4EJRA

Crystal structure of major capsid protein s domain from rabbit hemorrhagic disease virus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
163
structure length
163
Chain Sequence
b'TWRTNFYYNDVFTWSVADAPGSILYTVQHSPQNNPFTAVLSQMYAGWAGGMQFRFIVAGSGVFGGRLVAAVIPPGIEIGPGLEVRQFPHVVIDARSLEPVTITMPDLRPNMYHPTGDPGLVPTLVLSVYNNLINPFGGSTNAIQVTVETRPSDDFEFVMIRAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major capsid protein VP60
publication title Atomic model of rabbit hemorrhagic disease virus by cryo-electron microscopy and crystallography.
pubmed doi rcsb
source organism Rabbit hemorrhagic disease virus
molecule tags Viral protein
total genus 27
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ejrA00
1OPOA 1HRV3 1D4M1 1QJU1 1EAH2 3VBOA 4YVWA 4Q4Y2 1R081 4CDQB 1RUF2 4RHV2 1AL23 4YVSA 5BNOC 3CJIA 1EAH1 1HRV2 3VBOB 5K0UA 1F2NA 4YVWB 1PGW2 4Q4Y1 5C9AA 1RUF1 1C8M2 4RHV1 4CDQC 4YVSB 1RUD2 3HAGA 1DDLA 1RUE3 3TN93 2GH8A 3CJIB 1VBA3 1HRV1 1E57A 4AEDA 5K0UB 3VBOC 1PGW1 1RMU3 4YVWC 5C9AB 4WM7A 1C8M1 1RUD1 4YVSC 3DPRA 2WLPA 4AEDB 2HWC3 1RUE2 3TN92 5K0UC 1VBA2 4BCUA 4WM7B 2HWD3 5C9AC 3NAPC 1RB8G 4FSJA 2XBO2 1RMU2 2HWE3 1ND2C 2GSYA 1WCDJ 3DPRB 3VBFC 3J8F3 1RUE1 3TN91 4AEDC 1VBA1 1EV12 4CDXA 1RUG3 2XBO1 1RMU1 4JGYC 2HWB3 1K5MA 1VB2A 3VBSA 1AR93 3DPRC 2WS92 1EV11 1RUJ3 2RS13 3J8F2 4CDXB 2VQ0A 2DF7A 2Y26A 1PO13 1NA1A 1RUG2 1K5MB 3VBSB 1BBT3 2R073 2HWB2 2WS91 3ZFGC 1CD3G 5CFCA 2IZWA 1AR92 3J8F1 1ASJ3 4CDXC 1VRH3 1NA1B 1RUG1 1TMF3 1K5MC 4RS5A 3VBSC 4EJRA 1BEV3 2ZZQA 2HWB1 5CFCB 1BBT2 1AR91 4RR3A 2WFF3 5DDJ2 5CFDA 1ASJ2 1FOD3 1AYM3 1NA1C 1R093 4RS5B 5FMOL 1PO23 2PLV3 1BBT1 4RR3B 4RQPC 5CFCC 1BEV2 5DDJ1 5CFDB 1AR62 1F8VA 1VBD3 2HWF3 1ASJ1 1VBB3 4Q4X2 4QPGA 1HRI2 1AYM2 1R092 1ZBE2 1BEV1 4RR3C 1PO22 4QPIA 2BPA2 2PLV2 1RHI3 1AR61 5CFDC 4IV3A 5JZGA 5A32A 4QPGB 4Q4X1 2RM22 1VBD2 1HRI1 2HWF2 4Q4V2 1AYM1 1QJX3 1R091 1ZBE1 2WZR2 4CEYC 1PO21 4QPIB 1X36A 2PLV1 3VBHC 1ND3A 4IV3B 5C8CA 5JZGB 5A32B 2R043 2RM21 3JB8A 4QPGC 1Z7S3 1M06G 1VBD1 2HWF1 3NAPA 2RMU3 4Q4V1 1HXS3 2WZR1 5J98B 1ND2A 3VBUA 1QJX2 5FOJB 4QPIC 1AL22 1ND3B 5C8CB 3LOBA 3VBFA 1PIV3 4IV3C 1A6CA 1FPN3 5JZGC 3NAPB 2RS53 1PGL2 2R042 1SMVA 1ND2B 3VBUB 4JGYA 2RMU2 1QJX1 1MEC3 2MEV3 1COV3 1AL21 1QJY3 3VBFB 1ND3C 5C8CC 1AUYA 1AR83 3JBG3 1PGL1 1RUH3 2R041 4JGYB 3VBUC 1VBE3 2RS52 2RMU1 4NWWA 1NCQC 1POV3 5FMOS 5D8AA 2MEV2 3ZFGA 5L7OA 2RS33 2HWC2 1AR82 3JBG2 4GB33 2FZ2A 2X5IA 1HQNA 2RS51 4RFT0 2HWD2 4FTEA 2QQPA 2HWE2 1OHFA 5D8AB 3ZFGB 2MEV1 5BNPC 5L7OB 1TME3 5A33A 2HWC1 1AR81 2R063 3JBG1 2X5IB 1AYN3 2HWD1 2HWE1 1H8TC 4GMP3 1MQTA 1POV1 5D8AC 4RQPA 5A33B 5L7OC 1QQP3 4GH4A 2WWSA 1RUJ2 2RS12 2X5IC 4LLFA 3VDDA 1MQTB 1PO12 4RQPB 4PDWA 3M8LA 2R072 4GH4B 4Q4W3 4JGZA 1RUJ1 2RS11 3VDDB 1VRH2 1PVC3 1PO11 1MQTC 1TMF2 1ZBA3 4PDWB 5BNNA 1AR73 2R071 4CEYA 1RVF3 4SBVA 4GH4C 1VBC3 4JGZB 3VBHA 1RUI3 2WFF2 4FTBA 4IV1A 4Q4W2 1QJU3 1VRH1 3IDEA 3VDDC 1OOPB 1FOD2 4WM8A 1TMF1 5BNNB 4PDWC 2BBVA 4CEYB 3VBHB 4JGZC 2WFF1 4N53A 4IV1B 1VBC2 4Q4W1 4CDWC 5AC93 4FTSA 1RUI2 1EAH3 2XPJA 1POV0 1W39A 1NG0A 4WM8B 1VBB2 1FOD1 1OOPC 5BNNC 5ACA3 1VB4A 3JB4C 4N53B 3S6PA 1VBC1 4IV1C 1FMD3 1RHI2 1RUI1 1VBB1 4WM8C 5AC92 1C8M3 1NCQA 1CJDA 1HX6A 5ACA2 2ZAHA 1RUD3 4N53C 1VAKA 1BMV2 1RHI1 4N43A 5GKAC 4Y4YA 2BUKA 1B35A 1FMD2 5AC91 5ABJA 1Z7S2 4GMP0 1NCQB 1HXS2 4Y5Z0 5ACA1 5C4WA 5BNPA 1BMV1 4N43B 1R1A3 1RUC3 1PIV2 1B35B 1FPN2 1FMD1 5ABJB 2TBVA 1Z7S1 1HXS1 2XBO3 1H8TA 5C4WB 5BNPB 1MEC2 1COV2 1QJY2 1AL0G 4NWVA 1PIV1 4N43C 1FPN1 2BFUL 1B35C 1C8NA 1EV13 1NCRA 1R1A2 1RUC2 1V9U3 3CJIC 5ABJC 3JD73 1RUH2 1H8TB 4CEWA 1VBE2 5C4WC 1MEC1 4Z92B 1COV1 1QJY1 2WS93 1NCRB 1R1A1 1RUC1 2RS32 5J96B 1RUH1 4CEWB 2ZTNA 4GB32 1V9U2 1VBE1 3JD72 4WM7C 3ZXAC 3ZFEA 2RR13 1TME2 1NOVA 1NCRC 2RS31 2R062 4GB31 3ZFFA 1V9U1 4CEWC 1AYN2 3JD71 1QJZA 3ZFEB 2RR12 3VBRA 1NY72 1TME1 1QQP2 4CDUA 2R061 4CDWA 3ZFFB 5DDJ3 2FZ1A 1AYN1 1OOPA 1GFF2 3ZFEC 4GMP1 3VBRB 2RR11 1NY71 4CDUB 1QQP1 1D4M3 4CDWB 5LK7B 3ZFFC 1AR63 4Q4X3 1X33A 1PVC2 1HRI3 1R083 1ZBA2 3VBRC 1ZBE3 1AR72 4CDUC 1RVF2 3FBMA 5BNOA 1D4M2 2BFUS 1QJU2 2RM23 1IHMA 4Q4Y3 1PVC1 1RUF3 4Q4V3 1ZBA1 4RHV3 2WZR3 1AR71 4RS5C 1R082 1RVF1 4CDQA 5BNOB
chains in the Genus database with same CATH superfamily
1ZNPA 2WWUA 1DQ4A 2QCSB 2PELA 3WQBA 4QXBA 3AZXA 4FPEA 2DURA 5JSRA 3B69A 2DV9A 4P9JA 1JOBA 3ZXFA 2JE7A 2PHRA 1X7NA 4HBNA 3T30A 3B01A 1OI6A 3KM5A 3OYWB 1O3RA 2BERA 4Y1ZA 2RJ2A 3MUY1 4LHKA 3LE0A 1EAH1 1OC1A 1SACA 3Q9OA 1F2NA 2WN2A 5K0UA 3UGFA 1H2MA 1OH4A 2ZGTA 5I0RA 4YVSB 4DXZA 3RZKA 1RUD2 3HAGA 4KH9A 3EB7A 1RUE3 2EXIA 2RG4A 1SLAA 2WJSA 1SDWA 2D3PA 2GH8A 3I2FA 1ENSA 4HN0A 1QEXA 2R6QA 1SLLA 4U2AA 5KXEA 5CEHA 3LSEA 3VBOC 1CPMA 3I2JA 1RMU3 3MF9A 1LHVA 2QQKA 4YVWC 5T3NA 4IE5A 4JHZA 5DZEA 1C8M1 5F3IA 3SH4A 2E53A 4AFDA 1SDDB 3WSOA 4B7EA 2WNUB 4DS0A 4OI0A 4AOCA 3NVCA 4FT8A 1VP6A 3VDCA 4NAOA 5IK5A 2P6CA 4DFSA 1CAUB 4JRLA 3I49A 2LW8A 2WLPA 4HN1A 4FOVA 3CMGA 1UO9A 1RUE2 4BK5A 3AMNA 4B8EA 3HD8B 3FFZA 2ZX1A 2O8QA 4WM7B 2F4PA 4XW3A 4OHXA 1RB8G 1W8WA 4HL0A 1YHFA 2J1EA 1FYUA 1RMU2 1XNAA 2HWE3 2OW4A 3QBQA 4XEZA 1YJLA 2GSYA 2WABA 4LE4A 2XUEA 1WCDJ 2DVGA 3DYOA 4GKYA 3WW4A 3IAQA 2JWPA 3I59B 5FZAA 4A7YA 1OA2A 3VBFC 3J8F3 4FPHA 3PUSA 3TN91 4AEDC 4D0QA 1VBA1 3DXUA 1QNYA 2XH6A 1LECA 2HEVF 2K46A 2XBO1 1X8EA 4Y4RA 4HPKA 4O7XA 1WLTA 2HWB3 2VZRA 3DYPA 2IXCA 1UL9A 1VB2A 2P3YA 4IDZA 2QQIA 4L0PA 4XF9A 4EWAA 3AP4A 3POBA 3RYKA 4XBNA 1EV11 2G19A 1Q8PA 1YQ2A 2RS13 3J8F2 3OCPA 4S2FA 5BUVA 5IK8A 1QOSA 3CU7A 2JDUA 4XOGA 4CE8A 1UU5A 5DN2A 2DF7A 2Y26A 1PO13 4XVHA 2W0XA 5J09A 1K5MB 4DEQA 4I0AA 4Z8BA 3ZXJA 2R073 2PHLA 5FY0A 2D40A 3WW2A 2HWB2 5F7UA 3B9IA 5EJ3A 3UK9A 4AHYA 3RZMA 3RQ0A 4AVCA 5JLVA 2WNEA 2NM1A 4XXAA 3ZSEA 3T09A 3MW4A 4E27A 2RVAA 4F8AA 4Z1VA 3JCIA 3R0RA 4OZOA 4X8NA 1BKZA 5JXHA 1XRUA 2DUPA 1R1ZA 2ZZQA 4NUBA 4Y26A 4XQDA 3TB0A 2Y0OA 5E16A 5FYSA 2F4LA 2B39A 3AMPA 3OGVA 4OUMA 2CSGA 5IATA 3POJA 4XMAA 5T5JA 1DYOA 1UX7A 3NSTA 4QU2A 3BTYA 3UESA 1FOD3 4NPRA 3ZYRA 4K20A 1UY1A 2TUNA 4ITCA 3M7AA 1GP5A 3IPVB 3LOIA 3BOWA 2D5FA 2PQSA 3OGSA 4RR3B 4KNCA 4RQPC 5CFCC 4AG4A 4BA6A 5C3RA 1FATA 3KT1A 5DDJ1 3M70A 5CFDB 1I9RA 2GC2A 4IEOA 2R0FA 2HWF3 3AYCA 5EJ1B 1VBB3 2ARXA 1DQ5A 2P37A 4RGKA 4BIFA 4V1PA 1UAIA 3Q8AA 4YG6A 1RGSA 2ZKNA 4IUGA 3NJZA 1M4WA 4QX8A 1GNZA 5F3GA 1ZVFA 2AENA 2B46X 1QXPA 2OYZA 3N4MA 4JQTA 1LJ7A 1ULCA 3CNAA 4HZFA 5IVCA 3WCSA 1AR61 1C4RA 1OFSA 2VGDA 2VM9A 5KHIA 5JZGA 4LHSA 2W1SA 5EPAA 4GALA 4QPGB 3VKMA 5C71A 2RM22 3KV5A 1ZM1A 1W8ZA 1YFWA 2G9GA 3J9SA 3TAYA 2HWF2 1Y9MA 3C7HA 1QJX3 1R091 3WNNA 4CVUA 1JI6A 1ZBE1 5D2AA 4AL9A 2XVLA 4FAHA 3E5UA 1C1LA 1DCSA 3MO4A 4P9IA 4CEYC 4QPIB 4AHXA 5C3PA 2PLV1 3R4UA 1W9SA 1YQ6A 1H4HA 3VBHC 4QDSA 1ZREA 4IV3B 3SITA 5A32B 2ZGPA 2ZGSA 3OEBA 4LIUA 4XJZA 3IWZA 3WNOA 4M3CF 3USSA 1Z7S3 4LBMA 4NRPA 1VBD1 3H1YA 2JIJA 4Q4V1 2AEYA 2JXAA 3F95A 3CZJA 5IFTA 3ACIA 5DZFA 1QJX2 5CA6A 4H2AA 2VY0A 1AL22 2WZEA 1MS4A 2ZGKA 3VBFA 1KJRA 5FBJA 5C8CB 4ISRA 5BXXA 2KM2A 2EVXA 2Y6FA 2K2SA 4I01A 3NAPB 3N9PA 1IOAA 1HJGA 4TN7A 1ND2B 3VBUB 1LHUA 5A6XA 3O1MA 1XSQA 4H7MA 1SG3A 4D6RA 3FX3A 3VKNA 1YQ8A 1S4CA 4Y1YA 2GNMA 1WZXA 2ZZJA 4INDA 4OZXA 1IPKA 1ND3C 5JAXA 1AUYA 4K40A 2PXJA 3JBG3 5DUVA 3MUZ1 3VKLA 2FHRA 3CKHA 2JG8C 2P2KA 1S0IA 4FFFA 5F32A 4LMFA 1RUH3 1CAVA 5IAVA 3ZLIA 3POSA 3N36A 2VTXJ 5FWJA 4I2OA 3M1HA 5FJHA 4NWWA 2W1UA 4OMDA 1YJKA 2UWCA 2GZWA 1Q8VA 2WNVC 4NHXA 3VZMA 2ORZA 3PL0A 2XJRA 4FXKB 4MHUA 1YEWA 4ZXEA 4AQ2A 3O0VA 1PMHX 1ZZBA 4QXCA 1E5HA 1W28A 3JBG2 5DPNA 4I02A 1HQNA 2QQNA 2RS51 1YI7A 2ATFA 2HWD2 2NMOA 1LB2A 4E2QA 2QQPA 2J1VA 4ZXKA 3WP4A 3AKTA 2WKKA 1OHFA 3NRUA 2QZ2A 2RJKA 2MEV1 4WZCA 5BNPC 2VBPA 5E88A 5L7OB 1TME3 1U0AA 2DFBA 2KD7A 2QQMA 1W6QA 4Y20B 1AZDA 5A80A 3CQOA 2AUYA 3GCWA 3T3YA 1DGRA 3NNLA 2WBKA 2X5IB 2XKPA 2E7TA 1J59A 1XNCA 1NZCA 1MZ5A 4CU7A 2EIGA 3ZDVA 5FZ6A 4OI1A 4HSJA 5IK4A 3CEWA 4JDOA 2PTMA 2Q0AA 2H0VA 2JKBA 4RQPA 5A33B 1QQP3 1LGNA 1UY2A 3IN9A 1C5HA 1EP0A 1U5YA 1JZ2A 1Q8QA 4BDVB 3PUAA 4C1XA 1RUJ2 1XSRA 3MI8A 4LT5A 4YW3A 4QPYA 2W5FA 1OSGA 2XLFA 4KBZA 5FZOB 2C6SA 3HR9A 1G9CA 1IQAA 1PGL1 3N3HA 1PVXA 1A8DA 1CONA 1OLME 1WLDA 2C26A 3BN6A 3OEAA 2GC3A 4GH4B 4MX3A 3S7EA 4C90A 4XABA 2HYKA 5T54A 4BPZA 5A3UA 4B4RA 1UXXX 4XIOA 2DTWA 4COWA 2H6CA 3W5MA 3KMHA 3WNMA 1MQTC 5BNNA 3V0BB 3B3QE 4MVTA 2A1XA 2L9LA 3AYDA 3HEIA 5LBFA 4CEYA 1VBC3 5FO8B 3MHZA 5FZKA 3VBHA 2WFF2 2JICA 3I2KA 4XAEA 1HB1A 4IV1A 3AJYA 4XJ8A 1VRH1 1KS4A 1NE6A 2YU1A 1MS5A 3VDDC 3H3UA 1SQ4A 4Q26A 1ULDA 3OGJA 3AZZA 4QB2A 4PDWC 4N90A 2O8OA 2Z2SB 3CO2A 1GWKA 2VH9A 2BTVC 4I3PA 5FXZA 4UXAA 1QJEA 5TSWA 1C57A 1JHNA 4N53A 2OZ6A 4Z2AA 2DFCA 3JQXA 4AEMA 1VBC2 3OSDA 4K8FA 4Q4W1 3AM2A 5AC93 4WVMA 1EAH3 3D4KA 4XTPA 4KI5M 4LOTA 3GHMA 4K21A 1W6PB 2D98A 4JDMA 4WM8B 1OH3A 2QUOA 5LBEA 2ZX4A 1BVVA 3T08A 2ET1A 4S2GA 1EUUA 1VB4A 1QXJA 5AVPA 3S7IA 4LBLA 1YYNA 3VD9A 4K1ZA 1GZTA 3S6PA 1Q8OA 1Y3TA 2YMZA 4DEVA 4HVQA 5I0SA 2ZEWA 1RHI2 1RUI1 4FXGB 4RSUA 5FIXA 2VNOA 3WNLA 5GZDA 1LAJA 4RL7A 4XMIA 2ES3A 4Q8LA 2EIBA 3MBWA 4FPJA 4OMCA 1QWRA 5AC92 4BM8A 3NNFA 4KWKA 4MG2A 1C8M3 1FX5A 1I6XA 1MS8A 4KBBA 1HX6A 4AF9A 2JB8A 4WVVA 2FQPA 4YZ5A 4AHZA 3BU7A 3THTA 3A4UA 3U1XA 4IGPA 5GKAC 1HLCA 4Y4YA 5EXOA 3BB6A 1B35A 5DG2A 4ES9A 3KB5A 2FCUA 1NCQB 4XYXA 1LTEA 1ZA4A 3HQUA 3VDBA 3AFKA 4BH9A 2OS2A 1NXD1 2RDRA 3NNJA 4UFKA 5ACA1 3WV6A 3IZOA 4QB6A 2PA7A 5BNPA 2DU0A 1LOFA 2NP0A 1BMV1 5FO7B 3HBZA 3K3NA 1JODA 3J7HA 4E8CA 3GM8A 2RDQA 1CIYA 4LBQB 3DECA 5EYYA 4BZ4A 4DXRA 4GIQA 1H1IA 3GDBA 1BHGA 2WYSA 4G9SB 1CAWB 1YIFA 1HXS1 3INAA 5I8SA 2XBO3 1DHKB 2UYAA 5JOWA 3GZUC 4Z2WA 1JH5A 1NX9A 2OXBA 4IEYA 2W95A 4MADA 1U5XA 5A6ZA 2ID4A 2OPKA 5A3WA 3ZKYA 2BU9A 4IEUA 4LORA 4XUTA 4D7YA 1EV13 3JD73 3LOBA 5A3LA 1N1TA 1H8TB 1S0EA 4IGQA 3RVHA 3HWJA 5C4WC 3JZVA 1O4ZA 4BQXA 4QXHA 1COV1 3J4UH 1QJY1 2VZQA 4JAAA 2WNUC 2FCVA 3LIGA 1H2KA 4P5HA 3N7MA 1KITA 1UZ0A 1NLSA 3JXSA 2Q5TA 3W20A 3WVJA 3LA7A 5J7MA 1GANA 5J96B 1X9PA 1MVEA 3RJ2X 5FZLA 3O1VA 2J1TA 4GB32 3C7GA 4AI3A 1VBE1 4AW7A 3JD72 4WM7C 3ZXAC 1GWLA 3ACHA 2RR13 3F2ZA 4QQPA 3MIEA 4COVA 4QMAA 2P5BA 4L92A 2FDFA 4AZZA 3B94A 1NCRC 2RS31 2GP3A 2AH2A 3VHOA 1DQ0A 1GLHA 3BPZA 2CL2A 1AYN2 4CEWC 1RUNA 1AVBA 1QJZA 1SHWB 3UKVA 3KQ4B 5FP8A 3E1F1 2YC4A 3ZFEB 4ATEA 3MFAA 3HMYA 3A7QA 2OKXA 3OUJA 4ES8A 1ENQA 1RIRA 2RR12 4YW2A 1NY72 3M3EA 1LNSA 1QF3A 5F6LB 4DB5A 4HT1T 1JOJA 2BZDA 3ZFFB 5DDJ3 5A7WB 1DG6A 4XJUA 1F15A 2C24A 3N7JA 1SZBA 3WDYA 1MR5A 5GLVA 2ZGRA 1MPXA 5GZEA 4M3CB 1JYNA 2VMFA 4CDUB 1NQDA 5LK5A 4YM3A 5D21A 4CDWB 1XB9A 1LRHA 1VMHA 3OPWA 2ARCA 4TYSA 1AR63 1NZIA 3U14A 3ZSLA 2Y6JA 3ITQA 1N3OA 2XDVA 3OUHA 5J37A 1PGSA 4HFSA 2YBPA 4X8PA 1UIJA 3SCFA 1CIWA 1WMFA 1X33A 3TWIA 1PVC2 1QJFA 1R083 4BB3A 1KFUL 3RPQA 4XJAA 4XCAA 1W04A 1ZBE3 4AI1A 4BQ1A 1ZRIA 4MXVA 5FQ0B 5JVVA 3IB3A 2LUWA 3GZTB 1XYPA 4P9XA 1ZRFA 2NN8A 4W65A 2VUAA 3B9CA 5DAPA 1D2QA 1K3IA 2X8KA 1RUOA 3O5SA 3WDUA 2HKXA 1IHMA 2Z79A 4WBBA 4AFCA 3ETQA 4Q4V3 1PZ9A 4RHV3 1K42A 2BWCA 2JEMA 4JHTA 1R082 1RVF1 1QH7A 2WT2A 4A3XA 3THCA 3TNPB 1GZCA 1O7FA 3LSDA 1OPOA 3OYWA 1HRV3 5AFEA 2A70A 3FHAA 3KSCA 1IPSA 1QJU1 2F6BA 1YQ5A 4XACA 5LRSA 2BGOA 4QU1A 1EUTA 1ULPA 1VMFA 1ZZ9A 1IS6A 3VB9A 1CR7A 3AB0A 3ATGA 2WO2A 5JIUA 3CJXA 1LHNA 4GWIA 5FXXA 5FZBA 3FLRA 2BP6A 4CDQB 4M3CE 3ROUA 2DVFA 4RHV2 2ZX3A 4YVSA 3RYPA 1JHJA 5BNOC 4CUBA 2DCKA 1LOBA 1XNDA 1G86A 1HB4A 5FXVA 2LRPA 4LK7A 3P5BA 4JQRA 1L7LA 1HRV2 3CDZB 2JG9B 2JDPA 3VGIA 5JMCA 4Q4Y1 5C9AA 1QNWA 2PMWB 1RUF1 3ASIA 4JCKA 1NT0A 2VMHA 2ZHLA 5LZ6A 2WNUA 1GQHA 3NNMA 1W03A 4AFMA 3J7NA 1SFYA 3ORJA 4BQ4A 1CAUA 3ALQA 1PGW1 2W46A 2VOWA 4WM7A 4P02B 1CZSA 3CHXA 5CVRA 5CADA 3VV1A 2AZ5A 5DAXA 4QKBA 2AACA 3AYEA 3HT1A 1I5ZA 3T1LA 4PIXA 4GWNA 3I59A 3JQWA 2CGPA 1CVNA 1F4HA 4FFIA 2Y64A 5GLZA 3DUIA 1PHMA 5K0UC 5GLUA 4ONUA 1XYOA 4P9LA 3T0AA 4A4AA 2XJUA 1LULA 3NAPC 1OD5A 4Q0VA 4QGMA 1NQJA 1J3RA 3BCWA 4HANA 1RINA 4YG3A 1ND2C 2VTXA 4YZ1A 1PNFA 2DTYA 1GZWB 5HCAA 5HV4A 1AX2A 3DPRB 4ARXA 4LULA 3I7DA 1J1LA 3HN3A 5F2SA 4EN7B 3RZLA 3NO8A 3IIIA 3PJQA 3WZ1A 2CGOA 4YZ4A 1WCUA 3MW3A 4XF3A 4XURA 2VBDA 1JZ3A 1CN1A 3IDAA 3ZPOA 2XMLA 3AP5A 1IPJA 3EXUA 3GBWA 3IMNA 3ECQA 5JXGA 1K5MA 3RGBA 4C91A 3U0ZA 3UNPA 4DOUA 1HB2A 1HV0A 1N47A 1O4TA 4H7LA 3ZN6B 1A3KA 4HXCA 4CA9A 2EIDA 1RXFA 3LEIA 4MUVA 1D4VB 5FPBA 3SMHA 3WQ1A 4CDXB 4EZHA 3EYPA 2O14A 2R1DA 4QB1A 2FDGA 3VBSB 3WP5A 2FMYA 3OY8B 5FZGA 5A7OA 2WS91 3HQXA 4JV4A 3ZYHA 1NE4A 3WR0A 2EXHA 3N9LA 3O14A 3POYA 5JSOA 1DYPA 2IWGB 2XQXA 3C7FA 4BK4A 3D0JA 1VRH3 1PM7A 3SCGA 5KHJA 4XUNA 3LA2A 4LKEA 1NA1B 3L2HA 5FY1A 1RUG1 1YRZA 3ZXDA 2R1BA 4EJRA 4OUEA 1BEV3 1YI9A 2VQAA 2VNRA 1UCXA 3BPSA 3IPVA 3AL5A 4AAPA 4W6YA 1AR91 3R4SA 4RR3A 2WSVA 3ZXLA 5ANNA 3SLIA 5HCHA 3I97A 1W05A 1FV3A 5CFDA 4AI8A 1GNYA 2CNAA 4QQLA 4BXSV 5I8YA 5T55A 4RS5B 2YBKA 5FYHA 4F83A 3E5QA 2N7GA 4XETA 4AQ6A 2A6VA 2VW1A 3WG1A 1BBT1 1LKNA 4U36A 5LBBA 1H9WA 1BEV2 1S0FA 3GJAA 2J1AA 3LEMA 1AJOA 4GAZA 2W47A 5E89A 1ZRRA 4XHXA 1ASJ1 2HEYF 1WW7A 4Q4X2 4QPGA 2FDIA 4D94A 2BYVE 3KWVA 1HRI2 4JX0A 4OULA 5FP4A 4FPGA 2HBTA 5FY8A 3H7YA 2I45A 4QPIA 2VMCA 3KGZA 4DUVA 4IV3A 1W2AX 5A32A 4ISQA 2EIEA 2QKDA 1F5FA 3KT4A 4QQOA 4OHZA 4MSVA 3ZYPA 1AYM1 3VZLA 2WZR2 2AREA 3N9MA 2OT7A 1PO21 4MGKE 4XDPA 1CX4A 5IWFA 5C8CA 3KF5A 2CDOA 5FBZA 3ZDSA 3D3AA 3NAPA 2RV9A 2RMU3 3E6BA 1HXS3 2ET7A 1HB3A 1T2XA 3M3QA 3MF6A 5DAQA 5G04L 1ND2A 5J98B 3VBUA 4CCNA 1UMHA 1V6LA 2XQRA 5L9RA 1CESA 3ZSJA 5FOJB 5GJ6A 4PLOA 3WF2A 2W1QA 1ENRA 1EYBA 1G8WA 4B1MA 2VVEA 5JZGC 1OMIA 5J36A 3K4ZA 2YPJA 1BYHA 1SPPB 5C3QA 1PGL2 1SMVA 4IERA 3O0WA 2RMU2 4QWNA 2FDKA 1COV3 1LHOA 5FY9A 1QJY3 4DZGA 1WW6A 3ZN4A 2VVDA 4YFZA 3PHMA 1OLMA 5CYYA 2QVSB 3FMGA 1PX4A 1UMZA 2R041 1GV9A 3DL3A 1S2BA 2UYBA 3UYJA 1VBE3 4TLFA 1V70A 4K9SA 5JUVA 4LE3A 1NCQC 1POV3 4P9WA 4A44A 2E33A 3FLTA 3QLQA 4LNVA 4B1LA 1H6XA 5KHKA 3WF4A 1O59A 4PIYA 4AQTA 5LASA 5L7OA 2JJ6A 1YXWA 4H3WA 2RS33 2QQVA 4PQQA 4Y20A 1LEDA 1IGOA 3ZYFA 4D3WA 1VMJA 4XFFA 2FZ2A 1R64A 2X5IA 4LBNA 2YGMA 2ZMKA 4Q1RA 3S0MA 4QHBA 2B7YA 3VZNA 4Y3OA 2HWE2 2WZPP 5D8AB 5JMOA 3ZFGB 4UAPA 1LHWA 4J1WA 2VNGA 1U5IA 5A33A 2HWC1 3RZGA 1AR81 1SEFA 2IC1A 4CZSA 5LY1A 5CB7A 2BNMA 2DBIA 2C5DA 2WLQA 4BQWA 1UYPA 5J3UA 1H8TC 5FZOA 4QKDA 5K7PA 1W8HA 3DV8A 1GNHA 3THDA 3WP3A 4NIGA 1V6IA 5FOBB 4NRMA 4YW7A 1RJ8A 1CGPA 1SLBA 3ILRA 1DZRA 2WWSA 3JUUA 4GH4A 4UOJA 5DQ0A 3ZO0B 4DNYA 1W3XA 2VZSA 1SBFA 2RS12 3PVOA 4M0NA 3RMYA 4LLFA 4CPBA 1STMA 3CBNA 2BW8A 1PO12 5FYMA 2XXZA 1IZ3A 2YHJA 3O1UA 3M8LA 1VE0A 2ZABA 3V0BA 2R072 1S55A 1S0JA 3O7OA 2PYTA 2I2SA 3BODA 1GSLA 3OG2A 4KQ7A 1TEIA 4IE6A 4BQYA 1W8TA 4R9DA 3RWNA 5FFOC 1H6YA 4IEPA 1JZ8A 4CCMA 4CUGA 2BGPA 2X09A 2B5HA 2TNFA 3MW2A 5F3CA 1W0PA 3A23A 1HJFA 4F7ZA 4NE9A 3QOPA 1XBFA 1QDOA 2B9UA 2VMDA 2XLAA 1RVF3 3BKZA 1KQRA 5JPNB 4JGZB 4R4ZA 4M01A 4TSVA 5IAXA 1D0GA 4MGSA 4QM9A 3DKWA 2HLEA 4F3JA 1QJU3 2YYOA 5IK7A 4MLOA 4MV2A 4E9KA 5A1LA 2Q8CA 1FOD2 1W6PA 1TMF1 4WM8A 5LEJA 2YV8A 3WD5A 4FAGA 3IIAA 2BBVA 1SCSA 1UPIA 1C5IA 3WXPA 2W3JA 5KWRA 1XC6A 4IETA 5JOYA 3BOPA 2HH9A 1UU6A 4CDWC 4XJWA 4O65A 5JCTA 2JKXA 2XPJA 2W94A 2JENA 4N7UA 5CZKA 2Z4FA 1VBB2 3WCRA 1OOPC 1RTVA 3WG2A 5BNNC 4JKKA 4ZY9A 5GZGA 5F9TA 2QQWA 2PHUA 5DMYA 1YC61 4W4ZA 5JR2A 2LROA 3S30A 1DU3D 3PTYA 4KU7A 4META 2DUOA 4IV1C 2R49A 4P00B 1FMD3 3BI3A 3ES1A 2EICA 2Q1ZB 4HK9A 3KHBA 1W6NB 2VNVA 3OPTA 1JBCA 1JYIA 1NCQA 5IVFA 1KJLA 3SQOA 4QX7A 2WQ8A 1Z78A 4EYUA 4N53C 4LBJA 4LO7A 2IXHA 5A7PA 5E8AA 2D6MA 2NQYA 1K5JA 4WZFA 5LY2A 4LBQA 3A22A 4NHKA 5FO9B 1FMD2 1RYYA 2KXLA 3K3OA 1Z7S2 4GMP0 1DGRN 1YNAA 2EXJA 4PI2A 3OUIA 2A3XA 2WRAA 1CAWA 3DYMA 4AR2A 4QPWA 3K46A 4LUMA 3QACA 4XF1A 4N43B 1R1A3 2Y8KA 1RUC3 3H1MA 5DUWA 1N3QA 1HDKA 4FPKA 4KWUA 5ABJB 5I0DA 3SEPA 2B42B 2UWBA 1ZRDA 2JDNA 5GZCA 3Q8FA 4KMQA 2WR9A 1H8TA 3UJQA 4HONA 3C7EA 3GGLA 4I30A 2J42A 2O1QA 4IE7A 5FKCA 3ZMNA 5M0TA 1DYKA 1GWMA 4J1XA 4CU8A 2LTNA 4Z07A 3WW3A 1PIV1 1FPN1 3TYJA 5DG1A 2B9VA 1B35C 2A7AA 4AQSA 2A71A 4TXWA 1C8NA 1R1A2 1RUC2 1RUH2 5EP9A 2VECA 2CAUA 1W6MB 5H9SA 1N1VA 3H42B 4HMZA 3GZAA 1MEC1 4Q5OA 5CKMA 1LOFC 2D5HA 2GMMA 2QTWB 5HXVA 1G7YA 2VZVA 3KHCA 1VR3A 1LCLA 2E7AA 2WS93 3ST7A 2VQTA 4N9HA 3JU9A 2EALA 1WD3A 4NIAA 4Q0UA 4XZPA 2AR6A 4HKWA 5BPXA 1P8JA 3R05A 3ZFEA 4AFAA 1MS1A 4A6OA 2GMPA 4Z82A 4BE3A 1OA3A 5JI7A 4MZUA 2YC0A 2JD4A 3LZZA 1TME2 2XJVA 4LA2A 2UWAA 1O3QA 3B93A 1PMJX 2YY1A 1H1AA 3B00A 3FFQA 1W9TA 3R4DB 3SHRA 3ZFFA 4BXFA 4BQ2A 1V9U1 5A7WA 2WO1A 4XFCA 1S2EA 4HKOA 1F9KA 2GC0A 3KCCA 5FK8A 1KD7A 2A75A 4FPOB 4PBOA 2TEPA 1F5JA 1W0NA 3VZJA 4MO3M 1QMJA 4Y1VA 3VD5A 4HKLA 5F2WA 4XFBA 5FZDA 2G9FA 3AC0A 3M3IA 4M3CA 1QQP2 4CDUA 1NUKA 5KXBA 5FZ9A 4PI0A 4NOTA 2R061 4QHZA 2ZGMA 4CDWA 1GP6A 3ZMOA 3H8RA 4NPMA 2VUCA 3RWKX 1OOPA 2VXRA 1K45A 2V4VA 1JMUB 5CKQA 5HPOA 2ZBJA 3EMRA 5LEKA 1WBFA 2V5YA 3IM0A 2D6LX 1O5UA 1SFNA 1BJQA 3POGA 4PJYA 3VBRB 2QDNA 1UIKA 3RZJA 3KD4A 1GQPA 1DLLA 5FQ0A 4LXLA 3CL1A 2GNDA 3UETA 1ULEA 2VCMA 3U10A 4MGQA 1FXZA 5LBCA 5FYZA 2IXKA 3HIFA 5LA9A 4LKDA 4XJ9A 1ODNA 5BY5A 2A5ZA 1CJPA 3FBMA 3RJRA 5K8SA 3AXEA 5EZWA 1WD4A 3KS7A 4BLIA 3U37A 2ERFA 1UF2C 2XKOA 1JXNA 3VKFC 4C0BA 2ADEA 3ZR6A 5HV0A 5BV6A 3I54A 1ZBA1 2OUHA 2GMEA 1AR71 3ETPA 4RFRB 2JECA 4RS5C 4CDQA 1ZRCA 4GJYA 3POIA 1WWYA 5E6HA 3AKQA 3ON7A 1D4M1 1HN0A 1N1SA 1REEA 2YB7A 2GH2A 4AI9A 1EAH2 3RFRA 4YNIA 2XHNA 5LB6A 2YROA 2P3JA 1O3SA 2JG9A 5C5UA 4J25A 4R8HA 1I3HA 1Y9GA 2HEWF 5T5LA 1W9YA 4CCCA 4COUA 1JYCA 1VPHA 1UYYA 3FN9A 3ZXEA 3WUDA 2GDFA 4GWMA 1WMDA 2VJXA 3IDCB 4D6QA 4FBFA 4NMIA 1FAYA 2IVJA 3H3ZA 1XNBA 4IEWA 2VMEA 4Q1PA 3VBOB 4YVWB 4XUQA 1C8M2 4UWDA 3VD7A 3TOJA 2W2IA 4IQPA 1L7RA 4KG8A 4I0WB 3TN93 3CJIB 3W58A 1VBA3 4KG0A 4FQZA 3OD4A 4NIDA 2WYFA 1F31A 2KA3A 1S2KA 1QY4A 2ZPXA 4RD7A 2VD7A 2BWAA 3HQRA 3LPGA 5C33A 1RUD1 4YVSC 3OJBA 5JDBA 5LCWL 4PLNA 2VCCA 1GZWA 5L9VA 1W8FA 2Y60A 3DPRA 1G9FA 1WW4A 1SFPA 2ZGNA 2WWJA 3MIBA 2HWC3 3AMHA 4RGAA 5H9RA 3RZZA 3J7LA 1E5IA 3H0OA 4UFMA 3TN92 1VBA2 4BCUA 4E4ZA 1TE1B 1AJKA 1O5LA 3K4DA 2PFWA 3MV01 5C9AC 4FSJA 1ULOA 3H3LA 2FCTA 2XBO2 4J6GA 4GZ9A 4I3GA 4GXLA 3NW4A 3IBMA 1XXNA 3ZX7A 1JYVA 3D8CA 4ZS2A 4COYA 1RUE1 1LOAA 5DAVA 2OIIA 1OLRA 4YRDA 3ZN6A 1EV12 4EV0A 1PZ7A 2J7MA 5FZMA 4XCBA 1W8OA 4DO0A 4CDXA 5FZ4A 3R6SA 1RMU1 2NPIA 4BQ5A 3AZVA 3HBKA 3GCXA 4OFGA 1W9WA 2PHDA 1BQPA 1DQ6A 4URTA 5A7QA 3VBSA 4XDOA 3W21A 2CV6A 2J1SA 3KV9A 3OY8A 3BTXA 2A6XA 4FPYA 1ULGA 1Q3EA 2W91A 1W2NA 3RZHA 5F39A 4P5YA 2IXJA 4UFLA 4CP0A 1W06A 2E6VA 2HBUA 3PU8A 3AMQA 1XYNA 1XPWA 2D6NA 1NA1A 5I8TA 1LR5A 2P3KA 1C3HA 3K77A 3WX5A 2ENRA 2Q4SA 2GN7A 3KZ4C 3MPBA 3ZFGC 4C0HA 4CXWA 2BNOA 4KU8A 3J8F1 2OVUA 4CP9B 3KF3A 3ZOIA 3MV11 4YLZA 5CU1A 5HCBA 4W50A 1POQA 2W39A 4P9GA 4OYUA 1TMF3 4CCKA 5FY5A 5CAZA 1K5MC 4RS5A 3WQ0A 5APAA 2BQPA 2HWB1 1KGYA 2XGXA 5FMCA 3NV3A 4ASLA 5CFCB 2GALA 3LFIA 1W90A 2X29A 4GWJA 1WBLA 3ES4A 4DMIA 3LIHA 4XE9A 1F4AA 2EAKA 5DDJ2 5FPZA 1LOEA 1UY3A 2XOMA 2P34A 5JOZA 1VALA 1YCIA 3QH6A 5FUPA 1R093 5KBFA 4DUXA 4UW6A 2QDRA 2IXIA 2ZGQA 2PLV3 3PUHA 4NAMA 1NAEA 3V0AB 2QQLA 3VZKA 1S1AA 4YFWA 1XE7A 3K51A 4YGDA 4XUPA 3VLBB 1WCKA 4K8RB 2C9AA 4AVAA 1QXRA 3HNBM 4FCAA 1AR62 1VBD3 1ZZ6A 5AFBA 3KGLA 3B5LB 3OOXA 4N9IA 2Z69A 2OPWA 4QKNA 4DUWA 5C3SA 3H8XA 1R092 3CZUA 3MGUA 1ZBE2 4RR3C 4LKSA 1X9TA 2ZX0A 5EFUA 2PLV2 4D8MA 3DGTA 3MLJA 3P6BA 1WLWA 4YG0A 5BNQA 4HOOA 5DUXA 5CFDC 4K7JA 3IT8A 2A3YA 3J7MA 2G1MA 3NV1A 1AX1A 1IKPA 2YC2A 3VUOA 2ZEYA 1UD1A 2BDRA 3WW1A 1VBD2 3NWKA 1GMMA 2JDHA 2V5DA 2Y6LA 4Q4V2 2ZKLA 3PMEA 5FPUA 3SKJE 4OVEA 3CF6E 1D2SA 5IFPA 1QOOA 2QNKA 3KCXA 3WOGA 4LO5B 1U5ZA 4GJZA 4LHLA 4RYDA 2WQ4A 2ZMNA 2WQZC 2RM21 1PMIA 4QPGC 1M06G 2HWF1 1SPPA 5A3OA 2SBAA 2VXJA 1HV1A 3UGGA 4LKFA 4AVTA 2YBSA 5ISLA 5F5IA 3OTFA 1CPNA 4QPIC 1ND3B 2YG0A 4XAAA 3RSJA 3ZYJB 4CPBD 2VCBA 1HN1A 1B09A 1PIV3 2OZJA 4IV3C 1A6CA 1FPN3 4HSLA 4XIKA 4Y5TA 3WNKA 5LA0A 5CNAA 3VD4A 2JG8B 5EYXA 3OBZA 4MGZE 4AGGA 2A73B 2RS53 4UT5A 1UZVA 3I3MA 2PHFA 3N7LA 4LJHA 1VIWB 4NROA 2P3IA 2ZS6B 1QJX1 1MEC3 1RITA 1XU1A 1AL21 1Y4WA 2MEV3 1X50A 2WNVB 3UKTA 4DINB 4IW3A 3U11A 3W5NA 3PVBB 5C8CC 1J3PA 1KXGA 3ZIXA 4CCOA 3LWCA 1UOFA 3ACGA 4BMEA 1DP0A 5IVVA 2B4KA 3ACLA 4NIHA 1WCQA 4JGYB 2UY8A 3VBUC 3DEMA 2RS52 4UW3A 5KXCA 1DLCA 3GALA 2W87A 2P4EA 2JDZA 2DVAA 5D8AA 2MEV2 3ZFGA 5F37A 3TEYA 1MS0A 1T6GC 3OB8A 2D97A 4ZONA 2AGSA 3ZM8A 5JOXA 1NXMA 2CAVA 2V72A 5JPMB 3MIFA 3ABZA 1D7PM 3GZEA 5IUQA 2JDMA 3AP9A 3EJKA 4IEVA 4D6SA 1APNA 1ZZ7A 4LTAA 3USUB 1PX3A 1Y9QA 5FZHA 4ZS3A 2WAOA 3VZOA 4CU6A 1TNRA 1OPMA 5I93A 2Y6KA 2B8MA 2R063 2RHPA 3EO6A 3JBG1 1G9BA 4PF5A 2HWD1 3AJZA 1Q56A 3T0DA 4ATFA 2BBAA 1FNYA 4OQ9A 1BVP1 3ZYIB 4BU2A 1KDMA 3AP7A 4IEZA 4EN6B 5L7OC 2VW0A 2Q30A 1ST8A 1UZYA 2W92A 1C1FA 2ZXQA 3PNAA 5JIAA 3S5QA 4JZRA 3ZYGA 2A3WA 2X5IC 3L2YA 1QU0A 3WT3A 2V09A 4UF0B 1BXHA 1KEXA 5IYYA 1FT9A 1MQTB 4AGVA 2VL4A 5J48A 4LBQD 1GOGA 2ADDA 2D6OX 1LENA 3MLLA 4Q4W3 3CIHA 4JGZA 1RUJ1 4HVRA 4W8JA 3QH7A 2DU1A 3H1WA 3HNMA 5FUIA 3I3QA 1RXGA 5FZ0A 3VDDB 1VRH2 1IS3A 2BOIA 2CTVA 4FFGA 1S0BA 2ZJCA 5H9PA 1O6UA 1WKYA 1ZBA3 4PDWB 3X29B 1IKQA 4JC1A 2DVDA 4MXWB 2FMDA 1AR73 2DCZA 3M3CA 3N35A 1XNTA 3MZHA 4GH4C 1QDCA 3T2TA 3I3DA 5HBAA 1RUI3 3WHUA 4FTBA 1ODMA 4Q4W2 4LA3A 5AVAA 3SCHA 3WF0A 1OVPA 2JE8A 3VKOA 3WINE 2XWBB 2ZMLA 4QM8A 2A6ZA 4CCLA 3IKWA 2PN5A 3PMSA 4LEJA 3WDVA 1MZFA 4AEDB 4CXYA 5A1FA 1UOJA 2WFF1 5CBLA 1XQNA 5DXDA 3BVCA 3LD8A 4YM1A 4YSFA 1RUI2 2A6WA 2Z42A 3U78A 1AXKA 3SNMA 1J84A 5B4XA 1S0DA 1K12A 3APBA 3PDQA 4FPCA 4X6RB 5EJZB 4QDQA 3PIJA 1W6NA 5ACA3 2UU8A 1MZEA 4XFIA 3BGAA 4R9AA 3SC7X 2J1UA 1GKBA 2PHWA 3IDBB 1G9AA 1IQDC 3PJYA 1BLZA 1Y43B 5T5PA 3T0BA 5T5OA 2D7FA 1VBC1 1XNKA 4IEQA 5FZ7A 1LGCA 3NKTA 4CU9A 1GYKA 4B4PA 5DZGA 3T4VA 4WM8C 5FY7A 4C1WA 3URFA 2VTFA 3GJBA 2E31A 3NJYA 1LEMA 4QHOA 2C9KA 3GXUA 5ACA2 1MACA 1RUD3 2ZAHA 3E6DA 3C2UA 5I0TA 4DRVA 5L36A 3O1RA 1NKGA 4BHPA 2YZ4A 1W2OA 1BMV2 1RHI1 4N8MA 2G4IA 3WP6A 2GNTA 4N43A 3WDTA 2BUKA 5C70A 1BZWA 4UBGA 4XZUG 4Y24A 4NIIA 5ABJA 1AX0A 1H4GA 5AC91 2XWJB 4XF4A 4XILA 2VOKA 1LOGA 2XLGA 5SV8A 5FREA 4OHWA 4AGRA 1HXS2 1V6JA 2BEOA 3ENRA 2R0HA 4XBLA 5LRRA 1ALYA 2R32A 1GUIA 2VR4A 3ZR5A 1V6OA 2ZACA 4DY5A 5JSPA 4G3YC 3P3PA 2CDPA 3OF1A 3RI8A 2OX0A 1UXZA 5D1IA 4BWOA 3NJVA 3QCWA 1E5RA 5F6KA 4BLJA 5F1RA 3FJSA 1UYXA 3PLQA 2LS6A 5C4WB 1W6MA 4Q0QA 4UBHA 3VD3A 3GNEA 4MGIE 1COV2 2WT0A 1X82A 1QJY2 4FVVA 4YZ3A 4NRQA 4LR4A 1LOCA 4NWVA 4PIZA 1OUXA 2VZUA 2ZX2A 4IXLA 4E4DX 2BFUL 2VVFA 3D0SA 5F3EA 3M3OA 3CJIC 1KDKA 1UOBA 2BRTA 1MZ6A 3KV6A 1OQEA 4AVVA 3ZYBA 4S2DA 5HI0A 3H7JA 1HQLA 1VBE2 5F5AA 1Y7BA 2WO3A 5FK7A 3OBTA 1OQDA 3UJOA 3V56A 4UI9L 5FP9A 4Z92B 3OPZA 3AZWA 1NLQA 2B45X 3HOBA 1CAXB 1O91A 2EF6A 1SLTA 2JDKA 4LBOA 2UURA 3FHIB 3RYRA 3W59A 1N3PA 1NCRB 4L8QA 2RS32 3O1TA 2ZHNA 2Y34A 3SISA 4KWJA 4CEWB 4M00A 4OQ8A 2WUHA 3VHPA 5I0UA 1OVSA 4XFAA 5FMBA 1UX6A 3QD6A 3RNSA 5J1XA 1ENXA 3AKRA 3KCYA 3THPA 1DZQA 1NOVA 5GALA 3LEGA 3EQEA 4LLOA 4X6QB 1UW8A 2DBNA 4GB31 4EN8B 3POWA 3JD71 3VHRA 1SLCA 1UZZA 1PK6B 1UNBA 1US2A 2PAKA 4QAWA 4R4XA 1XE0A 3AX4A 2D43A 2HYXA 3VBRA 1G6NA 1DF0A 1WMXA 4Y5SA 4PF1A 5L9BA 1RC6A 1U12A 4K6BA 2D3RA 1CZVA 4LK6A 1BCXA 1AYN1 4GA9A 3WG3A 2XUMA 1DZTA 3DXTA 2Y6HA 3FLPA 4O9GA 3ZFEC 5ANQA 3RMXA 1AHSA 5LWBA 4GMP1 3MLKA 3FUQA 4AVBA 2RR11 2F17A 3P1IA 4E4SA 1NY71 3IAPA 4YWAA 1TZOA 2QQOA 3Q8CA 4IE0A 3LFMA 3BALA 5LK7B 2VU9A 3AVRA 3ZFFC 3DCQA 5KC6A 2VUJA 5KXDA 2IFWA 1QHDA 4A2UA 2WSUA 5FPVA 1Q43A 4YM0A 1OF3A 4MOAA 1UKRA 2Z5WA 4Q0SA 1E5SA 3POEA 2CY6A 3C3VA 3ZXKA 3U4XA 4Y22B 2C0ZA 4CDUC 1HKDA 1RVF2 2IXLA 3OBAA 4NN0A 4TLGA 4W6WA 2YDEA 3O1SA 2FD8A 2AEZA 4FPFA 4L11A 4CYDA 4EWDA 3B7MA 3MIDA 2BFUS 4R52A 4W6XA 3VHNA 1QJU2 2RM23 5L73A 4MYEA 4Q4Y3 1PVC1 1PZ8A 1RUF3 5FZIA 2MHFA 4DY3A 2WDBA 4QDRA 3TEZA 3WG4A 1W6OB 1H2NA 5JI9A 2WL1A 5BNOB 4P9YA 4ZU7A 2P1BA 5EWSA 1OQ1A 1UQXA 4CRQA 5GLWA 3A0KA 2YFZA 3FL7A 2D3SA 3K75B 3MFCA 2GN3A 3LDRA 3RG0A 1Q8SA 5KHHA 3NV2A 1Q5OA 3VBOA 2XJQA 4YVWA 3KVAA 4Q4Y2 1VJ2A 1R081 4XBQA 1RUF2 4JVAA 4LPLA 4HK8A 1AL23 2ZGLA 4EE2A 3NMBA 1H1MA 3SEEA 1OF4A 5C5TA 5JXIA 4H55A 4QXKA 3UV9A 2XJSA 1ZZ8A 2HJIA 4PT6A 2WNOA 3FHQA 3CJIA 3OBRA 3U75A 3FC0A 1LU1A 1IG3A 2QQUA 1L3JA 4B7KA 3S5AA 2E32A 5FPLA 1PGW2 2JB4A 4L9BA 4O61A 1DGLA 3LDKA 3O1OA 2OQ7A 2WO7A 4YGCA 4RHV1 4CDQC 1GR3A 1GQGA 2BV4A 3I2IA 4NJ4A 5G05L 2RE9A 1DGWX 2QFEA 2XR4A 1J1TA 3HVDA 3ZN5A 1YWKA 5KR7A 1DDLA 1XJAA 2DDUA 1HRV1 1E57A 1HW5A 3AP6A 1YFXA 4AEDA 5K0UB 4IL7A 2JG9C 1GBGA 4O9EA 3I8TA 2R16A 2XHKA 1G9DA 4ZZ8A 2ZA9A 4YGEA 4COZA 4YGBA 2ZGOA 5FY4A 1DQ2A 3EBRA 5FZEA 4AI2A 5A3TA 1US3A 4NHYA 5DUUA 5FXWA 3K4AA 1OT5A 5IVBA 1OKOA 3AYAA 3C8XA 2HWD3 3WDXA 2BVBA 3FE5A 4OUSA 2VCAA 3BYWA 5K4LA 2ZOEB 2ILMA 2I07B 4A3ZA 2C1FA 4AEKA 2W68A 5DAWA 5FRAA 4HG6B 4XQ4A 5GZFA 4OI2A 3FZ3A 1I5PA 2RDSA 3G6JB 4AXOA 4JKMA 1BK1A 3BU0A 1RUG3 1H8VA 1WUVA 1OUSA 1PNGA 1YFUA 2MNGA 2AC1A 4M4PA 1V6NA 4JGYC 4BIOA 1O3TA 1UY4A 2ARAA 2JDAA 4YW4A 5EV7A 1AR93 3DPRC 4XF0A 1JW6A 2WS92 3KLSA 4HLTA 1J83A 3O1PA 4DIQA 1RL3A 5A6QA 1RUJ3 1KS5A 2XVGA 3GYDA 3ILNA 2VZPA 4FP2A 3MDPA 5FMDA 4CP9A 2AYHA 4CTEA 5C3OA 1WCSA 2VQ0A 4XFHA 3HJRA 1YO8A 4HPKB 2ZEXA 2WIIB 3WY6A 3I3BA 3ZIWA 1HQWA 2UY9A 3B02A 1RUG2 4CCEA 3AZYA 1REFA 3NNGA 2D44A 3ZPYA 1BBT3 1OKQA 4GKXA 4ZPIA 4B29A 2Y6GA 5FP3A 5DABA 1CD3G 5CFCA 1DQ1A 2IZWA 1AR92 2W08A 2QE3A 3LA3A 4JDNA 1H9PA 3MYXA 1ASJ3 2P17A 5FZ3A 4CDXC 5CISA 5FJKA 4OHYA 1W99A 4K3UA 3SKVA 5IHRA 5FLIA 2WZ8A 4JRAA 4QX2A 2NZ9A 3KV4A 4P08A 1YLLA 3UGHA 2WT1A 1AF9A 3H8UA 4I0BA 3VBSC 1LESA 2WA3A 4AEJA 4AFBA 4AWDA 5I91A 2ZGUA 1BBT2 4CCDA 1S0CA 2WFF3 4AYUA 3V0AA 4TTGA 2VPVA 3HN1A 5A3NA 2PHTA 3A21A 5FYCA 5EIYB 3O12A 4V2WA 1ASJ2 1AYM3 1AXYA 1NA1C 5FMOL 4KGQA 5B2GB 1OFNA 5FYBA 1PO23 4RGGA 2E63A 2E51A 3ELNA 3Q8EA 4P14A 4Q2FA 2BNNA 4UFJA 4KL1A 3BIEA 2Y0IA 1YIPA 3NKGA 4FOYA 1F8VA 1SBEA 3N9QA 4Y1XA 3ZXGA 5FKBA 4MGYE 4NO4A 4XDQA 1A34A 4ARYA 1MS9A 2XL7A 4BOWA 3I4IA 3CLPA 1AYM2 1SBDA 5FZ1A 4DXTA 2Q8EA 1BEV1 2D6PA 1PO22 3I2DA 2WN3A 2YUEA 4QQ2A 2LM3A 3GBGA 4XC9A 5FLJA 5B4NA 2BPA2 1RHI3 3AXDA 4G4FA 4L2NA 4D7SA 1JYTA 2R30A 4QX3A 4TWTA 4QT6A 5C9AB 2YXSA 1W2TA 1JU4A 4Q4X1 4FQ4A 2QZ3A 3PVEA 4MHRA 4QQHA 1W0OA 3DF0A 1HRI1 3PUIA 2O0OA 4FI9A 4UFIA 4XFGA 4XHBA 5LW9A 3PVNA 1UOGA 3KT7A 2X05A 4CSWA 3AKSA 1X36A 2FBEA 2V73A 4GQ7A 1W8UA 4YW6A 1ND3A 3ZSMA 5JZGB 1XE8A 1MS3A 3M4FA 2R043 3JB8A 5K9YA 2OA2A 1JU3A 2JD9A 2JG8A 4YM2A 3T4HB 4WV8A 4ZKTB 2QJVA 3E97A 3OGGA 4FFHA 1REDA 2BOJA 4QD2A 2WZR1 5JR7B 3RS6A 3WF3A 2EA7A 1V0AA 4BISA 4URAA 2W52A 4NPLA 1JZ7A 1QOTA 2BJSA 2JE9A 2WNVA 1CWPA 2A6YA 1TG7A 3SH5A 1AXZA 1QIQA 1T6BX 2ORXA 3LF7A 3PUQA 2VZTA 3PURA 2XG3A 3L9JT 3WF1A 5C7GA 3SXWA 5FLHA 1V00A 4CXXA 5EHDA 2R042 3AFGA 4C8DA 2WC2A 4FO9A 4L97A 1VLNA 4JGYA 3GBFA 2YU2A 3A0NA 3S57A 2NLRA 2VZ3A 4S2HA 4CP2A 2E26A 2FDHA 5T52A 4QX1A 3VBFB 3G7DA 3GF6A 1IG0A 2JIGA 1J3QA 5IJRA 3UT0A 1AR83 3E6CC 1GICA 5IW0A 1GP4A 3AVSA 2CHHA 4FOQA 4MGTA 1GOFA 3POFA 1F35A 4JKLA 1L7QA 4QGLA 1DGWA 4UW4A 3U4SA 5FDBA 3WLUA 5FYYA 1YQCA 4FP3A 4M0HA 4SLIA 2RMU1 3V64A 1YUDA 3N7KA 2VG9A 1JN2P 4NHMA 2EXKA 5FZ8A 3W9AA 5FMOS 1KRIA 2BVVA 1UMIA 2PAEA 4D69A 1O8SA 3MIGA 4M4RA 4YW5A 3USUA 5FYVA 5ERLA 3ZVXA 3FUOA 4A45A 4B4QA 4L99A 1VAMA 1OBNA 1YFYA 5F8PA 4OCTA 1JZ6A 3H8OA 2HWC2 3MIHA 1CAVB 4A6SA 1AR82 3BTAA 2VO5A 1PM4A 4GB33 3TEWA 1NLRA 3I3EA 1JS9A 4RFT0 4FTEA 1SLIA 4ZZ5A 3Q8BA 5A70A 2VBBA 4AI0A 2CYFA 2VE1A 4IE4A 4PQ9A 5FPXA 1OURA 1UY0A 2WA4A 2ARBA 3KQRA 2RJLA 3T1MA 4QKFA 5FTTC 2GAUA 5FZFA 5FYIA 5H9QA 1AYN3 1JUHA 3V65A 1OXCA 2BGCA 1OA4A 2QBXA 1QH6A 3LGRA 1UYZA 2OQ6A 3K48A 2HWE1 4UF0A 3WQ7A 2GP5A 1IS5A 3TEXA 4GMP3 1MQTA 1POV1 3LDBA 5D8AC 4FPLA 2PHXA 5E1RA 4OI4A 4PLMA 1W6QB 2Q8OA 4HVOA 3TNQA 4QGNA 1TQ5A 1DBNA 3I2GA 2CGNA 2GC1A 2WAAA 3E5XA 3LB9A 1S0GA 3HT2A 5CIRA 4ZU5A 2D6KA 3VDDA 4ET7A 5A6YA 1O4YA 2LALA 1SCRA 3UKNA 5FCCA 4RQPB 4PDWA 4XPVA 4LIVA 4MXWA 2VC9A 2ZHKA 1A8MA 2RS11 1J58A 1VRBA 2SLIA 4PCRA 2KR2A 3MEPA 3TBDA 5A1AA 3HPNA 1PVC3 1PO11 2J1RA 3BUCA 1JUIA 4Q29A 1PK6C 1TMF2 4K1YA 2Y38A 3PIGA 4LOSA 2R071 3FWEA 2YPDA 4SBVA 3LCPA 4WVWA 2Q1MA 3C7OA 1XOYA 5HCFA 5C6CA 4AE2A 2DCJA 5IVEA 4GD4A 3AK0A 4LO8A 1GOHA 1WA6X 3IDEA 5CKNA 5A3MA 4LITA 3RRDA 1OOPB 3U07A 1QKQA 3ILFA 3LKJA 5BNNB 1BK0A 2ZAAA 3WDWA 2IUWA 4RA0A 4CEYB 2X10A 4LBKA 4EN0A 5GM0A 5FP7A 5JXJA 1UPSA 3VBHB 1ONAA 4ASMB 1WW5A 2RDNA 2NYYA 4JGZC 1GZ9A 2WFPA 4E2GA 4IV1B 3BTZA 2W9XA 1W8NA 1I1EA 3N9OA 4IESA 2E9QA 5FYUA 4FTSA 4Q0PA 3RI9A 3VL8A 1POV0 1JTZX 1NG0A 1W39A 3AMMA 3H50A 4MH0E 1FOD1 4YW1A 4B3NA 5HXMA 1ZA7A 1HIXA 3MPPG 2DCYA 4IEXA 3WNPA 5FWEA 1UZWA 3JB4C 2GNBA 4N53B 3WHTA 4AAXA 2OUJA 4LO4B 5FR3A 1A78A 2CWMA 4WVMB 1UKGA 4DQAA 3WNXA 2H0BA 4DXSA 1VBB1 2ZEZA 2VOXA 4ZHNA 2JDYA 4JTNA 3T2PA 4PHZA 3ME2A 4LHNA 4E4HA 2XJPA 1W9FA 4EZ4A 1Z0HA 1O8PA 1WA4A 1CJDA 3WEZA 4E2SA 3BIWE 2K0GA 3D5OA 5C8WA 1D0HA 1JZ4A 2ZCWA 1TVGA 1VAKA 1JOPA 1W2UA 5LA1A 3AL6A 4I09A 4XUOA 1ZYBA 3J26N 4NR1A 1OD3A 1LODA 4XQWA 5KHGA 4FOWA 4GULA 2DYCA 2VQUA 3DKQA 4Y5Z0 5C4WA 3VDAA 4RN5A 2CWSA 1LU2A 2W1WA 1ACCA 4KGGA 3PU3A 4TZDA 3T2OA 4BJ0A 1CX1A 1PIV2 1GU3A 4CCJA 1B35B 1FPN2 2H6BA 3NQHA 4N7IA 5FYTA 1FMD1 4A41A 2TBVA 4CUCA 1Z7S1 1QGLA 5IVJA 2FDJA 2VULA 1JYXA 4NHLA 3PTRB 5LA2A 5BNPB 4LUKA 1H30A 1MEC2 2VMGA 5A3PA 4JTOA 1MVQA 1CAXA 1AL0G 2WINB 4LQRA 1EPWA 4N43C 3NV4A 1DIWA 4LO6B 5F5CA 4HETA 1EPZA 4AVSA 5ABJC 1NCRA 1V9U3 1DFQA 1WMEA 2MPFA 1WLCA 3NL1A 4CEWA 4EN9B 1UU4A 3ZKUA 3O0XA 1JZ5A 4Y33A 4CP1A 3LPFA 2VOTA 3HNYM 1H2LA 3LQCA 4IGOA 2VZ1A 3D82A 2Q8DA 5CG9A 1RJ7A 2XONA 5T50A 4YZ2A 1R1A1 2IFRA 1ULFA 1RUC1 1ZZCA 2GU9A 2XB6C 1VAVA 1RUH1 2R7EB 2P6HA 4WVZA 4XXPA 2YGLA 2ZTNA 1V9U2 4BYYA 4Q8KA 4H14A 3RDIA 4UFHA 1PK6A 4ASKA 4QX5A 5IVYA 4D7TA 2PAMA 2PQQA 4ORFA 4OLLA 4ZU4A 2XL9A 1V6KA 4R9CA 5FAXA 2V4AA 1KFXL 4EQVA 3ZSKA 2R062 2X53S 1URXA 1ZX5A 4UYBA 2CU5A 5CG8A 3NJXA 1NYWA 4E8DA 1UN1A 3MICA 4OHVA 4PBPA 3OGRA 3VN4A 1W3VA 2JX9A 4A7KA 5L19A 3FBYA 3I2OA 1TME1 5FPAA 3SH3A 4QX0A 2VMIA 4KWLA 5F5QA 3OD0A 3K2OA 4DRRA 2FZ1A 3AKPA 2D93A 4NVPA 2VZOA 3DN7A 5A7SA 2VUDA 5JWPA 1JYWA 1N1YA 4EWEA 1GFF2 5LATA 3TRSB 4A42A 5KC5A 1FNZA 5A7NA 2J22A 2Q1FA 4BQ3A 4AHWA 1CQ9A 3KVBA 2YFUA 2ZHMA 1X8MA 4Y22A 1EY2A 1QQP1 5GLTA 1D4M3 3UL2A 2DWRA 4AK3A 2XVKA 1XU2A 2I74A 1LGBA 2E7QA 4A7ZA 1TNFA 1OLQA 2C4XA 2NMNA 2QQJA 2VAUA 1IS4A 4Q4X3 4UW5A 1V6MA 4XTMA 1FI2A 2IVIB 1HRI3 4EROA 3ACFA 5FV3A 1ZBA2 2G9ZA 3VBRC 3H9AA 5IT6A 1AR72 5FUNA 1W6OA 1WGPA 3WUCA 4Q27A 2K9ZA 4DPNA 4R9BA 3LAGA 4YYOA 3D6EA 3T2QA 5BNOA 3M2MA 3I2HA 4Y1UA 1CZTA 1D4M2 2DCTA 3LEKA 4V2VA 2VOVA 3IMMA 3EHKA 1C28A 1UWWA 2VW2A 2Y33A 4YARA 3N9NA 2EAAA 4BMBA 5EQUA 5BYNA 5FZCA 4YPJA 1H0BA 4CUAA 5SV5A 3GHNA 1FV2A 2XJTA 2ETEA 2WZR3 3P3NA 2DVBA 3VL9A 2DUQA
chains in the Genus database with same CATH topology
1ZNPA 1DQ4A 2QCSB 2PELA 3AZXA 4FPEA 2DURA 5JSRA 3B69A 2DV9A 4P9JA 3ZXFA 2JE7A 2PHRA 1X7NA 4HBNA 3B01A 1OI6A 3KM5A 3OYWB 1O3RA 4Y1ZA 4LHKA 1EAH1 1SACA 3Q9OA 1F2NA 5K0UA 1H2MA 2ZGTA 5I0RA 4YVSB 4DXZA 1RUD2 3HAGA 4KH9A 1RUE3 2EXIA 1SLAA 2WJSA 1SDWA 2D3PA 2GH8A 1ENSA 4HN0A 2R6QA 4U2AA 1SLLA 5KXEA 3LSEA 3VBOC 1CPMA 3MF9A 1RMU3 4YVWC 1LHVA 5C9AB 5T3NA 5DZEA 3SH4A 4AFDA 1C8M1 2E53A 4B7EA 2WNUB 4DS0A 4OI0A 3NVCA 4FT8A 1VP6A 5IK5A 4DFSA 1CAUB 4JRLA 4HN1A 2WLPA 4FOVA 1RUE2 3AMNA 4B8EA 3HD8B 3FFZA 2ZX1A 2O8QA 4WM7B 2F4PA 4XW3A 4OHXA 1RB8G 4HL0A 1YHFA 1FYUA 1RMU2 2HWE3 2OW4A 3QBQA 4XEZA 1YJLA 2GSYA 4LE4A 4AFMA 1WCDJ 2DVGA 4GKYA 3WW4A 4A7YA 3I59B 1OA2A 3VBFC 3J8F3 4FPHA 3TN91 4AEDC 1VBA1 1QNYA 2XH6A 1LECA 2HEVF 2XBO1 1X8EA 4HPKA 1WLTA 2HWB3 2IXCA 1UL9A 1VB2A 4EWAA 4XF9A 3AP4A 3RYKA 4XBNA 1EV11 3OCPA 1Q8PA 5IK8A 2RS13 3J8F2 4S2FA 5BUVA 1QOSA 3CU7A 4XOGA 1UU5A 2DF7A 2Y26A 1PO13 2W0XA 5J09A 1K5MB 4I0AA 4Z8BA 3ZXJA 2R073 2PHLA 3WW2A 2D40A 2HWB2 3B9IA 5EJ3A 3UK9A 4AHYA 3RQ0A 4AVCA 5JLVA 2WNEA 2NM1A 4XXAA 3ZSEA 4E27A 3MW4A 4F8AA 4Z1VA 3JCIA 3R0RA 4X8NA 1BKZA 1XRUA 2DUPA 1R1ZA 2ZZQA 4Y26A 4XQDA 3TB0A 2Y0OA 5E16A 2B39A 3AMPA 4OUMA 4XMAA 5T5JA 3NSTA 4QU2A 1FOD3 4NPRA 3ZYRA 4K20A 2TUNA 4ITCA 3M7AA 3IPVB 3LOIA 3BOWA 2D5FA 4RR3B 4KNCA 4RQPC 5CFCC 4AG4A 4BA6A 1FATA 3KT1A 5DDJ1 3M70A 5CFDB 1I9RA 2GC2A 4IEOA 2R0FA 2HWF3 3AYCA 1VBB3 2ARXA 1DQ5A 2P37A 4BIFA 4V1PA 1UAIA 4YG6A 1RGSA 2ZKNA 3NJZA 1M4WA 1GNZA 1ZVFA 2AENA 2B46X 1QXPA 2OYZA 3N4MA 1LJ7A 1ULCA 3CNAA 4HZFA 3WCSA 1AR61 1C4RA 1OFSA 2VGDA 5KHIA 5JZGA 4GALA 4QPGB 3VKMA 2RM22 1ZM1A 2G9GA 1YFWA 3J9SA 3TAYA 2HWF2 1QJX3 1R091 1ZBE1 4FAHA 2XVLA 3E5UA 1C1LA 4P9IA 4CEYC 4QPIB 4AHXA 2PLV1 3R4UA 1H4HA 3VBHC 1ZREA 4IV3B 3SITA 5A32B 2ZGPA 2ZGSA 4XJZA 3IWZA 4M3CF 3USSA 1Z7S3 4LBMA 1VBD1 3H1YA 4Q4V1 2JXAA 5DZFA 1QJX2 5CA6A 2VY0A 1AL22 1MS4A 2ZGKA 3VBFA 1KJRA 5C8CB 4ISRA 5BXXA 2KM2A 2EVXA 2K2SA 4I01A 3NAPB 1IOAA 1ND2B 3VBUB 1LHUA 4H7MA 3FX3A 3VKNA 4Y1YA 2GNMA 2ZZJA 4INDA 4OZXA 1IPKA 1ND3C 5JAXA 1AUYA 4K40A 5DUVA 3JBG3 2FHRA 2JG8C 2P2KA 1S0IA 1RUH3 1CAVA 3POSA 3N36A 4I2OA 3M1HA 4NWWA 1YJKA 2UWCA 2GZWA 1Q8VA 2WNVC 4AQ2A 3VZMA 2XJRA 4FXKB 3O0VA 1ZZBA 3JBG2 4I02A 1HQNA 2RS51 1YI7A 2ATFA 2HWD2 2NMOA 1LB2A 4E2QA 2QQPA 4ZXKA 3WP4A 3AKTA 2WKKA 1OHFA 2QZ2A 2RJKA 2MEV1 4WZCA 5BNPC 5E88A 5L7OB 1TME3 1U0AA 2DFBA 1W6QA 4Y20B 1AZDA 2AUYA 1DGRA 2X5IB 2XKPA 2E7TA 1J59A 1XNCA 1NZCA 1MZ5A 2EIGA 5IK4A 4OI1A 4HSJA 3CEWA 4JDOA 2PTMA 2Q0AA 2H0VA 2JKBA 4RQPA 5A33B 1QQP3 1LGNA 3IN9A 1C5HA 1EP0A 1U5YA 1Q8QA 4C1XA 1RUJ2 3MI8A 4LT5A 4YW3A 4QPYA 2XLFA 1OSGA 3HR9A 1G9CA 1IQAA 3N3HA 1PVXA 1A8DA 1CONA 4GH4B 1WLDA 4MX3A 3S7EA 2GC3A 4C90A 2HYKA 5T54A 4BPZA 4B4RA 4XIOA 2DTWA 4COWA 2H6CA 3KMHA 1MQTC 5BNNA 3V0BB 3B3QE 4MVTA 4CEYA 3AYDA 1VBC3 5FO8B 3VBHA 2WFF2 2JICA 4IV1A 3AJYA 4XJ8A 1VRH1 1KS4A 1NE6A 1MS5A 3VDDC 3H3UA 1SQ4A 4Q26A 1ULDA 3OGJA 3AZZA 4PDWC 4N90A 2O8OA 2Z2SB 3CO2A 2VH9A 4I3PA 2BTVC 4E2SA 4UXAA 5TSWA 1C57A 1JHNA 4N53A 2OZ6A 2DFCA 3JQXA 4AEMA 1VBC2 4Q4W1 4K8FA 3AM2A 5AC93 4WVMA 1EAH3 3D4KA 4XTPA 3GHMA 4K21A 1W6PB 2D98A 4JDMA 4WM8B 2QUOA 2ZX4A 1BVVA 2ET1A 4S2GA 1VB4A 1QXJA 5AVPA 3S7IA 4LBLA 1YYNA 4K1ZA 3S6PA 1Q8OA 1Y3TA 2YMZA 5I0SA 1RHI2 1RUI1 4FXGB 4RSUA 2VNOA 5GZDA 4RL7A 4XMIA 2ES3A 4Q8LA 4FPJA 5AC92 1QWRA 4BM8A 4KWKA 1C8M3 1FX5A 1I6XA 1MS8A 4KBBA 1HX6A 4AF9A 4WVVA 2FQPA 4YZ5A 4AHZA 3BU7A 3THTA 3A4UA 5GKAC 1HLCA 4Y4YA 5EXOA 3BB6A 1B35A 5DG2A 4ES9A 3KB5A 1NCQB 4XYXA 1LTEA 1ZA4A 3AFKA 4BH9A 5ACA1 1NXD1 3WV6A 2PA7A 5BNPA 2DU0A 1LOFA 2NP0A 1BMV1 5FO7B 3HBZA 4LBQB 4BZ4A 5EYYA 4GIQA 1H1IA 4G9SB 1CAWB 1YIFA 1HXS1 3INAA 5I8SA 2XBO3 1DHKB 2UYAA 5JOWA 3GZUC 4Z2WA 1JH5A 4IEYA 1U5XA 2OPKA 4IEUA 4D7YA 1EV13 3JD73 5A3LA 1N1TA 1H8TB 1S0EA 3HWJA 5C4WC 3JZVA 1O4ZA 1COV1 3J4UH 1QJY1 4JAAA 2WNUC 1H2KA 4P5HA 3N7MA 1KITA 1NLSA 2Q5TA 3WVJA 3LA7A 5J7MA 1GANA 5J96B 1MVEA 3RJ2X 4GB32 4AI3A 1VBE1 4AW7A 3JD72 4WM7C 3ZXAC 2RR13 4QQPA 3MIEA 4COVA 4QMAA 4L92A 3B94A 1NCRC 2RS31 2AH2A 3VHOA 1DQ0A 1GLHA 3BPZA 2CL2A 1AYN2 4CEWC 1RUNA 1AVBA 1QJZA 3UKVA 3ZFEB 4ATEA 3MFAA 3HMYA 4ES8A 1ENQA 1RIRA 2RR12 4YW2A 1NY72 3M3EA 5F6LB 1QF3A 4DB5A 4HT1T 1JOJA 3ZFFB 5DDJ3 1DG6A 4XJUA 3WDYA 3N7JA 1MR5A 5GLVA 2ZGRA 5GZEA 4M3CB 4CDUB 1NQDA 5LK5A 4YM3A 4CDWB 1LRHA 4TYSA 1AR63 3ZSLA 1N3OA 1PGSA 4HFSA 4X8PA 3TWIA 1UIJA 3SCFA 1CIWA 1WMFA 1X33A 1PVC2 1R083 1KFUL 3RPQA 4XJAA 4AI1A 1ZBE3 4BQ1A 4MXVA 5FQ0B 5JVVA 2LUWA 3GZTB 1XYPA 4P9XA 1ZRFA 2NN8A 4W65A 2VUAA 3B9CA 1D2QA 2X8KA 1RUOA 3O5SA 3WDUA 2HKXA 1IHMA 2Z79A 4WBBA 4AFCA 3ETQA 4Q4V3 1PZ9A 4RHV3 2BWCA 2JEMA 1R082 2WT2A 1RVF1 1QH7A 4A3XA 3TNPB 1GZCA 1O7FA 3LSDA 1OPOA 3OYWA 1HRV3 5AFEA 2A70A 3KSCA 2F6BA 1QJU1 5LRSA 1ZZ9A 1IS6A 1CR7A 3AB0A 3ATGA 5JIUA 3CJXA 1LHNA 3FLRA 4CDQB 4M3CE 3ROUA 2DVFA 4RHV2 2ZX3A 4YVSA 3RYPA 5BNOC 2DCKA 1LOBA 1XNDA 1G86A 4JQRA 1HRV2 2JG9B 3VGIA 5JMCA 4Q4Y1 5C9AA 1QNWA 4JCKA 1RUF1 3ASIA 2VMHA 2ZHLA 2WNUA 1GQHA 1SFYA 1CAUA 3ALQA 1PGW1 2VOWA 4WM7A 5CVRA 5CADA 3VV1A 2AZ5A 3AYEA 3HT1A 1I5ZA 3T1LA 4PIXA 4GWNA 3I59A 3JQWA 2CGPA 1CVNA 5GLZA 3DUIA 1PHMA 5K0UC 5GLUA 4ONUA 1XYOA 4P9LA 2XJUA 1LULA 3NAPC 1OD5A 4Q0VA 4QGMA 1NQJA 1J3RA 3BCWA 4HANA 1RINA 4YG3A 1ND2C 4YZ1A 1PNFA 2DTYA 1GZWB 5HCAA 1AX2A 3DPRB 4LULA 3I7DA 1J1LA 4EN7B 3NO8A 3PJQA 3WZ1A 2CGOA 4YZ4A 3MW3A 4XF3A 1CN1A 3AP5A 1IPJA 3EXUA 3GBWA 3IMNA 3ECQA 1K5MA 3U0ZA 4C91A 4DOUA 1HV0A 1N47A 1O4TA 4H7LA 3ZN6B 1A3KA 4CDXB 4MUVA 1D4VB 3SMHA 3WQ1A 2R1DA 3VBSB 3WP5A 2FMYA 3OY8B 2WS91 3HQXA 4JV4A 1NE4A 3WR0A 2EXHA 5JSOA 3O14A 3POYA 1DYPA 2IWGB 3D0JA 1VRH3 1PM7A 3SCGA 5KHJA 3LA2A 1NA1B 3L2HA 1RUG1 1YRZA 3ZXDA 2R1BA 4EJRA 1BEV3 1YI9A 2VQAA 2VNRA 1UCXA 3IPVA 4W6YA 1AR91 3R4SA 4RR3A 2WSVA 3ZXLA 3SLIA 1FV3A 5CFDA 4AI8A 4QQLA 2CNAA 5I8YA 5T55A 4RS5B 4F83A 3E5QA 2N7GA 4XETA 4AQ6A 2A6VA 2VW1A 3WG1A 1BBT1 1LKNA 4U36A 1H9WA 1BEV2 1S0FA 1AJOA 5E89A 1ZRRA 4XHXA 1ASJ1 2HEYF 1WW7A 4Q4X2 4QPGA 2BYVE 1HRI2 4OULA 4FPGA 3H7YA 2I45A 4QPIA 3KGZA 4IV3A 5A32A 4ISQA 2QKDA 1F5FA 3KT4A 4QQOA 4OHZA 4MSVA 3ZYPA 1AYM1 3VZLA 2WZR2 2AREA 1PO21 4MGKE 1CX4A 5C8CA 5FBZA 3ZDSA 3NAPA 2RMU3 3E6BA 1HXS3 2ET7A 3MF6A 3M3QA 5J98B 1ND2A 3VBUA 1V6LA 1CESA 3ZSJA 5FOJB 5GJ6A 4PLOA 1ENRA 1EYBA 1G8WA 2VVEA 5JZGC 1OMIA 5J36A 2YPJA 1BYHA 1PGL2 1SMVA 4IERA 3O0WA 2RMU2 1COV3 1LHOA 1QJY3 4DZGA 1WW6A 3ZN4A 2VVDA 4YFZA 3PHMA 2QVSB 3FMGA 1UMZA 2R041 1GV9A 3DL3A 1S2BA 2UYBA 1VBE3 4TLFA 1V70A 4K9SA 4LE3A 1NCQC 1POV3 4P9WA 3FLTA 4LNVA 3QLQA 5KHKA 4PIYA 4AQTA 5L7OA 2JJ6A 1YXWA 4H3WA 2RS33 4Y20A 1LEDA 1IGOA 4D3WA 4XFFA 2FZ2A 4LBNA 2X5IA 4Q1RA 2YGMA 2ZMKA 3S0MA 4QHBA 2B7YA 3VZNA 2HWE2 2WZPP 5D8AB 3ZFGB 1LHWA 4J1WA 2VNGA 1U5IA 5A33A 2HWC1 1AR81 1SEFA 2IC1A 4CZSA 5CB7A 2BNMA 2C5DA 2WLQA 5J3UA 1H8TC 5K7PA 3DV8A 3WP3A 1GNHA 1V6IA 5FOBB 1CGPA 1RJ8A 1SLBA 3ILRA 1DZRA 2WWSA 3JUUA 4GH4A 4DNYA 3ZO0B 1SBFA 2RS12 3PVOA 4M0NA 3RMYA 4LLFA 2BW8A 1PO12 1IZ3A 2YHJA 3M8LA 3V0BA 2ZABA 2R072 1S55A 1S0JA 3O7OA 2PYTA 2I2SA 3BODA 1GSLA 4KQ7A 1TEIA 4R9DA 3RWNA 5FFOC 4IEPA 2B5HA 2TNFA 3MW2A 1W0PA 4F7ZA 3QOPA 2XLAA 1QDOA 2B9UA 1RVF3 1KQRA 5JPNB 4JGZB 4R4ZA 4M01A 4TSVA 1D0GA 4QM9A 3DKWA 4F3JA 1QJU3 2YYOA 5IK7A 4MLOA 4MV2A 4E9KA 1FOD2 1W6PA 1TMF1 4WM8A 5LEJA 2YV8A 3WD5A 4FAGA 3IIAA 2BBVA 1SCSA 1UPIA 1C5IA 3WXPA 5KWRA 4IETA 5JOYA 3BOPA 1UU6A 4CDWC 4XJWA 5JCTA 2XPJA 2JENA 4N7UA 1VBB2 3WCRA 1OOPC 1RTVA 3WG2A 5BNNC 5GZGA 5F9TA 2PHUA 3S30A 1DU3D 3PTYA 4KU7A 4META 2DUOA 4IV1C 2R49A 1FMD3 3ES1A 2Q1ZB 4HK9A 1W6NB 1JBCA 1JYIA 1NCQA 1KJLA 1Z78A 4N53C 4LBJA 4LO7A 2IXHA 5E8AA 2D6MA 2NQYA 4WZFA 4LBQA 4NHKA 5FO9B 1FMD2 2KXLA 1Z7S2 4GMP0 1DGRN 1YNAA 2EXJA 2A3XA 1CAWA 4LUMA 3QACA 4XF1A 4N43B 1R1A3 1RUC3 3H1MA 5DUWA 1N3QA 1HDKA 4FPKA 5ABJB 2B42B 2UWBA 1ZRDA 5GZCA 3UJQA 1H8TA 3ZMNA 4I30A 2O1QA 1DYKA 4J1XA 2LTNA 4Z07A 3WW3A 1PIV1 1FPN1 3TYJA 5DG1A 1B35C 2A7AA 4AQSA 2A71A 1C8NA 1R1A2 1RUC2 1RUH2 2VECA 2CAUA 1W6MB 5H9SA 1N1VA 4HMZA 3GZAA 1MEC1 1LOFC 2D5HA 2GMMA 5HXVA 1G7YA 1VR3A 1LCLA 2E7AA 2WS93 3ST7A 4N9HA 3JU9A 2EALA 1WD3A 4Q0UA 4XZPA 2AR6A 4HKWA 5BPXA 3R05A 3ZFEA 4AFAA 1MS1A 2GMPA 4Z82A 4BE3A 1OA3A 5JI7A 4MZUA 2YC0A 2JD4A 3LZZA 1TME2 2XJVA 4LA2A 2UWAA 1O3QA 3B93A 2YY1A 1H1AA 3B00A 3FFQA 3R4DB 3SHRA 3ZFFA 1V9U1 4XFCA 4HKOA 1F9KA 2GC0A 3KCCA 1KD7A 2A75A 4FPOB 4PBOA 2TEPA 1F5JA 3VZJA 4Y1VA 1QMJA 4HKLA 4XFBA 2G9FA 3M3IA 4M3CA 1QQP2 4CDUA 5KXBA 4NOTA 2R061 4CDWA 2ZGMA 3ZMOA 1OOPA 2VXRA 5LEKA 2ZBJA 1WBFA 2V5YA 3IM0A 2D6LX 1O5UA 1SFNA 1BJQA 4PJYA 3VBRB 2QDNA 1UIKA 3KD4A 1DLLA 5FQ0A 3CL1A 2GNDA 1ULEA 3U10A 1FXZA 2IXKA 3HIFA 4XJ9A 5BY5A 2A5ZA 1CJPA 3FBMA 3RJRA 5K8SA 3AXEA 5EZWA 1WD4A 3KS7A 4BLIA 2ERFA 2XKOA 1UF2C 1JXNA 3VKFC 4C0BA 5BV6A 3I54A 1ZBA1 2OUHA 2GMEA 1AR71 4RS5C 2JECA 4CDQA 1ZRCA 3AKQA 1D4M1 1N1SA 1REEA 2GH2A 1EAH2 4YNIA 2YROA 2P3JA 1O3SA 2JG9A 4R8HA 1I3HA 2HEWF 5T5LA 4COUA 1JYCA 3ZXEA 3WUDA 2GDFA 4GWMA 1WMDA 4FBFA 3IDCB 1FAYA 3H3ZA 1XNBA 4IEWA 3VBOB 4Q1PA 4YVWB 1C8M2 3TOJA 4IQPA 4KG8A 4I0WB 3TN93 3CJIB 3W58A 1VBA3 4KG0A 4FQZA 3OD4A 1F31A 2KA3A 1S2KA 1QY4A 2ZPXA 4RD7A 2BWAA 5C33A 1RUD1 4YVSC 3OJBA 5JDBA 4PLNA 1GZWA 3DPRA 1G9FA 1WW4A 2ZGNA 3MIBA 4RGAA 3RZZA 2HWC3 3AMHA 5H9RA 4AEDB 3TN92 4BLJA 3H0OA 4E4ZA 1VBA2 4BCUA 1TE1B 1AJKA 1O5LA 2PFWA 5C9AC 4FSJA 2XBO2 4J6GA 4I3GA 4GXLA 3NW4A 3IBMA 1XXNA 3ZX7A 3D8CA 4COYA 1RUE1 1LOAA 2OIIA 1OLRA 4YRDA 3ZN6A 1EV12 4EV0A 1PZ7A 4CDXA 3R6SA 1RMU1 2NPIA 3AZVA 4OFGA 2PHDA 1BQPA 1DQ6A 4URTA 3VBSA 2CV6A 3OY8A 2A6XA 4FPYA 1ULGA 1Q3EA 2IXJA 4CP0A 2E6VA 3AMQA 1XYNA 2D6NA 1NA1A 5I8TA 1LR5A 2P3KA 1C3HA 3WX5A 2ENRA 2Q4SA 2GN7A 3KZ4C 3MPBA 3ZFGC 4C0HA 2BNOA 4KU8A 3J8F1 2OVUA 4YLZA 5CU1A 5HCBA 2W39A 4P9GA 1TMF3 5CAZA 1K5MC 4RS5A 3WQ0A 2BQPA 2HWB1 2XGXA 4ASLA 3NV3A 5CFCB 2GALA 2X29A 1WBLA 3ES4A 4DMIA 4XE9A 2EAKA 5DDJ2 5FPZA 1LOEA 2P34A 5JOZA 1VALA 1YCIA 3QH6A 1R093 5KBFA 4UW6A 2QDRA 2IXIA 2ZGQA 2PLV3 3V0AB 3VZKA 1S1AA 4YFWA 1XE7A 3K51A 4YGDA 3VLBB 1WCKA 4AVAA 2C9AA 1QXRA 4FCAA 1AR62 1VBD3 1ZZ6A 5AFBA 3KGLA 3B5LB 4N9IA 2Z69A 1R092 3MGUA 1ZBE2 4RR3C 2ZX0A 5EFUA 2PLV2 3DGTA 3MLJA 1WLWA 4YG0A 5BNQA 5CFDC 5DUXA 4K7JA 3IT8A 2A3YA 3NV1A 1AX1A 1IKPA 3VUOA 3WW1A 1UD1A 1VBD2 3NWKA 4Q4V2 2ZKLA 3PMEA 4OVEA 3CF6E 1D2SA 1QOOA 2QNKA 3KCXA 3WOGA 4LO5B 1U5ZA 4LHLA 2WQ4A 2ZMNA 2WQZC 2RM21 1PMIA 4QPGC 1M06G 2HWF1 2SBAA 1HV1A 4AVTA 3OTFA 1CPNA 4QPIC 1ND3B 3RSJA 3ZYJB 3LOBA 1B09A 1PIV3 2OZJA 4IV3C 1A6CA 1FPN3 4HSLA 4XIKA 5CNAA 2JG8B 5EYXA 4MGZE