3T4HB

Crystal structure of alkb in complex with fe(iii) and n-oxalyl-s-(3-nitrobenzyl)-l-cysteine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
201
structure length
201
Chain Sequence
PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Dynamic combinatorial mass spectrometry leads to inhibitors of a 2-oxoglutarate-dependent nucleic Acid demethylase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 48
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3t4hB00
3BIEA 4O61A 4NROA 4NIGA 4MG2A 2FDJA 4CXXA 4IE7A 4QKFA 3BKZA 2FDFA 3I3QA 3RZKA 4NIHA 2FD8A 3KHBA 4ZS3A 4NIIA 3S57A 3O1TA 3O1RA 4IE6A 4CXYA 4ZHNA 3O1VA 3RZGA 4NJ4A 4MGTA 3I2OA 4IDZA 4NRMA 3O1OA 3H8RA 4QHOA 3O1MA 3RZJA 4JHTA 3T3YA 4IE4A 4ZS2A 3H8OA 4QKDA 3BTYA 3I3MA 4NRPA 5DABA 2FDHA 4NPLA 3BU0A 3KHCA 3O1UA 4IE5A 3BI3A 2FDGA 3BTZA 3BUCA 4QKBA 3O1SA 3T4HB 3O1PA 4NIDA 4QKNA 3RZHA 3RZMA 4NRQA 2FDKA 4OCTA 3BTXA 3LFMA 4IE0A 4O7XA 3H8XA 3RZLA 5F8PA 3I49A 4CXWA 3S5AA 4NPMA 4RFRB 2IUWA 2FDIA 3T4VA
chains in the Genus database with same CATH superfamily
4JGZC 4Q4X2 1Q8QA 4P9YA 1UCXA 4V2WA 5ACA1 4J1WA 4N43A 2VUAA 4NO4A 5A3PA 1GNZA 2FDJA 5FZ4A 4A7KA 4AL9A 1IOAA 1P8JA 2NMOA 4DOUA 4FAGA 3GALA 4GH4B 5I0TA 5ABJB 3VBOC 2V5YA 4AI3A 2OW4A 2GC2A 4FPJA 4LLFA 1D4M1 2DWRA 1TMF2 1W3XA 1YNAA 3A0KA 5DG1A 3ZXGA 4AHZA 1V6IA 2CGPA 4BJ0A 2A75A 4ET7A 1UYXA 3JD71 3OGGA 4KU7A 4LTAA 4ZPIA 3WLUA 3K77A 5IK4A 3UYJA 4WM7B 2RR12 2O14A 3KF5A 1GV9A 2XJRA 3S57A 2WQ8A 4FQ4A 4OQ9A 1SHWB 4DMIA 1QWRA 2H6BA 4XBLA 1BQPA 3AJZA 4SLIA 4YVSB 4YGBA 4GD4A 2A6YA 5HCFA 2YFZA 1KDMA 4ZU7A 1ZREA 5C7GA 5J37A 3USUA 5F1RA 1J1LA 4WZFA 1TQ5A 1JZ4A 3FHIB 4NRMA 3DV8A 3IKWA 3S6PA 1PO13 2PHDA 2B5HA 2O8QA 3KCXA 4ZU5A 5IFTA 1O4ZA 1ZA7A 2IXIA 4HG6B 5FZBA 5T54A 3O12A 1BXHA 1NT0A 1QH6A 1YI7A 2HWD1 1AL0G 4CDXC 4FTEA 2NLRA 5CKQA 4PIXA 4ATFA 1RITA 3CJXA 1GQPA 4JKKA 2Q8EA 4MGQA 2WN2A 4IESA 4P02B 3TEXA 3TEWA 3IMMA 4FTSA 4E2QA 1O3QA 4AI9A 4P14A 5FTTC 5JOZA 5FZOA 3DCQA 4R8HA 4XQDA 4XZUG 3TB0A 4QX8A 4EWAA 4HFSA 1CJPA 5FO8B 4KBBA 1JW6A 4LOSA 1YJLA 4FOQA 1HW5A 5A1LA 5CYYA 2J1AA 3BYWA 4QX2A 1D0GA 1EUTA 3MPPG 3GHMA 4RHV1 5FPLA 3ZR6A 3N9LA 4CEWA 4YW2A 1AYM3 2IFRA 2X5IA 1QJY2 2WA3A 2ZPXA 1C5HA 4XMAA 5IHRA 3R4UA 3MW4A 1OKQA 2CWMA 5J1XA 1KQRA 1HX6A 2BWAA 1X33A 2J1SA 2D44A 4Q4V3 3T4HB 3O1PA 5DXDA 1ZRCA 1PO23 4BPZA 3AB0A 5JXGA 3KF3A 2E6VA 4HPKA 5GZGA 1NZIA 4XEZA 4EE2A 1RHI3 4LBQB 4OCTA 2WFF2 4META 4ORFA 5DAQA 3BTXA 5FP9A 2MEV2 2P6CA 3QD6A 4QDQA 1QXPA 1ZX5A 2D93A 2Z69A 1JU3A 3ZFFB 1STMA 4JRLA 3UKVA 1R092 4R9CA 1DCSA 1IPSA 2A6WA 2C0ZA 5J98B 4PDWA 4B1LA 2P5BA 5G05L 4CEYA 5FYYA 1AX0A 2A3YA 2ID4A 5DN2A 4COVA 4YLZA 1SG3A 1YHFA 1TME2 1LESA 2VVEA 4BQ2A 5FZEA 4AVBA 2D3RA 2IXKA 1BVP1 1IS4A 3OCPA 3IDCB 5CNAA 1ND3B 4LBJA 1GWKA 5FYBA 4AVSA 4NIGA 1WW4A 1YO8A 5KHIA 4LHSA 4QT6A 1YC61 1BKZA 2VOVA 2BWCA 4HSLA 4JCKA 1HRI3 4I0BA 1KS4A 1QDCA 4Q4Y2 2RJLA 5JMOA 3PVOA 3LF7A 3HMYA 4YGEA 4QPIA 1L7LA 1OURA 2YGMA 3K4AA 5FY7A 5LA9A 3C7GA 3SKJE 4DUWA 1KD7A 1TE1B 3N36A 3NSTA 2XDVA 4P5YA 1CIYA 1VBC1 4ZS3A 5JI7A 3T08A 1ZZ7A 1W6MB 2DCYA 2VVFA 1I6XA 1YUDA 3K3NA 4JVAA 1HB3A 3VBRB 4XACA 4ZZ8A 1R64A 1RUJ3 4IE6A 1YIFA 1UY0A 3ITQA 4WM8C 4ZHNA 2VMCA 1AR72 3N9NA 5GM0A 3T30A 2UYBA 3O1VA 2QQVA 2GMPA 4QXHA 3IT8A 4Y5TA 1MVEA 1PIV1 3WP6A 5BNNB 3D8CA 5C8CA 2LTNA 2W1SA 3LDRA 4AE2A 5JDBA 3E6CC 1IS6A 1FXZA 1W04A 5F3EA 5BXXA 3ZDVA 4CA9A 3I4IA 2VBDA 3MLJA 3POJA 4NR1A 5CG8A 2JE8A 2OVUA 2Y6LA 3DECA 4QGNA 2ZMNA 4CP0A 2QZ2A 4NAMA 1JHJA 4CU8A 3W5NA 3KQRA 1I9RA 2RV9A 2LROA 5KHKA 4QKDA 3VDCA 5JXJA 1HQNA 4GMP3 4L2NA 3V56A 3I3MA 4HKWA 4UYBA 2IXJA 2Q1ZB 3VBHB 2Y6JA 3CL1A 3TN91 2P34A 3KHCA 1UPSA 2IC1A 4L8QA 4O9EA 5F5CA 5BUVA 1GZWA 2Q4SA 4U2AA 4QX3A 4P5HA 2QFEA 2VUCA 1LGNA 1WW6A 3J8F3 4YZ1A 5BNPB 5FBZA 1VAKA 4MXWA 4G9SB 1S2BA 3KT1A 1JTZX 4AVCA 1LHUA 1CVNA 3E5QA 1JZ5A 4BYYA 1Q43A 4GWMA 3ZPYA 5J09A 3WDXA 2FCVA 2HWB1 5DDJ1 1CAWA 4CVUA 1NCRA 2B4KA 4Q0SA 3GCWA 4M3CB 3PHMA 3IM0A 5IVCA 1PO12 4LHLA 5ERLA 5L9BA 1WCUA 5LBEA 3RZMA 3ZMOA 2EXIA 5KXBA 3AKQA 4CCJA 1WCSA 2E33A 4FXGB 4J1XA 4D0QA 1J3QA 5GZDA 1VRH3 1W6QB 4XFCA 3ZSLA 4D7TA 4P00B 4OHZA 2O1QA 4L9BA 5AC93 4OI4A 3ZIXA 2G9GA 2QQMA 3WCRA 3PMEA 4DQAA 4IUGA 4EZ4A 1Z7S1 4QGMA 5BNNA 5FPAA 2VXJA 1UKGA 1TG7A 1H6YA 3N35A 3TEZA 3U10A 5JUVA 4C90A 4MOAA 3UNPA 3H42B 3UJQA 3VV1A 3M4FA 3J7HA 3H9AA 1R1A1 3T2PA 1JN2P 2VMGA 3VDBA 2VNOA 3KT7A 3R4SA 1Y7BA 5IVEA 1J83A 3VBUA 2VOTA 3V0BA 2DUQA 1AYM2 3HIFA 4LITA 1JZ6A 4R4ZA 1SPPB 2ILMA 1C8M1 3C8XA 2VXRA 2R0HA 2D98A 4LKDA 4AF9A 3ILFA 5BNOB 4WVZA 1SLCA 4MGSA 4DRVA 3U14A 2QDNA 1FOD1 4Q4V2 1UOJA 1AL23 1NE6A 1PO22 2VR4A 4PLMA 4RSUA 4Y4RA 1IG3A 1OH3A 3OY8B 1VALA 4I01A 2Z2SB 3KHBA 1FYUA 1QKQA 3QCWA 3TWIA 5A6XA 4YVSC 4AFDA 5KBFA 1RHI2 1W6OB 1UW8A 1IPJA 1AZDA 2SBAA 5FLHA 5A3MA 3J9SA 5GZCA 1RUOA 2ADDA 3SH3A 3EYPA 5K0UA 1H1MA 2CTVA 1EPZA 4LO8A 4PLNA 5FR3A 1TVGA 3L2HA 3HBKA 3JB8A 4KGQA 1QIQA 1JZ2A 1X9PA 3AP5A 3WX5A 1SDDB 1BMV1 4JQRA 2RJ2A 2YY1A 2ZZQA 2EIBA 4OFGA 2VD7A 1LEDA 2JG8A 2Y6HA 1XJAA 5FCCA 2W92A 3ZKYA 4P08A 3FLTA 4IEPA 1REEA 4AGRA 3LKJA 4BQ3A 1UF2C 3IPVB 2BGOA 1PVC1 3SCHA 5IAXA 3N7JA 1LCLA 4YW4A 4ASMB 1FPN3 1JYIA 2Q1MA 3CQOA 2JD9A 4AFMA 1AXZA 1FAYA 1QJZA 4NMIA 3RYPA 1BK0A 1HJFA 1HRI2 1VBB3 2XGXA 2KXLA 4MGYE 3ZN6B 1RUI1 4Q29A 4XUQA 4D7SA 2PLV3 2R1BA 1GZTA 1NG0A 3KQ4B 3APBA 4FOVA 1KFXL 2GC0A 4HSJA 3S7EA 4YW7A 5JAXA 3HEIA 2WLPA 4H55A 2E7TA 1ZBE3 4K7JA 3VL9A 2HWF1 1E5RA 4UW5A 4CCEA 2RDNA 3FBYA 4Y4YA 2NM1A 4WBBA 4CDQC 5FK8A 5KHHA 5IVVA 1EAH3 2GC1A 5I8YA 2WZEA 1O5UA 1OD5A 1QJX1 1DQ1A 1RUJ2 4UW4A 5IUQA 2HWE1 5FP7A 1X8MA 2XUMA 5FQ0B 1LB2A 1W99A 4UT5A 5I8SA 4JAAA 2QQJA 4R4XA 4C8DA 4RGKA 2HH9A 3MW3A 4J6GA 1G9AA 4CPBA 3IZOA 4OMCA 5DQ0A 5T50A 1WCQA 4IEWA 1F31A 2KD7A 4XIKA 4Y3OA 4NRQA 4YGDA 2VECA 5A70A 3POIA 2EF6A 1ZZ6A 4CDWB 3V0AA 2NMNA 3LEGA 3IIIA 4I3GA 1JZ3A 2V4AA 4PF1A 3GZUC 2DVGA 3MIGA 3S5AA 1UNBA 5FZDA 1B35A 4E2GA 1VBA1 4EWEA 4JDNA 4S2GA 1V6OA 4JGZA 5CZKA 1UQXA 1RXFA 1ULEA 2LRPA 1Q5OA 2XVKA 1LHOA 4XAAA 3ZDSA 4AEMA 3NJZA 4RS5B 2UWCA 1RMU3 2DVDA 3HR9A 3M3OA 3VHOA 5LY1A 2J1RA 4AEKA 4WVMB 3J8F2 1U5YA 3VBOA 5CG9A 1T6BX 5JVVA 3HT2A 1UY1A 3KV5A 2XBO1 3H3LA 3MIEA 4BWOA 1FT9A 3LQCA 3VHPA 1JZ8A 1RIRA 5FYIA 3P6BA 4DRRA 1W9SA 3ZSEA 2R7EB 2EA7A 3IAQA 1LOGA 1Q8PA 3RZZA 3AXEA 1QNWA 2J7MA 4GB33 2H6CA 5FZAA 4PBPA 1DYKA 2FD8A 3KCYA 2DCJA 1POV3 2WNUB 1OQDA 2VOXA 1H9WA 4K6BA 2IXHA 3J7NA 4BM8A 5C3PA 1ENSA 1UYYA 5DAPA 1VRH2 4JGYB 3MO4A 2VQ0A 2WYSA 5AC92 5DAXA 1OUSA 2XB6C 3O0VA 5C33A 5DAWA 5JIUA 3FWEA 1NKGA 1F5FA 2AH2A 4YZ2A 3ETQA 4R9DA 4CPBD 1H2LA 3U1XA 2QQWA 1W8HA 2UU8A 4DB5A 1AYN3 1UY2A 5D21A 1FI2A 3AYDA 2XUEA 3ZYHA 3E6DA 5DAVA 2RJKA 4CDXA 2FZ2A 2VMDA 5GZEA 4A41A 4LORA 1RUG1 3VZKA 1H0BA 2B42B 4XQ4A 2JE7A 5I0RA 4O65A 3VBHC 4BCUA 3AL5A 4AEJA 2VCCA 1N3PA 2D6NA 1DLLA 2TUNA 5LWBA 4XYXA 1DLCA 5D8AB 4IE4A 4Z07A 3T3YA 5FP8A 3WP3A 2JDKA 5FOJB 3BVCA 1AL22 1N3OA 1S0JA 2XJVA 4HT1T 4LO5B 4XUPA 4QQPA 1UN1A 4CU7A 5FYVA 2JXAA 2ZS6B 5B4XA 1DYPA 1S0GA 1PNGA 2ORXA 2ATFA 4DFSA 4LA2A 5B4NA 3ASIA 1CAUA 4A42A 4NHLA 2XVLA 2CY6A 4JDOA 2R1DA 4FT8A 4AAXA 2R041 3FHAA 4FPOB 2ENRA 1D2SA 5C4WB 4HKLA 1UZZA 3PNAA 2R32A 3AMQA 1MZEA 2A73B 2PHLA 3VBSB 2VW2A 1WLCA 4QKBA 2AENA 4AAPA 3WHUA 5A6ZA 4TZDA 1W06A 5DUXA 1BCXA 1NQDA 4ARXA 1QQP3 2ZAAA 4UBHA 3VGIA 3WQBA 1MZFA 4NIAA 3RJ2X 4ISQA 4KG8A 1LODA 2WWSA 3UETA 1XE8A 2BBVA 1CAVB 2YBSA 2JG9B 4M00A 4CCKA 2OZ6A 2A71A 1LEMA 1J3PA 4IEYA 1HQLA 3PU8A 3LDKA 1AR83 1FPN2 3MIBA 3I3DA 3A22A 3GZAA 1AHSA 1WLDA 3MLLA 3POGA 3N4MA 4O7XA 4LO7A 3UKTA 1VBB2 4BXFA 4ZKTB 2QBXA 3B9IA 5F32A 3C2UA 3MZHA 1V9U1 5FBJA 1H8TB 2WSVA 2PLV2 4RGAA 3TNQA 2A6ZA 4OZOA 4RFRB 2R49A 2DTYA 1MQTB 4CU9A 3U75A 1ZRRA 5IYYA 4BA6A 2D7FA 2WN3A 4BLIA 1RUC3 1ZBE2 2ORZA 1POQA 2UURA 5BNOC 3AXDA 5HV0A 3F2ZA 4DXZA 3JXSA 1SLLA 1QHDA 1EAH2 5CFDB 1H2KA 2OUJA 3LIHA 3D0JA 2PHFA 1W6NB 3CO2A 3N7LA 3NRUA 3IDEA 4AFBA 1PNFA 1LGBA 2HYXA 4JX0A 1BHGA 3NJYA 2OT7A 3WINE 1RJ7A 5HPOA 2CL2A 5A3OA 2CDPA 1DZQA 1QJU1 2C5DA 3ES4A 2HEYF 4Q0PA 1BBT3 2E53A 2GNDA 4EZHA 5FAXA 1HB2A 5KR7A 1PK6A 5IAVA 1ST8A 5FJHA 4IGOA 2ZX4A 5JMCA 1JI6A 3THCA 5FO9B 3VD9A 2DVAA 3CKHA 4UWDA 2PHXA 5T55A 2RG4A 2WNVB 4XHXA 4WM8A 1B09A 1ACCA 5I93A 2P1BA 2BJSA 1JYVA 1WD4A 5IFPA 4BZ4A 1G86A 2YFUA 2DVBA 4GZ9A 1KRIA 3ACHA 1YFYA 1UU4A 1SQ4A 2PTMA 3GCXA 4M4RA 3SCFA 2BGPA 1VB2A 4QQLA 3ZYGA 2ET7A 3VKNA 3ZXDA 4LK6A 2GP5A 3S7IA 2ETEA 5FZLA 1MEC1 4AI0A 1KJRA 4I2OA 1PVXA 4LIUA 4FSJA 1FX5A 1F15A 1RMU2 3CLPA 4JKMA 1ULDA 3OBZA 1XYPA 4Q0UA 3NNLA 1IQAA 1YFWA 4HLTA 4IEVA 3FUQA 4FOYA 2QDRA 3CF6E 3NL1A 2VGDA 3BIWE 1REDA 1XE7A 3PIGA 3WQ7A 5A3LA 2MPFA 4C1XA 4GWNA 5D2AA 4BQYA 3H7YA 2D6PA 5DUVA 1NY72 4E4SA 4TXWA 3ECQA 1FV2A 4K1ZA 5K7PA 2I07B 4EN6B 4GB32 4AHYA 3FLRA 4RR3C 4B8EA 4BIOA 2WO1A 4YG6A 4JTOA 4ZZ5A 2ZGPA 4M01A 5A32A 4A4AA 4LULA 2XWBB 1OUXA 2BEOA 4YVWC 2PN5A 5F7UA 2DBIA 4XFBA 1GMMA 3N9MA 3VN4A 1K42A 2BV4A 2VBBA 3NV1A 3OBRA 1X9TA 1VRBA 4GQ7A 3BUCA 4RQPC 1GP6A 5T52A 2ZGSA 2BBAA 3O1SA 2VZVA 5FV3A 4DXTA 5LRSA 1W9YA 1AYN2 4FFIA 4XDPA 5FXVA 4YZ3A 5FZHA 4ITCA 4CDWC 3ZFGA 4XUTA 3VLBB 4XF1A 4LJHA 5FLJA 5I0DA 3AYCA 5FXWA 3OYWA 1ZZBA 1U5XA 1DBNA 2Q8OA 3VKOA 2W2IA 5CA6A 2ZEZA 3AVRA 1V6MA 1E57A 2YUEA 1K5MB 3LAGA 2A1XA 2JEMA 2MHFA 3AKRA 1G9FA 2ZBJA 1UX6A 2W94A 5CKNA 1SZBA 4GWJA 1JUHA 2VUDA 4E8DA 1WKYA 3ZSJA 3CJIB 3POBA 2QVSB 4NE9A 3I2JA 5F6LB 2UYAA 5LA2A 4AVTA 1YXWA 4B7KA 2D6MA 2IUWA 5GJ6A 4JQTA 3ACLA 4KWJA 3L2YA 2GC3A 1NA1B 3DPRC 3GBWA 3SXWA 3GGLA 2P4EA 5ACA3 2R071 4QXKA 4YM2A 1O3TA 3OPTA 2CU5A 2D3SA 2GP3A 3ZFEA 1ZRDA 1W28A 2QQOA 4K20A 4F83A 1AX1A 3PDQA 3FUOA 4IV1B 1V6NA 2ZXQA 3G6JB 2EAKA 4RA0A 2OZJA 3IDAA 4UFJA 5A3NA 2BFUS 1JODA 1QQP2 3OPZA 3WF0A 4Q26A 4JGYC 1ZRFA 1D4M3 2ARAA 4N53B 3J4UH 1FNYA 1BYHA 2EVXA 3P3PA 2YC2A 2ZABA 2FMDA 4CP2A 5SV8A 3SEPA 1NXD1 3JD73 3HJRA 5C3QA 1C8NA 1XNCA 1W8WA 4LHNA 5A33B 4KL1A 1AR82 3ROUA 2A70A 4IEQA 3NVCA 3INAA 3AM2A 1QOSA 2QQUA 4FVVA 4WVVA 2F17A 5JOYA 2VULA 3GM8A 3DUIA 1RUH1 4YZ5A 1JMUB 1XRUA 1JU4A 1G6NA 2VM9A 1I5ZA 1UMHA 1HXS1 1XB9A 3M7AA 4IV3B 4E4HA 5C9AC 1RYYA 4YM3A 2ZJCA 4LOTA 5GALA 2PMWB 2GNTA 3I2OA 3EMRA 2K46A 1RUC2 1SLAA 2XXZA 4W6YA 4A2UA 4Z92B 4QHBA 2YBPA 1SFPA 1ZZCA 2BNNA 3NNJA 4HK9A 4RYDA 1Q3EA 5A7QA 1W9FA 1W05A 4FFGA 3SH5A 2HWD3 4CYDA 1AR61 3WT3A 4MYEA 1SCRA 1C1LA 1VLNA 5L7OB 1WD3A 3MIDA 2ZMLA 3ZSKA 4ARYA 2VVDA 3GZTB 4AQ6A 1GP4A 4DEVA 5J48A 1BBT2 4UF0A 4BQWA 1OA3A 4MVTA 4BQ5A 4OHYA 2ZCWA 4TSVA 1XYOA 3WNKA 4CDQA 3AMNA 1RJ8A 1NOVA 5DMYA 4HL0A 3M3IA 3VBSC 5CKMA 4RFT0 2EIGA 1WLWA 4AEDC 3ZXLA 2DTWA 4K9SA 1ND2A 1R1ZA 4HBNA 1MS0A 2Q30A 3AZZA 3DKQA 2W87A 3GNEA 4RHV3 5FKBA 2E31A 3UV9A 3WDWA 3WNXA 1YEWA 1XC6A 2JG9C 4MGZE 3RRDA 3MF9A 3IDBB 1DQ5A 4UFIA 4YWAA 1F8VA 4COWA 4HETA 4DIQA 3N9PA 4HOOA 4KQ7A 1W9TA 1RUD1 2WZR3 3WW2A 5JPMB 4DXRA 1V6JA 2IZWA 2ARBA 2FQPA 3A7QA 4UW6A 4ASKA 5EWSA 3LOIA 3NAPB 5EPAA 3VDDC 3KT4A 2FDKA 1W8NA 1K5JA 4XIOA 2RHPA 2ZGNA 3DYMA 3LFMA 4U36A 3E97A 3RVHA 1DQ2A 4FPGA 1QF3A 2Z4FA 3MIFA 3WR0A 1MZ5A 3I2FA 3RZLA 3ZKUA 4CEYB 4X6RB 2AZ5A 4YG3A 1MACA 1J3RA 1OHFA 1PGW1 2JDNA 5FDBA 4N43B 2ZEXA 4YYOA 1H1AA 3ABZA 2JWPA 3NJXA 4MHUA 3WCSA 2GMMA 3I97A 3KS7A 3HQXA 1NX9A 1Y9GA 5CBLA 2C9KA 4EQVA 2VU9A 3QOPA 4Y22A 1X50A 4P9XA 4W6XA 3PUIA 4QPGC 2Q1FA 2P3KA 3DXUA 3WNPA 2C24A 4N7IA 2ZACA 1QMJA 3PIJA 2WNVC 3K48A 1UD1A 2WDBA 4LA3A 4QKFA 1D4VB 3PTRB 3WOGA 3KM5A 3ZX7A 1KEXA 1CD3G 1ZRIA 3BKZA 5EJ1B 1GYKA 3WP4A 1O7FA 3RZKA 2ZKLA 5IWFA 5IVJA 3VHNA 1U0AA 3PUQA 1HV0A 2YU2A 4OHVA 1VBC3 2F4PA 2IFWA 4LQRA 3ZMNA 1ZVFA 4LNVA 3USUB 5DG2A 3VBFA 4B4PA 1O3RA 2Z42A 5GLWA 3ZLIA 3RPQA 2IXCA 3ORJA 2WKKA 1CN1A 2WA4A 2HWC1 2QUOA 1PIV3 2V5DA 4MGTA 1UIKA 3BOWA 1H6XA 3QH6A 2GNMA 4G3YC 3O1OA 3RSJA 4CTEA 2MNGA 2B9UA 4Y24A 5E88A 3HN3A 3THTA 5IJRA 3WDVA 2DBNA 1JYXA 4GJYA 3H8RA 2QZ3A 5T5JA 5ACA2 3VUOA 3HQUA 4HK8A 2VNVA 1WBLA 4XJWA 3T1MA 3ZXEA 4ZU4A 5FZOB 4XXAA 5EYXA 1W2OA 5HCBA 1XPWA 3CBNA 1HRV1 1PO21 4CDUC 2XJPA 4H7MA 1YQ2A 3AP7A 2GH8A 1MS1A 3K46A 1D4M2 2XQRA 3VD3A 4Y1UA 3W59A 3BB6A 5FREA 4CEWB 1WCDJ 3JD72 4HXCA 3I2KA 4NRPA 4DS0A 4BU2A 5HCAA 3TN93 2QQKA 4FFHA 4AFCA 1FMD3 2BP6A 5FZCA 1BEV1 4QPWA 5FYUA 3MGUA 2A6XA 2XQXA 4D3WA 3CZUA 4LBKA 4V1PA 4Q0QA 4LE4A 3WF4A 2W1WA 1QJEA 3K75B 1PZ7A 1W6QA 3BTZA 1XSQA 3OG2A 4E2SA 4JTNA 1VBD1 2HWB3 5DDJ3 3AMMA 1LTEA 3UT0A 5F3CA 3KVBA 4JZRA 3OUHA 3U0ZA 4MHRA 4DINB 2HWD2 2W3JA 4FPYA 3CJIC 4PDWB 1LR5A 3MICA 3PTYA 2A5ZA 5F37A 2HYKA 2A3WA 2RS51 1MS4A 4X6QB 4D6RA 4M0NA 3LFIA 4XF3A 4YSFA 3W20A 5C3RA 1JYTA 3E1F1 3RFRA 1SFNA 5F2WA 2BQPA 5F8PA 5C3OA 1JYNA 3V65A 2NQYA 4IEOA 4BIFA 1LOFC 2PAMA 4H2AA 1AXYA 3NWKA 1VE0A 5BYNA 1R1A3 2DURA 2K2SA 5EP9A 3DYPA 2BOJA 2YROA 4XFFA 1VIWB 1UIJA 4RHV2 1Y3TA 5EIYB 3S0MA 4QPIB 3R6SA 1C8M3 4MGIE 4FPFA 3T1LA 2PYTA 5LA1A 4XC9A 1W8FA 3R4DB 3JZVA 1FOD3 3NV4A 2JE9A 4AI2A 5CFCC 3PMSA 1KXGA 4UW3A 4Z1VA 2V73A 4QMAA 3B3QE 2WZR2 4FPKA 2DU1A 4CSWA 3OJBA 4N9HA 2ADEA 4LBOA 1PX4A 3MLKA 4KU8A 2VMEA 4IV3C 4K3UA 3I7DA 5FZ3A 4Q8KA 4NIIA 5E6HA 5FP4A 1Q8VA 1OBNA 3LZZA 1C1FA 4GH4C 3SISA 5ABJC 3NKGA 1SBFA 5C8CB 5JZGA 5F39A 2FCTA 4A3XA 1EV13 4Z82A 4AQSA 4BMBA 1Q56A 4P9LA 4BLJA 3ZN6A 5FZ6A 2ARCA 5FP3A 1ASJ1 4P9IA 5FYCA 4YG0A 3SNMA 4UFMA 1S1AA 5FZGA 4BISA 4WM7C 5L9VA 2OPWA 1PVC3 3WY6A 5FMBA 5FYHA 3O1MA 1FV3A 4UXAA 5FOBB 1NAEA 2XJTA 2YG0A 4UFLA 2C6SA 3I8TA 1XNTA 3ZN4A 3WG2A 1V70A 1GFF2 3KB5A 4FOWA 1A3KA 1RUI3 2GDFA 4OUMA 2EICA 2N7GA 4RR3A 4LEJA 2I2SA 4PI0A 2HKXA 1GZWB 2GAUA 3KGZA 1G9DA 2BUKA 3MBWA 4YVWA 3NO8A 2HWF3 3WDYA 3ME2A 1NCQA 2AEYA 2VQUA 3ALQA 4MXWB 1VBC2 2BNOA 2WAAA 4KGGA 1VJ2A 4H14A 4OHXA 1CONA 2GN7A 3OD0A 4E9KA 1IPKA 1MVQA 1QJX3 2GALA 2RE9A 4RQPA 1CAWB 1DQ6A 1HV1A 1OOPA 1NCRB 1R081 3FE5A 2WZPP 3SHRA 2HWE3 1AR93 4QPYA 2WYFA 3RYKA 1LULA 3D0SA 2XKPA 2VQTA 1SFYA 3BPZA 1PIV2 2VJXA 1WMEA 2ZEWA 3LD8A 1D2QA 4XXPA 3RZHA 1F9KA 2RMU1 4PJYA 1KGYA 3VKLA 3ZYBA 4KWLA 4HVRA 1W6PA 4XBNA 5LEJA 2RS11 1A8MA 5J3UA 1ULGA 3C7OA 1QEXA 2CHHA 5JXIA 1DGWA 5IT6A 2D97A 1J1TA 1HB1A 1NLQA 2Y6FA 2XKOA 2AC1A 1EYBA 1S4CA 2YC4A 3B7MA 1YWKA 1O4TA 3EJKA 3OBAA 3AP6A 4N43C 1CGPA 3DF0A 4GXLA 3PJQA 1SLBA 1XNAA 1DZTA 4L0PA 1C3HA 1OC1A 5L19A 5L9RA 3WF3A 1YCIA 4WVWA 3Q8CA 1W2UA 1XNBA 1DF0A 4CUBA 4BDVB 3RMYA 4NPMA 4LE3A 3VBUB 3ZO0B 3V0BB 3WD5A 3PVNA 1QDOA 5FKCA 5FO7B 3DPRA 2XG3A 2VNRA 5CAZA 2XHNA 3J26N 3G7DA 3TN92 1FMD2 3U11A 3LWCA 2WT1A 3ZFFC 1JOPA 4IL7A 4NROA 3FN9A 4DY3A 1OPMA 4MLOA 4S2FA 4NHMA 3WW4A 3Q8EA 3T09A 5IK5A 2XBO3 4JGYA 4Z8BA 3I2DA 3W5MA 3O5SA 3K3OA 4W8JA 2R061 2FCUA 2HWB2 3BPSA 1N1TA 1S0FA 5DDJ2 3AYAA 3WG3A 3SC7X 4A6SA 3B69A 1I1EA 4OQ8A 1WWYA 1UOBA 3A23A 2VCAA 2QQNA 5H9PA 1VBE1 1ND3C 2JJ6A 5K0UB 4IEZA 4AQTA 4MADA 4YPJA 3ZYPA 4ES9A 1H4HA 4YNIA 1RVF1 4BE3A 2RS31 1COV3 1H4GA 1HIXA 4LLOA 2G9FA 1KFUL 1RUE1 1LOCA 4GKXA 3AJYA 5A6QA 5FZ8A 4LO4B 5C9AA 3O1TA 3VHRA 4OI0A 2WC2A 3O1RA 4W50A 2WT2A 4CXYA 4GKYA 2JG8B 3TEYA 4XUOA 2B45X 4OI2A 4DY5A 2WSUA 3W9AA 1WA4A 1IS3A 1GQGA 3M70A 3PJYA 2VZSA 1R1A2 2PHUA 3EQEA 1H2MA 1LRHA 2QQLA 3MUZ1 3TYJA 4NOTA 3HBZA 1LU2A 1RUG3 1UL9A 2ZKNA 3OSDA 4AHXA 4KWKA 5CIRA 3VBRC 5FFOC 4CEWC 1BK1A 3T0DA 1C8M2 1K12A 2LW8A 3K51A 3GXUA 2WL1A 5DUUA 3OB8A 4P9GA 1C57A 1K3IA 3K4DA 5EHDA 4QX1A 4D69A 1FOD2 5IVFA 2CAUA 2DUOA 3FX3A 1YI9A 2VZTA 4UAPA 1TNRA 3AK0A 4OUSA 4AEDA 3GYDA 2W39A 5IK8A 3HAGA 3C7EA 2EXKA 1BLZA 3ZSMA 3A21A 2D40A 3OOXA 4QDSA 1O5LA 1YQCA 4COUA 2FDHA 5A7OA 1DHKB 4XJ8A 4AVVA 3Q8BA 2JG9A 3UKNA 2EAAA 2JIJA 5FPZA 4MO3M 1N1VA 2R043 2QTWB 5A80A 2XOMA 1CIWA 2AEZA 4YZ4A 2P3IA 3AFGA 5E16A 1SLIA 5A3WA 1EV12 4CP9A 3ES1A 1X8EA 2BW8A 1Z0HA 2TBVA 3NW4A 4PDWC 4Y26A 3OTFA 1BMV2 1O91A 3AX4A 4NIDA 4QKNA 4MSVA 3DEMA 3VDDA 4Z2AA 2HJIA 1N1YA 5FWJA 3NQHA 3UESA 3FFQA 4D6QA 4QB6A 1ULPA 3LIGA 2ERFA 3V0AB 1WLTA 1PVC2 2BFUL 2PELA 3KD4A 1ALYA 4P9JA 4Y1YA 5BNPC 5GZFA 5LA0A 2I74A 3H0OA 5IK7A 1B35B 3WHTA 1J59A 5FPBA 3TOJA 3CNAA 1GZ9A 4OULA 3MI8A 4JGZB 2P6HA 1QJFA 3M3EA 1RUI2 3MEPA 1V9U3 4FCAA 3RG0A 4D7YA 5FLIA 4XOGA 3ZIWA 2PFWA 3AZWA 4M4PA 4Q4W1 5A7NA 5HV4A 2DFCA 2X53S 3CIHA 4WZCA 4OVEA 2HWF2 4ES8A 1GOFA 3VBOB 4XHBA 1PGSA 3FC0A 5A7WA 4QPGA 3ZYFA 1DG6A 1AF9A 1UZYA 3T4VA 3K4ZA 4GIQA 3SEEA 1MZ6A 1QJX2 3KGLA 4QM8A 1WMFA 3PUHA 3USSA 5A3UA 3BOPA 2ZGTA 1TEIA 4LHKA 2HWE2 1AR92 1O6UA 4S2HA 4TYSA 3B02A 4XZPA 2WUHA 1F4AA 1QJU3 1LOBA 1S2KA 4XTMA 4DXSA 3VKMA 2YGLA 2CAVA 3HOBA 2FDFA 2E26A 2ARXA 1W0OA 4NIHA 4XUNA 2RM21 2AACA 5DZGA 1H2NA 2HEVF 1XXNA 3HN1A 3POFA 2XWJB 3OGSA 5SV5A 1RUF1 3KMHA 5ABJA 4KNCA 3V64A 3T2OA 1ZBA1 3NMBA 5A6YA 1JHNA 4Y1XA 2VH9A 2YHJA 5FMCA 1IS5A 1MPXA 1RC6A 2CV6A 4QX7A 2NZ9A 4CDXB 4XABA 4B4RA 4CCCA 2LUWA 4ZY9A 4FAHA 5JWPA 2X05A 2BOIA 3I59A 4Q1PA 1SCSA 4FTBA 5FY0A 3WDTA 1QOOA 1DIWA 3DKWA 1MEC3 4IDZA 2CSGA 4I3PA 3ZN5A 4FP2A 1WW5A 5FPXA 2PAKA 1OLME 2YB7A 3S30A 2A6VA 5LASA 5EJZB 1W2NA 1PMJX 5FZIA 2JECA 5FK7A 4CDUA 2XHKA 2WINB 2XBO2 1AXKA 2JDPA 4L97A 1CAXA 1LU1A 3KZ4C 4MXVA 3WNMA 5LK7B 3THDA 5KC5A 2H0VA 3R0RA 4LIVA 3ATGA 5I91A 1CAUB 1ONAA 2C9AA 1VMHA 2XONA 3U37A 1U5ZA 3JQWA 1W9WA 5KXDA 1DFQA 1XU1A 4PBOA 3PUSA 3H3ZA 5FMOS 1LOAA 3JBG1 2BTVC 1UYZA 3E5XA 3AL6A 4E27A 2WNEA 3O7OA 5KXCA 1COV2 1U12A 1YJKA 4EN9B 4COZA 4C0HA 1J84A 4Q4X1 2W95A 2D6KA 3H1MA 2JB4A 3WVJA 1G7YA 1L3JA 5CEHA 1A34A 4HVQA 4BH9A 1OH4A 4XCAA 5BNNC 3RGBA 2LM3A 2W9XA 2Y64A 2XLFA 3NJVA 5CB7A 3OGRA 4Y5SA 1IZ3A 3PLQA 4PIZA 3OBTA 2ZMKA 3SITA 3VL8A 4XETA 1W8OA 2Y26A 5FUPA 2OPKA 3T2TA 1TMF1 3QBQA 1RUG2 2WS93 3GJBA 4HZFA 4K8FA 4D94A 2FZ1A 4QQHA 2B39A 3PUAA 4NHYA 4IGPA 4IE0A 4Y20A 2F4LA 2RR11 4CUCA 1W03A 1IG0A 2PAEA 1O8SA 2YU1A 3H7JA 3JQXA 3LPGA 3LSDA 4LO6B 3WW3A 4F7ZA 4YARA 3RI9A 4MUVA 1XSRA 2PA7A 3SQOA 1DYOA 3CDZB 4JC1A 1PM4A 5BY5A 4RD7A 2R042 2UWBA 2R073 3OUJA 3BIEA 2FHRA 1ZNPA 3AVSA 5EXOA 1V00A 4XTPA 5EFUA 2QE3A 3ST7A 1UXZA 1PK6B 2V09A 5CFCA 1M06G 3ZM8A 4IERA 3VDAA 3P1IA 4W6WA 4CUGA 1Y9QA 2WWJA 2IWGB 4ATEA 4CCLA 3D5OA 5I0SA 3BGAA 1X36A 3WNOA 4A44A 4L92A 4WM8B 4IV3A 5T5LA 5E1RA 4RS5C 3I3QA 2V4VA 3D3AA 1ULCA 3O14A 3ACIA 1PMHX 2YDEA 4GH4A 1UOFA 1S0IA 1RL3A 3BU7A 3AC0A 2XL9A 5APAA 5FY4A 4CCOA 4CUAA 1PGL2 2OA2A 1AJKA 3ZXJA 2JIGA 3KWVA 1N47A 2JD4A 3CMGA 1UMZA 3HNBM 3OF1A 1RUH3 3N7MA 4XQWA 4LKFA 1GANA 5H9QA 1V9U2 1QJY1 4Y33A 1HXS3 3HQRA 1O59A 4WM7A 1CESA 2WNUC 2P17A 4FPCA 1GP5A 1Q8SA 4LUKA 1UKRA 1W8TA 3MPBA 4FPHA 3WZ1A 4Q0VA 4YVSA 1HJGA 2XLGA 1AR63 3E6BA 1LAJA 5C5UA 5LEKA 4Q27A 2VUJA 2WRAA 1SDWA 3ACGA 2KM2A 1YFXA 2WFF1 1MS5A 2J22A 2XLAA 3MF6A 2AREA 2MEV1 5HXVA 1LGCA 1QJU2 2BU9A 3IIAA 3RWNA 3TBDA 1EY2A 3WP5A 1H30A 3WNLA 1LHVA 5A32B 1R091 5LBBA 3HNMA 4PT6A 3UGFA 4AGVA 4GULA 1KITA 2JKXA 1S55A 1GQHA 4QX5A 1RTVA 1UY4A 4IQPA 5DABA 4FPEA 1TME1 2QQIA 1VB4A 3HD8B 3T2QA 2VZ3A 1YQ8A 2VAUA 4YM0A 3A4UA 3W21A 5D8AC 1C5IA 4JKLA 4K21A 2AYHA 2BDRA 5CVRA 3S5QA 2O0OA 3WQ0A 5BNQA 1QXRA 4A7YA 3BI3A 2DCKA 3KVAA 4GWIA 3QLQA 5FYZA 3ZFGB 5C71A 5KHJA 5FYMA 3WW1A 2W1QA 3WG1A 5EV7A 3FJSA 1AX2A 3OYWB 2E51A 1Y4WA 3GBGA 1B35C 1BZWA 2ZGMA 4A6OA 2OQ6A 2WO2A 4Q4Y1 1OQEA 1MEC2 1RUD3 4N90A 1ENQA 3H50A 5FY9A 2PXJA 5FYSA 3RDIA 2VMIA 1LNSA 4IW3A 4YW1A 4UOJA 3WEZA 2BGCA 3WNNA 2JDYA 3LGRA 4YGCA 5C4WC 5J96B 2YYOA 2VMHA 1CJDA 1DU3D 1NUKA 1WGPA 4CRQA 1UOGA 5EQUA 5I8TA 4XJZA 4UI9L 1QGLA 4LBQA 5AFEA 1S0CA 3C3VA 2VC9A 3LPFA 5JSRA 1OF4A 3I49A 1AR71 1I3HA 3AZYA 5A7PA 2E63A 1A6CA 2NPIA 1CPNA 1N3QA 3ZFFA 3CEWA 3ZFEB 1Q8OA 1W2TA 5HBAA 4EYUA 4AZZA 3KV4A 2WO3A 4CCMA 1HKDA 4E8CA 4EN8B 1XNDA 4D6SA 2B9VA 3OGJA 4ASLA 1PX3A 3BTAA 4L99A 1OI6A 2WBKA 3GZEA 2EIDA 3DYOA 3NV2A 3FL7A 1H8TC 4MX3A 4RL7A 2JDZA 5L73A 2J42A 4H7LA 2HEWF 2OIIA 2XR4A 4Y5Z0 4CXXA 4E4ZA 1MQTC 1YRZA 4IE7A 1ND3A 3P3NA 2BRTA 1UPIA 4DUVA 5F9TA 4QU2A 5H9SA 5FMDA 1XNKA 5CFDC 1UZWA 1WCKA 2D6LX 2ET1A 3H1YA 2JDHA 4N8MA 2F6BA 4NAOA 1NE4A 2WS92 3KCCA 3MV01 1FATA 5L36A 2WABA 1TZOA 5LCWL 3PL0A 3H8UA 3AKPA 3AMHA 3ILRA 4QM9A 1YLLA 1CZSA 5K9YA 1XYNA 2G4IA 1W2AX 3OEBA 4FQZA 3MIHA 4EROA 1RINA 2J1UA 3A0NA 2D43A 1OLRA 5DPNA 2HWC3 2WLQA 1W6MA 5CU1A 5IW0A 4AG4A 3Q8FA 3VBRA 2VQAA 1VMFA 1LHWA 4JRAA 3NNGA 3I3EA 1PO11 4XJ9A 5KWRA 2XVGA 2R072 2ZGUA 3L9JT 1W0NA 2W91A 3UGGA 1LKNA 4UF0B 3FLPA 4LBQD 4BMEA 4CDQB 3WDUA 3WXPA 1HRV3 5ANQA 1X82A 5H9RA 1LHNA 3SLIA 4NWWA 1OA4A 2VL4A 2WT0A 2R0FA 4XE9A 4ZS2A 2WZR1 3WSOA 3HT1A 5T5OA 1ND2B 3M8LA 3BTYA 4DEQA 5C5TA 4AVAA 4YFZA 5A1FA 4KMQA 3WUCA 1VAVA 1DGLA 3LEIA 1LENA 2TNFA 5LBFA 4D8MA 2ZTNA 3UJOA 1BEV3 4BHPA 4QGLA 3VZJA 4XFGA 4LPLA 3PU3A 1ULOA 4EN7B 4TLFA 5F3GA 2ZGOA 1RUH2 3VBHA 1S2EA 1GKBA 1AYM1 1VBD3 1HXS2 3D4KA 3D82A 1J58A 1JXNA 3FFZA 2CYFA 3UL2A 3ZYJB 4Q4V1 2AGSA 3EB7A 5BNPA 1PZ8A 3B5LB 3RMXA 4Y1VA 4XF0A 4YFWA 4CU6A 2ZGKA 5ANNA 3OD4A 1AR62 4W65A 1OF3A 3ON7A 4QX0A 5AVAA 3GDBA 1RHI1 4R9BA 2RS53 4XFAA 1BJQA 2VZPA 2X5IB 1YQ5A 2TEPA 4GA9A 4GMP0 4M3CA 3AKSA 3AZVA 1A78A 4XAEA 3B01A 1YYNA 1ENRA 1T6GC 1KS5A 4DO0A 4HANA 1GLHA 2VOWA 3LEMA 4HPKB 1PK6C 4ZXEA 1V0AA 4Y22B 3Q9OA 5J7MA 5FIXA 4RN5A 5FPVA 4DNYA 4QHZA 2VMFA 3I3BA 5GLVA 4DPNA 4EWDA 1CPMA 1GR3A 3PVBB 3EO6A 4N9IA 2CWSA 5E89A 1GZCA 2HBUA 4URAA 2WR9A 1K5MC 3RJRA 3LA3A 5FYTA 3U78A 2K0GA 2P3YA 1SBEA 2NYYA 5DZEA 3WF2A 1Y9MA 4NUBA 4QD2A 1AVBA 1QOTA 1UYPA 1YQ6A 3OGVA 2ZGRA 2DDUA 2VZQA 1HRI1 2H0BA 1ODNA 3ZFEC 1RUD2 4FP3A 3I54A 2WNOA 1Z7S3 2PQQA 2K9ZA 1SPPA 1NA1C 4PQQA 5FUIA 4LR4A 3VBFB 5IATA 4PCRA 5BNOA 2NP0A 1XBFA 2W46A 5FZMA 4BOWA 5F3IA 3BCWA 3ELNA 4B29A 4FBFA 2P3JA 2LS6A 4Z2WA 1JYWA 5FZ0A 3C7FA 1LECA 1E5SA 3OY8A 4IV1C 4AK3A 2Q8CA 4B4QA 2DUPA 5JOXA 1DP0A 2GZWA 1APNA 4IGQA 3RYRA 2KR2A 5FPUA 1RUJ1 1BVVA 4N53C 4AHWA 1W6OA 2ZX0A 1PGW2 3MFCA 3U4XA 3MUY1 1ASJ3 1ODMA 4NJ4A 1DQ0A 4E4DX 1FMD1 1VMJA 2WQ4A 2E32A 3O0XA 5I0UA 2OYZA 2Y38A 3AFKA 5B2GB 4M3CE 4LBNA 1ENXA 5CISA 1FNZA 4XFIA 4MGKE 4CCDA 5F5IA 4NVPA 3MV11 4FO9A 2ZX2A 3MW2A 1OSGA 2P37A 2XL7A 3LCPA 1RUNA 1HB4A 4AW7A 5FY1A 4I0AA 4LK7A 5FY5A 3X29B 2PQSA 3LOBA 3VZOA 2GNBA 1V6KA 3IPVA 3IAPA 3H8OA 3RQ0A 3B00A 4A45A 2G9ZA 4GMP1 3ZFGC 2VTXJ 3OEAA 3KV9A 1XE0A 2EXJA 1H9PA 3BODA 3FZ3A 2GN3A 5L7OC 1OQ1A 1O3SA 2JX9A 4WV8A 3C7HA 1PZ9A 1HDKA 1K45A 1R083 4Q8LA 4QDRA 4AXOA 4XF9A 4TTGA 4MV2A 4I30A 4O9GA 2G1MA 1CR7A 3EXUA 3OPWA 3J8F1 4YW3A 3ZVXA 1WMDA 2FDGA 1HQWA 3GJAA 2EALA 2SLIA 2HWC2 2BVBA 1NYWA 2RMU3 3LSEA 1E5HA 4LT5A 5JPNB 5LATA 1DGRA 3DXTA 5CADA 1LOEA 2RS13 3WF1A 3ZYIB 3ZXKA 5JCTA 1VAMA 4PIYA 5FQ0A 5JLVA 1PM7A 1IGOA 2Q5TA 2Q0AA 1YFUA 4DUXA 1W8UA 4LUMA 3VB9A 2YPJA 5ISLA 3ZXFA 2QJVA 2Y60A 1IKPA 1XU2A 1HRV2 1E5IA 2VCMA 1VRH1 2B7YA 2Y6GA 2IVIB 2Z5WA 3IMNA 4R9AA 4SBVA 5AC91 1VPHA 5FZFA 2QKDA 1GBGA 4CXWA 5M0TA 1UXXX 1CQ9A 3NAPC 4XF4A 2O8OA 4CDWA 1JUIA 3J7LA 3ZPOA 3AMPA 2Y6KA 5FUNA 2ZX1A 3R05A 3ZOIA 1S0EA 1BEV2 1QH7A 4HN0A 2FDIA 4AQ2A 4O61A 4H3WA 2WFPA 1EV11 1VP6A 2VY0A 1LJ7A 4K1YA 4V2VA 4CEYC 2X10A 2EXHA 1URXA 4P9WA 4C91A 4EV0A 1REFA 1VBD2 2YC0A 1UX7A 2R063 5TSWA 4RS5A 3QACA 1RB8G 1C4RA 3H3UA 2C1FA 4WVMA 2JENA 2C4XA 3VZMA 1AL21 1SBDA 5C6CA 1VBE3 3CHXA 3VD5A 1C28A 5JZGB 1VBA3 5FJKA 2Q8DA 2OKXA 4AFAA 3WG4A 1S0BA 2UWAA 1RVF3 2RVAA 2RS33 4MH0E 1F2NA 2W1UA 2DCTA 3I2GA 2RS52 3SKVA 5KC6A 1RUE3 2ZGLA 5JR7B 5HXMA 5C8WA 5GLZA 2VG9A 5FMOL 4JV4A 1JOJA 2WNUA 2Y8KA 1CZVA 3KLSA 2R6QA 4TN7A 2B46X 2RDSA 5EZWA 3UK9A 2ZAHA 2EIEA 2JKBA 2ZGQA 3MYXA 4BK4A 5KXEA 1I5PA 2DCZA 2BZDA 1Z78A 3D6EA 1IHMA 4NHXA 4XCBA 1DQ4A 4ZONA 5LB6A 4AGGA 3FBMA 3I2HA 4TLGA 2VPVA 4CE8A 3K2OA 5G04L 3N7KA 1ND2C 2VOKA 4QHOA 2BYVE 1AR91 2WO7A 4RR3B 5FRAA 1GUIA 2VCBA 3JUUA 3IWZA 2I45A 1W3VA 1NZCA 4FXKB 1JH5A 1MS3A 4YVWB 1FPN1 1POV0 1NCQB 1CZTA 4PQ9A 2GH2A 2R16A 1VBB1 1OVSA 3THPA 1RGSA 4URTA 4BQ1A 1D0HA 4I02A 5IVBA 2PLV1 2GSYA 1Z7S2 3H1WA 2ZHNA 2XJUA 4RQPB 4X8NA 1OOPB 4ZXKA 4RGGA 5D8AA 1MR5A 4AI1A 1ZBE1 4COYA 2DV9A 1UWWA 4B1MA 2QQPA 2VNGA 1JOBA 4F8AA 1F4HA 3N9OA 1EAH1 2XJSA 3LE0A 1N1SA 1DGRN 2ZHKA 4QQOA 2Y0IA 3P5BA 4XJUA 2XMLA 2ZOEB 3POWA 1W6PB 2OX0A 2VZRA 5F2SA 2DVFA 3ENRA 3M3CA 1ASJ2 2X5IC 3WV6A 2YMZA 1L7QA 5C4WA 4A7ZA 2QCSB 1WMXA 2E7AA 3FMGA 3VBSA 3AP4A 5T3NA 3GF6A 4YW5A 1XOYA 5AFBA 1AJOA 1EP0A 1GU3A 5DUWA 4AOCA 5HI0A 1US3A 5FXZA 1NXMA 2W08A 4NPRA 2J1EA 3JCIA 1H8VA 1CAVA 4ONUA 3DPRB 5FZ1A 4BB3A 2DF7A 4Q4W3 2D6OX 4B3NA 4OMDA 1MS9A 2RDQA 2FBEA 2AUYA 4GAZA 4N7UA 4XVHA 2JB8A 1WA6X 5KHGA 3EHKA 5HCHA 3NNMA 4AWDA 2UY8A 1COV1 1GSLA 3NNFA 4XDQA 5F5QA 1H8TA 3SMHA 4XJAA 2AR6A 4IEXA 4EN0A 2G19A 2CGNA 1MQTA 1WZXA 1RMU1 1R082 2LALA 2CGOA 5LK5A 3VBFC 4C1WA 5JXHA 3IB3A 2GU9A 3WUDA 4MZUA 4B7EA 5J36A 4MG2A 3AP9A 4Q2FA 4QU1A 2Y33A 2E7QA 1ZM1A 2ZHMA 3M2MA 5EJ3A 1SMVA 2D5FA 4FFFA 4QAWA 5CFDA 1GOGA 1GWLA 5C70A 1OLMA 1W6NA 1OXCA 2RMU2 3FHQA 3PURA 5EYYA 3SH4A 1NY71 3N3HA 4BQ4A 1OFSA 5JR2A 2RS12 5C9AB 2VW1A 2RM23 2A7AA 2OQ7A 1DDLA 4GB31 4KH9A 4KWUA 2PHWA 1POV1 2UY9A 3GBFA 3KSCA 3LEKA 4QPIC 5BV6A 5LW9A 1RUF3 5A7SA 2DFBA 2BNMA 2W0XA 1UZ0A 4YW6A 1ZBA3 3NV3A 2VZOA 3J7MA 4XMIA 4KBZA 3ZYRA 5GLUA 1EUUA 4K40A 3W58A 1QXJA 1W0PA 2ZA9A 3KV6A 4Y1ZA 2WNVA 2ZZJA 5E8AA 5LZ6A 1DGWX 5BPXA 1OD3A 4QWNA 3O1UA 1AYN1 1MS8A 4GJZA 1PHMA 1WUVA 1GICA 4K8RB 4UBGA 5C8CC 1HLCA 1GNHA 1NQJA 4JDMA 5GLTA 3NKTA 3RZJA 1H1IA 2YV8A 1W39A 3HPNA 4JHTA 1O4YA 4OHWA 4AEDB 2X8KA 1EPWA 3MHZA 4W4ZA 4PHZA 2R062 3DN7A 2D3PA 3DGTA 4Q5OA 4R52A 2X29A 1OFNA 2RDRA 2VBPA 2WZ8A 3Q8AA 1VBE2 2CDOA 3TRSB 2KA3A 1UO9A 2J1VA 5FZ7A 5JOWA 3HVDA 1VBA2 1JYCA 2WWUA 3JBG3 1PGL1 3TAYA 4NPLA 4CP9B 1OA2A 1RVF2 2RS32 4ISRA 2WIIB 1PMIA 2IVJA 1KDKA 1OVPA 1RUE2 2CNAA 4XILA 1IKQA 2VTXA 3POSA 4Q4X3 5JIAA 1UAIA 4KG0A 3POEA 3VDDB 2Y0OA 4EJRA 1L7RA 4C0BA 2PHRA 4OLLA 2L9LA 2VO5A 4FPLA 2Z79A 1S0DA 4QB1A 1GNYA 4F3JA 2A3XA 5DZFA 2VW0A 3LA7A 5LRRA 4UFHA 2ZEYA 4HVOA 1QQP1 4QQ2A 3RS6A 3IN9A 2YBKA 3RI8A 1TMF3 4Q1RA 4M3CF 2WAOA 5A3TA 2WQZC 4OI1A 2BPA2 1NCRC 1JBCA 3MFAA 5FY8A 3HWJA 3QH7A 5LBCA 2W47A 1AR81 2RR13 5T5PA 1OMIA 2X09A 1SEFA 1ZA4A 2W68A 4PLOA 3N9QA 4JHZA 4QXCA 5A7WB 4BK5A 4YM1A 4QPGB 1W90A 4OZXA 4BXSV 4NWVA 1QNYA 3SCGA 4QB2A 2VE1A 2C26A 1ZZ9A 5F6KA 1YIPA 1K5MA 2XH6A 4LBMA 4NHKA 1RUC1 1DZRA 1OLQA 5FXXA 3UGHA 3HNYM 3TNPB 5GKAC 1M4WA 3CJIA 1QY4A 2FMYA 5JZGC 3BALA 3PVEA 1VR3A 4AI8A 4NN0A 2YZ4A 3VBUC 5JSOA 1NLSA 4OUEA 1NA1A 1G8WA 1F5JA 2WJSA 2ES3A 1OKOA 1XQNA 4G4FA 4LKSA 1HN1A 4CCNA 1LOFA 1BBT1 5C3SA 2VZ1A 3POYA 1U5IA 4IV1A 4LXLA 3VD4A 2D5HA 1IQDC 2ZHLA 3ZR5A 4GALA 4S2DA 2XJQA 1X7NA 2OUHA 2VTFA 3CU7A 4N53A 3I59B 5K4LA 4FI9A 2XPJA 1D7PM 1GWMA 1UY3A 5A1AA 1QJY3 3E5UA 3ETPA 1JZ7A 3U4SA 3LA2A 2GMEA 4Q4W2 3GHNA 1T2XA 3JB4C 5A33A 3CZJA 5K0UC 2R30A 3RZGA 2B8MA 3BN6A 2Y34A 3O0WA 1GOHA 4CDUB 2JICA 4AR2A 4A3ZA 1UZVA 1NCQC 4TWTA 1F35A 1CAXB 4KI5M 1QU0A 2P2KA 2QNKA 3AZXA 5D1IA 5FZ9A 3VZNA 2DU0A 2JG8C 2WFF3 1CX4A 2W5FA 3LB9A 1OOPC 4QXBA 2MEV3 1JS9A 1ZZ8A 2J1TA 1HN0A 5FWEA 5K8SA 1UMIA 3LDBA 3I2IA 3B94A 3OUIA 4IETA 3AKTA 5LY2A 2V72A 4XPVA 5FZKA 1WW7A 1R093 5JSPA 3RNSA 1AUYA 4HONA 1UU5A 2JDAA 1CWPA 2VZUA 2WS91 5JI9A 5L7OA 1RXGA 4X8PA 2RM22 3T0BA 1CX1A 3F95A 1TME3 2BERA 1SACA 4LMFA 4I0WB 4CP1A 3BU0A 4HN1A 1RUF2 2HLEA 1TNFA 1ZBA2 4XDOA 4XFHA 4IE5A 4YRDA 4AYUA 4LBLA 3IBMA 1NLRA 4HMZA 5AVPA 2NN8A 4J25A 2YPDA 4M0HA 4PI2A 3VD7A 1W8ZA 3ILNA 4IEUA 4Q4Y3 4CZSA 3VZLA 4BQXA 2IXLA 2OXBA 3DL3A 4XW3A 1G9BA 1SLTA 1ZYBA 2E9QA 4Y20B 2DYCA 1V6LA 3ZXAC 4IXLA 1G9CA 2PHTA 2YXSA 4XURA 1WBFA 3RWKX 3T0AA 4INDA 2W52A 3ACFA 3EBRA 1US2A 1ULFA 4OYUA 1OPOA 4UFKA 4I09A 3M3QA 4L11A 1O8PA 3NAPA 3H8XA 3JU9A 3M1HA 5IVYA 1AR73 1A8DA 1KJLA 4LKEA 3URFA 2JDMA 3B9CA 4DZGA 5F5AA 2BVVA 3U07A 2HBTA 3VKFC 1UU6A 1Y43B 1OT5A 2JDUA 2ZX3A 3B93A 3WQ1A 3JBG2 5CFCB 4PF5A 3AYEA 4HKOA 3MDPA 2OS2A 4XBQA
chains in the Genus database with same CATH topology
3BIEA 4O61A 4NROA 4NIGA 4MG2A 2FDJA 4CXXA 4IE7A 4QKFA 3BKZA 2FDFA 3I3QA 3RZKA 4NIHA 2FD8A 3KHBA 4ZS3A 4NIIA 3S57A 3O1TA 3O1RA 4IE6A 4CXYA 4ZHNA 3O1VA 3RZGA 4NJ4A 4MGTA 3I2OA 4IDZA 4NRMA 3O1OA 3H8RA 4QHOA 3O1MA 3RZJA 4JHTA 3T3YA 4IE4A 4ZS2A 3H8OA 4QKDA 3BTYA 3I3MA 4NRPA 5DABA 2FDHA 4NPLA 3BU0A 3KHCA 3O1UA 4IE5A 3BI3A 2FDGA 3BTZA 3BUCA 4QKBA 3O1SA 3T4HB 3O1PA 4NIDA 4QKNA 3RZHA 3RZMA 4NRQA 2FDKA 4OCTA 3BTXA 3LFMA 4IE0A 4O7XA 3H8XA 3RZLA 5F8PA 3I49A 4CXWA 3S5AA 4NPMA 4RFRB 2IUWA 2FDIA 3T4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIE A;  4O61 A;  4NRO A;  4NIG A;  4MG2 A;  2FDJ A;  4CXX A;  4IE7 A;  4QKF A;  3BKZ A;  2FDF A;  3I3Q A;  3RZK A;  4NIH A;  2FD8 A;  3KHB A;  4ZS3 A;  4NII A;  3S57 A;  3O1T A;  3O1R A;  4IE6 A;  4CXY A;  4ZHN A;  3O1V A;  3RZG A;  4NJ4 A;  4MGT A;  3I2O A;  4IDZ A;  4NRM A;  3O1O A;  3H8R A;  4QHO A;  3O1M A;  3RZJ A;  4JHT A;  3T3Y A;  4IE4 A;  4ZS2 A;  3H8O A;  4QKD A;  3BTY A;  3I3M A;  4NRP A;  5DAB A;  2FDH A;  4NPL A;  3BU0 A;  3KHC A;  3O1U A;  4IE5 A;  3BI3 A;  2FDG A;  3BTZ A;  3BUC A;  4QKB A;  3O1S A;  3T4H B;  3O1P A;  4NID A;  4QKN A;  3RZH A;  3RZM A;  4NRQ A;  2FDK A;  4OCT A;  3BTX A;  3LFM A;  4IE0 A;  4O7X A;  3H8X A;  3RZL A;  5F8P A;  3I49 A;  4CXW A;  3S5A A;  4NPM A;  4RFR B;  2IUW A;  2FDI A;  3T4V A; 
#chains in the Genus database with same CATH topology
 4JGZ C;  4Q4X 2;  1Q8Q A;  4P9Y A;  1UCX A;  4V2W A;  5ACA 1;  4J1W A;  4N43 A;  2VUA A;  4NO4 A;  5A3P A;  1GNZ A;  2FDJ A;  5FZ4 A;  4A7K A;  4AL9 A;  1IOA A;  1P8J A;  2NMO A;  4DOU A;  4FAG A;  3GAL A;  4GH4 B;  5I0T A;  5ABJ B;  3VBO C;  2V5Y A;  4AI3 A;  2OW4 A;  2GC2 A;  4FPJ A;  4LLF A;  1D4M 1;  2DWR A;  1TMF 2;  1W3X A;  1YNA A;  3A0K A;  5DG1 A;  3ZXG A;  4AHZ A;  1V6I A;  2CGP A;  4BJ0 A;  2A75 A;  4ET7 A;  1UYX A;  3JD7 1;  3OGG A;  4KU7 A;  4LTA A;  4ZPI A;  3WLU A;  3K77 A;  5IK4 A;  3UYJ A;  4WM7 B;  2RR1 2;  2O14 A;  3KF5 A;  1GV9 A;  2XJR A;  3S57 A;  2WQ8 A;  4FQ4 A;  4OQ9 A;  1SHW B;  4DMI A;  1QWR A;  2H6B A;  4XBL A;  1BQP A;  3AJZ A;  4SLI A;  4YVS B;  4YGB A;  4GD4 A;  2A6Y A;  5HCF A;  2YFZ A;  1KDM A;  4ZU7 A;  1ZRE A;  5C7G A;  5J37 A;  3USU A;  5F1R A;  1J1L A;  4WZF A;  1TQ5 A;  1JZ4 A;  3FHI B;  4NRM A;  3DV8 A;  3IKW A;  3S6P A;  1PO1 3;  2PHD A;  2B5H A;  2O8Q A;  3KCX A;  4ZU5 A;  5IFT A;  1O4Z A;  1ZA7 A;  2IXI A;  4HG6 B;  5FZB A;  5T54 A;  3O12 A;  1BXH A;  1NT0 A;  1QH6 A;  1YI7 A;  2HWD 1;  1AL0 G;  4CDX C;  4FTE A;  2NLR A;  5CKQ A;  4PIX A;  4ATF A;  1RIT A;  3CJX A;  1GQP A;  4JKK A;  2Q8E A;  4MGQ A;  2WN2 A;  4IES A;  4P02 B;  3TEX A;  3TEW A;  3IMM A;  4FTS A;  4E2Q A;  1O3Q A;  4AI9 A;  4P14 A;  5FTT C;  5JOZ A;  5FZO A;  3DCQ A;  4R8H A;  4XQD A;  4XZU G;  3TB0 A;  4QX8 A;  4EWA A;  4HFS A;  1CJP A;  5FO8 B;  4KBB A;  1JW6 A;  4LOS A;  1YJL A;  4FOQ A;  1HW5 A;  5A1L A;  5CYY A;  2J1A A;  3BYW A;  4QX2 A;  1D0G A;  1EUT A;  3MPP G;  3GHM A;  4RHV 1;  5FPL A;  3ZR6 A;  3N9L A;  4CEW A;  4YW2 A;  1AYM 3;  2IFR A;  2X5I A;  1QJY 2;  2WA3 A;  2ZPX A;  1C5H A;  4XMA A;  5IHR A;  3R4U A;  3MW4 A;  1OKQ A;  2CWM A;  5J1X A;  1KQR A;  1HX6 A;  2BWA A;  1X33 A;  2J1S A;  2D44 A;  4Q4V 3;  3T4H B;  3O1P A;  5DXD A;  1ZRC A;  1PO2 3;  4BPZ A;  3AB0 A;  5JXG A;  3KF3 A;  2E6V A;  4HPK A;  5GZG A;  1NZI A;  4XEZ A;  4EE2 A;  1RHI 3;  4LBQ B;  4OCT A;  2WFF 2;  4MET A;  4ORF A;  5DAQ A;  3BTX A;  5FP9 A;  2MEV 2;  2P6C A;  3QD6 A;  4QDQ A;  1QXP A;  1ZX5 A;  2D93 A;  2Z69 A;  1JU3 A;  3ZFF B;  1STM A;  4JRL A;  3UKV A;  1R09 2;  4R9C A;  1DCS A;  1IPS A;  2A6W A;  2C0Z A;  5J98 B;  4PDW A;  4B1L A;  2P5B A;  5G05 L;  4CEY A;  5FYY A;  1AX0 A;  2A3Y A;  2ID4 A;  5DN2 A;  4COV A;  4YLZ A;  1SG3 A;  1YHF A;  1TME 2;  1LES A;  2VVE A;  4BQ2 A;  5FZE A;  4AVB A;  2D3R A;  2IXK A;  1BVP 1;  1IS4 A;  3OCP A;  3IDC B;  5CNA A;  1ND3 B;  4LBJ A;  1GWK A;  5FYB A;  4AVS A;  4NIG A;  1WW4 A;  1YO8 A;  5KHI A;  4LHS A;  4QT6 A;  1YC6 1;  1BKZ A;  2VOV A;  2BWC A;  4HSL A;  4JCK A;  1HRI 3;  4I0B A;  1KS4 A;  1QDC A;  4Q4Y 2;  2RJL A;  5JMO A;  3PVO A;  3LF7 A;  3HMY A;  4YGE A;  4QPI A;  1L7L A;  1OUR A;  2YGM A;  3K4A A;  5FY7 A;  5LA9 A;  3C7G A;  3SKJ E;  4DUW A;  1KD7 A;  1TE1 B;  3N36 A;  3NST A;  2XDV A;  4P5Y A;  1CIY A;  1VBC 1;  4ZS3 A;  5JI7 A;  3T08 A;  1ZZ7 A;  1W6M B;  2DCY A;  2VVF A;  1I6X A;  1YUD A;  3K3N A;  4JVA A;  1HB3 A;  3VBR B;  4XAC A;  4ZZ8 A;  1R64 A;  1RUJ 3;  4IE6 A;  1YIF A;  1UY0 A;  3ITQ A;  4WM8 C;  4ZHN A;  2VMC A;  1AR7 2;  3N9N A;  5GM0 A;  3T30 A;  2UYB A;  3O1V A;  2QQV A;  2GMP A;  4QXH A;  3IT8 A;  4Y5T A;  1MVE A;  1PIV 1;  3WP6 A;  5BNN B;  3D8C A;  5C8C A;  2LTN A;  2W1S A;  3LDR A;  4AE2 A;  5JDB A;  3E6C C;  1IS6 A;  1FXZ A;  1W04 A;  5F3E A;  5BXX A;  3ZDV A;  4CA9 A;  3I4I A;  2VBD A;  3MLJ A;  3POJ A;  4NR1 A;  5CG8 A;  2JE8 A;  2OVU A;  2Y6L A;  3DEC A;  4QGN A;  2ZMN A;  4CP0 A;  2QZ2 A;  4NAM A;  1JHJ A;  4CU8 A;  3W5N A;  3KQR A;  1I9R A;  2RV9 A;  2LRO A;  5KHK A;  4QKD A;  3VDC A;  5JXJ A;  1HQN A;  4GMP 3;  4L2N A;  3V56 A;  3I3M A;  4HKW A;  4UYB A;  2IXJ A;  2Q1Z B;  3VBH B;  2Y6J A;  3CL1 A;  3TN9 1;  2P34 A;  3KHC A;  1UPS A;  2IC1 A;  4L8Q A;  4O9E A;  5F5C A;  5BUV A;  1GZW A;  2Q4S A;  4U2A A;  4QX3 A;  4P5H A;  2QFE A;  2VUC A;  1LGN A;  1WW6 A;  3J8F 3;  4YZ1 A;  5BNP B;  5FBZ A;  1VAK A;  4MXW A;  4G9S B;  1S2B A;  3KT1 A;  1JTZ X;  4AVC A;  1LHU A;  1CVN A;  3E5Q A;  1JZ5 A;  4BYY A;  1Q43 A;  4GWM A;  3ZPY A;  5J09 A;  3WDX A;  2FCV A;  2HWB 1;  5DDJ 1;  1CAW A;  4CVU A;  1NCR A;  2B4K A;  4Q0S A;  3GCW A;  4M3C B;  3PHM A;  3IM0 A;  5IVC A;  1PO1 2;  4LHL A;  5ERL A;  5L9B A;  1WCU A;  5LBE A;  3RZM A;  3ZMO A;  2EXI A;  5KXB A;  3AKQ A;  4CCJ A;  1WCS A;  2E33 A;  4FXG B;  4J1X A;  4D0Q A;  1J3Q A;  5GZD A;  1VRH 3;  1W6Q B;  4XFC A;  3ZSL A;  4D7T A;  4P00 B;  4OHZ A;  2O1Q A;  4L9B A;  5AC9 3;  4OI4 A;  3ZIX A;  2G9G A;  2QQM A;  3WCR A;  3PME A;  4DQA A;  4IUG A;  4EZ4 A;  1Z7S 1;  4QGM A;  5BNN A;  5FPA A;  2VXJ A;  1UKG A;  1TG7 A;  1H6Y A;  3N35 A;  3TEZ A;  3U10 A;  5JUV A;  4C90 A;  4MOA A;  3UNP A;  3H42 B;  3UJQ A;  3VV1 A;  3M4F A;  3J7H A;  3H9A A;  1R1A 1;  3T2P A;  1JN2 P;  2VMG A;  3VDB A;  2VNO A;  3KT7 A;  3R4S A;  1Y7B A;  5IVE A;  1J83 A;  3VBU A;  2VOT A;  3V0B A;  2DUQ A;  1AYM 2;  3HIF A;  4LIT A;  1JZ6 A;  4R4Z A;  1SPP B;  2ILM A;  1C8M 1;  3C8X A;  2VXR A;  2R0H A;  2D98 A;  4LKD A;  4AF9 A;  3ILF A;  5BNO B;  4WVZ A;  1SLC A;  4MGS A;  4DRV A;  3U14 A;  2QDN A;  1FOD 1;  4Q4V 2;  1UOJ A;  1AL2 3;  1NE6 A;  1PO2 2;  2VR4 A;  4PLM A;  4RSU A;  4Y4R A;  1IG3 A;  1OH3 A;  3OY8 B;  1VAL A;  4I01 A;  2Z2S B;  3KHB A;  1FYU A;  1QKQ A;  3QCW A;  3TWI A;  5A6X A;  4YVS C;  4AFD A;  5KBF A;  1RHI 2;  1W6O B;  1UW8 A;  1IPJ A;  1AZD A;  2SBA A;  5FLH A;  5A3M A;  3J9S A;  5GZC A;  1RUO A;  2ADD A;  3SH3 A;  3EYP A;  5K0U A;  1H1M A;  2CTV A;  1EPZ A;  4LO8 A;  4PLN A;  5FR3 A;  1TVG A;  3L2H A;  3HBK A;  3JB8 A;  4KGQ A;  1QIQ A;  1JZ2 A;  1X9P A;  3AP5 A;  3WX5 A;  1SDD B;  1BMV 1;  4JQR A;  2RJ2 A;  2YY1 A;  2ZZQ A;  2EIB A;  4OFG A;  2VD7 A;  1LED A;  2JG8 A;  2Y6H A;  1XJA A;  5FCC A;  2W92 A;  3ZKY A;  4P08 A;  3FLT A;  4IEP A;  1REE A;  4AGR A;  3LKJ A;  4BQ3 A;  1UF2 C;  3IPV B;  2BGO A;  1PVC 1;  3SCH A;  5IAX A;  3N7J A;  1LCL A;  4YW4 A;  4ASM B;  1FPN 3;  1JYI A;  2Q1M A;  3CQO A;  2JD9 A;  4AFM A;  1AXZ A;  1FAY A;  1QJZ A;  4NMI A;  3RYP A;  1BK0 A;  1HJF A;  1HRI 2;  1VBB 3;  2XGX A;  2KXL A;  4MGY E;  3ZN6 B;  1RUI 1;  4Q29 A;  4XUQ A;  4D7S A;  2PLV 3;  2R1B A;  1GZT A;  1NG0 A;  3KQ4 B;  3APB A;  4FOV A;  1KFX L;  2GC0 A;  4HSJ A;  3S7E A;  4YW7 A;  5JAX A;  3HEI A;  2WLP A;  4H55 A;  2E7T A;  1ZBE 3;  4K7J A;  3VL9 A;  2HWF 1;  1E5R A;  4UW5 A;  4CCE A;  2RDN A;  3FBY A;  4Y4Y A;  2NM1 A;  4WBB A;  4CDQ C;  5FK8 A;  5KHH A;  5IVV A;  1EAH 3;  2GC1 A;  5I8Y A;  2WZE A;  1O5U A;  1OD5 A;  1QJX 1;  1DQ1 A;  1RUJ 2;  4UW4 A;  5IUQ A;  2HWE 1;  5FP7 A;  1X8M A;  2XUM A;  5FQ0 B;  1LB2 A;  1W99 A;  4UT5 A;  5I8S A;  4JAA A;  2QQJ A;  4R4X A;  4C8D A;  4RGK A;  2HH9 A;  3MW3 A;  4J6G A;  1G9A A;  4CPB A;  3IZO A;  4OMC A;  5DQ0 A;  5T50 A;  1WCQ A;  4IEW A;  1F31 A;  2KD7 A;  4XIK A;  4Y3O A;  4NRQ A;  4YGD A;  2VEC A;  5A70 A;  3POI A;  2EF6 A;  1ZZ6 A;  4CDW B;  3V0A A;  2NMN A;  3LEG A;  3III A;  4I3G A;  1JZ3 A;  2V4A A;  4PF1 A;  3GZU C;  2DVG A;  3MIG A;  3S5A A;  1UNB A;  5FZD A;  1B35 A;  4E2G A;  1VBA 1;  4EWE A;  4JDN A;  4S2G A;  1V6O A;  4JGZ A;  5CZK A;  1UQX A;  1RXF A;  1ULE A;  2LRP A;  1Q5O A;  2XVK A;  1LHO A;  4XAA A;  3ZDS A;  4AEM A;  3NJZ A;  4RS5 B;  2UWC A;  1RMU 3;  2DVD A;  3HR9 A;  3M3O A;  3VHO A;  5LY1 A;  2J1R A;  4AEK A;  4WVM B;  3J8F 2;  1U5Y A;  3VBO A;  5CG9 A;  1T6B X;  5JVV A;  3HT2 A;  1UY1 A;  3KV5 A;  2XBO 1;  3H3L A;  3MIE A;  4BWO A;  1FT9 A;  3LQC A;  3VHP A;  1JZ8 A;  1RIR A;  5FYI A;  3P6B A;  4DRR A;  1W9S A;  3ZSE A;  2R7E B;  2EA7 A;  3IAQ A;  1LOG A;  1Q8P A;  3RZZ A;  3AXE A;  1QNW A;  2J7M A;  4GB3 3;  2H6C A;  5FZA A;  4PBP A;  1DYK A;  2FD8 A;  3KCY A;  2DCJ A;  1POV 3;  2WNU B;  1OQD A;  2VOX A;  1H9W A;  4K6B A;  2IXH A;  3J7N A;  4BM8 A;  5C3P A;  1ENS A;  1UYY A;  5DAP A;  1VRH 2;  4JGY B;  3MO4 A;  2VQ0 A;  2WYS A;  5AC9 2;  5DAX A;  1OUS A;  2XB6 C;  3O0V A;  5C33 A;  5DAW A;  5JIU A;  3FWE A;  1NKG A;  1F5F A;  2AH2 A;  4YZ2 A;  3ETQ A;  4R9D A;  4CPB D;  1H2L A;  3U1X A;  2QQW A;  1W8H A;  2UU8 A;  4DB5 A;  1AYN 3;  1UY2 A;  5D21 A;  1FI2 A;  3AYD A;  2XUE A;  3ZYH A;  3E6D A;  5DAV A;  2RJK A;  4CDX A;  2FZ2 A;  2VMD A;  5GZE A;  4A41 A;  4LOR A;  1RUG 1;  3VZK A;  1H0B A;  2B42 B;  4XQ4 A;  2JE7 A;  5I0R A;  4O65 A;  3VBH C;  4BCU A;  3AL5 A;  4AEJ A;  2VCC A;  1N3P A;  2D6N A;  1DLL A;  2TUN A;  5LWB A;  4XYX A;  1DLC A;  5D8A B;  4IE4 A;  4Z07 A;  3T3Y A;  5FP8 A;  3WP3 A;  2JDK A;  5FOJ B;  3BVC A;  1AL2 2;  1N3O A;  1S0J A;  2XJV A;  4HT1 T;  4LO5 B;  4XUP A;  4QQP A;  1UN1 A;  4CU7 A;  5FYV A;  2JXA A;  2ZS6 B;  5B4X A;  1DYP A;  1S0G A;  1PNG A;  2ORX A;  2ATF A;  4DFS A;  4LA2 A;  5B4N A;  3ASI A;  1CAU A;  4A42 A;  4NHL A;  2XVL A;  2CY6 A;  4JDO A;  2R1D A;  4FT8 A;  4AAX A;  2R04 1;  3FHA A;  4FPO B;  2ENR A;  1D2S A;  5C4W B;  4HKL A;  1UZZ A;  3PNA A;  2R32 A;  3AMQ A;  1MZE A;  2A73 B;  2PHL A;  3VBS B;  2VW2 A;  1WLC A;  4QKB A;  2AEN A;  4AAP A;  3WHU A;  5A6Z A;  4TZD A;  1W06 A;  5DUX A;  1BCX A;  1NQD A;  4ARX A;  1QQP 3;  2ZAA A;  4UBH A;  3VGI A;  3WQB A;  1MZF A;  4NIA A;  3RJ2 X;  4ISQ A;  4KG8 A;  1LOD A;  2WWS A;  3UET A;  1XE8 A;  2BBV A;  1CAV B;  2YBS A;  2JG9 B;  4M00 A;  4CCK A;  2OZ6 A;  2A71 A;  1LEM A;  1J3P A;  4IEY A;  1HQL A;  3PU8 A;  3LDK A;  1AR8 3;  1FPN 2;  3MIB A;  3I3D A;  3A22 A;  3GZA A;  1AHS A;  1WLD A;  3MLL A;  3POG A;  3N4M A;  4O7X A;  4LO7 A;  3UKT A;  1VBB 2;  4BXF A;  4ZKT B;  2QBX A;  3B9I A;  5F32 A;  3C2U A;  3MZH A;  1V9U 1;  5FBJ A;  1H8T B;  2WSV A;  2PLV 2;  4RGA A;  3TNQ A;  2A6Z A;  4OZO A;  4RFR B;  2R49 A;  2DTY A;  1MQT B;  4CU9 A;  3U75 A;  1ZRR A;  5IYY A;  4BA6 A;  2D7F A;  2WN3 A;  4BLI A;  1RUC 3;  1ZBE 2;  2ORZ A;  1POQ A;  2UUR A;  5BNO C;  3AXD A;  5HV0 A;  3F2Z A;  4DXZ A;  3JXS A;  1SLL A;  1QHD A;  1EAH 2;  5CFD B;  1H2K A;  2OUJ A;  3LIH A;  3D0J A;  2PHF A;  1W6N B;  3CO2 A;  3N7L A;  3NRU A;  3IDE A;  4AFB A;  1PNF A;  1LGB A;  2HYX A;  4JX0 A;  1BHG A;  3NJY A;  2OT7 A;  3WIN E;  1RJ7 A;  5HPO A;  2CL2 A;  5A3O A;  2CDP A;  1DZQ A;  1QJU 1;  2C5D A;  3ES4 A;  2HEY F;  4Q0P A;  1BBT 3;  2E53 A;  2GND A;  4EZH A;  5FAX A;  1HB2 A;  5KR7 A;  1PK6 A;  5IAV A;  1ST8 A;  5FJH A;  4IGO A;  2ZX4 A;  5JMC A;  1JI6 A;  3THC A;  5FO9 B;  3VD9 A;  2DVA A;  3CKH A;  4UWD A;  2PHX A;  5T55 A;  2RG4 A;  2WNV B;  4XHX A;  4WM8 A;  1B09 A;  1ACC A;  5I93 A;  2P1B A;  2BJS A;  1JYV A;  1WD4 A;  5IFP A;  4BZ4 A;  1G86 A;  2YFU A;  2DVB A;  4GZ9 A;  1KRI A;  3ACH A;  1YFY A;  1UU4 A;  1SQ4 A;  2PTM A;  3GCX A;  4M4R A;  3SCF A;  2BGP A;  1VB2 A;  4QQL A;  3ZYG A;  2ET7 A;  3VKN A;  3ZXD A;  4LK6 A;  2GP5 A;  3S7I A;  2ETE A;  5FZL A;  1MEC 1;  4AI0 A;  1KJR A;  4I2O A;  1PVX A;  4LIU A;  4FSJ A;  1FX5 A;  1F15 A;  1RMU 2;  3CLP A;  4JKM A;  1ULD A;  3OBZ A;  1XYP A;  4Q0U A;  3NNL A;  1IQA A;  1YFW A;  4HLT A;  4IEV A;  3FUQ A;  4FOY A;  2QDR A;  3CF6 E;  3NL1 A;  2VGD A;  3BIW E;  1RED A;  1XE7 A;  3PIG A;  3WQ7 A;  5A3L A;  2MPF A;  4C1X A;  4GWN A;  5D2A A;  4BQY A;  3H7Y A;  2D6P A;  5DUV A;  1NY7 2;  4E4S A;  4TXW A;  3ECQ A;  1FV2 A;  4K1Z A;  5K7P A;  2I07 B;  4EN6 B;  4GB3 2;  4AHY A;  3FLR A;  4RR3 C;  4B8E A;  4BIO A;  2WO1 A;  4YG6 A;  4JTO A;  4ZZ5 A;  2ZGP A;  4M01 A;  5A32 A;  4A4A A;  4LUL A;  2XWB B;  1OUX A;  2BEO A;  4YVW C;  2PN5 A;  5F7U A;  2DBI A;  4XFB A;  1GMM A;  3N9M A;  3VN4 A;  1K42 A;  2BV4 A;  2VBB A;  3NV1 A;  3OBR A;  1X9T A;  1VRB A;  4GQ7 A;  3BUC A;  4RQP C;  1GP6 A;  5T52 A;  2ZGS A;  2BBA A;  3O1S A;  2VZV A;  5FV3 A;  4DXT A;  5LRS A;  1W9Y A;  1AYN 2;  4FFI A;  4XDP A;  5FXV A;  4YZ3 A;  5FZH A;  4ITC A;  4CDW C;  3ZFG A;  4XUT A;  3VLB B;  4XF1 A;  4LJH A;  5FLJ A;  5I0D A;  3AYC A;  5FXW A;  3OYW A;  1ZZB A;  1U5X A;  1DBN A;  2Q8O A;  3VKO A;  2W2I A;  5CA6 A;  2ZEZ A;  3AVR A;  1V6M A;  1E57 A;  2YUE A;  1K5M B;  3LAG A;  2A1X A;  2JEM A;  2MHF A;  3AKR A;  1G9F A;  2ZBJ A;  1UX6 A;  2W94 A;  5CKN A;  1SZB A;  4GWJ A;  1JUH A;  2VUD A;  4E8D A;  1WKY A;  3ZSJ A;  3CJI B;  3POB A;  2QVS B;  4NE9 A;  3I2J A;  5F6L B;  2UYA A;  5LA2 A;  4AVT A;  1YXW A;  4B7K A;  2D6M A;  2IUW A;  5GJ6 A;  4JQT A;  3ACL A;  4KWJ A;  3L2Y A;  2GC3 A;  1NA1 B;  3DPR C;  3GBW A;  3SXW A;  3GGL A;  2P4E A;  5ACA 3;  2R07 1;  4QXK A;  4YM2 A;  1O3T A;  3OPT A;  2CU5 A;  2D3S A;  2GP3 A;  3ZFE A;  1ZRD A;  1W28 A;  2QQO A;  4K20 A;  4F83 A;  1AX1 A;  3PDQ A;  3FUO A;  4IV1 B;  1V6N A;  2ZXQ A;  3G6J B;  2EAK A;  4RA0 A;  2OZJ A;  3IDA A;  4UFJ A;  5A3N A;  2BFU S;  1JOD A;  1QQP 2;  3OPZ A;  3WF0 A;  4Q26 A;  4JGY C;  1ZRF A;  1D4M 3;  2ARA A;  4N53 B;  3J4U H;  1FNY A;  1BYH A;  2EVX A;  3P3P A;  2YC2 A;  2ZAB A;  2FMD A;  4CP2 A;  5SV8 A;  3SEP A;  1NXD 1;  3JD7 3;  3HJR A;  5C3Q A;  1C8N A;  1XNC A;  1W8W A;  4LHN A;  5A33 B;  4KL1 A;  1AR8 2;  3ROU A;  2A70 A;  4IEQ A;  3NVC A;  3INA A;  3AM2 A;  1QOS A;  2QQU A;  4FVV A;  4WVV A;  2F17 A;  5JOY A;  2VUL A;  3GM8 A;  3DUI A;  1RUH 1;  4YZ5 A;  1JMU B;  1XRU A;  1JU4 A;  1G6N A;  2VM9 A;  1I5Z A;  1UMH A;  1HXS 1;  1XB9 A;  3M7A A;  4IV3 B;  4E4H A;  5C9A C;  1RYY A;  4YM3 A;  2ZJC A;  4LOT A;  5GAL A;  2PMW B;  2GNT A;  3I2O A;  3EMR A;  2K46 A;  1RUC 2;  1SLA A;  2XXZ A;  4W6Y A;  4A2U A;  4Z92 B;  4QHB A;  2YBP A;  1SFP A;  1ZZC A;  2BNN A;  3NNJ A;  4HK9 A;  4RYD A;  1Q3E A;  5A7Q A;  1W9F A;  1W05 A;  4FFG A;  3SH5 A;  2HWD 3;  4CYD A;  1AR6 1;  3WT3 A;  4MYE A;  1SCR A;  1C1L A;  1VLN A;  5L7O B;  1WD3 A;  3MID A;  2ZML A;  3ZSK A;  4ARY A;  2VVD A;  3GZT B;  4AQ6 A;  1GP4 A;  4DEV A;  5J48 A;  1BBT 2;  4UF0 A;  4BQW A;  1OA3 A;  4MVT A;  4BQ5 A;  4OHY A;  2ZCW A;  4TSV A;  1XYO A;  3WNK A;  4CDQ A;  3AMN A;  1RJ8 A;  1NOV A;  5DMY A;  4HL0 A;  3M3I A;  3VBS C;  5CKM A;  4RFT 0;  2EIG A;  1WLW A;  4AED C;  3ZXL A;  2DTW A;  4K9S A;  1ND2 A;  1R1Z A;  4HBN A;  1MS0 A;  2Q30 A;  3AZZ A;  3DKQ A;  2W87 A;  3GNE A;  4RHV 3;  5FKB A;  2E31 A;  3UV9 A;  3WDW A;  3WNX A;  1YEW A;  1XC6 A;  2JG9 C;  4MGZ E;  3RRD A;  3MF9 A;  3IDB B;  1DQ5 A;  4UFI A;  4YWA A;  1F8V A;  4COW A;  4HET A;  4DIQ A;  3N9P A;  4HOO A;  4KQ7 A;  1W9T A;  1RUD 1;  2WZR 3;  3WW2 A;  5JPM B;  4DXR A;  1V6J A;  2IZW A;  2ARB A;  2FQP A;  3A7Q A;  4UW6 A;  4ASK A;  5EWS A;  3LOI A;  3NAP B;  5EPA A;  3VDD C;  3KT4 A;  2FDK A;  1W8N A;  1K5J A;  4XIO A;  2RHP A;  2ZGN A;  3DYM A;  3LFM A;  4U36 A;  3E97 A;  3RVH A;  1DQ2 A;  4FPG A;  1QF3 A;  2Z4F A;  3MIF A;  3WR0 A;  1MZ5 A;  3I2F A;  3RZL A;  3ZKU A;  4CEY B;  4X6R B;  2AZ5 A;  4YG3 A;  1MAC A;  1J3R A;  1OHF A;  1PGW 1;  2JDN A;  5FDB A;  4N43 B;  2ZEX A;  4YYO A;  1H1A A;  3ABZ A;  2JWP A;  3NJX A;  4MHU A;  3WCS A;  2GMM A;  3I97 A;  3KS7 A;  3HQX A;  1NX9 A;  1Y9G A;  5CBL A;  2C9K A;  4EQV A;  2VU9 A;  3QOP A;  4Y22 A;  1X50 A;  4P9X A;  4W6X A;  3PUI A;  4QPG C;  2Q1F A;  2P3K A;  3DXU A;  3WNP A;  2C24 A;  4N7I A;  2ZAC A;  1QMJ A;  3PIJ A;  2WNV C;  3K48 A;  1UD1 A;  2WDB A;  4LA3 A;  4QKF A;  1D4V B;  3PTR B;  3WOG A;  3KM5 A;  3ZX7 A;  1KEX A;  1CD3 G;  1ZRI A;  3BKZ A;  5EJ1 B;  1GYK A;  3WP4 A;  1O7F A;  3RZK A;  2ZKL A;  5IWF A;  5IVJ A;  3VHN A;  1U0A A;  3PUQ A;  1HV0 A;  2YU2 A;  4OHV A;  1VBC 3;  2F4P A;  2IFW A;  4LQR A;  3ZMN A;  1ZVF A;  4LNV A;  3USU B;  5DG2 A;  3VBF A;  4B4P A;  1O3R A;  2Z42 A;  5GLW A;  3ZLI A;  3RPQ A;  2IXC A;  3ORJ A;  2WKK A;  1CN1 A;  2WA4 A;  2HWC 1;  2QUO A;  1PIV 3;  2V5D A;  4MGT A;  1UIK A;  3BOW A;  1H6X A;  3QH6 A;  2GNM A;  4G3Y C;  3O1O A;  3RSJ A;  4CTE A;  2MNG A;  2B9U A;  4Y24 A;  5E88 A;  3HN3 A;  3THT A;  5IJR A;  3WDV A;  2DBN A;  1JYX A;  4GJY A;  3H8R A;  2QZ3 A;  5T5J A;  5ACA 2;  3VUO A;  3HQU A;  4HK8 A;  2VNV A;  1WBL A;  4XJW A;  3T1M A;  3ZXE A;  4ZU4 A;  5FZO B;  4XXA A;  5EYX A;  1W2O A;  5HCB A;  1XPW A;  3CBN A;  1HRV 1;  1PO2 1;  4CDU C;  2XJP A;  4H7M A;  1YQ2 A;  3AP7 A;  2GH8 A;  1MS1 A;  3K46 A;  1D4M 2;  2XQR A;  3VD3 A;  4Y1U A;  3W59 A;  3BB6 A;  5FRE A;  4CEW B;  1WCD J;  3JD7 2;  4HXC A;  3I2K A;  4NRP A;  4DS0 A;  4BU2 A;  5HCA A;  3TN9 3;  2QQK A;  4FFH A;  4AFC A;  1FMD 3;  2BP6 A;  5FZC A;  1BEV 1;  4QPW A;  5FYU A;  3MGU A;  2A6X A;  2XQX A;  4D3W A;  3CZU A;  4LBK A;  4V1P A;  4Q0Q A;  4LE4 A;  3WF4 A;  2W1W A;  1QJE A;  3K75 B;  1PZ7 A;  1W6Q A;  3BTZ A;  1XSQ A;  3OG2 A;  4E2S A;  4JTN A;  1VBD 1;  2HWB 3;  5DDJ 3;  3AMM A;  1LTE A;  3UT0 A;  5F3C A;  3KVB A;  4JZR A;  3OUH A;  3U0Z A;  4MHR A;  4DIN B;  2HWD 2;  2W3J A;  4FPY A;  3CJI C;  4PDW B;  1LR5 A;  3MIC A;  3PTY A;  2A5Z A;  5F37 A;  2HYK A;  2A3W A;  2RS5 1;  1MS4 A;  4X6Q B;  4D6R A;  4M0N A;  3LFI A;  4XF3 A;  4YSF A;  3W20 A;  5C3R A;  1JYT A;  3E1F 1;  3RFR A;  1SFN A;  5F2W A;  2BQP A;  5F8P A;  5C3O A;  1JYN A;  3V65 A;  2NQY A;  4IEO A;  4BIF A;  1LOF C;  2PAM A;  4H2A A;  1AXY A;  3NWK A;  1VE0 A;  5BYN A;  1R1A 3;  2DUR A;  2K2S A;  5EP9 A;  3DYP A;  2BOJ A;  2YRO A;  4XFF A;  1VIW B;  1UIJ A;  4RHV 2;  1Y3T A;  5EIY B;  3S0M A;  4QPI B;  3R6S A;  1C8M 3;  4MGI E;  4FPF A;  3T1L A;  2PYT A;  5LA1 A;  4XC9 A;  1W8F A;  3R4D B;  3JZV A;  1FOD 3;  3NV4 A;  2JE9 A;  4AI2 A;  5CFC C;  3PMS A;  1KXG A;  4UW3 A;  4Z1V A;  2V73 A;  4QMA A;  3B3Q E;  2WZR 2;  4FPK A;  2DU1 A;  4CSW A;  3OJB A;  4N9H A;  2ADE A;  4LBO A;  1PX4 A;  3MLK A;  4KU8 A;  2VME A;  4IV3 C;  4K3U A;  3I7D A;  5FZ3 A;  4Q8K A;  4NII A;  5E6H A;  5FP4 A;  1Q8V A;  1OBN A;  3LZZ A;  1C1F A;  4GH4 C;  3SIS A;  5ABJ C;  3NKG A;  1SBF A;  5C8C B;  5JZG A;  5F39 A;  2FCT A;  4A3X A;  1EV1 3;  4Z82 A;  4AQS A;  4BMB A;  1Q56 A;  4P9L A;  4BLJ A;  3ZN6 A;  5FZ6 A;  2ARC A;  5FP3 A;  1ASJ 1;  4P9I A;  5FYC A;  4YG0 A;  3SNM A;  4UFM A;  1S1A A;  5FZG A;  4BIS A;  4WM7 C;  5L9V A;  2OPW A;  1PVC 3;  3WY6 A;  5FMB A;  5FYH A;  3O1M A;  1FV3 A;  4UXA A;  5FOB B;  1NAE A;  2XJT A;  2YG0 A;  4UFL A;  2C6S A;  3I8T A;  1XNT A;  3ZN4 A;  3WG2 A;  1V70 A;  1GFF 2;  3KB5 A;  4FOW A;  1A3K A;  1RUI 3;  2GDF A;  4OUM A;  2EIC A;  2N7G A;  4RR3 A;  4LEJ A;  2I2S A;  4PI0 A;  2HKX A;  1GZW B;  2GAU A;  3KGZ A;  1G9D A;  2BUK A;  3MBW A;  4YVW A;  3NO8 A;  2HWF 3;  3WDY A;  3ME2 A;  1NCQ A;  2AEY A;  2VQU A;  3ALQ A;  4MXW B;  1VBC 2;  2BNO A;  2WAA A;  4KGG A;  1VJ2 A;  4H14 A;  4OHX A;  1CON A;  2GN7 A;  3OD0 A;  4E9K A;  1IPK A;  1MVQ A;  1QJX 3;  2GAL A;  2RE9 A;  4RQP A;  1CAW B;  1DQ6 A;  1HV1 A;  1OOP A;  1NCR B;  1R08 1;  3FE5 A;  2WZP P;  3SHR A;  2HWE 3;  1AR9 3;  4QPY A;  2WYF A;  3RYK A;  1LUL A;  3D0S A;  2XKP A;  2VQT A;  1SFY A;  3BPZ A;  1PIV 2;  2VJX A;  1WME A;  2ZEW A;  3LD8 A;  1D2Q A;  4XXP A;  3RZH A;  1F9K A;  2RMU 1;  4PJY A;  1KGY A;  3VKL A;  3ZYB A;  4KWL A;  4HVR A;  1W6P A;  4XBN A;  5LEJ A;  2RS1 1;  1A8M A;  5J3U A;  1ULG A;  3C7O A;  1QEX A;  2CHH A;  5JXI A;  1DGW A;  5IT6 A;  2D97 A;  1J1T A;  1HB1 A;  1NLQ A;  2Y6F A;  2XKO A;  2AC1 A;  1EYB A;  1S4C A;  2YC4 A;  3B7M A;  1YWK A;  1O4T A;  3EJK A;  3OBA A;  3AP6 A;  4N43 C;  1CGP A;  3DF0 A;  4GXL A;  3PJQ A;  1SLB A;  1XNA A;  1DZT A;  4L0P A;  1C3H A;  1OC1 A;  5L19 A;  5L9R A;  3WF3 A;  1YCI A;  4WVW A;  3Q8C A;  1W2U A;  1XNB A;  1DF0 A;  4CUB A;  4BDV B;  3RMY A;  4NPM A;  4LE3 A;  3VBU B;  3ZO0 B;  3V0B B;  3WD5 A;  3PVN A;  1QDO A;  5FKC A;  5FO7 B;  3DPR A;  2XG3 A;  2VNR A;  5CAZ A;  2XHN A;  3J26 N;  3G7D A;  3TN9 2;  1FMD 2;  3U11 A;  3LWC A;  2WT1 A;  3ZFF C;  1JOP A;  4IL7 A;  4NRO A;  3FN9 A;  4DY3 A;  1OPM A;  4MLO A;  4S2F A;  4NHM A;  3WW4 A;  3Q8E A;  3T09 A;  5IK5 A;  2XBO 3;  4JGY A;  4Z8B A;  3I2D A;  3W5M A;  3O5S A;  3K3O A;  4W8J A;  2R06 1;  2FCU A;  2HWB 2;  3BPS A;  1N1T A;  1S0F A;  5DDJ 2;  3AYA A;  3WG3 A;  3SC7 X;  4A6S A;  3B69 A;  1I1E A;  4OQ8 A;  1WWY A;  1UOB A;  3A23 A;  2VCA A;  2QQN A;  5H9P A;  1VBE 1;  1ND3 C;  2JJ6 A;  5K0U B;  4IEZ A;  4AQT A;  4MAD A;  4YPJ A;  3ZYP A;  4ES9 A;  1H4H A;  4YNI A;  1RVF 1;  4BE3 A;  2RS3 1;  1COV 3;  1H4G A;  1HIX A;  4LLO A;  2G9F A;  1KFU L;  1RUE 1;  1LOC A;  4GKX A;  3AJY A;  5A6Q A;  5FZ8 A;  4LO4 B;  5C9A A;  3O1T A;  3VHR A;  4OI0 A;  2WC2 A;  3O1R A;  4W50 A;  2WT2 A;  4CXY A;  4GKY A;  2JG8 B;  3TEY A;  4XUO A;  2B45 X;  4OI2 A;  4DY5 A;  2WSU A;  3W9A A;  1WA4 A;  1IS3 A;  1GQG A;  3M70 A;  3PJY A;  2VZS A;  1R1A 2;  2PHU A;  3EQE A;  1H2M A;  1LRH A;  2QQL A;  3MUZ 1;  3TYJ A;  4NOT A;  3HBZ A;  1LU2 A;  1RUG 3;  1UL9 A;  2ZKN A;  3OSD A;  4AHX A;  4KWK A;  5CIR A;  3VBR C;  5FFO C;  4CEW C;  1BK1 A;  3T0D A;  1C8M 2;  1K12 A;  2LW8 A;  3K51 A;  3GXU A;  2WL1 A;  5DUU A;  3OB8 A;  4P9G A;  1C57 A;  1K3I A;  3K4D A;  5EHD A;  4QX1 A;  4D69 A;  1FOD 2;  5IVF A;  2CAU A;  2DUO A;  3FX3 A;  1YI9 A;  2VZT A;  4UAP A;  1TNR A;  3AK0 A;  4OUS A;  4AED A;  3GYD A;  2W39 A;  5IK8 A;  3HAG A;  3C7E A;  2EXK A;  1BLZ A;  3ZSM A;  3A21 A;  2D40 A;  3OOX A;  4QDS A;  1O5L A;  1YQC A;  4COU A;  2FDH A;  5A7O A;  1DHK B;  4XJ8 A;  4AVV A;  3Q8B A;  2JG9 A;  3UKN A;  2EAA A;  2JIJ A;  5FPZ A;  4MO3 M;  1N1V A;  2R04 3;  2QTW B;  5A80 A;  2XOM A;  1CIW A;  2AEZ A;  4YZ4 A;  2P3I A;  3AFG A;  5E16 A;  1SLI A;  5A3W A;  1EV1 2;  4CP9 A;  3ES1 A;  1X8E A;  2BW8 A;  1Z0H A;  2TBV A;  3NW4 A;  4PDW C;  4Y26 A;  3OTF A;  1BMV 2;  1O91 A;  3AX4 A;  4NID A;  4QKN A;  4MSV A;  3DEM A;  3VDD A;  4Z2A A;  2HJI A;  1N1Y A;  5FWJ A;  3NQH A;  3UES A;  3FFQ A;  4D6Q A;  4QB6 A;  1ULP A;  3LIG A;  2ERF A;  3V0A B;  1WLT A;  1PVC 2;  2BFU L;  2PEL A;  3KD4 A;  1ALY A;  4P9J A;  4Y1Y A;  5BNP C;  5GZF A;  5LA0 A;  2I74 A;  3H0O A;  5IK7 A;  1B35 B;  3WHT A;  1J59 A;  5FPB A;  3TOJ A;  3CNA A;  1GZ9 A;  4OUL A;  3MI8 A;  4JGZ B;  2P6H A;  1QJF A;  3M3E A;  1RUI 2;  3MEP A;  1V9U 3;  4FCA A;  3RG0 A;  4D7Y A;  5FLI A;  4XOG A;  3ZIW A;  2PFW A;  3AZW A;  4M4P A;  4Q4W 1;  5A7N A;  5HV4 A;  2DFC A;  2X53 S;  3CIH A;  4WZC A;  4OVE A;  2HWF 2;  4ES8 A;  1GOF A;  3VBO B;  4XHB A;  1PGS A;  3FC0 A;  5A7W A;  4QPG A;  3ZYF A;  1DG6 A;  1AF9 A;  1UZY A;  3T4V A;  3K4Z A;  4GIQ A;  3SEE A;  1MZ6 A;  1QJX 2;  3KGL A;  4QM8 A;  1WMF A;  3PUH A;  3USS A;  5A3U A;  3BOP A;  2ZGT A;  1TEI A;  4LHK A;  2HWE 2;  1AR9 2;  1O6U A;  4S2H A;  4TYS A;  3B02 A;  4XZP A;  2WUH A;  1F4A A;  1QJU 3;  1LOB A;  1S2K A;  4XTM A;  4DXS A;  3VKM A;  2YGL A;  2CAV A;  3HOB A;  2FDF A;  2E26 A;  2ARX A;  1W0O A;  4NIH A;  4XUN A;  2RM2 1;  2AAC A;  5DZG A;  1H2N A;  2HEV F;  1XXN A;  3HN1 A;  3POF A;  2XWJ B;  3OGS A;  5SV5 A;  1RUF 1;  3KMH A;  5ABJ A;  4KNC A;  3V64 A;  3T2O A;  1ZBA 1;  3NMB A;  5A6Y A;  1JHN A;  4Y1X A;  2VH9 A;  2YHJ A;  5FMC A;  1IS5 A;  1MPX A;  1RC6 A;  2CV6 A;  4QX7 A;  2NZ9 A;  4CDX B;  4XAB A;  4B4R A;  4CCC A;  2LUW A;  4ZY9 A;  4FAH A;  5JWP A;  2X05 A;  2BOI A;  3I59 A;  4Q1P A;  1SCS A;  4FTB A;  5FY0 A;  3WDT A;  1QOO A;  1DIW A;  3DKW A;  1MEC 3;  4IDZ A;  2CSG A;  4I3P A;  3ZN5 A;  4FP2 A;  1WW5 A;  5FPX A;  2PAK A;  1OLM E;  2YB7 A;  3S30 A;  2A6V A;  5LAS A;  5EJZ B;  1W2N A;  1PMJ X;  5FZI A;  2JEC A;  5FK7 A;  4CDU A;  2XHK A;  2WIN B;  2XBO 2;  1AXK A;  2JDP A;  4L97 A;  1CAX A;  1LU1 A;  3KZ4 C;  4MXV A;  3WNM A;  5LK7 B;  3THD A;  5KC5 A;  2H0V A;  3R0R A;  4LIV A;  3ATG A;  5I91 A;  1CAU B;  1ONA A;  2C9A A;  1VMH A;  2XON A;  3U37 A;  1U5Z A;  3JQW A;  1W9W A;  5KXD A;  1DFQ A;  1XU1 A;  4PBO A;  3PUS A;  3H3Z A;  5FMO S;  1LOA A;  3JBG 1;  2BTV C;  1UYZ A;  3E5X A;  3AL6 A;  4E27 A;  2WNE A;  3O7O A;  5KXC A;  1COV 2;  1U12 A;  1YJK A;  4EN9 B;  4COZ A;  4C0H A;  1J84 A;  4Q4X 1;  2W95 A;  2D6K A;  3H1M A;  2JB4 A;  3WVJ A;  1G7Y A;  1L3J A;  5CEH A;  1A34 A;  4HVQ A;  4BH9 A;  1OH4 A;  4XCA A;  5BNN C;  3RGB A;  2LM3 A;  2W9X A;  2Y64 A;  2XLF A;  3NJV A;  5CB7 A;  3OGR A;  4Y5S A;  1IZ3 A;  3PLQ A;  4PIZ A;  3OBT A;  2ZMK A;  3SIT A;  3VL8 A;  4XET A;  1W8O A;  2Y26 A;  5FUP A;  2OPK A;  3T2T A;  1TMF 1;  3QBQ A;  1RUG 2;  2WS9 3;  3GJB A;  4HZF A;  4K8F A;  4D94 A;  2FZ1 A;  4QQH A;  2B39 A;  3PUA A;  4NHY A;  4IGP A;  4IE0 A;  4Y20 A;  2F4L A;  2RR1 1;  4CUC A;  1W03 A;  1IG0 A;  2PAE A;  1O8S A;  2YU1 A;  3H7J A;  3JQX A;  3LPG A;  3LSD A;  4LO6 B;  3WW3 A;  4F7Z A;  4YAR A;  3RI9 A;  4MUV A;  1XSR A;  2PA7 A;  3SQO A;  1DYO A;  3CDZ B;  4JC1 A;  1PM4 A;  5BY5 A;  4RD7 A;  2R04 2;  2UWB A;  2R07 3;  3OUJ A;  3BIE A;  2FHR A;  1ZNP A;  3AVS A;  5EXO A;  1V00 A;  4XTP A;  5EFU A;  2QE3 A;  3ST7 A;  1UXZ A;  1PK6 B;  2V09 A;  5CFC A;  1M06 G;  3ZM8 A;  4IER A;  3VDA A;  3P1I A;  4W6W A;  4CUG A;  1Y9Q A;  2WWJ A;  2IWG B;  4ATE A;  4CCL A;  3D5O A;  5I0S A;  3BGA A;  1X36 A;  3WNO A;  4A44 A;  4L92 A;  4WM8 B;  4IV3 A;  5T5L A;  5E1R A;  4RS5 C;  3I3Q A;  2V4V A;  3D3A A;  1ULC A;  3O14 A;  3ACI A;  1PMH X;  2YDE A;  4GH4 A;  1UOF A;  1S0I A;  1RL3 A;  3BU7 A;  3AC0 A;  2XL9 A;  5APA A;  5FY4 A;  4CCO A;  4CUA A;  1PGL 2;  2OA2 A;  1AJK A;  3ZXJ A;  2JIG A;  3KWV A;  1N47 A;  2JD4 A;  3CMG A;  1UMZ A;  3HNB M;  3OF1 A;  1RUH 3;  3N7M A;  4XQW A;  4LKF A;  1GAN A;  5H9Q A;  1V9U 2;  1QJY 1;  4Y33 A;  1HXS 3;  3HQR A;  1O59 A;  4WM7 A;  1CES A;  2WNU C;  2P17 A;  4FPC A;  1GP5 A;  1Q8S A;  4LUK A;  1UKR A;  1W8T A;  3MPB A;  4FPH A;  3WZ1 A;  4Q0V A;  4YVS A;  1HJG A;  2XLG A;  1AR6 3;  3E6B A;  1LAJ A;  5C5U A;  5LEK A;  4Q27 A;  2VUJ A;  2WRA A;  1SDW A;  3ACG A;  2KM2 A;  1YFX A;  2WFF 1;  1MS5 A;  2J22 A;  2XLA A;  3MF6 A;  2ARE A;  2MEV 1;  5HXV A;  1LGC A;  1QJU 2;  2BU9 A;  3IIA A;  3RWN A;  3TBD A;  1EY2 A;  3WP5 A;  1H30 A;  3WNL A;  1LHV A;  5A32 B;  1R09 1;  5LBB A;  3HNM A;  4PT6 A;  3UGF A;  4AGV A;  4GUL A;  1KIT A;  2JKX A;  1S55 A;  1GQH A;  4QX5 A;  1RTV A;  1UY4 A;  4IQP A;  5DAB A;  4FPE A;  1TME 1;  2QQI A;  1VB4 A;  3HD8 B;  3T2Q A;  2VZ3 A;  1YQ8 A;  2VAU A;  4YM0 A;  3A4U A;  3W21 A;  5D8A C;  1C5I A;  4JKL A;  4K21 A;  2AYH A;  2BDR A;  5CVR A;  3S5Q A;  2O0O A;  3WQ0 A;  5BNQ A;  1QXR A;  4A7Y A;  3BI3 A;  2DCK A;  3KVA A;  4GWI A;  3QLQ A;  5FYZ A;  3ZFG B;  5C71 A;  5KHJ A;  5FYM A;  3WW1 A;  2W1Q A;  3WG1 A;  5EV7 A;  3FJS A;  1AX2 A;  3OYW B;  2E51 A;  1Y4W A;  3GBG A;  1B35 C;  1BZW A;  2ZGM A;  4A6O A;  2OQ6 A;  2WO2 A;  4Q4Y 1;  1OQE A;  1MEC 2;  1RUD 3;  4N90 A;  1ENQ A;  3H50 A;  5FY9 A;  2PXJ A;  5FYS A;  3RDI A;  2VMI A;  1LNS A;  4IW3 A;  4YW1 A;  4UOJ A;  3WEZ A;  2BGC A;  3WNN A;  2JDY A;  3LGR A;  4YGC A;  5C4W C;  5J96 B;  2YYO A;  2VMH A;  1CJD A;  1DU3 D;  1NUK A;  1WGP A;  4CRQ A;  1UOG A;  5EQU A;  5I8T A;  4XJZ A;  4UI9 L;  1QGL A;  4LBQ A;  5AFE A;  1S0C A;  3C3V A;  2VC9 A;  3LPF A;  5JSR A;  1OF4 A;  3I49 A;  1AR7 1;  1I3H A;  3AZY A;  5A7P A;  2E63 A;  1A6C A;  2NPI A;  1CPN A;  1N3Q A;  3ZFF A;  3CEW A;  3ZFE B;  1Q8O A;  1W2T A;  5HBA A;  4EYU A;  4AZZ A;  3KV4 A;  2WO3 A;  4CCM A;  1HKD A;  4E8C A;  4EN8 B;  1XND A;  4D6S A;  2B9V A;  3OGJ A;  4ASL A;  1PX3 A;  3BTA A;  4L99 A;  1OI6 A;  2WBK A;  3GZE A;  2EID A;  3DYO A;  3NV2 A;  3FL7 A;  1H8T C;  4MX3 A;  4RL7 A;  2JDZ A;  5L73 A;  2J42 A;  4H7L A;  2HEW F;  2OII A;  2XR4 A;  4Y5Z 0;  4CXX A;  4E4Z A;  1MQT C;  1YRZ A;  4IE7 A;  1ND3 A;  3P3N A;  2BRT A;  1UPI A;  4DUV A;  5F9T A;  4QU2 A;  5H9S A;  5FMD A;  1XNK A;  5CFD C;  1UZW A;  1WCK A;  2D6L X;  2ET1 A;  3H1Y A;  2JDH A;  4N8M A;  2F6B A;  4NAO A;  1NE4 A;  2WS9 2;  3KCC A;  3MV0 1;  1FAT A;  5L36 A;  2WAB A;  1TZO A;  5LCW L;  3PL0 A;  3H8U A;  3AKP A;  3AMH A;  3ILR A;  4QM9 A;  1YLL A;  1CZS A;  5K9Y A;  1XYN A;  2G4I A;  1W2A X;  3OEB A;  4FQZ A;  3MIH A;  4ERO A;  1RIN A;  2J1U A;  3A0N A;  2D43 A;  1OLR A;  5DPN A;  2HWC 3;  2WLQ A;  1W6M A;  5CU1 A;  5IW0 A;  4AG4 A;  3Q8F A;  3VBR A;  2VQA A;  1VMF A;  1LHW A;  4JRA A;  3NNG A;  3I3E A;  1PO1 1;  4XJ9 A;  5KWR A;  2XVG A;  2R07 2;  2ZGU A;  3L9J T;  1W0N A;  2W91 A;  3UGG A;  1LKN A;  4UF0 B;  3FLP A;  4LBQ D;  4BME A;  4CDQ B;  3WDU A;  3WXP A;  1HRV 3;  5ANQ A;  1X82 A;  5H9R A;  1LHN A;  3SLI A;  4NWW A;  1OA4 A;  2VL4 A;  2WT0 A;  2R0F A;  4XE9 A;  4ZS2 A;  2WZR 1;  3WSO A;  3HT1 A;  5T5O A;  1ND2 B;  3M8L A;  3BTY A;  4DEQ A;  5C5T A;  4AVA A;  4YFZ A;  5A1F A;  4KMQ A;  3WUC A;  1VAV A;  1DGL A;  3LEI A;  1LEN A;  2TNF A;  5LBF A;  4D8M A;  2ZTN A;  3UJO A;  1BEV 3;  4BHP A;  4QGL A;  3VZJ A;  4XFG A;  4LPL A;  3PU3 A;  1ULO A;  4EN7 B;  4TLF A;  5F3G A;  2ZGO A;  1RUH 2;  3VBH A;  1S2E A;  1GKB A;  1AYM 1;  1VBD 3;  1HXS 2;  3D4K A;  3D82 A;  1J58 A;  1JXN A;  3FFZ A;  2CYF A;  3UL2 A;  3ZYJ B;  4Q4V 1;  2AGS A;  3EB7 A;  5BNP A;  1PZ8 A;  3B5L B;  3RMX A;  4Y1V A;  4XF0 A;  4YFW A;  4CU6 A;  2ZGK A;  5ANN A;  3OD4 A;  1AR6 2;  4W65 A;  1OF3 A;  3ON7 A;  4QX0 A;  5AVA A;  3GDB A;  1RHI 1;  4R9B A;  2RS5 3;  4XFA A;  1BJQ A;  2VZP A;  2X5I B;  1YQ5 A;  2TEP A;  4GA9 A;  4GMP 0;  4M3C A;  3AKS A;  3AZV A;  1A78 A;  4XAE A;  3B01 A;  1YYN A;  1ENR A;  1T6G C;  1KS5 A;  4DO0 A;  4HAN A;  1GLH A;  2VOW A;  3LEM A;  4HPK B;  1PK6 C;  4ZXE A;  1V0A A;  4Y22 B;  3Q9O A;  5J7M A;  5FIX A;  4RN5 A;  5FPV A;  4DNY A;  4QHZ A;  2VMF A;  3I3B A;  5GLV A;  4DPN A;  4EWD A;  1CPM A;  1GR3 A;  3PVB B;  3EO6 A;  4N9I A;  2CWS A;  5E89 A;  1GZC A;  2HBU A;  4URA A;  2WR9 A;  1K5M C;  3RJR A;  3LA3 A;  5FYT A;  3U78 A;  2K0G A;  2P3Y A;  1SBE A;  2NYY A;  5DZE A;  3WF2 A;  1Y9M A;  4NUB A;  4QD2 A;  1AVB A;  1QOT A;  1UYP A;  1YQ6 A;  3OGV A;  2ZGR A;  2DDU A;  2VZQ A;  1HRI 1;  2H0B A;  1ODN A;  3ZFE C;  1RUD 2;  4FP3 A;  3I54 A;  2WNO A;  1Z7S 3;  2PQQ A;  2K9Z A;  1SPP A;  1NA1 C;  4PQQ A;  5FUI A;  4LR4 A;  3VBF B;  5IAT A;  4PCR A;  5BNO A;  2NP0 A;  1XBF A;  2W46 A;  5FZM A;  4BOW A;  5F3I A;  3BCW A;  3ELN A;  4B29 A;  4FBF A;  2P3J A;  2LS6 A;  4Z2W A;  1JYW A;  5FZ0 A;  3C7F A;  1LEC A;  1E5S A;  3OY8 A;  4IV1 C;  4AK3 A;  2Q8C A;  4B4Q A;  2DUP A;  5JOX A;  1DP0 A;  2GZW A;  1APN A;  4IGQ A;  3RYR A;  2KR2 A;  5FPU A;  1RUJ 1;  1BVV A;  4N53 C;  4AHW A;  1W6O A;  2ZX0 A;  1PGW 2;  3MFC A;  3U4X A;  3MUY 1;  1ASJ 3;  1ODM A;  4NJ4 A;  1DQ0 A;  4E4D X;  1FMD 1;  1VMJ A;  2WQ4 A;  2E32 A;  3O0X A;  5I0U A;  2OYZ A;  2Y38 A;  3AFK A;  5B2G B;  4M3C E;  4LBN A;  1ENX A;  5CIS A;  1FNZ A;  4XFI A;  4MGK E;  4CCD A;  5F5I A;  4NVP A;  3MV1 1;  4FO9 A;  2ZX2 A;  3MW2 A;  1OSG A;  2P37 A;  2XL7 A;  3LCP A;  1RUN A;  1HB4 A;  4AW7 A;  5FY1 A;  4I0A A;  4LK7 A;  5FY5 A;  3X29 B;  2PQS A;  3LOB A;  3VZO A;  2GNB A;  1V6K A;  3IPV A;  3IAP A;  3H8O A;  3RQ0 A;  3B00 A;  4A45 A;  2G9Z A;  4GMP 1;  3ZFG C;  2VTX J;  3OEA A;  3KV9 A;  1XE0 A;  2EXJ A;  1H9P A;  3BOD A;  3FZ3 A;  2GN3 A;  5L7O C;  1OQ1 A;  1O3S A;  2JX9 A;  4WV8 A;  3C7H A;  1PZ9 A;  1HDK A;  1K45 A;  1R08 3;  4Q8L A;  4QDR A;  4AXO A;  4XF9 A;  4TTG A;  4MV2 A;  4I30 A;  4O9G A;  2G1M A;  1CR7 A;  3EXU A;  3OPW A;  3J8F 1;  4YW3 A;  3ZVX A;  1WMD A;  2FDG A;  1HQW A;  3GJA A;  2EAL A;  2SLI A;  2HWC 2;  2BVB A;  1NYW A;  2RMU 3;  3LSE A;  1E5H A;  4LT5 A;  5JPN B;  5LAT A;  1DGR A;  3DXT A;  5CAD A;  1LOE A;  2RS1 3;  3WF1 A;  3ZYI B;  3ZXK A;  5JCT A;  1VAM A;  4PIY A;  5FQ0 A;  5JLV A;  1PM7 A;  1IGO A;  2Q5T A;  2Q0A A;  1YFU A;  4DUX A;  1W8U A;  4LUM A;  3VB9 A;  2YPJ A;  5ISL A;  3ZXF A;  2QJV A;  2Y60 A;  1IKP A;  1XU2 A;  1HRV 2;  1E5I A;  2VCM A;  1VRH 1;  2B7Y A;  2Y6G A;  2IVI B;  2Z5W A;  3IMN A;  4R9A A;  4SBV A;  5AC9 1;  1VPH A;  5FZF A;  2QKD A;  1GBG A;  4CXW A;  5M0T A;  1UXX X;  1CQ9 A;  3NAP C;  4XF4 A;  2O8O A;  4CDW A;  1JUI A;  3J7L A;  3ZPO A;  3AMP A;  2Y6K A;  5FUN A;  2ZX1 A;  3R05 A;  3ZOI A;  1S0E A;  1BEV 2;  1QH7 A;  4HN0 A;  2FDI A;  4AQ2 A;  4O61 A;  4H3W A;  2WFP A;  1EV1 1;  1VP6 A;  2VY0 A;  1LJ7 A;  4K1Y A;  4V2V A;  4CEY C;  2X10 A;  2EXH A;  1URX A;  4P9W A;  4C91 A;  4EV0 A;  1REF A;  1VBD 2;  2YC0 A;  1UX7 A;  2R06 3;  5TSW A;  4RS5 A;  3QAC A;  1RB8 G;  1C4R A;  3H3U A;  2C1F A;  4WVM A;  2JEN A;  2C4X A;  3VZM A;  1AL2 1;  1SBD A;  5C6C A;  1VBE 3;  3CHX A;  3VD5 A;  1C28 A;  5JZG B;  1VBA 3;  5FJK A;  2Q8D A;  2OKX A;  4AFA A;  3WG4 A;  1S0B A;  2UWA A;  1RVF 3;  2RVA A;  2RS3 3;  4MH0 E;  1F2N A;  2W1U A;  2DCT A;  3I2G A;  2RS5 2;  3SKV A;  5KC6 A;  1RUE 3;  2ZGL A;  5JR7 B;  5HXM A;  5C8W A;  5GLZ A;  2VG9 A;  5FMO L;  4JV4 A;  1JOJ A;  2WNU A;  2Y8K A;  1CZV A;  3KLS A;  2R6Q A;  4TN7 A;  2B46 X;  2RDS A;  5EZW A;  3UK9 A;  2ZAH A;  2EIE A;  2JKB A;  2ZGQ A;  3MYX A;  4BK4 A;  5KXE A;  1I5P A;  2DCZ A;  2BZD A;  1Z78 A;  3D6E A;  1IHM A;  4NHX A;  4XCB A;  1DQ4 A;  4ZON A;  5LB6 A;  4AGG A;  3FBM A;  3I2H A;  4TLG A;  2VPV A;  4CE8 A;  3K2O A;  5G04 L;  3N7K A;  1ND2 C;  2VOK A;  4QHO A;  2BYV E;  1AR9 1;  2WO7 A;  4RR3 B;  5FRA A;  1GUI A;  2VCB A;  3JUU A;  3IWZ A;  2I45 A;  1W3V A;  1NZC A;  4FXK B;  1JH5 A;  1MS3 A;  4YVW B;  1FPN 1;  1POV 0;  1NCQ B;  1CZT A;  4PQ9 A;  2GH2 A;  2R16 A;  1VBB 1;  1OVS A;  3THP A;  1RGS A;  4URT A;  4BQ1 A;  1D0H A;  4I02 A;  5IVB A;  2PLV 1;  2GSY A;  1Z7S 2;  3H1W A;  2ZHN A;  2XJU A;  4RQP B;  4X8N A;  1OOP B;  4ZXK A;  4RGG A;  5D8A A;  1MR5 A;  4AI1 A;  1ZBE 1;  4COY A;  2DV9 A;  1UWW A;  4B1M A;  2QQP A;  2VNG A;  1JOB A;  4F8A A;  1F4H A;  3N9O A;  1EAH 1;  2XJS A;  3LE0 A;  1N1S A;  1DGR N;  2ZHK A;  4QQO A;  2Y0I A;  3P5B A;  4XJU A;  2XML A;  2ZOE B;  3POW A;  1W6P B;  2OX0 A;  2VZR A;  5F2S A;  2DVF A;  3ENR A;  3M3C A;  1ASJ 2;  2X5I C;  3WV6 A;  2YMZ A;  1L7Q A;  5C4W A;  4A7Z A;  2QCS B;  1WMX A;  2E7A A;  3FMG A;  3VBS A;  3AP4 A;  5T3N A;  3GF6 A;  4YW5 A;  1XOY A;  5AFB A;  1AJO A;  1EP0 A;  1GU3 A;  5DUW A;  4AOC A;  5HI0 A;  1US3 A;  5FXZ A;  1NXM A;  2W08 A;  4NPR A;  2J1E A;  3JCI A;  1H8V A;  1CAV A;  4ONU A;  3DPR B;  5FZ1 A;  4BB3 A;  2DF7 A;  4Q4W 3;  2D6O X;  4B3N A;  4OMD A;  1MS9 A;  2RDQ A;  2FBE A;  2AUY A;  4GAZ A;  4N7U A;  4XVH A;  2JB8 A;  1WA6 X;  5KHG A;  3EHK A;  5HCH A;  3NNM A;  4AWD A;  2UY8 A;  1COV 1;  1GSL A;  3NNF A;  4XDQ A;  5F5Q A;  1H8T A;  3SMH A;  4XJA A;  2AR6 A;  4IEX A;  4EN0 A;  2G19 A;  2CGN A;  1MQT A;  1WZX A;  1RMU 1;  1R08 2;  2LAL A;  2CGO A;  5LK5 A;  3VBF C;  4C1W A;  5JXH A;  3IB3 A;  2GU9 A;  3WUD A;  4MZU A;  4B7E A;  5J36 A;  4MG2 A;  3AP9 A;  4Q2F A;  4QU1 A;  2Y33 A;  2E7Q A;  1ZM1 A;  2ZHM A;  3M2M A;  5EJ3 A;  1SMV A;  2D5F A;  4FFF A;  4QAW A;  5CFD A;  1GOG A;  1GWL A;  5C70 A;  1OLM A;  1W6N A;  1OXC A;  2RMU 2;  3FHQ A;  3PUR A;  5EYY A;  3SH4 A;  1NY7 1;  3N3H A;  4BQ4 A;  1OFS A;  5JR2 A;  2RS1 2;  5C9A B;  2VW1 A;  2RM2 3;  2A7A A;  2OQ7 A;  1DDL A;  4GB3 1;  4KH9 A;  4KWU A;  2PHW A;  1POV 1;  2UY9 A;  3GBF A;  3KSC A;  3LEK A;  4QPI C;  5BV6 A;  5LW9 A;  1RUF 3;  5A7S A;  2DFB A;  2BNM A;  2W0X A;  1UZ0 A;  4YW6 A;  1ZBA 3;  3NV3 A;  2VZO A;  3J7M A;  4XMI A;  4KBZ A;  3ZYR A;  5GLU A;  1EUU A;  4K40 A;  3W58 A;  1QXJ A;  1W0P A;  2ZA9 A;  3KV6 A;  4Y1Z A;  2WNV A;  2ZZJ A;  5E8A A;  5LZ6 A;  1DGW X;  5BPX A;  1OD3 A;  4QWN A;  3O1U A;  1AYN 1;  1MS8 A;  4GJZ A;  1PHM A;  1WUV A;  1GIC A;  4K8R B;  4UBG A;  5C8C C;  1HLC A;  1GNH A;  1NQJ A;  4JDM A;  5GLT A;  3NKT A;  3RZJ A;  1H1I A;  2YV8 A;  1W39 A;  3HPN A;  4JHT A;  1O4Y A;  4OHW A;  4AED B;  2X8K A;  1EPW A;  3MHZ A;  4W4Z A;  4PHZ A;  2R06 2;  3DN7 A;  2D3P A;  3DGT A;  4Q5O A;  4R52 A;  2X29 A;  1OFN A;  2RDR A;  2VBP A;  2WZ8 A;  3Q8A A;  1VBE 2;  2CDO A;  3TRS B;  2KA3 A;  1UO9 A;  2J1V A;  5FZ7 A;  5JOW A;  3HVD A;  1VBA 2;  1JYC A;  2WWU A;  3JBG 3;  1PGL 1;  3TAY A;  4NPL A;  4CP9 B;  1OA2 A;  1RVF 2;  2RS3 2;  4ISR A;  2WII B;  1PMI A;  2IVJ A;  1KDK A;  1OVP A;  1RUE 2;  2CNA A;  4XIL A;  1IKQ A;  2VTX A;  3POS A;  4Q4X 3;  5JIA A;  1UAI A;  4KG0 A;  3POE A;  3VDD B;  2Y0O A;  4EJR A;  1L7R A;  4C0B A;  2PHR A;  4OLL A;  2L9L A;  2VO5 A;  4FPL A;  2Z79 A;  1S0D A;  4QB1 A;  1GNY A;  4F3J A;  2A3X A;  5DZF A;  2VW0 A;  3LA7 A;  5LRR A;  4UFH A;  2ZEY A;  4HVO A;  1QQP 1;  4QQ2 A;  3RS6 A;  3IN9 A;  2YBK A;  3RI8 A;  1TMF 3;  4Q1R A;  4M3C F;  2WAO A;  5A3T A;  2WQZ C;  4OI1 A;  2BPA 2;  1NCR C;  1JBC A;  3MFA A;  5FY8 A;  3HWJ A;  3QH7 A;  5LBC A;  2W47 A;  1AR8 1;  2RR1 3;  5T5P A;  1OMI A;  2X09 A;  1SEF A;  1ZA4 A;  2W68 A;  4PLO A;  3N9Q A;  4JHZ A;  4QXC A;  5A7W B;  4BK5 A;  4YM1 A;  4QPG B;  1W90 A;  4OZX A;  4BXS V;  4NWV A;  1QNY A;  3SCG A;  4QB2 A;  2VE1 A;  2C26 A;  1ZZ9 A;  5F6K A;  1YIP A;  1K5M A;  2XH6 A;  4LBM A;  4NHK A;  1RUC 1;  1DZR A;  1OLQ A;  5FXX A;  3UGH A;  3HNY M;  3TNP B;  5GKA C;  1M4W A;  3CJI A;  1QY4 A;  2FMY A;  5JZG C;  3BAL A;  3PVE A;  1VR3 A;  4AI8 A;  4NN0 A;  2YZ4 A;  3VBU C;  5JSO A;  1NLS A;  4OUE A;  1NA1 A;  1G8W A;  1F5J A;  2WJS A;  2ES3 A;  1OKO A;  1XQN A;  4G4F A;  4LKS A;  1HN1 A;  4CCN A;  1LOF A;  1BBT 1;  5C3S A;  2VZ1 A;  3POY A;  1U5I A;  4IV1 A;  4LXL A;  3VD4 A;  2D5H A;  1IQD C;  2ZHL A;  3ZR5 A;  4GAL A;  4S2D A;  2XJQ A;  1X7N A;  2OUH A;  2VTF A;  3CU7 A;  4N53 A;  3I59 B;  5K4L A;  4FI9 A;  2XPJ A;  1D7P M;  1GWM A;  1UY3 A;  5A1A A;  1QJY 3;  3E5U A;  3ETP A;  1JZ7 A;  3U4S A;  3LA2 A;  2GME A;  4Q4W 2;  3GHN A;  1T2X A;  3JB4 C;  5A33 A;  3CZJ A;  5K0U C;  2R30 A;  3RZG A;  2B8M A;  3BN6 A;  2Y34 A;  3O0W A;  1GOH A;  4CDU B;  2JIC A;  4AR2 A;  4A3Z A;  1UZV A;  1NCQ C;  4TWT A;  1F35 A;  1CAX B;  4KI5 M;  1QU0 A;  2P2K A;  2QNK A;  3AZX A;  5D1I A;  5FZ9 A;  3VZN A;  2DU0 A;  2JG8 C;  2WFF 3;  1CX4 A;  2W5F A;  3LB9 A;  1OOP C;  4QXB A;  2MEV 3;  1JS9 A;  1ZZ8 A;  2J1T A;  1HN0 A;  5FWE A;  5K8S A;  1UMI A;  3LDB A;  3I2I A;  3B94 A;  3OUI A;  4IET A;  3AKT A;  5LY2 A;  2V72 A;  4XPV A;  5FZK A;  1WW7 A;  1R09 3;  5JSP A;  3RNS A;  1AUY A;  4HON A;  1UU5 A;  2JDA A;  1CWP A;  2VZU A;  2WS9 1;  5JI9 A;  5L7O A;  1RXG A;  4X8P A;  2RM2 2;  3T0B A;  1CX1 A;  3F95 A;  1TME 3;  2BER A;  1SAC A;  4LMF A;  4I0W B;  4CP1 A;  3BU0 A;  4HN1 A;  1RUF 2;  2HLE A;  1TNF A;  1ZBA 2;  4XDO A;  4XFH A;  4IE5 A;  4YRD A;  4AYU A;  4LBL A;  3IBM A;  1NLR A;  4HMZ A;  5AVP A;  2NN8 A;  4J25 A;  2YPD A;  4M0H A;  4PI2 A;  3VD7 A;  1W8Z A;  3ILN A;  4IEU A;  4Q4Y 3;  4CZS A;  3VZL A;  4BQX A;  2IXL A;  2OXB A;  3DL3 A;  4XW3 A;  1G9B A;  1SLT A;  1ZYB A;  2E9Q A;  4Y20 B;  2DYC A;  1V6L A;  3ZXA C;  4IXL A;  1G9C A;  2PHT A;  2YXS A;  4XUR A;  1WBF A;  3RWK X;  3T0A A;  4IND A;  2W52 A;  3ACF A;  3EBR A;  1US2 A;  1ULF A;  4OYU A;  1OPO A;  4UFK A;  4I09 A;  3M3Q A;  4L11 A;  1O8P A;  3NAP A;  3H8X A;  3JU9 A;  3M1H A;  5IVY A;  1AR7 3;  1A8D A;  1KJL A;  4LKE A;  3URF A;  2JDM A;  3B9C A;  4DZG A;  5F5A A;  2BVV A;  3U07 A;  2HBT A;  3VKF C;  1UU6 A;  1Y43 B;  1OT5 A;  2JDU A;  2ZX3 A;  3B93 A;  3WQ1 A;  3JBG 2;  5CFC B;  4PF5 A;  3AYE A;  4HKO A;  3MDP A;  2OS2 A;  4XBQ A; 
#chains in the Genus database with same CATH homology
 3BIE A;  4O61 A;  4NRO A;  4NIG A;  4MG2 A;  2FDJ A;  4CXX A;  4IE7 A;  4QKF A;  3BKZ A;  2FDF A;  3I3Q A;  3RZK A;  4NIH A;  2FD8 A;  3KHB A;  4ZS3 A;  4NII A;  3S57 A;  3O1T A;  3O1R A;  4IE6 A;  4CXY A;  4ZHN A;  3O1V A;  3RZG A;  4NJ4 A;  4MGT A;  3I2O A;  4IDZ A;  4NRM A;  3O1O A;  3H8R A;  4QHO A;  3O1M A;  3RZJ A;  4JHT A;  3T3Y A;  4IE4 A;  4ZS2 A;  3H8O A;  4QKD A;  3BTY A;  3I3M A;  4NRP A;  5DAB A;  2FDH A;  4NPL A;  3BU0 A;  3KHC A;  3O1U A;  4IE5 A;  3BI3 A;  2FDG A;  3BTZ A;  3BUC A;  4QKB A;  3O1S A;  3T4H B;  3O1P A;  4NID A;  4QKN A;  3RZH A;  3RZM A;  4NRQ A;  2FDK A;  4OCT A;  3BTX A;  3LFM A;  4IE0 A;  4O7X A;  3H8X A;  3RZL A;  5F8P A;  3I49 A;  4CXW A;  3S5A A;  4NPM A;  4RFR B;  2IUW A;  2FDI A;  3T4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...