3T4HB

Crystal structure of alkb in complex with fe(iii) and n-oxalyl-s-(3-nitrobenzyl)-l-cysteine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
201
structure length
201
Chain Sequence
PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic combinatorial mass spectrometry leads to inhibitors of a 2-oxoglutarate-dependent nucleic Acid demethylase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
total genus 48
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3t4hB00
3BUCA 4QKFA 3H8RA 3RZHA 4NROA 4NPLA 3O1PA 3BTYA 3BI3A 4ZHNA 4IE7A 4CXYA 3O1OA 2IUWA 3RZJA 4NIDA 4IE5A 3S57A 2FDHA 4NRMA 3BIEA 2FDGA 3BTXA 3RZGA 4OCTA 4RFRB 4QKDA 4NIHA 3O1UA 3O1MA 3H8OA 3H8XA 5F8PA 3BKZA 3O1TA 4ZS3A 4MGTA 3RZMA 3I49A 3I2OA 3BTZA 3I3MA 4QKNA 4O7XA 3RZKA 4NIGA 3S5AA 3LFMA 2FDIA 4IDZA 4CXXA 4ZS2A 4NJ4A 2FDKA 4O61A 3T4HB 3KHCA 4QHOA 3T4VA 4IE4A 4IE0A 3O1SA 4CXWA 4NRPA 4JHTA 3BU0A 4NIIA 2FD8A 4NPMA 3O1VA 2FDFA 3I3QA 4MG2A 3O1RA 5DABA 4QKBA 3KHBA 4NRQA 3RZLA 4IE6A 3T3YA 2FDJA
chains in the Genus database with same CATH superfamily
4Y24A 5FBZA 4QAWA 1ENRA 4ZXEA 5DAVA 2D3PA 4DO0A 4FPCA 2ZGOA 2NLRA 4GQ7A 5A1FA 5C8CB 2FDGA 1UOFA 4XCBA 1JZ7A 1OF3A 1RJ7A 3B5LB 1HQLA 4FOVA 4X6RB 4EN8B 4WVWA 4F7ZA 2NQYA 4AQ2A 4AHZA 5C9AC 5HPOA 1JYIA 2VY0A 5B2GB 1R091 3OBZA 4AI9A 2ZHNA 2R041 4RS5B 3AFKA 2W1QA 3RRDA 4UFJA 2B8MA 2D93A 1IZ3A 4Y1YA 4COYA 4W50A 4FTEA 5A7WA 4N53B 4W65A 4ARYA 2BW8A 5CFCB 2PHUA 3IM0A 1W8TA 4UW3A 4Q4Y1 4IE7A 4CEWC 3J9SA 4XF3A 5FZ9A 3NSTA 4UBGA 1LOGA 2VQUA 2WZ8A 2LRPA 3AMMA 1WA4A 1XYPA 3GHNA 4IGPA 3H8UA 3FJSA 1C1LA 3MEPA 2JECA 2Q0AA 4TLGA 2XLAA 1V6NA 2VW1A 2ARCA 4QMAA 4XUNA 2H6CA 1CAVB 1YQ8A 4XE9A 3M2MA 2WZR2 3MIBA 3MLJA 3POEA 2OKXA 4CDUA 1UZ0A 2D97A 5DUUA 3DXTA 4EZHA 1R1A3 1COV1 1PMHX 1TME3 4QPIA 1OLME 1W2OA 4GB31 5JI7A 2J42A 3FMGA 4XBQA 3FBYA 3VKLA 2ZABA 4WVMA 1H8TC 4IV1B 4XBNA 4YZ2A 2JKBA 2QFEA 1BCXA 2H6BA 1S0EA 1NCRB 3B7MA 2CAUA 2Y6LA 3I2GA 3D5OA 2YPDA 3ZDVA 2G9GA 2HJIA 3AKSA 3OBTA 1IKQA 5JOYA 3QOPA 2R072 3BIWE 3RWKX 3POGA 5IJRA 4K21A 3ZN6B 3ZSEA 2I2SA 2VAUA 4FFGA 3D0SA 3FLTA 3B9IA 5FUPA 3RZZA 3UJOA 4XHBA 4HKOA 1PZ8A 1SZBA 3IWZA 1W28A 4XVHA 5F5CA 1AL22 2C24A 2FCVA 4GWNA 3WCRA 4AK3A 5E1RA 4DS0A 3VD3A 2YB7A 4HVOA 1ULEA 1ALYA 2IXCA 4YSFA 2XLGA 1JZ2A 1BZWA 2GH8A 2KM2A 4P5HA 2OXBA 2RHPA 3KT1A 4AYUA 1JW6A 5FYYA 4U2AA 5A7WB 4BQXA 2VBDA 4LBKA 3CHXA 4CPBA 5FOBB 1C3HA 4S2FA 4FFFA 1RC6A 1L7LA 2CTVA 1SBDA 3B01A 3J8F1 1KFUL 3LE0A 4DINB 1LOBA 3M3QA 3EMRA 3OJBA 3POFA 5FP4A 3ZXFA 2RR11 5I0TA 1F31A 1X33A 1O5UA 5EXOA 3TB0A 4AFAA 2PHDA 4QT6A 2ZGMA 4RFT0 4BXSV 4A7KA 1X8MA 4CXWA 4GH4C 4Y33A 2YYOA 5IT6A 1CVNA 4QQOA 1HRI2 3F2ZA 3NNGA 4Q4Y2 2WNOA 3OPTA 4X6QB 1YQCA 3DECA 2IVIB 2BV4A 1R083 2A6XA 2XONA 4LOSA 3T0DA 4CDQB 2LTNA 2JDYA 4LA3A 2MEV3 2IUWA 4IETA 4QD2A 5A3NA 4K6BA 3GBFA 4NRMA 4QB2A 4QQHA 3UKNA 2ARBA 2DCJA 1W8OA 3H7JA 1Q56A 5ANNA 4YW1A 2L9LA 2YDEA 3T2OA 1GP6A 3AVRA 3H8XA 1F8VA 4KWLA 1WMXA 1GWKA 1WCDJ 1PGW1 1WWYA 2CGNA 4IGQA 2DUOA 4CUGA 1J1TA 5JR2A 1RUJ2 1ZM1A 3PU8A 4RQPC 2Q8EA 1H4GA 4UWDA 1W3XA 3ZXDA 4N43A 5FMDA 3TBDA 1ZRCA 2ZTNA 2QQVA 1EUUA 3NWKA 4M4RA 3V0AB 1K42A 3J7MA 4LBLA 3KHBA 2K2SA 2XDVA 1RUE2 3IPVB 5IK5A 1OSGA 5C3OA 5DN2A 2D43A 4UOJA 1GNYA 1S0DA 3FC0A 2ZX4A 4JTNA 2WKKA 1YYNA 4P14A 1UYYA 5J1XA 2P4EA 1H4HA 1RUH2 1NT0A 1OQ1A 4JX0A 4JRLA 2XKPA 3WG1A 3S30A 3OCPA 1QMJA 2E7TA 4KU7A 4OI4A 4R52A 5FKCA 3VDDB 3NKTA 4CDWB 2CDPA 3LFMA 4W6XA 2VZQA 1B35B 3ZN4A 5CEHA 1RUF2 4LUKA 4X8PA 1AVBA 1NOVA 1VBA2 5JOWA 1US2A 4Z2WA 1TNRA 2FD8A 1K45A 2IXKA 2RS13 5FJKA 5HXVA 2EXJA 5IVVA 3AP5A 1CPNA 2PLV1 3S5QA 2R16A 4N7IA 5FYVA 3HOBA 1RUD1 4CE8A 1FOD2 5ABJC 4LHSA 3BOWA 3FN9A 4AGGA 1G9CA 3PIJA 2EAKA 3NJYA 3ZOIA 1W03A 1W6OA 5IW0A 3ZKYA 4GD4A 1Q8QA 3LOIA 2QQIA 3PURA 4XAAA 2EALA 2AR6A 2QUOA 2GMEA 2MNGA 1V9U2 1XSQA 2IZWA 3LA7A 3LPGA 3TRSB 1U12A 2VZUA 3D0JA 3ZFEB 2VG9A 3AJYA 1V9U3 3ZYJB 1FATA 1K5MA 4RHV1 1D2QA 2AZ5A 1QXRA 1KQRA 2YBPA 1ND3C 3DPRB 4XYXA 4C91A 2DFCA 2QQOA 4IESA 4XUTA 2WZR3 1W04A 2PELA 4WV8A 2HWC1 3U07A 1QJEA 2AACA 5FZ4A 1IPSA 2WN2A 2QE3A 4KBZA 1OF4A 2Y6JA 2P3JA 2QQLA 1WCUA 4GKXA 1O5LA 4CP1A 4ZKTB 1BQPA 3GDBA 4O9GA 1AXZA 4V1PA 3USUA 2CNAA 3LCPA 3WNLA 3PVEA 1GSLA 3VHRA 1JUIA 1QY4A 3HJRA 3MO4A 4BH9A 1RB8G 5F7UA 3ASIA 2VCCA 2NM1A 3AFGA 2W47A 1UU6A 3HIFA 1CGPA 4CEWB 5F5IA 4FP2A 2X5IA 1WA6X 2IFWA 1OFNA 2R063 3VN4A 2EICA 1G7YA 1SBEA 2ZPXA 4P02B 2YFUA 1KDMA 3OUIA 4GB33 1Q8PA 3O14A 1B09A 1PX3A 2HWE1 4Q4V1 1HJFA 1O7FA 3RFRA 2WRAA 5AVAA 1LOFA 3WF1A 3DKWA 1XC6A 1YFYA 4YNIA 5EZWA 5AC91 3JZVA 5LRRA 1PO21 3L2YA 3IT8A 1PO12 2YBSA 5BXXA 2C1FA 4I3GA 3AMHA 3SC7X 1AL21 2OZ6A 3GZAA 4OZOA 1TMF1 4HSJA 4ZZ8A 4QHBA 4ZU5A 5IHRA 5C71A 2WS92 1IG3A 1Y43B 5L73A 3VL8A 3WG2A 2W52A 1H6XA 2ZGLA 2ATFA 3RYPA 2W1UA 4BK5A 2CY6A 2VZSA 4NPMA 4YG0A 2B39A 1EPWA 3WEZA 1DGRA 1R082 1ZRRA 2J1AA 3ZFGB 3WDXA 1DP0A 1LNSA 3CJIA 1PIV1 1ND2A 2JKXA 2JDKA 4LBQA 4RHV3 3PVOA 2Z2SB 3VBUC 1XPWA 1AR92 1CPMA 1AXKA 3OBAA 5SV8A 3RSJA 1ZZ6A 2VXRA 4IEYA 5A33B 2GC2A 1RUC2 5LATA 2YHJA 1CIYA 3C2UA 3E6CC 3L2HA 4E2SA 5BNPB 2WLPA 3X29B 3THCA 1FX5A 3LGRA 2HBUA 1ULCA 1AHSA 4V2VA 2WA4A 3LEMA 2GDFA 3V56A 1IS3A 4Q4W2 1E5IA 1GQGA 1O3QA 1M4WA 4IE4A 4PQ9A 2NPIA 3VBFB 2X5IB 3THPA 1JODA 2R7EB 3SH4A 2GN3A 2G9FA 1S1AA 1TVGA 1UL9A 4FI9A 2LM3A 4NWWA 4XF4A 1RMU3 4YM3A 1I1EA 4HG6B 1RUI1 3WNXA 1I5ZA 4E4SA 2SLIA 1ULOA 2P2KA 2Y6HA 3PUQA 4QDQA 1WMEA 3D8CA 2WFF1 3N9NA 4A4AA 1FI2A 1ZBA3 4BXFA 3MZHA 1CR7A 1NUKA 5LB6A 3USUB 4YPJA 4CPBD 2DTWA 1DQ1A 4E4ZA 2V4VA 3ZKUA 4BCUA 1N1YA 1S2EA 4XDPA 4JZRA 5EYXA 1VBE3 2D7FA 2YZ4A 4XW3A 2UY8A 2C5DA 1VBB2 1QJU2 3U10A 5ABJA 3BTZA 1OLQA 2NYYA 3APBA 3IB3A 4UW5A 4COWA 2NZ9A 3VDBA 3T4HB 2VGDA 5EIYB 1LRHA 2IFRA 1XBFA 2ADDA 2OVUA 3VLBB 1K5MB 5JXIA 3DPRC 4V2WA 5K9YA 1WGPA 1KRIA 2X53S 3W5MA 1JZ6A 3HBKA 3ZXGA 1W0NA 1XNTA 4IEOA 5L9RA 1EAH1 4DUXA 5KR7A 5T3NA 4LKEA 1W6OB 5FPZA 4ET7A 5A7SA 3KVBA 4YW6A 4YW3A 1Y3TA 2FMYA 4E8DA 2CAVA 4Z1VA 1VMFA 2JDMA 3NNMA 1VAVA 1VBA1 1DQ0A 3AJZA 3TN93 3RDIA 3U11A 1RUI3 4B29A 1HIXA 2JDUA 5FUNA 1FMD1 5BY5A 5LWBA 3MF9A 1POV3 3HR9A 3KF5A 3LQCA 5KHJA 1YLLA 2IXIA 1BJQA 2CWMA 3CL1A 3DUIA 2RMU1 1XYNA 2VMGA 4AHXA 1DGWX 2VMFA 5CIRA 1CX1A 5FP3A 5HCBA 1ONAA 1MS5A 1VB2A 2BVBA 4XUQA 2QZ3A 4JTOA 2XQXA 4XJ9A 5DG2A 1ULPA 3D82A 2HWF1 1ZZ9A 1DFQA 4LKFA 4DY5A 3HNMA 4IV3B 3O12A 4YGBA 1UOGA 4GWMA 4C1WA 2HLEA 3A22A 1MEC3 4MGKE 3IPVA 2CYFA 2EIBA 2R1DA 3J8F3 5CZKA 1C8M1 5A3MA 5BV6A 1LHUA 4HN0A 4PDWA 1RUNA 2BTVC 2VD7A 4YM0A 3DV8A 2R043 2XUEA 1M06G 4LIVA 1RJ8A 4OQ8A 1H2MA 3T09A 1AR61 2WABA 3B00A 4Y5SA 1V6IA 2WNUB 1DLLA 5FZFA 4AQTA 5A3UA 3H1WA 1BHGA 4RGAA 5LW9A 1W0PA 2XJRA 3WNPA 4TLFA 5IVYA 1ULDA 4FPKA 3VGIA 3H1MA 5H9RA 3JD72 4CDXB 4WZCA 2C9AA 2XJVA 1ZYBA 4CCKA 3N9OA 2EXKA 3B69A 4LBMA 3N7JA 4UAPA 2JB8A 3FUOA 1W2AX 4KGGA 2BGCA 4M00A 1L7QA 2D6MA 3E1F1 4MGZE 5FJHA 2XVLA 1XYOA 3QBQA 2F4LA 1LESA 5F2WA 5F3EA 5DMYA 5LZ6A 1OFSA 2FBEA 3H3UA 4OVEA 5A70A 4AVAA 3HEIA 3WV6A 5I8SA 3EQEA 5ACA2 5C4WB 1H2NA 4LTAA 2VZ1A 5FZ1A 3MW3A 1UXXX 1W6QA 4IEXA 1KXGA 4N8MA 1NA1C 4GH4A 3S6PA 5F3IA 3NNFA 5JCTA 3MIGA 5A3WA 4RGKA 1LHNA 3J7NA 4IEWA 5JI9A 3IDBB 4Q0VA 1YIFA 4I30A 4BB3A 2VZRA 3C7FA 3J4UH 2PHRA 3ZFEC 3E6DA 1QHDA 4QQ2A 1RIRA 1FMD2 3ZSJA 2Q8CA 3EJKA 2E7AA 4IDZA 1ODNA 2WNEA 4TSVA 4X8NA 2D6NA 4XFBA 5DAWA 5LRSA 1XNAA 2HWC3 5JUVA 4AI2A 5FLJA 1G8WA 2IC1A 1POQA 3O5SA 5FZOA 4G4FA 1PZ7A 1BEV1 3OGGA 1WLCA 1YFWA 2R071 4AR2A 3H3ZA 3KCXA 3ES4A 2WAAA 2OUJA 2XBO1 1W99A 3ZLIA 1QWRA 2YU2A 1LGNA 3U1XA 3OF1A 4IXLA 5JPNB 4NN0A 4QX0A 4NUBA 3I2JA 1SMVA 1YXWA 1MEC1 3K3OA 2ADEA 3ACFA 5FZ6A 1V70A 3VBHA 1ZBA1 3OTFA 2BFUS 1NCQC 4A2UA 1H2LA 3ZMNA 4Q4W1 5SV5A 5F1RA 3I2OA 1DLCA 2VMIA 2WNUC 1ASJ1 1GOHA 3M3CA 4WVMB 3N36A 5DUVA 3H3LA 3G7DA 3HT2A 2G4IA 3PVBB 1AJKA 1S2BA 1CAWB 1NG0A 4JHTA 4AAPA 4CDUB 4K1ZA 2PMWB 1OVSA 5JIAA 4XF0A 3W20A 4KNCA 2J1VA 4Y3OA 4AFCA 1OHFA 1POV1 2FZ2A 5JOXA 3WDTA 3GHMA 4ORFA 3T1MA 1JOPA 1KGYA 3AKQA 2JE7A 4BU2A 2WO7A 4YG6A 4KWJA 4AZZA 4JC1A 4AI1A 3CJXA 3PNAA 1PIV3 1HW5A 3HNBM 5FZ0A 5GM0A 3I3MA 2RM22 4N53A 5CKNA 1REEA 3GZEA 2VNGA 3KZ4C 1CIWA 5FZCA 3RI8A 1V00A 1HXS1 4Q27A 1XRUA 1PGL1 3NNLA 4AI0A 2H0BA 4JKKA 4K8FA 1QJU3 2W08A 3D4KA 1AUYA 2B9VA 4MGIE 4CU9A 2VCAA 3RZMA 4P9WA 2RS53 4IEUA 4B3NA 5DAQA 1QJY1 1TEIA 4FQZA 5DG1A 1SBFA 2Y0IA 4H3WA 1J58A 3KGZA 4AI3A 2P3IA 4JKLA 4QU2A 3B93A 5C9AB 1R1ZA 1VAKA 5A3LA 1GLHA 4IW3A 5T5LA 1QF3A 3AZZA 4AEDB 1H8TA 5BNNC 5FO8B 5A7QA 1RMU2 1S0GA 3ETQA 3AXEA 5KHGA 3ACHA 1PHMA 2ZGTA 4Q2FA 5A32B 4EQVA 3VD7A 3ENRA 4FVVA 4BA6A 4KI5M 1BEV2 3WSOA 1JYNA 4JGYB 1S0BA 5DAXA 4XJAA 4NMIA 2Y26A 4CUCA 2GSYA 4WVZA 3RYRA 3GGLA 4E4DX 3MV11 1C5HA 3DYOA 4NROA 3VBSC 4GZ9A 2VTXJ 4PIXA 5BYNA 2ZX3A 4M4PA 4YVSA 3S57A 1AR93 3WXPA 1QOSA 1N3QA 5FREA 4CP9B 1ASJ2 1JOBA 1JU3A 3WNNA 3I54A 1H9PA 3BPZA 5C7GA 3HN3A 3OYWB 1AF9A 2E9QA 1NA1A 4BLIA 4CCJA 4AVCA 1UIKA 5GLWA 1GNZA 4UBHA 4BQ3A 4NJ4A 1LEDA 1LULA 1GFF2 3K77A 3PDQA 1UIJA 2NMOA 4LK6A 1CZVA 3CJIC 2WS93 3TAYA 4FBFA 1H30A 4ES8A 2DCZA 3OBRA 5EP9A 1NLQA 2XWBB 3FFZA 2GALA 1JYXA 2KXLA 3TEWA 4DEVA 5I8TA 2HWD2 2GNDA 4U36A 5E16A 3W21A 4XIKA 3O1MA 2UWBA 4PBOA 3U4XA 4D69A 3GM8A 1FYUA 2E32A 2MPFA 3WF4A 1RUD3 1VE0A 4IEQA 4M0HA 4N9HA 3DYMA 2DWRA 1B35C 3D3AA 4LR4A 4TWTA 1UN1A 2A1XA 2WQ8A 3CQOA 4MHRA 5IVCA 1RHI2 2JX9A 4XZPA 3ZO0B 5JXJA 4HETA 4AGVA 3KV6A 1NXMA 1OD3A 4ZZ5A 1SACA 1NZIA 4TYSA 1PGW2 2WO3A 3WF3A 2EAAA 3K46A 3KT4A 5I8YA 3EXUA 3LD8A 4NPRA 2DV9A 3AP9A 5DDJ2 4YGDA 2DYCA 4HZFA 4NOTA 1OD5A 3BODA 4W6YA 3CBNA 1FXZA 2RS51 3PUAA 2ILMA 2XL7A 1AYN2 4UXAA 4JCKA 5CADA 4R8HA 1N47A 3PUHA 4I09A 2ARAA 5FOJB 3AYEA 2Z69A 4XJUA 3V0BB 4DEQA 5CISA 4PLNA 4C1XA 5IYYA 2PA7A 4BM8A 4BQ2A 1ND3B 1JBCA 4D0QA 5FY9A 1LENA 1O6UA 2OUHA 2GZWA 2GNTA 2R1BA 5FZOB 3RS6A 4LO6B 2YC2A 5GLVA 1QKQA 4LKSA 4QM9A 3SMHA 5T50A 2A3YA 3T30A 2AGSA 1D0HA 4I2OA 4E9KA 1FNYA 4OUSA 2ZEZA 3VZNA 1COV3 1HV1A 2AYHA 1ACCA 2WWSA 2VVFA 3FHQA 5C6CA 1H1IA 2FZ1A 1DIWA 1UX7A 2FDKA 2JDNA 4RA0A 5A1LA 4NRPA 2ZGKA 1WBFA 2D98A 1JS9A 4UF0B 3UGGA 1C4RA 4DQAA 4LMFA 3ZFFA 2JDAA 4R9DA 5FP7A 2YG0A 4EYUA 4KL1A 5EJ1B 2WSVA 4AGRA 3DKQA 1UMIA 1Q8OA 2NN8A 4GALA 1RUH3 4CUBA 1PVC2 4COUA 3PJYA 3E97A 2ZCWA 2A3WA 3KV9A 3VKFC 2E31A 4EN6B 3O1UA 1RUD2 3JBG1 2D44A 3LEKA 1TG7A 3M3IA 2WYFA 2XJTA 1QJFA 3WR0A 4YZ3A 4ASMB 5FXXA 2JDZA 4TXWA 2WZEA 5JXHA 5H9SA 2ZXQA 5T5JA 3ECQA 1W6MB 3WQ7A 3B94A 4UFMA 4BJ0A 3AL5A 4R9BA 5CAZA 2A75A 4Y1ZA 2CDOA 2BBAA 2WNVA 1QJZA 1GZTA 4CUAA 4L11A 2J22A 3MYXA 4HOOA 3BUCA 2WNUA 2ZMNA 2FHRA 1DZRA 5LK5A 4AEDC 5BNNB 2BGOA 2PQQA 1GUIA 1H0BA 1QJU1 2JG8A 2W5FA 4YGCA 1NQDA 4OI2A 2FDHA 3KQRA 4PDWB 4GKYA 2HEWF 5D8AA 2PTMA 3HPNA 3TEZA 2D5FA 2Y64A 1W8HA 4KU8A 5FQ0B 2VULA 1Z0HA 2JD4A 3DYPA 3SITA 1AX1A 2A70A 1IKPA 5C4WC 1MS1A 5AC93 4IV3A 1SG3A 5BNPC 4XJWA 5JLVA 3RMXA 3CF6E 2TUNA 5CBLA 3ZXLA 4XZUG 2RJKA 1DYPA 4Y20B 1XOYA 1RL3A 2NP0A 1V6OA 4FP3A 4TTGA 4Z82A 2DBIA 3IMMA 4YVWB 3HQUA 4I0WB 4KG8A 3TNQA 3RZHA 3J26N 3ON7A 4KWUA 1I3HA 3TEXA 5IAXA 5F5QA 4YRDA 2HWD3 2WO2A 4MH0E 3BIEA 1BEV3 2UY9A 1XNDA 1NCQB 1RUE1 1ZA7A 1REFA 3M4FA 2ZA9A 5I0SA 2RS11 1RVF1 1SPPA 3PMSA 5A6ZA 3LF7A 1GQHA 1GV9A 5GLZA 1E5HA 2X10A 4BISA 2E51A 4XC9A 2XGXA 3THTA 4O61A 1HKDA 1PO11 2WZPP 4CDUC 3VHNA 1JUHA 4Y22B 2MEV2 2OT7A 5A7NA 3T2TA 1HB1A 2OS2A 3I4IA 1KS5A 5EQUA 3ZFFC 4BIFA 5KC6A 1PVC1 1XNCA 2WS91 2Y38A 3BCWA 1RUF1 1BLZA 2VH9A 2Z5WA 3E6BA 4H2AA 1R64A 4JDOA 2OYZA 3ZSKA 4CXYA 2R073 4HKWA 1XU1A 3S7EA 1HRV1 3OUJA 1R081 5FPLA 1ODMA 5FYBA 5FXVA 2VZTA 1WW6A 1OQDA 4HLTA 1JU4A 1U5YA 4PCRA 4QX1A 5FY5A 4AQSA 2B46X 4QXHA 2BGPA 5FY0A 2ZGQA 4KGQA 3LDRA 4Y20A 2VOKA 3ABZA 3CIHA 1JMUB 2JEMA 3ZXJA 3OOXA 5GZFA 3WG3A 4A3XA 2D6KA 5A3PA 4D8MA 2VM9A 3KQ4B 4LIUA 4DY3A 3WQ1A 4GAZA 4WM8C 3DF0A 3OSDA 1W6PB 3ZR6A 2K9ZA 1QH6A 2RS32 3BU0A 5FQ0A 1SDDB 2GAUA 4MX3A 3IDCB 1GWLA 4IERA 3MI8A 3SH3A 2DVFA 2QQJA 3WVJA 3WNKA 5IWFA 4LO8A 2PQSA 3Q9OA 1AR63 4L92A 1OOPB 3CZJA 1ZBE3 2Y6FA 4DNYA 4FPOB 1ULFA 3U37A 3UNPA 2WFF2 4DXTA 3I3BA 4XDQA 4XEZA 2ZX1A 3CLPA 3MW2A 3S0MA 2JB4A 5JZGB 4JDMA 2VNOA 5FZ7A 4LBQB 2QQMA 3NAPA 3FLPA 4Y5TA 4Q1RA 3CJIB 3QH6A 1ENQA 3ZYRA 4AVBA 5KHKA 3OD4A 5FZLA 3JB4C 1Q5OA 1S55A 2FDJA 2VVDA 3KV4A 4H7LA 1C57A 1IQDC 4LPLA 2D3RA 3POBA 3RQ0A 5CG8A 2GMPA 3K4ZA 1DG6A 2BDRA 1QU0A 2W92A 2WT2A 3W9AA 3N9QA 1U5ZA 1ZZ8A 3N7KA 4RFRB 4BOWA 2W3JA 4K3UA 3ACIA 4XAEA 4YGEA 5J37A 4MHUA 3K3NA 3BALA 1JOJA 2K46A 5DAPA 3ZFFB 1XXNA 4PT6A 3VBFC 3WUCA 2O0OA 5LBCA 1UY3A 1STMA 4FPYA 2H0VA 4XJ8A 1W9WA 3H42B 3I2FA 5CFDB 3N3HA 1NLRA 2VNRA 4L8QA 5GLUA 4IGOA 1QNWA 3W59A 1MS8A 2HH9A 1S2KA 2EA7A 4HXCA 4BQ1A 2DVDA 4C0BA 2Y8KA 4LT5A 5ACA3 3BYWA 2W1WA 4DZGA 3MFAA 5FDBA 4OLLA 4P9GA 2D5HA 4J1XA 3UESA 2ZKLA 2PAMA 3OEBA 2B7YA 4IEVA 4XDOA 5EV7A 2ETEA 2O8OA 1BXHA 4QPGA 1EPZA 1VLNA 2BWAA 3E5UA 5JMOA 1YFUA 4NVPA 4YYOA 5FMOL 1OKOA 2ZGUA 2BVVA 3FE5A 3UJQA 3T4VA 2ES3A 1UOJA 1H8VA 4AAXA 3LA3A 5F6KA 1I9RA 3BGAA 4CEYA 4CU6A 5F3CA 5HV4A 1UAIA 1GZWA 1CAXB 2ZAAA 1CONA 5DUWA 3A23A 1V6KA 1JYVA 1XSRA 2VZOA 2A6VA 4LBQD 3ACGA 1NAEA 4R4ZA 5FPAA 1XU2A 3SISA 3C7HA 4WM7A 2AREA 2P5BA 1TQ5A 4RQPA 5JDBA 5KBFA 4NIHA 2GC0A 2LROA 2BNOA 3J8F2 1CAUB 2OPKA 1SEFA 3VBOA 3AP6A 4LBNA 4Z07A 3ZIWA 4M0NA 1PGL2 1WLDA 5KHHA 2HKXA 4XQDA 4M01A 1XNBA 5IFPA 3VBOC 1HLCA 3M7AA 4QHZA 4E2GA 4CCOA 2Z79A 1OURA 3B3QE 3BOPA 4K7JA 4BDVB 4HT1T 1XE7A 5JWPA 5L7OA 1IS5A 1MACA 3UETA 2D6PA 2WAOA 5C5TA 4F3JA 4R9CA 1U5XA 3ELNA 3ILRA 3ZPYA 3MICA 1PM4A 4AW7A 4BWOA 4XACA 4CCLA 3MFCA 5F2SA 2DURA 3RJ2X 2RE9A 3NJVA 2CWSA 3H7YA 3P5BA 4YW7A 1UPSA 5FPVA 3HMYA 4I02A 5C3RA 4CVUA 5C8WA 5IVFA 2A6ZA 4IE5A 4LHNA 1RVF2 2P3YA 4JGYC 3AKPA 2O8QA 4S2GA 3TN92 1L7RA 3AL6A 4PLOA 4MGTA 4OZXA 5FZ8A 5FZHA 1D4M1 3Q8EA 4PHZA 1JXNA 4Q8KA 3OGJA 5K0UB 2WT1A 1QJY3 2JE8A 5F39A 1UX6A 4ZU4A 1RGSA 1UOBA 2WZR1 4N7UA 1Y9MA 2ZHKA 3WY6A 4NIIA 2FDFA 2X5IC 2JWPA 3WX5A 3QD6A 1NA1B 3FL7A 1JI6A 5A3OA 2P37A 2WDBA 2G1MA 3KCYA 4JAAA 4RR3C 3H0OA 2DF7A 5FP9A 4I0BA 1HRV2 4CP9A 5DZGA 1G9DA 4PBPA 1A8MA 1Q3EA 4XUPA 1G86A 1C8M3 4QGNA 4ARXA 3H1YA 5EWSA 4YVSB 1YI9A 3S7IA 3ZYIB 1SDWA 2Q1FA 1EV12 2WFF3 4GMP3 4FXGB 4LOTA 4CCEA 3R4DB 3ZFGC 1RUH1 2ET7A 3M8LA 5L7OC 4D7SA 2XQRA 1KD7A 5GLTA 1WW7A 1W9YA 3ME2A 3E5XA 3U75A 4LE3A 2PLV3 4QHOA 5JSPA 1ZBA2 5GZEA 4CDXC 1L3JA 5EPAA 1W0OA 1VBC3 4AHWA 3M1HA 4AVSA 4CDWC 1AXYA 2RS33 3HN1A 3VHOA 5A32A 5A1AA 4KQ7A 3O0WA 3IDEA 5A3TA 5T55A 1VB4A 3WINE 4ASLA 4Y1VA 4XTMA 5C9AA 4LQRA 3POJA 3AZWA 1MQTA 4GMP0 4RS5C 1S0JA 3ACLA 3NV4A 4IEZA 5JR7B 1GKBA 3C8XA 2RDQA 2ZGSA 4LXLA 4Q4W3 2R061 1UPIA 1IHMA 3EBRA 4LITA 2D3SA 5D2AA 4ATFA 1LHWA 2VW0A 5ERLA 3ROUA 3PVNA 1WUVA 3AMQA 4P9LA 4MXWB 4YZ4A 5DXDA 3I2DA 3JBG3 5C8CC 4OHYA 2W0XA 4W4ZA 4LA2A 2CHHA 3HT1A 4RHV2 1DF0A 2BU9A 3RGBA 4BIOA 1ZRDA 2IXLA 5J96B 3ZYFA 2XJSA 4KG0A 4F83A 4QM8A 3UGHA 1YEWA 1BBT1 4JGZA 3RZJA 5ACA1 2UURA 2XUMA 1RUG1 4D3WA 5FBJA 4LBOA 2EXHA 4YVSC 5LA9A 3WP6A 2OQ6A 2RMU3 3EHKA 1BMV2 4ZU7A 3WOGA 4FTSA 1J3RA 4QKNA 1GYKA 2W91A 1YC61 1UZZA 2UYBA 4I3PA 2RDSA 3RG0A 4YFZA 5FPXA 5HCAA 4MUVA 2E33A 4QXBA 2JD9A 4DRRA 4YZ5A 1NCRA 1UYXA 1VRH2 1APNA 3AKRA 3SXWA 4RL7A 2VZVA 1X9TA 1O4TA 4QX7A 4PIYA 1OQEA 3ZMOA 4PQQA 1RUC3 3TYJA 4NWVA 1H6YA 1WW5A 5K7PA 4QPIB 4DXZA 1TZOA 2RDRA 1WCSA 1ZVFA 1NX9A 2BP6A 5FYTA 1HJGA 2XBO2 1S0CA 1XE8A 2V72A 5AC92 3SLIA 3JQWA 1F4AA 5LBFA 4JQRA 1Y9GA 4QX8A 3FHAA 5FMBA 3ZYBA 3NKGA 5LY1A 3KB5A 3P1IA 1FT9A 5HBAA 4FCAA 1JZ3A 3O1VA 1QJX3 5FUIA 2Y0OA 4MG2A 3LFIA 3OPZA 1ZBE1 3FZ3A 5CFCA 3VBSA 4JHZA 2RG4A 3WDVA 1FNZA 5FYSA 2CV6A 1PO13 1J3QA 5A6QA 5IK4A 1JYTA 1FOD1 5LK7B 4NR1A 3DEMA 1US3A 3AYDA 3W5NA 1S0IA 4RS5A 2OPWA 1PNGA 1F2NA 3CNAA 4OYUA 4XHXA 2YXSA 4URAA 2G9ZA 2HWF3 4XQWA 5FZKA 2E53A 1W6QB 2KR2A 3ILFA 5FZBA 4L99A 4Q4X3 5C4WA 4XILA 1WLTA 2FCUA 4MVTA 2W94A 1MQTB 3PTYA 3R4UA 4PI0A 1UO9A 4Q8LA 4E2QA 5GKAC 4PF1A 4BE3A 2E63A 1VBE1 5LEJA 3FLRA 2F17A 1XE0A 5DZFA 3J7LA 1BBT2 1K12A 1VBD2 3WDYA 1NE6A 4YG3A 5DDJ3 2WQ4A 5A6YA 1OT5A 3KT7A 3KLSA 4TN7A 2X29A 1V6MA 4NIDA 3U4SA 2GNBA 2VMHA 4D6RA 1HQNA 3LZZA 1F9KA 4IEPA 2Z42A 1D4M2 3K48A 2VOWA 3KD4A 3NO8A 2D6OX 3I7DA 4LORA 1BBT3 3ZSLA 5E8AA 4N53C 4WBBA 4OI0A 1COV2 1DHKB 4AEMA 1W8WA 4XFFA 4MYEA 2DCKA 5FP8A 4L97A 4RR3B 4OQ9A 4L2NA 1Z7S3 1AR83 3GNEA 3NV3A 1Z7S1 4S2DA 2WINB 5IVEA 1ZZ7A 1W2TA 3ZPOA 2WIIB 4XTPA 1LEMA 5F6LB 2XG3A 3C3VA 4ES9A 1FPN1 4OULA 3NW4A 3KM5A 2ET1A 2HEVF 4NIAA 3ZN5A 1OI6A 4HPKB 4J1WA 4QDRA 5FMOS 1N3OA 2VNVA 1SHWB 5FO7B 4OMDA 3I59A 1POV0 5EFUA 5K0UA 4BMBA 1KS4A 5IFTA 1O4ZA 2PHTA 2OA2A 5IK8A 3UV9A 3LWCA 1JZ8A 3I3DA 3WHTA 5J48A 3L9JT 2GC3A 1PZ9A 3I2HA 1I5PA 2QQPA 3C7EA 1HQWA 1UD1A 3MIFA 1HN0A 4ISRA 2QKDA 1OMIA 3QH7A 4UFKA 4P9XA 1LAJA 5FYIA 2BQPA 4B4PA 1UYZA 2BRTA 3LB9A 2GP3A 4ZS2A 3K75B 4YW5A 3URFA 4D7TA 4ZHNA 2HWB3 4Q5OA 5L7OB 1W06A 4UYBA 4AL9A 1DU3D 1JYCA 1DGRN 1YO8A 2JG9B 1QGLA 4CCCA 3K51A 1PVXA 5CKQA 1HXS3 5DPNA 5KXBA 5D1IA 4CCMA 3MIDA 2WNVC 1K3IA 2SBAA 4MV2A 5FY7A 2ORXA 5G04L 4BK4A 1OLMA 2ZHLA 1G9BA 5EJ3A 4CSWA 2PXJA 2WJSA 4WM8B 2ZEWA 2JDPA 1PK6B 4QPYA 4CA9A 1SLTA 4NHKA 3JUUA 3SQOA 4IUGA 1E57A 4JKMA 4EWDA 1OVPA 4FAHA 5ABJB 4IE6A 3WNMA 2ZEYA 1LU2A 3P3PA 1CAXA 1GZWB 1LOAA 2AH2A 5E88A 2I45A 3VZLA 3V64A 1MPXA 1EP0A 1GU3A 1WZXA 1GZCA 2R0HA 3LA2A 2ID4A 3NRUA 1WW4A 3LIHA 1CESA 2VC9A 2PHLA 3QLQA 4QPGB 2Q4SA 3TEYA 5JSRA 4AVTA 2XVKA 1UXZA 2XVGA 2YPJA 4QQLA 5FMCA 4CCNA 2ZEXA 2UWCA 4HBNA 3GYDA 5GALA 3MUZ1 4H14A 3PJQA 2Y6KA 2YMZA 3RYKA 3VBFA 4MGYE 3KSCA 4YFWA 1AL0G 5E89A 2O14A 4N9IA 3ZXEA 1R1A1 2LALA 2VZPA 3WW2A 1CZSA 1VAMA 4WZFA 5G05L 2V4AA 5FO9B 2V73A 5TSWA 5JSOA 1NYWA 4URTA 4AEJA 5JPMB 5CFDA 1AR82 2XXZA 4E4HA 5CG9A 4KWKA 1IQAA 3HQRA 1NE4A 2QQWA 5HXMA 4DUWA 3CKHA 3HD8B 5BNOB 3KV5A 3ALQA 3BTXA 4FT8A 2O1QA 3F95A 2Q8OA 1LJ7A 1HV0A 4EN7B 5HI0A 1LECA 4YM2A 2EF6A 3TOJA 3I49A 1SLAA 3U14A 3BVCA 3ZFGA 1GANA 1OLRA 2A71A 5H9PA 3S5AA 1CX4A 1E5SA 4BQWA 3WW4A 2QVSB 3N9LA 4ITCA 3RMYA 1Q43A 2GMMA 2NMNA 3IMNA 1MZ5A 2XH6A 2PLV2 5FPBA 1DYKA 1G9FA 3U78A 2ZJCA 4Y26A 1GQPA 5I91A 3INAA 1VBD3 4AFDA 4CZSA 2EIDA 1QJX1 1D4VB 1X9PA 2P6CA 2A6YA 5K4LA 4HKLA 4XFIA 2BZDA 1EV13 5I0DA 4XF1A 3O0VA 1X50A 1HB3A 5JMCA 4NE9A 5JZGA 1OH3A 1MS0A 1CN1A 1CD3G 1OOPC 4HVRA 2BPA2 4DOUA 1IS4A 1WCQA 2K0GA 2FQPA 2RM23 5BNOC 1ST8A 3VDAA 2HWF2 2ZZQA 2CGOA 3DN7A 5FXZA 3RZKA 3MIEA 3IZOA 3AZVA 3VB9A 4G9SB 4I01A 2WYSA 1YQ5A 4LHKA 4NHMA 4G3YC 1WCKA 4CCDA 1V6LA 2J1UA 3J7HA 4Q4X1 1K5MC 2N7GA 2HWC2 3NL1A 3RI9A 1CZTA 3RVHA 1QOOA 4BPZA 3N7MA 5IVJA 2Y60A 3Q8FA 1DZQA 4MGQA 4GULA 4QX5A 2OW4A 4A6SA 5CFDC 1NQJA 1SFYA 5LY2A 3T3YA 2X09A 3VHPA 2PN5A 3SEEA 1W8UA 1ZA4A 2G19A 3PU3A 1HB2A 4GWJA 4HK8A 1IS6A 1QDCA 1J83A 4P5YA 5FV3A 5FXWA 3SKVA 3O1OA 3ES1A 5KXDA 5FY4A 5B4XA 1PM7A 4TZDA 1LOCA 2A5ZA 1ZNPA 3RWNA 4ZONA 1PX4A 3JD71 1OC1A 2C4XA 5L19A 1ND2C 4J25A 5HCFA 4LULA 3VDDC 4C90A 4RN5A 3SH5A 1AZDA 1VALA 4S2HA 1N1TA 5F3GA 1W9SA 2ZGPA 5LASA 4IE0A 2ZMKA 1RINA 5APAA 4NAMA 1PK6A 1DQ2A 2TNFA 2VBBA 3FFQA 4BQYA 5KWRA 2Q8DA 1BKZA 5CA6A 4WM8A 4D7YA 4EJRA 1A6CA 2JIJA 2QQKA 1D0GA 1DCSA 2XKOA 3OGVA 1AR81 3WDUA 5CYYA 1NLSA 1VPHA 4OFGA 3U0ZA 1A8DA 4QWNA 2W1SA 3POIA 5JVVA 1PO22 1P8JA 1MZ6A 2VE1A 3MLKA 2JG9A 1JTZX 1YQ2A 1LGCA 2ZACA 1W9TA 4LE4A 4NHYA 2LS6A 2WC2A 3WF0A 3MW4A 1LOFC 1FMD3 1WD4A 3NMBA 1SPPB 2BWCA 3WHUA 1S0FA 1G9AA 2CGPA 3ATGA 3HVDA 4LLFA 1OXCA 1GP5A 1NCQA 2XJUA 3VZMA 2VOVA 4A42A 5LEKA 3SCHA 1GOFA 1ULGA 1LOEA 1T6BX 4QKBA 4UFHA 4AHYA 2YUEA 3VZKA 3HNYM 3BPSA 1VBC1 3VDDA 1SFPA 4ZXKA 4CDWA 1AR91 1YFXA 4P9YA 4AXOA 2BFUL 4A7ZA 3I59B 1YNAA 4YW4A 1BYHA 4DXSA 4JGZC 5GJ6A 2VCMA 2EXIA 3MGUA 1SLBA 1UKRA 2BJSA 2OZJA 4JRAA 3WCSA 3DXUA 4P9JA 4FPEA 3IIIA 3M70A 1QQP3 2TEPA 4RSUA 4XQ4A 5CVRA 1Z78A 2WO1A 1Q8VA 2RV9A 1GNHA 1WD3A 1TE1B 4H55A 4HSLA 4DFSA 2YFZA 4N43B 1MVQA 1O4YA 5A7OA 3ILNA 3O1SA 1AYM1 2B5HA 1UW8A 2YROA 3NVCA 1RUI2 4RR3A 1ZZBA 2Q30A 3VBRB 1UY2A 5KHIA 1IGOA 1C28A 1YWKA 3A0KA 3LSEA 4XF9A 1H9WA 3NJXA 5FK8A 4YW2A 5FIXA 1YJKA 2EVXA 2VW2A 1CWPA 4FPHA 5FZDA 1WBLA 3OGSA 5FWJA 3H9AA 2R042 5FY1A 4CTEA 4EWAA 2B9UA 2BEOA 3HBZA 1YUDA 2XB6C 4IV3C 5JZGC 1Y4WA 3AYAA 3AXDA 2RS31 4QQPA 4XURA 2HWD1 1W90A 1DDLA 3Q8CA 5IVBA 5D8AC 5FYZA 2ZAHA 1LGBA 1XQNA 3KHCA 4K8RB 2JDHA 3N9MA 3VD4A 3ORJA 3K4DA 4XMIA 4AG4A 2JENA 2RM21 2W2IA 4Q0QA 3OUHA 3UKVA 5JIUA 5FTTC 2DDUA 2PFWA 3O1RA 4Q29A 3AP4A 4GMP1 2PHWA 1SLIA 3M3OA 3NQHA 1UZVA 4B7KA 2Z4FA 5JXGA 1QNYA 4KMQA 3VZJA 1CQ9A 2IWGB 3I97A 3PUSA 4GA9A 4IL7A 2BERA 2F4PA 5LA1A 2HYXA 3ZX7A 3IKWA 1QJY2 3Q8BA 4QX2A 3I8TA 4JQTA 2P1BA 4PDWC 1GICA 4P08A 4XXPA 3VBSB 3UKTA 4DPNA 5BUVA 1OKQA 2OX0A 1RTVA 4GJYA 4A45A 4EWEA 3NAPC 2WR9A 1RXGA 3AX4A 4LO4B 2BOJA 5F37A 1AYN1 5J7MA 1J3PA 4B7EA 2I74A 1FV2A 2F6BA 1SLCA 1YJLA 1QQP2 1UKGA 3KWVA 5I0UA 3FX3A 3ZN6A 3LOBA 3V0BA 2V5DA 1JZ4A 2DU1A 2WFPA 4XFAA 4QGMA 1J1LA 5CNAA 4B4QA 4DB5A 2R0FA 3HWJA 1R093 1ZRFA 5LA2A 1X8EA 4YLZA 3VD9A 4ATEA 4OHVA 4IV1A 2HWB1 2VMCA 3VBRC 5ISLA 3WP5A 4LK7A 2FDIA 3CEWA 4UI9L 5FRAA 4CU8A 3QACA 1V6JA 4COZA 3OPWA 5AFBA 2R49A 3SCGA 3WF2A 1MS9A 3ZSMA 1KDKA 5KXCA 4HANA 3CDZB 1F5JA 2BOIA 3GZUC 4L0PA 2W87A 3NNJA 1CAVA 4FAGA 3MUY1 1LTEA 2UYAA 4BQ4A 5DQ0A 2KA3A 1WMFA 2VQAA 1O59A 3LDKA 2RR12 4HONA 1H1MA 5F32A 3O1PA 3CMGA 3DCQA 4XIOA 4FQ4A 2WBKA 1URXA 1JHJA 1QXJA 1AR73 2QCSB 2WUHA 3POSA 1J84A 4JGZB 1MQTC 2J7MA 2YGLA 4K40A 5AFEA 1O8PA 1W8FA 4BLJA 2C26A 5FYMA 4ZS3A 3O1TA 4ZPIA 3O7OA 4CDQC 1QIQA 2C0ZA 2DUQA 4XFGA 5GZDA 3R4SA 4CEYC 5C70A 3RPQA 1EAH3 2GC1A 3THDA 1H1AA 1LODA 1VBD1 4BMEA 1X7NA 2R062 2XOMA 3USSA 5JAXA 4B4RA 1KJRA 1V0AA 4MXWA 2AUYA 1OBNA 1VMHA 2JXAA 4UW6A 4YVWC 5FZ3A 2ZX2A 1KEXA 3OGRA 5ANQA 3CZUA 5LA0A 4AVVA 2ZOEB 3HQXA 1BK1A 2PHXA 2RJLA 3LPFA 5EJZB 1F15A 4EZ4A 4MLOA 4FXKB 1SQ4A 5K0UC 3N4MA 2VPVA 2XWJB 4CU7A 1UF2C 5C8CA 4Q1PA 4OMCA 3P6BA 4QKDA 3PUIA 1AX0A 1UWWA 4GJZA 3H8OA 1DZTA 5J09A 4FPJA 5FZGA 3JCIA 4CP2A 3OYWA 1OH4A 5C3PA 5I93A 2YC4A 4O7XA 5DDJ1 2ZZJA 2XHKA 4E8CA 3V65A 5C33A 2CU5A 1MS3A 2YBKA 4FPGA 4DUVA 2VO5A 1OA4A 3TN91 4QPIC 4Q26A 4FO9A 4NRQA 2ZBJA 3WQ0A 1UQXA 1ENXA 1LCLA 3ZDSA 1NZCA 3PHMA 2FCTA 2IVJA 1PGSA 1QEXA 2DUPA 4GB32 5LBBA 4Z2AA 5KXEA 1O3SA 4JGYA 4LO5B 1BVVA 1OA2A 2VQ0A 3QCWA 3RZGA 4PF5A 4EROA 4MADA 2Y33A 1FOD3 1I6XA 4A3ZA 1O3RA 1H8TB 4AEDA 1ZBE2 5C5UA 1VMJA 2RS12 2VU9A 4KBBA 1AR62 2GNMA 2C6SA 1MS4A 1VBA3 1RUF3 3GALA 2ARXA 1O91A 5FYCA 4M3CF 2OIIA 2YU1A 4QXCA 1A3KA 2A7AA 4EE2A 2MEV1 4IQPA 3W58A 1IG0A 3TNPB 1V9U1 1IPKA 3GJBA 2WWJA 5JOZA 3WW3A 1NKGA 3KCCA 4Q0SA 1PNFA 1TMF3 4JVAA 3R6SA 5L9BA 3BTAA 4Z92B 1YI7A 1EY2A 5D21A 3AMPA 2VR4A 4LHLA 4AF9A 1C1FA 2GU9A 1RUE3 2UWAA 1HRI1 2XJPA 5CFCC 1A34A 3O0XA 5IAVA 3WZ1A 2QZ2A 4MO3M 1JN2P 4QGLA 4HL0A 3OG2A 1Q8SA 3GBWA 4CYDA 1TME1 1LU1A 3VBHC 3OB8A 1CAUA 4YWAA 1N1VA 1VRBA 3I2IA 4QPWA 3VBOB 3DGTA 3VKOA 3AMNA 3B9CA 1XB9A 3FUQA 1CAWA 3D6EA 3POYA 4FSJA 2AC1A 4Y4RA 3VD5A 3Q8AA 1Y9QA 3LDBA 4RQPB 4WM7B 2HEYF 4K20A 1FPN3 3UGFA 2P34A 3B02A 3IAPA 4Q4Y3 5J98B 4AQ6A 1RHI3 3I3EA 1LHVA 2HWE2 4Q4V2 3VBHB 3NV2A 3DL3A 1RUG2 5J3UA 3IAQA 2W95A 4XOGA 3KVAA 4CEYB 1BVP1 5HCHA 5FFOC 1VR3A 3WD5A 3ZYPA 1DYOA 3WT3A 2WT0A 1D2SA 2QQUA 4O9EA 1F35A 4W8JA 4NPLA 4LBJA 2GP5A 3POWA 3ST7A 3AP7A 2E7QA 2WSUA 1RUJ3 3PMEA 4A6OA 4P9IA 3GF6A 2HWB2 4RYDA 5FAXA 2HWE3 2VL4A 4Q4V3 5CU1A 3C7GA 1UY0A 4I0AA 4OHWA 2ORZA 5FK7A 5F9TA 2VVEA 1FPN2 2E6VA 2WA3A 4DIQA 2ZMLA 3GCWA 3MLLA 1YCIA 4N90A 3MF6A 4XJZA 2DVGA 3BU7A 4D6QA 5GZGA 3LAGA 1DBNA 1PK6C 5T5PA 5GZCA 2I07B 3GCXA 4AWDA 2VTFA 4DXRA 1AL23 1UU4A 4L9BA 1W8NA 4LKDA 4QU1A 4GH4B 4HFSA 5FZMA 3WQBA 1RUC1 1SCSA 5H9QA 3WW1A 1YIPA 4AEKA 3AYCA 3N35A 1HRI3 3LIGA 3N7LA 3OD0A 1ASJ3 4O65A 3BI3A 5CKMA 4F8AA 3T0BA 2P6HA 5FCCA 2ZS6B 2ZHMA 3ITQA 1YRZA 1ZRIA 3G6JB 2XLFA 2Y6GA 3LEIA 2HBTA 2DCYA 4D94A 5FPUA 3E5QA 3NJZA 1QXPA 2JJ6A 4MZUA 4DRVA 2GH2A 1ENSA 2VTXA 3T08A 1NXD1 1C8NA 4SBVA 1HXS2 2WWUA 3NAPB 1SLLA 2BYVE 1N1SA 2R32A 1KFXL 2R6QA 3RJRA 4PLMA 2P17A 1F4HA 1TME2 1W39A 4LJHA 1UCXA 4CDXA 1RUG3 1PVC3 4AE2A 3JU9A 1FAYA 4XXAA 3A7QA 3UK9A 5C3SA 3VBRA 2HYKA 1OOPA 4MGSA 1D4M3 4YM1A 3VV1A 1TNFA 3T0AA 4SLIA 4COVA 3OEAA 1RUOA 1UY4A 2DVAA 2VBPA 3WDWA 3VBUB 2ZGRA 3WP3A 1GWMA 2RS52 4OI1A 1GP4A 4C0HA 1W6PA 1A78A 1W6NB 2CL2A 4CRQA 4NIGA 2IXHA 4OUMA 2XL9A 4XFCA 1D7PM 2AEZA 3PIGA 5L36A 5F5AA 1OUSA 4GXLA 4P00B 1ZREA 3SCFA 3WP4A 4A44A 1LHOA 3KS7A 4BQ5A 3T1LA 2VXJA 3HAGA 4M3CA 2X05A 2DFBA 5T5OA 5FZAA 1K5JA 1W3VA 1RUJ1 3JB8A 3K2OA 2DVBA 3OY8B 1TMF2 3SKJE 1Z7S2 4INDA 1T6GC 3FWEA 4EN0A 1R1A2 4UW4A 3SHRA 4ONUA 1AYN3 5IATA 5IUQA 5IK7A 3TWIA 1W05A 4LLOA 5FYHA 4DMIA 1HDKA 2WL1A 2RVAA 4FOYA 1QJX2 2W68A 4LO7A 2J1TA 3PL0A 4N43C 4B8EA 1U5IA 1UU5A 4Y22A 5A80A 4K1YA 3I2KA 3IDAA 3NV1A 4BZ4A 1NY71 4OHZA 2J1EA 4AOCA 1GMMA 4A7YA 5J36A 3M3EA 2J1RA 3BB6A 4ZY9A 4ASKA 3BTYA 3CU7A 2EIGA 4PIZA 3VUOA 3IBMA 1RXFA 1VP6A 3EYPA 4OHXA 2VJXA 2WLQA 4E27A 3MIHA 4B1LA 3AK0A 3ZYGA 1X82A 2KD7A 1BK0A 2ZX0A 3OY8A 4ISQA 4Q4X2 1HB4A 4WM7C 5A6XA 3ZM8A 2IXJA 4YVWA 4FFIA 1EUTA 1VRH3 1QH7A 1PMIA 1T2XA 4M3CB 2B42B 3WNOA 4XBLA 1RHI1 4BYYA 3T2QA 4XETA 3UT0A 3AC0A 2B45X 1JH5A 2VECA 2C9KA 2RR13 3CO2A 4XMAA 1J59A 4MSVA 1W6NA 1NCRC 2QTWB 4HVQA 4WVVA 2DCTA 1JYWA 5D8AB 4QX3A 3VBUA 4D6SA 3AZXA 1XNKA 1G6NA 3IN9A 2JG8B 5FWEA 4META 4B1MA 3WLUA 3A0NA 2DU0A 1DGWA 4NAOA 4A41A 5BNNA 2VCBA 3MV01 4XFHA 3EB7A 5BNPA 2A3XA 3A21A 2XBO3 2WNVB 4PI2A 3RNSA 1JZ5A 1JHNA 3FHIB 5FR3A 3AZYA 4LEJA 1R092 4XPVA 2VUCA 1OPMA 5A33A 2LUWA 2YGMA 2OQ7A 4HMZA 1W6MA 1DGLA 3LKJA 1AJOA 1EAH2 4XCAA 5FY8A 1WLWA 2QNKA 3R05A 5A7PA 1ND2B 4R9AA 2VZ3A 4EV0A 1UY1A 1UNBA 2X8KA 3ZIXA 4QKFA 4KH9A 1W2UA 3IIAA 1PMJX 2BNMA 2YV8A 4RGGA 3ZYHA 5HV0A 1LKNA 3PLQA 2BNNA 3UL2A 3VKMA 1UZWA 2J1SA 1AR72 3N9PA 2VOTA 1O8SA 3JD73 1QDOA 1DQ4A 4M3CE 2R30A 1AYM3 3ZXAC 1HX6A 5K8SA 3VZOA 2A73B 3C7OA 2D40A 1MZEA 2Q1MA 2QBXA 2RMU2 5AVPA 4PJYA 1VIWB 4UF0A 1UYPA 3KF3A 1VBC2 1BMV1 2JICA 5BNOA 1QQP1 2XR4A 4JV4A 5EYYA 5KC5A 1YHFA 2WQZC 4CP0A 2VUAA 5DABA 3H50A 4Y1XA 1F5FA 4AFBA 1LR5A 1MEC2 3KMHA 4QXKA 4UFIA 3VKNA 2GN7A 2W46A 1VRH1 3ZXKA 1E5RA 5T52A 4C8DA 3JBG2 4XUOA 2XPJA 1MVEA 4J6GA 1C8M2 4CEWA 1DQ6A 1LB2A 2DBNA 3FBMA 4OCTA 1U0AA 4LUMA 4QB6A 3LSDA 1PIV2 5F8PA 3BKZA 1KJLA 2B4KA 3AM2A 5FYUA 1EV11 1GOGA 1ND3A 4UT5A 1H2KA 1OPOA 2RDNA 3MPBA 1GZ9A 4CXXA 5FLIA 4LNVA 3LEGA 2W9XA 3AVSA 4FTBA 4FOWA 2Q5TA 4HK9A 4JDNA 5DUXA 5I0RA 3EO6A 4NHXA 5T54A 2QDRA 5B4NA 1S4CA 3PTRB 3I3QA 5E6HA 1VJ2A 2DTYA 1SCRA 4FOQA 5EHDA 4AI8A 1RITA 3SEPA 2VOXA 5FZEA 2TBVA 2XJQA 1CJPA 2YC0A 3MPPG 3ZVXA 5BNQA 3DPRA 1AYM2 3AKTA 3VDCA 2ZKNA 1UZYA 3P3NA 3VL9A 4Y4YA 3MHZA 2ENRA 2BUKA 2W39A 1GBGA 3KGLA 3MBWA 4QDSA 2QDNA 2AEYA 1O3TA 1KITA 2E26A 2VMEA 3A4UA 4QB1A 3ZFEA 5LBEA 3SNMA 2PAEA 4AFMA 1OUXA 4NO4A 1C5IA 2PHFA 2V09A 1YQ6A 2JIGA 3T2PA 1CJDA 5BPXA 4FPLA 2UU8A 1VBB1 2VUJA 1HRV3 5FZIA 4QPGC 2ZGNA 2FMDA 3JXSA 4HN1A 1ZZCA 3ETPA 1VBB3 5FKBA 2VUDA 1AR71 1VBE2 1W2NA 1RMU1 2VQTA 4MXVA 4W6WA 2A6WA 4YZ1A 3AB0A 1FV3A 4GIQA 1SFNA 2V5YA 1XJAA 3ZR5A 2BBVA 1IPJA 2MHFA 4UFLA 4Q0UA 1B35A 3WUDA 2LW8A 2QJVA 2XMLA 1X36A 4R4XA 1REDA 1IOAA 2Q1ZB 1UMHA 4Z8BA 4HPKA 1RVF3 1NY72 3BN6A 4NHLA 4H7MA 1RYYA 4BHPA 5CB7A 3WG4A 1PO23 3GZTB 5LCWL 2WN3A 1HN1A 4OUEA 3GJAA 4Y1UA 1GR3A 3UYJA 1WMDA 3H8RA 4GWIA 5L9VA 3V0AA 1W9FA 2JG9C 4K9SA 2JE9A 1QOTA 1EYBA 2AENA 2PYTA 4XABA 5DZEA 1OA3A 4MOAA 2YY1A 2P3KA 1ZX5A 2VMDA 4EN9B 2PAKA 4FPFA 4Y5Z0 2QQNA 2D6LX 4IV1C 5FLHA 1WKYA 1AX2A 2JG8C 2RJ2A 2XHNA 3GXUA 1MZFA 2CSGA 3GBGA 3K4AA 1MR5A 3JQXA 4Q0PA 1Y7BA 5M0TA 1DQ5A 4YARA 1W8ZA 2EIEA 2ERFA 5C3QA 4RD7A 3MDPA 2Y34A 3R0RA 4CDQA 4FFHA 1N3PA 1UMZA 3RZLA
chains in the Genus database with same CATH topology
3BUCA 4QKFA 3H8RA 3RZHA 4NROA 4NPLA 3O1PA 3BTYA 3BI3A 4ZHNA 4IE7A 4CXYA 3O1OA 2IUWA 3RZJA 4NIDA 4IE5A 3S57A 2FDHA 4NRMA 3BIEA 2FDGA 3BTXA 3RZGA 4OCTA 4RFRB 4QKDA 4NIHA 3O1UA 3O1MA 3H8OA 3H8XA 5F8PA 3BKZA 3O1TA 4ZS3A 4MGTA 3RZMA 3I49A 3I2OA 3BTZA 3I3MA 4QKNA 4O7XA 3RZKA 4NIGA 3S5AA 3LFMA 2FDIA 4IDZA 4CXXA 4ZS2A 4NJ4A 2FDKA 4O61A 3T4HB 3KHCA 4QHOA 3T4VA 4IE4A 4IE0A 3O1SA 4CXWA 4NRPA 4JHTA 3BU0A 4NIIA 2FD8A 4NPMA 3O1VA 2FDFA 3I3QA 4MG2A 3O1RA 5DABA 4QKBA 3KHBA 4NRQA 3RZLA 4IE6A 3T3YA 2FDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUC A;  4QKF A;  3H8R A;  3RZH A;  4NRO A;  4NPL A;  3O1P A;  3BTY A;  3BI3 A;  4ZHN A;  4IE7 A;  4CXY A;  3O1O A;  2IUW A;  3RZJ A;  4NID A;  4IE5 A;  3S57 A;  2FDH A;  4NRM A;  3BIE A;  2FDG A;  3BTX A;  3RZG A;  4OCT A;  4RFR B;  4QKD A;  4NIH A;  3O1U A;  3O1M A;  3H8O A;  3H8X A;  5F8P A;  3BKZ A;  3O1T A;  4ZS3 A;  4MGT A;  3RZM A;  3I49 A;  3I2O A;  3BTZ A;  3I3M A;  4QKN A;  4O7X A;  3RZK A;  4NIG A;  3S5A A;  3LFM A;  2FDI A;  4IDZ A;  4CXX A;  4ZS2 A;  4NJ4 A;  2FDK A;  4O61 A;  3T4H B;  3KHC A;  4QHO A;  3T4V A;  4IE4 A;  4IE0 A;  3O1S A;  4CXW A;  4NRP A;  4JHT A;  3BU0 A;  4NII A;  2FD8 A;  4NPM A;  3O1V A;  2FDF A;  3I3Q A;  4MG2 A;  3O1R A;  5DAB A;  4QKB A;  3KHB A;  4NRQ A;  3RZL A;  4IE6 A;  3T3Y A;  2FDJ A; 
#chains in the Genus database with same CATH topology
 4Y24 A;  5FBZ A;  4QAW A;  1ENR A;  4ZXE A;  5DAV A;  2D3P A;  4DO0 A;  4FPC A;  2ZGO A;  2NLR A;  4GQ7 A;  5A1F A;  5C8C B;  2FDG A;  1UOF A;  4XCB A;  1JZ7 A;  1OF3 A;  1RJ7 A;  3B5L B;  1HQL A;  4FOV A;  4X6R B;  4EN8 B;  4WVW A;  4F7Z A;  2NQY A;  4AQ2 A;  4AHZ A;  5C9A C;  5HPO A;  1JYI A;  2VY0 A;  5B2G B;  1R09 1;  3OBZ A;  4AI9 A;  2ZHN A;  2R04 1;  4RS5 B;  3AFK A;  2W1Q A;  3RRD A;  4UFJ A;  2B8M A;  2D93 A;  1IZ3 A;  4Y1Y A;  4COY A;  4W50 A;  4FTE A;  5A7W A;  4N53 B;  4W65 A;  4ARY A;  2BW8 A;  5CFC B;  2PHU A;  3IM0 A;  1W8T A;  4UW3 A;  4Q4Y 1;  4IE7 A;  4CEW C;  3J9S A;  4XF3 A;  5FZ9 A;  3NST A;  4UBG A;  1LOG A;  2VQU A;  2WZ8 A;  2LRP A;  3AMM A;  1WA4 A;  1XYP A;  3GHN A;  4IGP A;  3H8U A;  3FJS A;  1C1L A;  3MEP A;  2JEC A;  2Q0A A;  4TLG A;  2XLA A;  1V6N A;  2VW1 A;  2ARC A;  4QMA A;  4XUN A;  2H6C A;  1CAV B;  1YQ8 A;  4XE9 A;  3M2M A;  2WZR 2;  3MIB A;  3MLJ A;  3POE A;  2OKX A;  4CDU A;  1UZ0 A;  2D97 A;  5DUU A;  3DXT A;  4EZH A;  1R1A 3;  1COV 1;  1PMH X;  1TME 3;  4QPI A;  1OLM E;  1W2O A;  4GB3 1;  5JI7 A;  2J42 A;  3FMG A;  4XBQ A;  3FBY A;  3VKL A;  2ZAB A;  4WVM A;  1H8T C;  4IV1 B;  4XBN A;  4YZ2 A;  2JKB A;  2QFE A;  1BCX A;  2H6B A;  1S0E A;  1NCR B;  3B7M A;  2CAU A;  2Y6L A;  3I2G A;  3D5O A;  2YPD A;  3ZDV A;  2G9G A;  2HJI A;  3AKS A;  3OBT A;  1IKQ A;  5JOY A;  3QOP A;  2R07 2;  3BIW E;  3RWK X;  3POG A;  5IJR A;  4K21 A;  3ZN6 B;  3ZSE A;  2I2S A;  2VAU A;  4FFG A;  3D0S A;  3FLT A;  3B9I A;  5FUP A;  3RZZ A;  3UJO A;  4XHB A;  4HKO A;  1PZ8 A;  1SZB A;  3IWZ A;  1W28 A;  4XVH A;  5F5C A;  1AL2 2;  2C24 A;  2FCV A;  4GWN A;  3WCR A;  4AK3 A;  5E1R A;  4DS0 A;  3VD3 A;  2YB7 A;  4HVO A;  1ULE A;  1ALY A;  2IXC A;  4YSF A;  2XLG A;  1JZ2 A;  1BZW A;  2GH8 A;  2KM2 A;  4P5H A;  2OXB A;  2RHP A;  3KT1 A;  4AYU A;  1JW6 A;  5FYY A;  4U2A A;  5A7W B;  4BQX A;  2VBD A;  4LBK A;  3CHX A;  4CPB A;  5FOB B;  1C3H A;  4S2F A;  4FFF A;  1RC6 A;  1L7L A;  2CTV A;  1SBD A;  3B01 A;  3J8F 1;  1KFU L;  3LE0 A;  4DIN B;  1LOB A;  3M3Q A;  3EMR A;  3OJB A;  3POF A;  5FP4 A;  3ZXF A;  2RR1 1;  5I0T A;  1F31 A;  1X33 A;  1O5U A;  5EXO A;  3TB0 A;  4AFA A;  2PHD A;  4QT6 A;  2ZGM A;  4RFT 0;  4BXS V;  4A7K A;  1X8M A;  4CXW A;  4GH4 C;  4Y33 A;  2YYO A;  5IT6 A;  1CVN A;  4QQO A;  1HRI 2;  3F2Z A;  3NNG A;  4Q4Y 2;  2WNO A;  3OPT A;  4X6Q B;  1YQC A;  3DEC A;  2IVI B;  2BV4 A;  1R08 3;  2A6X A;  2XON A;  4LOS A;  3T0D A;  4CDQ B;  2LTN A;  2JDY A;  4LA3 A;  2MEV 3;  2IUW A;  4IET A;  4QD2 A;  5A3N A;  4K6B A;  3GBF A;  4NRM A;  4QB2 A;  4QQH A;  3UKN A;  2ARB A;  2DCJ A;  1W8O A;  3H7J A;  1Q56 A;  5ANN A;  4YW1 A;  2L9L A;  2YDE A;  3T2O A;  1GP6 A;  3AVR A;  3H8X A;  1F8V A;  4KWL A;  1WMX A;  1GWK A;  1WCD J;  1PGW 1;  1WWY A;  2CGN A;  4IGQ A;  2DUO A;  4CUG A;  1J1T A;  5JR2 A;  1RUJ 2;  1ZM1 A;  3PU8 A;  4RQP C;  2Q8E A;  1H4G A;  4UWD A;  1W3X A;  3ZXD A;  4N43 A;  5FMD A;  3TBD A;  1ZRC A;  2ZTN A;  2QQV A;  1EUU A;  3NWK A;  4M4R A;  3V0A B;  1K42 A;  3J7M A;  4LBL A;  3KHB A;  2K2S A;  2XDV A;  1RUE 2;  3IPV B;  5IK5 A;  1OSG A;  5C3O A;  5DN2 A;  2D43 A;  4UOJ A;  1GNY A;  1S0D A;  3FC0 A;  2ZX4 A;  4JTN A;  2WKK A;  1YYN A;  4P14 A;  1UYY A;  5J1X A;  2P4E A;  1H4H A;  1RUH 2;  1NT0 A;  1OQ1 A;  4JX0 A;  4JRL A;  2XKP A;  3WG1 A;  3S30 A;  3OCP A;  1QMJ A;  2E7T A;  4KU7 A;  4OI4 A;  4R52 A;  5FKC A;  3VDD B;  3NKT A;  4CDW B;  2CDP A;  3LFM A;  4W6X A;  2VZQ A;  1B35 B;  3ZN4 A;  5CEH A;  1RUF 2;  4LUK A;  4X8P A;  1AVB A;  1NOV A;  1VBA 2;  5JOW A;  1US2 A;  4Z2W A;  1TNR A;  2FD8 A;  1K45 A;  2IXK A;  2RS1 3;  5FJK A;  5HXV A;  2EXJ A;  5IVV A;  3AP5 A;  1CPN A;  2PLV 1;  3S5Q A;  2R16 A;  4N7I A;  5FYV A;  3HOB A;  1RUD 1;  4CE8 A;  1FOD 2;  5ABJ C;  4LHS A;  3BOW A;  3FN9 A;  4AGG A;  1G9C A;  3PIJ A;  2EAK A;  3NJY A;  3ZOI A;  1W03 A;  1W6O A;  5IW0 A;  3ZKY A;  4GD4 A;  1Q8Q A;  3LOI A;  2QQI A;  3PUR A;  4XAA A;  2EAL A;  2AR6 A;  2QUO A;  2GME A;  2MNG A;  1V9U 2;  1XSQ A;  2IZW A;  3LA7 A;  3LPG A;  3TRS B;  1U12 A;  2VZU A;  3D0J A;  3ZFE B;  2VG9 A;  3AJY A;  1V9U 3;  3ZYJ B;  1FAT A;  1K5M A;  4RHV 1;  1D2Q A;  2AZ5 A;  1QXR A;  1KQR A;  2YBP A;  1ND3 C;  3DPR B;  4XYX A;  4C91 A;  2DFC A;  2QQO A;  4IES A;  4XUT A;  2WZR 3;  1W04 A;  2PEL A;  4WV8 A;  2HWC 1;  3U07 A;  1QJE A;  2AAC A;  5FZ4 A;  1IPS A;  2WN2 A;  2QE3 A;  4KBZ A;  1OF4 A;  2Y6J A;  2P3J A;  2QQL A;  1WCU A;  4GKX A;  1O5L A;  4CP1 A;  4ZKT B;  1BQP A;  3GDB A;  4O9G A;  1AXZ A;  4V1P A;  3USU A;  2CNA A;  3LCP A;  3WNL A;  3PVE A;  1GSL A;  3VHR A;  1JUI A;  1QY4 A;  3HJR A;  3MO4 A;  4BH9 A;  1RB8 G;  5F7U A;  3ASI A;  2VCC A;  2NM1 A;  3AFG A;  2W47 A;  1UU6 A;  3HIF A;  1CGP A;  4CEW B;  5F5I A;  4FP2 A;  2X5I A;  1WA6 X;  2IFW A;  1OFN A;  2R06 3;  3VN4 A;  2EIC A;  1G7Y A;  1SBE A;  2ZPX A;  4P02 B;  2YFU A;  1KDM A;  3OUI A;  4GB3 3;  1Q8P A;  3O14 A;  1B09 A;  1PX3 A;  2HWE 1;  4Q4V 1;  1HJF A;  1O7F A;  3RFR A;  2WRA A;  5AVA A;  1LOF A;  3WF1 A;  3DKW A;  1XC6 A;  1YFY A;  4YNI A;  5EZW A;  5AC9 1;  3JZV A;  5LRR A;  1PO2 1;  3L2Y A;  3IT8 A;  1PO1 2;  2YBS A;  5BXX A;  2C1F A;  4I3G A;  3AMH A;  3SC7 X;  1AL2 1;  2OZ6 A;  3GZA A;  4OZO A;  1TMF 1;  4HSJ A;  4ZZ8 A;  4QHB A;  4ZU5 A;  5IHR A;  5C71 A;  2WS9 2;  1IG3 A;  1Y43 B;  5L73 A;  3VL8 A;  3WG2 A;  2W52 A;  1H6X A;  2ZGL A;  2ATF A;  3RYP A;  2W1U A;  4BK5 A;  2CY6 A;  2VZS A;  4NPM A;  4YG0 A;  2B39 A;  1EPW A;  3WEZ A;  1DGR A;  1R08 2;  1ZRR A;  2J1A A;  3ZFG B;  3WDX A;  1DP0 A;  1LNS A;  3CJI A;  1PIV 1;  1ND2 A;  2JKX A;  2JDK A;  4LBQ A;  4RHV 3;  3PVO A;  2Z2S B;  3VBU C;  1XPW A;  1AR9 2;  1CPM A;  1AXK A;  3OBA A;  5SV8 A;  3RSJ A;  1ZZ6 A;  2VXR A;  4IEY A;  5A33 B;  2GC2 A;  1RUC 2;  5LAT A;  2YHJ A;  1CIY A;  3C2U A;  3E6C C;  3L2H A;  4E2S A;  5BNP B;  2WLP A;  3X29 B;  3THC A;  1FX5 A;  3LGR A;  2HBU A;  1ULC A;  1AHS A;  4V2V A;  2WA4 A;  3LEM A;  2GDF A;  3V56 A;  1IS3 A;  4Q4W 2;  1E5I A;  1GQG A;  1O3Q A;  1M4W A;  4IE4 A;  4PQ9 A;  2NPI A;  3VBF B;  2X5I B;  3THP A;  1JOD A;  2R7E B;  3SH4 A;  2GN3 A;  2G9F A;  1S1A A;  1TVG A;  1UL9 A;  4FI9 A;  2LM3 A;  4NWW A;  4XF4 A;  1RMU 3;  4YM3 A;  1I1E A;  4HG6 B;  1RUI 1;  3WNX A;  1I5Z A;  4E4S A;  2SLI A;  1ULO A;  2P2K A;  2Y6H A;  3PUQ A;  4QDQ A;  1WME A;  3D8C A;  2WFF 1;  3N9N A;  4A4A A;  1FI2 A;  1ZBA 3;  4BXF A;  3MZH A;  1CR7 A;  1NUK A;  5LB6 A;  3USU B;  4YPJ A;  4CPB D;  2DTW A;  1DQ1 A;  4E4Z A;  2V4V A;  3ZKU A;  4BCU A;  1N1Y A;  1S2E A;  4XDP A;  4JZR A;  5EYX A;  1VBE 3;  2D7F A;  2YZ4 A;  4XW3 A;  2UY8 A;  2C5D A;  1VBB 2;  1QJU 2;  3U10 A;  5ABJ A;  3BTZ A;  1OLQ A;  2NYY A;  3APB A;  3IB3 A;  4UW5 A;  4COW A;  2NZ9 A;  3VDB A;  3T4H B;  2VGD A;  5EIY B;  1LRH A;  2IFR A;  1XBF A;  2ADD A;  2OVU A;  3VLB B;  1K5M B;  5JXI A;  3DPR C;  4V2W A;  5K9Y A;  1WGP A;  1KRI A;  2X53 S;  3W5M A;  1JZ6 A;  3HBK A;  3ZXG A;  1W0N A;  1XNT A;  4IEO A;  5L9R A;  1EAH 1;  4DUX A;  5KR7 A;  5T3N A;  4LKE A;  1W6O B;  5FPZ A;  4ET7 A;  5A7S A;  3KVB A;  4YW6 A;  4YW3 A;  1Y3T A;  2FMY A;  4E8D A;  2CAV A;  4Z1V A;  1VMF A;  2JDM A;  3NNM A;  1VAV A;  1VBA 1;  1DQ0 A;  3AJZ A;  3TN9 3;  3RDI A;  3U11 A;  1RUI 3;  4B29 A;  1HIX A;  2JDU A;  5FUN A;  1FMD 1;  5BY5 A;  5LWB A;  3MF9 A;  1POV 3;  3HR9 A;  3KF5 A;  3LQC A;  5KHJ A;  1YLL A;  2IXI A;  1BJQ A;  2CWM A;  3CL1 A;  3DUI A;  2RMU 1;  1XYN A;  2VMG A;  4AHX A;  1DGW X;  2VMF A;  5CIR A;  1CX1 A;  5FP3 A;  5HCB A;  1ONA A;  1MS5 A;  1VB2 A;  2BVB A;  4XUQ A;  2QZ3 A;  4JTO A;  2XQX A;  4XJ9 A;  5DG2 A;  1ULP A;  3D82 A;  2HWF 1;  1ZZ9 A;  1DFQ A;  4LKF A;  4DY5 A;  3HNM A;  4IV3 B;  3O12 A;  4YGB A;  1UOG A;  4GWM A;  4C1W A;  2HLE A;  3A22 A;  1MEC 3;  4MGK E;  3IPV A;  2CYF A;  2EIB A;  2R1D A;  3J8F 3;  5CZK A;  1C8M 1;  5A3M A;  5BV6 A;  1LHU A;  4HN0 A;  4PDW A;  1RUN A;  2BTV C;  2VD7 A;  4YM0 A;  3DV8 A;  2R04 3;  2XUE A;  1M06 G;  4LIV A;  1RJ8 A;  4OQ8 A;  1H2M A;  3T09 A;  1AR6 1;  2WAB A;  3B00 A;  4Y5S A;  1V6I A;  2WNU B;  1DLL A;  5FZF A;  4AQT A;  5A3U A;  3H1W A;  1BHG A;  4RGA A;  5LW9 A;  1W0P A;  2XJR A;  3WNP A;  4TLF A;  5IVY A;  1ULD A;  4FPK A;  3VGI A;  3H1M A;  5H9R A;  3JD7 2;  4CDX B;  4WZC A;  2C9A A;  2XJV A;  1ZYB A;  4CCK A;  3N9O A;  2EXK A;  3B69 A;  4LBM A;  3N7J A;  4UAP A;  2JB8 A;  3FUO A;  1W2A X;  4KGG A;  2BGC A;  4M00 A;  1L7Q A;  2D6M A;  3E1F 1;  4MGZ E;  5FJH A;  2XVL A;  1XYO A;  3QBQ A;  2F4L A;  1LES A;  5F2W A;  5F3E A;  5DMY A;  5LZ6 A;  1OFS A;  2FBE A;  3H3U A;  4OVE A;  5A70 A;  4AVA A;  3HEI A;  3WV6 A;  5I8S A;  3EQE A;  5ACA 2;  5C4W B;  1H2N A;  4LTA A;  2VZ1 A;  5FZ1 A;  3MW3 A;  1UXX X;  1W6Q A;  4IEX A;  1KXG A;  4N8M A;  1NA1 C;  4GH4 A;  3S6P A;  5F3I A;  3NNF A;  5JCT A;  3MIG A;  5A3W A;  4RGK A;  1LHN A;  3J7N A;  4IEW A;  5JI9 A;  3IDB B;  4Q0V A;  1YIF A;  4I30 A;  4BB3 A;  2VZR A;  3C7F A;  3J4U H;  2PHR A;  3ZFE C;  3E6D A;  1QHD A;  4QQ2 A;  1RIR A;  1FMD 2;  3ZSJ A;  2Q8C A;  3EJK A;  2E7A A;  4IDZ A;  1ODN A;  2WNE A;  4TSV A;  4X8N A;  2D6N A;  4XFB A;  5DAW A;  5LRS A;  1XNA A;  2HWC 3;  5JUV A;  4AI2 A;  5FLJ A;  1G8W A;  2IC1 A;  1POQ A;  3O5S A;  5FZO A;  4G4F A;  1PZ7 A;  1BEV 1;  3OGG A;  1WLC A;  1YFW A;  2R07 1;  4AR2 A;  3H3Z A;  3KCX A;  3ES4 A;  2WAA A;  2OUJ A;  2XBO 1;  1W99 A;  3ZLI A;  1QWR A;  2YU2 A;  1LGN A;  3U1X A;  3OF1 A;  4IXL A;  5JPN B;  4NN0 A;  4QX0 A;  4NUB A;  3I2J A;  1SMV A;  1YXW A;  1MEC 1;  3K3O A;  2ADE A;  3ACF A;  5FZ6 A;  1V70 A;  3VBH A;  1ZBA 1;  3OTF A;  2BFU S;  1NCQ C;  4A2U A;  1H2L A;  3ZMN A;  4Q4W 1;  5SV5 A;  5F1R A;  3I2O A;  1DLC A;  2VMI A;  2WNU C;  1ASJ 1;  1GOH A;  3M3C A;  4WVM B;  3N36 A;  5DUV A;  3H3L A;  3G7D A;  3HT2 A;  2G4I A;  3PVB B;  1AJK A;  1S2B A;  1CAW B;  1NG0 A;  4JHT A;  4AAP A;  4CDU B;  4K1Z A;  2PMW B;  1OVS A;  5JIA A;  4XF0 A;  3W20 A;  4KNC A;  2J1V A;  4Y3O A;  4AFC A;  1OHF A;  1POV 1;  2FZ2 A;  5JOX A;  3WDT A;  3GHM A;  4ORF A;  3T1M A;  1JOP A;  1KGY A;  3AKQ A;  2JE7 A;  4BU2 A;  2WO7 A;  4YG6 A;  4KWJ A;  4AZZ A;  4JC1 A;  4AI1 A;  3CJX A;  3PNA A;  1PIV 3;  1HW5 A;  3HNB M;  5FZ0 A;  5GM0 A;  3I3M A;  2RM2 2;  4N53 A;  5CKN A;  1REE A;  3GZE A;  2VNG A;  3KZ4 C;  1CIW A;  5FZC A;  3RI8 A;  1V00 A;  1HXS 1;  4Q27 A;  1XRU A;  1PGL 1;  3NNL A;  4AI0 A;  2H0B A;  4JKK A;  4K8F A;  1QJU 3;  2W08 A;  3D4K A;  1AUY A;  2B9V A;  4MGI E;  4CU9 A;  2VCA A;  3RZM A;  4P9W A;  2RS5 3;  4IEU A;  4B3N A;  5DAQ A;  1QJY 1;  1TEI A;  4FQZ A;  5DG1 A;  1SBF A;  2Y0I A;  4H3W A;  1J58 A;  3KGZ A;  4AI3 A;  2P3I A;  4JKL A;  4QU2 A;  3B93 A;  5C9A B;  1R1Z A;  1VAK A;  5A3L A;  1GLH A;  4IW3 A;  5T5L A;  1QF3 A;  3AZZ A;  4AED B;  1H8T A;  5BNN C;  5FO8 B;  5A7Q A;  1RMU 2;  1S0G A;  3ETQ A;  3AXE A;  5KHG A;  3ACH A;  1PHM A;  2ZGT A;  4Q2F A;  5A32 B;  4EQV A;  3VD7 A;  3ENR A;  4FVV A;  4BA6 A;  4KI5 M;  1BEV 2;  3WSO A;  1JYN A;  4JGY B;  1S0B A;  5DAX A;  4XJA A;  4NMI A;  2Y26 A;  4CUC A;  2GSY A;  4WVZ A;  3RYR A;  3GGL A;  4E4D X;  3MV1 1;  1C5H A;  3DYO A;  4NRO A;  3VBS C;  4GZ9 A;  2VTX J;  4PIX A;  5BYN A;  2ZX3 A;  4M4P A;  4YVS A;  3S57 A;  1AR9 3;  3WXP A;  1QOS A;  1N3Q A;  5FRE A;  4CP9 B;  1ASJ 2;  1JOB A;  1JU3 A;  3WNN A;  3I54 A;  1H9P A;  3BPZ A;  5C7G A;  3HN3 A;  3OYW B;  1AF9 A;  2E9Q A;  1NA1 A;  4BLI A;  4CCJ A;  4AVC A;  1UIK A;  5GLW A;  1GNZ A;  4UBH A;  4BQ3 A;  4NJ4 A;  1LED A;  1LUL A;  1GFF 2;  3K77 A;  3PDQ A;  1UIJ A;  2NMO A;  4LK6 A;  1CZV A;  3CJI C;  2WS9 3;  3TAY A;  4FBF A;  1H30 A;  4ES8 A;  2DCZ A;  3OBR A;  5EP9 A;  1NLQ A;  2XWB B;  3FFZ A;  2GAL A;  1JYX A;  2KXL A;  3TEW A;  4DEV A;  5I8T A;  2HWD 2;  2GND A;  4U36 A;  5E16 A;  3W21 A;  4XIK A;  3O1M A;  2UWB A;  4PBO A;  3U4X A;  4D69 A;  3GM8 A;  1FYU A;  2E32 A;  2MPF A;  3WF4 A;  1RUD 3;  1VE0 A;  4IEQ A;  4M0H A;  4N9H A;  3DYM A;  2DWR A;  1B35 C;  3D3A A;  4LR4 A;  4TWT A;  1UN1 A;  2A1X A;  2WQ8 A;  3CQO A;  4MHR A;  5IVC A;  1RHI 2;  2JX9 A;  4XZP A;  3ZO0 B;  5JXJ A;  4HET A;  4AGV A;  3KV6 A;  1NXM A;  1OD3 A;  4ZZ5 A;  1SAC A;  1NZI A;  4TYS A;  1PGW 2;  2WO3 A;  3WF3 A;  2EAA A;  3K46 A;  3KT4 A;  5I8Y A;  3EXU A;  3LD8 A;  4NPR A;  2DV9 A;  3AP9 A;  5DDJ 2;  4YGD A;  2DYC A;  4HZF A;  4NOT A;  1OD5 A;  3BOD A;  4W6Y A;  3CBN A;  1FXZ A;  2RS5 1;  3PUA A;  2ILM A;  2XL7 A;  1AYN 2;  4UXA A;  4JCK A;  5CAD A;  4R8H A;  1N47 A;  3PUH A;  4I09 A;  2ARA A;  5FOJ B;  3AYE A;  2Z69 A;  4XJU A;  3V0B B;  4DEQ A;  5CIS A;  4PLN A;  4C1X A;  5IYY A;  2PA7 A;  4BM8 A;  4BQ2 A;  1ND3 B;  1JBC A;  4D0Q A;  5FY9 A;  1LEN A;  1O6U A;  2OUH A;  2GZW A;  2GNT A;  2R1B A;  5FZO B;  3RS6 A;  4LO6 B;  2YC2 A;  5GLV A;  1QKQ A;  4LKS A;  4QM9 A;  3SMH A;  5T50 A;  2A3Y A;  3T30 A;  2AGS A;  1D0H A;  4I2O A;  4E9K A;  1FNY A;  4OUS A;  2ZEZ A;  3VZN A;  1COV 3;  1HV1 A;  2AYH A;  1ACC A;  2WWS A;  2VVF A;  3FHQ A;  5C6C A;  1H1I A;  2FZ1 A;  1DIW A;  1UX7 A;  2FDK A;  2JDN A;  4RA0 A;  5A1L A;  4NRP A;  2ZGK A;  1WBF A;  2D98 A;  1JS9 A;  4UF0 B;  3UGG A;  1C4R A;  4DQA A;  4LMF A;  3ZFF A;  2JDA A;  4R9D A;  5FP7 A;  2YG0 A;  4EYU A;  4KL1 A;  5EJ1 B;  2WSV A;  4AGR A;  3DKQ A;  1UMI A;  1Q8O A;  2NN8 A;  4GAL A;  1RUH 3;  4CUB A;  1PVC 2;  4COU A;  3PJY A;  3E97 A;  2ZCW A;  2A3W A;  3KV9 A;  3VKF C;  2E31 A;  4EN6 B;  3O1U A;  1RUD 2;  3JBG 1;  2D44 A;  3LEK A;  1TG7 A;  3M3I A;  2WYF A;  2XJT A;  1QJF A;  3WR0 A;  4YZ3 A;  4ASM B;  5FXX A;  2JDZ A;  4TXW A;  2WZE A;  5JXH A;  5H9S A;  2ZXQ A;  5T5J A;  3ECQ A;  1W6M B;  3WQ7 A;  3B94 A;  4UFM A;  4BJ0 A;  3AL5 A;  4R9B A;  5CAZ A;  2A75 A;  4Y1Z A;  2CDO A;  2BBA A;  2WNV A;  1QJZ A;  1GZT A;  4CUA A;  4L11 A;  2J22 A;  3MYX A;  4HOO A;  3BUC A;  2WNU A;  2ZMN A;  2FHR A;  1DZR A;  5LK5 A;  4AED C;  5BNN B;  2BGO A;  2PQQ A;  1GUI A;  1H0B A;  1QJU 1;  2JG8 A;  2W5F A;  4YGC A;  1NQD A;  4OI2 A;  2FDH A;  3KQR A;  4PDW B;  4GKY A;  2HEW F;  5D8A A;  2PTM A;  3HPN A;  3TEZ A;  2D5F A;  2Y64 A;  1W8H A;  4KU8 A;  5FQ0 B;  2VUL A;  1Z0H A;  2JD4 A;  3DYP A;  3SIT A;  1AX1 A;  2A70 A;  1IKP A;  5C4W C;  1MS1 A;  5AC9 3;  4IV3 A;  1SG3 A;  5BNP C;  4XJW A;  5JLV A;  3RMX A;  3CF6 E;  2TUN A;  5CBL A;  3ZXL A;  4XZU G;  2RJK A;  1DYP A;  4Y20 B;  1XOY A;  1RL3 A;  2NP0 A;  1V6O A;  4FP3 A;  4TTG A;  4Z82 A;  2DBI A;  3IMM A;  4YVW B;  3HQU A;  4I0W B;  4KG8 A;  3TNQ A;  3RZH A;  3J26 N;  3ON7 A;  4KWU A;  1I3H A;  3TEX A;  5IAX A;  5F5Q A;  4YRD A;  2HWD 3;  2WO2 A;  4MH0 E;  3BIE A;  1BEV 3;  2UY9 A;  1XND A;  1NCQ B;  1RUE 1;  1ZA7 A;  1REF A;  3M4F A;  2ZA9 A;  5I0S A;  2RS1 1;  1RVF 1;  1SPP A;  3PMS A;  5A6Z A;  3LF7 A;  1GQH A;  1GV9 A;  5GLZ A;  1E5H A;  2X10 A;  4BIS A;  2E51 A;  4XC9 A;  2XGX A;  3THT A;  4O61 A;  1HKD A;  1PO1 1;  2WZP P;  4CDU C;  3VHN A;  1JUH A;  4Y22 B;  2MEV 2;  2OT7 A;  5A7N A;  3T2T A;  1HB1 A;  2OS2 A;  3I4I A;  1KS5 A;  5EQU A;  3ZFF C;  4BIF A;  5KC6 A;  1PVC 1;  1XNC A;  2WS9 1;  2Y38 A;  3BCW A;  1RUF 1;  1BLZ A;  2VH9 A;  2Z5W A;  3E6B A;  4H2A A;  1R64 A;  4JDO A;  2OYZ A;  3ZSK A;  4CXY A;  2R07 3;  4HKW A;  1XU1 A;  3S7E A;  1HRV 1;  3OUJ A;  1R08 1;  5FPL A;  1ODM A;  5FYB A;  5FXV A;  2VZT A;  1WW6 A;  1OQD A;  4HLT A;  1JU4 A;  1U5Y A;  4PCR A;  4QX1 A;  5FY5 A;  4AQS A;  2B46 X;  4QXH A;  2BGP A;  5FY0 A;  2ZGQ A;  4KGQ A;  3LDR A;  4Y20 A;  2VOK A;  3ABZ A;  3CIH A;  1JMU B;  2JEM A;  3ZXJ A;  3OOX A;  5GZF A;  3WG3 A;  4A3X A;  2D6K A;  5A3P A;  4D8M A;  2VM9 A;  3KQ4 B;  4LIU A;  4DY3 A;  3WQ1 A;  4GAZ A;  4WM8 C;  3DF0 A;  3OSD A;  1W6P B;  3ZR6 A;  2K9Z A;  1QH6 A;  2RS3 2;  3BU0 A;  5FQ0 A;  1SDD B;  2GAU A;  4MX3 A;  3IDC B;  1GWL A;  4IER A;  3MI8 A;  3SH3 A;  2DVF A;  2QQJ A;  3WVJ A;  3WNK A;  5IWF A;  4LO8 A;  2PQS A;  3Q9O A;  1AR6 3;  4L92 A;  1OOP B;  3CZJ A;  1ZBE 3;  2Y6F A;  4DNY A;  4FPO B;  1ULF A;  3U37 A;  3UNP A;  2WFF 2;  4DXT A;  3I3B A;  4XDQ A;  4XEZ A;  2ZX1 A;  3CLP A;  3MW2 A;  3S0M A;  2JB4 A;  5JZG B;  4JDM A;  2VNO A;  5FZ7 A;  4LBQ B;  2QQM A;  3NAP A;  3FLP A;  4Y5T A;  4Q1R A;  3CJI B;  3QH6 A;  1ENQ A;  3ZYR A;  4AVB A;  5KHK A;  3OD4 A;  5FZL A;  3JB4 C;  1Q5O A;  1S55 A;  2FDJ A;  2VVD A;  3KV4 A;  4H7L A;  1C57 A;  1IQD C;  4LPL A;  2D3R A;  3POB A;  3RQ0 A;  5CG8 A;  2GMP A;  3K4Z A;  1DG6 A;  2BDR A;  1QU0 A;  2W92 A;  2WT2 A;  3W9A A;  3N9Q A;  1U5Z A;  1ZZ8 A;  3N7K A;  4RFR B;  4BOW A;  2W3J A;  4K3U A;  3ACI A;  4XAE A;  4YGE A;  5J37 A;  4MHU A;  3K3N A;  3BAL A;  1JOJ A;  2K46 A;  5DAP A;  3ZFF B;  1XXN A;  4PT6 A;  3VBF C;  3WUC A;  2O0O A;  5LBC A;  1UY3 A;  1STM A;  4FPY A;  2H0V A;  4XJ8 A;  1W9W A;  3H42 B;  3I2F A;  5CFD B;  3N3H A;  1NLR A;  2VNR A;  4L8Q A;  5GLU A;  4IGO A;  1QNW A;  3W59 A;  1MS8 A;  2HH9 A;  1S2K A;  2EA7 A;  4HXC A;  4BQ1 A;  2DVD A;  4C0B A;  2Y8K A;  4LT5 A;  5ACA 3;  3BYW A;  2W1W A;  4DZG A;  3MFA A;  5FDB A;  4OLL A;  4P9G A;  2D5H A;  4J1X A;  3UES A;  2ZKL A;  2PAM A;  3OEB A;  2B7Y A;  4IEV A;  4XDO A;  5EV7 A;  2ETE A;  2O8O A;  1BXH A;  4QPG A;  1EPZ A;  1VLN A;  2BWA A;  3E5U A;  5JMO A;  1YFU A;  4NVP A;  4YYO A;  5FMO L;  1OKO A;  2ZGU A;  2BVV A;  3FE5 A;  3UJQ A;  3T4V A;  2ES3 A;  1UOJ A;  1H8V A;  4AAX A;  3LA3 A;  5F6K A;  1I9R A;  3BGA A;  4CEY A;  4CU6 A;  5F3C A;  5HV4 A;  1UAI A;  1GZW A;  1CAX B;  2ZAA A;  1CON A;  5DUW A;  3A23 A;  1V6K A;  1JYV A;  1XSR A;  2VZO A;  2A6V A;  4LBQ D;  3ACG A;  1NAE A;  4R4Z A;  5FPA A;  1XU2 A;  3SIS A;  3C7H A;  4WM7 A;  2ARE A;  2P5B A;  1TQ5 A;  4RQP A;  5JDB A;  5KBF A;  4NIH A;  2GC0 A;  2LRO A;  2BNO A;  3J8F 2;  1CAU B;  2OPK A;  1SEF A;  3VBO A;  3AP6 A;  4LBN A;  4Z07 A;  3ZIW A;  4M0N A;  1PGL 2;  1WLD A;  5KHH A;  2HKX A;  4XQD A;  4M01 A;  1XNB A;  5IFP A;  3VBO C;  1HLC A;  3M7A A;  4QHZ A;  4E2G A;  4CCO A;  2Z79 A;  1OUR A;  3B3Q E;  3BOP A;  4K7J A;  4BDV B;  4HT1 T;  1XE7 A;  5JWP A;  5L7O A;  1IS5 A;  1MAC A;  3UET A;  2D6P A;  2WAO A;  5C5T A;  4F3J A;  4R9C A;  1U5X A;  3ELN A;  3ILR A;  3ZPY A;  3MIC A;  1PM4 A;  4AW7 A;  4BWO A;  4XAC A;  4CCL A;  3MFC A;  5F2S A;  2DUR A;  3RJ2 X;  2RE9 A;  3NJV A;  2CWS A;  3H7Y A;  3P5B A;  4YW7 A;  1UPS A;  5FPV A;  3HMY A;  4I02 A;  5C3R A;  4CVU A;  5C8W A;  5IVF A;  2A6Z A;  4IE5 A;  4LHN A;  1RVF 2;  2P3Y A;  4JGY C;  3AKP A;  2O8Q A;  4S2G A;  3TN9 2;  1L7R A;  3AL6 A;  4PLO A;  4MGT A;  4OZX A;  5FZ8 A;  5FZH A;  1D4M 1;  3Q8E A;  4PHZ A;  1JXN A;  4Q8K A;  3OGJ A;  5K0U B;  2WT1 A;  1QJY 3;  2JE8 A;  5F39 A;  1UX6 A;  4ZU4 A;  1RGS A;  1UOB A;  2WZR 1;  4N7U A;  1Y9M A;  2ZHK A;  3WY6 A;  4NII A;  2FDF A;  2X5I C;  2JWP A;  3WX5 A;  3QD6 A;  1NA1 B;  3FL7 A;  1JI6 A;  5A3O A;  2P37 A;  2WDB A;  2G1M A;  3KCY A;  4JAA A;  4RR3 C;  3H0O A;  2DF7 A;  5FP9 A;  4I0B A;  1HRV 2;  4CP9 A;  5DZG A;  1G9D A;  4PBP A;  1A8M A;  1Q3E A;  4XUP A;  1G86 A;  1C8M 3;  4QGN A;  4ARX A;  3H1Y A;  5EWS A;  4YVS B;  1YI9 A;  3S7I A;  3ZYI B;  1SDW A;  2Q1F A;  1EV1 2;  2WFF 3;  4GMP 3;  4FXG B;  4LOT A;  4CCE A;  3R4D B;  3ZFG C;  1RUH 1;  2ET7 A;  3M8L A;  5L7O C;  4D7S A;  2XQR A;  1KD7 A;  5GLT A;  1WW7 A;  1W9Y A;  3ME2 A;  3E5X A;  3U75 A;  4LE3 A;  2PLV 3;  4QHO A;  5JSP A;  1ZBA 2;  5GZE A;  4CDX C;  1L3J A;  5EPA A;  1W0O A;  1VBC 3;  4AHW A;  3M1H A;  4AVS A;  4CDW C;  1AXY A;  2RS3 3;  3HN1 A;  3VHO A;  5A32 A;  5A1A A;  4KQ7 A;  3O0W A;  3IDE A;  5A3T A;  5T55 A;  1VB4 A;  3WIN E;  4ASL A;  4Y1V A;  4XTM A;  5C9A A;  4LQR A;  3POJ A;  3AZW A;  1MQT A;  4GMP 0;  4RS5 C;  1S0J A;  3ACL A;  3NV4 A;  4IEZ A;  5JR7 B;  1GKB A;  3C8X A;  2RDQ A;  2ZGS A;  4LXL A;  4Q4W 3;  2R06 1;  1UPI A;  1IHM A;  3EBR A;  4LIT A;  2D3S A;  5D2A A;  4ATF A;  1LHW A;  2VW0 A;  5ERL A;  3ROU A;  3PVN A;  1WUV A;  3AMQ A;  4P9L A;  4MXW B;  4YZ4 A;  5DXD A;  3I2D A;  3JBG 3;  5C8C C;  4OHY A;  2W0X A;  4W4Z A;  4LA2 A;  2CHH A;  3HT1 A;  4RHV 2;  1DF0 A;  2BU9 A;  3RGB A;  4BIO A;  1ZRD A;  2IXL A;  5J96 B;  3ZYF A;  2XJS A;  4KG0 A;  4F83 A;  4QM8 A;  3UGH A;  1YEW A;  1BBT 1;  4JGZ A;  3RZJ A;  5ACA 1;  2UUR A;  2XUM A;  1RUG 1;  4D3W A;  5FBJ A;  4LBO A;  2EXH A;  4YVS C;  5LA9 A;  3WP6 A;  2OQ6 A;  2RMU 3;  3EHK A;  1BMV 2;  4ZU7 A;  3WOG A;  4FTS A;  1J3R A;  4QKN A;  1GYK A;  2W91 A;  1YC6 1;  1UZZ A;  2UYB A;  4I3P A;  2RDS A;  3RG0 A;  4YFZ A;  5FPX A;  5HCA A;  4MUV A;  2E33 A;  4QXB A;  2JD9 A;  4DRR A;  4YZ5 A;  1NCR A;  1UYX A;  1VRH 2;  1APN A;  3AKR A;  3SXW A;  4RL7 A;  2VZV A;  1X9T A;  1O4T A;  4QX7 A;  4PIY A;  1OQE A;  3ZMO A;  4PQQ A;  1RUC 3;  3TYJ A;  4NWV A;  1H6Y A;  1WW5 A;  5K7P A;  4QPI B;  4DXZ A;  1TZO A;  2RDR A;  1WCS A;  1ZVF A;  1NX9 A;  2BP6 A;  5FYT A;  1HJG A;  2XBO 2;  1S0C A;  1XE8 A;  2V72 A;  5AC9 2;  3SLI A;  3JQW A;  1F4A A;  5LBF A;  4JQR A;  1Y9G A;  4QX8 A;  3FHA A;  5FMB A;  3ZYB A;  3NKG A;  5LY1 A;  3KB5 A;  3P1I A;  1FT9 A;  5HBA A;  4FCA A;  1JZ3 A;  3O1V A;  1QJX 3;  5FUI A;  2Y0O A;  4MG2 A;  3LFI A;  3OPZ A;  1ZBE 1;  3FZ3 A;  5CFC A;  3VBS A;  4JHZ A;  2RG4 A;  3WDV A;  1FNZ A;  5FYS A;  2CV6 A;  1PO1 3;  1J3Q A;  5A6Q A;  5IK4 A;  1JYT A;  1FOD 1;  5LK7 B;  4NR1 A;  3DEM A;  1US3 A;  3AYD A;  3W5N A;  1S0I A;  4RS5 A;  2OPW A;  1PNG A;  1F2N A;  3CNA A;  4OYU A;  4XHX A;  2YXS A;  4URA A;  2G9Z A;  2HWF 3;  4XQW A;  5FZK A;  2E53 A;  1W6Q B;  2KR2 A;  3ILF A;  5FZB A;  4L99 A;  4Q4X 3;  5C4W A;  4XIL A;  1WLT A;  2FCU A;  4MVT A;  2W94 A;  1MQT B;  3PTY A;  3R4U A;  4PI0 A;  1UO9 A;  4Q8L A;  4E2Q A;  5GKA C;  4PF1 A;  4BE3 A;  2E63 A;  1VBE 1;  5LEJ A;  3FLR A;  2F17 A;  1XE0 A;  5DZF A;  3J7L A;  1BBT 2;  1K12 A;  1VBD 2;  3WDY A;  1NE6 A;  4YG3 A;  5DDJ 3;  2WQ4 A;  5A6Y A;  1OT5 A;  3KT7 A;  3KLS A;  4TN7 A;  2X29 A;  1V6M A;  4NID A;  3U4S A;  2GNB A;  2VMH A;  4D6R A;  1HQN A;  3LZZ A;  1F9K A;  4IEP A;  2Z42 A;  1D4M 2;  3K48 A;  2VOW A;  3KD4 A;  3NO8 A;  2D6O X;  3I7D A;  4LOR A;  1BBT 3;  3ZSL A;  5E8A A;  4N53 C;  4WBB A;  4OI0 A;  1COV 2;  1DHK B;  4AEM A;  1W8W A;  4XFF A;  4MYE A;  2DCK A;  5FP8 A;  4L97 A;  4RR3 B;  4OQ9 A;  4L2N A;  1Z7S 3;  1AR8 3;  3GNE A;  3NV3 A;  1Z7S 1;  4S2D A;  2WIN B;  5IVE A;  1ZZ7 A;  1W2T A;  3ZPO A;  2WII B;  4XTP A;  1LEM A;  5F6L B;  2XG3 A;  3C3V A;  4ES9 A;  1FPN 1;  4OUL A;  3NW4 A;  3KM5 A;  2ET1 A;  2HEV F;  4NIA A;  3ZN5 A;  1OI6 A;  4HPK B;  4J1W A;  4QDR A;  5FMO S;  1N3O A;  2VNV A;  1SHW B;  5FO7 B;  4OMD A;  3I59 A;  1POV 0;  5EFU A;  5K0U A;  4BMB A;  1KS4 A;  5IFT A;  1O4Z A;  2PHT A;  2OA2 A;  5IK8 A;  3UV9 A;  3LWC A;  1JZ8 A;  3I3D A;  3WHT A;  5J48 A;  3L9J T;  2GC3 A;  1PZ9 A;  3I2H A;  1I5P A;  2QQP A;  3C7E A;  1HQW A;  1UD1 A;  3MIF A;  1HN0 A;  4ISR A;  2QKD A;  1OMI A;  3QH7 A;  4UFK A;  4P9X A;  1LAJ A;  5FYI A;  2BQP A;  4B4P A;  1UYZ A;  2BRT A;  3LB9 A;  2GP3 A;  4ZS2 A;  3K75 B;  4YW5 A;  3URF A;  4D7T A;  4ZHN A;  2HWB 3;  4Q5O A;  5L7O B;  1W06 A;  4UYB A;  4AL9 A;  1DU3 D;  1JYC A;  1DGR N;  1YO8 A;  2JG9 B;  1QGL A;  4CCC A;  3K51 A;  1PVX A;  5CKQ A;  1HXS 3;  5DPN A;  5KXB A;  5D1I A;  4CCM A;  3MID A;  2WNV C;  1K3I A;  2SBA A;  4MV2 A;  5FY7 A;  2ORX A;  5G04 L;  4BK4 A;  1OLM A;  2ZHL A;  1G9B A;  5EJ3 A;  4CSW A;  2PXJ A;  2WJS A;  4WM8 B;  2ZEW A;  2JDP A;  1PK6 B;  4QPY A;  4CA9 A;  1SLT A;  4NHK A;  3JUU A;  3SQO A;  4IUG A;  1E57 A;  4JKM A;  4EWD A;  1OVP A;  4FAH A;  5ABJ B;  4IE6 A;  3WNM A;  2ZEY A;  1LU2 A;  3P3P A;  1CAX A;  1GZW B;  1LOA A;  2AH2 A;  5E88 A;  2I45 A;  3VZL A;  3V64 A;  1MPX A;  1EP0 A;  1GU3 A;  1WZX A;  1GZC A;  2R0H A;  3LA2 A;  2ID4 A;  3NRU A;  1WW4 A;  3LIH A;  1CES A;  2VC9 A;  2PHL A;  3QLQ A;  4QPG B;  2Q4S A;  3TEY A;  5JSR A;  4AVT A;  2XVK A;  1UXZ A;  2XVG A;  2YPJ A;  4QQL A;  5FMC A;  4CCN A;  2ZEX A;  2UWC A;  4HBN A;  3GYD A;  5GAL A;  3MUZ 1;  4H14 A;  3PJQ A;  2Y6K A;  2YMZ A;  3RYK A;  3VBF A;  4MGY E;  3KSC A;  4YFW A;  1AL0 G;  5E89 A;  2O14 A;  4N9I A;  3ZXE A;  1R1A 1;  2LAL A;  2VZP A;  3WW2 A;  1CZS A;  1VAM A;  4WZF A;  5G05 L;  2V4A A;  5FO9 B;  2V73 A;  5TSW A;  5JSO A;  1NYW A;  4URT A;  4AEJ A;  5JPM B;  5CFD A;  1AR8 2;  2XXZ A;  4E4H A;  5CG9 A;  4KWK A;  1IQA A;  3HQR A;  1NE4 A;  2QQW A;  5HXM A;  4DUW A;  3CKH A;  3HD8 B;  5BNO B;  3KV5 A;  3ALQ A;  3BTX A;  4FT8 A;  2O1Q A;  3F95 A;  2Q8O A;  1LJ7 A;  1HV0 A;  4EN7 B;  5HI0 A;  1LEC A;  4YM2 A;  2EF6 A;  3TOJ A;  3I49 A;  1SLA A;  3U14 A;  3BVC A;  3ZFG A;  1GAN A;  1OLR A;  2A71 A;  5H9P A;  3S5A A;  1CX4 A;  1E5S A;  4BQW A;  3WW4 A;  2QVS B;  3N9L A;  4ITC A;  3RMY A;  1Q43 A;  2GMM A;  2NMN A;  3IMN A;  1MZ5 A;  2XH6 A;  2PLV 2;  5FPB A;  1DYK A;  1G9F A;  3U78 A;  2ZJC A;  4Y26 A;  1GQP A;  5I91 A;  3INA A;  1VBD 3;  4AFD A;  4CZS A;  2EID A;  1QJX 1;  1D4V B;  1X9P A;  2P6C A;  2A6Y A;  5K4L A;  4HKL A;  4XFI A;  2BZD A;  1EV1 3;  5I0D A;  4XF1 A;  3O0V A;  1X50 A;  1HB3 A;  5JMC A;  4NE9 A;  5JZG A;  1OH3 A;  1MS0 A;  1CN1 A;  1CD3 G;  1OOP C;  4HVR A;  2BPA 2;  4DOU A;  1IS4 A;  1WCQ A;  2K0G A;  2FQP A;  2RM2 3;  5BNO C;  1ST8 A;  3VDA A;  2HWF 2;  2ZZQ A;  2CGO A;  3DN7 A;  5FXZ A;  3RZK A;  3MIE A;  3IZO A;  3AZV A;  3VB9 A;  4G9S B;  4I01 A;  2WYS A;  1YQ5 A;  4LHK A;  4NHM A;  4G3Y C;  1WCK A;  4CCD A;  1V6L A;  2J1U A;  3J7H A;  4Q4X 1;  1K5M C;  2N7G A;  2HWC 2;  3NL1 A;  3RI9 A;  1CZT A;  3RVH A;  1QOO A;  4BPZ A;  3N7M A;  5IVJ A;  2Y60 A;  3Q8F A;  1DZQ A;  4MGQ A;  4GUL A;  4QX5 A;  2OW4 A;  4A6S A;  5CFD C;  1NQJ A;  1SFY A;  5LY2 A;  3T3Y A;  2X09 A;  3VHP A;  2PN5 A;  3SEE A;  1W8U A;  1ZA4 A;  2G19 A;  3PU3 A;  1HB2 A;  4GWJ A;  4HK8 A;  1IS6 A;  1QDC A;  1J83 A;  4P5Y A;  5FV3 A;  5FXW A;  3SKV A;  3O1O A;  3ES1 A;  5KXD A;  5FY4 A;  5B4X A;  1PM7 A;  4TZD A;  1LOC A;  2A5Z A;  1ZNP A;  3RWN A;  4ZON A;  1PX4 A;  3JD7 1;  1OC1 A;  2C4X A;  5L19 A;  1ND2 C;  4J25 A;  5HCF A;  4LUL A;  3VDD C;  4C90 A;  4RN5 A;  3SH5 A;  1AZD A;  1VAL A;  4S2H A;  1N1T A;  5F3G A;  1W9S A;  2ZGP A;  5LAS A;  4IE0 A;  2ZMK A;  1RIN A;  5APA A;  4NAM A;  1PK6 A;  1DQ2 A;  2TNF A;  2VBB A;  3FFQ A;  4BQY A;  5KWR A;  2Q8D A;  1BKZ A;  5CA6 A;  4WM8 A;  4D7Y A;  4EJR A;  1A6C A;  2JIJ A;  2QQK A;  1D0G A;  1DCS A;  2XKO A;  3OGV A;  1AR8 1;  3WDU A;  5CYY A;  1NLS A;  1VPH A;  4OFG A;  3U0Z A;  1A8D A;  4QWN A;  2W1S A;  3POI A;  5JVV A;  1PO2 2;  1P8J A;  1MZ6 A;  2VE1 A;  3MLK A;  2JG9 A;  1JTZ X;  1YQ2 A;  1LGC A;  2ZAC A;  1W9T A;  4LE4 A;  4NHY A;  2LS6 A;  2WC2 A;  3WF0 A;  3MW4 A;  1LOF C;  1FMD 3;  1WD4 A;  3NMB A;  1SPP B;  2BWC A;  3WHU A;  1S0F A;  1G9A A;  2CGP A;  3ATG A;  3HVD A;  4LLF A;  1OXC A;  1GP5 A;  1NCQ A;  2XJU A;  3VZM A;  2VOV A;  4A42 A;  5LEK A;  3SCH A;  1GOF A;  1ULG A;  1LOE A;  1T6B X;  4QKB A;  4UFH A;  4AHY A;  2YUE A;  3VZK A;  3HNY M;  3BPS A;  1VBC 1;  3VDD A;  1SFP A;  4ZXK A;  4CDW A;  1AR9 1;  1YFX A;  4P9Y A;  4AXO A;  2BFU L;  4A7Z A;  3I59 B;  1YNA A;  4YW4 A;  1BYH A;  4DXS A;  4JGZ C;  5GJ6 A;  2VCM A;  2EXI A;  3MGU A;  1SLB A;  1UKR A;  2BJS A;  2OZJ A;  4JRA A;  3WCS A;  3DXU A;  4P9J A;  4FPE A;  3III A;  3M70 A;  1QQP 3;  2TEP A;  4RSU A;  4XQ4 A;  5CVR A;  1Z78 A;  2WO1 A;  1Q8V A;  2RV9 A;  1GNH A;  1WD3 A;  1TE1 B;  4H55 A;  4HSL A;  4DFS A;  2YFZ A;  4N43 B;  1MVQ A;  1O4Y A;  5A7O A;  3ILN A;  3O1S A;  1AYM 1;  2B5H A;  1UW8 A;  2YRO A;  3NVC A;  1RUI 2;  4RR3 A;  1ZZB A;  2Q30 A;  3VBR B;  1UY2 A;  5KHI A;  1IGO A;  1C28 A;  1YWK A;  3A0K A;  3LSE A;  4XF9 A;  1H9W A;  3NJX A;  5FK8 A;  4YW2 A;  5FIX A;  1YJK A;  2EVX A;  2VW2 A;  1CWP A;  4FPH A;  5FZD A;  1WBL A;  3OGS A;  5FWJ A;  3H9A A;  2R04 2;  5FY1 A;  4CTE A;  4EWA A;  2B9U A;  2BEO A;  3HBZ A;  1YUD A;  2XB6 C;  4IV3 C;  5JZG C;  1Y4W A;  3AYA A;  3AXD A;  2RS3 1;  4QQP A;  4XUR A;  2HWD 1;  1W90 A;  1DDL A;  3Q8C A;  5IVB A;  5D8A C;  5FYZ A;  2ZAH A;  1LGB A;  1XQN A;  3KHC A;  4K8R B;  2JDH A;  3N9M A;  3VD4 A;  3ORJ A;  3K4D A;  4XMI A;  4AG4 A;  2JEN A;  2RM2 1;  2W2I A;  4Q0Q A;  3OUH A;  3UKV A;  5JIU A;  5FTT C;  2DDU A;  2PFW A;  3O1R A;  4Q29 A;  3AP4 A;  4GMP 1;  2PHW A;  1SLI A;  3M3O A;  3NQH A;  1UZV A;  4B7K A;  2Z4F A;  5JXG A;  1QNY A;  4KMQ A;  3VZJ A;  1CQ9 A;  2IWG B;  3I97 A;  3PUS A;  4GA9 A;  4IL7 A;  2BER A;  2F4P A;  5LA1 A;  2HYX A;  3ZX7 A;  3IKW A;  1QJY 2;  3Q8B A;  4QX2 A;  3I8T A;  4JQT A;  2P1B A;  4PDW C;  1GIC A;  4P08 A;  4XXP A;  3VBS B;  3UKT A;  4DPN A;  5BUV A;  1OKQ A;  2OX0 A;  1RTV A;  4GJY A;  4A45 A;  4EWE A;  3NAP C;  2WR9 A;  1RXG A;  3AX4 A;  4LO4 B;  2BOJ A;  5F37 A;  1AYN 1;  5J7M A;  1J3P A;  4B7E A;  2I74 A;  1FV2 A;  2F6B A;  1SLC A;  1YJL A;  1QQP 2;  1UKG A;  3KWV A;  5I0U A;  3FX3 A;  3ZN6 A;  3LOB A;  3V0B A;  2V5D A;  1JZ4 A;  2DU1 A;  2WFP A;  4XFA A;  4QGM A;  1J1L A;  5CNA A;  4B4Q A;  4DB5 A;  2R0F A;  3HWJ A;  1R09 3;  1ZRF A;  5LA2 A;  1X8E A;  4YLZ A;  3VD9 A;  4ATE A;  4OHV A;  4IV1 A;  2HWB 1;  2VMC A;  3VBR C;  5ISL A;  3WP5 A;  4LK7 A;  2FDI A;  3CEW A;  4UI9 L;  5FRA A;  4CU8 A;  3QAC A;  1V6J A;  4COZ A;  3OPW A;  5AFB A;  2R49 A;  3SCG A;  3WF2 A;  1MS9 A;  3ZSM A;  1KDK A;  5KXC A;  4HAN A;  3CDZ B;  1F5J A;  2BOI A;  3GZU C;  4L0P A;  2W87 A;  3NNJ A;  1CAV A;  4FAG A;  3MUY 1;  1LTE A;  2UYA A;  4BQ4 A;  5DQ0 A;  2KA3 A;  1WMF A;  2VQA A;  1O59 A;  3LDK A;  2RR1 2;  4HON A;  1H1M A;  5F32 A;  3O1P A;  3CMG A;  3DCQ A;  4XIO A;  4FQ4 A;  2WBK A;  1URX A;  1JHJ A;  1QXJ A;  1AR7 3;  2QCS B;  2WUH A;  3POS A;  1J84 A;  4JGZ B;  1MQT C;  2J7M A;  2YGL A;  4K40 A;  5AFE A;  1O8P A;  1W8F A;  4BLJ A;  2C26 A;  5FYM A;  4ZS3 A;  3O1T A;  4ZPI A;  3O7O A;  4CDQ C;  1QIQ A;  2C0Z A;  2DUQ A;  4XFG A;  5GZD A;  3R4S A;  4CEY C;  5C70 A;  3RPQ A;  1EAH 3;  2GC1 A;  3THD A;  1H1A A;  1LOD A;  1VBD 1;  4BME A;  1X7N A;  2R06 2;  2XOM A;  3USS A;  5JAX A;  4B4R A;  1KJR A;  1V0A A;  4MXW A;  2AUY A;  1OBN A;  1VMH A;  2JXA A;  4UW6 A;  4YVW C;  5FZ3 A;  2ZX2 A;  1KEX A;  3OGR A;  5ANQ A;  3CZU A;  5LA0 A;  4AVV A;  2ZOE B;  3HQX A;  1BK1 A;  2PHX A;  2RJL A;  3LPF A;  5EJZ B;  1F15 A;  4EZ4 A;  4MLO A;  4FXK B;  1SQ4 A;  5K0U C;  3N4M A;  2VPV A;  2XWJ B;  4CU7 A;  1UF2 C;  5C8C A;  4Q1P A;  4OMC A;  3P6B A;  4QKD A;  3PUI A;  1AX0 A;  1UWW A;  4GJZ A;  3H8O A;  1DZT A;  5J09 A;  4FPJ A;  5FZG A;  3JCI A;  4CP2 A;  3OYW A;  1OH4 A;  5C3P A;  5I93 A;  2YC4 A;  4O7X A;  5DDJ 1;  2ZZJ A;  2XHK A;  4E8C A;  3V65 A;  5C33 A;  2CU5 A;  1MS3 A;  2YBK A;  4FPG A;  4DUV A;  2VO5 A;  1OA4 A;  3TN9 1;  4QPI C;  4Q26 A;  4FO9 A;  4NRQ A;  2ZBJ A;  3WQ0 A;  1UQX A;  1ENX A;  1LCL A;  3ZDS A;  1NZC A;  3PHM A;  2FCT A;  2IVJ A;  1PGS A;  1QEX A;  2DUP A;  4GB3 2;  5LBB A;  4Z2A A;  5KXE A;  1O3S A;  4JGY A;  4LO5 B;  1BVV A;  1OA2 A;  2VQ0 A;  3QCW A;  3RZG A;  4PF5 A;  4ERO A;  4MAD A;  2Y33 A;  1FOD 3;  1I6X A;  4A3Z A;  1O3R A;  1H8T B;  4AED A;  1ZBE 2;  5C5U A;  1VMJ A;  2RS1 2;  2VU9 A;  4KBB A;  1AR6 2;  2GNM A;  2C6S A;  1MS4 A;  1VBA 3;  1RUF 3;  3GAL A;  2ARX A;  1O91 A;  5FYC A;  4M3C F;  2OII A;  2YU1 A;  4QXC A;  1A3K A;  2A7A A;  4EE2 A;  2MEV 1;  4IQP A;  3W58 A;  1IG0 A;  3TNP B;  1V9U 1;  1IPK A;  3GJB A;  2WWJ A;  5JOZ A;  3WW3 A;  1NKG A;  3KCC A;  4Q0S A;  1PNF A;  1TMF 3;  4JVA A;  3R6S A;  5L9B A;  3BTA A;  4Z92 B;  1YI7 A;  1EY2 A;  5D21 A;  3AMP A;  2VR4 A;  4LHL A;  4AF9 A;  1C1F A;  2GU9 A;  1RUE 3;  2UWA A;  1HRI 1;  2XJP A;  5CFC C;  1A34 A;  3O0X A;  5IAV A;  3WZ1 A;  2QZ2 A;  4MO3 M;  1JN2 P;  4QGL A;  4HL0 A;  3OG2 A;  1Q8S A;  3GBW A;  4CYD A;  1TME 1;  1LU1 A;  3VBH C;  3OB8 A;  1CAU A;  4YWA A;  1N1V A;  1VRB A;  3I2I A;  4QPW A;  3VBO B;  3DGT A;  3VKO A;  3AMN A;  3B9C A;  1XB9 A;  3FUQ A;  1CAW A;  3D6E A;  3POY A;  4FSJ A;  2AC1 A;  4Y4R A;  3VD5 A;  3Q8A A;  1Y9Q A;  3LDB A;  4RQP B;  4WM7 B;  2HEY F;  4K20 A;  1FPN 3;  3UGF A;  2P34 A;  3B02 A;  3IAP A;  4Q4Y 3;  5J98 B;  4AQ6 A;  1RHI 3;  3I3E A;  1LHV A;  2HWE 2;  4Q4V 2;  3VBH B;  3NV2 A;  3DL3 A;  1RUG 2;  5J3U A;  3IAQ A;  2W95 A;  4XOG A;  3KVA A;  4CEY B;  1BVP 1;  5HCH A;  5FFO C;  1VR3 A;  3WD5 A;  3ZYP A;  1DYO A;  3WT3 A;  2WT0 A;  1D2S A;  2QQU A;  4O9E A;  1F35 A;  4W8J A;  4NPL A;  4LBJ A;  2GP5 A;  3POW A;  3ST7 A;  3AP7 A;  2E7Q A;  2WSU A;  1RUJ 3;  3PME A;  4A6O A;  4P9I A;  3GF6 A;  2HWB 2;  4RYD A;  5FAX A;  2HWE 3;  2VL4 A;  4Q4V 3;  5CU1 A;  3C7G A;  1UY0 A;  4I0A A;  4OHW A;  2ORZ A;  5FK7 A;  5F9T A;  2VVE A;  1FPN 2;  2E6V A;  2WA3 A;  4DIQ A;  2ZML A;  3GCW A;  3MLL A;  1YCI A;  4N90 A;  3MF6 A;  4XJZ A;  2DVG A;  3BU7 A;  4D6Q A;  5GZG A;  3LAG A;  1DBN A;  1PK6 C;  5T5P A;  5GZC A;  2I07 B;  3GCX A;  4AWD A;  2VTF A;  4DXR A;  1AL2 3;  1UU4 A;  4L9B A;  1W8N A;  4LKD A;  4QU1 A;  4GH4 B;  4HFS A;  5FZM A;  3WQB A;  1RUC 1;  1SCS A;  5H9Q A;  3WW1 A;  1YIP A;  4AEK A;  3AYC A;  3N35 A;  1HRI 3;  3LIG A;  3N7L A;  3OD0 A;  1ASJ 3;  4O65 A;  3BI3 A;  5CKM A;  4F8A A;  3T0B A;  2P6H A;  5FCC A;  2ZS6 B;  2ZHM A;  3ITQ A;  1YRZ A;  1ZRI A;  3G6J B;  2XLF A;  2Y6G A;  3LEI A;  2HBT A;  2DCY A;  4D94 A;  5FPU A;  3E5Q A;  3NJZ A;  1QXP A;  2JJ6 A;  4MZU A;  4DRV A;  2GH2 A;  1ENS A;  2VTX A;  3T08 A;  1NXD 1;  1C8N A;  4SBV A;  1HXS 2;  2WWU A;  3NAP B;  1SLL A;  2BYV E;  1N1S A;  2R32 A;  1KFX L;  2R6Q A;  3RJR A;  4PLM A;  2P17 A;  1F4H A;  1TME 2;  1W39 A;  4LJH A;  1UCX A;  4CDX A;  1RUG 3;  1PVC 3;  4AE2 A;  3JU9 A;  1FAY A;  4XXA A;  3A7Q A;  3UK9 A;  5C3S A;  3VBR A;  2HYK A;  1OOP A;  4MGS A;  1D4M 3;  4YM1 A;  3VV1 A;  1TNF A;  3T0A A;  4SLI A;  4COV A;  3OEA A;  1RUO A;  1UY4 A;  2DVA A;  2VBP A;  3WDW A;  3VBU B;  2ZGR A;  3WP3 A;  1GWM A;  2RS5 2;  4OI1 A;  1GP4 A;  4C0H A;  1W6P A;  1A78 A;  1W6N B;  2CL2 A;  4CRQ A;  4NIG A;  2IXH A;  4OUM A;  2XL9 A;  4XFC A;  1D7P M;  2AEZ A;  3PIG A;  5L36 A;  5F5A A;  1OUS A;  4GXL A;  4P00 B;  1ZRE A;  3SCF A;  3WP4 A;  4A44 A;  1LHO A;  3KS7 A;  4BQ5 A;  3T1L A;  2VXJ A;  3HAG A;  4M3C A;  2X05 A;  2DFB A;  5T5O A;  5FZA A;  1K5J A;  1W3V A;  1RUJ 1;  3JB8 A;  3K2O A;  2DVB A;  3OY8 B;  1TMF 2;  3SKJ E;  1Z7S 2;  4IND A;  1T6G C;  3FWE A;  4EN0 A;  1R1A 2;  4UW4 A;  3SHR A;  4ONU A;  1AYN 3;  5IAT A;  5IUQ A;  5IK7 A;  3TWI A;  1W05 A;  4LLO A;  5FYH A;  4DMI A;  1HDK A;  2WL1 A;  2RVA A;  4FOY A;  1QJX 2;  2W68 A;  4LO7 A;  2J1T A;  3PL0 A;  4N43 C;  4B8E A;  1U5I A;  1UU5 A;  4Y22 A;  5A80 A;  4K1Y A;  3I2K A;  3IDA A;  3NV1 A;  4BZ4 A;  1NY7 1;  4OHZ A;  2J1E A;  4AOC A;  1GMM A;  4A7Y A;  5J36 A;  3M3E A;  2J1R A;  3BB6 A;  4ZY9 A;  4ASK A;  3BTY A;  3CU7 A;  2EIG A;  4PIZ A;  3VUO A;  3IBM A;  1RXF A;  1VP6 A;  3EYP A;  4OHX A;  2VJX A;  2WLQ A;  4E27 A;  3MIH A;  4B1L A;  3AK0 A;  3ZYG A;  1X82 A;  2KD7 A;  1BK0 A;  2ZX0 A;  3OY8 A;  4ISQ A;  4Q4X 2;  1HB4 A;  4WM7 C;  5A6X A;  3ZM8 A;  2IXJ A;  4YVW A;  4FFI A;  1EUT A;  1VRH 3;  1QH7 A;  1PMI A;  1T2X A;  4M3C B;  2B42 B;  3WNO A;  4XBL A;  1RHI 1;  4BYY A;  3T2Q A;  4XET A;  3UT0 A;  3AC0 A;  2B45 X;  1JH5 A;  2VEC A;  2C9K A;  2RR1 3;  3CO2 A;  4XMA A;  1J59 A;  4MSV A;  1W6N A;  1NCR C;  2QTW B;  4HVQ A;  4WVV A;  2DCT A;  1JYW A;  5D8A B;  4QX3 A;  3VBU A;  4D6S A;  3AZX A;  1XNK A;  1G6N A;  3IN9 A;  2JG8 B;  5FWE A;  4MET A;  4B1M A;  3WLU A;  3A0N A;  2DU0 A;  1DGW A;  4NAO A;  4A41 A;  5BNN A;  2VCB A;  3MV0 1;  4XFH A;  3EB7 A;  5BNP A;  2A3X A;  3A21 A;  2XBO 3;  2WNV B;  4PI2 A;  3RNS A;  1JZ5 A;  1JHN A;  3FHI B;  5FR3 A;  3AZY A;  4LEJ A;  1R09 2;  4XPV A;  2VUC A;  1OPM A;  5A33 A;  2LUW A;  2YGM A;  2OQ7 A;  4HMZ A;  1W6M A;  1DGL A;  3LKJ A;  1AJO A;  1EAH 2;  4XCA A;  5FY8 A;  1WLW A;  2QNK A;  3R05 A;  5A7P A;  1ND2 B;  4R9A A;  2VZ3 A;  4EV0 A;  1UY1 A;  1UNB A;  2X8K A;  3ZIX A;  4QKF A;  4KH9 A;  1W2U A;  3IIA A;  1PMJ X;  2BNM A;  2YV8 A;  4RGG A;  3ZYH A;  5HV0 A;  1LKN A;  3PLQ A;  2BNN A;  3UL2 A;  3VKM A;  1UZW A;  2J1S A;  1AR7 2;  3N9P A;  2VOT A;  1O8S A;  3JD7 3;  1QDO A;  1DQ4 A;  4M3C E;  2R30 A;  1AYM 3;  3ZXA C;  1HX6 A;  5K8S A;  3VZO A;  2A73 B;  3C7O A;  2D40 A;  1MZE A;  2Q1M A;  2QBX A;  2RMU 2;  5AVP A;  4PJY A;  1VIW B;  4UF0 A;  1UYP A;  3KF3 A;  1VBC 2;  1BMV 1;  2JIC A;  5BNO A;  1QQP 1;  2XR4 A;  4JV4 A;  5EYY A;  5KC5 A;  1YHF A;  2WQZ C;  4CP0 A;  2VUA A;  5DAB A;  3H50 A;  4Y1X A;  1F5F A;  4AFB A;  1LR5 A;  1MEC 2;  3KMH A;  4QXK A;  4UFI A;  3VKN A;  2GN7 A;  2W46 A;  1VRH 1;  3ZXK A;  1E5R A;  5T52 A;  4C8D A;  3JBG 2;  4XUO A;  2XPJ A;  1MVE A;  4J6G A;  1C8M 2;  4CEW A;  1DQ6 A;  1LB2 A;  2DBN A;  3FBM A;  4OCT A;  1U0A A;  4LUM A;  4QB6 A;  3LSD A;  1PIV 2;  5F8P A;  3BKZ A;  1KJL A;  2B4K A;  3AM2 A;  5FYU A;  1EV1 1;  1GOG A;  1ND3 A;  4UT5 A;  1H2K A;  1OPO A;  2RDN A;  3MPB A;  1GZ9 A;  4CXX A;  5FLI A;  4LNV A;  3LEG A;  2W9X A;  3AVS A;  4FTB A;  4FOW A;  2Q5T A;  4HK9 A;  4JDN A;  5DUX A;  5I0R A;  3EO6 A;  4NHX A;  5T54 A;  2QDR A;  5B4N A;  1S4C A;  3PTR B;  3I3Q A;  5E6H A;  1VJ2 A;  2DTY A;  1SCR A;  4FOQ A;  5EHD A;  4AI8 A;  1RIT A;  3SEP A;  2VOX A;  5FZE A;  2TBV A;  2XJQ A;  1CJP A;  2YC0 A;  3MPP G;  3ZVX A;  5BNQ A;  3DPR A;  1AYM 2;  3AKT A;  3VDC A;  2ZKN A;  1UZY A;  3P3N A;  3VL9 A;  4Y4Y A;  3MHZ A;  2ENR A;  2BUK A;  2W39 A;  1GBG A;  3KGL A;  3MBW A;  4QDS A;  2QDN A;  2AEY A;  1O3T A;  1KIT A;  2E26 A;  2VME A;  3A4U A;  4QB1 A;  3ZFE A;  5LBE A;  3SNM A;  2PAE A;  4AFM A;  1OUX A;  4NO4 A;  1C5I A;  2PHF A;  2V09 A;  1YQ6 A;  2JIG A;  3T2P A;  1CJD A;  5BPX A;  4FPL A;  2UU8 A;  1VBB 1;  2VUJ A;  1HRV 3;  5FZI A;  4QPG C;  2ZGN A;  2FMD A;  3JXS A;  4HN1 A;  1ZZC A;  3ETP A;  1VBB 3;  5FKB A;  2VUD A;  1AR7 1;  1VBE 2;  1W2N A;  1RMU 1;  2VQT A;  4MXV A;  4W6W A;  2A6W A;  4YZ1 A;  3AB0 A;  1FV3 A;  4GIQ A;  1SFN A;  2V5Y A;  1XJA A;  3ZR5 A;  2BBV A;  1IPJ A;  2MHF A;  4UFL A;  4Q0U A;  1B35 A;  3WUD A;  2LW8 A;  2QJV A;  2XML A;  1X36 A;  4R4X A;  1RED A;  1IOA A;  2Q1Z B;  1UMH A;  4Z8B A;  4HPK A;  1RVF 3;  1NY7 2;  3BN6 A;  4NHL A;  4H7M A;  1RYY A;  4BHP A;  5CB7 A;  3WG4 A;  1PO2 3;  3GZT B;  5LCW L;  2WN3 A;  1HN1 A;  4OUE A;  3GJA A;  4Y1U A;  1GR3 A;  3UYJ A;  1WMD A;  3H8R A;  4GWI A;  5L9V A;  3V0A A;  1W9F A;  2JG9 C;  4K9S A;  2JE9 A;  1QOT A;  1EYB A;  2AEN A;  2PYT A;  4XAB A;  5DZE A;  1OA3 A;  4MOA A;  2YY1 A;  2P3K A;  1ZX5 A;  2VMD A;  4EN9 B;  2PAK A;  4FPF A;  4Y5Z 0;  2QQN A;  2D6L X;  4IV1 C;  5FLH A;  1WKY A;  1AX2 A;  2JG8 C;  2RJ2 A;  2XHN A;  3GXU A;  1MZF A;  2CSG A;  3GBG A;  3K4A A;  1MR5 A;  3JQX A;  4Q0P A;  1Y7B A;  5M0T A;  1DQ5 A;  4YAR A;  1W8Z A;  2EIE A;  2ERF A;  5C3Q A;  4RD7 A;  3MDP A;  2Y34 A;  3R0R A;  4CDQ A;  4FFH A;  1N3P A;  1UMZ A;  3RZL A; 
#chains in the Genus database with same CATH homology
 3BUC A;  4QKF A;  3H8R A;  3RZH A;  4NRO A;  4NPL A;  3O1P A;  3BTY A;  3BI3 A;  4ZHN A;  4IE7 A;  4CXY A;  3O1O A;  2IUW A;  3RZJ A;  4NID A;  4IE5 A;  3S57 A;  2FDH A;  4NRM A;  3BIE A;  2FDG A;  3BTX A;  3RZG A;  4OCT A;  4RFR B;  4QKD A;  4NIH A;  3O1U A;  3O1M A;  3H8O A;  3H8X A;  5F8P A;  3BKZ A;  3O1T A;  4ZS3 A;  4MGT A;  3RZM A;  3I49 A;  3I2O A;  3BTZ A;  3I3M A;  4QKN A;  4O7X A;  3RZK A;  4NIG A;  3S5A A;  3LFM A;  2FDI A;  4IDZ A;  4CXX A;  4ZS2 A;  4NJ4 A;  2FDK A;  4O61 A;  3T4H B;  3KHC A;  4QHO A;  3T4V A;  4IE4 A;  4IE0 A;  3O1S A;  4CXW A;  4NRP A;  4JHT A;  3BU0 A;  4NII A;  2FD8 A;  4NPM A;  3O1V A;  2FDF A;  3I3Q A;  4MG2 A;  3O1R A;  5DAB A;  4QKB A;  3KHB A;  4NRQ A;  3RZL A;  4IE6 A;  3T3Y A;  2FDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...