4EJRA

Crystal structure of major capsid protein s domain from rabbit hemorrhagic disease virus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
163
structure length
163
Chain Sequence
TWRTNFYYNDVFTWSVADAPGSILYTVQHSPQNNPFTAVLSQMYAGWAGGMQFRFIVAGSGVFGGRLVAAVIPPGIEIGPGLEVRQFPHVVIDARSLEPVTITMPDLRPNMYHPTGDPGLVPTLVLSVYNNLINPFGGSTNAIQVTVETRPSDDFEFVMIRAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major capsid protein VP60
publication title Atomic model of rabbit hemorrhagic disease virus by cryo-electron microscopy and crystallography.
pubmed doi rcsb
source organism Rabbit hemorrhagic disease virus
molecule tags Viral protein
total genus 27
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ejrA00
4CDXA 1AYN1 1K5MA 1RUJ3 1RUI3 1AR92 1MEC1 3TN91 3JB8A 3JBG3 4Q4W1 4CDXC 3M8LA 1VRH3 4EJRA 2RR13 1R082 5ABJB 2R042 1POV1 2WS91 2HWE1 2HWF3 5C4WA 4CDUA 4Z92B 3JD73 4FTEA 3CJIA 1HXS2 4Q4Y1 1OOPA 1H8TA 5DDJ1 1FOD2 5AC91 1NY71 4N53A 3VBHC 5K0UA 3ZFEB 4CDUC 1V9U2 2R063 4Q4V3 1EAH3 1H8TC 2BPA2 4N53C 4WM7B 1NCRB 1QQP3 4Q4X3 3VBOB 4GMP0 1VBE2 1PGW1 3VBFA 1NA1B 1C8M2 1RUE2 4AEDC 3VBFC 4WM8B 3VDDA 2R073 1TMF1 2XPJA 2RM21 1RUD1 1ASJ1 1D4M1 3VDDC 4IV1C 4RHV2 5A33B 1BBT2 4GMP3 4IV3B 1ND2A 1BEV1 1MQTA 2GSYA 3IDEA 4RS5C 4CDXB 1K5MB 2XBO3 4LLFA 4QPIC 1WCDJ 3VBRA 1MQTC 1FPN3 4RR3A 3ZFGA 1C8NA 1QJU1 1AYN2 1HRI3 3VBRC 1VB2A 1MEC2 1TME1 3ZFGC 5C4WB 4Q4W2 1RUF1 2HWC3 4YVWC 4CDUB 3HAGA 3CJIB 4YVSA 1OOPB 1H8TB 4N53B 2WS92 2HWE2 5K0UB 1BEV3 1RMU1 4JGZA 4RQPA 5DDJ2 1ZBE3 3S6PA 5AC92 1NY72 3VBUA 1AR61 1M06G 1FMD1 1RUE1 1B35A 2PLV1 3VBFB 1PIV3 2RMU3 2X5IA 1RUJ1 5BNNC 1RUH3 2RS33 1RUI1 3VBUC 5FMOS 5CFDA 3ZXAC 3JBG1 1ZBA3 2WFF3 1VRH1 4JGYA 3VDDB 2RR11 1NG0A 1PGW2 1F8VA 1RUF3 4PDWA 4GB31 4N43A 2HWF1 5L7OA 3JD71 1TMF2 5CFCA 4PDWC 1ND2B 4N43C 2RM22 1RHI3 5L7OC 1MQTB 1RUD2 1ASJ2 1D4M2 2MEV3 2FZ1A 2R061 4Q4V1 1EAH1 2BFUS 3VBRB 1R1A3 1BEV2 1QQP1 4Q4X1 4RR3B 3J8F3 3ZFGB 1RUC1 1VBC3 1QJY3 2IZWA 1VBA1 4GB33 2R071 5JZGA 1AL23 2HWB3 1QJU2 4YVSB 3VBHA 1PO23 1TME2 1AL0G 1SMVA 5ACA3 5JZGC 1RUF2 1AYM3 1RB8G 4GMP1 4JGZB 4RQPB 5BNNB 4RFT0 3VBUB 1NCQA 1Z7S1 1PVC1 1B35B 4SBVA 1RMU2 2X5IB 2XBO1 4AEDA 1AR83 5D8AC 1FPN1 2DF7A 1NCQC 1VB4A 5CFDB 1RUC3 1AR62 1FMD2 4JGYB 2PLV2 3LOBA 1QJZA 1HRI1 1RUJ2 1POV0 1VBA3 4PDWB 1RUI2 5BNPA 4CDQC 4N43B 4IV1A 1W39A 2HWD3 5L7OB 3JBG2 2HWC1 1VRH2 2RR12 5CFCB 1QJX1 1RVF3 5C9AC 5BNPC 4RS5A 4GB32 2HWF2 1AL22 4QPIA 1PGL1 3JD72 1Z7S3 1PVC3 1ZBE1 5C8CA 2WZR3 1HRV3 2RMU1 1PIV1 2R062 4Q4V2 1VBB3 1RUH1 1RUG3 2RS31 1EAH2 5C8CC 4YVWA 1QQP2 1CD3G 4Q4X2 1ZBA1 2WFF1 5JZGB 1COV3 3VBHB 1RUC2 1QJX3 1HX6A 1VBA2 2RS13 2R072 1DDLA 1RHI1 5GKAC 1OHFA 1NCQB 5BNNA 2RS53 1VBD3 2MEV1 1VAKA 5A32B 4NWWA 4AEDB 1AR73 1R1A1 3J8F1 3ZFFA 1Z7S2 4CEWA 5J96B 1PVC2 2WWSA 1EV13 2XBO2 1VBC1 2ZAHA 5BNPB 1PO13 3ZFFC 4IV1B 1FPN2 4CEWC 1QJY1 2BUKA 4GH4A 2Y26A 1AL21 2HWB1 1X33A 1HRI2 4RS5B 1ND3C 1PO21 1R083 4GH4C 2QQPA 4QPIB 5ACA1 2HWC2 1AYM1 2R043 4Y5Z0 1QJX2 5C8CB 4WM7C 1R091 1E57A 1HXS3 1FOD3 1PGL2 1NA1C 1AR81 1V9U3 3FBMA 4YVWB 1ZBE2 4Y4YA 4WM8C 1BMV1 1PIV2 2RMU2 5LK7B 1RUH2 2RS32 4CEYA 1VBE3 2HWD1 1C8M3 1ZBA2 2WFF2 1RVF1 4IV3C 1NOVA 4CEYC 4BCUA 2ZZQA 5D8AA 5FOJB 1R093 3NAPA 1K5MC 5FMOL 5A32A 2WZR1 4RHV3 3ZFFB 1RHI2 1BBT3 4CEWB 3NAPC 1HRV1 1F2NA 2MEV2 4CDQA 1VBB1 1RUG1 1R1A2 1ND3B 3J8F2 5C9AA 4GH4B 5C4WC 1COV1 3CJIC 1OOPC 1VBC2 1AYN3 5K0UC 1QJY2 2RS11 1MEC3 2BFUL 3TN93 2HWB2 3JB4C 4Q4W3 4NWVA 1PO22 2BBVA 2RS51 1VBD1 4CDWA 5ACA2 1AYM2 1POV3 2WS93 2HWE3 4QPGA 1AR71 3DPRA 4FTBA 1R092 3VBSA 4CDWC 4Q4Y3 5DDJ3 1EV11 5AC93 4QPGC 3DPRC 1AR82 1PO11 4CEYB 3VBSC 5BNOA 1AR91 2WLPA 1BMV2 1A6CA 1ND2C 1R081 2VQ0A 5BNOC 2HWD2 5D8AB 2R041 3NAPB 1RVF2 4RR3C 1TMF3 3TN92 1HXS1 1AUYA 1FOD1 4CDQB 5ABJA 2RM23 1RUD3 1ASJ3 1V9U1 1D4M3 2TBVA 2WZR2 5C9AB 5ABJC 1ND3A 1HRV2 1VBB2 1RUG2 4YVSC 1AR93 3ZFEA 1VBE1 4FSJA 4Q4Y2 4FTSA 1C8M1 1HQNA 4WM7A 1NCRA 1COV2 4JGZC 3VBOA 2ZTNA 4RQPC 3ZFEC 2GH8A 1NA1A 1QJU3 4CDWB 1B35C 1CJDA 1GFF2 1NCRC 3VBOC 2RS12 2X5IC 1IHMA 1TME3 4QPGB 5J98B 3DPRB 4RHV1 4WM8A 1BBT1 5CFDC 3VBSB 2RS52 1X36A 1VBD2 4JGYC 2FZ2A 1AR72 1RMU3 5A33A 5BNOB 4IV3A 1EV12 1OPOA 5CFCC 1AR63 1FMD3 1RUE3 2PLV3 1PO12
chains in the Genus database with same CATH superfamily
4CDXA 4DXZA 2LROA 2E7TA 5FY4A 2LRPA 1RUI3 1SBDA 2IXKA 3M70A 3TN91 4A41A 3JB8A 3JBG3 4OHZA 2JDYA 3UNPA 4XJZA 3CO2A 4EJRA 1UYZA 3WOGA 3WNKA 1ODNA 3SMHA 2VQTA 3FLTA 3ZSKA 3IZOA 4BM8A 2R042 2WS91 3N9LA 3MIHA 1JYCA 3WQ1A 5FZFA 1GOFA 5C4WA 4XAEA 1UOFA 2K46A 2VBBA 4LE3A 4EN9B 1G9CA 4URTA 4FOWA 1CZVA 1QDCA 1HXS2 3ILRA 5A7WA 1ZX5A 2VNOA 4N53A 2MPFA 3VBHC 4PQ9A 3S0MA 1V9U2 1QGLA 4C90A 4QGLA 3CZJA 1OUXA 2D6OX 3DV8A 3PUQA 5JR2A 5LA0A 1IPJA 1HKDA 2VZRA 2ZKNA 5GZEA 4WM7B 2MNGA 3ZN4A 3FWEA 5JMCA 4FPCA 3MUZ1 4LBQA 4Z2WA 1FYUA 4DUXA 4DPNA 3UK9A 5BXXA 2VCCA 3T4HB 3H8RA 1JYTA 4XIKA 1OT5A 3VHPA 1WMDA 4GJZA 4D94A 1OH3A 2HEYF 4WM8B 2VY0A 3V65A 3VKFC 1GYKA 1HQLA 4OVEA 3T0BA 4U2AA 3SEPA 1HB4A 5GZCA 3BIEA 1OA3A 3CU7A 1GP5A 1LRHA 5EV7A 4IV1C 3HOBA 1BBT2 2I07B 4FI9A 4IV3B 4LA3A 1SDDB 1QNWA 4Q0PA 4IL7A 4QX3A 1DGWX 3ETPA 4A45A 2G4IA 5AFBA 2O14A 1HV1A 3Q8AA 2ARXA 3ZYHA 4YGEA 1PK6A 2X8KA 4JDOA 3AZVA 2R30A 3IDEA 3NV2A 4QKNA 1K5MB 4LLFA 3WW4A 1CONA 1W9FA 1FATA 3POBA 3PVBB 5APAA 3POYA 3ZYJB 1W8OA 1SBFA 4RR3A 1S0FA 5A7NA 4LIVA 2Z2SB 4DUWA 1O91A 3ZYPA 3F95A 2PHLA 3ZSLA 2IXLA 1VB2A 1XE0A 2QUOA 3H3LA 1JZ2A 4AI1A 1JH5A 1MEC2 3T4VA 2J1RA 3I3BA 4ZS2A 3OGGA 1LHNA 3HAGA 5HXVA 3I2HA 1DBNA 1IQAA 1KS4A 1RXGA 1T6GC 1CIWA 2DVDA 2FMYA 1AX1A 2K0GA 3OBAA 3I8TA 4R9DA 5A7PA 4XETA 2Y34A 3WNNA 4FPJA 1RMU1 4DOUA 1GBGA 1L7RA 2YMZA 2Q1FA 3ZVXA 3S6PA 2XLGA 3UJOA 5DABA 5EWSA 3VBUA 2IVIB 2YB7A 3UGHA 2J22A 3N9NA 2C5DA 2BEOA 4NROA 1GANA 3DCQA 2RHPA 4LTAA 2YV8A 4YLZA 4BJ0A 4RGGA 1RUI1 1UPIA 5L19A 4L9BA 4LHLA 4XF4A 3KF5A 5FTTC 5FXVA 1JHNA 5CFDA 3OJBA 4Q8LA 3ZXAC 4CXWA 3JBG1 5I8TA 5JXGA 4EE2A 2D3RA 2WABA 2WFF3 5LA9A 1UZ0A 2AR6A 2W9XA 1E5SA 1W28A 2WZEA 1UKRA 1DF0A 2YPDA 3MIFA 4XFHA 2ZGUA 1MZ5A 3RGBA 1PX3A 3H8OA 4UFKA 3RJRA 4Y26A 1TMF2 1MS5A 1ND2B 5LCWL 4LBMA 4YW4A 2JD4A 2PTMA 1D4M2 3EMRA 4BK5A 1W8TA 2MEV3 3ZDSA 4AVVA 1H2NA 4ONUA 3MYXA 2E33A 1JOPA 1J84A 2RJ2A 3UJQA 4Z1VA 3J26N 2XMLA 2D3SA 4PCRA 3BI3A 4PIXA 4FOVA 4ES9A 2BOJA 2QTWB 2NMOA 4CA9A 1VBC3 4XDOA 4AF9A 4B4PA 3IWZA 1GMMA 3LA7A 4BA6A 1Y9MA 1WCUA 3U75A 5FCCA 5FY8A 4NVPA 4D3WA 1B09A 2HWB3 2AYHA 1WLWA 1PO23 3QLQA 4XAAA 3Q8BA 5C3QA 1AL0G 2RJKA 2JECA 3V0BA 5DZGA 3WHTA 4A7ZA 3USSA 1YQ6A 3AP5A 4JGZB 4BLJA 3SLIA 5CISA 4IE7A 2XONA 4INDA 2PHTA 1B35B 3AZYA 5FYYA 2CAVA 4AQ6A 3ORJA 4N90A 5DUWA 2X5IB 2GH2A 3CHXA 1JYNA 2C9KA 2DF7A 5FYSA 2DCZA 4ZU7A 3OD4A 1RUC3 3CIHA 4MHRA 4PQQA 3RSJA 2WZ8A 1Q8QA 2PLV2 4JGYB 1A8DA 2JDNA 1VBA3 1V70A 2BRTA 2CNAA 2ILMA 3VD7A 3KVBA 4V2WA 4FOQA 4K8FA 1XC6A 1CR7A 2G19A 3MW3A 5ISLA 1I3HA 1W03A 2IXHA 1U5XA 1EY2A 4MSVA 5DDJ1 1MS8A 1MZ6A 2IC1A 4IEWA 2WO1A 1G9DA 2F6BA 4HSJA 4DINB 5FZLA 4CP2A 1NXMA 3OBTA 3Q8EA 1LOAA 3K3OA 4QPIA 1PGL1 4OZOA 2XWJB 1Z7S3 4HL0A 5A1LA 1PVC3 1UOJA 4M3CE 4KBZA 4IETA 3WUDA 1POQA 4D7YA 2YGLA 1UU6A 3LPFA 4HN1A 2G9FA 1HRV3 2R062 1D0HA 3D5OA 4NPLA 1VBB3 3HQXA 3OUIA 4EWEA 4UW5A 1UL9A 2FMDA 4TSVA 5C8CC 4A3ZA 1V00A 2NMNA 5FAXA 4YM0A 5FYBA 1CD3G 3IIAA 5HCAA 4UF0A 3HMYA 2WFF1 1GQGA 2E51A 3C7HA 4UWDA 3LAGA 4XURA 3H50A 5KXEA 4XJ8A 4HKWA 1C1FA 1AXKA 3RZKA 3BTZA 3S30A 2A1XA 1HX6A 3GZTB 4XBNA 3LA3A 5BV6A 1OQ1A 4NR1A 3ZSJA 1AXZA 1D4VB 4FQZA 2XQXA 3PVEA 1YC61 1HJFA 3HBZA 4RN5A 1IOAA 5BNNA 3HJRA 3GJBA 2YFUA 2MEV1 3JXSA 5JWPA 3RZHA 4AEDB 5GM0A 3FJSA 4OUMA 1AR73 4YW6A 1FNZA 3ZFFA 4AOCA 5JSOA 2BU9A 2PXJA 3OBRA 5DQ0A 1K42A 2C6SA 2D93A 2ZA9A 1ZZ6A 1VBC1 3WZ1A 1UU5A 1T6BX 1YQCA 2JIJA 3KV6A 1JU3A 4Z2AA 5IVCA 1FPN2 2VL4A 4B7EA 1HB3A 3I2OA 4NE9A 4KWUA 4BPZA 1OQEA 2O8OA 2W87A 2VZSA 4P9GA 1O6UA 4AHZA 4X8PA 4TLFA 4AI9A 2HWB1 1X33A 1HRI2 2JJ6A 4LLOA 1W9WA 3DKWA 4QKDA 3ZPYA 1G9BA 1UF2C 2HYXA 4AG4A 1BK1A 4L99A 1PO21 4FXKB 4MGKE 5FP3A 1QEXA 1BYHA 4LO4B 2GP5A 1ZYBA 5I0UA 5IYYA 1ULOA 2R043 3WF2A 2XJRA 4Y5Z0 1QJX2 3VBRB 5C8CB 2WSUA 1QXJA 1VRBA 4FT8A 4QPYA 4HVQA 1W2TA 1HXS3 4OZXA 2GN3A 3T30A 1C1LA 5KR7A 1WBLA 3GBFA 4DEQA 2DDUA 2EIEA 2VH9A 5F32A 1SPPA 1V9U3 3PUHA 5FJKA 4YVWB 1X8MA 2YG0A 1NKGA 4XCAA 2W39A 5C33A 4L11A 1BMV1 2VD7A 4WZCA 4AVCA 4F8AA 3GYDA 2JG8A 1GOHA 2W0XA 4IE0A 4ATEA 2DVBA 3BODA 4R4ZA 4CEYA 1LGCA 1A8MA 2A70A 1V6IA 4XF9A 1ZBA2 2CV6A 3P3NA 4JDMA 2SBAA 1EPZA 3HEIA 3Q9OA 1NOVA 5FZGA 2BNOA 2XJQA 3LPGA 1MVEA 2ZZQA 2W3JA 2XJUA 2UWBA 4UAPA 3HN1A 4AGGA 1CAWB 4XHXA 2A3YA 1E5HA 1JTZX 3NNMA 3WR0A 2WKKA 1LHUA 2GZWA 2L9LA 1CGPA 4I0WB 4PI0A 4GWJA 4XUPA 1A3KA 1BBT3 2E63A 4FOYA 2ZGSA 3O5SA 4HLTA 1CAUA 1F2NA 1HRV1 4CDQA 2VMEA 1VBB1 4Y20A 2B9UA 3I3EA 5T55A 5JPNB 1W2NA 3OEAA 1MVQA 4H2AA 4PIYA 2ZEZA 4AVSA 4NJ4A 2ZX3A 1RIRA 1QKQA 2XQRA 3IKWA 3V56A 1VLNA 3RZLA 2C24A 3CJIC 4BQXA 1QNYA 1OOPC 3NKTA 2ADEA 3OYWA 4FPGA 3LEKA 1H9WA 3R05A 3SISA 5K0UC 4R9AA 2ERFA 4JTOA 5I91A 1MEC3 2BFUL 2ENRA 1REDA 4P9XA 3WDVA 3HWJA 3FE5A 3FL7A 4NWVA 2C0ZA 3ALQA 5JOXA 2B45X 5D2AA 1LGBA 3OUJA 1YI7A 4KG8A 4YGDA 5FK7A 3USUA 1LESA 1XNAA 1AR71 3RFRA 4B4RA 2VTXA 3O14A 4FTBA 2HH9A 1K45A 1PNFA 5JPMB 1PZ7A 4Q26A 3KVAA 4QKFA 1W8ZA 1JZ3A 3ILFA 1OMIA 3KHBA 5B4XA 4ZONA 1NQDA 3PNAA 4HKLA 1IZ3A 5KXDA 4FAHA 1ODMA 3CF6E 5F2WA 3Q8FA 4TN7A 3VBSC 2ZX0A 3ZXGA 4KWLA 5BNOA 5A70A 5F1RA 4BISA 1VALA 3WW2A 4CZSA 1JHJA 3FHAA 3FLRA 3VKMA 1QJFA 3WDWA 1X82A 2O8QA 3ON7A 2VQ0A 5FO7B 3MPPG 4JX0A 4KI5M 4C0HA 2QZ2A 1X9PA 2R041 2VCAA 3SH4A 4B3NA 3ZYFA 3H1YA 2HEWF 3A0NA 4OHWA 2DYCA 2W1QA 1V6NA 2WL1A 1TMF3 5FZ0A 1VIWB 1HXS1 4B8EA 3KHCA 4YW1A 4H55A 3ITQA 2FDJA 1ZRRA 3D6EA 4FFIA 1V9U1 1D4M3 4E8DA 4MGZE 1ENQA 1FT9A 1S0GA 2R32A 4GXLA 3ACLA 3G7DA 4F7ZA 4QB1A 5AFEA 2P3IA 1G6NA 3QOPA 5ABJC 4JQTA 3ABZA 2ZCWA 3ASIA 1XOYA 3DL3A 1EPWA 1ULGA 1LECA 2IFRA 3HT2A 3RG0A 5FPVA 2GNBA 2WT1A 1AR93 2YXSA 2R49A 2XOMA 1KQRA 4FTSA 2OX0A 3DGTA 4TZDA 3B00A 2JWPA 2HLEA 4AQ2A 2VCBA 3BU7A 3IAQA 1W8HA 4BQ5A 3N9QA 4WM7A 3M3EA 1S2KA 4BIOA 5FPAA 1Q8OA 1LULA 1NYWA 4GALA 4O9GA 2Q0AA 2PFWA 1W6OB 4LA2A 4LBNA 5C9AB 5E89A 2BQPA 4UFLA 2OPKA 2ZAAA 4FBFA 4XJ9A 4QX8A 3RI9A 4O7XA 4L97A 3T08A 4A4AA 4LBKA 2JD9A 5EJ3A 5GLZA 2OZ6A 2XJVA 2Z42A 3VUOA 2GALA 2ZHMA 4WM8A 1BBT1 4YM3A 2VBPA 3FHQA 3W20A 3VBSB 4D7TA 3O1MA 2B5HA 5FZAA 3BTAA 3EJKA 3ATGA 1NZCA 5FXZA 4COYA 4LHNA 1H2MA 5A3TA 1GKBA 1W0NA 2GU9A 4FAGA 4XJWA 3O7OA 2QDRA 1H2KA 4Y1ZA 2EXJA 3QBQA 4YM2A 1JS9A 5FRAA 1H6YA 4AE2A 1VPHA 4IV3A 3W21A 2YU2A 2JDMA 1OPMA 3ZR5A 4IQPA 3POJA 1FNYA 2ZABA 1EV12 4UBGA 1OPOA 5FZ4A 5CFCC 2RDQA 1UOBA 1S0JA 2XR4A 1IG3A 2PLV3 2WN2A 1LENA 4LBJA 4NN0A 4K1ZA 5FYUA 1K5MA 1O3SA 3BOWA 1ENXA 4Y3OA 4HN0A 2D44A 1DGLA 1MEC1 3DYOA 3WF3A 5I0SA 2G9GA 1HLCA 2GC1A 3M8LA 1E5RA 4NRPA 3GBGA 1R082 1RINA 4MV2A 2PHWA 3WSOA 3WVJA 5ABJB 4ZS3A 2RG4A 5FZCA 4AAPA 1H1AA 1ZZBA 3LQCA 2W1WA 4YG6A 4AW7A 1DGWA 2BDRA 5JXIA 1O7FA 4QDSA 2DFBA 5LBFA 4ZU4A 3T3YA 2BNNA 1LOGA 4OI2A 3VKOA 2WAOA 2BP6A 1I6XA 2R063 3LEMA 1VJ2A 4L8QA 4MGIE 4AFCA 3R4DB 3DXUA 1OQDA 5J7MA 2D7FA 3W9AA 3JQWA 2BGPA 1MS9A 1QDOA 4ZZ5A 1XSRA 5A3NA 1GWKA 2HBTA 3J7MA 2VO5A 3HD8B 3LFMA 4BXSV 3KGZA 3HBKA 3WDTA 1W2OA 5JXJA 1RUE2 2Q1ZB 1D2SA 3OG2A 4UOJA 1CJPA 4BXFA 2VMHA 4MX3A 2AEZA 3AVSA 3MV11 5L73A 4ASKA 1TMF1 2WO2A 4YYOA 4IE5A 4CCJA 4P9WA 4ARXA 2J1TA 2WO7A 5FWJA 1IS3A 5IHRA 1D4M1 2ZHLA 3VDDC 3POWA 4IEUA 5LBCA 2VZOA 4QWNA 2BVBA 3DXTA 3M3CA 1ND2A 2D6NA 2VUCA 4ZY9A 4BWOA 2XJPA 3AM2A 3MLKA 2CAUA 2OS2A 4Q0UA 5F6KA 2IWGB 4COUA 4RS5C 3BYWA 3S7EA 1UWWA 5A6XA 2YU1A 5KHKA 5H9RA 4FQ4A 4JVAA 2QDNA 2ZHKA 5C71A 1WCDJ 1Y9QA 1MQTC 1FPN3 2WNVB 2WT2A 4YW7A 2OT7A 3THCA 2JE8A 3OTFA 4WVMB 2VW2A 4KGQA 2JG9C 2ORXA 3VZNA 2R1BA 1ZZ7A 2VTXJ 4AI2A 1HRI3 1XNCA 2W2IA 1Y4WA 5T5JA 3VBRC 4BE3A 5FYTA 5HCHA 5A3WA 2JENA 2WRAA 4FPKA 1UYYA 2RDNA 2A6YA 3HNBM 4GULA 5EJ1B 5FZ9A 4Q4W2 2H0BA 4XIOA 3M3IA 1NLQA 1VAVA 3KT4A 4CUBA 2I45A 2EAAA 5E1RA 2HWE2 2X10A 3ZIWA 2EVXA 2ZJCA 4CU9A 2LS6A 4JGZA 4NRMA 4PLOA 3AC0A 5DDJ2 5AC92 1NY72 4EROA 4EV0A 2C4XA 3QD6A 1B35A 2PLV1 5A3MA 4S2HA 4XVHA 3U14A 2X5IA 4S2FA 4Z8BA 5LZ6A 1D2QA 3EO6A 2VZUA 4HOOA 2GMEA 4AZZA 2LTNA 4Y22B 3AVRA 5DUXA 5F3GA 1WD3A 4CUAA 4M00A 1ZBA3 2ZEXA 3WX5A 3A22A 5FXXA 3VDDB 4JGYA 1NG0A 4K1YA 2E26A 3DF0A 2CY6A 3DUIA 3CEWA 4LKSA 1DHKB 1MS0A 1ULPA 5FZBA 4DXSA 2OIIA 4LR4A 3J7LA 4KMQA 3I2IA 1J3QA 1ONAA 4GKXA 5F2SA 2ZACA 4IE4A 4HPKB 2OYZA 5HPOA 3T2PA 4MYEA 3O0WA 4I0BA 5JMOA 2WYFA 3PL0A 3IPVB 2RM22 1XRUA 1MQTB 2E32A 2P37A 3V0AB 2VOXA 2FZ1A 2JG9B 2R061 3WDYA 4CU8A 2CGOA 1TG7A 2ATFA 2J7MA 1OURA 3IIIA 1LHOA 2GAUA 4LJHA 1BEV2 1BXHA 2X09A 4NUBA 5FQ0B 3TOJA 4MO3M 5DZFA 5BY5A 1X7NA 2OVUA 2VTFA 3WINE 3GNEA 3OPTA 5FREA 1YWKA 1AJOA 3ACHA 5CKMA 1O4YA 2VOKA 3N9PA 3TAYA 3QCWA 2LM3A 2P5BA 4BQ4A 1TNFA 2IZWA 2KR2A 4Q0QA 3FLPA 1GICA 1O5LA 1OA4A 2Y60A 4YVSB 5C3PA 4P5HA 1UMIA 4XCBA 3AZXA 1UYXA 3I59B 4DEVA 1GZTA 3W58A 5JZGC 1RUF2 3GBWA 3NWKA 3GHMA 4NPRA 4RQPB 3U0ZA 2Y6HA 3HIFA 4RFT0 2PELA 1VAMA 4GIQA 3WHUA 4CCCA 4XQ4A 4I2OA 3GCXA 3WEZA 4ASMB 1H0BA 4EN8B 4EN7B 1OLMA 1YIFA 1RJ8A 3RDIA 2D5FA 3MBWA 3P5BA 4CXXA 3APBA 2W5FA 4QKBA 4AEDA 4XUOA 3B5LB 2WR9A 5D8AC 3WP3A 5BUVA 2VUJA 3ME2A 2XUMA 1FPN1 3NJVA 3OBZA 1JZ5A 5G04L 3TNQA 1AR62 1BJQA 1FMD2 1JMUB 3LDKA 1SACA 3VD5A 4QDRA 4HG6B 5GZGA 1FAYA 1DQ5A 1QJZA 1HRI1 1DZTA 1WW4A 1POV0 1LNSA 4LORA 5I8SA 2FDKA 1S0EA 2ZS6B 5FKCA 3FN9A 4QU2A 2X29A 1SHWB 2ZBJA 1XNTA 3KMHA 2RR12 1QJX1 1Y43B 5C9AC 3LE0A 3JUUA 5BNPC 4BH9A 1NQJA 1ZRIA 3CLPA 4GB32 1W3XA 2HWF2 2TEPA 1AL22 1W3VA 2Z79A 1C3HA 3AP9A 2WWJA 3AKTA 3EQEA 3PVOA 2CHHA 1UMHA 4MUVA 4P08A 4AVTA 1KGYA 1PM4A 1NZIA 3THDA 2W68A 3OGVA 3ZXKA 5C8CA 4JQRA 5F5QA 5JUVA 2HKXA 2WN3A 2PAEA 1W04A 1MPXA 2PN5A 3OEBA 3RYPA 1K12A 1M4WA 4L0PA 4ZKTB 2ZX1A 1SLTA 4QXBA 4YVWA 5EHDA 4Q8KA 4Q4X2 1O3RA 1ZBA1 4IESA 4MADA 1RYYA 2YC0A 3GZAA 1MS1A 1FV2A 5JZGB 4V2VA 5FBJA 1GZWB 4JAAA 3I2GA 3VBHB 2D6KA 4QGNA 1V6LA 5FUPA 3BN6A 4R8HA 1N1YA 3H3UA 5TSWA 4QHBA 4NHKA 2V4AA 3PVNA 5ERLA 4C1XA 4AQSA 1ZRFA 2R072 5A7SA 4GZ9A 1KFXL 3SKJE 1CAVB 5J48A 4YPJA 4PT6A 1SLLA 4CCDA 4FP3A 1WW7A 1CAWA 4XQDA 1V6KA 3WT3A 3MV01 2BYVE 4MVTA 4ZZ8A 3KQ4B 4KG0A 1GNYA 1GQPA 4AEMA 4JZRA 2CGPA 5KC6A 2IVJA 2DVFA 5CB7A 3RS6A 1WCQA 3WDUA 4V1PA 1EV13 2VGDA 2VVDA 4PBOA 2XBO2 3PJYA 4YNIA 1W9SA 5FP4A 5BNPB 1RUOA 2WNOA 4IV1B 1N1SA 2DU1A 2QE3A 2QQWA 4KQ7A 4Q1PA 3ZMOA 1KEXA 2VU9A 2GNTA 4XFCA 5E8AA 4CEWC 3WQ0A 1OBNA 3MW2A 3PTYA 1XBFA 4RA0A 2VZ3A 2DU0A 4I3GA 4YGCA 3I49A 1CX1A 2WIIB 5K4LA 1ND3C 3M3OA 1GOGA 3ILNA 1R083 4DS0A 2D43A 3ZN6B 5J36A 1SLAA 4OMDA 2HWC2 3B69A 4HVOA 4NO4A 3UESA 3GZUC 1VMFA 5F5CA 3MIBA 1EUUA 1U12A 4XF1A 1HW5A 2AREA 2NM1A 2HYKA 4E4ZA 2ZX2A 2AACA 3BVCA 3OCPA 2A71A 5E16A 1GWMA 3SQOA 4PLMA 1GZCA 1NA1C 3L9JT 4LOTA 4AEJA 1HJGA 4MGSA 1DQ2A 4RFRB 1ZBE2 2ETEA 3BALA 2XKPA 3MIEA 4Y4YA 5IWFA 3O0VA 4LIUA 3LSDA 1TZOA 2XB6C 3AMPA 5CA6A 1PIV2 3B02A 5LK7B 4JHTA 4YFWA 1RUH2 4PHZA 3WNXA 1ZA4A 3M3QA 5IVEA 1GR3A 5LWBA 5FP9A 3I54A 2W52A 4UYBA 2QFEA 3N9OA 5FPUA 5EXOA 2VC9A 3N3HA 1ZA7A 1MACA 4Q2FA 4XDQA 2Y38A 1WWYA 2PA7A 2VOWA 3I3DA 5FZ7A 3U11A 5CADA 2QVSB 1O4TA 4YZ1A 2ADDA 5LA1A 2QQUA 4JHZA 1C57A 2KM2A 1DP0A 2DCTA 2NZ9A 3D0JA 4XUTA 5A32A 3T1LA 5FO9B 1RHI2 3VLBB 4IDZA 4XFFA 1FI2A 1UKGA 4CEWB 5IJRA 1TNRA 5FY9A 4A42A 4QX1A 4YZ2A 4ES8A 5C3RA 2F4LA 4LK6A 1W6MA 4QX7A 1H1IA 1ND3B 3T0DA 1YFWA 2AC1A 3O12A 1Q43A 1DLLA 3UKNA 5C4WC 5ANNA 1LOFC 3UV9A 4D6SA 3UGFA 3PDQA 2DVGA 5G05L 2XL7A 2VW1A 1Q3EA 4UW4A 5HI0A 2W94A 4QHOA 4XQWA 2RE9A 3W59A 4X6RB 1D7PM 2XJTA 4KU8A 1QJY2 5FY1A 5IK4A 1JZ8A 2WQZC 3I2JA 2E6VA 2JDZA 2JDKA 2Q8OA 1W05A 1ZVFA 5C5TA 4Q4W3 2W47A 4A6OA 1W6OA 2ES3A 5HV0A 4Y33A 3EYPA 2CTVA 2Q30A 3ETQA 2B7YA 1AYM2 4XF0A 2CDOA 2HWE3 2R16A 1H4GA 5F39A 2FD8A 1C28A 4IEQA 4LBOA 1R092 4MH0E 4Y5SA 3VBSA 4WVWA 3CZUA 5A3LA 3ZYIB 2UWCA 4Q4Y3 2WNUA 5DDJ3 4YW3A 1EV11 5AC93 4QPGC 3MIGA 5T52A 3DPRC 3AXEA 1US2A 3I97A 4AXOA 3ZDVA 4QX5A 1GQHA 1RTVA 3WF4A 4PJYA 3H42B 2EXKA 4R52A 3ZPOA 1IGOA 3ZX7A 3PU3A 3K75B 5DN2A 3VZMA 2WLPA 5I8YA 1R081 3OPWA 4FPYA 4BMBA 1PK6C 1OF3A 2D40A 5FZIA 3A23A 2PMWB 4MGTA 4LBQD 4L92A 4CPBA 1PVXA 1RVF2 2VAUA 4HK8A 4HT1T 5DAVA 4DY3A 3U78A 2P3JA 3FX3A 3LOIA 4RR3C 2VULA 3TN92 4DUVA 1AUYA 1NE4A 3SEEA 2BW8A 4XHBA 1ZNPA 2RM23 3NW4A 3RRDA 3I2FA 5ABJA 3GALA 2JX9A 3J9SA 4W4ZA 2TBVA 5HCBA 1A78A 1H2LA 3AP7A 1OLRA 2F17A 2WQ8A 3LIHA 2DCKA 4IEXA 1S0BA 1SFYA 3MGUA 4FPEA 1W90A 2YGMA 4ISRA 5FYHA 3T1MA 1XU1A 5C7GA 1RUG2 3TEYA 3K3NA 3LSEA 4XUNA 1YQ8A 4FSJA 2GMPA 3ZXLA 1HQNA 4GD4A 1J3RA 1UO9A 4CUGA 1N1TA 2ZTNA 5L36A 3C7EA 1LGNA 1OH4A 2DBIA 3NV3A 3VV1A 2JIGA 2VUAA 3C7FA 3IDAA 1AX2A 3K4AA 2ZPXA 4FPFA 1EP0A 3AYEA 2OXBA 1F4HA 1JBCA 4S2DA 4YW5A 5I0DA 1CJDA 1GFF2 3VBOC 4CU6A 4ZHNA 1ZRCA 1IHMA 1CAXB 2VXJA 4QPGB 1MR5A 3DPRB 4LO8A 5A6YA 2QCSB 3KT7A 1DYOA 5GJ6A 2P6HA 2LALA 3KWVA 2ZZJA 5CFDC 1N47A 3TRSB 1YUDA 3LFIA 4W8JA 4DQAA 2B46X 5FZHA 1X36A 1VBD2 4AHYA 3FUQA 4BB3A 4XTPA 2FZ2A 1F9KA 3KCCA 2FDFA 1RUNA 5JDBA 3KV9A 2WYSA 3JZVA 4RGAA 4CP9B 1KJLA 2K2SA 3D8CA 4XFAA 1MS4A 2W1UA 2W91A 2YPJA 1AR63 2WFPA 1IG0A 1FMD3 2KA3A 1ENSA 1DQ6A 1CPNA 3H9AA 1D0GA 5LRRA 1G9AA 1S2EA 2JB8A 1UIKA 5FY0A 1K5JA 1BVP1 2GP3A 2WNVA 3FZ3A 4FPLA 5B4NA 4WVMA 4Q4W1 2KD7A 2V5DA 2Y0IA 3E1F1 3LGRA 4BQWA 1JUIA 2RR13 3AP4A 1JYVA 2EIDA 4AFAA 1JW6A 2ZEYA 4D7SA 4BDVB 2OQ6A 2HWE1 2HWF3 2GNDA 3ZSEA 2Q4SA 3UGGA 2ORZA 4FTEA 1OVPA 3EHKA 2VZTA 2YHJA 4Q4Y1 4JRLA 1LCLA 1F4AA 3M1HA 1FOD2 2VMCA 1NY71 2PYTA 3NNGA 5EFUA 1AX0A 1V6MA 5GLWA 5AC91 5FJHA 5HBAA 3RZJA 4CDUC 1QOTA 2D3PA 2WLQA 3B7MA 2ZGMA 4MZUA 2AZ5A 2EXIA 4H3WA 1EYBA 1H8TC 4LE4A 4XMIA 4XEZA 5LW9A 1JYWA 1UXXX 2PHUA 4Q4X3 3RVHA 3VBOB 3ZXEA 4A44A 2YDEA 4GMP0 4XPVA 4ASLA 4CRQA 4OHXA 5F3IA 1H1MA 5FZ1A 4LNVA 5DUUA 3KV5A 3U4XA 2FHRA 3VD9A 3MDPA 4RYDA 3PUSA 4UBHA 4UT5A 4NMIA 3U37A 3VBFC 3ZOIA 2Y6LA 1OD3A 3VDDA 2R073 2TUNA 3NL1A 4YM1A 2XPJA 1U5YA 2B4KA 1SFNA 1R64A 2RM21 1KS5A 4FP2A 4DO0A 1JU4A 3WG3A 4HPKA 4RHV2 3WW1A 3E97A 4GMP3 5A33B 4H7MA 4PI2A 2RVAA 1QWRA 1BEV1 3IPVA 3WUCA 1MQTA 4GWNA 4A6SA 3F2ZA 3L2HA 1C4RA 2QKDA 4M4PA 4QMAA 1S0IA 3V0AA 2JG9A 4XOGA 2XBO3 3OD0A 1W8NA 3UKVA 4QPIC 4R9BA 4HMZA 2BTVC 4K3UA 3VBRA 5FQ0A 1W99A 4EN0A 3ZXDA 2YBKA 4Y1XA 1S4CA 3IN9A 3T2TA 3O1OA 3AX4A 3FC0A 3U07A 4JTNA 4YW2A 1C8NA 3RJ2X 1AYN2 2QQNA 4F83A 1NT0A 3SNMA 1JYIA 4P9JA 4Z82A 4JC1A 1XU2A 3KF3A 2W95A 4B29A 1UZYA 2A6ZA 1MZFA 1OVSA 3ZFGC 3SC7X 1WD4A 1U5IA 1RUF1 2HWC3 4OULA 4CDUB 1QY4A 3WDXA 2PHFA 2Y64A 4OLLA 2VNGA 1F5JA 1OSGA 1NLSA 1W8UA 3CJIB 1OOPB 1H8TB 1QIQA 3N7LA 4YVSA 2Y6FA 1QH6A 3N35A 5IVBA 5K0UB 3I59A 5L9VA 2VJXA 3ZYRA 5H9QA 4N7IA 4W50A 3MF6A 2P17A 2UWAA 3LEIA 4RQPA 2VMIA 5FMBA 1ZBE3 3UKTA 1RITA 4CCLA 1AR61 1LKNA 1WLTA 1M06G 1FMD1 2WINB 3AFGA 5AVAA 3VBFB 5IFPA 1PIV3 5BNNC 4EWDA 1RUH3 2ZXQA 3AKRA 4IGQA 2ZGRA 4Q0VA 1YEWA 1ENRA 5FMOS 1S2BA 2BWCA 4DNYA 1BZWA 2YZ4A 5JXHA 1GNZA 1WW5A 5LBBA 2RR11 5FDBA 5KXBA 1PGW2 4AEKA 1F8VA 2W1SA 3VL8A 5KC5A 3CNAA 4NAOA 5FLHA 1LTEA 4TTGA 3HNMA 4GB31 5IVVA 2HWF1 2ZGTA 2XWBB 4FPHA 2CDPA 3VKNA 3BOPA 3WNMA 1G7YA 2E9QA 3VGIA 2Q8CA 5DAQA 2FCTA 4C0BA 1J1TA 4PDWC 3W5NA 2BBAA 4QQHA 4N43C 5CU1A 3BB6A 3UL2A 1RHI3 3IDBB 5L7OC 1RUD2 1UAIA 2JXAA 2X53S 1ASJ2 3AL6A 1LOEA 5T5LA 4QB2A 1XYPA 1KD7A 3FFQA 4KBBA 4XXAA 1AF9A 4QQLA 4Q4X1 3WP6A 4D8MA 2FQPA 5JOYA 2WA3A 5DAPA 3ZFGB 4M4RA 1GNHA 1W9TA 3M2MA 1YRZA 5FP7A 4AI3A 4M01A 1XQNA 3IMMA 1FXZA 5JLVA 1RGSA 2W46A 3BIWE 1LAJA 4XW3A 4FXGB 2NP0A 4KWJA 1QJY3 4CXYA 1XE7A 4NRQA 2ZMNA 2R071 1X8EA 5JZGA 3K2OA 1GZWA 1QJU2 5DG2A 3VBHA 3ZYGA 4NHYA 3SITA 3TEWA 4O61A 1PZ8A 2YROA 4DXTA 3B01A 3LCPA 1TME2 4J25A 3D3AA 4NIDA 3WP5A 1OXCA 2ARCA 1AYM3 3NJZA 4GMP1 5BNNB 2YBSA 2O0OA 3H8UA 4HSLA 3I4IA 2E31A 3R4SA 1XB9A 3VHOA 1CAVA 4YWAA 3HR9A 1UCXA 4O9EA 5IK7A 4GAZA 1NAEA 2XBO1 4CCNA 2XXZA 1W8WA 1SCSA 4WZFA 5EYYA 3O1RA 5KHGA 2WUHA 1NCQC 1VB4A 2XDVA 1N3PA 3RMYA 3ST7A 2GMMA 3ZYBA 1CQ9A 4WV8A 4BOWA 3ELNA 1JOJA 4Q27A 3LOBA 2CU5A 2XL9A 1RUJ2 5GZDA 5IVJA 2RJLA 1F15A 1XJAA 3BPZA 3E6BA 4PDWB 5BNPA 4CDQC 3NRUA 4GJYA 4IV1A 4N43B 4BQ3A 2GC2A 2WQ4A 5L7OB 1W6PB 4JCKA 2BERA 4AFMA 4DB5A 2ZOEB 2HWC1 1Y7BA 1YI9A 1W8FA 4SLIA 5CG8A 1VRH2 2C26A 4DIQA 5T5OA 5CFCB 1RVF3 2YFZA 4NHLA 4W6YA 1Q8SA 4X8NA 4META 3LEGA 3HNYM 3G6JB 4MHUA 3J7HA 2D6PA 4DXRA 2XLAA 1WMXA 2D97A 3H1MA 3ZN6A 3OY8B 3JD72 3A0KA 2VPVA 1Q8VA 1ZBE1 2QQVA 3GM8A 4LHKA 3VZKA 3ZKYA 2A3XA 4JKLA 4XFIA 2OA2A 5LEJA 1APNA 1SPPB 1URXA 2DUPA 1PIV1 4Q4V2 2R7EB 5H9SA 1RUH1 1RUG3 2XJSA 1YFXA 1EAH2 4AGVA 5KHHA 5LRSA 1Q56A 2VW0A 4IERA 2PHXA 3WF0A 1VMHA 1QQP2 1J3PA 2QQOA 4HONA 3E5UA 3W5MA 4WBBA 2NPIA 3PJQA 4HZFA 1J59A 1RUC2 2Q1MA 1MS3A 1KRIA 4AFDA 1WLDA 1QJX3 2VE1A 2HBUA 2ZGPA 4YZ5A 3SCGA 1GWLA 1VBA2 4LUMA 1HV0A 4A3XA 2HJIA 2Q8DA 3VL9A 2AGSA 1RHI1 5GKAC 1OHFA 4AFBA 1NCQB 4N8MA 2P6CA 1UMZA 2GC0A 5FZKA 3RI8A 5CBLA 1VBD3 4AWDA 1VAKA 5DAXA 4NWWA 5K9YA 2KXLA 1YJKA 1DIWA 3KSCA 5C5UA 5CKNA 1STMA 2IUWA 4XABA 3ZSMA 3BPSA 4AK3A 1Z7S2 2VECA 4CEWA 1OKOA 1AXYA 1PVC2 3MEPA 4YRDA 3B94A 3S7IA 1NXD1 3C2UA 2Q5TA 3BTXA 2ID4A 3PU8A 3FMGA 3Q8CA 4HBNA 1WBFA 4AL9A 4NAMA 2VOTA 2XVLA 3WV6A 1QJY1 2ET7A 1OI6A 4CSWA 1QU0A 4QT6A 1S1AA 3KQRA 4IGOA 5ANQA 4QM9A 5JSRA 4RS5B 4IE6A 4TWTA 4PBPA 1QOSA 1QXRA 4S2GA 4XDPA 5SV8A 5F7UA 5LEKA 4NIHA 3GXUA 2J1UA 4GH4C 5LB6A 1ZM1A 1DGRA 3B3QE 1AYM1 4X6QB 2WT0A 3PHMA 3K77A 3OB8A 4P9LA 4Q1RA 4EN6B 4CVUA 5A1AA 1YXWA 1LB2A 5FYVA 4RSUA 4XYXA 3WY6A 2OUJA 4WM7C 5IAXA 1R091 4OCTA 4XC9A 4AVAA 3N7KA 1YHFA 2XKOA 2H6BA 3SH3A 1FOD3 2WAAA 3KD4A 1GSLA 3CL1A 3AMNA 3THTA 5CKQA 5A7QA 1F35A 1BLZA 3ZO0B 5F9TA 4Q29A 5J1XA 3MIDA 4UI9L 3MZHA 1SBEA 1XNDA 2B8MA 3I2KA 3HPNA 4WM8C 2RMU2 1DCSA 4MXWB 5DG1A 5DXDA 2IXIA 2RS32 2Z5WA 1OF4A 5T50A 1NUKA 5T5PA 1OC1A 4ZU5A 4AI0A 3QH7A 1DYPA 1LEMA 5K7PA 2A6WA 3WQBA 3NKGA 4EZ4A 1DU3D 3SXWA 1RVF1 1JZ7A 3POIA 4IV3C 5CG9A 1FV3A 1UX6A 4BCUA 2BNMA 3WNLA 1HB2A 5J3UA 2RDSA 1QOOA 1SG3A 4K8RB 4AHXA 4BZ4A 4DMIA 3TB0A 1SLBA 4FO9A 4IXLA 1K5MC 2Y0OA 4PF1A 1RC6A 1ZZ8A 4DZGA 3RZMA 4N9IA 5FLIA 3SCHA 3KCYA 5BYNA 1I9RA 4RHV3 2WDBA 3T09A 1I5PA 3NAPC 3HVDA 1UY0A 1RUG1 3IMNA 2EF6A 1LOFA 2OUHA 1UPSA 2WA4A 1R1A2 3WP4A 1REEA 3D4KA 3J8F2 1OA2A 2OPWA 3K4ZA 1BQPA 4QX2A 4GH4B 2JKXA 5JSPA 2YUEA 1KJRA 2ZMLA 2P2KA 3MPBA 3OF1A 2XGXA 3K46A 5LA2A 2EA7A 3D0SA 3E5QA 3K4DA 2A6XA 5FOBB 4BMEA 4B4QA 4HVRA 1JODA 4R9CA 1AYN3 5HCFA 3IBMA 5FFOC 1WLCA 4QAWA 1ST8A 4OUEA 3GGLA 1BHGA 2QQLA 3JB4C 5FMCA 1YFUA 4NHXA 3E6CC 2D5HA 2ZGLA 2SLIA 4RGKA 2UURA 4IEZA 4ZXEA 3TYJA 3ACFA 4UFHA 3DECA 1VBD1 5ACA2 1O4ZA 1XNKA 1HDKA 5F6LB 1POV3 3O0XA 3BUCA 4FVVA 1CAXA 4QPGA 1FX5A 3DPRA 3VDBA 1LR5A 2NQYA 3GJAA 3ZN5A 1AJKA 3MHZA 4YZ3A 4CDWC 2QBXA 2B42B 4QXCA 2ARAA 2Y6KA 3DYMA 4YARA 2VOVA 3VZOA 5FR3A 2JDUA 1XPWA 1DGRN 4XZPA 1AR82 4P14A 2P34A 2UYBA 2VZ1A 4DRVA 1IQDC 5CVRA 2EICA 5JIUA 1PGSA 4UW6A 4UFMA 3POEA 1H30A 3ES1A 2PAMA 4NIIA 1VR3A 3T2QA 3ZM8A 4CP9A 3E5XA 1CZSA 1A6CA 4JV4A 1ND2C 1BCXA 4DRRA 2Y33A 5CNAA 2HWD2 2DBNA 3WNOA 2V4VA 5D8AB 5LATA 3NAPB 1TVGA 4OHYA 1PM7A 2FDHA 3PMEA 4ARYA 4BQYA 5BNQA 3POFA 3AXDA 5FYCA 4M3CB 4XTMA 3U10A 5KHIA 3URFA 4IUGA 1FOD1 1AHSA 5A3OA 1RUD3 2ZMKA 3J7NA 4LKDA 1XYOA 1A34A 1ASJ3 1W6NB 3NSTA 4O65A 4AR2A 3E6DA 4M3CF 2WZR2 4MG2A 1S0CA 2EIBA 2P3KA 4EZHA 4YGBA 4WVVA 2O1QA 4IEPA 5JI7A 3SKVA 4D69A 3MW4A 2WJSA 4LO5B 2P4EA 4LQRA 2WC2A 4GWMA 3V64A 2JDPA 2VG9A 4QU1A 1LU2A 5C3OA 1US3A 1KDMA 5L9RA 5D1IA 5A6ZA 2YC4A 5E88A 1QJEA 2BVVA 4LMFA 5FZMA 5FIXA 3OUHA 5FZ3A 1PMHX 1COV2 4JGZC 3VBOA 2R6QA 3ZFEC 4QD2A 5E6HA 4K20A 5IK5A 2K9ZA 1LOCA 1U0AA 2GH8A 3IT8A 4D6QA 1BK0A 1QJU3 5FWEA 5A1FA 5JIAA 4CDWB 1B35C 2J1VA 4MOAA 1NCRC 2RS12 4FFHA 4KU7A 2X5IC 1TME3 1N3OA 1L3JA 2W92A 4K9SA 2WBKA 5FYMA 4CU7A 3AB0A 2I74A 1NLRA 4OHVA 1L7QA 4HANA 4RHV1 3LIGA 4N9HA 1H8VA 3VDAA 5FZOB 2RS52 3WXPA 4KGGA 2A73B 1REFA 3FBYA 4JGYC 2GN7A 1OKQA 2ARBA 5FBZA 5FY5A 1ACCA 1LEDA 5FUNA 2XVGA 5LK5A 3FUOA 4QPWA 2WZPP 3WW3A 4HK9A 3KCXA 5A33A 2C1FA 5EIYB 4L2NA 1WCKA 1PMIA 1N3QA 2VMGA 3VKLA 3B93A 2W08A 4D0QA 5EP9A 1S55A 2QJVA 4OI4A 2V09A 4I0AA 1RUE3 1W6QB 1PO12 4PLNA 5FYIA 1AYN1 2XG3A 4I09A 1RUJ3 2YYOA 2UYAA 4TLGA 1ULCA 3WCSA 2LW8A 1AR92 1TEIA 3EB7A 4XMAA 3A21A 1UXZA 4E9KA 4LOSA 5C8WA 3PIJA 4FCAA 4CDXC 1VRH3 1H4HA 2DVAA 3WLUA 4LT5A 3OSDA 1POV1 1Q5OA 1GUIA 5HV4A 1JYXA 1UY2A 4CP1A 3BU0A 4UFJA 4CDUA 4Z92B 3OGJA 3ZMNA 1UY3A 3JD73 3I3MA 3CJIA 4MLOA 5F8PA 4E4SA 1OOPA 1H8TA 3AL5A 3AP6A 2IXJA 4OFGA 3M4FA 4CCOA 2VZVA 5GZFA 5K0UA 3ZFEB 4D6RA 3O1TA 1SQ4A 1VMJA 1JI6A 2VNRA 3ENRA 4Q4V3 5F37A 3KV4A 1EAH3 3N9MA 2J42A 2BPA2 4N53C 1G8WA 3PUAA 1IKPA 2PHDA 1W0PA 1GU3A 1NCRB 1QQP3 3HQRA 4I02A 4CE8A 2A6VA 2BJSA 1CPMA 4Y1YA 3TEXA 1VBE2 1PGW1 5FZ6A 1Z78A 2J1AA 3VBFA 1IS4A 1NA1B 2JB4A 3HN3A 4E2SA 3H7YA 1C8M2 1F31A 3AKPA 2D6LX 4ET7A 3O1SA 3JCIA 1F5FA 3S5QA 4Q0SA 4AEDC 5JCTA 3NV4A 4COWA 1ALYA 4P9YA 4HXCA 5EJZB 2R1DA 3ZIXA 3IDCB 1RUD1 2R0HA 4KWKA 1ASJ1 2JKBA 1CVNA 1LHVA 3PTRB 1OUSA 3QACA 3NQHA 3EBRA 5FZDA 5DUVA 3RQ0A 1DZRA 1Y9GA 2QQMA 2V73A 2GNMA 2UY9A 2VR4A 4KH9A 4YSFA 4FFGA 4RD7A 5DMYA 1KDKA 1PX4A 2A3WA 2GSYA 2H0VA 1PMJX 3RMXA 5I0RA 4CDXB 1GLHA 1VE0A 1C5HA 2BZDA 2DTWA 5FZEA 2G9ZA 3B9IA 4TXWA 2CYFA 1DZQA 2XVKA 5FUIA 3ZFGA 3UETA 4DY5A 2UY8A 3T2OA 2DCYA 1QJU1 4GWIA 1RXFA 4JKMA 2ZGOA 1UQXA 3AMQA 1WKYA 2QQKA 4LKEA 4PF5A 4B7KA 5JI9A 2C9AA 3NVCA 1TME1 4ATFA 3BCWA 3P1IA 2CWMA 5C4WB 1XE8A 4K7JA 3LD8A 4YVWC 3ES4A 3GHNA 5A6QA 4MXVA 1GZ9A 5IFTA 4A2UA 4IEYA 1UN1A 5A7WB 5GLVA 2FCUA 4N53B 3CKHA 2WS92 1W0OA 3VZLA 4AI8A 1CESA 4YFZA 3BGAA 4I30A 3C3VA 1BEV3 3PUIA 1JOBA 4BLIA 4AGRA 1CIYA 5FPBA 1DQ4A 5FXWA 1AZDA 3FFZA 2DUOA 1IPKA 5LY2A 1HN0A 3LDBA 1YCIA 4N7UA 3TBDA 3O1UA 3H8XA 1OFSA 1RUE1 4W6WA 5DZEA 1WCSA 2A7AA 2DCJA 4LBQB 2RMU3 1RUJ1 1YO8A 4LPLA 2RS33 3VBUC 4J1XA 4RL7A 3UT0A 4LEJA 1VRH1 1IS5A 3MUY1 3IB3A 5FKBA 3AZZA 1RUF3 3RYRA 4PDWA 5HXMA 1MZEA 2IXCA 2BOIA 3OGRA 2B9VA 1WZXA 4N43A 3CMGA 4XACA 1Z0HA 1QMJA 1W6PA 3SH5A 5L7OA 1R1ZA 2ZX4A 4XJAA 3JD71 2A75A 3B9CA 3C7OA 5CFCA 2E7AA 3RPQA 3S57A 3PIGA 1RL3A 3DKQA 1PK6B 3AYCA 3AZWA 3R6SA 4YG3A 2NYYA 4Q4V1 2EALA 3T0AA 1J58A 2JE7A 3OY8A 1ZRDA 1EAH1 1H6XA 2BV4A 2BFUS 2QQIA 3MF9A 4QDQA 4NHMA 4HFSA 4OMCA 1AVBA 1R1A3 2WSVA 1QQP1 2HEVF 4RR3B 1V0AA 3J8F3 4XFBA 3TEZA 3ZXFA 3N7JA 5C3SA 1J1LA 3HT1A 4LO7A 1RUC1 1QH7A 5D21A 4CYDA 4LXLA 2FDGA 1G9FA 5CZKA 3POGA 3U1XA 3LKJA 4JDNA 1C5IA 3ZR6A 2FBEA 1VBA1 3P3PA 4GB33 4DFSA 5DPNA 1AL23 2AENA 4F3JA 1DFQA 1S0DA 3AKSA 3UYJA 4FPOB 4QX0A 3MLJA 3ZLIA 1G86A 3OGSA 1IKQA 3GZEA 2AH2A 1SMVA 4CCMA 5ACA3 2VNVA 2B39A 1RB8G 3GF6A 4QQPA 2VMFA 4QXKA 1WMEA 3VBUB 1NCQA 1Z7S1 2AEYA 4OQ8A 1PVC1 3DEMA 2XLFA 5FLJA 5H9PA 4SBVA 1GP6A 4ZXKA 1RMU2 4BK4A 2ET1A 1AR83 2VZQA 2FDIA 3NV1A 1LJ7A 1UZVA 4YZ4A 5CFDB 1V6JA 3OOXA 2FCVA 4NIGA 4Y22A 3NMBA 4NOTA 3NO8A 1WGPA 3K51A 5A3PA 2JE9A 2JEMA 4LUKA 4NIAA 5CEHA 1YIPA 4XFGA 3O1PA 2VQAA 1KXGA 1RUI2 2N7GA 1W39A 2HWD3 2Y6GA 3WQ7A 3JBG2 3TNPB 4XZUG 4Y5TA 2BGOA 1E5IA 4FFFA 5F5IA 2XUEA 4OYUA 3SHRA 4H14A 4RS5A 5T54A 5FPXA 2IFWA 3A7QA 4QGMA 2Z4FA 3QH6A 3KB5A 5IVFA 1UU4A 1NX9A 4LHSA 1UY1A 1YNAA 2VBDA 4U36A 4EWAA 2F4PA 5B2GB 1OLME 2EAKA 3GDBA 5T3NA 5M0TA 4XILA 2XHKA 1JUHA 3J4UH 3LDRA 4J6GA 1BKZA 2WZR3 2YBPA 4LO6B 5LBEA 4COZA 5CYYA 5FV3A 5IUQA 4M0NA 1SFPA 1UYPA 2RMU1 2CSGA 1UD1A 4ISQA 4Y1UA 2RS31 4P00B 4QQ2A 4OI1A 2VXRA 2ZKLA 2D98A 3MI8A 3INAA 4LKFA 5L9BA 3VD3A 1TE1B 3LWCA 3RZGA 2ZGNA 4I3PA 5IT6A 2JICA 3M7AA 5FZ8A 1COV3 4MXWA 3S5AA 2DUQA 2CGNA 3MO4A 1YQ5A 5F5AA 4I01A 2WNUC 3ZKUA 3RYKA 3V0BB 3AYAA 1PZ9A 1TQ5A 4TYSA 1BVVA 2RS13 4G3YC 1K3IA 5JR7B 1ZZ9A 2TNFA 1ULEA 3VD4A 1X50A 5J09A 1DDLA 1JZ4A 2RS53 1IPSA 5LY1A 1HB1A 5A32B 4C8DA 2D6MA 4MGQA 4IEVA 4IW3A 1ZZCA 1R1A1 2R0FA 2Y6JA 1W2AX 3C7GA 3J8F1 2I2SA 3VDCA 3WG1A 2ZGKA 1WW6A 2E7QA 2WWSA 5J96B 1W6MB 1SZBA 1YQ2A 3U4SA 2ZAHA 4G9SB 1PO13 3ZFFC 5AVPA 1SLCA 4XE9A 2P1BA 4XBLA 1O5UA 3P6BA 2BUKA 3BKZA 4GH4A 1LODA 3MICA 2PHRA 2J1EA 1AL21 2Y26A 4KL1A 5FYZA 4B1LA 1L7LA 3KT1A 5KWRA 5FMDA 3SCFA 2PQSA 3H1WA 5CIRA 4ZPIA 4BQ2A 4ORFA 4QPIB 2DFCA 5ACA1 2QQPA 3AMMA 2VQUA 4Y1VA 4M0HA 3PLQA 4GQ7A 2OQ7A 4IGPA 3MFAA 3I3QA 4NPMA 4CCEA 3AJZA 3NJYA 4CPBD 4A7KA 1E57A 4ITCA 5KXCA 1ULDA 2VVEA 3TWIA 2EXHA 1PGL2 1I1EA 1UX7A 2DTYA 1XYNA 3ACGA 5EPAA 1AR81 2Z69A 2VUDA 3FBMA 2WNUB 4C91A 4K21A 1SDWA 4UF0B 1XNBA 1RJ7A 4B1MA 1ULFA 5IAVA 1LU1A 4CTEA 3NNJA 1UY4A 3WG2A 4JKKA 4Q5OA 4P9IA 4P5YA 1VBE3 3WNPA 1HN1A 2GC3A 2HWD1 3PURA 4IEOA 1CX4A 4G4FA 1C8M3 1DG6A 2OKXA 2WFF2 3R4UA 4H7LA 4BYYA 1W2UA 1IS6A 3LA2A 2JG8C 3N36A 4XXPA 3LF7A 4CEYC 2NN8A 2VVFA 2QQJA 1J83A 1OLQA 3DYPA 3H0OA 4UW3A 3WF1A 1I5ZA 4CP0A 5D8AA 4EYUA 5A3UA 5FOJB 1R093 3NAPA 5LASA 4XUQA 3WG4A 5FY7A 2LUWA 1DQ1A 1DYKA 5FMOL 3CBNA 3AFKA 4LITA 1JN2P 2E53A 2WZR1 2ZHNA 2WNVC 4KNCA 4M3CA 4W6XA 5DAWA 3X29B 3ZFFB 3O1VA 1PNGA 3H3ZA 3GCWA 1U5ZA 4LULA 2MEV2 3L2YA 3NNLA 2WWUA 5FP8A 3ROUA 5KBFA 1UNBA 3LZZA 1XXNA 5IK8A 1JXNA 1W6NA 4GKYA 1XSQA 2NLRA 3AMHA 4JRAA 1T2XA 5C9AA 1O8PA 3ECQA 2OZJA 3A4UA 1W9YA 3CQOA 3K48A 2RDRA 1COV1 5A80A 5BPXA 3CJXA 1VBC2 5IW0A 1KITA 4E2QA 3VN4A 1UOGA 4AAXA 1CZTA 2V72A 2H6CA 3H7JA 4AQTA 1YJLA 2DURA 2MHFA 2RS11 1WMFA 1HQWA 3TN93 2HWB2 4C1WA 4R4XA 5C70A 1PO22 2BBVA 4XJUA 2RS51 1YFYA 4CDWA 1O3QA 3CDZB 2V5YA 2WS93 3VZJA 5K8SA 5I0TA 1QF3A 3WCRA 4K40A 3VHNA 1UW8A 3N4MA 1W06A 1Q8PA 5GLUA 3I2DA 3DN7A 3D82A 3LB9A 4LK7A 1GP4A 4W65A 5FZOA 3ZXJA 3BTYA 4Z07A 5FPLA 4QHZA 2JG8B 5FO8B 2G1MA 3WD5A 1PO11 1WA6X 4CEYB 3PMSA 1YYNA 4QXHA 4E8CA 4XBQA 2XHNA 4MGYE 3POSA 4P02B 2CL2A 4QQOA 1WA4A 5GLTA 5GALA 1AR91 1X9TA 4OI0A 1DLCA 2VZPA 1P8JA 3C8XA 4BIFA 1HIXA 1BMV2 4UXAA 3AKQA 1W6QA 4WVZA 1V6OA 1VP6A 2AUYA 2DWRA 2VCMA 3KM5A 4K6BA 1O59A 5BNOC 2WO3A 1H9PA 2X05A 4CCKA 3MLLA 4PIZA 5KHJA 2VMDA 3IAPA 4XF3A 3AJYA 1ZREA 2P3YA 4AHWA 5I93A 4URAA 3AK0A 2PAKA 4QM8A 3HQUA 1EUTA 2BGCA 1LOBA 3N7MA 1CAUB 4CDQB 2CWSA 4Y20B 2QNKA 2J1SA 4QB6A 2EIGA 5SV5A 4OQ9A 1NE6A 4Y4RA 1QXPA 2Y8KA 2QZ3A 5JOZA 3FHIB 3JQXA 4LBLA 5EZWA 5JVVA 5JOWA 5IVYA 3VHRA 1WUVA 2JDAA 4J1WA 1ND3A 1OFNA 3KZ4C 4YG0A 5EQUA 1HRV2 5CAZA 3KS7A 1VBB2 2XH6A 3ACIA 2UU8A 3R0RA 4YVSC 1OD5A 5A7OA 3ZFEA 3OYWB 1VBE1 1CWPA 1KFUL 4Q4Y2 4COVA 4UFIA 5EYXA 1C8M1 1Y3TA 2BWAA 2YY1A 5F3CA 3RNSA 5J37A 3IM0A 1JZ6A 4CUCA 3KLSA 2JDHA 3RWNA 1NCRA 2VM9A 4RQPC 3NNFA 1CN1A 4AVBA 4E4DX 3VB9A 1SEFA 5FK8A 1SLIA 3RWKX 5FPZA 1NA1A 2A5ZA 2YC2A 3THPA 1UZZA 2ZEWA 1QHDA 3USUB 1SCRA 2ZGQA 2GDFA 5J98B 3OPZA 4Y24A 2DV9A 4OUSA 4AYUA 3I7DA 1DQ0A 1GV9A 1UZWA 1O8SA 1UIJA 1YLLA 2RV9A 2Q8EA 4A7YA 3NJXA 3KGLA 1LHWA 5F3EA 4EQVA 2OW4A 4HETA 4BQ1A 4E2GA 1AR72 4BHPA 1PHMA 5C6CA 1RMU3 3RZZA 5BNOB 5IATA 5JAXA 1O3TA 4E4HA 2PQQA 4HKOA 4BU2A 3MFCA 4E27A 3EXUA 1N1VA 3JU9A 4GA9A 3AYDA 2WNEA
chains in the Genus database with same CATH topology
4CDXA 4DXZA 2E7TA 1RUI3 1SBDA 2IXKA 3M70A 3TN91 3JB8A 3JBG3 4OHZA 4XJZA 3CO2A 4EJRA 3WOGA 4BM8A 3SMHA 3ZSKA 3FLTA 2R042 2WS91 3MIHA 1JYCA 3WQ1A 5C4WA 1G9CA 4EN9B 4LE3A 4URTA 4FOWA 1QDCA 1HXS2 3ILRA 1ZX5A 2VNOA 4N53A 2MPFA 3VBHC 4PQ9A 3S0MA 1V9U2 1QGLA 4C90A 4QGLA 2D6OX 3DV8A 1IPJA 1HKDA 2ZKNA 5GZEA 4WM7B 2MNGA 3ZN4A 3FWEA 5JMCA 4FPCA 4LBQA 4Z2WA 1FYUA 4DPNA 3UK9A 5BXXA 4XIKA 3VHPA 1WMDA 4D94A 2HEYF 4WM8B 2VY0A 3V65A 3VKFC 1GYKA 1HQLA 4OVEA 4U2AA 5GZCA 1OA3A 3CU7A 1LRHA 5EV7A 4IV1C 4LA3A 1BBT2 2I07B 4Q0PA 4IV3B 1QNWA 4IL7A 1DGWX 5AFBA 2G4IA 1HV1A 2ARXA 4YGEA 1PK6A 2X8KA 4JDOA 3AZVA 2R30A 3IDEA 3NV2A 1K5MB 4LLFA 3WW4A 1CONA 1FATA 3PVBB 3ZYJB 3POYA 4RR3A 1SBFA 1S0FA 2Z2SB 1O91A 3ZYPA 2PHLA 3ZSLA 2IXLA 1VB2A 2QUOA 4AI1A 1JH5A 1MEC2 3OGGA 1LHNA 3HAGA 5HXVA 1DBNA 1IQAA 1KS4A 2FMYA 1T6GC 1CIWA 2DVDA 2K0GA 1AX1A 3I8TA 4R9DA 4XETA 4FPJA 1RMU1 4DOUA 1GBGA 2YMZA 3ZVXA 3S6PA 2XLGA 3UJOA 5EWSA 3VBUA 2C5DA 2BEOA 1GANA 2RHPA 4LTAA 2YV8A 4YLZA 4RGGA 1RUI1 1UPIA 5L19A 4L9BA 4LHLA 4XF4A 5FTTC 1JHNA 5CFDA 3OJBA 4Q8LA 3ZXAC 5I8TA 3JBG1 2D3RA 2WFF3 2AR6A 1UKRA 1DF0A 3MIFA 4XFHA 2ZGUA 1MZ5A 3RJRA 4Y26A 1TMF2 1MS5A 1ND2B 4LBMA 4YW4A 2JD4A 2PTMA 1D4M2 2MEV3 3ZDSA 4AVVA 1H2NA 4ONUA 3MYXA 3UJQA 4Z1VA 3J26N 4PCRA 2D3SA 4PIXA 4FOVA 4ES9A 2NMOA 1VBC3 4AF9A 4B4PA 3IWZA 3LA7A 4BA6A 5FCCA 4NVPA 4D3WA 1B09A 2HWB3 2AYHA 1WLWA 1PO23 3QLQA 1AL0G 2RJKA 2JECA 3V0BA 5DZGA 3WHTA 4A7ZA 3USSA 3AP5A 4JGZB 4BLJA 3SLIA 4INDA 2PHTA 1B35B 3AZYA 2CAVA 4AQ6A 5DUWA 4N90A 2X5IB 2GH2A 2DF7A 2DCZA 4ZU7A 3OD4A 1RUC3 3RSJA 4JGYB 1Q8QA 2PLV2 1A8DA 1VBA3 1V70A 2CNAA 2ILMA 4FOQA 4K8FA 1CR7A 3MW3A 1I3HA 2IXHA 1U5XA 1EY2A 4MSVA 1MS8A 1MZ6A 2IC1A 4IEWA 1G9DA 2F6BA 4HSJA 4DINB 4CP2A 1NXMA 3OBTA 1LOAA 4QPIA 1PGL1 2XWJB 1Z7S3 4HL0A 1PVC3 4M3CE 4IETA 3WUDA 4D7YA 2YGLA 1UU6A 4HN1A 2G9FA 1HRV3 2R062 1D0HA 3D5OA 1VBB3 3HQXA 4EWEA 4UW5A 1UL9A 2FMDA 4TSVA 5C8CC 1V00A 2NMNA 5FAXA 4YM0A 5HCAA 1CD3G 3IIAA 3HMYA 2WFF1 1GQGA 2E51A 3LAGA 3H50A 5KXEA 4XJ8A 4HKWA 1C1FA 1AXKA 3S30A 1HX6A 3GZTB 4XBNA 3LA3A 5BV6A 1OQ1A 4NR1A 3ZSJA 1AXZA 1D4VB 4FQZA 3PVEA 3HBZA 1IOAA 5BNNA 2MEV1 5JWPA 4AEDB 5GM0A 3FJSA 4OUMA 1AR73 1FNZA 3ZFFA 5JSOA 3OBRA 2D93A 2ZA9A 1ZZ6A 1VBC1 3WZ1A 1UU5A 1FPN2 4B7EA 1OQEA 2O8OA 4P9GA 4AHZA 4X8PA 4TLFA 2HWB1 1X33A 1HRI2 2JJ6A 4LLOA 3DKWA 3ZPYA 1G9BA 1UF2C 4AG4A 1BK1A 4L99A 1PO21 4FXKB 4MGKE 1BYHA 4LO4B 1ZYBA 5I0UA 2R043 2XJRA 4Y5Z0 1QJX2 5C8CB 2WSUA 1QXJA 4FT8A 4QPYA 4HVQA 1HXS3 4OZXA 2GN3A 1C1LA 1WBLA 3GBFA 2VH9A 1V9U3 4YVWB 1X8MA 2W39A 5C33A 4L11A 1BMV1 4WZCA 4AVCA 4F8AA 3GYDA 2JG8A 2W0XA 4ATEA 2DVBA 3BODA 4R4ZA 4CEYA 1LGCA 1A8MA 2A70A 1V6IA 4XF9A 1ZBA2 2CV6A 3P3NA 4JDMA 2SBAA 1EPZA 3Q9OA 1NOVA 2BNOA 2XJQA 1MVEA 2ZZQA 2XJUA 2UWBA 3HN1A 4AGGA 1CAWB 4XHXA 2A3YA 1JTZX 3WR0A 2WKKA 1LHUA 2GZWA 1CGPA 4I0WB 1A3KA 1BBT3 2E63A 4FOYA 2ZGSA 3O5SA 4HLTA 1CAUA 1F2NA 1HRV1 4CDQA 4Y20A 1VBB1 5JPNB 2B9UA 5T55A 1MVQA 4AVSA 4PIYA 2ZX3A 1RIRA 1QKQA 3IKWA 3V56A 1VLNA 3CJIC 1QNYA 1OOPC 3NKTA 3OYWA 4FPGA 1H9WA 3R05A 3SISA 5K0UC 4R9AA 2ERFA 4JTOA 5I91A 1MEC3 2BFUL 2ENRA 1REDA 4P9XA 3WDVA 3HWJA 3FE5A 4NWVA 2C0ZA 3ALQA 5JOXA 2B45X 1LGBA 1YI7A 4KG8A 4YGDA 3USUA 1LESA 1AR71 4B4RA 4FTBA 3O14A 1PNFA 5JPMB 1PZ7A 4Q26A 3ILFA 1OMIA 1NQDA 3PNAA 4HKLA 1IZ3A 5KXDA 4FAHA 3CF6E 3VBSC 3ZXGA 2ZX0A 5BNOA 4KWLA 5F1RA 1VALA 3WW2A 4CZSA 3FLRA 3VKMA 3WDWA 1X82A 2O8QA 2VQ0A 5FO7B 3MPPG 4C0HA 2QZ2A 2R041 3SH4A 4B3NA 3H1YA 2HEWF 3A0NA 4OHWA 2DYCA 1V6NA 2WL1A 1TMF3 1VIWB 1HXS1 4B8EA 4YW1A 4H55A 1ZRRA 3D6EA 1V9U1 1D4M3 4MGZE 1ENQA 1FT9A 1S0GA 2R32A 4GXLA 3ACLA 3G7DA 4F7ZA 5AFEA 2P3IA 1G6NA 3QOPA 5ABJC 2ZCWA 3ASIA 3HT2A 3DL3A 1EPWA 1ULGA 1LECA 2IFRA 3RG0A 2GNBA 2WT1A 1AR93 2YXSA 2R49A 1KQRA 4FTSA 3DGTA 4TZDA 3B00A 4AQ2A 3BU7A 4WM7A 3M3EA 1S2KA 4BIOA 1Q8OA 1LULA 1NYWA 4GALA 4O9GA 2Q0AA 2PFWA 1W6OB 4LA2A 4LBNA 5E89A 2BQPA 2OPKA 2ZAAA 4FBFA 4XJ9A 3RI9A 4L97A 4LBKA 5EJ3A 5GLZA 2OZ6A 2XJVA 2Z42A 3VUOA 2GALA 2ZHMA 4WM8A 1BBT1 4YM3A 4D7TA 3VBSB 2B5HA 3BTAA 3EJKA 3ATGA 1NZCA 4COYA 4LHNA 1H2MA 1GKBA 2GU9A 4FAGA 4XJWA 3O7OA 2QDRA 1H2KA 4Y1ZA 2EXJA 3QBQA 4YM2A 5FRAA 4AE2A 4IV3A 1OPMA 4IQPA 4UBGA 1FNYA 2ZABA 1EV12 1OPOA 5CFCC 1S0JA 2PLV3 1LENA 4LBJA 4NN0A 4K1ZA 1K5MA 1O3SA 3BOWA 1ENXA 4HN0A 2D44A 1DGLA 1MEC1 5I0SA 2G9GA 1HLCA 2GC1A 3M8LA 3GBGA 1R082 1RINA 4MV2A 2PHWA 5ABJB 3WVJA 1H1AA 1ZZBA 4AW7A 4YG6A 1DGWA 1O7FA 2DFBA 4ZU4A 2BNNA 1LOGA 4OI2A 3VKOA 1I6XA 2R063 1VJ2A 4L8QA 4MGIE 4AFCA 3R4DB 1OQDA 5J7MA 2D7FA 3W9AA 3JQWA 1MS9A 1QDOA 3HD8B 3KGZA 3WDTA 1RUE2 2Q1ZB 1D2SA 1CJPA 2VMHA 4MX3A 5L73A 1TMF1 4YYOA 4P9WA 1IS3A 1D4M1 2ZHLA 3VDDC 3POWA 4IEUA 2BVBA 3M3CA 1ND2A 2D6NA 4BWOA 2XJPA 3AM2A 3MLKA 2CAUA 4Q0UA 5F6KA 4COUA 2IWGB 4RS5C 3S7EA 5KHKA 5H9RA 4FQ4A 4JVAA 2QDNA 2ZHKA 1WCDJ 1Y9QA 1MQTC 1FPN3 2WNVB 2WT2A 4WVMB 3OTFA 2VW2A 4KGQA 2JG9C 3VZNA 2R1BA 1ZZ7A 4AI2A 1HRI3 1XNCA 5T5JA 3VBRC 4BE3A 2JENA 4FPKA 2A6YA 4GULA 4Q4W2 2H0BA 4XIOA 3M3IA 1VAVA 3KT4A 2I45A 2EAAA 5E1RA 2HWE2 3ZIWA 2EVXA 2ZJCA 4JGZA 4PLOA 5DDJ2 5AC92 1NY72 4EROA 4EV0A 3QD6A 1B35A 2PLV1 5A3MA 4S2HA 2X5IA 4S2FA 4Z8BA 1D2QA 3EO6A 2GMEA 2LTNA 4Y22B 5DUXA 1WD3A 4M00A 1ZBA3 3WX5A 3VDDB 4JGYA 1NG0A 4K1YA 3DF0A 2CY6A 3DUIA 3CEWA 1DHKB 1MS0A 2OIIA 4LR4A 1J3QA 1ONAA 4GKXA 2ZACA 2OYZA 4HPKB 4MYEA 3O0WA 4I0BA 3IPVB 2RM22 1XRUA 1MQTB 2P37A 3V0AB 2VOXA 2FZ1A 2JG9B 2R061 3WDYA 2CGOA 2ATFA 3VBRB 1LHOA 2GAUA 1BEV2 1BXHA 5FQ0B 3TOJA 5DZFA 5BY5A 1X7NA 2OVUA 3WINE 3GNEA 5FREA 1YWKA 1AJOA 1O4YA 2VOKA 3TAYA 3QCWA 2LM3A 1TNFA 2IZWA 4Q0QA 3FLPA 1GICA 1O5LA 1OA4A 4YVSB 4P5HA 3AZXA 3I59B 3W58A 5JZGC 1RUF2 3GBWA 3NWKA 3GHMA 4NPRA 4RQPB 3U0ZA 3HIFA 4RFT0 2PELA 1VAMA 4GIQA 3WHUA 4XQ4A 4I2OA 4EN8B 4ASMB 1H0BA 4EN7B 1YIFA 3RDIA 1RJ8A 2D5FA 3APBA 4AEDA 3B5LB 5D8AC 3WP3A 5BUVA 2VUJA 3ME2A 2XUMA 1FPN1 3TNQA 1AR62 1BJQA 1FMD2 1SACA 5GZGA 1FAYA 1DQ5A 1QJZA 1HRI1 1DZTA 1WW4A 1POV0 5I8SA 1S0EA 2ZS6B 4QU2A 2X29A 2ZBJA 3KMHA 2RR12 1QJX1 1Y43B 5C9AC 5BNPC 3JUUA 4BH9A 1NQJA 3CLPA 4GB32 2HWF2 2TEPA 1AL22 2Z79A 3AP9A 1C3HA 3EQEA 3AKTA 3PVOA 4MUVA 4AVTA 2W68A 3ZXKA 5C8CA 4JQRA 5F5QA 2HKXA 2PAEA 2PN5A 3RYPA 1M4WA 4ZKTB 2ZX1A 1SLTA 4YVWA 4Q8KA 4Q4X2 1O3RA 1ZBA1 4IESA 2YC0A 3GZAA 1MS1A 1FV2A 5JZGB 1GZWB 4JAAA 3VBHB 2D6KA 4QGNA 1V6LA 4R8HA 1N1YA 3H3UA 5TSWA 4QHBA 4NHKA 3PVNA 4C1XA 4AQSA 1ZRFA 2R072 1KFXL 1CAVB 5J48A 1SLLA 4FP3A 1WW7A 1CAWA 4XQDA 1V6KA 3WT3A 2BYVE 4MVTA 4KG0A 4AEMA 2CGPA 5KC6A 2DVFA 5CB7A 3RS6A 3WDUA 4V1PA 1EV13 2VGDA 2VVDA 4PBOA 2XBO2 3PJYA 4YNIA 5BNPB 1RUOA 4IV1B 1N1SA 2DU1A 2QE3A 4KQ7A 4Q1PA 3ZMOA 4CEWC 5E8AA 2VU9A 2GNTA 4XFCA 3WQ0A 3MW2A 3PTYA 4RA0A 4I3GA 2DU0A 4YGCA 2WIIB 1ND3C 3M3OA 3ILNA 4DS0A 1R083 2D43A 3ZN6B 5J36A 1SLAA 2HWC2 3B69A 4HVOA 4NO4A 3GZUC 3MIBA 4XF1A 1U12A 1HW5A 2AREA 2NM1A 2HYKA 4E4ZA 2ZX2A 5E16A 3OCPA 2A71A 4PLMA 1GZCA 1NA1C 3L9JT 4AEJA 1DQ2A 1ZBE2 2ETEA 3BALA 2XKPA 3MIEA 4Y4YA 3O0VA 3LSDA 2XB6C 3AMPA 5CA6A 1PIV2 3B02A 5LK7B 4YFWA 3WNXA 1RUH2 1ZA4A 3M3QA 1GR3A 3I54A 2W52A 2QFEA 5EXOA 3N3HA 1MACA 4Q2FA 4XDQA 2Y38A 2PA7A 5CADA 2VOWA 3U11A 2QVSB 1O4TA 4YZ1A 1C57A 2KM2A 2DCTA 2NZ9A 3D0JA 5A32A 5FO9B 3T1LA 1RHI2 3VLBB 4XFFA 1FI2A 1UKGA 4CEWB 1TNRA 4YZ2A 4ES8A 1W6MA 1H1IA 1ND3B 1YFWA 3O12A 1Q43A 1DLLA 3UKNA 5C4WC 1LOFC 3UV9A 2DVGA 2XL7A 2VW1A 1Q3EA 4UW4A 5HI0A 4XQWA 2RE9A 3W59A 4X6RB 4KU8A 2XJTA 5IK4A 1QJY2 2WQZC 2E6VA 2JDZA 2Q8OA 1ZVFA 4Q4W3 1W6OA 2ES3A 2CTVA 2Q30A 3ETQA 2B7YA 1AYM2 4XF0A 2HWE3 2R16A 1H4GA 1C28A 4IEQA 4LBOA 1R092 4MH0E 3VBSA 4WVWA 5A3LA 3ZYIB 2UWCA 4Q4Y3 2WNUA 5DDJ3 4YW3A 1EV11 5AC93 4QPGC 3MIGA 5T52A 3DPRC 3AXEA 4AXOA 4QX5A 1GQHA 1RTVA 4PJYA 2EXKA 4R52A 1IGOA 3ZX7A 3VZMA 2WLPA 5I8YA 1R081 4FPYA 4BMBA 1PK6C 2D40A 4LBQD 4L92A 1PVXA 1RVF2 4HK8A 4HT1T 4DY3A 2P3JA 3FX3A 3LOIA 4RR3C 2VULA 3TN92 1AUYA 1NE4A 2BW8A 4XHBA 1ZNPA 2RM23 3NW4A 3RRDA 5ABJA 3GALA 2JX9A 3J9SA 2TBVA 5HCBA 1A78A 1H2LA 3AP7A 1OLRA 2DCKA 4IEXA 1S0BA 1SFYA 3MGUA 4FPEA 2YGMA 3T1MA 4ISRA 1XU1A 1RUG2 3LSEA 4FSJA 2GMPA 3ZXLA 1HQNA 1J3RA 1N1TA 2ZTNA 5L36A 1LGNA 3NV3A 3VV1A 2VUAA 1AX2A 4FPFA 2ZPXA 4S2DA 1EP0A 3AYEA 4YW5A 1JBCA 1CJDA 1GFF2 3VBOC 1ZRCA 1IHMA 1CAXB 4QPGB 1MR5A 3DPRB 4LO8A 2QCSB 3KT7A 5GJ6A 5CFDC 2LALA 2ZZJA 1N47A 3TRSB 1YUDA 4DQAA 2B46X 1X36A 1VBD2 4AHYA 3FUQA 4XTPA 2FZ2A 1F9KA 3KCCA 1RUNA 5JDBA 3JZVA 4RGAA 1KJLA 2K2SA 3D8CA 4XFAA 1MS4A 2YPJA 1AR63 2WFPA 1FMD3 2KA3A 1ENSA 1DQ6A 1CPNA 3H9AA 1D0GA 5LRRA 1G9AA 1UIKA 1BVP1 2WNVA 4FPLA 3FZ3A 4WVMA 4Q4W1 2Y0IA 3LGRA 1JUIA 2RR13 3AP4A 4AFAA 1JW6A 4D7SA 2HWE1 2HWF3 2GNDA 3ZSEA 2Q4SA 4FTEA 3EHKA 2YHJA 4Q4Y1 4JRLA 1LCLA 3M1HA 5DDJ1 1FOD2 5AC91 1NY71 2PYTA 5EFUA 5HBAA 1AX0A 1V6MA 5GLWA 4CDUC 1QOTA 2D3PA 2WLQA 3B7MA 2ZGMA 4MZUA 2AZ5A 2EXIA 4H3WA 1EYBA 1H8TC 4LE4A 4XMIA 4XEZA 2PHUA 4Q4X3 3VBOB 3ZXEA 4ASLA 4CRQA 2YDEA 4GMP0 4XPVA 4OHXA 1H1MA 4LNVA 5DUUA 3U4XA 2FHRA 3MDPA 4UBHA 3VBFC 3VDDA 2R073 2TUNA 3NL1A 4YM1A 2XPJA 1U5YA 1SFNA 2RM21 1KS5A 4FP2A 3WG3A 4HPKA 4RHV2 3WW1A 3E97A 4GMP3 5A33B 4H7MA 1QWRA 1BEV1 3IPVA 3WUCA 1MQTA 4GWNA 3L2HA 1C4RA 2QKDA 4QMAA 3V0AA 1S0IA 2JG9A 4XOGA 2XBO3 3OD0A 3UKVA 4QPIC 4R9BA 4HMZA 2BTVC 4K3UA 3VBRA 5FQ0A 4EN0A 3ZXDA 4Y1XA 3IN9A 3T2TA 3AX4A 3FC0A 3U07A 4JTNA 4YW2A 1C8NA 3RJ2X 1AYN2 4F83A 1JYIA 3SNMA 4P9JA 4Z82A 4JC1A 1XU2A 4B29A 1UZYA 2A6ZA 1MZFA 3ZFGC 1WD4A 1U5IA 1RUF1 2HWC3 4OULA 4CDUB 1QY4A 3WDXA 2PHFA 4OLLA 2VNGA 1F5JA 1OSGA 1NLSA 3CJIB 4YVSA 1OOPB 1H8TB 3N7LA 1QH6A 3N35A 5K0UB 3I59A 3ZYRA 5H9QA 4N7IA 3MF6A 2P17A 2UWAA 4RQPA 2VMIA 1ZBE3 3UKTA 1RITA 1AR61 1LKNA 1WLTA 1M06G 1FMD1 2WINB 3AFGA 5AVAA 3VBFB 1PIV3 5BNNC 4EWDA 1RUH3 4Q0VA 3AKRA 2ZGRA 1ENRA 5FMOS 1S2BA 2BWCA 4DNYA 1BZWA 2YZ4A 1GNZA 1WW5A 5FDBA 2RR11 5KXBA 1PGW2 4AEKA 1F8VA 3VL8A 5KC5A 3CNAA 5FLHA 1LTEA 4GB31 2HWF1 2ZGTA 2XWBB 4FPHA 3VKNA 3BOPA 1G7YA 2E9QA 3VGIA 4C0BA 1J1TA 4PDWC 4QQHA 4N43C 5CU1A 3BB6A 3UL2A 1RHI3 3IDBB 5L7OC 1RUD2 1UAIA 2JXAA 2X53S 1ASJ2 1LOEA 5T5LA 1XYPA 1KD7A 3FFQA 4KBBA 4XXAA 1AF9A 4QQLA 4Q4X1 3WP6A 2FQPA 5JOYA 2WA3A 3ZFGB 1GNHA 3M2MA 1YRZA 4AI3A 4M01A 1XQNA 1FXZA 5JLVA 1RGSA 3BIWE 4XW3A 4FXGB 2NP0A 4KWJA 1QJY3 1XE7A 2ZMNA 2R071 1X8EA 5JZGA 1GZWA 1QJU2 5DG2A 3VBHA 3ZYGA 3SITA 1PZ8A 2YROA 3B01A 3LCPA 1TME2 3WP5A 3NJZA 1AYM3 4GMP1 5BNNB 3H8UA 2O0OA 4HSLA 3I4IA 3R4SA 3VHOA 1CAVA 3HR9A 1UCXA 4O9EA 5IK7A 2XBO1 1SCSA 4WZFA 5EYYA 5KHGA 1NCQC 1VB4A 3RMYA 1N3PA 3ST7A 2GMMA 1CQ9A 4WV8A 4BOWA 3ELNA 1JOJA 4Q27A 3LOBA 5GZDA 2XL9A 1RUJ2