1LOEA

X-ray crystal structure determination and refinement at 1.9 angstroms resolution of isolectin i from the seeds of lathyrus ochrus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
180
structure length
180
Chain Sequence
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEGUME ISOLECTIN I (ALPHA CHAIN)
publication title X-ray crystal structure determination and refinement at 1.9 A resolution of isolectin I from the seeds of Lathyrus ochrus.
pubmed doi rcsb
source organism Lathyrus ochrus
molecule tags Lectin
total genus 26
structure length 180
sequence length 180
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1loeA00
3ILRA 1VALA 4Q1RA 3AX4A 1VIWB 1AZDA 2YY1A 1SBDA 1SLTA 3V64A 1Q8SA 1LHWA 3AJZA 2SLIA 1LGBA 2EALA 4FOVA 2E53A 2EXKA 4WVWA 3IKWA 5JOXA 2NYYA 1G9BA 1F9KA 4SLIA 1DQ2A 2CY6A 3DGTA 3POSA 1B09A 3HN1A 4RA0A 1ULEA 4BMBA 1BKZA 4K20A 1SACA 1FAYA 2PHTA 4WVVA 2EAKA 5T55A 1V6OA 1WW5A 2ARXA 1LHUA 2YROA 3N7MA 1FV2A 1A3KA 4R9DA 4UW5A 3T1MA 4PCRA 5L73A 4YGBA 3INAA 4BPZA 1Z78A 2DUQA 1UL9A 1V6JA 1N3QA 4GKXA 3WDVA 5CA6A 2AGSA 1DZQA 2OUHA 4CRQA 4C1XA 3AZYA 1CVNA 5IK7A 1GKBA 3ZXEA 2UWCA 4P9WA 3C2UA 3SH5A 4DQAA 2DYCA 1KDMA 1V00A 1X50A 2ZZJA 1AJOA 5F5QA 5F9TA 1C1FA 1QDOA 2PHFA 2D6MA 2ZA9A 5E88A 2ZHKA 2ZGSA 5FREA 1DQ0A 3NV2A 4XILA 1AX1A 4FPEA 1PZ9A 4P14A 3WZ1A 2DV9A 1GZCA 5IT6A 3B00A 4K1ZA 1VAMA 3WUCA 5DG1A 3WDWA 4AVSA 2FMDA 3AK0A 2GMMA 1UX6A 3M3EA 3A0KA 2DU0A 3WHTA 2ZBJA 1D0HA 1S0DA 5BYNA 1LOFC 4XBNA 1S0JA 3VKMA 2PHRA 5DUUA 1LODA 5DUVA 3AP4A 4FPFA 1HQLA 4AWDA 3RRDA 2DUOA 5H9RA 3V0BA 2DUPA 1ULFA 4FPYA 4R9AA 1MVQA 2EXJA 3KM5A 4FPKA 5DZEA 1LGCA 2P3IA 1RITA 3BODA 4GWMA 1UZZA 1YRZA 1XQNA 1PZ8A 4YG0A 3U4XA 5EYXA 3LSEA 3IM0A 3L2YA 3WCSA 2ENRA 1JXNA 2ZGMA 1DQ4A 2E6VA 1Q8OA 3W59A 1H9PA 1WLCA 1CN1A 1DQ6A 3WHUA 1W6MA 5IK5A 3ILNA 1AX0A 1BJQA 3AZXA 4XMIA 3ZPYA 5JOWA 1JYIA 4ZXKA 3QLQA 3RQ0A 3MW3A 1DYKA 1V6MA 2D3RA 2ZGNA 5JDBA 3IPVA 4LBJA 4UW3A 3WDTA 1QNWA 2H0BA 3KQRA 2A3XA 3FLRA 5T52A 2AREA 2AH2A 3M3CA 1GNHA 3NV4A 4BLIA 2C5DA 3ATGA 2ZMLA 1CR7A 2GN3A 3M1HA 2PHXA 3PVEA 1WD4A 1FNZA 2VY0A 5T50A 4C1WA 3PMEA 1IS3A 2D6KA 4GWNA 4LBLA 5GM0A 3V65A 3VKLA 1AXZA 3NWKA 5E89A 3SNMA 4YZ1A 1HKDA 1A78A 4LBOA 5GALA 3N36A 4JRAA 3TB0A 3WNXA 2PELA 1W0PA 1G9DA 3H0OA 1J1TA 3SITA 2A6YA 2GALA 2EXHA 2JKBA 2JD4A 1IS5A 2ZAAA 2DTWA 4DRRA 4UW4A 2ZGQA 3BTAA 3V0BB 3UJOA 2D3PA 2WSVA 1ULGA 1CJPA 1W6PA 3ZSMA 2LALA 5JMCA 2WKKA 2R49A 2D3SA 2VW0A 4LBKA 4R9BA 1BXHA 2WLQA 4WV8A 4AYUA 4FP2A 4UW6A 3B3QE 5IUQA 4Z8BA 4YW5A 4ISRA 1O4ZA 3D4KA 2WJSA 2WNEA 4FOYA 2NMNA 3A4UA 3AZVA 4XJUA 1W6QA 1LTEA 2I2SA 1W6MB 4FOQA 3UL2A 1UAIA 1N1SA 4DS0A 1WUVA 4XIKA 1ENQA 3AYAA 2B7YA 2VU9A 1S0EA 4XIOA 1Z0HA 2JECA 4Q2FA 4YZ2A 4XBLA 3O0XA 1LJ7A 1QGLA 1GZWA 2OVUA 3IPVB 1YO8A 1MR5A 3ILFA 3AP6A 3AYDA 1YXWA 3MPPG 4FQZA 3AP5A 4JC1A 1S0FA 3RMYA 5HCFA 3WDYA 1LHNA 4Y22A 1D2SA 4Q26A 2CWMA 3WG3A 2ZGKA 4XJ8A 1S0GA 3FLPA 1GLHA 1JW6A 3RG0A 1AF9A 1V6KA 4ZKTB 3LSDA 2SBAA 1MZ5A 5EXOA 3ZXLA 2ZGOA 1IS6A 1VLNA 4XTMA 2W52A 4IQPA 2ZGRA 1U0AA 4DPNA 1S0IA 1F31A 3JU9A 2NP0A 1G9FA 2ZKNA 1IS4A 1QDCA 3ZXKA 2JJ6A 2VH9A 4ASMB 1JBCA 2VW2A 1QOSA 1SLIA 1CPNA 1NXD1 2FHRA 1DBNA 1Q8PA 3WLUA 1ULCA 2P3JA 4FOWA 1JHNA 3T1LA 1QOOA 1LOCA 4DRVA 4Q27A 5EYYA 1HDKA 5T5JA 1W6PB 1LOAA 1WW7A 2A3WA 3MW4A 1QKQA 3VKNA 2TEPA 5T5PA 1MACA 1WW4A 3WDXA 1SBFA 4YW4A 2PHWA 4Y24A 1F5FA 4LBQA 4YG3A 1LOFA 1ENSA 1LULA 1V6IA 3WCRA 5JLVA 5KXCA 3OJBA 3FBYA 5FRAA 1C4RA 5GZGA 4AGGA 4LBMA 3M3QA 3M3OA 1QF3A 3ZSKA 3TAYA 5CAZA 1W6QB 4TYSA 5DZGA 1C1LA 3SLIA 1UZYA 4NOTA 3HMYA 4YGEA 4YM3A 1FATA 3WDUA 2CL2A 2ZMNA 2A75A 4P9XA 4XDQA 5GZDA 4Y1XA 3WV6A 4WZFA 1GZWB 3W58A 2V73A 2DTYA 4OZXA 2A6WA 4PQ9A 4U2AA 1DHKB 2E7TA 1DFQA 4JCKA 1Q56A 5DZFA 5H9SA 3GALA 4Y1VA 4Y22B 3OBRA 4Y1ZA 1G9AA 2JE7A 4BMEA 1G9CA 2A5ZA 1GSLA 3IMNA 2W39A 1GV9A 1N3PA 3V0AA 4YZ3A 2DVFA 2ZHNA 1CIWA 1G8WA 3RMXA 1ULDA 1WD3A 3OPZA 1AXKA 4AGVA 4YGDA 1HQWA 2D7FA 1URXA 1SCRA 1AX2A 2P2KA 3N35A 3ZVXA 1AXYA 4K1YA 4W65A 1JUIA 1SFYA 3FLTA 2CYFA 2R0FA 3R4UA 2WT1A 3Q9OA 2UWBA 1WBFA 4YM0A 4BQ1A 3BOPA 5GZCA 1DIWA 1DQ5A 2YZ4A 2W68A 2GNDA 2V5YA 1IKQA 1YI7A 2GDFA 2P34A 2ZHMA 4XJWA 5T54A 4CTEA 1MVEA 2DU1A 5GZFA 4YZ4A 3PVOA 4Y20A 5GLVA 3AZZA 3D5OA 1SLCA 2E7QA 4M00A 3WUDA 1LEDA 3VV1A 4ISQA 1LHVA 1ENRA 1MS9A 3WOGA 1QU0A 4LBQB 5GZEA 4F83A 2D6OX 4ATFA 1LENA 4XXPA 1BZWA 4YW3A 3O0VA 5SV8A 1KRIA 3GNEA 3FUOA 1LGNA 3IN9A 4BOWA 3DUIA 5IK8A 5JOYA 5DUXA 1WCSA 4M3CE 4XZPA 1LCLA 2JDZA 5GJ6A 2VXRA 1DYPA 2P3KA 1KJLA 1Q8VA 1W0OA 2GN7A 3I4IA 2OUJA 2R1BA 3VKFC 1I1EA 3UK9A 2ZGTA 4XJ9A 4YFWA 1DQ1A 4M3CA 1MS8A 2JE9A 1OQ1A 3V0AB 2GNMA 1UPSA 1NLSA 4FPGA 5KXDA 2VW1A 1G7YA 2D6LX 4GALA 2WQZC 1JN2P 1N1TA 4YLZA 1W6OA 4PBOA 3CNAA 4XXAA 4Y1YA 5DUWA 3ENRA 1O4YA 2XB6C 1AVBA 2CTVA 3ZYRA 5GLZA 1QNYA 2DURA 3JUUA 2UWAA 1CESA 4YM2A 5CB7A 3OY8A 3FUQA 1YYNA 3AFKA 3N7LA 3WG1A 2EXIA 1LESA 1C57A 1CQ9A 2HYKA 5IK4A 1IKPA 4Y20B 1WW6A 3POWA 5CBLA 1MS0A 2GMPA 4R9CA 5EWSA 4AVTA 3PJQA 4TZDA 4GA9A 3USUA 2WT2A 4GKYA 1DGLA 5LK5A 1UKGA 3AP7A 1FV3A 1LOEA 1W6NA 2RHPA 1QOTA 1N47A 1MZ6A 4AGRA 1SBEA 5JVVA 3MEPA 4M01A 1WBLA 5H9PA 2Z42A 3D6EA 4ITCA 4XTPA 3WVJA 3HR9A 3A0NA 4PF5A 4Y26A 2NN8A 5GLWA 1RINA 1RIRA 2D43A 1JOJA 1N3OA 2UURA 3FFZA 4K21A 1CPMA 1GYKA 2R1DA 2ZABA 4YW2A 2CWSA 1SLLA 4M3CF 4FPHA 4BM8A 2GNBA 2UU8A 3OYWA 2R16A 1R1ZA 1Q8QA 2E51A 2XG3A 4FQ4A 4Y1UA 4YG6A 3SH4A 1GBGA 2ZGLA 1YIFA 4XMAA 3OGGA 2A71A 3M2MA 5KXEA 4FPLA 4M3CB 3RS6A 1FYUA 5HCAA 1DLLA 2G4IA 2AR6A 2ZMKA 4LBQD 1ZA4A 3AYEA 1ONAA 3ZYPA 4PBPA 1IOAA 2YMZA 2A7AA 2GNTA 4XYXA 2D6NA 4KBBA 4D69A 1W6OB 1SCSA 3OBTA 4RL7A 4Q8KA 3WG4A 3SH3A 1N1VA 1MS5A 2R0HA 5GLUA 1SLBA 1FX5A 2ZACA 3AP9A 4XE9A 4FPJA 3ASIA 3QCWA 3SISA 2ERFA 3OY8B 4FPOB 2WT0A 4L8QA 1BQPA 1GNZA 3O12A 1G86A 5DG2A 2DVDA 1WLWA 4XBQA 1MS3A 1KDKA 3N3HA 3N7KA 3ZXJA 3USUB 3B01A 3ZSLA 3ZXFA 4P9YA 2D44A 4Q8LA 4FP3A 1LU1A 1W6NB 2EF6A 2NZ9A 4ATEA 3N7JA 5JOZA 1S0BA 1AJKA 1KITA 3R05A 1EPWA 4FPCA 1N1YA 2DVBA 5T5OA 1Y7BA 3O0WA 4DFSA 2YV8A 3AXEA 1H9WA 4CZSA 2DVAA 1I3HA 2AUYA 2EIGA 3AXDA 1UMZA 3MW2A 2CNAA 2NM1A 3I8TA 2P37A 4XHXA 4YGCA 2A6ZA 1APNA 3OYWB 1LU2A 4FVVA 4I30A 1BYHA 3T2TA 5KXBA 2ES3A 2WSUA 1KQRA 2AYHA 2ZGPA 2DVGA 2BQPA 2Q5TA 2ARBA 4NO4A 4H55A 4YM1A 3BIWE 4GXLA 3B69A 2VUAA 5CNAA 1GZ9A 5T5LA 1GANA 1ZM1A 2DWRA 3WG2A 1LHOA 3NV3A 5HCBA 3UJQA 1H30A 1JYCA 1V6NA 2PHUA 1PZ7A 2ZGUA 4XOGA 1FNYA 3AZWA 3VUOA 1QMJA 1S1AA 1CONA 4Q1PA 1VAVA 4U36A 2AENA 4HL0A 1MS4A 5H9QA 4YFZA 1LECA 2W08A 1LOBA 2A6VA 3NV1A 4XJZA 3O5SA 4YZ5A 4MYEA 4HANA 2OW4A 2LTNA 3RSJA 4LBNA 3POYA 4XHBA 1TEIA 2D6PA 3AYCA 1SLAA 1UN1A 2C9AA 2A70A 3LCPA 2ZHLA 1LOGA 5DXDA 5E8AA 3APBA 1LEMA 5GLTA 1OKQA 2A3YA 2GMEA 4BLJA 2A6XA 1WLDA 1MS1A 3PVNA 1S0CA 3ZSJA 3R4SA 4YW1A 2KM2A 4XJAA 1V6LA 3B9CA 2YXSA 5AVAA 1GICA 3AJYA 1OFSA 2NMOA 1A8DA 1KJRA 4AVVA 3VKOA 1HLCA
chains in the Genus database with same CATH superfamily
1QJU3 4KU8A 3KGLA 1VALA 4Q1RA 4UFIA 3I97A 3WR0A 2WO2A 4QX0A 4AEMA 2C6SA 3PDQA 5FYZA 4XAAA 4G4FA 4L97A 2EALA 5JR7B 1I5ZA 2EXKA 4JGZB 5FUIA 5JOXA 3LIGA 5JXJA 2IXKA 2RS12 3OGJA 4MGIE 4NHYA 1B09A 4URTA 3ZYHA 4K8FA 1BKZA 2IZWA 4ZZ8A 1SACA 2GZWA 4WVVA 1BK1A 5FKCA 4UBGA 1QXJA 3N7MA 5AC91 4AI0A 4CP2A 3T1MA 1QJX3 1O59A 4AQ2A 1OD5A 4XUNA 3VD9A 3NMBA 5A3LA 1Z7S1 4TLFA 1PGW1 1UL9A 1AUYA 1JOBA 3I3BA 2AGSA 4ZHNA 2RG4A 3WNMA 2D98A 3H8UA 2IXJA 1CVNA 2BUKA 4MGYE 5HV0A 1UYXA 2Y33A 4HK8A 4ZY9A 3SH5A 1U12A 2CGPA 2ZZJA 1AJOA 1NUKA 2TUNA 1GWKA 3OEAA 4HXCA 3AVRA 1XPWA 2ZHKA 2ZKLA 5KHIA 4HSJA 2JKXA 5C4WC 1DQ0A 3FMGA 4D94A 4HKLA 1R082 1AX1A 4GH4C 1CZVA 1PZ9A 4A41A 1K5MB 5ABJB 3VBUA 1VBA1 3B00A 5IT6A 2VMFA 3WDWA 1PVC2 3CIHA 2D97A 3N9QA 1BMV2 5FY0A 3M3EA 4MO3M 4AQ6A 1NYWA 3H7JA 3LQCA 4DY3A 3O1OA 5C8CC 4DO0A 2V09A 4ASLA 3AP4A 3CLPA 3JD72 5F5AA 3VBOC 3HWJA 3OUHA 4QU1A 1UU6A 2DUOA 2W9XA 4IV1C 4RSUA 4DINB 1F35A 2JDUA 3VBHA 3RYPA 2RMU2 4OVEA 4FPKA 2MNGA 5JSPA 3O1PA 2P3IA 1VBD3 2R041 3H8XA 3U4XA 3AMPA 4QPGA 2R30A 1PZ8A 2DBNA 3J7NA 5EYXA 3BI3A 4MGTA 3WCSA 4N53C 4NAMA 2BGOA 2ENRA 4HONA 4NE9A 2R063 2PFWA 1WLCA 1W90A 2CHHA 3S6PA 1BJQA 3ZPYA 5FQ0A 3MW3A 1V6MA 2ZGNA 2D3RA 1W8TA 2XKPA 5EQUA 5C3SA 5JDBA 3UNPA 5CKNA 2H0BA 2VMEA 3VN4A 1ODNA 4CEYA 1H4HA 2VZUA 1W2NA 5FR3A 3FLRA 1BEV2 1FOD1 1ODMA 5B4XA 5T52A 1RUE2 4YARA 1NCQA 5FJHA 5A3MA 5F39A 3NV4A 4O61A 1POV1 4LLFA 2GN3A 3M1HA 2PHXA 3M3IA 1WD4A 1FNZA 1I6XA 5T50A 4C1WA 5JSRA 3WW1A 4QD2A 3VLBB 1UYZA 3OBAA 4BQ2A 2GH8A 1H8TC 3IIIA 4YZ1A 4ZXEA 3VBUB 3ZYFA 1A78A 5E6HA 3POEA 3C7HA 4GJZA 4LBOA 3N36A 3WNXA 5FPXA 2JE8A 5F3CA 1W8HA 1W0PA 4B7EA 2F6BA 4P5YA 1VBB3 2GALA 2XBO1 3EBRA 2JKBA 4KGQA 2ZAAA 4QHOA 3U78A 2YBKA 2ZGQA 1EV12 2ET1A 3U07A 4JV4A 4CE8A 2D3PA 2D5FA 4W6YA 1EYBA 1CJPA 2YU1A 4XEZA 3FFQA 3AC0A 3KD4A 2LALA 3ELNA 4HLTA 4RHV1 3VBHB 4BCUA 4LBKA 1REFA 2VBDA 1HJGA 4QPGB 4YW5A 5FZ7A 3RJRA 3CKHA 1EUUA 2N7GA 1C5HA 2WJSA 3C8XA 4FAHA 4FOYA 2WLPA 4BE3A 2PLV2 3N9NA 5A3PA 4CEWC 1C8M3 3C3VA 1W6QA 1LTEA 1H1MA 2AEZA 3CZJA 2JIGA 3UL2A 5FQ0B 1WUVA 1XSQA 1ENQA 2B7YA 4NUBA 4CCDA 1UOJA 4Q2FA 3GDBA 3LWCA 2IWGB 3O0XA 4XBLA 4A3XA 4I2OA 5BNPC 1YO8A 5BUVA 3J8F3 4W6WA 3ILFA 3AP6A 3AYDA 2XONA 4CEYB 4FQZA 5JIUA 1S0FA 2XKOA 3HBZA 4Y22A 4RGKA 2CGOA 3WD5A 5FLHA 4EN7B 2HWF2 4IDZA 3WG3A 2F17A 3B02A 2VUJA 1NCQB 2ZGKA 3JBG1 4PLMA 3VZOA 1JYWA 1S0GA 1GR3A 2YYOA 5F37A 3E5XA 3I2KA 3RG0A 4I01A 4LKFA 1V6KA 2WRAA 1JOPA 2SBAA 3LSDA 5EXOA 1IS6A 2VPVA 4JHZA 4XTMA 3I2OA 5LASA 3FL7A 2R072 1R1A3 3VDAA 3VZLA 1U0AA 1RUF3 4DPNA 2IUWA 4LQRA 1OHFA 1F31A 3JU9A 1RUH3 4ASMB 4HETA 2JJ6A 4HN0A 4IE6A 5LA2A 1JBCA 1OA4A 2VW2A 1X9PA 4QWNA 3CO2A 4EN8B 2FHRA 1T2XA 1DGRN 2P3JA 3T1LA 1JHNA 5FFOC 3SEPA 4X8NA 1QOOA 4GIQA 4GH4A 1LOCA 4DRVA 1I9RA 5CYYA 3HOBA 3ES4A 5LBCA 3KHBA 3WP6A 1WW7A 2A3WA 3MW4A 3VKNA 4META 5IVBA 2F4PA 1O4TA 1UCXA 2VOXA 1FXZA 4QM8A 4Y24A 5EV7A 5CADA 1F5FA 1QHDA 3A23A 4YG3A 1ENSA 3N9OA 4X8PA 5ACA3 4LXLA 5KXCA 4N7IA 1TME3 2RS52 5FRAA 5JI7A 1C4RA 4UXAA 4LBMA 5FPUA 3M3OA 2W0XA 4INDA 4DIQA 3OUJA 3J7HA 1W6QB 5DZGA 2WZR2 4B8EA 4YGEA 4P9XA 3GYDA 1UY0A 2RDSA 2YC2A 2W3JA 1GMMA 1W8NA 3TNPB 2NLRA 3AMHA 3CL1A 2V73A 2DTYA 2A6WA 2IVJA 4QDQA 3ZSEA 4JCKA 1QH6A 1QH7A 2X05A 4W4ZA 4Y1VA 2W47A 4Y22B 5F32A 4COVA 1ND3C 3T08A 2G1MA 1G9AA 4BMEA 1H2KA 2R061 2ARAA 4S2GA 1S2EA 1G6NA 3IMNA 1YQ2A 4AEJA 1XYNA 3CJIC 3EHKA 4YZ3A 2RM23 2ZHNA 4AZZA 5FZ3A 4AG4A 2D40A 1VBC1 5HBAA 1HQWA 4NWVA 3LDKA 2YB7A 3KZ4C 1AX2A 3N35A 4W65A 3BPSA 2LM3A 2QQNA 1JUIA 2XQXA 4BU2A 5C9AC 3R4UA 2WT1A 3TRSB 2UWBA 5GZCA 4YM0A 2VCCA 3GCWA 2Z4FA 4NRPA 1ZBE3 4P02B 5LY1A 5DAQA 2GNDA 4XURA 1IKQA 4GJYA 3VBRA 1QJU2 3LE0A 3Q8BA 4GH4B 4KWJA 4YZ4A 1OF4A 2BW8A 4CDUA 2V5DA 4Y20A 5K7PA 1SLCA 1CX4A 4M00A 2GSYA 2HJIA 2CAUA 5E16A 5FXZA 1ULOA 1KFXL 2D6OX 2JDKA 3OD4A 2OYZA 4YW3A 4WM8A 1L3JA 1KXGA 3B5LB 3FUOA 1YFXA 4E8CA 4JRLA 4SBVA 1QJX2 5CKMA 5IK8A 4KWKA 3S30A 1AR93 2XJUA 4MGSA 4DEVA 2VOWA 2WZPP 2JEMA 4KG0A 4XZPA 1LCLA 2ETEA 2JDZA 1WCUA 3R4DB 4E8DA 4GZ9A 5DDJ3 3LKJA 4FFIA 5FZ6A 1ZZ9A 4I3PA 2P3KA 4BYYA 4CEWA 1KFUL 1ND2A 1Q8VA 3BKZA 2QQMA 3PIJA 3DN7A 5FV3A 1W9TA 1SFPA 2ZGTA 2XJRA 4XJ9A 5B4NA 4JTNA 1DQ1A 4M3CA 4P9IA 1OQ1A 3P5BA 4PIYA 1J84A 3BOWA 4D6RA 1U5ZA 1W9SA 1EY2A 1UYYA 1L7RA 4GALA 1DYOA 4UF0A 4OUSA 1N1TA 1UZVA 1PM7A 2BOIA 3J8F1 3RWKX 3MV01 1XE8A 3ENRA 4W8JA 5DAXA 5D21A 3ZYRA 1IPKA 1RUOA 2ZJCA 3ZKUA 1R092 3OY8A 3QOPA 2EAAA 3WG1A 3VBRB 1R64A 1C57A 3ZIWA 2ZX0A 1C5IA 2W92A 4CDUB 5IK4A 4Y20B 4O7XA 3PVBB 5L7OA 2BU9A 1FPN3 2GMPA 5EWSA 1VBD2 2WT2A 2C24A 1NCRC 3LEIA 4GKYA 4XETA 4B3NA 2VC9A 3ST7A 1LOEA 2WWSA 2ADDA 4LJHA 1W6NA 2KA3A 2PHLA 4WM8B 1MZ6A 2VNGA 3TOJA 4YWAA 2IXCA 1WBLA 5H9PA 2OS2A 4ITCA 5CFDC 1JZ7A 5JSOA 4AEDC 4FAGA 3HR9A 3THPA 2Q1MA 4Q0UA 4CDWC 1U5XA 4Y26A 2NN8A 2RJ2A 4IEOA 1RINA 1JOJA 3R0RA 4HVRA 4K21A 3OOXA 2R1DA 2ZABA 4Q4W3 1RHI3 4B4RA 3B9IA 2WFF1 1SLLA 1W04A 4CEWB 4IGOA 4LHNA 5ACA1 1ND2B 2Z2SB 2WNVA 4FXGB 1R1ZA 1TME1 5HV4A 4Y1UA 2HWB3 5JZGC 2A71A 3ACIA 5KXEA 3GF6A 4LA3A 4M3CB 2Y6KA 1FYUA 4QHBA 4A42A 5LZ6A 2G4IA 4HT1T 1CIYA 4BQ5A 1ZA4A 2J1VA 3PU3A 3WF3A 5FPAA 3FHIB 1IOAA 4LO4B 2E26A 4M0HA 4UF0B 3SKJE 2GNTA 4HMZA 3URFA 4KBBA 1ND3A 3ZM8A 2JDAA 1SCSA 2WZ8A 3MIFA 4RL7A 2C4XA 4Q8KA 3JZVA 3WG4A 4OHXA 3BVCA 2GU9A 1SLBA 2QCSB 1FX5A 3AP9A 1HRV3 4R4XA 3HNBM 4MXVA 4TWTA 1VBB2 4FPJA 3ASIA 5F2SA 1LAJA 2WYSA 3SISA 4A7KA 3OY8B 4FPOB 4C90A 4DXRA 4N9HA 2WT0A 4JTOA 1LR5A 5DG2A 1G86A 5LBFA 5L7OB 2DVDA 4B7KA 5LEKA 2J1TA 2VL4A 3M8LA 4CU6A 1OFNA 4P9YA 4CYDA 4QGLA 2E63A 4RQPC 1LU1A 4OHWA 1Q3EA 1XRUA 1J58A 1W6NB 2EF6A 2Q1FA 4JHTA 4UOJA 4XW3A 3WNNA 3N7JA 4MXWA 2B8MA 3VD5A 2JB8A 4WZCA 5JOZA 1AJKA 2A1XA 1C8M2 4MHUA 3IZOA 4PI0A 3IDBB 3O0WA 4Q0PA 3AMNA 2YV8A 2VZ3A 3AXEA 2W1SA 1M06G 4MHRA 2EIGA 1PX4A 5G04L 1UY3A 2HH9A 4CCCA 3U37A 4MADA 4YGCA 3J8F2 5FKBA 2XPJA 1HB3A 1APNA 4RS5C 2WNVB 1LU2A 3LOIA 4FVVA 4IEVA 3UGHA 2ES3A 5K8SA 4EYUA 2MEV1 5C33A 3UGFA 1IGOA 5EIYB 4CPBD 4BA6A 3AMMA 4ZU7A 1QIQA 1UMHA 2DWRA 2RV9A 1ZNPA 5K4LA 4AFAA 2ZX1A 3NSTA 1VR3A 1H30A 1V6NA 1VE0A 2J1EA 3ZKYA 3Q8EA 1HX6A 1R1A2 3AZWA 3KLSA 1RUF2 2I07B 5A3OA 1ND3B 2VBPA 4AL9A 1RUH2 1WCQA 4XF1A 1V9U3 4U36A 2AENA 3OCPA 4OYUA 1YI9A 1OH3A 5H9QA 2H6CA 3U11A 5FWJA 2YC4A 2A6VA 3NKTA 4YZ5A 5EHDA 1E5IA 3POGA 5LATA 2OW4A 1YFYA 3ZOIA 4KQ7A 1TEIA 1VPHA 5FYMA 1SLAA 2BNOA 2BTVC 2CDPA 3MLKA 1W2OA 4QXHA 4OCTA 4AF9A 5EJZB 5KC6A 4JQRA 3VBSC 2A3YA 4BQ3A 1QJY3 4ZZ5A 5FZ0A 5IVFA 3PTRB 3H7YA 3MYXA 5FYCA 3BN6A 5A6ZA 2HYXA 1S55A 1X9TA 2WN3A 4IUGA 3C7GA 4KH9A 5I8TA 3AKPA 1DZTA 4UAPA 4MXWB 2VAUA 3NNLA 4BQ4A 3GJBA 3I2DA 3TYJA 4ES9A 5JXGA 4DUXA 1JZ8A 3VZKA 3LFIA 2OPKA 5DAPA 3WT3A 2X29A 4LTAA 1Q43A 3DKQA 5FMOL 1RUG1 1AYN1 4YVSA 5LBEA 1NXMA 4OMDA 2JB4A 3I2GA 1LHWA 2SLIA 3ES1A 1CAWA 5FUPA 2LROA 3WF1A 4SLIA 1VRBA 4AEDA 1OPOA 3POSA 4RA0A 3HN1A 3O1TA 1ULEA 2WZEA 1BCXA 3SXWA 2PHTA 3AL6A 1TG7A 1ZBA1 2BV4A 1WW5A 2ARXA 2YHJA 4IEPA 5T55A 1LHUA 1JODA 2RM22 3ZYIB 4UW5A 4R52A 1V0AA 2WWJA 4YGBA 3INAA 4BPZA 1OUXA 2QKDA 5FK7A 1Z78A 1Z7S3 2B46X 1IHMA 3AFGA 3NJYA 4GKXA 4IL7A 1RHI1 1DZQA 2OUHA 1W8FA 5A3NA 5CU1A 3THCA 5HXMA 2HWB1 1GKBA 2UWCA 1GOFA 3MV11 1ZBE2 5GKAC 3T2OA 3WW3A 4AVCA 4A4AA 1XJAA 3FE5A 1X50A 3WX5A 1VB4A 4UFKA 1SPPA 1POQA 2WL1A 2PHFA 4ARXA 1HRI2 2ZA9A 2RS31 5I93A 4L0PA 1QXPA 4B4QA 3OTFA 1XYPA 4Y4RA 2D93A 2G19A 1HB2A 3NV2A 4XILA 5FMDA 5HXVA 3GM8A 3WSOA 4K3UA 4LUMA 1VBA3 1GZCA 4K1ZA 2ORXA 5A7SA 5FYUA 2XXZA 1VMHA 5DAVA 4AVSA 1HRV1 3AK0A 3NNGA 1UX6A 2QZ3A 2B45X 2X10A 1D0HA 1GQGA 5BYNA 4LHLA 4XBNA 1S0JA 1LODA 4FPFA 1HQLA 2G9GA 5FIXA 3MGUA 4N90A 1AR92 4UFMA 5CIRA 4YVSB 5H9RA 4EJRA 3NAPC 1ULFA 2E9QA 4FPYA 1MVQA 1NA1C 2K9ZA 2EXJA 5DDJ2 5FZLA 1CAXA 1QJEA 1W05A 1CAWB 1LGCA 2R043 3BODA 1YRZA 1W03A 1XQNA 4RGAA 1NE6A 3LSEA 4NPRA 3ZR6A 1UU4A 2XJQA 4AEDB 1OC1A 1JXNA 2ZGMA 5DMYA 1CX1A 5L36A 1Q8OA 2UY9A 4JKMA 4WM7C 1S4CA 1CN1A 1O6UA 4JGYC 3H3UA 5LB6A 5J48A 4OUMA 5IK5A 4IEZA 4EV0A 2X5IA 5JOWA 4I3GA 4ZXKA 4Y4YA 3RQ0A 1TNFA 4JQTA 2XGXA 1PK6C 1PGSA 1QNWA 3WDTA 3BGAA 3NNMA 4TTGA 3N9MA 3T3YA 4UI9L 4QXBA 1FOD3 3L9JT 4L11A 4NRQA 5FJKA 1ZRIA 1SPPB 1POV3 4BLIA 3ATGA 1PGL1 2ZMLA 1CR7A 4B1LA 5L9RA 5F3IA 1FPN2 4GWNA 4IV3A 1UX7A 5GM0A 5BPXA 1AXZA 4LO8A 1OVSA 4IEXA 3HQUA 4D7TA 3K3OA 3T2PA 3T09A 3TB0A 5FZOA 1G9DA 1YC61 3B94A 3H0OA 1J1TA 4MOAA 4QMAA 3SHRA 3W9AA 3VDBA 2O8OA 4MZUA 5HI0A 4DRRA 4WVMA 2Y26A 3FZ3A 1EAH1 2FDKA 2WSVA 3VB9A 1RTVA 5A3UA 1W6PA 3WEZA 3OB8A 4RHV3 4Q4W2 3GBFA 2R49A 2VW0A 1CAXB 4WV8A 2EIDA 2WLQA 1QJY1 3KMHA 4LKDA 3EYPA 5FOJB 3ACLA 5IUQA 5C8WA 4IXLA 1BLZA 3D4KA 1QEXA 4BHPA 2V72A 5EJ1B 4RD7A 2YBPA 1IQAA 3KVBA 3PU8A 5FMCA 1OH4A 1UKRA 3ABZA 3WQ1A 2WYFA 5A7WA 4LORA 3A4UA 1QXRA 4B29A 4FOQA 1PVXA 5C70A 5DAWA 4DS0A 3DV8A 2Y38A 2X5IB 1NAEA 4PLNA 3BYWA 4XF0A 1Z0HA 2JECA 4YZ2A 2AZ5A 2OVUA 3RDIA 1MR5A 2K2SA 4XQDA 5IAVA 4FTSA 5IVVA 1HRV2 1ST8A 1TMF1 5HCFA 1GNYA 1AR73 5JPMB 3JBG3 1D7PM 3OPTA 4IE4A 1WCKA 1UNBA 5FBJA 1XE7A 1VB2A 2GH2A 4ZKTB 3ZXLA 1MZ5A 2JG8A 2ZGOA 5CISA 3IT8A 3ZYJB 2W52A 4IQPA 1D4M2 4IV3B 4BQWA 4EE2A 2HWE3 1S0IA 3HAGA 2NP0A 2VMGA 2DF7A 3KF3A 5ISLA 1QDCA 1UY4A 2CV6A 3ZXKA 3A7QA 5FZOB 4OUEA 2O1QA 1NQJA 2X09A 1CPNA 1NXD1 1W8UA 5KR7A 1A8MA 3ZFGC 2WNUC 1DGRA 1RJ7A 4Q4V1 4WVMB 3VBSB 3IDAA 2YGMA 3FJSA 1OBNA 4N43A 1HDKA 4IESA 1W6PB 3D0SA 5DABA 5FMOS 2BGPA 3WNOA 2FQPA 3WDXA 1D2QA 2X8KA 2RDQA 4E4SA 1SBFA 4YW4A 2PHWA 3NKGA 1CJDA 4QAWA 5DN2A 1HN0A 1LULA 1UOGA 5KHGA 4CDXC 3OJBA 3FBYA 2JDNA 1Y43B 2YPDA 5CVRA 4CUBA 3HBKA 2XLGA 3HN3A 3M3QA 4AGGA 1LNSA 1XOYA 3OSDA 5A7WB 5GZGA 1ENXA 5CAZA 4TYSA 2QE3A 3MIBA 2XOMA 1ZRCA 3AKRA 3H9AA 2CL2A 2XVKA 2A75A 2ZMNA 5GZDA 1PO23 4BK5A 3RZZA 1W0NA 5CFCC 1CZTA 4WZFA 2ZEWA 4OZXA 1V9U2 3ZN6A 4CU8A 3UGGA 1DFQA 1VBE3 1Q56A 3GALA 2OPWA 3DF0A 3FHQA 3OBRA 4MSVA 3VHNA 3POIA 4D3WA 4QB1A 4AAXA 1G9CA 2A5ZA 1GSLA 3O1VA 2WDBA 3ZPOA 2XR4A 2DVFA 3WQ7A 2JG9C 1PK6A 1VBC3 3LA2A 1G8WA 4AHZA 2JG8B 4JDOA 3OPZA 1AXKA 1O3TA 2BDRA 1BBT1 2VOKA 3U10A 1URXA 3S0MA 4NPLA 1GZTA 5FY7A 2P2KA 2WBKA 1AXYA 2BYVE 5IYYA 2L9LA 2Y0IA 3FLTA 2CYFA 4E2QA 1F4HA 1UQXA 2QTWB 1DIWA 3OEBA 1FMD3 1UW8A 4BXSV 1PO12 2ZHMA 1RC6A 1YI7A 2P34A 4NN0A 4DXZA 1MEC3 3C7FA 1UY1A 1MVEA 4QT6A 2BZDA 3PVOA 2Y6GA 4N43B 3VD3A 2ZX4A 2Q0AA 2VCMA 4JX0A 4LKSA 4PQQA 3WUDA 1E57A 1LEDA 3VV1A 4TLGA 4AFCA 4AVBA 5DPNA 1QU0A 3IDEA 1GU3A 4F83A 2CDOA 3I2IA 3DL3A 4XXPA 3CHXA 3X29B 4PHZA 4AI3A 4IETA 4D6QA 3O0VA 2BWAA 1OQDA 4AE2A 1KRIA 1U5IA 1XNAA 4QQOA 1AHSA 2BWCA 5AC92 4Y5Z0 4E27A 1WGPA 3ZX7A 4P08A 4QQ2A 1Z7S2 1PGW2 5E1RA 3KF5A 2QQPA 5IVEA 4IGQA 5GJ6A 4BK4A 5A7PA 4XFBA 4CUCA 5BNNC 3H8RA 4P9LA 4PIZA 5EP9A 1WKYA 1DYPA 1FI2A 3I3MA 3RPQA 3ZN6B 2FDGA 3WF2A 5FCCA 1W0OA 2GN7A 4LNVA 4JAAA 1REDA 3LDRA 1KS4A 3VKFC 2P6HA 2VNVA 2WFPA 4MGKE 1GWLA 1DZRA 3HPNA 1MS8A 4BISA 2VZRA 1OKOA 1PK6B 5KXDA 3PUAA 1O5UA 1OF3A 2YUEA 2PXJA 1UOBA 5A7QA 2WQZC 1JN2P 5L9VA 3BUCA 5A6QA 2D5HA 2GP3A 3CNAA 1VBA2 4Y1YA 2VNOA 1F5JA 5DUWA 4AR2A 1E5RA 1CZSA 4GMP1 5GLZA 3K4AA 1AR71 2UWAA 4IE7A 3EB7A 4CUAA 2OZJA 2XDVA 5FZEA 2Z79A 2GP5A 4LO6B 1AYM1 1ULPA 1BVVA 3FUQA 4HG6B 2EXIA 3MF9A 4P5HA 4L99A 3WQBA 4PI2A 1IKPA 1AR83 1JUHA 4EQVA 4KL1A 4QQHA 4TXWA 1WW6A 3H50A 1MS0A 3VD7A 2WAOA 1UD1A 4R9CA 4AVTA 2HWE1 4GA9A 2R042 3USUA 4UYBA 1F2NA 2VM9A 3HVDA 4XDPA 5FZHA 1O3SA 2OXBA 2WNUA 4K40A 3ZFGA 3H1MA 1N47A 5IATA 4AGRA 3KV5A 1J3QA 2VMDA 3TNQA 1WMDA 3CDZB 2JIJA 2Z42A 5C4WA 2WINB 2VZSA 1XB9A 4CCNA 2W1UA 3W5NA 3A0NA 4N7UA 1RUD3 3MLLA 4YW7A 4DY5A 5GLWA 3TEYA 4RYDA 3T0AA 1O3RA 4CDXA 3DECA 1CPMA 1GYKA 5FYIA 4EWAA 2WFF3 5C8CA 3TWIA 4UT5A 1PHMA 4BM8A 2GNBA 4OLLA 2TNFA 3VBOA 1FOD2 1Q8QA 1JZ5A 4QKFA 2ORZA 4IV1A 4Q0SA 1UIKA 2ZMKA 3SCHA 4KG8A 3WP4A 5FZAA 2WA3A 4J1XA 5FY8A 2YMZA 2VVDA 2K0GA 1PO21 4B4PA 3S5AA 3U14A 2UYAA 3UKVA 1OLQA 2VMHA 4N53A 2D6NA 4J1WA 5J36A 1JTZX 4D6SA 2NPIA 3WNPA 1VBE1 1N1VA 5GLUA 4O9EA 5LK7B 3N9LA 2JG9A 4XE9A 1AL0G 2VQUA 2XBO2 3JCIA 1NY71 3IIAA 5AVPA 3KSCA 1REEA 1CGPA 4HKOA 5IJRA 3LEKA 4ARYA 4HPKA 1RJ8A 4Y3OA 1WLWA 4GQ7A 4RHV2 3ZFFC 4BDVB 4XBQA 1IQDC 1KDKA 1MS3A 2VOTA 3N7KA 5ANQA 1H0BA 3B01A 3USUB 4XUTA 1X8MA 1AR61 3ZFGB 1CAUA 2WNUB 4MX3A 1JYXA 2NZ9A 1UZWA 1Y9QA 1FMD1 1KS5A 1S0BA 3DYMA 4AFDA 1O91A 3RI9A 4FPCA 2QUOA 2YPJA 2I74A 5C4WB 1MEC1 1OI6A 3LB9A 1WA6X 1H8TA 2Y6JA 3HNMA 1H2LA 1VJ2A 1HV0A 1I3HA 1POV0 2DVAA 2VD7A 3JQXA 5AFBA 1OURA 2GC3A 2VTXA 3O1SA 5J09A 3O1UA 2CNAA 2NM1A 4CDXB 2P37A 1QY4A 3S5QA 2I45A 3KGZA 1ASJ1 1RUI3 5FBZA 2OIIA 5C8CB 4JDNA 4TN7A 3KV9A 4I30A 4XFHA 3VBOB 1KQRA 1AR72 2ZGPA 2MEV3 3JBG2 4IV1B 4OHZA 5FDBA 4NO4A 1X36A 1ZYBA 1O8SA 3BIWE 4GXLA 4LIVA 3B69A 4LHKA 5IVCA 5T5LA 1GANA 3WG2A 4ZONA 5HCBA 4L92A 2ZPXA 4Q0QA 3P3NA 1L7LA 2ADEA 5I0DA 4XF3A 1FNYA 4N53B 4XOGA 5HCHA 1RB8G 2QFEA 1QMJA 1VRH1 2ZOEB 5JXHA 1S1AA 2ID4A 3BTYA 1YQ5A 1C3HA 4QB6A 1WMEA 4QB2A 2JG9B 2QQJA 1OLME 4DXTA 4DZGA 4A44A 1LOBA 4XJZA 2JX9A 5IHRA 3M4FA 4MYEA 2VMIA 4FTBA 2XMLA 4FXKB 3LEMA 3I3DA 4LBNA 5BNPA 5D8AC 3O1MA 3RZMA 1UXXX 3OF1A 4HPKB 1F4AA 1UN1A 2C9AA 3RNSA 4DEQA 5F1RA 1JU3A 3DEMA 1UO9A 1M4WA 1OKQA 2GMEA 5F6LB 4BLJA 4OI4A 1WLDA 5DQ0A 5A7NA 4AHWA 4COWA 2RJKA 3THDA 1CAUB 2KM2A 2Y6FA 4XJAA 3B9CA 4XABA 5F2WA 1GICA 1H8VA 3MIHA 5AVAA 5A3TA 3AJYA 1W9WA 3K4DA 4NIIA 2XJPA 1B35C 1KJRA 2DBIA 2GC2A 4E2SA 3O1RA 3PUQA 4AVVA 3GZTB 1LRHA 1RUG3 1AYN3 1H8TB 1AR81 3ILRA 1W2UA 3AX4A 2W91A 5JI9A 1OVPA 1AZDA 1OOPC 1SBDA 3V64A 1Q8SA 3AJZA 3MI8A 4KI5M 4FOVA 3ZMNA 4UFJA 2NYYA 1G9BA 3OD0A 3T30A 1F9KA 4D8MA 4QXCA 3J26N 1DQ2A 2CY6A 1S2BA 2R062 3BPZA 4BMBA 1YNAA 4A3ZA 5LA1A 4NVPA 1ZBA3 2EAKA 2NQYA 1FV2A 4GB31 1VBC2 4RFRB 5FPVA 1O8PA 4PCRA 2HLEA 2R32A 1RUD1 3WY6A 5IW0A 3ZYGA 5C7GA 4WVZA 1DCSA 4FFGA 1DF0A 3KS7A 5JPNB 3WDVA 1N3QA 1XC6A 3SEEA 1GWMA 2FD8A 3AKSA 5F8PA 2QZ2A 4C1XA 2VZOA 3F2ZA 4CRQA 2HWD3 2B9VA 2RDRA 4LOTA 3V56A 4URAA 1NKGA 5EPAA 4BWOA 2R7EB 3BTXA 1VAKA 4YVWC 1J3PA 1NG0A 3ZXEA 5KC5A 3C2UA 3MUY1 2E31A 1KDMA 1COV1 2XJSA 3P1IA 1QQP1 2ET7A 2HKXA 3ACFA 1MEC2 5BNPB 2Y64A 1C1FA 5F9TA 5BNQA 2DFBA 1J3RA 1YFWA 2D6MA 4DMIA 4ORFA 2RS33 3CMGA 2ZGSA 5FREA 4QX5A 5L9BA 4FPEA 3AKQA 4P14A 4LEJA 1UF2C 3RVHA 2P6CA 2WR9A 4NPMA 3TBDA 1VAMA 3CJIA 2GMMA 1X33A 4XFFA 3KCCA 4MG2A 1YQ8A 2ZX3A 3WHTA 2B4KA 2DU0A 4ZS3A 1S0DA 1IPJA 4LMFA 5F6KA 2PHRA 5DUUA 4COYA 4Z2AA 4LUKA 2IXLA 1HXS1 5C9AA 5K9YA 3OGVA 4AVAA 5JUVA 1X82A 4QXKA 2RDNA 5DZEA 1YFUA 5FZGA 1RITA 2O14A 3OGSA 4YG0A 5A32A 2CGNA 2WS91 3OPWA 4I0WB 3HNYM 1SG3A 1BK0A 3IM0A 2FBEA 4UFHA 1DQ4A 2E6VA 4OMCA 3W59A 1H9PA 1DG6A 2VQ0A 1QJZA 1DQ6A 2VVFA 4XUQA 3TEXA 5LEJA 1W6MA 4DOUA 4RN5A 2LUWA 3KB5A 1JZ2A 1DYKA 5SV5A 1OPMA 1WCDJ 4EROA 1DGWX 1NQDA 1RUI1 1XU1A 3ZN4A 4GWIA 2LS6A 3KQRA 3IBMA 5CG9A 2FCTA 2A3XA 2W95A 3FHAA 3VD4A 4AI9A 3M3CA 4XVHA 5A1FA 5JR2A 1IZ3A 1C8NA 1Y9GA 2AEYA 2QJVA 2C5DA 3RZJA 1AR82 1GP5A 5ANNA 2VY0A 1OQEA 3MO4A 4NHXA 1V70A 5A33A 1H6YA 4RR3C 4LBLA 1IS3A 1W2AX 2D6KA 3ITQA 3V65A 5IWFA 4A6OA 3PIGA 5LA9A 5C3RA 2WAAA 3TN91 1ZZBA 3VL9A 3T0BA 4HVQA 3I2HA 1YJKA 3CJIB 4OZOA 3UETA 2PQQA 5I8SA 2EVXA 1PX3A 3AM2A 1PVC3 2OZ6A 4XDOA 5FLIA 3SITA 2A6YA 1X8EA 4JGZC 4A6SA 4CXWA 2YDEA 2JD4A 2FDJA 1JZ6A 2Q30A 4UW4A 4IEWA 3T4VA 1EAH3 2ZCWA 1RUD2 3UJOA 3QH6A 5C9AB 1GFF2 5JIAA 1XNCA 4XC9A 2WQ8A 1DGWA 3EXUA 3ZSMA 1ZZ7A 4R9BA 1BXHA 3BALA 5F5CA 2HWC3 2WFF2 2RMU3 3PTYA 4FP2A 4G3YC 4UW6A 4I0BA 5A32B 4ISRA 3UYJA 4E9KA 1B35A 2HEWF 5ACA2 1TME2 4OQ9A 4ET7A 2BRTA 1Y4WA 4X6QB 4NIDA 4XJUA 1OOPA 2I2SA 1W6MB 1NCRA 1UAIA 1N1SA 2Y6LA 4NR1A 4XIKA 5A6XA 5A7OA 2VZVA 4L2NA 1O3QA 2V4AA 1S0EA 4XIOA 3OUIA 4A2UA 4DUVA 1LJ7A 1QGLA 5APAA 4YSFA 4JDMA 4JKKA 3RWNA 4QPYA 5CFDA 2P1BA 1RVF3 4HSLA 2ATFA 2CAVA 3AP5A 3WINE 1TMF3 4PF1A 1D4VB 2QVSB 1D2SA 4CDWA 3FBMA 1BEV3 1DP0A 2VQAA 3HIFA 4GAZA 4Q4X1 1K5MC 3AKTA 5ABJC 2QDNA 3FLPA 4YW6A 5JMOA 1GLHA 2A73B 1JW6A 5C5TA 2PAMA 1AF9A 2AC1A 4I0AA 4ZS2A 3ACHA 4D7YA 1Q5OA 5FYBA 2TBVA 4K7JA 5A33B 2ZGRA 3CBNA 1STMA 4NAOA 4YVWA 5JZGA 3HT1A 4ZPIA 3DXTA 2HWD1 5FO8B 1G9FA 2ZKNA 3J7MA 3D8CA 1OA2A 1IG3A 3PL0A 3VZJA 3Q8CA 3QBQA 2AACA 4QX8A 3ZMOA 1Q8PA 4OQ8A 3WLUA 4Q4V3 2B9UA 4FCAA 3NW4A 3FN9A 4QX7A 2PAKA 4IE0A 2WA4A 4Q27A 2PHDA 5EYYA 5T5JA 2GC1A 1LOAA 1UWWA 4QHZA 1RMU1 4LLOA 2X53S 2VQTA 2WNOA 2TEPA 3KCXA 1WW4A 3AL5A 1HB1A 4LBQA 1B35B 1EP0A 3WCRA 3ZDVA 5C6CA 1KD7A 2MEV2 2W2IA 2JDPA 3ZSKA 2YBSA 2PLV3 5LW9A 4AFMA 5JWPA 1OOPB 1W8OA 1NCRB 5FP9A 1GOHA 2KXLA 4NOTA 4YM3A 5LWBA 1FATA 3ZXDA 4RQPA 4XDQA 3UKTA 3BU0A 5BV6A 1H4GA 4Y1XA 5FYVA 2JDHA 3WV6A 2XL9A 2PYTA 1YQ6A 5FP8A 2DCKA 3KV6A 5BY5A 5CFDB 2E7TA 2ZX2A 4XCBA 5CKQA 3VDCA 2RS11 3WP5A 4Y1ZA 4CDWB 2GAUA 3NVCA 4BXFA 1WLTA 3VBUC 2OX0A 2H6BA 2QQLA 3V0AA 4P00B 1H2MA 4QKNA 3MIDA 3RMXA 1WD3A 4AGVA 3H8OA 4RS5A 1BBT3 4YGDA 3U1XA 1NLRA 4CCMA 1XSRA 2D7FA 4FSJA 3NNJA 1SCRA 1VP6A 4YVWB 2HBTA 2E32A 5JZGB 5C3QA 2R073 4XQWA 1A6CA 4C91A 1SFYA 1J59A 3C7OA 1SDWA 4W6XA 4XFIA 3Q9OA 3VBHC 4AK3A 3IDCB 3BOPA 3OGRA 2YZ4A 1MZFA 1XYOA 4BQXA 5J7MA 4YPJA 1K42A 1J1LA 2J42A 3JXSA 2GDFA 5T54A 1OA3A 1RUG2 1AYN2 1NOVA 1TNRA 2BFUL 2DU1A 2J1SA 1TE1B 5F5IA 1WZXA 3AZZA 2BVBA 1O7FA 4PDWC 4Z82A 2W1QA 4ISQA 3RYRA 4QX2A 1LHVA 3PMSA 2VZ1A 1R081 1XNTA 4NRMA 2VCBA 5BNOC 4LBQB 5J96B 5FZIA 3GBGA 3B7MA 4F8AA 1RUNA 4ATFA 5I0UA 1BZWA 5D2AA 4MH0E 1ZVFA 1PVC1 4CCKA 5I8YA 3GNEA 1BMV1 1LKNA 5FY4A 1ZBA2 2IXHA 4KGGA 1LGNA 4Z07A 1TZOA 3VBSA 4XQ4A 4XUPA 3BB6A 4R8HA 5JOYA 4RQPB 4CU7A 2P4EA 2J7MA 1RHI2 2XLAA 2VXRA 3K46A 1YCIA 2HWC1 2RMU1 4LR4A 4O9GA 1MQTC 2HWD2 5M0TA 4MV2A 2FZ2A 2HWB2 1GQHA 3I4IA 5FZKA 2P17A 4CCJA 2OUJA 2R1BA 2VUDA 1I1EA 4BH9A 4YFWA 2Z5WA 3LD8A 3V0AB 1ZRDA 1UPSA 2BOJA 4FPGA 1H6XA 5FYYA 2VW1A 1G7YA 2RS32 1WMFA 1ALYA 4JVAA 4RS5B 3ZIXA 2DCYA 4UWDA 3W20A 4YLZA 1RL3A 3NJXA 1W6OA 1UOFA 2G9FA 1RVF1 1O4YA 2EA7A 2XB6C 2CTVA 4GMP3 4PLOA 3FWEA 2Y8KA 1QNYA 2DURA 2W87A 4CUGA 2B5HA 1BEV1 1CESA 3PNAA 4YM2A 5L19A 1RUE1 3IAQA 2O0OA 4LIUA 1AYM3 3EQEA 2QQIA 1YYNA 3A22A 2Y0OA 3IWZA 3N7LA 1LESA 4OHYA 2WO1A 1W9FA 1F8VA 1CQ9A 2HYKA 5I0SA 4XAEA 4P9GA 3POWA 5KHJA 1ZREA 3MICA 1UMIA 5LK5A 5C3PA 2RJLA 5FZBA 4M4RA 5FXXA 3AP7A 1FV3A 3VZNA 3K48A 4LK7A 2XWJB 1RUC3 1PNFA 1SBEA 2ZS6B 3D6EA 4I02A 2GC0A 4LPLA 2JDYA 3CJXA 3BU7A 1AL23 3WVJA 5I0TA 1EV11 3BCWA 1XNDA 4AI8A 2D43A 3FFZA 1W06A 2WO7A 4CP1A 2W46A 4M3CF 3LA7A 1XE0A 2E51A 3NQHA 4FQ4A 3SH4A 4AI1A 2FDIA 4Z1VA 4QGMA 4ASKA 1YIFA 3NAPA 2JXAA 3LIHA 4FPLA 2OQ7A 2PLV1 1NA1A 1PGL2 5HCAA 1DLLA 1W99A 4UBHA 1ONAA 3MPBA 2XJVA 1JHJA 4LHSA 3VGIA 3P3PA 2FDHA 1ACCA 2Q8EA 3ZN5A 4XYXA 1D0GA 3CEWA 4FO9A 4NJ4A 1W6OB 3K4ZA 3NO8A 1BVP1 2RVAA 4OHVA 4CTEA 4KWLA 1SZBA 2ZEZA 4WM7A 5A80A 1XU2A 4JGYA 3TEZA 2R0HA 5KHKA 4MUVA 5FZ9A 2XHKA 1YJLA 2HWF1 4QKDA 3BIEA 2ERFA 1H1AA 1R093 4XUOA 4C0BA 1EAH2 2ZEXA 2OA2A 1JMUB 1U5YA 5IFPA 2C26A 1WWYA 2XVLA 1QJY2 3ZXJA 4YYOA 2HWC2 2OT7A 2R071 3E6BA 3ZSLA 2WWUA 3ZXFA 4OULA 1ZZ8A 1AR63 4FP3A 3ME2A 2VZQA 4QU2A 5KHHA 4EZ4A 4ATEA 1XNBA 4MLOA 4BB3A 1UPIA 4CCOA 3PHMA 4H3WA 2QNKA 4QX3A 4CA9A 5T5OA 1Y7BA 4PDWA 4DFSA 3JB4C 3EJKA 2W94A 1H9WA 4CZSA 3AXDA 3I2FA 5BNOA 1UMZA 2QQWA 3MZHA 1BHGA 2VGDA 4XHXA 1ASJ3 2A6ZA 2VZTA 1RVF2 4FFHA 3LFMA 1CD3G 3I54A 4S2HA 1TMF2 4A7YA 4CCLA 4FBFA 1BYHA 3ON7A 2AYHA 2DVGA 3LF7A 2RS51 2ARCA 3G7DA 3NAPB 2ARBA 3BTZA 1T6GC 5IAXA 5A3WA 1NA1B 3ROUA 2VUAA 5CNAA 2BP6A 4E4DX 1ZZ6A 2C0ZA 2JICA 5FZFA 2WZR1 3PURA 3UJQA 1MQTA 2HEVF 2PHUA 4EWDA 2VO5A 1PM4A 1PZ7A 3ZXAC 4CP0A 1NLQA 2J1RA 3VUOA 3VBRC 3AB0A 1VRH3 4CDUC 5J37A 5BXXA 4WM7B 4NIHA 4JGYB 3CZUA 1GUIA 1OMIA 4AHYA 3PLQA 4HL0A 4YFZA 2ZEYA 4LO5B 2W08A 3EO6A 3J7LA 3J9SA 2OKXA 3O5SA 5F7UA 4BQYA 4Q4V2 4HANA 1P8JA 2LTNA 3POYA 4XHBA 4WM8C 3ZXGA 2A70A 3LCPA 4QKBA 2BFUS 2ZZQA 2XH6A 1LOGA 4S2FA 4LK6A 1LEMA 3LDBA 1XBFA 5F3GA 1OLMA 2VTXJ 1MS1A 3PVNA 1S0CA 1FT9A 3R4SA 4G9SB 4YNIA 3MIGA 1E5HA 3OG2A 5FP4A 1OFSA 5TSWA 4AOCA 3UV9A 3CU7A 3P6BA 4PDWB 1TVGA 1ND2C 4LITA 5CG8A 3VKOA 3JQWA 1XNKA 1HLCA 2UYBA 1QJU1 3VDDC 5A6YA 5BNOB 4IW3A 1VIWB 4LULA 4Y5SA 3KQ4B 4ZU5A 2YY1A 3HQRA 1SLTA 3M7AA 4Q4Y3 4D7SA 1LGBA 4WVWA 2E53A 5FUNA 3IKWA 1ZZCA 3ALQA 1CWPA 3WF4A 1RUC1 3DGTA 5LY2A 1YHFA 4K20A 1K12A 1FAYA 5FY1A 1V6OA 3HT2A 2YROA 5FZMA 1AL21 4GB33 1A3KA 4R9DA 5FAXA 4D0QA 1VMFA 1QJX1 3KWVA 3E6CC 1Y3TA 5L73A 1MQTB 1BBT2 2DUQA 5LCWL 1V6JA 2VMCA 3L2HA 3POJA 4CDQC 5CA6A 3KVAA 3U4SA 1JI6A 2VTFA 3ZFEC 2R6QA 1MPXA 4BIFA 2VNRA 3AZYA 5L7OC 4ZU4A 5IK7A 5D1IA 2QQUA 4H7MA 2UY8A 2BJSA 4P9WA 1PIV3 3LOBA 5FP3A 4DQAA 2DYCA 1COV3 4LE4A 1V00A 1QQP3 2XVGA 3HQXA 5CFCA 5FZ8A 4J6GA 5F5QA 2PN5A 1QDOA 4NIGA 5LA0A 5E88A 4GULA 2ZAHA 4NMIA 2JWPA 1NE4A 3K77A 4C8DA 2VE1A 3W5MA 3D3AA 1HB4A 1QWRA 3UESA 4HOOA 2DV9A 3WZ1A 4CP9A 5JCTA 1W9YA 2OQ6A 2RR13 3B93A 2K46A 3WUCA 5DG1A 2FMDA 2V4VA 1Y9MA 3A0KA 4KNCA 5FPZA 1HQNA 2ZBJA 1R091 1LOFC 3VKMA 3ZYBA 2BPA2 5DUVA 3VZMA 3I2JA 2WNVC 1YWKA 2PQSA 4RFT0 4AWDA 1JYNA 3RRDA 1EPZA 1HXS3 5KWRA 3V0BA 4XFGA 3MIEA 1OT5A 2DUPA 4R9AA 1WMXA 3RZLA 3JB8A 4X6RB 3KM5A 5FO7B 2DDUA 4OFGA 1W28A 1VBD1 2VG9A 4GWMA 1K5JA 1UZZA 2QQKA 2DCZA 4IEYA 2WS93 4GD4A 5FOBB 3L2YA 4CXXA 5F3EA 1W39A 5CZKA 5B2GB 5LRSA 5FP7A 1RUJ3 2YFZA 4XF4A 3WHUA 4QPWA 4XF9A 3ILNA 1AX0A 3AZXA 2CSGA 4XMIA 2WABA 4AQTA 1JYIA 3U0ZA 3E5QA 3QLQA 4OI2A 4NWWA 4PJYA 3ACGA 3IPVA 4EZHA 4LBJA 4UW3A 3MHZA 4AAPA 1DU3D 2C9KA 3IB3A 5JXIA 5ERLA 2F4LA 2BNNA 3H42B 1I5PA 3S57A 2AREA 1K3IA 2AH2A 1YEWA 1AYM2 1GNHA 3DXUA 5CFCB 5K0UC 1UYPA 3FX3A 5BNNA 1JYTA 3ZLIA 3RJ2X 2Q1ZB 1MZEA 3PVEA 3MFCA 4QQPA 4CCEA 4OI0A 3AMQA 1IG0A 2YFUA 1O5LA 2ZXQA 4NHMA 1HRI3 2Y34A 3PMEA 3VKLA 2HWE2 4MGZE 4XFCA 5CEHA 3TEWA 2YC0A 3TN93 3PUHA 2B39A 3NWKA 5EJ3A 5E89A 3SNMA 4CP9B 3GZEA 2IC1A 3F95A 2YU2A 1HKDA 4AQSA 1RUC2 5GALA 4JRAA 1JZ4A 2PELA 1H1IA 3N9PA 1UY2A 5FTTC 4HK9A 1VBB1 3E97A 3POFA 2EXHA 1IS5A 3DPRC 5FYSA 4QPIC 2DTWA 1AL22 2O8QA 3K75B 3RGBA 3BTAA 2W1WA 2Y60A 3DYPA 4GWJA 5FPBA 3V0BB 2C1FA 1ULGA 2VXJA 4K9SA 1NZCA 5JMCA 2WKKA 2D3SA 2BERA 1K45A 4AYUA 2XHNA 3UKNA 1W8WA 3B3QE 4Z8BA 4KWUA 1O4ZA 2Q8DA 4XZUG 2KR2A 2LW8A 2WNEA 4HBNA 2Q4SA 3VDDA 5IFTA 1HIXA 3D82A 2DCTA 4GMP0 2NMNA 1C8M1 4FFFA 3AZVA 3ORJA 5T3NA 2WUHA 4LOSA 3GZAA 3VBFC 1PO22 2BGCA 1XXNA 3AYAA 4Q5OA 2VU9A 4S2DA 4Z92B 4Q4Y1 5FLJA 1GZWA 3IPVB 3NL1A 4QDRA 3GHMA 1VBE2 2ILMA 1S2KA 1W8ZA 1YXWA 3MPPG 4JC1A 4KU7A 3S7IA 1US2A 3RMYA 3WDYA 1LHNA 5FMBA 4Q26A 4M4PA 1NY72 2CWMA 5HPOA 4Q4X3 4XJ8A 2Q8CA 2QQOA 2J1UA 4EN9B 2VECA 3ETQA 3E1F1 4QX1A 5BNNB 4CDQA 3Q8AA 3I59A 3ZFEA 5FXWA 4QQLA 3E5UA 1VLNA 5IVYA 1OSGA 1R1A1 1RUF1 1AR62 4YVSC 4ES8A 2IFWA 4BJ0A 1RUH1 1IS4A 3PUSA 1EUTA 2VH9A 3FC0A 2G9ZA 3I7DA 4KMQA 1FMD2 1PIV1 1QOSA 1PMHX 2JD9A 3GBWA 4DUWA 1SLIA 3SCGA 1DBNA 3PJYA 3G6JB 1ULCA 4FOWA 4H7LA 4HFSA 1W2TA 4V2VA 4OI1A 5FXVA 1RMU3 1QKQA 5T5PA 1MACA 1ASJ2 3QD6A 1NT0A 4HKWA 2PA7A 4TSVA 4XACA 4Y33A 1LOFA 1WA4A 1V6IA 2RR11 5FZCA 3LGRA 5JLVA 5A70A 2QQVA 4LO7A 5I91A 2WO3A 2MHFA 5FK8A 1YUDA 3VDDB 1QF3A 2VOVA 3TAYA 3ZFFA 4AXOA 4LT5A 3GHNA 2MPFA 1RXFA 3LA3A 3SQOA 1C1LA 3SLIA 1UXZA 1UZYA 3HMYA 3VHOA 3WDUA 4HN1A 3ZO0B 2FMYA 5LRRA 2DCJA 4ONUA 4B1MA 3W58A 1GZWB 1VRH2 3HEIA 1QJFA 1HN1A 4NHKA 4PQ9A 4U2AA 1DHKB 5FY9A 2FZ1A 1VMJA 5DZFA 3GGLA 5H9SA 4MVTA 2BEOA 1W3XA 2RS13 3W21A 2JE7A 1DLCA 3Q8FA 1RUJ1 4W50A 2IXIA 4AEKA 5AFEA 3I49A 2W39A 5A1AA 1GV9A 1N3PA 1YLLA 4CDQB 1CIWA 2RM21 1JH5A 4EN0A 1ULDA 3I59B 3ZFEB 4A7ZA 4NHLA 4H2AA 1GP6A 2EICA 1SMVA 1D4M3 4R4ZA 3ZVXA 4K1YA 2J22A 4AW7A 4K8RB 4QM9A 1NZIA 2R0FA 2VCAA 5K0UA 1WBFA 4BQ1A 3WXPA 4KBZA 1DQ5A 4BZ4A 2P5BA 1ZBE1 2W68A 3MBWA 4H14A 2V5YA 4COUA 4XJWA 3MUZ1 5GZFA 1SDDB 4CU9A 5GLVA 3D5OA 4M0NA 1PNGA 1HRI1 2Z69A 3WF0A 2E7QA 3NJZA 5IVJA 4Q4Y2 3WNKA 2KD7A 4IE5A 3WQ0A 1A34A 1ENRA 1MS9A 1R083 3MDPA 2Q8OA 3WOGA 3ZR5A 4AFBA 4CPBA 3SCFA 4E2GA 5C71A 2X5IC 5GZEA 4DB5A 3DPRA 1LENA 4NROA 4QPIA 5D8AA 5SV8A 4A45A 5J1XA 2CU5A 3ZFFB 4K6BA 3IN9A 4BOWA 3DUIA 3CF6E 4GB32 3ECQA 5FWEA 1C28A 3JD73 1E5SA 3O7OA 1AR91 3POBA 5DUXA 2Y6HA 1WCSA 4RGGA 4M3CE 3SC7X 1JYVA 5DDJ1 5A1LA 1NX9A 3RZGA 3RI8A 3MFAA 3LEGA 3RFRA 1H2NA 1KJLA 4Z2WA 1PIV2 4IV3C 1HW5A 4PIXA 1GQPA 3VBFA 3UK9A 1ZRRA 1COV2 1ZX5A 1ZRFA 1QQP2 3ZDSA 4LKEA 3K2OA 3LZZA 2BBVA 2JE9A 2GNMA 3KV4A 1DDLA 1NLSA 3LAGA 1T6BX 3IMMA 5FZ1A 4EWEA 3OBZA 2D6LX 2PTMA 1TQ5A 3O14A 4N8MA 5FYHA 3KHCA 3VHRA 3KT7A 4PBOA 3THTA 4EN6B 4XXAA 2RR12 4L9BA 3MLJA 1AVBA 5K0UB 2PMWB 4F3JA 3JUUA 3SMHA 2EIEA 2P3YA 1RUE3 5CB7A 2VVEA 3HJRA 3AFKA 1YIPA 1PO13 3UT0A 2VZPA 4CVUA 4MGQA 2JENA 4Y5TA 1CAVA 1HXS2 3EMRA 3R6SA 4XCAA 5FZDA 5C5UA 2XQRA 5CBLA 3A21A 2WC2A 1FPN1 4TZDA 3PJQA 5EFUA 3NNFA 1DGLA 2FDFA 1UKGA 2BBAA 2WS92 1UU5A 4DNYA 3DPRB 4AI2A 1US3A 2RHPA 1W3VA 4QPIB 1QOTA 5D8AB 2WQ4A 4LE3A 2E33A 2ZTNA 3K3NA 5JVVA 5FO9B 1RUJ2 3MEPA 1L7QA 2WIIB 4M01A 1JZ3A 4IEUA 3WP3A 4XTPA 5AC93 1LB2A 4Q0VA 4WBBA 1EV13 1YQCA 2JDMA 4PF5A 2B42B 4NIAA 1RIRA 2XLFA 4FT8A 1N3OA 2UURA 2QBXA 2YG0A 1RUI2 4Q4W1 1PMIA 4YW2A 2H0VA 2CWSA 2IVIB 3I3EA 2JG8C 4JZRA 4FPHA 3S7EA 2UU8A 3OYWA 2R16A 2XG3A 4YG6A 1GOGA 1GBGA 2ZGLA 4XMAA 3VBFB 3N4MA 3OGGA 4V2WA 3M2MA 3NJVA 3KCYA 3RS6A 2VUCA 2AR6A 2BVVA 4LBQD 3AYEA 1ZA7A 3ZYPA 4PBPA 5J98B 1SEFA 3VHPA 3AVSA 3GXUA 2A7AA 4O65A 5FYTA 2XL7A 3KT4A 3TN92 2IFRA 4XPVA 2XJTA 3E6DA 3OBTA 4D69A 3QH7A 4N43C 3SH3A 1RYYA 1MS5A 3ETPA 2ZACA 1J83A 3PUIA 2VR4A 5FY5A 1JS9A 3T2QA 3RZHA 2HWF3 3QCWA 2J1AA 3WW2A 5G05L 3T4HB 1F15A 3LPGA 3MF6A 2HEYF 4LA2A 4CSWA 4L8QA 1CAVB 1BQPA 1GNZA 2WN2A 3O12A 5LBBA 2E7AA 2VULA 4CXYA 1X7NA 3DCQA 5J3UA 2FCVA 3N3HA 1D4M1 5KBFA 1OUSA 4J25A 5I0RA 2D44A 4Q8LA 1RGSA 4IGPA 3NRUA 4Q29A 5C3OA 3DKWA 4E4ZA 1IPSA 3T0DA 1SHWB 3WNLA 1KITA 4FI9A 3R05A 1EPWA 3D0JA 4QDSA 1KEXA 3QACA 4QPGC 3H3LA 1N1YA 2DVBA 4RR3A 3RZKA 2HBUA 2DFCA 3HD8B 3H3ZA 2W5FA 2AUYA 2QDRA 3DYOA 3MW2A 3GCXA 1SFNA 3I8TA 2FCUA 4UFLA 3WW4A 5JAXA 1HV1A 4JGZA 4HVOA 1GP4A 2BNMA 3GZUC 3OYWB 3T2TA 5KXBA 2XWBB 3KT1A 2WSUA 2RS53 5FPLA 4Q4X2 2BQPA 2Q5TA 4JKLA 4DXSA 4H55A 4CEYC 4YM1A 2YGLA 3M70A 3U75A 4BIOA 1GZ9A 3JD71 1ZM1A 1LHOA 3NV3A 4YRDA 2WZR3 1NCQC 1JYCA 3H1WA 4E4HA 1JU4A 1HJFA 4C0HA 3VL8A 2ZGUA 4COZA 4PT6A 5FZ4A 1CONA 1RXGA 2VBBA 4Q1PA 4QGNA 1V9U1 1VAVA 2XUEA 4V1PA 3USSA 4F7ZA 1OXCA 1MS4A 1LECA 4I09A 5EZWA 4N9IA 3IAPA 3NV1A 3RYKA 2XBO3 4P9JA 3RSJA 2D6PA 3AYCA 2XUMA 3K51A 4IEQA 1PMJX 1RMU2 2ZHLA 3C7EA 5DXDA 5E8AA 3APBA 5GLTA 2LRPA 2RE9A 2A6XA 1K5MA 5ABJA 3ZSJA 1KGYA 3CQOA 4YW1A 1OD3A 1V6LA 2YXSA 1UZ0A 3H1YA 1SQ4A 2NMOA 3I3QA 2EIBA 2VJXA 3GJAA 3SKVA 3J4UH 4FTEA 1A8DA 4RR3B 4XFAA 4AHXA 1OLRA 1PO11 4HZFA 2PAEA 4IERA 1UIJA 3LPFA
chains in the Genus database with same CATH topology
1QJU3 4KU8A 3KGLA 1VALA 4Q1RA 3WR0A 4AEMA 4G4FA 4L97A 2EALA 5JR7B 1I5ZA 2EXKA 4JGZB 5JOXA 2IXKA 2RS12 3OGJA 4MGIE 1B09A 4URTA 4K8FA 1BKZA 2IZWA 1SACA 2GZWA 4WVVA 1BK1A 4UBGA 1QXJA 3N7MA 5AC91 4AI0A 4CP2A 3T1MA 1QJX3 4AQ2A 1OD5A 5A3LA 1Z7S1 4TLFA 1PGW1 1UL9A 1AUYA 2AGSA 2D98A 3H8UA 2IXJA 1CVNA 2BUKA 4MGYE 4HK8A 3SH5A 1U12A 2CGPA 2ZZJA 1AJOA 2TUNA 2ZHKA 2ZKLA 5KHIA 4HSJA 5C4WC 1DQ0A 3FMGA 4D94A 4HKLA 1R082 1AX1A 4GH4C 1PZ9A 1K5MB 5ABJB 3VBUA 1VBA1 3B00A 5IT6A 3WDWA 1PVC2 1BMV2 2D97A 3M3EA 4AQ6A 1NYWA 3H7JA 4DY3A 5C8CC 2V09A 4ASLA 3AP4A 3CLPA 3JD72 3VBOC 3HWJA 1UU6A 2DUOA 4IV1C 4RSUA 4DINB 3VBHA 3RYPA 2RMU2 4OVEA 4FPKA 2MNGA 5JSPA 2P3IA 1VBD3 2R041 3U4XA 3AMPA 4QPGA 2R30A 1PZ8A 5EYXA 3WCSA 4N53C 2ENRA 2R063 2PFWA 1WLCA 3S6PA 1BJQA 3ZPYA 5FQ0A 3MW3A 1V6MA 2ZGNA 2D3RA 5JDBA 2XKPA 2H0BA 3VN4A 4CEYA 1H4HA 3FLRA 1BEV2 1FOD1 5T52A 1RUE2 4YARA 1NCQA 5A3MA 3NV4A 1POV1 4LLFA 2GN3A 3M1HA 2PHXA 3M3IA 1WD4A 1FNZA 1I6XA 5T50A 4C1WA 5JSRA 3WW1A 4QD2A 3VLBB 2GH8A 1H8TC 4YZ1A 3VBUB 1A78A 4LBOA 5FPXA 3N36A 3WNXA 1W0PA 4B7EA 2F6BA 1VBB3 2GALA 2XBO1 3EBRA 2JKBA 4KGQA 2ZAAA 2ZGQA 1EV12 2ET1A 3U07A 4JV4A 2D3PA 2D5FA 4W6YA 1EYBA 1CJPA 4XEZA 3FFQA 3KD4A 4HLTA 2LALA 3ELNA 4RHV1 3VBHB 4BCUA 4LBKA 1REFA 4QPGB 4YW5A 3RJRA 2N7GA 1C5HA 2WJSA 4FAHA 4FOYA 2WLPA 4BE3A 2PLV2 4CEWC 1C8M3 3C3VA 1W6QA 1LTEA 1H1MA 3UL2A 5FQ0B 1WUVA 1ENQA 2B7YA 4Q2FA 4XBLA 3LWCA 2IWGB 3O0XA 4A3XA 4I2OA 5BNPC 1YO8A 5BUVA 3J8F3 4W6WA 3ILFA 3AP6A 3AYDA 5JIUA 4CEYB 4FQZA 1S0FA 2XKOA 3HBZA 4Y22A 3WD5A 2CGOA 4EN7B 5FLHA 2HWF2 3WG3A 3B02A 4PLMA 2VUJA 1NCQB 2ZGKA 3JBG1 3VZOA 1S0GA 1GR3A 2YYOA 3E5XA 3RG0A 4I01A 1V6KA 3LSDA 2SBAA 5EXOA 1IS6A 2VPVA 4XTMA 2R072 1R1A3 3VZLA 1U0AA 1RUF3 4DPNA 1OHFA 1F31A 3JU9A 1RUH3 4ASMB 4HETA 2JJ6A 4HN0A 1JBCA 1OA4A 2VW2A 3CO2A 4EN8B 2FHRA 1DGRN 2P3JA 3T1LA 1JHNA 5FFOC 4X8NA 1QOOA 4GIQA 4GH4A 1LOCA 4DRVA 1I9RA 3ES4A 3WP6A 1WW7A 2A3WA 3MW4A 3VKNA 4META 2F4PA 1O4TA 1UCXA 2VOXA 1FXZA 4QM8A 4Y24A 5EV7A 5CADA 1F5FA 1QHDA 4YG3A 1ENSA 4X8PA 5ACA3 5KXCA 4N7IA 1TME3 2RS52 5FRAA 5JI7A 1C4RA 4UXAA 4LBMA 3M3OA 2W0XA 4INDA 1W6QB 5DZGA 2WZR2 4B8EA 4YGEA 4P9XA 3GYDA 3TNPB 2NLRA 3AMHA 3CL1A 2V73A 2DTYA 2A6WA 3ZSEA 4JCKA 1QH6A 1QH7A 4COVA 4Y1VA 4Y22B 1ND3C 1G9AA 4BMEA 1H2KA 2R061 4S2GA 1G6NA 3IMNA 4AEJA 1XYNA 3CJIC 3EHKA 4YZ3A 2RM23 2ZHNA 4AG4A 2D40A 1VBC1 5HBAA 1HQWA 4NWVA 3KZ4C 1AX2A 3N35A 4W65A 2LM3A 1JUIA 5C9AC 3R4UA 2WT1A 3TRSB 2UWBA 5GZCA 4YM0A 1ZBE3 2GNDA 1IKQA 3VBRA 1QJU2 4GH4B 4KWJA 4YZ4A 4CDUA 2BW8A 4Y20A 5K7PA 1SLCA 1CX4A 4M00A 2GSYA 2HJIA 2CAUA 5E16A 1KFXL 2D6OX 3OD4A 2OYZA 4YW3A 4WM8A 1L3JA 1KXGA 3B5LB 3FUOA 1YFXA 4JRLA 4SBVA 1QJX2 5IK8A 4KWKA 3S30A 1AR93 2XJUA 2VOWA 2WZPP 2JEMA 4KG0A 4XZPA 1LCLA 2ETEA 2JDZA 3R4DB 5DDJ3 3LKJA 1ZZ9A 4I3PA 2P3KA 4BYYA 4CEWA 1KFUL 1ND2A 1Q8VA 3DN7A 2ZGTA 2XJRA 4XJ9A 4JTNA 1DQ1A 4M3CA 4P9IA 1OQ1A 4PIYA 3BOWA 1U5ZA 1EY2A 4GALA 4OUSA 1N1TA 1PM7A 3J8F1 1XE8A 3ENRA 3ZYRA 1IPKA 1RUOA 2ZJCA 1R092 3OY8A 3QOPA 2EAAA 3WG1A 3VBRB 1C57A 3ZIWA 2ZX0A 1C5IA 4CDUB 5IK4A 4Y20B 3PVBB 5L7OA 1FPN3 2GMPA 5EWSA 1VBD2 2WT2A 4GKYA 1NCRC 4XETA 4B3NA 3ST7A 1LOEA 2WWSA 1W6NA 2KA3A 2PHLA 4WM8B 1MZ6A 2VNGA 3TOJA 2IXCA 1WBLA 5H9PA 5CFDC 4ITCA 5JSOA 4AEDC 4FAGA 3HR9A 3THPA 2Q1MA 4Q0UA 4CDWC 1U5XA 4Y26A 2NN8A 4IEOA 1RINA 1JOJA 3R0RA 4HVRA 4K21A 4Q4W3 2R1DA 2ZABA 4B4RA 1RHI3 3B9IA 2WFF1 1SLLA 4CEWB 4LHNA 5ACA1 1ND2B 2Z2SB 2WNVA 4FXGB 1R1ZA 1TME1 4Y1UA 2HWB3 5JZGC 2A71A 5KXEA 3GF6A 4LA3A 4M3CB 1FYUA 4QHBA 2G4IA 4HT1T 1ZA4A 3FHIB 1IOAA 4LO4B 4M0HA 2GNTA 4HMZA 3URFA 4KBBA 1ND3A 1SCSA 4RL7A 3MIFA 4Q8KA 3JZVA 3WG4A 4OHXA 2GU9A 1SLBA 2QCSB 1FX5A 3AP9A 1HRV3 4R4XA 4TWTA 4MXVA 1VBB2 4FPJA 3ASIA 3SISA 4A7KA 3OY8B 4FPOB 4C90A 4N9HA 2WT0A 4JTOA 1LR5A 5DG2A 1G86A 5L7OB 2DVDA 4B7KA 5LEKA 3M8LA 1OFNA 4P9YA 4CYDA 4QGLA 2E63A 4RQPC 1LU1A 4OHWA 1Q3EA 1XRUA 1J58A 1W6NB 2EF6A 4XW3A 3N7JA 4MXWA 2B8MA 4WZCA 5JOZA 1AJKA 1C8M2 3IDBB 3O0WA 4Q0PA 3AMNA 2YV8A 3AXEA 1M06G 2EIGA 4YGCA 3J8F2 2XPJA 1APNA 4RS5C 2WNVB 1LU2A 3LOIA 4FVVA 4IEVA 2ES3A 5K8SA 2MEV1 5C33A 1IGOA 4BA6A 3AMMA 4ZU7A 2DWRA 1ZNPA 4AFAA 2ZX1A 3NSTA 1VR3A 1H30A 1V6NA 1HX6A 1R1A2 3AZWA 3KLSA 1RUF2 2I07B 1ND3B 1RUH2 4XF1A 1V9U3 4U36A 2AENA 3OCPA 1YI9A 5H9QA 2H6CA 3U11A 2A6VA 3NKTA 4YZ5A 2OW4A 1YFYA 4KQ7A 1TEIA 1SLAA 2BNOA 2BTVC 3MLKA 4AF9A 5KC6A 4JQRA 3VBSC 2A3YA 1QJY3 3H7YA 3MYXA 1S55A 4KH9A 5I8TA 3AKPA 1DZTA 4MXWB 3TYJA 3I2DA 4ES9A 3VZKA 2OPKA 3WT3A 2X29A 4LTAA 1Q43A 5FMOL 1RUG1 1AYN1 4YVSA 1NXMA 1LHWA 2SLIA 3ES1A 1CAWA 4SLIA 4AEDA 1OPOA 3POSA 4RA0A 3HN1A 1ULEA 3SXWA 1BCXA 2PHTA 1ZBA1 2YHJA 1WW5A 2ARXA 4IEPA 5T55A 1LHUA 2RM22 3ZYIB 4UW5A 4R52A 4YGBA 3INAA 4BPZA 2QKDA 1Z78A 1Z7S3 2B46X 1IHMA 3AFGA 4GKXA 4IL7A 1RHI1 1DZQA 2OUHA 5CU1A 2HWB1 1GKBA 2UWCA 4AVCA 1ZBE2 5GKAC 3WW3A 3FE5A 1X50A 3WX5A 1VB4A 2WL1A 2PHFA 1HRI2 2ZA9A 2RS31 5I93A 1QXPA 4B4QA 3OTFA 1XYPA 2D93A 3NV2A 4XILA 5HXVA 4K3UA 4LUMA 1VBA3 1GZCA 4K1ZA 4AVSA 1HRV1 3AK0A 1UX6A 2QZ3A 2B45X 5BYNA 1D0HA 1GQGA 4LHLA 4XBNA 1S0JA 1LODA 4FPFA 1HQLA 2G9GA 3MGUA 4N90A 1AR92 5CIRA 4EJRA 4YVSB 5H9RA 3NAPC 1ULFA 2E9QA 4FPYA 1MVQA 1NA1C 2K9ZA 2EXJA 5DDJ2 1CAXA 1CAWB 1LGCA 2R043 3BODA 1YRZA 4RGAA 1XQNA 1NE6A 3LSEA 4NPRA 1UU4A 2XJQA 4AEDB 1JXNA 2ZGMA 5L36A 1Q8OA 2UY9A 4WM7C 1CN1A 4JGYC 3H3UA 5J48A 4OUMA 5IK5A 4IEZA 4EV0A 2X5IA 5JOWA 4I3GA 4ZXKA 4Y4YA 3RQ0A 1TNFA 2XGXA 1PK6C 1PGSA 1QNWA 3WDTA 1FOD3 3L9JT 4L11A 1POV3 4BLIA 3ATGA 1PGL1 2ZMLA 1CR7A 1FPN2 4GWNA 4IV3A 5GM0A 5BPXA 1AXZA 4LO8A 4IEXA 4D7TA 3TB0A 1G9DA 3B94A 3H0OA 1J1TA 4QMAA 3SHRA 3W9AA 2O8OA 4MZUA 5HI0A 4DRRA 4WVMA 2Y26A 3FZ3A 1EAH1 2WSVA 1RTVA 1W6PA 4RHV3 4Q4W2 3GBFA 2R49A 2VW0A 1CAXB 4WV8A 2WLQA 1QJY1 3KMHA 5FOJB 3ACLA 5IUQA 5C8WA 4IXLA 3D4KA 4BHPA 4RD7A 1IQAA 1UKRA 3WQ1A 3A4UA 1QXRA 4B29A 4FOQA 1PVXA 4DS0A 3DV8A 2Y38A 2X5IB 4PLNA 4XF0A 1Z0HA 2JECA 4YZ2A 2AZ5A 2OVUA 3RDIA 1MR5A 2K2SA 4XQDA 4FTSA 1HRV2 1TMF1 5HCFA 1AR73 5JPMB 3JBG3 1WCKA 1XE7A 1VB2A 2GH2A 4ZKTB 3ZXLA 1MZ5A 2JG8A 2ZGOA 3IT8A 3ZYJB 2W52A 4IQPA 1D4M2 4IV3B 2HWE3 1S0IA 3HAGA 2NP0A 2VMGA 2DF7A 1QDCA 2CV6A 3ZXKA 2O1QA 1NQJA 1CPNA 1NXD1 1A8MA 3ZFGC 2WNUC 1DGRA 1RJ7A 4Q4V1 4WVMB 3VBSB 2YGMA 3FJSA 4N43A 1HDKA 4IESA 1W6PB 3D0SA 5FMOS 2FQPA 3WDXA 1D2QA 2X8KA 4E4SA 1SBFA 4YW4A 2PHWA 3NKGA 1CJDA 1LULA 5KHGA 4CDXC 3OJBA 3FBYA 1Y43B 5CVRA 5GZGA 2XLGA 4AGGA 3M3QA 1ENXA 5CAZA 4TYSA 2QE3A 3MIBA 1ZRCA 3AKRA 3H9AA 2CL2A 2XVKA 2A75A 2ZMNA 5GZDA 1PO23 3RZZA 5CFCC 4WZFA 4OZXA 1V9U2 3ZN6A 1DFQA 1VBE3 1Q56A 3GALA 3DF0A 3OBRA 4MSVA 3VHNA 4D3WA 1G9CA 2A5ZA 1GSLA 2DVFA 3WQ7A 2JG9C 1PK6A 1VBC3 3LA2A 1G8WA 4AHZA 2JG8B 4JDOA 3OPZA 1AXKA 1O3TA 1BBT1 2VOKA 3U10A 1URXA 3S0MA 2P2KA 1AXYA 2BYVE 3FLTA 2Y0IA 2CYFA 4E2QA 1DIWA 1FMD3 1UW8A 1PO12 2ZHMA 1RC6A 1YI7A 2P34A 4NN0A 4DXZA 1MEC3 1MVEA 4QT6A 3PVOA 4N43B 2ZX4A 2Q0AA 3WUDA 1E57A 1LEDA 3VV1A 4AFCA 4AVBA 1QU0A 3IDEA 4F83A 3DL3A 4XXPA 3X29B 4AI3A 4IETA 3O0VA 2BWAA 1OQDA 4AE2A 1KRIA 1U5IA 4QQOA 1AHSA 2BWCA 5AC92 4Y5Z0 4E27A 1WGPA 3ZX7A 4QQ2A 1Z7S2 1PGW2 5E1RA 2QQPA 5GJ6A 4XFBA 5BNNC 4P9LA 4PIZA 1DYPA 1FI2A 3RPQA 3ZN6B 5FCCA 1W0OA 2GN7A 4LNVA 4JAAA 1REDA 1KS4A 3VKFC 2WFPA 4MGKE 1DZRA 1MS8A 1PK6B 5KXDA 1O5UA 2YUEA 2WQZC 1JN2P 2D5HA 3CNAA 1VBA2 4Y1YA 2VNOA 1F5JA 5DUWA 4GMP1 5GLZA 1AR71 2UWAA 2OZJA 2Z79A 4LO6B 1AYM1 1BVVA 3FUQA 2EXIA 3MF9A 4P5HA 4L99A 1IKPA 1AR83 1JUHA 4KL1A 4QQHA 1WW6A 3H50A 1MS0A 4R9CA 1UD1A 4AVTA 2HWE1 4GA9A 2R042 3USUA 1F2NA 1O3SA 4K40A 2WNUA 3ZFGA 3H1MA 1N47A 4AGRA 1J3QA 3TNQA 1WMDA 2Z42A 5C4WA 2WINB 3A0NA 4N7UA 1RUD3 3MLLA 4DY5A 5GLWA 1O3RA 4CDXA 1CPMA 1GYKA 4EWAA 2WFF3 5C8CA 3TWIA 1PHMA 4BM8A 2GNBA 4OLLA 2TNFA 3VBOA 1FOD2 1Q8QA 4IV1A 4Q0SA 1UIKA 2ZMKA 3SCHA 4KG8A 3WP4A