1NA1C

The structure of hrv14 when complexed with pleconaril
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
total genus 39
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1na1C00
4Y4YA 4CDWC 2R042 4GMP1 1K5MA 1QJU1 1IHMA 1ZBA2 5CFDB 1M06G 4RHV3 1Z7S1 2MEV2 1POV1 1PO23 4YVSB 2R071 1COV3 2GSYA 1ND2A 1RUG1 1NA1A 1B35A 2HWC3 1AR61 4NWWA 3JD71 5K0UC 1NCRA 5JZGA 4RR3A 2X5IB 3ZFGA 2QQPA 4RHV2 1PO22 5A33A 1COV2 3ZFFB 1VBB3 4IV1C 2BFUL 5LK7B 2HWC2 4CDQB 4IV3B 4Q4X2 4YVWA 1ZBE1 4N43C 5D8AA 2VQ0A 4RQPC 2HWF3 4CDWB 1NG0A 3TN91 4QPGB 1VBB2 1AUYA 2R061 2RR13 4Y5Z0 1FMD1 1RUC3 1ND3B 3LOBA 4AEDB 1QJY3 2HWF2 4JGYC 3IDEA 1PGW2 1Z7S3 1RHI1 1AR91 1AYM3 2PLV1 5C8CC 2RR12 3ZFEA 1R1A1 1VBA1 3M8LA 1RUC2 1AR63 4IV1B 1RUJ3 3JD73 4JGZC 2R041 1QJY2 5CFCA 4CEWC 5BNOA 1R083 1Z7S2 4GH4C 1PIV3 1RMU3 1OPOA 2MEV1 1AYM2 4N43B 4RQPB 1PVC1 1OOPC 1RUJ2 1QJX1 3JD72 3CJIC 1W39A 4JGYA 4WM8B 1R082 1PIV2 1RMU2 4QPIC 1HXS3 1VB4A 4JGZA 2HWC1 1FMD3 4Q4X1 4FTBA 2WZR1 4GH4A 5BNPC 4PDWB 3S6PA 1VAKA 2FZ1A 1HXS2 1V9U1 1K5MC 1RHI3 1OOPA 4CEWB 1VBB1 1A6CA 1CD3G 1FMD2 4RS5A 5FOJB 1NY71 1C8NA 1NA1C 1B35C 1RUF1 5BNNA 2WS93 3CJIB 2HWF1 2XPJA 1VBC1 1NCRC 1RHI2 3ZFGC 1PGW1 3VBUA 1AR71 1PVC3 4QPIB 1AL23 3VBSB 4Q4W3 1QJX3 1F8VA 2WS92 1QJY1 2RS31 4N53A 2RS11 1MQTB 4YVWC 5BNPB 1AYM1 1PVC2 5D8AC 4RFT0 1AL22 5C9AA 4Q4W2 1QJX2 1RUJ1 4Q4X3 3VBFC 1SMVA 2WZR3 1GFF2 1ND2B 1R081 1NA1B 1B35B 1PIV1 1RMU1 1BBT1 1V9U3 4CEYA 1NCRB 2BPA2 2RM21 5JZGB 4RR3B 3ZFGB 5J96B 3ZFEC 2WZR2 5A33B 4Z92B 4Q4V1 1RUF3 5FMOS 1VBC3 1V9U2 1HXS1 4CDUA 1AR73 1QQP2 5CFCC 1RB8G 5BNOC 4YVWB 3VBHC 3VBFA 5D8AB 1NY72 3DPRA 1RUF2 5K0UB 2RS33 1VBC2 2RS13 1NCQA 2WWSA 1AR72 3HAGA 1HRI1 1VBD1 1VBE1 1OHFA 5J98B 2WLPA 2ZAHA 1FOD3 1X33A 4GB31 5ACA3 1AR83 2RS32 2WS91 1ASJ3 3ZFEB 2RS12 3NAPC 1BBT3 3VBHA 5C4WA 2RM23 1AL21 4Q4W1 1RUH1 5CFCB 4CDXA 5ABJA 5BNOB 1EV11 3VBOA 1FOD2 1HRV3 5ACA2 1AR82 4Q4V3 1ASJ2 4RS5C 1BBT2 5BNNC 3J8F3 2RM22 4JGYB 2IZWA 3VBRC 1QJZA 4GMP0 1H8TC 3VBUC 5C8CB 2HWD1 1RUI1 1E57A 1HRV2 3NAPA 1POV0 4Q4V2 4FTEA 5L7OC 4JGZB 1AYN3 1PGL2 3J8F2 2BBVA 4N53C 1VRH1 1QQP1 4GH4B 1HRI3 1VBD3 1HX6A 1EAH2 1VBE3 5DDJ3 5C9AC 1TMF3 1OOPB 2BFUS 4GB33 1AYN2 4NWVA 3VBRA 4RS5B 1H8TA 1AL0G 1HRI2 2RS53 4YVSC 1VBD2 3VDDA 1RVF1 1VBE2 4CEYC 5DDJ2 1RUH3 5A32A 5L7OA 1TMF2 1EV13 3VBUB 4GB32 2Y26A 2X5IC 3JBG3 2RS52 1RUE3 4WM7A 3ZFFC 4WM8A 1K5MB 1R091 4N53B 1RUH2 1RUD1 3FBMA 4CDUC 1EV12 2HWD3 1RUI3 1MEC1 1WCDJ 4IV3C 1FOD1 5CFDA 5ACA1 1AR81 2DF7A 1ASJ1 5C9AB 3JBG2 4YVSA 3DPRC 2RMU2 1RUE2 1VRH3 1QQP3 4QPGC 1NCQC 2HWD2 1RUI2 2X5IA 1HRV1 2HWE2 4CEYB 1HQNA 1ND3C 2ZZQA 4AEDC 1C8M3 3ZFFA 5GKAC 1PGL1 2XBO3 1VRH2 3J8F1 4CDQA 2HWB3 4IV3A 1RVF3 5C4WC 1EAH1 1PO13 1BMV2 1DDLA 4CDWA 4CDUB 4CDXC 5ABJC 3VBOC 1C8M2 3VBFB 1AYN1 4QPGA 2XBO2 1TME3 2HWB2 3DPRB 1RVF2 1ND3A 1R093 1PO12 1RUD3 1FPN1 5DDJ1 4AEDA 1MEC3 1TMF1 1NCQB 2WFF3 4SBVA 5K0UA 5AC91 4Q4Y3 1BEV3 1TME2 4GMP3 1QJU3 2RS51 1D4M1 1R092 1X36A 4IV1A 1POV3 1RUD2 1MEC2 2R073 2WFF2 3VBHB 5C4WB 1RUG3 2TBVA 4FTSA 4Q4Y2 1BEV2 4N43A 4PDWC 3JBG1 1NOVA 4RQPA 3ZXAC 2RMU1 4CDXB 5ABJB 1QJU2 3VBOB 1RUE1 1ZBA1 2ZTNA 4LLFA 3JB4C 1EAH3 2R072 2HWE1 1RUG2 3VDDC 1AR62 2FZ2A 5FMOL 2GH8A 5C8CA 1ZBE3 3NAPB 4RHV1 1PO21 3VBSC 4BCUA 4WM7C 4FSJA 3TN93 1COV1 1FPN3 4WM8C 1BMV1 4PDWA 2R063 5AC93 1C8M1 4CEWA 5CFDC 4EJRA 1MQTC 1F2NA 1ZBE2 2XBO1 2HWB1 5BNNB 1CJDA 1D4M3 1VB2A 3TN92 1AR93 1FPN2 3JB8A 1PO11 2PLV3 3VBRB 2R062 1H8TB 3CJIA 1R1A3 1VBA3 5AC92 3VDDB 1ND2C 2RMU3 4QPIA 5A32B 5L7OB 1TME1 2R043 3VBSA 1D4M2 1ZBA3 5JZGC 4RR3C 1AR92 2MEV3 2PLV2 4CDQC 2WFF1 1R1A2 2RR11 1VBA2 2HWE3 4WM7B 1MQTA 5BNPA 4Q4Y1 2BUKA 1RUC1 1BEV1
chains in the Genus database with same CATH superfamily
3I3BA 4CP1A 4Y4YA 3ZX7A 4CDWC 5FZMA 1F4AA 2WWUA 1QJFA 2BNNA 4QPYA 2VR4A 4NPLA 1AF9A 3LKJA 4ARYA 4W6WA 1DQ1A 4YW5A 5FZ7A 2MEV2 1FYUA 1POV1 3OG2A 3AXEA 3QOPA 3AMQA 3PUHA 4IEUA 5BNQA 2R071 5LW9A 2BWAA 2GSYA 3ETPA 4YM0A 2QQUA 3LDBA 1HW5A 2BW8A 2EALA 1UOGA 4ZU7A 1ST8A 1Q56A 2Y0IA 4YW4A 5K0UC 2VNGA 1KXGA 3M3EA 2X5IB 2FDGA 1CAWA 3AMNA 4EZ4A 1C4RA 4IE6A 1PO22 1QEXA 2A6VA 4YFZA 2ZAAA 5FFOC 2FHRA 5IVEA 4X6RB 1O8SA 1VBB3 2XGXA 4IV1C 4QXBA 2VQUA 2WNOA 2HWC2 3CQOA 3D4KA 4RSUA 4FPGA 4CDQB 2ZPXA 3LDRA 4KNCA 2Y6FA 4Q0VA 2VZPA 1UNBA 3DCQA 4AL9A 2VMCA 3X29B 1G9BA 5FO8B 5BYNA 2WWJA 4CE8A 1HB4A 4XFCA 5I8SA 5JMOA 1K42A 2VQ0A 5B4XA 3P3NA 4FXGB 1W8TA 4JQTA 2P37A 3POWA 1O4ZA 2N7GA 1PZ9A 1WCUA 1FNZA 1WBFA 3GZUC 5CKMA 4AEMA 2R061 5JIAA 1J3QA 2QQNA 4Y5Z0 1RUC3 3LOBA 4FAGA 4Y24A 4KQ7A 5D2AA 4HXCA 1DHKB 3JU9A 5FP9A 4BQXA 2D97A 3KCCA 1IG3A 3M3IA 4IEXA 2OXBA 4JGYC 4AFBA 3AFGA 5LA0A 1PGW2 1Z7S3 1ZZ9A 2BU9A 4ZS2A 3SH5A 4E2GA 1V6IA 4X8PA 1LGCA 5FZ8A 1VBA1 3CNAA 1WBLA 1W04A 3HIFA 5A3WA 2CGPA 3NL1A 3T1MA 5A6QA 2E51A 1QJY2 4LXLA 4AK3A 1W2TA 4NE9A 3ZYIB 4CCOA 5FTTC 5FY5A 1RIRA 4F8AA 1OPOA 2A3YA 3KM5A 1SZBA 2WN3A 3OJBA 4ZXKA 2QQLA 3ON7A 4P9GA 4E4ZA 3B3QE 3FMGA 5FJKA 4DOUA 1UWWA 1IS6A 3CJIC 4X8NA 1W39A 2ZGUA 4Z82A 1W06A 2YBPA 4F3JA 1ULPA 1CGPA 1R082 3NW4A 4IEWA 1RMU2 2Q4SA 1AZDA 3N35A 4RN5A 5CISA 5FXXA 3KVAA 4QM8A 2OZJA 4R4XA 2K2SA 3U4XA 5IK7A 4JKLA 4P9IA 4QDRA 3T2TA 1GP5A 3MUZ1 1RC6A 3OEAA 4PLMA 1ZVFA 4DY3A 5DUXA 4JGZA 1UXXX 2WNUA 4GWJA 3PVBB 2OUHA 2FDIA 1I9RA 3QLQA 4XQ4A 1SEFA 1ZX5A 5IYYA 1FMD3 3IIAA 5ANNA 2VCMA 4FTBA 1S2KA 2JIJA 2WO1A 1IPKA 1GQGA 1ZA7A 5EWSA 4CSWA 2WR9A 2P1BA 1WD3A 4JHZA 1BCXA 4R9BA 1C1FA 5GLVA 2Y6JA 3ROUA 3VZOA 1GANA 2PHDA 1UOBA 5FR3A 4QKNA 4KWKA 1HXS2 4Y33A 4FPLA 3O1VA 3UGFA 2DVFA 3PVNA 5FPAA 4CEWB 2J1VA 2VXRA 1YI9A 2W3JA 5DUWA 3VHRA 2YPDA 1ENRA 2EIEA 3DXTA 2WA4A 2IXJA 3WF4A 4BXSV 5FK7A 1Y4WA 2RDNA 4Y20A 4GKXA 4AVVA 4TLFA 3IDCB 4MUVA 2DURA 3WXPA 5LA2A 3RZHA 5FYZA 2ORZA 2WS93 2HWF1 1SLAA 4NROA 3VDBA 1PM7A 1U5YA 4XBQA 3RDIA 3LWCA 1QH7A 5F6LB 5LRRA 3KF3A 5FZIA 4LHLA 1YCIA 3AZVA 4XJUA 3VBSB 1HB3A 1Q8SA 1DBNA 4HKLA 3I54A 2Y8KA 5FYBA 4LKEA 1RXFA 1VP6A 3LIHA 2RS31 4N53A 1A8MA 4XJWA 4L8QA 1MQTB 2WKKA 2WNVB 4OZXA 4Z2WA 5BNPB 2SBAA 2JDPA 4XUNA 5EYYA 3IPVA 1F5FA 3SMHA 5A1LA 5JVVA 1NE6A 3OGGA 1AJOA 4YZ2A 3T0BA 4ZU4A 1H2LA 4QQLA 1OF4A 1QJX2 4QX1A 3O1OA 4CXYA 2H0VA 2P3KA 4R8HA 2XWJB 4AQ6A 1QDCA 3OBTA 2XG3A 2GC3A 1YFUA 1GFF2 2FCTA 4XIKA 1B35B 4NOTA 4QT6A 4OHYA 1BBT1 3AYDA 1DYPA 4I3PA 1AJKA 1V9U3 3PMEA 1NXMA 1Y9MA 3BU0A 2AR6A 2AACA 1NCRB 2TEPA 4LO7A 3MIHA 3ZFGB 4HPKA 5J09A 1UOJA 5GLTA 1DIWA 1OA4A 1XSRA 1KJLA 5BY5A 4TXWA 3RGBA 5JSRA 2K0GA 2WZR2 1N3PA 4XF3A 5A33B 3UJQA 5C3RA 1RUF3 2JX9A 4KWJA 5JXHA 4N7IA 2A1XA 2L9LA 2OZ6A 5EP9A 5CADA 1OT5A 2B42B 3VHOA 2WL1A 1GZWB 1REFA 2JG9A 2D5HA 1G9FA 1W6OA 2J1UA 3EXUA 3LE0A 3VBFA 2Y6KA 4AQTA 3CL1A 3DXUA 2TNFA 4CCLA 5LATA 2DV9A 4IETA 1EUUA 1QNYA 3DPRA 3ZYPA 1OQDA 4NPMA 3RI9A 3H8XA 1YJLA 1DLLA 2PQSA 2J1RA 4P9LA 1VBC2 4L9BA 5HCAA 3FLTA 4URTA 1K45A 4AFMA 2ZGSA 5FMBA 4MHRA 1RJ8A 2VOXA 1REEA 1BHGA 2EIBA 1LEDA 1JODA 4ZY9A 3KV6A 5J98B 5LA9A 5KXEA 3TEYA 3FC0A 2WLPA 4HKWA 3WDXA 4HLTA 2ZAHA 4QM9A 4GB31 5G05L 2WNUC 4XFBA 3SKVA 4EYUA 1XXNA 3BOWA 1JH5A 1SBDA 3UGHA 3HVDA 1EY2A 4IL7A 3O1SA 3NAPC 4CPBA 5L9VA 2O1QA 1UX6A 1O6UA 3WDTA 2DCYA 1V6JA 4BDVB 4EROA 2OQ6A 4CDXA 1DZQA 4L97A 5ACA2 1AR82 5A7QA 2UYAA 1CZVA 1EPWA 4Q4V3 4ASMB 2ET1A 4YGBA 3FE5A 4Y5SA 3A23A 3IWZA 4PLNA 4LBQB 5JOWA 2F6BA 2VZTA 2IXKA 2RM22 3HQUA 3AMPA 4QD2A 2VCAA 4P14A 1PK6B 5IAVA 1UQXA 2NMNA 4L11A 4XCBA 5L9BA 2HWD1 5C8CB 3I4IA 1RUI1 4BHPA 3QBQA 2UYBA 1SLLA 1CZSA 1POV0 1EP0A 4GJYA 1KS5A 3T4HB 3ACFA 3CBNA 4JRLA 2RVAA 1SLCA 2J1EA 5F5IA 3NJVA 3BALA 4H7MA 4CP9A 4N53C 4GH4B 3ZXKA 5B4NA 4YGCA 2VUDA 2PQQA 4IEVA 1VBD3 4XVHA 4AQSA 4XILA 1VBE3 4LHKA 3V56A 1OD3A 2C0ZA 4GALA 4YZ4A 1BK1A 2PA7A 4NIGA 3T08A 4MH0E 4QKFA 1I5ZA 1XYOA 1OUXA 2BFUS 1NZCA 3M2MA 2BOJA 2AEZA 1GZCA 1W6PB 4C1XA 1NAEA 4KBBA 3IDAA 2VQAA 3FJSA 4OFGA 4BM8A 4INDA 2AUYA 4V1PA 2CSGA 3OGJA 4MYEA 1RVF1 5F7UA 3BU7A 3ORJA 3CIHA 4HT1T 4K1ZA 3WT3A 2ZBJA 3MEPA 3F95A 1UOFA 3PJYA 5L7OA 4AEJA 4NPRA 4O65A 2XLFA 1I6XA 4XDPA 5LBBA 3VBUB 1MVEA 1CZTA 3AP9A 2X5IC 3NVCA 4XDOA 1G9CA 4MSVA 1JZ5A 3M70A 1DG6A 4Y22A 3MLLA 1ZREA 4DZGA 4WV8A 5A6XA 4WM8A 1CAUB 1K5MB 1YLLA 1SLIA 2HYKA 4M00A 1WGPA 4Y5TA 1RUH2 3EHKA 1EV12 2QTWB 3MFAA 2WQ8A 3N7LA 5KHGA 2OT7A 2BNOA 4JV4A 1FOD1 2JKBA 2W91A 2Q1MA 4I01A 5FY1A 3AP7A 4PBPA 2D3SA 5CFDA 5J36A 3WNOA 1ASJ1 1YFYA 4NIDA 3JBG2 3PL0A 1CPNA 3DPRC 4YVSA 5KC5A 3DN7A 4LORA 1QDOA 1RUE2 3JQXA 3ZN5A 2CDOA 1QQP3 4D8MA 3EBRA 3TYJA 2HLEA 2VNVA 3BUCA 1S0EA 1U5ZA 2ZHMA 4XOGA 2ARCA 3WF3A 3C7GA 3ZVXA 2O14A 2Y33A 3NRUA 4CEYB 1HQNA 2HJIA 3THDA 3ZIWA 1VAMA 3WINE 4CCNA 2JECA 1FATA 3AFKA 3ZMNA 4FPKA 4CXXA 1CR7A 4ISRA 2AGSA 3I2OA 3ZN4A 1O3QA 2FCUA 1VRH2 2XBO3 4AI3A 4YZ3A 4IV3A 3LAGA 3I2DA 4LBQD 2W94A 1EAH1 3VLBB 4AVTA 5JI7A 3GCXA 4XEZA 1PO13 1DDLA 2HYXA 3TOJA 4YM2A 5FXZA 3ATGA 4NRQA 3VHPA 4CDXC 3HT1A 4A7ZA 2DU1A 4CUGA 1VR3A 2ZMLA 3OYWA 5A3TA 2JD9A 3UV9A 2QNKA 3D0JA 3WDVA 1QXPA 4XF9A 4B1LA 2D44A 4TN7A 3DUIA 2ZX1A 3I3EA 5FXVA 2VVFA 1CX1A 4M0NA 4Q0SA 4AVSA 2EIGA 5CNAA 1R093 2E7AA 5IW0A 1J1TA 3CU7A 1RUD3 3OD4A 1TMF1 1NCQB 1H30A 4RYDA 2WFF3 3VGIA 2RHPA 2WSVA 3UKVA 4EV0A 3H8UA 1WKYA 2XONA 4Q4Y3 4B29A 5A3OA 1HN1A 2R1BA 3SXWA 3ZXLA 4KG8A 5F6KA 5FWEA 3VZMA 1W8HA 5H9PA 5J37A 1AX2A 4ES8A 4PBOA 1SDDB 3DF0A 4JX0A 1E5SA 1MEC2 3H7YA 5T54A 2WRAA 1Q8OA 3VBHB 3DL3A 1RUG3 4YYOA 1JS9A 3PNAA 5JLVA 4RQPA 4MADA 3AJZA 5FO7B 2RMU1 2ATFA 4V2WA 5AVAA 3WP6A 4XCAA 5C3QA 3BTZA 3G6JB 5FIXA 4I09A 5A3NA 1ZBA1 1W9TA 2WQ4A 4ISQA 4DIQA 5JSPA 1C28A 3VB9A 5IVBA 1W2OA 5HI0A 1BYHA 2OA2A 4YG6A 1WMEA 5FP4A 2Y6HA 2R072 2ZEZA 1AXYA 4Z1VA 1BQPA 1U5IA 1X9PA 5A7PA 5F8PA 1W99A 3G7DA 3O0XA 4R4ZA 5JCTA 2WFPA 1YFXA 4MGZE 4CCJA 5L36A 4CU9A 1T6BX 5IFPA 1Q43A 1YIPA 4OHVA 4AHXA 5C8CA 1ZBE3 2JDMA 3FUQA 1PMHX 1E5HA 3CO2A 3N9MA 3ZYHA 1UU4A 1JOPA 4FO9A 3VBSC 2NLRA 4MGTA 3WY6A 4BCUA 2ZGMA 4BK5A 4FAHA 4FSJA 1RTVA 4WM8C 2LM3A 2XJSA 3J7NA 4PDWA 3WP3A 4I2OA 2P2KA 3FX3A 4I3GA 1VPHA 3M3QA 5DUUA 2BGCA 2E9QA 5AC93 4EN6B 4A6OA 5FMDA 1C8M1 2WAOA 4BQ2A 3UK9A 1WD4A 2WZEA 4KMQA 5CFDC 3WQ1A 4AI9A 1MQTC 2VE1A 1LGBA 3WCRA 1DU3D 2X8KA 1ULCA 4LBJA 2ZGKA 1T2XA 2ZXQA 5EPAA 4NMIA 1W8ZA 2CWSA 5FZOA 3O1RA 4YFWA 4QX5A 5A80A 4QB2A 2R062 3LFIA 3D8CA 1R1A3 4C91A 5EJZB 3E1F1 2A6XA 2UU8A 4LEJA 1NX9A 4QPIA 5A32B 1WMXA 2PAEA 4D7SA 1D4M2 3MF9A 4PQ9A 1LEMA 4KI5M 4NIAA 3K4DA 2MEV3 1DF0A 1O8PA 2QZ3A 5C70A 1UCXA 1HJFA 3R4UA 2ZKLA 1JZ6A 1VBA2 2HWE3 4WM7B 2VMGA 5KXCA 1W9WA 3MGUA 4YW6A 3UGGA 3VKOA 2BUKA 1FV2A 2UWAA 1W8WA 1RUC1 3AL6A 1Q8QA 3POJA 3ELNA 3R4DB 1GUIA 4UFLA 1K5MA 1QJU1 3C7OA 3WNPA 1F5JA 4EN0A 3NNGA 1H2NA 5JI9A 1LGNA 3POGA 4UBGA 4GWMA 1W3VA 1Z7S1 4YG3A 3I49A 1PO23 2VMFA 3IM0A 5F3CA 2XVLA 1LOFC 2JDAA 3D3AA 4Q27A 1CONA 4LBKA 5FP8A 3PLQA 2XVGA 4IERA 2HWC3 1D7PM 2R0HA 3MI8A 3QH7A 4Q1RA 1W0OA 4X6QB 5FPBA 3CHXA 4P9WA 4RR3A 5CIRA 4BQWA 4NUBA 5EHDA 3ITQA 2QQPA 3N3HA 4RHV2 2LRPA 2VCCA 4MGYE 3OUHA 2R16A 3T3YA 3CMGA 1W6MA 3BGAA 1OFNA 4ASKA 3F2ZA 2XDVA 5AVPA 4NN0A 4BLJA 1XQNA 4Y1ZA 1Z0HA 2CHHA 1JW6A 2F4PA 3JQWA 2J42A 4XMIA 1M4WA 2VJXA 3B69A 3FHAA 4K20A 4YVWA 4LQRA 4AGGA 2D6LX 2GMMA 3BB6A 2J1AA 3E5UA 2GNTA 3N7JA 3GCWA 3BVCA 4KG0A 4RQPC 5D21A 5D8AA 2J1TA 2UURA 4Q26A 1NG0A 3WP4A 1BVP1 2V73A 4OHXA 2IWGB 2Y64A 4AXOA 5A6ZA 1W28A 3KMHA 2QBXA 5FPVA 5GZEA 1TVGA 4AVCA 2B4KA 1FMD1 1S2EA 3PJQA 2XJPA 5SV8A 2J22A 1DFQA 4AEDB 5FCCA 1QJY3 2HWF2 2R30A 5GZDA 2PAMA 5KBFA 3IDEA 1FV3A 5A7NA 3VHNA 1AR91 2ZZJA 4Q8LA 5C8CC 3T2QA 1NXD1 4MHUA 2A6ZA 5FZLA 5D1IA 2RR12 5J1XA 1S0JA 2FDFA 1S0IA 1GZTA 1UO9A 2ZEYA 4Q0PA 1XU2A 3W21A 4XJZA 4UYBA 1GWMA 2YGLA 5GLWA 3WG3A 3WLUA 1KQRA 5L19A 5EJ3A 3ZIXA 2R041 2Q1FA 1S0FA 2ZGNA 2WO3A 4ZS3A 2JICA 1S2BA 1R083 5HCHA 4GH4C 1RMU3 4OI2A 1JYIA 5FZGA 1ZRRA 4N43B 3SH3A 3WD5A 2FCVA 3N36A 1NT0A 3MYXA 4FPJA 5FREA 4DS0A 1CX4A 4PF5A 2W47A 1ZM1A 1LR5A 3JD72 2YC2A 1NKGA 4XUPA 2VD7A 4JGYA 5C5TA 5IFTA 3A21A 4GQ7A 5E8AA 5F5AA 3WQ0A 2PTMA 3FWEA 4AOCA 3ZN6A 4BXFA 4XABA 4QPIC 3WZ1A 1HXS3 2D5FA 2ZS6B 5JAXA 1VB4A 1BKZA 2HEVF 2ZMKA 5A1AA 1J59A 5FYYA 3OOXA 3AZZA 3S30A 3B01A 1CAXB 1GSLA 4LA2A 3LGRA 3C2UA 1YJKA 3KT1A 4KWLA 3WEZA 2KD7A 3ZOIA 1MZFA 1V9U1 5KWRA 1K5MC 4OUMA 1W6NB 3LZZA 2ZHNA 4QX7A 3WNNA 4WVMB 1GV9A 3WNLA 4J1XA 4I0BA 4CRQA 4KL1A 4RS5A 1AXKA 1MACA 1OUSA 3MO4A 1X8MA 5FOJB 1OXCA 4Z07A 1LCLA 2AYHA 1RUF1 1UAIA 4KU7A 3K77A 3LA7A 2Q5TA 1NE4A 3MV11 4NJ4A 4A44A 1SG3A 2A3WA 1NQDA 3MLKA 2XPJA 4M3CF 5F39A 3OUJA 1RHI2 1VE0A 1O3SA 1JYWA 2VAUA 3PIGA 2C4XA 2ZGOA 1MS3A 3E6CC 1DGWA 4DXZA 4UWDA 1QJX3 3MW2A 1F8VA 4C90A 4G4FA 1UMZA 3S5AA 3HN1A 3D0SA 4KBZA 1UF2C 2RJLA 5KXBA 3NV4A 2CY6A 2ZGRA 3RJ2X 4YVWC 3NNJA 4ZZ8A 1AYM1 1FI2A 4AYUA 1PVC2 5D8AC 1W03A 4YWAA 4B7KA 5C9AA 4OYUA 4QWNA 2YBSA 1JMUB 2D6PA 1RUJ1 1ODNA 1LJ7A 3NSTA 2VZ1A 4Q4X3 1IS5A 1N1TA 2RDRA 2WZR3 1ZA4A 3JXSA 5FO9B 1LNSA 4FQZA 1JU4A 4XFIA 1FXZA 4XJ8A 1ND2B 3A7QA 1NA1B 1KD7A 1NQJA 1PIV1 2XR4A 3OPZA 3ABZA 4LBNA 3PMSA 4YZ5A 1DLCA 2QQWA 1VMJA 4ORFA 1VAVA 5LBFA 1ZRCA 3D5OA 5JZGB 1TG7A 4CXWA 3GM8A 3KV5A 2CYFA 1H1MA 3NV3A 3IT8A 3UYJA 2PFWA 2P4EA 3POYA 1OURA 3OY8A 4P9XA 2CGNA 3KZ4C 3N7KA 1F31A 4IE4A 4XJAA 1SLTA 4H7LA 4Q4V1 5FUPA 4B1MA 1UX7A 3U0ZA 2NPIA 3W5NA 3J26N 1DQ6A 2FD8A 3NMBA 5FMOS 2QE3A 3GDBA 1VBC3 5FY7A 5DAPA 1ZYBA 2VTXJ 3OSDA 4Y1VA 4CDUA 1DCSA 2VVEA 3ZYRA 2ARAA 1PMJX 3IBMA 3PTYA 2VMIA 4Y1XA 5E1RA 3VBHC 3K2OA 2W92A 3VKFC 3DYOA 2E32A 2FDJA 1NY72 4K9SA 4BK4A 4JTNA 2VUAA 2BDRA 4WVZA 2PHWA 2IUWA 3E5XA 4RGGA 2VCBA 1RGSA 2TUNA 2XH6A 1BVVA 1E5IA 5HCBA 4IEQA 4LOTA 4XTPA 4BYYA 1AR72 4D7YA 2YUEA 2E7QA 5GLZA 4B4RA 1VBD1 3B02A 3WR0A 4LHSA 1VBE1 1SLBA 3SEPA 3GBWA 2DWRA 1CIYA 1PZ7A 1X33A 5ACA3 3IZOA 1AR83 1Y3TA 5F3EA 3WDWA 3ZFEB 2MHFA 1IGOA 1ENXA 1OF3A 2RS12 3V64A 1SBEA 3ZSMA 5DAXA 5EQUA 5C3SA 4M3CB 4GWNA 4HN1A 1UY4A 3N9PA 3RI8A 2RM23 1AL21 3AMHA 4Q4W1 3ZXDA 4EZHA 3V0AA 3TB0A 3TEZA 5CFCB 1UW8A 5BNOB 2Q0AA 2LROA 1Y43B 1FOD2 4XPVA 1UZWA 4K6BA 5IK8A 1MS9A 1ASJ2 3W20A 4RS5C 2XL7A 4HK9A 5I0RA 3L2HA 2PMWB 4TYSA 4IEPA 1H9PA 1Z78A 1R64A 1UPSA 3WHTA 2MNGA 4YZ1A 2ETEA 5FLHA 1O4YA 3ES1A 2OIIA 5APAA 3GZEA 3ZSJA 1XNDA 3NAPA 3AVSA 4QHBA 3J4UH 3A4UA 2YFZA 5BXXA 3ZYGA 2ZEWA 4O9GA 1RXGA 1UXZA 4FT8A 4WZCA 2QKDA 4QB6A 4Z2AA 1QQP1 3BTYA 2V4VA 4FBFA 1EAH2 5C7GA 5A7WB 4LHNA 4BQ4A 4B3NA 4XACA 3ZYBA 4WVVA 5C9AC 2QUOA 5JPMB 1OOPB 5HXVA 3O0WA 1IPSA 2W0XA 2CNAA 3T2OA 5HXMA 2X10A 1QXRA 2JG8A 3WW3A 2C24A 4QU1A 2RV9A 4JRAA 4E4DX 3T0DA 1W0NA 1LAJA 4O9EA 2RDSA 1HRI2 1S1AA 4Y1YA 2I2SA 3RZJA 2QFEA 2FBEA 1RUH3 3B00A 2B7YA 1TMF2 1EV13 2LALA 2X53S 2RG4A 2YG0A 2Y26A 2BVBA 1QHDA 5DZFA 1YQ6A 4YLZA 2JJ6A 1KFXL 1N1YA 2B9UA 3JBG3 5LY1A 2Z42A 5JOZA 3FUOA 3MF6A 2R1DA 1RUE3 1NLRA 1ZZ7A 2JEMA 3BIWE 3NJYA 3OPTA 4JTOA 3ST7A 3AZXA 4D7TA 4GAZA 3LEMA 1R091 4EQVA 3RZMA 5FYMA 4DUVA 1RUD1 4JKKA 4CDUC 4IE0A 1WCDJ 3OBRA 2VULA 4LKFA 4BPZA 5CAZA 1IQDC 5JOYA 2YU2A 1JUHA 2BJSA 4EWAA 5FQ0B 5A3UA 1C5IA 2RMU2 1WW4A 4IEZA 4UF0B 2NZ9A 1QOOA 3SH4A 2BVVA 1VRH3 1SFYA 3NO8A 2ARBA 2DCKA 4JC1A 4D94A 2X5IA 3AX4A 4DO0A 2EAKA 1HRV1 4HMZA 2YDEA 4MGSA 3K51A 4OHWA 3UJOA 5FYUA 4AEDC 2EXHA 4DEVA 3DEMA 2X29A 3R05A 1UY3A 1MZEA 5J3UA 1PGL1 2VMHA 2XOMA 3Q8EA 3J8F1 2XJRA 3VN4A 4E2QA 4CDQA 3PUAA 4JHTA 2IVJA 5FLJA 5FMCA 4CU6A 1G9AA 4KH9A 2OUJA 4DB5A 3USUB 3KS7A 4QKBA 1QMJA 1V6MA 1BMV2 1UU6A 1DQ5A 3O7OA 4IDZA 3IN9A 2WT2A 3ACHA 1SPPB 1W6QB 1LU2A 3WHUA 1C8M2 2CV6A 1ULGA 2VUCA 1AYN1 2UY9A 2VOKA 4K7JA 4UFIA 5ISLA 1GWKA 1SBFA 2UWCA 3M1HA 1URXA 1UY2A 2G1MA 3KT4A 3ENRA 5M0TA 3O12A 4MXWB 4P02B 4FOQA 4A45A 3K3NA 3Q8BA 5L9RA 4BJ0A 5DDJ1 1MEC3 2VPVA 4SBVA 5FOBB 1X50A 4XQDA 5AC91 2A3XA 2WSUA 4NHLA 4HZFA 1LOEA 2XKOA 5IVCA 3SCGA 3LF7A 2HBUA 3RWNA 1CPMA 1KJRA 2RS51 5FYCA 2D43A 5LASA 2WA3A 3VZNA 5H9QA 1X36A 1POV3 3SITA 2JIGA 4IEOA 1BJQA 4E9KA 2R073 4DPNA 5FYIA 1W0PA 3GJAA 5C4WB 4COUA 1G7YA 3KHBA 2W08A 2GH2A 2CGOA 1GU3A 3KB5A 3K3OA 1NOVA 4MLOA 1W05A 2B5HA 3FLPA 4YGDA 2WYSA 5FLIA 3VD3A 5ABJB 1QJU2 3AKRA 3VBOB 4LPLA 2JG8C 4BB3A 2ZTNA 1XNKA 3KWVA 1D4VB 3LPGA 1V0AA 1Q8VA 4BH9A 3HOBA 1RITA 3I59B 3N9OA 4QX2A 2VL4A 1HQWA 4RA0A 4D69A 1CESA 2WO2A 2HWE1 1G9DA 1REDA 1OH3A 1X8EA 2OW4A 2ZGLA 4S2HA 5DUVA 4C1WA 1ZZ8A 1SDWA 2BGPA 3RWKX 3ZYJB 2QQOA 3WDUA 1W2NA 4YNIA 1PNFA 4B4PA 1YWKA 2DUPA 2GH8A 1L7RA 2V5DA 1PO21 1OVPA 3E97A 3N7MA 3PUQA 4FXKB 5HPOA 2J1SA 4E4SA 1XC6A 2R063 3S57A 2Z2SB 3WQ7A 4C0BA 2ES3A 2WO7A 1MVQA 2C5DA 4CEWA 3ILNA 2A75A 4QQPA 3NKTA 3TEWA 1D2QA 1JYNA 3MIDA 2ADDA 2HWB1 3PVOA 2AREA 1LOBA 1MS5A 1XYPA 1CN1A 1CJDA 1D4M3 2RE9A 3ECQA 4XUQA 2XHKA 3ILRA 1VMHA 5FZ1A 1PNGA 5FZ9A 1XSQA 1FPN2 2P6CA 3IKWA 3JB8A 5JUVA 3VBRB 4COYA 4GZ9A 1H8TB 4A2UA 1VBA3 2YROA 5FUIA 3AP5A 1Y9QA 3MFCA 3VDDB 1ND2C 5FZBA 2XLAA 5T50A 4E4HA 1TME1 3VBSA 4E27A 2Q1ZB 3GHNA 4N90A 1ZRFA 2WN2A 4JDMA 4NHKA 1H2KA 5JZGC 1AR92 5H9SA 5C71A 4FPOB 2IXHA 4FPFA 2C9AA 4CDQC 5CKNA 1TNFA 2VW0A 5LEJA 4AGVA 2VQTA 2C9KA 1MQTA 2WNVA 5BNPA 1BEV1 5F5CA 3W5MA 2CTVA 3E5QA 3JUUA 2JDUA 2R042 4JVAA 4UFKA 4AHWA 2C26A 4GMP1 3O1TA 2DBNA 4Y3OA 2FDHA 5T3NA 5A3LA 2GALA 2K46A 3AZWA 4RHV3 2X05A 4M4PA 1C1LA 3VD5A 4LNVA 1WCKA 2ZJCA 2WIIB 1B35A 4FPYA 4J1WA 4O7XA 3FHIB 2XL9A 4OMDA 4NWWA 1NCRA 3H1MA 3ZFGA 5GLUA 2ZABA 1FT9A 3K4AA 4AZZA 4ATFA 2LW8A 3I2IA 4W4ZA 2WDBA 4JZRA 3K46A 3ZO0B 5A70A 4Q1PA 5A33A 3VKMA 1COV2 3ZFFB 2Y6GA 5KHJA 1LKNA 3AK0A 4PI0A 3ZXFA 4L99A 3LQCA 1OA3A 1QWRA 2BFUL 2E7TA 2MPFA 4P00B 1ZZCA 1CAVB 1UY0A 4LBMA 1GZWA 1A34A 3P1IA 1XBFA 4EE2A 2XJUA 3NJXA 4YW1A 4EWDA 1J1LA 5KR7A 4HVOA 2O8QA 2SLIA 2JDZA 5A7OA 2QQMA 3GBFA 2GNDA 3POBA 2VMEA 2HWF3 1LOFA 2OS2A 4KGQA 4XBNA 4CDWB 3BOPA 1WCQA 1ZNPA 4HANA 2BYVE 3U10A 3TN91 5ANQA 3CDZB 4QPGB 3WDYA 1AUYA 2VBPA 4M3CE 2RR13 1VIWB 2D7FA 2QQIA 2VZUA 4UW3A 4V2VA 3U75A 3QACA 3NQHA 1LTEA 3BPZA 1ND3B 2X09A 2FMDA 3KLSA 1OKOA 4PQQA 3LIGA 3CF6E 3BKZA 2YU1A 4YPJA 3BIEA 5FRAA 4YM1A 5LZ6A 3E6DA 2VOVA 3WW2A 2PLV1 4PF1A 1DYOA 1UY1A 2R49A 5JOXA 3LB9A 3AP6A 4N8MA 2YGMA 1IZ3A 3CZUA 3M8LA 5E88A 4BU2A 2Y34A 1AR63 3ASIA 3KV9A 4IV1B 5IWFA 4BQ1A 4JDNA 3JD73 4PIYA 3O1UA 3CZJA 5IT6A 5JDBA 2B45X 1ACCA 4UXAA 3OUIA 3W59A 4XFGA 2WINB 4CEWC 2AENA 1BK0A 4HOOA 2IFRA 2DTYA 2ZHKA 3HNMA 1AYM2 1BLZA 3AM2A 3ILFA 4XETA 1JZ4A 4DUWA 3C3VA 3AKSA 4H2AA 4LJHA 2V09A 1OOPC 3OBZA 1CQ9A 1RUJ2 1JBCA 4LBQA 4LO5B 1H4HA 1QIQA 1QJX1 3GXUA 3HQRA 4UOJA 5F9TA 2DCJA 2G9GA 1PK6A 1P8JA 4OUEA 4YARA 1PIV2 1OA2A 2I45A 1G8WA 4QGMA 3W9AA 4F83A 3ZKUA 4AEKA 3C7HA 4ATEA 4CYDA 2WNEA 3HNBM 3Q8CA 4RGKA 1WA4A 1WZXA 5GZFA 4DRRA 3MHZA 2K9ZA 5HV4A 4Q4X1 1GWLA 1NLQA 1D2SA 2WZR1 3GBGA 4GH4A 2GN3A 5A3PA 2WNVC 3PUSA 4W6YA 3VZLA 5BNPC 3V0BB 3S6PA 1VAKA 3ZLIA 2VW2A 1RHI3 1TNRA 4LK7A 4XF0A 1QXJA 1VBB1 4QGLA 1W6PA 4GA9A 3JZVA 1DGWX 4AAPA 2ET7A 5HCFA 3RYKA 1A6CA 2YYOA 5AFBA 2QCSB 2P6HA 1U0AA 2YHJA 3ZMOA 1C8NA 1B35C 2A5ZA 3T2PA 4HL0A 3INAA 3I2HA 4R9CA 4ES9A 1WLCA 2VECA 2XXZA 3CJIB 2RJ2A 1VBC1 1YXWA 1NCRC 2ZX3A 1HN0A 2A6WA 3U14A 3ZFGC 1VLNA 1O5UA 1LHOA 1IPJA 3VBUA 2I07B 2D40A 4FCAA 5DPNA 5BPXA 5LRSA 4TZDA 5FZ6A 4ARXA 4EN8B 2H6BA 1PVC3 2AZ5A 4BE3A 3VD4A 1F35A 3Q9OA 3IMMA 1KITA 5I8YA 2EXJA 4Q29A 2QZ2A 2VZSA 1UKRA 5CKQA 4I0AA 5DN2A 1HV1A 4HFSA 3VL8A 3TAYA 1SCSA 3H1YA 3VD9A 2V4AA 1CAUA 1R1ZA 2VG9A 4PCRA 4UBHA 4NRMA 1BZWA 1F15A 2D93A 4OQ9A 1V00A 1AL22 1LODA 4Q4W2 2KXLA 1S0BA 2V5YA 5FPZA 2BRTA 3KGZA 4UFMA 3WF1A 4YM3A 2DCZA 4Q0UA 3QCWA 2Z5WA 3SQOA 1AX1A 1S4CA 3ZXEA 1SMVA 5LBCA 1QJEA 1SFNA 2CAUA 2VMDA 1V70A 5LY2A 5IVFA 1LOAA 4HVQA 1YIFA 4NO4A 4MZUA 5KXDA 1HB1A 5E89A 4CEYA 1O3TA 1YQ8A 2EAAA 1CIWA 4XAAA 1PX3A 2NQYA 2RM21 3ZXJA 2BPA2 1YQ5A 1RINA 1W9FA 2OKXA 4CCKA 1CAWB 5EXOA 2E6VA 2JE8A 2GNBA 5FY9A 3S7EA 5J96B 5C8WA 4MGQA 1H9WA 2LS6A 1LULA 4Z92B 4Z8BA 3J7MA 1W90A 5IATA 2OYZA 1W2AX 2XQRA 1JI6A 3I7DA 1I5PA 5IK5A 3LSEA 3WUDA 3A22A 3B93A 2QDRA 1AR73 1QQP2 2OVUA 1GP6A 3OGSA 5FZ4A 3RPQA 5FPUA 2HBTA 1JUIA 3I3QA 4M4RA 3WG4A 1PVXA 3GF6A 3VDAA 4LIUA 3LPFA 4FQ4A 3VV1A 1HDKA 1QNWA 1GKBA 4XYXA 4CUBA 4P9YA 5EFUA 2W87A 2QDNA 2RS13 3BYWA 4COZA 4DMIA 1NCQA 1VMFA 1F4HA 1PK6C 5C3PA 2W95A 1STMA 1RYYA 2VUJA 3HAGA 3OB8A 1O7FA 1H8VA 4Q5OA 1UMHA 1AX0A 1YI7A 1PMIA 1OHFA 4S2GA 5EIYB 2CL2A 2GDFA 1JZ8A 2YB7A 1LESA 5DAWA 1FOD3 4BOWA 2PHUA 3ZSKA 1WMFA 2RS32 2VZRA 2WS91 1ASJ3 1O91A 1PGSA 4HN0A 4JCKA 3ZXGA 1OBNA 4FPEA 1KDKA 3VBHA 3WNXA 5GALA 1K5JA 1W2UA 2H0BA 3NNFA 4QB1A 3GNEA 1JXNA 3IAPA 3LEIA 4HETA 2ZKNA 3I2FA 4NHXA 4WVWA 1LB2A 3DECA 1HQLA 4MOAA 1RUH1 4C8DA 4DY5A 5LWBA 4LT5A 1EV11 2JWPA 4QU2A 3H8OA 2QJVA 4PLOA 2BBAA 5G04L 3T09A 5A6YA 1QOSA 1DYKA 1VJ2A 4J25A 1BBT2 4HKOA 3EJKA 2Z79A 4DEQA 4A3XA 4AFAA 3HN3A 4ONUA 1DQ0A 1UZ0A 5ERLA 2IZWA 4FOYA 4EN7B 4A7KA 3LA2A 1QJZA 3MW3A 4IW3A 3VBRC 4GMP0 1H8TC 3VBUC 3ZYFA 5C3OA 5F32A 2B9VA 4GULA 1OPMA 4AR2A 1HRV2 1F9KA 1DQ2A 4FTEA 4B4QA 4OUSA 5T52A 2R0FA 4JGZB 1ODMA 2WNUB 3AYAA 1PGL2 4AE2A 1GYKA 4XXAA 3AKQA 3J8F2 2WLQA 2XQXA 1VRH1 3OTFA 4JQRA 4R9AA 1XE0A 1HRI3 2XJQA 5FUNA 5EJ1B 1HX6A 3M3CA 4CU8A 1N3OA 2IXCA 4YGEA 3B9IA 3IMNA 1WMDA 4FP3A 4GD4A 4PIXA 1TMF3 4K8FA 5I91A 3THTA 1D0GA 2W2IA 1SQ4A 4A4AA 4AFCA 5IUQA 5KHIA 1AYN2 3L2YA 3LD8A 3UETA 3ZSEA 4NWVA 5H9RA 3KD4A 4Y20B 5T55A 1AL0G 3QH6A 4CCEA 5EZWA 1JTZX 2Y6LA 4CEYC 2CAVA 5DDJ2 5A32A 5JSOA 2R32A 2WUHA 3D6EA 4GB32 2YFUA 4HSJA 1WA6X 4BZ4A 1A78A 1OKQA 1Y7BA 4ZHNA 1US3A 3PTRB 3BTAA 5IAXA 3H7JA 4I0WB 3EMRA 3GGLA 2P3YA 2RS52 3POEA 3GZTB 4RD7A 2VVDA 4WM7A 4A7YA 3J7LA 2C6SA 2YMZA 3ZFFC 5AFEA 3S0MA 1UL9A 2D3PA 2WT1A 5DZEA 1EUTA 3KQ4B 4N53B 4PJYA 4AGRA 3FBMA 5A3MA 5FZFA 1YEWA 1MEC1 3CLPA 3CEWA 1Q8PA 1OD5A 1WLDA 3RZLA 2DF7A 3MLJA 2EXIA 5FZ0A 5T5JA 4UW4A 1RUNA 4ZZ5A 2FQPA 4W8JA 1DZTA 3K4ZA 2HEYF 4QHOA 5FYVA 4QPGC 2YZ4A 1NCQC 4I02A 1YYNA 2HWD2 4OCTA 2JD4A 1RUI2 2P17A 3P3PA 3UESA 4LMFA 3ACIA 1YFWA 3HR9A 4J6GA 5L73A 2HWE2 3WF0A 5JPNB 3QD6A 2F4LA 2ZGQA 3DGTA 1ND3C 3R6SA 4KGGA 1QY4A 4HPKB 3WV6A 1ULDA 1C8M3 4QGNA 3LFMA 1YQCA 1XU1A 2JE9A 4XDQA 4DFSA 1SACA 1WUVA 3IB3A 2BNMA 4WBBA 1ENQA 5SV5A 5E16A 1XNAA 1NLSA 1X82A 2JG9B 4LTAA 3W58A 1W6OB 5F3IA 2Q8EA 3VBFB 1L7LA 1LU1A 4LUKA 5I0UA 3OPWA 2HWB2 3DPRB 3DYMA 4OHZA 1J3PA 3AP4A 1RVF2 1XJAA 4JDOA 3H1WA 2Q8OA 4AQ2A 1DGRA 4AEDA 3I97A 5GZGA 4AI1A 3MV01 4A42A 1UZZA 4CA9A 2DVDA 4YW2A 1TME2 2PAKA 1QJU3 1WLWA 2XVKA 5IVJA 1QF3A 3R0RA 4A6SA 1D4M1 1NYWA 3VZJA 4DXSA 4LKSA 5HV0A 2G9FA 1N1SA 1XB9A 4YW7A 3WSOA 1TE1B 2ZHLA 4XF1A 4B7EA 2BEOA 3ZDSA 1DP0A 1W8NA 3I2KA 4XJ9A 2E53A 3PIJA 2XUEA 3TEXA 3ZSLA 4H55A 1JZ7A 5K8SA 1BEV2 3MIFA 4N43A 2IXLA 1VRBA 2YC0A 3ZXAC 3KCXA 3HQXA 5CA6A 1C5HA 4CDXB 1JYCA 3KT7A 4AVBA 3FZ3A 3H3UA 1RUOA 2G4IA 5LA1A 1KRIA 5FZAA 3ZM8A 2F17A 3JB4C 1KFUL 4XQWA 3RRDA 1H2MA 1J83A 3H50A 3MUY1 5GZCA 3U37A 4CP2A 4OVEA 1OLME 5IHRA 5CG8A 3THCA 4BLIA 4XW3A 5FMOL 3VKNA 3SLIA 4CTEA 4Q2FA 1H1IA 2P5BA 3MPBA 4JAAA 4CCMA 2O8OA 5CZKA 4RHV1 2XUMA 3VKLA 1B09A 2ZACA 1CAXA 3O1PA 1US2A 4WM7C 5F5QA 1FPN3 2G19A 1DGLA 4IESA 4CUCA 4Y26A 5F2SA 1SFPA 4CU7A 5KC6A 4CP9B 1YO8A 3UKTA 1W8FA 1MS0A 1QH6A 1W6NA 2PELA 1LHWA 3I8TA 5CYYA 4QQHA 2C1FA 2Y0OA 4WVMA 4M0HA 4FOVA 4PIZA 5CEHA 3RMXA 1F2NA 2W5FA 1KS4A 2XBO1 3ZPYA 3HWJA 2Z69A 5BNNB 1GOFA 4FOWA 1TZOA 1ALYA 1H6YA 4GXLA 3TN92 1AR93 1OH4A 1PO11 2A7AA 5DQ0A 2OX0A 3KF5A 5T5LA 1YUDA 2D6KA 2KR2A 1ZZBA 2DU0A 2DYCA 4LLOA 3POFA 1YNAA 3RMYA 3WQBA 3U1XA 2XWBB 1OC1A 4CP0A 5FWJA 3MIEA 5L7OB 2R043 2ZGPA 1S0GA 2XJTA 1GOGA 5F2WA 5DMYA 2DVGA 2ZGTA 4LBLA 3TRSB 1K3IA 4IGPA 2PLV2 1AVBA 5F1RA 3LEKA 1A3KA 2WFF1 3WCSA 1XRUA 2RR11 4NR1A 5T5PA 2W52A 3Q8FA 4Y22B 3RS6A 4CCDA 1UYXA 2WC2A 5I8TA 5FJHA 4Q4Y1 4WM8B 3WF2A 1V6NA 2GC2A 5CBLA 3OEBA 2BQPA 1GLHA 2VW1A 1IHMA 3NWKA 5FPXA 4XE9A 3NKGA 1ZBA2 3ALQA 5CFDB 1WLTA 3URFA 3I2JA 4A3ZA 1M06G 2JB8A 2IFWA 4YVSB 4LULA 4W50A 1COV3 3FFQA 3UNPA 3H3ZA 5A7SA 5JWPA 1ND2A 1RUG1 4P5HA 1NA1A 1J58A 5JXIA 5K7PA 3C8XA 4CPBD 5J48A 3M3OA 1AR61 4NHYA 4LUMA 2DVAA 3JD71 4QDSA 2VY0A 5DZGA 4QXHA 5JZGA 2PHLA 3WG1A 3J7HA 1H0BA 4XURA 1K12A 2W9XA 1OI6A 1AXZA 1IS3A 4P5YA 2OPWA 5LK7B 5LBEA 4EN9B 4LOSA 4ZONA 4IV3B 1PX4A 3LA3A 4BIOA 3HEIA 3AVRA 2VM9A 4Q4X2 1LOCA 1WCSA 2AH2A 1JYXA 3T1LA 1ZBE1 3MZHA 1MR5A 3L9JT 3M7AA 1GP4A 3AKPA 4N43C 5I0SA 1MPXA 1QGLA 4YG0A 3CKHA 3OYWB 1LENA 1W8OA 2GMEA 5FKCA 3U07A 3U4SA 1VBB2 4K8RB 2GNMA 4AF9A 4R9DA 3OCPA 4K21A 4ASLA 2WYFA 3MPPG 1IKPA 4IE5A 4S2DA 4UW5A 2ENRA 4QPWA 3GALA 5DABA 2W46A 3AKTA 1UMIA 4XUTA 3WX5A 3AMMA 4RGAA 1HLCA 4TLGA 3GJBA 1RHI1 5FDBA 1AYM3 1V6KA 3TNQA 3C7EA 3FL7A 1JYTA 1OFSA 3O5SA 4U36A 3ZFEA 4AW7A 4D6RA 1R1A1 1GR3A 3AB0A 2BP6A 4XUOA 1ENSA 3RYRA 1RUC2 4AFDA 3E6BA 4M3CA 5EYXA 1RUJ3 3HMYA 2DTWA 4JGZC 2QVSB 3B5LB 1S0CA 1A8DA 2W1UA 5KHHA 3MDPA 5CFCA 2ORXA 5BNOA 1Z7S2 1PIV3 1O59A 1WW6A 3Q8AA 2MEV1 3DKQA 5FPLA 3CJXA 4DNYA 1GZ9A 3HD8B 4QXKA 4RQPB 4EWEA 1PVC1 4NRPA 2NN8A 4CVUA 2VNRA 4UFJA 4MVTA 4AI0A 5C6CA 2ILMA 5C5UA 4AI8A 2QQKA 3PURA 4K1YA 4N7UA 2PN5A 3KCYA 3RZKA 5HBAA 2GZWA 3EO6A 3NV1A 1MZ6A 1ZZ6A 3MBWA 4A41A 1PM4A 1G86A 2JKXA 1IKQA 4OULA 3U78A 4OI1A 1IS4A 1DGRN 2UWBA 3RSJA 5TSWA 3H8RA 3P6BA 2O0OA 2HWC1 1Y9GA 1MS8A 4N9IA 1AHSA 4MGKE 1XNTA 1GMMA 5FY8A 4I30A 4PDWB 2QQVA 4Y1UA 1EPZA 4MX3A 1ULFA 5A7WA 2FZ1A 4H3WA 3ES4A 1X9TA 1Q5OA 1FAYA 1S55A 1FX5A 2BWCA 4MG2A 1OOPA 1UIKA 2XKPA 3NNLA 4FFFA 2GC0A 3VZKA 3RZGA 5LCWL 4AHYA 1H6XA 2BGOA 4GWIA 1S0DA 3SISA 4M01A 1CD3G 1FMD2 1NY71 1NA1C 5BNNA 5FZOB 1WW7A 4LBOA 3RFRA 2WABA 3JCIA 3H9AA 4FVVA 3O14A 4YSFA 3AYEA 1PHMA 3SHRA 5FZKA 2VU9A 5K4LA 5EV7A 4OI0A 1PGW1 2Q8DA 3AYCA 1AR71 3POIA 3VD7A 3UL2A 1BXHA 4QPIB 4IUGA 5A1FA 2AEYA 1AL23 1UU5A 2VNOA 2VZQA 2VC9A 3DYPA 4Q4W3 3APBA 4CUAA 2YY1A 2HH9A 3LDKA 3OD0A 2YC4A 5FY4A 1BMV1 4N9HA 2XLGA 4HG6B 5JXJA 2WT0A 2WS92 1QJY1 5FYTA 1W9SA 4CCCA 4Q0QA 4AWDA 2RS11 1LECA 2PHFA 3OF1A 3N9QA 3SNMA 4AG4A 4DRVA 4HVRA 4XFFA 3EQEA 2E63A 4RFT0 3RZZA 2VH9A 4H14A 5FQ0A 5FZ3A 4RFRB 2ZEXA 4L2NA 2JG9C 1GQHA 2Y38A 4XXPA 3LEGA 4UF0A 3FLRA 3HJRA 5FKBA 3OGRA 4HONA 4MGIE 3VBFC 3AL5A 2P3IA 3I3MA 4BIFA 2G9ZA 1R081 4B8EA 1RMU1 4IGQA 3VDCA 4QX0A 4E8CA 4D0QA 4Y4RA 4QAWA 4ZU5A 4NIHA 2AC1A 4COWA 5CVRA 5FAXA 4P9JA 2PXJA 2BV4A 4TTGA 3B94A 3RVHA 4RR3B 4XHXA 3KQRA 3T0AA 1WWYA 4IQPA 3N9NA 2ZX0A 2EIDA 4XHBA 3ZFEC 4MO3M 4QMAA 5LEKA 1N47A 1W6MB 2DUOA 4Q8KA 2XJVA 3VUOA 3O0VA 4OLLA 1LHVA 2NMOA 3USUA 3BODA 5IJRA 1LRHA 4ET7A 5GJ6A 3TNPB 1V9U2 1W3XA 1HXS1 4META 4XMAA 2VZ3A 1SPPA 5CFCC 1RB8G 5BNOC 5GM0A 2W1WA 1W6QA 2ZA9A 4YVWB 3IIIA 1N3QA 2BTVC 2CWMA 3NNMA 5IVYA 3BN6A 1JHJA 5D8AB 3PVEA 1XYNA 3ZKYA 3PUIA 5FZEA 3B9CA 3WUCA 1RUF2 1UN1A 5IVVA 1PZ8A 2JDYA 4QQOA 4MXWA 3A0NA 1RL3A 1C3HA 1KGYA 4HSLA 2RS33 4BQ3A 5K0UB 1OLRA 2R7EB 3PDQA 2GP3A 2JENA 1I3HA 2WWSA 1VALA 1JZ2A 4FI9A 2EICA 4S2FA 1HRI1 4XF4A 2VOWA 1H1AA 4FFGA 5BUVA 1MS4A 3B7MA 3PU3A 4LR4A 3BTXA 2GN7A 1UYPA 3UT0A 1W9YA 5E6HA 1OSGA 3P5BA 5FV3A 3ETQA 3FHQA 3T30A 2HEWF 3LCPA 3T4VA 4UAPA 4GKYA 3KHCA 5FZCA 1BBT3 1ONAA 5C4WA 4LO8A 4OZOA 3MIGA 1J3RA 2B8MA 4W65A 4NIIA 2IC1A 3K48A 4SLIA 2J7MA 5ABJA 2FMYA 3VBOA 2NM1A 2Z4FA 1YQ2A 1GNHA 1HRV3 2DDUA 4QX3A 1HV0A 2DVBA 4LK6A 3WP5A 3ACGA 2GU9A 2BERA 2Y60A 4U2AA 3GHMA 3I59A 5BNNC 2IXIA 1YRZA 4FP2A 4XZPA 1LOGA 2DUQA 2D98A 3J8F3 4JGYB 4LE3A 4QX8A 4W6XA 3PU8A 5DG1A 5CG9A 4XTMA 4OI4A 1E57A 3KGLA 2GMPA 3ZN6B 2ARXA 3D82A 3HBKA 4HBNA 4Q4V2 3RNSA 4UT5A 1UD1A 5L7OC 4FPHA 3ZR5A 4LKDA 1YHFA 1UPIA 2BZDA 1AYN3 4ZPIA 1LHNA 2VTXA 4P08A 1JYVA 4YRDA 2W68A 2BBVA 1DQ4A 2VTFA 1HKDA 1IG0A 3H3LA 3VL9A 1XE8A 2XB6C 3PHMA 4AAXA 2KM2A 1G6NA 4ZXEA 3BCWA 1WW5A 5FK8A 4BQYA 5DDJ3 5J7MA 3H0OA 3ZDVA 4MXVA 4GB33 5FBJA 2P3JA 1E5RA 2DFCA 2VO5A 3AZYA 4KU8A 4BWOA 4PT6A 4TSVA 5DAQA 3J9SA 2ADEA 3VBRA 5K9YA 4RS5B 1H8TA 4BQ5A 2VOTA 2RS53 4YVSC 1TQ5A 1VBD2 3SEEA 3VDDA 1VBE2 2I74A 2JXAA 3EB7A 3LSDA 2WJSA 4LO4B 4AI2A 3WW1A 4LIVA 1NZIA 1J84A 4DXRA 2JB4A 4XFHA 3MICA 5FP7A 5LB6A 2VZOA 5CU1A 4L92A 2D6OX 4UI9L 1O4TA 2R6QA 1UYZA 3USSA 3WNMA 2GAUA 5T5OA 3GZAA 3IAQA 4NVPA 2FDKA 4ITCA 5FXWA 3ME2A 4IEYA 3OGVA 2DFBA 5I0DA 5FYHA 1JOJA 1XNCA 2ZOEB 4L0PA 1UYYA 1GBGA 2E31A 3KSCA 2B46X 2HWD3 4G3YC 4LE4A 1RUI3 1D0HA 4IV3C 4XZUG 5LK5A 3RG0A 2PHXA 5ACA1 1AR81 4AVAA 1IOAA 2EA7A 3HNYM 5C9AB 3SCHA 1V6OA 1C57A 1T6GC 1POQA 2PYTA 2Q30A 2VGDA 2VBDA 2VZVA 5F3GA 2Q8CA 3KVBA 4FFHA 3RYPA 1KDMA 1APNA 2IVIB 2NP0A 2YV8A 5FYSA 3V65A 1MS1A 4COVA 2VXJA 1QU0A 2ZX4A 4XFAA 1JU3A 2JDHA 5JMCA 1SHWB 2D6MA 2ZZQA 1YC61 3M4FA 3WVJA 1JN2P 3ZFFA 5BV6A 2RDQA 1UKGA 1QKQA 3DKWA 5GKAC 1ZRIA 3WG2A 4ZKTB 3OY8B 3S7IA 1SCRA 1JHNA 5B2GB 2WZPP 2HWB3 1CAVA 1UIJA 3RJRA 2GC1A 3FN9A 2WQZC 2CDPA 3U11A 4DINB 1RVF3 4BISA 3UKNA 5C4WC 5JXGA 3NJZA 4D3WA 1N1VA 2OPKA 1OQEA 3S5QA 4LA3A 4PHZA 4CDWA 4CDUB 2D3RA 5FBZA 4F7ZA 1ULOA 5ABJC 3VBOC 2ZMNA 3POSA 2V72A 1DZRA 2ZX2A 4QPGA 4PI2A 3DV8A 3HT2A 2XBO2 1ULEA 2PHTA 1TME3 3EYPA 3OBAA 3KV4A 3K75B 1OMIA 1CJPA 2PHRA 3ACLA 3HBZA 5KHKA 1XE7A 2EVXA 2YBKA 1ND3A 1OQ1A 1PO12 2ERFA 1FPN1 4XIOA 4DUXA 5K0UA 1GICA 4AHZA 1XNBA 1QOTA 2XMLA 3LOIA 4D6QA 3N9LA 3SCFA 4IE7A 5F37A 5IK4A 1HB2A 1BEV3 5JIUA 4DQAA 3BI3A 2JDKA 4GMP3 1IQAA 5DG2A 5I93A 2JE7A 1NUKA 1V6LA 2KA3A 4IGOA 4LITA 4URAA 1U5XA 1L7QA 1R092 2OQ7A 4IV1A 4JKMA 4NAOA 5FZHA 1RUD2 2EF6A 1HJGA 2LTNA 3SC7X 3TWIA 4NAMA 2UY8A 2WFF2 3WW4A 3O1MA 4HK8A 2TBVA 4FTSA 3TBDA 4Q4Y2 3WOGA 4LO6B 1RJ7A 2ID4A 4G9SB 4PDWC 2W1QA 3JBG1 1LHUA 4GIQA 4KWUA 3SKJE 3NV2A 3V0AB 3FBYA 1RUE1 3IDBB 1HIXA 5FP3A 4MV2A 1X7NA 1TEIA 4LLFA 4IXLA 2JDNA 1Q3EA 2A6YA 1EAH3 1EYBA 1GNZA 3THPA 4GJZA 3VDDC 1RUG2 3ZPOA 2XHNA 3I2GA 4OQ8A 4R52A 1AR62 2FZ2A 2YPJA 1W8UA 3H42B 4OMCA 1L3JA 4UFHA 1CVNA 2P34A 3MIBA 4XBLA 2DCTA 4XC9A 3AJYA 1OLQA 4QKDA 2B39A 3BPSA 2E26A 3FFZA 3NAPB 5CB7A 4BA6A 2DBIA 5DAVA 3RQ0A 2A73B 5DXDA 1O5LA 1XOYA 1COV1 3TN93 4DXTA 1FNYA 1GQPA 3V0BA 4WZFA 4O61A 4YW3A 3R4SA 2VBBA 2CU5A 3HPNA 1MZ5A 1OLMA 2NYYA 2WZ8A 4FPCA 5C33A 2ZCWA 4EJRA 2LUWA 5I0TA 2A70A 1ZRDA 1ZBE2 1XPWA 3GYDA 1UZVA 5FZDA 2BOIA 5JR2A 2YXSA 3I3DA 3AC0A 1OVSA 3ZR6A 1VB2A 2JG8B 4QQ2A 4C0HA 4E8DA 2RJKA 4CZSA 2PLV3 2EXKA 1O3RA 1GNYA 3CJIA 4RL7A 5JR7B 4E2SA 3MW4A 2D6NA 5AC92 1JZ3A 2WAAA 1JOBA 2QQJA 4FFIA 4TWTA 4QDQA 4BMBA 2RMU3 4K3UA 4D6SA 2A71A 2H6CA 4QXCA 1KEXA 1ZBA3 3C7FA 3N4MA 1I1EA 1UZYA 2GP5A 4RR3C 4QHZA 2HKXA 2WBKA 2W1SA 3AXDA 3WNKA 4BMEA 4XAEA 5FY0A 1H4GA 1CWPA 1GOHA 1R1A2 1U12A 4NHMA 4UW6A 4K40A 2W39A 3IPVB 2E33A 3A0KA
chains in the Genus database with same CATH topology
4CP1A 4Y4YA 3ZX7A 4CDWC 2BNNA 4QPYA 1AF9A 3LKJA 4W6WA 1DQ1A 4YW5A 2MEV2 1FYUA 1POV1 3AXEA 3QOPA 3AMQA 5BNQA 4IEUA 2R071 2BWAA 2GSYA 4YM0A 1HW5A 2BW8A 2EALA 4ZU7A 1Q56A 2Y0IA 4YW4A 5K0UC 2VNGA 1KXGA 3M3EA 2X5IB 1CAWA 3AMNA 1C4RA 1PO22 2A6VA 4YFZA 2ZAAA 5FFOC 2FHRA 4X6RB 1VBB3 2XGXA 4IV1C 2HWC2 3D4KA 4RSUA 4FPGA 4CDQB 2ZPXA 4KNCA 4Q0VA 3X29B 1G9BA 5FO8B 5BYNA 4XFCA 5I8SA 2VQ0A 3P3NA 4FXGB 2P37A 3POWA 1O4ZA 2N7GA 1PZ9A 1FNZA 1WBFA 3GZUC 4AEMA 2R061 5JIAA 1J3QA 4Y5Z0 1RUC3 3LOBA 4FAGA 4Y24A 4KQ7A 1DHKB 3JU9A 2D97A 3KCCA 3M3IA 4IEXA 4JGYC 4AFBA 3AFGA 1PGW2 1Z7S3 1ZZ9A 3SH5A 4E2GA 1V6IA 4X8PA 1LGCA 1VBA1 3CNAA 1WBLA 3HIFA 2CGPA 3NL1A 3T1MA 2E51A 1QJY2 4AK3A 3ZYIB 5FTTC 1RIRA 4F8AA 1OPOA 2A3YA 3KM5A 3OJBA 4ZXKA 4P9GA 4E4ZA 3B3QE 3FMGA 4DOUA 1IS6A 3CJIC 4X8NA 1W39A 2ZGUA 4Z82A 1CGPA 4F3JA 1R082 3NW4A 4IEWA 1RMU2 2Q4SA 1AZDA 3N35A 4QM8A 2OZJA 4R4XA 2K2SA 3U4XA 5IK7A 4P9IA 3T2TA 1RC6A 4PLMA 1ZVFA 4DY3A 5DUXA 4JGZA 2WNUA 3PVBB 2OUHA 1I9RA 3QLQA 4XQ4A 1SEFA 1ZX5A 1FMD3 3IIAA 4FTBA 1S2KA 1IPKA 1GQGA 5EWSA 5GLVA 3ROUA 1WD3A 4R9BA 1BCXA 3VZOA 1C1FA 1GANA 2PHDA 4KWKA 1HXS2 4FPLA 2DVFA 3PVNA 4CEWB 2VXRA 1YI9A 5DUWA 3VHRA 1ENRA 2WA4A 2IXJA 4Y20A 4GKXA 4AVVA 4TLFA 3IDCB 4MUVA 2DURA 3WXPA 2WS93 2HWF1 1SLAA 1PM7A 1U5YA 4XBQA 3RDIA 3LWCA 1QH7A 5F6LB 5LRRA 4LHLA 1YCIA 3AZVA 4XJUA 3VBSB 1Q8SA 1DBNA 4HKLA 3I54A 1VP6A 2RS31 4N53A 1A8MA 4XJWA 4L8QA 1MQTB 2WKKA 2WNVB 4OZXA 4Z2WA 5BNPB 2SBAA 5EYYA 3IPVA 1F5FA 3SMHA 5JVVA 1NE6A 3OGGA 1AJOA 4YZ2A 4ZU4A 1H2LA 4QQLA 1QJX2 2H0VA 2P3KA 4R8HA 2XWJB 4AQ6A 1QDCA 3OBTA 2XG3A 2GC3A 1YFUA 1GFF2 4XIKA 1B35B 4NOTA 4QT6A 4OHYA 1BBT1 3AYDA 1DYPA 4I3PA 1AJKA 1V9U3 3PMEA 1NXMA 2AR6A 2TEPA 1NCRB 4LO7A 3MIHA 3ZFGB 4HPKA 5J09A 5GLTA 1DIWA 1OA4A 1KJLA 5BY5A 5JSRA 2K0GA 2WZR2 1N3PA 4XF3A 5A33B 3UJQA 1RUF3 2JX9A 4KWJA 4N7IA 2OZ6A 5CADA 2B42B 3VHOA 2WL1A 1GZWB 1REFA 2JG9A 2D5HA 1G9FA 1W6OA 3EXUA 3VBFA 4AQTA 3CL1A 2TNFA 2DV9A 4IETA 1QNYA 3DPRA 3ZYPA 1OQDA 3RI9A 1YJLA 1DLLA 4P9LA 1VBC2 4L9BA 5HCAA 3FLTA 4URTA 4AFMA 2ZGSA 1RJ8A 2VOXA 1REEA 1LEDA 5J98B 5KXEA 3FC0A 2WLPA 4HKWA 3WDXA 4HLTA 2ZAHA 4QM9A 4GB31 2WNUC 4XFBA 1XXNA 3BOWA 1JH5A 1SBDA 1EY2A 4IL7A 3NAPC 2O1QA 1UX6A 3WDTA 2DCYA 1V6JA 4EROA 4CDXA 1DZQA 4L97A 5ACA2 1AR82 2UYAA 1EPWA 4Q4V3 4ASMB 2ET1A 4YGBA 3FE5A 3IWZA 4PLNA 4LBQB 5JOWA 2F6BA 2IXKA 2RM22 3AMPA 4QD2A 4P14A 1PK6B 2NMNA 4L11A 5C8CB 2HWD1 3I4IA 1RUI1 4BHPA 3QBQA 2UYBA 1SLLA 1POV0 1EP0A 1KS5A 4JRLA 1SLCA 3BALA 4H7MA 4N53C 4GH4B 3ZXKA 4YGCA 2PQQA 4IEVA 1VBD3 4AQSA 4XILA 1VBE3 4LHKA 3V56A 2C0ZA 4GALA 4YZ4A 1BK1A 2PA7A 4MH0E 1I5ZA 1XYOA 2BFUS 1NZCA 3M2MA 4C1XA 1GZCA 1W6PB 4KBBA 4OFGA 2VQAA 3FJSA 4BM8A 4INDA 2AUYA 4V1PA 3OGJA 4MYEA 1RVF1 3BU7A 4HT1T 4K1ZA 3WT3A 2ZBJA 3MEPA 3PJYA 5L7OA 4AEJA 4NPRA 2XLFA 1I6XA 3VBUB 1MVEA 3AP9A 2X5IC 3NVCA 1G9CA 4MSVA 3M70A 1DG6A 4Y22A 3MLLA 1ZREA 4DZGA 4WV8A 4WM8A 1CAUB 1K5MB 1SLIA 1YLLA 2HYKA 4M00A 1WGPA 1RUH2 3EHKA 1EV12 3N7LA 3MFAA 5KHGA 2BNOA 4JV4A 1FOD1 2JKBA 5CFDA 2Q1MA 4I01A 5J36A 3AP7A 4PBPA 2D3SA 1ASJ1 1YFYA 3JBG2 4YVSA 1CPNA 3DPRC 5KC5A 3DN7A 1QDOA 1RUE2 3JQXA 3ZN5A 1QQP3 3EBRA 3TYJA 1S0EA 1U5ZA 2ZHMA 4XOGA 3ZVXA 4CEYB 1HQNA 2HJIA 3ZIWA 1VAMA 3WINE 2JECA 1FATA 3AFKA 3ZMNA 4FPKA 1CR7A 4ISRA 2AGSA 3ZN4A 1O3QA 2XBO3 1VRH2 4AI3A 4YZ3A 4IV3A 3LAGA 3I2DA 4LBQD 1EAH1 3VLBB 4AVTA 5JI7A 4XEZA 1PO13 1DDLA 3TOJA 4YM2A 3ATGA 3VHPA 4CDXC 3HT1A 4A7ZA 2DU1A 1VR3A 2ZMLA 3OYWA 3UV9A 2QNKA 3D0JA 3WDVA 1QXPA 4XF9A 2D44A 3DUIA 2ZX1A 2VVFA 4M0NA 4Q0SA 4AVSA 2EIGA 5CNAA 1R093 2E7AA 1J1TA 3CU7A 1RUD3 3OD4A 1TMF1 1NCQB 1H30A 3VGIA 2WFF3 2RHPA 2WSVA 3UKVA 4EV0A 3H8UA 4Q4Y3 4B29A 2R1BA 3SXWA 3ZXLA 4KG8A 5F6KA 3VZMA 5H9PA 5J37A 1AX2A 4ES8A 4PBOA 3DF0A 1MEC2 3H7YA 5T54A 3VBHB 1Q8OA 3DL3A 1RUG3 4YYOA 3PNAA 5JLVA 4RQPA 3WP6A 3AJZA 5FO7B 2RMU1 2ATFA 5AVAA 3G6JB 4I09A 1ZBA1 2WQ4A 4ISQA 5JSPA 1C28A 5HI0A 1BYHA 2OA2A 4YG6A 1WMEA 2R072 1AXYA 4Z1VA 1BQPA 1U5IA 3G7DA 3O0XA 4R4ZA 5JCTA 2WFPA 1YFXA 4MGZE 5L36A 1Q43A 1YIPA 4OHVA 4AHXA 5C8CA 1ZBE3 3FUQA 3CO2A 1UU4A 4FO9A 3VBSC 2NLRA 3WY6A 4BCUA 2ZGMA 4FSJA 4FAHA 1RTVA 4WM8C 2LM3A 2XJSA 4PDWA 3WP3A 4I2OA 1BMV1 2P2KA 3FX3A 4I3GA 3M3QA 5DUUA 2BGCA 2E9QA 5AC93 4EN6B 1C8M1 3UK9A 1WD4A 5CFDC 3WQ1A 1MQTC 1LGBA 3WCRA 1DU3D 2X8KA 1ULCA 4LBJA 2ZGKA 2CWSA 4YFWA 4QX5A 2R062 3D8CA 1R1A3 4C91A 2A6XA 2UU8A 4LEJA 4QPIA 5A32B 2PAEA 4D7SA 1D4M2 3MF9A 4PQ9A 1LEMA 2MEV3 1DF0A 2QZ3A 1UCXA 3R4UA 2ZKLA 1VBA2 2HWE3 4WM7B 2VMGA 5KXCA 3MGUA 3VKOA 2UWAA 2BUKA 1FV2A 1RUC1 1Q8QA 3ELNA 3R4DB 1K5MA 1QJU1 4EN0A 1F5JA 1H2NA 5JI9A 1LGNA 4UBGA 4GWMA 1Z7S1 4YG3A 1PO23 3IM0A 2XVLA 1LOFC 4Q27A 1CONA 4LBKA 3PLQA 2XVGA 4IERA 2HWC3 2R0HA 3MI8A 3QH7A 4Q1RA 1W0OA 4X6QB 4P9WA 4RR3A 5CIRA 2QQPA 3N3HA 4RHV2 4MGYE 2R16A 1W6MA 1OFNA 5AVPA 4NN0A 4BLJA 1XQNA 4Y1ZA 1Z0HA 1JW6A 2F4PA 3JQWA 4XMIA 1M4WA 3B69A 4K20A 4YVWA 4AGGA 2D6LX 2GMMA 3BB6A 3E5UA 5D8AA 2GNTA 3N7JA 4KG0A 4RQPC 2UURA 4Q26A 1NG0A 3WP4A 1BVP1 2V73A 4OHXA 2IWGB 4AXOA 3KMHA 5GZEA 4AVCA 1FMD1 3PJQA 2XJPA 5SV8A 1DFQA 4AEDB 5FCCA 1QJY3 2HWF2 2R30A 5GZDA 2PAMA 5KBFA 3IDEA 1FV3A 3VHNA 1AR91 2ZZJA 4Q8LA 5C8CC 1NXD1 2A6ZA 5D1IA 2RR12 1S0JA 1S0IA 4Q0PA 1XU2A 3WG3A 4XJZA 5GLWA 2YGLA 3WLUA 1KQRA 5L19A 5EJ3A 3ZIXA 2R041 1S0FA 2ZGNA 2JICA 1S2BA 1R083 4GH4C 1RMU3 4OI2A 1JYIA 1ZRRA 4N43B 3SH3A 3WD5A 3N36A 3MYXA 4FPJA 5FREA 4DS0A 1CX4A 4PF5A 1ZM1A 1LR5A 3JD72 4JGYA 4GQ7A 5E8AA 3WQ0A 2PTMA 3FWEA 3ZN6A 4QPIC 3WZ1A 1HXS3 2D5FA 2ZS6B 5JAXA 1VB4A 1BKZA 2HEVF 2ZMKA 1J59A 3AZZA 3S30A 3B01A 1CAXB 1GSLA 4LA2A 3LGRA 3C2UA 1YJKA 3KT1A 4KWLA 1MZFA 1V9U1 5KWRA 1K5MC 4OUMA 1W6NB 3LZZA 2ZHNA 4WVMB 1GV9A 4J1XA 4I0BA 4CRQA 4KL1A 4RS5A 1AXKA 1MACA 5FOJB 1X8MA 4Z07A 1LCLA 2AYHA 1RUF1 1UAIA 4KU7A 3LA7A 2Q5TA 1NE4A 2A3WA 2XPJA 1NQDA 3MLKA 4M3CF 1RHI2 1O3SA 2ZGOA 1MS3A 3E6CC 1DGWA 4DXZA 1QJX3 3MW2A 1F8VA 4C90A 4G4FA 1UMZA 3HN1A 3D0SA 1UF2C 2RJLA 5KXBA 3NV4A 2CY6A 2ZGRA 3RJ2X 4YVWC 1AYM1 1FI2A 4AYUA 1PVC2 5D8AC 4B7KA 5C9AA 2D6PA 1RUJ1 1LJ7A 3NSTA 4XXAA 4Q4X3 1IS5A 1N1TA 2WZR3 1ZA4A 5FO9B 4FQZA 4XFIA 1FXZA 4XJ8A 1ND2B 1NA1B 1KD7A 1NQJA 1PIV1 3OPZA 4LBNA 3PMSA 4YZ5A 4ORFA 1VAVA 1ZRCA 3D5OA 5JZGB 2CYFA 1H1MA 3NV3A 3IT8A 2PFWA 3POYA 4P9XA 3OY8A 2CGNA 3KZ4C 3N7KA 1F31A 4XJAA 1SLTA 4H7LA 4Q4V1 3U0ZA 2NPIA 3J26N 1DQ6A 5FMOS 2QE3A 1VBC3 1ZYBA 4Y1VA 4CDUA 2VVEA 3ZYRA 3IBMA 3PTYA 2VMIA 4Y1XA 5E1RA 3VBHC 3VKFC 4K9SA 1NY72 4JTNA 2VUAA 4WVZA 2PHWA 3E5XA 4RGGA 1RGSA 2TUNA 2XH6A 1BVVA 5HCBA 4IEQA 4XTPA 4BYYA 1AR72 4D7YA 2YUEA 2E7QA 5GLZA 4B4RA 1VBD1 3B02A 3WR0A 1VBE1 1SLBA 3GBWA 2DWRA 1PZ7A 1X33A 5ACA3 1AR83 1Y3TA 3WDWA 3ZFEB 2MHFA 1IGOA 1ENXA 2RS12 3V64A 1SBEA 3ZSMA 4M3CB 4GWNA 4HN1A 3RI8A 2RM23 1AL21 3AMHA 4Q4W1 3ZXDA 3V0AA 3TB0A 5CFCB 1UW8A 5BNOB 2Q0AA 1Y43B 1FOD2 4XPVA 4K6BA 5IK8A 1MS9A 1ASJ2 4RS5C 2XL7A 4HK9A 5I0RA 3L2HA 4TYSA 4IEPA 1H9PA 1Z78A 1UPSA 3WHTA 2MNGA 4YZ1A 2ETEA 5FLHA 1O4YA 3ES1A 2OIIA 3ZSJA 1XNDA 3NAPA 4QHBA 3J4UH 3A4UA 5BXXA 3ZYGA 4O9GA 4FT8A 4WZCA 2QKDA 1QQP1 4FBFA 1EAH2 4LHNA 4B3NA 5C9AC 5JPMB 4WVVA 2QUOA 1OOPB 5HXVA 3O0WA 2W0XA 2CNAA 1QXRA 2JG8A 3WW3A 4JRAA 4E4DX 4O9EA 1HRI2 1S1AA 4Y1YA 2I2SA 2QFEA 2FBEA 1RUH3 3B00A 2B7YA 1TMF2 1EV13 2LALA 2X53S 2Y26A 2BVBA 1QHDA 5DZFA 4YLZA 2JJ6A 1KFXL 1N1YA 2B9UA 3JBG3 2Z42A 5JOZA 3FUOA 3MF6A 2R1DA 1RUE3 1NLRA 1ZZ7A 2JEMA 3BIWE 4JTOA 3ST7A 4D7TA 3AZXA 1R091 1RUD1 4CDUC 1WCDJ 3OBRA 2VULA 4BPZA 5CAZA 5JOYA 1JUHA 4EWAA 5FQ0B 1C5IA 2RMU2 1WW4A 4IEZA 2NZ9A 1QOOA 3SH4A 2BVVA 1VRH3 1SFYA 3NO8A 2ARBA 2DCKA 4JC1A 4D94A 2X5IA 3AX4A 2EAKA 1HRV1 4HMZA 2YDEA 3K51A 4OHWA 3UJOA 4AEDC 2EXHA 2X29A 3R05A 5J3UA 1MZEA 1PGL1 2VMHA 4E2QA 3J8F1 2XJRA 3VN4A 4CDQA 5FLJA 1G9AA 4KH9A 2OUJA 4DB5A 3USUB 3KS7A 1QMJA 1V6MA 1BMV2 1UU6A 1DQ5A 3O7OA 3IN9A 2WT2A 1W6QB 1LU2A 3WHUA 1C8M2 2CV6A 1ULGA 1AYN1 2UY9A 2VOKA 4K7JA 1SBFA 2UWCA 3M1HA 1URXA 3KT4A 3ENRA 3O12A 4MXWB 4FOQA 5DDJ1 1MEC3 2VPVA 4SBVA 5FOBB 1X50A 4XQDA 5AC91 2A3XA 2WSUA 4NHLA 4HZFA 1LOEA 2XKOA 3SCGA 3RWNA 2RS51 1CPMA 1KJRA 2D43A 2WA3A 3VZNA 5H9QA 1X36A 1POV3 3SITA 4IEOA 1BJQA 4E9KA 2R073 4DPNA 1W0PA 5C4WB 4COUA 1G7YA 2W08A 2GH2A 2CGOA 3KB5A 1NOVA 4MLOA 4YGDA 2B5HA 3FLPA 5FLIA 5ABJB 1QJU2 3AKRA 3VBOB 2JG8C 2ZTNA 1XNKA 1D4VB 1Q8VA 4BH9A 1RITA 3I59B 4RA0A 1HQWA 4D69A 1G9DA 1CESA 2HWE1 1REDA 1X8EA 2ZGLA 2OW4A 5DUVA 4S2HA 4C1WA 1ZZ8A 1SDWA 3ZYJB 3WDUA 4YNIA 1PNFA 4B4PA 1YWKA 2DUPA 2GH8A 1PO21 3N7MA 3E97A 4FXKB 4E4SA 2R063 2Z2SB 3WQ7A 4C0BA 2ES3A 1MVQA 2C5DA 4CEWA 3ILNA 2A75A 4QQPA 3NKTA 1D2QA 3MIDA 2HWB1 3PVOA 1LOBA 1MS5A 1XYPA 1CN1A 2AREA 1CJDA 1D4M3 2RE9A 3ECQA 2XHKA 3ILRA 1PNGA 1FPN2 3JB8A 3IKWA 3VBRB 4COYA 1H8TB 4A2UA 1VBA3 2YROA 3AP5A 1Y9QA 3MFCA 3VDDB 1ND2C 5T50A 2XLAA 1TME1 3VBSA 4E27A 2Q1ZB 3GHNA 4N90A 1ZRFA 4JDMA 4NHKA 1H2KA 5JZGC 1AR92 5H9SA 4FPOB 2IXHA 4FPFA 2C9AA 4CDQC 1TNFA 2VW0A 5LEJA 4AGVA 1MQTA 2WNVA 5BNPA 1BEV1 2CTVA 3E5QA 3JUUA 4AHWA 2R042 4JVAA 4GMP1 5T3NA 5A3LA 2GALA 3AZWA 4RHV3 1C1LA 4LNVA 1WCKA 2ZJCA 2WIIB 1B35A 4FPYA 4J1WA 3FHIB 2XL9A 4NWWA 1NCRA 3H1MA 3ZFGA 5GLUA 2ZABA 1FT9A 4ATFA 3ZO0B 5A33A 3VKMA 1COV2 3ZFFB 5KHJA 1LKNA 3AK0A 3ZXFA 4L99A 1OA3A 1QWRA 2BFUL 2E7TA 2MPFA 1ZZCA 1CAVB 4LBMA 1GZWA 2XJUA 4YW1A 4EWDA 1J1LA 4HVOA 2O8QA 2SLIA 2JDZA 3GBFA 2GNDA 4KGQA 4XBNA 2HWF3 1LOFA 4CDWB 3BOPA 1ZNPA 4HANA 2BYVE 3U10A 3TN91 4QPGB 3WDYA 1AUYA 4M3CE 2RR13 1VIWB 2D7FA 4UW3A 3QACA 1LTEA 3BPZA 1ND3B 2FMDA 3KLSA 3CF6E 5FRAA 4YM1A 3E6DA 2VOVA 3WW2A 2PLV1 2R49A 5JOXA 3LB9A 3AP6A 2YGMA 1IZ3A 3M8LA 5E88A 4CYDA 1AR63 3ASIA 4IV1B 4BQ1A 4JDNA 3JD73 4PIYA 5IT6A 5JDBA 2B45X 4UXAA 3W59A 4CEWC 4XFGA 2WINB 2AENA 2IFRA 2DTYA 2ZHKA 1AYM2 3AM2A 3ILFA 4XETA 3C3VA 3AKSA 2V09A 1OOPC 1CQ9A 1RUJ2 1JBCA 4LBQA 4LO5B 1H4HA 1QJX1 5F9TA 2DCJA 2G9GA 1PK6A 4YARA 1PIV2 1OA2A 2I45A 1G8WA 4QGMA 3W9AA 4F83A 4AEKA 4ATEA 2WNEA 1WA4A 5GZFA 4DRRA 2K9ZA 4Q4X1 3GBGA 1D2SA 2WZR1 4GH4A 2GN3A 2WNVC 4W6YA 3VZLA 5BNPC 3V0BB 3S6PA 1VAKA 2VW2A 1RHI3 1TNRA 4XF0A 1QXJA 1VBB1 4QGLA 1W6PA 4GA9A 3JZVA 1DGWX 2ET7A 5HCFA 3RYKA 1A6CA 2YYOA 5AFBA 2QCSB 1U0AA 2YHJA 3ZMOA 1C8NA 1B35C 2A5ZA 4ES9A 4HL0A 3INAA 4R9CA 1WLCA 2VECA 3CJIB 1VBC1 1YXWA 1NCRC 2ZX3A 2A6WA 3ZFGC 1VLNA 1O5UA 1LHOA 1IPJA 3VBUA 2I07B 2D40A 4FCAA 5BPXA 5LRSA 4TZDA 4EN8B 2H6BA 1PVC3 2AZ5A 4BE3A 3Q9OA 1KITA 5I8YA 2EXJA 4Q29A 2QZ2A 1UKRA 4I0AA 1HV1A 4HFSA 3VL8A 3TAYA 1SCSA 3H1YA 1CAUA 1R1ZA 2VG9A 4PCRA 4UBHA 1BZWA 2D93A 1V00A 1AL22 1LODA 4Q4W2 2KXLA 1S0BA