1NA1C

The structure of hrv14 when complexed with pleconaril
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
molecule keywords Coat protein VP1
total genus 39
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1na1C00
4WM8A 1VBB1 3DPRA 4RR3A 2GH8A 3CJIC 1RUJ1 1VBD1 5L7OC 1D4M1 1R092 2ZZQA 1OOPC 4Q4X1 3VBOA 4CDQC 1H8TC 1IHMA 1NA1A 1ZBE1 1NCRC 2HWF2 2RM23 1R082 2WZR3 4RHV2 1PVC2 5CFDA 1RUF1 1NA1B 2BPA2 3M8LA 1VBB2 1RUC1 1BEV1 1NG0A 1VBD2 1W39A 4GB31 1PIV1 2RS33 1AR81 3JBG3 1OOPB 3ZFFB 1ZBA1 2ZTNA 1EV12 5A33A 5C9AB 5ABJB 4N43C 4YVSB 1RUJ2 4AEDC 3VBSC 1FPN1 5BNPA 2FZ2A 1HRV2 4GH4C 4Q4X2 5J98B 4YVWA 3JB4C 1RUE3 4GB32 5K0UC 1RVF3 1QJU2 1RMU2 5BNOA 3ZFFA 1NCRA 3JBG1 4QPIC 2X5IA 4IV3A 1VBC3 4IV1A 1QJX1 4CDXC 3VBHB 4RQPA 2R043 1PIV2 2PLV3 1V9U2 1AR82 2HWF1 5GKAC 1PGW1 1RUH1 3J8F1 2R072 4RQPC 1VRH3 3VDDC 1X36A 4IV1B 1C8M3 4LLFA 2MEV2 1NY72 4N43B 5C8CB 1RMU1 1B35A 1K5MB 4N53A 3JBG2 1EAH1 1AR91 1MEC3 1FPN2 1X33A 1TMF2 5CFCC 1QJU3 4GMP3 5FOJB 1AR63 4WM7C 1FOD3 1Z7S2 1NCQA 5JZGC 1QJX3 4Q4W2 5BNPC 4GMP0 2VQ0A 4CDUA 1R083 4RHV3 1FOD1 4RS5B 5ABJA 1NA1C 1PO11 1HQNA 5C4WC 1QJX2 1M06G 1K5MC 3VBHC 1PGL1 1EAH2 1MQTB 2Y26A 4Q4V1 5CFCB 1R093 1PGW2 4Q4Y1 2TBVA 1BBT1 1FPN3 3JD73 1ND3A 4WM7A 3VBFA 4Q4V3 3ZFGA 2WWSA 4QPGC 1ZBA3 1RUJ3 3ZFGC 3VBSB 4Q4W3 4CDWB 3VBFC 2R071 4WM7B 2R062 1ND3B 3VDDA 1PIV3 2RS31 1ASJ2 3VBHA 1OHFA 1ZBE2 1PO21 4Q4W1 1NY71 2DF7A 1PVC1 1RUF2 2QQPA 1TMF1 4IV1C 1ZBE3 4WM8B 1RUC2 1RUD1 2XBO2 5ABJC 1Z7S1 5C9AC 4QPGB 1HXS3 1PVC3 1HRI2 1QJY1 2RMU1 4AEDB 4YVWB 4Q4V2 2PLV2 1D4M3 4Q4Y2 2RS52 1FOD2 2HWB3 4QPGA 4YVSA 1H8TB 4CEYB 1PO22 4GH4A 2WLPA 2XPJA 5AC91 1RUI1 2WFF3 4GB33 2R061 4CDQA 4CEWA 3ZFEB 1QJY2 3HAGA 5C4WA 1QJU1 4Q4Y3 4SBVA 3LOBA 2RS51 1NCQC 1RHI1 5FMOL 1R1A3 1HXS2 1AR62 3VBRA 1EV13 5DDJ3 5LK7B 2X5IB 1NCRB 1ASJ1 2BBVA 1HRI1 2RMU2 1V9U1 5AC92 5D8AB 4QPIB 2PLV1 3NAPC 5CFCA 1QQP1 1MQTA 1RB8G 1B35C 2R041 1ASJ3 2RR11 1VAKA 1VBB3 2MEV1 4CEYC 5BNPB 4PDWC 1F2NA 1R1A2 4CDUB 1RUC3 3S6PA 1A6CA 3DPRC 4GMP1 4WM8C 4YVSC 1RUE1 1Z7S3 1VBA3 1QJZA 2HWD1 4QPIA 3VDDB 1RUI2 1QQP3 1PO23 1VBC1 3VBSA 1AYN3 3ZFGB 2R073 3VBFB 2FZ1A 1QQP2 3NAPB 2RS12 1HXS1 1QJY3 3TN93 1AUYA 1AR61 2R042 2RM21 1MQTC 2ZAHA 1ND2B 4IV3B 1VBE3 4PDWB 1TMF3 1VBA2 1R1A1 5ACA2 3DPRB 2X5IC 1RUG3 1FMD2 2MEV3 4FTBA 2WFF1 2RS32 1F8VA 5BNOC 2RR12 5JZGA 1RUE2 4JGYA 1E57A 1V9U3 2RS11 2RM22 4RFT0 4AEDA 3VBOC 1AR71 1RUD2 2XBO1 5A33B 2BFUL 1VBC2 3VBUB 5BNNC 4JGZC 1POV1 2GSYA 5C8CA 4N43A 2RMU3 5ACA1 1VBE1 4PDWA 1OOPA 1RUD3 1GFF2 3VBRB 1VRH2 5L7OA 3ZFEC 2R063 2RS53 3NAPA 4Q4X3 4BCUA 4JGYC 1NOVA 4RQPB 2RR13 4N53C 3ZFEA 3TN91 4CDQB 1AR72 1CD3G 1FMD1 1RHI3 1AL23 5CFDC 1HX6A 5BNOB 5C8CC 4YVWC 1C8NA 1VBE2 3FBMA 4CEYA 1RHI2 1H8TA 5A32A 4CDXA 4RR3B 1ND2C 5DDJ1 1AR93 2HWD3 4JGYB 1WCDJ 1TME1 3CJIA 1AYN2 2HWC2 4CDUC 1FMD3 2WZR2 2WS93 2HWF3 2XBO3 1RUI3 1VRH1 3VBRC 2BFUS 4CDXB 5K0UA 1R081 4RHV1 1VB2A 2HWE1 5D8AC 3JB8A 1ND2A 1VBD3 4N53B 1B35B 1K5MA 4FTSA 4CEWC 2RS13 5DDJ2 5BNNB 1C8M2 4CDWA 5CFDB 2HWC1 1BBT3 2WZR1 2HWD2 4FTEA 1HRV3 5C4WB 5ACA3 3VBOB 1PO13 5L7OB 4Z92B 1AYM2 3VBUC 5AC93 3IDEA 1HRV1 3ZFFC 1TME2 1MEC2 1AYN1 1BMV2 1RUH3 1AL21 3J8F3 4Y5Z0 2WS92 3VBUA 2HWB2 2IZWA 5J96B 3ZXAC 3CJIB 1COV3 1POV0 1SMVA 1CJDA 2HWE2 4EJRA 1VBA1 1AR83 4NWVA 1BEV3 1NCQB 5A32B 5JZGB 2WFF2 4RR3C 1RUG1 1AYM1 1C8M1 4IV3C 1R091 5D8AA 4JGZB 1RUF3 1RUH2 3J8F2 3JD71 1RMU3 1VB4A 1AL22 1AL0G 1TME3 4NWWA 1AYM3 1RVF2 1ND3C 1D4M2 1AR92 1COV1 1HRI3 2HWE3 1BMV1 4CEWB 4Y4YA 1RUG2 2WS91 5BNNA 1OPOA 2HWB1 3JD72 4FSJA 4JGZA 4CDWC 5FMOS 4GH4B 1EV11 1EAH3 1MEC1 1RVF1 3TN92 1PO12 1BEV2 5K0UB 1POV3 1PGL2 1AR73 1COV2 4RS5A 1ZBA2 1BBT2 4RS5C 2HWC3 1DDLA 5C9AA 2BUKA
chains in the Genus database with same CATH superfamily
1QJEA 4WM8A 2ZX3A 1W9YA 1BYHA 1ENXA 1S55A 2GN7A 2IVIB 2AZ5A 4LR4A 2Z4FA 1YO8A 4QB6A 4YGEA 2GH8A 2DWRA 3VB9A 1ZZ9A 1JHNA 1D4M1 4NHYA 1R092 4F8AA 1Q3EA 2ZZQA 3T1LA 2B8MA 5LY2A 1QU0A 4E8DA 5E16A 5K4LA 1H8TC 1UW8A 5H9RA 4FOVA 3UKVA 1HQWA 3VN4A 5LBFA 2ARXA 2YV8A 5KC6A 3POFA 1NCRC 1WCSA 1R082 2W52A 3KGZA 4RHV2 4XW3A 3TEYA 3GJBA 5C3QA 3KHCA 3KGLA 1KFXL 1RUF1 2E51A 2K9ZA 3ZMNA 1H1AA 4GXLA 2J1SA 3EYPA 3HPNA 1RUC1 4XJWA 1Y43B 4CSWA 1LNSA 1JTZX 2KXLA 5JR7B 1NXMA 4XDPA 1YJKA 2H6CA 4I3PA 2EXKA 4DXSA 5FXZA 3OUJA 3ZFFB 1JN2P 2WNUB 3I2HA 2O0OA 3INAA 1IS6A 1QWRA 4IE5A 4Q29A 4XIOA 1HLCA 4QXBA 5CKQA 5A33A 2JENA 5JSPA 5C9AB 5ABJB 1REDA 2XLFA 4B7EA 1JW6A 1RUJ2 3MUZ1 2ZGNA 4AEDC 2JDKA 5FZOB 3E5UA 2ZGKA 2D40A 2V5DA 2WQ4A 4AEKA 4AE2A 3NKGA 5J98B 2MHFA 4YVWA 3JB4C 5FZMA 3OD4A 4BOWA 1JZ5A 1A3KA 2Q8DA 5K0UC 4OYUA 1RVF3 4YM3A 5A70A 5FPVA 1NAEA 1JYTA 2DCYA 2NM1A 4QX0A 2O8OA 1JI6A 1GUIA 3OTFA 3VDBA 3J7LA 1RMU2 1US2A 3NV4A 1LEMA 2WNUA 4Q2FA 3ZFFA 4BLJA 3AFKA 2WA4A 3O1MA 2WYSA 4IV3A 5EP9A 1VBC3 2W95A 1GR3A 3MUY1 3DYOA 1LU2A 4CDXC 5HI0A 4YLZA 3VBHB 5I91A 3B02A 4IETA 4UI9L 2R043 1JODA 3OBRA 4OUEA 1HKDA 1E5RA 4DS0A 4HVOA 1AR82 2BBAA 4K9SA 4O7XA 1RUH1 2JDZA 5FZ3A 1JZ4A 5FUPA 5IJRA 2XONA 1AXZA 4XBNA 3VDDC 4BQ3A 4GJZA 1C8M3 1SG3A 2MEV2 3WXPA 2VZ1A 1XSRA 3E6CC 2FDFA 4HG6B 3X29B 1IPSA 2N7GA 3CO2A 3JBG2 1MEC3 2VBPA 5DAVA 1LOGA 4AFAA 4GIQA 4XJ9A 5FOJB 1S0GA 1MS4A 3KT1A 1Z7S2 4XF1A 3P1IA 1QJX3 1IOAA 3HVDA 4Q4W2 4Y5SA 2QJVA 4LTAA 2PHDA 5JDBA 2EAAA 1ONAA 4CDUA 1LCLA 4XVHA 2A6XA 1FATA 3VHPA 1AHSA 3C7OA 4R9CA 4RS5B 3GBWA 1X82A 1LAJA 1PK6C 2VOWA 2WN2A 4AR2A 2FDKA 3PVOA 3KD4A 1JYWA 1QJX2 5A7WB 2D43A 4DB5A 3NMBA 5FO9B 1M06G 2CSGA 3O1VA 3PUHA 3WF2A 3ZYGA 5CFCB 4OHVA 5JIAA 5BUVA 4Q4Y1 2TBVA 5C7GA 1ZRRA 3SMHA 4NR1A 4B4RA 3DECA 2ET7A 4JTOA 1ND3A 3C7HA 3IAQA 4WM7A 4MGKE 5CBLA 3IIIA 4XZUG 1XBFA 2UU8A 2BVVA 2Y6KA 2XJRA 3NV1A 1YI9A 2WWSA 3QH6A 1ZBA3 3MF6A 4JKLA 4MGSA 4YW1A 3HIFA 3WW3A 4NPMA 3NJYA 3WW4A 4L8QA 4COZA 3I2JA 1J59A 4ZZ8A 1YYNA 2W3JA 4LE3A 4PBPA 2JE8A 1GSLA 2R071 1N1YA 5GLVA 5FY1A 1TNFA 1LOBA 2JIGA 3CJXA 3ZYIB 4WZFA 3VBHA 4FXKB 1H9PA 1OHFA 1V6IA 2C1FA 3BOPA 3K4DA 5LRSA 2XHNA 3NJVA 2ADDA 5CNAA 3WHUA 2VZSA 3L2YA 4BYYA 4TTGA 3C7GA 1U5YA 4LHNA 1ULPA 2J1UA 4OI4A 4KG8A 1RUF2 1V6NA 1YEWA 1TMF1 4Y5TA 3UESA 2X29A 4XYXA 5CISA 1ZBE3 4WM8B 1PMHX 1RUC2 1UIJA 2XBO2 4YZ3A 4KG0A 5E6HA 1UY0A 1SDDB 3T1MA 3BIEA 1HXS3 5AFEA 1HRI2 2RMU1 5FYYA 1JS9A 1KJLA 1M4WA 2J7MA 2Y6HA 4HK9A 1STMA 2AGSA 1QOOA 2JEMA 2XWBB 2PLV2 3K77A 3OJBA 4XFCA 1PM7A 3RNSA 3WG3A 2RS52 1LOFA 1WBLA 1UN1A 3EQEA 2AENA 2DUPA 3AL5A 2HWB3 4OHWA 5FDBA 1H8TB 4JHTA 2B45X 2PYTA 4C1WA 5IVBA 2TUNA 4GH4A 2R30A 4XETA 2UY8A 3MFCA 2QQMA 4UF0B 4GA9A 1V00A 3A22A 2WLPA 1XU1A 1ZRFA 3B94A 3O14A 4HSLA 4ZONA 1UIKA 3MW2A 4YM2A 2D5HA 2OPWA 2HEYF 3Q8BA 2R061 1HN1A 3ZYBA 2QQJA 2VH9A 5FZ0A 4LITA 1QJY2 3POJA 4MADA 3FHIB 3GGLA 4UBGA 4ET7A 3LPFA 3RJ2X 4DO0A 4Q4Y3 2P37A 2DUOA 4QB1A 4QPYA 3KCCA 5FREA 4A7YA 2MNGA 4Q1RA 2QE3A 2JD9A 4CUBA 2GDFA 1EV13 2X5IB 4ZS3A 3QD6A 3POIA 2HEWF 2JDAA 1ASJ1 1KS4A 2XQRA 4W4ZA 4XMIA 2YBKA 1XE0A 3LD8A 2JKXA 3NAPC 2JWPA 4IEQA 3SCFA 5C5TA 1W28A 3OBZA 1ENRA 2A3WA 3WDYA 4XJAA 3N9LA 3RVHA 2YBPA 1VMJA 1UYPA 4OMCA 1VAKA 2CHHA 1VBB3 1WCUA 2L9LA 2MEV1 1XYOA 3KB5A 4H3WA 2A5ZA 5FZAA 3WF1A 2FCUA 3LEIA 2BWCA 1WMXA 4LORA 1F2NA 4UW5A 2P4EA 4FPYA 4ASMB 2LRPA 1ZRDA 1REFA 2B42B 1RUC3 1MS5A 2D7FA 2VE1A 1SCSA 1X7NA 1G7YA 2R1DA 2W47A 3PMEA 4GMP1 4QX2A 3SEEA 4DUXA 2PA7A 3V0BB 3E5XA 4I02A 4YVSC 3VHNA 2GNMA 3I49A 1RUE1 1W8WA 1F31A 1VALA 1GWMA 3KT4A 3E1F1 3NNMA 3ON7A 2EXIA 1BJQA 5F3EA 1C5IA 1W8TA 4KL1A 1QJZA 2VG9A 2W94A 3W9AA 5IVJA 2Q4SA 2LM3A 5B2GB 2PAKA 3MZHA 2P34A 3ZYFA 4V1PA 4MV2A 3I2OA 4I2OA 1XXNA 4FPKA 2GMEA 5LA1A 3MIFA 5DUWA 4LK6A 4KGGA 1VBC1 3ALQA 3VBSA 5A3PA 4BXFA 2EXHA 1AYN3 1HW5A 4LEJA 4LJHA 3ZX7A 4COUA 1LHUA 1WCKA 2WL1A 4HBNA 3EJKA 3AMQA 3AKQA 3UL2A 3VBFB 3FHQA 3NAPB 4XUNA 5DUVA 1QDCA 4XDOA 3LOIA 3RDIA 3O1PA 1QJY3 1KGYA 4R4XA 1AR61 4XOGA 1K45A 4N7UA 1CVNA 4AF9A 3CIHA 4E4DX 3P3NA 1VBE3 4B1LA 1R1A1 2FCVA 3E6DA 2VTXJ 3IKWA 4V2VA 5CVRA 5J3UA 4LIUA 2GALA 4AVCA 2VZOA 2AH2A 2W9XA 4JKMA 5FAXA 3DPRB 5I8SA 5ACA2 1JYXA 3THCA 1SPPB 5T50A 3WNNA 4DRVA 2WZEA 2XLAA 3AMNA 5BNOC 5JZGA 5KHKA 3AYAA 4BQ4A 4NROA 4K21A 2K2SA 4JGYA 4XQWA 5LK5A 1LB2A 2GC2A 5FPZA 1IKPA 1E57A 1DQ4A 1L7LA 4XUOA 1JBCA 2QDNA 4OVEA 2RS11 2WNVC 2RM22 4HMZA 5FXXA 4JAAA 2JE7A 5A7NA 3VBOC 3M2MA 5FZFA 4AEDA 2RJ2A 1AR71 2XBO1 3C7EA 2BFUL 4M01A 3LA3A 1MS0A 3OEBA 1PZ9A 4JGZC 3LGRA 1POV1 2Y6JA 1G8WA 3POEA 4N43A 1W8NA 4IE6A 1S2EA 2YUEA 1LHOA 2YGMA 3CDZB 4UYBA 1RUD3 5FQ0A 4BZ4A 2I74A 2W2IA 5FP9A 1QHDA 2X53S 4F7ZA 3AJYA 3NAPA 3ZOIA 3U0ZA 1IPJA 4E2QA 4ITCA 4D69A 4I0BA 4IGPA 4BCUA 5IT6A 2MPFA 3RWNA 2KA3A 4EE2A 3SISA 3UGHA 2RR13 4HK8A 1VAVA 2E53A 5CAZA 1UKGA 4L99A 2J1RA 4AHWA 1ZA4A 2BERA 4KGQA 3GZAA 3GZEA 4YW5A 2FDHA 4NIGA 1WMEA 5FCCA 4IUGA 1WGPA 3WLUA 4MHUA 3O0XA 1H1MA 1CZSA 2OPKA 3BU7A 5HV4A 3LDRA 3ASIA 1C5HA 1S0JA 1W3VA 3AYCA 3IWZA 4KBZA 1IKQA 5FP4A 5FZDA 2BOIA 1ND2C 1QXRA 3D6EA 4H2AA 4I30A 4Y24A 2PQSA 4L11A 4CP0A 4AZZA 4R9DA 4WVWA 2VNGA 4UFIA 2VPVA 5FLHA 2WA3A 2WZR2 1RXFA 4OI0A 4XE9A 2XBO3 3I4IA 1MS8A 4QDQA 5K7PA 2QQWA 3DEMA 5DZGA 2BFUS 4CDXB 3IDBB 4K7JA 5K0UA 2JXAA 2DU0A 4IEPA 3HQRA 4COVA 3T0DA 4L9BA 4Y20A 4IEZA 1VP6A 1ND2A 2D3RA 2RHPA 3ACGA 4UFMA 1O8SA 4JDOA 1V6JA 4ES9A 3T2QA 4CE8A 1W8FA 4LBQD 2DBNA 4NHXA 5DDJ2 1C8M2 5F5AA 5DZEA 1NQDA 1QNYA 3WT3A 2NPIA 1XOYA 3I2DA 4MGIE 3WF3A 2HWC1 4U2AA 1BBT3 3OCPA 5GLUA 5A1LA 5FTTC 3RWKX 1WD4A 4LHSA 4QHZA 5BPXA 3GJAA 2R7EB 3KVAA 2VY0A 2LROA 4XPVA 4YW6A 4AEMA 4AFCA 1NYWA 3U11A 4OQ8A 3WCRA 2WWJA 4XCBA 1RXGA 1PO13 3RZJA 2GC0A 4Z92B 3MF9A 4I0WB 2HYKA 5AC93 3IDEA 3ZFFC 1TME2 3ME2A 3V65A 1AYN1 3ZSKA 2D93A 3WNKA 2D6OX 3J8F3 3I8TA 4EYUA 2Y6GA 5FZGA 4IEWA 3RMYA 2DYCA 4LHKA 1UYZA 2VMIA 3H42B 1JUHA 5IAVA 4Z8BA 1COV3 1POV0 3FLRA 3IN9A 4AOCA 1CJDA 4CP1A 3KCYA 3OGGA 3AZXA 2ETEA 3PU8A 3WSOA 3L9JT 4FO9A 5FZOA 3URFA 2CTVA 5A3TA 3H8XA 3I3DA 4HVQA 4FFHA 1J3PA 2SBAA 3LFIA 5IVFA 5C6CA 2BTVC 2JDMA 1RUG1 3M1HA 1R091 2GZWA 4JGZB 4UWDA 3JUUA 4OHZA 3ZVXA 4G9SB 5I8TA 1AL0G 5GZDA 1I3HA 1C28A 3OUHA 3PJYA 5G05L 2LUWA 3ZXEA 3WY6A 4E2GA 3RRDA 5JUVA 1AYM3 1WA4A 2VTFA 4MG2A 1DGWA 2TEPA 2WT2A 1RUNA 1J1TA 2VQAA 3AB0A 3KHBA 3SEPA 1YXWA 5FO7B 5T52A 2WT1A 2YFUA 1AR92 3ES1A 1COV1 3H9AA 4XURA 3H3LA 3FMGA 5CZKA 3AXEA 5FP7A 3WDTA 4CEWB 3LSEA 1SACA 2UWBA 4Y4YA 2XG3A 1UF2C 3LSDA 4NN0A 2ZHMA 3FE5A 2WS91 4XIKA 3P5BA 1PGSA 2ZX2A 1W2UA 4FAGA 2ZHLA 2J22A 2VULA 3JD72 3F2ZA 4ATEA 4MXVA 1O3SA 2XJSA 5IATA 4UW3A 1IS3A 1MEC1 2XHKA 4FT8A 1RVF1 1BEV2 2DCJA 5F6KA 3ITQA 2J1EA 4CUAA 2VNVA 3R05A 2NN8A 2C5DA 4CCDA 1FXZA 3CL1A 3PHMA 5EJ3A 4NIIA 3VGIA 3O1OA 4OUSA 4RS5C 3TEZA 4S2GA 1OD3A 1TVGA 2BUKA 1DG6A 5C9AA 1SPPA 2WJSA 5A3OA 5BV6A 3SNMA 2W5FA 3WCSA 2J1AA 2PHRA 3KSCA 4ZU5A 3RZKA 4K3UA 1RIRA 3CMGA 2JG9B 4P9IA 5FYTA 3WZ1A 4Q0UA 1OKOA 2VJXA 4Y1YA 1OOPC 4Q4X1 2YGLA 2NMNA 3UKTA 1H0BA 1BXHA 1GNZA 1VE0A 5SV5A 4CDQC 5FOBB 1VAMA 3HNMA 1QGLA 1IHMA 1NA1A 2BRTA 2KD7A 4IEXA 4KH9A 4MHRA 1PVC2 4YARA 2WO2A 2ORXA 3OYWB 1KRIA 2VCCA 4E8CA 4HOOA 4JDNA 3I2IA 2DTWA 3BI3A 1DGRN 3M3CA 4YVWB 1KD7A 4COYA 2QZ3A 1W39A 2DVGA 2P3YA 2RS33 2BQPA 4QDRA 1HN0A 1Q8QA 2ZPXA 5FMDA 3ZKYA 1HIXA 4AW7A 1ZBA1 3SKJE 4PLOA 5A6ZA 3L2HA 4FFIA 1WLTA 3HT2A 5KHGA 2Y34A 3IB3A 4P9LA 4FPOB 4YVSB 2PQQA 4A3XA 3LPGA 3ES4A 1LKNA 2WQ8A 4XFAA 1GQPA 3NNGA 1FPN1 1GMMA 4NAMA 1W3XA 4GH4C 3VZJA 4LKFA 2YY1A 1W6PB 3PTRB 4H7MA 3USSA 4AGGA 1UD1A 5LBBA 3ZDSA 1LOFC 3MO4A 1RUE3 4GB32 4RA0A 3U14A 2P3KA 2W08A 3ILNA 5IHRA 1YFUA 5A3LA 4LBQB 1W99A 4YW2A 4KI5M 2VMGA 5BNOA 1DZRA 2XVKA 3JBG1 5GJ6A 4O65A 3QOPA 4QXHA 4D6QA 1Q8PA 5M0TA 4TLGA 4QX8A 3WNMA 3B01A 3HD8B 3VL8A 1PIV2 5DABA 1V9U2 3AZWA 1BZWA 1GZWB 3LFMA 4ARYA 1HJFA 3IPVA 4FVVA 3SCHA 1BLZA 3J7MA 1GP5A 1GWKA 2R072 4QU1A 4RQPC 1DCSA 2V73A 1X36A 4EROA 2VECA 4PF5A 1UMZA 2CL2A 4LA2A 2IXKA 5FLJA 1F5JA 3ZXGA 4ARXA 1K5MB 1SZBA 3TWIA 1CAXA 3DV8A 1AR91 3U4SA 2A6WA 1TMF2 1QJU3 4GMP3 5JOZA 2XL9A 1AR63 2JG9A 2D6KA 1YRZA 1WMFA 3HBZA 1YC61 3SKVA 1JZ7A 4I0AA 2H0VA 3DKQA 4AVTA 1HV0A 1S0DA 4JCKA 4DEVA 1AXKA 1PZ8A 4CP2A 1SLLA 4Q8KA 2QCSB 2XWJB 5T5JA 1TQ5A 5BNPC 2RDRA 4GMP0 4M00A 2VQ0A 2VZRA 4N90A 4QX7A 4Y4RA 5EZWA 3V64A 3PJQA 5B4NA 1RITA 1K42A 1GZCA 1QOTA 2YG0A 3KMHA 3DXTA 3OGRA 1YLLA 4NIDA 5C4WC 3VZKA 1CAVB 4AFBA 1XQNA 4BH9A 1K5MC 3GCWA 4NUBA 4UOJA 4ASLA 3SH5A 4HKLA 1ZRIA 2BNNA 2XVGA 1CIWA 4Q4V1 3BODA 1PGW2 1SLAA 4E4ZA 1FAYA 1FPN3 1V6KA 2AREA 2Z2SB 5FZ8A 3FHAA 1KITA 5D2AA 2VGDA 5F2WA 3BU0A 3PVNA 2XJPA 4XFGA 3LIHA 2W68A 1C1FA 3AZYA 3G7DA 5T3NA 4Q0PA 2E7QA 4BM8A 4EWAA 3WP5A 2RVAA 1LOCA 3W20A 4Z2AA 2CGOA 4QMAA 2UY9A 3VDDA 2RS31 4K40A 1ASJ2 1N1VA 4XFIA 1W8UA 5IK5A 4JHZA 5JXIA 2R16A 4CU6A 3PNAA 2C24A 2HLEA 1DLCA 3BGAA 2AYHA 1PVC1 2A7AA 4RFRB 4RL7A 1L3JA 5E1RA 1OURA 1EPWA 2BYVE 2OUHA 1H2MA 1OH3A 1MACA 3AMMA 3LAGA 4FQZA 5F39A 5FUNA 4BHPA 4AAPA 1CJPA 1S4CA 5J7MA 2NP0A 1SBFA 1OFNA 4XQDA 2VD7A 1OXCA 3MLJA 5A3MA 3VD3A 4QPGB 5F32A 1QJY1 4J6GA 4LPLA 4NHMA 3VDCA 3LF7A 4LO8A 5CIRA 2YROA 3BB6A 4HONA 1H2KA 1I1EA 2O14A 1H9WA 1D4M3 3AVSA 1FYUA 4ZKTB 1DYKA 1EY2A 4XHXA 3OGVA 1W90A 4YVSA 1FX5A 4LLOA 1Y9QA 1AF9A 4GKYA 4R9AA 1CR7A 3GHMA 5TSWA 5DN2A 4YSFA 1JMUB 3G6JB 1N1SA 3RYPA 2WT0A 1WZXA 4B4PA 2OVUA 4UW4A 3NJZA 3UKNA 1S1AA 1QNWA 3OBTA 4GB33 1X8EA 1KQRA 1MVQA 2OX0A 2WO3A 4MXWA 3ZFEB 2BWAA 3N9PA 4CEWA 4K1YA 4XF0A 1W6NB 3UK9A 4YW4A 2VVFA 3R6SA 5C4WA 5LA2A 2KM2A 2YPJA 2ZCWA 4P08A 2DBIA 4SBVA 3QH7A 1NCQC 2ZX1A 5GALA 1CPMA 3ZPOA 4CCEA 1W06A 3GCXA 3VBRA 1AR62 4DOUA 1G9BA 1X9TA 5FYCA 5HCAA 5H9PA 1Q5OA 4XJZA 3LE0A 4JC1A 2ERFA 2A3XA 4JVAA 1EP0A 1V9U1 2XGXA 4PCRA 5AVPA 4EV0A 2BW8A 5JLVA 3W58A 2R041 1ASJ3 2XLGA 5A7WA 2WSVA 4XFFA 4ZPIA 4JX0A 2WNEA 3MIBA 2AEYA 4QQHA 1SBDA 1ACCA 4AI2A 4BQ5A 1K5JA 2GAUA 3S6PA 4CDUB 3T09A 1A6CA 4YG6A 4EN6B 3QCWA 4BMEA 3M3EA 4WM8C 4FBFA 4W8JA 2FMDA 4PQQA 2OQ6A 1QJFA 4FQ4A 4X8NA 5EWSA 2WAOA 3I59B 3ECQA 4LO6B 4BIOA 1VBA3 3IIAA 4J25A 3DYPA 4OUMA 5DQ0A 1VJ2A 2ZGMA 2K0GA 3NSTA 1V6MA 1MS1A 2WNUC 1XNTA 1RUI2 3FUOA 3O0VA 5I8YA 1RC6A 3RS6A 4PHZA 3KQ4B 3M3QA 4QGNA 5FY7A 4MH0E 3ZXDA 1KEXA 5F6LB 1GBGA 1WWYA 1Q8VA 2BGCA 3BUCA 1IQAA 1NLSA 2FHRA 3NKTA 1OUSA 1GQHA 4FOYA 1QQP2 1Y9GA 2RS12 4H55A 1AX0A 4UFJA 1HXS1 2AEZA 2GC3A 2EIGA 1AUYA 1WA6X 2NQYA 1RGSA 2RM21 2VOXA 1WW7A 4YW3A 3W21A 1ZX5A 5IK7A 3QBQA 3PURA 1J84A 2Y38A 3HWJA 5J09A 5J1XA 3K2OA 2RG4A 4PDWB 1S0CA 1TMF3 2VNRA 5HCBA 2VBBA 3ILFA 1JYVA 3HEIA 2ZGUA 4FPCA 2GNBA 4UXAA 5EV7A 2VUAA 1FMD2 4PF1A 5DMYA 2BP6A 1UMIA 2RS32 4AQ6A 1UOBA 4AEJA 5FWJA 2E6VA 5JMCA 1LHVA 3CEWA 1UY1A 5F37A 4XDQA 4JZRA 3R4SA 1ZZ7A 4MZUA 3UETA 3K75B 2W1SA 1IG0A 1V9U3 2ZEWA 5HV0A 2CDPA 1PHMA 4M3CB 1W05A 4HLTA 1LJ7A 5A33B 1MZEA 2IUWA 2DTYA 4IDZA 3NWKA 2GSYA 3SH4A 5HCHA 4AGRA 2P1BA 1W2TA 1AZDA 4AI0A 4BXSV 1LECA 3TYJA 1DZQA 3VHRA 1QDOA 2ID4A 4BLIA 4CCJA 2OW4A 1OOPA 3ELNA 1PK6B 4HL0A 1OUXA 5FKCA 4ES8A 4OCTA 1KJRA 3VBRB 1VRH2 2UWCA 3ZYRA 1FNZA 2ZKNA 4OZXA 3ZFEC 1FT9A 2FDJA 2I2SA 3OPTA 2HBTA 4GWNA 1UZVA 1C1LA 2GMPA 2RS53 2Y6FA 1MR5A 3CQOA 1E5SA 1U5ZA 2FBEA 2A70A 3DUIA 3RMXA 1ZZBA 4A2UA 2JG8A 3GZTB 2ZGQA 2YC4A 1H6XA 4RQPB 2P3JA 3POBA 4XJUA 1UO9A 1CX4A 4S2FA 3WNXA 2RE9A 3LCPA 2QQIA 3K46A 1RHI3 4Y1VA 1H4GA 1WLDA 4KU7A 1DGWX 3ZXFA 2OZJA 1HX6A 1GZ9A 2Y60A 5F5IA 3TNQA 4CVUA 2CGPA 5L9RA 4E2SA 2VOTA 4HZFA 2GN3A 2IFWA 1SFYA 1RHI2 4LBMA 5JCTA 3ZXKA 1VMHA 4EWEA 1BK0A 1Z0HA 2E9QA 5FPBA 5JI9A 2A3YA 1I9RA 3BTAA 4CDXA 5JMOA 4RR3B 1OBNA 3GBFA 4R4ZA 1AR93 2JDHA 2OUJA 4JRAA 5DDJ1 4YPJA 3EBRA 1AX2A 1WCDJ 3FWEA 4JGYB 3S5AA 2XH6A 1XYPA 5L9VA 2HWC2 2QFEA 2VXRA 4YFWA 5JPMB 5EYYA 1DBNA 3PIGA 2B9VA 2QZ2A 3BPZA 1V6OA 5JOXA 1NUKA 4A4AA 2ZX0A 1RUI3 5J48A 1FV2A 1GQGA 1I5PA 4YFZA 2VR4A 4Z1VA 3Q8AA 4LULA 2HWE1 1W0NA 3N7LA 2G19A 2Y33A 3JB8A 4P5YA 2G9GA 4Z2WA 4CCOA 1PMIA 2ZA9A 1K5MA 5FXVA 3OBAA 1MZ6A 1W0PA 3OY8B 1O91A 1SLIA 4FOQA 2TNFA 2DURA 2ZMKA 3EXUA 4YYOA 4BPZA 2WINB 4EN0A 3ZO0B 4RYDA 2QQLA 4CPBA 4AQ2A 3CZUA 2E32A 2VUDA 3C3VA 2QBXA 4P9WA 2QUOA 1YCIA 3AP5A 2YZ4A 4X8PA 5KXCA 1CGPA 4D7YA 5LCWL 1QH6A 2JG9C 4OHXA 4ZHNA 4I01A 1XU2A 1KS5A 1HB3A 4META 2DVFA 5FR3A 1YFWA 3SXWA 3AP9A 1HRV1 2P2KA 3C8XA 1MEC2 4N9IA 3I3BA 3WUDA 1BMV2 4E4SA 4M3CF 2PXJA 4LUKA 1GANA 1SLBA 3WR0A 3NQHA 3V0BA 3HJRA 2ZS6B 3LKJA 5GZGA 3LA7A 3AMHA 3CBNA 3KV9A 2ZEZA 1GICA 1CAWA 1BHGA 3FJSA 4Q26A 3BPSA 1UPSA 2OKXA 1O4YA 2DCKA 1ZZCA 1CX1A 3WQ1A 1AR83 2IVJA 3U75A 3SITA 1CESA 2XXZA 5FZ9A 1AYM1 1GU3A 2DDUA 3KF3A 5FYUA 4TWTA 1FNYA 1RL3A 3J7NA 5DAPA 3JD71 5JR2A 2XJUA 4L0PA 1PNGA 1RMU3 5JSRA 2W46A 4YGDA 3TEWA 3S57A 3JQWA 3ZXJA 2QQUA 3DN7A 4URAA 3P6BA 2C6SA 3T2OA 1RVF2 5HXVA 2ZGRA 3DXUA 5GM0A 2WZ8A 4IE4A 3ZR6A 2CU5A 3VKFC 5KXEA 5LW9A 5LZ6A 4BQ1A 2Q8EA 1D4M2 5IW0A 2W1UA 2BJSA 3WF0A 1GZWA 3N3HA 1OT5A 2DVAA 4NRQA 2E26A 2QQVA 3NVCA 2IC1A 3ZLIA 3J26N 2VO5A 4K6BA 4KQ7A 3POSA 2D5FA 4WVZA 2LALA 5IYYA 1ST8A 3N35A 2HWB1 3RZHA 2ZGTA 1OF3A 3ZN4A 4GD4A 4CDWC 4FP3A 5F8PA 4GH4B 5FY9A 4GULA 1AJOA 1PMJX 1EAH3 1LGCA 1ODNA 1PO12 5FYBA 4F3JA 1O3TA 1SLTA 2EALA 1NQJA 2ZHNA 3QACA 4TXWA 3PL0A 3T2TA 1PGL2 4XILA 2QKDA 1C4RA 4HETA 4C1XA 3GHNA 4HFSA 4JQTA 5BYNA 5GLZA 3VHOA 4AXOA 4A3ZA 4M4PA 1BBT2 2HWC3 5IVEA 1DDLA 1RHI1 2VMDA 1LTEA 4XABA 4EZ4A 1AX1A 4YGCA 2PHXA 4RR3A 1W8HA 4XCAA 1RUJ1 4IEYA 2VUJA 2QDRA 2VMEA 4JKKA 3VBOA 1DHKB 5FZIA 2WO7A 1XNAA 1NZIA 2JICA 3U10A 4W6WA 1QY4A 1YUDA 4LKEA 1WLWA 1ENQA 1UY4A 5EJZB 2BZDA 3FC0A 3VZOA 4DPNA 1SDWA 2WYFA 4CUCA 1ZBE1 4ZY9A 2WZR3 2RM23 3PUIA 2C9KA 4LBKA 5IUQA 4Y1XA 5CKNA 1DIWA 5CFDA 4IE7A 1JZ8A 3RI8A 1NA1B 4DXRA 1VBB2 4FPEA 5IVCA 2EIBA 2VNOA 4XTPA 3ACHA 3KZ4C 5FY4A 1ZZ6A 4XBQA 3VKOA 2HEVF 5L9BA 1VBD2 4GB31 5LASA 3K3NA 4MYEA 1O3RA 1AR81 2A6VA 5FYSA 1OOPB 4LK7A 3SQOA 2BU9A 4OFGA 4OULA 1V6LA 3AKTA 4I3GA 2ZTNA 1W8OA 5LRRA 1EV12 2YYOA 4QGLA 2AACA 4N43C 3H8OA 1AVBA 2DFCA 3NNLA 3AZZA 2Y64A 4Y33A 3VBSC 5KXBA 3FLTA 2HH9A 3O0WA 1UYYA 1HRV2 4Z82A 2IXIA 4LBLA 1ULFA 4RSUA 2P5BA 2DV9A 3OF1A 1DP0A 5FBJA 1OVSA 2PHWA 3I97A 4GKXA 5C3SA 3N9QA 2EA7A 2GC1A 5A1FA 2ZABA 3R4UA 4OMDA 4Q1PA 4D0QA 4BDVB 4WVMB 5I93A 1YWKA 3MIGA 5K9YA 3WP6A 4QHBA 1J58A 4P14A 3VLBB 1UU5A 4QPIC 4E4HA 4XXAA 4UFKA 1WKYA 3CLPA 1QJX1 5C3PA 4NRPA 3JU9A 4PJYA 5FZBA 3CU7A 4P02B 4CU7A 5FPLA 1UAIA 1WUVA 2PLV3 4UT5A 3M7AA 2EAKA 4YG0A 5GLTA 2VVDA 4K1ZA 1MS3A 2HWF1 2WZPP 5IVVA 2YFZA 3AYDA 5FYHA 4CRQA 1W04A 3PVBB 3ZDVA 3A21A 2FDIA 4ZXKA 3NL1A 4CTEA 3O7OA 4N43B 1QKQA 1B35A 4N53A 4YG3A 2WRAA 4RN5A 4CCKA 2A1XA 3EB7A 1MS9A 1X33A 1XC6A 2QQKA 3B69A 5FK7A 3TB0A 3VUOA 4Y20B 3ACIA 1BKZA 3RYRA 3OOXA 4WM7C 1XNDA 3AK0A 3WG1A 4BQ2A 4CP9A 1NCQA 5FJHA 4BQXA 2GP5A 4AI3A 3E6BA 3WQ0A 2B9UA 5I0RA 3BN6A 1JOPA 4OI1A 4XUTA 4XAAA 5EQUA 1CAUB 4URTA 2XQXA 5ABJA 1ZREA 4PI0A 1NA1C 1XB9A 4BMBA 3T3YA 2GU9A 4ZXEA 4EN8B 4O9GA 1PO11 2I07B 3WDUA 4PI2A 1EUUA 3N7JA 2E7TA 3THDA 1PGL1 2PHLA 2Z5WA 4WBBA 1EAH2 1S0BA 4KWUA 2Y26A 4LIVA 3N4MA 1ULOA 3BOWA 3B3QE 5BNQA 1BBT1 1DYOA 4Y3OA 3S7IA 1Z78A 4D94A 2JDYA 5FYIA 1N47A 2VQUA 3VBFA 4CU9A 3IT8A 5JVVA 4EZHA 5KR7A 4QM8A 3ZFGA 3KF5A 5D1IA 2W91A 2FMYA 3SH3A 3VBSB 1Q43A 1O6UA 1YQ5A 4MUVA 4N9HA 4Q4W3 1F9KA 3VBFC 2EIDA 3HN1A 4NHLA 1LODA 3FBYA 5A7PA 2R062 4L97A 1NT0A 1W2NA 3GZUC 1DGRA 4Y22B 3AKSA 1UPIA 2XUMA 1ZBE2 3B9CA 1FI2A 4Q4W1 3TEXA 1NY71 2DF7A 1O8PA 3VZNA 4L92A 2QQPA 5CEHA 4IV1C 4WVMA 3RPQA 5BXXA 3I2FA 4BB3A 1RUD1 1UZYA 4P5HA 4QQ2A 3UJOA 3R0RA 2DVBA 2ZHKA 1GOFA 2ZMNA 4DUVA 4AEDB 1PVC3 1YQCA 3NJXA 4XC9A 3ZSLA 4X6QB 2JD4A 1WBFA 3E97A 4Q4Y2 2Q0AA 1US3A 4QPWA 4A7ZA 1W6MB 1FOD2 3C2UA 1R64A 4AVSA 4B8EA 2Q8OA 4QPGA 4FI9A 2PFWA 4NO4A 1LESA 3KT7A 3H7YA 2QQNA 1PO22 2RJKA 1V0AA 4QKDA 1J3RA 3ZYHA 3BVCA 1D0GA 1UOJA 4B7KA 1ZVFA 3WG4A 3I3QA 1ALYA 1RUI1 4LKDA 1UMHA 1YIPA 5I0UA 4ISQA 1OSGA 3VV1A 4CDQA 5T5OA 1WW4A 3HAGA 3JQXA 1LU1A 5FZ7A 2OA2A 3GBGA 4QQLA 1A34A 2ZACA 2ATFA 1W9TA 2CYFA 1EYBA 2QNKA 2YMZA 5EHDA 2BV4A 3LOBA 3TRSB 1LULA 1IPKA 3KWVA 3OG2A 5JOWA 2VW0A 4GWIA 2B46X 5FMOL 4QX1A 5HCFA 2XKOA 4NIHA 5EJ1B 1HXS2 2VZ3A 4X6RB 5FJKA 3VDAA 3WINE 1OVPA 1I6XA 5LK7B 1NCRB 1BCXA 3U78A 5A6XA 2BBVA 3RSJA 3LB9A 3AZVA 1HRI1 1YQ2A 2EVXA 2RMU2 2SLIA 1OQEA 3K4ZA 4HSJA 3HNBM 3J4UH 1MPXA 4MSVA 2R0HA 2CNAA 1YJLA 5D8AB 2PLV1 5AC92 1J1LA 1OLME 4D6SA 3I54A 1MQTA 4MO3M 1RB8G 1O4TA 2B4KA 2BNMA 1W9FA 2ILMA 1CAVA 2VTXA 3IZOA 4ONUA 2BDRA 4IE0A 4BK4A 1D4VB 2D97A 2ZOEB 2IXJA 1S2BA 4PDWC 4P9GA 5BNPB 1NE4A 1CN1A 2E7AA 1R1A2 1CAWB 3RJRA 1GWLA 4B29A 4EWDA 5E89A 3N9MA 3UGGA 5L73A 1W6QB 1LEDA 2D98A 3OGJA 4AL9A 1NLQA 2QVSB 2BGOA 3T0AA 1YFXA 5DG1A 2WSUA 1A8DA 4B3NA 3Q8CA 4AI9A 1IGOA 4S2HA 4QB2A 5A1AA 2CAUA 4RD7A 2X8KA 2D6MA 4CXXA 5JPNB 4Y22A 5AVAA 3OUIA 4AAXA 3ETQA 1D7PM 5FMCA 3S30A 3BTXA 3U07A 3AM2A 3WV6A 1K3IA 1W2OA 1Q8OA 2ZGOA 4PQ9A 4Q8LA 5F2SA 5EXOA 3CKHA 4QQOA 3ZFGB 2VOKA 3THPA 5GZCA 2YC2A 2R073 2JG8B 3VD7A 3HBKA 2D3SA 5A6YA 1REEA 2E31A 2FZ1A 2RDSA 5C33A 5FZHA 3TN93 2FD8A 4LBOA 5ISLA 4JRLA 1U12A 4QGMA 4LT5A 1LHNA 2OS2A 3D3AA 3OD0A 4AFDA 2JIJA 4JDMA 5EPAA 3ZM8A 3WDVA 1GYKA 5FKBA 4W6YA 1DFQA 3PU3A 4UF0A 5A80A 3FFZA 1DF0A 2PTMA 1RUG3 5H9QA 1LGNA 2MEV3 3PDQA 2VZQA 4IL7A 4DIQA 1W6QA 5IAXA 1F8VA 1BVP1 4M3CA 2RR12 4QKNA 5K8SA 1CAUA 2HJIA 1RUE2 3AC0A 1T2XA 1W6MA 4BA6A 4P9JA 2W1QA 4P00B 3KCXA 3O5SA 4IGOA 3UJQA 3RG0A 2G9FA 2PAEA 3MEPA 4FPJA 4CCLA 3DL3A 1H8VA 3N9NA 4LQRA 4RGKA 3ZR5A 2GMMA 4RFT0 4CP9B 1RJ8A 5EIYB 4XJ8A 3MIEA 3USUA 2WC2A 2ZGPA 1RUD2 5JXJA 2D6PA 1VBC2 3UGFA 5I0SA 1XYNA 2RMU3 5FYZA 3U1XA 1OH4A 3CZJA 2V72A 4PDWA 1GFF2 4L2NA 4AHZA 1OPMA 5L7OA 5A6QA 2G1MA 2NMOA 3MIHA 4BJ0A 2YU2A 4XFBA 3RGBA 4HPKB 4COWA 2WNVA 3NO8A 1J3QA 2R063 3ACFA 4ORFA 2YXSA 2AUYA 4EN9B 3SLIA 1RTVA 4JGYC 1NOVA 2D6LX 2VMHA 3A0KA 4CDQB 3H1MA 1CD3G 2WKKA 2LS6A 3DKWA 4RGAA 4CA9A 4CPBD 1AL23 1HB2A 4NHKA 2CDOA 4GZ9A 2ZZJA 4HXCA 5C8CC 3ATGA 2V4VA 4OLLA 1UWWA 1VBE2 4QXCA 1X50A 1VMFA 1JU4A 2V4AA 3WG2A 4HT1T 1H8TA 2R32A 3WX5A 4SLIA 4EN7B 3T30A 1UY3A 5KXDA 3WVJA 3ZIXA 3UNPA 4IEUA 2HWD3 3O1TA 1POQA 5DUXA 3FUQA 1TME1 4QU2A 1AYN2 4HVRA 1IG3A 3IDAA 2WS93 2OQ7A 4IERA 1XNKA 4GJYA 1TE1B 4CCNA 2Z69A 3VBRC 3GM8A 1ZYBA 4QM9A 3PUSA 3WDWA 4LBJA 1VB2A 1VIWB 3DCQA 5JIUA 4AHYA 3O1UA 1VBD3 2Y6LA 4UFLA 2K46A 4CXWA 2DVDA 2ES3A 1B35B 4N53B 3VKMA 4CEWC 3WF4A 3P3PA 2RS13 1PNFA 1UCXA 2ARCA 4PIYA 3KVBA 4AVVA 4DFSA 3F95A 5CFDB 1UZZA 2UWAA 2WFPA 4IGQA 1EPZA 2OYZA 2OT7A 1UX7A 4LO4B 3LDBA 4FTEA 2JE9A 3ZN6A 3B00A 5C4WB 5ACA3 1Y3TA 2LTNA 2P6HA 2VQTA 4QT6A 4UFHA 2VL4A 5FZ6A 3VBOB 5IWFA 3S7EA 3AP7A 1P8JA 1AYM2 1PVXA 5FZLA 3VBUC 3ZPYA 1XE7A 1XJAA 4ZU7A 5FIXA 2ENRA 4JTNA 4AWDA 4IXLA 1LR5A 3MV01 1B09A 3ZSMA 5FPAA 4WVVA 4AG4A 5JAXA 1JZ2A 5FYMA 4Y5Z0 1KDMA 3IMNA 3I3MA 2WS92 3VBUA 4DEQA 2D3PA 4YWAA 5IVYA 3IMMA 1OF4A 1XE8A 2IZWA 4OZOA 3ZXAC 4EQVA 5J96B 1E5HA 2YU1A 3H7JA 5HPOA 1SMVA 2WWUA 3RYKA 2VC9A 4M0NA 3WUCA 4EJRA 4M0HA 3D0SA 3H0OA 1SFNA 5JXHA 1NCQB 3TNPB 4NAOA 3HMYA 3H3ZA 4LO7A 1WMDA 1GOGA 2A75A 4INDA 1W9WA 2O1QA 1C8M1 1DQ2A 2QTWB 4IV3C 4YGBA 4MGQA 1G9AA 1SFPA 2VOVA 3J8F2 4Q27A 4V2WA 1QMJA 4TSVA 3JZVA 4XHBA 1AL22 2PMWB 4Y26A 5CU1A 1T6BX 1TME3 3LQCA 5FY5A 3T4VA 3OB8A 1OA2A 4C0BA 3MIDA 4QKFA 1XPWA 4NRMA 1ND3C 1GOHA 4LNVA 5FP3A 3ORJA 5DG2A 3AXDA 4A44A 3O1RA 2NZ9A 3WP4A 3PUAA 2YDEA 4XFHA 3H50A 1WCQA 1F4AA 3OEAA 2W39A 4W6XA 5T55A 1HRI3 2HWE3 3FFQA 4UAPA 4BE3A 2IXCA 1S0EA 1SHWB 4C8DA 5FY0A 4LOSA 1N3OA 3HOBA 1XNCA 3KV6A 3O12A 1N3PA 2XUEA 3R4DB 4PIXA 1MZFA 4Z07A 3TAYA 1RUOA 4FSJA 1QOSA 5IK8A 2B5HA 3ST7A 4D3WA 4QQPA 2XKPA 3MI8A 5GLWA 2RDNA 2ZMLA 1EV11 1YQ8A 3LZZA 4YZ5A 1JYIA 1LHWA 3B5LB 2R0FA 1GZTA 5EFUA 4MVTA 4C90A 3BKZA 5K0UB 1POV3 1GKBA 2BOJA 3HR9A 3D4KA 3T2PA 1S0FA 1AR73 3MBWA 1D0HA 4OI2A 3MW3A 1ZBA2 4DRRA 3WP3A 3W5MA 3ZYJB 1VBB1 1ZZ8A 1H2LA 3AFGA 3DPRA 1FV3A 2VUCA 4TYSA 3CJIC 3FZ3A 4N7IA 1U0AA 3AP6A 1VBD1 5L7OC 5F3GA 3N7KA 3NNFA 2B7YA 3DF0A 4O9EA 1TNRA 3V0AB 1HV1A 1L7QA 1PX3A 1T6GC 3HQUA 5JXGA 1DU3D 4HANA 4IEOA 3O1SA 1Y9MA 1N1TA 5L19A 5F5CA 3TOJA 4BISA 2PAMA 1GV9A 3PMSA 2HWF2 2ZEYA 1CWPA 4BK5A 1YFYA 5DZFA 4IW3A 3KQRA 5FWEA 1JUIA 1CIYA 1DGLA 3KLSA 4K8FA 5E88A 4CCMA 2JG8C 2BPA2 3M8LA 4AYUA 4BWOA 2C4XA 3EHKA 4HN0A 1WW5A 1GP4A 1W6NA 1BEV1 1NG0A 4HPKA 1KFUL 2RV9A 4G3YC 4MXWB 4U36A 1PIV1 5KHHA 4DXZA 2Q1ZB 2YBSA 3ROUA 3JBG3 1OMIA 2VZTA 1VPHA 3SHRA 2G4IA 4A6SA 3IM0A 4NJ4A 5FLIA 3ZSEA 5AFBA 3QLQA 4NPLA 2VMFA 2CGNA 5FY8A 5FPUA 4FFGA 1S0IA 3GDBA 5BY5A 3MPPG 2JX9A 3RZZA 4PLNA 5GZEA 1CPNA 2EICA 1PX4A 3U4XA 3NRUA 5BNPA 4D6RA 2FZ2A 3HT1A 2XJTA 3K4AA 2Q30A 2F4PA 4Q4X2 4W65A 5CA6A 5B4XA 4AVAA 1NXD1 2XMLA 1F15A 2A6YA 3TBDA 1RYYA 5EYXA 3WNOA 1G9CA 1DLLA 2X09A 3JCIA 5FRAA 1QJU2 1NKGA 1JZ3A 1YQ6A 2IWGB 4AVBA 3A23A 4NOTA 4AQSA 1NCRA 4K20A 2IXLA 2X5IA 4IQPA 1K12A 2D6NA 2ZAAA 5FZCA 1TG7A 2WABA 4IV1A 1UXXX 3B9IA 2YB7A 1UU6A 3BTYA 2BGPA 4RQPA 2E63A 4KWKA 1QXPA 4N8MA 2Z79A 1U5XA 1YNAA 4A42A 1OC1A 5CG8A 2Z42A 1G86A 3AKRA 5GKAC 1PGW1 3J8F1 2EIEA 3WW1A 5D21A 3WW2A 4FPFA 4D7TA 3Q9OA 1VRH3 1JOJA 4XEZA 1CZVA 4IV1B 1JYCA 3AP4A 4XZPA 5FUIA 4LLFA 1QXJA 4MGZE 1LOAA 1NY72 2GP3A 1RMU1 5C8CB 4HKWA 1EAH1 3D82A 3H8UA 1FPN2 3WNPA 5CFCC 3UT0A 1UY2A 4O61A 3IDCB 5FBZA 2H6BA 3M4FA 3H1YA 1D2SA 1FOD3 1OA4A 1E5IA 5A3WA 1ULGA 5JZGC 4LHLA 4XTMA 3PTYA 3MV11 3OSDA 4GWJA 1R083 4RHV3 4B1MA 4Y1ZA 3ZXLA 1FOD1 1QEXA 2DCTA 2VZPA 3HQXA 3PUQA 1GLHA 4XF4A 5A3NA 1HJGA 3FX3A 4HN1A 4ZZ5A 1HQNA 3MYXA 5F3CA 4A41A 4J1WA 2ZJCA 5FO8B 2WN3A 3VBHC 4QKBA 2WIIB 5JSOA 1MQTB 4BQWA 4B4QA 1OQ1A 2V09A 4PIZA 1R093 2WQZC 3LA2A 4XACA 2W0XA 3JD73 4LKSA 2VW1A 5C8CA 5DAWA 4GALA 2ARBA 4Q0SA 4BU2A 2XR4A 2YC0A 4Q4V3 3GNEA 3OYWA 3GYDA 4LBNA 5T5LA 2CWSA 2ZBJA 4QPGC 2P6CA 1RUJ3 3ZFGC 5I0DA 3LEKA 2VW2A 4CDWB 3OY8A 5C71A 1SLCA 4R9BA 4WM7B 1ND3B 3FL7A 1PIV3 1WW6A 2UYBA 5C5UA 3KM5A 2JDUA 3RI9A 1ODMA 1PO21 2VM9A 3AVRA 3NV3A 5CYYA 3VZLA 5F7UA 3OPZA 1DZTA 2IFRA 4AHXA 2PHFA 3FN9A 1KXGA 5L36A 4K8RB 5FYVA 3WNLA 2A73B 3APBA 5ABJC 4P9YA 1Z7S1 2ZEXA 4YM1A 5C9AC 2YPDA 3LEMA 1OQDA 3PLQA 3A4UA 1C3HA 3T4HB 3MFAA 3VKNA 2F6BA 1GP6A 3OPWA 2NLRA 4H7LA 1UYXA 1F4HA 1SBEA 2E33A 4Q4V2 4G4FA 3WDXA 4M3CE 2A6ZA 1EUTA 2XOMA 1DQ1A 4YW7A 3POGA 1QIQA 1UX6A 4QHOA 3DYMA 4CEYB 2R49A 4JV4A 4XBLA 1UQXA 1W9SA 1HB1A 2JDNA 5KHJA 4YZ1A 2XPJA 2JKBA 5AC91 3I2KA 3ACLA 3OGSA 2WFF3 4RGGA 4FFFA 1IQDC 2VU9A 2PELA 4LA3A 2CY6A 5G04L 5HXMA 1ULCA 4UBHA 4ISRA 1UXZA 1OKQA 4LMFA 4XQ4A 3RZLA 4QXKA 1O5LA 1QJU1 1F5FA 4MX3A 5KBFA 4R8HA 4HKOA 2RS51 2DUQA 2UURA 2GNTA 4GWMA 2HYXA 5IFPA 1R1A3 2QQOA 3DGTA 5LWBA 1Q56A 3ZSJA 5DDJ3 5FZKA 2KR2A 4FPGA 4FPLA 1Y4WA 1PZ7A 4PBOA 4WZCA 1BK1A 5DXDA 4C0HA 3NW4A 3ZIWA 2Y0OA 5J37A 4QPIB 3V0AA 1WLCA 4NPRA 4CXYA 5CFCA 4KU8A 4QAWA 1QQP1 4DXTA 3S0MA 1LENA 2VCMA 1ULEA 1B35C 2RR11 2PHUA 4F83A 2JJ6A 4S2DA 1DYPA 4NIAA 4CEYC 4AI8A 3MLLA 3Q8EA 4M4RA 2XVLA 5FMBA 1UU4A 2GNDA 2ZGSA 3K48A 2Q8CA 3RFRA 4C91A 4DZGA 4Q0VA 1TZOA 4KWLA 3MDPA 4UW6A 3WOGA 4A7KA 4MOAA 3HN3A 3DPRC 1Q8SA 3AX4A 4TN7A 5JWPA 5CKMA 2X05A 3VD5A 1OLMA 1GNYA 3LIGA 1D2QA 2NYYA 4AI1A 1VRBA 4FAHA 5FP8A 2ORZA 1IS4A 1Z7S3 3BIWE 1NE6A 2B39A 3ENRA 3AMPA 5LB6A 5F5QA 2HWD1 1U5IA 3ZKUA 3GF6A 4QPIA 5IK4A 2WO1A 5KHIA 4H14A 2C9AA 1L7RA 1HDKA 4DY3A 5FXWA 3VDDB 1QQP3 2CWMA 3B93A 3PIJA 1PO23 4CZSA 2J42A 5IFTA 4BQYA 4GAZA 3ABZA 5ANQA 2VZVA 1OLQA 4AFMA 2YHJA 3AKPA 4NMIA 1OD5A 1GNHA 2BVBA 1A78A 1DQ6A 2XL7A 3UYJA 2ZXQA 1UZ0A 3ZYPA 2OZ6A 2W87A 3MLKA 1X9PA 3VKLA 2DCZA 1UL9A 2VMCA 2R042 2EF6A 2J1VA 4W50A 2D44A 5J36A 1O4ZA 4KNCA 5CG9A 1SEFA 1MQTC 2ZAHA 1ND2B 2H0BA 5ANNA 1UZWA 3WQ7A 5F9TA 5FPXA 4IV3B 1VR3A 3ZN5A 2R1BA 1IZ3A 3I59A 1VBA2 1O3QA 2G9ZA 1YHFA 3W5NA 2XB6C 1WD3A 2WUHA 1LGBA 2X5IC 5FV3A 3UV9A 4E9KA 3KS7A 4KBBA 5A7OA 5KC5A 2WFF1 4LUMA 4FTBA 1UOFA 4TZDA 3USUB 3IBMA 5DAQA 5JI7A 1H1IA 1TEIA 5LEJA 4MGTA 2CV6A 2WBKA 4DMIA 2JB4A 1OLRA 3C7FA 2HBUA 4FPHA 4D8MA 5C70A 3D5OA 2HKXA 1O5UA 2WAAA 5ERLA 4A6OA 4Y1UA 3RZMA 1RJ7A 4FXGB 4ZS2A 4YRDA 1O7FA 1Y7BA 3VBUB 1AXYA 4CUGA 2IXHA 4XUPA 5BNNC 1R1ZA 4I09A 4AK3A 1XSQA 1MVEA 3B7MA 2J1TA 3IAPA 1VBE1 3RQ0A 4DNYA 5ACA1 4KWJA 3VD9A 4J1XA 4MLOA 3U37A 3WEZA 2ZX4A 3THTA 1OFSA 4WV8A 3VZMA 2ZKLA 2O8QA 3CNAA 5GZFA 3K51A 3LEGA 4XUQA 1NLRA 1W6OB 4QWNA 5F1RA 5SV8A 2I45A 4Q4X3 4LE4A 3W59A 2RDQA 2PHTA 3ZN6B 4CCCA 4TLFA 3POWA 4P9XA 2WNVB 5FFOC 2ZGLA 5T5PA 4N53C 3ZFEA 3TN91 3I7DA 1W8ZA 2X10A 3EMRA 1AR72 2WNOA 5DUUA 4DINB 2F17A 1FMD1 5C3RA 3SCGA 4YZ2A 5CFDC 5E8AA 2CAVA 1SQ4A 3POYA 5BNOB 5I0TA 1W03A 2Y0IA 4LBQA 4YVWC 3N7MA 1C8NA 4FCAA 3AL6A 1QH7A 3FBMA 2DFBA 1KDKA 5LBEA 4CEYA 5HBAA 3M3OA 4YM0A 4IEVA 4LOTA 1G6NA 3V56A 5A32A 2ADEA 3ZMOA 4JQRA 4ATFA 1C57A 2Y8KA 3EO6A 5DPNA 1W6PA 5A7SA 2AC1A 2FQPA 3LDKA 4DUWA 2ARAA 2GH2A 5FK8A 2AR6A 1XNBA 2Q5TA 3CJIA 4AGVA 2JB8A 4CDUC 3JXSA 3N9OA 2VVEA 5T54A 2HWF3 3K3OA 4QD2A 5APAA 1OI6A 1UKRA 3MW4A 5LBCA 1VRH1 3H1WA 2XJQA 5FZEA 1YIFA 1G9FA 5KWRA 1R081 2WLQA 4RHV1 1QF3A 4XAEA 4XF9A 5D8AC 2UYAA 1JHJA 3H3UA 2LW8A 1UOGA 1H30A 1IS5A 1CAXB 5LA9A 4FTSA 2VZUA 3WHTA 5JOYA 4ZU4A 5BNNB 4CDWA 4R52A 5LA0A 1S2KA 1W2AX 2Q1FA 2WZR1 2HWD2 1HB4A 5DAXA 1H2NA 1HRV3 4PLMA 5F3IA 1F35A 2OXBA 2PN5A 4QX3A 1DQ5A 3N36A 1I5ZA 5LY1A 2XDVA 1PM4A 2VBDA 3I2GA 2JECA 2VXJA 2V5YA 3LWCA 1ZRCA 5L7OB 1J83A 1DQ0A 2BNOA 3T0BA 3CHXA 2ET1A 5FQ0B 3A0NA 1XRUA 3MGUA 2RJLA 3Q8FA 3SC7X 4NVPA 1CQ9A 4NE9A 2VAUA 5FZ1A 3MICA 4AQTA 1RUH3 1AL21 1RINA 1ZNPA 3J9SA 3ETPA 3KV4A 3VL9A 4DQAA 3BTZA 1ZM1A 3RZGA 1X8MA 2HWB2 2XJVA 2C26A 3BYWA 3AJZA 2VCBA 1APNA 3AYEA 3CJIB 3D0JA 4YNIA 4XXPA 4LO5B 4E27A 3S5QA 2HWE2 1AJKA 4OQ9A 3BALA 1VBA1 2Q1MA 1JXNA 3M3IA 1SCRA 4Q0QA 4NWVA 1BEV3 2WDBA 4CYDA 4CU8A 5A32B 1CONA 3NNJA 1ULDA 1JYNA 5JZGB 1JU3A 2WFF2 3ILRA 4RR3C 5H9SA 5D8AA 1HQLA 1RUF3 5A7QA 1RUH2 2W1WA 3KV5A 3MPBA 2P17A 1VB4A 1YI7A 1O59A 2A71A 5CB7A 2C0ZA 5LEKA 1W0OA 4NWWA 4LXLA 4OHYA 1NX9A 1H4HA 2JDPA 1BVVA 3M70A 5C8WA 1URXA 4FOWA 1UNBA 2R6QA 2DU1A 3IPVB 5CADA 1A8MA 4A45A 1N3QA 4IESA 1W6OA 3GXUA 4Q5OA 5A3UA 3T08A 1BMV1 3VD4A 5FZ4A 1MZ5A 1ZA7A 1JZ6A 3H8RA 4YZ4A 3BCWA 1LRHA 1RUG2 2FCTA 1PK6A 3PVEA 1BQPA 4BIFA 5BNNA 1G9DA 3HNYM 1OPOA 3WD5A 3CF6E 3GALA 1VLNA 4JGZA 1JH5A 2F4LA 3FLPA 5FMOS 3I3EA 4GQ7A 1LOEA 4ASKA 4PT6A 5C3OA 3TN92 4QX5A 3MHZA 2OIIA 3NV2A 3E5QA 4FP2A 4MGYE 1NZCA 2P3IA 4XF3A 1H6YA 4XMAA 3WQBA 4QDSA 1OA3A 5LATA 2EXJA 3D8CA 1COV2 4KMQA 1CZTA 2W92A 2WR9A 3J7HA 2VCAA 4RS5A 4D7SA 2FDGA 2BEOA 1JOBA 1V70A 1ENSA 4DY5A 1FMD3 3A7QA
chains in the Genus database with same CATH topology
4WM8A 2ZX3A 2GN7A 1BYHA 1ENXA 1S55A 2AZ5A 3WDUA 4LR4A 1YO8A 4YGEA 2GH8A 2DWRA 1ZZ9A 1JHNA 1D4M1 1R092 4F8AA 1Q3EA 2ZZQA 3T1LA 2B8MA 1QU0A 5E16A 1H8TC 1UW8A 5H9RA 4FOVA 3UKVA 1HQWA 3VN4A 2ARXA 2YV8A 5KC6A 1NCRC 1WCSA 1R082 2W52A 3KGZA 4RHV2 4XW3A 3KGLA 1KFXL 1RUF1 2E51A 2K9ZA 3ZMNA 1H1AA 4GXLA 1RUC1 4XJWA 1Y43B 1JTZX 2KXLA 5JR7B 1NXMA 1YJKA 2H6CA 4I3PA 2EXKA 3ZFFB 1JN2P 2WNUB 2O0OA 3INAA 1IS6A 1QWRA 4Q29A 4XIOA 1HLCA 5A33A 2JENA 5JSPA 5C9AB 5ABJB 1REDA 2XLFA 4B7EA 1JW6A 1RUJ2 4AEDC 2ZGNA 3E5UA 2ZGKA 2D40A 2WQ4A 4AEKA 4AE2A 3NKGA 5J98B 2MHFA 4YVWA 3JB4C 3OD4A 4BOWA 1A3KA 5K0UC 1RVF3 4YM3A 2DCYA 2NM1A 2O8OA 3OTFA 1RMU2 3NV4A 1LEMA 2WNUA 4Q2FA 3ZFFA 4BLJA 3AFKA 2WA4A 4IV3A 1VBC3 1GR3A 1LU2A 4CDXC 5HI0A 4YLZA 3VBHB 5I91A 3B02A 4IETA 2R043 3OBRA 1HKDA 4DS0A 4HVOA 1AR82 4K9SA 1RUH1 2JDZA 1AXZA 4XBNA 3VDDC 1C8M3 2MEV2 3WXPA 3E6CC 3X29B 2N7GA 3CO2A 3JBG2 1MEC3 1LOGA 4AFAA 4GIQA 4XJ9A 5FOJB 1S0GA 1MS4A 3KT1A 1Z7S2 4XF1A 1QJX3 1IOAA 4Q4W2 2QJVA 4LTAA 2PHDA 5JDBA 2EAAA 1ONAA 4CDUA 1LCLA 2A6XA 1FATA 3VHPA 1AHSA 4R9CA 4RS5B 3GBWA 1X82A 1PK6C 2VOWA 3PVOA 3KD4A 1QJX2 4DB5A 2D43A 1M06G 5FO9B 3ZYGA 5CFCB 4OHVA 5JIAA 5BUVA 4Q4Y1 2TBVA 1ZRRA 3SMHA 4NR1A 4B4RA 2ET7A 4JTOA 1ND3A 4WM7A 4MGKE 5CBLA 2UU8A 2BVVA 2XJRA 3NV1A 1YI9A 2WWSA 3QH6A 1ZBA3 3MF6A 4YW1A 3WW3A 3HIFA 3WW4A 4L8QA 4COZA 1J59A 1YYNA 4LE3A 4PBPA 1GSLA 2R071 1N1YA 5GLVA 1TNFA 1LOBA 3CJXA 3ZYIB 4WZFA 3VBHA 4FXKB 1H9PA 1OHFA 1V6IA 2C1FA 3BOPA 5LRSA 5CNAA 3WHUA 4BYYA 3L2YA 1U5YA 4LHNA 4OI4A 4KG8A 1RUF2 1V6NA 1TMF1 2X29A 4XYXA 1ZBE3 4WM8B 1RUC2 1UIJA 2XBO2 4YZ3A 4KG0A 3T1MA 1HXS3 5AFEA 1HRI2 2RMU1 1M4WA 1KJLA 4YVWB 4HK9A 4AHWA 2AGSA 2JEMA 1QOOA 2XWBB 3OJBA 2PLV2 4XFCA 1PM7A 3RNSA 3WG3A 2RS52 1LOFA 1WBLA 1UN1A 3EQEA 2AENA 2DUPA 2HWB3 4OHWA 5FDBA 1H8TB 2B45X 2PYTA 4C1WA 2TUNA 4GH4A 2R30A 4XETA 2UY8A 3MFCA 1ZRFA 4GA9A 1V00A 2WLPA 1XU1A 3B94A 3O14A 4HSLA 1UIKA 3MW2A 4YM2A 2D5HA 2HEYF 2R061 2VH9A 1QJY2 4UBGA 3FHIB 3RJ2X 4Q4Y3 2P37A 2DUOA 4QPYA 3KCCA 5FREA 4A7YA 2MNGA 4Q1RA 2QE3A 2GDFA 1EV13 2X5IB 3QD6A 2HEWF 1ASJ1 1KS4A 4XMIA 3NAPC 4IEQA 3SCFA 1ENRA 2A3WA 3WDYA 4XJAA 1VAKA 1VBB3 4H3WA 2MEV1 1XYOA 3KB5A 2A5ZA 2BWCA 1F2NA 4UW5A 4FPYA 4ASMB 1ZRDA 1REFA 2B42B 1RUC3 1MS5A 2D7FA 1SCSA 1X7NA 1G7YA 2R1DA 3PMEA 4GMP1 2PA7A 3V0BB 3E5XA 4I02A 4YVSC 3VHNA 2GNMA 1RUE1 1F31A 1VALA 3KT4A 2EXIA 1BJQA 1C5IA 4KL1A 1QJZA 2VG9A 3W9AA 2Q4SA 2LM3A 5B2GB 2PAKA 3MZHA 2P34A 4V1PA 4MV2A 4I2OA 1XXNA 4FPKA 2GMEA 3MIFA 5DUWA 4KGGA 1VBC1 3ALQA 3VBSA 1AYN3 1HW5A 2EXHA 4LEJA 3ZX7A 4COUA 1LHUA 1WCKA 2WL1A 4HBNA 3EJKA 3AMQA 3AKQA 3UL2A 3VBFB 3NAPB 5DUVA 1QDCA 3LOIA 3RDIA 1QJY3 4R4XA 1AR61 4XOGA 4N7UA 1CVNA 4AF9A 4E4DX 3P3NA 1VBE3 1R1A1 3E6DA 5CVRA 3IKWA 5J3UA 2GALA 4AVCA 2AH2A 5ACA2 1I1EA 5FAXA 3DPRB 5I8SA 4DRVA 5T50A 2XLAA 3AMNA 5BNOC 5JZGA 5KHKA 3AYAA 4K21A 2K2SA 4JGYA 4XQWA 5LK5A 2GC2A 5FPZA 1IKPA 1E57A 1DQ4A 1JBCA 2QDNA 4OVEA 2RS11 2WNVC 2RM22 4HMZA 4AEDA 4JAAA 2JE7A 3VBOC 3M2MA 1AR71 2XBO1 2BFUL 4M01A 3LA3A 1MS0A 1PZ9A 4JGZC 3LGRA 1POV1 1G8WA 4N43A 2YUEA 1LHOA 2YGMA 5FQ0A 1RUD3 4BZ4A 2I74A 4F7ZA 1QHDA 2X53S 3AJYA 3U0ZA 1IPJA 4E2QA 4ITCA 4D69A 4I0BA 4BCUA 5IT6A 2MPFA 3RWNA 2KA3A 3SISA 2RR13 4HK8A 1VAVA 2E53A 5CAZA 1UKGA 4L99A 1ZA4A 4KGQA 3GZAA 4YW5A 1WMEA 5FCCA 1WGPA 3WLUA 3O0XA 1H1MA 2OPKA 3BU7A 3ASIA 1C5HA 1S0JA 3IWZA 3AYCA 3UKNA 1IKQA 3D6EA 1ND2C 1QXRA 4I30A 4Y24A 4L11A 4CP0A 4R9DA 4WVWA 2VNGA 2VPVA 5FLHA 2WA3A 2WZR2 4OI0A 4XE9A 2XBO3 3I4IA 1MS8A 5K7PA 5DZGA 2BFUS 4CDXB 3IDBB 4K7JA 5K0UA 2JXAA 2DU0A 4IEPA 4COVA 4L9BA 4Y20A 4IEZA 1VP6A 1ND2A 2D3RA 2RHPA 4JDOA 1V6JA 4ES9A 4LBQD 5DDJ2 1C8M2 5DZEA 1NQDA 1QNYA 3WT3A 2NPIA 3I2DA 4MGIE 2HWC1 4U2AA 1BBT3 3OCPA 5GLUA 5FTTC 1WD4A 5BPXA 4AEMA 2VY0A 4XPVA 4AFCA 1NYWA 3U11A 3WCRA 1PO13 2GC0A 4Z92B 3MF9A 4I0WB 2HYKA 5AC93 3IDEA 3ZFFC 1TME2 3ME2A 3V65A 1AYN1 3ZSKA 2D93A 2D6OX 3J8F3 3I8TA 4IEWA 3RMYA 2DYCA 4LHKA 2VMIA 1JUHA 4Z8BA 1COV3 1POV0 3FLRA 3IN9A 1CJDA 4CP1A 3KCYA 3OGGA 3AZXA 2ETEA 3L9JT 4FO9A 3URFA 2CTVA 4HVQA 1J3PA 2SBAA 5C6CA 2BTVC 3M1HA 1RUG1 1R091 2GZWA 4JGZB 3JUUA 4OHZA 3ZVXA 4G9SB 5I8TA 1AL0G 5GZDA 1I3HA 1C28A 3PJYA 3ZXEA 4E2GA 2LUWA 3WY6A 3RRDA 1AYM3 1WA4A 1DGWA 2TEPA 2WT2A 1RUNA 1J1TA 2VQAA 3AB0A 1YXWA 5FO7B 5T52A 2WT1A 3ES1A 1AR92 1COV1 3H9AA 3FMGA 3AXEA 3WDTA 4CEWB 3LSEA 1SACA 2UWBA 4Y4YA 2XG3A 1UF2C 3LSDA 4NN0A 2ZHMA 3FE5A 2WS91 4XIKA 1PGSA 2ZX2A 1W2UA 4FAGA 2ZHLA 3JD72 2VULA 4ATEA 4MXVA 1O3SA 2XJSA 4UW3A 1IS3A 1MEC1 2XHKA 4FT8A 1RVF1 1BEV2 2DCJA 5F6KA 3R05A 2NN8A 2C5DA 1FXZA 3CL1A 3PHMA 5EJ3A 3VGIA 4OUSA 4RS5C 4S2GA 5C9AA 2BUKA 1DG6A 2WJSA 5BV6A 3SNMA 3WCSA 2PHRA 3KSCA 4ZU5A 4K3UA 1RIRA 2JG9B 4P9IA 3WZ1A 4Q0UA 4Y1YA 1OOPC 4Q4X1 2YGLA 2NMNA 3UKTA 1H0BA 1BXHA 1GNZA 5SV5A 5FOBB 4CDQC 1VAMA 1QGLA 1IHMA 1NA1A 4IEXA 4KH9A 1PVC2 4YARA 3OYWB 1KRIA 4JDNA 2DTWA 1DGRN 3M3CA 4COYA 1KD7A 2QZ3A 1W39A 2DVGA 2RS33 2BQPA 1Q8QA 2ZPXA 1HIXA 4AW7A 1ZBA1 4PLOA 3L2HA 1WLTA 3HT2A 5KHGA 4P9LA 4FPOB 4YVSB 2PQQA 4A3XA 3ES4A 1LKNA 4XFAA 1FPN1 4GH4C 3VZJA 2YY1A 1W6PB 3USSA 4H7MA 4AGGA 1UD1A 3ZDSA 1LOFC 1RUE3 4GB32 4RA0A 2P3KA 2W08A 3ILNA 1YFUA 5A3LA 4LBQB 4YW2A 2VMGA 5BNOA 1DZRA 2XVKA 3JBG1 5GJ6A 3QOPA 1Q8PA 3B01A 3HD8B 3VL8A 1PIV2 1V9U2 3AZWA 1BZWA 1GZWB 3IPVA 4FVVA 3SCHA 2R072 4RQPC 2V73A 1X36A 4EROA 2VECA 4PF5A 1UMZA 2CL2A 4LA2A 2IXKA 5FLJA 1F5JA 3ZXGA 1K5MB 3TWIA 1CAXA 3DV8A 1AR91 2A6WA 1TMF2 1QJU3 4GMP3 5JOZA 2XL9A 1AR63 2JG9A 2D6KA 1YRZA 1WMFA 3HBZA 4I0AA 2H0VA 4AVTA 1HV0A 1S0DA 4JCKA 1AXKA 1PZ8A 4CP2A 1SLLA 4Q8KA 2QCSB 2XWJB 5T5JA 1TQ5A 5BNPC 4GMP0 4M00A 2VQ0A 4N90A 5EZWA 3V64A 3PJQA 1RITA 1GZCA 1QOTA 3KMHA 1YLLA 5C4WC 3VZKA 1CAVB 4AFBA 1XQNA 4BH9A 1K5MC 4ASLA 3SH5A 4HKLA 2BNNA 2XVGA 1CIWA 4Q4V1 3BODA 1PGW2 1SLAA 4E4ZA 1FAYA 1FPN3 1V6KA 2AREA 2Z2SB 1KITA 2VGDA 3PVNA 2XJPA 4XFGA 2W68A 1C1FA 3AZYA 3G7DA 5T3NA 4Q0PA 2E7QA 4BM8A 4EWAA 3WP5A 1LOCA 2CGOA 4QMAA 2UY9A 3VDDA 2RS31 4K40A 1ASJ2 1N1VA 4XFIA 5IK5A 2R16A 3PNAA 4RL7A 2AYHA 1PVC1 2A7AA 1L3JA 5E1RA 2BYVE 1EPWA 2OUHA 1H2MA 3AMMA 1MACA 3LAGA 4FQZA 4BHPA 1CJPA 5J7MA 2NP0A 1SBFA 1OFNA 4XQDA 3MLJA 5A3MA 4QPGB 1QJY1 4J6GA 4NHMA 4LO8A 5CIRA 2YROA 3BB6A 1H2KA 1H9WA 1D4M3 1FYUA 4ZKTB 1DYKA 1EY2A 4XHXA 4YVSA 1FX5A 4LLOA 1Y9QA 1AF9A 4GKYA 4R9AA 1CR7A 3GHMA 5TSWA 4YSFA 3G6JB 1N1SA 3RYPA 2WT0A 4B4PA 2OVUA 4UW4A 3NJZA 1S1AA 1QNWA 3OBTA 4GB33 1X8EA 1KQRA 1MVQA 3ZFEB 4CEWA 4MXWA 1LB2A 2BWAA 4K1YA 4XF0A 1W6NB 4YW4A 2VVFA 3R6SA 5C4WA 2YPJA 2KM2A 2ZCWA 4SBVA 3QH7A 1NCQC 2ZX1A 5GALA 1CPMA 1AR62 3VBRA 4DOUA 1G9BA 5HCAA 5H9PA 1Q5OA 4XJZA 4JC1A 2ERFA 2A3XA 4JVAA 1EP0A 1V9U1 2XGXA 4PCRA 5AVPA 4EV0A 2BW8A 5JLVA 3W58A 2R041 1ASJ3 2XLGA 2WSVA 4XFFA 2WNEA 3MIBA 4QQHA 1SBDA 4AI2A 2GAUA 4CDUB 3S6PA 1A6CA 4YG6A 4EN6B 3QCWA 4BMEA 3M3EA 4WM8C 4FBFA 2FMDA 4FQ4A 4X8NA 5EWSA 3I59B 3ECQA 4LO6B 4BIOA 1VBA3 3IIAA 4OUMA 1VJ2A 2ZGMA 2K0GA 3NSTA 1V6MA 1MS1A 2WNUC 1RUI2 3FUOA 3O0VA 5I8YA 1RC6A 3RS6A 3M3QA 3ZXDA 4QGNA 4MH0E 5F6LB 1GBGA 1Q8VA 2BGCA 1IQAA 1NLSA 2FHRA 3NKTA 1GQHA 4FOYA 1QQP2 4H55A 2RS12 1AX0A 1HXS1 1AUYA 2EIGA 2GC3A 2VOXA 2RM21 1RGSA 2NQYA 4YW3A 1WW7A 5IK7A 1ZX5A 3QBQA 3HWJA 2Y38A 5J09A 5HCBA 4PDWB 1S0CA 1TMF3 2VNRA 3ILFA 2ZGUA 4FPCA 2GNBA 4UXAA 5EV7A 2VUAA 1FMD2 4AQ6A 2RS32 4AEJA 2E6VA 1LHVA 3CEWA 4XDQA 3R4SA 1ZZ7A 4MZUA 1V9U3 1PHMA 4M3CB 4HLTA 1LJ7A 5A33B 1MZEA 2DTYA 3NWKA 2GSYA 3SH4A 4AGRA 5C8CA 4AI0A 1AZDA 4DPNA 1LECA 3TYJA 1DZQA 3VHRA 1QDOA 4BLIA 2OW4A 1OOPA 3ELNA 1PK6B 4HL0A 4ES8A 3VBRB 1KJRA 1VRH2 2UWCA 3ZYRA 1FNZA 2ZKNA 4OZXA 3ZFEC 1FT9A 2I2SA 4GWNA 1C1LA 2GMPA 2RS53 3IT8A 1MR5A 3DUIA 3NAPA 1U5ZA 2FBEA 2A70A 3RMXA 3UK9A 1ZZBA 4A2UA 2JG8A 3GZTB 2ZGQA 4RQPB 2P3JA 4XJUA 1CX4A 4S2FA 3WNXA 2RE9A 3LCPA 1RHI3 4Y1VA 1H4GA 1WLDA 4KU7A 1DGWX 3ZXFA 2OZJA 1HX6A 1GZ9A 3TNQA 2CGPA 4E2SA 4HZFA 2GN3A 2IFWA 1SFYA 1RHI2 4LBMA 5JCTA 3ZXKA 4EWEA 1Z0HA 2E9QA 5JI9A 2A3YA 1I9RA 3BTAA 4CDXA 4RR3B 3GBFA 4R4ZA 1AR93 2OUJA 4JRAA 5DDJ1 3EBRA 1AX2A 1WCDJ 3FWEA 4JGYB 2XH6A 1XYPA 2HWC2 2QFEA 2VXRA 4YFWA 5JPMB 5EYYA 1DBNA 2QZ2A 3BPZA 1V6OA 5JOXA 2ZX0A 1RUI3 5J48A 1FV2A 1GQGA 4YFZA 4Z1VA 4LULA 2HWE1 3N7LA 3JB8A 2G9GA 4Z2WA 1PMIA 2ZA9A 1K5MA 1MZ6A 1W0PA 3OY8B 1O91A 1SLIA 4FOQA 2TNFA 2DURA 2ZMKA 3EXUA 4YYOA 2WINB 4EN0A 3ZO0B 4AQ2A 3C3VA 4P9WA 2QUOA 1YCIA 3AP5A 2YZ4A 4X8PA 5KXCA 1CGPA 4D7YA 1QH6A 2JG9C 4OHXA 4I01A 1XU2A 1KS5A 4META 2DVFA 1YFWA 3SXWA 3AP9A 1HRV1 2P2KA 1MEC2 4N9IA 3WUDA 1BMV2 4E4SA 4M3CF 4LUKA 3WR0A 1GANA 1SLBA 3V0BA 2ZS6B 3LKJA 5GZGA 3LA7A 3AMHA 1GICA 1CAWA 3FJSA 4Q26A 1UPSA 1O4YA 2DCKA 1ZZCA 3WQ1A 1AR83 3SITA 1CESA 1AYM1 4TWTA 1FNYA 1RL3A 3JD71 2XJUA 1PNGA 1RMU3 5JSRA 4YGDA 3JQWA 3ZXJA 3DN7A 1RVF2 5HXVA 2ZGRA 5GM0A 5KXEA 3VKFC 4BQ1A 1D4M2 1GZWA 3N3HA 2DVAA 3NVCA 2IC1A 3J26N 4KQ7A 4K6BA 3POSA 2D5FA 4WVZA 2LALA 3N35A 2HWB1 2ZGTA 3ZN4A 4CDWC 4FP3A 4GH4B 4GULA 1AJOA 1EAH3 1LGCA 1PO12 4F3JA 1O3TA 1SLTA 2EALA 1NQJA 2ZHNA 3QACA 3T2TA 1PGL2 4XILA 2QKDA 1C4RA 4HETA 4C1XA 3GHNA 4HFSA 5BYNA 5GLZA 3VHOA 4AXOA 1BBT2 2HWC3 1DDLA 1RHI1 1LTEA 1AX1A 4YGCA 2PHXA 4RR3A 1RUJ1 4IEYA 2VUJA 2QDRA 3VBOA 1DHKB 2JICA 3U10A 4W6WA 1QY4A 1YUDA 1WLWA 1ENQA 3VZOA 3FC0A 1SDWA 1ZBE1 2WZR3 2RM23 5IUQA 4LBKA 4Y1XA 1DIWA 5CFDA 3RI8A 1NA1B 1VBB2 4FPEA 2VNOA 4XTPA 3KZ4C 3VKOA 1ZZ6A 4XBQA 2HEVF 1VBD2 4GB31 4MYEA 1O3RA 1AR81 2A6VA 1OOPB 4OFGA 4OULA 1V6LA 3AKTA 4I3GA 2ZTNA 5LRRA 1EV12 2YYOA 4QGLA 4N43C 1AVBA 2DFCA 3AZZA 3VBSC 5KXBA 3FLTA 3O0WA 4Z82A 1HRV2 2IXIA 4LBLA 1ULFA 4RSUA 2DV9A 3OF1A 2PHWA 4GKXA 2EA7A 2GC1A 2ZABA 3R4UA 4Q1PA 4WVMB 5I93A 1YWKA 3MIGA 5K9YA 3WP6A 4QHBA 1J58A 4P14A 3VLBB 1UU5A 4QPIC 4XXAA 3CLPA 1QJX1 3JU9A 4PJYA 3CU7A 1UAIA 1WUVA 2PLV3 4YG0A 3M7AA 2EAKA 5GLTA 2VVDA 4K1ZA 1MS3A 2HWF1 2WZPP 3AYDA 4CRQA 3PVBB 4ZXKA 3NL1A 4CTEA 3O7OA 4N43B 1QKQA 1B35A 4N53A 4YG3A 1MS9A 1X33A 3B69A 3TB0A 3VUOA 4Y20B 1BKZA 3RYRA 4WM7C 1XNDA 3AK0A 3WG1A 1NCQA 4AI3A 3E6BA 3WQ0A 2B9UA 5I0RA 4OI1A 1CAUB 4URTA 5ABJA 1ZREA 1NA1C 4BMBA 2GU9A 4EN8B 4O9GA 1PO11 2I07B 3N7JA 2E7TA 1PGL1 2PHLA 2Z5WA 4WBBA 1EAH2 1S0BA 3N4MA 2Y26A 3BOWA 3B3QE 5BNQA 1BBT1 3S7IA 1Z78A 4D94A 3VBFA 1N47A 5JVVA 4QM8A 3ZFGA 5D1IA 3SH3A 2FMYA 3VBSB 1Q43A 4MUVA 4Q4W3 4N9HA 1F9KA 3VBFC 3HN1A 4NHLA 1LODA 3FBYA 2R062 4L97A 3GZUC 1DGRA 4Y22B 3AKSA 1UPIA 2XUMA 1ZBE2 3B9CA 1FI2A 4Q4W1 1NY71 2DF7A 3VZNA 4L92A 2QQPA 4IV1C 4WVMA 3RPQA 5BXXA 1RUD1 1UZYA 4P5HA 4QQ2A 3UJOA 3R0RA 2DVBA 2ZHKA 2ZMNA 1ENSA 1PVC3 4AEDB 3ZSL