1LOEA

X-ray crystal structure determination and refinement at 1.9 angstroms resolution of isolectin i from the seeds of lathyrus ochrus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
180
structure length
180
Chain Sequence
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords LEGUME ISOLECTIN I (ALPHA CHAIN)
publication title X-ray crystal structure determination and refinement at 1.9 A resolution of isolectin I from the seeds of Lathyrus ochrus.
pubmed doi rcsb
source organism Lathyrus ochrus
total genus 26
structure length 180
sequence length 180
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1loeA00
1AZDA 2YROA 4XJZA 3VKNA 1BJQA 2WLQA 2GMMA 3WOGA 1DLLA 1SLBA 4RL7A 1DQ1A 1CESA 1F31A 1G7YA 4FPLA 5GZGA 1O4ZA 2D3PA 4JC1A 1AF9A 1S0EA 2UWBA 1ONAA 3AZYA 1CVNA 3WHUA 2AENA 4BMBA 4XJ9A 4DS0A 1SLLA 3USUA 4FPKA 3AXDA 5H9QA 5JDBA 1JXNA 4FQ4A 5JMCA 2ZHLA 4NO4A 1N1TA 3INAA 5F5QA 4Q8KA 4XZPA 2YY1A 4TZDA 2ZHNA 1O4YA 2GNDA 1FYUA 3QLQA 3R4UA 1BKZA 5KXCA 1DQ5A 4FOYA 3O0VA 2EALA 1DQ6A 1F5FA 1S0CA 4FPYA 1W6PA 1HDKA 1MVEA 1V6KA 1S0BA 4UW3A 4AYUA 3OYWA 3VKOA 1FV2A 4BMEA 3DUIA 1RINA 3WVJA 1VIWB 1WCSA 2ZBJA 3LSDA 2A7AA 2ZHMA 3WZ1A 4GKXA 2JE7A 2UURA 2NM1A 2EXIA 4YG3A 4XBNA 4AGGA 1QOTA 4XE9A 3WDWA 5JOXA 1W6MA 2AYHA 2Z42A 1WW7A 2GNMA 3AX4A 1BQPA 2SBAA 5DUXA 1YO8A 5T54A 3SH5A 4M3CB 4BPZA 2E7TA 2PHUA 4U36A 5L73A 2A6ZA 4FP3A 4DRRA 4LBJA 5DZEA 3WDTA 2ZACA 1LU2A 4H55A 4YW5A 4D69A 1OFSA 2ZGPA 3ILNA 4FPGA 1JYIA 1SACA 4XIKA 4ATFA 1XQNA 1Q8OA 2DV9A 5DZGA 3WUDA 2UWCA 1S0IA 4Y24A 5DUVA 3W58A 1Q8SA 4WVVA 3PMEA 2PELA 2ZMLA 3PVNA 4XHXA 4YGEA 3WCSA 3WUCA 1CR7A 1FAYA 1GNHA 1LHWA 2GNBA 2WT2A 3N7JA 3R4SA 1UAIA 3ZXKA 5EXOA 1QMJA 5AVAA 1B09A 2ZMKA 1AXZA 3U4XA 3NV3A 3RMYA 4LBQA 1ULDA 3ZXLA 1UN1A 3BODA 2FHRA 1JBCA 4P9WA 4Q2FA 4Y20A 4YW4A 5T52A 1LJ7A 2NN8A 4WVWA 1V6IA 1N3PA 3WDVA 1GYKA 1SBFA 4DPNA 5IK7A 2OUHA 5EWSA 5GM0A 2NMOA 4YG6A 3B01A 4R9CA 4XILA 1D2SA 4FOVA 4YFWA 2GALA 5CAZA 4JRAA 1G9AA 1LOFA 1QNYA 3M3OA 1KJLA 2V5YA 1PZ8A 4ATEA 2A3WA 2GN7A 4CTEA 1QGLA 1Q56A 1S1AA 2WKKA 1AX0A 3B3QE 4FP2A 4K21A 3IN9A 1W6QA 3FUOA 1LU1A 2HYKA 1ENSA 1ULEA 2C9AA 3IPVB 1URXA 4Y1XA 2DTYA 2ZGUA 3OBTA 1WLWA 2D6KA 1S0FA 4XIOA 4YM0A 4PF5A 1QOOA 4XOGA 1AXKA 4NOTA 3DGTA 1HLCA 4M00A 3HMYA 5DXDA 3RG0A 1Q8PA 3N7MA 2WQZC 2ZGOA 3RQ0A 1GNZA 3M3QA 3WCRA 2NZ9A 2DVBA 2LALA 2RHPA 2A3XA 5T5LA 1NLSA 3UJQA 4YGBA 4FPHA 5DG1A 5DZFA 3AZVA 1WLCA 4K1YA 1OKQA 2ARBA 1G8WA 2CY6A 1H30A 4GXLA 2ZGQA 2ZGRA 3N7LA 5JOWA 3WHTA 3V0BB 2GDFA 2P2KA 4UW6A 2DVGA 1LOBA 1WD3A 3ILFA 5EYXA 5EYYA 2PHFA 1YYNA 2R0FA 2ARXA 1UL9A 1ULGA 3TB0A 5GZDA 3OYWB 2R0HA 3B00A 2ENRA 4KBBA 1WW5A 1CONA 1W6OB 3KM5A 1LODA 2P3KA 4AVSA 3M1HA 3A0NA 4K1ZA 4ASMB 3FLRA 1W6MB 2LTNA 1QOSA 4FQZA 4PQ9A 2EXJA 2R1BA 4C1XA 4XDQA 1LHUA 1NXD1 1YXWA 1HKDA 3AZWA 1N47A 1MZ6A 4FPFA 4FPCA 2A75A 2DUOA 4GALA 2VY0A 3NV2A 3I8TA 5E8AA 5T55A 4CZSA 4ITCA 1Z78A 3AP9A 2DVDA 1ENRA 3RS6A 3WNXA 1WBLA 3BIWE 3N3HA 2EIGA 2OW4A 4IQPA 3ZSKA 1MZ5A 2A6XA 3QCWA 3FFZA 1BYHA 3WV6A 5GJ6A 1ZA4A 4YZ5A 2A5ZA 4M3CF 4XJUA 5DUUA 5DUWA 3BTAA 2ZGTA 2ZHKA 4W65A 3HN1A 1VAVA 1APNA 1LESA 4Q1RA 1N1VA 1LEDA 1EPWA 2DWRA 1MS4A 2P34A 1UPSA 1DFQA 4LBQB 4XJ8A 4Y1YA 1DYKA 3AXEA 3ZXEA 1DBNA 5E89A 1LOCA 1V6JA 5GLZA 4WZFA 1QDOA 2P3JA 1PZ7A 2WNEA 3MPPG 3ATGA 3ZXJA 2NP0A 1MR5A 4YW3A 3WG4A 3H0OA 4SLIA 2WJSA 2ZMNA 3AZZA 2A6VA 2DUQA 2UU8A 1QKQA 4YZ4A 4BOWA 2JKBA 4TYSA 3Q9OA 4M01A 1S0DA 1FX5A 1W6QB 2VXRA 3AJYA 3WG2A 2YV8A 1CPMA 1FATA 1JW6A 1LENA 4FPJA 1LHVA 4XHBA 4XYXA 1N3OA 5IK4A 1G9FA 5KXEA 3A0KA 1GZWA 3AZXA 2TEPA 2DYCA 3D4KA 3JUUA 3LCPA 1LOFC 1GKBA 2VH9A 1W6NB 1SLAA 2GMEA 2P3IA 2OUJA 1UMZA 2R49A 2D6OX 4YGDA 5T5PA 1V6NA 4CRQA 3AYAA 1PZ9A 4YZ2A 3V64A 2VU9A 2WT1A 5H9RA 3WG1A 3N7KA 3OY8B 4PBPA 2AREA 1LHNA 3C2UA 3D6EA 1MVQA 2BQPA 4ZXKA 1GBGA 1DQ0A 2E51A 4P9YA 3O0XA 3VKLA 1SLIA 4K20A 4YM1A 1YRZA 5F9TA 1LOAA 1MS5A 3NV4A 2W08A 4R9AA 4DFSA 3M2MA 2AR6A 5IT6A 1FNYA 4LBMA 3AK0A 1MS3A 3ZXFA 4XTPA 2XG3A 3AFKA 3I4IA 5H9PA 3RMXA 2A70A 1YIFA 4LBQD 5KXBA 4BM8A 1LGCA 1KJRA 1TEIA 1W0OA 3A4UA 1MS8A 2ZA9A 4M3CA 4Y1VA 5GALA 3SNMA 1JOJA 4XBLA 1VALA 3GALA 5HCBA 5GLWA 2E53A 4FOWA 3N36A 1VLNA 1J1TA 1BZWA 3USUB 3ENRA 5GZCA 1IKQA 3ZSJA 4Y26A 1WD4A 5JLVA 3VKMA 1MS9A 2R1DA 2EAKA 1FV3A 2D3SA 1CPNA 1WW4A 4LBOA 1JN2P 3V0AA 1LOGA 4ZKTB 3ZYRA 1KDMA 4WV8A 1LCLA 1DHKB 2ZGKA 1S0JA 4LBLA 3UK9A 2WSUA 1A78A 3IMNA 4AVTA 1GANA 5SV8A 3RSJA 4I30A 1LULA 1VAMA 1S0GA 1AJOA 4XMAA 3VKFC 2D7FA 1W6PB 3UL2A 4XXPA 2ZKNA 4AGRA 3KQRA 1QDCA 3WG3A 4AVVA 4L8QA 4Y22A 3V65A 4GWNA 3PVOA 1I3HA 2A6YA 1V6OA 5E88A 4P14A 2NMNA 4Y1ZA 1G86A 2GN3A 1X50A 2GMPA 3WLUA 1G9DA 1AJKA 1C57A 2DU1A 1MS1A 1N1YA 1UZZA 1WW6A 4Z8BA 2YMZA 2CNAA 1AXYA 2ZABA 3OPZA 2CTVA 4GA9A 1DYPA 1CQ9A 4YLZA 2W68A 5T50A 3WDXA 3PVEA 1LGNA 2JJ6A 3FBYA 4U2AA 4HANA 3AP5A 3CNAA 5HCFA 5IUQA 1LEMA 4YFZA 5GLTA 3O12A 3IPVA 4UW5A 3T2TA 4XJAA 3VUOA 1LTEA 1AX1A 2DUPA 2WT0A 2PHTA 3M3CA 3OJBA 2D6PA 1KITA 3FLTA 3IM0A 1G9BA 5FREA 4Q8LA 4MYEA 3UJOA 3ILRA 3WDYA 1BXHA 1GZWB 2CL2A 3FLPA 4YM3A 5JOZA 1Q8QA 2A6WA 2B7YA 3RRDA 2Q5TA 1MS0A 1RIRA 4YG0A 1R1ZA 2DVFA 2E7QA 2PHXA 4HL0A 2PHRA 4Y20B 1U0AA 3MW4A 1DZQA 5CBLA 4FOQA 1ULFA 3GNEA 4GWMA 3V0BA 2E6VA 4YW1A 2VUAA 5GLUA 3JU9A 4F83A 2NYYA 3B9CA 3SITA 2UWAA 2A71A 1DQ2A 2CWSA 1V00A 1IS5A 3AYDA 1OQ1A 1WBFA 1JHNA 2ZGMA 4BQ1A 2EXKA 2FMDA 3BOPA 2EXHA 3SH3A 2D44A 5LK5A 1V6LA 2ZGNA 2D3RA 3SH4A 3AP4A 1AX2A 1JYCA 1W6OA 5FRAA 3AJZA 4DRVA 2I2SA 5H9SA 1SCRA 4YZ1A 3O0WA 5CA6A 1IS6A 3W59A 5JVVA 5IK8A 1H9WA 3POSA 4GKYA 3ZSMA 2SLIA 1N1SA 2ES3A 2AUYA 1KQRA 2DVAA 3O5SA 4ISQA 1IOAA 1KDKA 4AWDA 3FUQA 2DTWA 3M3EA 4JCKA 4Q26A 4BLIA 1UZYA 1GICA 1RITA 1WLDA 2DU0A 3HR9A 3POWA 4P9XA 3ZSLA 2ZGSA 4FPEA 3MW2A 5JOYA 1AVBA 4R9BA 2JDZA 1IS4A 2D6LX 5BYNA 1IS3A 3OBRA 1FNZA 1H9PA 4XBQA 5HCAA 2JECA 2D6NA 3ASIA 3V0AB 2P37A 4DQAA 1MACA 2ZAAA 2V73A 2CWMA 1Z0HA 3MEPA 2VW1A 2XB6C 1N3QA 1ULCA 1GSLA 2KM2A 2H0BA 3AP6A 3LSEA 4PBOA 5KXDA 2A3YA 5T5OA 1QU0A 3IKWA 4Y22B 4XXAA 4XJWA 1UKGA 1KRIA 3OGGA 4OZXA 1SBDA 1LOEA 1UX6A 4BLJA 1A3KA 2G4IA 2YXSA 3R05A 4R9DA 1DIWA 1LHOA 4Y1UA 2W39A 5CNAA 2ZZJA 3POYA 3ZPYA 1SBEA 5GZEA 4YW2A 5IK5A 1Y7BA 1QF3A 1V6MA 3AYCA 1W0PA 5GLVA 4YGCA 4YM2A 4XTMA 3N35A 1IKPA 3APBA 1D0HA 3PJQA 1F9KA 4LBKA 2W52A 1SLTA 4RA0A 1QNWA 2R16A 3AP7A 3ZYPA 5GZFA 2ZGLA 1I1EA 1DGLA 1C1FA 1ZM1A 1GV9A 4FVVA 4UW4A 5T5JA 4AGVA 2D43A 2OVUA 1CN1A 2WSVA 2DURA 4C1WA 2ERFA 3MW3A 4M3CE 2VW0A 1SFYA 1W6NA 1HQLA 1WUVA 1JUIA 3VV1A 1SLCA 2AGSA 2VW2A 4PCRA 2GNTA 1GZCA 1CJPA 2D6MA 3NWKA 3ZVXA 1A8DA 3WDUA 3L2YA 3SLIA 3D5OA 1GZ9A 3OY8A 1GLHA 1LGBA 1HQWA 1DQ4A 5CB7A 2PHWA 1CIWA 1YI7A 2C5DA 1C1LA 1SCSA 2CYFA 2JE9A 3B69A 3SISA 1ENQA 3T1MA 4Q1PA 4ISRA 2AH2A 1G9CA 2JD4A 4LBNA 3AYEA 3TAYA 3T1LA 2YZ4A 1Q8VA 4XMIA 4Q27A 4FPOB 5DG2A 2EF6A 1C4RA 4YZ3A 1LECA 3NV1A
chains in the Genus database with same CATH superfamily
1PGW2 3IAQA 3ZXGA 4CCMA 2WLQA 1VBB1 4Q4W2 4QPIA 1SLBA 3GJAA 1C5HA 4QM8A 4UF0B 5J48A 1GQHA 4JC1A 1AF9A 1S0EA 2WO1A 1ONAA 3AZYA 2AENA 3HNMA 1UQXA 3ABZA 4XJ9A 4B1MA 3NJZA 3USUA 4WVZA 3F2ZA 3AXDA 5H9QA 3TEWA 4Z92B 1JXNA 2JD9A 1W04A 3OD4A 3T0AA 3UV9A 4IV1C 4NO4A 4AEDA 2EA7A 1BBT2 4ZXEA 4Q8KA 3POJA 2YY1A 4CEYC 4OULA 1X36A 3ZFEA 1XXNA 5C3QA 2GNDA 4XAEA 1FYUA 3LEGA 3HQXA 3T4HB 2JX9A 1DQ5A 5F3CA 4E8CA 2EALA 3PHMA 1UOFA 3UKNA 1F5FA 2AEZA 4FI9A 4L11A 3KCYA 3TRSB 4ZZ5A 4FPYA 4O61A 4HPKB 4X8NA 1HDKA 1MVEA 1V6KA 1WMDA 2OQ7A 2Y6LA 4ORFA 4C0HA 3VKOA 4NRMA 1VIWB 3LSDA 5IWFA 2ZHMA 3VDAA 4NMIA 5B2GB 4CDUB 4XBNA 4AVBA 1CAVB 1QOTA 4AI3A 3WDWA 4CDXC 2YC0A 4COWA 1XYOA 1BQPA 2J1VA 3AB0A 2SBAA 4NRQA 4AFCA 1SDDB 2VZUA 3FHAA 4U36A 2VBBA 1EYBA 3TWIA 4DRRA 1F4HA 4PDWB 2ZACA 1T6BX 2ARAA 4NROA 1OFSA 4WZCA 1XB9A 4HKWA 1VMJA 1D4M2 1PIV1 1AR91 2HWB3 3H7YA 3LDBA 2Z4FA 3UGGA 4XIKA 4BQ5A 4AZZA 4X6RB 3O1VA 1XQNA 2VM9A 3VZKA 2GC0A 2FBEA 5JI9A 5DUVA 2BV4A 1Q8SA 2WNUB 3PMEA 1Z7S1 3WF3A 4DZGA 4QQLA 1XNAA 2DCZA 2GNBA 2VQUA 1GUIA 2XLGA 3NJYA 3WP6A 3ZM8A 1BK1A 1Y43B 1UAIA 2XJSA 4RQPB 3VDCA 3ZXKA 4E9KA 1X8EA 4FTBA 1OOPA 3NV3A 2P1BA 4RR3A 1J3QA 3RMYA 1ULDA 1AYN3 1UN1A 4P9WA 4N7IA 4Y20A 1RUE1 2IVJA 5FY9A 2WZ8A 3ITQA 2F17A 1N3PA 4WVWA 2PMWB 5GM0A 5LBBA 1EY2A 4XILA 4R9CA 5KBFA 3I2GA 5FYCA 2GALA 5FXWA 2PQSA 1LOFA 1QNYA 3CKHA 1KJLA 4Q4X1 2O8OA 4Y4RA 4P08A 5DAWA 2A3WA 2VMCA 2E31A 3CJIB 1QGLA 4HLTA 1RB8G 1XNCA 2OX0A 2WKKA 3VD4A 3WP3A 4IEVA 4LHKA 2HYKA 2XUEA 3HBZA 4LO4B 1PM4A 1VR3A 2VTFA 3G6JB 2XBO3 3LB9A 2DTYA 4IE0A 1WLWA 2D6KA 5FZ9A 1S0FA 2P6CA 3K48A 4OUEA 4PF5A 2WZR1 1QOOA 3AKSA 1J1LA 1E5SA 1X33A 2WWJA 5FBZA 4EV0A 5FFOC 1JOBA 1W05A 2V72A 3P3NA 2WFF1 3RG0A 3LAGA 2ZGOA 1XE7A 3ACHA 2VZPA 1GNZA 5A32B 1ZREA 5A33B 3HN3A 2NZ9A 3NW4A 4GIQA 2LALA 3C7FA 4E4ZA 4MHRA 3KGLA 4AEDB 3N9NA 4UBHA 1PGL2 1RJ7A 3UJQA 4YGBA 2WNVA 3THTA 5DG1A 3ZLIA 2Y26A 1YQ8A 2VZTA 3ZFEB 3AZVA 1R1A3 1TNRA 1WLCA 1OKQA 3MPBA 5LA2A 3ZXJA 4B1LA 2ZGQA 2JE8A 2KXLA 2D97A 4BXSV 1VPHA 2D98A 4IV3A 1QJFA 4LK6A 2V09A 2ZKLA 1F5JA 3IAPA 3QD6A 4YVSC 2B45X 2Q30A 1ULGA 1YQCA 2HWB2 4COZA 2FQPA 1H2KA 4KBBA 1WW5A 3BTYA 5A7QA 3ZN6A 1W6OB 1X82A 3THPA 2P3KA 3M1HA 3OEAA 1RUG3 4K1ZA 4ASMB 3FLRA 2LTNA 3E5UA 1QOSA 2I74A 4JV4A 3TN93 3IDEA 4FAGA 1ASJ1 3GM8A 1YXWA 4KWKA 1UPIA 3FL7A 4FPFA 3JQXA 3N9LA 4FPCA 2A75A 3RI8A 3T30A 2VY0A 3J8F1 3I8TA 3VBRC 5BY5A 3ZPOA 5DABA 4F8AA 1HQNA 4UOJA 3S7IA 3E6CC 4QKNA 2RM21 1MZ5A 2A6XA 3NAPA 4XFIA 2WL1A 1BHGA 1BYHA 1OD3A 2XR4A 3DYPA 3FFZA 5CIRA 1R64A 4D6SA 1ALYA 2BZDA 2ZGTA 4HVRA 4V2WA 3RZGA 2WDBA 4MX3A 3HN1A 2PHDA 4QX3A 4UFKA 2VVFA 1LESA 1OOPB 1AL23 3WEZA 5IATA 3VZNA 2QUOA 1ZZ9A 4XJ8A 4XUPA 1BEV3 3ALQA 1J58A 1DYKA 1RUH3 3CZUA 1Q43A 4Y1YA 3ZSEA 4CP9A 3AXEA 2XBO2 1PO13 4Z1VA 5FYYA 3S6PA 1DLCA 2I45A 1XC6A 4W6XA 1OXCA 3H0OA 4W6YA 2WJSA 2ZMNA 2VAUA 3AZZA 2EIEA 3I3MA 1IQAA 2DUQA 2UU8A 4JGZA 3FE5A 3NQHA 1Y9GA 2GP5A 3Q9OA 1H6YA 3K4DA 1O8PA 2VXRA 1JZ4A 1WA4A 3WG2A 2XUMA 2YV8A 3VBUC 1RHI1 2VOKA 1NCQC 5FP8A 2GZWA 3DECA 2GAUA 1B35C 5FZIA 3WD5A 3V56A 3MF9A 1REFA 1R1A2 2KD7A 1G9FA 2WO3A 4META 3WF4A 2J22A 2PYTA 3A0KA 4RHV1 3AZXA 2TEPA 5AVPA 3D4KA 1NY71 1KEXA 3WNPA 1Q3EA 5F6LB 1GKBA 1CJDA 2GMEA 1SLAA 1PO23 1I9RA 2VNOA 1UMZA 3CJXA 2R063 1XRUA 4NHLA 1XNBA 2D6OX 3A22A 4Y5SA 5F3EA 5IJRA 4CCJA 4YGDA 3T0DA 1I5ZA 3PU3A 1V6NA 4JZRA 1DGRN 2ADDA 2LS6A 1PZ9A 3GZTB 1VBC3 3MFCA 2WT1A 4D6RA 2WYSA 2WO7A 1RUG2 3ZFFB 4H3WA 3C2UA 2MNGA 4AR2A 3TN92 1UW8A 2VUCA 1DQ0A 2W0XA 3T2QA 4C0BA 5D2AA 2PFWA 1C3HA 4NR1A 1LOAA 5BUVA 4IETA 1UYPA 5D8AB 4DFSA 3KV6A 4XFBA 5BNNC 2VNRA 4N9HA 4LBMA 2RS11 3AK0A 3Q8BA 1R083 4XTPA 4FFFA 1JZ6A 5A6ZA 3AFKA 4QU1A 5H9PA 3H3UA 5EJ3A 3RMXA 2VBPA 1JTZX 4DUWA 5DAVA 2Q8CA 2VZ1A 1KJRA 1D4VB 5GALA 1MS8A 1HRV1 4IGPA 5BNPA 2WO2A 5HCBA 3K4ZA 3MHZA 3K3NA 3PU8A 1J1TA 1GWMA 3IMMA 1H2LA 5K0UB 3BKZA 3ZYHA 1BZWA 4KH9A 1CGPA 1XNTA 1O8SA 3BPSA 1K5JA 1HXS1 4UFMA 5IVYA 1AL22 2VG9A 2J1EA 2QQPA 1QJEA 3JXSA 1UD1A 1SFNA 4DUXA 1CPNA 1WW4A 1BEV2 2RS53 4LBOA 1RUH2 3CIHA 4WV8A 1LCLA 2WWUA 1PO12 5A7OA 5FMOS 3E1F1 3P6BA 3WX5A 3NAPB 2P6HA 4OMDA 5IAXA 1GANA 4FFGA 3RSJA 3EXUA 5EJZB 5CISA 2FDIA 1VAMA 1AJOA 4NJ4A 5FBJA 4J25A 4JRLA 3UL2A 2X09A 2ZKNA 1M4WA 4XXPA 3ZXDA 1O6UA 1QDCA 4AGRA 3RZJA 4YARA 3RI9A 2IVIB 2XXZA 4L8QA 1U12A 4QQHA 1QQP1 1ZZ7A 2VZQA 2VO5A 3PVOA 3SHRA 3SQOA 2A6YA 4MSVA 4P14A 1OBNA 1O3TA 2WQ4A 5JXIA 3RZKA 4W6WA 2ZX3A 4YVWC 2GMPA 2XGXA 4CCLA 2KA3A 2W94A 1N1YA 1OLMA 3QOPA 4UI9L 3SKJE 1WW6A 5FLHA 4PJYA 3OPZA 4LIVA 1OQEA 2WLPA 1DGWX 1PO22 2CDPA 1LGNA 4QDSA 2R062 4U2AA 3H8RA 4JGZB 1RJ8A 3WW2A 1UOGA 4Q0UA 5I0UA 4YFZA 1MZEA 3I3BA 2VZOA 5GLTA 2LUWA 3VBFA 3T2TA 1W8OA 4XJAA 3QH7A 1RUC3 1UXZA 3WNLA 5CG9A 4XCBA 3RDIA 3CEWA 1KITA 3GHMA 1H8TC 2AC1A 2CL2A 5FV3A 3FLPA 4YM3A 1RUF1 2A6WA 2EICA 4OCTA 1L7LA 3RZHA 1MS0A 1RIRA 1QJX3 1R1ZA 2Y60A 4YG0A 4AHYA 3U0ZA 1T6GC 2E7QA 3BGAA 2FDHA 1R082 1Y9QA 3KWVA 4AI9A 1DZQA 3BOWA 2Y6GA 1ZZBA 5C9AB 1FOD1 1PK6A 4L9BA 5CYYA 4YW1A 4PI0A 2WN2A 3JU9A 4MGSA 5JSOA 3VBHC 3B9CA 3GDBA 1VBD1 3AYDA 3I3EA 3NSTA 2CWSA 1V00A 1FPN1 4ZONA 5F5IA 2DCYA 2JG8C 2ZGMA 2XH6A 3RNSA 3WW3A 4AG4A 3NNGA 1U5ZA 2FMDA 4QHBA 3IB3A 4BQ1A 3E97A 1PX4A 2ZGNA 3WSOA 4RR3C 1XNDA 1AX2A 3ZMOA 2BVBA 4Q0VA 1XJAA 2QNKA 2I2SA 1WCKA 1IPJA 3FJSA 2RS52 1WCQA 3BALA 1AR83 4LHSA 3W9AA 4BE3A 5IK8A 2W5FA 2BWAA 4O65A 3ZSMA 1N1SA 3O5SA 5FR3A 2Y33A 5FY7A 1XE8A 2WINB 3WR0A 2JKXA 4KQ7A 4P5YA 3B94A 4Q4Y3 1UZYA 4DOUA 3HR9A 4P9XA 3MIGA 1COV3 2CSGA 1TE1B 4XW3A 3RJ2X 4FPEA 3IT8A 4XAAA 3SKVA 3FFQA 4AI1A 3VBOC 5AC93 5JOYA 4LLOA 2JDZA 1IS3A 5LA1A 4CDXA 3GGLA 4NUBA 3N9OA 5HCAA 2JECA 1LRHA 5JAXA 3ASIA 3MI8A 2XQXA 2V73A 2PA7A 2XVLA 5JIUA 1Z0HA 3U1XA 2Z69A 3WNMA 4K3UA 4QQOA 1TMF1 4RGAA 5IFTA 1IPSA 1GSLA 1HV1A 2BU9A 3ZFGC 2KM2A 2ZAHA 1ZA7A 1E57A 5KXDA 2A3YA 2VOVA 5T5OA 4PIZA 3J9SA 1HRI1 1PM7A 4A7ZA 2FDGA 3DYOA 4D0QA 2RG4A 5J3UA 4Y1UA 2K46A 4IV3C 5CNAA 4Y33A 5CEHA 4J1XA 5BNQA 4L99A 1V9U1 1UCXA 4C90A 1ZRDA 2BJSA 3T3YA 1V6MA 5KC6A 4I0WB 4IE5A 4YGCA 3HQRA 3NNLA 3N35A 4RFT0 4XTMA 1YIPA 3PNAA 1ST8A 3MYXA 5FJHA 4LBKA 2W52A 4QKFA 1VP6A 1UYXA 2R16A 2ORXA 4HK8A 4LPLA 4CA9A 1GV9A 4AGVA 4SBVA 4UW4A 4QGLA 5T5JA 2D43A 2Q0AA 3FWEA 4CPBA 3ACIA 4C1WA 3BTXA 5E16A 4NIAA 3JBG1 1NAEA 3KZ4C 5C8CA 2GC1A 2XJVA 4AK3A 1HQLA 2HEWF 2VE1A 4BWOA 2GSYA 4HK9A 3UGFA 4FXGB 5T3NA 3NWKA 5L9RA 1UIJA 3I2KA 3USSA 3WDUA 2Y0IA 1RUD1 3D5OA 3CL1A 1GZ9A 5F7UA 1WCDJ 3KF5A 4TXWA 1VBE1 3HNYM 2HEYF 1AR82 5CB7A 5A3LA 1E5HA 3R4DB 4DXSA 1SCSA 3SXWA 3T1MA 3TNQA 2XONA 5CKNA 5LK7B 4Q1PA 4ISRA 3WQ1A 1O3SA 5F2SA 3K46A 5J09A 1G9CA 1S55A 4Q4Y2 3ORJA 1EAH3 5L9VA 3H3LA 1COV2 4NPLA 2PQQA 1QJU1 2YGLA 1PMJX 4IV1B 4AXOA 4RGGA 4DINB 5AC92 4XJZA 1OD5A 1BJQA 4DY5A 2GC2A 2GMMA 1ZVFA 4CEYB 2OZ6A 3CU7A 3MICA 3PUAA 1CESA 4BCUA 4FPLA 1TME3 5GZGA 1YQ5A 4UYBA 3WHUA 2VOTA 3KV9A 4DS0A 1OLME 2XHKA 4FPKA 2RJLA 1NE6A 4AHWA 4KL1A 5F5QA 5ABJC 1SFPA 4XFCA 2BP6A 4XZPA 2ZHNA 4MADA 3K75B 2JG9C 3B5LB 4CDXB 5FPLA 2VCCA 1RVF3 4RD7A 5BV6A 1GU3A 2RJKA 3AMMA 3IIAA 4N9IA 1C8NA 1DQ6A 3LEKA 1XNKA 4BYYA 1C28A 2HWE3 3PUIA 1W6PA 5FP9A 3D8CA 3Q8EA 1M06G 3VBRA 1WCSA 2ZBJA 2A7AA 3MUZ1 2B4KA 2BFUL 2QDRA 2W46A 4YG3A 5FKBA 4XE9A 3S57A 5JOXA 3OEBA 1RMU3 5IVVA 1G6NA 1PMHX 2Z42A 4MZUA 1WW7A 4NRPA 4TLGA 4UFLA 4EQVA 2VD7A 4KU7A 4XUTA 2WS91 3RPQA 1O3QA 4CUBA 3SH5A 4BPZA 2PHUA 5L73A 1RUI3 4JTOA 5AFEA 3HT2A 3K77A 1GP4A 2XOMA 4KGQA 3G7DA 4COVA 3HWJA 2ZGPA 1REEA 1IHMA 3NJXA 4OZOA 3ILNA 4X6QB 1UZ0A 1NE4A 5FZKA 3WF0A 4IEQA 3O1PA 1UZWA 3J7LA 4LJHA 4D7SA 1SACA 2WR9A 4ATFA 1O4TA 5LB6A 1ZBE1 2DV9A 2ETEA 2VQ0A 5JMOA 1S0IA 1EV13 3W58A 5TSWA 2FCVA 2PELA 3PMSA 4XHXA 4YGEA 5FZBA 3WCSA 1CR7A 2QQJA 5BNPC 1LHWA 3R4SA 4LOTA 3MIHA 3KVBA 1QMJA 2R073 3AFGA 2JDNA 4W50A 1EAH2 3ROUA 2V4AA 5FOBB 4KWUA 4Q2FA 4EWEA 5C4WC 4HVOA 3VBUA 2AACA 1V6IA 4LHLA 1NCQA 4JDNA 4DPNA 5IK7A 4HG6B 2PAEA 4YG6A 2O8QA 1GP5A 5FO9B 5FUPA 1TME2 4FOVA 4YFWA 4DMIA 5CAZA 3PLQA 4XUOA 2C0ZA 3LWCA 4LO5B 2OA2A 1VB2A 4K21A 2HH9A 3KD4A 4L0PA 4AAPA 4QT6A 4PQQA 4WBBA 1LNSA 4NWWA 2UYAA 4NHKA 4QQPA 4DNYA 4Y1XA 3VD7A 4DIQA 1NYWA 1RVF2 4XIOA 5FZLA 3U14A 5ABJB 3PURA 4LR4A 4QXCA 4CDQB 4NOTA 5FXVA 5LEJA 3HMYA 4AEJA 1JS9A 2HWE2 3FN9A 4BQWA 3N7MA 4FXKB 1K42A 3RQ0A 5FZGA 2DVBA 5BNNA 4YVSB 2RHPA 2A3XA 1XE0A 3RJRA 1JU3A 1NLSA 1W2OA 2H0VA 5FZCA 4QXKA 5I8SA 1EUTA 4YNIA 5JXGA 1S2KA 1JODA 4DUVA 3H8OA 4Q4V1 1RMU2 4JKMA 1REDA 4AFAA 3E5QA 4GXLA 1G8WA 1H30A 3V0BB 1GZTA 2WFPA 1H1AA 4Q29A 5BNOB 4XQDA 1RUI2 3D0JA 4UW6A 3JQWA 4BH9A 5BXXA 3ILFA 2TBVA 4D94A 5EYYA 4PLOA 1YYNA 1W06A 5GZDA 1W8TA 2VTXA 3KM5A 3NNMA 5F5AA 4CP2A 3C7OA 1PK6C 3OGSA 1EV12 1O5UA 2YGMA 5FQ0B 4FQZA 3BN6A 2G9FA 4B7KA 3OBZA 1W2NA 5IW0A 1LHUA 1W8WA 1HKDA 4LE4A 2R072 3UNPA 1N47A 1MZ6A 1O91A 2YBSA 1WA6X 1VE0A 3E5XA 2XJUA 4GALA 4OUMA 5E8AA 1QJZA 4CZSA 2JB4A 1VBB3 1JYXA 4EYUA 5C3OA 1ENRA 1VMFA 2EAAA 1WBLA 3BU0A 3BIWE 3N3HA 4IEYA 4YVWA 4IQPA 2IXKA 5FPAA 3QCWA 4NHXA 4BQXA 1NA1C 1ZA4A 3J7MA 2QJVA 2PLV1 3N4MA 4XJUA 5DUUA 3VL8A 1H4GA 3BTAA 4XF4A 1TQ5A 2F4PA 3U11A 2ZHKA 4XFHA 4Q1RA 2QQKA 2XDVA 4A3XA 1DFQA 3R0RA 5FTTC 1K12A 2IUWA 4XDOA 5FP3A 2D93A 2RMU1 3VBUB 3RYRA 4CUCA 1NCQB 3ZXEA 1B35B 1LOCA 4PLMA 3H7JA 5EJ1B 1QDOA 3ATGA 4A2UA 1H8TA 3WG4A 3NVCA 1JYNA 3NKTA 3OGVA 4Y5TA 2K0GA 2JKBA 3RWNA 2E7AA 3RGBA 2X5IC 1MEC1 2W1SA 4FT8A 1WGPA 4A6OA 4FFHA 4DXZA 4UFIA 1S4CA 2RJ2A 2XL9A 1CPMA 1FATA 3SCGA 1LENA 4FPJA 1LHVA 2Y38A 5FPVA 2GH8A 2VECA 5IK4A 3ZMNA 3HBKA 3VBHA 4IESA 3FZ3A 1GZWA 3JUUA 2YU2A 5JZGA 1GFF2 1JU4A 2JG8A 2Y8KA 5FYBA 4I09A 3ZKUA 2VH9A 1AR61 1AR93 1PIV3 1W6NB 2OUJA 1AL0G 2BGPA 4FCAA 4QD2A 3A23A 2Z5WA 3PUSA 1PHMA 5BNNB 4CRQA 4A44A 4MVTA 3DF0A 4CSWA 4YZ2A 4OLLA 1Z7S3 3WG1A 4MGKE 4EN8B 1O3RA 5FUNA 1UF2C 4G3YC 4XUNA 3OY8B 4PBPA 1LHNA 1JZ3A 4EN7B 1W8NA 3J7HA 4P9YA 5C8CC 3VKLA 1X8MA 2C4XA 3H3ZA 4YM1A 4OI2A 3BI3A 3E6DA 3VDBA 1PMIA 1RUE3 5B4XA 1YJKA 5IT6A 3VBOA 3W20A 4A3ZA 1JYTA 4MGYE 5LATA 1VBB2 4KG0A 5K7PA 2XG3A 1US3A 2A70A 4LKEA 4Z07A 5KXBA 2WYFA 5G04L 4AQSA 2JIGA 3OUHA 4QPIB 3SMHA 4AF9A 4M3CA 4NVPA 4Y1VA 3A4UA 4PIXA 4ZKTB 4Q4X3 4IEUA 4XBLA 2BW8A 1JZ8A 3GALA 2ZJCA 3ZIWA 3MLKA 2ADEA 4QMAA 2X53S 4HKOA 2XJTA 1OPOA 3USUB 4OHXA 1SHWB 4IDZA 4Y26A 3ZFGA 3ZX7A 4COYA 5JLVA 1JI6A 4YW7A 1FV3A 2D3SA 3CHXA 2NLRA 5DQ0A 1JN2P 1K45A 1LOGA 2WZR3 1KDMA 2W3JA 3H1WA 4Q0PA 1JMUB 1NKGA 5FMOL 1ND2A 5C33A 2WSUA 4WVMA 4UFHA 3IZOA 2WFF3 3IMNA 4AVTA 3UGHA 5LASA 3I7DA 5SV8A 2XVKA 4CPBD 4H14A 1UU4A 5A7SA 1NCRC 1NZIA 2QKDA 4EZ4A 3KQRA 4JKLA 4AVVA 3JCIA 1CZVA 4LKDA 5JXHA 4GWNA 1U5XA 1H2MA 1W8FA 3BB6A 1I3HA 1Q5OA 2Q8DA 2NMNA 1EPZA 5CFCC 2GN3A 1U5YA 3ES1A 4AFMA 1AJKA 4Q0SA 3LOBA 1W9TA 2J1TA 1PVC1 2W87A 4Z8BA 4YPJA 1QJY1 2CNAA 3OD0A 1DYPA 4OVEA 2IFRA 4YLZA 2JWPA 1PIV2 1AR92 1NQDA 2PN5A 3LIGA 3PVEA 5JPMB 3RZLA 1RC6A 4HANA 1AYN2 5IUQA 3S5QA 3JD71 2BOIA 3D82A 3IPVA 3OB8A 4CCNA 1LTEA 3THDA 4XZUG 3VD3A 1Z7S2 2BUKA 3VUOA 4CCEA 2VZ3A 3ZYBA 2WT0A 4CU8A 2Q1ZB 3RVHA 2PHTA 3M3CA 4EN9B 1ASJ3 1DZRA 2YHJA 4NIDA 5L19A 4AI2A 5IYYA 2VNGA 3I59A 3UJOA 1WCUA 3ETQA 1Y9MA 3WDYA 1BXHA 1GZWB 4PF1A 3J8F3 2ET7A 3MO4A 5DAPA 3ST7A 2DVFA 1RUE2 3Q8CA 2W2IA 2IFWA 1QEXA 4RR3B 4HL0A 4Y20B 2HWF1 4TN7A 2RM23 4URTA 1IG0A 4P9JA 2E6VA 4HT1T 1OLQA 1RXGA 5FWEA 3VZOA 3WT3A 1GOGA 4ARXA 4Q4X2 2E33A 4C91A 2A71A 1DQ2A 2LRPA 1BMV1 5SV5A 4G9SB 1WBFA 1CAXA 2VPVA 3BOPA 2E63A 2EXHA 5LK5A 3SH4A 4E2GA 3KCCA 1IG3A 5FY1A 4Q5OA 5GKAC 1AR71 1JYCA 3VBOB 3H42B 1JZ7A 2JG9A 1DU3D 3NL1A 5CA6A 3AKPA 1H2NA 1QXRA 3LPGA 1H9WA 5FZ1A 1ULPA 4GKYA 2AUYA 2J42A 2DVAA 3WNKA 1DCSA 1OF3A 4ISQA 2BOJA 4R4ZA 1VRBA 1SG3A 1KDKA 1ZZCA 2WFF2 2YFZA 3P3PA 3AMHA 4AWDA 3M3EA 4RN5A 5FY4A 3K4AA 1WLDA 3ZSLA 2ZGSA 1FI2A 1RHI3 1UXXX 5A3MA 3WF1A 1HX6A 4R9BA 3KHCA 1ZRFA 2B5HA 3ZN5A 5D21A 1FNZA 3ACLA 1NLRA 1YI9A 5FOJB 4XBQA 2WNVB 5C5TA 1UKRA 4RHV3 3U10A 1QH7A 5G05L 2VOWA 3QACA 1FMD3 1AYM1 3BVCA 4IV3B 4FBFA 2R30A 4K8FA 3MEPA 2EIBA 4KG8A 1GR3A 2QFEA 3LA2A 1OVPA 3L9JT 2VQAA 4E2QA 5FJKA 3D0SA 3AP6A 4GJZA 3OBAA 4PBOA 5KC5A 4QPYA 3OG2A 4P9LA 1CAUA 4XJWA 5A7PA 3PTYA 3ZN6B 3OGGA 3LDKA 4OZXA 1SBDA 3GBFA 4BHPA 5ACA1 5I8TA 2YXSA 3PTRB 3R05A 1ASJ2 5F8PA 5ANQA 4Y4YA 3POYA 1SBEA 5IK5A 4YW2A 3TNPB 5IAVA 5I91A 4ONUA 2YU1A 4H2AA 3TEXA 3J8F2 3EB7A 2VNVA 2RS13 1W9FA 5FZFA 2BWCA 4BIFA 5A3PA 1D0HA 3PJQA 2L9LA 1F9KA 5C4WA 3VGIA 5LY1A 1NUKA 1SLTA 3KT7A 5FZ0A 4CDWC 1VBA1 2RM22 1SMVA 3ZO0B 1DGLA 3T09A 2YC4A 3EO6A 3PDQA 2R041 4GH4C 4B29A 1W9YA 1UU6A 3O1OA 4TSVA 5DAQA 4I0BA 4K7JA 1XPWA 4M3CE 4ES9A 5IVJA 1HXS3 1WUVA 3VV1A 2AGSA 2VVDA 3HNBM 2YB7A 4PCRA 2Y6FA 2ORZA 5APAA 5CG8A 2HWC1 2WABA 2IXJA 3H1YA 4XF3A 3A7QA 1POQA 1RYYA 2WWSA 3OCPA 2IXCA 4QX7A 4D3WA 5M0TA 2BBAA 3I3DA 4CP9B 2HWD1 3QBQA 4IXLA 5IHRA 1S2EA 1UY3A 3WQBA 3MLLA 1DQ4A 2PHWA 1CIWA 2B8MA 4EROA 1ODNA 2AEYA 2V4VA 2DDUA 4QU2A 4QHOA 3WNNA 2VCMA 2RR11 2YG0A 2IZWA 2WN3A 4I01A 4PLNA 4XF1A 1YCIA 5F5CA 2JD4A 3DXUA 3N9MA 2W9XA 1J3RA 4TTGA 1C4RA 1RHI2 1UOBA 4NE9A 3NV1A 4K40A 2YROA 5FYUA 1HV0A 2YDEA 1VBC2 3WOGA 1DLLA 5FLIA 5C6CA 2X8KA 3KQ4B 3LOIA 4RL7A 1DQ1A 2JG9B 3HJRA 4KMQA 2B9UA 4QX0A 4RHV2 3WNOA 5HI0A 5A70A 1NY72 5A3OA 3UT0A 1FMD2 3ES4A 1GOHA 1BK0A 4QX5A 1HIXA 4OI1A 4BMBA 4M4PA 1SLLA 1BLZA 1JOPA 5JDBA 1E5IA 4FQ4A 3GZAA 4CCKA 3RYPA 4IUGA 1HB2A 4LLFA 4MGQA 4Z2AA 2DCTA 5FZMA 5DDJ1 5KHKA 1O4YA 4TZDA 1BVVA 2Y0OA 3GHNA 2QZ2A 5C3PA 2ZOEB 1ZBA1 4N90A 2QQOA 4FOYA 3O0VA 5JZGC 1YQ2A 1BVP1 1L7QA 4QX1A 1RUF3 2PXJA 4UXAA 5E1RA 4N53A 3LKJA 3POGA 1VRH1 1K5MC 3OYWA 2XLAA 4BMEA 1FV2A 1PGSA 2RS12 3DUIA 3WZ1A 3C3VA 4JGYC 4BZ4A 1FOD3 1UY4A 2JE7A 2NM1A 2UURA 4XFAA 4AGGA 2CGNA 2VQTA 4CVUA 2AYHA 3KHBA 1CAUB 2W91A 5EFUA 1VBD3 5DUXA 1YO8A 1FPN3 1OFNA 3OUJA 4GB31 1NA1A 4OYUA 4V1PA 4DXRA 1OH4A 2A6ZA 3VLBB 4EJRA 5BNPB 3ACGA 1OQDA 2O1QA 4LBJA 4MGZE 5DZEA 5L9BA 2TUNA 1HXS2 1LU2A 3WDTA 4H55A 4BXFA 4YW5A 3UKTA 2N7GA 4YW6A 4Q4Y1 2YFUA 4FPGA 3AL5A 1JYIA 1QIQA 2VCAA 2PAKA 1Q8OA 5C4WB 3WUDA 4Y24A 5LA9A 2PHLA 5FYVA 3POIA 2Y34A 4WVVA 5FK7A 5L36A 2ILMA 2ZMLA 5I8YA 4GMP3 1GNHA 1FAYA 3F95A 3I2FA 3N7JA 2WT2A 3MGUA 2GC3A 5EXOA 2XHNA 2BGCA 3AKQA 1Y4WA 4QB1A 1J59A 4NWVA 4P5HA 2IXLA 2ZMKA 3FMGA 2XWBB 4L92A 4I0AA 2C26A 2X5IA 3PIGA 3ZXLA 4YW4A 1UU5A 2FHRA 5EZWA 1RUOA 1ZRCA 1QXJA 1TVGA 1RUC2 3WDVA 1GYKA 1SBFA 1W99A 3KCXA 3HD8B 2OUHA 1WKYA 1ND2C 1H6XA 3LD8A 2VZSA 1TMF3 4HSJA 5AFBA 4AFDA 1IZ3A 1WWYA 5I0RA 5FYSA 1QXPA 1E5RA 2GN7A 4AI8A 4Y5Z0 3B3QE 4FP2A 1QJX2 3IN9A 2BYVE 3FUOA 5FPBA 3W5NA 2ZS6B 1ULOA 2ZZQA 2BVVA 3HVDA 1HRI3 3KF3A 4KU8A 1FT9A 1LKNA 1ULEA 5FMDA 3VBFB 4MGIE 1URXA 1ZRRA 2ZGUA 4XUQA 1KFXL 1C8M1 4YM0A 4F7ZA 5FP7A 1V9U3 4CXXA 3MBWA 4AEKA 5CKMA 1AXKA 2VL4A 3DGTA 1RUF2 4B8EA 4QPGA 1H1IA 1Q8PA 4EE2A 4ZPIA 3LFMA 4FO9A 4DY3A 3WCRA 4I2OA 1EUUA 1W8UA 2MEV1 1NZCA 1XYNA 5FZOA 5FO7B 4LE3A 4P9IA 1FOD2 2WZPP 2Q4SA 3KV5A 2GH2A 2QQLA 4FPHA 4PIYA 5DZFA 1WZXA 4K1YA 2ARBA 1PK6B 4RS5A 1VBD2 2JDHA 1ZX5A 2ZGRA 3MV01 4MXWA 3WHTA 5JOWA 1FPN2 4GQ7A 4EWAA 2P2KA 5CFDC 1ND3C 5J36A 2JEMA 1D7PM 2VJXA 3VBSC 5K0UC 2DVGA 3H9AA 1R091 1WD3A 4RYDA 4OUSA 5F37A 4KNCA 3TB0A 5FUIA 3OYWB 1RUD3 2R0HA 2ENRA 1SQ4A 1UYZA 1VBE3 3U4SA 5HV0A 2DFCA 3A0NA 2K9ZA 5FIXA 5HBAA 4CCDA 3T4VA 5IVFA 5EQUA 3DL3A 3U78A 1YUDA 2J1SA 2R1BA 4XETA 4C1XA 4XDQA 4OHYA 1CAWA 1YLLA 5LY2A 2ATFA 5LZ6A 1GNYA 3EJKA 1NCRA 1QJU3 2DUOA 5A7NA 2OPWA 3C7EA 5T55A 4GAZA 5HXVA 5A3NA 3AP9A 1RUJ3 2DVDA 4ZY9A 3GBWA 4LUMA 2Y6JA 2VMGA 1OURA 4WM8C 4XC9A 3VDDA 3WNXA 4LULA 2C9KA 2Q8OA 5C7GA 1J83A 5CFCA 5I0SA 3DN7A 3C7GA 3GZUC 4I3GA 2A5ZA 1TMF2 4H7LA 4LIUA 4Q0QA 5LEKA 1TG7A 3CBNA 3B93A 4JHZA 1IPKA 4GZ9A 1APNA 2FD8A 5F6KA 1MPXA 1N1VA 2DWRA 1EPWA 4BQ3A 1MS4A 2G9ZA 2P34A 1NXMA 1UPSA 5A80A 1HRI2 2X5IB 4XQWA 2W1UA 3EBRA 3UETA 3WQ0A 5LRSA 2VMDA 3VZMA 5JR2A 1POV1 1OLRA 2QQIA 1DBNA 5E89A 5KHGA 1V6JA 4NHYA 1RMU1 2O14A 5GLZA 2P3JA 2RS31 3UKVA 2NP0A 1V9U2 3MPPG 3EQEA 4QWNA 3I97A 1W8ZA 4YW3A 1NG0A 4SLIA 5F1RA 4LNVA 1QKQA 5FWJA 4BOWA 4JAAA 2ZX4A 4TYSA 4M01A 1S0DA 1FX5A 3LZZA 5FZ7A 1JW6A 3DYMA 1DGWA 2WS93 1PGW1 4XHBA 1L7RA 3DPRC 3LEMA 4A6SA 4XYXA 1N3OA 3ETPA 4Q4W1 3O1RA 5KXEA 2QZ3A 4PI2A 4D8MA 1XU2A 2DYCA 1A8MA 3LCPA 3GZEA 2KR2A 3I3QA 3RWKX 4M0HA 3SCFA 3OTFA 4COUA 2J1AA 5C8CB 2R49A 3WINE 1QWRA 2ZXQA 3HQUA 2R071 3OUIA 2IWGB 1ZBE3 1RUD2 4QHZA 4H7MA 3RZZA 4AI0A 1BBT1 5FY8A 1VBE2 2VU9A 5H9RA 2ZEZA 5C71A 1W2AX 3ZDSA 3CZJA 3DKWA 4A42A 1LR5A 3D6EA 2Q1MA 2C24A 2BQPA 4HPKA 4ZXKA 2HBUA 4JTNA 2RDQA 4IW3A 2ID4A 4QB6A 4K20A 1JYVA 1YRZA 5F9TA 1MS5A 3IIIA 3NV4A 2W08A 1UMHA 3THCA 1QJU2 4R9AA 2J1UA 2AZ5A 5HCHA 1FNYA 1MS3A 3ZXFA 3MIBA 1RUJ2 3KMHA 4CXWA 5JSPA 4LBQD 1X9TA 1OA4A 1LGCA 1TEIA 1W0OA 3BU7A 2ZA9A 3SNMA 4NPRA 4HMZA 1JOJA 1ODMA 1VALA 2WBKA 4HONA 5GLWA 3VBHB 4PDWA 2E53A 3M8LA 3PUQA 4FOWA 3N36A 5IVEA 4JX0A 5LA0A 1YFWA 1MQTC 1CAWB 1V70A 3ENRA 4YWAA 1W2UA 4DXTA 5KWRA 4XF0A 1WD4A 2DCJA 4J6GA 1NCRB 3VKMA 5IVCA 1MS9A 5JI7A 2CDOA 4NPMA 1D4M1 4BU2A 3GCXA 3NKGA 5FPXA 1HJGA 3OPTA 4OQ9A 2P17A 1ACCA 3V0AA 4CYDA 2VMHA 3H8UA 3ZYRA 3I2IA 4MG2A 5JCTA 4ZS2A 5JIAA 4LBLA 5CFCB 1HB3A 2JDMA 2OT7A 1D2QA 5C5UA 4A45A 4I30A 1OUSA 1HN0A 3VKFC 3TEZA 1W6PB 2XJRA 2R6QA 3ZXAC 5A3TA 1OA3A 1DZTA 3VBRB 2IXHA 3V65A 2O0OA 4INDA 3POFA 4DB5A 4Q4V3 1JUHA 3UYJA 3ZDVA 1PNGA 3T2OA 2BNNA 4CDWA 1ZNPA 2DBNA 3AVSA 3WLUA 4GH4A 1G9DA 4QKBA 2DU1A 2DCKA 1MS1A 2WQ8A 4A4AA 2LW8A 1JZ5A 2YMZA 1AXYA 2HJIA 2ZABA 2CTVA 3CJIA 4N53C 4GA9A 4RGKA 1CQ9A 3WY6A 3KS7A 2W68A 5T50A 3WDXA 1L3JA 3AP5A 4UAPA 3CNAA 5HCFA 1ZBE2 2CGOA 4HBNA 1HJFA 5F3IA 3O12A 2OQ6A 4K9SA 4UW5A 4E8DA 4LK7A 2OZJA 4MOAA 3DCQA 3OGRA 3FLTA 3IM0A 1G9BA 4AVAA 4MYEA 2ZX2A 4NHMA 4TWTA 3POEA 4HN1A 5JOZA 5A32A 3RZMA 5A33A 2B7YA 2QQVA 3OOXA 2XJQA 3RRDA 4E27A 4M4RA 3H50A 2P3YA 2HBTA 1WMEA 1O59A 3BTZA 2PHRA 2BGOA 4L97A 3MW4A 3NNJA 4MLOA 5CBLA 1PGL1 1ULFA 2B42B 3GNEA 3K3OA 5C3SA 2JDPA 4F83A 3CF6E 4Y3OA 2PLV3 2NYYA 4W8JA 3ZKYA 3SITA 1AUYA 5DAXA 1IS5A 4IERA 4CXYA 3QH6A 4MHUA 3KLSA 3KSCA 1V6LA 2Y64A 5KHHA 3PJYA 1UX7A 2K2SA 1UY1A 3B02A 1DP0A 4CCOA 1W6OA 3O14A 2RMU3 2HWB1 4AQ2A 2BFUS 4DRVA 5FLJA 1SCRA 5FZ4A 4YZ1A 3O0WA 2D5FA 5LRRA 4ES8A 5A1LA 1ENXA 3W5MA 4P00B 2B9VA 1QH6A 2E9QA 2ES3A 3K51A 2WIIB 5FMCA 3GBGA 3AKRA 2VC9A 4N7UA 1H0BA 4JCKA 4Q26A 1NLQA 5FMBA 4BLIA 1K5MA 1RITA 4B4PA 1MEC3 3POWA 4LT5A 1CZTA 1POV0 4JGYA 2VULA 1AVBA 4Q4V2 1IS4A 2D6LX 2QCSB 1AYN1 3EYPA 3OBRA 2VTXJ 2FMYA 4P9GA 1RXFA 3V0AB 4KI5M 1DYOA 5FYTA 1MACA 5A6QA 2BNMA 4R52A 2WRAA 2XPJA 5J98B 4E2SA 1AR63 1QY4A 4QPGC 1CWPA 3KB5A 1F15A 1Y3TA 2VW1A 1GP6A 3ZYIB 2XB6C 2QTWB 4S2DA 4M0NA 2H0BA 4LO7A 4YYOA 2BNOA 2V5DA 1EP0A 4LKFA 4XXAA 3I49A 2YYOA 1UKGA 4QX8A 1KRIA 3FX3A 3I2HA 1LOEA 4RS5C 3O7OA 3LA3A 1A3KA 1SPPA 3I2JA 3AM2A 4CDWB 2XBO1 1LHOA 2W39A 2ZZJA 3ZPYA 3PUHA 4GH4B 4CEWC 5GZEA 2QQUA 4NAOA 1UOJA 1OUXA 3AVRA 3MLJA 2EIDA 3AYCA 2TNFA 3PL0A 5FXZA 1TZOA 3APBA 1YC61 3HEIA 5FDBA 4IEOA 5JWPA 3W21A 5D1IA 4GJYA 5CADA 4RA0A 1LAJA 1QNWA 4R4XA 4AQTA 4XF9A 5GZFA 1H8VA 4FVVA 5FK8A 4YVWB 4N43C 2PLV2 1R1A1 1UO9A 1CN1A 2OVUA 3K2OA 3MW3A 4B3NA 2VW0A 1H4HA 5A3UA 3KVAA 2OS2A 2HEVF 1JUIA 2WC2A 2ZEXA 5IVBA 5DPNA 2VW2A 1YEWA 3GYDA 4OMCA 1GZCA 1NX9A 4XURA 2W92A 4JQTA 4BQ2A 1YNAA 2RMU2 4S2GA 4WM7C 2GU9A 3VDDC 4ZHNA 1KFUL 1GOFA 2WA4A 3ZFFA 1GLHA 1LGBA 3PIJA 1XSQA 2XWJB 5L7OC 1YI7A 4CDQC 2BPA2 1RUG1 2CYFA 1OI6A 5FY0A 1CD3G 2I07B 3SISA 3NJVA 1IQDC 3TN91 4ARYA 1H8TB 2AH2A 3MIFA 4NIIA 1OF4A 2OYZA 3A21A 1YFUA 5D8AA 1MEC2 3TAYA 3T1LA 2YZ4A 1Q8VA 4XMIA 2CAUA 5DG2A 3AJYA 1ZYBA 1LECA 4YZ3A 4QB2A 1AZDA 3VKNA 4DEVA 2JDUA 2RDNA 3WF2A 2ZEYA 3S7EA 3LA7A 1PVC3 5LW9A 1F31A 3IDCB 1G7YA 1O4ZA 1QJY3 1SEFA 2D3PA 5CFDA 5BNOC 1DF0A 5I0TA 2UWBA 2JDAA 2IXIA 1ND3A 5CKQA 1CVNA 5F32A 1WMFA 3VBSA 5K0UA 3T0BA 1GQPA 4AFBA 3AL6A 5JZGB 2JG8B 1AR62 5J1XA 5JMCA 3JD73 2ZHLA 1K5MB 1I6XA 1N1TA 2UY8A 3INAA 4GWJA 3VL9A 4AOCA 2YUEA 4XABA 4UBGA 3SEPA 1AL21 5K4LA 4BDVB 4JGYB 2XLFA 4OQ8A 2P5BA 3RYKA 4QXBA 4B7EA 1YQ6A 1W28A 3QLQA 3CMGA 1BEV1 2NQYA 3R4UA 1BKZA 1RUH1 2G1MA 4BA6A 5A7WA 5KHJA 5KXCA 4BISA 1PO11 3WW4A 1VAKA 1S0CA 3EHKA 3B9IA 2FCUA 4UW3A 2XKOA 4OFGA 1S0BA 4AYUA 2CAVA 2PTMA 2Q1FA 1RINA 2WAAA 3WVJA 4AW7A 2HWF3 2QBXA 4GKXA 4LORA 2EXIA 4WM8A 3OGJA 4FFIA 4E4HA 1W6MA 2WZR2 2W1WA 2GNMA 3AX4A 3WP4A 5JXJA 1OA2A 3M70A 2LROA 4AQ6A 2IC1A 4QDRA 5T54A 4M3CB 1SPPB 2E7TA 2XL7A 4QPWA 1OC1A 4FP3A 1STMA 4XACA 2WUHA 3WW1A 2ZTNA 3U37A 4QQ2A 5FXXA 4D69A 4HVQA 3EMRA 1AR73 2YPDA 4CUGA 3ZFGB 1PO21 4CDUC 2R061 1CX4A 3ZN4A 5DZGA 4AHZA 2UWCA 3H1MA 2QE3A 1NT0A 4LUKA 3WP5A 4L2NA 1VBC1 3PVNA 1DDLA 3WUCA 1UY2A 2ARCA 2VVEA 2VGDA 1ND2B 4PDWC 1C5IA 4WVMB 5F3GA 4AEMA 2FDFA 4CU7A 1SZBA 1FMD1 1B09A 3LGRA 2RE9A 5AVAA 5FZ6A 3R6SA 1AXZA 2OIIA 3U4XA 4Z82A 2VZVA 5FYIA 5FY5A 4LBQA 4O7XA 4GULA 3BODA 1JBCA 4QX2A 5T52A 1TNFA 2CHHA 3MDPA 1LJ7A 2NN8A 3MFAA 4EN6B 4URAA 2A1XA 4X8PA 5C9AA 4FTEA 3BPZA 2WNUC 1R081 3DPRA 5LBEA 3ZYGA 4XQ4A 5EWSA 3SCHA 2NMOA 1PVC2 1AYM3 3B01A 1D2SA 3Q8FA 4KWJA 5DMYA 4RQPC 2WAOA 5EHDA 3S0MA 1QJY2 4JRAA 1G9AA 3M3OA 2V5YA 5EP9A 1PZ8A 5J37A 5E6HA 4ATEA 3Q8AA 3LDRA 4CTEA 1Q56A 1S1AA 5EV7A 1AX0A 1V0AA 3MIEA 3JD72 1CIYA 1W6QA 1ZZ6A 1LU1A 2BEOA 1ENSA 3AMQA 5LCWL 4TLFA 2VCBA 1HB4A 1W9SA 1RUNA 5ACA3 5DN2A 3MZHA 2C9AA 2XKPA 3IPVB 4LKSA 4NN0A 1HRV3 2CGPA 3OBTA 2DFBA 4HXCA 2RS51 3LIHA 2BBVA 5ISLA 5HPOA 2J1RA 4XOGA 1YJLA 1XSRA 4LITA 3I54A 2Z79A 3IBMA 3CJIC 5FAXA 1HLCA 3I59B 4M00A 3ZYFA 5DXDA 4CP1A 5CFDB 1ND3B 2E32A 3IDBB 2C6SA 2X05A 3DXTA 1XYPA 4GD4A 2WQZC 3VBSB 1GWLA 3M3QA 4LHNA 1KS4A 1UNBA 3ZR6A 3CQOA 2FDKA 1VMHA 4PHZA 5FZEA 2HWF2 5T5LA 4OI0A 1VBA3 1J84A 2YBPA 1NQJA 1VB4A 3J4UH 4NIHA 1OHFA 2DBIA 2OPKA 1F35A 2R043 4QPIC 3SEEA 4IL7A 2CY6A 5EIYB 1UWWA 1W9WA 3N7LA 4IGOA 2H6BA 2R7EB 4BQYA 4C8DA 5K9YA 5A7WB 2GDFA 1BMV2 5KHIA 1KGYA 3GJBA 1MQTA 2FCTA 1LOBA 1CAXB 3IWZA 5EYXA 5JPNB 2HWC3 4HZFA 1QQP3 2PHFA 2R0FA 4XFFA 2ARXA 1UL9A 1AR72 3VHNA 2BRTA 4AEDC 3B00A 5LBFA 5A6XA 1WMXA 2B39A 4NAMA 1CONA 2HWD3 2OXBA 3VD9A 3ZFEC 4EN0A 5FO8B 4OHVA 1NOVA 1LODA 3D3AA 4AVSA 4A7YA 4WM8B 1FXZA 1RUC1 1K3IA 1W6MB 1YFXA 5F2WA 2P4EA 2RR13 1XBFA 2D40A 4I02A 4PQ9A 2EXJA 1W3XA 1W3VA 1NXD1 2FDJA 4LMFA 3AZWA 5ANNA 1W03A 3BIEA 2BTVC 4JVAA 3NV2A 1HN1A 4UFJA 4ITCA 1Z78A 3GXUA 1QJX1 2Y6HA 2WZEA 3O1UA 3MIDA 1GWKA 3RS6A 2VZRA 1J3PA 3BUCA 2EIGA 2OW4A 4AE2A 1OKOA 3ZSKA 1AYM2 2ZPXA 5GJ6A 3WV6A 4YZ5A 4M3CF 5DUWA 4R8HA 2PAMA 4HETA 4QM9A 2VR4A 3OF1A 1S2BA 4W65A 1VAVA 2EVXA 5EPAA 4FAHA 3S5AA 1LEDA 5LBCA 5DDJ3 2VMIA 4PT6A 4LBQB 2W1QA 5ACA2 1ZBA3 3KT4A 1HRV2 5FKCA 3HPNA 3IDAA 3DPRB 3HOBA 3J26N 4WZFA 1PZ7A 1AR81 2WNEA 4LOSA 4B4RA 4XDPA 1KS5A 1MR5A 1VRH3 5FYMA 1RTVA 3VN4A 2A6VA 1OOPC 3FBMA 1W2TA 4YZ4A 2VMFA 5A3WA 3VZLA 4AHXA 4ASLA 4JQRA 5J7MA 2VUJA 4IE6A 4IV1A 1COV1 3HT1A 1W6QB 2ZCWA 4E4SA 1VBA2 1D0GA 4CEYA 1F2NA 5AC91 2WNOA 3E6BA 3P1IA 1WLTA 4JHTA 4GB33 1U5IA 2R042 2MHFA 4LA2A 4CCCA 4QKDA 4IEXA 4HOOA 4I3PA 2Q8EA 1LOFC 3LQCA 4S2HA 3URFA 2QVSB 4GMP1 4KGGA 5K8SA 2W47A 5A6YA 2P3IA 4LTAA 2HWC2 5JR7B 1QQP2 4D7YA 3OSDA 2ZX0A 1JH5A 4JDMA 1P8JA 5T5PA 3GCWA 4A41A 1KXGA 1SDWA 3AYAA 3DKQA 2HWD2 5FZHA 5FZAA 3V64A 1CX1A 2RDRA 3AKTA 4QGNA 3ECQA 1PVXA 3N7KA 4HFSA 2AREA 4QGMA 4D6QA 2RR12 1MVQA 2XQRA 1GBGA 4P02B 1DGRA 2E51A 3U75A 3O0XA 4IEWA 4BB3A 1SLIA 3VD5A 4DO0A 2D5HA 2JICA 2VXJA 1MQTB 3M2MA 2AR6A 5CVRA 3S30A 5CU1A 2QQNA 3UESA 3I4IA 4FSJA 2WNVC 1YIFA 3ZFFC 4BM8A 1ZRIA 5FZDA 1OVSA 4ZZ8A 4J1WA 3O1SA 3GF6A 1X7NA 1VLNA 3KV4A 4MGTA 5CZKA 5D8AC 4B4QA 4HKLA 5GZCA 1IKQA 4QXHA 3ZSJA 2ZEWA 3ZR5A 2CU5A 3TYJA 3LFIA 3KT1A 3VB9A 2R1DA 2EAKA 4KWLA 5DDJ2 4IE7A 1C8M3 2VMEA 3ELNA 1ZBA2 4LO8A 4IE4A 3SC7X 1DHKB 4A7KA 2VBDA 1S0JA 2ZGKA 3JBG3 3UK9A 3BCWA 4E4DX 3DV8A 3VHRA 4CEWA 4ASKA 5KR7A 1A78A 1VRH2 1A6CA 2DF7A 1LULA 1MZFA 1S0GA 4XMAA 3RFRA 2D7FA 2MEV3 4N53B 3ON7A 3JB4C 2CV6A 3WG3A 4Y22A 4UT5A 4F3JA 2JIJA 1EAH1 3M7AA 1JYWA 1HB1A 3CDZB 3N9PA 4QDQA 3TOJA 4ZU7A 2JENA 1AHSA 4K6BA 1V6OA 1YWKA 3DEMA 3FHIB 3HIFA 3AMPA 4IEZA 5E88A 3ZYJB 4Y1ZA 4AVCA 1G86A 4GB32 2XVGA 1X50A 4CP0A 2C1FA 3NAPC 1OH3A 4MV2A 1C57A 4N43A 4MO3M 4OI4A 2FZ1A 1R093 1NA1B 1UZZA 1TME1 1GQGA 2Y6KA 3FC0A 4NIGA 5FPUA 4BK4A 1HW5A 3L2HA 1UY0A 2F6BA 2JJ6A 3FBYA 4YRDA 1LEMA 5FYZA 3LPFA 4MUVA 4WM7A 1JHJA 1AX1A 1KD7A 2DUPA 1RUJ1 4MH0E 5ABJA 2ZX1A 4N8MA 3OJBA 2D6PA 1US2A 4CDQA 5L7OA 5LWBA 2BDRA 1RVF1 2GP3A 4Q8LA 5FREA 4LXLA 1GMMA 3H8XA 3ILRA 3VHPA 1XOYA 2XJPA 3TEYA 5FP4A 1Q8QA 4JGZC 2Q5TA 4XVHA 3WXPA 2HWE1 4YVSA 3WQ7A 2PHXA 1BCXA 4CE8A 4ET7A 1U0AA 2MPFA 4O9EA 2X10A 5FZ8A 5BPXA 1PNFA 3T08A 3AC0A 4FOQA 3M4FA 4GWMA 3V0BA 3NO8A 3VZJA 1UMIA 2VUAA 3LEIA 5GLUA 2OKXA 5HXMA 1O7FA 5BNOA 5I0DA 2UWAA 4RFRB 3M3IA 4D7TA 1OQ1A 4G4FA 1JHNA 2FZ2A 2EXKA 3SH3A 1OSGA 1RUI1 2JB8A 2D44A 3TBDA 2JXAA 2D3RA 2QQMA 3AP4A 3POBA 3CLPA 2RV9A 1W0NA 5FPZA 5FRAA 3AJZA 5C9AC 1POV3 5H9SA 3X29B 4BJ0A 5A1AA 1DG6A 4OHWA 4LO6B 3MV11 1C8M2 4UF0A 1IS6A 2E26A 2RS33 5FQ0A 2J7MA 2WA3A 5JVVA 3W59A 3POSA 5FYHA 1EV11 4W4ZA 2SLIA 3JBG2 4HSLA 5HV4A 2QDNA 1KQRA 4XCAA 4XEZA 1IOAA 1H1MA 3FUQA 4BQ4A 2DTWA 3C8XA 4QPGB 2JDKA 1OPMA 2DU0A 1GICA 2MEV2 2RVAA 5J96B 1PX3A 3ZIXA 3T2PA 5JSRA 2A73B 2VOXA 3MW2A 3ZOIA 4AL9A 4EWDA 1ZZ8A 3NMBA 2G19A 5FZOB 5BYNA 5I93A 4Q4W3 2R32A 3N9QA 4MXVA 1H9PA 1VJ2A 2B46X 4BK5A 1A34A 2D6NA 2P37A 4CU9A 4DQAA 2ZAAA 4RS5B 4FTSA 4MXWB 4S2FA 5A1FA 2CWMA 2VUDA 3U07A 4Z2WA 1R092 2HLEA 4XFGA 4CEWB 2Z2SB 4GWIA 1N3QA 1ULCA 3I2DA 3B7MA 5F39A 2NPIA 3LSEA 1W8HA 1BBT3 2H6CA 4CDUA 1CAVA 1QU0A 3IKWA 4Y22B 1YFYA 3I2OA 1UZVA 4KBZA 2G9GA 5C3RA 4K8RB 1B35A 4LEJA 3MUY1 1UX6A 4BLJA 2G4IA 3ME2A 4GMP0 3NRUA 4LA3A 4R9DA 1DIWA 3PVBB 1XU1A 4V2VA 4ZU5A 1LB2A 5FZ3A 5C8WA 4QAWA 4JDOA 4N43B 2JDYA 4CUAA 2XMLA 1Y7BA 3J7NA 1QF3A 1CZSA 1W0PA 4RSUA 5GLVA 4YM2A 2W95A 1IKPA 2YC2A 3O1TA 5IFPA 4O9GA 4ZS3A 2YPJA 1O5LA 3JB8A 2UY9A 1YHFA 3LE0A 3MF6A 2RDSA 4YSFA 3AP7A 2WNUA 2QQWA 3ZYPA 2ZGLA 4WM7B 1I1EA 1W39A 3VDDB 1C1FA 1ZM1A 3C7HA 1IGOA 3OPWA 1I5PA 5B4NA 4RQPA 2X29A 2WSVA 2DURA 2ERFA 5L7OB 3O1MA 1T2XA 5FCCA 1SFYA 1W6NA 3LF7A 4HN0A 4DEQA 3P5BA 2HYXA 5JUVA 1SLCA 3NNFA 3VHOA 1D4M3 1F4AA 3HAGA 2GNTA 4ZU4A 1CJPA 1JZ2A 2D6MA 4IGQA 3ZVXA 2BERA 2YBKA 4OHZA 1A8DA 3L2YA 3ACFA 1UIKA 3SLIA 3VBFC 3FHQA 4CU6A 2WS92 1OT5A 5C70A 3KGZA 4IEPA 5ERLA 3OY8A 4JKKA 1F8VA 2RS32 2HKXA 1RGSA 1HQWA 1X9PA 4EZHA 2C5DA 1C1LA 3B69A 1RL3A 2JE9A 1ENQA 2F4LA 3JZVA 4AAXA 4BIOA 3AMNA 3CO2A 3BYWA 1UYYA 4LBNA 1OMIA 1W90A 2UYBA 2LM3A 3AYEA 4XPVA 2ET1A 4UWDA 4Q27A 4FPOB 4LQRA 2EF6A 1QHDA
chains in the Genus database with same CATH topology
1PGW2 3ZXGA 2WLQA 1VBB1 4Q4W2 4QPIA 1SLBA 1C5HA 4QM8A 5J48A 1GQHA 4JC1A 1AF9A 1S0EA 1ONAA 3AZYA 2AENA 4XJ9A 3NJZA 3USUA 4WVZA 3AXDA 5H9QA 4Z92B 1JXNA 3OD4A 3UV9A 4IV1C 4NO4A 4AEDA 2EA7A 1BBT2 4Q8KA 2YY1A 4CEYC 4OULA 1X36A 3ZFEA 1XXNA 2GNDA 1FYUA 3HQXA 2JX9A 1DQ5A 2EALA 3PHMA 3UKNA 1F5FA 4L11A 3KCYA 3TRSB 4FPYA 4HPKB 4X8NA 1HDKA 1MVEA 1V6KA 1WMDA 4ORFA 4C0HA 3VKOA 1VIWB 3LSDA 2ZHMA 5B2GB 4CDUB 4XBNA 4AVBA 1CAVB 1QOTA 4AI3A 3WDWA 4CDXC 2YC0A 4COWA 1XYOA 1BQPA 3AB0A 2SBAA 4AFCA 4U36A 1EYBA 3TWIA 4DRRA 4PDWB 2ZACA 1OFSA 4WZCA 4HKWA 2HWB3 1D4M2 1PIV1 1AR91 3H7YA 4XIKA 4X6RB 1XQNA 3VZKA 2GC0A 2FBEA 5JI9A 5DUVA 1Q8SA 2WNUB 3PMEA 1Z7S1 4DZGA 4QQLA 2DCZA 2GNBA 2XLGA 3WP6A 4E9KA 1BK1A 1Y43B 1UAIA 2XJSA 4RQPB 3ZXKA 1X8EA 4FTBA 1OOPA 3NV3A 4RR3A 1J3QA 3RMYA 1ULDA 1AYN3 1UN1A 4P9WA 4N7IA 4Y20A 1RUE1 4WVWA 1N3PA 5GM0A 1EY2A 4XILA 4R9CA 5KBFA 2GALA 1LOFA 1QNYA 1KJLA 4Q4X1 2O8OA 2A3WA 3CJIB 4HLTA 1RB8G 1QGLA 1XNCA 2WKKA 3WP3A 4IEVA 4LHKA 2HYKA 3HBZA 4LO4B 1VR3A 3G6JB 2XBO3 3LB9A 2DTYA 1WLWA 2D6KA 1S0FA 3K48A 4PF5A 2WZR1 1QOOA 3AKSA 1J1LA 1X33A 5FBZA 4EV0A 5FFOC 3P3NA 3RG0A 2WFF1 3LAGA 2ZGOA 1XE7A 1ZREA 1GNZA 5A32B 5A33B 2NZ9A 3NW4A 4GIQA 2LALA 4E4ZA 3KGLA 4AEDB 4UBHA 1PGL2 1RJ7A 3UJQA 4YGBA 2WNVA 3THTA 5DG1A 2Y26A 3ZFEB 3AZVA 1R1A3 1TNRA 1WLCA 1OKQA 3MPBA 3ZXJA 5ABJC 2ZGQA 2KXLA 2D97A 2D98A 4IV3A 2V09A 2ZKLA 1F5JA 3QD6A 4YVSC 2B45X 2Q30A 1ULGA 2HWB2 4COZA 2FQPA 1H2KA 4KBBA 1WW5A 3ZN6A 1W6OB 1X82A 3THPA 2P3KA 3M1HA 1RUG3 4K1ZA 4ASMB 3FLRA 2LTNA 3E5UA 1QOSA 2I74A 4JV4A 3TN93 3IDEA 4FAGA 1ASJ1 1YXWA 4KWKA 1UPIA 4FPFA 3JQXA 3RI8A 4FPCA 2A75A 3VBRC 2VY0A 3J8F1 3I8TA 5BY5A 4F8AA 1HQNA 3S7IA 3E6CC 2RM21 1MZ5A 2A6XA 3NAPA 4XFIA 2WL1A 3FFZA 1BYHA 5CIRA 1ALYA 2ZGTA 4HVRA 4MX3A 3HN1A 2PHDA 2VVFA 1LESA 1OOPB 1AL23 3VZNA 2QUOA 1ZZ9A 4XJ8A 1BEV3 3ALQA 1J58A 1DYKA 1RUH3 4Y1YA 1Q43A 3ZSEA 3AXEA 2XBO2 1PO13 4Z1VA 3S6PA 2I45A 4W6XA 3H0OA 4W6YA 2WJSA 2ZMNA 3AZZA 1IQAA 2DUQA 2UU8A 4JGZA 3FE5A 3Q9OA 2VXRA 1WA4A 3WG2A 2XUMA 2YV8A 3VBUC 1RHI1 2VOKA 1NCQC 2GZWA 2GAUA 1B35C 3WD5A 3V56A 3MF9A 1REFA 1R1A2 4META 1G9FA 2PYTA 3A0KA 4RHV1 3AZXA 2TEPA 5AVPA 3D4KA 1NY71 1Q3EA 5F6LB 1GKBA 1CJDA 2GMEA 1SLAA 1PO23 1I9RA 2VNOA 1UMZA 3CJXA 2R063 1XRUA 4NHLA 1XNBA 2D6OX 4YGDA 1I5ZA 1V6NA 1DGRN 1PZ9A 3GZTB 1VBC3 3MFCA 2WT1A 1RUG2 3ZFFB 4H3WA 3C2UA 2MNGA 3TN92 1UW8A 1DQ0A 2W0XA 4C0BA 2PFWA 1C3HA 4NR1A 1LOAA 5BUVA 4IETA 5D8AB 4DFSA 4XFBA 5BNNC 2VNRA 4N9HA 4LBMA 2RS11 3AK0A 1R083 4XTPA 3AFKA 5H9PA 3RMXA 3H3UA 5EJ3A 1JTZX 1KJRA 1D4VB 5GALA 1MS8A 1HRV1 5BNPA 5HCBA 1J1TA 5K0UB 1H2LA 1CGPA 1BZWA 4KH9A 1HXS1 1AL22 2VG9A 2QQPA 1UD1A 1SFNA 1CPNA 1WW4A 1BEV2 2RS53 4LBOA 1RUH2 4WV8A 1LCLA 1PO12 5FMOS 3WX5A 3NAPB 1GANA 3RSJA 3EXUA 1VAMA 1AJOA 3ZXDA 4JRLA 3UL2A 4XXPA 2ZKNA 1M4WA 4AGRA 1QDCA 4YARA 3RI9A 4L8QA 1U12A 4QQHA 1QQP1 1ZZ7A 3PVOA 3SHRA 2A6YA 4MSVA 4P14A 1O3TA 2WQ4A 4W6WA 2ZX3A 4YVWC 2GMPA 2XGXA 2KA3A 1N1YA 3QOPA 1WW6A 5FLHA 4PJYA 3OPZA 1OQEA 2WLPA 1DGWX 1PO22 1LGNA 2R062 4U2AA 4JGZB 1RJ8A 3WW2A 4Q0UA 5I0UA 4YFZA 1MZEA 5GLTA 2LUWA 3VBFA 3T2TA 4XJAA 3QH7A 1RUC3 5CG9A 3RDIA 3CEWA 1KITA 3GHMA 1H8TC 2CL2A 3FLPA 4YM3A 1RUF1 2A6WA 1MS0A 1RIRA 1QJX3 1R1ZA 4YG0A 3U0ZA 4AHYA 1T6GC 2E7QA 1R082 1Y9QA 1DZQA 3BOWA 1ZZBA 5C9AB 1FOD1 1PK6A 4L9BA 4YW1A 3JU9A 5JSOA 3VBHC 3B9CA 1VBD1 3AYDA 3NSTA 2CWSA 1V00A 1FPN1 3WW3A 4AG4A 2DCYA 2JG8C 2ZGMA 2XH6A 3RNSA 4BQ1A 1U5ZA 2FMDA 4QHBA 3E97A 2ZGNA 4RR3C 1XNDA 1AX2A 3ZMOA 2BVBA 4Q0VA 2QNKA 2I2SA 1WCKA 1IPJA 3FJSA 2RS52 3BALA 1AR83 3W9AA 4BE3A 5IK8A 2BWAA 3ZSMA 1N1SA 3O5SA 1XE8A 2WINB 3WR0A 4KQ7A 4Q4Y3 4DOUA 3B94A 1UZYA 3HR9A 4P9XA 3MIGA 1COV3 4XW3A 1TE1B 3RJ2X 4AI1A 4FPEA 3IT8A 4ES9A 3FFQA 3VBOC 5AC93 5JOYA 4LLOA 2JDZA 1IS3A 4CDXA 5HCAA 2JECA 1LRHA 5JAXA 3ASIA 3MI8A 2V73A 2PA7A 2XVLA 5JIUA 1Z0HA 2Z69A 4K3UA 4QQOA 1TMF1 4RGAA 1GSLA 1HV1A 3ZFGC 2KM2A 2ZAHA 1E57A 5KXDA 2A3YA 2VOVA 5T5OA 4PIZA 3J9SA 1HRI1 1PM7A 4A7ZA 5J3UA 4Y1UA 4IV3C 5CNAA 4J1XA 5BNQA 4L99A 1V9U1 1UCXA 4C90A 1ZRDA 1V6MA 5KC6A 4I0WB 4YGCA 4RFT0 3N35A 4XTMA 1YIPA 3PNAA 3MYXA 4LBKA 2W52A 1VP6A 2R16A 4HK8A 1GV9A 4AGVA 4SBVA 4UW4A 4QGLA 5T5JA 2D43A 2Q0AA 3FWEA 4C1WA 5E16A 3JBG1 3KZ4C 5C8CA 2GC1A 2XJVA 4AK3A 1HQLA 2HEWF 4BWOA 2GSYA 4HK9A 4FXGB 5T3NA 3NWKA 1UIJA 3USSA 3WDUA 2Y0IA 1RUD1 3D5OA 3CL1A 1GZ9A 1WCDJ 1VBE1 2HEYF 1AR82 5CB7A 5A3LA 3R4DB 1SCSA 3SXWA 3T1MA 3TNQA 1O3SA 5LK7B 4Q1PA 4ISRA 3WQ1A 1G9CA 5J09A 1S55A 4Q4Y2 1EAH3 1COV2 2PQQA 1QJU1 2YGLA 4IV1B 4AXOA 4DINB 4RGGA 5AC92 4XJZA 1OD5A 1BJQA 4DY5A 2GC2A 2GMMA 1ZVFA 4CEYB 2OZ6A 3CU7A 3MICA 1CESA 4BCUA 4FPLA 1TME3 5GZGA 3WHUA 4DS0A 2XHKA 4FPKA 2RJLA 1NE6A 4AHWA 4KL1A 5F5QA 4XFCA 4XZPA 2ZHNA 2JG9C 3B5LB 4CDXB 1RVF3 4RD7A 5BV6A 2RJKA 3IIAA 3AMMA 4N9IA 1C8NA 1DQ6A 1XNKA 4BYYA 1C28A 2HWE3 1W6PA 3D8CA 1M06G 3VBRA 1WCSA 2ZBJA 2A7AA 2BFUL 2QDRA 4YG3A 4XE9A 5JOXA 1RMU3 1G6NA 2Z42A 4MZUA 1WW7A 4KU7A 2WS91 3RPQA 1O3QA 3SH5A 4BPZA 2PHUA 5L73A 1RUI3 4JTOA 5AFEA 3HT2A 4KGQA 3G7DA 4COVA 3HWJA 2ZGPA 1REEA 1IHMA 3ILNA 4X6QB 1NE4A 4IEQA 4D7SA 1SACA 4ATFA 1O4TA 1ZBE1 2DV9A 2ETEA 2VQ0A 1S0IA 1EV13 3W58A 5TSWA 2PELA 3PMSA 4XHXA 4YGEA 3WCSA 1CR7A 5BNPC 1LHWA 3R4SA 3MIHA 1QMJA 2R073 3AFGA 1EAH2 3ROUA 5FOBB 4Q2FA 4EWEA 5C4WC 4HVOA 3VBUA 1V6IA 4LHLA 1NCQA 4JDNA 4DPNA 5IK7A 2PAEA 4YG6A 2O8QA 5FO9B 1TME2 4FOVA 4YFWA 4DMIA 5CAZA 3PLQA 2C0ZA 3LWCA 4LO5B 2OA2A 1VB2A 4K21A 3KD4A 4QT6A 4WBBA 4NWWA 2UYAA 4NHKA 4QQPA 4DNYA 4Y1XA 1NYWA 1RVF2 4XIOA 5ABJB 4LR4A 4CDQB 4NOTA 5LEJA 3HMYA 4AEJA 2HWE2 3N7MA 4FXKB 3RQ0A 2DVBA 5BNNA 4YVSB 2RHPA 2A3XA 3RJRA 1NLSA 2H0VA 5I8SA 4QXKA 4YNIA 1S2KA 4Q4V1 1RMU2 4AFAA 1REDA 3E5QA 4GXLA 1G8WA 1H30A 3V0BB 2WFPA 1H1AA 4Q29A 5BNOB 4XQDA 1RUI2 3D0JA 4UW6A 3JQWA 4BH9A 5BXXA 3ILFA 2TBVA 4D94A 5EYYA 4PLOA 1YYNA 5GZDA 3KM5A 4CP2A 1PK6C 1EV12 1O5UA 2YGMA 5FQ0B 4FQZA 2G9FA 4B7KA 1LHUA 1HKDA 4LE4A 2R072 1N47A 1MZ6A 1O91A 3E5XA 4OUMA 2XJUA 4GALA 5E8AA 1QJZA 4CZSA 1VBB3 1ENRA 2EAAA 1WBLA 3BIWE 3N3HA 4IEYA 4YVWA 4IQPA 2IXKA 3QCWA 1NA1C 1ZA4A 2QJVA 2PLV1 3N4MA 4XJUA 5DUUA 3VL8A 1H4GA 3BTAA 4XF4A 1TQ5A 2F4PA 3U11A 2ZHKA 4XFHA 4Q1RA 4A3XA 1DFQA 3R0RA 5FTTC 2D93A 2RMU1 3VBUB 3RYRA 1NCQB 3ZXEA 1B35B 1LOCA 4PLMA 3H7JA 1QDOA 3ATGA 4A2UA 1H8TA 3WG4A 3NVCA 3NKTA 3RWNA 2K0GA 2JKBA 2E7AA 2X5IC 1MEC1 4FT8A 1WGPA 4DXZA 2XL9A 1CPMA 1FATA 3SCGA 1LENA 4FPJA 1LHVA 2Y38A 2GH8A 2VECA 5IK4A 3ZMNA 3VBHA 4IESA 3FZ3A 1GZWA 3JUUA 5JZGA 1GFF2 2JG8A 4I09A 2VH9A 1AR61 1AR93 1PIV3 1W6NB 2OUJA 1AL0G 4FCAA 4QD2A 2Z5WA 1PHMA 5BNNB 4CRQA 4MVTA 3DF0A 4YZ2A 4OLLA 1Z7S3 3WG1A 4MGKE 4EN8B 1O3RA 1UF2C 4G3YC 3OY8B 4PBPA 1LHNA 4EN7B 4P9YA 5C8CC 3VKLA 1X8MA 3H3ZA 4YM1A 4OI2A 3E6DA 1PMIA 1RUE3 1YJKA 5IT6A 3VBOA 4MGYE 5K7PA 1VBB2 4KG0A 2XG3A 2A70A 4Z07A 5KXBA 4AQSA 4QPIB 4AF9A 3SMHA 4M3CA 4NVPA 4Y1VA 3A4UA 4PIXA 4ZKTB 4Q4X3 4IEUA 4XBLA 2BW8A 3GALA 2ZJCA 3ZIWA 3MLKA 4QMAA 2X53S 4HKOA 2XJTA 1OPOA 3USUB 4OHXA 3ZFGA 4Y26A 3ZX7A 4COYA 5JLVA 1FV3A 2D3SA 2NLRA 1JN2P 1LOGA 2WZR3 1KDMA 3H1WA 4Q0PA 5FMOL 5C33A 1ND2A 2WSUA 4WVMA 2WFF3 3IMNA 4AVTA 5SV8A 3I7DA 2XVKA 4H14A 1UU4A 1NCRC 2QKDA 3KQRA 4AVVA 3JCIA 4GWNA 1U5XA 1H2MA 3BB6A 1I3HA 1Q5OA 2NMNA 1EPZA 5CFCC 2GN3A 1U5YA 3ES1A 4AFMA 1AJKA 4Q0SA 3LOBA 1PVC1 4Z8BA 1QJY1 2CNAA 3OD0A 1DYPA 4OVEA 2IFRA 4YLZA 2PN5A 1PIV2 1AR92 1NQDA 3PVEA 5JPMB 1RC6A 4HANA 1AYN2 5IUQA 3JD71 3D82A 3IPVA 3VUOA 1LTEA 1Z7S2 2BUKA 2WT0A 2Q1ZB 4EN9B 2PHTA 3M3CA 1ASJ3 1DZRA 2YHJA 5L19A 4AI2A 2VNGA 3I59A 3UJOA 3ETQA 3WDYA 1BXHA 1GZWB 3J8F3 2ET7A 3ST7A 2DVFA 1RUE2 2IFWA 4RR3B 4HL0A 4Y20B 2HWF1 2RM23 4URTA 4P9JA 2E6VA 4HT1T 1OLQA 3VZOA 3WT3A 4Q4X2 4C91A 2A71A 1DQ2A 1BMV1 5SV5A 4G9SB 1WBFA 1CAXA 2VPVA 3BOPA 2E63A 2EXHA 5LK5A 3SH4A 4E2GA 3KCCA<