1LOEA

X-ray crystal structure determination and refinement at 1.9 angstroms resolution of isolectin i from the seeds of lathyrus ochrus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
180
structure length
180
Chain Sequence
b'TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEGUME ISOLECTIN I (ALPHA CHAIN)
publication title X-ray crystal structure determination and refinement at 1.9 A resolution of isolectin I from the seeds of Lathyrus ochrus.
pubmed doi rcsb
source organism Lathyrus ochrus
molecule tags Lectin
total genus 26
structure length 180
sequence length 180
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1loeA00
4RA0A 3ZXLA 4ZKTB 3SH4A 1LENA 4ISRA 1PZ9A 2D6OX 2ZGTA 5FRAA 3WG1A 3ZSMA 1AVBA 2DTWA 1Z0HA 4XIOA 5GJ6A 3ENRA 1SCSA 1S1AA 5T5OA 2YV8A 4Z8BA 1BXHA 5L73A 1F9KA 1LHWA 3RS6A 4C1XA 1LCLA 3AJZA 3T1MA 1A78A 1CIWA 1V6MA 2DTYA 4PF5A 3USUB 5CA6A 3MW2A 4UW5A 2TEPA 4XJ8A 2ZGUA 3R05A 2SBAA 1BYHA 4XE9A 1LOEA 4FOYA 2GN7A 1ULDA 3DGTA 1XQNA 2DVGA 5T5PA 1S0JA 3R4UA 3WDWA 1BQPA 3AXDA 4JCKA 2GMEA 1AF9A 3WDUA 4Y24A 1N1TA 1SLCA 1AJOA 5LK5A 1SCRA 1SLLA 2ZBJA 2Q5TA 4LBQD 3ZSJA 3HN1A 2WNEA 4JC1A 3SH3A 1GZWB 1WLDA 4Q1RA 3IMNA 2GMMA 2NN8A 2D3SA 3WDYA 2ZMKA 2NMNA 4BPZA 1FNYA 2YXSA 2LTNA 4XXAA 1URXA 1GZ9A 1Q8VA 1WW7A 4FPHA 1N47A 5CAZA 3N3HA 4Q26A 1BZWA 1CONA 4UW4A 5JLVA 1LGNA 1FX5A 5EXOA 4Y1XA 4YM2A 1AXYA 4ASMB 1QOSA 4GWMA 1GNZA 2AUYA 5DG1A 4BQ1A 4LBKA 3RG0A 1CPNA 3UL2A 3BODA 1W6NB 2GMPA 3V0BA 2GDFA 1GZCA 3NV3A 4P9XA 1MS5A 1H30A 3OBTA 3N7JA 4XHBA 1DQ1A 2D6KA 3AP5A 1ZM1A 5F5QA 1RITA 1LJ7A 3A0KA 5KXBA 4Y20A 3WDTA 5CNAA 1KRIA 1X50A 1GSLA 1Q8QA 4WVWA 4YZ1A 4AVTA 1FATA 3Q9OA 4FPCA 1MS1A 1MS9A 3PVEA 1DQ2A 1RIRA 1CJPA 1GLHA 2A7AA 2OVUA 3AP4A 1APNA 2DWRA 3V0AA 2DVAA 2R1DA 1WW6A 1AJKA 2P3KA 4YGEA 3N35A 4XIKA 1O4YA 4M3CF 5GZDA 1GKBA 2XG3A 4AVSA 5HCAA 2GNMA 4LBJA 1WLWA 3LCPA 4YLZA 4BLIA 3BIWE 3C2UA 4KBBA 3WG2A 3FUOA 4K21A 1DYPA 1CR7A 5T50A 1UMZA 1S0DA 2VW0A 3VUOA 3AYDA 2V5YA 1Q8SA 3ZXFA 1C57A 3V0BB 1WUVA 1H9PA 3M2MA 4FPOB 4H55A 1MVQA 4LBLA 4I30A 3FLPA 4NO4A 1LU1A 5E8AA 1JW6A 1UKGA 1G9CA 4GXLA 3MW3A 4Q1PA 4YGDA 3CNAA 2H0BA 3INAA 4GALA 2D7FA 3VKOA 1MS4A 2ENRA 3ZPYA 1N1SA 5DUUA 4TYSA 1QF3A 2R49A 2ZGSA 2E7TA 4FOVA 4FPLA 4Y20B 3MW4A 2NP0A 4Q27A 4JRAA 2VW2A 2OUHA 1HLCA 2JECA 4YW5A 3PMEA 3WUDA 4AWDA 3ZYPA 1MR5A 1SLTA 3RQ0A 4FQ4A 3GNEA 2A6YA 1Z78A 4Y1ZA 2ARXA 3WLUA 2DVFA 3O5SA 4PBPA 1GYKA 5SV8A 5GZGA 3V0AB 1D0HA 1I3HA 2YZ4A 1LEMA 4YG3A 2PHFA 1ENRA 4K1YA 2ARBA 3H0OA 2CYFA 1OKQA 1LTEA 5BYNA 2UWCA 3OBRA 4DS0A 2GNDA 3WHUA 2WSVA 4YZ2A 4Q8LA 1LHOA 5H9PA 4R9AA 5EWSA 2D3RA 3APBA 3PJQA 4U2AA 5CB7A 3AP6A 1UZYA 3M3CA 2DV9A 2Z42A 4YFZA 1G9FA 2D43A 5JDBA 2WT1A 1KITA 2ZMNA 5DG2A 1DIWA 4BOWA 4CRQA 1GICA 4NOTA 2EF6A 4FQZA 3SITA 1QKQA 1MS8A 1VAVA 4DRVA 1JN2P 3OGGA 2WT0A 2EALA 4IQPA 1BJQA 2FHRA 2CL2A 1W6NA 2GN3A 1IKQA 2W52A 3A0NA 4FPFA 3ZYRA 1QOOA 2P34A 5GLUA 3ILRA 3O0WA 3NV2A 4XJ9A 3FLRA 5DUXA 4XTMA 3SLIA 5JVVA 1HDKA 5DZFA 1DBNA 2WQZC 1G9DA 2LALA 2PHUA 2BQPA 1IS5A 1WD4A 2P2KA 4ATFA 1JHNA 2YROA 1SLIA 3D4KA 4PQ9A 4P14A 3AYAA 1N3OA 4CZSA 1ENSA 1QNYA 1IS4A 4XBNA 1DLLA 1VIWB 3LSDA 3O0XA 4XXPA 2ZHKA 2ZMLA 1MVEA 1C1FA 1UAIA 4ZXKA 4ATEA 1DZQA 2DURA 1AX2A 4FPEA 3HMYA 3AXEA 1EPWA 3QCWA 4ISQA 1ULCA 2D6PA 2DU0A 1D2SA 3O0VA 1SLAA 4LBMA 2RHPA 1CPMA 4XBLA 1LOBA 4DPNA 2VU9A 1N3QA 1CN1A 2ZGPA 3FLTA 2ZGRA 2AH2A 4XJAA 2GNBA 2AENA 5KXDA 2P37A 2A75A 4YZ4A 1KJRA 5DXDA 4AVVA 3ZXEA 4FPKA 1G8WA 4GKXA 5DZEA 5GLWA 4M3CA 3WZ1A 3WOGA 4BLJA 3HR9A 3WG4A 3A4UA 5IUQA 4HANA 1AXKA 1DYKA 1O4ZA 5H9SA 2CY6A 2E6VA 3W58A 1QNWA 1SBDA 4XBQA 2AR6A 1WW5A 2NMOA 2CWMA 3AX4A 1F31A 1ZA4A 4K1ZA 1R1ZA 1N1YA 1V6KA 3V65A 1DFQA 1WBFA 4XDQA 2D6NA 1QGLA 2UWAA 5CBLA 4YW3A 3ZXKA 1W6PA 3WVJA 1YRZA 3GALA 5GZFA 4P9YA 4AGGA 2OW4A 4WZFA 2A3XA 3M3OA 5FREA 4FP3A 2PHWA 2A3WA 1YI7A 1Q56A 1VLNA 4F83A 3IN9A 3AP9A 1KJLA 4XTPA 3AZYA 1CESA 3RRDA 3T2TA 4AGVA 1C1LA 4LBQA 1G86A 4R9CA 4D69A 2AYHA 4Q2FA 3KM5A 3WNXA 2P3JA 4M3CB 1JOJA 3PVNA 3I8TA 5DUWA 4UW3A 1Q8OA 2D6MA 1IS6A 1JYCA 2YMZA 2R0HA 2ZGLA 3B00A 3OY8B 2DYCA 4UW6A 1F5FA 4PCRA 3TAYA 3WV6A 3SNMA 1HQLA 2SLIA 1WD3A 1OQ1A 2VW1A 5HCFA 4YW1A 5T55A 1OFSA 4FPGA 3O12A 3RSJA 1U0AA 3ZSLA 2UWBA 3D6EA 3ZSKA 2WKKA 1DQ0A 3AK0A 5T5LA 2YY1A 4YZ5A 4DQAA 5DUVA 2WJSA 1W6PB 3POWA 3KQRA 2E51A 4XHXA 3VKNA 3M3EA 1W6OA 3AJYA 4Q8KA 1LHUA 1ULEA 2CTVA 2ZHNA 3WDXA 4DFSA 1W0PA 3RMYA 4L8QA 1LGBA 1HKDA 2VH9A 2ZHMA 5GZEA 2ZGNA 1CVNA 4LBOA 3U4XA 1B09A 5GLVA 1VAMA 3B01A 3B9CA 1GANA 4LBQB 1TEIA 2WT2A 5EYXA 5T52A 1S0GA 2EAKA 3BOPA 2CNAA 2W39A 1ULFA 1IKPA 1V00A 1LOAA 2A70A 3LSEA 2JD4A 1LHNA 1C4RA 1ULGA 2ZGKA 4M3CE 4YM1A 4BMEA 1MZ6A 2DVBA 3JU9A 1S0CA 3PVOA 2A6ZA 4M00A 4YZ3A 5E89A 4OZXA 3V64A 2ZKNA 2EXIA 1HQWA 2WSUA 1CQ9A 1LU2A 5H9QA 2D3PA 3SISA 2AGSA 1V6OA 3M1HA 3ASIA 4DRRA 2JE9A 1W0OA 4YGBA 3BTAA 1S0EA 1ONAA 1PZ8A 4LBNA 3W59A 1I1EA 5IK7A 4P9WA 2ZGMA 4YW2A 1QOTA 2VUAA 3AZVA 4YFWA 3AZXA 3T1LA 5GM0A 1WBLA 1UX6A 1W6OB 4YG6A 4SLIA 5GLTA 1UZZA 3FFZA 3AYEA 5F9TA 1BKZA 2PHRA 1JXNA 2FMDA 1H9WA 2ERFA 1YYNA 1PZ7A 2UURA 4CTEA 4XYXA 1YO8A 2DUQA 2ZZJA 1KDMA 1LEDA 1JYIA 4YM3A 5KXCA 1LOCA 2CWSA 3ILNA 1UL9A 3MPPG 1Q8PA 1FYUA 3I4IA 3N36A 3AZWA 1WLCA 3MEPA 1V6JA 1S0FA 3VKMA 4YM0A 3N7MA 2HYKA 1W6QA 4Y22A 2A71A 1V6LA 1FAYA 1QDOA 1SBFA 3D5OA 3NV1A 1FV3A 2PELA 4FP2A 1MZ5A 3N7LA 2WLQA 3B3QE 3JUUA 1LODA 4FOQA 2A6VA 4YGCA 2C9AA 2GNTA 1LOFA 2R0FA 3AFKA 5E88A 1AX0A 4YG0A 1J1TA 1ENQA 2D44A 4M01A 1DQ5A 5JOWA 3OY8A 4Y1YA 4TZDA 3IKWA 1YXWA 1LOGA 5IK4A 4R9BA 4FVVA 1AXZA 1Y7BA 1FV2A 2EIGA 2EXJA 2W08A 1SACA 4XJWA 4XJZA 1N1VA 3UJQA 5JMCA 2OUJA 2PHTA 2JKBA 2PHXA 5AVAA 1G7YA 5IK5A 1GV9A 3ZXJA 1AX1A 3N7KA 2C5DA 5JOXA 3L2YA 2VY0A 1KDKA 1JUIA 4W65A 4XMIA 3WUCA 2D6LX 2VXRA 1LGCA 3DUIA 2B7YA 4K20A 5GALA 1LHVA 4Y1UA 1A8DA 5EYYA 3VKFC 1SFYA 3NWKA 2JE7A 4PBOA 1DQ4A 2W68A 3IM0A 2ZAAA 1W6QB 4Y22B 1QMJA 2R16A 1V6IA 2XB6C 1V6NA 1FNZA 1SBEA 1JBCA 1LOFC 4Y26A 3IPVA 2ES3A 5GZCA 2ZGOA 3OPZA 4MYEA 2DUOA 2ZHLA 5JOZA 3POSA 3RMXA 2KM2A 1VALA 1GBGA 4BM8A 1MACA 1N3PA 4FOWA 1G9AA 3VKLA 2NZ9A 3AP7A 1NLSA 1RINA 3AYCA 5DZGA 5H9RA 2NM1A 3R4SA 2I2SA 4XOGA 3UJOA 3OYWA 3TB0A 4C1WA 3ILFA 3SH5A 4HL0A 1W6MA 4R9DA 1WCSA 3UK9A 3VV1A 4WV8A 1WW4A 4AYUA 1AZDA 1UPSA 2GALA 4Y1VA 5IT6A 1A3KA 5IK8A 1IS3A 5HCBA 2V73A 3WCRA 3AZZA 1DGLA 2ZACA 3WG3A 1DHKB 1IOAA 2E7QA 4U36A 1LULA 2G4IA 3FUQA 1LESA 1YIFA 2DU1A 3B69A 4GKYA 2A6XA 3QLQA 1UN1A 3M3QA 5GLZA 4XJUA 1G9BA 3USUA 2ZA9A 4GA9A 4YW4A 2AREA 2A5ZA 3WCSA 2NYYA 4XMAA 1NXD1 2R1BA 2ZABA 3WHTA 2P3IA 4GWNA 1S0IA 4FPYA 3FBYA 5T54A 2JDZA 2UU8A 4XILA 2EXHA 1GNHA 1SLBA 2ZGQA 3WDVA 3IPVB 4AGRA 3OJBA 4XZPA 4RL7A 3ATGA 1KQRA 2A6WA 2JJ6A 2E53A 1MS0A 1MS3A 4FPJA 1QU0A 5T5JA 5KXEA 1LECA 3ZVXA 4WVVA 4ITCA 5JOYA 1GZWA 1S0BA 2DUPA 3OYWB 2A3YA 1QDCA 3POYA 1W6MB 4BMBA 3NV4A 2EXKA 2DVDA 1DQ6A
chains in the Genus database with same CATH superfamily
3ZXLA 4ZKTB 3FFQA 1K5JA 3R0RA 4ZHNA 5EJ1B 5FXZA 4Q4W2 2ZCWA 1PZ9A 3I2IA 5F32A 2H6CA 5FZEA 4QM9A 2DTWA 1Z0HA 3OGJA 4XIOA 3ENRA 4DUWA 4K8FA 3DXUA 2HWD2 2EICA 2HWE3 2K2SA 4BQ5A 2W46A 1HN1A 4YVSC 3JD71 5EHDA 4JKLA 1CIWA 3LDRA 1V6MA 5ACA2 4Y5Z0 3QACA 4A7YA 2O8QA 3J8F3 3R05A 2SBAA 4RR3A 1LOEA 4QPIC 5JXGA 4LE3A 5FY4A 3CJXA 1IG3A 4LO4B 1BQPA 1XXNA 2EIDA 3WDWA 2VNOA 2VULA 3OUJA 3HD8B 4BYYA 1OD5A 1QQP1 2RMU1 4HOOA 3WP4A 4C0HA 1HJFA 3RJ2X 1WMEA 1QHDA 2ZEXA 4QT6A 4BB3A 3SCHA 2QQJA 4C0BA 1WLDA 4E8DA 1OOPB 5A3OA 3NRUA 3MZHA 1RC6A 3OOXA 2E33A 2Y34A 2NMNA 3SHRA 2HLEA 5CU1A 3SCGA 5C5TA 3U1XA 1PIV1 4QU2A 4XXAA 1Q8VA 4FPHA 2L9LA 5A70A 2Q4SA 4Q26A 1XB9A 3ZYJB 2EIBA 4JAAA 1W9SA 5KHHA 5JLVA 5FO8B 1W2UA 1W99A 2FQPA 1FX5A 3GCWA 4NIGA 4Y1XA 3CLPA 4OUSA 4RR3C 3PUQA 3MIGA 3DF0A 1GNZA 2AUYA 3MUZ1 4OMCA 4CEYA 2R042 3FMGA 2RS31 4DIQA 1HW5A 4OCTA 2E31A 2GDFA 1ZRFA 3T2PA 1NZIA 5F3CA 3OBTA 2VJXA 3KV5A 1RMU1 4H7LA 3S6PA 4WBBA 5F5QA 4HT1T 5CFCA 4IV3B 1YWKA 2P5BA 3WDTA 5AC92 5FMDA 4FTBA 4LUMA 3GBGA 3ZYFA 3T2OA 4AVTA 1FATA 4LORA 4H7MA 1DQ2A 3LDKA 4QXKA 5C3OA 4RHV2 4MADA 1PGW1 1GP4A 2DWRA 3LA2A 3NO8A 3VHNA 4DOUA 3CHXA 2R1DA 4LIVA 2VOVA 4MVTA 2HWE1 5FZBA 4IV1A 1O4YA 5JZGA 4M3CF 4OQ9A 2VMIA 2Z69A 2GNMA 3I3QA 4G4FA 5FOBB 5HV4A 3WG2A 4BJ0A 5T50A 1VBA3 3I97A 3RZZA 1ND2B 3GHNA 1RXFA 2VW0A 1Q8SA 4XUOA 2VZ3A 4J1XA 3V0BB 4XEZA 1YJKA 4LBLA 1MVQA 1RUI3 3QBQA 4I30A 4NO4A 4OI2A 5CFCC 4ZZ5A 4Q1PA 3CNAA 2H0BA 4CDUC 3J9SA 1SG3A 1W8HA 4GALA 3U75A 1MPXA 3TYJA 3VKOA 1O4TA 1F15A 3OPTA 3L2HA 4D8MA 5JAXA 3MGUA 4ZS3A 3O1VA 1YI9A 2PA7A 1PO13 4ZPIA 5F6LB 4CCOA 2I07B 2GP3A 2WO1A 3AL5A 4XQ4A 3ZSEA 2YU2A 4QX2A 2W95A 2VZVA 3BU7A 2B9UA 3RQ0A 1ZBA3 2BYVE 2W5FA 3GNEA 3WLUA 4ES9A 3ME2A 5SV8A 1OT5A 1H8VA 4IV1C 5JZGC 3U78A 3URFA 4NN0A 1LEMA 1DGWX 4ONUA 2PHFA 1MZFA 4GMP0 3VBOB 4CPBA 5FYVA 3W5MA 2VZTA 1FMD2 5ANNA 3DCQA 5BYNA 2BGPA 2ID4A 3BB6A 2AEZA 4DS0A 1GP5A 2Q30A 2CDOA 2O8OA 1BEV1 2WSVA 1LHOA 4UF0B 4E2GA 2D3RA 4HKWA 1SHWB 3MLKA 3PUHA 1C8M3 1RB8G 1KS5A 1OQDA 1JZ4A 4L99A 5F3EA 2DV9A 2Z42A 4GMP3 1UWWA 1EPZA 1VPHA 1T2XA 3ZDVA 5JDBA 2OT7A 3NNMA 1A6CA 3ACLA 4CRQA 2W1SA 1YQ6A 2EF6A 2R062 2VM9A 1VAVA 3BVCA 4FQZA 1O6UA 1JN2P 1D0GA 3H42B 5L9BA 2EALA 2ZEZA 5FJKA 2XL9A 4LPLA 5LA0A 3RDIA 3HVDA 3J7LA 4GQ7A 1ZX5A 1NE4A 2P34A 3MICA 4ORFA 5BNOA 1W39A 3P1IA 3FLRA 5DUXA 3SKJE 5IATA 2XHKA 1PO22 3RVHA 5JVVA 2PLV1 3E6CC 3IZOA 1R1A1 5FK7A 2HYXA 2WQZC 3CZUA 2BGOA 1JTZX 2P2KA 2R6QA 5JUVA 1JHNA 2AZ5A 5F8PA 1OOPC 4PQ9A 3D4KA 4P00B 1IS4A 1J3PA 2XUEA 1C1FA 2WA3A 2XGXA 4CCKA 3VBFA 1VBD2 1AX2A 4FPEA 1X82A 3ACHA 4NROA 1EPWA 2P17A 3QCWA 1Y9GA 2Q8OA 5A6YA 1FOD2 5FLJA 1YUDA 1UU6A 4KWUA 1HV1A 1C8NA 2RHPA 4M0NA 4W6YA 4D6RA 1AR73 1YLLA 3FL7A 1LOBA 4QWNA 1CZVA 1TME3 4QKFA 1CN1A 3D8CA 4OHWA 1PNFA 1ZBE2 1H6YA 3K46A 1CWPA 1PO11 2OXBA 2GNBA 3VD9A 2K0GA 3HQUA 1ND2A 4GD4A 3GZTB 5LA2A 3THDA 5DXDA 3ZXEA 3NJYA 4NWVA 1A34A 1ZBA1 2W47A 1QH7A 2KA3A 2OIIA 4B4QA 4OYUA 4IV3C 1AXKA 1DYKA 3IBMA 3LIHA 4NAOA 3PHMA 5LASA 3NVCA 3M3IA 3EO6A 2WAAA 4IEXA 3TN92 2CWMA 2XXZA 1PHMA 2V4VA 4Q4V3 1QWRA 4CEWA 1V6KA 1WMDA 3WSOA 3HBKA 1C8M1 4G3YC 1BK0A 3I2FA 5JIAA 4A4AA 2B46X 4AQSA 2B42B 1UY3A 5FYSA 5KHJA 2VC9A 1DYOA 4YW3A 2VE1A 4PQQA 1YRZA 3GALA 4NHKA 5GZFA 2A3XA 2XKOA 3M3OA 3MPBA 1F5JA 4FP3A 3VBOA 2VO5A 2A3WA 4W8JA 2VL4A 5F5IA 4MGZE 2QZ3A 1GOGA 2WN3A 4XTPA 3AZYA 3KMHA 1ND2C 4UF0A 3H8XA 4MUVA 2UYAA 3TEWA 4LBQA 3THTA 2N7GA 2DCZA 2BFUS 1RUJ3 1MQTB 2ORXA 2VAUA 1ZZCA 1UOFA 3POIA 4QKNA 4R9CA 4XC9A 4Q2FA 2GH2A 2X5IB 4I09A 1S55A 3BGAA 3KM5A 4FTEA 3ROUA 4QX7A 3PVNA 4HVOA 4QHBA 2PQQA 4PT6A 1OC1A 1GQPA 2D97A 4UW3A 4DEQA 1AL21 1LRHA 1IS6A 1JYCA 4JTNA 1O8PA 4E9KA 1XNDA 4HKOA 4AHZA 4Z92B 3PNAA 3WNOA 3B00A 5LZ6A 3OY8B 1TZOA 4CEWC 2G9GA 4UBGA 2SLIA 2LS6A 2VW1A 2FCTA 2WWUA 1OFSA 4Z2WA 1U0AA 1V9U3 3P6BA 1DQ0A 3AK0A 1RUF3 4CU9A 1W2NA 1BK1A 1VBC2 3NJVA 2JX9A 1AR71 1OA2A 4DQAA 3VN4A 3VBOC 1TME1 1PGL1 1UO9A 4Y33A 2WZ8A 3M7AA 5EPAA 4QGMA 4X8NA 2ZHNA 3WDXA 3OEAA 3FHAA 3LD8A 2UYBA 3WT3A 2E32A 4N7UA 2JD9A 1L7QA 2ZS6B 1HKDA 2Q8DA 4CE8A 3B5LB 5GZEA 4LBOA 1CVNA 1PM7A 4ASLA 3B9CA 4B7KA 3VBUB 3HOBA 5F39A 3VBHB 4MX3A 2W39A 2IFRA 1RL3A 3DKWA 3WEZA 3RZGA 1LOAA 1W9FA 2ET7A 4EN8B 5C4WB 4IXLA 3LA7A 5JR7B 1MZ6A 2DVBA 3UV9A 2VNVA 2XJTA 1FI2A 1ZNPA 3VLBB 4CDXA 3UNPA 2ZKNA 5H9QA 1HQWA 1LU2A 5FZ0A 1HIXA 1W03A 3RGBA 2Y0IA 3SISA 4IEQA 1WMXA 4LKSA 3ASIA 3BTAA 4D6QA 4ZU4A 1ONAA 1U5YA 1PZ8A 1I1EA 1VMFA 3JBG1 4DXTA 3IDCB 2QQVA 4GULA 1AYN3 4QHZA 4P9WA 4YW2A 1QOTA 5FZ6A 1POV0 2EVXA 3AZVA 3D0JA 3CZJA 1NXMA 4YFWA 5LCWL 1WBLA 1AR83 5GLTA 3ZIXA 3AYEA 4WVZA 1OA3A 3JQWA 4AAXA 2DDUA 2HEWF 1H9WA 2ERFA 1YYNA 4RGAA 4COUA 1PZ7A 2DUQA 2ZZJA 3S30A 2QDNA 5KHIA 3THPA 3FX3A 4MXWB 1POV3 1SZBA 3ZMNA 1SPPB 4E2QA 3NNFA 1XU2A 4XF0A 3ZXAC 1E5IA 2X09A 3V56A 3VKMA 1S0FA 3N7MA 1YFWA 1W6QA 2HYKA 3MIBA 4Y22A 4B3NA 2KD7A 2A71A 4HK8A 1QDOA 1HRV3 3NV1A 2F17A 5A32B 1FV3A 4HZFA 1V9U1 1ODMA 3QH7A 2X5IA 3LAGA 5DN2A 1LODA 5FY8A 4UAPA 1LOFA 1YHFA 4KL1A 1OVSA 3VZKA 2RV9A 1IZ3A 1W3XA 2HEYF 2X53S 1ENQA 4NAMA 4PLNA 2VMFA 1ZRIA 4XCAA 3OY8A 4XUNA 4Y1YA 1VB2A 5BUVA 2WIIB 2ZAHA 1LOGA 2PYTA 3KZ4C 4O7XA 1Y7BA 3S5AA 2EIGA 4OHZA 4AI2A 1DLCA 2EXJA 1C5IA 3CO2A 4EROA 2IWGB 3KT7A 4UFJA 2QQUA 4YVWB 2OUJA 3VZOA 5I0TA 5BNPB 1QJU2 3MF9A 5IK5A 2C5DA 4XUTA 3VDDB 5BXXA 3AKRA 4JV4A 3AM2A 4BISA 1LGCA 3KF5A 4MZUA 4Y1UA 1A8DA 2FCUA 4D7SA 4D3WA 1UKRA 5FPZA 4AEJA 2Y6KA 1MQTC 2JICA 1YEWA 2R073 3KV9A 4E4DX 5FXXA 4BXSV 3EB7A 1UOJA 2X5IC 3ECQA 4LKDA 1V6IA 1OFNA 2XB6C 1J3RA 2QQIA 3POBA 1LOFC 4WVMB 4BWOA 3IPVA 2PXJA 2ES3A 2ZGOA 1EY2A 4MYEA 3WINE 5JOZA 3POSA 5C4WA 2KM2A 1PMJX 1VALA 2JB8A 2PHDA 1L7LA 5K0UB 1E57A 1HB3A 4NWWA 2VUDA 5DDJ3 3AP7A 4AL9A 4FAHA 1RINA 2ZKLA 3M8LA 3I3EA 3NAPB 4XQDA 5EV7A 5L36A 4XOGA 3UJOA 4AG4A 1QJX1 5IVVA 2JXAA 1W9YA 3UK9A 2RS12 1WW4A 1AZDA 3LF7A 2HWC1 1UPSA 2RDRA 3RFRA 3MLJA 2RDSA 1QJY3 5HCBA 2WZR3 1MEC1 2ZACA 5HV0A 5FYCA 1POV1 2QQPA 1DHKB 1Z7S1 1X36A 1LULA 4G9SB 3MV01 3MYXA 4GKYA 4OI4A 1UN1A 1CD3G 5LB6A 4XJUA 2JG8B 4HFSA 4QKBA 4CDQB 1G9BA 1HRV1 3HT2A 4GA9A 3BTZA 4Y4RA 1EAH1 3ZMOA 1W04A 3O1UA 2NYYA 5LEKA 2LM3A 2ZABA 5LWBA 4GWNA 1AR62 1NQJA 1GQHA 2A1XA 1ZYBA 2VBBA 3DPRA 3FBYA 4FPYA 4Q4X1 4MXWA 1SPPA 2IZWA 5C4WC 4AGRA 3LA3A 3VD5A 4HSLA 1JYNA 5FZHA 1KQRA 4MHUA 2QQNA 3HT1A 1M06G 1W8ZA 2B39A 3OPWA 5JIUA 1QU0A 5ABJA 5G05L 1ENXA 1F8VA 5KWRA 4I3GA 4LHLA 5C3SA 4Y5TA 4WVVA 1CAWB 2H0VA 4ITCA 4NR1A 1GZWA 5JOYA 2AC1A 1E5HA 3GZAA 5CFDB 1OVPA 2HH9A 1REDA 1RUE2 4L9BA 2DVDA 1PK6B 1GP6A 4HPKB 4RA0A 2HWF3 3H8RA 2IVJA 4GH4A 2QCSB 4PIYA 5I8YA 5HI0A 1YFUA 3PTYA 4UFLA 2JDNA 2WFF3 4DXSA 3WG1A 1F2NA 5LRRA 3ZYIB 1FXZA 1D4M3 5FIXA 2PAMA 5CZKA 1COV3 1Y9MA 5LEJA 4EJRA 3AJZA 3HIFA 3LEGA 2E7AA 4HN1A 2VQAA 4PF5A 3USUB 3UKTA 1H4GA 3MW2A 3WR0A 4K6BA 1VP6A 1H6XA 3IDAA 4XJ8A 5BNPA 4FOYA 1IPKA 4YW6A 4M4RA 2PTMA 3DGTA 5D8AB 1I5ZA 1WCDJ 3VDDA 2MEV2 1HX6A 1HRI3 2BU9A 4V2WA 5DDJ1 1AYM2 1NYWA 2GMEA 1CGPA 4L11A 4CUBA 1N1TA 1SLCA 2CV6A 4FTSA 1SCRA 1W05A 2V09A 4EN0A 3ZYBA 1CZTA 2VTXJ 2WZEA 1VBE2 2YPDA 3HN1A 3SH3A 2FMYA 1QJY1 4P9JA 2BV4A 2WZR1 1ASJ2 4XFFA 5I93A 4XACA 3WW3A 5JCTA 2NN8A 3A23A 5FQ0B 1SMVA 3WXPA 2K9ZA 1YC61 1QXJA 1IPSA 1BCXA 2LTNA 1URXA 1GZ9A 4GJZA 4OI1A 5C70A 1UF2C 1N47A 4JGYA 3ZKUA 1XOYA 1NKGA 3GBWA 4BQXA 3G7DA 1W90A 5E1RA 4EN6B 4RQPA 2B45X 5A80A 4YVWC 2JDAA 4QMAA 5EXOA 5FZDA 5A7SA 1O3RA 2E26A 4YM2A 1L7RA 4YPJA 5A3NA 5BNPC 4LLOA 1UOGA 1XU1A 4HN0A 4B4RA 2VQUA 3USSA 3VDDC 1W6NB 1WKYA 5DAPA 2VCBA 3OGSA 4M0HA 3MIFA 3H1MA 1GZCA 3NV3A 4P9XA 4AOCA 3N7JA 3GDBA 4Q0QA 1HQNA 1RUD2 4CDQA 2HWB2 4I2OA 1VR3A 4Y20A 3E5QA 3PMSA 1C28A 5CNAA 1KRIA 3NW4A 3ZYGA 3I2OA 1PVC1 3JD73 4WVWA 4XF1A 4E4SA 1TNRA 4Z1VA 2HWF1 2WAOA 5IYYA 4FFHA 4IW3A 5LY2A 1MS1A 4CCJA 5K0UC 5M0TA 3RZJA 2CGNA 1HXS2 3VZNA 2WFF1 4BXFA 4HMZA 3RPQA 4YNIA 3NAPC 3AP4A 3NNJA 1DF0A 3E1F1 2OPWA 1D4M1 3AB0A 4AI9A 3V0AA 1QJEA 2DVAA 3L9JT 4W4ZA 4CP9A 1WW6A 2KR2A 3O1PA 2BPA2 1UYXA 3N35A 4XIKA 2RR11 4MGQA 3W9AA 3E5UA 5GZDA 4KMQA 4A41A 4CUCA 3CMGA 3I59B 4K8RB 3Q8EA 4LBJA 5CFDA 4BLIA 3UT0A 1Q43A 1RUG2 3C2UA 3AVRA 1DYPA 3CKHA 3TEYA 2Q1ZB 2WO2A 4CEYB 3VUOA 2V5YA 5EJZB 1C57A 5A7PA 1WUVA 4FXKB 4MXVA 3ZX7A 2G9ZA 2JG8C 1QXRA 1PIV3 2TUNA 3FLPA 5K4LA 5E8AA 1UKGA 4CDQC 4BQ4A 4GXLA 1G9CA 3HJRA 5HXVA 4EN9B 3NKGA 3LEIA 2CGOA 5CFCB 2D7FA 5A3MA 1MS4A 2ENRA 1N1SA 1LKNA 2W2IA 3FC0A 3LOIA 4LKFA 4FOVA 2E7TA 3PLQA 4O9EA 5B4NA 1W8NA 2DCJA 2NP0A 2VZOA 4Q27A 3I54A 2J22A 1XE0A 5FPUA 2VW2A 4QPGB 5C33A 2OQ6A 2BWCA 4YW5A 3WUDA 1NCQA 2RS33 4FBFA 5K7PA 1JYWA 1SLTA 5FZOB 1ZZ9A 4QX5A 4FQ4A 2XLGA 4JRLA 3I2JA 2A6YA 4N7IA 2ARXA 2YC4A 4IGOA 4PBPA 5A7OA 3ZFEA 1JZ8A 4MGKE 1RMU3 1D0HA 1OLQA 3PUAA 3S5QA 5CFDC 4Q4Y2 4IV1B 2XJSA 5JZGB 1PK6C 3FJSA 2BOIA 2UWCA 3VD3A 1UNBA 1VE0A 4FFIA 4Q8LA 2XLFA 5H9PA 4QX8A 4R9AA 3ES1A 2JWPA 4LHKA 1W2AX 4PLMA 4U2AA 5CADA 1DP0A 4LUKA 4UOJA 2OQ7A 2Y6JA 4ARXA 4QQPA 4YFZA 3LGRA 1BMV1 1DGRN 4O65A 2ZMNA 4DY3A 1H1AA 4B7EA 5FDBA 2QUOA 1ND3A 2PN5A 4HG6B 3OGGA 4IEZA 5FAXA 4CUGA 5D8AC 4AHXA 5A6ZA 2FHRA 5FPAA 1W6NA 1AR91 2GN3A 3A0NA 2JEMA 2NPIA 2XPJA 2WBKA 5GLUA 1BBT2 1TMF3 2AACA 4Q4W1 5JSOA 1OH4A 4QB6A 3JCIA 5EP9A 4A7ZA 1UY0A 3ACGA 5J37A 5BPXA 2IVIB 2B8MA 1NZCA 2CGPA 2PHUA 1HB4A 1UPIA 1WD4A 4ATFA 3OGVA 3RWNA 1QQP2 2RMU2 3C8XA 2I74A 4B1MA 4GZ9A 1O5LA 5ACA1 3AYAA 1N3OA 4CZSA 1QNYA 3RZHA 3LSDA 3PTRB 4ZXKA 5FY9A 1RUH2 2VVDA 4HBNA 4ISQA 4CYDA 2D6PA 4XUQA 1QEXA 4AFCA 3WF3A 4B4PA 1D2SA 4LBMA 2G1MA 3I59A 3ZR5A 4FAGA 2FZ1A 1AUYA 3EMRA 4DPNA 2QKDA 4URAA 2ZGPA 4Q0SA 4AEDA 4BDVB 1J84A 1RHI3 3SQOA 4XJAA 2AENA 1R093 2P37A 2ZX4A 1JZ7A 3WP5A 2IXIA 2XLAA 1BEV3 4CXYA 2WWSA 1NY71 3OD4A 4M3CA 3H8UA 4JTOA 5BNOB 4JKMA 2JDYA 3HR9A 3WG4A 4FSJA 3N9QA 4UBHA 2VD7A 3EXUA 3MO4A 5FP3A 2JDMA 3W58A 1QNWA 3ZFFA 4YYOA 1SBDA 3J4UH 4Q29A 4AE2A 3VBSA 4XBQA 2NMOA 2WS92 3AX4A 4QXCA 1F31A 4QPGA 3WW4A 3T3YA 3VHRA 1N1YA 3H1WA 4SBVA 4OZOA 1C3HA 1O91A 2R041 1PM4A 1DFQA 5FZOA 2NQYA 4XDQA 4GIQA 2EAAA 3VBFB 3NNLA 2UWAA 4OHXA 5FZ4A 2QQMA 3O14A 4H14A 3WVJA 1R64A 2PLV3 2F4LA 4JX0A 4OMDA 4AGGA 1R1A3 4IEWA 1J1LA 4P5YA 5FREA 1PVXA 2HWE2 3AKSA 4BIFA 1IQAA 4UXAA 1VLNA 5FY1A 3RRDA 2WLPA 2HJIA 1NUKA 4OFGA 1C1LA 3J8F2 4CEYC 1NCRA 5BV6A 5L7OA 4EV0A 5A1FA 1TMF1 2XMLA 4AFDA 4D69A 2AYHA 2BJSA 4N9IA 4RHV1 1O3QA 5IVFA 3WNXA 1LR5A 5KHGA 1CJDA 2BBAA 4UFIA 3JXSA 3Q8AA 4LT5A 3NSTA 5F5CA 4TN7A 3OUIA 2R0HA 5LRSA 3H3UA 3B7MA 5FYTA 2DYCA 3GBFA 1F5FA 1WGPA 4UW6A 4QPGC 4B29A 5C5UA 3I2KA 5JXHA 3WY6A 4RFRB 1WD3A 4C91A 1XC6A 2XHNA 4CEWB 5A6XA 1ZZ8A 3D6EA 3ZKYA 3B02A 4R4XA 2XBO3 3ACIA 4COZA 4YZ5A 2OKXA 2BDRA 4JDOA 4QM8A 2WJSA 1SEFA 5FZCA 2BFUL 2DCYA 3B93A 4XHXA 3TBDA 3JZVA 3T08A 3U37A 5IAXA 3AJYA 1RHI1 1OMIA 4I0BA 1OI6A 2GU9A 4CVUA 5J48A 1R091 4NIAA 3IDEA 1W0PA 3SEEA 3DYMA 3F95A 1LGBA 3HQXA 4L8QA 2OS2A 3HPNA 4XETA 3U10A 1F35A 1NX9A 3DEMA 1B09A 5GLVA 2O14A 4LBQB 4MO3M 4W6XA 3MI8A 3T4HB 1TEIA 5BY5A 3TNPB 4P9LA 2CNAA 3MLLA 1ULFA 1IKPA 4QD2A 5FBJA 3VDCA 3LSEA 5DQ0A 2J1UA 3K48A 1B35A 4DUXA 1C4RA 2ZGKA 2RDNA 2ADDA 2YFZA 1XRUA 5FYMA 3PVOA 2A6ZA 4M00A 1UQXA 4YZ3A 3V64A 3OB8A 1OKOA 1NAEA 5A7NA 2OZJA 2OX0A 4NHLA 5FP7A 2Y60A 3M1HA 2JE9A 3CF6E 3H3ZA 4ZZ8A 2Q0AA 2XUMA 3KCXA 3KCCA 1ZA7A 4KNCA 1UIKA 4LBNA 4A7KA 4IUGA 4GB33 1W28A 4LK6A 4YARA 4A3XA 4FFFA 2BOJA 2QJVA 3AL6A 1AL23 3BPSA 4MH0E 5GM0A 1UX6A 3OSDA 4IDZA 2VTFA 1UZZA 4XFCA 2PHRA 3P3NA 4TSVA 1UY4A 1Y4WA 3HNYM 4CTEA 1VBA2 1POQA 5FMBA 1O8SA 1YO8A 2OYZA 2BNNA 4Y5SA 5FUPA 5FYHA 1JYIA 4BQWA 5KXCA 3T0DA 1PO21 4KQ7A 1RUI2 2ZZQA 3ILNA 1UL9A 3U0ZA 4BHPA 3MPPG 1Q8PA 5FO9B 3IAQA 3N36A 3AZWA 3AKPA 4AK3A 5C71A 4I0WB 1GR3A 2FDHA 4LLFA 1ZZ6A 3TWIA 5IW0A 1VJ2A 5J3UA 3E97A 1FAYA 2B9VA 2JDHA 3CEWA 3D5OA 2W87A 5FZIA 1PO12 3K4DA 1MZ5A 4CDXB 3GZUC 2ATFA 4IGPA 2WLQA 3JUUA 5BNOC 2XBO1 1VBD1 3VD7A 4FOQA 2GNTA 4P9GA 1FOD1 2WN2A 4DEVA 1ZBA2 4YG0A 3I2GA 5FY5A 2XONA 1DQ5A 4M01A 5IVBA 2VQ0A 2WC2A 4LK7A 5TSWA 4BQYA 5IK4A 2OA2A 5J96B 4FVVA 2D40A 1FV2A 4HXCA 3RI8A 3K4AA 1C5HA 1JU4A 4XJZA 1Q3EA 5EQUA 3VBFC 1N1VA 5A3TA 4L97A 1O59A 5AVAA 1C8M2 2J1TA 5FZGA 4GJYA 3N7KA 2VOXA 4EWAA 3L2YA 2VY0A 1NT0A 4CPBD 3JBG3 4BU2A 5FR3A 3DUIA 5GALA 4F8AA 5EYYA 3VKFC 4ZU5A 1WZXA 4PBOA 4D0QA 3KT1A 3TN91 2VOTA 2ZAAA 1W6QB 4Y22B 5JR2A 4IERA 1NA1A 4RSUA 4Z2AA 3CJIA 3LE0A 5FWJA 4LXLA 1SBEA 3GCXA 3CU7A 1VBB3 1W06A 4X8PA 3RZMA 1S4CA 3OPZA 4GB31 2JDPA 3E6DA 4BM8A 1GBGA 2R30A 1G9AA 3VKLA 4BQ2A 4XUPA 3RYRA 2ZOEB 2W94A 2WL1A 5H9RA 3KD4A 1O3TA 3OYWA 1H2LA 2CDPA 3ILFA 4IETA 4V2VA 4TLGA 4L92A 3WNMA 5C8WA 4WV8A 4AYUA 3J7MA 5EZWA 2GALA 2V72A 5IT6A 2HBUA 1IS3A 4H2AA 5J98B 3LZZA 3OG2A 3AZZA 1Y9QA 5FZFA 4UI9L 1GNYA 4MHRA 2ZX3A 3WP6A 2ZX1A 4XF3A 3WW1A 1LESA 1JOPA 2QVSB 2K46A 1YIFA 1AR72 3AFGA 2A6XA 3QLQA 5CKMA 1TME2 1PGL2 2FDGA 2P4EA 4AFBA 3NMBA 4CU7A 1YCIA 2ZA9A 2ZX0A 4J1WA 2AREA 2JDUA 1XSQA 2A5ZA 2VVFA 2VTXA 1EUTA 3HN3A 3WCSA 3RZKA 4DO0A 1S0IA 5F3GA 5T54A 4IGQA 2QQOA 3HBZA 1R081 1U5IA 1SLBA 2ZGQA 3FZ3A 3IPVB 4FI9A 4JHTA 4JZRA 3WDVA 1OPOA 3I2DA 1QXPA 4A45A 5K9YA 1DGWA 2ZEYA 1MS3A 5JI7A 2FDKA 2DBIA 2GP5A 4JKKA 3H9AA 3N9MA 1D4VB 4Q4V2 2O1QA 2VBPA 2A3YA 3LOBA 3POYA 3JB4C 4OQ8A 1KD7A 3NV4A 4TZDA 4BCUA 1T6BX 1DQ6A 4NHYA 3K2OA 4DMIA 2Z5WA 3O7OA 1OLRA 3SH4A 4COWA 5A3LA 4ISRA 1AVBA 1SDWA 5D21A 4LO8A 1SCSA 5T5OA 2YV8A 2ZEWA 4TWTA 4P08A 3RS6A 4FXGB 3BKZA 4C1XA 2ADEA 3RNSA 2XR4A 3T1MA 3BU0A 1QJX3 1A78A 4X6QB 2DTYA 5BNQA 2TEPA 3DKQA 4NE9A 1RUJ2 1VBB1 1BYHA 2IFWA 3C7HA 2HWC3 4XE9A 1QJZA 1ULDA 3KHCA 1XQNA 5T5PA 2XDVA 3DPRB 1MEC3 3R4UA 3ZN6B 4GAZA 1ZRRA 1YIPA 1Z7S3 2BUKA 3AXDA 2X8KA 4JCKA 3UYJA 5ANQA 2G19A 3ZOIA 4CCNA 3WDUA 5LA9A 4NPRA 4Y24A 4PI2A 5LK5A 1BVP1 4CDXC 3P5BA 5ABJB 1Y3TA 1SLLA 2ZBJA 3NQHA 2Q5TA 4LBQD 1XNAA 3KB5A 5IWFA 2WNEA 4LQRA 2XKPA 1GZWB 4AF9A 1EAH3 5J7MA 4Q1RA 3IMNA 2GMMA 2CAUA 3GXUA 4LITA 1V9U2 3WDYA 4AHYA 1RUF2 4Q4X3 2WQ8A 4XDPA 4GH4B 4IEUA 4L2NA 1A8MA 3WF2A 3J26N 4KU7A 1UY2A 2VQTA 4IE0A 4PF1A 4CU6A 5F7UA 1VRH3 1CAVA 3N3HA 1BZWA 1ST8A 3VGIA 1W2OA 3KWVA 1CONA 4UW4A 1LGNA 1QJFA 4DNYA 3W21A 1OF4A 1XNKA 4PDWA 4LA2A 4ASMB 4JHZA 1QOSA 2WNUA 3ABZA 5B2GB 3DYPA 1UXXX 4LBKA 3RG0A 1CPNA 5HPOA 1PX4A 3BODA 3UL2A 2GMPA 3CL1A 1KS4A 1RJ8A 2X29A 3SCFA 2CSGA 1E5SA 3BUCA 2X05A 2D6KA 3AP5A 1RUC3 3ITQA 4N43A 4NUBA 3PJYA 2GSYA 1JHJA 1LJ7A 3A0KA 1X33A 4AQ2A 3E5XA 2BRTA 3IB3A 4I3PA 4A44A 5FP8A 1X50A 1GSLA 1EV13 2BERA 3Q9OA 3DN7A 2J1VA 3SXWA 3SEPA 1TNFA 3PVEA 1CJPA 1GLHA 1QJU1 3LPGA 3ZLIA 4PIXA 3CBNA 4XAAA 1APNA 4D6SA 5JSPA 1AYN2 5CEHA 3S57A 3ZPOA 3E6BA 5JWPA 4JGYB 5FYUA 3GM8A 1AR82 2XG3A 4I0AA 4EWEA 3WF1A 4YLZA 4CXXA 1JOBA 4RQPB 2WNUC 4K7JA 3FUOA 1X9PA 2VCAA 4WM8A 4COVA 3K4ZA 1S0DA 3AYDA 5KC5A 3ZXFA 4ASKA 3M2MA 4H55A 3N9LA 5IAVA 2QQWA 4N43C 3VB9A 1LU1A 3ON7A 2HBTA 3VDBA 3CIHA 2W0XA 3MW3A 2RS53 3INAA 4CCLA 2FBEA 4IE6A 4QXHA 3OD0A 1SQ4A 3ZPYA 5DUUA 3ZN4A 1HRV2 2R49A 4TYSA 2ZGSA 4Y20B 2RS11 3MW4A 2YG0A 4BIOA 3FBMA 3ZN6A 1HLCA 5FYBA 5E6HA 3GHMA 3AMPA 5F2SA 4E4HA 4RGGA 3UGGA 1VRH1 1MR5A 3I3MA 3NJXA 1ZREA 4Y1ZA 4LMFA 5KR7A 3ZFGA 1H8TB 3V0AB 3O5SA 4K9SA 1GYKA 4AW7A 3PL0A 4CP9B 4EZ4A 4DUVA 4YRDA 5GZGA 1GZTA 1I3HA 2YZ4A 4AR2A 4YG3A 4DINB 5FZLA 3H0OA 2CYFA 2VZSA 4JDMA 2D5FA 4HKLA 5GKAC 3MHZA 1PVC3 1AR61 4YZ2A 4IEPA 5EWSA 2WRAA 4URTA 2WNVA 3APBA 3U07A 3MF6A 5CB7A 3AP6A 1Y43B 4PHZA 2GC1A 3AKQA 3M3CA 1RUC1 1DDLA 4JGZB 4YWAA 2XQRA 1JU3A 1NG0A 3A7QA 1F4AA 2VMDA 2D43A 3DL3A 2WT1A 4WM7A 4BOWA 2RR13 2WA4A 1AHSA 3WQ0A 4NOTA 1EV11 2LRPA 1QKQA 2R072 2VMGA 4N90A 3SITA 4IQPA 3J7NA 1BJQA 3DPRC 4XURA 1RUE1 4Y3OA 5FPBA 2W52A 4ES8A 4FPFA 2ETEA 1QOOA 5FZ9A 3ZYRA 1YFYA 4PI0A 3O0WA 1M4WA 3NV2A 5FMOL 1IG0A 4XTMA 4AAPA 3SLIA 1JYXA 1NCQB 1V70A 3I3DA 4NHMA 5ABJC 5IVEA 5DDJ2 1DBNA 1G9DA 5FKBA 3BIEA 3AMNA 2BQPA 3FN9A 3ZFEB 4XFIA 3PDQA 3JQXA 2YROA 2RM23 4S2HA 5I8TA 1ENSA 2TBVA 1DLLA 1QJY2 2DF7A 2IXJA 3EJKA 2ZHKA 3O0XA 1MVEA 2WZR2 4GH4C 4LHNA 4ATEA 1DZQA 2V4AA 2DURA 4XAEA 4RFT0 3AXEA 2MEV1 1ULCA 3MBWA 5CISA 5FZMA 1AYM1 2DU0A 1GU3A 3O0VA 3Q8BA 5FZKA 2RS51 4XBLA 1GFF2 4QPYA 1N3QA 1RUOA 1YQ2A 2DCTA 3BCWA 2VMHA 1ZVFA 5LA1A 1OLMA 3IT8A 3TRSB 1VAKA 4KGQA 2ZGRA 2AH2A 1ND3B 1ASJ1 1RVF1 3LB9A 4MSVA 4LULA 1KJRA 3WF0A 2Y6FA 1VMJA 4AVVA 4Q5OA 4FPKA 1FPN3 1G8WA 3KSCA 4GWIA 5LBBA 2YGLA 3RYPA 3WZ1A 2VVEA 3WOGA 4BLJA 4COYA 1J83A 1DU3D 2OZ6A 3A4UA 2XJRA 5IUQA 2ET1A 1S2BA 4HANA 1JZ6A 1JMUB 3EBRA 5H9SA 2E6VA 4KBZA 4NIDA 1V0AA 5FJHA 4FT8A 1UZ0A 2BGCA 2AR6A 3U11A 4X6RB 4LO6B 4OUMA 2C0ZA 3I3BA 3BI3A 1R1ZA 3AKTA 3N9OA 5EIYB 1IPJA 2HWF2 3RJRA 1G6NA 2QQLA 1AR93 2EA7A 5LBFA 3PIJA 3SC7X 2D6NA 1QGLA 3EHKA 2XJVA 2WFF2 5CBLA 1XNCA 4JGYC 5CVRA 1H8TA 4Q4W3 3VD4A 3ZXKA 2OPKA 1W6PA 5ERLA 4EQVA 1WCQA 2BVBA 1D4M2 2VNRA 1RUD1 4P9YA 2OW4A 4WZFA 3WD5A 4RQPC 1COV2 2ARCA 2PHWA 2HWD3 2YBKA 3GJAA 2YGMA 1Q56A 2TNFA 4F83A 1W8UA 4R4ZA 2IXHA 4AEDB 1CESA 4AGVA 2JG9A 1KGYA 5ACA3 5C9AB 1W9WA 5C7GA 1G86A 2WNOA 1HXS1 1UU4A 4IESA 1FT9A 4Q0UA 5F1RA 2GC0A 1HRI2 2I45A 4JGZA 3OCPA 4M3CB 2ZJCA 3ST7A 3I8TA 4AI1A 2Z4FA 2YMZA 2Q8CA 2WDBA 2XJQA 3SMHA 5FXVA 4AFMA 5J1XA 2ZGLA 4UWDA 3S0MA 2RM21 3CDZB 1VB4A 3TAYA 3VZMA 3WQ1A 3ZFFB 3Q8CA 4EYUA 3SNMA 1WA6X 1UY1A 1HQLA 2YYOA 3VBSB 5HCFA 4FPGA 4HLTA 3WP3A 3ZSLA 5JXJA 2VZQA 3SKVA 4R52A 3OF1A 1H8TC 5T5LA 2YY1A 2Z2SB 4BZ4A 5DABA 5DUVA 5A33A 3POWA 4J25A 4NJ4A 4AZZA 3N9PA 3PURA 3QOPA 1W6OA 5CG8A 1LHUA 2CTVA 2D93A 2PQSA 5FMOS 1W3VA 3T0BA 3RMYA 3T09A 3BTYA 4XCBA 2VNGA 2YC0A 2VH9A 3A21A 1FPN1 3BN6A 3U4XA 1NCRB 3B01A 3MV11 2R043 4JGZC 5L7OB 4QPIA 2EAKA 1S2EA 2Z79A 1VRBA 1GQGA 3H7JA 4XFAA 3LWCA 5FZ8A 1XYNA 2PFWA 2Q1FA 4M3CE 2YFUA 4YM1A 1BMV2 4S2DA 5J36A 4QXBA 1WMFA 3RYKA 4CP0A 5AC93 3JD72 3JU9A 1BHGA 4PJYA 3WF4A 1YQ8A 5E89A 3NJZA 2XQXA 2WSUA 1CQ9A 2BTVC 2P3YA 1NCQC 5FP4A 5E16A 2X10A 5FV3A 2VZ1A 2AGSA 1V6OA 1WA4A 2C24A 4YGBA 1S0EA 4RHV3 3ZFEC 3W59A 2BW8A 1OH3A 3ACFA 4UFMA 2HWD1 3AMQA 5IK7A 4KH9A 4MG2A 5CKQA 2VUAA 3N4MA 2C1FA 3UESA 3T1LA 3AZXA 3FHQA 1WCKA 2FDIA 2B5HA 3ZM8A 5FKCA 4N8MA 4FCAA 4KI5M 1OBNA 5L9VA 4ZONA 1JXNA 4RD7A 1EUUA 2D5HA 3W5NA 3IAPA 3R4DB 1RYYA 3RZLA 1GWLA 3LEMA 1BBT1 1O5UA 1KEXA 5L9RA 3DXTA 4ZU7A 2CWSA 2W3JA 1PIV2 1O3SA 1X8EA 1FYUA 1EYBA 3I4IA 3POGA 4NRPA 1WLCA 5I0UA 3MEPA 5F3IA 1ND3C 1B35B 4YM0A 1OF3A 5IHRA 5C9AA 3S7EA 1SBFA 2PELA 4A42A 3O1SA 4QX1A 5LK7B 1RUH1 5FWEA 3WNLA 2A6VA 2WQ4A 4YGCA 2RS32 2C9AA 4LEJA 3ZIWA 2R0FA 3AFKA 5I0RA 1NY72 1AX0A 3JB8A 1J1TA 2P1BA 4LOSA 2J1SA 1RMU2 2QZ2A 2VMCA 3IKWA 3KV4A 4AXOA 5LATA 1W8OA 2G9FA 4E8CA 4XABA 5DAQA 2WFPA 1YQCA 1H1MA 2DBNA 1FMD3 2W08A 3MFCA 4XJWA 3O1RA 1ODNA 4ZXEA 3UJQA 4MGIE 3OBAA 4QDQA 3WNPA 4J6GA 5FY7A 3HAGA 2JKBA 1K42A 3ORJA 2PHXA 2H6BA 3DECA 5JOXA 1PGW2 1JUIA 4W65A 3UKNA 2VUCA 3WUCA 4AEDC 2VXRA 4K20A 2B7YA 3LDBA 5AC91 1CAXA 1UW8A 2JE7A 1DQ4A 2W68A 3TNQA 4CDUA 2WS91 5C9AC 2R063 1T6GC 3AMHA 2R16A 4CUAA 4QX0A 1V6NA 1FNZA 2YB7A 2D98A 1TMF2 4K3UA 4KU8A 5DAXA 3FWEA 5LBEA 5A6QA 1PNGA 2DUOA 2ZHLA 2RJKA 3TOJA 3RMXA 1PO23 2J1AA 4QQOA 1UX7A 2YBPA 1MACA 5F2WA 4E27A 5A1LA 1CX1A 2WUHA 3ZFFC 1JODA 3AYCA 3VBRA 5DZGA 1JH5A 1MZEA 3R4SA 5FZ3A 3VBSC 1UU5A 1YNAA 4HL0A 4AHWA 1W6MA 2JIJA 1PMHX 2ZX2A 5G04L 3VV1A 3J8F1 4D7YA 4XQWA 5AFEA 4QQLA 5D1IA 4EE2A 5L19A 4JDNA 1NLQA 2XWBB 1DG6A 2V73A 3WCRA 2JDKA 1KFXL 3ZXDA 4TLFA 4CCDA 1VBD3 4HK9A 2CHHA 3Q8FA 3G6JB 4LNVA 2G4IA 1FOD3 2UY8A 1LNSA 3FUQA 5DPNA 2DU1A 2RDQA 3B69A 3KQ4B 2VGDA 2QTWB 3M3QA 4PIZA 3K51A 3POJA 1K5MB 4LO7A 2Y26A 4GWJA 1NQDA 4YW4A 1RHI2 2DFBA 5KBFA 1NCRC 1ZBE3 1JZ5A 1R092 3LQCA 3VHPA 4XMAA 3C7FA 1NXD1 3WHTA 3ZR6A 3LIGA 5L7OC 1YJLA 4CXWA 1JYTA 5FZ1A 1NA1B 2BEOA 1BEV2 4DXZA 2JENA 3CJIB 1DZTA 2UU8A 5FK8A 3PIGA 2BVVA 1UMIA 5JXIA 1REEA 5C8CB 4XZPA 2VG9A 1AL0G 4UT5A 3VBRC 5IJRA 5T5JA 4O61A 2FDJA 3D82A 5C3RA 1LECA 2GZWA 4CCCA 5BNNB 5KXEA 1I5PA 1XE7A 1BLZA 1FMD1 2ILMA 2Y6GA 1KXGA 3OYWB 1S0BA 2DUPA 3D0SA 3TN93 3WQBA 1OOPA 2IUWA 4AQTA 4C8DA 1OA4A 3PVBB 2EXKA 4KG8A 1E5RA 4LHSA 2Y33A 2MPFA 1LENA 2P6HA 4QU1A 2GC2A 1K3IA 3POFA 2D6OX 2ZGTA 5FRAA 4UFHA 2PLV2 3ZSMA 5GJ6A 5IVYA 1R1A2 3MIEA 1S1AA 2VMEA 1UZWA 4Z8BA 2W92A 4RS5B 2YC2A 1BXHA 3BYWA 5L73A 1F9KA 1LHWA 2R061 1LCLA 1PX3A 1US3A 5CA6A 4UW5A 1XYOA 1PGSA 2ZGUA 4AI0A 1ZRCA 1GOFA 2R32A 3ELNA 2GN7A 4LTAA 2DVGA 1Q5OA 1I9RA 1S0JA 2Y8KA 3AVSA 4N53B 1NLRA 3I2HA 3MIHA 1B35C 1AF9A 5KC6A 1UOBA 3B94A 4KWJA 1H1IA 4IV3A 1AJOA 5F6KA 1JI6A 1SFNA 2C26A 1ZZBA 2VXJA 3ZSJA 4NRQA 3A22A 3DV8A 4JC1A 5FPXA 2ARAA 2RG4A 1VBA1 5CG9A 1L3JA 2D3SA 4BPZA 2GH8A 2IXKA 2QDRA 2ZMKA 2XBO2 1FNYA 3LFMA 5A3PA 5DMYA 5APAA 2YXSA 3POEA 1RUI1 4F3JA 1K45A 1R083 1VBC3 1WW7A 3K3OA 5CAZA 4F7ZA 4UYBA 1WWYA 4NPMA 5EFUA 2WWJA 4XF9A 1ZBE1 1WLTA 2Y64A 2ORZA 3C7OA 1U5XA 4BK4A 2HEVF 1AXYA 2WYSA 3DYOA 1UD1A 4GWMA 4UFKA 3F2ZA 3MFAA 5DG1A 4BQ1A 5K8SA 4DXRA 4XFHA 1JS9A 3V0BA 1KFUL 2QFEA 5JMOA 2WZPP 3U4SA 2W1UA 1MS5A 1H30A 1J58A 1K5MA 4XHBA 1DQ1A 2HKXA 2WYFA 1ZM1A 1RITA 1OHFA 5FXWA 5KXBA 4OHYA 4XZUG 5CYYA 2YHJA 5FPVA 3J7HA 1Q8QA 4OULA 2WR9A 2J42A 4YZ1A 4FPCA 1MS9A 1P8JA 5C8CA 1RIRA 4MGSA 2A7AA 1LB2A 4LKEA 2OVUA 2PAEA 4GMP1 2P6CA 4GB32 2J1EA 3LEKA 1AJKA 2P3KA 1CX4A 4YGEA 1AL22 5BNNA 1CAVB 1ACCA 4IL7A 1GKBA 4AVSA 2J1RA 4KG0A 5CIRA 1O7FA 1SDDB 3BALA 1WLWA 5HCAA 3LCPA 2QQKA 3BIWE 4KBBA 1DGRA 4QX3A 4K21A 2W1WA 4C90A 1CR7A 3H50A 3M70A 4OUEA 4PDWB 2WNUB 4MLOA 2CU5A 1UMZA 2PAKA 4TXWA 1H9PA 4FPOB 1LAJA 1K5MC 2MNGA 4RS5A 1HB1A 2VBDA 1JW6A 5F5AA 5ISLA 2XL7A 2BWAA 4YGDA 3OUHA 4N43B 4CU8A 4P02B 4Z82A 3BPZA 1NA1C 5FOJB 3ES4A 1QF3A 3CJIC 4FPLA 3H8OA 2GC3A 5HCHA 4BQ3A 4NVPA 2YPJA 4JRAA 5C8CC 3D3AA 5J09A 2OUHA 1HB2A 2JECA 5B4XA 2Y6HA 1OUXA 1VBC1 3PMEA 4XVHA 4AWDA 3ZYPA 2PHLA 3ETQA 1R082 1REFA 3QD6A 3LPFA 3VL9A 4V1PA 3ALQA 1OSGA 5BNNC 4R8HA 5FZ7A 1Z78A 3THCA 3KVBA 2DVFA 4I01A 2W91A 2YBSA 4ARYA 1ENRA 4K1YA 3O1OA 2ARBA 4OHVA 4QPWA 2PMWB 1GOHA 1CZSA 1H0BA 1LTEA 1OKQA 3OBRA 1H2MA 2BZDA 2GNDA 3WHUA 1U12A 2FCVA 1W2TA 3W20A 4LE4A 4WM8B 3R6SA 1W0NA 4NHXA 2UY9A 3PJQA 1UIJA 1UZVA 1QJU3 3EQEA 1QIQA 3OTFA 1UZYA 3QH6A 4LA3A 1F4HA 4RS5C 1RJ7A 4E2SA 4AEMA 1JZ3A 1PMIA 2VR4A 3JBG2 3K3NA 3HQRA 4HSJA 4ZY9A 4IE5A 1G9FA 4NRMA 3T4VA 4EN7B 5DG2A 1KITA 2YUEA 1DIWA 5JSRA 2BP6A 2C9KA 1GICA 5IFTA 1YQ5A 4AEKA 2ZXQA 4Q4V1 1MS8A 2QBXA 4S2FA 5DAVA 4DRVA 3N9NA 2WT0A 3HNMA 2CL2A 4LO5B 4A6OA 4BH9A 1IKQA 4N53C 1VBB2 1BVVA 3UETA 4RGKA 4Z07A 2A73B 3ILRA 5FY0A 4O9GA 4XJ9A 3NNGA 1HDKA 5DZFA 4QB1A 1H4HA 4CDWB 2LALA 1IQDC 3ZFGB 1IS5A 4ZS2A 3PU8A 5LW9A 3WW2A 4I02A 1ULOA 1SLIA 2BNMA 3KV6A 4P14A 5FBZA 3WNKA 4XBNA 1VIWB 1RUJ1 2RS13 3IIIA 1QY4A 2ZMLA 4XXPA 1ZRDA 1UAIA 1K12A 1VMHA 1OURA 3KT4A 3KHBA 3EYPA 2RJLA 3HMYA 2FD8A 2WNVB 1IGOA 3ZO0B 3GF6A 4CCEA 4DZGA 1SLAA 1D7PM 2JKXA 1CPMA 2VU9A 4QGLA 3IDBB 3FLTA 5FTTC 4WM7B 3C7EA 4XPVA 2DCKA 3WNNA 2XWJB 1XPWA 5KXDA 1UYZA 1MQTA 2A75A 2RVAA 4YZ4A 4OLLA 4LR4A 1AR63 1RUF1 2CAVA 3IWZA 2O0OA 4GKXA 5DZEA 3T2QA 5GLWA 4B8EA 1W8TA 5CKNA 3UKVA 3KVAA 4NIHA 3KCYA 1JZ2A 3MDPA 4WZCA 5JI9A 4IEVA 1O4ZA 4QHOA 4RN5A 5AVPA 3VZJA 2CY6A 2VECA 1CAUB 3P3PA 4CCMA 2W9XA 3CQOA 2XVKA 2VCCA 3GJBA 4QKDA 1ULPA 5I91A 4N53A 1WW5A 1ZA4A 3HNBM 4XW3A 2BNOA 4INDA 3V65A 2W1QA 2XVLA 1RUE3 4AVBA 1WBFA 2V5DA 3I7DA 1JUHA 2JB4A 3ZDSA 4FO9A 4TTGA 2VOWA 4Q0VA 3LKJA 4XDOA 1NOVA 1YI7A 2MHFA 4OVEA 3U14A 5T3NA 5IVCA 1QJX2 3AP9A 1KJLA 2F4PA 2RE9A 3IN9A 4PDWC 1OUSA 3T2TA 1UCXA 3ZN5A 4BA6A 2HWC2 2Q8EA 5FYIA 4LIUA 3VBUA 5KHKA 2LUWA 1OXCA 2YU1A 1UYYA 3VBHA 1MEC2 1XBFA 2F6BA 2P3JA 1HV0A 1Z7S2 2MEV3 1JOJA 2XJUA 5JPMB 2E9QA 2VZPA 1AYN1 3OGRA 5DUWA 1AYM3 1Q8OA 2D6MA 2VCMA 3ZXGA 1AR81 3C7GA 3AC0A 1I6XA 3UGFA 4AVCA 4KWKA 4PCRA 3WV6A 2WO7A 1EAH2 1S2KA 1VBE3 4XFGA 1OQ1A 4YW1A 5T55A 4B1LA 1ASJ3 1RVF3 3O12A 3RSJA 3TEZA 3FE5A 3MUY1 2UWBA 1ALYA 1YFXA 4Q4X2 3H7YA 2WKKA 3ZSKA 5I0SA 4QB2A 4CDWA 3HWJA 4AVAA 5HBAA 1VRH2 2AEYA 4Q0PA 5EJ3A 1STMA 1W6PB 3KQRA 2E51A 3VKNA 3UGHA 4KGGA 4E4ZA 3M3EA 3M4FA 4NMIA 4EWDA 1ULEA 1NE6A 4Q8KA 4IEOA 4DFSA 1UXZA 4WM8C 5FLHA 2Q1MA 2FZ2A 5I8SA 4CSWA 4OI0A 3KGLA 3VBUC 3NKTA 4MGYE 2ZHMA 2JG9B 2IXCA 2B4KA 2ZGNA 3H1YA 3OEBA 4N9HA 3VBHC 4CA9A 1OLME 1VAMA 1GANA 5T52A 2WT2A 4JQTA 5EYXA 1S0GA 3BOPA 4RYDA 4IE4A 5DAWA 1V00A 4QDSA 3KF3A 2A70A 1RUC2 5HXMA 2JD4A 1LHNA 1RUD3 1ULGA 2HWB3 4BMEA 4YSFA 5A32A 3B9IA 4QAWA 1S0CA 1EV12 5FLIA 2WABA 4H3WA 5D2AA 4OZXA 2EXIA 1QH6A 1W8FA 1XNTA 4MOAA 2D3PA 5A7WB 4HVQA 2YDEA 1HXS3 3IMMA 4CDWC 4DRRA 1W0OA 1XSRA 1XE8A 2VZUA 5AFBA 3ZFGC 4CP2A 5A3UA 4AI3A 1CAUA 5SV5A 1HN0A 1HJGA 1X7NA 1OPMA 2VZRA 2ZGMA 4EZHA 5A33B 1DCSA 4YG6A 1W6OB 1D2QA 2R071 4SLIA 5LY1A 5F9TA 3FFZA 3NL1A 1BKZA 2FMDA 1H2KA 4YVWA 1RUG3 3VZLA 4YVSB 4BE3A 2UURA 1GWKA 2WNVC 2XOMA 4XYXA 3KGZA 3RI9A 1KDMA 1LEDA 4ET7A 1JYVA 4QQHA 2VUJA 4HONA 4YM3A 3BOWA 1LOCA 4QPIB 2RJ2A 3MIDA 3BTXA 4WM7C 3GYDA 2RS52 2ZPXA 2NLRA 1V6JA 5IFPA 1UMHA 1VBE1 3O1TA 2GAUA 3GGLA 1V6LA 4XF4A 2LW8A 3TEXA 4FP2A 5FUNA 2C4XA 3WQ7A 2Y38A 3C3VA 3N7LA 4WVMA 1RVF2 3B3QE 5FCCA 4MV2A 3H3LA 1J3QA 4QQ2A 1TQ5A 1US2A 5E88A 5K0UA 4KWLA 2XVGA 4CP1A 2D44A 3NAPA 4HETA 4QGNA 5JOWA 3VDAA 1TVGA 1YXWA 5C3QA 4XFBA 3ZYHA 2LROA 1X8MA 4R9BA 5JPNB 1AXZA 2R7EB 4A2UA 4Q4Y3 4AI8A 4BK5A 1TE1B 4FFGA 1PVC2 1SACA 4LOTA 1XYPA 5LBCA 4W50A 5JMCA 4DB5A 2PHTA 3LFIA 4D7TA 1TG7A 1G7YA 4RR3B 5FP9A 1GV9A 3ZXJA 1AX1A 5A7QA 1KDKA 1U5ZA 4QDRA 2HWB1 4XMIA 4MGTA 2D6LX 2JG8A 3GZEA 4K40A 2WINB 4PLOA 2RR12 1LHVA 3S7IA 3I49A 1SFYA 4S2GA 3NWKA 5IVJA 3IM0A 5FFOC 5FYYA 3PUIA 4M4PA 4YW7A 1QMJA 2EIEA 3O1MA 1XNBA 1W9TA 1SFPA 3K77A 1JBCA 1CIYA 4Y26A 5A3WA 3AMMA 4Y4YA 4AFAA 5GZCA 2KXLA 2XJPA 3KLSA 3K75B 1BBT3 2IC1A 3VL8A 4A3ZA 1UYPA 1N3PA 2VOKA 4FOWA 1RTVA 2VPVA 4IE7A 2NZ9A 5I0DA 1NLSA 1COV1 1H2NA 2WO3A 3RWKX 2NM1A 1CAWA 2I2SA 4C1WA 3TB0A 1RUNA 3SH5A 2DFCA 1QQP3 2RM22 1RUG1 2RMU3 4P5HA 4R9DA 2J7MA 1WCSA 3PU3A 2BBVA 2ZTNA 1J59A 5A7WA 1PK6A 4HPKA 5C6CA 5F37A 4Y1VA 4NIIA 1A3KA 5FZAA 5IK8A 4A6SA 3OBZA 3WX5A 1DGLA 1WCUA 2E63A 3WG3A 1RUH3 1HRI1 4P9IA 1IOAA 2E7QA 4U36A 1OD3A 1RXGA 5FPLA 3IIAA 2C6SA 2QNKA 5GLZA 2JE8A 2QE3A 5FMCA 3USUA 4W6WA 1CAXB 2JG9C 2XH6A 3PUSA 4YVSA 4CDUB 1GUIA 2R1BA 3T30A 1GMMA 1X9TA 1XJAA 2P3IA 5D8AA 1DZRA 1FPN2 2JDZA 5A1AA 4XILA 3ETPA 2EXHA 1GNHA 4LJHA 1W8WA 2FDFA 2Y0OA 3OJBA 4RL7A 3FHIB 1OQEA 3ATGA 1RGSA 2A6WA 1IHMA 2E53A 2JJ6A 4JVAA 4META 4JQRA 1MS0A 4FPJA 3VHOA 4AQ6A 4DY5A 3X29B 4D94A 1ZZ7A 4Q4Y1 3ZVXA 3KS7A 4IEYA 3VBRB 2JIGA 5C3PA 5FYZA 1EP0A 1GWMA 2WS93 1QDCA 2Y6LA 1W6MB 4L0PA 2IXLA 5FO7B 4NPLA 5FUIA 3T0AA 4BMBA 5FQ0A 4K1ZA 3HEIA 1AR92 4HVRA
chains in the Genus database with same CATH topology
3ZXLA 4ZKTB 3FFQA 3R0RA 4Q4W2 2ZCWA 1PZ9A 2H6CA 4QM9A 2DTWA 1Z0HA 3OGJA 4XIOA 3ENRA 4K8FA 2HWD2 2K2SA 2HWE3 4YVSC 3JD71 1CIWA 1V6MA 5ACA2 4Y5Z0 3QACA 4A7YA 2O8QA 3J8F3 3R05A 2SBAA 4RR3A 1LOEA 4QPIC 4LE3A 3CJXA 4LO4B 1BQPA 1XXNA 3WDWA 2VNOA 2VULA 3HD8B 4BYYA 1OD5A 1QQP1 2RMU1 3WP4A 4C0HA 3RJ2X 1WMEA 1QHDA 4C0BA 4QT6A 3SCHA 1WLDA 1OOPB 3MZHA 1RC6A 2NMNA 3SHRA 5CU1A 3SCGA 1PIV1 4QU2A 4XXAA 1Q8VA 4FPHA 2Q4SA 4Q26A 3ZYJB 4JAAA 5KHHA 5JLVA 5FO8B 1W2UA 2FQPA 1FX5A 4Y1XA 3CLPA 4OUSA 4RR3C 3MIGA 3DF0A 1GNZA 2AUYA 4CEYA 2R042 3FMGA 2RS31 1HW5A 2GDFA 1ZRFA 3OBTA 4H7LA 1RMU1 3S6PA 4WBBA 5F5QA 4HT1T 5CFCA 4IV3B 1YWKA 3WDTA 5AC92 4FTBA 4LUMA 3GBGA 4AVTA 1FATA 4H7MA 1DQ2A 4QXKA 4RHV2 1PGW1 2DWRA 3LA2A 3NO8A 3VHNA 4DOUA 2R1DA 2VOVA 4MVTA 2HWE1 4IV1A 1O4YA 5JZGA 4M3CF 2VMIA 2Z69A 2GNMA 4G4FA 5FOBB 3WG2A 5T50A 1VBA3 3RZZA 1ND2B 3GHNA 2VW0A 1Q8SA 4J1XA 3V0BB 4XEZA 1YJKA 4LBLA 1MVQA 1RUI3 3QBQA 4I30A 4NO4A 4OI2A 5CFCC 4Q1PA 3CNAA 2H0BA 4CDUC 3J9SA 4GALA 3TYJA 3VKOA 1O4TA 3L2HA 5JAXA 3MGUA 1YI9A 2PA7A 1PO13 5F6LB 2I07B 3ZSEA 4XQ4A 3BU7A 2B9UA 3RQ0A 1ZBA3 2BYVE 3GNEA 4ES9A 3WLUA 3ME2A 5SV8A 4IV1C 1H8VA 5JZGC 3URFA 4NN0A 1LEMA 1DGWX 4ONUA 2PHFA 1MZFA 4GMP0 3VBOB 1FMD2 5BYNA 3BB6A 4DS0A 2Q30A 2O8OA 2WSVA 1BEV1 1LHOA 4E2GA 2D3RA 4HKWA 3MLKA 1RB8G 1C8M3 1KS5A 1OQDA 4L99A 2DV9A 2Z42A 4GMP3 1EPZA 5JDBA 4CRQA 1A6CA 3ACLA 2EF6A 2R062 4FQZA 1VAVA 1JN2P 1D0GA 2EALA 2XL9A 3RDIA 4GQ7A 1ZX5A 1NE4A 2P34A 3MICA 4ORFA 5BNOA 1W39A 3FLRA 5DUXA 2XHKA 1PO22 5JVVA 2PLV1 3E6CC 1R1A1 2WQZC 1JTZX 2P2KA 2R6QA 1JHNA 2AZ5A 1OOPC 4PQ9A 3D4KA 1IS4A 1J3PA 1C1FA 2WA3A 2XGXA 3VBFA 1VBD2 1AX2A 4FPEA 1X82A 1EPWA 2P17A 3QCWA 2Q8OA 1FOD2 5FLJA 1YUDA 1UU6A 1HV1A 1C8NA 2RHPA 4M0NA 4W6YA 1AR73 1YLLA 1LOBA 1TME3 1CN1A 3D8CA 4OHWA 1PNFA 1ZBE2 1PO11 2GNBA 2K0GA 1ND2A 3GZTB 5DXDA 3ZXEA 4NWVA 1ZBA1 1QH7A 2KA3A 2OIIA 4B4QA 4IV3C 1AXKA 1DYKA 3IBMA 3PHMA 3NVCA 3M3IA 3EO6A 4IEXA 3TN92 4CEWA 2CWMA 1PHMA 4Q4V3 1QWRA 1V6KA 1WMDA 4G3YC 1C8M1 5JIAA 2B46X 4AQSA 2B42B 5KHJA 4YW3A 1YRZA 3GALA 4NHKA 5GZFA 2A3XA 2XKOA 3M3OA 3MPBA 1F5JA 4FP3A 3VBOA 2A3WA 4MGZE 2QZ3A 4XTPA 3AZYA 3KMHA 1ND2C 4MUVA 2UYAA 4LBQA 3THTA 2N7GA 2DCZA 2BFUS 1RUJ3 1MQTB 4R9CA 3U0ZA 1ZZCA 4Q2FA 2GH2A 2X5IB 4I09A 1S55A 3KM5A 4FTEA 3ROUA 3PVNA 4HVOA 4QHBA 2PQQA 2D97A 4UW3A 1AL21 1LRHA 1IS6A 1JYCA 4JTNA 4E9KA 4Z92B 1XNDA 4HKOA 4AHZA 3PNAA 3B00A 3OY8B 4CEWC 2G9GA 4UBGA 2SLIA 2VW1A 1OFSA 4Z2WA 1U0AA 1V9U3 1DQ0A 3AK0A 1RUF3 1BK1A 1VBC2 2JX9A 1AR71 1OA2A 4DQAA 3VN4A 3VBOC 1TME1 1PGL1 3M7AA 4QGMA 4X8NA 2ZHNA 3WDXA 2UYBA 3WT3A 4N7UA 2ZS6B 1HKDA 3B5LB 5GZEA 4LBOA 1CVNA 1PM7A 4ASLA 3B9CA 4B7KA 3VBUB 3VBHB 4MX3A 2W39A 2IFRA 1RL3A 3DKWA 1LOAA 4EN8B 2ET7A 5C4WB 4IXLA 3LA7A 5JR7B 1MZ6A 2DVBA 3UV9A 2XJTA 1FI2A 1ZNPA 3VLBB 4CDXA 2ZKNA 5H9QA 1HQWA 1LU2A 1HIXA 2Y0IA 3SISA 4IEQA 3ASIA 3BTAA 4ZU4A 1ONAA 1U5YA 1PZ8A 1I1EA 3JBG1 3IDCB 4GULA 1AYN3 4P9WA 4YW2A 1QOTA 1POV0 2EVXA 3AZVA 3D0JA 1NXMA 4YFWA 1WBLA 1AR83 5GLTA 3ZIXA 3AYEA 4WVZA 1OA3A 3JQWA 2HEWF 1H9WA 2ERFA 1YYNA 4RGAA 4COUA 1PZ7A 2DUQA 2ZZJA 3S30A 2QDNA 5KHIA 3THPA 3FX3A 4MXWB 1POV3 3ZMNA 4E2QA 1XU2A 4XF0A 3ZXAC 3V56A 3VKMA 1S0FA 3N7MA 1YFWA 1W6QA 2HYKA 3MIBA 4Y22A 4B3NA 2A71A 4HK8A 1QDOA 1HRV3 3NV1A 5A32B 1FV3A 4HZFA 1V9U1 3QH7A 2X5IA 3LAGA 1LODA 1LOFA 1YHFA 4KL1A 3VZKA 1IZ3A 2HEYF 2X53S 1ENQA 4PLNA 3OY8A 4Y1YA 1VB2A 5BUVA 2WIIB 2ZAHA 1LOGA 2PYTA 3KZ4C 1Y7BA 2EIGA 4OHZA 4AI2A 2EXJA 1C5IA 3CO2A 4EROA 2IWGB 3KT7A 4YVWB 2OUJA 3VZOA 5I0TA 5BNPB 1QJU2 3MF9A 5IK5A 2C5DA 3VDDB 5BXXA 3AKRA 4JV4A 3AM2A 1LGCA 4MZUA 4Y1UA 1A8DA 4D7SA 4D3WA 1UKRA 5FPZA 4AEJA 1MQTC 2JICA 2R073 4E4DX 2X5IC 3ECQA 1V6IA 1OFNA 2XB6C 1J3RA 1LOFC 4WVMB 4BWOA 3IPVA 2ES3A 2ZGOA 1EY2A 4MYEA 3WINE 5JOZA 3POSA 5C4WA 2KM2A 1VALA 2PHDA 5K0UB 1E57A 4NWWA 5DDJ3 3AP7A 4FAHA 1RINA 2ZKLA 3M8LA 3NAPB 5EV7A 4XQDA 5L36A 4XOGA 3UJOA 4AG4A 1QJX1 2JXAA 3UK9A 2RS12 1WW4A 1AZDA 2HWC1 1UPSA 3MLJA 1QJY3 5HCBA 2WZR3 1MEC1 2ZACA 1POV1 2QQPA 1DHKB 1Z7S1 1X36A 1LULA 4G9SB 3MYXA 4GKYA 4OI4A 1UN1A 1CD3G 4XJUA 2JG8B 4HFSA 1G9BA 4CDQB 1HRV1 3HT2A 4GA9A 1EAH1 3ZMOA 2NYYA 5LEKA 2LM3A 2ZABA 4GWNA 1AR62 1NQJA 1GQHA 4FPYA 1ZYBA 3DPRA 3FBYA 4Q4X1 4MXWA 2IZWA 5C4WC 4AGRA 3LA3A 4HSLA 1KQRA 3HT1A 1M06G 2B39A 5JIUA 1QU0A 5ABJA 1F8VA 1ENXA 5KWRA 4I3GA 4LHLA 4WVVA 1CAWB 2H0VA 4ITCA 4NR1A 1GZWA 5JOYA 3GZAA 5CFDB 1REDA 1RUE2 4L9BA 2DVDA 1PK6B 4HPKB 4RA0A 2HWF3 4PIYA 4GH4A 2QCSB 5I8YA 5HI0A 1YFUA 3PTYA 2WFF3 3WG1A 1F2NA 5LRRA 3ZYIB 1FXZA 1D4M3 2PAMA 1COV3 5LEJA 4EJRA 3AJZA 3HIFA 2E7AA 4HN1A 2VQAA 4PF5A 3USUB 3UKTA 1H4GA 3MW2A 3WR0A 4K6BA 1VP6A 4XJ8A 5BNPA 4FOYA 1IPKA 2PTMA 3DGTA 5D8AB 1I5ZA 1WCDJ 3VDDA 2MEV2 1HX6A 1HRI3 5DDJ1 1AYM2 1NYWA 2GMEA 1CGPA 4L11A 1N1TA 1SLCA 2CV6A 4FTSA 1SCRA 2V09A 4EN0A 3HN1A 1VBE2 3SH3A 2FMYA 1QJY1 4P9JA 2WZR1 1ASJ2 4XFFA 5I93A 3WW3A 5JCTA 2NN8A 5FQ0B 1SMVA 3WXPA 2K9ZA 1QXJA 1BCXA 2LTNA 1URXA 1GZ9A 4OI1A 1UF2C 1N47A 4JGYA 3GBWA 3G7DA 5E1RA 4EN6B 4RQPA 2B45X 4YVWC 4QMAA 5EXOA 1O3RA 4YM2A 5BNPC 4LLOA 1XU1A 4HN0A 4B4RA 3USSA 3VDDC 1W6NB 4M0HA 3MIFA 3H1MA 1GZCA 3NV3A 4P9XA 3N7JA 4Q0QA 1HQNA 1RUD2 4CDQA 2HWB2 4I2OA 1VR3A 4Y20A 3E5QA 3PMSA 1C28A 5CNAA 1KRIA 3NW4A 3ZYGA 1PVC1 3JD73 4WVWA 4XF1A 4E4SA 1TNRA 4Z1VA 2HWF1 1MS1A 5K0UC 2CGNA 1HXS2 3VZNA 2WFF1 4HMZA 3RPQA 4YNIA 3NAPC 3AP4A 1DF0A 3AB0A 1D4M1 3V0AA 3L9JT 2DVAA 1WW6A 2BPA2 3N35A 4XIKA 2RR11 3W9AA 3E5UA 5GZDA 3I59B 4LBJA 5CFDA 4BLIA 1Q43A 1RUG2 3C2UA 1DYPA 2Q1ZB 4CEYB 3VUOA 2V5YA 1C57A 1WUVA 4FXKB 4MXVA 3ZX7A 2JG8C 1QXRA 1PIV3 2TUNA 3FLPA 4CDQC 5E8AA 1UKGA 1G9CA 4GXLA 4EN9B 5HXVA 3NKGA 2CGOA 5CFCB 2D7FA 5A3MA 1MS4A 2ENRA 1N1SA 1LKNA 3FC0A 3LOIA 4O9EA 4FOVA 2E7TA 3PLQA 2DCJA 2NP0A 4Q27A 3I54A 2VW2A 4QPGB 5C33A 2BWCA 4YW5A 3WUDA 1NCQA 2RS33 4FBFA 5K7PA 1SLTA 1ZZ9A 4QX5A 4FQ4A 2XLGA 4JRLA 2A6YA 4N7IA 2ARXA 4PBPA 3ZFEA 4MGKE 1RMU3 1D0HA 1OLQA 5CFDC 4Q4Y2 4IV1B 2XJSA 5JZGB 1PK6C 3FJSA 2UWCA 4Q8LA 2XLFA 5H9PA 4R9AA 3ES1A 4LHKA 4PLMA 4U2AA 5CADA 4LUKA 4QQPA 4YFZA 3LGRA 1BMV1 1DGRN 2ZMNA 4DY3A 1H1AA 4B7EA 5FDBA 2QUOA 1ND3A 2PN5A 5FAXA 3OGGA 4IEZA 5D8AC 4AHXA 2FHRA 1W6NA 1AR91 2GN3A 3A0NA 2JEMA 2NPIA 2XPJA 5GLUA 1BBT2 1TMF3 4Q4W1 5JSOA 3JCIA 4A7ZA 5J37A 5BPXA 2B8MA 1NZCA 2CGPA 2PHUA 1UPIA 1WD4A 4ATFA 3RWNA 1QQP2 2RMU2 2I74A 1O5LA 5ACA1 3AYAA 1N3OA 4CZSA 1QNYA 3LSDA 4ZXKA 1RUH2 2VVDA 4HBNA 4ISQA 4CYDA 2D6PA 4AFCA 4B4PA 1D2SA 4LBMA 3I59A 4FAGA 2FZ1A 1AUYA 4DPNA 2QKDA 2ZGPA 4Q0SA 4AEDA 1RHI3 4XJAA 2AENA 1R093 2P37A 2ZX4A 3WP5A 2IXIA 2XLAA 1BEV3 2WWSA 1NY71 3OD4A 4M3CA 3H8UA 4JTOA 5BNOB 3HR9A 3WG4A 4FSJA 4UBHA 3EXUA 3W58A 1QNWA 3ZFFA 4YYOA 1SBDA 3J4UH 4Q29A 4AE2A 3VBSA 4XBQA 2NMOA 2WS92 3AX4A 1F31A 4QPGA 3WW4A 3VHRA 1N1YA 3H1WA 4SBVA 1C3HA 1O91A 2R041 1DFQA 2NQYA 4XDQA 4GIQA 2EAAA 3VBFB 2UWAA 4OHXA 3O14A 4H14A 3WVJA 2PLV3 4AGGA 1R1A3 4IEWA 1J1LA 5FREA 1PVXA 2HWE2 3AKSA 4BIFA 1IQAA 4UXAA 1VLNA 3RRDA 2WLPA 2HJIA 4OFGA 1C1LA 3J8F2 4CEYC 1NCRA 5BV6A 5L7OA 4EV0A 1TMF1 4AFDA 4D69A 2AYHA 4N9IA 4RHV1 1O3QA 3WNXA 1LR5A 5KHGA 1CJDA 4LT5A 3NSTA 5LRSA 2R0HA 3H3UA 3B7MA 2DYCA 3GBFA 1F5FA 1WGPA 4UW6A 4QPGC 4B29A 3WY6A 1WD3A 4C91A 4CEWB 1ZZ8A 3D6EA 3B02A 4R4XA 2XBO3 4COZA 4YZ5A 4JDOA 4QM8A 2WJSA 1SEFA 2BFUL 2DCYA 3B93A 4XHXA 3TBDA 3JZVA 3AJYA 1RHI1 1OMIA 4I0BA 1OI6A 2GU9A 5J48A 1R091 3IDEA 1W0PA 3HQXA 1LGBA 4L8QA 4XETA 3U10A 1B09A 5GLVA 4LBQB 4W6XA 3MI8A 1TEIA 5BY5A 3TNPB 4P9LA 2CNAA 3MLLA 1ULFA 1IKPA 4QD2A 3LSEA 3K48A 1B35A 1C4RA 2ZGKA 1XRUA 3PVOA 2A6ZA 4M00A 4YZ3A 3V64A 2OZJA 4NHLA 3M1HA 2JE9A 3CF6E 3H3ZA 2Q0AA 2XUMA 3KCXA 3KCCA 4KNCA 1UIKA 4LBNA 4A7KA 4GB33 4YARA 4A3XA 2QJVA 1AL23 4MH0E 5GM0A 1UX6A 1UZZA 4XFCA 2PHRA 3P3NA 4TSVA 4CTEA 1VBA2 1YO8A 2OYZA 2BNNA 1JYIA