3T4HB

Crystal structure of alkb in complex with fe(iii) and n-oxalyl-s-(3-nitrobenzyl)-l-cysteine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
201
structure length
201
Chain Sequence
b'PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Dynamic combinatorial mass spectrometry leads to inhibitors of a 2-oxoglutarate-dependent nucleic Acid demethylase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 48
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3t4hB00
4IE0A 3O1TA 4NROA 3H8XA 2FDGA 2FDIA 3BIEA 4IE7A 3BKZA 3I49A 3O1RA 4CXWA 3BTZA 2FD8A 2FDHA 4OCTA 4QKBA 4NRMA 3RZKA 4QKDA 4QHOA 4NPMA 4IE6A 2IUWA 3T4VA 3BTYA 3I2OA 3O1UA 4NIGA 3RZLA 4O61A 4O7XA 4NPLA 2FDFA 4CXYA 4NIDA 3S5AA 4IDZA 4NRQA 4MGTA 4CXXA 5F8PA 3O1VA 4QKFA 4ZS3A 4QKNA 3BU0A 4IE4A 3LFMA 4NRPA 4ZHNA 3O1OA 4RFRB 4MG2A 3O1PA 3O1SA 2FDJA 3RZHA 3S57A 3RZJA 3KHBA 4NJ4A 3RZGA 3I3MA 3BTXA 2FDKA 3T4HB 3H8RA 4NIHA 3T3YA 4NIIA 3BI3A 3RZMA 5DABA 4IE5A 4ZS2A 4JHTA 3H8OA 3BUCA 3KHCA 3O1MA 3I3QA
chains in the Genus database with same CATH superfamily
2XHKA 4ZONA 1V9U1 1AR62 2DURA 2E7AA 5ABJC 4KG8A 4KH9A 4B3NA 1X33A 3WDYA 4EQVA 2GDFA 2OT7A 3OEAA 4QX3A 3OY8B 5F2SA 1YQ5A 2GNTA 4YVWB 3WP3A 5BNNA 1HB3A 3PU3A 4DFSA 2ZGSA 4HN0A 1YEWA 3ES4A 3TEWA 1RGSA 2A73B 5E1RA 3RZKA 1K12A 4XDPA 3RMXA 1W8HA 3H1WA 2VXRA 2EIBA 2YU1A 5H9RA 3VD3A 1S2KA 4COWA 2FQPA 5FYHA 2JX9A 1LOAA 3ZFGC 3QH7A 1N3OA 1QJX3 1UU5A 1ZZ8A 1Q8SA 2EXIA 2B8MA 2UWBA 1U5YA 2R1BA 2VR4A 5CKMA 5A7SA 3N7MA 3WQBA 1PGL2 4N53C 3NJYA 4YZ3A 1RUI2 4QPGC 3WEZA 3ROUA 4CCKA 4XF4A 5C8CC 5LRRA 4AGVA 2WZEA 3WG2A 2YBPA 2BGPA 3KT7A 4Q4V3 3VDDB 3HQXA 4FOYA 5IVBA 3OJBA 3GBGA 3KM5A 2X53S 2BBAA 2JDMA 4R9BA 5BYNA 3OBZA 5HCAA 2Q30A 1ULPA 3KS7A 2BNNA 3VBFB 1VAKA 1SLAA 4CRQA 4XF3A 5F8PA 5GLZA 4E8DA 2CU5A 1POV3 4DY5A 4KWKA 4C90A 2O14A 1QJX1 2RJLA 1JI6A 2BERA 5KC6A 1W8NA 2XWBB 3PUSA 2LROA 2R30A 1YRZA 1H8TA 3CKHA 1ZA4A 2PHWA 2WQZC 1QH6A 5HCBA 1L7QA 2BVVA 2YZ4A 1NCQC 1OA4A 1H6XA 1HB4A 4GKXA 3BU0A 4XOGA 3MV11 4PI2A 1E5RA 1PNGA 2DCZA 2OQ6A 4KU8A 2XVKA 4XF1A 4CSWA 3ENRA 3TN92 1VMFA 1LHUA 2JDAA 3LA3A 3M3IA 4TXWA 3T2PA 4MXWA 3O1SA 1RHI1 1HV1A 3SMHA 2VCMA 4AAPA 3J7HA 3GM8A 1CPMA 1YHFA 3GXUA 2JECA 1LEMA 3RZGA 1UMZA 3FFQA 1POV1 1W6NA 4YWAA 2P37A 3Q8BA 4QAWA 1OF3A 2I74A 3RYKA 5CG9A 4FBFA 3JQWA 4CEWC 3LGRA 1DFQA 1L7RA 2XKPA 4TLFA 4P02B 5EQUA 1OURA 3HD8B 3JXSA 2WA4A 3O0VA 2Y34A 3AYEA 3OSDA 4GD4A 4TYSA 4XVHA 4P14A 1W6QA 2RS51 1UX6A 2OQ7A 3BB6A 3H3ZA 4LLOA 2YG0A 4YG3A 5A80A 1AL21 3BU7A 1H8VA 3CBNA 1UOFA 4G4FA 3T1LA 1NY71 3VBOB 4AEDB 1PM7A 3JB4C 1WD4A 1YUDA 1SFYA 1ASJ1 4KQ7A 4AK3A 1CZSA 3C2UA 1H1AA 2ZPXA 4GH4A 3L2YA 1HRI3 1QJY1 5FPUA 2ZHLA 2D6LX 3A23A 4LQRA 4MGZE 2ZX2A 1GP5A 2HEWF 1SLCA 4MGSA 4BWOA 3BIEA 3EMRA 5FZOA 5FYVA 3VKNA 5T5OA 4NWVA 1AR83 5KHHA 5AVAA 2D44A 4AI2A 4I3GA 4COYA 1I9RA 3ACGA 2WINB 4XF9A 1UMHA 1YQ2A 2B46X 4HPKA 4B1MA 4Q0PA 5C4WB 5E88A 4OMDA 1QJX2 4JQTA 4GMP0 4BQ1A 2VUJA 2CSGA 4M4RA 4CUCA 2VH9A 2X5IB 1W6OB 4KNCA 4ZU4A 4DUVA 2ZAHA 3WG4A 3ZDSA 3R4DB 2C24A 2JD4A 2Q1MA 2ZABA 3UL2A 1ZREA 4IEZA 4LBQB 4Y1UA 3WVJA 5F5IA 1HRI1 3ACHA 3O7OA 2WABA 1OD3A 1OVSA 3B69A 1V6OA 2HBTA 3JU9A 3PJYA 2ZGKA 4NIGA 4DNYA 1W06A 4S2FA 4O7XA 5DUWA 1AR81 4I01A 3SCGA 4C1WA 4Q8KA 4JTNA 5IWFA 4COZA 3RI8A 2JG8A 1JZ7A 4AQTA 3IPVA 5A3UA 1D0HA 3AJZA 2WLPA 5CFDB 4CCMA 3KT1A 3LAGA 1W9TA 2EALA 3HNYM 2QVSB 5CADA 1CONA 1QU0A 3AP5A 1GWMA 1J59A 1BYHA 1PX4A 4C91A 1B35C 1VAVA 4DQAA 4WVZA 4DPNA 4IERA 5G05L 5F7UA 5I0RA 5I0DA 3VBHC 4FP3A 4UYBA 4I0AA 1ENSA 2RS52 3PL0A 4K21A 2GMPA 1UNBA 2BTVC 3NV2A 1PO21 2LRPA 4CDQB 3IKWA 3LSDA 2BWCA 2RG4A 3GDBA 5F6LB 1NY72 2VECA 4LORA 4XFAA 1HN1A 3WX5A 1CJDA 1CWPA 1ZVFA 2X10A 2Y6FA 3BODA 1GP4A 3UGHA 5LK7B 5FPAA 2ZZQA 1IG3A 4IEXA 1F35A 4RYDA 4DXRA 4UXAA 2YU2A 2EXJA 4AHZA 2AACA 4WVMA 2DF7A 4O65A 2BFUL 1Q3EA 2VQUA 2J1UA 3ZFFC 3K3NA 3RZJA 3I2HA 3AKRA 2AYHA 5IAVA 4CDXB 1I5PA 4Q0QA 2VZ1A 2Q5TA 4K1YA 5A6YA 1BBT3 2J7MA 4YVSA 4HMZA 4NPRA 3SEPA 4A6SA 3FBYA 2WNVB 3LF7A 2XB6C 1QMJA 1H2NA 3H50A 3WW4A 2LS6A 2XL7A 1GWKA 4MGYE 5FZIA 1VBE3 1F2NA 4XC9A 3VDCA 5SV5A 1G9AA 2ARAA 3CO2A 5JR7B 3I2DA 4W6YA 1V6KA 1JBCA 3CJIC 4AFDA 4MHRA 1HQWA 3HPNA 1HRI2 2P3JA 4XJAA 1CN1A 5KHJA 1F5FA 5GZFA 5JUVA 3RDIA 3ABZA 2QQUA 3M8LA 4LKDA 2WQ8A 4BE3A 4UI9L 3NKGA 1AR82 2BV4A 2PMWB 1V6IA 2ZGTA 1WZXA 2E63A 3U07A 3Q8EA 1S0FA 1JS9A 1NCRB 4IE7A 5J09A 3OCPA 5E6HA 4FAHA 1Q43A 2JE7A 3RWNA 4D6SA 3B94A 4PHZA 3SH3A 4E4SA 3ZPYA 1ENQA 1VBE1 5KC5A 1AYM3 2AR6A 3OGGA 4YGDA 5E16A 2DUPA 4RQPA 4YFZA 1W28A 5F3EA 1JZ3A 2ARBA 1NA1A 2VVEA 2WNUA 5FMDA 1FMD3 2WO1A 2JIJA 2RV9A 3R0RA 1OH4A 1Q8OA 4R9CA 1AVBA 1QXRA 1YFWA 5A7PA 1G9BA 4XABA 2DUOA 3Q8CA 5EFUA 5EJ3A 1OLQA 2BEOA 4IEWA 2QQVA 2AEYA 4A41A 2D5FA 1JZ6A 2UWAA 5JIUA 1XQNA 5A7OA 2DWRA 3H1MA 2QFEA 4CYDA 3BTYA 3WF2A 4RGAA 3I2OA 2ADEA 2W2IA 1KDKA 1W8FA 1S0CA 1YI7A 3ITQA 1Y4WA 5LBBA 1MVQA 4QDRA 4MLOA 1DGWA 4BQXA 1QJU1 3NO8A 4OUEA 1ZX5A 5JAXA 4ISQA 2J42A 3J26N 3WSOA 1MR5A 1RL3A 2VZOA 4UWDA 4RSUA 4CDUC 2D6NA 2E26A 3VBRC 1QNWA 2D98A 1GBGA 4EJRA 2RVAA 1VB4A 4NMIA 2G9ZA 1AYM1 2VCCA 4OI2A 5HCFA 2WWJA 4WBBA 1EUUA 1WA4A 1NE4A 2RS33 4K20A 4AWDA 4BK5A 2ZX3A 4QPWA 4AF9A 1RUJ3 1WMFA 2ZGPA 1OLMA 2IVIB 3D0SA 2BGCA 3Q8FA 3VHRA 1LOEA 5I91A 1QOSA 3KQRA 1HXS1 2DU0A 1AZDA 2G4IA 5A33A 4QDQA 5FYUA 5LY2A 2WZR1 4BXSV 1A34A 2VULA 4LBMA 3LOIA 2JDNA 1OLME 2GSYA 1H2KA 2JD9A 2VOKA 4Q1RA 2ZGOA 1UZVA 1JTZX 2MHFA 1NG0A 4BHPA 3AYCA 1K45A 2QQLA 3WOGA 5ACA3 5ISLA 4ZHNA 4MG2A 2JDPA 2G9GA 4M0NA 4W65A 3POIA 5F5CA 4EROA 1XNDA 3CF6E 1YI9A 1ZZ6A 1UYXA 1FXZA 1V0AA 4LHSA 4RR3B 1CR7A 4AVSA 2ZXQA 2WT1A 1BBT2 4NHLA 1PZ8A 5IAXA 3ZXAC 3ON7A 3MIBA 5JMOA 2OVUA 2V09A 3AZXA 2CTVA 2RS31 1BHGA 1RUJ1 5EJ1B 4CP9B 3M3QA 4BLJA 3ACLA 2R49A 2J1SA 2GP3A 2J1VA 2VNRA 4KG0A 1ONAA 1HIXA 1VBE2 3I4IA 2IXKA 4HVRA 4QPIB 4J1XA 5BNNC 4Z07A 2VNGA 1DYPA 2WWUA 3AMNA 3MLLA 4LUKA 4QXBA 4FQZA 4XXPA 5E8AA 2K0GA 1COV3 3QOPA 4ZS2A 4JGZB 1DHKB 2WSVA 5H9QA 1MACA 5FZ6A 3MGUA 1YWKA 3KB5A 5LATA 2WWSA 2W1QA 4OHVA 3U1XA 5FP8A 1GZWB 4GKYA 4P5YA 4W6XA 3VUOA 3KD4A 1E5HA 2HWB3 2A1XA 1U12A 2H0VA 1IS3A 1QJFA 4SBVA 2C26A 2Y6KA 1QJU2 4AYUA 2CWSA 3VL9A 3N7KA 4HT1T 1GLHA 1WCSA 2DCTA 4IXLA 3ZIXA 4GJYA 1UX7A 4CXWA 1PGSA 5FZ8A 1AYM2 2JE9A 4P08A 3PU8A 2ZX0A 5A6XA 2ZMNA 4B4PA 5C9AB 1COV1 4P9YA 2NLRA 1NX9A 1LRHA 1BMV2 1RVF3 1G86A 4LK6A 5JSOA 1RTVA 1JN2P 1OT5A 3HQRA 3A21A 1RUE1 1NOVA 4R4XA 3OPTA 3R4SA 3QLQA 1OKOA 1XNTA 2VMFA 4NPMA 2ZS6B 4E4ZA 3DKWA 2HWB1 5F37A 5BPXA 1H8TC 3AKSA 1H0BA 4HK9A 2JENA 4WM8B 2HKXA 5LK5A 1W3VA 1TNRA 5ANQA 1RUOA 2AREA 4NE9A 4LO6B 4N8MA 3ZMOA 1GUIA 1S0EA 3JCIA 3AP9A 5JOWA 1E57A 2BFUS 4IDZA 2QNKA 2VBBA 3B00A 3POBA 4MVTA 5A3OA 3WDUA 2RS32 3V0AA 5APAA 3H0OA 1PVXA 5FZ7A 2IZWA 2W1SA 4J1WA 1RVF1 1RUJ2 1N47A 3AZWA 2BBVA 1W8UA 2L9LA 2QQJA 2YBSA 3INAA 3ZXDA 4FOVA 2QDRA 3N35A 1OBNA 2JXAA 4S2HA 4IGOA 5IVEA 3OUJA 5IVYA 3TRSB 2VC9A 3QD6A 2E7TA 3GHNA 1ZRDA 2ZCWA 2ETEA 4M3CA 5FKBA 2RMU3 2WT2A 5ACA2 3K4ZA 1YO8A 4META 1DQ4A 4Q0VA 5LA9A 4MUVA 1RUC3 4YZ5A 2XPJA 2QZ3A 1XYPA 5L73A 1FYUA 3H9AA 1W6MA 4ZPIA 3ZSEA 3CHXA 1U5XA 3IT8A 4M3CE 4ARYA 4H55A 4L99A 1AXZA 1K3IA 2AEZA 5KR7A 2IWGB 3VGIA 5BY5A 3OGRA 2NN8A 2QKDA 3B5LB 4EN6B 1I6XA 1GZCA 2PAEA 4GH4C 1TMF3 5FUNA 4HANA 1RB8G 1OA2A 1VRH3 4Y4YA 3H8RA 2R061 4YZ2A 4LKEA 5F1RA 2ILMA 1N3QA 2QUOA 4Q26A 5DAPA 1ZBE1 3GZTB 4CTEA 4OI4A 1UPSA 4JKLA 3UJQA 1O3TA 1PK6B 3HR9A 4LITA 1COV2 3QH6A 1H4HA 4JGYB 4V2VA 4XIKA 5FZDA 3WF3A 2A6VA 5FYMA 4FTSA 3I97A 5ERLA 3LPGA 2OA2A 3X29B 1H4GA 5FLJA 3RQ0A 4KGGA 2ZGNA 1RUC1 1TZOA 3CZJA 1OVPA 2FCUA 4MZUA 2EIEA 5DDJ3 1MQTB 3TNPB 3LCPA 1K5MA 4H7LA 4BQ2A 5JOXA 4YGBA 1S0BA 3WY6A 1DGRN 4AOCA 3ZXJA 2HWB2 4XF0A 1JUHA 5C5UA 5B4NA 3RFRA 3OPWA 1JYTA 1IS5A 4QX5A 1W0OA 4IE0A 4MO3M 2ENRA 2I07B 2W68A 5FXZA 2YV8A 4CDWB 4Y20B 4QQPA 3JUUA 4QGNA 2P2KA 1TMF1 2WUHA 3VB9A 5FOBB 1D0GA 2A71A 1VRH1 3W9AA 1LNSA 3PDQA 1J3QA 5A32A 4DO0A 4Y1XA 1ULGA 4ZXKA 1DG6A 3E6DA 2ORZA 3T2QA 3WW1A 1OUSA 1RVF2 2JG8C 1LECA 2WAOA 4EV0A 4XZUG 2B42B 4RGGA 4DXZA 1C8NA 4W4ZA 3VHPA 2CAVA 1T6BX 1NXD1 4P5HA 4Y1VA 5DDJ1 1YQCA 4LBKA 2ORXA 1VBB3 2F6BA 2YUEA 1S2BA 5FWJA 3S30A 3DXUA 2GNMA 5E89A 3W20A 3ZN4A 4EZ4A 1POV0 1UMIA 1BEV3 2A6WA 2UY8A 4N90A 5FTTC 5JZGC 1W0NA 1NCQB 2VQ0A 2KR2A 5FPVA 2AUYA 3M3EA 1QXJA 3N9OA 2SLIA 3DXTA 1V00A 5D2AA 1DGWX 5FPXA 5A1AA 4JX0A 3W59A 1REFA 1AR93 4BIOA 3WG1A 1AF9A 5J1XA 1GICA 2C4XA 3O5SA 1W6PB 2B7YA 1ZRRA 3LFIA 5C7GA 4HVQA 1CAXA 1WLDA 2GNDA 5FIXA 4MGIE 3ZOIA 4QXHA 3GF6A 3AMMA 4O9GA 4Y1YA 3NQHA 5JOYA 1VBB1 1QNYA 4YVSC 1J58A 1XSRA 4O9EA 4AE2A 3TBDA 4BZ4A 1BEV1 3USUB 5EZWA 2RMU2 3IAPA 4QX7A 4UFIA 3WZ1A 4QKNA 1QJZA 1ZBA1 3SITA 1BK1A 1RUC2 4BOWA 5L9BA 5DUUA 2Q1FA 3VDDA 1GQGA 5EPAA 5FUPA 4AW7A 2WS91 1R1A1 2WJSA 5FZKA 1YYNA 1VB2A 4LBNA 3I3DA 1G9DA 2HLEA 1EP0A 1KFXL 2VVFA 3DCQA 4S2DA 3HWJA 1AR91 5HBAA 3D5OA 2G19A 5G04L 2R1DA 1REEA 5F3GA 3TYJA 4CVUA 5DZFA 2O1QA 2X8KA 1TMF2 4P9WA 1BK0A 2WKKA 3TEXA 1TME3 2CYFA 3G7DA 4COUA 2BPA2 3OGJA 1VRH2 3OBTA 4MH0E 4XZPA 2R0HA 5BNPA 3MW3A 2XJQA 3BTXA 1XC6A 2PAKA 1YQ8A 2JDHA 1P8JA 2XUMA 4XIOA 5A3PA 2D6OX 4R4ZA 5T5JA 4BLIA 4ZKTB 4D6QA 4PQ9A 5GLVA 4FPOB 3S5QA 1PMHX 5K8SA 5FAXA 1C5IA 2G1MA 4ASKA 1A8DA 1JU4A 1MS9A 3A0NA 5IVVA 4K7JA 1OFSA 5FREA 5DDJ2 3OGSA 4UF0B 5FZFA 3CLPA 1Y43B 4LLFA 4Y24A 4XUOA 3H8OA 1XE8A 1SLIA 3GZAA 4RQPC 5D8AB 3TEZA 1NA1C 2VZPA 4CEYB 1V9U3 3AB0A 5HV4A 2C0ZA 2LM3A 2DU1A 1N1YA 1O5LA 1MS0A 1TME1 3I3BA 1WGPA 5C3SA 4QHZA 4A7YA 2OW4A 4ITCA 4URTA 1EPWA 3LB9A 1ENXA 4PI0A 1NQJA 1UOGA 1BZWA 4QM8A 2OYZA 2GU9A 3KT4A 1AUYA 3AKQA 3BTZA 3HT2A 3NV1A 5I8SA 2PLV3 1GQPA 2VUCA 1DQ6A 4QKBA 1FV3A 3PTRB 4UBHA 3BTAA 1GOHA 3E5QA 2ZEWA 4PLOA 4EN7B 5CB7A 1Q8QA 4CUAA 4D0QA 4I3PA 5FY9A 4GIQA 1VBB2 4RHV3 3CNAA 1POQA 1H30A 4AEDA 1LOFC 1BEV2 1CZVA 3IDAA 3VBHB 4WZCA 2VGDA 1GNZA 4PJYA 2RM23 4K40A 3SKVA 2V73A 3O12A 3VKLA 1LULA 5K7PA 4JKMA 3K48A 3SISA 1HQLA 2XJRA 4CU8A 2Q0AA 3SNMA 3UKTA 2FCTA 1XNKA 4CU6A 3VV1A 3N36A 1AR92 1NQDA 5J98B 1V70A 2DDUA 2WBKA 2R041 2CGNA 2Y38A 2BZDA 1UU4A 4XYXA 3WDTA 5C3OA 5IHRA 4AHYA 3WHUA 4NIDA 4DRVA 1GU3A 5JDBA 1MZ5A 3WV6A 2PLV1 3HAGA 3ZFFB 4XTPA 4P9XA 4INDA 4KWUA 5KXBA 3U0ZA 2YGMA 2ADDA 3GJAA 3SEEA 1X7NA 1C1LA 1GOFA 4RHV1 3VZJA 1UW8A 1IS6A 5LBEA 3W5NA 4IQPA 2VJXA 3SC7X 5F5QA 2DTYA 4LBQA 2OKXA 4AFMA 2RM21 5LA0A 1SDWA 2A6ZA 1CAWB 1RUNA 4S2GA 3CQOA 4X8PA 4IE4A 3P5BA 1QGLA 5L7OB 3J8F3 4HKLA 1SQ4A 4FPHA 3RNSA 3CJIB 4FTBA 3IAQA 1RHI3 1Z7S1 2ZEYA 3DECA 2BOJA 2D40A 4FPKA 4D7TA 1Y7BA 1TME2 3AL5A 5CFDA 3WNPA 2GMMA 1W2UA 4IV3C 4QWNA 4YM0A 4DS0A 4RA0A 3MW4A 3ZXKA 1F4HA 1FPN3 4XILA 4PDWC 4FPJA 4Q29A 2FDKA 4TWTA 3MEPA 2NP0A 2TUNA 2QQKA 3KMHA 1OUXA 4L2NA 4UFKA 5F6KA 1JZ5A 4MYEA 5AVPA 2RS53 3B01A 4JQRA 4XQDA 1AL23 2P3IA 3AZYA 4GALA 1VIWB 2UY9A 3SHRA 2YROA 4AR2A 1JW6A 2R6QA 3WHTA 4CCLA 2JDUA 3ZSJA 2A7AA 3J8F1 2B9VA 3ZVXA 1VBC1 1ASJ3 4Q4Y3 3FUOA 4AEKA 4GWJA 1V9U2 1XOYA 1QJY3 1E5IA 3O1MA 4XBNA 3S7IA 5CG8A 2PAMA 1OD5A 5DZEA 2XQRA 1XBFA 4DXTA 4AI1A 3PMSA 3VD9A 1FPN1 4Y5SA 2BYVE 4PIZA 3TWIA 1LHWA 4QQ2A 2XBO1 1N1VA 2PTMA 2WNVA 1OLRA 5FY1A 5T52A 3CEWA 3C3VA 2PLV2 3HN3A 4YM1A 4YLZA 1N3PA 2X29A 3O1RA 1UD1A 2GNBA 2WIIB 5FYZA 2W0XA 4CDUB 1WCKA 3VBRB 1TQ5A 3HMYA 4RHV2 4NHYA 1UU6A 2HEYF 3EXUA 3IZOA 3M3OA 4QDSA 4C8DA 1FV2A 3QACA 5LCWL 1Y3TA 1GNYA 1JUIA 4Q4Y1 2RM22 2XVGA 4JVAA 4XFCA 4BYYA 1J1TA 2BNOA 3NMBA 4E2GA 1F8VA 1W2NA 4QXKA 4KBZA 4XXAA 3V65A 4Y4RA 2YXSA 2NM1A 2VBDA 4SLIA 5CVRA 1LESA 2EIGA 1ND2B 2K46A 2XH6A 4P9IA 1RUD3 2MEV1 1Z7S2 5DAWA 4AFAA 1NCRA 2WNEA 4BQ5A 3WP6A 1J3RA 4N43C 2FDFA 1DF0A 3ZPOA 4CU7A 4PBOA 4LULA 5J37A 5JIAA 1S0DA 1J1LA 4UFMA 4QX8A 4BISA 1DZQA 3E6BA 3C8XA 3K46A 4K8RB 4I02A 2Y6LA 2ZKNA 4AVBA 3O14A 1TVGA 1FATA 2RDSA 4XDQA 4HG6B 1Q56A 1N1SA 4AVVA 5FOJB 5K0UB 5DUVA 1PO23 2FZ1A 3MFAA 3VZLA 4HL0A 5BNNB 3KV5A 3FZ3A 3J8F2 2FBEA 1RXGA 1OFNA 2C5DA 5GZDA 1UY3A 4QB1A 3SCHA 1RUD1 5BNQA 1RHI2 4PF1A 1NLQA 1KRIA 4RFRB 2E7QA 4AG4A 1SLLA 1YXWA 1F5JA 4CCDA 4YPJA 1K5MC 3NSTA 5FV3A 4BCUA 4YARA 1FPN2 1G8WA 1WA6X 2XR4A 4R8HA 3ZFEA 4I2OA 4H14A 4EZHA 3IDBB 1PZ9A 2HWD1 4TTGA 3T4HB 4OHXA 1ENRA 4CP0A 1H2LA 1PX3A 3AP6A 1KDMA 1LKNA 3ASIA 4M0HA 3HBZA 3E5XA 5EYYA 3VL8A 3WD5A 3WINE 1O8PA 3ZKYA 1LTEA 3OPZA 3WF1A 1X8EA 2P6CA 5AFEA 3S7EA 3T3YA 1AL22 1BVVA 3MW2A 4YW2A 3POYA 5T50A 3ZM8A 2NPIA 5C3PA 4CUGA 1ULEA 1W9WA 2WDBA 3M7AA 5FCCA 3ZSMA 2F17A 4Q4Y2 1ASJ2 2JKBA 1ULOA 3A4UA 5A70A 4MV2A 3RVHA 1XE0A 3JD73 1QJY2 2TEPA 3ZXFA 3MICA 3VZNA 2DCJA 1X8MA 1OOPB 2G9FA 4WM7B 5FZMA 4RR3A 2HEVF 5DAQA 2XLAA 2VQAA 2WFF1 3DYPA 4K9SA 4MSVA 1JYWA 2IXJA 3NJXA 5FKCA 3MLKA 2WR9A 1CESA 2DVGA 4PIYA 5FO7B 4YYOA 1NXMA 4CP9A 3LDBA 5EIYB 3BKZA 5EYXA 5J7MA 3BPZA 5DUXA 4M00A 4ORFA 3OUHA 4QPIA 1R64A 5FY0A 2GN7A 1ODMA 3OB8A 2W87A 3WLUA 1XE7A 3EHKA 4JGZA 1VPHA 4XFFA 5CFCB 1YCIA 3PUAA 4C0BA 3LIHA 2E51A 1JZ4A 3NAPA 4QHOA 4A42A 3JD71 2A6YA 1DDLA 1UIJA 2WN3A 4D69A 3UGGA 3WCSA 1PO13 3FLTA 4G3YC 3M2MA 3ALQA 2A3YA 1RUD2 5BNOB 4XFHA 4XUPA 2HWF3 4P9GA 2AC1A 2IXCA 4R52A 1GMMA 1C3HA 1W6QB 1YJLA 3H42B 3GZUC 1QJU3 5FXXA 1W9FA 3VDDC 1AX2A 1C8M1 2EF6A 5GM0A 1B09A 1AYN3 2J1EA 3ZXLA 2Q8CA 5DAVA 2CDOA 1AJOA 2RE9A 3EO6A 3MI8A 1JYXA 2PHUA 3AX4A 4DXSA 4YZ4A 4KWLA 3JBG1 5C9AA 2HWD2 3PUIA 2J1TA 4QT6A 3SLIA 3J7LA 4GH4B 4TLGA 3VBUB 1EUTA 2WL1A 1ZZ9A 1DQ2A 3GHMA 3L2HA 1PO22 2BOIA 1UL9A 4WV8A 3FHIB 3WNOA 5BNPC 1HXS3 3ZR5A 3SKJE 3KV9A 2BDRA 2WZR3 2ET7A 2P34A 5CISA 1PO11 5HI0A 2JICA 3WF4A 2VCAA 1LB2A 5LBFA 4GXLA 4IGQA 2WC2A 1UAIA 1EV13 3C7HA 5FZ4A 3IMNA 2D93A 4YFWA 3HNMA 2HWF1 4IEVA 2OS2A 3IIIA 4QM9A 4PCRA 4U2AA 4WM8A 2CGPA 2VUAA 5FMOL 3K51A 1BLZA 1HX6A 2B9UA 1LU1A 4J25A 3HQUA 3ZLIA 2DVAA 3K3OA 1AYN1 2WFF2 3EJKA 3EQEA 1OH3A 4PLMA 4AEMA 1O3QA 3P6BA 4HFSA 3H7JA 1J84A 3K4AA 4L9BA 2D6KA 3S57A 3UT0A 4B7KA 4LBJA 1W3XA 3I2JA 5GLTA 3I2FA 1HN0A 1LCLA 1KQRA 2KM2A 1WUVA 4GQ7A 1RUG3 1SACA 1ULFA 2AENA 3DPRA 4D3WA 5FDBA 4FPEA 5LEJA 3VHNA 5LRSA 2VZTA 1IZ3A 4L11A 4NAMA 3DKQA 3BI3A 3NW4A 1EV11 1IKPA 1VP6A 1K5JA 5FK8A 4Q4W3 5A7WB 5CKNA 2OXBA 2OZ6A 3JD72 3RJRA 3ZIWA 3FHAA 4JHTA 1DZTA 1Q5OA 4D6RA 4NUBA 4MX3A 1U0AA 3BCWA 3C7GA 4D7SA 4OI1A 1LHOA 4RS5B 2Q8EA 3T0DA 1ND3A 2Y26A 1DQ5A 1N1TA 4LBLA 5JZGB 5FZHA 2V5YA 2EXHA 2CV6A 5FLHA 5FZLA 3AFGA 3WQ0A 2X05A 4A44A 4B4RA 1HKDA 3H8XA 1IPKA 4JTOA 4XJ9A 1W2AX 3RJ2X 5LB6A 2VE1A 2RDRA 1RUG1 2QQWA 3M70A 1PK6A 2IXIA 3JBG2 4KGQA 2D3PA 1RXFA 2BWAA 3NV3A 3L9JT 4JGYA 3T08A 3ILFA 2Z79A 2GN3A 4Q4W1 2ZA9A 1ZA7A 5KXCA 1JHJA 1NYWA 1MQTA 3CDZB 1H6YA 3DYOA 4HETA 4NOTA 4AI8A 2PHTA 1RUE3 1MZ6A 4EN8B 3LPFA 1PO12 1GQHA 3WDXA 5AC93 5A3LA 2DVDA 3NV4A 1WMDA 1C57A 2HWF2 4Q5OA 4CDWA 3BOPA 1O59A 4Y20A 3WG3A 5HV0A 3OG2A 4LK7A 4QHBA 2VVDA 3FMGA 3VDAA 3J7MA 1QEXA 3B9IA 3I2KA 1UY2A 1OPOA 3O0WA 3FLPA 4UW4A 4KL1A 3PVEA 1AYN2 3NKTA 4O61A 1T2XA 4AL9A 4YM2A 1WWYA 3LZZA 2YPDA 3ZYIB 2VBPA 3AC0A 3SH4A 3POEA 3U37A 4B1LA 3GCXA 4AFCA 2GAUA 4KI5M 4GMP1 4I09A 2LW8A 4IV1A 3PURA 3V0BB 5CFDC 1L7LA 5JSPA 3VBSB 1HXS2 5H9PA 4OHWA 1KJRA 4XHXA 2WZR2 1SG3A 4OQ9A 1EAH3 3IDCB 5FR3A 1XNAA 5AC91 1EV12 2VMGA 3U75A 4XACA 4FFFA 2RHPA 1YLLA 4UAPA 2ZJCA 3VKMA 4JDOA 1GKBA 1UIKA 2VNVA 1GWLA 4LHKA 5C5TA 1CIYA 1LJ7A 1PGW1 3ZYJB 2IVJA 3WXPA 4XEZA 1UF2C 3U4SA 3NL1A 5JI7A 4XMIA 2RDNA 1OA3A 4NVPA 4RQPB 4D94A 5FJHA 4IESA 3T1MA 4MADA 4N9IA 3MIFA 4LXLA 2YMZA 1UQXA 3AZZA 4AFBA 2JG9A 1O3RA 1LOCA 1Y9GA 2XXZA 4XCBA 4E4DX 3N9PA 4LA2A 1YFUA 4N7IA 2YBKA 3ZYHA 4MGQA 1D4M1 1RUG2 2R063 2ZGQA 5LW9A 1ZBE3 2BGOA 2E9QA 3DV8A 1EAH1 5CEHA 3C7FA 1LAJA 2HBUA 3GZEA 3FN9A 3USUA 2FCVA 3QBQA 1H9PA 2WNVC 4GZ9A 4Q4W2 3S0MA 1YFYA 4JV4A 2JIGA 4OUMA 5IVCA 1FT9A 3NNLA 2ZBJA 4LPLA 4IEOA 5IT6A 1CJPA 2HWE1 2W46A 2VZSA 4Q8LA 1ZM1A 1VLNA 2VY0A 2Q1ZB 4PIXA 5C71A 1AHSA 3BPSA 1EY2A 4J6GA 2XQXA 1JXNA 1RUH1 1O4TA 1UY0A 1LEDA 2JB4A 1YJKA 3PUQA 1S0GA 4Z8BA 3PMEA 3AVRA 2B4KA 1KS5A 3AJYA 5ABJB 3KCXA 5A33B 2FDGA 4LE4A 4LT5A 1NLRA 2P1BA 2ARCA 5K4LA 1G9CA 2EICA 3H8UA 4I0WB 4KU7A 1D4VB 3LEKA 1NKGA 1OI6A 4XAEA 3WP4A 1NCRC 1ZZBA 3AFKA 3UYJA 5A6ZA 2FD8A 5IK7A 4HK8A 1QXPA 4UF0A 5C6CA 1HW5A 3KGLA 3ZFGB 1RUE2 1Q8PA 3OF1A 4QX0A 4Q0UA 4HOOA 5AC92 5D8AA 2MNGA 1FOD3 1S55A 2KA3A 3FC0A 3KVAA 4N53B 3RMYA 4EYUA 5JI9A 3N9MA 4QPGB 4CEYA 1AX1A 3CIHA 1NLSA 1R081 3FBMA 4AQSA 4ZZ5A 3DYMA 4Z82A 1RITA 1ZNPA 5C8CB 2D6MA 1PMIA 2VZRA 4LO4B 1RUF3 4BM8A 1PGW2 1RC6A 1WW6A 3T4VA 4CA9A 5LEKA 3BALA 1S4CA 1I5ZA 2BJSA 3N3HA 4FXKB 5LY1A 3O1UA 5FMOS 5FQ0B 4NWWA 1MEC3 3B93A 1VBA3 3V56A 3RZLA 3OYWB 1VBD3 3OGVA 4BQWA 4YW1A 5DN2A 4Y22A 3IWZA 2C9KA 2PYTA 4YG6A 1LENA 2ZACA 4PT6A 4XJZA 2WN2A 3H3LA 1VMHA 1UCXA 2JDYA 2VW2A 4JDNA 4F83A 1FNYA 2GALA 4FPYA 4NRQA 4IV3B 5KXDA 4GWNA 5F39A 1YQ6A 4FFIA 3K77A 4PDWB 3LD8A 5JLVA 3WNXA 1EAH2 3ZFEC 2QE3A 2W1UA 5FP3A 3KF3A 5LA2A 1FOD1 3WW2A 1GOGA 1W8WA 2NZ9A 2XJPA 4QKFA 4W50A 3Q8AA 5FFOC 1ULCA 1TEIA 2ZMLA 4XJUA 1ZBA3 3WNKA 1ZRCA 5FY4A 1RUF1 3W58A 1OPMA 1UXXX 3B3QE 3P3NA 2WS93 5T5LA 1HQNA 1R1A3 3GJBA 1JYCA 2EVXA 2QQNA 3GCWA 3OY8A 1CZTA 1MEC1 4GA9A 1VBA1 4AGGA 4YVWA 4NRPA 4ES9A 1VBD1 1F4AA 4D7YA 3LSEA 4LR4A 3O1PA 1Y9MA 4XFBA 4BJ0A 4BK4A 3WP5A 3I2IA 3ZFFA 4Y3OA 3ZYGA 4AI0A 4FO9A 3RZHA 2D6PA 4RR3C 3TEYA 2I2SA 2Y6GA 2GH8A 2PQSA 2R062 5JXJA 2MPFA 3ETQA 1ZBE2 2UYAA 2CAUA 3A0KA 1ZRIA 5A3WA 3VN4A 4CEWB 1EPZA 3BVCA 4ONUA 1MS5A 2XOMA 4HBNA 4K6BA 3ZN6B 1UWWA 1U5IA 2D3SA 4QB2A 3T0AA 1G7YA 4UW5A 4XE9A 2Y6JA 1J83A 4CCEA 1CAWA 1HB1A 2GH2A 2RS13 2K2SA 3RPQA 3ZYBA 3KSCA 4QPIC 4QU2A 3NJZA 4DOUA 1ULDA 4YM3A 5FJKA 5L7OA 1MZFA 4URAA 2DYCA 2IFWA 3KCCA 3UETA 3B9CA 4Z2AA 1IPSA 4IEQA 4LE3A 1A3KA 2O0OA 2VZQA 3NAPC 4V1PA 3VBFA 4LTAA 2ZGLA 3WCRA 3KHCA 2WRAA 2Z42A 1W8TA 1FNZA 2VTXA 4GB31 3IIAA 4X8NA 1SMVA 1AR71 5J36A 4ASMB 2XJUA 1UOJA 2HJIA 1X50A 3AK0A 3LEIA 2Q8DA 2XGXA 1RJ7A 3DGTA 2VTFA 3TAYA 4CUBA 1R093 2UWCA 5LA1A 1WCDJ 1UXZA 4N43B 5AFBA 2ZEXA 5FZ1A 4XTMA 1WMXA 4JC1A 5JCTA 2ERFA 5M0TA 1PIV3 4QGLA 2RS11 3M1HA 4OUSA 4YZ1A 4DUXA 2DBIA 1FOD2 1WKYA 1GSLA 5C9AC 1Z78A 4Y5TA 2WNUC 1YIPA 3WUDA 4IUGA 1RUF2 4FCAA 1OQEA 4WVWA 5HXMA 4B8EA 2C6SA 2ZGMA 4LO5B 3WNLA 3MZHA 1MEC2 3USSA 1VBA2 1RUI1 1VBD2 3U14A 2N7GA 5FY5A 5F2WA 2R043 5L9VA 4WM8C 4BIFA 1R091 2A3WA 5GJ6A 4LBQD 1IPJA 1QIQA 1SPPB 5BXXA 2SBAA 3BIWE 3ZXEA 1SHWB 1KGYA 2WQ4A 1NZCA 2XLGA 4CDUA 1K5MB 2JEMA 3A22A 4FT8A 1MZEA 1PIV1 1IQAA 3PNAA 2XJVA 3THTA 2JKXA 5JPMB 2AZ5A 4E9KA 3VBOA 2PHLA 2RR13 3A7QA 3FE5A 1B35B 3ILNA 3R05A 1PMJX 2I45A 1X9TA 5JXIA 2XJSA 1GP6A 1ZBA2 4JZRA 4UBGA 4CE8A 3NNGA 4M4PA 2VL4A 2WS92 1R1A2 4YG0A 5CU1A 2WO7A 2ZMKA 4NHKA 1ND2A 1JMUB 3DPRC 1REDA 2VZUA 1HB2A 5B4XA 2H6CA 5LASA 1O6UA 2VAUA 2PHXA 3U4XA 4GWIA 2CWMA 1LGCA 3LDKA 3DF0A 3AXEA 3JQXA 1UPIA 1UKGA 1Z7S3 3D0JA 2W9XA 1AL0G 2IXHA 1XNBA 3T2TA 1ZZ7A 2GC0A 2HWC3 3KV6A 2A70A 2XUEA 3PUHA 4XURA 5C4WA 3UESA 4B4QA 1IG0A 5KHGA 4Y33A 3KHBA 4NJ4A 1ND3C 2QJVA 2X5IA 4OQ8A 1W6OA 2RR11 2W39A 2WNOA 4AI9A 1QQP3 4DEQA 2A3XA 2VOWA 1OC1A 2DVBA 4MXVA 5K0UA 4FVVA 2RS12 2WO3A 4G9SB 5DPNA 5T3NA 2Z69A 1KD7A 1SBEA 3PJQA 4QU1A 2RJ2A 4KWJA 5FLIA 3T0BA 4XJWA 1PK6C 1XU2A 2JE8A 3MUZ1 4HLTA 3GBWA 4QX1A 5DABA 5DQ0A 4JGYC 3ZO0B 5EP9A 2TBVA 5JPNB 2ZZJA 4OFGA 3RGBA 1FX5A 4ZU7A 2AH2A 3LEMA 1VBC3 1CAXB 1LR5A 3RYRA 1XRUA 1AXKA 1H9WA 1IS4A 5FK7A 1MQTC 4A4AA 1QY4A 3IB3A 2HWC1 4UW6A 2DFCA 3T2OA 3NNJA 4QQLA 5FPZA 4CP2A 3ACFA 2GMEA 4CDWC 1CVNA 1R092 5KWRA 2UU8A 2XBO3 2DUQA 3T09A 2YGLA 2XMLA 1QQP1 5FPLA 3AKTA 5I0TA 1XPWA 4QQHA 1DLLA 1S1AA 2LTNA 3Q9OA 4DEVA 1UY1A 1PIV2 4AQ6A 4CDQA 1YC61 1QKQA 2YY1A 3OUIA 3GALA 4Q2FA 4N9HA 4AGRA 1DYOA 5CAZA 2CL2A 2VD7A 5GALA 1O7FA 4AQ2A 2D43A 4CCOA 2ET1A 2DBNA 3T30A 4IV1C 1TG7A 2GC3A 4XAAA 4XDOA 4GULA 3PIGA 1OOPA 4WM7A 4BQ3A 3AZVA 2ZGUA 5BNPB 3LQCA 4XHBA 1X82A 5D1IA 2ZKLA 4CDXA 1NE6A 1RIRA 2AGSA 4IE6A 2VMIA 5FUIA 2V5DA 4AI3A 4COVA 4JDMA 2R042 2MEV3 4FFHA 4LKFA 1OMIA 2TNFA 2ZEZA 3H7YA 3POFA 4K1ZA 1XYNA 4K8FA 4YW6A 3NVCA 5FWEA 1MS4A 4A3XA 1XNCA 2VTXJ 2BRTA 1BJQA 4JRLA 4Q4V1 1RYYA 3HOBA 2QBXA 1UY4A 3MIHA 2HH9A 3POGA 1XJAA 4NPLA 1CD3G 3MPBA 3EYPA 5C3RA 4CXYA 1O3SA 4LKSA 3VD7A 5FO8B 2YDEA 1PNFA 1SEFA 1JZ8A 4IL7A 2RR12 3DEMA 5FP9A 5CFCA 2BP6A 1HRV3 4CXXA 2IXLA 2P6HA 1HJFA 1O4YA 3OBAA 2JG9C 4FOQA 1YIFA 3MYXA 3LOBA 1F31A 4PBPA 1QDOA 2VPVA 5J48A 3OD4A 2OPKA 4Q1PA 1M4WA 2QQIA 5CA6A 1CAUB 3AMHA 3B7MA 1CAVB 5IJRA 5BNOA 2CGOA 3RZZA 3LE0A 2ZAAA 1ZZCA 3POSA 1OF4A 2Q8OA 4HSJA 2OPWA 4HSLA 4HKOA 2Z2SB 4ASLA 5EHDA 1GZTA 2KD7A 4A6OA 1UZZA 3WDWA 1SLBA 2HWC2 2XVLA 1WCQA 1UOBA 3PVBB 3HNBM 2VM9A 3MUY1 3VZMA 1IKQA 5C8WA 3I59B 4AXOA 1ST8A 4UT5A 4Z2WA 3RSJA 1QQP2 4DMIA 1HRV1 2HWD3 3VBUA 4FPGA 4L8QA 5DAXA 5GKAC 4Z1VA 1EYBA 3UNPA 1DQ0A 2R32A 1A6CA 2VMDA 4XBQA 4WVVA 4YGCA 1NZIA 1SZBA 4E2QA 2GC2A 1F9KA 4OI0A 3K75B 3E5UA 4AEJA 5F5AA 4YW5A 2LUWA 2J1AA 5EV7A 1E5SA 5A7NA 3R6SA 4B29A 1VBC2 3VD5A 3GNEA 1I3HA 2NMOA 1AJKA 2PQQA 1HDKA 4NR1A 4UFJA 3URFA 5CYYA 2R0FA 3MBWA 4MHUA 2R16A 3LA2A 4DUWA 5FYTA 1ACCA 2EAAA 2X09A 3AVSA 3POWA 2W1WA 2W91A 2WFF3 1R1ZA 1JOJA 5D8AC 1X9PA 2W94A 2VZ3A 2QQOA 3FWEA 4Y26A 5IVJA 5H9SA 4CEYC 2XBO2 1GNHA 2PELA 4NO4A 5C70A 1W03A 4Q4V2 1V6JA 2RJKA 4N7UA 3ZYFA 4H2AA 3KGZA 1DCSA 3MHZA 5EWSA 5LBCA 1US2A 1S0IA 3NNMA 2WZ8A 3GGLA 2WYSA 3DN7A 1Q8VA 2JJ6A 2RDQA 4E27A 1WD3A 3E97A 5A7WA 4HN1A 4XJ8A 4ARXA 1A8MA 3DL3A 2DVFA 3OOXA 3E1F1 5JXGA 5BV6A 1IOAA 4Q4X3 2VU9A 4OYUA 5IYYA 1UKRA 4L92A 2WSUA 4RS5A 2VMCA 4MGKE 4R9AA 3OTFA 2Z4FA 1RJ8A 2DTWA 2MEV2 2XONA 5JZGA 3HJRA 2IUWA 3KQ4B 1VJ2A 1H8TB 3PLQA 4LEJA 4F7ZA 1JOPA 2VQTA 1DQ1A 4PLNA 3AP7A 2HYKA 3VHOA 4DIQA 4E2SA 2B5HA 2H0BA 1UZ0A 2R073 1C8M3 5A1FA 4FI9A 3OBRA 2NMNA 1DU3D 4YVWC 5F32A 1OSGA 1UYPA 3BOWA 4ZY9A 5GZGA 4MXWB 3JBG3 4EE2A 1HRV2 2WLQA 4LO7A 1W9SA 2EIDA 3AL6A 3ZDVA 4CPBD 4OMCA 3ZMNA 4LOSA 3POJA 4XBLA 3D82A 3D3AA 2LALA 3ZN5A 1US3A 3VKOA 2Y0OA 4ZZ8A 2FHRA 3RG0A 3ETPA 4Q4X1 5EJZB 1LGNA 4NHMA 3I2GA 1GZWA 1W6NB 3THCA 2D7FA 1WW7A 3UV9A 3W21A 4CCNA 3CJXA 3W5MA 3K2OA 2PXJA 4QPYA 3HN1A 4I30A 2W3JA 4DB5A 1DIWA 4C1XA 2A6XA 4NAOA 3KF5A 4LUMA 4XETA 4JRAA 2V72A 2Y6HA 4FPFA 4LJHA 2R071 4OULA 3WQ1A 1JZ2A 1X36A 3O1OA 3ATGA 5L7OC 5FZ0A 1WLWA 5FPBA 2W92A 4LA3A 4BU2A 5IFTA 5TSWA 3LA7A 3APBA 2XJTA 2EAKA 5FRAA 5GLUA 1TNFA 1JH5A 3AMPA 3V0BA 3VBFC 3VDBA 4W8JA 1RINA 3TOJA 1BXHA 1LHVA 1JU3A 1QWRA 3KCYA 3KVBA 3VBSA 1VRBA 2P4EA 3C7OA 4OZOA 5FZ3A 5A6QA 4FPLA 5A3MA 2DCYA 3CU7A 2OX0A 3ES1A 1PM4A 1W8OA 1BBT1 5FZOB 4RD7A 1PZ7A 3ZR6A 3SH5A 1UO9A 1Y9QA 2YFZA 4A7KA 5LZ6A 4CP1A 4NIIA 2CY6A 3MV01 3WQ7A 5FZBA 2YB7A 5FZEA 4CPBA 2D97A 3LKJA 5FZGA 3RZMA 4HPKB 4IE5A 4BMEA 3IN9A 3HIFA 4FTEA 5DG1A 3SXWA 3D6EA 5A3TA 2GC1A 1QOTA 5J3UA 3WNNA 3IMMA 3HBKA 4YSFA 1QH7A 2H6BA 1S0JA 4GWMA 1OHFA 1GV9A 1NT0A 4H3WA 2O8QA 1C1FA 3BN6A 3ME2A 3MIDA 4IEPA 3ZYRA 3FUQA 3BGAA 4QD2A 3O1TA 2WO2A 1H2MA 4NROA 3ZSLA 1QHDA 4L97A 1F15A 2FDIA 5FZAA 3THPA 1L3JA 4KMQA 1WBLA 1QDCA 2JDKA 3VLBB 4BXFA 3HT1A 5F9TA 2ZOEB 2QZ2A 5D21A 2A5ZA 2JG8B 1LGBA 4OCTA 4NIAA 2FDHA 3CZUA 3P1IA 1IGOA 2XDVA 3IPVB 4FQ4A 4Q4X2 2CDPA 1DLCA 5JR2A 3UK9A 4ES8A 3EBRA 2ZX1A 4BDVB 3ZFEB 1W05A 2BVBA 4BA6A 3PVNA 1FAYA 1LOFA 1W2TA 1XU1A 2BQPA 4UFHA 3R4UA 3VBOC 4AAXA 1J3PA 4AEDC 4JKKA 1FMD1 5A7QA 1BMV1 1SFPA 4LOTA 2VZVA 4LHNA 1SLTA 1AX0A 5ABJA 1KEXA 1M06G 3AMQA 5K9YA 1WW5A 2QCSB 1BCXA 2R072 1C8M2 3C7EA 3NRUA 4UW3A 5FBZA 3TB0A 5A3NA 3IDEA 5DXDA 5LWBA 4LMFA 1ND2C 5IK4A 4OVEA 3AP4A 2UYBA 4NHXA 1MS8A 3MPPG 1DYKA 3I54A 2VUDA 4RGKA 3WUCA 4BQYA 5J96B 4GMP3 2WA3A 4JCKA 1LU2A 2WYFA 1LHNA 1H1IA 1LOBA 1XB9A 4WVMB 4HZFA 2E33A 1KJLA 2W5FA 4P00B 3ZFGA 1SBFA 4F3JA 5C4WC 4TN7A 2HYXA 2NYYA 2ARXA 2E31A 1GYKA 4N53A 2X5IC 1W39A 3AXDA 2J1RA 4NN0A 1FI2A 4QPGA 5EXOA 4ATFA 5DMYA 4YVSB 5FP4A 2QQPA 3U10A 4QMAA 1W04A 5C8CA 1JYNA 2YC0A 5FBJA 2QDNA 5K0UC 1H1MA 2W08A 4OLLA 1KXGA 1MS3A 3MFCA 3UGFA 2PFWA 2B39A 2Y33A 2PHDA 4RFT0 3FHQA 5FQ0A 1A78A 1APNA 1MS1A 1PHMA 2YPJA 3FX3A 3LFMA 3OYWA 4PQQA 5FYBA 1OQDA 2VMEA 2VOTA 2PHRA 3BYWA 5ACA1 1W8ZA 1WLCA 4ET7A 3NAPB 4F8AA 1W90A 3KV4A 5HXVA 4W6WA 1D7PM 4FSJA 3AYDA 4IV3A 2DFBA 1T6GC 2B45X 5FO9B 4PDWA 3CL1A 4EN0A 2OUHA 5T55A 1D4M3 3NWKA 3EB7A 3ILRA 4XUTA 4E8CA 3O0XA 5GLWA 5A1LA 2VW1A 3WR0A 4BPZA 1GANA 2PN5A 4FPCA 3I7DA 5FZ9A 1G9FA 4RN5A 3P3PA 1NCQA 4GAZA 1SDDB 2D3RA 2VMHA 1RMU3 4XFGA 5FYYA 3I3EA 3ELNA 4MOAA 4I0BA 3RS6A 4CDQC 2K9ZA 1DZRA 3DUIA 5T5PA 3N7JA 2YYOA 2HWE3 1SFNA 3PVOA 4BH9A 5IK8A 2XKOA 2VOXA 4XMAA 1FMD2 3N4MA 3VKFC 2OZJA 3FFZA 2WNUB 1NA1B 5C33A 4A45A 1W6PA 3ZSKA 1RUH3 4TSVA 2P17A 4FFGA 3MF6A 1D2QA 1OOPC 4WM7C 2JDZA 2WZPP 2FMDA 4AHWA 2FZ2A 5JOZA 3MDPA 2ZGRA 1O91A 5JXHA 5FYCA 4AZZA 4CDXC 2XG3A 3AYAA 3CMGA 4H7MA 4CEWA 5DZGA 4X6RB 2ZHMA 5KBFA 2JB8A 5KHKA 4Q0SA 3ZN6A 2V4AA 2ZHKA 4A2UA 3I49A 3FLRA 4XUNA 4LHLA 4QGMA 1W9YA 1RMU1 1GFF2 1V6NA 4YRDA 2NQYA 1PVC3 2EXKA 2XWJB 4AVCA 1GZ9A 5IATA 1BKZA 2ID4A 2UURA 4YGEA 1IQDC 5CFCC 4QQOA 2VG9A 3PTYA 4OZXA 1ODNA 3ACIA 4IGPA 2BW8A 1R083 4EWDA 4HXCA 1S2EA 4CCCA 5IW0A 3DPRB 1ZYBA 3KWVA 5BUVA 2DV9A 4RL7A 1BQPA 5CBLA 5BNOC 2W52A 5FZCA 1CQ9A 5B2GB 5L36A 3J7NA 1AXYA 4N43A 4HVOA 2Z5WA 3WW3A 2FMYA 1C28A 2Y60A 2QTWB 1OXCA 3S5AA 1IHMA 4GJZA 3ZKUA 3KLSA 3WF0A 1PVC1 3THDA 4BB3A 2YFUA 3K4DA 1ND3B 1HV0A 4IETA 4BMBA 3VBUC 5IK5A 1O8SA 1SCRA 5FY7A 1TE1B 1UYZA 3ORJA 4AVTA 1CPNA 4XQWA 3HVDA 4ISRA 3OD0A 5FYIA 3MIGA 2A75A 2PA7A 2WAAA 4TZDA 3KZ4C 2E32A 2P3KA 4WZFA 1K42A 4UOJA 1YFXA 1C4RA 2V4VA 4A3ZA 4QXCA 2RMU1 5I8YA 1WW4A 1SPPA 2DCKA 1GR3A 2ZHNA 4P9JA 4EWEA 2Y8KA 3F95A 4AHXA 1OQ1A 4YW7A 5L9RA 5FY8A 3M4FA 5CIRA 1D4M2 4YW3A 3E6CC 3MIEA 1MVEA 3D4KA 5JSRA 1SBDA 1DGRA 2ATFA 1JHNA 2EA7A 4P9LA 1UZWA 3WDVA 1B35A 3VZKA 5F3IA 4A7ZA 3VBHA 4Y1ZA 4CZSA 3JB8A 1RMU2 3RI9A 2GZWA 3JZVA 2C9AA 5I0UA 2QQMA 3D8CA 1WCUA 3ST7A 2HWE2 4XFIA 3GYDA 1C5HA 1XSQA 1W0PA 4IV1B 1G6NA 4EWAA 2BUKA 4L0PA 5C3QA 1RUH2 3I8TA 4AVAA 5FXVA 5DG2A 2Y0IA 2IFRA 4DZGA 1D2SA 2E53A 2WFPA 2YC4A 4KBBA 4FP2A 1YNAA 2W47A 4GB33 4RS5C 5ANNA 3PHMA 3ZYPA 1AR73 5KXEA 3WNMA 5FYSA 3UKVA 4ZU5A 4K3UA 2P5BA 2D5HA 3F2ZA 3N9LA 4ZXEA 1UN1A 1AR63 5JWPA 1DGLA 1VR3A 4XCAA 5SV8A 1PVC2 1URXA 3ZXGA 5FP7A 4HONA 3J9SA 3MO4A 4NRMA 4IW3A 2CHHA 3RYPA 1LOGA 3CJIA 3V0AB 1U5ZA 1V6LA 2C1FA 2JG9B 3NJVA 4JGZC 4M3CF 2XHNA 1R082 4QKDA 2ES3A 4LO8A 4QX2A 5IVFA 2BU9A 5F3CA 5I0SA 1KITA 4DY3A 1CGPA 4C0HA 3S6PA 4DINB 2VCBA 4XUQA 3SQOA 1VMJA 3AKPA 4XQ4A 1UZYA 2R7EB 4Z92B 1VAMA 1QOOA 1RUI3 4LIUA 4Q27A 3VD4A 4FXGB 5L19A 1ALYA 2F4LA 2OUJA 4M3CB 3UJOA 2GP5A 1I1EA 4X6QB 1NAEA 2F4PA 1DP0A 1AR61 2Q4SA 5GZCA 3MF9A 1W6MB 3N9NA 2VOVA 3MLJA 4YNIA 1CIWA 1W2OA 3N9QA 4JAAA 4ATEA 4D8MA 1XXNA 2YC2A 4MGTA 4PF5A 5T54A 5I8TA 4R9DA 1STMA 1CX1A 1OKQA 2W95A 5CNAA 3GBFA 3RWKX 4B7EA 3O1VA 4OHZA 1NUKA 4V2WA 4IEUA 3SCFA 4EN9B 3VBSC 3N7LA 3V64A 4CCJA 3U78A 2J22A 4HKWA 4UFLA 3TNQA 5GZEA 4XW3A 3HEIA 1PGL1 1JODA 3OEBA 4BQ4A 2VNOA 4ZS3A 2KXLA 4Y5Z0 1ZRFA 4LBOA 3FJSA 3LIGA 5FMCA 1VALA 5CKQA 3G6JB 1Z0HA 1WLTA 2OIIA 1KFUL 3IM0A 4YW4A 3LEGA 5IUQA 5HPOA 1DBNA 3QCWA 5JMCA 5KHIA 1VE0A 2WT0A 4CU9A 1UYYA 1QJEA 3UKNA 1LODA 1QF3A 1JYVA 3VBRA 5HCHA 4LNVA 3LDRA 1JOBA 2XLFA 4XPVA 3TN93 2PHFA 1HJGA 2FDJA 1JYIA 3PIJA 5FXWA 4DRRA 3RRDA 3NNFA 2YHJA 3LWCA 1W99A 4FAGA 4JHZA 3H3UA 3I3MA 4OHYA 3VZOA 5JVVA 1SCSA 2VW0A 1BVP1 4IEYA 3WT3A 4NIHA 4M01A 5FMBA 2VXJA 2O8OA 3H1YA 1O5UA 1CAUA 1WBFA 2CNAA 2ZX4A 5A32B 1WMEA 1CAVA 4Y22B 1HLCA 2Y64A 4LIVA 2BNMA 3ZX7A 5I93A 3M3CA 2JWPA 3FL7A 1V6MA 1KS4A 3IBMA 1O4ZA 4QB6A 1XYOA 2XL9A 4FOWA 3AM2A 3J4UH 3U11A 1CX4A 2ZTNA 1MPXA 3ECQA 4GB32 4E4HA 5IFPA 3BUCA 1AR72 4U36A 2VO5A 3B02A 3I59A 5CZKA 3TN91 3I3QA 2E6VA 2IC1A 2P3YA
chains in the Genus database with same CATH topology
4IE0A 3O1TA 4NROA 3H8XA 2FDGA 2FDIA 3BIEA 4IE7A 3BKZA 3I49A 3O1RA 4CXWA 3BTZA 2FD8A 2FDHA 4OCTA 4QKBA 4NRMA 3RZKA 4QKDA 4QHOA 4NPMA 4IE6A 2IUWA 3T4VA 3BTYA 3I2OA 3O1UA 4NIGA 3RZLA 4O61A 4O7XA 4NPLA 2FDFA 4CXYA 4NIDA 3S5AA 4IDZA 4NRQA 4MGTA 4CXXA 5F8PA 3O1VA 4QKFA 4ZS3A 4QKNA 3BU0A 4IE4A 3LFMA 4NRPA 4ZHNA 3O1OA 4RFRB 4MG2A 3O1PA 3O1SA 2FDJA 3RZHA 3S57A 3RZJA 3KHBA 4NJ4A 3RZGA 3I3MA 3BTXA 2FDKA 3T4HB 3H8RA 4NIHA 3T3YA 4NIIA 3BI3A 3RZMA 5DABA 4IE5A 4ZS2A 4JHTA 3H8OA 3BUCA 3KHCA 3O1MA 3I3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IE0 A;  3O1T A;  4NRO A;  3H8X A;  2FDG A;  2FDI A;  3BIE A;  4IE7 A;  3BKZ A;  3I49 A;  3O1R A;  4CXW A;  3BTZ A;  2FD8 A;  2FDH A;  4OCT A;  4QKB A;  4NRM A;  3RZK A;  4QKD A;  4QHO A;  4NPM A;  4IE6 A;  2IUW A;  3T4V A;  3BTY A;  3I2O A;  3O1U A;  4NIG A;  3RZL A;  4O61 A;  4O7X A;  4NPL A;  2FDF A;  4CXY A;  4NID A;  3S5A A;  4IDZ A;  4NRQ A;  4MGT A;  4CXX A;  5F8P A;  3O1V A;  4QKF A;  4ZS3 A;  4QKN A;  3BU0 A;  4IE4 A;  3LFM A;  4NRP A;  4ZHN A;  3O1O A;  4RFR B;  4MG2 A;  3O1P A;  3O1S A;  2FDJ A;  3RZH A;  3S57 A;  3RZJ A;  3KHB A;  4NJ4 A;  3RZG A;  3I3M A;  3BTX A;  2FDK A;  3T4H B;  3H8R A;  4NIH A;  3T3Y A;  4NII A;  3BI3 A;  3RZM A;  5DAB A;  4IE5 A;  4ZS2 A;  4JHT A;  3H8O A;  3BUC A;  3KHC A;  3O1M A;  3I3Q A; 
#chains in the Genus database with same CATH topology
 2XHK A;  4ZON A;  1V9U 1;  1AR6 2;  2DUR A;  2E7A A;  5ABJ C;  4KG8 A;  4KH9 A;  4B3N A;  1X33 A;  3WDY A;  4EQV A;  2GDF A;  2OT7 A;  3OEA A;  4QX3 A;  3OY8 B;  5F2S A;  1YQ5 A;  2GNT A;  4YVW B;  3WP3 A;  5BNN A;  1HB3 A;  3PU3 A;  4DFS A;  2ZGS A;  4HN0 A;  1YEW A;  3ES4 A;  3TEW A;  1RGS A;  2A73 B;  5E1R A;  3RZK A;  1K12 A;  4XDP A;  3RMX A;  1W8H A;  3H1W A;  2VXR A;  2EIB A;  2YU1 A;  5H9R A;  3VD3 A;  1S2K A;  4COW A;  2FQP A;  5FYH A;  2JX9 A;  1LOA A;  3ZFG C;  3QH7 A;  1N3O A;  1QJX 3;  1UU5 A;  1ZZ8 A;  1Q8S A;  2EXI A;  2B8M A;  2UWB A;  1U5Y A;  2R1B A;  2VR4 A;  5CKM A;  5A7S A;  3N7M A;  3WQB A;  1PGL 2;  4N53 C;  3NJY A;  4YZ3 A;  1RUI 2;  4QPG C;  3WEZ A;  3ROU A;  4CCK A;  4XF4 A;  5C8C C;  5LRR A;  4AGV A;  2WZE A;  3WG2 A;  2YBP A;  2BGP A;  3KT7 A;  4Q4V 3;  3VDD B;  3HQX A;  4FOY A;  5IVB A;  3OJB A;  3GBG A;  3KM5 A;  2X53 S;  2BBA A;  2JDM A;  4R9B A;  5BYN A;  3OBZ A;  5HCA A;  2Q30 A;  1ULP A;  3KS7 A;  2BNN A;  3VBF B;  1VAK A;  1SLA A;  4CRQ A;  4XF3 A;  5F8P A;  5GLZ A;  4E8D A;  2CU5 A;  1POV 3;  4DY5 A;  4KWK A;  4C90 A;  2O14 A;  1QJX 1;  2RJL A;  1JI6 A;  2BER A;  5KC6 A;  1W8N A;  2XWB B;  3PUS A;  2LRO A;  2R30 A;  1YRZ A;  1H8T A;  3CKH A;  1ZA4 A;  2PHW A;  2WQZ C;  1QH6 A;  5HCB A;  1L7Q A;  2BVV A;  2YZ4 A;  1NCQ C;  1OA4 A;  1H6X A;  1HB4 A;  4GKX A;  3BU0 A;  4XOG A;  3MV1 1;  4PI2 A;  1E5R A;  1PNG A;  2DCZ A;  2OQ6 A;  4KU8 A;  2XVK A;  4XF1 A;  4CSW A;  3ENR A;  3TN9 2;  1VMF A;  1LHU A;  2JDA A;  3LA3 A;  3M3I A;  4TXW A;  3T2P A;  4MXW A;  3O1S A;  1RHI 1;  1HV1 A;  3SMH A;  2VCM A;  4AAP A;  3J7H A;  3GM8 A;  1CPM A;  1YHF A;  3GXU A;  2JEC A;  1LEM A;  3RZG A;  1UMZ A;  3FFQ A;  1POV 1;  1W6N A;  4YWA A;  2P37 A;  3Q8B A;  4QAW A;  1OF3 A;  2I74 A;  3RYK A;  5CG9 A;  4FBF A;  3JQW A;  4CEW C;  3LGR A;  1DFQ A;  1L7R A;  2XKP A;  4TLF A;  4P02 B;  5EQU A;  1OUR A;  3HD8 B;  3JXS A;  2WA4 A;  3O0V A;  2Y34 A;  3AYE A;  3OSD A;  4GD4 A;  4TYS A;  4XVH A;  4P14 A;  1W6Q A;  2RS5 1;  1UX6 A;  2OQ7 A;  3BB6 A;  3H3Z A;  4LLO A;  2YG0 A;  4YG3 A;  5A80 A;  1AL2 1;  3BU7 A;  1H8V A;  3CBN A;  1UOF A;  4G4F A;  3T1L A;  1NY7 1;  3VBO B;  4AED B;  1PM7 A;  3JB4 C;  1WD4 A;  1YUD A;  1SFY A;  1ASJ 1;  4KQ7 A;  4AK3 A;  1CZS A;  3C2U A;  1H1A A;  2ZPX A;  4GH4 A;  3L2Y A;  1HRI 3;  1QJY 1;  5FPU A;  2ZHL A;  2D6L X;  3A23 A;  4LQR A;  4MGZ E;  2ZX2 A;  1GP5 A;  2HEW F;  1SLC A;  4MGS A;  4BWO A;  3BIE A;  3EMR A;  5FZO A;  5FYV A;  3VKN A;  5T5O A;  4NWV A;  1AR8 3;  5KHH A;  5AVA A;  2D44 A;  4AI2 A;  4I3G A;  4COY A;  1I9R A;  3ACG A;  2WIN B;  4XF9 A;  1UMH A;  1YQ2 A;  2B46 X;  4HPK A;  4B1M A;  4Q0P A;  5C4W B;  5E88 A;  4OMD A;  1QJX 2;  4JQT A;  4GMP 0;  4BQ1 A;  2VUJ A;  2CSG A;  4M4R A;  4CUC A;  2VH9 A;  2X5I B;  1W6O B;  4KNC A;  4ZU4 A;  4DUV A;  2ZAH A;  3WG4 A;  3ZDS A;  3R4D B;  2C24 A;  2JD4 A;  2Q1M A;  2ZAB A;  3UL2 A;  1ZRE A;  4IEZ A;  4LBQ B;  4Y1U A;  3WVJ A;  5F5I A;  1HRI 1;  3ACH A;  3O7O A;  2WAB A;  1OD3 A;  1OVS A;  3B69 A;  1V6O A;  2HBT A;  3JU9 A;  3PJY A;  2ZGK A;  4NIG A;  4DNY A;  1W06 A;  4S2F A;  4O7X A;  5DUW A;  1AR8 1;  4I01 A;  3SCG A;  4C1W A;  4Q8K A;  4JTN A;  5IWF A;  4COZ A;  3RI8 A;  2JG8 A;  1JZ7 A;  4AQT A;  3IPV A;  5A3U A;  1D0H A;  3AJZ A;  2WLP A;  5CFD B;  4CCM A;  3KT1 A;  3LAG A;  1W9T A;  2EAL A;  3HNY M;  2QVS B;  5CAD A;  1CON A;  1QU0 A;  3AP5 A;  1GWM A;  1J59 A;  1BYH A;  1PX4 A;  4C91 A;  1B35 C;  1VAV A;  4DQA A;  4WVZ A;  4DPN A;  4IER A;  5G05 L;  5F7U A;  5I0R A;  5I0D A;  3VBH C;  4FP3 A;  4UYB A;  4I0A A;  1ENS A;  2RS5 2;  3PL0 A;  4K21 A;  2GMP A;  1UNB A;  2BTV C;  3NV2 A;  1PO2 1;  2LRP A;  4CDQ B;  3IKW A;  3LSD A;  2BWC A;  2RG4 A;  3GDB A;  5F6L B;  1NY7 2;  2VEC A;  4LOR A;  4XFA A;  1HN1 A;  3WX5 A;  1CJD A;  1CWP A;  1ZVF A;  2X10 A;  2Y6F A;  3BOD A;  1GP4 A;  3UGH A;  5LK7 B;  5FPA A;  2ZZQ A;  1IG3 A;  4IEX A;  1F35 A;  4RYD A;  4DXR A;  4UXA A;  2YU2 A;  2EXJ A;  4AHZ A;  2AAC A;  4WVM A;  2DF7 A;  4O65 A;  2BFU L;  1Q3E A;  2VQU A;  2J1U A;  3ZFF C;  3K3N A;  3RZJ A;  3I2H A;  3AKR A;  2AYH A;  5IAV A;  4CDX B;  1I5P A;  4Q0Q A;  2VZ1 A;  2Q5T A;  4K1Y A;  5A6Y A;  1BBT 3;  2J7M A;  4YVS A;  4HMZ A;  4NPR A;  3SEP A;  4A6S A;  3FBY A;  2WNV B;  3LF7 A;  2XB6 C;  1QMJ A;  1H2N A;  3H50 A;  3WW4 A;  2LS6 A;  2XL7 A;  1GWK A;  4MGY E;  5FZI A;  1VBE 3;  1F2N A;  4XC9 A;  3VDC A;  5SV5 A;  1G9A A;  2ARA A;  3CO2 A;  5JR7 B;  3I2D A;  4W6Y A;  1V6K A;  1JBC A;  3CJI C;  4AFD A;  4MHR A;  1HQW A;  3HPN A;  1HRI 2;  2P3J A;  4XJA A;  1CN1 A;  5KHJ A;  1F5F A;  5GZF A;  5JUV A;  3RDI A;  3ABZ A;  2QQU A;  3M8L A;  4LKD A;  2WQ8 A;  4BE3 A;  4UI9 L;  3NKG A;  1AR8 2;  2BV4 A;  2PMW B;  1V6I A;  2ZGT A;  1WZX A;  2E63 A;  3U07 A;  3Q8E A;  1S0F A;  1JS9 A;  1NCR B;  4IE7 A;  5J09 A;  3OCP A;  5E6H A;  4FAH A;  1Q43 A;  2JE7 A;  3RWN A;  4D6S A;  3B94 A;  4PHZ A;  3SH3 A;  4E4S A;  3ZPY A;  1ENQ A;  1VBE 1;  5KC5 A;  1AYM 3;  2AR6 A;  3OGG A;  4YGD A;  5E16 A;  2DUP A;  4RQP A;  4YFZ A;  1W28 A;  5F3E A;  1JZ3 A;  2ARB A;  1NA1 A;  2VVE A;  2WNU A;  5FMD A;  1FMD 3;  2WO1 A;  2JIJ A;  2RV9 A;  3R0R A;  1OH4 A;  1Q8O A;  4R9C A;  1AVB A;  1QXR A;  1YFW A;  5A7P A;  1G9B A;  4XAB A;  2DUO A;  3Q8C A;  5EFU A;  5EJ3 A;  1OLQ A;  2BEO A;  4IEW A;  2QQV A;  2AEY A;  4A41 A;  2D5F A;  1JZ6 A;  2UWA A;  5JIU A;  1XQN A;  5A7O A;  2DWR A;  3H1M A;  2QFE A;  4CYD A;  3BTY A;  3WF2 A;  4RGA A;  3I2O A;  2ADE A;  2W2I A;  1KDK A;  1W8F A;  1S0C A;  1YI7 A;  3ITQ A;  1Y4W A;  5LBB A;  1MVQ A;  4QDR A;  4MLO A;  1DGW A;  4BQX A;  1QJU 1;  3NO8 A;  4OUE A;  1ZX5 A;  5JAX A;  4ISQ A;  2J42 A;  3J26 N;  3WSO A;  1MR5 A;  1RL3 A;  2VZO A;  4UWD A;  4RSU A;  4CDU C;  2D6N A;  2E26 A;  3VBR C;  1QNW A;  2D98 A;  1GBG A;  4EJR A;  2RVA A;  1VB4 A;  4NMI A;  2G9Z A;  1AYM 1;  2VCC A;  4OI2 A;  5HCF A;  2WWJ A;  4WBB A;  1EUU A;  1WA4 A;  1NE4 A;  2RS3 3;  4K20 A;  4AWD A;  4BK5 A;  2ZX3 A;  4QPW A;  4AF9 A;  1RUJ 3;  1WMF A;  2ZGP A;  1OLM A;  2IVI B;  3D0S A;  2BGC A;  3Q8F A;  3VHR A;  1LOE A;  5I91 A;  1QOS A;  3KQR A;  1HXS 1;  2DU0 A;  1AZD A;  2G4I A;  5A33 A;  4QDQ A;  5FYU A;  5LY2 A;  2WZR 1;  4BXS V;  1A34 A;  2VUL A;  4LBM A;  3LOI A;  2JDN A;  1OLM E;  2GSY A;  1H2K A;  2JD9 A;  2VOK A;  4Q1R A;  2ZGO A;  1UZV A;  1JTZ X;  2MHF A;  1NG0 A;  4BHP A;  3AYC A;  1K45 A;  2QQL A;  3WOG A;  5ACA 3;  5ISL A;  4ZHN A;  4MG2 A;  2JDP A;  2G9G A;  4M0N A;  4W65 A;  3POI A;  5F5C A;  4ERO A;  1XND A;  3CF6 E;  1YI9 A;  1ZZ6 A;  1UYX A;  1FXZ A;  1V0A A;  4LHS A;  4RR3 B;  1CR7 A;  4AVS A;  2ZXQ A;  2WT1 A;  1BBT 2;  4NHL A;  1PZ8 A;  5IAX A;  3ZXA C;  3ON7 A;  3MIB A;  5JMO A;  2OVU A;  2V09 A;  3AZX A;  2CTV A;  2RS3 1;  1BHG A;  1RUJ 1;  5EJ1 B;  4CP9 B;  3M3Q A;  4BLJ A;  3ACL A;  2R49 A;  2J1S A;  2GP3 A;  2J1V A;  2VNR A;  4KG0 A;  1ONA A;  1HIX A;  1VBE 2;  3I4I A;  2IXK A;  4HVR A;  4QPI B;  4J1X A;  5BNN C;  4Z07 A;  2VNG A;  1DYP A;  2WWU A;  3AMN A;  3MLL A;  4LUK A;  4QXB A;  4FQZ A;  4XXP A;  5E8A A;  2K0G A;  1COV 3;  3QOP A;  4ZS2 A;  4JGZ B;  1DHK B;  2WSV A;  5H9Q A;  1MAC A;  5FZ6 A;  3MGU A;  1YWK A;  3KB5 A;  5LAT A;  2WWS A;  2W1Q A;  4OHV A;  3U1X A;  5FP8 A;  1GZW B;  4GKY A;  4P5Y A;  4W6X A;  3VUO A;  3KD4 A;  1E5H A;  2HWB 3;  2A1X A;  1U12 A;  2H0V A;  1IS3 A;  1QJF A;  4SBV A;  2C26 A;  2Y6K A;  1QJU 2;  4AYU A;  2CWS A;  3VL9 A;  3N7K A;  4HT1 T;  1GLH A;  1WCS A;  2DCT A;  4IXL A;  3ZIX A;  4GJY A;  1UX7 A;  4CXW A;  1PGS A;  5FZ8 A;  1AYM 2;  2JE9 A;  4P08 A;  3PU8 A;  2ZX0 A;  5A6X A;  2ZMN A;  4B4P A;  5C9A B;  1COV 1;  4P9Y A;  2NLR A;  1NX9 A;  1LRH A;  1BMV 2;  1RVF 3;  1G86 A;  4LK6 A;  5JSO A;  1RTV A;  1JN2 P;  1OT5 A;  3HQR A;  3A21 A;  1RUE 1;  1NOV A;  4R4X A;  3OPT A;  3R4S A;  3QLQ A;  1OKO A;  1XNT A;  2VMF A;  4NPM A;  2ZS6 B;  4E4Z A;  3DKW A;  2HWB 1;  5F37 A;  5BPX A;  1H8T C;  3AKS A;  1H0B A;  4HK9 A;  2JEN A;  4WM8 B;  2HKX A;  5LK5 A;  1W3V A;  1TNR A;  5ANQ A;  1RUO A;  2ARE A;  4NE9 A;  4LO6 B;  4N8M A;  3ZMO A;  1GUI A;  1S0E A;  3JCI A;  3AP9 A;  5JOW A;  1E57 A;  2BFU S;  4IDZ A;  2QNK A;  2VBB A;  3B00 A;  3POB A;  4MVT A;  5A3O A;  3WDU A;  2RS3 2;  3V0A A;  5APA A;  3H0O A;  1PVX A;  5FZ7 A;  2IZW A;  2W1S A;  4J1W A;  1RVF 1;  1RUJ 2;  1N47 A;  3AZW A;  2BBV A;  1W8U A;  2L9L A;  2QQJ A;  2YBS A;  3INA A;  3ZXD A;  4FOV A;  2QDR A;  3N35 A;  1OBN A;  2JXA A;  4S2H A;  4IGO A;  5IVE A;  3OUJ A;  5IVY A;  3TRS B;  2VC9 A;  3QD6 A;  2E7T A;  3GHN A;  1ZRD A;  2ZCW A;  2ETE A;  4M3C A;  5FKB A;  2RMU 3;  2WT2 A;  5ACA 2;  3K4Z A;  1YO8 A;  4MET A;  1DQ4 A;  4Q0V A;  5LA9 A;  4MUV A;  1RUC 3;  4YZ5 A;  2XPJ A;  2QZ3 A;  1XYP A;  5L73 A;  1FYU A;  3H9A A;  1W6M A;  4ZPI A;  3ZSE A;  3CHX A;  1U5X A;  3IT8 A;  4M3C E;  4ARY A;  4H55 A;  4L99 A;  1AXZ A;  1K3I A;  2AEZ A;  5KR7 A;  2IWG B;  3VGI A;  5BY5 A;  3OGR A;  2NN8 A;  2QKD A;  3B5L B;  4EN6 B;  1I6X A;  1GZC A;  2PAE A;  4GH4 C;  1TMF 3;  5FUN A;  4HAN A;  1RB8 G;  1OA2 A;  1VRH 3;  4Y4Y A;  3H8R A;  2R06 1;  4YZ2 A;  4LKE A;  5F1R A;  2ILM A;  1N3Q A;  2QUO A;  4Q26 A;  5DAP A;  1ZBE 1;  3GZT B;  4CTE A;  4OI4 A;  1UPS A;  4JKL A;  3UJQ A;  1O3T A;  1PK6 B;  3HR9 A;  4LIT A;  1COV 2;  3QH6 A;  1H4H A;  4JGY B;  4V2V A;  4XIK A;  5FZD A;  3WF3 A;  2A6V A;  5FYM A;  4FTS A;  3I97 A;  5ERL A;  3LPG A;  2OA2 A;  3X29 B;  1H4G A;  5FLJ A;  3RQ0 A;  4KGG A;  2ZGN A;  1RUC 1;  1TZO A;  3CZJ A;  1OVP A;  2FCU A;  4MZU A;  2EIE A;  5DDJ 3;  1MQT B;  3TNP B;  3LCP A;  1K5M A;  4H7L A;  4BQ2 A;  5JOX A;  4YGB A;  1S0B A;  3WY6 A;  1DGR N;  4AOC A;  3ZXJ A;  2HWB 2;  4XF0 A;  1JUH A;  5C5U A;  5B4N A;  3RFR A;  3OPW A;  1JYT A;  1IS5 A;  4QX5 A;  1W0O A;  4IE0 A;  4MO3 M;  2ENR A;  2I07 B;  2W68 A;  5FXZ A;  2YV8 A;  4CDW B;  4Y20 B;  4QQP A;  3JUU A;  4QGN A;  2P2K A;  1TMF 1;  2WUH A;  3VB9 A;  5FOB B;  1D0G A;  2A71 A;  1VRH 1;  3W9A A;  1LNS A;  3PDQ A;  1J3Q A;  5A32 A;  4DO0 A;  4Y1X A;  1ULG A;  4ZXK A;  1DG6 A;  3E6D A;  2ORZ A;  3T2Q A;  3WW1 A;  1OUS A;  1RVF 2;  2JG8 C;  1LEC A;  2WAO A;  4EV0 A;  4XZU G;  2B42 B;  4RGG A;  4DXZ A;  1C8N A;  4W4Z A;  3VHP A;  2CAV A;  1T6B X;  1NXD 1;  4P5H A;  4Y1V A;  5DDJ 1;  1YQC A;  4LBK A;  2ORX A;  1VBB 3;  2F6B A;  2YUE A;  1S2B A;  5FWJ A;  3S30 A;  3DXU A;  2GNM A;  5E89 A;  3W20 A;  3ZN4 A;  4EZ4 A;  1POV 0;  1UMI A;  1BEV 3;  2A6W A;  2UY8 A;  4N90 A;  5FTT C;  5JZG C;  1W0N A;  1NCQ B;  2VQ0 A;  2KR2 A;  5FPV A;  2AUY A;  3M3E A;  1QXJ A;  3N9O A;  2SLI A;  3DXT A;  1V00 A;  5D2A A;  1DGW X;  5FPX A;  5A1A A;  4JX0 A;  3W59 A;  1REF A;  1AR9 3;  4BIO A;  3WG1 A;  1AF9 A;  5J1X A;  1GIC A;  2C4X A;  3O5S A;  1W6P B;  2B7Y A;  1ZRR A;  3LFI A;  5C7G A;  4HVQ A;  1CAX A;  1WLD A;  2GND A;  5FIX A;  4MGI E;  3ZOI A;  4QXH A;  3GF6 A;  3AMM A;  4O9G A;  4Y1Y A;  3NQH A;  5JOY A;  1VBB 1;  1QNY A;  4YVS C;  1J58 A;  1XSR A;  4O9E A;  4AE2 A;  3TBD A;  4BZ4 A;  1BEV 1;  3USU B;  5EZW A;  2RMU 2;  3IAP A;  4QX7 A;  4UFI A;  3WZ1 A;  4QKN A;  1QJZ A;  1ZBA 1;  3SIT A;  1BK1 A;  1RUC 2;  4BOW A;  5L9B A;  5DUU A;  2Q1F A;  3VDD A;  1GQG A;  5EPA A;  5FUP A;  4AW7 A;  2WS9 1;  1R1A 1;  2WJS A;  5FZK A;  1YYN A;  1VB2 A;  4LBN A;  3I3D A;  1G9D A;  2HLE A;  1EP0 A;  1KFX L;  2VVF A;  3DCQ A;  4S2D A;  3HWJ A;  1AR9 1;  5HBA A;  3D5O A;  2G19 A;  5G04 L;  2R1D A;  1REE A;  5F3G A;  3TYJ A;  4CVU A;  5DZF A;  2O1Q A;  2X8K A;  1TMF 2;  4P9W A;  1BK0 A;  2WKK A;  3TEX A;  1TME 3;  2CYF A;  3G7D A;  4COU A;  2BPA 2;  3OGJ A;  1VRH 2;  3OBT A;  4MH0 E;  4XZP A;  2R0H A;  5BNP A;  3MW3 A;  2XJQ A;  3BTX A;  1XC6 A;  2PAK A;  1YQ8 A;  2JDH A;  1P8J A;  2XUM A;  4XIO A;  5A3P A;  2D6O X;  4R4Z A;  5T5J A;  4BLI A;  4ZKT B;  4D6Q A;  4PQ9 A;  5GLV A;  4FPO B;  3S5Q A;  1PMH X;  5K8S A;  5FAX A;  1C5I A;  2G1M A;  4ASK A;  1A8D A;  1JU4 A;  1MS9 A;  3A0N A;  5IVV A;  4K7J A;  1OFS A;  5FRE A;  5DDJ 2;  3OGS A;  4UF0 B;  5FZF A;  3CLP A;  1Y43 B;  4LLF A;  4Y24 A;  4XUO A;  3H8O A;  1XE8 A;  1SLI A;  3GZA A;  4RQP C;  5D8A B;  3TEZ A;  1NA1 C;  2VZP A;  4CEY B;  1V9U 3;  3AB0 A;  5HV4 A;  2C0Z A;  2LM3 A;  2DU1 A;  1N1Y A;  1O5L A;  1MS0 A;  1TME 1;  3I3B A;  1WGP A;  5C3S A;  4QHZ A;  4A7Y A;  2OW4 A;  4ITC A;  4URT A;  1EPW A;  3LB9 A;  1ENX A;  4PI0 A;  1NQJ A;  1UOG A;  1BZW A;  4QM8 A;  2OYZ A;  2GU9 A;  3KT4 A;  1AUY A;  3AKQ A;  3BTZ A;  3HT2 A;  3NV1 A;  5I8S A;  2PLV 3;  1GQP A;  2VUC A;  1DQ6 A;  4QKB A;  1FV3 A;  3PTR B;  4UBH A;  3BTA A;  1GOH A;  3E5Q A;  2ZEW A;  4PLO A;  4EN7 B;  5CB7 A;  1Q8Q A;  4CUA A;  4D0Q A;  4I3P A;  5FY9 A;  4GIQ A;  1VBB 2;  4RHV 3;  3CNA A;  1POQ A;  1H30 A;  4AED A;  1LOF C;  1BEV 2;  1CZV A;  3IDA A;  3VBH B;  4WZC A;  2VGD A;  1GNZ A;  4PJY A;  2RM2 3;  4K40 A;  3SKV A;  2V73 A;  3O12 A;  3VKL A;  1LUL A;  5K7P A;  4JKM A;  3K48 A;  3SIS A;  1HQL A;  2XJR A;  4CU8 A;  2Q0A A;  3SNM A;  3UKT A;  2FCT A;  1XNK A;  4CU6 A;  3VV1 A;  3N36 A;  1AR9 2;  1NQD A;  5J98 B;  1V70 A;  2DDU A;  2WBK A;  2R04 1;  2CGN A;  2Y38 A;  2BZD A;  1UU4 A;  4XYX A;  3WDT A;  5C3O A;  5IHR A;  4AHY A;  3WHU A;  4NID A;  4DRV A;  1GU3 A;  5JDB A;  1MZ5 A;  3WV6 A;  2PLV 1;  3HAG A;  3ZFF B;  4XTP A;  4P9X A;  4IND A;  4KWU A;  5KXB A;  3U0Z A;  2YGM A;  2ADD A;  3GJA A;  3SEE A;  1X7N A;  1C1L A;  1GOF A;  4RHV 1;  3VZJ A;  1UW8 A;  1IS6 A;  5LBE A;  3W5N A;  4IQP A;  2VJX A;  3SC7 X;  5F5Q A;  2DTY A;  4LBQ A;  2OKX A;  4AFM A;  2RM2 1;  5LA0 A;  1SDW A;  2A6Z A;  1CAW B;  1RUN A;  4S2G A;  3CQO A;  4X8P A;  4IE4 A;  3P5B A;  1QGL A;  5L7O B;  3J8F 3;  4HKL A;  1SQ4 A;  4FPH A;  3RNS A;  3CJI B;  4FTB A;  3IAQ A;  1RHI 3;  1Z7S 1;  2ZEY A;  3DEC A;  2BOJ A;  2D40 A;  4FPK A;  4D7T A;  1Y7B A;  1TME 2;  3AL5 A;  5CFD A;  3WNP A;  2GMM A;  1W2U A;  4IV3 C;  4QWN A;  4YM0 A;  4DS0 A;  4RA0 A;  3MW4 A;  3ZXK A;  1F4H A;  1FPN 3;  4XIL A;  4PDW C;  4FPJ A;  4Q29 A;  2FDK A;  4TWT A;  3MEP A;  2NP0 A;  2TUN A;  2QQK A;  3KMH A;  1OUX A;  4L2N A;  4UFK A;  5F6K A;  1JZ5 A;  4MYE A;  5AVP A;  2RS5 3;  3B01 A;  4JQR A;  4XQD A;  1AL2 3;  2P3I A;  3AZY A;  4GAL A;  1VIW B;  2UY9 A;  3SHR A;  2YRO A;  4AR2 A;  1JW6 A;  2R6Q A;  3WHT A;  4CCL A;  2JDU A;  3ZSJ A;  2A7A A;  3J8F 1;  2B9V A;  3ZVX A;  1VBC 1;  1ASJ 3;  4Q4Y 3;  3FUO A;  4AEK A;  4GWJ A;  1V9U 2;  1XOY A;  1QJY 3;  1E5I A;  3O1M A;  4XBN A;  3S7I A;  5CG8 A;  2PAM A;  1OD5 A;  5DZE A;  2XQR A;  1XBF A;  4DXT A;  4AI1 A;  3PMS A;  3VD9 A;  1FPN 1;  4Y5S A;  2BYV E;  4PIZ A;  3TWI A;  1LHW A;  4QQ2 A;  2XBO 1;  1N1V A;  2PTM A;  2WNV A;  1OLR A;  5FY1 A;  5T52 A;  3CEW A;  3C3V A;  2PLV 2;  3HN3 A;  4YM1 A;  4YLZ A;  1N3P A;  2X29 A;  3O1R A;  1UD1 A;  2GNB A;  2WII B;  5FYZ A;  2W0X A;  4CDU B;  1WCK A;  3VBR B;  1TQ5 A;  3HMY A;  4RHV 2;  4NHY A;  1UU6 A;  2HEY F;  3EXU A;  3IZO A;  3M3O A;  4QDS A;  4C8D A;  1FV2 A;  3QAC A;  5LCW L;  1Y3T A;  1GNY A;  1JUI A;  4Q4Y 1;  2RM2 2;  2XVG A;  4JVA A;  4XFC A;  4BYY A;  1J1T A;  2BNO A;  3NMB A;  4E2G A;  1F8V A;  1W2N A;  4QXK A;  4KBZ A;  4XXA A;  3V65 A;  4Y4R A;  2YXS A;  2NM1 A;  2VBD A;  4SLI A;  5CVR A;  1LES A;  2EIG A;  1ND2 B;  2K46 A;  2XH6 A;  4P9I A;  1RUD 3;  2MEV 1;  1Z7S 2;  5DAW A;  4AFA A;  1NCR A;  2WNE A;  4BQ5 A;  3WP6 A;  1J3R A;  4N43 C;  2FDF A;  1DF0 A;  3ZPO A;  4CU7 A;  4PBO A;  4LUL A;  5J37 A;  5JIA A;  1S0D A;  1J1L A;  4UFM A;  4QX8 A;  4BIS A;  1DZQ A;  3E6B A;  3C8X A;  3K46 A;  4K8R B;  4I02 A;  2Y6L A;  2ZKN A;  4AVB A;  3O14 A;  1TVG A;  1FAT A;  2RDS A;  4XDQ A;  4HG6 B;  1Q56 A;  1N1S A;  4AVV A;  5FOJ B;  5K0U B;  5DUV A;  1PO2 3;  2FZ1 A;  3MFA A;  3VZL A;  4HL0 A;  5BNN B;  3KV5 A;  3FZ3 A;  3J8F 2;  2FBE A;  1RXG A;  1OFN A;  2C5D A;  5GZD A;  1UY3 A;  4QB1 A;  3SCH A;  1RUD 1;  5BNQ A;  1RHI 2;  4PF1 A;  1NLQ A;  1KRI A;  4RFR B;  2E7Q A;  4AG4 A;  1SLL A;  1YXW A;  1F5J A;  4CCD A;  4YPJ A;  1K5M C;  3NST A;  5FV3 A;  4BCU A;  4YAR A;  1FPN 2;  1G8W A;  1WA6 X;  2XR4 A;  4R8H A;  3ZFE A;  4I2O A;  4H14 A;  4EZH A;  3IDB B;  1PZ9 A;  2HWD 1;  4TTG A;  3T4H B;  4OHX A;  1ENR A;  4CP0 A;  1H2L A;  1PX3 A;  3AP6 A;  1KDM A;  1LKN A;  3ASI A;  4M0H A;  3HBZ A;  3E5X A;  5EYY A;  3VL8 A;  3WD5 A;  3WIN E;  1O8P A;  3ZKY A;  1LTE A;  3OPZ A;  3WF1 A;  1X8E A;  2P6C A;  5AFE A;  3S7E A;  3T3Y A;  1AL2 2;  1BVV A;  3MW2 A;  4YW2 A;  3POY A;  5T50 A;  3ZM8 A;  2NPI A;  5C3P A;  4CUG A;  1ULE A;  1W9W A;  2WDB A;  3M7A A;  5FCC A;  3ZSM A;  2F17 A;  4Q4Y 2;  1ASJ 2;  2JKB A;  1ULO A;  3A4U A;  5A70 A;  4MV2 A;  3RVH A;  1XE0 A;  3JD7 3;  1QJY 2;  2TEP A;  3ZXF A;  3MIC A;  3VZN A;  2DCJ A;  1X8M A;  1OOP B;  2G9F A;  4WM7 B;  5FZM A;  4RR3 A;  2HEV F;  5DAQ A;  2XLA A;  2VQA A;  2WFF 1;  3DYP A;  4K9S A;  4MSV A;  1JYW A;  2IXJ A;  3NJX A;  5FKC A;  3MLK A;  2WR9 A;  1CES A;  2DVG A;  4PIY A;  5FO7 B;  4YYO A;  1NXM A;  4CP9 A;  3LDB A;  5EIY B;  3BKZ A;  5EYX A;  5J7M A;  3BPZ A;  5DUX A;  4M00 A;  4ORF A;  3OUH A;  4QPI A;  1R64 A;  5FY0 A;  2GN7 A;  1ODM A;  3OB8 A;  2W87 A;  3WLU A;  1XE7 A;  3EHK A;  4JGZ A;  1VPH A;  4XFF A;  5CFC B;  1YCI A;  3PUA A;  4C0B A;  3LIH A;  2E51 A;  1JZ4 A;  3NAP A;  4QHO A;  4A42 A;  3JD7 1;  2A6Y A;  1DDL A;  1UIJ A;  2WN3 A;  4D69 A;  3UGG A;  3WCS A;  1PO1 3;  3FLT A;  4G3Y C;  3M2M A;  3ALQ A;  2A3Y A;  1RUD 2;  5BNO B;  4XFH A;  4XUP A;  2HWF 3;  4P9G A;  2AC1 A;  2IXC A;  4R52 A;  1GMM A;  1C3H A;  1W6Q B;  1YJL A;  3H42 B;  3GZU C;  1QJU 3;  5FXX A;  1W9F A;  3VDD C;  1AX2 A;  1C8M 1;  2EF6 A;  5GM0 A;  1B09 A;  1AYN 3;  2J1E A;  3ZXL A;  2Q8C A;  5DAV A;  2CDO A;  1AJO A;  2RE9 A;  3EO6 A;  3MI8 A;  1JYX A;  2PHU A;  3AX4 A;  4DXS A;  4YZ4 A;  4KWL A;  3JBG 1;  5C9A A;  2HWD 2;  3PUI A;  2J1T A;  4QT6 A;  3SLI A;  3J7L A;  4GH4 B;  4TLG A;  3VBU B;  1EUT A;  2WL1 A;  1ZZ9 A;  1DQ2 A;  3GHM A;  3L2H A;  1PO2 2;  2BOI A;  1UL9 A;  4WV8 A;  3FHI B;  3WNO A;  5BNP C;  1HXS 3;  3ZR5 A;  3SKJ E;  3KV9 A;  2BDR A;  2WZR 3;  2ET7 A;  2P34 A;  5CIS A;  1PO1 1;  5HI0 A;  2JIC A;  3WF4 A;  2VCA A;  1LB2 A;  5LBF A;  4GXL A;  4IGQ A;  2WC2 A;  1UAI A;  1EV1 3;  3C7H A;  5FZ4 A;  3IMN A;  2D93 A;  4YFW A;  3HNM A;  2HWF 1;  4IEV A;  2OS2 A;  3III A;  4QM9 A;  4PCR A;  4U2A A;  4WM8 A;  2CGP A;  2VUA A;  5FMO L;  3K51 A;  1BLZ A;  1HX6 A;  2B9U A;  1LU1 A;  4J25 A;  3HQU A;  3ZLI A;  2DVA A;  3K3O A;  1AYN 1;  2WFF 2;  3EJK A;  3EQE A;  1OH3 A;  4PLM A;  4AEM A;  1O3Q A;  3P6B A;  4HFS A;  3H7J A;  1J84 A;  3K4A A;  4L9B A;  2D6K A;  3S57 A;  3UT0 A;  4B7K A;  4LBJ A;  1W3X A;  3I2J A;  5GLT A;  3I2F A;  1HN0 A;  1LCL A;  1KQR A;  2KM2 A;  1WUV A;  4GQ7 A;  1RUG 3;  1SAC A;  1ULF A;  2AEN A;  3DPR A;  4D3W A;  5FDB A;  4FPE A;  5LEJ A;  3VHN A;  5LRS A;  2VZT A;  1IZ3 A;  4L11 A;  4NAM A;  3DKQ A;  3BI3 A;  3NW4 A;  1EV1 1;  1IKP A;  1VP6 A;  1K5J A;  5FK8 A;  4Q4W 3;  5A7W B;  5CKN A;  2OXB A;  2OZ6 A;  3JD7 2;  3RJR A;  3ZIW A;  3FHA A;  4JHT A;  1DZT A;  1Q5O A;  4D6R A;  4NUB A;  4MX3 A;  1U0A A;  3BCW A;  3C7G A;  4D7S A;  4OI1 A;  1LHO A;  4RS5 B;  2Q8E A;  3T0D A;  1ND3 A;  2Y26 A;  1DQ5 A;  1N1T A;  4LBL A;  5JZG B;  5FZH A;  2V5Y A;  2EXH A;  2CV6 A;  5FLH A;  5FZL A;  3AFG A;  3WQ0 A;  2X05 A;  4A44 A;  4B4R A;  1HKD A;  3H8X A;  1IPK A;  4JTO A;  4XJ9 A;  1W2A X;  3RJ2 X;  5LB6 A;  2VE1 A;  2RDR A;  1RUG 1;  2QQW A;  3M70 A;  1PK6 A;  2IXI A;  3JBG 2;  4KGQ A;  2D3P A;  1RXF A;  2BWA A;  3NV3 A;  3L9J T;  4JGY A;  3T08 A;  3ILF A;  2Z79 A;  2GN3 A;  4Q4W 1;  2ZA9 A;  1ZA7 A;  5KXC A;  1JHJ A;  1NYW A;  1MQT A;  3CDZ B;  1H6Y A;  3DYO A;  4HET A;  4NOT A;  4AI8 A;  2PHT A;  1RUE 3;  1MZ6 A;  4EN8 B;  3LPF A;  1PO1 2;  1GQH A;  3WDX A;  5AC9 3;  5A3L A;  2DVD A;  3NV4 A;  1WMD A;  1C57 A;  2HWF 2;  4Q5O A;  4CDW A;  3BOP A;  1O59 A;  4Y20 A;  3WG3 A;  5HV0 A;  3OG2 A;  4LK7 A;  4QHB A;  2VVD A;  3FMG A;  3VDA A;  3J7M A;  1QEX A;  3B9I A;  3I2K A;  1UY2 A;  1OPO A;  3O0W A;  3FLP A;  4UW4 A;  4KL1 A;  3PVE A;  1AYN 2;  3NKT A;  4O61 A;  1T2X A;  4AL9 A;  4YM2 A;  1WWY A;  3LZZ A;  2YPD A;  3ZYI B;  2VBP A;  3AC0 A;  3SH4 A;  3POE A;  3U37 A;  4B1L A;  3GCX A;  4AFC A;  2GAU A;  4KI5 M;  4GMP 1;  4I09 A;  2LW8 A;  4IV1 A;  3PUR A;  3V0B B;  5CFD C;  1L7L A;  5JSP A;  3VBS B;  1HXS 2;  5H9P A;  4OHW A;  1KJR A;  4XHX A;  2WZR 2;  1SG3 A;  4OQ9 A;  1EAH 3;  3IDC B;  5FR3 A;  1XNA A;  5AC9 1;  1EV1 2;  2VMG A;  3U75 A;  4XAC A;  4FFF A;  2RHP A;  1YLL A;  4UAP A;  2ZJC A;  3VKM A;  4JDO A;  1GKB A;  1UIK A;  2VNV A;  1GWL A;  4LHK A;  5C5T A;  1CIY A;  1LJ7 A;  1PGW 1;  3ZYJ B;  2IVJ A;  3WXP A;  4XEZ A;  1UF2 C;  3U4S A;  3NL1 A;  5JI7 A;  4XMI A;  2RDN A;  1OA3 A;  4NVP A;  4RQP B;  4D94 A;  5FJH A;  4IES A;  3T1M A;  4MAD A;  4N9I A;  3MIF A;  4LXL A;  2YMZ A;  1UQX A;  3AZZ A;  4AFB A;  2JG9 A;  1O3R A;  1LOC A;  1Y9G A;  2XXZ A;  4XCB A;  4E4D X;  3N9P A;  4LA2 A;  1YFU A;  4N7I A;  2YBK A;  3ZYH A;  4MGQ A;  1D4M 1;  1RUG 2;  2R06 3;  2ZGQ A;  5LW9 A;  1ZBE 3;  2BGO A;  2E9Q A;  3DV8 A;  1EAH 1;  5CEH A;  3C7F A;  1LAJ A;  2HBU A;  3GZE A;  3FN9 A;  3USU A;  2FCV A;  3QBQ A;  1H9P A;  2WNV C;  4GZ9 A;  4Q4W 2;  3S0M A;  1YFY A;  4JV4 A;  2JIG A;  4OUM A;  5IVC A;  1FT9 A;  3NNL A;  2ZBJ A;  4LPL A;  4IEO A;  5IT6 A;  1CJP A;  2HWE 1;  2W46 A;  2VZS A;  4Q8L A;  1ZM1 A;  1VLN A;  2VY0 A;  2Q1Z B;  4PIX A;  5C71 A;  1AHS A;  3BPS A;  1EY2 A;  4J6G A;  2XQX A;  1JXN A;  1RUH 1;  1O4T A;  1UY0 A;  1LED A;  2JB4 A;  1YJK A;  3PUQ A;  1S0G A;  4Z8B A;  3PME A;  3AVR A;  2B4K A;  1KS5 A;  3AJY A;  5ABJ B;  3KCX A;  5A33 B;  2FDG A;  4LE4 A;  4LT5 A;  1NLR A;  2P1B A;  2ARC A;  5K4L A;  1G9C A;  2EIC A;  3H8U A;  4I0W B;  4KU7 A;  1D4V B;  3LEK A;  1NKG A;  1OI6 A;  4XAE A;  3WP4 A;  1NCR C;  1ZZB A;  3AFK A;  3UYJ A;  5A6Z A;  2FD8 A;  5IK7 A;  4HK8 A;  1QXP A;  4UF0 A;  5C6C A;  1HW5 A;  3KGL A;  3ZFG B;  1RUE 2;  1Q8P A;  3OF1 A;  4QX0 A;  4Q0U A;  4HOO A;  5AC9 2;  5D8A A;  2MNG A;  1FOD 3;  1S55 A;  2KA3 A;  3FC0 A;  3KVA A;  4N53 B;  3RMY A;  4EYU A;  5JI9 A;  3N9M A;  4QPG B;  4CEY A;  1AX1 A;  3CIH A;  1NLS A;  1R08 1;  3FBM A;  4AQS A;  4ZZ5 A;  3DYM A;  4Z82 A;  1RIT A;  1ZNP A;  5C8C B;  2D6M A;  1PMI A;  2VZR A;  4LO4 B;  1RUF 3;  4BM8 A;  1PGW 2;  1RC6 A;  1WW6 A;  3T4V A;  4CA9 A;  5LEK A;  3BAL A;  1S4C A;  1I5Z A;  2BJS A;  3N3H A;  4FXK B;  5LY1 A;  3O1U A;  5FMO S;  5FQ0 B;  4NWW A;  1MEC 3;  3B93 A;  1VBA 3;  3V56 A;  3RZL A;  3OYW B;  1VBD 3;  3OGV A;  4BQW A;  4YW1 A;  5DN2 A;  4Y22 A;  3IWZ A;  2C9K A;  2PYT A;  4YG6 A;  1LEN A;  2ZAC A;  4PT6 A;  4XJZ A;  2WN2 A;  3H3L A;  1VMH A;  1UCX A;  2JDY A;  2VW2 A;  4JDN A;  4F83 A;  1FNY A;  2GAL A;  4FPY A;  4NRQ A;  4IV3 B;  5KXD A;  4GWN A;  5F39 A;  1YQ6 A;  4FFI A;  3K77 A;  4PDW B;  3LD8 A;  5JLV A;  3WNX A;  1EAH 2;  3ZFE C;  2QE3 A;  2W1U A;  5FP3 A;  3KF3 A;  5LA2 A;  1FOD 1;  3WW2 A;  1GOG A;  1W8W A;  2NZ9 A;  2XJP A;  4QKF A;  4W50 A;  3Q8A A;  5FFO C;  1ULC A;  1TEI A;  2ZML A;  4XJU A;  1ZBA 3;  3WNK A;  1ZRC A;  5FY4 A;  1RUF 1;  3W58 A;  1OPM A;  1UXX X;  3B3Q E;  3P3N A;  2WS9 3;  5T5L A;  1HQN A;  1R1A 3;  3GJB A;  1JYC A;  2EVX A;  2QQN A;  3GCW A;  3OY8 A;  1CZT A;  1MEC 1;  4GA9 A;  1VBA 1;  4AGG A;  4YVW A;  4NRP A;  4ES9 A;  1VBD 1;  1F4A A;  4D7Y A;  3LSE A;  4LR4 A;  3O1P A;  1Y9M A;  4XFB A;  4BJ0 A;  4BK4 A;  3WP5 A;  3I2I A;  3ZFF A;  4Y3O A;  3ZYG A;  4AI0 A;  4FO9 A;  3RZH A;  2D6P A;  4RR3 C;  3TEY A;  2I2S A;  2Y6G A;  2GH8 A;  2PQS A;  2R06 2;  5JXJ A;  2MPF A;  3ETQ A;  1ZBE 2;  2UYA A;  2CAU A;  3A0K A;  1ZRI A;  5A3W A;  3VN4 A;  4CEW B;  1EPZ A;  3BVC A;  4ONU A;  1MS5 A;  2XOM A;  4HBN A;  4K6B A;  3ZN6 B;  1UWW A;  1U5I A;  2D3S A;  4QB2 A;  3T0A A;  1G7Y A;  4UW5 A;  4XE9 A;  2Y6J A;  1J83 A;  4CCE A;  1CAW A;  1HB1 A;  2GH2 A;  2RS1 3;  2K2S A;  3RPQ A;  3ZYB A;  3KSC A;  4QPI C;  4QU2 A;  3NJZ A;  4DOU A;  1ULD A;  4YM3 A;  5FJK A;  5L7O A;  1MZF A;  4URA A;  2DYC A;  2IFW A;  3KCC A;  3UET A;  3B9C A;  4Z2A A;  1IPS A;  4IEQ A;  4LE3 A;  1A3K A;  2O0O A;  2VZQ A;  3NAP C;  4V1P A;  3VBF A;  4LTA A;  2ZGL A;  3WCR A;  3KHC A;  2WRA A;  2Z42 A;  1W8T A;  1FNZ A;  2VTX A;  4GB3 1;  3IIA A;  4X8N A;  1SMV A;  1AR7 1;  5J36 A;  4ASM B;  2XJU A;  1UOJ A;  2HJI A;  1X50 A;  3AK0 A;  3LEI A;  2Q8D A;  2XGX A;  1RJ7 A;  3DGT A;  2VTF A;  3TAY A;  4CUB A;  1R09 3;  2UWC A;  5LA1 A;  1WCD J;  1UXZ A;  4N43 B;  5AFB A;  2ZEX A;  5FZ1 A;  4XTM A;  1WMX A;  4JC1 A;  5JCT A;  2ERF A;  5M0T A;  1PIV 3;  4QGL A;  2RS1 1;  3M1H A;  4OUS A;  4YZ1 A;  4DUX A;  2DBI A;  1FOD 2;  1WKY A;  1GSL A;  5C9A C;  1Z78 A;  4Y5T A;  2WNU C;  1YIP A;  3WUD A;  4IUG A;  1RUF 2;  4FCA A;  1OQE A;  4WVW A;  5HXM A;  4B8E A;  2C6S A;  2ZGM A;  4LO5 B;  3WNL A;  3MZH A;  1MEC 2;  3USS A;  1VBA 2;  1RUI 1;  1VBD 2;  3U14 A;  2N7G A;  5FY5 A;  5F2W A;  2R04 3;  5L9V A;  4WM8 C;  4BIF A;  1R09 1;  2A3W A;  5GJ6 A;  4LBQ D;  1IPJ A;  1QIQ A;  1SPP B;  5BXX A;  2SBA A;  3BIW E;  3ZXE A;  1SHW B;  1KGY A;  2WQ4 A;  1NZC A;  2XLG A;  4CDU A;  1K5M B;  2JEM A;  3A22 A;  4FT8 A;  1MZE A;  1PIV 1;  1IQA A;  3PNA A;  2XJV A;  3THT A;  2JKX A;  5JPM B;  2AZ5 A;  4E9K A;  3VBO A;  2PHL A;  2RR1 3;  3A7Q A;  3FE5 A;  1B35 B;  3ILN A;  3R05 A;  1PMJ X;  2I45 A;  1X9T A;  5JXI A;  2XJS A;  1GP6 A;  1ZBA 2;  4JZR A;  4UBG A;  4CE8 A;  3NNG A;  4M4P A;  2VL4 A;  2WS9 2;  1R1A 2;  4YG0 A;  5CU1 A;  2WO7 A;  2ZMK A;  4NHK A;  1ND2 A;  1JMU B;  3DPR C;  1RED A;  2VZU A;  1HB2 A;  5B4X A;  2H6C A;  5LAS A;  1O6U A;  2VAU A;  2PHX A;  3U4X A;  4GWI A;  2CWM A;  1LGC A;  3LDK A;  3DF0 A;  3AXE A;  3JQX A;  1UPI A;  1UKG A;  1Z7S 3;  3D0J A;  2W9X A;  1AL0 G;  2IXH A;  1XNB A;  3T2T A;  1ZZ7 A;  2GC0 A;  2HWC 3;  3KV6 A;  2A70 A;  2XUE A;  3PUH A;  4XUR A;  5C4W A;  3UES A;  4B4Q A;  1IG0 A;  5KHG A;  4Y33 A;  3KHB A;  4NJ4 A;  1ND3 C;  2QJV A;  2X5I A;  4OQ8 A;  1W6O A;  2RR1 1;  2W39 A;  2WNO A;  4AI9 A;  1QQP 3;  4DEQ A;  2A3X A;  2VOW A;  1OC1 A;  2DVB A;  4MXV A;  5K0U A;  4FVV A;  2RS1 2;  2WO3 A;  4G9S B;  5DPN A;  5T3N A;  2Z69 A;  1KD7 A;  1SBE A;  3PJQ A;  4QU1 A;  2RJ2 A;  4KWJ A;  5FLI A;  3T0B A;  4XJW A;  1PK6 C;  1XU2 A;  2JE8 A;  3MUZ 1;  4HLT A;  3GBW A;  4QX1 A;  5DAB A;  5DQ0 A;  4JGY C;  3ZO0 B;  5EP9 A;  2TBV A;  5JPN B;  2ZZJ A;  4OFG A;  3RGB A;  1FX5 A;  4ZU7 A;  2AH2 A;  3LEM A;  1VBC 3;  1CAX B;  1LR5 A;  3RYR A;  1XRU A;  1AXK A;  1H9W A;  1IS4 A;  5FK7 A;  1MQT C;  4A4A A;  1QY4 A;  3IB3 A;  2HWC 1;  4UW6 A;  2DFC A;  3T2O A;  3NNJ A;  4QQL A;  5FPZ A;  4CP2 A;  3ACF A;  2GME A;  4CDW C;  1CVN A;  1R09 2;  5KWR A;  2UU8 A;  2XBO 3;  2DUQ A;  3T09 A;  2YGL A;  2XML A;  1QQP 1;  5FPL A;  3AKT A;  5I0T A;  1XPW A;  4QQH A;  1DLL A;  1S1A A;  2LTN A;  3Q9O A;  4DEV A;  1UY1 A;  1PIV 2;  4AQ6 A;  4CDQ A;  1YC6 1;  1QKQ A;  2YY1 A;  3OUI A;  3GAL A;  4Q2F A;  4N9H A;  4AGR A;  1DYO A;  5CAZ A;  2CL2 A;  2VD7 A;  5GAL A;  1O7F A;  4AQ2 A;  2D43 A;  4CCO A;  2ET1 A;  2DBN A;  3T30 A;  4IV1 C;  1TG7 A;  2GC3 A;  4XAA A;  4XDO A;  4GUL A;  3PIG A;  1OOP A;  4WM7 A;  4BQ3 A;  3AZV A;  2ZGU A;  5BNP B;  3LQC A;  4XHB A;  1X82 A;  5D1I A;  2ZKL A;  4CDX A;  1NE6 A;  1RIR A;  2AGS A;  4IE6 A;  2VMI A;  5FUI A;  2V5D A;  4AI3 A;  4COV A;  4JDM A;  2R04 2;  2MEV 3;  4FFH A;  4LKF A;  1OMI A;  2TNF A;  2ZEZ A;  3H7Y A;  3POF A;  4K1Z A;  1XYN A;  4K8F A;  4YW6 A;  3NVC A;  5FWE A;  1MS4 A;  4A3X A;  1XNC A;  2VTX J;  2BRT A;  1BJQ A;  4JRL A;  4Q4V 1;  1RYY A;  3HOB A;  2QBX A;  1UY4 A;  3MIH A;  2HH9 A;  3POG A;  1XJA A;  4NPL A;  1CD3 G;  3MPB A;  3EYP A;  5C3R A;  4CXY A;  1O3S A;  4LKS A;  3VD7 A;  5FO8 B;  2YDE A;  1PNF A;  1SEF A;  1JZ8 A;  4IL7 A;  2RR1 2;  3DEM A;  5FP9 A;  5CFC A;  2BP6 A;  1HRV 3;  4CXX A;  2IXL A;  2P6H A;  1HJF A;  1O4Y A;  3OBA A;  2JG9 C;  4FOQ A;  1YIF A;  3MYX A;  3LOB A;  1F31 A;  4PBP A;  1QDO A;  2VPV A;  5J48 A;  3OD4 A;  2OPK A;  4Q1P A;  1M4W A;  2QQI A;  5CA6 A;  1CAU B;  3AMH A;  3B7M A;  1CAV B;  5IJR A;  5BNO A;  2CGO A;  3RZZ A;  3LE0 A;  2ZAA A;  1ZZC A;  3POS A;  1OF4 A;  2Q8O A;  4HSJ A;  2OPW A;  4HSL A;  4HKO A;  2Z2S B;  4ASL A;  5EHD A;  1GZT A;  2KD7 A;  4A6O A;  1UZZ A;  3WDW A;  1SLB A;  2HWC 2;  2XVL A;  1WCQ A;  1UOB A;  3PVB B;  3HNB M;  2VM9 A;  3MUY 1;  3VZM A;  1IKQ A;  5C8W A;  3I59 B;  4AXO A;  1ST8 A;  4UT5 A;  4Z2W A;  3RSJ A;  1QQP 2;  4DMI A;  1HRV 1;  2HWD 3;  3VBU A;  4FPG A;  4L8Q A;  5DAX A;  5GKA C;  4Z1V A;  1EYB A;  3UNP A;  1DQ0 A;  2R32 A;  1A6C A;  2VMD A;  4XBQ A;  4WVV A;  4YGC A;  1NZI A;  1SZB A;  4E2Q A;  2GC2 A;  1F9K A;  4OI0 A;  3K75 B;  3E5U A;  4AEJ A;  5F5A A;  4YW5 A;  2LUW A;  2J1A A;  5EV7 A;  1E5S A;  5A7N A;  3R6S A;  4B29 A;  1VBC 2;  3VD5 A;  3GNE A;  1I3H A;  2NMO A;  1AJK A;  2PQQ A;  1HDK A;  4NR1 A;  4UFJ A;  3URF A;  5CYY A;  2R0F A;  3MBW A;  4MHU A;  2R16 A;  3LA2 A;  4DUW A;  5FYT A;  1ACC A;  2EAA A;  2X09 A;  3AVS A;  3POW A;  2W1W A;  2W91 A;  2WFF 3;  1R1Z A;  1JOJ A;  5D8A C;  1X9P A;  2W94 A;  2VZ3 A;  2QQO A;  3FWE A;  4Y26 A;  5IVJ A;  5H9S A;  4CEY C;  2XBO 2;  1GNH A;  2PEL A;  4NO4 A;  5C70 A;  1W03 A;  4Q4V 2;  1V6J A;  2RJK A;  4N7U A;  3ZYF A;  4H2A A;  3KGZ A;  1DCS A;  3MHZ A;  5EWS A;  5LBC A;  1US2 A;  1S0I A;  3NNM A;  2WZ8 A;  3GGL A;  2WYS A;  3DN7 A;  1Q8V A;  2JJ6 A;  2RDQ A;  4E27 A;  1WD3 A;  3E97 A;  5A7W A;  4HN1 A;  4XJ8 A;  4ARX A;  1A8M A;  3DL3 A;  2DVF A;  3OOX A;  3E1F 1;  5JXG A;  5BV6 A;  1IOA A;  4Q4X 3;  2VU9 A;  4OYU A;  5IYY A;  1UKR A;  4L92 A;  2WSU A;  4RS5 A;  2VMC A;  4MGK E;  4R9A A;  3OTF A;  2Z4F A;  1RJ8 A;  2DTW A;  2MEV 2;  2XON A;  5JZG A;  3HJR A;  2IUW A;  3KQ4 B;  1VJ2 A;  1H8T B;  3PLQ A;  4LEJ A;  4F7Z A;  1JOP A;  2VQT A;  1DQ1 A;  4PLN A;  3AP7 A;  2HYK A;  3VHO A;  4DIQ A;  4E2S A;  2B5H A;  2H0B A;  1UZ0 A;  2R07 3;  1C8M 3;  5A1F A;  4FI9 A;  3OBR A;  2NMN A;  1DU3 D;  4YVW C;  5F32 A;  1OSG A;  1UYP A;  3BOW A;  4ZY9 A;  5GZG A;  4MXW B;  3JBG 3;  4EE2 A;  1HRV 2;  2WLQ A;  4LO7 A;  1W9S A;  2EID A;  3AL6 A;  3ZDV A;  4CPB D;  4OMC A;  3ZMN A;  4LOS A;  3POJ A;  4XBL A;  3D82 A;  3D3A A;  2LAL A;  3ZN5 A;  1US3 A;  3VKO A;  2Y0O A;  4ZZ8 A;  2FHR A;  3RG0 A;  3ETP A;  4Q4X 1;  5EJZ B;  1LGN A;  4NHM A;  3I2G A;  1GZW A;  1W6N B;  3THC A;  2D7F A;  1WW7 A;  3UV9 A;  3W21 A;  4CCN A;  3CJX A;  3W5M A;  3K2O A;  2PXJ A;  4QPY A;  3HN1 A;  4I30 A;  2W3J A;  4DB5 A;  1DIW A;  4C1X A;  2A6X A;  4NAO A;  3KF5 A;  4LUM A;  4XET A;  4JRA A;  2V72 A;  2Y6H A;  4FPF A;  4LJH A;  2R07 1;  4OUL A;  3WQ1 A;  1JZ2 A;  1X36 A;  3O1O A;  3ATG A;  5L7O C;  5FZ0 A;  1WLW A;  5FPB A;  2W92 A;  4LA3 A;  4BU2 A;  5IFT A;  5TSW A;  3LA7 A;  3APB A;  2XJT A;  2EAK A;  5FRA A;  5GLU A;  1TNF A;  1JH5 A;  3AMP A;  3V0B A;  3VBF C;  3VDB A;  4W8J A;  1RIN A;  3TOJ A;  1BXH A;  1LHV A;  1JU3 A;  1QWR A;  3KCY A;  3KVB A;  3VBS A;  1VRB A;  2P4E A;  3C7O A;  4OZO A;  5FZ3 A;  5A6Q A;  4FPL A;  5A3M A;  2DCY A;  3CU7 A;  2OX0 A;  3ES1 A;  1PM4 A;  1W8O A;  1BBT 1;  5FZO B;  4RD7 A;  1PZ7 A;  3ZR6 A;  3SH5 A;  1UO9 A;  1Y9Q A;  2YFZ A;  4A7K A;  5LZ6 A;  4CP1 A;  4NII A;  2CY6 A;  3MV0 1;  3WQ7 A;  5FZB A;  2YB7 A;  5FZE A;  4CPB A;  2D97 A;  3LKJ A;  5FZG A;  3RZM A;  4HPK B;  4IE5 A;  4BME A;  3IN9 A;  3HIF A;  4FTE A;  5DG1 A;  3SXW A;  3D6E A;  5A3T A;  2GC1 A;  1QOT A;  5J3U A;  3WNN A;  3IMM A;  3HBK A;  4YSF A;  1QH7 A;  2H6B A;  1S0J A;  4GWM A;  1OHF A;  1GV9 A;  1NT0 A;  4H3W A;  2O8Q A;  1C1F A;  3BN6 A;  3ME2 A;  3MID A;  4IEP A;  3ZYR A;  3FUQ A;  3BGA A;  4QD2 A;  3O1T A;  2WO2 A;  1H2M A;  4NRO A;  3ZSL A;  1QHD A;  4L97 A;  1F15 A;  2FDI A;  5FZA A;  3THP A;  1L3J A;  4KMQ A;  1WBL A;  1QDC A;  2JDK A;  3VLB B;  4BXF A;  3HT1 A;  5F9T A;  2ZOE B;  2QZ2 A;  5D21 A;  2A5Z A;  2JG8 B;  1LGB A;  4OCT A;  4NIA A;  2FDH A;  3CZU A;  3P1I A;  1IGO A;  2XDV A;  3IPV B;  4FQ4 A;  4Q4X 2;  2CDP A;  1DLC A;  5JR2 A;  3UK9 A;  4ES8 A;  3EBR A;  2ZX1 A;  4BDV B;  3ZFE B;  1W05 A;  2BVB A;  4BA6 A;  3PVN A;  1FAY A;  1LOF A;  1W2T A;  1XU1 A;  2BQP A;  4UFH A;  3R4U A;  3VBO C;  4AAX A;  1J3P A;  4AED C;  4JKK A;  1FMD 1;  5A7Q A;  1BMV 1;  1SFP A;  4LOT A;  2VZV A;  4LHN A;  1SLT A;  1AX0 A;  5ABJ A;  1KEX A;  1M06 G;  3AMQ A;  5K9Y A;  1WW5 A;  2QCS B;  1BCX A;  2R07 2;  1C8M 2;  3C7E A;  3NRU A;  4UW3 A;  5FBZ A;  3TB0 A;  5A3N A;  3IDE A;  5DXD A;  5LWB A;  4LMF A;  1ND2 C;  5IK4 A;  4OVE A;  3AP4 A;  2UYB A;  4NHX A;  1MS8 A;  3MPP G;  1DYK A;  3I54 A;  2VUD A;  4RGK A;  3WUC A;  4BQY A;  5J96 B;  4GMP 3;  2WA3 A;  4JCK A;  1LU2 A;  2WYF A;  1LHN A;  1H1I A;  1LOB A;  1XB9 A;  4WVM B;  4HZF A;  2E33 A;  1KJL A;  2W5F A;  4P00 B;  3ZFG A;  1SBF A;  4F3J A;  5C4W C;  4TN7 A;  2HYX A;  2NYY A;  2ARX A;  2E31 A;  1GYK A;  4N53 A;  2X5I C;  1W39 A;  3AXD A;  2J1R A;  4NN0 A;  1FI2 A;  4QPG A;  5EXO A;  4ATF A;  5DMY A;  4YVS B;  5FP4 A;  2QQP A;  3U10 A;  4QMA A;  1W04 A;  5C8C A;  1JYN A;  2YC0 A;  5FBJ A;  2QDN A;  5K0U C;  1H1M A;  2W08 A;  4OLL A;  1KXG A;  1MS3 A;  3MFC A;  3UGF A;  2PFW A;  2B39 A;  2Y33 A;  2PHD A;  4RFT 0;  3FHQ A;  5FQ0 A;  1A78 A;  1APN A;  1MS1 A;  1PHM A;  2YPJ A;  3FX3 A;  3LFM A;  3OYW A;  4PQQ A;  5FYB A;  1OQD A;  2VME A;  2VOT A;  2PHR A;  3BYW A;  5ACA 1;  1W8Z A;  1WLC A;  4ET7 A;  3NAP B;  4F8A A;  1W90 A;  3KV4 A;  5HXV A;  4W6W A;  1D7P M;  4FSJ A;  3AYD A;  4IV3 A;  2DFB A;  1T6G C;  2B45 X;  5FO9 B;  4PDW A;  3CL1 A;  4EN0 A;  2OUH A;  5T55 A;  1D4M 3;  3NWK A;  3EB7 A;  3ILR A;  4XUT A;  4E8C A;  3O0X A;  5GLW A;  5A1L A;  2VW1 A;  3WR0 A;  4BPZ A;  1GAN A;  2PN5 A;  4FPC A;  3I7D A;  5FZ9 A;  1G9F A;  4RN5 A;  3P3P A;  1NCQ A;  4GAZ A;  1SDD B;  2D3R A;  2VMH A;  1RMU 3;  4XFG A;  5FYY A;  3I3E A;  3ELN A;  4MOA A;  4I0B A;  3RS6 A;  4CDQ C;  2K9Z A;  1DZR A;  3DUI A;  5T5P A;  3N7J A;  2YYO A;  2HWE 3;  1SFN A;  3PVO A;  4BH9 A;  5IK8 A;  2XKO A;  2VOX A;  4XMA A;  1FMD 2;  3N4M A;  3VKF C;  2OZJ A;  3FFZ A;  2WNU B;  1NA1 B;  5C33 A;  4A45 A;  1W6P A;  3ZSK A;  1RUH 3;  4TSV A;  2P17 A;  4FFG A;  3MF6 A;  1D2Q A;  1OOP C;  4WM7 C;  2JDZ A;  2WZP P;  2FMD A;  4AHW A;  2FZ2 A;  5JOZ A;  3MDP A;  2ZGR A;  1O91 A;  5JXH A;  5FYC A;  4AZZ A;  4CDX C;  2XG3 A;  3AYA A;  3CMG A;  4H7M A;  4CEW A;  5DZG A;  4X6R B;  2ZHM A;  5KBF A;  2JB8 A;  5KHK A;  4Q0S A;  3ZN6 A;  2V4A A;  2ZHK A;  4A2U A;  3I49 A;  3FLR A;  4XUN A;  4LHL A;  4QGM A;  1W9Y A;  1RMU 1;  1GFF 2;  1V6N A;  4YRD A;  2NQY A;  1PVC 3;  2EXK A;  2XWJ B;  4AVC A;  1GZ9 A;  5IAT A;  1BKZ A;  2ID4 A;  2UUR A;  4YGE A;  1IQD C;  5CFC C;  4QQO A;  2VG9 A;  3PTY A;  4OZX A;  1ODN A;  3ACI A;  4IGP A;  2BW8 A;  1R08 3;  4EWD A;  4HXC A;  1S2E A;  4CCC A;  5IW0 A;  3DPR B;  1ZYB A;  3KWV A;  5BUV A;  2DV9 A;  4RL7 A;  1BQP A;  5CBL A;  5BNO C;  2W52 A;  5FZC A;  1CQ9 A;  5B2G B;  5L36 A;  3J7N A;  1AXY A;  4N43 A;  4HVO A;  2Z5W A;  3WW3 A;  2FMY A;  1C28 A;  2Y60 A;  2QTW B;  1OXC A;  3S5A A;  1IHM A;  4GJZ A;  3ZKU A;  3KLS A;  3WF0 A;  1PVC 1;  3THD A;  4BB3 A;  2YFU A;  3K4D A;  1ND3 B;  1HV0 A;  4IET A;  4BMB A;  3VBU C;  5IK5 A;  1O8S A;  1SCR A;  5FY7 A;  1TE1 B;  1UYZ A;  3ORJ A;  4AVT A;  1CPN A;  4XQW A;  3HVD A;  4ISR A;  3OD0 A;  5FYI A;  3MIG A;  2A75 A;  2PA7 A;  2WAA A;  4TZD A;  3KZ4 C;  2E32 A;  2P3K A;  4WZF A;  1K42 A;  4UOJ A;  1YFX A;  1C4R A;  2V4V A;  4A3Z A;  4QXC A;  2RMU 1;  5I8Y A;  1WW4 A;  1SPP A;  2DCK A;  1GR3 A;  2ZHN A;  4P9J A;  4EWE A;  2Y8K A;  3F95 A;  4AHX A;  1OQ1 A;  4YW7 A;  5L9R A;  5FY8 A;  3M4F A;  5CIR A;  1D4M 2;  4YW3 A;  3E6C C;  3MIE A;  1MVE A;  3D4K A;  5JSR A;  1SBD A;  1DGR A;  2ATF A;  1JHN A;  2EA7 A;  4P9L A;  1UZW A;  3WDV A;  1B35 A;  3VZK A;  5F3I A;  4A7Z A;  3VBH A;  4Y1Z A;  4CZS A;  3JB8 A;  1RMU 2;  3RI9 A;  2GZW A;  3JZV A;  2C9A A;  5I0U A;  2QQM A;  3D8C A;  1WCU A;  3ST7 A;  2HWE 2;  4XFI A;  3GYD A;  1C5H A;  1XSQ A;  1W0P A;  4IV1 B;  1G6N A;  4EWA A;  2BUK A;  4L0P A;  5C3Q A;  1RUH 2;  3I8T A;  4AVA A;  5FXV A;  5DG2 A;  2Y0I A;  2IFR A;  4DZG A;  1D2S A;  2E53 A;  2WFP A;  2YC4 A;  4KBB A;  4FP2 A;  1YNA A;  2W47 A;  4GB3 3;  4RS5 C;  5ANN A;  3PHM A;  3ZYP A;  1AR7 3;  5KXE A;  3WNM A;  5FYS A;  3UKV A;  4ZU5 A;  4K3U A;  2P5B A;  2D5H A;  3F2Z A;  3N9L A;  4ZXE A;  1UN1 A;  1AR6 3;  5JWP A;  1DGL A;  1VR3 A;  4XCA A;  5SV8 A;  1PVC 2;  1URX A;  3ZXG A;  5FP7 A;  4HON A;  3J9S A;  3MO4 A;  4NRM A;  4IW3 A;  2CHH A;  3RYP A;  1LOG A;  3CJI A;  3V0A B;  1U5Z A;  1V6L A;  2C1F A;  2JG9 B;  3NJV A;  4JGZ C;  4M3C F;  2XHN A;  1R08 2;  4QKD A;  2ES3 A;  4LO8 A;  4QX2 A;  5IVF A;  2BU9 A;  5F3C A;  5I0S A;  1KIT A;  4DY3 A;  1CGP A;  4C0H A;  3S6P A;  4DIN B;  2VCB A;  4XUQ A;  3SQO A;  1VMJ A;  3AKP A;  4XQ4 A;  1UZY A;  2R7E B;  4Z92 B;  1VAM A;  1QOO A;  1RUI 3;  4LIU A;  4Q27 A;  3VD4 A;  4FXG B;  5L19 A;  1ALY A;  2F4L A;  2OUJ A;  4M3C B;  3UJO A;  2GP5 A;  1I1E A;  4X6Q B;  1NAE A;  2F4P A;  1DP0 A;  1AR6 1;  2Q4S A;  5GZC A;  3MF9 A;  1W6M B;  3N9N A;  2VOV A;  3MLJ A;  4YNI A;  1CIW A;  1W2O A;  3N9Q A;  4JAA A;  4ATE A;  4D8M A;  1XXN A;  2YC2 A;  4MGT A;  4PF5 A;  5T54 A;  5I8T A;  4R9D A;  1STM A;  1CX1 A;  1OKQ A;  2W95 A;  5CNA A;  3GBF A;  3RWK X;  4B7E A;  3O1V A;  4OHZ A;  1NUK A;  4V2W A;  4IEU A;  3SCF A;  4EN9 B;  3VBS C;  3N7L A;  3V64 A;  4CCJ A;  3U78 A;  2J22 A;  4HKW A;  4UFL A;  3TNQ A;  5GZE A;  4XW3 A;  3HEI A;  1PGL 1;  1JOD A;  3OEB A;  4BQ4 A;  2VNO A;  4ZS3 A;  2KXL A;  4Y5Z 0;  1ZRF A;  4LBO A;  3FJS A;  3LIG A;  5FMC A;  1VAL A;  5CKQ A;  3G6J B;  1Z0H A;  1WLT A;  2OII A;  1KFU L;  3IM0 A;  4YW4 A;  3LEG A;  5IUQ A;  5HPO A;  1DBN A;  3QCW A;  5JMC A;  5KHI A;  1VE0 A;  2WT0 A;  4CU9 A;  1UYY A;  1QJE A;  3UKN A;  1LOD A;  1QF3 A;  1JYV A;  3VBR A;  5HCH A;  4LNV A;  3LDR A;  1JOB A;  2XLF A;  4XPV A;  3TN9 3;  2PHF A;  1HJG A;  2FDJ A;  1JYI A;  3PIJ A;  5FXW A;  4DRR A;  3RRD A;  3NNF A;  2YHJ A;  3LWC A;  1W99 A;  4FAG A;  4JHZ A;  3H3U A;  3I3M A;  4OHY A;  3VZO A;  5JVV A;  1SCS A;  2VW0 A;  1BVP 1;  4IEY A;  3WT3 A;  4NIH A;  4M01 A;  5FMB A;  2VXJ A;  2O8O A;  3H1Y A;  1O5U A;  1CAU A;  1WBF A;  2CNA A;  2ZX4 A;  5A32 B;  1WME A;  1CAV A;  4Y22 B;  1HLC A;  2Y64 A;  4LIV A;  2BNM A;  3ZX7 A;  5I93 A;  3M3C A;  2JWP A;  3FL7 A;  1V6M A;  1KS4 A;  3IBM A;  1O4Z A;  4QB6 A;  1XYO A;  2XL9 A;  4FOW A;  3AM2 A;  3J4U H;  3U11 A;  1CX4 A;  2ZTN A;  1MPX A;  3ECQ A;  4GB3 2;  4E4H A;  5IFP A;  3BUC A;  1AR7 2;  4U36 A;  2VO5 A;  3B02 A;  3I59 A;  5CZK A;  3TN9 1;  3I3Q A;  2E6V A;  2IC1 A;  2P3Y A; 
#chains in the Genus database with same CATH homology
 4IE0 A;  3O1T A;  4NRO A;  3H8X A;  2FDG A;  2FDI A;  3BIE A;  4IE7 A;  3BKZ A;  3I49 A;  3O1R A;  4CXW A;  3BTZ A;  2FD8 A;  2FDH A;  4OCT A;  4QKB A;  4NRM A;  3RZK A;  4QKD A;  4QHO A;  4NPM A;  4IE6 A;  2IUW A;  3T4V A;  3BTY A;  3I2O A;  3O1U A;  4NIG A;  3RZL A;  4O61 A;  4O7X A;  4NPL A;  2FDF A;  4CXY A;  4NID A;  3S5A A;  4IDZ A;  4NRQ A;  4MGT A;  4CXX A;  5F8P A;  3O1V A;  4QKF A;  4ZS3 A;  4QKN A;  3BU0 A;  4IE4 A;  3LFM A;  4NRP A;  4ZHN A;  3O1O A;  4RFR B;  4MG2 A;  3O1P A;  3O1S A;  2FDJ A;  3RZH A;  3S57 A;  3RZJ A;  3KHB A;  4NJ4 A;  3RZG A;  3I3M A;  3BTX A;  2FDK A;  3T4H B;  3H8R A;  4NIH A;  3T3Y A;  4NII A;  3BI3 A;  3RZM A;  5DAB A;  4IE5 A;  4ZS2 A;  4JHT A;  3H8O A;  3BUC A;  3KHC A;  3O1M A;  3I3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...