3T4HB

Crystal structure of alkb in complex with fe(iii) and n-oxalyl-s-(3-nitrobenzyl)-l-cysteine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
201
structure length
201
Chain Sequence
PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Dynamic combinatorial mass spectrometry leads to inhibitors of a 2-oxoglutarate-dependent nucleic Acid demethylase.
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3t4hB00
2FDFA 4QKFA 3O1UA 4NJ4A 4MG2A 4NIIA 4CXXA 3I3QA 3BUCA 3O1PA 4O7XA 3O1MA 3H8XA 4NIGA 3BIEA 2FDGA 4CXYA 3I3MA 4NPLA 3S57A 3RZGA 4IE4A 4IE6A 5F8PA 4NRQA 5DABA 2FDKA 4O61A 4ZHNA 3RZLA 3BTZA 4NIDA 3BTXA 3H8OA 4NPMA 3O1VA 4QHOA 2IUWA 4NROA 3I49A 4NRMA 3O1SA 4MGTA 4JHTA 3LFMA 3I2OA 4IDZA 3O1OA 4CXWA 2FD8A 4QKBA 4ZS2A 3T4HB 3BU0A 4NIHA 2FDJA 3KHBA 3BTYA 3RZJA 4ZS3A 4OCTA 3H8RA 3RZMA 2FDHA 2FDIA 3BKZA 3KHCA 4IE7A 3BI3A 4NRPA 3T3YA 4IE5A 3S5AA 3T4VA 4QKDA 3RZKA 3O1RA 3RZHA 4QKNA 3O1TA 4RFRB 4IE0A
chains in the Genus database with same CATH superfamily
4R9CA 3N36A 2VH9A 3B01A 2RE9A 1W6OB 3VBOA 4LA3A 1W0PA 2TEPA 1YI9A 3AFKA 4IEPA 5GJ6A 3ZR6A 1EV13 4D3WA 1OD5A 5TSWA 1FT9A 2BWAA 1ULDA 2EXHA 3OD0A 4UYBA 5FXXA 2TNFA 1OFNA 4FFIA 3MW2A 3D4KA 2QCSB 1OOPC 1XOYA 2EF6A 4D6RA 3H42B 1IQDC 2ZCWA 1O4TA 3U4SA 3CZUA 3EB7A 4A2UA 4DXSA 4A4AA 1AUYA 2E9QA 2ZXQA 3KVBA 4LKDA 1VR3A 4YW7A 5EQUA 3GBGA 5L9VA 1PZ9A 3AZZA 3W21A 3HEIA 1JODA 2GC3A 2JDZA 1F31A 1RUH1 3K75B 3Q8BA 2DTWA 4XXAA 2X05A 4AEMA 5HBAA 3S0MA 5BNOB 2PTMA 4NOTA 5C70A 1VAVA 1NKGA 3VDCA 1KJLA 3ZFEA 4BLJA 4AVSA 4QX1A 4A42A 1KDMA 4JKMA 4FPOB 1T6GC 2W94A 3N9NA 3AXEA 5T3NA 4OFGA 2AYHA 1GP4A 3POWA 4WZFA 3K48A 3ZXLA 5IWFA 3QH6A 4FXKB 2F4LA 2W5FA 1VBA2 5IVFA 3ZN4A 5HXVA 4XUTA 2KR2A 1J1TA 2RM22 1IS3A 5CIRA 1SPPA 3KT7A 4AHYA 1YXWA 3AP7A 2E32A 3Q8AA 1HV0A 4MLOA 2VCAA 3LA3A 4OVEA 3GDBA 2AH2A 2PAEA 5JSOA 4XFIA 1QJU3 4HT1T 3FL7A 4HONA 1S2BA 4UW5A 5HV0A 1Y9QA 2ZBJA 3CMGA 3PUQA 5C8CA 4FPHA 3PU8A 2AZ5A 3M8LA 4QXKA 3SCGA 2XOMA 4MHUA 2A6YA 5FDBA 1W2AX 5EYYA 1X9PA 3NMBA 5J48A 3WW3A 5FPLA 5C9AB 3VB9A 3UKNA 4R4XA 1RITA 3ZYRA 2ZMLA 1BCXA 3WF0A 1SLCA 1REFA 4QXHA 1B35A 3VKOA 3LFIA 2YFZA 4CCEA 4LO8A 1JS9A 2VOVA 1UZVA 1HDKA 1AJOA 3D0SA 4E4ZA 3P6BA 4P9JA 5K0UB 5F3IA 3SNMA 1S55A 2A71A 4Y20A 2W3JA 4BXSV 3J4UH 3VZOA 1K45A 4M3CA 2CGOA 5E89A 4AEDC 2F4PA 2DBIA 3JBG3 1GWKA 3SQOA 2JICA 1L7RA 4ZXKA 5I0DA 4XJAA 1E5RA 2I2SA 4M0NA 2W9XA 1RUI2 3FX3A 5EJ1B 3UV9A 3E5XA 3RPQA 5EZWA 4Q1RA 1QJX1 1S0IA 2QQNA 1MACA 2QQKA 2VQTA 4CCKA 3PTRB 4WVMB 1TME3 3CQOA 4CCMA 3OBAA 4RFRB 5DQ0A 1AR82 3H3LA 5LA9A 4COZA 5JPNB 2CGNA 3OF1A 4CCCA 2CV6A 2QQIA 2QQOA 3ACGA 2RDQA 5L7OA 5GKAC 2VQ0A 5A3LA 1UOBA 3WOGA 4DUXA 5FY8A 2RV9A 2J7MA 2A1XA 2FCVA 4FFGA 5A7WA 4CXXA 4CP2A 1C3HA 3VD4A 3BIWE 3SH3A 3BUCA 1APNA 4GWJA 5EIYB 4YW5A 1MZEA 4XAAA 5F7UA 3A4UA 4WM7A 1JZ8A 1IS4A 3ES1A 2VMCA 1C57A 1V6LA 3PTYA 5K4LA 4CEWC 1YIFA 5I0RA 1BEV3 2OPKA 4IEXA 4DY3A 1VBD1 2A70A 4JGYA 4ISRA 3V65A 5F3CA 3UESA 3M3EA 3I3MA 5GZCA 4H2AA 1H8TB 2Y38A 3RJRA 1JHNA 2QQVA 5JI9A 4L92A 1ENXA 1J83A 3AXDA 4XCAA 4Q4X3 3KM5A 5FTTC 1FPN1 1AX1A 3M4FA 1JU4A 2WS91 1AVBA 4QAWA 4QX8A 5LWBA 1VAMA 1G6NA 5A3OA 4K40A 1C1FA 5B4XA 4M4RA 2JG9B 3T2OA 2Q5TA 1VBB3 4NRQA 3JXSA 2I07B 4UWDA 1W0NA 2RMU1 2PA7A 3MHZA 2ZHLA 4QX2A 3IB3A 1QXRA 1ND2B 2VZSA 2I45A 1UW8A 4EN0A 3PUAA 4S2FA 4C0HA 1X82A 2LS6A 1RUC2 2FQPA 3SCFA 4I3PA 1NCQA 1TMF2 2JJ6A 5F5QA 2CU5A 1PK6B 4SLIA 4LE3A 2PHWA 4LO4B 2D6KA 1GU3A 2QQUA 1F35A 5DZGA 5JZGA 2YGMA 3IMMA 1XJAA 2A3XA 1S0DA 2ZPXA 2LRPA 3F95A 5GLZA 3VBFC 5CFDC 4YVWB 2OPWA 4B1MA 1TVGA 3LFMA 5IK5A 1LEMA 2YU1A 2ZX2A 5J09A 1W2NA 1LHWA 1UZWA 1F8VA 3I59B 3NRUA 4QKBA 1RGSA 1DQ4A 2O0OA 2BNNA 3T4HB 4UI9L 3V64A 1UYPA 4HK9A 1AXKA 2Q1ZB 1FATA 4UW6A 2CL2A 1ZRIA 1QHDA 4GJYA 3WNKA 4AHXA 1YIPA 1ZBE1 2LW8A 1OHFA 1NCRB 4RL7A 2ZAAA 4CDXC 2A3YA 1CVNA 2VO5A 1NXMA 3LPGA 3VBSC 4YZ2A 1HQNA 3OJBA 4FXGB 5FV3A 2GAUA 1SZBA 3INAA 4H3WA 4YGBA 5DAWA 4AVVA 3BI3A 1YC61 4ASMB 2WNUB 3I54A 3IZOA 4FO9A 3VLBB 1RUG2 5F1RA 2BERA 3LDRA 1J58A 3THCA 1ZVFA 4M4PA 3N35A 3OB8A 2R071 4TLFA 4IE5A 5JMOA 2FCUA 1DBNA 2PHDA 1URXA 3D5OA 4I09A 1NX9A 1N3QA 1CONA 3WP6A 2BYVE 5H9PA 5I0TA 3EBRA 1VJ2A 4FVVA 1PIV2 2PMWB 4HVOA 3PNAA 4XFBA 1SG3A 3T2TA 5FZLA 3JUUA 4BQ4A 4XF4A 1XYPA 4GWNA 5C4WB 2G1MA 4RQPB 3HQUA 1OQEA 4BA6A 1JYWA 1AR92 1CX4A 1V9U2 2OXBA 2PLV3 5DUUA 1OVPA 1VALA 4QWNA 5IJRA 3P3PA 4CE8A 4ORFA 3USSA 3GNEA 4AI1A 1YNAA 1R1A3 2XJVA 5FZOA 5FCCA 2XGXA 3QD6A 1O3RA 4FQ4A 2CWMA 2PHTA 3POFA 4DB5A 3TOJA 1UOFA 1UMZA 4QHZA 4YVSC 1VBA3 1COV2 2EALA 1IPJA 2C9KA 3OPWA 4CA9A 5M0TA 1O6UA 4EWDA 2ET7A 2EIEA 4FTSA 3ZXJA 1NLRA 3NJVA 3ZYIB 4BM8A 3I3BA 3AKSA 4Y24A 2DU0A 1DLCA 2VBPA 2ZX3A 3OY8A 2BZDA 4GB32 1S0FA 2Y6LA 4I0BA 4XQ4A 3UT0A 1ZRRA 5BNNA 3TEYA 1NA1A 4BXFA 3DXUA 1C5HA 4BQ1A 4H7MA 3C7EA 3ZFFB 1FOD3 2OUJA 4OZXA 1W8ZA 4Q0VA 5F6KA 2P2KA 3DF0A 3VD9A 3CL1A 3BTZA 1QJY3 1PMHX 2NLRA 2EIGA 2WIIB 4TLGA 5GLTA 4OUEA 4JGZA 5I8TA 1H4HA 4N53C 3AVSA 3BN6A 5C71A 4XABA 1LHUA 4YZ1A 5ACA1 3URFA 1OSGA 2DFBA 4XIOA 3FN9A 4Y1UA 1AYN1 1RUF1 1EY2A 2F6BA 4G9SB 2HKXA 4K9SA 5FMOL 4B1LA 3N9PA 5BNPC 1IZ3A 1S0EA 3USUA 2YXSA 3DEMA 4XACA 1POQA 2OUHA 1O4ZA 2ZEXA 3MLKA 4NWWA 1AR72 4D6QA 4Z2WA 1OH3A 2AREA 4JZRA 5G04L 3H1MA 3OBTA 5LY2A 1RVF2 5CKNA 3HNBM 5I0UA 3UNPA 1S0BA 1DGLA 1KQRA 2YGLA 2Y6HA 1AYM2 3HQXA 4IEQA 1HKDA 2JDUA 3BYWA 5CEHA 1W6OA 3HPNA 3LA7A 4C91A 1RUI3 5FMCA 3K4ZA 1Z78A 1VBC2 4QX5A 1YRZA 5IAVA 4LO6B 4COYA 5IATA 1MEC1 1MS8A 2I74A 1W2OA 5EJ3A 2W1SA 4L99A 1STMA 3O0XA 3FHQA 1JZ3A 3T0AA 2XR4A 2RS52 2YYOA 4RHV2 1P8JA 3LZZA 5C3SA 1GZCA 2V09A 5GZEA 5A3NA 5FJHA 4QPIB 2JEMA 3D0JA 1OQDA 4WM8B 2C9AA 5CB7A 4PQQA 1H2KA 2VZRA 4E27A 1JZ7A 1PVC1 5EXOA 2DVAA 3MW4A 5BNOA 2HBUA 4J1WA 5DAPA 4OQ9A 1PGW1 4AVTA 5LBBA 5JR7B 4P14A 2VAUA 5LATA 4AR2A 5JSPA 1KEXA 2DCKA 4XURA 3B5LB 1HQLA 1D4M3 1OKOA 3I2DA 2WO3A 4K8FA 4NIIA 3JD71 4NHXA 1YUDA 2W47A 4QPGC 3VBRB 4Y22B 1RYYA 2VUJA 4UF0B 5LA0A 1H1AA 4Y3OA 1QXJA 4JDMA 2PHUA 1VRH2 1US2A 1MS0A 4K1ZA 2P17A 5A6ZA 2YBKA 1IG3A 3ECQA 2OYZA 1JW6A 3HQRA 3J7NA 1G9AA 1US3A 2MEV1 3R4DB 1A3KA 4FPCA 1Y9GA 3O12A 4Y5TA 3WSOA 4EN8B 1N1VA 1OLRA 4FOVA 5DZEA 3VZKA 4CCNA 3PVEA 2HLEA 1RUC3 3RDIA 1UD1A 3T1LA 1RINA 3U1XA 3GGLA 3TNQA 3UJOA 2WO1A 1AXZA 3RZZA 1YQ6A 4BCUA 5I91A 1ZBA1 1K42A 1VBD2 2PQQA 5KHIA 2ERFA 1W39A 1S2KA 3BOPA 3H3ZA 1B35B 4XIKA 5F8PA 5FO8B 5E88A 5FFOC 3WQBA 4EWEA 1CZSA 3SISA 1LJ7A 2X10A 1ENQA 5C9AA 2IZWA 4WZCA 2JIJA 3NNMA 3AC0A 1KXGA 4G3YC 1FPN2 4LO5B 1ASJ1 2Q8DA 3TEXA 3O0VA 3WD5A 5C3PA 4QQPA 2XDVA 2D3RA 4LE4A 5ERLA 2XL7A 1HN1A 3LCPA 2ORXA 2HWB1 3PVOA 4EJRA 5EP9A 4CP1A 3MUY1 2Q30A 1O3TA 5K0UA 4E2GA 3NV4A 1R081 2ZEWA 3VHRA 1C1LA 2R1BA 4URTA 1W8FA 3BPSA 4KNCA 5FY7A 4AI9A 5JCTA 4AYUA 3OSDA 3M3QA 3CJIB 5BY5A 4QXBA 4FPLA 4AQSA 1XNAA 2GMEA 3MICA 3PDQA 4XHBA 2FMYA 4UOJA 5A7PA 4CP9B 1KS4A 1JN2P 2DCJA 3BODA 4ZY9A 5FZDA 4OHVA 3W5MA 5IK8A 2FZ1A 2J1TA 2GP5A 2FD8A 5KHHA 4QU1A 4AEJA 2RS31 1W8HA 4JHZA 4MADA 5FUNA 4WVMA 1HB2A 4NMIA 3WNMA 1YQ5A 2HJIA 2DVFA 1AR61 1HN0A 5CAZA 4XUPA 2WAOA 3KF3A 4QDSA 2XQXA 1HXS2 2G19A 1RXFA 2XJTA 1HRV1 3K77A 4MV2A 3ZFFC 4CDWC 2JWPA 5FYHA 5FXVA 2OKXA 4CU6A 4ZZ8A 2PAMA 4CYDA 3QOPA 1OF3A 1PZ8A 5T54A 4ZS3A 4OCTA 3BCWA 3U14A 1X8MA 4B7KA 2E53A 4R9AA 3OBZA 5F6LB 4AFAA 5FYZA 4B4QA 1DU3D 5AC92 3H1YA 1NZCA 1XU2A 1VIWB 1AR93 1V9U3 3ME2A 5EJZB 3AM2A 4XJZA 1C8NA 5FYIA 2OZ6A 2XVKA 3NO8A 1H8TA 5DN2A 3CNAA 1RMU1 3W9AA 1ULOA 3APBA 4IV3A 1K5MB 4YW3A 4OI4A 3WNNA 5HI0A 2WYFA 1EAH1 1GWLA 2GMPA 3MO4A 3RNSA 3LOBA 1L3JA 1OFSA 1QJY1 3PJYA 2RG4A 3LEIA 3HBZA 5EV7A 2JG9A 4JKKA 1COV3 5E8AA 4QM9A 1U0AA 2IVJA 4W4ZA 3WDXA 2VXRA 1MQTB 1ND2A 2WWSA 2VNRA 4Q4Y3 5KXBA 1HB3A 2GNBA 3EXUA 3G7DA 4QX7A 4WV8A 4GB33 2VW1A 3BU7A 2BP6A 4O7XA 1Y4WA 4TN7A 3THTA 4CDQB 5FXWA 1PK6A 3RRDA 2DYCA 2JDHA 1VPHA 2NZ9A 4GH4B 4UBGA 1C8M1 4K21A 3ZFEC 3I2HA 5FYCA 4X8PA 3MBWA 2HEVF 3CKHA 4P9LA 1E57A 4PLOA 1FMD3 4DS0A 4YW1A 4YVWA 2YFUA 2XH6A 3S57A 2WQ8A 5CKQA 3DN7A 5FZEA 3AYCA 2CDPA 3I59A 2R063 4HMZA 5J36A 1HV1A 4IGPA 1CAVB 4C8DA 3WG1A 1SDWA 1WUVA 3C7OA 1DGWA 2HWC1 3KB5A 1VB4A 2WLPA 4OI2A 1IPKA 2VVFA 5FZ9A 3VBRC 5IVVA 1AR73 4FAGA 3OGJA 1QQP1 1L7LA 5CVRA 1NCRA 1RVF3 1SFNA 1RC6A 5FYUA 1AZDA 1E5IA 1GBGA 4Q4V3 4XFHA 4FOWA 1QNYA 2CYFA 1CJDA 2ZGMA 4UFJA 5FPAA 1AYM3 1BYHA 2ES3A 1ENRA 2ZX4A 1WD4A 3BB6A 3KCYA 2JDAA 3C8XA 2D5HA 3WQ0A 5C8CC 5JIUA 2GP3A 2UWAA 2WNUA 2XBO2 2P5BA 4LIVA 5A7OA 3ELNA 3ZSJA 1D4M1 2D6OX 5JPMB 1BBT1 1CX1A 1XPWA 2HWE3 2QDNA 2RJKA 2WKKA 3AP5A 4CTEA 2G9FA 3A23A 2RS53 4RHV3 4BQ5A 3KV4A 2ZEYA 3VL9A 4F3JA 1AYN2 4MGYE 1O3SA 1B35C 4CDUB 5EYXA 3WQ1A 4FAHA 1QDCA 2GC0A 2R041 4C0BA 3TAYA 2RS11 5LA2A 2QKDA 5HXMA 1GSLA 5C4WA 5DG2A 3QLQA 3HMYA 4RQPA 2D40A 1FAYA 3K4AA 3SXWA 5KHKA 2P3YA 5A3PA 5IFPA 2VVDA 3RZJA 4A6OA 1WCKA 3K46A 2QE3A 2X53S 1AXYA 2VOKA 5A3TA 3DPRB 3ZMOA 5JUVA 3A0KA 2QZ3A 3RMXA 2R0HA 3A0NA 4KU7A 4YRDA 1YI7A 2Y6FA 3J8F3 1GNYA 4HPKB 4LK7A 4LK6A 4D7YA 2CAUA 3I2KA 4XMIA 1GOGA 3M2MA 4ZU5A 4AE2A 3KSCA 4YFZA 4KMQA 5T5OA 1W05A 1HX6A 2D93A 3OY8B 3FJSA 1A34A 5ISLA 4V2WA 3IMNA 4D69A 1YLLA 3VKNA 5L7OC 4NN0A 1EUUA 4AGVA 1IS5A 2FMDA 4QT6A 3LB9A 3Q8EA 3UL2A 1PM4A 4A6SA 5C33A 4QKFA 1GYKA 4GULA 4Q4W1 4QPWA 3WUCA 4AI0A 1PVC2 3GZAA 1PO12 4BLIA 3ZXFA 2E26A 2QQJA 1ULCA 4PIXA 4WM7C 5DUWA 5L9RA 3ZFFA 3ZM8A 2RR13 3ASIA 3FFZA 1H1MA 4PJYA 3IIAA 4FFFA 5CZKA 1UKRA 1QH6A 4JGYC 3WF2A 4NHYA 3NV1A 3ZXAC 4Z1VA 3O1PA 4ES9A 1WW7A 3GF6A 1H1IA 3R05A 4QGNA 4JRLA 5B2GB 2XPJA 4FP3A 1OMIA 2D43A 2VTXJ 4CU8A 1G7YA 3T2QA 4Q1PA 5KBFA 3BIEA 1RUJ3 5DUVA 1SLLA 1UU6A 5FOJB 4QU2A 4BZ4A 2VPVA 4S2HA 1GNHA 1S0CA 4GJZA 1A6CA 1OURA 1UMHA 2MEV2 4OMDA 4RGGA 3RG0A 2W87A 2KA3A 4LKFA 3B02A 1WCSA 4KI5M 5IUQA 4IEVA 3K3OA 5KXDA 1W9TA 1DFQA 1WCQA 1OLME 4DZGA 5EWSA 2GN7A 1HB1A 2EIBA 3WP5A 1EPWA 1NCQC 2JDKA 3C7HA 4RFT0 5CBLA 3PIGA 1CJPA 2NN8A 3ENRA 2XJRA 4L0PA 4QB1A 2VMIA 4LQRA 2ARBA 4PLNA 2HWD1 4HANA 2WZR1 3RVHA 5JZGC 1W0OA 1W8OA 2W1WA 5J96B 1YQCA 2HWF1 2YPDA 4XUNA 4JRAA 3UK9A 5J3UA 4KL1A 3PLQA 3UGHA 2IC1A 4ISQA 1ASJ2 3CIHA 5JAXA 4XOGA 3WW1A 3O1VA 4BQXA 1SLBA 5F5AA 3U10A 4LKEA 4QHOA 2IUWA 4QPIA 5JI7A 4WM8A 2NP0A 5CADA 4GZ9A 1XQNA 1QKQA 1R082 4K1YA 4LLFA 1W06A 1XSRA 1MPXA 1H2NA 2BTVC 3UJQA 5LEJA 3TN93 2E51A 4N7UA 4XUOA 5AC93 3T08A 4S2GA 4ZS2A 2PYTA 4IERA 3LSDA 2RDRA 4LEJA 4JTOA 3V0AB 1RUOA 2CGPA 4Y4RA 3IKWA 3GALA 4K8RB 5FWJA 3HWJA 1HQWA 3DYMA 3KMHA 5FZFA 4OHZA 1X33A 1SBDA 5FP4A 4JKLA 2ZMKA 3DECA 2H0VA 2Z2SB 2C0ZA 4DY5A 1DIWA 3OGVA 3D6EA 3VBRA 2RS32 3I2FA 2VC9A 1RUE2 4CVUA 4Y22A 4DUVA 2ZKLA 4UF0A 3DKWA 5JXHA 3JZVA 3ZSEA 4CPBD 5FLJA 1O5UA 2VZTA 1HRV2 2MNGA 4N9HA 5C3RA 1AL21 2JB4A 2P37A 4RD7A 1HLCA 1QF3A 3AFGA 3T0BA 4NHLA 4QDQA 2NM1A 1R091 2ZGUA 3VGIA 1RXGA 3S5QA 2NMOA 3IAQA 5A1AA 3FBYA 4CU7A 2VCMA 4Q2FA 3NJYA 5AFBA 1NYWA 4OHWA 2BJSA 2G9ZA 4YGCA 1WMXA 3TBDA 3T2PA 1GZTA 4PBPA 2D3SA 4QXCA 3VHOA 4E4DX 3MYXA 3PUHA 4HN0A 1J3QA 3BGAA 4DEQA 2FDFA 1QMJA 1PNGA 5GZFA 1XBFA 4DMIA 3LE0A 1RMU2 1W8WA 3IDAA 2QJVA 5IVBA 3OPZA 4GWMA 1V6MA 2W91A 2WDBA 4J25A 4KU8A 5GLWA 3GHNA 1EAH2 3J26N 4Y4YA 1W04A 3N3HA 1PO21 4IV1B 2JG8B 2R7EB 4LHKA 4DFSA 1DGWX 3I2GA 5F3EA 3ZIXA 1GZWB 1LR5A 3LEGA 3POEA 5LBFA 2VW2A 4E8DA 2RHPA 1I1EA 5FZAA 4XBLA 3FHAA 2XJUA 4MYEA 1LGBA 4FPKA 4E4SA 2JE7A 2VNGA 4CUBA 1VP6A 3K4DA 3CJIA 4BH9A 5A7SA 4YW4A 4CEYB 5LY1A 5ABJB 4CP9A 1LRHA 5KHJA 4COVA 5BNNC 4WVVA 1ND3B 3A22A 3NNLA 3VBUB 1NA1C 4IE4A 1QU0A 4KWUA 1POV1 4FP2A 3LQCA 4FOQA 1XE7A 1FNYA 3NV3A 4J1XA 1W3XA 4EV0A 4Q0SA 4Q5OA 4Q26A 5CYYA 4JGZC 5EHDA 4GALA 1Y9MA 1VBE2 4GXLA 3F2ZA 4O65A 1BLZA 2J1RA 3W20A 3H7JA 2AR6A 3RWKX 4NIDA 4RS5B 3BTXA 2HWC2 1W8TA 1PMJX 2A75A 5DDJ2 1UY2A 2Z69A 4EZHA 1PMIA 4YZ3A 3SEPA 3IN9A 4YW6A 1OLQA 5IVYA 4TTGA 5LBEA 4X8NA 4IV3B 1D0HA 1QQP2 3J7HA 5IAXA 4Q0QA 2WNEA 3KF5A 1XSQA 4AAXA 1QGLA 1WW5A 4N43B 3OD4A 4XVHA 4ZPIA 3LDBA 3RFRA 2C26A 5E6HA 3VDDB 3TYJA 2C4XA 3I2OA 2B9VA 4Y1VA 1GP5A 5IVJA 4XQWA 1K5MA 5A3MA 1FXZA 3QH7A 1LODA 5FYBA 3HOBA 3LOIA 2A6VA 5FRAA 3FC0A 4LBMA 4BQ2A 1UY0A 5FR3A 3BTAA 1RUD2 3E5QA 2A73B 1S1AA 4UT5A 4E8CA 3POYA 2ARAA 4FTEA 2PHRA 2QUOA 2UURA 4PDWB 3ETPA 2EICA 4EROA 2UWCA 2ZGTA 3SKJE 1MQTA 4NR1A 2ET1A 2B4KA 1RUJ1 4GIQA 4J6GA 4COUA 1HRI2 4DINB 2WFF1 1TEIA 2RS12 4LBQB 5FK7A 5GZDA 3WUDA 2QTWB 1MZ6A 1Z7S1 5A3UA 3C3VA 3WX5A 2W1UA 4OLLA 2E6VA 1W9FA 2J1VA 3POBA 2DDUA 4CDQA 1PO13 1NLSA 3A7QA 3HN3A 5BNOC 2PN5A 3FE5A 5JXIA 4GH4A 1EV11 4Y1XA 2GU9A 3I2JA 2VZOA 1CN1A 5F9TA 4BMBA 5L19A 5LK7B 2QZ2A 3ACFA 5A1FA 3I4IA 3N9LA 4DXTA 5C3QA 1ZRCA 4BK5A 5FBJA 4XILA 4FPGA 5IFTA 3U4XA 1JU3A 1S2EA 1RHI2 1H8VA 3OPTA 5AVAA 3PJQA 3WG2A 1JYVA 2AGSA 3FLRA 1LOFA 3NSTA 1LENA 5I0SA 4JTNA 1CAVA 1KS5A 2WSUA 5FZ7A 2VL4A 4NJ4A 3T1MA 4HK8A 3VUOA 3R6SA 3ETQA 3ZFGB 2XLAA 3VN4A 4YWAA 4Y1YA 2BVVA 2R32A 4OHYA 2Q4SA 1NY71 2V73A 2NPIA 4Q4W2 4RGAA 4K7JA 5F5IA 5CG8A 4ARXA 1JYCA 1LESA 5HV4A 3M3OA 4N9IA 4I0AA 3N7MA 4KQ7A 1C28A 1UL9A 2YBPA 4H7LA 1CAUB 5KXCA 2ZGSA 1BXHA 3IDEA 3LGRA 1KRIA 5A3WA 1WBLA 1PGSA 2OZJA 2H6CA 5D21A 5A6XA 4K3UA 4XC9A 2VXJA 2JB8A 1N1YA 4Z8BA 1B09A 3WNXA 1SMVA 5C9AC 3U0ZA 4XTPA 4LBKA 4LULA 1W9YA 4CDUA 1UU4A 2WZ8A 1JOJA 3ZKUA 3M1HA 4XJUA 3JQWA 1QJU1 2WNVB 2A6XA 4F83A 5K0UC 2YROA 4AQ2A 3VL8A 2ARXA 1WCDJ 1XNBA 4ZHNA 4MH0E 1XU1A 4MUVA 1CAXB 3MIHA 5IW0A 5JMCA 3OGGA 3DPRA 1TZOA 4MGQA 3ZYHA 2JDPA 1V00A 1F5FA 2DCZA 4MXVA 1XYNA 2RM23 3KQ4B 1ZYBA 2IXKA 4HPKA 1LGNA 3VKMA 1LECA 4PI2A 5CISA 1YFXA 1CPNA 1NG0A 2WZR2 3ILFA 4HVRA 4BHPA 5FP3A 4ZZ5A 2HWF2 1RUE3 4M3CE 4AFDA 2XKOA 3KT1A 4UBHA 5FIXA 5FPBA 2VZQA 3B69A 1RUH2 2VTXA 1EUTA 2DFCA 1S0JA 2VU9A 3RMYA 3RS6A 1M4WA 3WF3A 2K0GA 4JCKA 4U36A 1UXXX 3NNFA 4QQ2A 2GALA 3GBWA 3VKFC 3WF4A 2Q1MA 3JBG1 1WLCA 3ZDSA 3DXTA 2ID4A 2C1FA 4P9YA 5E1RA 3LIHA 3TEZA 3KQRA 2B45X 2SBAA 4XDPA 1CAWB 3E97A 4UFLA 4E9KA 2XB6C 2JECA 4AVAA 4N90A 2J1EA 3WCRA 1LAJA 1TME1 5IVCA 1W9SA 3E1F1 4HN1A 1H8TC 2PHFA 3BKZA 4L9BA 1VLNA 3DUIA 3RWNA 4IV3C 1GOHA 3B9IA 4Q0PA 4QQOA 3PU3A 3B00A 4A3ZA 2C6SA 1JOPA 2P3IA 2WT1A 2X5IB 1PVXA 2GSYA 2JG9C 4QX3A 1V70A 3HVDA 3OYWB 2DU1A 4QPYA 4XBQA 4AVCA 1R092 4MHRA 2UY9A 4INDA 5BUVA 3GM8A 1O7FA 2WZPP 1ND2C 1IS6A 1BEV1 2VCCA 1F5JA 1LOGA 2EIDA 3GXUA 2VG9A 4FPEA 4XF3A 5LASA 3WW2A 4OQ8A 4UFMA 3O14A 3ZXKA 2VZ3A 1Q43A 4MGZE 1AR83 1PK6C 4X6RB 3AP6A 4Y1ZA 3M70A 4LNVA 5GALA 4Q4X1 3N9MA 2K46A 1TE1B 4A7KA 4A45A 2FCTA 4N7IA 5DG1A 3H8XA 2HYXA 2VOXA 2XMLA 3T30A 4GMP3 4FQZA 4YVWC 1VBB1 4YPJA 4NIGA 1SDDB 5FY0A 2Q8EA 4P9GA 1VBE3 2RDNA 4BYYA 5BNQA 5FZ4A 2Z4FA 4B4PA 1RTVA 3VZNA 2XWJB 4ZXEA 1DHKB 2ETEA 3WDTA 4CRQA 5DDJ3 4XCBA 1KJRA 4IE6A 4L2NA 4LTAA 4PQ9A 2BFUL 1W90A 1RL3A 1WLTA 1QJX2 4XXPA 5IYYA 4B3NA 3V0AA 4IEUA 5KC5A 4ATFA 1NCRC 1WBFA 2KM2A 3ZFGC 2XVLA 2YBSA 3OCPA 5FPVA 4GMP0 2GH2A 5DABA 5A7NA 3OTFA 3ACLA 4E4HA 1SLIA 5CFCB 3MUZ1 2XLGA 3U11A 1W8NA 2GMMA 5BXXA 2WNUC 1U5IA 5FY9A 3MIBA 1RUD3 1Q8QA 2Y33A 1CD3G 2WZEA 5FY5A 4PCRA 3AZVA 4U2AA 5A1LA 1XE0A 1TMF3 3VD5A 2OT7A 5IVEA 3D3AA 2BNMA 2QNKA 1RJ8A 4XHXA 4LORA 3UGGA 1H4GA 1O8PA 1CWPA 2ZEZA 4LJHA 4DO0A 4LUKA 2EVXA 2QQWA 5C4WC 4RQPC 5CA6A 4BPZA 1ZZ9A 3WEZA 3S30A 3VZMA 4Y33A 3POSA 3T0DA 5FAXA 2WS92 4TYSA 2J1SA 2LTNA 4GKYA 4W6WA 1OT5A 1ZA4A 3BU0A 1M06G 3ACHA 1R1ZA 4UW4A 3CF6E 1EP0A 1REDA 2XQRA 4NUBA 4S2DA 2VUCA 2P6CA 4HKOA 2RMU2 4IL7A 3B3QE 4LR4A 2XJSA 2NYYA 4IV1A 1ODMA 2JG8A 1RHI3 4QDRA 3ZXDA 4AI3A 1GANA 1QWRA 4LA2A 4AZZA 3NAPB 1GZWA 2AEZA 4RSUA 1JH5A 4D7TA 1CGPA 1DZTA 2OQ6A 1WA4A 3ROUA 1Q3EA 1UCXA 2ZGPA 1AL0G 4IQPA 2B7YA 5T50A 5FPXA 3MZHA 2PLV1 3D82A 3VBHB 1WW4A 2W68A 3J7LA 4RR3B 4CEYA 4JX0A 5A33B 5ABJA 4DNYA 1F4HA 2ZS6B 3E6CC 5H9SA 3T4VA 1RUG3 1E5HA 2DCYA 4AQ6A 3KV6A 1ND3A 1OA4A 3VBUA 1QJFA 5FUIA 1R1A1 2WC2A 4IEZA 1WA6X 2JD4A 3EO6A 3DYPA 3W5NA 2P4EA 3O1UA 1A78A 2IWGB 3W59A 1VBA1 4YNIA 5A32B 2GN3A 1PIV3 2BFUS 3NJZA 1UPSA 1ZZCA 2RM21 1SQ4A 1SCSA 3AL5A 3MGUA 1FX5A 1JHJA 1XRUA 1ZBE2 3HNMA 1NUKA 3KZ4C 5BPXA 3PMSA 4RS5A 2XL9A 2LM3A 2ZGNA 4PF1A 4K20A 4BU2A 2VOWA 4GWIA 2DV9A 1G8WA 2GNDA 5DAQA 4W6XA 2YDEA 1UYYA 5L73A 1SHWB 2FDGA 1WZXA 4YSFA 4FSJA 2BRTA 1FOD1 1NY72 3THDA 4NE9A 4N43A 1A8MA 1BMV1 1OC1A 4IEOA 4WBBA 4PF5A 3WDWA 5LRSA 3WHUA 2ORZA 2YZ4A 3VDDA 2R072 4LOSA 2JENA 4KG0A 4BE3A 5JOXA 1NXD1 3JB8A 3IAPA 5T5JA 4XFCA 2CSGA 3J9SA 2ZHNA 5T52A 4CCOA 5JLVA 3AYEA 2VMEA 2BUKA 4PDWA 1WMEA 2VOTA 3HJRA 3P5BA 3ZOIA 1RUH3 2IFWA 3AYDA 3MLJA 1UXZA 1YYNA 2Q0AA 3H8OA 4QPIC 3KV9A 2PQSA 2W08A 4LBQA 4WM8C 4C1XA 5JXJA 5JXGA 4NPMA 3GBFA 4PIZA 3NWKA 1D2SA 1UOJA 3N9OA 4OI0A 3MLLA 1XNKA 1OOPB 4NPRA 2R1DA 4LXLA 1F15A 4MX3A 1RUI1 1OUSA 3CZJA 5FO7B 2DUOA 2ZX0A 2H0BA 3D8CA 1NQJA 1Z0HA 4BISA 3SHRA 4EN7B 1BVVA 2VY0A 3JU9A 5F39A 3KT4A 4XDOA 2W92A 3SITA 2O8QA 3AVRA 2W2IA 1VMFA 1AR81 3KS7A 4FFHA 3WNOA 1CR7A 2FZ2A 4IUGA 4B4RA 2D97A 4KWJA 3T09A 1GR3A 4AGGA 4IGOA 4NHMA 3X29B 4NIHA 1UZYA 2YC2A 3ZFGA 4TWTA 1PHMA 3VDBA 2KD7A 1LCLA 1S0GA 4M01A 3KHBA 1BKZA 1WMDA 3GHMA 3KGZA 1GICA 5C5TA 4YZ5A 2Y34A 2Y6JA 4XMAA 1O5LA 2P3JA 4XZUG 4OYUA 1O8SA 3RZMA 3JBG2 3IDCB 3DV8A 1SCRA 1KGYA 3KCCA 1W6PB 1VBC3 3GCXA 1WCUA 4IE7A 1J3PA 4MSVA 5BYNA 5C5UA 2BW8A 3DKQA 1ZZ8A 5ACA2 1CAUA 2PHLA 1UYZA 3CEWA 3KVAA 1RUF2 1TME2 2ARCA 1O4YA 1LB2A 1U5XA 1WWYA 1O59A 2VZUA 3HAGA 4HXCA 4LBJA 3NL1A 4R9DA 3PUSA 1Q5OA 1GQHA 3CJXA 3DCQA 3RZHA 4L97A 1XNDA 1PZ7A 1R64A 1N47A 3MW3A 3OGSA 5FQ0B 3WHTA 3ZN5A 1QOTA 4SBVA 1L7QA 4I2OA 1JTZX 4MG2A 1WGPA 4YLZA 1RUC1 2A6ZA 2WNVA 5H9RA 1JZ4A 4KWKA 5I93A 5AVPA 2WO7A 1BEV2 4EQVA 1LEDA 1LOCA 2P34A 4Y5SA 2J1AA 3WDUA 1QJX3 4MXWB 1MEC2 3CJIC 3ZN6B 3ZXGA 3M3CA 1CAXA 3MPBA 1UKGA 5C3OA 4W50A 4QGMA 3H8UA 4XDQA 1VRH3 2XJQA 5FZ3A 3NKGA 5HCAA 4P9WA 2ZA9A 4GA9A 5JWPA 4ZONA 3AYAA 1OD3A 1BJQA 4I0WB 3ZSLA 4AEDB 2YY1A 2PXJA 3OUHA 5IK7A 2J42A 1VBB2 2WA4A 4NAOA 3L2YA 4XJ8A 3C7FA 1DDLA 1JYXA 5EFUA 2BBAA 1PGW2 2TUNA 5FP8A 5A7QA 3WCSA 1UF2C 1SBFA 3B9CA 4P08A 3UYJA 2MPFA 1WMFA 2PHXA 1VBD3 3ZX7A 4AHZA 3IPVB 4YGDA 4EWAA 3JD72 3PVBB 1K5JA 3ZPYA 4AI2A 4F8AA 1CAWA 4CUGA 5C7GA 1FPN3 2XHNA 5SV5A 3LAGA 2Y64A 4UFKA 1GV9A 3AMQA 5FYMA 4DOUA 2GZWA 4QGLA 3U07A 1H2MA 2JDMA 4A7ZA 1C4RA 1RJ7A 1K5MC 1V6KA 2ZTNA 5CKMA 4NROA 5JVVA 2SLIA 1PGL1 2RMU3 3ZO0B 3GCWA 1IQAA 3KV5A 4NRMA 3SCHA 4CEWB 4DEVA 5FO9B 2YC0A 4JVAA 2X5IA 1FI2A 2QBXA 1W28A 2BOJA 2IXCA 1BK0A 1V0AA 3LDKA 2YB7A 3OYWA 3SC7X 4YG3A 2VZVA 1ZBA2 2WT0A 1MQTC 3KLSA 1GQPA 3JB4C 4R52A 1KDKA 2CWSA 5GM0A 1AR91 1O91A 1V9U1 3ZKYA 1MZ5A 1DQ5A 3MFAA 2ZGKA 3VDAA 2RDSA 2OW4A 2DVBA 4DPNA 4A7YA 4CDQC 2ZHKA 1YWKA 2HEWF 4BWOA 2DUPA 3Q8FA 4LBQD 1QJZA 2CAVA 1HXS3 4GH4C 1HW5A 2VTFA 4K6BA 5FP9A 5HPOA 4YG0A 2WO2A 2Y26A 2HWB2 1DYOA 4HKLA 1H0BA 1ONAA 1LOAA 2A3WA 1COV1 2WSVA 1U5YA 2BOIA 3FLTA 3RI8A 4P5HA 4LO7A 2IFRA 2WJSA 1LOFC 2D6NA 1ZBE3 1KITA 4Q4Y1 1WW6A 3AMHA 5BV6A 1AHSA 4M0HA 2F17A 4GB31 4EN9B 2Z5WA 1DLLA 1EPZA 2NQYA 3VBFB 1WKYA 1CZTA 2IXIA 2PLV2 4ATEA 5CFDB 5A80A 1ZX5A 1UN1A 1X8EA 4HSJA 1QDOA 4Q27A 4CZSA 5IHRA 2CHHA 3NNGA 2RJLA 1YO8A 4I30A 2D6LX 1AR62 1NOVA 3O7OA 4HETA 5D8AA 1KFUL 3J7MA 1FMD1 4KGGA 2CY6A 1R1A2 2WL1A 3POGA 2R0FA 1UMIA 2OA2A 2R073 3H0OA 5CFCA 2A7AA 4LITA 5FJKA 1D2QA 1AJKA 2R061 4LHNA 4QX0A 2BGOA 4XBNA 4BIFA 5KR7A 5LA1A 1QXPA 4YGEA 1LHNA 1NLQA 4CDXB 2W39A 1UY3A 5FLHA 5FKCA 3VBSB 3IBMA 5FZ1A 4DXZA 1AR71 4IEWA 1XE8A 4AFMA 4AL9A 3WINE 1LHOA 1MS3A 1UNBA 4CDUC 1RUNA 1RVF1 3WV6A 1OI6A 1D0GA 4Q4V1 2DURA 3AX4A 2O8OA 4WVWA 5FYYA 1K12A 1ULPA 1Y43B 1AYM1 1CIWA 1NT0A 4IEYA 1IOAA 1FOD2 3FUOA 1DF0A 3DYOA 4D8MA 1BMV2 4CSWA 1JUHA 2ZKNA 1QOOA 3BALA 1QJY2 3HBKA 5F3GA 1VBC1 2RJ2A 3ZLIA 4ASLA 4ZKTB 4BQYA 3MIFA 2BPA2 4LBLA 2WWUA 2HWE1 3DPRC 4AFCA 4W6YA 3MF6A 2W52A 1SLAA 3FUQA 3WW4A 4M3CF 2Q8CA 2RS51 5JOYA 3MFCA 4RHV1 1NE4A 3OOXA 4YFWA 2R6QA 3ZMNA 3V0BB 2TBVA 3NAPA 2VBBA 1TNFA 4FBFA 4AOCA 4D7SA 4WVZA 4F7ZA 1QIQA 2VULA 2B8MA 1UY1A 3DGTA 1YQ2A 3LIGA 1UPIA 4JQTA 3UKVA 1MS5A 4KBBA 3NV2A 3P1IA 3IT8A 1C8M2 4HZFA 4YM1A 3S7EA 3VBHA 1UWWA 4MGTA 4RR3A 2D6PA 3TNPB 1JYIA 5APAA 3I7DA 5A33A 4IDZA 4BOWA 4CXWA 2NMNA 2XBO3 1X50A 3I97A 3U78A 4YVSB 5F37A 1G9BA 1S4CA 3J8F1 3UETA 4A3XA 5HCBA 3UKTA 5ACA3 5G05L 3KCXA 3PHMA 4I3GA 3OGRA 2QFEA 2B39A 4XETA 4ARYA 1AYN3 1RUF3 1AX0A 1GLHA 3M3IA 5A32A 2IVIB 2C5DA 4L8QA 5JOZA 4IESA 1ZREA 2WABA 1XNTA 4UFIA 1VRH1 2H6BA 3BTYA 1ZRFA 1DP0A 1ZNPA 3FZ3A 2PELA 4LHLA 3H8RA 1SFYA 3WG3A 5K9YA 2XWBB 2V5YA 2VMDA 1V6NA 2PAKA 3HD8B 5J1XA 1IKQA 1SEFA 1VB2A 1DGRA 1QEXA 1V6OA 3GYDA 4XF9A 3WY6A 3EYPA 2BQPA 1W6QB 1ZM1A 4Z2AA 3LPFA 4R9BA 4N53B 3LWCA 4XF0A 3VHNA 2RR11 4CU9A 1G86A 4KGQA 1YJKA 2WQ4A 3SLIA 4XEZA 3VHPA 1D4M2 2V72A 1SLTA 1MEC3 1BBT2 2BV4A 2Q8OA 3O1RA 4YARA 2G9GA 5BNPB 3KGLA 4Q8LA 1UY4A 2L9LA 2GDFA 2J22A 1XC6A 3WT3A 4HKWA 2O1QA 3BVCA 3I2IA 1YFYA 2R042 3HT2A 5GLVA 1W6NB 2V4VA 2E7TA 3NVCA 4BMEA 3FFQA 4MVTA 4EZ4A 1DCSA 1PVC3 2YPJA 3CBNA 4Q8KA 3ORJA 2JE9A 1LU1A 2WA3A 4PI0A 2CNAA 5FYVA 1W2TA 2BGPA 3MF9A 2YU2A 4LOTA 1GWMA 4NAMA 5SV8A 4BQWA 1SFPA 1OOPA 2JD9A 2X29A 3FHIB 3JD73 2EXJA 4V2VA 5FZKA 1UOGA 4AK3A 4A41A 4DXRA 1YEWA 4AF9A 4NPLA 2AENA 4KBZA 2WAAA 3WZ1A 5I8SA 2D6MA 4ITCA 1ZZBA 1HJFA 3W58A 3OUIA 3ABZA 2VGDA 1VE0A 1JMUB 2VZPA 1A8DA 1HXS1 4UW3A 2V4AA 2JX9A 2GC2A 3EQEA 1YFUA 2MEV3 3AP4A 1XXNA 5FZIA 1YFWA 5B4NA 2VR4A 5EPAA 5KC6A 1HIXA 3AMMA 4EN6B 3AKQA 1AX2A 4BK4A 3THPA 2JDNA 2FHRA 2GH8A 1ULEA 2Y6KA 4O9EA 2ZGQA 3TN91 4CCJA 1XB9A 4R4ZA 1UQXA 1ZBA3 1KFXL 3I3EA 4QPGB 5AC91 2EAKA 2LALA 1O3QA 1OA2A 1W6PA 3I8TA 3ST7A 1GFF2 4URAA 4QMAA 4TZDA 1N1TA 4YM2A 3ZSMA 3RGBA 4W8JA 1V6IA 2VVEA 2YC4A 5K8SA 1J1LA 2WLQA 1ASJ3 3ZYGA 4KWLA 4EE2A 2FBEA 3QCWA 2W95A 1BK1A 4HOOA 5GLUA 3LKJA 2HWB3 4XTMA 1GKBA 5FZCA 4ES8A 3Q8CA 1PGL2 1LOEA 1R083 5HCHA 3PIJA 2IXHA 4IV1C 5FQ0A 3AZYA 1VMJA 2JG8C 2QDRA 3AP9A 2VE1A 3ILNA 3PURA 4HL0A 2AACA 1I5PA 1KD7A 2E31A 4NHKA 5C8WA 2FDJA 3E6DA 5JR2A 1MVEA 1UZ0A 4CUCA 2ZMNA 2PFWA 2Q1FA 3ACIA 4MOAA 3LEKA 1F2NA 1JUIA 5JDBA 3B94A 2WUHA 4X6QB 1PX3A 4DQAA 2Z42A 2HWD2 3M7AA 1ACCA 4MXWA 1VRBA 3ZN6A 4AHWA 1ENSA 2FDIA 1WLDA 2RS33 4CEYC 2BBVA 5ABJC 1MS1A 3MI8A 1G9CA 1AR63 2QQLA 4NRPA 1ND3C 4LUMA 3VBUC 4A44A 1F4AA 1DG6A 1HRV3 2ATFA 5D2AA 4BDVB 2R16A 1U5ZA 1PM7A 1E5SA 1W6MB 1UIKA 1NZIA 3ZSKA 3S5AA 4OI1A 1REEA 3IIIA 1CESA 4AEDA 2VMHA 2WNOA 1LULA 2D5FA 2DVDA 2UY8A 4P9IA 4YG6A 4TSVA 3O1TA 2VBDA 2ZGRA 1Y7BA 3EHKA 3WLUA 2UYBA 4OUMA 4PLMA 2WRAA 2CDOA 1I6XA 5FKBA 4BIOA 4Q4Y2 4H14A 4RS5C 3B93A 4B7EA 3IPVA 3OEAA 1UZZA 2VM9A 3ITQA 5FOBB 4UXAA 3A21A 1UYXA 4B8EA 1RMU3 2HBTA 5FPZA 3QACA 4YM0A 4R8HA 3RYKA 3ES4A 2B46X 3AK0A 5T55A 4CDWB 4ZU7A 2BVBA 2A6WA 2IXJA 3E5UA 1EAH3 4N43C 5FUPA 3S7IA 3GZUC 3N4MA 2MHFA 3I3DA 3PUIA 4BQ3A 1FMD2 5LRRA 2XBO1 3OUJA 3WVJA 2HEYF 3WXPA 1J59A 5FLIA 1AL22 5E16A 3VDDC 1ZA7A 1WD3A 1VMHA 1LNSA 5FMBA 5LEKA 3FBMA 1JBCA 1TG7A 1YCIA 4ONUA 3BOWA 2R062 3MPPG 1H30A 3H50A 4CEWA 2D7FA 4P00B 1UIJA 1Y3TA 3RZGA 2DTYA 3OG2A 3TEWA 1OBNA 3WP4A 3ZYBA 2QQMA 2YV8A 4FPYA 4PDWC 2OS2A 3RYPA 1LHVA 3LEMA 5FMDA 1JZ6A 1JXNA 4PBOA 3SH5A 2N7GA 3HR9A 4Y5Z0 4YM3A 4FT8A 3VBOB 5KXEA 4JC1A 3OEBA 3AKPA 5LZ6A 3U37A 2GNMA 5FZ8A 1C8M3 3CDZB 1OVSA 1W9WA 2VCBA 2ZZJA 4Q4V2 5D1IA 2FDKA 4O61A 2WINB 1V6JA 3HIFA 4ZU4A 4B29A 2J1UA 2VD7A 1D4VB 3WNPA 2ZX1A 1OPOA 3ZIWA 3CLPA 3POJA 5FPUA 1JYNA 4IXLA 1PO22 5H9QA 3PMEA 2XVGA 5GZGA 2ZOEB 3RJ2X 4HFSA 5JOWA 3FMGA 3MIDA 2HWE2 2ILMA 1IGOA 2VMGA 2W46A 2XG3A 2HWC3 3IWZA 3MIEA 3VZJA 4ET7A 4XFFA 2DWRA 2HYKA 4O9GA 1ULGA 4BJ0A 1GZ9A 1QQP3 1YQ8A 3O1OA 2BWCA 4XW3A 3C2UA 3GJAA 3ZFEB 2OIIA 5DUXA 1J84A 2EAAA 1BHGA 1J3RA 1K3IA 2DUQA 1N3PA 5D8AB 4QQHA 4V1PA 2WWJA 5FP7A 3VBFA 1SBEA 1UO9A 1PO11 4XYXA 3AJZA 2WQZC 5DPNA 2WN2A 5CFDA 5LBCA 3NQHA 4PIYA 3VKLA 5IK4A 1ST8A 2VNVA 4RGKA 4QQLA 3K51A 4GAZA 4L11A 1Q8SA 5FXZA 4HLTA 2OVUA 3FWEA 3WR0A 2VJXA 3SH4A 4M00A 5A6QA 1BBT3 5FK8A 1QY4A 3J8F2 1H9WA 1SPPB 1OPMA 2E7AA 4LMFA 1EYBA 4QB2A 4HBNA 5CG9A 2O14A 3AL6A 4CUAA 3U75A 5FZHA 3UGFA 2R043 1HRI3 4D0QA 2VMFA 4CDXA 2RS13 4NO4A 4LIUA 3C7GA 2BDRA 4TXWA 3VBSA 4COWA 2WYSA 5DXDA 1G9FA 5A6YA 3KWVA 5JSRA 4E2SA 4AGRA 4RA0A 2D3PA 2UWBA 3GZTB 5C8CB 1XNCA 4QKDA 3H7YA 1IKPA 5L36A 2VUAA 5T5PA 3MDPA 4META 2WNVC 1RB8G 1W2UA 2P3KA 3AKTA 1MS4A 4AWDA 1FV2A 4IE0A 2RR12 1GNZA 5F2WA 1ZZ6A 1VAKA 1JYTA 1BQPA 3RSJA 1TNRA 5FMOS 1ODNA 2UU8A 5F5CA 2DF7A 2JKXA 1UX7A 4HSLA 4NVPA 1QH7A 3I3QA 3AJYA 1BZWA 1Q56A 4Y20B 1RUJ2 4AQTA 3SMHA 2XHKA 3E6BA 3WDVA 2WFF2 3ZDVA 3V0BA 2XLFA 4M3CB 4NWVA 1Z7S2 2EXKA 1H9PA 2KXLA 3R4SA 4Q4W3 1U12A 1SACA 3N7JA 4CXYA 4XFAA 2UYAA 5FZ0A 4OHXA 1EV12 4FPFA 3L2HA 1G9DA 5FZMA 1UU5A 3IM0A 3NNJA 3CO2A 4C1WA 2VQAA 3P3NA 4Q0UA 4BB3A 3OBRA 3LA2A 3NJXA 4YVSA 3S6PA 4OMCA 2ZACA 4Z07A 1IG0A 3G6JB 5AFEA 5K7PA 2GNTA 1YHFA 2P1BA 2WT2A 2X8KA 2E63A 4FCAA 1IHMA 4XAEA 3ZYJB 5L7OB 3ILRA 3Q9OA 4LT5A 1NQDA 1DQ0A 1Q8VA 1RUE1 4Y26A 3POIA 3TB0A 2VQUA 2Y0IA 5A7WB 5F32A 1OUXA 2AC1A 4GD4A 3MIGA 5FYTA 5J98B 1OF4A 1OA3A 1QOSA 4Z82A 5CNAA 4DRVA 3RZLA 2Y0OA 1I3HA 1XYOA 1DYPA 2E7QA 1X36A 2VECA 3O5SA 1D7PM 4WM7B 3N9QA 4OULA 5CU1A 5C6CA 1X9TA 4MGIE 1CPMA 1GP6A 2LROA 2X5IC 4MZUA 4EYUA 4JGYB 3ZPOA 5LCWL 1W6QA 4HG6B 4CCDA 3H9AA 5J7MA 3R4UA 2X09A 4N53A 3TN92 3ZYPA 3I49A 2RVAA 2YHJA 4JV4A 2YMZA 5FREA 2WFPA 4JHTA 4XE9A 3BPZA 3ALQA 2HWD3 1OLMA 1OH4A 2JXAA 2WZR3 4G4FA 3VD3A 3MEPA 2HWF3 3ATGA 5BNPA 2GC1A 4YZ4A 5DAXA 5ANNA 1W03A 1X7NA 4FPJA 5FY1A 2B9UA 2R49A 3VBOC 2YUEA 3MV01 3H1WA 3AMPA 1HJGA 2R30A 2XONA 4W65A 1W6NA 2ZGLA 1W8UA 1QJU2 3GZEA 1F9KA 3WF1A 1YJLA 4UAPA 5DAVA 5FWEA 4AFBA 4AW7A 1NCQB 4AXOA 1PNFA 2FDHA 2JE8A 3LSEA 3L9JT 2BU9A 5LW9A 1QNWA 2VNOA 2JDYA 3AKRA 4DUWA 3NKTA 5JZGB 5FYSA 1MR5A 2HH9A 3K3NA 1DGRN 3T3YA 3VD7A 3N7KA 3SKVA 2QVSB 1CZVA 3EJKA 3HT1A 4AEKA 2C24A 4DIQA 2ZJCA 1NAEA 1NE6A 1ZZ7A 2IXLA 2Y8KA 3GJBA 4LBOA 5D8AC 2XXZA 3H3UA 1LTEA 2EXIA 4GMP1 1AL23 2ZAHA 2ENRA 5T5LA 5CFCC 2K9ZA 5ANQA 1GUIA 2AUYA 3HNYM 1N1SA 1MZFA 1VBE1 3QBQA 1DZQA 4IETA 3VV1A 1R093 4P02B 2E33A 2A5ZA 4MGSA 3JQXA 4E2QA 2B5HA 3AZXA 4XUQA 5J37A 2OX0A 4XJ9A 4N8MA 1DQ6A 2Z79A 4YW2A 1H6XA 1OQ1A 5DDJ1 1FV3A 5FY4A 3ZXEA 4CCLA 2ADDA 2JKBA 3EMRA 4FOYA 3O1MA 4C90A 3NW4A 4QPGA 1WLWA 2XUMA 2ZHMA 4IGQA 2ZZQA 3LF7A 4KG8A 3ZVXA 4PHZA 1ALYA 3PVNA 2DVGA 4QD2A 1LOBA 2W0XA 5HCFA 4KH9A 4GKXA 4QM8A 4XFGA 3ZYFA 4P5YA 1UX6A 4CPBA 1MVQA 4MGKE 5JIAA 2EA7A 3CU7A 1PO23 3ON7A 3PL0A 1RIRA 1RUD1 1I5ZA 3B7MA 3VZLA 1GOFA 4AI8A 1JZ5A 4LHSA 4ASKA 2P6HA 3FLPA 2VUDA 4GQ7A 1TMF1 4RYDA 4YYOA 1I9RA 3O0WA 4I01A 1ZRDA 2Y60A 5FZGA 2B42B 4NIAA 2BNOA 3NAPC 4CP0A 2WBKA 1HRI1 2JIGA 3AZWA 5A70A 5IT6A 2VW0A 4UFHA 3AMNA 4Q4X2 2G4IA 1DZRA 1OKQA 3RQ0A 3N7LA 5LB6A 1DYKA 1H2LA 1POV3 5FZOB 2OQ7A 3VBHC 1T2XA 1GQGA 4RR3C 2YG0A 5FBZA 3RI9A 4D6SA 4HVQA 2D44A 1JZ2A 4AVBA 1BVP1 2DCTA 1T6BX 1Q8PA 1FNZA 4JDOA 4QHBA 3O1SA 1OXCA 4LPLA 1RHI1 3CHXA 2WR9A 1W6MA 1W99A 4FI9A 5L9BA 3TRSB 3WP3A 4AAPA 2BEOA 3WNLA 5DMYA 1JI6A 4XQDA 1ULFA 2WN3A 3LD8A 1Q8OA 4AG4A 3KD4A 5LK5A 4JAAA 2W1QA 4I02A 1DQ2A 5KHGA 4OUSA 5F2SA 4LBNA 4P9XA 2QQPA 5BNNB 5DZFA 2ZABA 2XUEA 4D94A 1MS9A 1W3VA 4H55A 1NA1B 1DQ1A 1POV0 1QJEA 2ZGOA 2V5DA 1TQ5A 2CTVA 5I8YA 4DRRA 3TWIA 1LU2A 2K2SA 2WS93 4FTBA 3IDBB 1RUG1 3RYRA 3WDYA 3WQ7A 1UAIA 3K2OA 2XKPA 4JGZB 1LGCA 3ZR5A 4XF1A 4CDWA 1GMMA 1H6YA 3WG4A 4Q29A 4LKSA 2LUWA 4PT6A 1N3OA 4JQRA 3KHCA 4XJWA 4XPVA 4OZOA 4IW3A 1PX4A 3USUB 2BGCA 1JOBA 1AF9A 1LKNA 1PIV1 2AEYA 4QB6A 3MV11 3V56A 4XZPA 4JDNA 5FZ6A 5FZBA 2Y6GA 3HN1A 3JCIA 3SEEA 1CIYA 4LLOA 1HB4A 2ADEA 5KWRA 3RZKA 4MO3M 2WFF3 3R0RA 4RN5A 1FYUA 4QKNA 2VZ1A 3DL3A 3AB0A 1C5IA 1Z7S3 1CQ9A 1IPSA 4Z92B 2DBNA 2XJPA 2D98A
chains in the Genus database with same CATH topology
2FDFA 4QKFA 3O1UA 4NJ4A 4MG2A 4NIIA 4CXXA 3I3QA 3BUCA 3O1PA 4O7XA 3O1MA 3H8XA 4NIGA 3BIEA 2FDGA 4CXYA 3I3MA 4NPLA 3S57A 3RZGA 4IE4A 4IE6A 5F8PA 4NRQA 5DABA 2FDKA 4O61A 4ZHNA 3RZLA 3BTZA 4NIDA 3BTXA 3H8OA 4NPMA 3O1VA 4QHOA 2IUWA 4NROA 3I49A 4NRMA 3O1SA 4MGTA 4JHTA 3LFMA 3I2OA 4IDZA 3O1OA 4CXWA 2FD8A 4QKBA 4ZS2A 3T4HB 3BU0A 4NIHA 2FDJA 3KHBA 3BTYA 3RZJA 4ZS3A 4OCTA 3H8RA 3RZMA 2FDHA 2FDIA 3BKZA 3KHCA 4IE7A 3BI3A 4NRPA 3T3YA 4IE5A 3S5AA 3T4VA 4QKDA 3RZKA 3O1RA 3RZHA 4QKNA 3O1TA 4RFRB 4IE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FDF A;  4QKF A;  3O1U A;  4NJ4 A;  4MG2 A;  4NII A;  4CXX A;  3I3Q A;  3BUC A;  3O1P A;  4O7X A;  3O1M A;  3H8X A;  4NIG A;  3BIE A;  2FDG A;  4CXY A;  3I3M A;  4NPL A;  3S57 A;  3RZG A;  4IE4 A;  4IE6 A;  5F8P A;  4NRQ A;  5DAB A;  2FDK A;  4O61 A;  4ZHN A;  3RZL A;  3BTZ A;  4NID A;  3BTX A;  3H8O A;  4NPM A;  3O1V A;  4QHO A;  2IUW A;  4NRO A;  3I49 A;  4NRM A;  3O1S A;  4MGT A;  4JHT A;  3LFM A;  3I2O A;  4IDZ A;  3O1O A;  4CXW A;  2FD8 A;  4QKB A;  4ZS2 A;  3T4H B;  3BU0 A;  4NIH A;  2FDJ A;  3KHB A;  3BTY A;  3RZJ A;  4ZS3 A;  4OCT A;  3H8R A;  3RZM A;  2FDH A;  2FDI A;  3BKZ A;  3KHC A;  4IE7 A;  3BI3 A;  4NRP A;  3T3Y A;  4IE5 A;  3S5A A;  3T4V A;  4QKD A;  3RZK A;  3O1R A;  3RZH A;  4QKN A;  3O1T A;  4RFR B;  4IE0 A; 
#chains in the Genus database with same CATH topology
 4R9C A;  3N36 A;  2VH9 A;  3B01 A;  2RE9 A;  1W6O B;  3VBO A;  4LA3 A;  1W0P A;  2TEP A;  1YI9 A;  3AFK A;  4IEP A;  5GJ6 A;  3ZR6 A;  1EV1 3;  4D3W A;  1OD5 A;  5TSW A;  1FT9 A;  2BWA A;  1ULD A;  2EXH A;  3OD0 A;  4UYB A;  5FXX A;  2TNF A;  1OFN A;  4FFI A;  3MW2 A;  3D4K A;  2QCS B;  1OOP C;  1XOY A;  2EF6 A;  4D6R A;  3H42 B;  1IQD C;  2ZCW A;  1O4T A;  3U4S A;  3CZU A;  3EB7 A;  4A2U A;  4DXS A;  4A4A A;  1AUY A;  2E9Q A;  2ZXQ A;  3KVB A;  4LKD A;  1VR3 A;  4YW7 A;  5EQU A;  3GBG A;  5L9V A;  1PZ9 A;  3AZZ A;  3W21 A;  3HEI A;  1JOD A;  2GC3 A;  2JDZ A;  1F31 A;  1RUH 1;  3K75 B;  3Q8B A;  2DTW A;  4XXA A;  2X05 A;  4AEM A;  5HBA A;  3S0M A;  5BNO B;  2PTM A;  4NOT A;  5C70 A;  1VAV A;  1NKG A;  3VDC A;  1KJL A;  3ZFE A;  4BLJ A;  4AVS A;  4QX1 A;  4A42 A;  1KDM A;  4JKM A;  4FPO B;  1T6G C;  2W94 A;  3N9N A;  3AXE A;  5T3N A;  4OFG A;  2AYH A;  1GP4 A;  3POW A;  4WZF A;  3K48 A;  3ZXL A;  5IWF A;  3QH6 A;  4FXK B;  2F4L A;  2W5F A;  1VBA 2;  5IVF A;  3ZN4 A;  5HXV A;  4XUT A;  2KR2 A;  1J1T A;  2RM2 2;  1IS3 A;  5CIR A;  1SPP A;  3KT7 A;  4AHY A;  1YXW A;  3AP7 A;  2E32 A;  3Q8A A;  1HV0 A;  4MLO A;  2VCA A;  3LA3 A;  4OVE A;  3GDB A;  2AH2 A;  2PAE A;  5JSO A;  4XFI A;  1QJU 3;  4HT1 T;  3FL7 A;  4HON A;  1S2B A;  4UW5 A;  5HV0 A;  1Y9Q A;  2ZBJ A;  3CMG A;  3PUQ A;  5C8C A;  4FPH A;  3PU8 A;  2AZ5 A;  3M8L A;  4QXK A;  3SCG A;  2XOM A;  4MHU A;  2A6Y A;  5FDB A;  1W2A X;  5EYY A;  1X9P A;  3NMB A;  5J48 A;  3WW3 A;  5FPL A;  5C9A B;  3VB9 A;  3UKN A;  4R4X A;  1RIT A;  3ZYR A;  2ZML A;  1BCX A;  3WF0 A;  1SLC A;  1REF A;  4QXH A;  1B35 A;  3VKO A;  3LFI A;  2YFZ A;  4CCE A;  4LO8 A;  1JS9 A;  2VOV A;  1UZV A;  1HDK A;  1AJO A;  3D0S A;  4E4Z A;  3P6B A;  4P9J A;  5K0U B;  5F3I A;  3SNM A;  1S55 A;  2A71 A;  4Y20 A;  2W3J A;  4BXS V;  3J4U H;  3VZO A;  1K45 A;  4M3C A;  2CGO A;  5E89 A;  4AED C;  2F4P A;  2DBI A;  3JBG 3;  1GWK A;  3SQO A;  2JIC A;  1L7R A;  4ZXK A;  5I0D A;  4XJA A;  1E5R A;  2I2S A;  4M0N A;  2W9X A;  1RUI 2;  3FX3 A;  5EJ1 B;  3UV9 A;  3E5X A;  3RPQ A;  5EZW A;  4Q1R A;  1QJX 1;  1S0I A;  2QQN A;  1MAC A;  2QQK A;  2VQT A;  4CCK A;  3PTR B;  4WVM B;  1TME 3;  3CQO A;  4CCM A;  3OBA A;  4RFR B;  5DQ0 A;  1AR8 2;  3H3L A;  5LA9 A;  4COZ A;  5JPN B;  2CGN A;  3OF1 A;  4CCC A;  2CV6 A;  2QQI A;  2QQO A;  3ACG A;  2RDQ A;  5L7O A;  5GKA C;  2VQ0 A;  5A3L A;  1UOB A;  3WOG A;  4DUX A;  5FY8 A;  2RV9 A;  2J7M A;  2A1X A;  2FCV A;  4FFG A;  5A7W A;  4CXX A;  4CP2 A;  1C3H A;  3VD4 A;  3BIW E;  3SH3 A;  3BUC A;  1APN A;  4GWJ A;  5EIY B;  4YW5 A;  1MZE A;  4XAA A;  5F7U A;  3A4U A;  4WM7 A;  1JZ8 A;  1IS4 A;  3ES1 A;  2VMC A;  1C57 A;  1V6L A;  3PTY A;  5K4L A;  4CEW C;  1YIF A;  5I0R A;  1BEV 3;  2OPK A;  4IEX A;  4DY3 A;  1VBD 1;  2A70 A;  4JGY A;  4ISR A;  3V65 A;  5F3C A;  3UES A;  3M3E A;  3I3M A;  5GZC A;  4H2A A;  1H8T B;  2Y38 A;  3RJR A;  1JHN A;  2QQV A;  5JI9 A;  4L92 A;  1ENX A;  1J83 A;  3AXD A;  4XCA A;  4Q4X 3;  3KM5 A;  5FTT C;  1FPN 1;  1AX1 A;  3M4F A;  1JU4 A;  2WS9 1;  1AVB A;  4QAW A;  4QX8 A;  5LWB A;  1VAM A;  1G6N A;  5A3O A;  4K40 A;  1C1F A;  5B4X A;  4M4R A;  2JG9 B;  3T2O A;  2Q5T A;  1VBB 3;  4NRQ A;  3JXS A;  2I07 B;  4UWD A;  1W0N A;  2RMU 1;  2PA7 A;  3MHZ A;  2ZHL A;  4QX2 A;  3IB3 A;  1QXR A;  1ND2 B;  2VZS A;  2I45 A;  1UW8 A;  4EN0 A;  3PUA A;  4S2F A;  4C0H A;  1X82 A;  2LS6 A;  1RUC 2;  2FQP A;  3SCF A;  4I3P A;  1NCQ A;  1TMF 2;  2JJ6 A;  5F5Q A;  2CU5 A;  1PK6 B;  4SLI A;  4LE3 A;  2PHW A;  4LO4 B;  2D6K A;  1GU3 A;  2QQU A;  1F35 A;  5DZG A;  5JZG A;  2YGM A;  3IMM A;  1XJA A;  2A3X A;  1S0D A;  2ZPX A;  2LRP A;  3F95 A;  5GLZ A;  3VBF C;  5CFD C;  4YVW B;  2OPW A;  4B1M A;  1TVG A;  3LFM A;  5IK5 A;  1LEM A;  2YU1 A;  2ZX2 A;  5J09 A;  1W2N A;  1LHW A;  1UZW A;  1F8V A;  3I59 B;  3NRU A;  4QKB A;  1RGS A;  1DQ4 A;  2O0O A;  2BNN A;  3T4H B;  4UI9 L;  3V64 A;  1UYP A;  4HK9 A;  1AXK A;  2Q1Z B;  1FAT A;  4UW6 A;  2CL2 A;  1ZRI A;  1QHD A;  4GJY A;  3WNK A;  4AHX A;  1YIP A;  1ZBE 1;  2LW8 A;  1OHF A;  1NCR B;  4RL7 A;  2ZAA A;  4CDX C;  2A3Y A;  1CVN A;  2VO5 A;  1NXM A;  3LPG A;  3VBS C;  4YZ2 A;  1HQN A;  3OJB A;  4FXG B;  5FV3 A;  2GAU A;  1SZB A;  3INA A;  4H3W A;  4YGB A;  5DAW A;  4AVV A;  3BI3 A;  1YC6 1;  4ASM B;  2WNU B;  3I54 A;  3IZO A;  4FO9 A;  3VLB B;  1RUG 2;  5F1R A;  2BER A;  3LDR A;  1J58 A;  3THC A;  1ZVF A;  4M4P A;  3N35 A;  3OB8 A;  2R07 1;  4TLF A;  4IE5 A;  5JMO A;  2FCU A;  1DBN A;  2PHD A;  1URX A;  3D5O A;  4I09 A;  1NX9 A;  1N3Q A;  1CON A;  3WP6 A;  2BYV E;  5H9P A;  5I0T A;  3EBR A;  1VJ2 A;  4FVV A;  1PIV 2;  2PMW B;  4HVO A;  3PNA A;  4XFB A;  1SG3 A;  3T2T A;  5FZL A;  3JUU A;  4BQ4 A;  4XF4 A;  1XYP A;  4GWN A;  5C4W B;  2G1M A;  4RQP B;  3HQU A;  1OQE A;  4BA6 A;  1JYW A;  1AR9 2;  1CX4 A;  1V9U 2;  2OXB A;  2PLV 3;  5DUU A;  1OVP A;  1VAL A;  4QWN A;  5IJR A;  3P3P A;  4CE8 A;  4ORF A;  3USS A;  3GNE A;  4AI1 A;  1YNA A;  1R1A 3;  2XJV A;  5FZO A;  5FCC A;  2XGX A;  3QD6 A;  1O3R A;  4FQ4 A;  2CWM A;  2PHT A;  3POF A;  4DB5 A;  3TOJ A;  1UOF A;  1UMZ A;  4QHZ A;  4YVS C;  1VBA 3;  1COV 2;  2EAL A;  1IPJ A;  2C9K A;  3OPW A;  4CA9 A;  5M0T A;  1O6U A;  4EWD A;  2ET7 A;  2EIE A;  4FTS A;  3ZXJ A;  1NLR A;  3NJV A;  3ZYI B;  4BM8 A;  3I3B A;  3AKS A;  4Y24 A;  2DU0 A;  1DLC A;  2VBP A;  2ZX3 A;  3OY8 A;  2BZD A;  4GB3 2;  1S0F A;  2Y6L A;  4I0B A;  4XQ4 A;  3UT0 A;  1ZRR A;  5BNN A;  3TEY A;  1NA1 A;  4BXF A;  3DXU A;  1C5H A;  4BQ1 A;  4H7M A;  3C7E A;  3ZFF B;  1FOD 3;  2OUJ A;  4OZX A;  1W8Z A;  4Q0V A;  5F6K A;  2P2K A;  3DF0 A;  3VD9 A;  3CL1 A;  3BTZ A;  1QJY 3;  1PMH X;  2NLR A;  2EIG A;  2WII B;  4TLG A;  5GLT A;  4OUE A;  4JGZ A;  5I8T A;  1H4H A;  4N53 C;  3AVS A;  3BN6 A;  5C71 A;  4XAB A;  1LHU A;  4YZ1 A;  5ACA 1;  3URF A;  1OSG A;  2DFB A;  4XIO A;  3FN9 A;  4Y1U A;  1AYN 1;  1RUF 1;  1EY2 A;  2F6B A;  4G9S B;  2HKX A;  4K9S A;  5FMO L;  4B1L A;  3N9P A;  5BNP C;  1IZ3 A;  1S0E A;  3USU A;  2YXS A;  3DEM A;  4XAC A;  1POQ A;  2OUH A;  1O4Z A;  2ZEX A;  3MLK A;  4NWW A;  1AR7 2;  4D6Q A;  4Z2W A;  1OH3 A;  2ARE A;  4JZR A;  5G04 L;  3H1M A;  3OBT A;  5LY2 A;  1RVF 2;  5CKN A;  3HNB M;  5I0U A;  3UNP A;  1S0B A;  1DGL A;  1KQR A;  2YGL A;  2Y6H A;  1AYM 2;  3HQX A;  4IEQ A;  1HKD A;  2JDU A;  3BYW A;  5CEH A;  1W6O A;  3HPN A;  3LA7 A;  4C91 A;  1RUI 3;  5FMC A;  3K4Z A;  1Z78 A;  1VBC 2;  4QX5 A;  1YRZ A;  5IAV A;  4LO6 B;  4COY A;  5IAT A;  1MEC 1;  1MS8 A;  2I74 A;  1W2O A;  5EJ3 A;  2W1S A;  4L99 A;  1STM A;  3O0X A;  3FHQ A;  1JZ3 A;  3T0A A;  2XR4 A;  2RS5 2;  2YYO A;  4RHV 2;  1P8J A;  3LZZ A;  5C3S A;  1GZC A;  2V09 A;  5GZE A;  5A3N A;  5FJH A;  4QPI B;  2JEM A;  3D0J A;  1OQD A;  4WM8 B;  2C9A A;  5CB7 A;  4PQQ A;  1H2K A;  2VZR A;  4E27 A;  1JZ7 A;  1PVC 1;  5EXO A;  2DVA A;  3MW4 A;  5BNO A;  2HBU A;  4J1W A;  5DAP A;  4OQ9 A;  1PGW 1;  4AVT A;  5LBB A;  5JR7 B;  4P14 A;  2VAU A;  5LAT A;  4AR2 A;  5JSP A;  1KEX A;  2DCK A;  4XUR A;  3B5L B;  1HQL A;  1D4M 3;  1OKO A;  3I2D A;  2WO3 A;  4K8F A;  4NII A;  3JD7 1;  4NHX A;  1YUD A;  2W47 A;  4QPG C;  3VBR B;  4Y22 B;  1RYY A;  2VUJ A;  4UF0 B;  5LA0 A;  1H1A A;  4Y3O A;  1QXJ A;  4JDM A;  2PHU A;  1VRH 2;  1US2 A;  1MS0 A;  4K1Z A;  2P17 A;  5A6Z A;  2YBK A;  1IG3 A;  3ECQ A;  2OYZ A;  1JW6 A;  3HQR A;  3J7N A;  1G9A A;  1US3 A;  2MEV 1;  3R4D B;  1A3K A;  4FPC A;  1Y9G A;  3O12 A;  4Y5T A;  3WSO A;  4EN8 B;  1N1V A;  1OLR A;  4FOV A;  5DZE A;  3VZK A;  4CCN A;  3PVE A;  2HLE A;  1RUC 3;  3RDI A;  1UD1 A;  3T1L A;  1RIN A;  3U1X A;  3GGL A;  3TNQ A;  3UJO A;  2WO1 A;  1AXZ A;  3RZZ A;  1YQ6 A;  4BCU A;  5I91 A;  1ZBA 1;  1K42 A;  1VBD 2;  2PQQ A;  5KHI A;  2ERF A;  1W39 A;  1S2K A;  3BOP A;  3H3Z A;  1B35 B;  4XIK A;  5F8P A;  5FO8 B;  5E88 A;  5FFO C;  3WQB A;  4EWE A;  1CZS A;  3SIS A;  1LJ7 A;  2X10 A;  1ENQ A;  5C9A A;  2IZW A;  4WZC A;  2JIJ A;  3NNM A;  3AC0 A;  1KXG A;  4G3Y C;  1FPN 2;  4LO5 B;  1ASJ 1;  2Q8D A;  3TEX A;  3O0V A;  3WD5 A;  5C3P A;  4QQP A;  2XDV A;  2D3R A;  4LE4 A;  5ERL A;  2XL7 A;  1HN1 A;  3LCP A;  2ORX A;  2HWB 1;  3PVO A;  4EJR A;  5EP9 A;  4CP1 A;  3MUY 1;  2Q30 A;  1O3T A;  5K0U A;  4E2G A;  3NV4 A;  1R08 1;  2ZEW A;  3VHR A;  1C1L A;  2R1B A;  4URT A;  1W8F A;  3BPS A;  4KNC A;  5FY7 A;  4AI9 A;  5JCT A;  4AYU A;  3OSD A;  3M3Q A;  3CJI B;  5BY5 A;  4QXB A;  4FPL A;  4AQS A;  1XNA A;  2GME A;  3MIC A;  3PDQ A;  4XHB A;  2FMY A;  4UOJ A;  5A7P A;  4CP9 B;  1KS4 A;  1JN2 P;  2DCJ A;  3BOD A;  4ZY9 A;  5FZD A;  4OHV A;  3W5M A;  5IK8 A;  2FZ1 A;  2J1T A;  2GP5 A;  2FD8 A;  5KHH A;  4QU1 A;  4AEJ A;  2RS3 1;  1W8H A;  4JHZ A;  4MAD A;  5FUN A;  4WVM A;  1HB2 A;  4NMI A;  3WNM A;  1YQ5 A;  2HJI A;  2DVF A;  1AR6 1;  1HN0 A;  5CAZ A;  4XUP A;  2WAO A;  3KF3 A;  4QDS A;  2XQX A;  1HXS 2;  2G19 A;  1RXF A;  2XJT A;  1HRV 1;  3K77 A;  4MV2 A;  3ZFF C;  4CDW C;  2JWP A;  5FYH A;  5FXV A;  2OKX A;  4CU6 A;  4ZZ8 A;  2PAM A;  4CYD A;  3QOP A;  1OF3 A;  1PZ8 A;  5T54 A;  4ZS3 A;  4OCT A;  3BCW A;  3U14 A;  1X8M A;  4B7K A;  2E53 A;  4R9A A;  3OBZ A;  5F6L B;  4AFA A;  5FYZ A;  4B4Q A;  1DU3 D;  5AC9 2;  3H1Y A;  1NZC A;  1XU2 A;  1VIW B;  1AR9 3;  1V9U 3;  3ME2 A;  5EJZ B;  3AM2 A;  4XJZ A;  1C8N A;  5FYI A;  2OZ6 A;  2XVK A;  3NO8 A;  1H8T A;  5DN2 A;  3CNA A;  1RMU 1;  3W9A A;  1ULO A;  3APB A;  4IV3 A;  1K5M B;  4YW3 A;  4OI4 A;  3WNN A;  5HI0 A;  2WYF A;  1EAH 1;  1GWL A;  2GMP A;  3MO4 A;  3RNS A;  3LOB A;  1L3J A;  1OFS A;  1QJY 1;  3PJY A;  2RG4 A;  3LEI A;  3HBZ A;  5EV7 A;  2JG9 A;  4JKK A;  1COV 3;  5E8A A;  4QM9 A;  1U0A A;  2IVJ A;  4W4Z A;  3WDX A;  2VXR A;  1MQT B;  1ND2 A;  2WWS A;  2VNR A;  4Q4Y 3;  5KXB A;  1HB3 A;  2GNB A;  3EXU A;  3G7D A;  4QX7 A;  4WV8 A;  4GB3 3;  2VW1 A;  3BU7 A;  2BP6 A;  4O7X A;  1Y4W A;  4TN7 A;  3THT A;  4CDQ B;  5FXW A;  1PK6 A;  3RRD A;  2DYC A;  2JDH A;  1VPH A;  2NZ9 A;  4GH4 B;  4UBG A;  1C8M 1;  4K21 A;  3ZFE C;  3I2H A;  5FYC A;  4X8P A;  3MBW A;  2HEV F;  3CKH A;  4P9L A;  1E57 A;  4PLO A;  1FMD 3;  4DS0 A;  4YW1 A;  4YVW A;  2YFU A;  2XH6 A;  3S57 A;  2WQ8 A;  5CKQ A;  3DN7 A;  5FZE A;  3AYC A;  2CDP A;  3I59 A;  2R06 3;  4HMZ A;  5J36 A;  1HV1 A;  4IGP A;  1CAV B;  4C8D A;  3WG1 A;  1SDW A;  1WUV A;  3C7O A;  1DGW A;  2HWC 1;  3KB5 A;  1VB4 A;  2WLP A;  4OI2 A;  1IPK A;  2VVF A;  5FZ9 A;  3VBR C;  5IVV A;  1AR7 3;  4FAG A;  3OGJ A;  1QQP 1;  1L7L A;  5CVR A;  1NCR A;  1RVF 3;  1SFN A;  1RC6 A;  5FYU A;  1AZD A;  1E5I A;  1GBG A;  4Q4V 3;  4XFH A;  4FOW A;  1QNY A;  2CYF A;  1CJD A;  2ZGM A;  4UFJ A;  5FPA A;  1AYM 3;  1BYH A;  2ES3 A;  1ENR A;  2ZX4 A;  1WD4 A;  3BB6 A;  3KCY A;  2JDA A;  3C8X A;  2D5H A;  3WQ0 A;  5C8C C;  5JIU A;  2GP3 A;  2UWA A;  2WNU A;  2XBO 2;  2P5B A;  4LIV A;  5A7O A;  3ELN A;  3ZSJ A;  1D4M 1;  2D6O X;  5JPM B;  1BBT 1;  1CX1 A;  1XPW A;  2HWE 3;  2QDN A;  2RJK A;  2WKK A;  3AP5 A;  4CTE A;  2G9F A;  3A23 A;  2RS5 3;  4RHV 3;  4BQ5 A;  3KV4 A;  2ZEY A;  3VL9 A;  4F3J A;  1AYN 2;  4MGY E;  1O3S A;  1B35 C;  4CDU B;  5EYX A;  3WQ1 A;  4FAH A;  1QDC A;  2GC0 A;  2R04 1;  4C0B A;  3TAY A;  2RS1 1;  5LA2 A;  2QKD A;  5HXM A;  1GSL A;  5C4W A;  5DG2 A;  3QLQ A;  3HMY A;  4RQP A;  2D40 A;  1FAY A;  3K4A A;  3SXW A;  5KHK A;  2P3Y A;  5A3P A;  5IFP A;  2VVD A;  3RZJ A;  4A6O A;  1WCK A;  3K46 A;  2QE3 A;  2X53 S;  1AXY A;  2VOK A;  5A3T A;  3DPR B;  3ZMO A;  5JUV A;  3A0K A;  2QZ3 A;  3RMX A;  2R0H A;  3A0N A;  4KU7 A;  4YRD A;  1YI7 A;  2Y6F A;  3J8F 3;  1GNY A;  4HPK B;  4LK7 A;  4LK6 A;  4D7Y A;  2CAU A;  3I2K A;  4XMI A;  1GOG A;  3M2M A;  4ZU5 A;  4AE2 A;  3KSC A;  4YFZ A;  4KMQ A;  5T5O A;  1W05 A;  1HX6 A;  2D93 A;  3OY8 B;  3FJS A;  1A34 A;  5ISL A;  4V2W A;  3IMN A;  4D69 A;  1YLL A;  3VKN A;  5L7O C;  4NN0 A;  1EUU A;  4AGV A;  1IS5 A;  2FMD A;  4QT6 A;  3LB9 A;  3Q8E A;  3UL2 A;  1PM4 A;  4A6S A;  5C33 A;  4QKF A;  1GYK A;  4GUL A;  4Q4W 1;  4QPW A;  3WUC A;  4AI0 A;  1PVC 2;  3GZA A;  1PO1 2;  4BLI A;  3ZXF A;  2E26 A;  2QQJ A;  1ULC A;  4PIX A;  4WM7 C;  5DUW A;  5L9R A;  3ZFF A;  3ZM8 A;  2RR1 3;  3ASI A;  3FFZ A;  1H1M A;  4PJY A;  3IIA A;  4FFF A;  5CZK A;  1UKR A;  1QH6 A;  4JGY C;  3WF2 A;  4NHY A;  3NV1 A;  3ZXA C;  4Z1V A;  3O1P A;  4ES9 A;  1WW7 A;  3GF6 A;  1H1I A;  3R05 A;  4QGN A;  4JRL A;  5B2G B;  2XPJ A;  4FP3 A;  1OMI A;  2D43 A;  2VTX J;  4CU8 A;  1G7Y A;  3T2Q A;  4Q1P A;  5KBF A;  3BIE A;  1RUJ 3;  5DUV A;  1SLL A;  1UU6 A;  5FOJ B;  4QU2 A;  4BZ4 A;  2VPV A;  4S2H A;  1GNH A;  1S0C A;  4GJZ A;  1A6C A;  1OUR A;  1UMH A;  2MEV 2;  4OMD A;  4RGG A;  3RG0 A;  2W87 A;  2KA3 A;  4LKF A;  3B02 A;  1WCS A;  4KI5 M;  5IUQ A;  4IEV A;  3K3O A;  5KXD A;  1W9T A;  1DFQ A;  1WCQ A;  1OLM E;  4DZG A;  5EWS A;  2GN7 A;  1HB1 A;  2EIB A;  3WP5 A;  1EPW A;  1NCQ C;  2JDK A;  3C7H A;  4RFT 0;  5CBL A;  3PIG A;  1CJP A;  2NN8 A;  3ENR A;  2XJR A;  4L0P A;  4QB1 A;  2VMI A;  4LQR A;  2ARB A;  4PLN A;  2HWD 1;  4HAN A;  2WZR 1;  3RVH A;  5JZG C;  1W0O A;  1W8O A;  2W1W A;  5J96 B;  1YQC A;  2HWF 1;  2YPD A;  4XUN A;  4JRA A;  3UK9 A;  5J3U A;  4KL1 A;  3PLQ A;  3UGH A;  2IC1 A;  4ISQ A;  1ASJ 2;  3CIH A;  5JAX A;  4XOG A;  3WW1 A;  3O1V A;  4BQX A;  1SLB A;  5F5A A;  3U10 A;  4LKE A;  4QHO A;  2IUW A;  4QPI A;  5JI7 A;  4WM8 A;  2NP0 A;  5CAD A;  4GZ9 A;  1XQN A;  1QKQ A;  1R08 2;  4K1Y A;  4LLF A;  1W06 A;  1XSR A;  1MPX A;  1H2N A;  2BTV C;  3UJQ A;  5LEJ A;  3TN9 3;  2E51 A;  4N7U A;  4XUO A;  5AC9 3;  3T08 A;  4S2G A;  4ZS2 A;  2PYT A;  4IER A;  3LSD A;  2RDR A;  4LEJ A;  4JTO A;  3V0A B;  1RUO A;  2CGP A;  4Y4R A;  3IKW A;  3GAL A;  4K8R B;  5FWJ A;  3HWJ A;  1HQW A;  3DYM A;  3KMH A;  5FZF A;  4OHZ A;  1X33 A;  1SBD A;  5FP4 A;  4JKL A;  2ZMK A;  3DEC A;  2H0V A;  2Z2S B;  2C0Z A;  4DY5 A;  1DIW A;  3OGV A;  3D6E A;  3VBR A;  2RS3 2;  3I2F A;  2VC9 A;  1RUE 2;  4CVU A;  4Y22 A;  4DUV A;  2ZKL A;  4UF0 A;  3DKW A;  5JXH A;  3JZV A;  3ZSE A;  4CPB D;  5FLJ A;  1O5U A;  2VZT A;  1HRV 2;  2MNG A;  4N9H A;  5C3R A;  1AL2 1;  2JB4 A;  2P37 A;  4RD7 A;  1HLC A;  1QF3 A;  3AFG A;  3T0B A;  4NHL A;  4QDQ A;  2NM1 A;  1R09 1;  2ZGU A;  3VGI A;  1RXG A;  3S5Q A;  2NMO A;  3IAQ A;  5A1A A;  3FBY A;  4CU7 A;  2VCM A;  4Q2F A;  3NJY A;  5AFB A;  1NYW A;  4OHW A;  2BJS A;  2G9Z A;  4YGC A;  1WMX A;  3TBD A;  3T2P A;  1GZT A;  4PBP A;  2D3S A;  4QXC A;  3VHO A;  4E4D X;  3MYX A;  3PUH A;  4HN0 A;  1J3Q A;  3BGA A;  4DEQ A;  2FDF A;  1QMJ A;  1PNG A;  5GZF A;  1XBF A;  4DMI A;  3LE0 A;  1RMU 2;  1W8W A;  3IDA A;  2QJV A;  5IVB A;  3OPZ A;  4GWM A;  1V6M A;  2W91 A;  2WDB A;  4J25 A;  4KU8 A;  5GLW A;  3GHN A;  1EAH 2;  3J26 N;  4Y4Y A;  1W04 A;  3N3H A;  1PO2 1;  4IV1 B;  2JG8 B;  2R7E B;  4LHK A;  4DFS A;  1DGW X;  3I2G A;  5F3E A;  3ZIX A;  1GZW B;  1LR5 A;  3LEG A;  3POE A;  5LBF A;  2VW2 A;  4E8D A;  2RHP A;  1I1E A;  5FZA A;  4XBL A;  3FHA A;  2XJU A;  4MYE A;  1LGB A;  4FPK A;  4E4S A;  2JE7 A;  2VNG A;  4CUB A;  1VP6 A;  3K4D A;  3CJI A;  4BH9 A;  5A7S A;  4YW4 A;  4CEY B;  5LY1 A;  5ABJ B;  4CP9 A;  1LRH A;  5KHJ A;  4COV A;  5BNN C;  4WVV A;  1ND3 B;  3A22 A;  3NNL A;  3VBU B;  1NA1 C;  4IE4 A;  1QU0 A;  4KWU A;  1POV 1;  4FP2 A;  3LQC A;  4FOQ A;  1XE7 A;  1FNY A;  3NV3 A;  4J1X A;  1W3X A;  4EV0 A;  4Q0S A;  4Q5O A;  4Q26 A;  5CYY A;  4JGZ C;  5EHD A;  4GAL A;  1Y9M A;  1VBE 2;  4GXL A;  3F2Z A;  4O65 A;  1BLZ A;  2J1R A;  3W20 A;  3H7J A;  2AR6 A;  3RWK X;  4NID A;  4RS5 B;  3BTX A;  2HWC 2;  1W8T A;  1PMJ X;  2A75 A;  5DDJ 2;  1UY2 A;  2Z69 A;  4EZH A;  1PMI A;  4YZ3 A;  3SEP A;  3IN9 A;  4YW6 A;  1OLQ A;  5IVY A;  4TTG A;  5LBE A;  4X8N A;  4IV3 B;  1D0H A;  1QQP 2;  3J7H A;  5IAX A;  4Q0Q A;  2WNE A;  3KF5 A;  1XSQ A;  4AAX A;  1QGL A;  1WW5 A;  4N43 B;  3OD4 A;  4XVH A;  4ZPI A;  3LDB A;  3RFR A;  2C26 A;  5E6H A;  3VDD B;  3TYJ A;  2C4X A;  3I2O A;  2B9V A;  4Y1V A;  1GP5 A;  5IVJ A;  4XQW A;  1K5M A;  5A3M A;  1FXZ A;  3QH7 A;  1LOD A;  5FYB A;  3HOB A;  3LOI A;  2A6V A;  5FRA A;  3FC0 A;  4LBM A;  4BQ2 A;  1UY0 A;  5FR3 A;  3BTA A;  1RUD 2;  3E5Q A;  2A73 B;  1S1A A;  4UT5 A;  4E8C A;  3POY A;  2ARA A;  4FTE A;  2PHR A;  2QUO A;  2UUR A;  4PDW B;  3ETP A;  2EIC A;  4ERO A;  2UWC A;  2ZGT A;  3SKJ E;  1MQT A;  4NR1 A;  2ET1 A;  2B4K A;  1RUJ 1;  4GIQ A;  4J6G A;  4COU A;  1HRI 2;  4DIN B;  2WFF 1;  1TEI A;  2RS1 2;  4LBQ B;  5FK7 A;  5GZD A;  3WUD A;  2QTW B;  1MZ6 A;  1Z7S 1;  5A3U A;  3C3V A;  3WX5 A;  2W1U A;  4OLL A;  2E6V A;  1W9F A;  2J1V A;  3POB A;  2DDU A;  4CDQ A;  1PO1 3;  1NLS A;  3A7Q A;  3HN3 A;  5BNO C;  2PN5 A;  3FE5 A;  5JXI A;  4GH4 A;  1EV1 1;  4Y1X A;  2GU9 A;  3I2J A;  2VZO A;  1CN1 A;  5F9T A;  4BMB A;  5L19 A;  5LK7 B;  2QZ2 A;  3ACF A;  5A1F A;  3I4I A;  3N9L A;  4DXT A;  5C3Q A;  1ZRC A;  4BK5 A;  5FBJ A;  4XIL A;  4FPG A;  5IFT A;  3U4X A;  1JU3 A;  1S2E A;  1RHI 2;  1H8V A;  3OPT A;  5AVA A;  3PJQ A;  3WG2 A;  1JYV A;  2AGS A;  3FLR A;  1LOF A;  3NST A;  1LEN A;  5I0S A;  4JTN A;  1CAV A;  1KS5 A;  2WSU A;  5FZ7 A;  2VL4 A;  4NJ4 A;  3T1M A;  4HK8 A;  3VUO A;  3R6S A;  3ETQ A;  3ZFG B;  2XLA A;  3VN4 A;  4YWA A;  4Y1Y A;  2BVV A;  2R32 A;  4OHY A;  2Q4S A;  1NY7 1;  2V73 A;  2NPI A;  4Q4W 2;  4RGA A;  4K7J A;  5F5I A;  5CG8 A;  4ARX A;  1JYC A;  1LES A;  5HV4 A;  3M3O A;  4N9I A;  4I0A A;  3N7M A;  4KQ7 A;  1C28 A;  1UL9 A;  2YBP A;  4H7L A;  1CAU B;  5KXC A;  2ZGS A;  1BXH A;  3IDE A;  3LGR A;  1KRI A;  5A3W A;  1WBL A;  1PGS A;  2OZJ A;  2H6C A;  5D21 A;  5A6X A;  4K3U A;  4XC9 A;  2VXJ A;  2JB8 A;  1N1Y A;  4Z8B A;  1B09 A;  3WNX A;  1SMV A;  5C9A C;  3U0Z A;  4XTP A;  4LBK A;  4LUL A;  1W9Y A;  4CDU A;  1UU4 A;  2WZ8 A;  1JOJ A;  3ZKU A;  3M1H A;  4XJU A;  3JQW A;  1QJU 1;  2WNV B;  2A6X A;  4F83 A;  5K0U C;  2YRO A;  4AQ2 A;  3VL8 A;  2ARX A;  1WCD J;  1XNB A;  4ZHN A;  4MH0 E;  1XU1 A;  4MUV A;  1CAX B;  3MIH A;  5IW0 A;  5JMC A;  3OGG A;  3DPR A;  1TZO A;  4MGQ A;  3ZYH A;  2JDP A;  1V00 A;  1F5F A;  2DCZ A;  4MXV A;  1XYN A;  2RM2 3;  3KQ4 B;  1ZYB A;  2IXK A;  4HPK A;  1LGN A;  3VKM A;  1LEC A;  4PI2 A;  5CIS A;  1YFX A;  1CPN A;  1NG0 A;  2WZR 2;  3ILF A;  4HVR A;  4BHP A;  5FP3 A;  4ZZ5 A;  2HWF 2;  1RUE 3;  4M3C E;  4AFD A;  2XKO A;  3KT1 A;  4UBH A;  5FIX A;  5FPB A;  2VZQ A;  3B69 A;  1RUH 2;  2VTX A;  1EUT A;  2DFC A;  1S0J A;  2VU9 A;  3RMY A;  3RS6 A;  1M4W A;  3WF3 A;  2K0G A;  4JCK A;  4U36 A;  1UXX X;  3NNF A;  4QQ2 A;  2GAL A;  3GBW A;  3VKF C;  3WF4 A;  2Q1M A;  3JBG 1;  1WLC A;  3ZDS A;  3DXT A;  2ID4 A;  2C1F A;  4P9Y A;  5E1R A;  3LIH A;  3TEZ A;  3KQR A;  2B45 X;  2SBA A;  4XDP A;  1CAW B;  3E97 A;  4UFL A;  4E9K A;  2XB6 C;  2JEC A;  4AVA A;  4N90 A;  2J1E A;  3WCR A;  1LAJ A;  1TME 1;  5IVC A;  1W9S A;  3E1F 1;  4HN1 A;  1H8T C;  2PHF A;  3BKZ A;  4L9B A;  1VLN A;  3DUI A;  3RWN A;  4IV3 C;  1GOH A;  3B9I A;  4Q0P A;  4QQO A;  3PU3 A;  3B00 A;  4A3Z A;  2C6S A;  1JOP A;  2P3I A;  2WT1 A;  2X5I B;  1PVX A;  2GSY A;  2JG9 C;  4QX3 A;  1V70 A;  3HVD A;  3OYW B;  2DU1 A;  4QPY A;  4XBQ A;  4AVC A;  1R09 2;  4MHR A;  2UY9 A;  4IND A;  5BUV A;  3GM8 A;  1O7F A;  2WZP P;  1ND2 C;  1IS6 A;  1BEV 1;  2VCC A;  1F5J A;  1LOG A;  2EID A;  3GXU A;  2VG9 A;  4FPE A;  4XF3 A;  5LAS A;  3WW2 A;  4OQ8 A;  4UFM A;  3O14 A;  3ZXK A;  2VZ3 A;  1Q43 A;  4MGZ E;  1AR8 3;  1PK6 C;  4X6R B;  3AP6 A;  4Y1Z A;  3M70 A;  4LNV A;  5GAL A;  4Q4X 1;  3N9M A;  2K46 A;  1TE1 B;  4A7K A;  4A45 A;  2FCT A;  4N7I A;  5DG1 A;  3H8X A;  2HYX A;  2VOX A;  2XML A;  3T30 A;  4GMP 3;  4FQZ A;  4YVW C;  1VBB 1;  4YPJ A;  4NIG A;  1SDD B;  5FY0 A;  2Q8E A;  4P9G A;  1VBE 3;  2RDN A;  4BYY A;  5BNQ A;  5FZ4 A;  2Z4F A;  4B4P A;  1RTV A;  3VZN A;  2XWJ B;  4ZXE A;  1DHK B;  2ETE A;  3WDT A;  4CRQ A;  5DDJ 3;  4XCB A;  1KJR A;  4IE6 A;  4L2N A;  4LTA A;  4PQ9 A;  2BFU L;  1W90 A;  1RL3 A;  1WLT A;  1QJX 2;  4XXP A;  5IYY A;  4B3N A;  3V0A A;  4IEU A;  5KC5 A;  4ATF A;  1NCR C;  1WBF A;  2KM2 A;  3ZFG C;  2XVL A;  2YBS A;  3OCP A;  5FPV A;  4GMP 0;  2GH2 A;  5DAB A;  5A7N A;  3OTF A;  3ACL A;  4E4H A;  1SLI A;  5CFC B;  3MUZ 1;  2XLG A;  3U11 A;  1W8N A;  2GMM A;  5BXX A;  2WNU C;  1U5I A;  5FY9 A;  3MIB A;  1RUD 3;  1Q8Q A;  2Y33 A;  1CD3 G;  2WZE A;  5FY5 A;  4PCR A;  3AZV A;  4U2A A;  5A1L A;  1XE0 A;  1TMF 3;  3VD5 A;  2OT7 A;  5IVE A;  3D3A A;  2BNM A;  2QNK A;  1RJ8 A;  4XHX A;  4LOR A;  3UGG A;  1H4G A;  1O8P A;  1CWP A;  2ZEZ A;  4LJH A;  4DO0 A;  4LUK A;  2EVX A;  2QQW A;  5C4W C;  4RQP C;  5CA6 A;  4BPZ A;  1ZZ9 A;  3WEZ A;  3S30 A;  3VZM A;  4Y33 A;  3POS A;  3T0D A;  5FAX A;  2WS9 2;  4TYS A;  2J1S A;  2LTN A;  4GKY A;  4W6W A;  1OT5 A;  1ZA4 A;  3BU0 A;  1M06 G;  3ACH A;  1R1Z A;  4UW4 A;  3CF6 E;  1EP0 A;  1RED A;  2XQR A;  4NUB A;  4S2D A;  2VUC A;  2P6C A;  4HKO A;  2RMU 2;  4IL7 A;  3B3Q E;  4LR4 A;  2XJS A;  2NYY A;  4IV1 A;  1ODM A;  2JG8 A;  1RHI 3;  4QDR A;  3ZXD A;  4AI3 A;  1GAN A;  1QWR A;  4LA2 A;  4AZZ A;  3NAP B;  1GZW A;  2AEZ A;  4RSU A;  1JH5 A;  4D7T A;  1CGP A;  1DZT A;  2OQ6 A;  1WA4 A;  3ROU A;  1Q3E A;  1UCX A;  2ZGP A;  1AL0 G;  4IQP A;  2B7Y A;  5T50 A;  5FPX A;  3MZH A;  2PLV 1;  3D82 A;  3VBH B;  1WW4 A;  2W68 A;  3J7L A;  4RR3 B;  4CEY A;  4JX0 A;  5A33 B;  5ABJ A;  4DNY A;  1F4H A;  2ZS6 B;  3E6C C;  5H9S A;  3T4V A;  1RUG 3;  1E5H A;  2DCY A;  4AQ6 A;  3KV6 A;  1ND3 A;  1OA4 A;  3VBU A;  1QJF A;  5FUI A;  1R1A 1;  2WC2 A;  4IEZ A;  1WA6 X;  2JD4 A;  3EO6 A;  3DYP A;  3W5N A;  2P4E A;  3O1U A;  1A78 A;  2IWG B;  3W59 A;  1VBA 1;  4YNI A;  5A32 B;  2GN3 A;  1PIV 3;  2BFU S;  3NJZ A;  1UPS A;  1ZZC A;  2RM2 1;  1SQ4 A;  1SCS A;  3AL5 A;  3MGU A;  1FX5 A;  1JHJ A;  1XRU A;  1ZBE 2;  3HNM A;  1NUK A;  3KZ4 C;  5BPX A;  3PMS A;  4RS5 A;  2XL9 A;  2LM3 A;  2ZGN A;  4PF1 A;  4K20 A;  4BU2 A;  2VOW A;  4GWI A;  2DV9 A;  1G8W A;  2GND A;  5DAQ A;  4W6X A;  2YDE A;  1UYY A;  5L73 A;  1SHW B;  2FDG A;  1WZX A;  4YSF A;  4FSJ A;  2BRT A;  1FOD 1;  1NY7 2;  3THD A;  4NE9 A;  4N43 A;  1A8M A;  1BMV 1;  1OC1 A;  4IEO A;  4WBB A;  4PF5 A;  3WDW A;  5LRS A;  3WHU A;  2ORZ A;  2YZ4 A;  3VDD A;  2R07 2;  4LOS A;  2JEN A;  4KG0 A;  4BE3 A;  5JOX A;  1NXD 1;  3JB8 A;  3IAP A;  5T5J A;  4XFC A;  2CSG A;  3J9S A;  2ZHN A;  5T52 A;  4CCO A;  5JLV A;  3AYE A;  2VME A;  2BUK A;  4PDW A;  1WME A;  2VOT A;  3HJR A;  3P5B A;  3ZOI A;  1RUH 3;  2IFW A;  3AYD A;  3MLJ A;  1UXZ A;  1YYN A;  2Q0A A;  3H8O A;  4QPI C;  3KV9 A;  2PQS A;  2W08 A;  4LBQ A;  4WM8 C;  4C1X A;  5JXJ A;  5JXG A;  4NPM A;  3GBF A;  4PIZ A;  3NWK A;  1D2S A;  1UOJ A;  3N9O A;  4OI0 A;  3MLL A;  1XNK A;  1OOP B;  4NPR A;  2R1D A;  4LXL A;  1F15 A;  4MX3 A;  1RUI 1;  1OUS A;  3CZJ A;  5FO7 B;  2DUO A;  2ZX0 A;  2H0B A;  3D8C A;  1NQJ A;  1Z0H A;  4BIS A;  3SHR A;  4EN7 B;  1BVV A;  2VY0 A;  3JU9 A;  5F39 A;  3KT4 A;  4XDO A;  2W92 A;  3SIT A;  2O8Q A;  3AVR A;  2W2I A;  1VMF A;  1AR8 1;  3KS7 A;  4FFH A;  3WNO A;  1CR7 A;  2FZ2 A;  4IUG A;  4B4R A;  2D97 A;  4KWJ A;  3T09 A;  1GR3 A;  4AGG A;  4IGO A;  4NHM A;  3X29 B;  4NIH A;  1UZY A;  2YC2 A;  3ZFG A;  4TWT A;  1PHM A;  3VDB A;  2KD7 A;  1LCL A;  1S0G A;  4M01 A;  3KHB A;  1BKZ A;  1WMD A;  3GHM A;  3KGZ A;  1GIC A;  5C5T A;  4YZ5 A;  2Y34 A;  2Y6J A;  4XMA A;  1O5L A;  2P3J A;  4XZU G;  4OYU A;  1O8S A;  3RZM A;  3JBG 2;  3IDC B;  3DV8 A;  1SCR A;  1KGY A;  3KCC A;  1W6P B;  1VBC 3;  3GCX A;  1WCU A;  4IE7 A;  1J3P A;  4MSV A;  5BYN A;  5C5U A;  2BW8 A;  3DKQ A;  1ZZ8 A;  5ACA 2;  1CAU A;  2PHL A;  1UYZ A;  3CEW A;  3KVA A;  1RUF 2;  1TME 2;  2ARC A;  1O4Y A;  1LB2 A;  1U5X A;  1WWY A;  1O59 A;  2VZU A;  3HAG A;  4HXC A;  4LBJ A;  3NL1 A;  4R9D A;  3PUS A;  1Q5O A;  1GQH A;  3CJX A;  3DCQ A;  3RZH A;  4L97 A;  1XND A;  1PZ7 A;  1R64 A;  1N47 A;  3MW3 A;  3OGS A;  5FQ0 B;  3WHT A;  3ZN5 A;  1QOT A;  4SBV A;  1L7Q A;  4I2O A;  1JTZ X;  4MG2 A;  1WGP A;  4YLZ A;  1RUC 1;  2A6Z A;  2WNV A;  5H9R A;  1JZ4 A;  4KWK A;  5I93 A;  5AVP A;  2WO7 A;  1BEV 2;  4EQV A;  1LED A;  1LOC A;  2P34 A;  4Y5S A;  2J1A A;  3WDU A;  1QJX 3;  4MXW B;  1MEC 2;  3CJI C;  3ZN6 B;  3ZXG A;  3M3C A;  1CAX A;  3MPB A;  1UKG A;  5C3O A;  4W50 A;  4QGM A;  3H8U A;  4XDQ A;  1VRH 3;  2XJQ A;  5FZ3 A;  3NKG A;  5HCA A;  4P9W A;  2ZA9 A;  4GA9 A;  5JWP A;  4ZON A;  3AYA A;  1OD3 A;  1BJQ A;  4I0W B;  3ZSL A;  4AED B;  2YY1 A;  2PXJ A;  3OUH A;  5IK7 A;  2J42 A;  1VBB 2;  2WA4 A;  4NAO A;  3L2Y A;  4XJ8 A;  3C7F A;  1DDL A;  1JYX A;  5EFU A;  2BBA A;  1PGW 2;  2TUN A;  5FP8 A;  5A7Q A;  3WCS A;  1UF2 C;  1SBF A;  3B9C A;  4P08 A;  3UYJ A;  2MPF A;  1WMF A;  2PHX A;  1VBD 3;  3ZX7 A;  4AHZ A;  3IPV B;  4YGD A;  4EWA A;  3JD7 2;  3PVB B;  1K5J A;  3ZPY A;  4AI2 A;  4F8A A;  1CAW A;  4CUG A;  5C7G A;  1FPN 3;  2XHN A;  5SV5 A;  3LAG A;  2Y64 A;  4UFK A;  1GV9 A;  3AMQ A;  5FYM A;  4DOU A;  2GZW A;  4QGL A;  3U07 A;  1H2M A;  2JDM A;  4A7Z A;  1C4R A;  1RJ7 A;  1K5M C;  1V6K A;  2ZTN A;  5CKM A;  4NRO A;  5JVV A;  2SLI A;  1PGL 1;  2RMU 3;  3ZO0 B;  3GCW A;  1IQA A;  3KV5 A;  4NRM A;  3SCH A;  4CEW B;  4DEV A;  5FO9 B;  2YC0 A;  4JVA A;  2X5I A;  1FI2 A;  2QBX A;  1W28 A;  2BOJ A;  2IXC A;  1BK0 A;  1V0A A;  3LDK A;  2YB7 A;  3OYW A;  3SC7 X;  4YG3 A;  2VZV A;  1ZBA 2;  2WT0 A;  1MQT C;  3KLS A;  1GQP A;  3JB4 C;  4R52 A;  1KDK A;  2CWS A;  5GM0 A;  1AR9 1;  1O91 A;  1V9U 1;  3ZKY A;  1MZ5 A;  1DQ5 A;  3MFA A;  2ZGK A;  3VDA A;  2RDS A;  2OW4 A;  2DVB A;  4DPN A;  4A7Y A;  4CDQ C;  2ZHK A;  1YWK A;  2HEW F;  4BWO A;  2DUP A;  3Q8F A;  4LBQ D;  1QJZ A;  2CAV A;  1HXS 3;  4GH4 C;  1HW5 A;  2VTF A;  4K6B A;  5FP9 A;  5HPO A;  4YG0 A;  2WO2 A;  2Y26 A;  2HWB 2;  1DYO A;  4HKL A;  1H0B A;  1ONA A;  1LOA A;  2A3W A;  1COV 1;  2WSV A;  1U5Y A;  2BOI A;  3FLT A;  3RI8 A;  4P5H A;  4LO7 A;  2IFR A;  2WJS A;  1LOF C;  2D6N A;  1ZBE 3;  1KIT A;  4Q4Y 1;  1WW6 A;  3AMH A;  5BV6 A;  1AHS A;  4M0H A;  2F17 A;  4GB3 1;  4EN9 B;  2Z5W A;  1DLL A;  1EPZ A;  2NQY A;  3VBF B;  1WKY A;  1CZT A;  2IXI A;  2PLV 2;  4ATE A;  5CFD B;  5A80 A;  1ZX5 A;  1UN1 A;  1X8E A;  4HSJ A;  1QDO A;  4Q27 A;  4CZS A;  5IHR A;  2CHH A;  3NNG A;  2RJL A;  1YO8 A;  4I30 A;  2D6L X;  1AR6 2;  1NOV A;  3O7O A;  4HET A;  5D8A A;  1KFU L;  3J7M A;  1FMD 1;  4KGG A;  2CY6 A;  1R1A 2;  2WL1 A;  3POG A;  2R0F A;  1UMI A;  2OA2 A;  2R07 3;  3H0O A;  5CFC A;  2A7A A;  4LIT A;  5FJK A;  1D2Q A;  1AJK A;  2R06 1;  4LHN A;  4QX0 A;  2BGO A;  4XBN A;  4BIF A;  5KR7 A;  5LA1 A;  1QXP A;  4YGE A;  1LHN A;  1NLQ A;  4CDX B;  2W39 A;  1UY3 A;  5FLH A;  5FKC A;  3VBS B;  3IBM A;  5FZ1 A;  4DXZ A;  1AR7 1;  4IEW A;  1XE8 A;  4AFM A;  4AL9 A;  3WIN E;  1LHO A;  1MS3 A;  1UNB A;  4CDU C;  1RUN A;  1RVF 1;  3WV6 A;  1OI6 A;  1D0G A;  4Q4V 1;  2DUR A;  3AX4 A;  2O8O A;  4WVW A;  5FYY A;  1K12 A;  1ULP A;  1Y43 B;  1AYM 1;  1CIW A;  1NT0 A;  4IEY A;  1IOA A;  1FOD 2;  3FUO A;  1DF0 A;  3DYO A;  4D8M A;  1BMV 2;  4CSW A;  1JUH A;  2ZKN A;  1QOO A;  3BAL A;  1QJY 2;  3HBK A;  5F3G A;  1VBC 1;  2RJ2 A;  3ZLI A;  4ASL A;  4ZKT B;  4BQY A;  3MIF A;  2BPA 2;  4LBL A;  2WWU A;  2HWE 1;  3DPR C;  4AFC A;  4W6Y A;  3MF6 A;  2W52 A;  1SLA A;  3FUQ A;  3WW4 A;  4M3C F;  2Q8C A;  2RS5 1;  5JOY A;  3MFC A;  4RHV 1;  1NE4 A;  3OOX A;  4YFW A;  2R6Q A;  3ZMN A;  3V0B B;  2TBV A;  3NAP A;  2VBB A;  1TNF A;  4FBF A;  4AOC A;  4D7S A;  4WVZ A;  4F7Z A;  1QIQ A;  2VUL A;  2B8M A;  1UY1 A;  3DGT A;  1YQ2 A;  3LIG A;  1UPI A;  4JQT A;  3UKV A;  1MS5 A;  4KBB A;  3NV2 A;  3P1I A;  3IT8 A;  1C8M 2;  4HZF A;  4YM1 A;  3S7E A;  3VBH A;  1UWW A;  4MGT A;  4RR3 A;  2D6P A;  3TNP B;  1JYI A;  5APA A;  3I7D A;  5A33 A;  4IDZ A;  4BOW A;  4CXW A;  2NMN A;  2XBO 3;  1X50 A;  3I97 A;  3U78 A;  4YVS B;  5F37 A;  1G9B A;  1S4C A;  3J8F 1;  3UET A;  4A3X A;  5HCB A;  3UKT A;  5ACA 3;  5G05 L;  3KCX A;  3PHM A;  4I3G A;  3OGR A;  2QFE A;  2B39 A;  4XET A;  4ARY A;  1AYN 3;  1RUF 3;  1AX0 A;  1GLH A;  3M3I A;  5A32 A;  2IVI B;  2C5D A;  4L8Q A;  5JOZ A;  4IES A;  1ZRE A;  2WAB A;  1XNT A;  4UFI A;  1VRH 1;  2H6B A;  3BTY A;  1ZRF A;  1DP0 A;  1ZNP A;  3FZ3 A;  2PEL A;  4LHL A;  3H8R A;  1SFY A;  3WG3 A;  5K9Y A;  2XWB B;  2V5Y A;  2VMD A;  1V6N A;  2PAK A;  3HD8 B;  5J1X A;  1IKQ A;  1SEF A;  1VB2 A;  1DGR A;  1QEX A;  1V6O A;  3GYD A;  4XF9 A;  3WY6 A;  3EYP A;  2BQP A;  1W6Q B;  1ZM1 A;  4Z2A A;  3LPF A;  4R9B A;  4N53 B;  3LWC A;  4XF0 A;  3VHN A;  2RR1 1;  4CU9 A;  1G86 A;  4KGQ A;  1YJK A;  2WQ4 A;  3SLI A;  4XEZ A;  3VHP A;  1D4M 2;  2V72 A;  1SLT A;  1MEC 3;  1BBT 2;  2BV4 A;  2Q8O A;  3O1R A;  4YAR A;  2G9G A;  5BNP B;  3KGL A;  4Q8L A;  1UY4 A;  2L9L A;  2GDF A;  2J22 A;  1XC6 A;  3WT3 A;  4HKW A;  2O1Q A;  3BVC A;  3I2I A;  1YFY A;  2R04 2;  3HT2 A;  5GLV A;  1W6N B;  2V4V A;  2E7T A;  3NVC A;  4BME A;  3FFQ A;  4MVT A;  4EZ4 A;  1DCS A;  1PVC 3;  2YPJ A;  3CBN A;  4Q8K A;  3ORJ A;  2JE9 A;  1LU1 A;  2WA3 A;  4PI0 A;  2CNA A;  5FYV A;  1W2T A;  2BGP A;  3MF9 A;  2YU2 A;  4LOT A;  1GWM A;  4NAM A;  5SV8 A;  4BQW A;  1SFP A;  1OOP A;  2JD9 A;  2X29 A;  3FHI B;  3JD7 3;  2EXJ A;  4V2V A;  5FZK A;  1UOG A;  4AK3 A;  4A41 A;  4DXR A;  1YEW A;  4AF9 A;  4NPL A;  2AEN A;  4KBZ A;  2WAA A;  3WZ1 A;  5I8S A;  2D6M A;  4ITC A;  1ZZB A;  1HJF A;  3W58 A;  3OUI A;  3ABZ A;  2VGD A;  1VE0 A;  1JMU B;  2VZP A;  1A8D A;  1HXS 1;  4UW3 A;  2V4A A;  2JX9 A;  2GC2 A;  3EQE A;  1YFU A;  2MEV 3;  3AP4 A;  1XXN A;  5FZI A;  1YFW A;  5B4N A;  2VR4 A;  5EPA A;  5KC6 A;  1HIX A;  3AMM A;  4EN6 B;  3AKQ A;  1AX2 A;  4BK4 A;  3THP A;  2JDN A;  2FHR A;  2GH8 A;  1ULE A;  2Y6K A;  4O9E A;  2ZGQ A;  3TN9 1;  4CCJ A;  1XB9 A;  4R4Z A;  1UQX A;  1ZBA 3;  1KFX L;  3I3E A;  4QPG B;  5AC9 1;  2EAK A;  2LAL A;  1O3Q A;  1OA2 A;  1W6P A;  3I8T A;  3ST7 A;  1GFF 2;  4URA A;  4QMA A;  4TZD A;  1N1T A;  4YM2 A;  3ZSM A;  3RGB A;  4W8J A;  1V6I A;  2VVE A;  2YC4 A;  5K8S A;  1J1L A;  2WLQ A;  1ASJ 3;  3ZYG A;  4KWL A;  4EE2 A;  2FBE A;  3QCW A;  2W95 A;  1BK1 A;  4HOO A;  5GLU A;  3LKJ A;  2HWB 3;  4XTM A;  1GKB A;  5FZC A;  4ES8 A;  3Q8C A;  1PGL 2;  1LOE A;  1R08 3;  5HCH A;  3PIJ A;  2IXH A;  4IV1 C;  5FQ0 A;  3AZY A;  1VMJ A;  2JG8 C;  2QDR A;  3AP9 A;  2VE1 A;  3ILN A;  3PUR A;  4HL0 A;  2AAC A;  1I5P A;  1KD7 A;  2E31 A;  4NHK A;  5C8W A;  2FDJ A;  3E6D A;  5JR2 A;  1MVE A;  1UZ0 A;  4CUC A;  2ZMN A;  2PFW A;  2Q1F A;  3ACI A;  4MOA A;  3LEK A;  1F2N A;  1JUI A;  5JDB A;  3B94 A;  2WUH A;  4X6Q B;  1PX3 A;  4DQA A;  2Z42 A;  2HWD 2;  3M7A A;  1ACC A;  4MXW A;  1VRB A;  3ZN6 A;  4AHW A;  1ENS A;  2FDI A;  1WLD A;  2RS3 3;  4CEY C;  2BBV A;  5ABJ C;  1MS1 A;  3MI8 A;  1G9C A;  1AR6 3;  2QQL A;  4NRP A;  1ND3 C;  4LUM A;  3VBU C;  4A44 A;  1F4A A;  1DG6 A;  1HRV 3;  2ATF A;  5D2A A;  4BDV B;  2R16 A;  1U5Z A;  1PM7 A;  1E5S A;  1W6M B;  1UIK A;  1NZI A;  3ZSK A;  3S5A A;  4OI1 A;  1REE A;  3III A;  1CES A;  4AED A;  2VMH A;  2WNO A;  1LUL A;  2D5F A;  2DVD A;  2UY8 A;  4P9I A;  4YG6 A;  4TSV A;  3O1T A;  2VBD A;  2ZGR A;  1Y7B A;  3EHK A;  3WLU A;  2UYB A;  4OUM A;  4PLM A;  2WRA A;  2CDO A;  1I6X A;  5FKB A;  4BIO A;  4Q4Y 2;  4H14 A;  4RS5 C;  3B93 A;  4B7E A;  3IPV A;  3OEA A;  1UZZ A;  2VM9 A;  3ITQ A;  5FOB B;  4UXA A;  3A21 A;  1UYX A;  4B8E A;  1RMU 3;  2HBT A;  5FPZ A;  3QAC A;  4YM0 A;  4R8H A;  3RYK A;  3ES4 A;  2B46 X;  3AK0 A;  5T55 A;  4CDW B;  4ZU7 A;  2BVB A;  2A6W A;  2IXJ A;  3E5U A;  1EAH 3;  4N43 C;  5FUP A;  3S7I A;  3GZU C;  3N4M A;  2MHF A;  3I3D A;  3PUI A;  4BQ3 A;  1FMD 2;  5LRR A;  2XBO 1;  3OUJ A;  3WVJ A;  2HEY F;  3WXP A;  1J59 A;  5FLI A;  1AL2 2;  5E16 A;  3VDD C;  1ZA7 A;  1WD3 A;  1VMH A;  1LNS A;  5FMB A;  5LEK A;  3FBM A;  1JBC A;  1TG7 A;  1YCI A;  4ONU A;  3BOW A;  2R06 2;  3MPP G;  1H30 A;  3H50 A;  4CEW A;  2D7F A;  4P00 B;  1UIJ A;  1Y3T A;  3RZG A;  2DTY A;  3OG2 A;  3TEW A;  1OBN A;  3WP4 A;  3ZYB A;  2QQM A;  2YV8 A;  4FPY A;  4PDW C;  2OS2 A;  3RYP A;  1LHV A;  3LEM A;  5FMD A;  1JZ6 A;  1JXN A;  4PBO A;  3SH5 A;  2N7G A;  3HR9 A;  4Y5Z 0;  4YM3 A;  4FT8 A;  3VBO B;  5KXE A;  4JC1 A;  3OEB A;  3AKP A;  5LZ6 A;  3U37 A;  2GNM A;  5FZ8 A;  1C8M 3;  3CDZ B;  1OVS A;  1W9W A;  2VCB A;  2ZZJ A;  4Q4V 2;  5D1I A;  2FDK A;  4O61 A;  2WIN B;  1V6J A;  3HIF A;  4ZU4 A;  4B29 A;  2J1U A;  2VD7 A;  1D4V B;  3WNP A;  2ZX1 A;  1OPO A;  3ZIW A;  3CLP A;  3POJ A;  5FPU A;  1JYN A;  4IXL A;  1PO2 2;  5H9Q A;  3PME A;  2XVG A;  5GZG A;  2ZOE B;  3RJ2 X;  4HFS A;  5JOW A;  3FMG A;  3MID A;  2HWE 2;  2ILM A;  1IGO A;  2VMG A;  2W46 A;  2XG3 A;  2HWC 3;  3IWZ A;  3MIE A;  3VZJ A;  4ET7 A;  4XFF A;  2DWR A;  2HYK A;  4O9G A;  1ULG A;  4BJ0 A;  1GZ9 A;  1QQP 3;  1YQ8 A;  3O1O A;  2BWC A;  4XW3 A;  3C2U A;  3GJA A;  3ZFE B;  2OII A;  5DUX A;  1J84 A;  2EAA A;  1BHG A;  1J3R A;  1K3I A;  2DUQ A;  1N3P A;  5D8A B;  4QQH A;  4V1P A;  2WWJ A;  5FP7 A;  3VBF A;  1SBE A;  1UO9 A;  1PO1 1;  4XYX A;  3AJZ A;  2WQZ C;  5DPN A;  2WN2 A;  5CFD A;  5LBC A;  3NQH A;  4PIY A;  3VKL A;  5IK4 A;  1ST8 A;  2VNV A;  4RGK A;  4QQL A;  3K51 A;  4GAZ A;  4L11 A;  1Q8S A;  5FXZ A;  4HLT A;  2OVU A;  3FWE A;  3WR0 A;  2VJX A;  3SH4 A;  4M00 A;  5A6Q A;  1BBT 3;  5FK8 A;  1QY4 A;  3J8F 2;  1H9W A;  1SPP B;  1OPM A;  2E7A A;  4LMF A;  1EYB A;  4QB2 A;  4HBN A;  5CG9 A;  2O14 A;  3AL6 A;  4CUA A;  3U75 A;  5FZH A;  3UGF A;  2R04 3;  1HRI 3;  4D0Q A;  2VMF A;  4CDX A;  2RS1 3;  4NO4 A;  4LIU A;  3C7G A;  2BDR A;  4TXW A;  3VBS A;  4COW A;  2WYS A;  5DXD A;  1G9F A;  5A6Y A;  3KWV A;  5JSR A;  4E2S A;  4AGR A;  4RA0 A;  2D3P A;  2UWB A;  3GZT B;  5C8C B;  1XNC A;  4QKD A;  3H7Y A;  1IKP A;  5L36 A;  2VUA A;  5T5P A;  3MDP A;  4MET A;  2WNV C;  1RB8 G;  1W2U A;  2P3K A;  3AKT A;  1MS4 A;  4AWD A;  1FV2 A;  4IE0 A;  2RR1 2;  1GNZ A;  5F2W A;  1ZZ6 A;  1VAK A;  1JYT A;  1BQP A;  3RSJ A;  1TNR A;  5FMO S;  1ODN A;  2UU8 A;  5F5C A;  2DF7 A;  2JKX A;  1UX7 A;  4HSL A;  4NVP A;  1QH7 A;  3I3Q A;  3AJY A;  1BZW A;  1Q56 A;  4Y20 B;  1RUJ 2;  4AQT A;  3SMH A;  2XHK A;  3E6B A;  3WDV A;  2WFF 2;  3ZDV A;  3V0B A;  2XLF A;  4M3C B;  4NWV A;  1Z7S 2;  2EXK A;  1H9P A;  2KXL A;  3R4S A;  4Q4W 3;  1U12 A;  1SAC A;  3N7J A;  4CXY A;  4XFA A;  2UYA A;  5FZ0 A;  4OHX A;  1EV1 2;  4FPF A;  3L2H A;  1G9D A;  5FZM A;  1UU5 A;  3IM0 A;  3NNJ A;  3CO2 A;  4C1W A;  2VQA A;  3P3N A;  4Q0U A;  4BB3 A;  3OBR A;  3LA2 A;  3NJX A;  4YVS A;  3S6P A;  4OMC A;  2ZAC A;  4Z07 A;  1IG0 A;  3G6J B;  5AFE A;  5K7P A;  2GNT A;  1YHF A;  2P1B A;  2WT2 A;  2X8K A;  2E63 A;  4FCA A;  1IHM A;  4XAE A;  3ZYJ B;  5L7O B;  3ILR A;  3Q9O A;  4LT5 A;  1NQD A;  1DQ0 A;  1Q8V A;  1RUE 1;  4Y26 A;  3POI A;  3TB0 A;  2VQU A;  2Y0I A;  5A7W B;  5F32 A;  1OUX A;  2AC1 A;  4GD4 A;  3MIG A;  5FYT A;  5J98 B;  1OF4 A;  1OA3 A;  1QOS A;  4Z82 A;  5CNA A;  4DRV A;  3RZL A;  2Y0O A;  1I3H A;  1XYO A;  1DYP A;  2E7Q A;  1X36 A;  2VEC A;  3O5S A;  1D7P M;  4WM7 B;  3N9Q A;  4OUL A;  5CU1 A;  5C6C A;  1X9T A;  4MGI E;  1CPM A;  1GP6 A;  2LRO A;  2X5I C;  4MZU A;  4EYU A;  4JGY B;  3ZPO A;  5LCW L;  1W6Q A;  4HG6 B;  4CCD A;  3H9A A;  5J7M A;  3R4U A;  2X09 A;  4N53 A;  3TN9 2;  3ZYP A;  3I49 A;  2RVA A;  2YHJ A;  4JV4 A;  2YMZ A;  5FRE A;  2WFP A;  4JHT A;  4XE9 A;  3BPZ A;  3ALQ A;  2HWD 3;  1OLM A;  1OH4 A;  2JXA A;  2WZR 3;  4G4F A;  3VD3 A;  3MEP A;  2HWF 3;  3ATG A;  5BNP A;  2GC1 A;  4YZ4 A;  5DAX A;  5ANN A;  1W03 A;  1X7N A;  4FPJ A;  5FY1 A;  2B9U A;  2R49 A;  3VBO C;  2YUE A;  3MV0 1;  3H1W A;  3AMP A;  1HJG A;  2R30 A;  2XON A;  4W65 A;  1W6N A;  2ZGL A;  1W8U A;  1QJU 2;  3GZE A;  1F9K A;  3WF1 A;  1YJL A;  4UAP A;  5DAV A;  5FWE A;  4AFB A;  4AW7 A;  1NCQ B;  4AXO A;  1PNF A;  2FDH A;  2JE8 A;  3LSE A;  3L9J T;  2BU9 A;  5LW9 A;  1QNW A;  2VNO A;  2JDY A;  3AKR A;  4DUW A;  3NKT A;  5JZG B;  5FYS A;  1MR5 A;  2HH9 A;  3K3N A;  1DGR N;  3T3Y A;  3VD7 A;  3N7K A;  3SKV A;  2QVS B;  1CZV A;  3EJK A;  3HT1 A;  4AEK A;  2C24 A;  4DIQ A;  2ZJC A;  1NAE A;  1NE6 A;  1ZZ7 A;  2IXL A;  2Y8K A;  3GJB A;  4LBO A;  5D8A C;  2XXZ A;  3H3U A;  1LTE A;  2EXI A;  4GMP 1;  1AL2 3;  2ZAH A;  2ENR A;  5T5L A;  5CFC C;  2K9Z A;  5ANQ A;  1GUI A;  2AUY A;  3HNY M;  1N1S A;  1MZF A;  1VBE 1;  3QBQ A;  1DZQ A;  4IET A;  3VV1 A;  1R09 3;  4P02 B;  2E33 A;  2A5Z A;  4MGS A;  3JQX A;  4E2Q A;  2B5H A;  3AZX A;  4XUQ A;  5J37 A;  2OX0 A;  4XJ9 A;  4N8M A;  1DQ6 A;  2Z79 A;  4YW2 A;  1H6X A;  1OQ1 A;  5DDJ 1;  1FV3 A;  5FY4 A;  3ZXE A;  4CCL A;  2ADD A;  2JKB A;  3EMR A;  4FOY A;  3O1M A;  4C90 A;  3NW4 A;  4QPG A;  1WLW A;  2XUM A;  2ZHM A;  4IGQ A;  2ZZQ A;  3LF7 A;  4KG8 A;  3ZVX A;  4PHZ A;  1ALY A;  3PVN A;  2DVG A;  4QD2 A;  1LOB A;  2W0X A;  5HCF A;  4KH9 A;  4GKX A;  4QM8 A;  4XFG A;  3ZYF A;  4P5Y A;  1UX6 A;  4CPB A;  1MVQ A;  4MGK E;  5JIA A;  2EA7 A;  3CU7 A;  1PO2 3;  3ON7 A;  3PL0 A;  1RIR A;  1RUD 1;  1I5Z A;  3B7M A;  3VZL A;  1GOF A;  4AI8 A;  1JZ5 A;  4LHS A;  4ASK A;  2P6H A;  3FLP A;  2VUD A;  4GQ7 A;  1TMF 1;  4RYD A;  4YYO A;  1I9R A;  3O0W A;  4I01 A;  1ZRD A;  2Y60 A;  5FZG A;  2B42 B;  4NIA A;  2BNO A;  3NAP C;  4CP0 A;  2WBK A;  1HRI 1;  2JIG A;  3AZW A;  5A70 A;  5IT6 A;  2VW0 A;  4UFH A;  3AMN A;  4Q4X 2;  2G4I A;  1DZR A;  1OKQ A;  3RQ0 A;  3N7L A;  5LB6 A;  1DYK A;  1H2L A;  1POV 3;  5FZO B;  2OQ7 A;  3VBH C;  1T2X A;  1GQG A;  4RR3 C;  2YG0 A;  5FBZ A;  3RI9 A;  4D6S A;  4HVQ A;  2D44 A;  1JZ2 A;  4AVB A;  1BVP 1;  2DCT A;  1T6B X;  1Q8P A;  1FNZ A;  4JDO A;  4QHB A;  3O1S A;  1OXC A;  4LPL A;  1RHI 1;  3CHX A;  2WR9 A;  1W6M A;  1W99 A;  4FI9 A;  5L9B A;  3TRS B;  3WP3 A;  4AAP A;  2BEO A;  3WNL A;  5DMY A;  1JI6 A;  4XQD A;  1ULF A;  2WN3 A;  3LD8 A;  1Q8O A;  4AG4 A;  3KD4 A;  5LK5 A;  4JAA A;  2W1Q A;  4I02 A;  1DQ2 A;  5KHG A;  4OUS A;  5F2S A;  4LBN A;  4P9X A;  2QQP A;  5BNN B;  5DZF A;  2ZAB A;  2XUE A;  4D94 A;  1MS9 A;  1W3V A;  4H55 A;  1NA1 B;  1DQ1 A;  1POV 0;  1QJE A;  2ZGO A;  2V5D A;  1TQ5 A;  2CTV A;  5I8Y A;  4DRR A;  3TWI A;  1LU2 A;  2K2S A;  2WS9 3;  4FTB A;  3IDB B;  1RUG 1;  3RYR A;  3WDY A;  3WQ7 A;  1UAI A;  3K2O A;  2XKP A;  4JGZ B;  1LGC A;  3ZR5 A;  4XF1 A;  4CDW A;  1GMM A;  1H6Y A;  3WG4 A;  4Q29 A;  4LKS A;  2LUW A;  4PT6 A;  1N3O A;  4JQR A;  3KHC A;  4XJW A;  4XPV A;  4OZO A;  4IW3 A;  1PX4 A;  3USU B;  2BGC A;  1JOB A;  1AF9 A;  1LKN A;  1PIV 1;  2AEY A;  4QB6 A;  3MV1 1;  3V56 A;  4XZP A;  4JDN A;  5FZ6 A;  5FZB A;  2Y6G A;  3HN1 A;  3JCI A;  3SEE A;  1CIY A;  4LLO A;  1HB4 A;  2ADE A;  5KWR A;  3RZK A;  4MO3 M;  2WFF 3;  3R0R A;  4RN5 A;  1FYU A;  4QKN A;  2VZ1 A;  3DL3 A;  3AB0 A;  1C5I A;  1Z7S 3;  1CQ9 A;  1IPS A;  4Z92 B;  2DBN A;  2XJP A;  2D98 A; 
#chains in the Genus database with same CATH homology
 2FDF A;  4QKF A;  3O1U A;  4NJ4 A;  4MG2 A;  4NII A;  4CXX A;  3I3Q A;  3BUC A;  3O1P A;  4O7X A;  3O1M A;  3H8X A;  4NIG A;  3BIE A;  2FDG A;  4CXY A;  3I3M A;  4NPL A;  3S57 A;  3RZG A;  4IE4 A;  4IE6 A;  5F8P A;  4NRQ A;  5DAB A;  2FDK A;  4O61 A;  4ZHN A;  3RZL A;  3BTZ A;  4NID A;  3BTX A;  3H8O A;  4NPM A;  3O1V A;  4QHO A;  2IUW A;  4NRO A;  3I49 A;  4NRM A;  3O1S A;  4MGT A;  4JHT A;  3LFM A;  3I2O A;  4IDZ A;  3O1O A;  4CXW A;  2FD8 A;  4QKB A;  4ZS2 A;  3T4H B;  3BU0 A;  4NIH A;  2FDJ A;  3KHB A;  3BTY A;  3RZJ A;  4ZS3 A;  4OCT A;  3H8R A;  3RZM A;  2FDH A;  2FDI A;  3BKZ A;  3KHC A;  4IE7 A;  3BI3 A;  4NRP A;  3T3Y A;  4IE5 A;  3S5A A;  3T4V A;  4QKD A;  3RZK A;  3O1R A;  3RZH A;  4QKN A;  3O1T A;  4RFR B;  4IE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...