR72 1F8VA 2RR13 1A6CA 1PIV1 1VBE2 1RUC2 1K5MC 2PLV1 1MEC1 3ZFEB 1C8M2 4IV3B 2BFUL 1NCRB 4CDUA 1HXS2 2WS91 1VBA3 3JD71 1NG0A 2MEV1 4WM8C 4CDQC 5C8CC 4JGZB 2HWB2 1AR81 1MEC3 5BNOA 1QJU1 1R1A1 4CDWA 5CFDA 1PIV3 1HQNA 5BNOB 4Q4X3 2WZR3 2HWD2 2XBO2 5BNNA 1OOPA 2HWB3 2RS11 2RS51 1QJZA 2MEV3 5AC93 2TBVA 4PDWA 2HWE2 4N43B 2BPA2 1FPN3 1VRH3 1PO13 1FOD3 1VBB1 1HX6A 1SMVA 1AR73 1AL23 5ACA2 1EAH2 1RUJ3 1CD3G 1QJY1 4Q4W3 5FMOL 5BNPA 1MQTB 5D8AB 3VBFB 1H8TB 2HWE3 4RQPC 4JGZC 5JZGB 3S6PA 4YVWC 4PDWB 3JB4C 2WS93 1FOD1 3JBG3 3VBRB 1ND3B 4NWVA 3DPRA 5L7OB 2BBVA 4YVWB 1ND2B 1VBD2 1RUH3 4RHV3 1ZBA2 4JGYA 1RUE2 4NWWA 4JGZA 2WZR1 1TME2 4Q4X1 1AR92 4GMP0 1BEV3 4RHV1 2R043 1HRI2 1B35A 1NCRA 1DDLA 2FZ2A 1PGL1 1PVC3 1AYN3 4RQPA 4N43C 5FOJB 4N53B 1VBA2 1AL21 1COV2 2ZTNA 4Y4YA 1RUE3 1AR61 4AEDC 4RQPB 1BMV2 2GH8A 3DPRC 4IV3A 1QJX2 1D4M3 1Z7S2 4YVWA 5L7OA 4QPGC 4QPIB 3VBOA 5CFCB 5K0UB 5C8CB 1QJY2 1FMD1 3J8F2 5C4WB 5C4WC 1NCRC 4CDXC 1RUC3 1ZBE1 1F2NA 1AYM3 3NAPB 5K0UC 1R082 1RUI2 1BBT3 4LLFA 3ZFFA 3VBOC 4Q4W1 4AEDA 4BCUA 1AYM2 5DDJ1 4RFT0 1C8M1 2GSYA 5A33B 4N53C 4N43A 4Q4Y1 4CEYB 2MEV2 1PO22
chains in the Genus database with same CATH superfamily
1RVF1 1PHMA 4YM1A 4P9WA 4WVMB 2PXJA 5CKMA 4EN9B 4K6BA 4ES8A 5JXJA 4FOQA 4IETA 5FY0A 3KLSA 5BNNB 4R4ZA 1GR3A 2O0OA 3W59A 4R52A 4YRDA 4AFCA 4AQSA 4CDXA 1DP0A 4AAPA 1GP5A 4GMP1 3LFMA 2BJSA 3JU9A 2XHKA 3LSDA 5A3OA 1GZWA 4CVUA 2NYYA 1AXZA 4XBQA 5G05L 4B4PA 1RUJ1 1ACCA 3MZHA 2YU2A 2O8QA 2VTXA 1AYN2 3MW2A 4F7ZA 4LXLA 1PMIA 1C5IA 3OBTA 1PGW2 1GBGA 3SKJE 2OUHA 1XJAA 1QY4A 2WWJA 3ORJA 2VCCA 4Q27A 2E7TA 1SLLA 1FMD2 3ZIXA 3AM2A 4L11A 1HB1A 4FOYA 2UY9A 2A6ZA 1UY2A 1YCIA 2VJXA 5GZDA 2VZVA 1CZSA 4NMIA 5JIAA 3VZJA 1H8VA 2D3SA 5DDJ3 2PHDA 4MOAA 3BUCA 4KL1A 4M0HA 2R0HA 4IEOA 5HPOA 3J4UH 1BLZA 1ND3A 4D7TA 4NRMA 2P6CA 4L0PA 5IUQA 4Y1VA 2ZPXA 4CDQB 4EN6B 2LUWA 4WZFA 2VMCA 1NOVA 4QMAA 4OI0A 1KD7A 5F5CA 1JU4A 4GWMA 3WDXA 3FL7A 1UO9A 5A6ZA 3VBRC 2FCVA 3RZMA 3UGHA 4Q4Y2 3KHBA 5FFOC 1DGLA 2XKPA 1W06A 5FY5A 4AR2A 2BV4A 2QVSB 2E51A 3GBFA 5JXHA 1YXWA 1EY2A 1J1TA 2Q4SA 2W9XA 4IV1A 2YY1A 2WDBA 5H9QA 1MPXA 2C4XA 4AYUA 4Y1XA 4D8MA 2K0GA 4Q2FA 1XNCA 2JB4A 2WRAA 4TSVA 2BYVE 1URXA 3WW4A 3M3IA 2ORXA 2FQPA 2R32A 3F2ZA 4E2GA 4FXKB 3S5AA 3AL6A 4MZUA 3DECA 4CP2A 2ZX2A 1DF0A 4FQZA 2DFBA 4FPLA 1PGL2 5EPAA 4NO4A 4Y1ZA 5KHJA 2RDSA 3CKHA 4HL0A 1JYTA 3O14A 1W39A 3VHRA 1P8JA 1UZYA 2IFRA 1ASJ2 4Q4V2 3VKMA 2JEMA 2VVEA 4WZCA 2HH9A 3C7HA 1R091 1WW5A 4PBOA 1K5MB 2QQOA 4G3YC 1C5HA 1UY3A 5FZ0A 1VLNA 3WDYA 5LK7B 1FATA 3C7GA 4HPKA 4KH9A 1VPHA 2RM22 4XFIA 4COYA 4KU8A 2A1XA 3UJOA 5HV4A 3WQ0A 3U07A 5FZEA 3WZ1A 3OUHA 1GU3A 4BMEA 1YI9A 3CF6E 4DUXA 4FXGB 5IK4A 1GANA 3DKWA 4FOVA 1LOCA 1I1EA 2E26A 4NRPA 3R6SA 1ULDA 3T0BA 1UYYA 3VKNA 2FCUA 3WG2A 4AL9A 2QNKA 1AR91 3AYDA 1YFUA 4ZU7A 1DQ4A 1O3QA 1I5ZA 3ZIWA 1H8TA 4HSLA 4XUTA 1LOAA 3VKLA 4Q4W2 4UW6A 1WMFA 1BHGA 4HK8A 4EQVA 1B09A 1OPMA 2GMMA 1LEMA 2D40A 3VBRA 1C4RA 2XBO1 4QPIC 2RS33 1N47A 1AVBA 3HQXA 2YXSA 3BTYA 1BEV1 3K2OA 4HSJA 2DVBA 1RJ7A 1IS3A 3ZSKA 2VZQA 2DUQA 3ZXJA 1DLCA 4G9SB 1Q5OA 2W1UA 5JSOA 1WCDJ 3I3EA 1F4HA 3DUIA 4QX5A 1CZVA 1E5IA 1OKOA 3OUIA 4V2VA 4A6OA 5E89A 4ZZ5A 4TYSA 1J58A 5IJRA 5LB6A 4EV0A 2EXKA 1KS5A 3HAGA 3ECQA 3PTYA 4QDSA 5F1RA 1QDOA 3H9AA 1VJ2A 1Z0HA 5T50A 5FZAA 3T3YA 4QGMA 1JH5A 4CCMA 1POV1 1V6OA 2ZZJA 3VBHB 1QJEA 1W8WA 3SEPA 1V6KA 4XFGA 3HVDA 3C3VA 4I3GA 2R7EB 2WC2A 2QQVA 3KV4A 1HV0A 2SLIA 1OQEA 1PK6B 1R081 1TMF3 1DYOA 5FMOS 5LW9A 3M3CA 3VBOB 4AGRA 2YC0A 4J1XA 1POV3 3AZVA 3PURA 2XMLA 2BQPA 1UMIA 1IS5A 4D6QA 4MSVA 3VV1A 3QCWA 4XUPA 1AR83 1ND2C 3NAPC 1QOTA 2ZOEB 5FZ4A 5JIUA 2J42A 4XFFA 4JQTA 3WHTA 4AAXA 1BZWA 1KDKA 4AGGA 2W52A 2GC2A 1UY0A 3J8F1 2WSUA 2OXBA 2Y6KA 4IGOA 2JJ6A 2VG9A 4NOTA 3JD72 5FYSA 1QNWA 1VAKA 2JB8A 3ZLIA 5C9AA 2D6LX 3FX3A 1C8M3 1HN0A 1DZRA 1WMEA 2WQ8A 4OLLA 1XNDA 4FT8A 4HN1A 4K40A 4XETA 4ZONA 1MZ6A 3GJAA 1A8DA 1PK6A 2WQ4A 2WL1A 4LHLA 1BEV2 5FCCA 3QLQA 1RHI1 4FSJA 1VBD1 2RS12 4XCAA 2WFF1 2PELA 3CDZB 1XU2A 5A33A 5JPMB 1UQXA 4L2NA 3VZKA 1AYN1 4XDQA 2QQJA 4PDWC 4M3CE 4MGIE 3I2DA 1F4AA 2GP3A 2JKXA 3H3UA 5IVVA 1TVGA 2XL7A 3IB3A 1C8NA 3PIGA 2Z42A 5A6XA 5CEHA 2QKDA 4HKLA 4COVA 5LEKA 4OVEA 3SLIA 1IG3A 2GZWA 1GYKA 5KHKA 4Y1UA 4F3JA 4LBQA 1BK0A 4XJWA 1IQAA 3LEKA 3VZMA 1OKQA 1X9TA 3B69A 5FZ8A 2WINB 2XJTA 1ZZ6A 5JI7A 3B00A 1ZYBA 3KZ4C 4PLMA 1HLCA 4XTMA 5FUNA 2XJUA 1UU4A 1W2NA 1UIJA 2WN3A 2Y6FA 4GKXA 5JR2A 4M01A 5LA0A 1V0AA 1BYHA 4K7JA 2AEYA 1PMHX 3J7MA 3KQRA 5A1AA 3VD9A 4LBOA 1PZ9A 2BOJA 1JOPA 1VE0A 1VB4A 2VNVA 3EHKA 4LITA 4EE2A 1WA4A 4URAA 5JUVA 1ULGA 3VUOA 4QHOA 2W0XA 2WUHA 3UNPA 4FPYA 3WF0A 3UGGA 4CCCA 4NR1A 2C5DA 5EHDA 1XBFA 4Q26A 3ZYPA 4DB5A 4JTNA 5EWSA 1IHMA 3FHQA 3O1PA 1COV3 1PO21 4WVMA 2JG8A 4A3ZA 2WZR2 3EYPA 2EA7A 2VTXJ 1W0NA 4KU7A 4RFRB 4AVCA 1W28A 3IMMA 1RUI1 4M00A 1JN2P 5A1LA 4HXCA 2DURA 2HWC3 2X5IA 3NW4A 1HJFA 2C9AA 1WMXA 1RTVA 2D97A 2GC0A 4MV2A 4Q1RA 1RHI2 1TZOA 3FJSA 3B01A 1LENA 4QQLA 3ETQA 3FLPA 3OPZA 3ZYJB 4KGGA 2RJ2A 4Q4V1 3A7QA 3VBFC 3SMHA 4AFAA 1ASJ3 1QWRA 2CWMA 1AL22 5ACA3 1R092 1W9YA 5JWPA 2DBNA 2Y60A 2IZWA 3M4FA 1CJDA 3MHZA 1LB2A 1ZREA 4JGYC 1UCXA 3WF3A 5A70A 3I2OA 2DVDA 3ABZA 4XUQA 4IE5A 3ZDSA 4LBQD 5EJ3A 3H1YA 5C4WA 2BTVC 2ZGKA 2VZPA 2VMFA 4B29A 2DCTA 2P5BA 1GMMA 4BLJA 1TNFA 5C8CA 3MDPA 1PVC1 4Y20B 4FTEA 4B4QA 2JDKA 2NLRA 5KWRA 1ND3C 1NLSA 1FPN1 2ZX0A 4AZZA 3NNFA 2Q0AA 3C2UA 2RV9A 5A1FA 2V4VA 2XJSA 1MQTA 2VUDA 4XTPA 1NYWA 1QHDA 1NY71 2VM9A 4BIFA 1RYYA 1FXZA 4XW3A 4CDQA 1X9PA 1R64A 4N53A 4XHXA 2IXLA 1EUTA 3T2QA 1RIRA 4B7EA 3J26N 5DUWA 5IFTA 1OLRA 4JDMA 1J3PA 3KF5A 2CNAA 4QB1A 1RUC2 5HCBA 3WCRA 3WSOA 2IXHA 2PLV1 4KI5M 5FMDA 3ZSLA 3O1RA 2C9KA 1NCRB 1O8PA 2UYAA 3ACIA 4JKMA 1HXS2 1O91A 3NJZA 2WS91 3MV11 1G7YA 3IDCB 5FLHA 1GNHA 1OQ1A 2ZAAA 1SFPA 4JGZB 1J84A 2HWB2 4SLIA 1MEC3 1WLCA 4MX3A 4D69A 1KEXA 5GJ6A 4CU7A 5CFDA 4AI9A 4DRRA 3VHNA 4P08A 4CUBA 5HV0A 4Y22B 4Q4X3 2AUYA 5CKNA 5GZGA 1BK1A 2OPWA 2HWB3 2UWCA 4FVVA 5FO7B 3OOXA 4MXWB 4RL7A 4BQYA 4GWNA 3K3NA 1QXPA 2GU9A 4EROA 4KWUA 1DIWA 2VW2A 4LA3A 2NMNA 3AMMA 2HWE2 3FHIB 3WY6A 5SV8A 3DKQA 1CAUB 4C1WA 2OYZA 1X8EA 1GSLA 1NKGA 2AH2A 4MGZE 4BOWA 3TEXA 5FO8B 4XPVA 1VRH3 3SISA 1H4HA 3KGZA 1C3HA 5K8SA 3KT4A 3OGVA 3OJBA 3M7AA 2I74A 5LCWL 2VO5A 1PVXA 2JG9B 3AYAA 4CCEA 5L9BA 1IKPA 1YI7A 3I4IA 5FTTC 1OMIA 3BI3A 1CR7A 3UGFA 3PVEA 3ON7A 2TUNA 4QQ2A 1C1FA 1NT0A 3V0AB 1YYNA 1SDDB 4RGGA 1LESA 1QIQA 3JB4C 4LK6A 2B5HA 1S4CA 1FOD1 3E6DA 4RGKA 3VBRB 1UKGA 2AACA 5FPVA 4XQDA 3NSTA 4W8JA 2P3YA 4LO4B 1U5ZA 2OS2A 4GWJA 3F95A 4YVWB 4CXWA 5LZ6A 1RUH3 3DXTA 1CAUA 1X50A 3HD8B 2GC1A 3NV2A 5B4XA 4JGYA 1RUNA 3AP9A 1KJLA 3NNJA 1RINA 4L92A 1RUE2 2AEZA 2WBKA 4LLOA 3HEIA 1UZ0A 2I07B 2BGCA 3I2KA 3Q8FA 5FP3A 1ZRIA 4HLTA 4A42A 3ZOIA 2JXAA 4RHV1 3AJYA 5LWBA 2ES3A 4IE4A 2DU0A 3VD5A 2HYKA 3D0JA 1GWKA 1AYN3 2YBKA 4XMIA 1JBCA 4XURA 1YLLA 2ZABA 3JCIA 1UYZA 4Y4YA 1COV2 4NIGA 2VZTA 5BY5A 4CPBD 2NM1A 1LJ7A 4GZ9A 4KBZA 4U36A 4Y5TA 1BMV2 3S7EA 1VALA 3VDBA 1D4M3 2CU5A 3ME2A 4GD4A 4XHBA 5I93A 5L7OA 3WX5A 3TRSB 2KD7A 4UBGA 3OUJA 1UXXX 3SCHA 3WXPA 5F32A 1O7FA 3POGA 2EIEA 4LMFA 2ZHMA 1HB3A 2JD4A 4COUA 1GOGA 3WV6A 1RGSA 3IAQA 3JZVA 3VDAA 1UMHA 4OULA 5K9YA 5GALA 1DQ1A 3OTFA 5IVFA 4CDXC 3IPVA 2XLAA 2VQTA 1ZBE1 2QQNA 1UD1A 1F15A 3D6EA 3NAPB 1JOBA 1R082 1ULPA 3PUSA 1RUI2 1W8FA 2EXIA 1NQJA 5FAXA 3D8CA 4XJAA 3KMHA 2FDFA 3J7HA 1GP4A 2W39A 2BBAA 3VBOC 5EXOA 1GUIA 2VAUA 1O6UA 2IXIA 3ES4A 4BCUA 2DTWA 4JHTA 5F2SA 4AQTA 5JOYA 3E6CC 1C8M1 1W05A 1XNTA 3EB7A 4P9JA 3MLJA 5FYBA 2XQRA 3AZZA 3MFCA 2CL2A 2YFUA 2MEV2 1AL23 5ACA2 1V00A 4FFFA 1NZIA 3O1MA 5DZFA 2G4IA 3S0MA 5JDBA 3N7KA 2O14A 4O65A 4QB2A 1IS6A 2Z4FA 4NHMA 3OPWA 2B4KA 2ARBA 4M3CF 4AOCA 2UU8A 1JYNA 4OI1A 4BYYA 1PVC2 5LEJA 2W08A 4LHNA 1XQNA 1YHFA 3D82A 2J1EA 5FWEA 5KBFA 4WM8A 1OA2A 4CDWB 4E9KA 1UOGA 3TOJA 1SLBA 2B9UA 4BLIA 4A6SA 3NJVA 5IFPA 2ZX3A 4CU9A 3IKWA 1OOPB 4ZKTB 3CBNA 5DMYA 1PX4A 1VIWB 1H2NA 2NMOA 1VBC2 3GXUA 5JSPA 4QX0A 2ZS6B 5G04L 5JI9A 5BUVA 2ZKLA 5L7OC 4Y5Z0 3TBDA 1JZ5A 4I0WB 2R16A 3D5OA 4PIZA 4S2GA 1CX4A 1RUF1 1UU6A 1VBE1 2DUPA 3WF1A 2X8KA 3ZFEC 3V0BB 4MO3M 3OEAA 4L99A 3KV9A 2HJIA 2W95A 1UZVA 4XFCA 1IPKA 2ADEA 3IDEA 4PF1A 3H1WA 2WS92 4XJZA 5HCAA 2IVJA 4YVSB 1ZRCA 1SQ4A 3THCA 4QU1A 3L2HA 4EZ4A 1H30A 3SNMA 1S2KA 1V6IA 2X09A 3M8LA 4J25A 3A21A 4XVHA 5C3PA 2K46A 2BOIA 1WGPA 3VBFA 5E1RA 4B1MA 3ZKUA 2R073 3PVBB 3MUY1 2D98A 4D94A 5FUIA 2LALA 5FRAA 3GF6A 3N7LA 5AC92 1ZNPA 3POWA 1NZCA 3I7DA 5F7UA 5C3QA 1BVP1 3MIFA 1OPOA 1WCSA 2JE9A 2P3IA 3O0XA 4CA9A 3OD0A 4HMZA 5A7NA 5LY1A 4FTBA 4N7IA 4W6WA 1LECA 4XYXA 2VC9A 4RR3A 5F5AA 2VTFA 4FFIA 2HWE1 2PQSA 3AKRA 5LATA 3ZO0B 2R062 4LBLA 3WQ1A 5FK8A 2C0ZA 4E2SA 5T5OA 4LKEA 3OY8B 2RS13 5DUVA 2VUCA 1B35C 4CXXA 2W91A 1H1IA 1BBT2 3T4VA 1EUUA 1S0GA 4V2WA 1Y9QA 2RHPA 2W92A 2W5FA 1LHOA 1RUG3 2H0VA 3H8XA 4L97A 4AI0A 2SBAA 2ZGOA 3FLTA 3M3EA 3OGJA 4O9GA 1FPN2 5KHIA 4WVVA 2YYOA 1GOFA 4NHLA 5DAVA 3ZPYA 1S2EA 3JB8A 4RD7A 5FP7A 4LJHA 3L2YA 3KCCA 3PNAA 1XNAA 4BM8A 1WMDA 3TYJA 4NJ4A 5E6HA 5J3UA 5IK8A 1SLAA 3NWKA 4ET7A 1UAIA 2BVVA 1Z7S1 1W9SA 2HWD3 3ZFGA 3WNXA 2OPKA 1SFYA 3E1F1 1H0BA 3CZUA 1SCSA 1MVEA 3I2HA 4QM8A 3RYRA 1GZCA 1SBEA 4AFBA 4Z8BA 3RZLA 1LCLA 3R05A 2XXZA 4GB31 4OHXA 4N8MA 2OW4A 1XSRA 2XQXA 5C7GA 2ZMNA 5JSRA 4CUGA 2N7GA 4ZU5A 1IS4A 3INAA 2AZ5A 3G7DA 3WT3A 2HLEA 4AHYA 2JDZA 1AR63 4XCBA 3BKZA 1TME1 4HFSA 1W03A 2JIJA 1OI6A 4P5HA 5KHHA 5CISA 1PZ7A 1W2TA 4COZA 4CP9B 4EZHA 2BFUS 4GH4B 3V56A 2PLV3 2J1SA 4K1YA 2ID4A 5AC91 1JODA 3EXUA 1ND2A 2RR12 1EV13 4M4PA 4UFMA 1GV9A 1K5JA 3FN9A 5LBFA 2K2SA 2XHNA 3POYA 4IXLA 4A44A 1PO12 5T3NA 1OVPA 2DVGA 2PLV2 4QKFA 3N9NA 4MADA 4O9EA 3NAPA 4YZ5A 1JZ3A 1ZRRA 3A23A 2ZGNA 3ZFFC 1JMUB 3BYWA 2VUAA 5FBZA 1J3RA 2VMGA 2ZAHA 4S2HA 4E8DA 3O12A 2ATFA 2VQAA 3KM5A 1X7NA 3N9LA 1OXCA 3LGRA 3ZXFA 1LAJA 5EV7A 1RITA 3CU7A 4UXAA 5FPZA 4P9IA 5FP9A 3I3QA 3ALQA 3RNSA 3ZXKA 5FV3A 2H0BA 1CPMA 2EAAA 5IVCA 1O4TA 1S55A 1YQ8A 5DABA 2EIGA 2DWRA 4UOJA 3H0OA 4FP2A 3NNGA 4FOWA 4JDNA 5BPXA 1JUIA 4Q4Y3 4W6XA 1V6LA 1AF9A 5LBEA 1GLHA 2LM3A 2OA2A 1ZBE2 2PN5A 2GMEA 1PK6C 3KVAA 2PHXA 4S2FA 5FZ7A 3T08A 4KWKA 1MS4A 1TG7A 2DTYA 2RM21 3GGLA 5FXZA 1JYCA 2PHFA 3A0NA 3MIBA 4DIQA 2XWJB 4YYOA 3WW1A 4JX0A 1EV11 3B9CA 4LR4A 4GB32 4WM7A 1NQDA 4NN0A 4OCTA 1QH6A 1FAYA 1HRI3 4C91A 4DQAA 3A0KA 1BKZA 1ODMA 2A75A 2BGPA 4QWNA 1N1VA 2EVXA 1XXNA 5GZEA 1OOPC 4NIAA 4LORA 1CAXB 4DEQA 2D6OX 3ZN6A 1UY1A 2RDRA 2YHJA 4YVSC 3VZNA 5C3RA 4QQOA 1SACA 2ZX4A 4CDWC 3H1MA 3U37A 3FFZA 1BJQA 4XAEA 3WVJA 3WQBA 2W1QA 2EF6A 3RDIA 1R1ZA 2H6CA 4J6GA 3RWNA 5EP9A 4BZ4A 4YM2A 2A73B 2YV8A 2JG8C 4E8CA 2B9VA 2ZGRA 1XE0A 4OYUA 4FPOB 5AVAA 4CEWC 5C33A 1K45A 2XLGA 4XUNA 5F3IA 1UKRA 5JOZA 1QJX1 1VBD3 3H42B 4A4AA 2R0FA 2ZGUA 3OGGA 2B45X 4Z1VA 1NA1B 1TQ5A 4YG3A 4FAHA 4HN0A 1LHUA 2ETEA 2BWAA 2WA3A 5FP8A 5BNOC 2XBO3 2B7YA 2C1FA 4RS5C 2WFPA 1ZM1A 1YC61 2WWUA 2WZEA 3N3HA 1Z7S3 2V4AA 4AFMA 4NIHA 1Q8VA 5FZHA 1ASJ1 4CP9A 3BU0A 1VBB3 1Y4WA 1E5RA 3K51A 4K9SA 4R9DA 1GFF2 5LASA 3CJXA 5FLIA 1A8MA 2BEOA 3QOPA 4NE9A 1UOFA 3FUOA 3MIHA 3RGBA 3GCWA 5A32B 2QDRA 4MGTA 3WW2A 2V73A 1Y43B 1U5YA 4KWJA 4ZZ8A 5A80A 5IK5A 5FZCA 3IN9A 1C1LA 4MLOA 2IXKA 2D6KA 1V9U1 2XL9A 3NJXA 4I30A 5DAQA 2WZPP 3ZN5A 1QNYA 1J59A 1DGRN 4BHPA 3HOBA 4DUWA 1MQTC 3LFIA 2E7QA 2D5HA 2KXLA 2WQZC 3KSCA 1AX2A 4MHUA 3MUZ1 4UW4A 3HT1A 5T5PA 2X05A 1YRZA 5FZMA 1RVF2 1XNBA 3AZWA 5DG1A 1NCQB 3TEYA 1L7QA 1A34A 3E6BA 4JTOA 4CDXB 2YDEA 1LR5A 1QH7A 2WFF3 4LBJA 1LU1A 2Q30A 2Y34A 2E32A 2EAKA 2O1QA 4FPCA 5L19A 4R4XA 1RVF3 3POSA 2HWF2 5JZGC 4YW4A 5A32A 3AVSA 3IBMA 5CKQA 1RB8G 2FDGA 1XE8A 4XDPA 2Y38A 3K75B 3ZFFB 2Q8EA 5C8WA 1YEWA 3KWVA 5ANQA 4ASMB 1Y9MA 3KV5A 1GQGA 1O5UA 3VDDB 1X36A 5CBLA 5DAPA 3ZYRA 1W9FA 2Z79A 4B4RA 3DYPA 4WM7C 5FXXA 2DU1A 2JX9A 2DCZA 3LOIA 5K0UA 3APBA 1WLDA 2ZHKA 3SKVA 4E2QA 2JDUA 1VRBA 2JDMA 4A2UA 4XF4A 2J1UA 4YWAA 4KMQA 3MGUA 3GZAA 5D8AA 5FYYA 5C9AB 2RVAA 1N3QA 3NKTA 2OKXA 1WWYA 1US3A 1GWMA 5A7SA 3TNPB 1O4ZA 1QEXA 4JC1A 2FBEA 1IPSA 4IE0A 3AP5A 3WDWA 1WBLA 3VL9A 5F6KA 2IXCA 4YZ1A 1ULCA 4IDZA 2RR13 1F8VA 4V1PA 3VL8A 5ISLA 3K48A 3HMYA 3NL1A 1A6CA 1S0EA 4FFHA 3USUB 4EWAA 2A6XA 1VBE2 4DUVA 2WN2A 2CGNA 2BFUL 4IGQA 4CDUA 2VZ1A 4XABA 1F35A 4XF0A 1HJGA 5K4LA 3IT8A 4OHZA 5F5IA 4YSFA 1VBA3 1JYIA 4W6YA 2XLFA 1YFXA 4XE9A 3RMXA 3T1LA 4YZ4A 5C71A 1HQWA 1AR81 3PLQA 4FP3A 5BNOA 1Q8PA 3ZYFA 3GDBA 2VECA 3JXSA 1R1A1 2XJPA 1UL9A 4IE6A 1OC1A 3QD6A 1W8TA 3AMQA 3O1OA 4HKOA 1CVNA 2J1AA 4EN8B 4Z2WA 5IVJA 3PDQA 2RS51 2PHRA 2VMDA 4IEPA 2LRPA 4BPZA 3DL3A 3LF7A 2VZOA 4OZOA 5L9RA 2AREA 2AR6A 3WP5A 4LHKA 3AFKA 4CCOA 2FDKA 5GZFA 2TBVA 4PDWA 4LIUA 4OZXA 4E4SA 4BA6A 2GNTA 5FWJA 3C7EA 1W6QA 2ENRA 2ZKNA 1JHJA 4LBKA 2J1RA 3ZSMA 3DXUA 3POIA 2I2SA 4MGKE 3RMYA 3LA3A 3VDCA 2Y8KA 3BU7A 3PU8A 2E31A 1VBB1 1YIFA 4AF9A 1SMVA 1FV3A 3LKJA 3SCFA 3R0RA 3VD7A 1AR73 4URTA 2OVUA 3M3QA 3R4UA 4BQ3A 5JPNB 2PFWA 3K77A 1Q56A 4XEZA 3NQHA 5A3TA 1V6MA 2Y0IA 3LD8A 1PMJX 3WP3A 1AHSA 1OH3A 1N3PA 1FNZA 4CE8A 1QJY1 2LS6A 1OA4A 2ZGQA 4Q4W3 4ZY9A 4IQPA 4YNIA 1M4WA 3EO6A 4JV4A 1DCSA 5FKCA 1H8TB 2ZMKA 4Q1PA 2DBIA 4P02B 4JGZC 4GIQA 4O7XA 1OF3A 3FHAA 4K8FA 4META 5F3EA 5FZ6A 1V70A 2VZRA 2WS93 2BU9A 5KXEA 4GA9A 5FQ0A 2Q8DA 1ZX5A 3V64A 1ND3B 4Q5OA 4IERA 4RSUA 1C57A 4A3XA 2C26A 5L7OB 4RHV3 1ONAA 4BWOA 2A70A 2D44A 3EJKA 3HBZA 2FMYA 5I8YA 4UI9L 3HPNA 2BRTA 4LNVA 4DEVA 3CMGA 2GALA 3RZJA 2WZR1 2PA7A 1TME2 4DXSA 1NAEA 4GMP0 1XB9A 2VL4A 3W58A 1PZ8A 2F4PA 1W0OA 4Y24A 5C6CA 3BTXA 3MFAA 3TEWA 4CSWA 2G1MA 4XMAA 3DN7A 3MIGA 4PHZA 1SCRA 3HQUA 5AFBA 2FZ2A 3W21A 2Q8CA 1I5PA 2PQQA 1CAXA 5DZEA 3UL2A 1EP0A 1PGL1 2BNOA 2IVIB 1VP6A 5LA1A 4WVWA 1REDA 4YW5A 4PT6A 3MPBA 2P1BA 3UKTA 5FOJB 3RZHA 3RFRA 3PVNA 4AEMA 3V65A 2HEYF 1AR61 2Z5WA 4RQPB 4Y33A 4RGAA 3DPRC 1K3IA 1H1AA 4Q29A 4YVWA 5FPAA 3ZXEA 4QQPA 3BPZA 2VVDA 1CESA 1WW4A 3MW4A 1ENQA 2ZBJA 1GWLA 4COWA 1XYOA 2A5ZA 5GLTA 5FZLA 1STMA 1QJY2 1UU5A 2EXJA 1IZ3A 3WG3A 2E63A 4LO7A 4UBHA 3J8F2 5IATA 2VPVA 2YBSA 3NJYA 3BALA 3V0AA 4UFHA 1LU2A 3AKTA 4XFBA 4YW7A 4JRLA 4LUMA 2XOMA 2FDHA 4IEVA 4Y5SA 2PAEA 2WAAA 4GWIA 3W5MA 3K3OA 2YPJA 2VUJA 1QOOA 4QXKA 4LKFA 5DN2A 4LLFA 3OYWB 4Q4W1 4PJYA 3FWEA 4BXSV 1BQPA 4ATEA 1W9WA 1K42A 4AEDA 3NRUA 4H7LA 4X6QB 1REEA 1S0FA 1X82A 2WO3A 2GSYA 3KS7A 2WIIB 1OH4A 1UY4A 1MS0A 2WT1A 2Q5TA 1CONA 2WNUB 3HR9A 3ACHA 1OD5A 2OX0A 1H9WA 3AVRA 1N1TA 3KF3A 4QPYA 3T0DA 1U5IA 3GNEA 3N7JA 1ULEA 5CFDC 4R9BA 4MYEA 4OQ8A 1VRH2 2DCYA 3M3OA 1XYPA 2UURA 4XF1A 4GAZA 4GH4A 5GLVA 1E5SA 1WLTA 1LEDA 3WDTA 4A7ZA 1RUH2 4Y26A 3USSA 1HRV2 3OBRA 2RMU1 4NHKA 1DYKA 4HOOA 4EN7B 2BDRA 1NXMA 4ASLA 3T4HB 4DMIA 1H2LA 2VOVA 5FP4A 1CIYA 5AFEA 3ZMNA 2J7MA 1D0GA 1ENSA 3ZPOA 5FMBA 1POQA 1APNA 1NUKA 1JYXA 3RI9A 1DFQA 3QH6A 3LWCA 5FY8A 4UFJA 1DGRA 5LK5A 2TNFA 3N9QA 4Q0VA 2P34A 2HWC1 1J3QA 4U2AA 1V9U2 1KITA 3MIEA 2OZJA 1W3VA 1Q8QA 2Y6HA 2WKKA 2YC2A 3NV1A 5CB7A 4A45A 3KVBA 4DPNA 2HEVF 4FPJA 2WYSA 4HK9A 2PYTA 1H6YA 4C8DA 4EN0A 4YM3A 3VKFC 2B46X 1AR82 4GXLA 2CY6A 2XUMA 4LE3A 1W6PA 3KCYA 4AHXA 3OD4A 2QQPA 1H1MA 4HONA 3RJRA 2FZ1A 4AVSA 5C3OA 4QDQA 3U0ZA 2A3XA 4IUGA 2XWBB 1YJKA 3SC7X 1FNYA 1X8MA 3M70A 2W94A 1BVVA 2RS52 2ZEYA 3LDRA 1W6NB 1ZVFA 2HKXA 3AMPA 3E5QA 1OLMA 3AB0A 4YGDA 3U11A 4ARXA 4RR3B 4PI0A 4YW1A 3B5LB 3VBUC 4J1WA 4OHWA 3ELNA 4RS5B 4XZPA 1JZ2A 2YGLA 2RS53 5FMCA 1QJFA 5D1IA 3W20A 1HKDA 4XFHA 2XJVA 1LHNA 1XRUA 4PBPA 1EPZA 1PNFA 1WCQA 3VBHC 1O3TA 2C6SA 1MS3A 3OEBA 4D7SA 2HWD1 1VBE3 2ERFA 5JMOA 3FBYA 2HWF1 5DPNA 3Q9OA 2GNMA 4HETA 2BERA 4CEWB 3TEZA 4BISA 1IKQA 3LDBA 3U4XA 4QD2A 2XPJA 1VBC1 1GOHA 4YFWA 4BQ4A 3B3QE 4OFGA 4CZSA 2WT2A 2IUWA 2FCTA 1H6XA 2V09A 1ZBA3 1HXS3 3UESA 1H8TC 4IEZA 2R49A 2R071 2ZGMA 2ZA9A 4QXBA 1E5HA 1CGPA 3UV9A 4LO8A 4MH0E 2R042 1JZ7A 2WNVC 2W47A 4QAWA 3L9JT 2PTMA 4D0QA 2W2IA 2WNUA 4Q4V3 3LEIA 5FYTA 2RDNA 2DUOA 4A7YA 3IDBB 4Q4X2 4QPGA 5H9PA 4WM8B 4DOUA 3HJRA 1DQ2A 2JWPA 1OHFA 3IIIA 4LBQB 4Q8KA 2CWSA 1R1A2 2P6HA 4JKKA 4R9AA 5A7QA 4INDA 2Y64A 2FD8A 3I8TA 1D0HA 3JUUA 1ZA7A 1T6BX 1KJRA 4OQ9A 3B93A 5FYMA 3VBSB 4XF3A 4OUEA 5FY4A 5FXVA 1R1A3 1VMHA 2EXHA 2R061 4ITCA 3VBUA 1ZZ8A 3AKPA 3URFA 2VBPA 2W68A 4XQWA 1IPJA 1YQ6A 2I45A 3AXEA 3SITA 4YVSA 1IGOA 1VBC3 1DU3D 1PNGA 1DZTA 3H3ZA 1RMU3 1RXFA 2GN7A 3WNOA 2FMDA 3KCXA 3WLUA 3BOWA 4NAMA 3HT2A 4YM0A 5FK7A 1DGWA 1KFXL 1G9FA 3CQOA 4UFLA 4CPBA 3RJ2X 4XBNA 3WNPA 1XSQA 1I9RA 4D3WA 1WZXA 5I0UA 3DEMA 5C9AC 4XF9A 2ZEXA 5FZBA 3P1IA 1FOD2 2OQ6A 2R072 4CEWA 4P00B 2VU9A 1DBNA 1RUF2 2EIBA 3NVCA 2R30A 4I0AA 1WD4A 4W65A 3ZFEA 2KM2A 5JOWA 5FR3A 1DQ5A 4KBBA 5DXDA 5J37A 1O3RA 3CO2A 4PCRA 1VB2A 4QX1A 2CYFA 4H55A 1CQ9A 1LGBA 5E8AA 2XKOA 5GLUA 2VXRA 5SV5A 1ENRA 4RS5A 2R063 4UWDA 3N7MA 1O8SA 1V6JA 4FBFA 3RYKA 2XVKA 4LKDA 3LPFA 3KB5A 3VBHA 3U14A 1IQDC 3VHOA 2RR11 2Y6LA 4QX2A 4QM9A 2BNMA 4K21A 5EJZB 4C1XA 1W8UA 1W6NA 5IAVA 4EJRA 3O1SA 1JS9A 2VE1A 1BXHA 1F31A 2DVFA 3I54A 3IAPA 1PO11 1MR5A 1EAH3 1ULFA 2ARXA 2MNGA 3HQRA 4MUVA 2J22A 4RR3C 1H2MA 1RUD3 4PIYA 5BNNC 4AE2A 5FY9A 5H9RA 1NLRA 3AC0A 1UYPA 3O1TA 2VH9A 2VY0A 5KHGA 4IV1B 4FPHA 1Q8OA 2ZCWA 4H2AA 5LBBA 1QQP2 4RN5A 1OBNA 5BNPB 1RUD2 2YUEA 2DYCA 4BQXA 2OZ6A 4DY5A 3MO4A 2A3YA 2P4EA 1GP6A 3LEGA 2GMPA 4MGQA 3TN91 4QU2A 3WD5A 5F3GA 5FUPA 1R083 1TMF1 1V9U3 1GZTA 2OT7A 2Z2SB 3PMSA 1AJOA 1QQP3 5JMCA 4Z92B 1SFNA 4OMCA 1LGCA 4D6SA 3VB9A 2JENA 4KG0A 1R093 5BNPC 1Y9GA 3TWIA 1KXGA 3VBSA 4WBBA 4H3WA 1VBA1 5E88A 1NE4A 2ADDA 2ZJCA 3Q8CA 3FLRA 2WA4A 2JE8A 2QZ2A 2DVAA 1FMD3 3DCQA 3WEZA 1A78A 4F8AA 3WINE 1OSGA 3ZMOA 5ABJB 1EV12 2A7AA 4GB33 4HZFA 5FY7A 3ZYBA 2Q1ZB 4BJ0A 3N4MA 2A71A 2XH6A 1ODNA 4FPGA 4Q0QA 4QPGB 3T0AA 2Q1MA 1FYUA 3ZFGB 1GICA 5D8AC 5A3UA 2UWAA 5JR7B 2VOWA 5ACA1 1RUE1 1UXZA 4Q8LA 3FE5A 3OBAA 4HG6B 1YQCA 5J98B 2NP0A 5HCHA 3BCWA 1AX0A 1I6XA 3NO8A 3GBWA 1GNYA 5CFDB 1VRH1 2CTVA 1JW6A 2WLQA 2VZSA 3MF6A 4ZS3A 4E27A 3O5SA 1HRV1 3O7OA 4AFDA 2Q1FA 4K20A 4BK5A 3C8XA 3OYWA 3QACA 3OSDA 4UFKA 5C70A 1HN1A 5CIRA 4OUMA 1COV1 1PO23 3K4ZA 5BNQA 1ALYA 2F17A 4B1LA 4FTSA 2BUKA 4I02A 3ZM8A 4XBLA 3VBUB 4CDUC 2RMU3 3WOGA 1GQHA 2EICA 4AVBA 4SBVA 4LOSA 5ABJC 1ZRDA 3JBG2 3ZSEA 3G6JB 3UJQA 2YROA 1TMF2 4K3UA 3U1XA 1WLWA 1S0DA 1YFYA 4LOTA 1BCXA 3I59B 5F8PA 3U4SA 2Y0OA 2E53A 3FC0A 5FY1A 3THDA 3RZKA 5FZFA 4JRAA 4AVAA 1W2AX 2RMU2 1WCUA 3ZYIB 1CJPA 5F3CA 4JHZA 3D0SA 3N36A 3Q8BA 1MZEA 1NCQC 5A7WB 1DYPA 2YBPA 4M4RA 1G9CA 5KC5A 2XVLA 1Q8SA 1YNAA 1A3KA 5FYVA 1NX9A 1RJ8A 2NN8A 3OCPA 1S1AA 4MXWA 1SEFA 5FYUA 1OD3A 5JXIA 2UY8A 3BIEA 3V0BA 1UWWA 1PIV1 1W0PA 4W4ZA 2Y33A 1VMJA 1K5MC 1W9TA 3WG1A 4CCJA 1IG0A 3W5NA 1MEC1 2WT0A 3B94A 2WABA 1CAVB 3POBA 4IV3B 5J09A 4M3CB 3RZZA 5IVYA 2YPDA 1O3SA 5F5QA 3ST7A 3JD71 2A3WA 3LCPA 4N7UA 1NG0A 4QGLA 3BN6A 4QDRA 4WM8C 1GZWB 4CDQC 2QQUA 3U75A 1K12A 5A7PA 5JAXA 3BIWE 1G9AA 3BOPA 3AYCA 1HW5A 4EWDA 3R4DB 4YLZA 1QJU1 5GLZA 5LY2A 4CDWA 4XIKA 1PIV3 1UOBA 1IOAA 5KR7A 4NPLA 2RG4A 3CIHA 5JXGA 2E6VA 5BNOB 1OQDA 3N9PA 4X8PA 1SZBA 1OA3A 1VMFA 1W8OA 2HWD2 2R1BA 2XBO2 3CLPA 4P14A 2OIIA 2RS11 5EJ1B 3T09A 3WP6A 5A6QA 5J48A 4TLGA 1QJZA 3QBQA 3POEA 2UWBA 4KGQA 5AVPA 5AC93 4GKYA 3ES1A 5F39A 4HVQA 1MS1A 3AKQA 5T52A 4IESA 1QU0A 4XUOA 4CUAA 1FPN3 4S2DA 2CDPA 2QQIA 2CDOA 5A6YA 2ZHLA 1FOD3 4DY3A 4FFGA 4ZU4A 3WG4A 5L9VA 1SLTA 1V6NA 5H9SA 4BDVB 2QUOA 5CVRA 2P2KA 5EYXA 3GHMA 3KHCA 1EAH2 1RUJ3 4GJYA 3ZXLA 1MS5A 1S0IA 5FMOL 3PU3A 5D8AB 3A4UA 1ZA4A 2GC3A 1AZDA 1W6PB 1DLLA 1Z78A 2V5DA 3K4AA 4GALA 4NPRA 4AXOA 4BIOA 1PX3A 3RI8A 2HWE3 3BTAA 1NXD1 5I0TA 1W6QB 3RYPA 3PUIA 3MIDA 5JZGB 4Z2AA 4YVWC 4NRQA 3J9SA 4PDWB 2V5YA 5CU1A 5GM0A 2W1SA 3MI8A 4JZRA 4YFZA 4AQ6A 1SLCA 1VR3A 2IC1A 2WZ8A 4JCKA 2R6QA 2W87A 3I2GA 4TWTA 4XQ4A 4DS0A 3DPRA 4XOGA 3O1UA 2B8MA 5FREA 2YZ4A 5FZGA 2EALA 5JVVA 1SDWA 5FZDA 1UZWA 3PVOA 3LZZA 4AI2A 3HNBM 4LE4A 4B8EA 4BQ1A 5IK7A 1JOJA 4CUCA 2WYFA 2YFZA 4BH9A 1CPNA 1DQ6A 3S7IA 2BWCA 3B02A 2AYHA 5CNAA 2P17A 4Q4X1 2Y6JA 1MS8A 4TN7A 1BEV3 1LGNA 3GALA 2Y6GA 4CYDA 3H8OA 3I2FA 1JYVA 4D6RA 4AW7A 3SCGA 1LKNA 3ZN4A 3CHXA 4R9CA 5IWFA 3ILRA 2PAKA 2WSVA 3JQXA 4RQPA 1W6OB 2ZHNA 5T5LA 3T1MA 5A3NA 5DAXA 5CAZA 5CG9A 1AXKA 4IW3A 4QX8A 1VBA2 1AL21 4K1ZA 1LOBA 3DV8A 1RUE3 2QQKA 4O61A 4QKNA 4AWDA 4M3CA 2QQMA 4AEDC 4BQ5A 4CU8A 4QHZA 4KNCA 1C28A 2G9FA 2GH8A 4LO6B 1H9PA 4UW5A 3T30A 2OQ7A 1JU3A 4YGCA 5HBAA 2P3JA 3UK9A 5EYYA 3DF0A 3P3PA 2AC1A 2CGPA 1CWPA 4AGVA 5FZIA 3VBOA 5CFCB 4DZGA 2WR9A 4MHRA 3RS6A 3CZJA 5K0UB 5HCFA 3AJZA 1JZ6A 1WA6X 1TNRA 4UT5A 1LHWA 1FMD1 3PHMA 4UW3A 2GH2A 2JIGA 5A3MA 3I97A 5C4WC 1NCRC 4YPJA 3LB9A 1RUC3 4HVRA 2GP5A 2D93A 4P9XA 2XGXA 3ZXGA 1RUOA 4G4FA 2VXJA 3T2OA 1KDMA 2QFEA 3ZFFA 5FQ0B 4Y3OA 2P37A 4PQQA 4NIIA 1XC6A 3POJA 1G9BA 5C5UA 3K46A 4B3NA 3MV01 4CU6A 3MPPG 3O0WA 4RFT0 1F5FA 4XC9A 1ST8A 2HEWF 4QX7A 1LOFC 4HKWA 4TTGA 1CAWB 4HBNA 3HBKA 5FO9B 2NQYA 4N53C 4N43A 2BGOA 5FPBA 4CEYB 1LTEA 4XXPA 3S57A 3H7YA 1PO22 4IGPA 1ZZ9A 1U12A 4FCAA 4BXFA 1QKQA 2E33A 4Y1YA 2LW8A 1DGWX 1KFUL 2D43A 2RJLA 3OPTA 4FO9A 4DXRA 2WNEA 1RUD1 5D21A 5CFCA 4RA0A 3JBG1 4K8RB 2XG3A 1POV0 3AL5A 1GQPA 3IDAA 4H7MA 1US2A 2WWSA 4W50A 3S30A 3TN92 5I0RA 4QT6A 4IL7A 4DINB 4WV8A 3PJQA 3ACGA 3ZN6B 2KA3A 3JQWA 1OT5A 1VAVA 5A3PA 4LULA 1D4M1 3WP4A 2JDPA 3BVCA 3WCSA 4B7KA 1RMU2 1FI2A 2VQUA 2Y26A 3MLKA 2A6YA 4LEJA 4L8QA 4YGEA 4LPLA 4ES9A 3WHUA 2VZUA 4YZ2A 1CIWA 1QXRA 1ZZ7A 3GBGA 5BXXA 2XR4A 1L7RA 1AR71 3HWJA 1VBB2 3I2IA 2B39A 1UPIA 2VULA 4FPEA 3HNMA 3MW3A 4KQ7A 3FBMA 4HPKB 1RUG2 4TXWA 4QXHA 4XIOA 5FYZA 1S0CA 5I0SA 1UN1A 2HYXA 5FPLA 1MEC2 2AENA 2RS32 3MF9A 3OG2A 1ULOA 3RQ0A 4CEYC 1ENXA 2WJSA 3OY8A 4AHZA 3CL1A 1WBFA 4AVVA 4CDUB 1Y7BA 3FUQA 5KC6A 3OF1A 5FZOA 5GKAC 3KT1A 2ZX1A 4XXAA 1WD3A 1OF4A 2CAVA 2GNDA 3B9IA 3PJYA 4LA2A 5EZWA 4CCLA 2YMZA 3USUA 1QOSA 2MPFA 3LA7A 2JKBA 1YQ5A 3A22A 3UYJA 5KXBA 5FZ3A 3D4KA 5FJHA 1S0JA 4NAOA 2MHFA 3ZDVA 1RXGA 5GZCA 5FLJA 3PL0A 3AZXA 1G86A 1M06G 3SXWA 1RUC1 2X29A 3HNYM 1DG6A 3LE0A 4FI9A 2WNUC 5A7OA 4JQRA 5BYNA 3TB0A 1UPSA 2H6BA 4AHWA 2JDHA 1D4VB 4FPFA 1CZTA 1KS4A 2K9ZA 2VBDA 4DFSA 2UYBA 3GYDA 3CJIB 4I0BA 1E57A 1GNZA 3AFGA 5IW0A 5KXDA 3VDDC 3RZGA 5CFCC 1PM7A 5J96B 2HWB1 2PMWB 3J7NA 3NKGA 3KV6A 4ZS2A 1X33A 3E5UA 3ASIA 3HN1A 2VCMA 5FPXA 2VBBA 5A3WA 3SH4A 1YUDA 2JE7A 1W6OA 4NUBA 4BMBA 3N9MA 1QMJA 1RUH1 1HRV3 3GZUC 4WVZA 2X5IB 1D4M2 3PMEA 1ZZBA 2ZEZA 3CNAA 4F83A 2JDYA 1QJX3 2NPIA 1H4GA 3R4SA 1SBDA 3WNNA 4I09A 3J8F3 3IMNA 4HT1T 4EYUA 1AR62 1AXYA 2F4LA 1K5MA 3JD73 2ZGLA 5FPUA 5I91A 3AXDA 2BVBA 2CV6A 2HWF3 2VCBA 4BK4A 2G9GA 5L73A 3AP7A 3ZXAC 1LHVA 1YIPA 2O8OA 2DDUA 2KR2A 2YG0A 5ERLA 5FYCA 1SPPB 1OFNA 1PIV2 5DUUA 3PUAA 1KQRA 5IAXA 4IEYA 1W2UA 3AYEA 3WNKA 1ZBA1 4CCDA 3KT7A 2ZGTA 5JCTA 1DZQA 1ZBE3 3THPA 5J1XA 4IEUA 5DZGA 4MVTA 4I2OA 4XACA 3WW3A 5JZGA 4AI1A 2G9ZA 2DCJA 4OI4A 3ITQA 4HVOA 3AK0A 5C3SA 1HRI1 1RL3A 1OURA 1QJU2 3ZR6A 4I3PA 3KQ4B 3EBRA 2X5IC 3ENRA 3ZR5A 4UAPA 4CP1A 3ZYHA 2VD7A 2JD9A 1W04A 4ZXEA 1QJU3 3NMBA 1SG3A 4ATFA 2CHHA 1UF2C 3VDDA 2WFF2 4ZPIA 2YGMA 3I2JA 2B42B 4ORFA 3CJIC 5HXVA 1OUSA 5FOBB 2WLPA 3WDUA 4LBNA 3ILFA 5FZ9A 2QJVA 4CCNA 1KGYA 3P6BA 3WQ7A 1OLQA 1XNKA 4GH4C 1W6MB 1XPWA 1RHI3 3B7MA 1EAH1 1EYBA 1WKYA 5CADA 1CX1A 4YG0A 2YC4A 1AJKA 1D2SA 1OFSA 2RM23 1QDCA 2QDNA 1UX7A 2WO2A 3C7FA 3MYXA 1WUVA 2VR4A 1XOYA 3QH7A 4LO5B 3ROUA 4C90A 4RYDA 3O0VA 1W8HA 2YU1A 4Z07A 3LA2A 3EQEA 2ARCA 1U0AA 3LIHA 2QZ3A 5JOXA 4QPIA 4R8HA 1MZ5A 4LKSA 4XDOA 2QBXA 2VVFA 2FDJA 2RE9A 2W1WA 1ZRFA 5EIYB 2HWC2 5B2GB 2FDIA 1SHWB 5FBJA 1SPPA 1REFA 4Z82A 3WF4A 1AYM1 3EMRA 5DDJ2 5JLVA 2CGOA 2ILMA 2WO7A 2IWGB 3P5BA 2CAUA 2VW0A 4A41A 1U5XA 3NV4A 3WUDA 1GKBA 1LOGA 3VLBB 2VOKA 2A6WA 4E4HA 4IV3C 3MBWA 1N1YA 3SQOA 4AQ2A 1QGLA 3H50A 2DV9A 4JGYB 4CRQA 3H7JA 4OUSA 4UFIA 5FYHA 5L36A 4X8NA 1RC6A 1YWKA 2D7FA 3AP4A 5F9TA 2D6MA 3VBSC 1B35B 5D2AA 4QKBA 3KD4A 1Q43A 3DPRB 3TN93 2D6PA 4CXYA 4ISRA 2OUJA 3LPGA 3LAGA 4A7KA 4BE3A 3M2MA 2J1VA 1I3HA 3T2PA 2D6NA 1UX6A 3OBZA 2WO1A 1FX5A 4E4ZA 1RMU1 3SH3A 2BP6A 1RUI3 4YARA 3THTA 2PAMA 2J1TA 1L7LA 1T6GC 3CJIA 1XE7A 5GLWA 3LOBA 2E7AA 2VQ0A 4N9HA 5BV6A 1KRIA 4NHXA 4JKLA 1PGW1 5TSWA 5K7PA 4QGNA 2C24A 1YJLA 2ZEWA 4CCKA 1JZ8A 1UMZA 4M0NA 4AG4A 2JG9A 4DNYA 3BTZA 1RUG1 4E4DX 2ET7A 2FHRA 3VKOA 5I0DA 1JI6A 5LRRA 1Y3TA 3RWKX 4GQ7A 4CP0A 2RS31 5DAWA 5IYYA 4ZHNA 2ZGSA 1O4YA 5DQ0A 2PHWA 2VMIA 4XJUA 4OHVA 1NA1C 3IPVB 1CN1A 1XYNA 2ARAA 1FT9A 5ANNA 4BU2A 3FFQA 1HV1A 4AEKA 5FZOB 4AK3A 2WNOA 5LBCA 3X29B 1FV2A 1RUJ2 3ETPA 3MLLA 4YG6A 1AR93 1NY72 5I8SA 1LULA 3GZTB 4JAAA 3DYOA 4LQRA 1MACA 2DF7A 4I01A 2VMHA 4Y4RA 5DUXA 5LA2A 4QB6A 2DCKA 1AL0G 1AX1A 1UOJA 4WM7B 2DFCA 2JECA 2JICA 2R041 3ZYGA 4MG2A 5ABJA 1NCQA 1PM4A 3VZLA 3ZFGC 3IWZA 2PHTA 1HXS1 4GMP3 4XFAA 5LRSA 4XJ9A 4TZDA 4P9YA 4BB3A 1NE6A 3WF2A 4X6RB 4KWLA 1HB2A 4YGBA 4BQ2A 1D7PM 5CG8A 4RHV2 2NZ9A 2ZACA 3IZOA 3Q8EA 1W2OA 1RUF3 5EFUA 1QF3A 3P3NA 4FPKA 5FYIA 2QCSB 4Q0UA 3SHRA 5B4NA 3O1VA 5CA6A 5FDBA 1TME3 1UW8A 3HIFA 4UYBA 4PIXA 4YW2A 5A3LA 3VGIA 2D3RA 5T54A 3H8RA 5CYYA 2XUEA 5IHRA 3VHPA 1DHKB 3SH5A 1GZ9A 3NV3A 1LRHA 1OUXA 3HN3A 3U10A 2CSGA 1QQP1 3FMGA 3LDKA 4GJZA 4LBMA 4CEYA 1T2XA 3I3MA 1JXNA 1G9DA 3WDVA 1BMV1 1HB4A 1CAWA 3VZOA 4AEDB 2ZXQA 4OI2A 3UKVA 4ONUA 1AUYA 1BBT1 3BPSA 4QQHA 2YB7A 4OMDA 4YZ3A 5FZ1A 4PQ9A 5J7MA 3ZXDA 2PHUA 3NNLA 1NA1A 4IV1C 3GHNA 4UF0B 3DYMA 1JYWA 2GDFA 2VOXA 2ZGPA 2AGSA 4DRVA 5HI0A 5F37A 1TEIA 2ZZQA 4UF0A 4LT5A 3GZEA 3RRDA 1YFWA 5T5JA 3VN4A 5EQUA 1QJY3 2QQLA 2XJQA 3N35A 5KXCA 1AR72 4Q0PA 4XILA 3WUCA 2ORZA 1O59A 3CEWA 1ZZCA 5IVBA 4CTEA 5M0TA 5FIXA 4LTAA 5FKBA 2G19A 4DXZA 1S0BA 4ARYA 3SEEA 3GM8A 3WR0A 1JTZX 1HQLA 3C7OA 3ZFEB 1C8M2 2VMEA 2PHLA 2VOTA 2JG8B 3AMHA 3GJBA 3TNQA 2ZMLA 2MEV1 2X53S 4P9LA 4AVTA 3LEMA 5C8CC 2VNGA 5DG2A 3RVHA 1UZZA 3E97A 2HBTA 4TLFA 4Y22A 1XU1A 4AI8A 2BNNA 4LIVA 2JDAA 4FQ4A 5J36A 2JDNA 1YO8A 1HQNA 1UNBA 4P5YA 1G6NA 1N1SA 3ATGA 2WZR3 3ACFA 3BODA 3VD3A 3NNMA 4GULA 3ZSJA 4BQWA 4FAGA 5BNNA 1OOPA 4IEWA 3UETA 2RDQA 5CZKA 1WCKA 4QHBA 1WW6A 2MEV3 1HDKA 2XJRA 3K4DA 2LROA 1D2QA 2VNRA 3AX4A 3FZ3A 4LUKA 4N43B 5APAA 1S2BA 3I3DA 2BPA2 3T2TA 1H2KA 2VZ3A 2QE3A 4ZXKA 2XDVA 1PO13 4JDOA 1HX6A 1HIXA 1W6MA 2BZDA 4IE7A 4NROA 1O5LA 2F6BA 4PLOA 3E5XA 4QX3A 1W90A 1Q3EA 3GCXA 2IXJA 3VD4A 1CD3G 1F5JA 1EPWA 4YW3A 5BNPA 1MQTB 1SLIA 3VBFB 4Q0SA 4C0BA 4XJ8A 2RJKA 2HBUA 2VCAA 1W8ZA 3PTRB 3AMNA 3TAYA 1MVQA 3D3AA 3M1HA 4RQPC 4N9IA 3S6PA 3LSEA 3I49A 1N3OA 1YQ2A 4LHSA 2R1DA 3RG0A 3AZYA 1NLQA 3JBG3 2W46A 3OB8A 3RPQA 4NWVA 1JHNA 2QQWA 1SBFA 3ACLA 3I3BA 2BBVA 1ND2B 1VBD2 2ET1A 4MGSA 4P9GA 4DO0A 5FZKA 1J1LA 4IEQA 3Q8AA 1ZBA2 4XZUG 2LTNA 1OLME 2WNVB 2E9QA 2X10A 4PF5A 1OVSA 4NWWA 4EWEA 3J7LA 2EIDA 4MXVA 4JGZA 5C5TA 2A6VA 1AR92 5HXMA 5F6LB 1MS9A 3N9OA 4ISQA 5FXWA 3RSJA 2R043 1HRI2 1B35A 1J83A 3PUQA 1NCRA 4H14A 4OHYA 1DDLA 3ZVXA 4NHYA 2GNBA 1MZFA 1LOFA 1PVC3 3POFA 4JVAA 3DGTA 5F2WA 4PLNA 4PI2A 4N43C 3UT0A 1LNSA 4NVPA 3AP6A 4D7YA 4IEXA 4N53B 3WNLA 2ZTNA 3ZX7A 4XAAA 2XVGA 2VGDA 2WNVA 4QXCA 4HANA 2QTWB 2IFWA 3IM0A 1CAVA 4IV3A 1QJX2 2Q8OA 1L3JA 3LQCA 1Z7S2 4QKDA 2BW8A 3ILNA 3H3LA 4QPGC 5FJKA 5I8TA 4QPIB 4AEJA 2D3PA 4Y20A 3AKSA 5LA9A 5C8CB 1JZ4A 1UYXA 2WAOA 1JUHA 3KGLA 3OGRA 2L9LA 1WW7A 3BB6A 2D5FA 5T55A 4AI3A 1QXJA 1LODA 5C4WB 2P3KA 1LOEA 5IT6A 3PIJA 5A7WA 1UIKA 4N90A 3MICA 2XB6C 1W8NA 4NPMA 1F2NA 3W9AA 1AYM3 3BGAA 2VW1A 1TE1B 1W99A 5K0UC 5IVEA 2XONA 2Z69A 2W3JA 4ASKA 1BBT3 4DXTA 3I59A 4QPWA 1DQ0A 5E16A 3UKNA 4MGYE 2V72A 1F9KA 3OGSA 4KG8A 4NIDA 2TEPA 4YW6A 1W3XA 2VNOA 3ZKYA 3IIAA 3H8UA 3WNMA 2JG9C 1AYM2 3PUHA 4LK7A 5DDJ1 1PGSA 2GAUA 1G8WA 4L9BA 5A33B 3S5QA 3U78A 4Q4Y1 4C0HA 2GN3A 3LIGA 1VAMA 3MEPA
chains in the Genus database with same CATH topology
1RVF1 1PHMA 4YM1A 4P9WA 4WVMB 4EN9B 4K6BA 4ES8A 4FOQA 4IETA 3KLSA 5BNNB 4R4ZA 1GR3A 2O0OA 3W59A 4R52A 4YRDA 4AFCA 4AQSA 4CDXA 4GMP1 3JU9A 2XHKA 3LSDA 1GZWA 2NYYA 1AXZA 4XBQA 4B4PA 1RUJ1 3MZHA 2O8QA 3MW2A 1AYN2 4F7ZA 1PMIA 1C5IA 3OBTA 1PGW2 1GBGA 2OUHA 1QY4A 4Q27A 2E7TA 1SLLA 1FMD2 3ZIXA 3AM2A 4L11A 4FOYA 2UY9A 2A6ZA 1YCIA 5GZDA 5JIAA 3VZJA 1H8VA 2D3SA 5DDJ3 2PHDA 4KL1A 4M0HA 2R0HA 4IEOA 3J4UH 1ND3A 4D7TA 5IUQA 4EN6B 4Y1VA 2ZPXA 4CDQB 2LUWA 4WZFA 1NOVA 4QMAA 4OI0A 1KD7A 4GWMA 3WDXA 3VBRC 4Q4Y2 5FFOC 1DGLA 2XKPA 2QVSB 2E51A 3GBFA 1YXWA 1EY2A 1J1TA 2Q4SA 4IV1A 2YY1A 5H9QA 4AYUA 4Y1XA 2K0GA 4Q2FA 1XNCA 4TSVA 2BYVE 1URXA 3WW4A 3M3IA 2FQPA 2R32A 4E2GA 4FXKB 4MZUA 4CP2A 2ZX2A 1DF0A 4FQZA 2DFBA 4FPLA 1PGL2 4NO4A 4Y1ZA 5KHJA 4HL0A 3O14A 1W39A 3VHRA 2IFRA 1UZYA 1ASJ2 4Q4V2 3VKMA 2JEMA 2VVEA 4WZCA 1R091 1WW5A 4PBOA 1K5MB 4G3YC 1C5HA 1VLNA 3WDYA 5LK7B 1FATA 4KH9A 4HPKA 4XFIA 2RM22 4COYA 4KU8A 3UJOA 3WQ0A 3U07A 3WZ1A 4BMEA 1YI9A 3CF6E 4FXGB 5IK4A 1GANA 3DKWA 4FOVA 1LOCA 1I1EA 3R6SA 1ULDA 3VKNA 3WG2A 2QNKA 1AR91 3AYDA 1YFUA 4ZU7A 1DQ4A 1O3QA 1I5ZA 3ZIWA 1H8TA 4HSLA 1LOAA 3VKLA 4Q4W2 4UW6A 1WMFA 4HK8A 1B09A 1OPMA 2GMMA 1LEMA 2D40A 3VBRA 1C4RA 2XBO1 4QPIC 2RS33 1N47A 1AVBA 3HQXA 2YXSA 1BEV1 4HSJA 2DVBA 1RJ7A 1IS3A 3ZSKA 2DUQA 3ZXJA 4G9SB 1Q5OA 5JSOA 1WCDJ 3DUIA 4QX5A 5E89A 4TYSA 1J58A 4EV0A 2EXKA 1KS5A 3HAGA 3ECQA 3PTYA 5F1RA 1QDOA 3H9AA 1VJ2A 1Z0HA 5T50A 4QGMA 1JH5A 1POV1 2ZZJA 1V6OA 3VBHB 1V6KA 4XFGA 3C3VA 4I3GA 2WC2A 1HV0A 2SLIA 1OQEA 1PK6B 1R081 1TMF3 5FMOS 3M3CA 3VBOB 4AGRA 2YC0A 4J1XA 1POV3 3AZVA 2BQPA 1IS5A 4MSVA 3VV1A 3QCWA 1AR83 1ND2C 3NAPC 1QOTA 2ZOEB 5JIUA 4XFFA 3WHTA 4AGGA 1BZWA 1KDKA 2W52A 2GC2A 3J8F1 2WSUA 2JJ6A 2VG9A 4NOTA 3JD72 1QNWA 1VAKA 5C9AA 2D6LX 3FX3A 1C8M3 1DZRA 1WMEA 4OLLA 1XNDA 4FT8A 4HN1A 4K40A 4XETA 1MZ6A 1A8DA 1PK6A 2WQ4A 2WL1A 4LHLA 1BEV2 5FCCA 3QLQA 1RHI1 4FSJA 1VBD1 2RS12 2WFF1 2PELA 1XU2A 5A33A 5JPMB 4L2NA 3VZKA 1AYN1 4XDQA 4PDWC 4M3CE 4MGIE 3I2DA 3H3UA 2XL7A 1C8NA 2Z42A 2QKDA 4HKLA 4COVA 5LEKA 4OVEA 3SLIA 2GZWA 1GYKA 5KHKA 4Y1UA 4F3JA 4LBQA 4XJWA 1IQAA 3VZMA 1OKQA 3B69A 2WINB 2XJTA 1ZZ6A 5JI7A 3B00A 1ZYBA 3KZ4C 4PLMA 1HLCA 4XTMA 2XJUA 1UU4A 1UIJA 4GKXA 4M01A 1BYHA 4K7JA 3KQRA 4LBOA 1PZ9A 3EHKA 1VB4A 1WA4A 1ULGA 3VUOA 2W0XA 4FPYA 4NR1A 2C5DA 4Q26A 3ZYPA 4DB5A 4JTNA 5EWSA 1IHMA 1COV3 1PO21 4WVMA 2JG8A 2WZR2 2EA7A 4KU7A 4AVCA 1RUI1 4M00A 1JN2P 2DURA 2HWC3 2X5IA 3NW4A 2C9AA 1RTVA 2D97A 2GC0A 4MV2A 4Q1RA 1RHI2 3FJSA 3B01A 1LENA 4QQLA 3ETQA 3FLPA 3OPZA 3ZYJB 4KGGA 4Q4V1 3VBFC 3SMHA 4AFAA 1ASJ3 1QWRA 2CWMA 1AL22 5ACA3 1R092 5JWPA 3M4FA 2IZWA 1CJDA 1LB2A 1ZREA 4JGYC 1UCXA 2DVDA 3ZDSA 4LBQD 5EJ3A 3H1YA 5C4WA 2BTVC 2ZGKA 4B29A 2DCTA 4BLJA 1TNFA 5C8CA 3MDPA 1PVC1 4Y20B 4FTEA 4B4QA 2NLRA 5KWRA 1ND3C 1NLSA 1FPN1 2ZX0A 2Q0AA 3C2UA 2XJSA 1MQTA 4XTPA 1NYWA 1QHDA 1NY71 4BIFA 1FXZA 4XW3A 4CDQA 4N53A 4XHXA 2IXLA 1RIRA 4B7EA 3J26N 1OLRA 4JDMA 1J3PA 2CNAA 5HCBA 1RUC2 3WCRA 2IXHA 2PLV1 3ZSLA 1NCRB 2UYAA 1HXS2 1O91A 3NJZA 2WS91 1G7YA 3IDCB 5FLHA 1GNHA 1OQ1A 2ZAAA 4JGZB 4SLIA 2HWB2 1MEC3 1WLCA 4MX3A 4D69A 5GJ6A 5CFDA 4DRRA 3VHNA 4Y22B 4Q4X3 2AUYA 5GZGA 1BK1A 2UWCA 2HWB3 4FVVA 5FO7B 4MXWB 4RL7A 4GWNA 1QXPA 2GU9A 4EROA 1DIWA 2VW2A 4LA3A 2NMNA 3AMMA 2HWE2 3FHIB 3WY6A 5SV8A 1CAUB 4C1WA 2OYZA 1X8EA 1GSLA 2AH2A 4BOWA 4MGZE 5FO8B 4XPVA 1VRH3 3SISA 1H4HA 3KGZA 1C3HA 5K8SA 3KT4A 3OJBA 3M7AA 2I74A 1PVXA 2JG9B 3AYAA 1IKPA 1YI7A 3I4IA 5FTTC 1OMIA 1CR7A 3PVEA 2TUNA 4QQ2A 1C1FA 3V0AB 1YYNA 4RGGA 1LESA 3JB4C 2B5HA 1FOD1 3E6DA 3VBRB 1UKGA 4XQDA 3NSTA 4LO4B 1U5ZA 4YVWB 1RUH3 1CAUA 1X50A 3HD8B 2GC1A 3NV2A 4JGYA 1RUNA 3AP9A 1KJLA 1RINA 4L92A 1RUE2 4LLOA 2I07B 2BGCA 4HLTA 2JXAA 4RHV1 3AJYA 2ES3A 2DU0A 2HYKA 3D0JA 1AYN3 4XMIA 1JBCA 1YLLA 2ZABA 3JCIA 4Y4YA 1COV2 5BY5A 2NM1A 1LJ7A 1BMV2 4U36A 3S7EA 1VALA 1D4M3 3ME2A 4XHBA 5I93A 5L7OA 3WX5A 3TRSB 4UBGA 3SCHA 3WXPA 1O7FA 2ZHMA 2JD4A 4COUA 3WV6A 1RGSA 3JZVA 4OULA 5K9YA 5GALA 1DQ1A 3OTFA 4CDXC 3IPVA 2XLAA 1ZBE1 1UD1A 3D6EA 3NAPB 1R082 1RUI2 2EXIA 1NQJA 5FAXA 3D8CA 4XJAA 3KMHA 3VBOC 2W39A 5EXOA 2IXIA 3ES4A 4BCUA 2DTWA 4AQTA 5JOYA 3E6CC 1C8M1 4P9JA 3MLJA 3AZZA 3MFCA 2CL2A 2MEV2 1AL23 5ACA2 1V00A 5DZFA 2G4IA 3S0MA 5JDBA 3N7KA 1IS6A 4NHMA 2ARBA 4M3CF 2UU8A 4OI1A 4BYYA 1PVC2 5LEJA 2W08A 4LHNA 1XQNA 1YHFA 3D82A 5KBFA 4WM8A 1OA2A 4CDWB 4E9KA 3TOJA 1SLBA 2B9UA 4BLIA 2ZX3A 3IKWA 1OOPB 4ZKTB 1VIWB 1H2NA 2NMOA 1VBC2 5JSPA 2ZS6B 5JI9A 5L7OC 5BUVA 2ZKLA 4Y5Z0 3TBDA 4I0WB 2R16A 3D5OA 4PIZA 4S2GA 1CX4A 1RUF1 1UU6A 1VBE1 2DUPA 3ZFEC 2X8KA 3V0BB 4L99A 2HJIA 4XFCA 1IPKA 3IDEA 3H1WA 2WS92 4XJZA 5HCAA 1ZRCA 4YVSB 1SQ4A 3L2HA 1H30A 3SNMA 1S2KA 1V6IA 3M8LA 3VBFA 1WGPA 5E1RA 2R073 3PVBB 2D98A 4D94A 2LALA 5FRAA 3GF6A 3N7LA 5AC92 1ZNPA 3POWA 1NZCA 3I7DA 1BVP1 3MIFA 1OPOA 1WCSA 2JE9A 2P3IA 3O0XA 3OD0A 4HMZA 4FTBA 4N7IA 4W6WA 1LECA 4XYXA 4RR3A 2HWE1 3AKRA 3ZO0B 2R062 4LBLA 3WQ1A 2C0ZA 4E2SA 5T5OA 3OY8B 2RS13 5DUVA 1B35C 1H1IA 1BBT2 1S0GA 1Y9QA 2RHPA 1LHOA 1RUG3 2H0VA 4L97A 4AI0A 2SBAA 2ZGOA 3FLTA 3M3EA 3OGJA 4O9GA 1FPN2 5KHIA 4WVVA 2YYOA 4NHLA 3ZPYA 3JB8A 4RD7A 3L2YA 3KCCA 3PNAA 4BM8A 1WMDA 3TYJA 5IK8A 5J3UA 1SLAA 3NWKA 1UAIA 2BVVA 1Z7S1 2HWD3 3ZFGA 3WNXA 2OPKA 1SFYA 1H0BA 1SCSA 1MVEA 4QM8A 3RYRA 1GZCA 1SBEA 4AFBA 4Z8BA 1LCLA 3R05A 4GB31 4OHXA 2OW4A 5JSRA 2ZMNA 2N7GA 4ZU5A 1IS4A 3INAA 2AZ5A 3G7DA 3WT3A 4AHYA 2JDZA 1AR63 1TME1 4HFSA 1OI6A 4P5HA 5KHHA 1PZ7A 4COZA 2BFUS 4GH4B 3V56A 2PLV3 4K1YA 5AC91 3EXUA 1ND2A 2RR12 1EV13 1GV9A 2K2SA 3POYA 4IXLA 1PO12 5T3NA 2DVGA 2PLV2 4O9EA 4YZ5A 3NAPA 1ZRRA 2ZGNA 3ZFFC 2VUAA 5FBZA 1J3RA 2VMGA 2ZAHA 4S2HA 3O12A 2ATFA 2VQAA 3KM5A 1X7NA 3LGRA 3ZXFA 5EV7A 1RITA 3CU7A 4UXAA 5FPZA 4P9IA 3ALQA 3RNSA 3ZXKA 2H0BA 1CPMA 2EAAA 1O4TA 1S55A 2EIGA 2DWRA 3H0OA 4FP2A 4FOWA 4JDNA 5BPXA 1JUIA 4Q4Y3 4W6XA 1V6LA 1AF9A 1GLHA 2LM3A 2OA2A 1ZBE2 2PN5A 2GMEA 1PK6C 4S2FA 2PHXA 4KWKA 1MS4A 2DTYA 2RM21 1JYCA 2PHFA 3A0NA 3MIBA 2XWJB 4YYOA 3WW1A 1EV11 3B9CA 4LR4A 4GB32 4WM7A 1NQDA 4NN0A 1QH6A 1FAYA 1HRI3 4C91A 4DQAA 3A0KA 1BKZA 2A75A 1N1VA 2EVXA 1XXNA 5GZEA 1OOPC 1CAXB 2D6OX 3ZN6A 2YHJA 4YVSC 3VZNA 4QQOA 1SACA 2ZX4A 4CDWC 3H1MA 3FFZA 1BJQA 3WVJA 2EF6A 3RDIA 1R1ZA 2H6CA 4J6GA 3RWNA 4BZ4A 4YM2A 2A73B 2YV8A 2JG8C 2ZGRA 5AVAA 4FPOB 4CEWC 5C33A 2XLGA 1UKRA 5JOZA 1QJX1 1VBD3 2R0FA 2ZGUA 3OGGA 2B45X 4Z1VA 1NA1B 1TQ5A 4YG3A 4FAHA 4HN0A 1LHUA 2ETEA 2BWAA 2WA3A 5BNOC 2XBO3 2B7YA 2C1FA 4RS5C 2WFPA 1ZM1A 3N3HA 1Z7S3 4AFMA 1Q8VA 1ASJ1 1VBB3 3K51A 4K9SA 4R9DA 1GFF2 3CJXA 5FLIA 1A8MA 2BEOA 3QOPA 3FUOA 3MIHA 5A32B 2QDRA 3WW2A 2V73A 1Y43B 1U5YA 4KWJA 5IK5A 3IN9A 1C1LA 4MLOA 2IXKA 2D6KA 1V9U1 2XL9A 4I30A 3ZN5A 2WZPP 1QNYA 1J59A 1DGRN 4BHPA 1MQTC 2E7QA 2D5HA 2KXLA 2WQZC 3KSCA 1AX2A 4UW4A 3HT1A 5T5PA 1YRZA 1RVF2 1XNBA 3AZWA 5DG1A 1NCQB 3E6BA 4JTOA 4CDXB 2YDEA 1LR5A 1QH7A 2WFF3 4LBJA 1LU1A 2Q30A 2EAKA 4FPCA 2O1QA 5L19A 4R4XA 1RVF3 3POSA 2HWF2 5JZGC 4YW4A 5A32A 3IBMA 1RB8G 1XE8A 2Y38A 3ZFFB 5C8WA 4ASMB 1GQGA 1O5UA 3VDDB 1X36A 5CBLA 3ZYRA 4B4RA 2Z79A 4WM7C 2DU1A 2JX9A 2DCZA 3LOIA 5K0UA 3APBA 1WLDA 2ZHKA 4E2QA 4A2UA 4XF4A 5D8AA 3MGUA 3GZAA 5C9AB 3NKTA 1N3QA 3TNPB 1O4ZA 4JC1A 2FBEA 3AP5A 3WDWA 1WBLA 3VL9A 5F6KA 2IXCA 4YZ1A 1ULCA 1F8VA 2RR13 4V1PA 3VL8A 3K48A 3HMYA 3NL1A 1A6CA 1S0EA 3USUB 4EWAA 2A6XA 1VBE2 2CGNA 2BFUL 4CDUA 4OHZA 4YSFA 4XF0A 3IT8A 1VBA3 1JYIA 4W6YA 2XLFA 1YFXA 4XE9A 3RMXA 3T1LA 4YZ4A 1HQWA 1AR81 3PLQA 4FP3A 5BNOA 1Q8PA 2VECA 1R1A1 2XJPA 1UL9A 3QD6A 3AMQA 4HKOA 1CVNA 4EN8B 4Z2WA 2RS51 2PHRA 4IEPA 4BPZA 3DL3A 3WP5A 2AREA 2AR6A 4LHKA 3AFKA 5GZFA 2TBVA 4PDWA 4OZXA 4E4SA 4BA6A 2GNTA 1W6QA 2ENRA 2ZKNA 4LBKA 3ZSMA 2I2SA 4MGKE 3RMYA 3LA3A 3BU7A 1VBB1 1YIFA 4AF9A 1SMVA 1FV3A 3LKJA 3SCFA 3R0RA 1AR73 4URTA 2OVUA 3M3QA 3R4UA 5JPNB 2PFWA 4XEZA 1Q56A 1V6MA 2Y0IA 3WP3A 1AHSA 1N3PA 1FNZA 1QJY1 1OA4A 2ZGQA 4Q4W3 4IQPA 4YNIA 1M4WA 3EO6A 4JV4A 1H8TB 2ZMKA 4Q1PA 4JGZC 4GIQA 4K8FA 4META 1V70A 2WS93 5KXEA 4GA9A 5FQ0A 1ZX5A 3V64A 1ND3B 4IERA 4RSUA 1C57A 4A3XA 5L7OB 4RHV3 1ONAA 4BWOA 2A70A 2D44A 3EJKA 3HBZA 2FMYA 5I8YA 4LNVA 2GALA 2WZR1 2PA7A 1TME2 4GMP0 3W58A 1PZ8A 2F4PA 1W0OA 4Y24A 5C6CA 3MFAA 4XMAA 3DN7A 3MIGA 5AFBA 1SCRA 2FZ2A 2PQQA 1CAXA 5DZEA 3UL2A 1EP0A 1PGL1 2BNOA 1VP6A 4WVWA 1REDA 4YW5A 3MPBA 3UKTA 5FOJB 3PVNA 4AEMA 3V65A 2HEYF 1AR61 2Z5WA 4RQPB 4RGAA 3DPRC 1H1AA 4Q29A 4YVWA 3ZXEA 4QQPA 3BPZA 2VVDA 1CESA 1WW4A 3MW4A 1ENQA 2ZBJA 4COWA 1XYOA 2A5ZA 5GLTA 1QJY2 1UU5A 2EXJA 1IZ3A 3WG3A 2E63A 4LO7A 4UBHA 3J8F2 2VPVA 3BALA 3V0AA 1LU2A 3AKTA 4XFBA 4JRLA 4LUMA 4IEVA 2PAEA 2YPJA 2VUJA 1QOOA 4QXKA 4LLFA 3OYWB 4Q4W1 4PJYA 3FWEA 1BQPA 4ATEA 4AEDA 4H7LA 4X6QB 1REEA 1S0FA 1X82A 3KS7A 2GSYA 2WIIB 1MS0A 2WT1A 2Q5TA 1CONA 2WNUB 3HR9A 1OD5A 1H9WA 4QPYA 1N1TA 1U5IA 3GNEA 3N7JA 1ULEA 5CFDC 4R9BA 4MYEA 1VRH2 2DCYA 3M3OA 1XYPA 2UURA 4XF1A 4GH4A 5GLVA 1WLTA 1LEDA 3WDTA 4A7ZA 1RUH2 4Y26A 3USSA 1HRV2 3OBRA 2RMU1 4NHKA 1DYKA 4EN7B 4ASLA 1NXMA 4DMIA 1H2LA 2VOVA 5AFEA 3ZMNA 1D0GA 1ENSA 1APNA 3RI9A 1DFQA 3QH6A 3LWCA 1DGRA 5LK5A 2TNFA 4Q0VA 2P34A 2HWC1 1J3QA 4U2AA 1V9U2 1KITA 3MIEA 2OZJA 3NV1A 1Q8QA 2WKKA 5CB7A 4DPNA 2HEVF 4FPJA 4HK9A 2PYTA 4YM3A 4EN0A 3VKFC 2B46X 1AR82 4GXLA 2CY6A 2XUMA 4LE3A 1W6PA 3KCYA 4AHXA 3OD4A 2QQPA 1H1MA 3RJRA 2FZ1A 4AVSA 3U0ZA 2A3XA 2XWBB 1YJKA 1FNYA 1X8MA 3M70A 1BVVA 2RS52 1W6NB 1ZVFA 2HKXA 3AMPA 3E5QA 3AB0A 4YGDA 3U11A 4RR3B 4YW1A 3B5LB 3VBUC 4J1WA 4OHWA 3ELNA 4RS5B 4XZPA 2YGLA 2RS53 5D1IA 1HKDA 4XFHA 2XJVA 1LHNA 1XRUA 4PBPA 1EPZA 1PNFA 3VBHC 1O3TA 1MS3A 4D7SA 2HWD1 1VBE3 2ERFA 3FBYA 2HWF1 3Q9OA 2GNMA 4HETA 4CEWB 1IKQA 3U4XA 4QD2A 2XPJA 1VBC1 4YFWA 3B3QE 4OFGA 4CZSA 2WT2A 2V09A 1ZBA3 1HXS3 1H8TC 4IEZA 2R49A 2R071 2ZGMA 2ZA9A 1CGPA 3UV9A 4LO8A 4MH0E 2R042 2WNVC 3L9JT 2PTMA 2WNUA 4Q4V3 2DUOA 4A7YA 3IDBB 4Q4X2 4QPGA 5H9PA 4WM8B 4DOUA 1DQ2A 1OHFA 4LBQB 4Q8KA 2CWSA 1R1A2 4R9AA 4INDA 3I8TA 1D0HA 3JUUA 1KJRA 3B93A 3VBSB 4XF3A 1R1A3 2EXHA 4ITCA 2R061 3VBUA 1ZZ8A 3AKPA 3URFA 2W68A 4XQWA 1IPJA 2I45A 3AXEA 3SITA 4YVSA 1IGOA 1VBC3 1DU3D 1PNGA 1DZTA 3H3ZA 1RMU3 2GN7A 2FMDA 3KCXA 3WLUA 3BOWA 3HT2A 4YM0A 1DGWA 1KFXL 1G9FA 3RJ2X 4XBNA 1I9RA 4D3WA 5I0UA 5C9AC 4XF9A 1FOD2 2R072 4CEWA 2VU9A 1DBNA 1RUF2 3NVCA 4I0AA 2R30A 4W65A 1WD4A 3ZFEA 5JOWA 2KM2A 1DQ5A 4KBBA 5DXDA 5J37A 1O3RA 3CO2A 4PCRA 1VB2A 2CYFA 4H55A 1CQ9A 1LGBA 5E8AA 2XKOA 5GLUA 2VXRA 5SV5A 1ENRA 4RS5A 2R063 3N7MA 1V6JA 4FBFA 3RYKA 2XVKA 3KB5A 3VBHA 3VHOA 2RR11