4EJRA

Crystal structure of major capsid protein s domain from rabbit hemorrhagic disease virus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
163
structure length
163
Chain Sequence
TWRTNFYYNDVFTWSVADAPGSILYTVQHSPQNNPFTAVLSQMYAGWAGGMQFRFIVAGSGVFGGRLVAAVIPPGIEIGPGLEVRQFPHVVIDARSLEPVTITMPDLRPNMYHPTGDPGLVPTLVLSVYNNLINPFGGSTNAIQVTVETRPSDDFEFVMIRAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Major capsid protein VP60
publication title Atomic model of rabbit hemorrhagic disease virus by cryo-electron microscopy and crystallography.
pubmed doi rcsb
source organism Rabbit hemorrhagic disease virus
total genus 27
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ejrA00
4RQPB 1QQP2 4IV3C 3HAGA 4CDXC 1RUG2 4IV1B 1EAH1 1BMV2 1FPN1 1M06G 2DF7A 4GMP0 1OOPB 1VB4A 5ABJA 1C8M3 4N53B 1VBD3 4YVWA 5BNNC 1AR93 2VQ0A 1F2NA 4GB33 1HXS2 4Y5Z0 1NG0A 1VRH2 1VBE1 4QPIA 4YVWB 1FMD1 1COV2 3VBUC 1PGL1 1ZBE1 4WM8C 2HWB2 3VBOA 1R1A1 4RS5A 5BNPC 4JGYA 3ZFFC 4YVSB 5DDJ2 4QPIB 2BFUS 1NA1A 2HWC3 1WCDJ 1BEV2 2HWC1 4Q4X3 1R092 1RUD1 1BBT2 3VDDA 1X36A 3ZFGC 2RR11 1RVF3 3VBHC 1QJX2 1AR63 4CEYB 1FOD2 1ND3C 5A33B 5C9AC 1MQTC 2R043 1RUJ1 4NWWA 1POV0 3VDDB 1HRV1 1IHMA 4Q4W1 2RMU3 4GMP3 1HRI1 2GSYA 1VBC3 2BPA2 1OPOA 5D8AB 1R082 5ABJC 3LOBA 1F8VA 1RUH2 2WS92 4LLFA 3FBMA 1RUI3 2XBO3 1EV12 3JBG3 2R063 5K0UB 2R061 1MEC3 2HWD3 2HWD1 1QJY2 5L7OC 5ACA2 1TMF1 1HXS3 1ND2C 3VBOC 1VBB2 1X33A 4RHV1 1AR83 1RHI3 4RS5C 4JGYC 4IV3B 1EAH2 4JGZA 4CDWC 1NA1C 1COV3 2RS53 4CDXB 2WZR1 5BNNA 4FTBA 2HWE2 1RUC2 4GH4C 2WLPA 5C8CC 3JB8A 2Y26A 5FMOL 3TN92 1QJU2 1BEV3 5BNNB 1POV3 2R072 1R093 4AEDC 2ZAHA 4FSJA 1AYM2 1ASJ3 1VBE2 1V9U2 3ZFFA 5BNPA 2RS12 1QJX3 1FMD2 1ZBA3 1ZBA1 1FOD3 1TME2 5CFDA 3VBUB 3ZFEC 5GKAC 1R1A2 1NCQC 1Z7S3 2MEV3 4Q4V1 4WM8B 4BCUA 4FTSA 3JD73 1AUYA 2PLV3 5BNPB 1D4M3 3ZFGA 3ZFFB 5C4WC 1VAKA 4WM7C 1HQNA 5FMOS 3S6PA 1CJDA 1ND3A 1R083 5C9AA 1MQTA 1AYN2 1B35A 1PO22 2RR12 3ZFGB 4RFT0 1RUH3 3VBHB 3VBRA 1NCRC 5LK7B 1SMVA 2BFUL 2BBVA 1ND3B 5C9AB 1RUJ2 3J8F3 1MQTB 3J8F1 1RUE3 4JGZC 3IDEA 1C8M1 1VBA2 4Q4W2 5CFCC 1VBD1 1PIV2 1AR91 3VBRB 1VBB3 4GB31 5AC92 1QJZA 2RM23 5ABJB 1RUC3 5L7OA 1PGW2 1ND2A 3M8LA 3TN93 1QJU3 4PDWA 1PVC3 2RS33 4CDWA 5CFDC 1AL23 1AL21 5L7OB 2R073 4GH4A 5C8CA 4RHV2 1ND2B 1OHFA 3VBOB 4Q4X1 4RR3C 1AYM3 4RS5B 1GFF2 4JGYB 2RS13 1RUF3 1RVF1 2WZR2 4CDQC 1TME3 1NY71 1AR61 4CDWB 1NA1B 1RMU2 1H8TC 2ZTNA 4GH4B 1AR72 5C8CB 4AEDA 1B35C 2R041 1PO13 4Q4Y2 2RMU1 3VBRC 4GMP1 2HWF2 1QQP3 1VBC1 3ZFEA 3DPRA 1NCQA 1AYN3 1PO23 4AEDB 1RUG3 1HX6A 5C4WA 2BUKA 4EJRA 4WM7A 1RUI1 3ZFEB 2XBO1 1NCQB 3JBG1 1VBA3 2WFF2 3CJIA 4SBVA 1MEC1 1PIV3 5C4WB 1HXS1 1NCRA 4WM7B 1AR81 1RHI1 5AC93 1VRH3 4PDWC 3JB4C 5CFCA 2RS51 1COV1 1FPN2 2HWB3 2HWB1 1NCRB 4Y4YA 1C8M2 1VBD2 5DDJ3 4JGZB 5DDJ1 5CFCB 1AR92 1BEV1 2GH8A 4QPGC 1POV1 3NAPA 1K5MC 1VB2A 1BBT3 1R091 1ASJ1 4N43A 4CEWA 1QJX1 3VBSA 1RMU3 1FOD1 1PGL2 1ZBE2 3DPRC 1Z7S1 2MEV1 4RR3A 1W39A 3JD71 4Q4Y3 2PLV1 1D4M1 2HWC2 4CDQA 2HWF3 5CFDB 5JZGA 1H8TA 5A32A 1R081 1RUD2 3CJIC 4RR3B 1RVF2 4NWVA 1NY72 2WS93 1RUH1 2X5IC 4CDQB 3VBFC 1EV13 1H8TB 5A32B 2R042 2WFF3 1B35B 1HRV2 1RUE1 1QJY3 1HRI2 2RMU2 5ACA3 5ACA1 1VBC2 1OOPA 1VBB1 4N53A 1EAH3 2RM21 2ZZQA 1FPN3 2HWE3 2HWE1 1RUC1 3NAPC 1RUI2 5J98B 2XBO2 3JBG2 3TN91 1QJU1 2R062 4N43C 4CEWC 1PVC1 4FTEA 1MEC2 2HWD2 1A6CA 2RS31 3VBSC 1TMF2 2R071 5BNOC 1AR82 1RHI2 1VBE3 1V9U3 1AYM1 4YVSA 1V9U1 4PDWB 4CDUC 2RS11 1FMD3 5J96B 1RUF1 2RS52 4Z92B 1TME1 1ZBE3 5JZGC 1R1A3 5FOJB 4QPGA 1K5MA 1PO11 4RQPC 4CEYA 5A33A 1QQP1 1RUD3 4QPGB 1K5MB 4IV1C 3ZXAC 1AYN1 1PO21 2RR13 1ASJ2 1RUG1 1DDLA 1ZBA2 1BMV1 1OOPC 5D8AA 4Q4V2 1Z7S2 2MEV2 1RUJ3 3DPRB 4N53C 1HRV3 3JD72 4Q4W3 1VBA1 2PLV2 1D4M2 2FZ1A 1HRI3 1PIV1 2IZWA 1RB8G 2X5IA 1E57A 3VBFA 2TBVA 5K0UA 5AC91 1VRH1 4YVWC 3CJIB 1PGW1 2FZ2A 2X5IB 3VBFB 4IV3A 4YVSC 2QQPA 3J8F2 4QPIC 1RUE2 4CDXA 1TMF3 4GB32 4RHV3 1BBT1 2WWSA 2RM22 4CEYC 2WZR3 1RMU1 1AR73 3NAPB 1AR71 5BNOA 3VDDC 1PVC2 2RS32 4CDUA 4Q4Y1 4N43B 4CEWB 3VBUA 1AL22 3VBSB 2HWF1 5D8AC 4WM8A 4Q4X2 5BNOB 1RUF2 1AL0G 1NOVA 4CDUB 4RQPA 1AR62 1CD3G 2WS91 4Q4V3 5JZGB 2XPJA 1EV11 5K0UC 1C8NA 4IV1A 1PO12 2WFF1 3VBHA 1QJY1
chains in the Genus database with same CATH superfamily
1LHVA 3IMMA 3B7MA 1ZZ9A 5GLZA 5T5PA 4FPKA 2GMEA 2NZ9A 4Q27A 1OT5A 1BLZA 5A1LA 3F95A 5FQ0A 4IEXA 4AHZA 1AHSA 5M0TA 1OFSA 4E2GA 1BMV2 1FPN1 1XNKA 2VQAA 3CIHA 1M06G 2VMDA 3ZLIA 1VPHA 3SCGA 5CBLA 2ZAAA 3DKWA 4B3NA 1VB4A 1C8M3 3L9JT 4N53B 5J1XA 2XJRA 3OPTA 5K7PA 3E6CC 2XJSA 4ZU4A 1WLCA 2UWAA 1HXS2 3T4HB 2B8MA 4IEPA 2ENRA 1W9WA 3H7JA 3ZR5A 4QX1A 5BXXA 1VRH2 1VBE1 2GU9A 3OTFA 3POEA 4AWDA 1S0DA 4QX8A 3LF7A 1C1LA 4ITCA 3MDPA 5CISA 5J37A 1S2EA 2WDBA 3T4VA 3JCIA 3NNLA 3VBOA 1R1A1 4CE8A 3H42B 4ET7A 2WWJA 3CZJA 3ZXEA 1X8MA 2QQOA 2VZOA 4XQDA 4CP0A 5BNPC 3NJYA 1YQ5A 3N9LA 1Y4WA 5FYCA 2WNEA 2V4AA 4QKNA 4F7ZA 1BEV2 2R49A 3RYKA 2VZRA 1UMHA 2P6HA 2W92A 1V70A 1W6QA 1UKGA 5CKMA 2RJKA 5FWEA 4XDQA 4EE2A 1D7PM 3POYA 1HN1A 4XCAA 4INDA 3VBHC 4YARA 4ISRA 1FOD2 1MR5A 3DXTA 5E8AA 1UYXA 5A33B 4EQVA 2FHRA 1MQTC 2EXJA 5T54A 1JI6A 3SKJE 1RUJ1 3JQXA 1POV0 3VDDB 4MVTA 4Q4W1 1IHMA 1H8VA 1HN0A 3HR9A 4DY3A 1HRI1 4A3ZA 2GSYA 4I01A 4M3CF 4NHKA 1MZ6A 2BVVA 1MZEA 5I8YA 4A2UA 3KQ4B 5FMBA 3V0AB 1HV1A 1R082 1XNTA 3J7MA 2ZJCA 3RGBA 5LA2A 4ORFA 2XWBB 1ZRRA 1EUTA 1SPPB 4GWIA 3DECA 5FXXA 3USUB 1RUH2 2XKOA 2ETEA 3FBMA 2VOTA 1VR3A 4XILA 2ZXQA 4JQRA 2XONA 4TSVA 4J25A 5JIAA 2JG9C 1UN1A 4CPBA 1MEC3 4HVQA 1MPXA 1WW7A 3LD8A 4QXCA 4Q0VA 2DFCA 5ACA2 1S55A 1TMF1 3VBOC 1MS8A 2YGLA 4C1WA 4RGAA 1VBB2 2WQ8A 1X33A 3SEEA 3TYJA 1GNHA 4IV3B 4EN8B 2IXHA 3ETQA 4XFFA 3VHRA 3GZTB 1YJKA 1EAH2 1H2LA 1LOEA 1QXJA 4MSVA 4CDWC 2RS53 1OBNA 4BWOA 3AXEA 3WNMA 3VD9A 1W8TA 5JSRA 5JI9A 1PK6A 3JB8A 5LBCA 2Y26A 5FLJA 1H4HA 5IAXA 1DQ1A 2VQUA 3POFA 5JOXA 2R32A 1IQDC 3E5XA 5JSOA 2YHJA 4AVCA 4FTBA 1OURA 4MOAA 3W21A 3DYPA 1LGCA 3I59A 5BNNB 1ST8A 5EIYB 1POV3 4PI2A 2GALA 1KQRA 2R072 2WBKA 2IC1A 3L2HA 4ZU5A 1VMJA 2O1QA 4FSJA 4FOVA 3RG0A 2QQNA 2YC4A 4AZZA 1V9U2 1XBFA 4ZXKA 4XAEA 1ZBA3 3HPNA 4LUMA 1ZBA1 4QWNA 2R0HA 1RC6A 4AW7A 4QX0A 5J7MA 3VBUB 1HJGA 3EJKA 3FZ3A 4QX5A 3T09A 2ZACA 2K9ZA 1QU0A 2MEV3 4Q4V1 5FOBB 4BB3A 2GC0A 4JHTA 5F39A 5J09A 5ANNA 1AUYA 3TOJA 3KB5A 1T6BX 1SG3A 3ZFFB 2DBNA 4YLZA 3ACLA 5GLTA 1BJQA 3PUIA 1W9FA 4DB5A 4YZ5A 4FPLA 4Q0SA 5LK5A 4D7YA 1HQNA 5FMOS 1MS5A 3OY8B 1ND3A 1V0AA 4HFSA 2EALA 1Y3TA 5FZDA 5IVBA 3U4SA 3BU0A 1B35A 1XC6A 1CZVA 4OI1A 3MO4A 3VL9A 4IGQA 1ZX5A 5IW0A 1K3IA 2VZQA 5GZFA 3VBRA 2WN3A 1W04A 4IDZA 1GZCA 5L73A 4AEJA 4CUBA 2P3KA 5C9AB 1O4ZA 4MHUA 4J1XA 3THCA 4AGGA 1RUE3 3ITQA 1QOSA 4KGQA 2Y6JA 2WN2A 4LBQD 4M3CA 4QDQA 3LEIA 3RZKA 3D5OA 4FP3A 3AMQA 3WUDA 1I3HA 1XQNA 4XUNA 1RTVA 5CZKA 2RM23 5ABJB 2J1EA 1SFNA 3LFMA 4WVMB 5LBEA 3FE5A 3WNNA 4CYDA 3SC7X 4MGYE 1S0FA 3LA3A 4XFGA 4Q8LA 1XNBA 3CZUA 5FY8A 2EF6A 1GZWB 1RUC3 3VZJA 3WVJA 5B2GB 1PGW2 2C6SA 4UF0A 5FYBA 1LNSA 3SH4A 4A41A 3M8LA 5CB7A 2XHNA 5APAA 5A6YA 2SBAA 2RS33 1Q43A 4XTPA 4BQYA 3KHCA 5CVRA 3IB3A 2YPJA 4AEMA 4P9IA 5I0UA 2EICA 2J1TA 1HB3A 4H14A 3A23A 3D82A 3R4SA 5L7OB 5L9RA 2ZHLA 4R9BA 1VRBA 4XF0A 5KXBA 4E9KA 5T5JA 2B46X 2RS13 1C4RA 3IBMA 4CCMA 4Y5SA 1WA4A 1TME3 2VMIA 3AKPA 3H50A 1NA1B 2VXRA 3VHNA 1GOHA 4CDQC 1QXPA 1XXNA 4GH4B 5C8CB 1CQ9A 1Y9GA 1UXXX 4AEDA 1B35C 4DS0A 5FP8A 1OH3A 1FI2A 2CYFA 3VBRC 2VNGA 3K4AA 3Q9OA 2DU0A 1QQP3 2EAKA 2HWF2 3H3ZA 4IEUA 4PHZA 3EHKA 4IERA 3WV6A 3QOPA 1SLTA 4FT8A 1MS3A 1AYN3 1PO23 1H1MA 1OMIA 2A6WA 4SLIA 2UURA 1HX6A 2E7QA 2VBBA 5HV4A 1KJLA 5C5TA 2VVEA 1QJEA 3POIA 1DG6A 1HW5A 3WT3A 4AR2A 5JOZA 1WD3A 2GC2A 4WM7A 3O1RA 1RUI1 2ORZA 2RJ2A 3ZFEB 2XBO1 4JDMA 1S0CA 3IMNA 3NL1A 3Q8BA 4MV2A 5FO7B 2OPKA 1YQ8A 2PHFA 3VDAA 2VCBA 1LOCA 4DUWA 4BK4A 1IG0A 5C4WB 3AZZA 4IGPA 2AREA 4CP2A 1E5RA 1RYYA 4FXKB 1AR81 1DIWA 4G9SB 4K6BA 1W8WA 5FPAA 2BV4A 5CKNA 1W2AX 5JVVA 4KI5M 1AXYA 4QPWA 2Q30A 2JE9A 4QQHA 4J6GA 1COV1 1FPN2 4E27A 5F3IA 1W03A 4YRDA 1UYZA 1NCRB 2OQ7A 4Y4YA 2EXKA 1W6MB 2WNVC 5IYYA 1EP0A 4OZOA 4XFIA 1SFYA 5FYZA 1SBEA 3BPZA 5JPNB 2Q1MA 1C8M2 1NQJA 1W9TA 2CWSA 2RG4A 3O5SA 4BQWA 1JZ7A 2ZKNA 2WR9A 2FBEA 2GH8A 2BTVC 3VKLA 1O5UA 3IT8A 4A7YA 2VGDA 1J58A 1LHUA 3NSTA 2CGPA 5FZ1A 1MACA 3MF9A 1XOYA 3BTZA 3ZN6A 2DDUA 4RGKA 4CP9A 4Q29A 3VUOA 1RMU3 2YROA 3HD8B 3OUIA 3ZXLA 1Y9QA 3GZUC 1DCSA 4BHPA 1AX2A 4B1MA 2A3XA 4NAMA 1UCXA 3JD71 1WCUA 4CU6A 5KXCA 1D4M1 1L7RA 3T0BA 3ZN5A 1XYNA 3AYCA 5B4NA 2ZGKA 4OUMA 1H8TA 1PX3A 3CO2A 4LHLA 1N47A 5JIUA 1GR3A 3AMHA 4QXKA 1X7NA 5JOWA 1JYNA 2FDJA 3GNEA 3BIWE 1WLTA 4D7SA 2PAMA 1QDCA 3H8UA 3KV4A 3LPFA 3ZR6A 1Q8OA 4YG0A 1QF3A 1ZNPA 4QXHA 4UFMA 1KRIA 3WDWA 3B9IA 2XVKA 2P17A 2ZMNA 3AKRA 3B69A 3DKQA 5D21A 5FZBA 4NJ4A 4E4HA 5F32A 1MS0A 3VGIA 3QBQA 4I2OA 3OB8A 4TLFA 1HRI2 1UZWA 1SDWA 1XE7A 2VECA 4YFZA 3AM2A 2FDFA 1FXZA 1WCQA 4S2GA 1W2UA 3KWVA 2FMYA 3BPSA 4B4QA 2P5BA 1VMHA 3S0MA 4QQOA 2VTFA 1JZ8A 3A22A 2H0BA 3ACFA 2W1SA 4E4SA 1X9TA 3ZYRA 4CA9A 1QJU1 1PVC1 1MEC2 2W3JA 1TMF2 3AL5A 1A34A 1WW4A 3IWZA 2XLFA 3HBZA 1BVP1 5C70A 3WP4A 4H7LA 1AYM1 4YVSA 4E4DX 4W6WA 1I5ZA 3T08A 3DN7A 1LAJA 1H30A 2YYOA 1ZVFA 5J96B 2RS52 1FATA 3Q8EA 1ZBE3 3I3EA 2ATFA 4KU7A 5EXOA 5FOJB 4D6QA 2O14A 3ECQA 4COUA 4DRRA 2W39A 2YBPA 4CEYA 4DXZA 4EWDA 3LWCA 3O0XA 4Y33A 3OGJA 4XVHA 1AXKA 2DCYA 1UY0A 2VUCA 1RUD3 4QPGB 3VDBA 2J1RA 4LLOA 3MLJA 3ZXAC 2JG8C 3WW1A 4JRAA 2GN7A 3GALA 3N35A 3WP5A 2OUHA 2QBXA 4MGKE 4R52A 5KC5A 1ZBA2 3AFKA 4MUVA 2RVAA 3V65A 4AGVA 4NUBA 3UKTA 1BMV1 1ACCA 2HJIA 5D8AA 4Q4V2 2FQPA 2MEV2 3DPRB 2VZ3A 3RWKX 1SLLA 1HRV3 1U0AA 5HCBA 1VBA1 2VVFA 1JN2P 4OUSA 4QD2A 4EWAA 2BERA 5JUVA 1PIV1 3FN9A 3WQBA 2Q1FA 2IZWA 4JC1A 3UL2A 3AMMA 1YHFA 3A21A 3PHMA 5FKBA 4F83A 1LGBA 1T2XA 4QAWA 5JAXA 4IE6A 1DQ5A 2TBVA 1NX9A 2WQ4A 3HJRA 1VRH1 5K0UA 5AC91 4GALA 1HQWA 3HOBA 3CJIB 2XB6C 1J3RA 1OFNA 2ZGRA 1UAIA 5FY4A 3LDRA 4NIAA 2JDHA 1REFA 3LDBA 1O3QA 4NPRA 5A3PA 2A71A 5FMCA 4XCBA 5LASA 4D3WA 3OOXA 3NKGA 3RPQA 4YVSC 2QQPA 3H0OA 2GMMA 1PM4A 4AAPA 1RUE2 3T30A 4X6RB 2YY1A 4HSLA 4YPJA 4YG3A 3POJA 4YM2A 4K3UA 1L7LA 2JE7A 2X8KA 4DFSA 1G9AA 3U4XA 4UFJA 1C3HA 1JYTA 3ZDVA 4K8FA 2WWSA 2PHLA 2ZGOA 2JB8A 2NN8A 4DMIA 1KGYA 1ZREA 2RM22 4O9GA 3OBRA 2UYAA 2WZR3 3M3OA 3SNMA 1ENXA 4CEYC 1W6NB 5C8WA 5FXZA 5FPUA 3P5BA 1X9PA 2ZEWA 3NAPB 3MUY1 5IK5A 1XSRA 1ZRDA 5FPBA 4C0BA 3WX5A 4AI3A 5LA1A 1OPMA 2RS32 4CDUA 4Q4Y1 5T3NA 4N43B 3VBSB 2VMHA 1W28A 5D8AC 3AVSA 2PAEA 4WM8A 5FR3A 2VBPA 3O0VA 4YM3A 5FV3A 3HT2A 5BNOB 1N1VA 3AYDA 2XH6A 5F5AA 1GICA 1YFUA 1WLWA 2YC2A 1AL0G 1NOVA 5FZGA 3ZMNA 3FC0A 4RQPA 1CAVB 4A42A 2O8OA 5I93A 1XU1A 5JZGB 3S5QA 3D8CA 3KGLA 5K0UC 2J7MA 2VM9A 2XVGA 4YM0A 5I8SA 4Z8BA 1C8NA 3FWEA 5LATA 1IS4A 2D44A 3ZKYA 1G6NA 3GZEA 1QQP2 1W05A 3LAGA 5CNAA 4B29A 1IZ3A 2BW8A 3N9PA 4UBHA 4KWKA 5C33A 1CWPA 2Y60A 4H55A 3KHBA 5FZEA 1BQPA 1EAH1 4IV1B 5A6ZA 1W6PA 4P02B 4XDOA 5K9YA 5T52A 5LA0A 2OX0A 1CX1A 4AXOA 3NVCA 1OOPB 4Z07A 1OA2A 1EPWA 3WF1A 1AJKA 1JYVA 1VBD3 3VD3A 4YVWA 5FQ0B 3W59A 3SQOA 3ZPOA 2J42A 2VQ0A 2D7FA 2WZPP 1UXZA 3FX3A 3GDBA 4PJYA 4Y5Z0 4FP2A 2ZX4A 4LE4A 1WWYA 2WYSA 3R05A 5C3PA 3MUZ1 1NG0A 2HEWF 2XUEA 3MI8A 4I0WB 4K21A 1DQ2A 4QPIA 2B45X 2OUJA 4ZZ5A 4M3CE 1COV2 4FPOB 4Y1UA 3ZSJA 1YQ2A 2JDNA 3KZ4C 4WM8C 3EB7A 2LROA 2W2IA 3AP4A 4ZXEA 1PZ9A 1Q56A 5FZ8A 2OA2A 4JGYA 2ZCWA 5FYTA 3S7IA 3ZX7A 3M2MA 2NMOA 1X50A 2VUAA 4OHXA 3WG3A 1HV0A 4HETA 2ET1A 5F6LB 1OQEA 4L92A 4Q4X3 3O1VA 1BKZA 4H2AA 4XJAA 5LB6A 2ZHNA 5FREA 2ZHKA 1X36A 5FZOB 3ZFGC 5A1AA 4OHZA 3ON7A 5KXDA 2D3RA 1NZIA 1AR63 2VZUA 1NE4A 1W0NA 1Z78A 4QHOA 4ZZ8A 2F4LA 4B4PA 1GNZA 4MO3M 1IGOA 4JV4A 5FWJA 1LECA 1W6QB 2BNNA 5CU1A 4NWWA 4NPMA 4WZFA 4Y1VA 3M7AA 2JDMA 1US3A 4FXGB 2RMU3 3ZSKA 1DFQA 2QQVA 4XE9A 5JMOA 4FFIA 5JWPA 3R4UA 3AMPA 1VBC3 1T6GC 4LBQA 2WNOA 2Z42A 2VG9A 1W8ZA 2VZTA 4KH9A 3OEBA 2N7GA 2WIIB 2VAUA 3LB9A 5L19A 4LLFA 4W50A 4GJZA 5A3TA 3RYPA 3WDVA 4AQSA 2QQUA 5CKQA 4AG4A 4B4RA 2DFBA 1OKQA 3JBG3 3I3DA 2IVIB 2ARBA 4BQ4A 2R063 3M4FA 2R061 5T5LA 2HWD3 2HWD1 5IVFA 3LKJA 4XEZA 1O8SA 2A6ZA 4XF3A 4IESA 1ND2C 4P9YA 3NNFA 4QHBA 3WP3A 3H7YA 1OA4A 1RHI3 2JKBA 4JGYC 2QQJA 3MHZA 3V64A 1OI6A 2FCTA 2D6LX 2QUOA 4AVBA 3DXUA 4CDXB 3WG4A 5DAQA 1OD3A 2BZDA 5GALA 4HKLA 3AXDA 1S2BA 4YGEA 1JZ6A 2VCCA 1WA6X 2E63A 2DUOA 1QJU2 3OUHA 2AEZA 4G4FA 3PIGA 3MW4A 3OUJA 2HYKA 2DURA 1O3SA 1R1ZA 2ARCA 4ONUA 4Q0PA 1PK6B 3CBNA 4FI9A 2D3SA 1R093 4LIUA 3HT1A 4KG8A 4RSUA 1S0IA 1AYM2 2PN5A 2BNOA 3WY6A 5BNPA 1OC1A 1W8HA 1IKQA 1QJX3 4CU9A 1GQGA 4CCDA 5LWBA 2DBIA 2B9UA 3I59B 3V56A 4ISQA 3UT0A 4XFCA 3VKFC 4YZ3A 5A3OA 4EN6B 1NLQA 3MICA 1CJPA 1NCQC 1GMMA 1Z7S3 1I5PA 2D5HA 3LZZA 4FTSA 1UZZA 2WA3A 3ZYJB 3QD6A 4BPZA 2XL9A 4GWMA 5A7WA 3OGSA 4HT1T 4LHSA 1YUDA 3N4MA 3LGRA 3WHUA 1VAKA 4KGGA 4YW2A 2WNUB 4MADA 4CTEA 3K48A 5DAXA 1MQTA 4MZUA 4CCJA 4QM9A 4LHNA 2FDIA 4L9BA 3ZYFA 1UY3A 3VKMA 4OHVA 4RFT0 2UWBA 4XPVA 4A45A 4CSWA 1CAWA 3WNLA 5F1RA 2FD8A 4XIKA 3ZYIB 1HB4A 2BFUL 2YB7A 4LXLA 4XXPA 2BBVA 1ND3B 1F4AA 4IXLA 5GLWA 1TE1B 3HN3A 3QH6A 1V6OA 5BNQA 3W5MA 5CFCC 2EIGA 1C8M1 1VBA2 3IDEA 3N9QA 3VV1A 3HN1A 1PIV2 4UT5A 5BPXA 1UY2A 2A3YA 2ZEZA 1U5IA 3VBRB 1A78A 2I2SA 1YYNA 1OLMA 3AZYA 2YDEA 3K3OA 2C4XA 2PHTA 5FY9A 5AC92 2HBTA 4QQLA 2JG9A 3AZWA 4G3YC 4Q0UA 3POSA 4JX0A 3HQUA 2W68A 3IAPA 3OD4A 4CXWA 3S5AA 4N9HA 1JUIA 4EWEA 3K46A 2RE9A 4HPKB 3MIHA 1RL3A 3SH5A 2VUJA 1QDOA 3TN93 4CCOA 1UU5A 3SLIA 5H9RA 5DN2A 4QKBA 5IJRA 1GKBA 2OW4A 3ZXFA 1UKRA 4QX3A 4CDWA 3FHIB 2V5YA 1AL23 4IEZA 1YNAA 1AL21 1D0GA 3EYPA 5FLIA 2ID4A 1OHFA 1XNCA 3E6BA 4UF0B 4XJ8A 2ZGQA 4RR3C 4YM1A 1PM7A 2P3JA 2VU9A 5FP4A 3FFQA 5D2AA 1DBNA 1GFF2 3GCWA 2VMGA 4RS5B 5DAPA 3RWNA 1AZDA 3WXPA 1RUF3 1PNFA 2QDRA 2G19A 2WZR2 4PI0A 1UZ0A 4XBNA 4UOJA 1W9YA 3MGUA 2W08A 2ZTNA 5C6CA 1MVQA 1ZA4A 2JKXA 2ZGNA 2HH9A 2R0FA 1XU2A 4FFHA 4Q4Y2 1J1TA 3ORJA 4PQ9A 4XURA 5DQ0A 4LEJA 5F6KA 1ULPA 5AFEA 4XJUA 2ADEA 2Y6LA 1LOAA 1DLLA 3SKVA 2XL7A 1OVPA 3ETPA 2VTXJ 1C57A 1ZZ8A 4AEDB 1RUG3 3WNPA 1BZWA 5KHKA 3GF6A 3R0RA 1HKDA 2YG0A 2YBSA 4EJRA 2IVJA 3IKWA 2E26A 1Q8PA 3ALQA 4YGDA 5FCCA 1DQ0A 1GP5A 3MFCA 1CESA 3B01A 4IE4A 4QX7A 3POGA 1PMIA 2OZJA 3SH3A 4URTA 3N7MA 1LB2A 1MEC1 2H6BA 3LEGA 2IFRA 1LHWA 1JYIA 4W4ZA 3CLPA 3BTAA 4DEQA 5FUNA 4UW3A 1WD4A 4WM7B 1YIFA 1S0JA 2GZWA 4UXAA 1KDKA 1WBLA 1UMIA 3I2KA 4JCKA 1JBCA 3AFGA 4KQ7A 4N9IA 4QGMA 2CAVA 4URAA 3MEPA 4DUXA 5FO8B 2RS51 2J22A 4KMQA 2DVBA 2HWB3 1UL9A 4KBZA 2HWB1 4QB6A 1W90A 2JIGA 4FVVA 1YFXA 4O61A 1NLRA 4GD4A 1IPSA 1GWLA 4BMEA 1D0HA 3WCRA 1VBD2 5DDJ3 1WW5A 4JGZB 1ZA7A 5DDJ1 2G4IA 2WZEA 1IQAA 1POV1 1K5MC 2W9XA 1WBFA 5GJ6A 1N3OA 1BBT3 4UW4A 5FXWA 2I07B 4ARXA 4DPNA 1OUSA 1LEDA 4E2SA 5FUIA 3AKTA 3CMGA 3GBGA 5FBZA 3MIEA 4YFWA 1XPWA 2E51A 4XF9A 2WO7A 1OA3A 2XLGA 5EV7A 3KVBA 2KM2A 3KCCA 5L9VA 1KXGA 1WMXA 2LW8A 3WF2A 2MEV1 4AI8A 1LU1A 2W87A 3ES4A 4NRQA 3AP6A 3U1XA 3ZPYA 3ZO0B 1NXMA 1GANA 1WMFA 4QDRA 4ZS2A 4F8AA 2QQIA 2QTWB 5FO9B 2D98A 4LBNA 2ZX0A 4CDQA 4M00A 3LOIA 5CFDB 2XJUA 2ZKLA 4XABA 5A32A 4IETA 3C7FA 1S4CA 3SITA 5LY1A 1OLRA 2Y38A 5JR7B 2GNDA 3VHPA 1FYUA 1J3QA 2OZ6A 1NY72 2A6VA 2E53A 2WS93 3T1MA 2X5IC 4EN7B 1K45A 3VZKA 4JDNA 3VBFC 2IXJA 1G9BA 3S7EA 4CRQA 1H8TB 3EQEA 4Y26A 2WFF3 3NV2A 3WF3A 1RUE1 4TTGA 4MHRA 1QJY3 1UU6A 2RMU2 3WDXA 2VMEA 1HB2A 4AFAA 2Q8EA 3NKTA 2DTWA 1VBC2 4LO7A 5KHHA 3RDIA 3RMYA 5AVPA 1YI9A 2VY0A 3ZVXA 4N53A 3H8XA 1W8FA 2XXZA 1OH4A 2RM21 4XZPA 2ORXA 2DU1A 2HYXA 5I0RA 4MXVA 2GMPA 1FT9A 2XMLA 5KHIA 4DRVA 1RUC1 1JOJA 1RGSA 4HK8A 4DXSA 4CUCA 2BWCA 4OLLA 5EQUA 3TWIA 4A4AA 3JBG2 4UW5A 3KS7A 2R062 1BHGA 1OF3A 2HWD2 3VL8A 1A6CA 2RS31 2WSVA 4BA6A 1PX4A 1W3VA 2C9AA 3C7EA 2YUEA 1UOGA 1XNDA 1D2SA 1Q8QA 1W9SA 1BK0A 1RHI2 1S0EA 2PAKA 2WNVA 4LIVA 3ES1A 5F2SA 3URFA 4EN9B 3AMNA 1Q5OA 4PDWB 1WW6A 2RS11 1VMFA 1FMD3 1DQ6A 1Y7BA 4R9DA 4COZA 4QT6A 3TAYA 5FKCA 1PMJX 1QWRA 4FOWA 1TME1 2TNFA 2DCTA 1QJFA 4CXYA 3MYXA 2VTXA 3C8XA 1JMUB 4M4RA 2Y0IA 5IK8A 3P6BA 4LA3A 1AVBA 1N1YA 3ZXGA 4Y1YA 5FK7A 5F5QA 5A33A 4XC9A 3CHXA 1QQP1 2WUHA 2YZ4A 4M0NA 2E32A 4GZ9A 5FTTC 4XAAA 2VUDA 1LESA 2VJXA 1GBGA 3GHNA 2J1SA 1AYN1 1PO21 2RR13 3PUAA 1WMEA 3L2YA 3RZHA 1GZ9A 4P5YA 3I3MA 4CCNA 2ZS6B 3KV9A 3E97A 4DUVA 1OVSA 5CADA 3BVCA 3UNPA 4YGBA 3V0AA 4AQTA 3T0DA 1Z7S2 3VD7A 3GZAA 4N53C 1H6YA 2GNTA 1J83A 2VNVA 4FOQA 4TWTA 5A80A 4IW3A 1SPPA 3WDTA 4BIOA 1H2MA 3ME2A 2FZ1A 4XETA 3WNKA 5EZWA 1D2QA 4RGGA 3T2TA 4XUTA 4GKYA 2DWRA 4BQ3A 1QH7A 4QGLA 1O6UA 4LBJA 5FYSA 1LENA 3Q8AA 4JHZA 4LA2A 1PHMA 5ERLA 5JLVA 3MF6A 5EYXA 5FZ9A 1O7FA 4LKFA 5HXVA 4R8HA 4Y22A 3SMHA 3N7KA 4XJZA 3THDA 2CDOA 4CUAA 2W47A 3HMYA 4IV3A 3UKVA 5FLHA 3W20A 2YBKA 2Z5WA 3JUUA 4W65A 3OBAA 3UV9A 2B39A 4RHV3 1G8WA 2X09A 1RJ7A 1F31A 3MBWA 5HCHA 4NPLA 1UIKA 3D4KA 1JU4A 3AKQA 4GQ7A 2QZ2A 2WO2A 3AP7A 1RMU1 3NNJA 5FPZA 1NQDA 3AYEA 4LPLA 1KJRA 5E16A 1GP6A 3FHAA 3VDDC 4XUQA 3OG2A 3TRSB 2JX9A 3H9AA 4COWA 1DGWA 5BY5A 2X29A 3NJZA 4CEWB 1RJ8A 2AUYA 1WCSA 3VBUA 1PGSA 1AL22 2EVXA 4FPFA 2WQZC 4GIQA 3AYAA 4Y20A 5H9PA 3WNOA 1W8NA 2Y6FA 5EP9A 2WRAA 1OSGA 2QZ3A 3PL0A 3H1YA 3QLQA 3KLSA 4XYXA 4C91A 3FL7A 1RUF2 4K7JA 5B4XA 4CDUB 4K40A 1CD3G 1I6XA 2GC1A 2GN3A 2YFUA 3M3CA 1QKQA 3HIFA 4JDOA 2G9GA 4ASLA 4BQXA 2UU8A 4HN1A 2KA3A 3E5UA 3F2ZA 4P9WA 2OYZA 3WZ1A 2B5HA 2P3IA 2JG8A 1C5HA 1LOGA 3PURA 2D6PA 5FMDA 4KWJA 4U2AA 5EYYA 1QIQA 1S0GA 1ULOA 1H1AA 3RZMA 4RQPB 4KBBA 4QMAA 3M3EA 4IE7A 4LO5B 4AVAA 1G9DA 2YC0A 4L2NA 3RZGA 3A7QA 4XW3A 4IV3C 1S0BA 1XB9A 2DVGA 5F8PA 1B09A 1RUG2 2QE3A 4BQ5A 2AC1A 5F37A 5FYIA 4JKKA 3VLBB 4DY5A 3N9NA 2ZMLA 2EXHA 4XQ4A 1Z0HA 1EYBA 2AEYA 3ZYBA 4XZUG 5FYHA 4HN0A 1WCKA 1SEFA 2JDUA 4GMP0 4OHYA 2GC3A 5A7SA 5ABJA 5A1FA 5LZ6A 1ENSA 1G7YA 5BNNC 3WG1A 1MZ5A 1AR93 2HEYF 2V09A 1A3KA 1W6PB 4GB33 1RITA 1LU2A 3PJYA 4TN7A 5A7QA 1DP0A 5FBJA 2E9QA 1JS9A 2CY6A 2JD4A 3K4ZA 3LA2A 3ZDSA 3LE0A 4L8QA 5FK8A 5I0DA 1OXCA 4OCTA 4YVWB 3VBUC 1SFPA 2EIBA 1OLME 4YZ4A 3KT1A 3THTA 2A3WA 1PGL1 1ZBE1 1GWKA 1QEXA 2HWB2 1H2NA 2VL4A 3IDAA 3OJBA 5J3UA 1GOFA 3ZYHA 2WYFA 3ZFFC 2QNKA 2Y34A 3LDKA 2VOVA 3LPGA 2W94A 3DCQA 3KCYA 4QPIB 5DDJ2 2BFUS 1NA1A 2HWC3 4O9EA 1NZCA 2HWC1 5DUXA 2VOKA 5FPVA 1LODA 1U5ZA 2BGOA 4NIIA 2W0XA 3BUCA 4QU1A 4A7ZA 1CVNA 1RUD1 1BBT2 5J36A 4JKLA 3ZN4A 1W6OA 1RVF3 2ZABA 2DUQA 4AEKA 1H1IA 5JPMB 4QU2A 5IWFA 5C9AC 2OT7A 5L36A 2R043 4OVEA 1F4HA 2CAUA 3GM8A 2JDYA 4LITA 4Y3OA 4ATEA 3PMSA 1VAMA 1HRV1 4P08A 1X82A 4GMP3 1DF0A 2VPVA 1WMDA 3CDZB 2BPA2 3RZZA 1OPOA 3CU7A 3IIIA 3AVRA 4KG0A 5ABJC 3LOBA 2X10A 1V6LA 4C0HA 5DXDA 4JZRA 1UWWA 4COVA 2J1VA 2WS92 3BOPA 3SCHA 2BYVE 2D97A 4DNYA 2BGCA 2C24A 2IUWA 1L3JA 1UF2C 2XVLA 1FNYA 4H3WA 1BYHA 3S57A 2DVFA 3W5NA 4CU7A 1UX7A 1APNA 4LBQB 2LTNA 1DGRA 3THPA 1WLDA 1U5XA 1QJY2 4YNIA 1E5HA 5L7OC 1HXS3 3R4DB 2ZX2A 1SQ4A 2ZZJA 4M0HA 4XFHA 1CAXA 1ZYBA 2DVAA 5FP7A 4B7KA 1VE0A 2IXIA 5CEHA 1GU3A 1W8OA 1ZRIA 4OYUA 4BISA 2VW1A 4MGZE 2CDPA 3H3UA 3BTXA 2P4EA 1NA1C 3GJBA 4AHYA 3UKNA 2WZR1 3CL1A 3Q8FA 4NMIA 2DUPA 4W6XA 4I3PA 5IUQA 1RUC2 1BVVA 1K5JA 2ES3A 2WLPA 1CIWA 1NYWA 2Y64A 2YPDA 4GH4C 4DOUA 5C8CC 1NT0A 5DUWA 3U14A 3ZKUA 5FMOL 2OVUA 1ODMA 2JDPA 3BU7A 3P3NA 1K12A 1JUHA 4MXWA 2C9KA 4Y24A 4TLGA 3WEZA 1BEV3 5K8SA 1QOOA 1URXA 1P8JA 1QH6A 3E5QA 2EIEA 4ZHNA 3LIGA 4LUKA 3OCPA 2CL2A 3HEIA 1HLCA 4LOTA 4R4XA 5CYYA 1ASJ3 3KGZA 3U37A 4NE9A 3ABZA 2RS12 3ILRA 2BQPA 1H9WA 2VE1A 5FYYA 1FMD2 1OF4A 2XQRA 1KFXL 1FOD3 4HOOA 4W8JA 1TME2 2J1AA 3WSOA 3UJQA 3LEMA 3ZFEC 3RJ2X 3KT4A 2KD7A 1AX1A 4UFIA 1O3TA 1IPJA 2PLV3 4D6RA 5BNPB 1YQCA 3JQWA 3ZFGA 5I0TA 5C4WC 3VN4A 3S6PA 1AJOA 1BXHA 1I9RA 2ZHMA 1CJDA 2OPWA 1R083 1XNAA 2OXBA 4O7XA 2XJVA 1AYN2 1PO22 2RR12 3J9SA 1ODNA 5A7WB 4HBNA 4NHXA 2QQLA 1RUH3 2ZGTA 3RI8A 4AHXA 4XBLA 1JYCA 3VBHB 1NCRC 2BRTA 5C3RA 4OULA 4LJHA 3AB0A 3MV11 1QY4A 1LRHA 2EIDA 3AJZA 4HVRA 3WQ7A 2VZSA 1MQTB 5JXIA 4UBGA 1VBD1 4V2VA 5A7NA 1YEWA 3AP5A 4AI9A 1MVEA 3PU8A 3ZSMA 1Y9MA 4IE0A 1VBB3 2XKPA 2D6KA 1D4VB 4FPGA 3O1UA 2BOJA 3OGRA 3P1IA 1I1EA 1TQ5A 5CA6A 1GQHA 3IPVA 5GLVA 5LEJA 2XHKA 3GXUA 1LKNA 1ND2A 2J1UA 2PHWA 5DABA 3KMHA 3AC0A 3DV8A 2I74A 3ST7A 4ATFA 1JOPA 4WV8A 3RFRA 4HMZA 2QJVA 4UFLA 5EJZB 2JG9B 2HEVF 2VZVA 4ES8A 2Q4SA 3ZYPA 3WDUA 2MNGA 1ZZ7A 4JTNA 3CF6E 3N9MA 3UESA 4OZXA 2R073 4OI0A 4RHV2 3VBOB 3TEZA 1IS5A 1UIJA 4Q4X1 2YFZA 5FP9A 2FDHA 5A3NA 2MPFA 4NIDA 3J4UH 4UFHA 1V6IA 3BCWA 4GWJA 3WW4A 3UGFA 3B00A 4CDWB 1SHWB 1NY71 1AR61 1ULFA 4PIXA 4CVUA 5IK4A 1RMU2 2O8QA 2WLQA 3FUOA 4LORA 2QQMA 2A73B 4N7UA 1QOTA 1PO13 2VC9A 3Q8CA 5HXMA 1RUOA 4YSFA 2RMU1 1W06A 4HL0A 3B02A 3D0JA 1IOAA 3WW3A 2D5FA 4JRLA 3M3QA 1VBC1 4XF4A 1POQA 3DPRA 4AYUA 1NCQA 2WINB 1NKGA 3ROUA 4AVVA 5GZGA 3LFIA 2XR4A 4PCRA 3MIBA 4EV0A 4ZPIA 4LBOA 1GYKA 4HG6B 4IGOA 4PIYA 4NHLA 5F3EA 4Z82A 2W95A 2VNOA 2JD9A 4Q0QA 4BZ4A 3JXSA 2Q0AA 3PVEA 1DU3D 1NLSA 3KT7A 2VH9A 4WVZA 3JBG1 3WG2A 4N8MA 2WJSA 3CJIA 4SBVA 5BYNA 4P5HA 2QDNA 4LOSA 4D94A 1NE6A 1HIXA 1SZBA 2KXLA 3O12A 2CV6A 1FX5A 2R7EB 5DG1A 1RHI1 5HBAA 3OYWA 5I8TA 3MW2A 3KD4A 4K9SA 5CFCA 2JIJA 5EHDA 3VZLA 5F5IA 1TNRA 4IEYA 4OI2A 1ZZBA 3RVHA 1CIYA 1QNWA 3PUQA 2AZ5A 2OQ6A 5FUPA 3DUIA 4QKDA 4AK3A 3D3AA 3OBZA 4LK6A 2Z69A 1XE8A 2R6QA 3T3YA 4BDVB 3RZJA 2GH2A 2WZ8A 4LNVA 3T2QA 1AR92 2D3PA 2P2KA 4FPHA 4GULA 5F3CA 4QPGC 1ULEA 3NAPA 4D7TA 4D6SA 1R091 3LCPA 1JZ3A 2XLAA 4NIHA 2OS2A 3MW3A 3B94A 4N43A 3VZNA 3ZXDA 5L9BA 5LBFA 1QJX1 1G86A 2Y6GA 5F5CA 1JYXA 1XYPA 1J84A 1HQLA 2LUWA 3VBSA 1ZBE2 1GWMA 4AFMA 1PGL2 5FYUA 1SLBA 4S2DA 3DPRC 3WHTA 4A44A 1NAEA 1Z7S1 3I3BA 1ULDA 2JDZA 3I2DA 4RR3A 4BMBA 1ULGA 2V5DA 4BLJA 4GJYA 3LSEA 3N9OA 5A7PA 2TUNA 5K4LA 1CAVA 2HWC2 2CWMA 4PF1A 3IIAA 2HWF3 4C8DA 5KHGA 1AXZA 5JZGA 4Y5TA 4MG2A 2PXJA 4QX2A 1XJAA 1SDDB 2WO3A 1DGRN 1RUD2 2R30A 3BOWA 1O5LA 3CJIC 2AGSA 2VCMA 1RVF2 3BGAA 3N7JA 5IHRA 4NWVA 4DEVA 4NRPA 1UY4A 4XFBA 4CDQB 3JU9A 3KCXA 3AP9A 2XJTA 1MS4A 3WNXA 5BV6A 1EV13 5A32B 1SCSA 3ENRA 2R042 1YWKA 3HWJA 4MGSA 5F3GA 1GV9A 2NM1A 4P14A 3UGGA 1B35B 1HRV2 4AQ6A 3GCXA 5J48A 1K42A 5LRRA 1GNYA 1O4TA 1TNFA 2R16A 3ZOIA 5LW9A 4E8DA 4CCLA 3ATGA 5C3OA 1OOPA 3WOGA 2B42B 4EN0A 4CCCA 4AGRA 2E7AA 2ZZQA 5FZKA 3AL6A 2ZGPA 1QHDA 1FPN3 2VVDA 3VZOA 2HWE3 1GUIA 2A1XA 2HWE1 3NAPC 2ZGLA 1O3RA 5DUVA 4M3CB 5J98B 5TSWA 1JTZX 2A6YA 5FY7A 1CAUA 5CG8A 3TN91 4PLMA 4BQ2A 3DYOA 4N43C 4FTEA 1C1FA 3TNPB 1US2A 3VBSC 4AFDA 4O65A 4FPCA 1R64A 4HXCA 2CSGA 1CX4A 4KL1A 1UYPA 3MIDA 4PBOA 4NROA 5BNOC 3O1MA 3J7LA 3W58A 3PVBB 1XYOA 2Q8OA 1VBE3 1PMHX 3FLTA 4GKXA 4C90A 4Z1VA 2BWAA 1N3QA 1RUF1 4IEOA 4XFAA 4YW5A 4DIQA 5JZGC 3PUHA 4Y4RA 1R1A3 5FFOC 2BP6A 4V1PA 1K5MA 3I2GA 1ENRA 1C5IA 3HNBM 5FZOA 2FCVA 2WNVB 1JXNA 2JDAA 3VD5A 3LIHA 3NRUA 2BDRA 1UMZA 3GGLA 3WQ0A 1U5YA 3PIJA 1DGLA 4JAAA 4ARYA 3DGTA 2PYTA 3IAQA 3NJXA 3U11A 3NMBA 4IV1C 3O7OA 2RHPA 4S2FA 4XMIA 4RFRB 5FY1A 4MGTA 1ASJ2 1RUG1 3M1HA 2WO1A 4CU8A 1DLCA 2AR6A 2FDGA 2NMNA 2RDRA 4XHBA 4YWAA 5F9TA 1OOPC 3RJRA 3V0BA 3NQHA 5IVVA 5JDBA 3W9AA 1YCIA 1RUJ3 2L9LA 5C5UA 2IXKA 4FOYA 4Q4W3 3ZXKA 5JXJA 3NW4A 2PLV2 2VMFA 1HRI3 2R1BA 4BYYA 4WZCA 3FUQA 2X5IA 3VBFA 1JODA 4NVPA 1WZXA 2C5DA 2V72A 1V6JA 4V2WA 3VKNA 3C7HA 4BOWA 4FCAA 3DF0A 4RD7A 5A3LA 2WWUA 1M4WA 2EXIA 1CONA 2Y8KA 4MGIE 3UYJA 4QXBA 5JOYA 1RXFA 3PJQA 1GSLA 4IEQA 5JI7A 3HNMA 3OGVA 4YW1A 2VZ1A 4A7KA 3CQOA 5EJ1B 4CDXA 4JVAA 3WW2A 1RUNA 1TMF3 2BGPA 4UYBA 3J26N 3KV6A 2YU1A 1DYPA 4Y22B 3RRDA 4XQWA 4IEVA 1VAVA 2XUMA 1BBT1 3ACGA 4ASMB 2WT2A 5I0SA 1F9KA 2YGMA 3I7DA 1ZM1A 4BM8A 4EYUA 4P9LA 2JICA 1DYKA 5E1RA 1AR73 2DCZA 2W1WA 1AR71 3AZXA 1MS1A 4Y1XA 2Q8CA 3K77A 1YC61 2K46A 3PTRB 4IUGA 5DZFA 5FIXA 1LR5A 4Y1ZA 3PVOA 3ZN6B 3I2FA 2Z2SB 5G05L 5IVCA 4CP9B 5A6XA 2JEMA 3B3QE 3WCSA 1SACA 4AAXA 3H1WA 4CXXA 2VW0A 4Q4X2 4F3JA 5F7UA 4KNCA 4QPYA 2G9ZA 4UW6A 2WKKA 3M3IA 1JYWA 5C3SA 2ZGMA 4I0AA 4YW4A 3H8RA 1U12A 4E4ZA 1AR62 2WS91 2WNUA 2GNMA 3PMEA 4XHXA 3S30A 1MS9A 4Y20B 4Q4V3 3ELNA 3BALA 4XIOA 2V73A 2PFWA 3NNMA 4AOCA 2BJSA 3K75B 3ZSLA 3I2HA 4HONA 1JHJA 3INAA 4YW7A 1PO12 2WFF1 5T5OA 3IM0A 4XXAA 4XJ9A 4DO0A 3DYMA 4LULA 4L97A 1QJY1 5IVYA 5LEKA 5FY5A 2RDSA 4NAOA 2C26A 1ZZ6A 4DXRA 2YXSA 2BEOA 2ZEXA 3HAGA 4CDXC 1V6NA 4K20A 5JR2A 2JG8B 3PDQA 5A3WA 4B7EA 3I4IA 1JH5A 3CEWA 2D40A 4BU2A 5EPAA 5FZ0A 1VIWB 3B5LB 2UY9A 4Q1RA 1VJ2A 1CZTA 1GQPA 1UD1A 3A0KA 2W52A 4XMAA 3ZIWA 2DF7A 5A70A 1YFYA 2C1FA 5FXVA 4EZ4A 1BCXA 3OEAA 2WL1A 4K1YA 4NOTA 4FQZA 1YLLA 2ERFA 2VD7A 4QQ2A 3O1OA 4ZY9A 1LGNA 3OSDA 1PK6C 1O91A 2UY8A 1F2NA 1YIPA 2P3YA 2VW2A 5FRAA 3RI9A 4HPKA 4PLOA 4HZFA 5FY0A 1W2TA 2CU5A 3E1F1 3FMGA 5FZFA 1F5FA 4UFKA 4BXFA 1CPNA 3C7OA 4AI2A 1FMD1 5JMCA 1LOFA 4WBBA 1JOBA 2BU9A 2V4VA 1UOBA 5FZ7A 3VKOA 1JZ4A 5FZLA 4P9XA 1O59A 3I54A 4RS5A 5HCAA 1UY1A 2DCJA 5LRSA 2ZGSA 5KR7A 4YVSB 4AFBA 3NO8A 5DUUA 3AX4A 1WCDJ 2DV9A 2WNUC 1JZ5A 4UWDA 3C7GA 5SV5A 3MLLA 3N36A 2VMCA 2VCAA 2IFWA 4M4PA 1LCLA 3MFAA 4NR1A 1R092 2QCSB 5BUVA 3VDDA 2W1UA 2B7YA 3MZHA 2RR11 3M70A 2MHFA 2NPIA 4KWLA 1QJX2 2VULA 4CEYB 3MPPG 5E88A 4OMCA 1CPMA 2E6VA 2ZBJA 4M01A 4X8PA 1ND3C 5GZCA 1UPIA 4N7IA 4QGNA 4PT6A 2WT1A 1HDKA 1W6OB 3USUA 2ZMKA 4FFFA 1UZVA 2XG3A 1Q8SA 4QHZA 5IVJA 2ZGUA 3APBA 4XJWA 4AF9A 1EUUA 1W2OA 3JZVA 5D8AB 2ILMA 3AJYA 3GHMA 4L0PA 4LMFA 1N1SA 1YJLA 4FPEA 4LR4A 3RMXA 3VDCA 2AH2A 3X29B 1OQ1A 1F8VA 1GZTA 1JHNA 3E6DA 1AF9A 4OQ8A 1GP4A 1AX0A 1KS5A 3DEMA 1RUI3 3GJAA 3HQXA 2ARXA 1W0OA 2XBO3 3FBYA 1EV12 3PTYA 4ES9A 1FAYA 3WF0A 4BQ1A 5K0UB 1DYOA 1REDA 1LOFC 2RJLA 4HK9A 4YYOA 3KV5A 2GAUA 4C1XA 4NN0A 1TEIA 2JWPA 1F5JA 4H7MA 4RHV1 1AR83 4RS5C 3HVDA 4R9CA 4LO6B 2BOIA 4JGZA 4D0QA 4LBLA 1COV3 3N7LA 5BNNA 2K0GA 2DTYA 1SLCA 1FV2A 5FYVA 2HWE2 4HVOA 1YO8A 3RYRA 1RIRA 3ZIXA 1CAXB 3CKHA 4K8RB 3MIFA 5C7GA 3TN92 1SLIA 4MX3A 4NRMA 2GP3A 3SISA 4X6QB 5DMYA 1GOGA 3MPBA 2VQTA 3FHQA 2YMZA 1JU3A 4LKDA 2CTVA 3CNAA 3H3LA 4AEDC 2XJPA 2ZAHA 4BH9A 1QMJA 2VOWA 3QACA 1VBE2 2KR2A 3ZFFA 5IATA 2ZEYA 4ZKTB 4MXWB 5DZGA 5FZ4A 4CCEA 5DG2A 5CFDA 5KBFA 5GKAC 3MLKA 2P34A 3OY8A 1R1A2 2D93A 2XJQA 4WM8B 4BCUA 4B1LA 3NNGA 1STMA 3JD73 3AKSA 1G9FA 1KS4A 2VBDA 2CHHA 1D4M3 2Y0OA 4K1ZA 1DGWX 1CZSA 2YU2A 3B9CA 2XDVA 4JTOA 5FZCA 1GLHA 4ZS3A 5FPLA 4PF5A 4WM7C 3LA7A 5T55A 4JKMA 5SV8A 4XUPA 4LO8A 5C9AA 1W8UA 2BBAA 3HBKA 4KU8A 3IDCB 5HCFA 4CZSA 1CN1A 2ET7A 1X8EA 4E2QA 3POWA 3LSDA 4LQRA 4QB1A 3ZFGB 2FDKA 2QKDA 5FYMA 5EJ3A 5LK7B 1SMVA 4RL7A 3H8OA 2GNBA 3G7DA 3AK0A 3O0WA 1RUJ2 2VXJA 3J8F3 5E6HA 3J8F1 1YQ6A 4J1WA 4JGZC 4Q4W2 4WVMA 1LOBA 2JENA 3VD4A 3J7NA 5ANQA 4PIZA 1GZWA 2G9FA 1AR91 2Z79A 3O1TA 4AHWA 1DHKB 3VB9A 3EXUA 4GB31 1UOFA 4KWUA 1OLQA 2PA7A 2X53S 3D6EA 1QJZA 1MZFA 2WT0A 3T2OA 4ZU7A 2AYHA 2OIIA 5FPXA 3RNSA 4RYDA 5L7OA 4AQ2A 3TNQA 2ADDA 2RV9A 5FZ6A 4CPBD 1KDMA 3T1LA 1QJU3 4PDWA 1E5IA 4LBKA 1PVC3 2WAAA 3T2PA 2JB4A 4RA0A 3U75A 3U10A 5CFDC 1TG7A 3IPVB 2IWGB 4FO9A 4GH4A 5FAXA 5C8CA 1ND2B 1W2NA 5LBBA 4LT5A 5A3UA 1ENQA 1AYM3 1O4YA 2JDKA 2VOXA 3AZVA 4A3XA 4JGYB 1PNGA 5FZMA 1UNBA 2PELA 5FZHA 4NO4A 1RVF1 5KC6A 5F2WA 2NQYA 4TXWA 2OKXA 1C28A 4AFCA 2FCUA 4HANA 1H8TC 1RINA 2WFPA 1SBDA 1Q8VA 3A0NA 2PQQA 1AR72 3DL3A 3K51A 1J1LA 5JCTA 2R041 3OBTA 1LTEA 5GZEA 3NV3A 4GMP1 2A5ZA 4MYEA 3IN9A 4EZHA 2Y33A 3KF3A 2NLRA 3ZFEA 4FFGA 5FP3A 2XGXA 1PZ7A 2CNAA 1W0PA 2ZOEB 4ASKA 4DZGA 2E33A 1KFUL 3UETA 2D6NA 1DZRA 3FJSA 1UO9A 4W6YA 5GLUA 5JXHA 5FDBA 1L7QA 1YFWA 3K3NA 3MV01 1Q3EA 5C4WA 5FZAA 1XE0A 2BUKA 2ZX1A 3FLPA 4XBQA 2F4PA 4QM8A 5JSPA 1IPKA 1UYYA 3QH7A 3K2OA 1S2KA 3PUSA 3GBWA 3KF5A 1NCQB 3OD0A 4GXLA 1REEA 3VZMA 1VBA3 2WFF2 3ILNA 3MIGA 2VO5A 4BE3A 1PIV3 1UW8A 1OKOA 2DYCA 5HV0A 4N90A 1OD5A 1HXS1 1NCRA 3WF4A 1KD7A 2AACA 2QFEA 1W6MA 3U78A 5KHJA 3EBRA 1UU4A 4I02A 4Q5OA 5IK7A 5AC93 1A8MA 1IKPA 1VRH3 1VLNA 4PDWC 3D0SA 4META 2PHRA 3JB4C 4D8MA 5IFTA 4IE5A 4XACA 4A6OA 5EWSA 4DXTA 4HKOA 4LO4B 4OQ9A 4AVTA 1N1TA 4XF1A 4BXSV 2W91A 3I49A 5AFBA 2JXAA 1LJ7A 3IDBB 3B93A 1H0BA 5D1IA 5LY2A 3ZSEA 2X05A 3TEWA 3I2IA 3BIEA 3OYWB 4WVWA 4Q2FA 3WQ1A 3P3PA 5CFCB 4YW3A 2HKXA 4NHMA 4BLIA 1BEV1 3C3VA 4PBPA 3LEKA 4WVVA 1EPZA 2EAAA 5HPOA 1VB2A 2A6XA 5FJKA 5GZDA 4LTAA 2LRPA 4FPYA 4YW6A 2Q8DA 5FJHA 3WUCA 3ZM8A 4S2HA 4I0BA 2YV8A 1ASJ1 5DAWA 4CEWA 1YXWA 3EMRA 4UI9L 3I2OA 1RXGA 1FOD1 2VR4A 1LHNA 1UOJA 1UPSA 3T0AA 1QGLA 1QNYA 2O0OA 3WINE 3PLQA 2E31A 1VP6A 3VHOA 5CG9A 4R9AA 1W39A 3OPWA 4Q4Y3 2PLV1 5IFPA 4OMDA 2IXCA 2JE8A 5GM0A 2WA4A 4FAHA 2B4KA 3I3QA 3BYWA 1H9PA 2UWCA 1R081 3FFZA 4LHKA 5A6QA 2QQWA 3HNYM 2BNMA 4RR3B 4Z2AA 1RUH1 5C71A 3RS6A 3SEPA 5E89A 1G9CA 2I45A 1ONAA 3ASIA 2ARAA 5G04L 4BK5A 1H2KA 1WUVA 2NP0A 4D69A 5ISLA 5JXGA 1F15A 2PMWB 1XSQA 3KSCA 4OHWA 5ACA3 5LCWL 5ACA1 3I2JA 4I09A 1CAWB 3NWKA 2D6MA 4AL9A 1VBB1 4BIFA 4OUEA 5C3QA 4UAPA 5CIRA 2WABA 3PNAA 4Q8KA 2A7AA 1EAH3 1H6XA 2Q1ZB 2UYBA 3A4UA 3PU3A 4FQ4A 4AE2A 4QKFA 4FBFA 2BVBA 3NV1A 2PHUA 5IVEA 3RQ0A 5EFUA 2FMDA 2WC2A 1IS3A 1RUI2 1W3XA 2XBO2 4LKEA 1HJFA 1TZOA 3UGHA 2ZA9A 1IS6A 2P6CA 5FZ3A 4CEWC 5IT6A 4PQQA 4YG6A 3TEYA 5CAZA 1CGPA 1JW6A 5I91A 2XOMA 1HB1A 1J3PA 4U36A 2W46A 3WP6A 2PHXA 1XRUA 2Q5TA 2R071 4YZ2A 1AR82 1KITA 3TBDA 4MGQA 1V9U3 3I8TA 1CAUB 1ZZCA 1V9U1 4MH0E 4CDUC 1O8PA 3TEXA 2AENA 1DZTA 2P1BA 2E7TA 3NJVA 4Z92B 1LEMA 1PZ8A 2D43A 3U0ZA 1TVGA 4XOGA 4XDPA 4QPGA 5T50A 3BKZA 2R1DA 3RSJA 3WD5A 4I3GA 1BK1A 4XUOA 2GDFA 1VALA 1LULA 1PO11 3H1MA 4HKWA 4L11A 1ZRFA 2TEPA 3GYDA 4LBMA 4RN5A 4RQPC 4COYA 1WGPA 2WSUA 2EA7A 1UX6A 3QCWA 4CCKA 3ACHA 3BI3A 2Y6HA 2Z4FA 1V6MA 1V00A 3EO6A 3R6SA 2A70A 2W5FA 1SCRA 2WAOA 1ULCA 3C2UA 1K5MB 3I97A 2PQSA 1UQXA 1NXD1 3IZOA 2P37A 3SCFA 2GP5A 2H6CA 4QQPA 4GAZA 1DDLA 3OF1A 3O14A 2XQXA 1EY2A 5A3MA 4OI4A 3BODA 2VZPA 2F6BA 5DAVA 4AI0A 2DCKA 3KM5A 3PVNA 4P9GA 3JD72 4LE3A 4NHYA 4I30A 2LM3A 4AVSA 4EROA 1D4M2 3SXWA 3O1SA 5DPNA 4QDSA 1PVXA 1SBFA 3POBA 2ZPXA 3ACIA 4R4ZA 1RB8G 4A6SA 3V0BB 1E57A 5AVAA 3OPZA 5DZEA 1YRZA 3NV4A 1SLAA 2W1QA 1FV3A 3UJOA 4YVWC 2PHDA 4CUGA 1JZ2A 3VBHA 3SHRA 3BB6A 1J59A 4HLTA 2RDNA 4GA9A 4TZDA 3KVAA 4GWNA 1PGW1 2HBUA 1QXRA 2K2SA 2FZ2A 2X5IB 3FLRA 3VBFB 4IL7A 5HI0A 2G1MA 4LKSA 1LHOA 2D6OX 3G6JB 3J8F2 4QPIC 3KQRA 1OUXA 4FPJA 4L99A 1W6NA 3LQCA 3WLUA 4PLNA 4TYSA 4DINB 1ALYA 1E5SA 5IAVA 3ZYGA 5H9SA 4GB32 3ZMOA 1YI7A 2NYYA 4QB2A 5LA9A 5A7OA 5KXEA 2VNRA 4YZ1A 3U07A 2C0ZA 1W99A 1FNZA 3ILFA 2PTMA 4Z2WA 1V6KA 4OFGA 1S1AA 2JJ6A 2IXLA 4BJ0A 4NIGA 3K4DA 3CJXA 1KEXA 2F17A 3TB0A 3ZXJA 4CP1A 4P00B 5BNOA 4LK7A 5H9QA 4IEWA 2Y6KA 1DZQA 4Q26A 1PVC2 3WR0A 2CGOA 3BN6A 4FAGA 3BTYA 2JECA 3WDYA 5KWRA 3OGGA 2QVSB 3J7HA 4IQPA 4ZONA 2RDQA 2HWF1 4JQTA 4E8CA 2CGNA 1UZYA 3HQRA 3UK9A 2DVDA 2ZX3A 4X8NA 1CR7A 2XWJB 2LS6A 4MLOA 1DQ4A 1F35A 2H0VA 4XTMA 4P9JA 3USSA 4AI1A 3O1PA 2SLIA 1H4GA 1N3PA 3N3HA 4YGCA 1Y43B 2XPJA 1ZRCA 1A8DA 2LALA 1EV11 4HSJA 4B8EA 2HLEA 4IV1A 4DQAA 2QQKA 3RZLA 2A75A 4Q1PA 5FZIA 1OQDA 1WKYA 1NUKA 3GBFA 1IG3A 2B9VA
chains in the Genus database with same CATH topology
1LHVA 3B7MA 1ZZ9A 5GLZA 5T5PA 4FPKA 2GMEA 2NZ9A 4Q27A 5FQ0A 4IEXA 4AHZA 1AHSA 1OFSA 4E2GA 1BMV2 1FPN1 1XNKA 2VQAA 1M06G 3SCGA 5CBLA 2ZAAA 3DKWA 4B3NA 1VB4A 1C8M3 3L9JT 4N53B 2XJRA 5K7PA 3E6CC 2XJSA 4ZU4A 1WLCA 2UWAA 1HXS2 2B8MA 4IEPA 2ENRA 3H7JA 5BXXA 1VRH2 1VBE1 2GU9A 3OTFA 4AWDA 1S0DA 1C1LA 4ITCA 3MDPA 5J37A 3JCIA 3VBOA 1R1A1 3ZXEA 1X8MA 4XQDA 4CP0A 5BNPC 2WNEA 4F7ZA 1BEV2 2R49A 3RYKA 1V70A 1W6QA 1UKGA 2RJKA 4XDQA 3POYA 4INDA 3VBHC 4YARA 4ISRA 1FOD2 1MR5A 5E8AA 5A33B 2FHRA 1MQTC 2EXJA 5T54A 1RUJ1 3JQXA 1POV0 3VDDB 4MVTA 4Q4W1 1IHMA 1H8VA 3HR9A 4DY3A 1HRI1 2GSYA 4I01A 4M3CF 4NHKA 1MZ6A 2BVVA 1MZEA 5I8YA 4A2UA 3V0AB 1HV1A 1R082 2ZJCA 4ORFA 2XWBB 1ZRRA 3USUB 1RUH2 2XKOA 2ETEA 3FBMA 1VR3A 4XILA 4JQRA 4TSVA 5JIAA 2JG9C 1UN1A 1MEC3 1WW7A 4Q0VA 2DFCA 5ACA2 1S55A 1TMF1 3VBOC 1MS8A 2YGLA 4C1WA 4RGAA 1VBB2 1X33A 3TYJA 1GNHA 4IV3B 4EN8B 2IXHA 3ETQA 4XFFA 3VHRA 3GZTB 1YJKA 1EAH2 1H2LA 1LOEA 1QXJA 4MSVA 4CDWC 2RS53 4BWOA 3AXEA 5JSRA 5JI9A 1PK6A 3JB8A 2Y26A 5FLJA 1H4HA 5JOXA 1DQ1A 2R32A 3E5XA 5JSOA 2YHJA 4AVCA 4FTBA 1LGCA 3I59A 5BNNB 1POV3 2GALA 1KQRA 2R072 2IC1A 3L2HA 4ZU5A 2O1QA 4FSJA 4FOVA 3RG0A 1V9U2 4ZXKA 1ZBA3 4LUMA 1ZBA1 2R0HA 1RC6A 4AW7A 5J7MA 3VBUB 4AFMA 3EJKA 3FZ3A 4QX5A 2ZACA 2K9ZA 1QU0A 2MEV3 4Q4V1 5FOBB 2GC0A 5J09A 1AUYA 3TOJA 3KB5A 3ZFFB 4YLZA 3ACLA 5GLTA 1BJQA 4DB5A 4YZ5A 4FPLA 4Q0SA 5LK5A 1HQNA 5FMOS 1MS5A 3OY8B 1ND3A 4HFSA 2EALA 1Y3TA 1B35A 4OI1A 3VL9A 1ZX5A 3VBRA 5GZFA 4AEJA 5L73A 1GZCA 2P3KA 5C9AB 1O4ZA 4J1XA 4AGGA 1RUE3 1QOSA 4KGQA 4LBQD 4M3CA 3D5OA 4FP3A 3AMQA 3WUDA 1I3HA 1XQNA 1RTVA 2RM23 5ABJB 1SFNA 4WVMB 4CYDA 4D7YA 3FE5A 4FBFA 4MGYE 1S0FA 3LA3A 4XFGA 4Q8LA 1XNBA 4EWAA 5B2GB 2EF6A 1GZWB 1RUC3 3VZJA 3WVJA 1PGW2 3SH4A 3M8LA 5CB7A 2SBAA 2RS33 1Q43A 4XTPA 5CVRA 4AEMA 2YPJA 4P9IA 5I0UA 5L7OB 4H14A 3D82A 3R4SA 2ZHLA 4R9BA 4XF0A 5KXBA 4E9KA 5T5JA 2B46X 2RS13 1C4RA 3IBMA 1WA4A 1TME3 2VMIA 3AKPA 3H50A 1NA1B 2VXRA 3VHNA 4CDQC 1QXPA 1XXNA 4GH4B 5C8CB 1CQ9A 4AEDA 1B35C 4DS0A 1FI2A 2CYFA 3VBRC 2VNGA 3Q9OA 2DU0A 1QQP3 2EAKA 2HWF2 3H3ZA 4IEUA 3WV6A 3EHKA 4IERA 3QOPA 1SLTA 4FT8A 1MS3A 1AYN3 1PO23 1H1MA 1OMIA 2A6WA 4SLIA 2UURA 1HX6A 2E7QA 1KJLA 2VVEA 3WT3A 1DG6A 1HW5A 5JOZA 1WD3A 2GC2A 4WM7A 1RUI1 3ZFEB 2XBO1 4JDMA 1S0CA 3IMNA 3NL1A 4MV2A 5FO7B 2OPKA 2PHFA 1LOCA 5C4WB 3AZZA 2AREA 4CP2A 4FXKB 1AR81 1DIWA 4G9SB 4K6BA 5JVVA 1AXYA 2Q30A 2JE9A 4QQHA 4J6GA 1COV1 1FPN2 4E27A 4YRDA 1NCRB 4Y4YA 2EXKA 1W6MB 2WNVC 1EP0A 4XFIA 1SFYA 1SBEA 3BPZA 5JPNB 2Q1MA 1C8M2 1NQJA 2CWSA 3O5SA 2ZKNA 2FBEA 2GH8A 2BTVC 3VKLA 1O5UA 3IT8A 4A7YA 2VGDA 1J58A 1LHUA 3NSTA 2CGPA 1MACA 3MF9A 3ZN6A 4Q29A 3VUOA 1RMU3 2YROA 3HD8B 3ZXLA 1Y9QA 3GZUC 4BHPA 1AX2A 2A3XA 1UCXA 3JD71 5KXCA 1D4M1 3ZN5A 1XYNA 3AYCA 2ZGKA 4OUMA 1H8TA 3CO2A 4LHLA 5JIUA 1N47A 1GR3A 3AMHA 4QXKA 1X7NA 5JOWA 3GNEA 3BIWE 1WLTA 4D7SA 2PAMA 1QDCA 3H8UA 1Q8OA 4YG0A 1QF3A 1ZNPA 1KRIA 3WDWA 3B9IA 2XVKA 2P17A 2ZMNA 3AKRA 3B69A 3VGIA 1MS0A 3QBQA 4I2OA 4TLFA 1HRI2 1SDWA 1XE7A 2VECA 4YFZA 3AM2A 1FXZA 4S2GA 1W2UA 2FMYA 4B4QA 3S0MA 4QQOA 2H0BA 4E4SA 3ZYRA 1QJU1 1PVC1 1MEC2 1TMF2 1WW4A 3IWZA 2XLFA 3HBZA 1BVP1 3WP4A 4H7LA 1AYM1 4YVSA 4E4DX 4W6WA 1I5ZA 3DN7A 1H30A 2YYOA 1ZVFA 5J96B 2RS52 1FATA 1ZBE3 2ATFA 4KU7A 5EXOA 5FOJB 3ECQA 4COUA 4DRRA 2W39A 4CEYA 4DXZA 4EWDA 3LWCA 3O0XA 3OGJA 1AXKA 2DCYA 1RUD3 4QPGB 4LLOA 3MLJA 3ZXAC 2JG8C 3WW1A 4JRAA 2GN7A 3GALA 3N35A 3WP5A 2OUHA 4MGKE 4R52A 5KC5A 1ZBA2 3AFKA 4MUVA 1BMV1 3V65A 4AGVA 3UKTA 2HJIA 5D8AA 4Q4V2 2FQPA 2MEV2 3DPRB 1SLLA 1HRV3 1U0AA 5HCBA 1VBA1 2VVFA 1JN2P 4OUSA 4QD2A 1PIV1 2IZWA 4JC1A 3UL2A 3AMMA 1YHFA 3PHMA 4F83A 1LGBA 5JAXA 1DQ5A 2TBVA 2WQ4A 5K0UA 1VRH1 5AC91 4GALA 1HQWA 3CJIB 2XB6C 1J3RA 1OFNA 2ZGRA 1UAIA 1REFA 1O3QA 4NPRA 2A71A 4D3WA 3NKGA 3RPQA 4YVSC 2QQPA 3H0OA 2GMMA 1RUE2 4X6RB 2YY1A 4HSLA 4YG3A 4YM2A 4K3UA 4DFSA 2JE7A 2X8KA 1G9AA 3U4XA 1C3HA 4K8FA 2WWSA 2PHLA 2ZGOA 2NN8A 4DMIA 1ZREA 2RM22 4O9GA 3OBRA 2UYAA 2WZR3 3M3OA 3SNMA 1ENXA 4CEYC 1W6NB 5C8WA 3NAPB 5IK5A 1ZRDA 4C0BA 3WX5A 4AI3A 1OPMA 2RS32 4CDUA 4Q4Y1 5T3NA 4N43B 3VBSB 2VMHA 5D8AC 2PAEA 4WM8A 3O0VA 4YM3A 3HT2A 5BNOB 1N1VA 3AYDA 2XH6A 1GICA 1YFUA 1WLWA 1AL0G 1NOVA 3ZMNA 3FC0A 4RQPA 1CAVB 2O8OA 5I93A 1XU1A 5JZGB 3D8CA 3KGLA 5K0UC 5I8SA 2XVGA 4YM0A 4Z8BA 1C8NA 3FWEA 1IS4A 2D44A 1G6NA 5CNAA 1QQP2 3LAGA 4B29A 1IZ3A 2BW8A 4UBHA 4KWKA 5C33A 4H55A 1BQPA 1EAH1 4IV1B 1W6PA 5K9YA 5T52A 4AXOA 3NVCA 1OOPB 4Z07A 1OA2A 1EPWA 1AJKA 1VBD3 3W59A 4YVWA 5FQ0B 2VQ0A 2D7FA 2WZPP 4PJYA 3FX3A 4Y5Z0 4FP2A 2ZX4A 4LE4A 3R05A 1NG0A 2HEWF 3MI8A 4I0WB 4K21A 1DQ2A 4QPIA 2B45X 2OUJA 4M3CE 1COV2 4FPOB 4Y1UA 3ZSJA 3KZ4C 4WM8C 3AP4A 1PZ9A 1Q56A 2OA2A 4JGYA 2ZCWA 3S7IA 3ZX7A 3M2MA 2NMOA 1X50A 2VUAA 4OHXA 3WG3A 1HV0A 4HETA 2ET1A 5F6LB 1OQEA 4L92A 4Q4X3 1BKZA 2ZHNA 5FREA 2ZHKA 1X36A 3ZFGC 4OHZA 5KXDA 2D3RA 1AR63 1NE4A 1Z78A 4B4PA 1GNZA 1IGOA 4JV4A 1LECA 1W6QB 2BNNA 5CU1A 4NWWA 4WZFA 4Y1VA 3M7AA 3ZSKA 4FXGB 2RMU3 1DFQA 4XE9A 5JWPA 3R4UA 3AMPA 1VBC3 1T6GC 4LBQA 2Z42A 2VG9A 4KH9A 2N7GA 2WIIB 3LB9A 5L19A 4LLFA 3WDVA 4AQSA 4AG4A 4B4RA 2DFBA 1OKQA 3JBG3 2ARBA 2R063 3M4FA 2R061 5T5LA 2HWD3 2HWD1 3LKJA 4XEZA 2A6ZA 4XF3A 4IESA 1ND2C 4P9YA 4QHBA 3WP3A 3H7YA 1OA4A 1RHI3 2JKBA 4JGYC 3V64A 1OI6A 2D6LX 2QUOA 4AVBA 4CDXB 3WG4A 5GALA 4HKLA 3AXDA 1S2BA 4YGEA 2E63A 2DUOA 1QJU2 4G4FA 3MW4A 2HYKA 2DURA 1O3SA 1R1ZA 4Q0PA 4ONUA 1PK6B 2D3SA 1R093 3HT1A 4KG8A 4RSUA 1S0IA 1AYM2 2PN5A 2BNOA 3WY6A 5BNPA 1IKQA 1QJX3 1GQGA 2B9UA 3I59B 3V56A 4ISQA 3VKFC 4XFCA 4YZ3A 4EN6B 3MICA 1CJPA 1NCQC 1Z7S3 4FTSA 2D5HA 3LZZA 1UZZA 2WA3A 3ZYJB 3QD6A 4BPZA 2XL9A 4GWMA 4HT1T 1YUDA 3N4MA 3LGRA 3WHUA 1VAKA 4KGGA 4YW2A 2WNUB 4CTEA 3K48A 1MQTA 4MZUA 4QM9A 4LHNA 4L9BA 3VKMA 4OHVA 4RFT0 2UWBA 4XPVA 5F1RA 1CAWA 4XIKA 3ZYIB 2BFUL 4XXPA 2BBVA 1ND3B 5GLWA 4IXLA 1TE1B 3QH6A 1V6OA 5BNQA 5CFCC 2EIGA 1C8M1 1VBA2 3IDEA 3VV1A 3HN1A 1PIV2 5BPXA 2A3YA 1U5IA 3VBRB 1A78A 2I2SA 1YYNA 3AZYA 2YDEA 2PHTA 5AC92 4QQLA 2JG9A 3AZWA 4G3YC 4Q0UA 3POSA 2W68A 3OD4A 4N9HA 1JUIA 4EWEA 2RE9A 4HPKB 3MIHA 1RL3A 3SH5A 2VUJA 1QDOA 3TN93 1UU5A 3SLIA 5H9RA 3ZXFA 1GKBA 2OW4A 1UKRA 4CDWA 3FHIB 2V5YA 1AL23 4IEZA 1YNAA 1AL21 1D0GA 5FLIA 1OHFA 1XNCA 3E6BA 4XJ8A 2ZGQA 4RR3C 4YM1A 1PM7A 2VU9A 2P3JA 4HVQA 3FFQA 1DBNA 1GFF2 4RS5B 2VMGA 3RWNA 1AZDA 3WXPA 1RUF3 1PNFA 2QDRA 2WZR2 4XBNA 3MGUA 2W08A 2ZTNA 5C6CA 1MVQA 1ZA4A 2ZGNA 2R0FA 1XU2A 4Q4Y2 1J1TA 4PQ9A 5F6KA 4LEJA 5AFEA 4XJUA 1LOAA 1DLLA 2XL7A 1C57A 1ZZ8A 4AEDB 1RUG3 1BZWA 5KHKA 3GF6A 3R0RA 1HKDA 4EJRA 3IKWA 4YGDA 1Q8PA 3ALQA 5FCCA 1DQ0A 3MFCA 1CESA 3B01A 1PMIA 2OZJA 3SH3A 4URTA 3N7MA 1LB2A 1MEC1 2H6BA 1JYIA 2IFRA 1LHWA 3CLPA 3BTAA 4UW3A 1WD4A 4WM7B 1YIFA 1S0JA 2GZWA 4UXAA 1KDKA 1WBLA 4JCKA 4KQ7A 1JBCA 3AFGA 4N9IA 4QGMA 2CAVA 3MEPA 5FO8B 2RS51 2DVBA 2HWB3 1UL9A 2HWB1 4FVVA 1YFXA 1NLRA 4BMEA 1D0HA 3WCRA 1VBD2 5DDJ3 1WW5A 4JGZB 5DDJ1 2G4IA 1IQAA 1POV1 1K5MC 5GJ6A 1WBFA 1N3OA 1BBT3 4UW4A 2I07B 4DPNA 1LEDA 4E2SA 3AKTA 3GBGA 5FBZA 3MIEA 4YFWA 4XF9A 2E51A 1OA3A 2XLGA 5EV7A 2KM2A 3KCCA 1KXGA 2MEV1 4AI8A 1LU1A 3ES4A 3ZPYA 3AP6A 3ZO0B 1NXMA 1GANA 1WMFA 4F8AA 5FO9B 2D98A 4LBNA 2ZX0A 4CDQA 4M00A 3LOIA 5CFDB 2XJUA 2ZKLA 5A32A 4IETA 3SITA 1OLRA 2Y38A 5JR7B 2GNDA 3VHPA 1FYUA 1J3QA 2OZ6A 1NY72 2A6VA 2E53A 2WS93 3T1MA 2X5IC 4EN7B 3VZKA 4JDNA 3VBFC 2IXJA 1G9BA 3S7EA 4CRQA 1H8TB 3EQEA 4Y26A 2WFF3 3NV2A 1RUE1 1QJY3 1UU6A 2RMU2 3WDXA 4AFAA 3NKTA 2DTWA 1VBC2 4LO7A 5KHHA 3RDIA 3RMYA 5AVPA 1YI9A 2VY0A 3ZVXA 4N53A 2RM21 4XZPA 2DU1A 5I0RA 4MXVA 2GMPA 1FT9A 5KHIA 4DRVA 1RUC1 1JOJA 1RGSA 4HK8A 2BWCA 4OLLA 3TWIA 3JBG2 4UW5A 3KS7A 2R062 2HWD2 3VL8A 1A6CA 2RS31 2WSVA 4BA6A 2C9AA 2YUEA 1XNDA 1D2SA 1Q8QA 1S0EA 2PAKA 1RHI2 3URFA 2WNVA 4EN9B 3ES1A 3AMNA 1Q5OA 4PDWB 1WW6A 2RS11 1Y7BA 1FMD3 1DQ6A 4R9DA 4COZA 4QT6A 3TAYA 1QWRA 4FOWA 1TME1 2TNFA 2DCTA 3MYXA 2Y0IA 5IK8A 4LA3A 1AVBA 1N1YA 3ZXGA 4Y1YA 5F5QA 5A33A 1QQP1 2YZ4A 4M0NA 5FTTC 3GHNA 1LESA 3RYPA 1GBGA 1AYN1 1PO21 2RR13 1WMEA 3L2YA 1GZ9A 2ZS6B 3E97A 5CADA 4YGBA 3V0AA 4AQTA 1Z7S2 3GZAA 4N53C 2GNTA 4FOQA 4TWTA 3WDTA 4BIOA 1H2MA 3ME2A 2FZ1A 4XETA 5EZWA 1D2QA 4RGGA 3T2TA 4GKYA 2DWRA 1QH7A 4QGLA 4LBJA 1LENA 4LA2A 1PHMA 5JLVA 3MF6A 5EYXA 1O7FA 5HXVA 4R8HA 4Y22A 3SMHA 3N7KA 4XJZA 3HMYA 4IV3A 3UKVA 5FLHA 2Z5WA 3JUUA 4W65A 3UV9A 2B39A 4RHV3 1G8WA 1RJ7A 1F31A 1UIKA 3D4KA 3AKQA 4GQ7A 2QZ2A 3AP7A 1RMU1 5FPZA 1NQDA 3AYEA 1KJRA 5E16A 3VDDC 3TRSB 2JX9A 3H9AA 4COWA 1DGWA 5BY5A 2X29A 3NJZA 4CEWB 1RJ8A 2AUYA 1WCSA 3VBUA 1PGSA 1AL22 2EVXA 4FPFA 2WQZC 4GIQA 3AYAA 4Y20A 5H9PA 1OSGA 2QZ3A 3H1YA 3QLQA 3KLSA 4XYXA 4C91A 4K7JA 1RUF2 4CDUB 4K40A 1CD3G 1I6XA 2GC1A 2GN3A 4ASLA 3M3CA 1QKQA 3HIFA 4JDOA 2G9GA 2UU8A 4HN1A 2KA3A 3E5UA 4P9WA 2OYZA 3WZ1A 2B5HA 2P3IA 2JG8A 1C5HA 1LOGA 2D6PA 4KWJA 4U2AA 5EYYA 1H1AA 1S0GA 4RQPB 4KBBA 4QMAA 3M3EA 4LO5B 4AVAA 1G9DA 2YC0A 4L2NA 4XW3A 4IV3C 1S0BA 2DVGA 1B09A 1RUG2 2QE3A 3VLBB 4DY5A 2ZMLA 2EXHA 4XQ4A 1Z0HA 1EYBA 4HN0A 1WCKA 1SEFA 4GMP0 4OHYA 2GC3A 5ABJA 1ENSA 1G7YA 5BNNC 3WG1A 1MZ5A 1AR93 2HEYF 2V09A 1A3KA 1W6PB 4GB33 1RITA 1LU2A 3PJYA 2E9QA 2JD4A 2CY6A 3LA2A 3ZDSA 4L8QA 4YVWB 3VBUC 4YZ4A 3KT1A 3THTA 2A3WA 1PGL1 1ZBE1 2HWB2 1H2NA 3OJBA 5J3UA 3ZFFC 2QNKA 2VOVA 3KCYA 4QPIB 5DDJ2 2BFUS 1NA1A 2HWC3 4O9EA 1NZCA 2HWC1 5DUXA 2VOKA 1LODA 1U5ZA 2W0XA 4A7ZA 1CVNA 1RUD1 1BBT2 5J36A 3ZN4A 1W6OA 1RVF3 2ZABA 2DUQA 4AEKA 1H1IA 5JPMB 4QU2A 5C9AC 5L36A 2R043 4OVEA 2CAUA 4ATEA 3PMSA 1VAMA 1HRV1 1X82A 4GMP3 1DF0A 2VPVA 1WMDA 2BPA2 3RZZA 1OPOA 3CU7A 4KG0A 5ABJC 3LOBA 1V6LA 4C0HA 5DXDA 4COVA 2WS92 3BOPA 3SCHA 2BYVE 2D97A 4DNYA 2BGCA 1L3JA 1UF2C 2XVLA 1FNYA 4H3WA 1BYHA 2DVFA 1APNA 4LBQB 2LTNA 1DGRA 3THPA 1WLDA 1U5XA 1QJY2 4YNIA 5L7OC 1HXS3 3R4DB 2ZX2A 1SQ4A 2ZZJA 4M0HA 4XFHA 1CAXA 1ZYBA 2DVAA 4B7KA 2IXIA 2VW1A 4MGZE 3H3UA 1NA1C 4AHYA 3UKNA 2WZR1 3CL1A 2DUPA 4W6XA 4I3PA 5IUQA 1RUC2 1BVVA 4GH4C 2ES3A 2WLPA 1CIWA 1NYWA 4DOUA 5C8CC 5DUWA 5FMOL 2OVUA 3BU7A 3P3NA 1JUHA 4MXWA 4Y24A 5K8SA 1BEV3 1QOOA 1URXA 1QH6A 3E5QA 4LUKA 3OCPA 2CL2A 1HLCA 4R4XA 1ASJ3 3KGZA 2RS12 3ILRA 2BQPA 1H9WA 1FMD2 1KFXL 1FOD3 1TME2 3UJQA 3ZFEC 3RJ2X 3KT4A 1AX1A 1O3TA 1IPJA 2PLV3 5BNPB 3ZFGA 3JQWA 5I0TA 5C4WC 3VN4A 3S6PA 1AJOA 1BXHA 1I9RA 2ZHMA 1CJDA 1R083 2XJVA 1AYN2 1PO22 2RR12 3J9SA 4HBNA 1RUH3 2ZGTA 3RI8A 4AHXA 4XBLA 1JYCA 3VBHB 1NCRC 4OULA 3AB0A 1QY4A 1LRHA 4HVRA 3AJZA 3WQ7A 1MQTB 4UBGA 1VBD1 3AP5A 1MVEA 3ZSMA 1VBB3 2XKPA 2D6KA 1D4VB 4FPGA 1I1EA 1TQ5A 5CA6A 1GQHA