4ZHNA

Crystal structure of alkb t208a mutant protein in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
200
structure length
200
Chain Sequence
b'LAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLAFRQAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methylated trinucleotide DNA T-meA-T
molecule tags Oxidoreductase/dna
source organism Escherichia coli (strain k12)
publication title DFT Studies of the Rate-Limiting Step in the Reaction Cycle of the Fe/2OG Dioxygenase AlkB and Related Experimental Studies
rcsb
total genus 55
structure length 200
sequence length 200
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2015-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4zhnA00
4NRQA 4NRPA 4ZHNA 3O1OA 3O1RA 2FDJA 4IE0A 4IDZA 5F8PA 3O1PA 3O1SA 3RZLA 2IUWA 4NPMA 3I49A 4QKNA 3BTYA 4NJ4A 4CXXA 5DABA 3BUCA 4JHTA 3RZHA 3T3YA 3I3QA 3KHBA 3O1TA 3O1VA 4RFRB 4NIHA 4QKBA 4NIDA 4ZS2A 3H8OA 2FD8A 2FDIA 4IE7A 3BKZA 3O1MA 2FDKA 4MG2A 3T4VA 4NRMA 4IE5A 4CXYA 2FDGA 4ZS3A 3BIEA 2FDFA 3S5AA 3RZGA 4IE6A 4IE4A 4NIIA 3H8XA 3BTXA 3BI3A 3LFMA 3RZKA 4NIGA 4NROA 4QKDA 4QHOA 4OCTA 3H8RA 3S57A 3RZJA 2FDHA 4MGTA 3T4HB 4QKFA 3KHCA 4O7XA 3I3MA 4NPLA 4CXWA 3I2OA 3BTZA 4O61A 3O1UA 3RZMA 3BU0A
chains in the Genus database with same CATH superfamily
1ULOA 1FAYA 2Y0IA 3GZAA 1NQJA 5BYNA 3DECA 3GXUA 5FZ9A 2XR4A 3BTYA 3KM5A 2J22A 4MOAA 1T6BX 1Z0HA 4Q4X2 1F2NA 1JOJA 4DEVA 5FK7A 2EICA 2RS32 5JIUA 4C8DA 4JGZC 2W92A 5KXCA 2D5FA 3VGIA 4PDWA 2JEMA 3AYAA 3R6SA 2ZHLA 1EV13 3KS7A 4B7KA 3URFA 3MIFA 3MEPA 2VW0A 4IERA 4UT5A 3ABZA 4PLOA 1AXYA 2V73A 2Q1ZB 5IVJA 2B9UA 1DQ4A 2K9ZA 2HYKA 3AZYA 3TAYA 5FPLA 1AYN2 1G7YA 1F4AA 4I09A 2WABA 5D21A 3FHIB 3QOPA 4QGNA 2BP6A 2SBAA 2DDUA 4HOOA 2XL9A 4XF4A 3VZJA 2ZX3A 1RUF2 3I2GA 4FT8A 1OXCA 2RM21 4RL7A 2XMLA 4I0WB 5IT6A 2XUMA 5C9AB 1A78A 2QNKA 3IN9A 1SFPA 1UY1A 3USUB 4YRDA 3OYWA 4IE7A 3MUY1 4AVTA 1PGL2 3UKNA 4ZONA 1XC6A 2P4EA 3LA7A 1E5SA 2V5YA 2LM3A 1CD3G 2PFWA 4Q4V1 2E63A 4B4RA 1E5RA 3M3EA 1NZIA 4QD2A 3H50A 2R1DA 4JAAA 4LKFA 1OT5A 2XXZA 3UL2A 5K9YA 5F5QA 1O3TA 1VBE3 3CEWA 1SCSA 1S0CA 4ISQA 4OQ9A 5DN2A 3E5QA 4Q4Y3 1DYKA 3AP7A 3OTFA 4RGAA 1H9PA 4IGOA 3O5SA 3ZFGA 1DGWX 4AI1A 1LHVA 1B35A 1XOYA 1RXFA 2IXLA 2VMGA 4IEOA 4IV1A 5KR7A 4MXVA 2ZKNA 2VW1A 3V0AB 2Y6GA 3ME2A 5FZFA 1DZTA 1OURA 2QZ3A 5CFCA 1A6CA 2XLAA 4Q27A 3AKSA 1UL9A 1HV0A 3W20A 1W8HA 1W8UA 1UD1A 5F7UA 1DDLA 2AC1A 1OUSA 2JDKA 4Y1XA 3KVAA 1IPJA 5CG8A 3AXEA 1K3IA 1GP5A 2VMHA 4QU2A 5EPAA 5J36A 5EWSA 4AFCA 4GB33 2ARBA 4QWNA 1NKGA 5J1XA 1UMZA 1BEV1 4IV3B 5C3PA 1GP4A 1ND3B 2EF6A 4XFAA 1CJDA 1AR73 2A70A 3OOXA 1NE6A 4AQ2A 2WS91 3RPQA 3GDBA 4EYUA 2Y34A 5IVFA 5FLIA 5FZ7A 1HN1A 3WCSA 2E7AA 3WT3A 4GALA 1MVEA 4Y1VA 3T30A 3PMEA 4CZSA 2B8MA 4YNIA 1AZDA 4Q0SA 2HWB3 1KJLA 1KRIA 2GC1A 4IEVA 4LPLA 2YPDA 2A6ZA 4A7ZA 2R062 4FQZA 2DBIA 5A3PA 5FO8B 4M3CE 5IK5A 3H8RA 4PHZA 1OFSA 3UK9A 2W91A 4Q8KA 4XABA 4QKFA 4UW3A 2WLQA 4HVRA 4DXRA 5HCAA 4GWJA 3OEAA 1RUG1 2R1BA 5CFDA 5JZGA 1GICA 2R30A 3RI8A 2R072 5IK7A 3AYEA 5HV0A 3FFZA 2XL7A 3C7OA 4O9EA 2ZPXA 4AOCA 2WN2A 4D6RA 2EXIA 3LEGA 1G6NA 1DFQA 4JHTA 2W1SA 4GJYA 3ASIA 3KHBA 4HFSA 2QQWA 3ALQA 1PNGA 5FUPA 3OBAA 2VBBA 1ND2C 5A1AA 3OPWA 1UN1A 1UYPA 5FRAA 1LNSA 1KS4A 3BIWE 1QNWA 4B8EA 4M01A 2XOMA 3AL5A 4I3GA 3BN6A 1S2EA 3KT4A 4KU8A 4BIFA 1C8M3 4DRRA 1COV3 2D98A 4RHV1 3T0BA 5FZ8A 3KD4A 4OI4A 1UZ0A 2C1FA 4NRPA 3ZXLA 3C8XA 1HRI2 2J1VA 4WVMB 5F32A 4AAXA 4CE8A 3VD4A 4ET7A 1NE4A 1RMU2 4YGCA 5CZKA 4CDUB 3F2ZA 3RZHA 2BUKA 1MS9A 4LHKA 4M00A 2D6PA 1XNBA 1TG7A 1OUXA 4N7IA 3WDXA 4FTEA 2RJKA 2XONA 2PLV1 1ZRDA 2ZMLA 1OQDA 3UV9A 3B5LB 3GZUC 5C70A 2RDNA 1O91A 3C2UA 3J8F3 4NAOA 2ZEZA 2G9ZA 2RS12 5FCCA 4JGYC 4BOWA 3FX3A 3VKOA 4LA2A 4AEJA 1QKQA 1S1AA 1FNYA 2PQQA 1EAH3 2VMFA 4S2DA 1BYHA 4FOQA 1JYIA 3K46A 2D43A 5IAVA 3I2IA 2RV9A 2YC0A 2JDHA 3AKRA 3FE5A 2LTNA 1GZCA 3M8LA 3ITQA 1UAIA 4FFHA 4G4FA 4YVSB 2VVEA 4ASMB 1VBE1 3ELNA 3ILNA 5JXJA 1QQP3 2HWC1 2DVAA 3FZ3A 4GMP0 3E5XA 5A3OA 1CESA 2BVBA 3B94A 2ZHKA 2W52A 5LB6A 1OI6A 1GR3A 2VTFA 4XFHA 4E8CA 4FSJA 3JD72 4LUKA 4IV1B 5HPOA 2JE7A 3CNAA 3ES4A 4KWUA 3R0RA 4ZY9A 2XJRA 1A8MA 3TN93 2RJ2A 2VJXA 3WV6A 3MIGA 2VOVA 3W9AA 3SNMA 3T08A 3GBGA 1PK6A 5FO7B 4JGYA 1GQHA 3VBFA 3WLUA 5HBAA 4QB6A 1CIWA 4L97A 2PAEA 5LA9A 4MXWB 1AUYA 2Z42A 4CU9A 1QH7A 1DQ5A 2XJPA 1NCQB 2VR4A 2UY9A 3MI8A 2BNOA 3QH6A 1H4GA 4JKKA 1QJY3 2MHFA 3CJXA 1AYM1 4UAPA 1AL21 4KBZA 4XBNA 1Y3TA 1AL22 2A71A 4CEYB 1EY2A 2P1BA 4HMZA 5FJHA 5FOBB 2D6KA 4HVOA 4NPLA 4AVAA 5F5CA 1AJKA 3RI9A 2BDRA 5A32A 1WCUA 3I97A 1FV2A 1OF4A 4BWOA 1NA1C 4Q1PA 1DF0A 5HCFA 4A4AA 2AZ5A 2D97A 5CEHA 2JB8A 3IWZA 2VTXA 3NQHA 4OHYA 1PGL1 3EO6A 3U10A 1IOAA 5B4NA 1PX3A 1NCQC 3AM2A 2WWUA 4YLZA 5EYYA 2YPJA 2G19A 3DXTA 3CZJA 3OEBA 2XH6A 4GH4B 1LHUA 2BGCA 3DPRA 2NLRA 2BRTA 1N3QA 2VZ3A 2FDHA 1X50A 5FY5A 1XRUA 4PQQA 2CY6A 5ABJC 4B4PA 1G9BA 2WT2A 4NRQA 2OQ6A 4GH4A 3RZLA 1URXA 3LEIA 4YGEA 4NPMA 1YIPA 4WM8B 4YG3A 5K7PA 4D7TA 3R4DB 1C28A 3DPRB 4FOWA 2E32A 4YZ2A 5FFOC 2W9XA 1WZXA 1PK6C 5GALA 5FP9A 1GZWB 5FPBA 4CCEA 4FPEA 4RS5A 3M2MA 4R4ZA 1W3XA 3VZKA 1CAXB 2N7GA 1J58A 5FPXA 2VE1A 1PMIA 1YHFA 4XTPA 3T4HB 1BK1A 5LASA 1FPN3 2RDRA 4JX0A 2WL1A 3TEYA 1F8VA 3IAQA 5IK4A 2WNEA 3RRDA 4IL7A 2W2IA 4UFJA 1OVPA 4XEZA 3KV5A 5EFUA 2BW8A 2FCUA 5FJKA 4AGRA 5FZ3A 5FMCA 5JI9A 2W46A 5FP7A 4MH0E 3IAPA 3VL9A 4P02B 2X10A 3IDEA 1DGRN 4XJWA 3MV11 4MX3A 5FZIA 1PM7A 3GHMA 1QJX2 4JVAA 3NV1A 5DDJ1 1O8PA 4XF1A 5L7OA 4HKOA 5GZGA 4RHV2 4URAA 4I0BA 1RUI2 4G9SB 2SLIA 2NQYA 4TTGA 3BI3A 3BTXA 2YXSA 2R043 3HPNA 5JSPA 3AMMA 1S55A 1D2SA 2UU8A 4Q0QA 1SLBA 3Q9OA 2YZ4A 3LDKA 4LOSA 3VKFC 1HDKA 1YQCA 3VUOA 2HEWF 3EJKA 5T52A 3ZR6A 1QJY1 2NMOA 3LEKA 5A70A 3O1RA 2VMDA 2ATFA 2W95A 2Y6FA 3SITA 1UMHA 2V4AA 2RMU2 3H42B 2E9QA 2GDFA 3NAPC 4KMQA 1IS4A 1QDCA 2GH8A 5DAVA 1MPXA 2DUPA 3JXSA 2YMZA 3WNXA 5JCTA 2H6CA 4NR1A 4ZS2A 5C4WC 3KGLA 2FDIA 3NO8A 4IGQA 5C3SA 5BV6A 4A45A 4ES8A 2RS53 2IXCA 2WSUA 2Q5TA 4JCKA 2PELA 5A33A 1W2NA 1Y4WA 4INDA 5GZFA 2P37A 3MHZA 1JZ7A 5IW0A 1Q56A 4LXLA 2C9KA 3N7KA 1W90A 1UKRA 1OMIA 2BV4A 2O1QA 2ZGTA 3JD71 1CAVA 3IDAA 1U5XA 1Y43B 1C57A 3B00A 1FMD3 3RWKX 4CA9A 1TNFA 1ZRFA 5IVBA 3C7EA 3FWEA 3NJVA 4HANA 4P9XA 3SKJE 4Y5Z0 1NZCA 5GLZA 4CVUA 5FBZA 2BQPA 3HN3A 2W0XA 1CPNA 3KT7A 5J09A 3WNNA 5GLTA 5DPNA 3ZSJA 5IVEA 1V9U3 2B5HA 4P9JA 5DQ0A 4BQWA 5FYBA 2QCSB 1DIWA 5M0TA 2RHPA 1VALA 4CCLA 4FP3A 1IKQA 2HWD3 4XDOA 5AVAA 2EIGA 3PURA 5DXDA 2JDMA 1W2OA 4HONA 1TME3 2IFRA 1H0BA 1V00A 4QPIA 1ZZ8A 1QQP1 3T2QA 3OGRA 4D6QA 2WFF1 2A6WA 4IEPA 3WNPA 5A3WA 5LBFA 1QDOA 2R7EB 3VBSB 2PLV3 1F31A 4CUGA 1ZA7A 4HSLA 1ASJ1 5A7QA 2W1QA 5IHRA 2HWC2 3VN4A 1UOJA 2ETEA 2AEZA 4W50A 5DAXA 5AVPA 4WM7A 1GV9A 2AYHA 3ZSKA 2RS52 1WMDA 1OLMA 5FZ1A 5E88A 1GZTA 3OUHA 3OY8B 3GZTB 4H7LA 4QXKA 4XBLA 3J4UH 2ZGPA 2P3JA 1JMUB 1SQ4A 1V6NA 3QCWA 1RUG2 3ZFFC 2VNVA 4D3WA 4Q8LA 2X53S 4JKLA 1W0PA 4CCNA 2UY8A 3NNLA 3RZKA 1D4M2 3V0BA 1JZ3A 1UIJA 2ZGKA 1LECA 1MS5A 5DUWA 3WF1A 4Y4RA 5IJRA 1AXKA 3VBOA 4EN9B 4NOTA 1HB2A 1WGPA 2DFCA 2DU0A 2CAVA 2YDEA 2CU5A 4AL9A 2JDAA 1UCXA 1TME1 2HEVF 4YZ1A 4K21A 4AZZA 1Y9GA 4QAWA 1RINA 4GMP1 4RQPA 3WP5A 1VMJA 2Q8CA 2O8OA 1G86A 4CUBA 3OY8A 3NJYA 2VPVA 1ASJ2 4C90A 1PX4A 5FP4A 4QQOA 1ULDA 3PVNA 1DHKB 1N1SA 4RHV3 1PO23 1L3JA 1VRH1 5GZEA 2R042 2GN3A 3RZGA 3OGVA 1HRI1 4BE3A 4NIGA 3GZEA 4MADA 3UESA 5CVRA 5L9BA 1S2BA 4L9BA 2FQPA 3IMNA 1H1AA 3L2YA 4JV4A 3WOGA 1GQPA 3RZZA 5EHDA 1ND3A 5KXEA 1J1TA 1C4RA 2FMDA 4L2NA 1H8TA 2WZR1 3V56A 5LA1A 4CUCA 3LAGA 1PVXA 3BGAA 4AEMA 4YGBA 1RXGA 5G04L 1RUG3 4OULA 3T3YA 2W08A 4COYA 4YGDA 3J7LA 4YFWA 2VVFA 4PDWC 3AZXA 4OHZA 1JXNA 2GN7A 1MQTC 4AI2A 2VCAA 1Q8PA 2F17A 1RMU3 1AR71 1T6GC 2XHKA 4J6GA 2QQUA 4QB2A 3T1LA 3VD3A 4RYDA 2LROA 5A3MA 4UBGA 4XC9A 3DKQA 4HPKA 2JD4A 1BMV2 1RC6A 4QMAA 4RSUA 2WT1A 1NXMA 1HJFA 1EP0A 1WCKA 3R4UA 5FWEA 4UXAA 2O14A 5I0TA 5IVYA 2E26A 1YQ5A 4GKYA 2AREA 3HWJA 3WVJA 4P00B 1W03A 3ETPA 1AF9A 3NNFA 5JOZA 3V64A 3UNPA 5FYIA 1BK0A 1X8MA 2QDRA 2QQNA 2GALA 2VM9A 1ODMA 2BOJA 2ZHMA 5TSWA 3SLIA 2O8QA 5D1IA 1SPPB 2BNNA 4GH4C 4QDSA 5LBCA 1J84A 1LOEA 2HLEA 2FDKA 4XETA 2WR9A 5J7MA 3NNGA 2HKXA 2WA3A 5HV4A 4YW6A 2VVDA 3W5NA 3VV1A 5FZLA 3TNPB 4CDQC 2WQ8A 1QMJA 4QKDA 4QPGC 3VBHC 4BU2A 4COZA 3DYOA 2OUJA 1I9RA 3B3QE 3ZXAC 5I0RA 1I1EA 2W94A 1D4VB 4AW7A 3NJZA 5ERLA 3WNLA 4R8HA 1UXZA 3PU3A 5EJ1B 1G9CA 3TN92 4CDXB 3HVDA 5FP8A 2Q8DA 4B1MA 3ORJA 1XPWA 1DYPA 1U5ZA 3MLLA 3C7HA 2R063 3LOIA 3HD8B 5E8AA 3IIIA 3CLPA 1VAMA 3U11A 2EAAA 1IQDC 3C7FA 1VR3A 4B7EA 4Q4V3 3QBQA 4NIIA 4V1PA 2YFZA 1H6YA 2LUWA 1NLSA 1ZBA3 4KGQA 1R081 2OYZA 1BVP1 1FOD1 1S0JA 3NV2A 2R071 2FZ1A 2VZSA 4IESA 4LULA 1N1YA 1MQTA 4JDOA 4FPLA 4LJHA 5T5LA 1SFYA 1UF2C 1SACA 3W58A 5JXIA 4FPYA 4DZGA 2E53A 5JZGB 1RUJ2 1MS4A 1A3KA 5FZGA 1UU5A 4COWA 1SDWA 4O9GA 2WFPA 1ULPA 4IW3A 3PTRB 4XAEA 2P6HA 5FKBA 3O1TA 4RFRB 4BA6A 3UKTA 2AEYA 4P5YA 4XQDA 2BPA2 5A7WA 2O0OA 2WDBA 1R1A2 1W6QB 5FYHA 4LBLA 4RS5B 4FPOB 3AXDA 4ZXKA 1W6OB 2JG8B 1SLIA 4TLGA 5CYYA 5CAZA 3WQ7A 1PHMA 4UFHA 1CPMA 4CCCA 2D6MA 2DVDA 3MDPA 3UJQA 4BDVB 3DL3A 4Q0UA 1PIV2 3FMGA 5CFDC 2WJSA 1GBGA 4JGZA 1FV3A 5JMCA 1OLME 3POGA 2RMU3 2VG9A 5T3NA 1H1MA 1W9SA 2YGMA 3ENRA 4JDNA 3ZXEA 4HETA 5J96B 3ILFA 1YQ6A 4AFAA 3AK0A 2D44A 1R083 1UQXA 1OFNA 1VBB2 3N7JA 3N9OA 2FBEA 5FO9B 5AC93 4AVCA 4AI3A 5H9RA 5KHGA 3J7HA 2B39A 4MUVA 4LTAA 3SCFA 4QPGB 4BQ4A 1XNCA 2VCMA 1TMF2 4LBQD 4EN8B 3A0NA 3D3AA 4CEWC 4N9IA 2D3SA 3PUAA 3WG2A 5HXMA 4V2VA 3NAPA 1GUIA 3SKVA 1CZSA 4XJZA 4P9YA 3TNQA 1YI7A 4WVWA 3K77A 1Z7S1 4I0AA 4RD7A 4EWEA 5C4WA 1KDKA 3ZFGB 1LGNA 1QGLA 5B2GB 4A44A 4DY3A 2XKPA 3PJYA 4KWJA 5DDJ2 3NKTA 4AI0A 2QQKA 4I02A 4GZ9A 2ORXA 4NWWA 1BBT1 1ENQA 4GD4A 3I2JA 3WP3A 1EUTA 2QDNA 3OUIA 3NV4A 1V6LA 4UFIA 5BNNC 4LORA 1G9DA 2ARXA 5HCBA 5LEJA 4KG0A 1BBT2 2LS6A 3PVBB 5A80A 1GOFA 1QJEA 1WMFA 2RE9A 2XJVA 4IEWA 4F8AA 1QJFA 2PHUA 4LHLA 3LDRA 4XBQA 3FUQA 4LUMA 2BBAA 1GANA 2HWF1 3J9SA 1F9KA 1TMF1 4QM9A 3ZFEA 2VZPA 3CJIB 4O61A 4IUGA 4XHXA 5L36A 4KH9A 4YG6A 2R32A 1GWLA 3EXUA 3W59A 3E6CC 2A3WA 4K1YA 4D6SA 3VDBA 5CNAA 1RGSA 3VHPA 1CWPA 1KJRA 3M4FA 1UPSA 2YROA 4CPBA 3FHAA 3ZXJA 1S0IA 3N9PA 4FFFA 2ZX0A 1NY71 4COUA 1LGBA 5FXZA 1DZQA 4MHRA 2LALA 1PZ7A 3B93A 3ZDSA 4Q4Y1 5APAA 1KEXA 1W6MA 3H8UA 2J1EA 2JWPA 1K12A 5L19A 1ND2B 2JICA 1VBC3 4CRQA 4P9WA 1G8WA 1Y7BA 2BWCA 1K5MB 2Q1FA 1HQNA 2VOTA 4J1WA 4K20A 4AI8A 4R9BA 1E5IA 4CDWA 2FDJA 2JE9A 2QQOA 2WWSA 2YC4A 3PUSA 3NV3A 2E33A 3D4KA 3JBG1 4K7JA 2ZGQA 1IHMA 3LOBA 2WNVA 3RJRA 1RHI2 4FAHA 1UIKA 4LE3A 3UJOA 4S2HA 3OPZA 1OVSA 4EWDA 4K6BA 1OHFA 3KLSA 4Y22A 2QKDA 4QXHA 1JHNA 2E7TA 3NMBA 3VBOC 1DGWA 3KSCA 5CKMA 4PBOA 3HNYM 4NHMA 3THCA 1R092 2DCJA 1TVGA 2RS33 2X5IA 2CGNA 4GMP3 5C33A 4Z1VA 5DUVA 5BNOB 2HWD2 5LRRA 2A3YA 1JODA 1ZZ9A 1V6IA 1UXXX 4BK5A 5E89A 4QGLA 3P1IA 5FY0A 2A5ZA 5FPZA 5EIYB 3B9IA 3LD8A 1ODNA 4XUOA 5L7OB 2WO7A 1H8VA 1FT9A 1PM4A 2R16A 5A7OA 5FR3A 1UNBA 2PXJA 3I3QA 2FHRA 4BMEA 5CFDB 1O3SA 2ZXQA 3LCPA 4E4ZA 5LWBA 3O1MA 2WZEA 3KGZA 1O8SA 1YWKA 2VQUA 1AX1A 1UPIA 2WS93 5GKAC 4IE4A 1GSLA 1AR61 1RJ8A 1LR5A 1W0OA 3DUIA 3QH7A 3WZ1A 1VBD1 1JUIA 3POIA 4XF0A 1WW4A 2PHLA 3OGSA 4D7SA 4JRLA 4XUTA 2QQIA 1LOFC 1GU3A 2PHXA 4MGYE 3H1MA 4YW2A 3NNMA 1MS8A 1WW7A 1W9WA 4F3JA 3KWVA 3BU0A 4DNYA 5FP3A 1HN0A 4FTBA 1OD5A 5SV5A 3AZVA 3POYA 4R9CA 2PYTA 1Q3EA 2R073 5JR7B 4LBMA 3EHKA 5T5OA 4Q1RA 3D0JA 4NIHA 1CAVB 4LOTA 3E5UA 4LA3A 3HEIA 4M3CA 5C8CB 3LKJA 4QX3A 2JDYA 5JOWA 5C3RA 4DEQA 4JQTA 2OVUA 4MSVA 1R1ZA 5A33B 2J7MA 4KNCA 1W0NA 2HWE3 1W2TA 4CUAA 1ZZBA 3H3LA 2D6LX 2WN3A 5KC6A 1OOPC 1NUKA 3HMYA 3MIEA 4XIOA 1LOFA 4YW1A 3VKLA 1SBFA 2D6OX 1J3PA 2DCYA 2Q30A 3Q8FA 5A7SA 3T2OA 5LEKA 5L9RA 2NP0A 1HXS1 3WDUA 1R64A 4GQ7A 1W2AX 4CCDA 2ID4A 1AL0G 2IC1A 3VD7A 4D7YA 2QFEA 4DUXA 1ZRCA 5I0SA 4LBKA 2MEV3 2A1XA 2B42B 3Q8BA 1GNYA 2ZACA 2WAOA 2Z4FA 2ZA9A 3HBZA 4XXPA 3ZXDA 5IFPA 2HBTA 4QGMA 1S2KA 2GNTA 3SISA 2RJLA 3J8F2 4DXTA 1LOCA 5JAXA 2ZEXA 5FQ0B 4E9KA 5FYTA 1GFF2 1AR81 1Y9MA 1UX6A 3H3UA 3H1WA 3HR9A 4Q4V2 4TXWA 1GOGA 2HEYF 3D0SA 2WZR2 3HNMA 4FFGA 3TOJA 1UW8A 3F95A 4HZFA 1JUHA 1W8TA 1U12A 3ZYJB 2G9GA 4XXAA 3O1OA 4LBJA 4H14A 4OZOA 4DUWA 3X29B 4JGYB 1FYUA 1ZA4A 3D82A 2CHHA 2P17A 2X5IB 1QU0A 4FPCA 4YG0A 3H7JA 4XJ8A 1HRV1 3LSDA 2R041 1YQ2A 4Z07A 3ZXGA 5B4XA 3ZLIA 1O5LA 1RMU1 3VBSC 4M4PA 2P2KA 2GMMA 4JDMA 4XQWA 1QXRA 2XVLA 1XSRA 4PF5A 3WX5A 2GNMA 3RMXA 4YYOA 2CGPA 4XE9A 4OHWA 1RTVA 2V72A 4R9DA 1W6PA 4OCTA 2JIJA 1LESA 1KDMA 2QJVA 3OG2A 4RS5C 3UGGA 4M4RA 4LBQB 4AHYA 1DLCA 3H7YA 1XNTA 4UYBA 4XURA 5AFEA 2OPKA 2PA7A 4IDZA 1FPN1 4UF0B 4I2OA 1XB9A 2ILMA 1VBA2 2YU1A 1LOAA 5IATA 4YM1A 2D3PA 1ZRRA 1S0BA 2ZKLA 5JIAA 1N3OA 1C1FA 1TE1B 2IVIB 1Q5OA 2XB6C 1ACCA 5ABJB 4P9LA 1MZ5A 1D2QA 1TMF3 4ZPIA 4I01A 3R05A 5FYMA 4AEDA 3PIGA 4IE5A 1W28A 4BMBA 1UKGA 1XJAA 2VBDA 2OKXA 4CPBD 1HLCA 4QXBA 1MVQA 1RITA 2MNGA 2ZAHA 4K9SA 4ZHNA 5JOYA 3DKWA 2J1RA 4TSVA 2FDGA 4KGGA 4AGGA 5FWJA 3S7EA 3RQ0A 4AF9A 3O1UA 2P3IA 3GGLA 3RS6A 5C9AC 4WVMA 4QX2A 4PT6A 3S0MA 4U36A 3ZSLA 4LKSA 4XHBA 2CWMA 2RR12 5I0DA 5I93A 2YGLA 3M3CA 4Y20A 3AKQA 4OFGA 1LHNA 2Q1MA 3OGGA 4QX0A 2UURA 2ZTNA 1W99A 3KQRA 1CONA 3N9NA 3GM8A 4H55A 1TEIA 1GYKA 1FX5A 1IPKA 2WC2A 2ZGRA 2G4IA 4YZ4A 1MEC1 1RUD3 4GJZA 1LB2A 2YBKA 1RL3A 3KV9A 1F5JA 4NWVA 1YLLA 2VMEA 3WY6A 1Q8OA 1DQ2A 2PQSA 3D5OA 2A75A 1ZZ6A 2XKOA 2C4XA 3A22A 2EXHA 3FUOA 2IZWA 4PIXA 4BHPA 4CCJA 4Y33A 5KHKA 1NYWA 2WWJA 4NO4A 5CG9A 3ZPYA 4XPVA 1AR72 3FLPA 5E16A 5ACA2 2ERFA 2JG9A 2X09A 3M70A 3K4AA 1Q8VA 1LCLA 3JZVA 5H9QA 1W06A 3VDDB 2RR11 3CF6E 3N35A 4KWKA 3WEZA 4AEDB 4AVBA 3I54A 1DBNA 3CHXA 1H4HA 1QJU1 4EE2A 1FOD3 3O14A 4MVTA 2UYBA 1FPN2 1FXZA 1RUI1 1CAUB 1YJKA 4XFCA 2R49A 5LK7B 2YU2A 3H3ZA 3JB8A 4PI0A 5DZEA 4NE9A 4QXCA 4YZ5A 4Q4W1 1BQPA 2RVAA 3IIAA 5DZGA 5T5PA 4EZ4A 4UF0A 3N9LA 3RDIA 3OD4A 4QPIC 4TYSA 1WW5A 4YSFA 1MZFA 2W47A 4BQ2A 1DGRA 3BB6A 4IEXA 4Z8BA 5FYCA 2XHNA 4XFGA 5LA0A 3ACFA 1PO22 3CL1A 2CNAA 2GC0A 3P6BA 1RUF1 1QOTA 1WLCA 1F4HA 1IZ3A 3UETA 4Y1ZA 1Z7S2 1OLRA 3DCQA 4W65A 2WNOA 3ROUA 3ZKYA 2DVGA 5KC5A 1AHSA 2E7QA 1L7RA 2WNUC 3DF0A 1EPWA 3OBZA 2DBNA 3PUIA 4NHYA 3VKNA 3ZKUA 1YQ8A 2ZX1A 1V9U1 3U1XA 2R061 4U2AA 3JU9A 3LZZA 5DMYA 4IQPA 1XSQA 2DUOA 2ORZA 2R0HA 1XU1A 5FMOL 3V0AA 1BJQA 2VUJA 1JOBA 3U4SA 2OUHA 2XQRA 3J8F1 4MGKE 2ET7A 2AGSA 3R4SA 2BYVE 1W3VA 4BLIA 3A0KA 2K0GA 2WS92 4N53B 5EJZB 3SC7X 2J1UA 2V09A 2UWBA 1KS5A 3MW3A 1V6JA 1NLRA 2XJTA 3VZMA 4XMAA 3RZJA 1NA1B 5DZFA 5JDBA 2V4VA 1JZ5A 1YIFA 1VLNA 3K3NA 3H1YA 1AVBA 3I8TA 3AMHA 3PLQA 3U0ZA 2YY1A 5T50A 3VBFB 1GWMA 2AR6A 2IXHA 4EQVA 4XJUA 2BFUS 4UFKA 5FZOA 1JU3A 1HJGA 3KV4A 1JZ2A 1O3QA 4HK9A 1F35A 1C8M1 4M0HA 5C3OA 3B7MA 2B46X 4DOUA 2K2SA 1SHWB 5E1RA 4QKBA 2UWAA 5IFTA 3IDCB 5J98B 2XBO2 4Z82A 4GB32 4C1WA 4PIYA 1NAEA 1RUJ1 5A1FA 2XVGA 1VBD2 1C3HA 1COV2 1XNAA 2H0BA 1IG0A 4AQSA 1XYOA 5L9VA 1S0EA 3ST7A 3WF3A 1ZZ7A 3FLTA 1RUD1 2HH9A 5K8SA 4B4QA 5JPMB 1COV1 3AJZA 3JUUA 3LA3A 1W6QA 4YZ3A 2IUWA 5A1LA 1IS5A 4EZHA 3WDWA 1HW5A 1AR91 2BU9A 4ZXEA 5A7NA 1POQA 3LDBA 5DUUA 1VMHA 3GALA 3RSJA 5HCHA 2A7AA 4P08A 4RA0A 5C8CA 4KBBA 1LULA 2EIEA 3A23A 3TB0A 4UFMA 2IFWA 3B02A 1RUC3 4OUEA 3HQUA 4QU1A 4IE6A 5FZ4A 1GNHA 1DQ6A 4FPGA 4Q0VA 4MHUA 1IS6A 1UMIA 5FREA 4CDUA 3O0XA 1ZZCA 1SBDA 2VZQA 1UY0A 2GNDA 4UOJA 4Y4YA 2DF7A 4CCKA 4EJRA 4AFBA 2A73B 1SLLA 4LR4A 4ORFA 4Q0PA 3VBHA 1QOOA 5FY9A 2OPWA 2BWAA 3PUQA 3T2TA 2EIBA 2C5DA 5GLVA 2Y64A 5A6XA 2IXIA 2JDNA 2OXBA 4RR3A 1ZM1A 2Y0OA 5DG1A 4N43C 1ZBE2 2C0ZA 5FXVA 4FI9A 4GULA 4OI1A 3PIJA 2X29A 1UYZA 1MEC2 3CIHA 2J1SA 3MF6A 3INAA 2WFF3 1S4CA 4RQPB 1OLQA 4BISA 1PO13 1JYCA 2DUQA 2TBVA 1YJLA 3QLQA 4YVWC 1BLZA 2RG4A 4OUMA 5EYXA 3SH5A 4AAPA 1LAJA 4QQHA 4NIAA 1PZ9A 1EV12 2VMIA 2YBPA 3IT8A 1RUH2 3ZMOA 2VTXJ 1PMHX 2D3RA 4WZFA 2OW4A 3ZIWA 1C5HA 2BEOA 5CADA 2XBO1 5FYYA 2HBUA 2R0FA 3KMHA 5J37A 4E4SA 2PHDA 3BVCA 3VD5A 2ZCWA 2PN5A 1J3RA 3ZN6A 4IEYA 2ZGOA 4LKEA 1A8DA 1FMD1 5FZ6A 4BQ1A 2JX9A 1JHJA 1VB2A 1RUF3 5FZOB 2QVSB 5FYSA 2HWF2 1AL23 2Q8EA 3RNSA 4A7YA 1AJOA 1EAH2 3EBRA 5FV3A 2EALA 3T09A 4TZDA 1XXNA 1BEV2 2RM23 1SPPA 3U37A 1IS3A 1G9FA 4CU7A 3ZXKA 5D8AB 1ZRIA 1UY2A 4R9AA 3ZYBA 1X8EA 3TRSB 3AYCA 3GJBA 1D4M3 1H2NA 1S0DA 5JI7A 5F3CA 1JZ4A 5FY8A 1BCXA 2Y60A 4EROA 2DV9A 2W3JA 2V5DA 3ZFEB 4BQYA 1RUE1 4MGZE 1WBFA 1MS3A 1O4ZA 2DYCA 3AX4A 1L7QA 2VECA 3C3VA 1JH5A 3TN91 2QQVA 3T4VA 5BUVA 1CX4A 1H8TB 5IUQA 4IXLA 5JXHA 3ES1A 5LRSA 4Q4W2 1HB1A 3UGFA 3E1F1 2WZPP 1UX7A 1VP6A 4YVSC 2DTWA 4ZKTB 2YBSA 1U5YA 1AYM2 4X6QB 2P5BA 3PVEA 4O7XA 3I59B 3I3MA 3MF9A 1ND3C 2W1UA 2BBVA 1W8WA 1BKZA 3KZ4C 1QJU3 3MIHA 2GNBA 5FZHA 4A42A 4CU6A 4WM8A 5AC92 5KHJA 2BOIA 1J59A 1RVF1 2RDQA 1UZWA 4AK3A 1ZX5A 3RFRA 2WO1A 4OI2A 4Y5SA 1Q43A 1WD3A 3DYMA 5LK5A 2DWRA 2W39A 2VXJA 4MZUA 3WXPA 2TUNA 4QT6A 1LHOA 1IKPA 1VBB1 1MACA 4GWNA 4QPGA 5CB7A 2F4LA 2H6BA 4AWDA 3EB7A 4JTNA 2H0VA 1K45A 4AI9A 4LITA 3WSOA 5DDJ3 2DCKA 2VZRA 5C9AA 3AP9A 3NAPB 5GZCA 2RS13 4ASKA 1SZBA 1JYWA 3PL0A 1JOPA 5FOJB 1RB8G 1XE8A 4P9IA 1W6NA 3WD5A 4MYEA 2JDPA 3WW4A 5A6YA 4DMIA 2BNMA 3ZFFA 1FATA 3UKVA 2WA4A 1LHWA 4AHXA 1GZ9A 4HXCA 3OB8A 2VBPA 2FD8A 2D5HA 4E2SA 3WNMA 3ZIXA 3FN9A 4A7KA 1CX1A 1BVVA 2OT7A 3MGUA 3WNKA 3FJSA 4W8JA 4LK6A 1X9TA 4DPNA 1O59A 5KHHA 4FOVA 1RUC1 3U78A 4AEKA 4J25A 2KXLA 3WHUA 2CAUA 2OA2A 2ET1A 4JC1A 1RUH3 2ZMKA 4YWAA 2VOXA 4IGPA 5LW9A 1VAVA 3SHRA 4IEUA 4Y22B 1NX9A 1JU4A 4FPFA 4NN0A 5I0UA 1H30A 2BGPA 1VPHA 3A21A 1AR93 2JJ6A 1V0AA 3FFQA 3SH4A 2JKXA 3S5QA 1I5ZA 3I2FA 3WUDA 3CJIC 2G1MA 3BKZA 1VBC2 1CIYA 1REFA 2KD7A 2RMU1 2QQMA 1YFXA 4EV0A 3JBG3 1POV1 2WKKA 2E6VA 4V2WA 1HRV3 3THTA 2CTVA 4CCOA 4Z2WA 1YFWA 3IM0A 3KQ4B 3TEWA 4LQRA 1DQ1A 2ZZQA 2Q8OA 4MGIE 5FPUA 3NWKA 5F8PA 5JSRA 4BXSV 1V6KA 2X5IC 1OKQA 1SDDB 3MW4A 4AFMA 3HIFA 5F9TA 1B35C 3PMSA 3POWA 1AR83 3NNJA 3ZFGC 4UBHA 2VZVA 1YYNA 5BY5A 1R093 3I3BA 2B45X 1IQAA 5CKQA 5FPVA 3RYPA 3VD9A 1IG3A 3WQ0A 1QOSA 4D0QA 3CJIA 4XILA 5FK8A 1W9TA 1CGPA 2WNUA 1QH6A 3RG0A 1X36A 2P34A 4CDXA 4JKMA 1AYM3 3HT2A 3WW1A 2TEPA 4PLNA 4XJAA 5KBFA 2ZABA 4K3UA 2ZGNA 1OH3A 5JZGC 5A32B 3BOPA 1D4M1 3PDQA 2QUOA 2XG3A 3IKWA 4LLOA 5BNOA 4KI5M 1SEFA 2HWC3 4N90A 4OQ8A 5A6ZA 3FHQA 4DRVA 4NJ4A 1UO9A 1ULCA 4ARXA 3PU8A 3OPTA 5DABA 2D40A 1W9FA 2WZ8A 5IAXA 3K4DA 5FAXA 5ANNA 1ND2A 3VZLA 3MV01 4LMFA 2JIGA 2CDOA 3J26N 3WQ1A 2W68A 3DYPA 3VZNA 4N53C 3MIDA 3WUCA 1RJ7A 5FTTC 4HKLA 4K1ZA 3POFA 2I74A 4BK4A 1WA4A 4W6XA 2W87A 3ACHA 3LPGA 4CDWC 2WT0A 4YW5A 1JZ6A 2ARAA 1OPOA 2WQ4A 2Y6JA 3SCHA 4CXWA 1YCIA 4DUVA 5IK8A 4EN0A 3K3OA 1JYTA 2IXJA 2Y6HA 3P5BA 5FQ0A 1PVC1 3AVRA 2ZS6B 3HNBM 4LHNA 1BMV1 1GZWA 1W9YA 2KM2A 2GP5A 1UZZA 3BUCA 1PO11 1E57A 1GKBA 1X33A 4X8NA 3U14A 2GP3A 2XLGA 4P14A 4CDQB 1REEA 4KU7A 1TME2 2ZHNA 2EA7A 2R6QA 3SH3A 5A3NA 3CBNA 4NPRA 4CP1A 4M3CF 2UYAA 1XE0A 2ZX4A 3ACLA 1MR5A 3D8CA 4LKDA 5LATA 1I5PA 3AC0A 5LCWL 3ZMNA 4XFFA 2A6VA 1LU2A 3OSDA 5F5AA 3W21A 5E6HA 5IYYA 3W5MA 5FPAA 3LPFA 1ZREA 1CQ9A 4ZZ8A 3NL1A 4AQ6A 2K46A 3IPVA 1R091 2Q4SA 1AR62 3AP6A 4NMIA 2VUAA 4XAAA 4ATFA 2RDSA 3AYDA 1MS1A 1RUE2 1V70A 1QEXA 2ZBJA 4B3NA 1QXPA 4XACA 2GMPA 2JD9A 2YC2A 3B69A 3RVHA 3OBTA 4AVVA 4DO0A 1X9PA 4AG4A 2P3YA 1RHI1 4QPWA 1ZNPA 1WCQA 5L73A 1OQEA 2JG9B 2YUEA 1XYNA 4C0BA 3ZSMA 2OZ6A 4J1XA 2QQPA 3E6BA 4MGQA 1LEDA 4B29A 1POV3 3H8XA 2IVJA 2D7FA 2Y6KA 3WDYA 1S0GA 4CCMA 4QHOA 3VBOB 1H2KA 1NA1A 1WUVA 2VXRA 3U75A 3WG3A 4TWTA 1ULGA 3V0BB 2A6XA 4P9GA 2FCTA 2ZEYA 3AL6A 3OF1A 4ZU4A 5T5JA 4Q29A 2RS31 4GIQA 5D8AC 5ISLA 4DFSA 1VE0A 5I8YA 1SCRA 5DAQA 1VBC1 2WNVC 3HJRA 2OZJA 3K51A 4TLFA 3AFKA 3O1VA 3SXWA 1NCRC 5FDBA 1CN1A 1VJ2A 1XBFA 1L7LA 4XTMA 3S7IA 4FPHA 1OA3A 2QTWB 4G3YC 4D8MA 4BB3A 3I2KA 1SLCA 3VDAA 2JDUA 3N3HA 3ZYIB 1TNRA 1LGCA 3VZOA 1GOHA 1IPSA 1UOGA 2WINB 3AKTA 4M0NA 4BZ4A 2W5FA 5FMBA 4PF1A 4MXWA 1CJPA 3AMNA 1R1A1 5A7PA 3VBUA 5IVVA 1OD3A 3VBSA 2WFF2 4XF9A 3O1SA 3MZHA 2Y26A 4XMIA 1WLTA 1VIWB 1VAKA 4QX7A 3G6JB 4AHWA 1N3PA 4HG6B 2Z69A 2OX0A 3ZPOA 4GAZA 4E27A 4DQAA 4DY5A 3KCXA 1JYVA 1J3QA 2VY0A 3PVOA 1CAWA 5DG2A 3A4UA 4CDWB 4N43A 2JG9C 5A3UA 1LRHA 1NCRA 4OYUA 4UW4A 4E2QA 4OMDA 2HYXA 3BIEA 2GU9A 4ZU5A 3SEPA 2VZTA 3MO4A 4FQ4A 1WMEA 3ZR5A 3UYJA 2FZ2A 1UZVA 1YI9A 4OI0A 1BHGA 3M3QA 5C7GA 2XPJA 1H1IA 3TWIA 5FBJA 4XYXA 1JBCA 1UY3A 1NCRB 4TN7A 3IZOA 5F2WA 4AQTA 3MBWA 4CP9A 5CKNA 1UY4A 3LE0A 1CZTA 4F7ZA 1SG3A 1AXZA 1CR7A 3KCYA 3GHNA 4IV3A 1D0HA 1KQRA 2XUEA 4LIVA 4Y5TA 1SMVA 1W6MB 2BERA 3VDDA 4WVVA 2GC3A 5C8WA 2ZAAA 3GCWA 2ARCA 3KF5A 3ZO0B 4CP9B 3O7OA 1CAWB 2PHWA 4QDQA 2FCVA 4L92A 2I07B 4XFBA 5FZ0A 1T2XA 4ES9A 1UYXA 5CA6A 1RUD2 3MIBA 4RR3C 4KG8A 3KV6A 1HQLA 1QJX3 4L8QA 4CXYA 4OMCA 1GQGA 4FXGB 5AC91 4XVHA 5K4LA 5C5TA 5EXOA 4F83A 1C8NA 4CEWA 4GXLA 4N9HA 4LLFA 4QPYA 3VBUB 4DXZA 4WM8C 2VCBA 4NAMA 4CU8A 4MGTA 5C5UA 3ZN6B 1SLAA 1ZVFA 4LBOA 4UI9L 3VBRB 1RUE3 3BPZA 1X7NA 2HWE2 4NVPA 1LEMA 1C5IA 4WVZA 4NUBA 4LEJA 1HXS3 1ZBE1 4H2AA 4QX1A 5A3TA 3CQOA 1WLWA 4CP0A 3B01A 1W05A 1POV0 1KITA 1UZYA 1W8OA 1QY4A 1ZBA2 4BQ3A 2QZ2A 3OYWB 4XIKA 2F6BA 3MLKA 2TNFA 4XUPA 1ULFA 3N36A 1EV11 4EN6B 3EYPA 4BQ5A 2WLPA 1N47A 4FTSA 4XZPA 1DP0A 2AH2A 2VU9A 3BALA 3K48A 3I2OA 2YB7A 4LO4B 2PHFA 4R4XA 3CDZB 1PZ8A 1BXHA 3ZFEC 3MFAA 1QNYA 1AR82 4HPKB 4QQPA 1JYXA 1FMD2 3N7LA 3VBHB 1OF3A 1ZBA1 1ALYA 1KD7A 1NQDA 1QHDA 1VBA1 3K4ZA 4Q4X3 5LBBA 1JYNA 1QXJA 2Y6LA 4MO3M 3ZN4A 4COVA 2ES3A 1VBD3 2NZ9A 2VL4A 4ZS3A 1SFNA 4ITCA 4C91A 2GH2A 1RUH1 1ASJ3 1AX0A 2VNRA 4QHZA 4LO5B 4FPJA 1W6OA 2JG8A 3LQCA 4OUSA 3USSA 2B4KA 2EIDA 4XCBA 5BNNB 1R082 3VBRC 1OPMA 1XNKA 1RUOA 4DS0A 1AYN3 2QBXA 3GBWA 2A6YA 2VAUA 1OBNA 4A2UA 2PLV2 5JWPA 4L0PA 5LBEA 3CZUA 3IMMA 3ZYHA 4FOYA 1N1TA 3LWCA 1OSGA 4K40A 3P3NA 4UW5A 3VHRA 1O7FA 3AMQA 5ACA3 2MPFA 4MV2A 1MQTB 1W04A 5FXXA 2VUCA 4LBNA 3U07A 2XVKA 4XFIA 4CSWA 3LSEA 4JTOA 1WWYA 1YXWA 4YM0A 5FZBA 4QQ2A 3LFMA 1UU6A 5EJ3A 5GLUA 2EVXA 5FYZA 3SQOA 1VRBA 3M1HA 3RMYA 3RYKA 2J1TA 5L7OC 4FVVA 2X8KA 1FOD2 3P3PA 4X8PA 3O12A 1RUJ3 1VBE2 4Y1YA 5FMOS 4DIQA 2RS51 4BJ0A 3VDCA 1NXD1 1DZRA 3JQWA 4KL1A 5FMDA 2P3KA 5FLHA 2DVFA 2E51A 2VMCA 2JENA 2Z5WA 5D8AA 5HXVA 3ZYGA 1FNZA 4Q26A 2VQTA 1B09A 3TBDA 1HB3A 3VHOA 2CDPA 2KR2A 3APBA 1M06G 2I45A 5DUXA 1NLQA 4XUNA 2WUHA 1QQP2 5CIRA 3S30A 3AVSA 1MS0A 3PHMA 3FBMA 1V9U2 5BNPC 2OQ7A 4OHVA 1YUDA 2PTMA 5BNPA 2VQ0A 1PIV3 3PTYA 3DXUA 5FY1A 2D93A 1PVC2 4HKWA 3VHNA 4FPKA 1WBLA 4HSJA 4FAGA 2JXAA 4QHBA 4YW7A 1HV1A 3S6PA 1HQWA 3OGJA 4BH9A 2GC2A 3I59A 3M7AA 5FY7A 3CO2A 3N7MA 2BFUL 2Y8KA 1QWRA 3Q8EA 1C1LA 4L99A 4RQPC 5C71A 5JOXA 3DEMA 1QJZA 3VL8A 4AXOA 1HRI3 4BCUA 2CV6A 3CU7A 1DQ0A 3BU7A 2XLFA 4JRAA 2HWF3 3SEEA 5CFCC 3POEA 3UT0A 3WDTA 3LA2A 3CMGA 1KXGA 1NG0A 1PNFA 2XWJB 3I4IA 3HBKA 2ZGUA 3AKPA 2DU1A 3NSTA 1GNZA 4YM2A 5FUNA 2PAKA 3RYRA 1SBEA 2LRPA 2NN8A 1HKDA 4XDQA 2JDZA 1EPZA 3ZDVA 4Y1UA 4YVWA 4H3WA 4D69A 4YFZA 1VRH2 3I3EA 2WYSA 3HQXA 3ZYRA 3SMHA 4AVSA 4Q4Y2 1Z78A 2XBO3 3ACGA 1PGW1 4W4ZA 3ZVXA 4LO7A 3POSA 3I7DA 4Q5OA 4DB5A 3ZXFA 4Q4W3 1YRZA 4WM7C 1FI2A 3M3OA 3WHTA 4Y26A 1AYN1 1WCDJ 1ENRA 5JLVA 1E5HA 4RFT0 4X6RB 1QJU2 3N4MA 3IBMA 2WO2A 3WP6A 2AACA 1TZOA 4XW3A 3QD6A 3J7NA 3WW3A 3L9JT 3KCCA 3BPSA 4XDPA 5BPXA 3HAGA 3JBG2 1AR63 4AEDC 1DU3D 3BYWA 3ZFFB 1VMFA 2WIIB 1VBA3 4Q4X1 5F3IA 3VBUC 4PIZA 1YEWA 1RVF3 4K8FA 2VNOA 4UWDA 1ENXA 2FMYA 4S2FA 3AZWA 4ARYA 4AR2A 4YPJA 4UW6A 2DVBA 2HWB2 3PJQA 1OKOA 2WBKA 4XOGA 1X82A 2CGOA 5J48A 1YFYA 2E31A 3ILRA 1NCQA 2DURA 3MFCA 4KQ7A 5F5IA 1GWKA 2DCZA 3E97A 3WF2A 3U4XA 1OH4A 4A6OA 4ZU7A 3OUJA 4QQLA 4YVWB 2BZDA 3FBYA 1W39A 2C6SA 5BNQA 2BTVC 4Y24A 1QIQA 3KF3A 3LIHA 4FCAA 4RN5A 1K5MC 5FUIA 1MEC3 2WO3A 1K5MA 1WCSA 4MG2A 5ABJA 3HN1A 3VB9A 4E2GA 4WV8A 2CL2A 1RYYA 5FYVA 5K0UB 3C7GA 1ZBE3 5I8SA 4OLLA 4LHSA 1ST8A 4HVQA 3H0OA 3ZM8A 2VW2A 3GNEA 2ZGLA 4CDQA 3DGTA 3VDDC 4QM8A 5GM0A 1CVNA 3JD73 5FXWA 5CBLA 2DFBA 5SV8A 1AX2A 2VCCA 1QF3A 3LEMA 3OCPA 4AYUA 4E8DA 1NT0A 2VNGA 3D6EA 5IWFA 4Q2FA 3WW2A 1UOBA 2VO5A 1YNAA 2HWB1 3HT1A 3MYXA 1JTZX 2VGDA 4YVSA 1QJX1 4IV1C 2B7YA 2XDVA 3MW2A 1TQ5A 4HT1T 4QB1A 3VKMA 1YFUA 2WQZC 5CU1A 2P6CA 3Q8AA 4NIDA 2NM1A 3O0WA 3VLBB 1A34A 5C8CC 2B9VA 1DG6A 1F15A 1OOPA 2FDFA 5T54A 2XJUA 5C4WB 5F2SA 1BEV3 1JN2P 1YO8A 2OIIA 2RM22 5BNPB 1QJY2 1B35B 3S57A 3M3IA 5EP9A 3ZYPA 4EN7B 3FL7A 4Z2AA 1O6UA 4LIUA 3BTZA 5CISA 1DGLA 2QE3A 2C9AA 4UFLA 3WF0A 4C0HA 3WR0A 5EV7A 3JCIA 4HK8A 5I8TA 2YYOA 1Q8QA 4FO9A 3GBFA 3NRUA 1H2MA 1G9AA 1GMMA 1SLTA 3I2DA 5A3LA 4HL0A 2XGXA 1STMA 3WP4A 3THDA 1LU1A 1W8FA 1CAUA 4Z92B 4W6YA 2X05A 3NKGA 4RGGA 1M4WA 2W1WA 2YG0A 3I3DA 1O4TA 3AMPA 5ACA1 1PIV1 2GMEA 2WNUB 2JE8A 3BODA 5LA2A 3G7DA 2PAMA 1LODA 4BXFA 2JB4A 1N1VA 3NW4A 1BZWA 3T2PA 2Q0AA 5FZEA 1R1A3 3AB0A 3WG1A 1PK6B 1UYYA 5A6QA 4GKXA 3RZMA 4PJYA 1US2A 4L11A 4PI2A 4Y20B 4YARA 3O1PA 1Z7S3 2XJQA 3WNOA 5D2AA 3RGBA 1GP6A 2DCTA 2KA3A 5IVCA 2MEV1 1ENSA 2BVVA 2VOWA 3V65A 1D0GA 2GSYA 2NYYA 3DN7A 1XU2A 4LO8A 4JQRA 4QX5A 5GLWA 4RR3B 3N9MA 1Y9QA 1OOPB 5BNNA 1RVF2 5FZKA 1HXS2 5JR2A 2XWBB 2MEV2 2CYFA 1MZEA 3TEXA 2C26A 1I3HA 3MPBA 3UGHA 2PMWB 3PNAA 4HN0A 1JW6A 3DPRC 2EAKA 3WQBA 4A41A 2HWE1 2ZOEB 4GWIA 3A7QA 4OHXA 2WAAA 5JMOA 4LO6B 4QX8A 3I2HA 2RR13 3IDBB 4XJ9A 2GAUA 3K75B 4FBFA 2ZEWA 4PCRA 1W8NA 4FXKB 4BIOA 3HQRA 4AHZA 5C6CA 1PGW2 3WF4A 3T0AA 2VC9A 5F6KA 3ETQA 5ANQA 4LE4A 1RHI3 3THPA 1CZVA 5FLJA 1WKYA 2XQXA 4KWLA 1O5UA 2OS2A 4PLMA 4AE2A 1J83A 1KGYA 2AENA 4N7UA 2ZZJA 1KFXL 4I3PA 4NRMA 3LGRA 4JZRA 5FY4A 5H9SA 1RIRA 4FFIA 2WRAA 3BOWA 2AUYA 1W6PB 1KFUL 4YW3A 5FZMA 4C1XA 1LOBA 2NMNA 3B9CA 4S2GA 3DV8A 3JQXA 1LJ7A 3ON7A 2ZX2A 1PVC3 5I91A 1P8JA 3EMRA 4N8MA 4ZZ5A 4LT5A 3AZZA 5HI0A 2IWGB 4IEQA 4LK7A 5KXBA 1DCSA 4OVEA 4CEYA 4CXXA 1GLHA 2VUDA 4BPZA 4CEYC 4DINB 4DXSA 1AR92 3BCWA 5KHIA 3ACIA 5FKCA 3KT1A 5LY2A 1H8TC 3POBA 1ONAA 4QDRA 2ZGMA 1JI6A 5BNOC 4AGVA 2HJIA 5FIXA 1K5JA 2IXKA 1HRV2 1WW6A 3KB5A 2VZUA 1W6NB 3S5AA 3CKHA 5GZDA 4B1LA 2HWD1 2WNVB 3FLRA 2GZWA 2Z79A 5KXDA 5EZWA 5JSOA 2DTYA 1MZ6A 1ZYBA 2Z2SB 3E6DA 3IB3A 4YM3A 3KHCA 4N53A 1RUC2 1HX6A 4URTA 3ZOIA 3VBRA 1HB4A 3MPPG 5F37A 1EAH1 2I2SA 4IE0A 3ZSEA 1W8ZA 3NVCA 1H6XA 1OA4A 2JECA 2VH9A 3H9AA 2A3XA 3I49A 1NOVA 2Y38A 4QPIB 4R52A 3JB4C 3MLJA 4MLOA 1NY72 4RGKA 4Y3OA 1JZ8A 5F6LB 2QQLA 1DLLA 4WM7B 5DAWA 1WLDA 4W6WA 4WBBA 4NHLA 5FZCA 1UU4A 1XQNA 2VQAA 4PBPA 2ZJCA 4GWMA 4BLJA 1UWWA 1XNDA 1Q8SA 3WINE 4ATEA 1C8M2 4HN1A 2G9FA 1O3RA 5C3QA 4K8RB 4I30A 4LNVA 1EUUA 1US3A 1D7PM 3K2OA 3ZX7A 5DAPA 4P5HA 3T1MA 1J1LA 4HLTA 4PDWB 3GCXA 1RUI3 3WDVA 3ECQA 1V6MA 1PMJX 1APNA 4M3CB 4LBQA 1V6OA 3ZN5A 3ATGA 4CDUC 1LTEA 2J42A 4PQ9A 3LB9A 1DYOA 2CWSA 3RJ2X 4EWAA 1VB4A 2L9LA 1UOFA 3PUHA 2BJSA 2CSGA 4IETA 5BXXA 5LY1A 4XCAA 5F3EA 3TYJA 2VULA 2ADDA 3VBFC 4BM8A 5FZAA 3POJA 4D94A 2ZMNA 4BQXA 4YW4A 4NHKA 5T55A 3AP4A 1HIXA 1S0FA 5G05L 1I6XA 4N43B 5CFCB 1K42A 4SBVA 4NHXA 3RWNA 5K0UA 1OQ1A 5KWRA 2XJSA 3WCRA 2WYFA 2QQJA 4OZXA 2EXKA 2EXJA 2YV8A 2ENRA 3USUA 1LKNA 5FYUA 1LENA 1WA6X 4XQ4A 4H7MA 2YFUA 1W2UA 2WZR3 3GJAA 3ZYFA 5JXGA 1REDA 1OC1A 4SLIA 3OD0A 3FC0A 2VOKA 3AP5A 4AFDA 3N9QA 3Q8CA 4E4HA 1BBT3 2JKBA 4FP2A 4CP2A 1U5IA 3LFIA 5F3GA 3GYDA 5EQUA 3KVBA 1F5FA 1PO21 1VRH3 2NPIA 2J1AA 2VZOA 4WZCA 5F39A 2VZ1A 4CTEA 1IGOA 4ONUA 5F1RA 2VD7A 3BTAA 4MGSA 1PO12 1WD4A 2PHRA 3O0VA 4META 3OJBA 4O65A 3J7MA 5AFBA 3HOBA 4CDXC 5GJ6A 1RUNA 4IEZA 4A3XA 5K0UC 1XYPA 2YHJA 1OA2A 1H2LA 3GF6A 3AJYA 3EQEA 4JGZB 4A3ZA 5FZDA 1EYBA 1JS9A 1LOGA 2PHTA 4QKNA 5A7WB 2C24A 2BGOA 4A6SA 4ASLA 2UWCA 5J3UA 5JPNB 1U0AA 1XE7A 2LW8A 3LF7A 3MICA 3QACA 1CAXA 4GB31 4JHZA 3SCGA 5LZ6A 1ULEA 2F4PA 3MUZ1 4IV3C 3LIGA 4CEWB 1VBB3 2Y33A 1H9WA 3NJXA 3IPVB 3H8OA 4XZUG 3AFGA 3WG4A 4CYDA 5H9PA 4E4DX 3T0DA 3L2HA 2WSVA 2D6NA 1PGSA 2ZGSA 1YC61 2JG8C 1O4YA 3TEZA 4NROA 3OBRA 5JVVA 5JUVA 4HBNA 4BYYA 4ISRA 1WMXA 2RS11 4XF3A 4XUQA 4GA9A 2ADEA
chains in the Genus database with same CATH topology
4NRQA 4NRPA 4ZHNA 3O1OA 3O1RA 2FDJA 4IE0A 4IDZA 5F8PA 3O1PA 3O1SA 3RZLA 2IUWA 4NPMA 3I49A 4QKNA 3BTYA 4NJ4A 4CXXA 5DABA 3BUCA 4JHTA 3RZHA 3T3YA 3I3QA 3KHBA 3O1TA 3O1VA 4RFRB 4NIHA 4QKBA 4NIDA 4ZS2A 3H8OA 2FD8A 2FDIA 4IE7A 3BKZA 3O1MA 2FDKA 4MG2A 3T4VA 4NRMA 4IE5A 4CXYA 2FDGA 4ZS3A 3BIEA 2FDFA 3S5AA 3RZGA 4IE6A 4IE4A 4NIIA 3H8XA 3BTXA 3BI3A 3LFMA 3RZKA 4NIGA 4NROA 4QKDA 4QHOA 4OCTA 3H8RA 3S57A 3RZJA 2FDHA 4MGTA 3T4HB 4QKFA 3KHCA 4O7XA 3I3MA 4NPLA 4CXWA 3I2OA 3BTZA 4O61A 3O1UA 3RZMA 3BU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NRQ A;  4NRP A;  4ZHN A;  3O1O A;  3O1R A;  2FDJ A;  4IE0 A;  4IDZ A;  5F8P A;  3O1P A;  3O1S A;  3RZL A;  2IUW A;  4NPM A;  3I49 A;  4QKN A;  3BTY A;  4NJ4 A;  4CXX A;  5DAB A;  3BUC A;  4JHT A;  3RZH A;  3T3Y A;  3I3Q A;  3KHB A;  3O1T A;  3O1V A;  4RFR B;  4NIH A;  4QKB A;  4NID A;  4ZS2 A;  3H8O A;  2FD8 A;  2FDI A;  4IE7 A;  3BKZ A;  3O1M A;  2FDK A;  4MG2 A;  3T4V A;  4NRM A;  4IE5 A;  4CXY A;  2FDG A;  4ZS3 A;  3BIE A;  2FDF A;  3S5A A;  3RZG A;  4IE6 A;  4IE4 A;  4NII A;  3H8X A;  3BTX A;  3BI3 A;  3LFM A;  3RZK A;  4NIG A;  4NRO A;  4QKD A;  4QHO A;  4OCT A;  3H8R A;  3S57 A;  3RZJ A;  2FDH A;  4MGT A;  3T4H B;  4QKF A;  3KHC A;  4O7X A;  3I3M A;  4NPL A;  4CXW A;  3I2O A;  3BTZ A;  4O61 A;  3O1U A;  3RZM A;  3BU0 A; 
#chains in the Genus database with same CATH topology
 1ULO A;  1FAY A;  2Y0I A;  3GZA A;  1NQJ A;  5BYN A;  3DEC A;  3GXU A;  5FZ9 A;  2XR4 A;  3BTY A;  3KM5 A;  2J22 A;  4MOA A;  1T6B X;  1Z0H A;  4Q4X 2;  1F2N A;  1JOJ A;  4DEV A;  5FK7 A;  2EIC A;  2RS3 2;  5JIU A;  4C8D A;  4JGZ C;  2W92 A;  5KXC A;  2D5F A;  3VGI A;  4PDW A;  2JEM A;  3AYA A;  3R6S A;  2ZHL A;  1EV1 3;  3KS7 A;  4B7K A;  3URF A;  3MIF A;  3MEP A;  2VW0 A;  4IER A;  4UT5 A;  3ABZ A;  4PLO A;  1AXY A;  2V73 A;  2Q1Z B;  5IVJ A;  2B9U A;  1DQ4 A;  2K9Z A;  2HYK A;  3AZY A;  3TAY A;  5FPL A;  1AYN 2;  1G7Y A;  1F4A A;  4I09 A;  2WAB A;  5D21 A;  3FHI B;  3QOP A;  4QGN A;  2BP6 A;  2SBA A;  2DDU A;  4HOO A;  2XL9 A;  4XF4 A;  3VZJ A;  2ZX3 A;  1RUF 2;  3I2G A;  4FT8 A;  1OXC A;  2RM2 1;  4RL7 A;  2XML A;  4I0W B;  5IT6 A;  2XUM A;  5C9A B;  1A78 A;  2QNK A;  3IN9 A;  1SFP A;  1UY1 A;  3USU B;  4YRD A;  3OYW A;  4IE7 A;  3MUY 1;  4AVT A;  1PGL 2;  3UKN A;  4ZON A;  1XC6 A;  2P4E A;  3LA7 A;  1E5S A;  2V5Y A;  2LM3 A;  1CD3 G;  2PFW A;  4Q4V 1;  2E63 A;  4B4R A;  1E5R A;  3M3E A;  1NZI A;  4QD2 A;  3H50 A;  2R1D A;  4JAA A;  4LKF A;  1OT5 A;  2XXZ A;  3UL2 A;  5K9Y A;  5F5Q A;  1O3T A;  1VBE 3;  3CEW A;  1SCS A;  1S0C A;  4ISQ A;  4OQ9 A;  5DN2 A;  3E5Q A;  4Q4Y 3;  1DYK A;  3AP7 A;  3OTF A;  4RGA A;  1H9P A;  4IGO A;  3O5S A;  3ZFG A;  1DGW X;  4AI1 A;  1LHV A;  1B35 A;  1XOY A;  1RXF A;  2IXL A;  2VMG A;  4IEO A;  4IV1 A;  5KR7 A;  4MXV A;  2ZKN A;  2VW1 A;  3V0A B;  2Y6G A;  3ME2 A;  5FZF A;  1DZT A;  1OUR A;  2QZ3 A;  5CFC A;  1A6C A;  2XLA A;  4Q27 A;  3AKS A;  1UL9 A;  1HV0 A;  3W20 A;  1W8H A;  1W8U A;  1UD1 A;  5F7U A;  1DDL A;  2AC1 A;  1OUS A;  2JDK A;  4Y1X A;  3KVA A;  1IPJ A;  5CG8 A;  3AXE A;  1K3I A;  1GP5 A;  2VMH A;  4QU2 A;  5EPA A;  5J36 A;  5EWS A;  4AFC A;  4GB3 3;  2ARB A;  4QWN A;  1NKG A;  5J1X A;  1UMZ A;  1BEV 1;  4IV3 B;  5C3P A;  1GP4 A;  1ND3 B;  2EF6 A;  4XFA A;  1CJD A;  1AR7 3;  2A70 A;  3OOX A;  1NE6 A;  4AQ2 A;  2WS9 1;  3RPQ A;  3GDB A;  4EYU A;  2Y34 A;  5IVF A;  5FLI A;  5FZ7 A;  1HN1 A;  3WCS A;  2E7A A;  3WT3 A;  4GAL A;  1MVE A;  4Y1V A;  3T30 A;  3PME A;  4CZS A;  2B8M A;  4YNI A;  1AZD A;  4Q0S A;  2HWB 3;  1KJL A;  1KRI A;  2GC1 A;  4IEV A;  4LPL A;  2YPD A;  2A6Z A;  4A7Z A;  2R06 2;  4FQZ A;  2DBI A;  5A3P A;  5FO8 B;  4M3C E;  5IK5 A;  3H8R A;  4PHZ A;  1OFS A;  3UK9 A;  2W91 A;  4Q8K A;  4XAB A;  4QKF A;  4UW3 A;  2WLQ A;  4HVR A;  4DXR A;  5HCA A;  4GWJ A;  3OEA A;  1RUG 1;  2R1B A;  5CFD A;  5JZG A;  1GIC A;  2R30 A;  3RI8 A;  2R07 2;  5IK7 A;  3AYE A;  5HV0 A;  3FFZ A;  2XL7 A;  3C7O A;  4O9E A;  2ZPX A;  4AOC A;  2WN2 A;  4D6R A;  2EXI A;  3LEG A;  1G6N A;  1DFQ A;  4JHT A;  2W1S A;  4GJY A;  3ASI A;  3KHB A;  4HFS A;  2QQW A;  3ALQ A;  1PNG A;  5FUP A;  3OBA A;  2VBB A;  1ND2 C;  5A1A A;  3OPW A;  1UN1 A;  1UYP A;  5FRA A;  1LNS A;  1KS4 A;  3BIW E;  1QNW A;  4B8E A;  4M01 A;  2XOM A;  3AL5 A;  4I3G A;  3BN6 A;  1S2E A;  3KT4 A;  4KU8 A;  4BIF A;  1C8M 3;  4DRR A;  1COV 3;  2D98 A;  4RHV 1;  3T0B A;  5FZ8 A;  3KD4 A;  4OI4 A;  1UZ0 A;  2C1F A;  4NRP A;  3ZXL A;  3C8X A;  1HRI 2;  2J1V A;  4WVM B;  5F32 A;  4AAX A;  4CE8 A;  3VD4 A;  4ET7 A;  1NE4 A;  1RMU 2;  4YGC A;  5CZK A;  4CDU B;  3F2Z A;  3RZH A;  2BUK A;  1MS9 A;  4LHK A;  4M00 A;  2D6P A;  1XNB A;  1TG7 A;  1OUX A;  4N7I A;  3WDX A;  4FTE A;  2RJK A;  2XON A;  2PLV 1;  1ZRD A;  2ZML A;  1OQD A;  3UV9 A;  3B5L B;  3GZU C;  5C70 A;  2RDN A;  1O91 A;  3C2U A;  3J8F 3;  4NAO A;  2ZEZ A;  2G9Z A;  2RS1 2;  5FCC A;  4JGY C;  4BOW A;  3FX3 A;  3VKO A;  4LA2 A;  4AEJ A;  1QKQ A;  1S1A A;  1FNY A;  2PQQ A;  1EAH 3;  2VMF A;  4S2D A;  1BYH A;  4FOQ A;  1JYI A;  3K46 A;  2D43 A;  5IAV A;  3I2I A;  2RV9 A;  2YC0 A;  2JDH A;  3AKR A;  3FE5 A;  2LTN A;  1GZC A;  3M8L A;  3ITQ A;  1UAI A;  4FFH A;  4G4F A;  4YVS B;  2VVE A;  4ASM B;  1VBE 1;  3ELN A;  3ILN A;  5JXJ A;  1QQP 3;  2HWC 1;  2DVA A;  3FZ3 A;  4GMP 0;  3E5X A;  5A3O A;  1CES A;  2BVB A;  3B94 A;  2ZHK A;  2W52 A;  5LB6 A;  1OI6 A;  1GR3 A;  2VTF A;  4XFH A;  4E8C A;  4FSJ A;  3JD7 2;  4LUK A;  4IV1 B;  5HPO A;  2JE7 A;  3CNA A;  3ES4 A;  4KWU A;  3R0R A;  4ZY9 A;  2XJR A;  1A8M A;  3TN9 3;  2RJ2 A;  2VJX A;  3WV6 A;  3MIG A;  2VOV A;  3W9A A;  3SNM A;  3T08 A;  3GBG A;  1PK6 A;  5FO7 B;  4JGY A;  1GQH A;  3VBF A;  3WLU A;  5HBA A;  4QB6 A;  1CIW A;  4L97 A;  2PAE A;  5LA9 A;  4MXW B;  1AUY A;  2Z42 A;  4CU9 A;  1QH7 A;  1DQ5 A;  2XJP A;  1NCQ B;  2VR4 A;  2UY9 A;  3MI8 A;  2BNO A;  3QH6 A;  1H4G A;  4JKK A;  1QJY 3;  2MHF A;  3CJX A;  1AYM 1;  4UAP A;  1AL2 1;  4KBZ A;  4XBN A;  1Y3T A;  1AL2 2;  2A71 A;  4CEY B;  1EY2 A;  2P1B A;  4HMZ A;  5FJH A;  5FOB B;  2D6K A;  4HVO A;  4NPL A;  4AVA A;  5F5C A;  1AJK A;  3RI9 A;  2BDR A;  5A32 A;  1WCU A;  3I97 A;  1FV2 A;  1OF4 A;  4BWO A;  1NA1 C;  4Q1P A;  1DF0 A;  5HCF A;  4A4A A;  2AZ5 A;  2D97 A;  5CEH A;  2JB8 A;  3IWZ A;  2VTX A;  3NQH A;  4OHY A;  1PGL 1;  3EO6 A;  3U10 A;  1IOA A;  5B4N A;  1PX3 A;  1NCQ C;  3AM2 A;  2WWU A;  4YLZ A;  5EYY A;  2YPJ A;  2G19 A;  3DXT A;  3CZJ A;  3OEB A;  2XH6 A;  4GH4 B;  1LHU A;  2BGC A;  3DPR A;  2NLR A;  2BRT A;  1N3Q A;  2VZ3 A;  2FDH A;  1X50 A;  5FY5 A;  1XRU A;  4PQQ A;  2CY6 A;  5ABJ C;  4B4P A;  1G9B A;  2WT2 A;  4NRQ A;  2OQ6 A;  4GH4 A;  3RZL A;  1URX A;  3LEI A;  4YGE A;  4NPM A;  1YIP A;  4WM8 B;  4YG3 A;  5K7P A;  4D7T A;  3R4D B;  1C28 A;  3DPR B;  4FOW A;  2E32 A;  4YZ2 A;  5FFO C;  2W9X A;  1WZX A;  1PK6 C;  5GAL A;  5FP9 A;  1GZW B;  5FPB A;  4CCE A;  4FPE A;  4RS5 A;  3M2M A;  4R4Z A;  1W3X A;  3VZK A;  1CAX B;  2N7G A;  1J58 A;  5FPX A;  2VE1 A;  1PMI A;  1YHF A;  4XTP A;  3T4H B;  1BK1 A;  5LAS A;  1FPN 3;  2RDR A;  4JX0 A;  2WL1 A;  3TEY A;  1F8V A;  3IAQ A;  5IK4 A;  2WNE A;  3RRD A;  4IL7 A;  2W2I A;  4UFJ A;  1OVP A;  4XEZ A;  3KV5 A;  5EFU A;  2BW8 A;  2FCU A;  5FJK A;  4AGR A;  5FZ3 A;  5FMC A;  5JI9 A;  2W46 A;  5FP7 A;  4MH0 E;  3IAP A;  3VL9 A;  4P02 B;  2X10 A;  3IDE A;  1DGR N;  4XJW A;  3MV1 1;  4MX3 A;  5FZI A;  1PM7 A;  3GHM A;  1QJX 2;  4JVA A;  3NV1 A;  5DDJ 1;  1O8P A;  4XF1 A;  5L7O A;  4HKO A;  5GZG A;  4RHV 2;  4URA A;  4I0B A;  1RUI 2;  4G9S B;  2SLI A;  2NQY A;  4TTG A;  3BI3 A;  3BTX A;  2YXS A;  2R04 3;  3HPN A;  5JSP A;  3AMM A;  1S55 A;  1D2S A;  2UU8 A;  4Q0Q A;  1SLB A;  3Q9O A;  2YZ4 A;  3LDK A;  4LOS A;  3VKF C;  1HDK A;  1YQC A;  3VUO A;  2HEW F;  3EJK A;  5T52 A;  3ZR6 A;  1QJY 1;  2NMO A;  3LEK A;  5A70 A;  3O1R A;  2VMD A;  2ATF A;  2W95 A;  2Y6F A;  3SIT A;  1UMH A;  2V4A A;  2RMU 2;  3H42 B;  2E9Q A;  2GDF A;  3NAP C;  4KMQ A;  1IS4 A;  1QDC A;  2GH8 A;  5DAV A;  1MPX A;  2DUP A;  3JXS A;  2YMZ A;  3WNX A;  5JCT A;  2H6C A;  4NR1 A;  4ZS2 A;  5C4W C;  3KGL A;  2FDI A;  3NO8 A;  4IGQ A;  5C3S A;  5BV6 A;  4A45 A;  4ES8 A;  2RS5 3;  2IXC A;  2WSU A;  2Q5T A;  4JCK A;  2PEL A;  5A33 A;  1W2N A;  1Y4W A;  4IND A;  5GZF A;  2P37 A;  3MHZ A;  1JZ7 A;  5IW0 A;  1Q56 A;  4LXL A;  2C9K A;  3N7K A;  1W90 A;  1UKR A;  1OMI A;  2BV4 A;  2O1Q A;  2ZGT A;  3JD7 1;  1CAV A;  3IDA A;  1U5X A;  1Y43 B;  1C57 A;  3B00 A;  1FMD 3;  3RWK X;  4CA9 A;  1TNF A;  1ZRF A;  5IVB A;  3C7E A;  3FWE A;  3NJV A;  4HAN A;  4P9X A;  3SKJ E;  4Y5Z 0;  1NZC A;  5GLZ A;  4CVU A;  5FBZ A;  2BQP A;  3HN3 A;  2W0X A;  1CPN A;  3KT7 A;  5J09 A;  3WNN A;  5GLT A;  5DPN A;  3ZSJ A;  5IVE A;  1V9U 3;  2B5H A;  4P9J A;  5DQ0 A;  4BQW A;  5FYB A;  2QCS B;  1DIW A;  5M0T A;  2RHP A;  1VAL A;  4CCL A;  4FP3 A;  1IKQ A;  2HWD 3;  4XDO A;  5AVA A;  2EIG A;  3PUR A;  5DXD A;  2JDM A;  1W2O A;  4HON A;  1TME 3;  2IFR A;  1H0B A;  1V00 A;  4QPI A;  1ZZ8 A;  1QQP 1;  3T2Q A;  3OGR A;  4D6Q A;  2WFF 1;  2A6W A;  4IEP A;  3WNP A;  5A3W A;  5LBF A;  1QDO A;  2R7E B;  3VBS B;  2PLV 3;  1F31 A;  4CUG A;  1ZA7 A;  4HSL A;  1ASJ 1;  5A7Q A;  2W1Q A;  5IHR A;  2HWC 2;  3VN4 A;  1UOJ A;  2ETE A;  2AEZ A;  4W50 A;  5DAX A;  5AVP A;  4WM7 A;  1GV9 A;  2AYH A;  3ZSK A;  2RS5 2;  1WMD A;  1OLM A;  5FZ1 A;  5E88 A;  1GZT A;  3OUH A;  3OY8 B;  3GZT B;  4H7L A;  4QXK A;  4XBL A;  3J4U H;  2ZGP A;  2P3J A;  1JMU B;  1SQ4 A;  1V6N A;  3QCW A;  1RUG 2;  3ZFF C;  2VNV A;  4D3W A;  4Q8L A;  2X53 S;  4JKL A;  1W0P A;  4CCN A;  2UY8 A;  3NNL A;  3RZK A;  1D4M 2;  3V0B A;  1JZ3 A;  1UIJ A;  2ZGK A;  1LEC A;  1MS5 A;  5DUW A;  3WF1 A;  4Y4R A;  5IJR A;  1AXK A;  3VBO A;  4EN9 B;  4NOT A;  1HB2 A;  1WGP A;  2DFC A;  2DU0 A;  2CAV A;  2YDE A;  2CU5 A;  4AL9 A;  2JDA A;  1UCX A;  1TME 1;  2HEV F;  4YZ1 A;  4K21 A;  4AZZ A;  1Y9G A;  4QAW A;  1RIN A;  4GMP 1;  4RQP A;  3WP5 A;  1VMJ A;  2Q8C A;  2O8O A;  1G86 A;  4CUB A;  3OY8 A;  3NJY A;  2VPV A;  1ASJ 2;  4C90 A;  1PX4 A;  5FP4 A;  4QQO A;  1ULD A;  3PVN A;  1DHK B;  1N1S A;  4RHV 3;  1PO2 3;  1L3J A;  1VRH 1;  5GZE A;  2R04 2;  2GN3 A;  3RZG A;  3OGV A;  1HRI 1;  4BE3 A;  4NIG A;  3GZE A;  4MAD A;  3UES A;  5CVR A;  5L9B A;  1S2B A;  4L9B A;  2FQP A;  3IMN A;  1H1A A;  3L2Y A;  4JV4 A;  3WOG A;  1GQP A;  3RZZ A;  5EHD A;  1ND3 A;  5KXE A;  1J1T A;  1C4R A;  2FMD A;  4L2N A;  1H8T A;  2WZR 1;  3V56 A;  5LA1 A;  4CUC A;  3LAG A;  1PVX A;  3BGA A;  4AEM A;  4YGB A;  1RXG A;  5G04 L;  1RUG 3;  4OUL A;  3T3Y A;  2W08 A;  4COY A;  4YGD A;  3J7L A;  4YFW A;  2VVF A;  4PDW C;  3AZX A;  4OHZ A;  1JXN A;  2GN7 A;  1MQT C;  4AI2 A;  2VCA A;  1Q8P A;  2F17 A;  1RMU 3;  1AR7 1;  1T6G C;  2XHK A;  4J6G A;  2QQU A;  4QB2 A;  3T1L A;  3VD3 A;  4RYD A;  2LRO A;  5A3M A;  4UBG A;  4XC9 A;  3DKQ A;  4HPK A;  2JD4 A;  1BMV 2;  1RC6 A;  4QMA A;  4RSU A;  2WT1 A;  1NXM A;  1HJF A;  1EP0 A;  1WCK A;  3R4U A;  5FWE A;  4UXA A;  2O14 A;  5I0T A;  5IVY A;  2E26 A;  1YQ5 A;  4GKY A;  2ARE A;  3HWJ A;  3WVJ A;  4P00 B;  1W03 A;  3ETP A;  1AF9 A;  3NNF A;  5JOZ A;  3V64 A;  3UNP A;  5FYI A;  1BK0 A;  1X8M A;  2QDR A;  2QQN A;  2GAL A;  2VM9 A;  1ODM A;  2BOJ A;  2ZHM A;  5TSW A;  3SLI A;  2O8Q A;  5D1I A;  1SPP B;  2BNN A;  4GH4 C;  4QDS A;  5LBC A;  1J84 A;  1LOE A;  2HLE A;  2FDK A;  4XET A;  2WR9 A;  5J7M A;  3NNG A;  2HKX A;  2WA3 A;  5HV4 A;  4YW6 A;  2VVD A;  3W5N A;  3VV1 A;  5FZL A;  3TNP B;  4CDQ C;  2WQ8 A;  1QMJ A;  4QKD A;  4QPG C;  3VBH C;  4BU2 A;  4COZ A;  3DYO A;  2OUJ A;  1I9R A;  3B3Q E;  3ZXA C;  5I0R A;  1I1E A;  2W94 A;  1D4V B;  4AW7 A;  3NJZ A;  5ERL A;  3WNL A;  4R8H A;  1UXZ A;  3PU3 A;  5EJ1 B;  1G9C A;  3TN9 2;  4CDX B;  3HVD A;  5FP8 A;  2Q8D A;  4B1M A;  3ORJ A;  1XPW A;  1DYP A;  1U5Z A;  3MLL A;  3C7H A;  2R06 3;  3LOI A;  3HD8 B;  5E8A A;  3III A;  3CLP A;  1VAM A;  3U11 A;  2EAA A;  1IQD C;  3C7F A;  1VR3 A;  4B7E A;  4Q4V 3;  3QBQ A;  4NII A;  4V1P A;  2YFZ A;  1H6Y A;  2LUW A;  1NLS A;  1ZBA 3;  4KGQ A;  1R08 1;  2OYZ A;  1BVP 1;  1FOD 1;  1S0J A;  3NV2 A;  2R07 1;  2FZ1 A;  2VZS A;  4IES A;  4LUL A;  1N1Y A;  1MQT A;  4JDO A;  4FPL A;  4LJH A;  5T5L A;  1SFY A;  1UF2 C;  1SAC A;  3W58 A;  5JXI A;  4FPY A;  4DZG A;  2E53 A;  5JZG B;  1RUJ 2;  1MS4 A;  1A3K A;  5FZG A;  1UU5 A;  4COW A;  1SDW A;  4O9G A;  2WFP A;  1ULP A;  4IW3 A;  3PTR B;  4XAE A;  2P6H A;  5FKB A;  3O1T A;  4RFR B;  4BA6 A;  3UKT A;  2AEY A;  4P5Y A;  4XQD A;  2BPA 2;  5A7W A;  2O0O A;  2WDB A;  1R1A 2;  1W6Q B;  5FYH A;  4LBL A;  4RS5 B;  4FPO B;  3AXD A;  4ZXK A;  1W6O B;  2JG8 B;  1SLI A;  4TLG A;  5CYY A;  5CAZ A;  3WQ7 A;  1PHM A;  4UFH A;  1CPM A;  4CCC A;  2D6M A;  2DVD A;  3MDP A;  3UJQ A;  4BDV B;  3DL3 A;  4Q0U A;  1PIV 2;  3FMG A;  5CFD C;  2WJS A;  1GBG A;  4JGZ A;  1FV3 A;  5JMC A;  1OLM E;  3POG A;  2RMU 3;  2VG9 A;  5T3N A;  1H1M A;  1W9S A;  2YGM A;  3ENR A;  4JDN A;  3ZXE A;  4HET A;  5J96 B;  3ILF A;  1YQ6 A;  4AFA A;  3AK0 A;  2D44 A;  1R08 3;  1UQX A;  1OFN A;  1VBB 2;  3N7J A;  3N9O A;  2FBE A;  5FO9 B;  5AC9 3;  4AVC A;  4AI3 A;  5H9R A;  5KHG A;  3J7H A;  2B39 A;  4MUV A;  4LTA A;  3SCF A;  4QPG B;  4BQ4 A;  1XNC A;  2VCM A;  1TMF 2;  4LBQ D;  4EN8 B;  3A0N A;  3D3A A;  4CEW C;  4N9I A;  2D3S A;  3PUA A;  3WG2 A;  5HXM A;  4V2V A;  3NAP A;  1GUI A;  3SKV A;  1CZS A;  4XJZ A;  4P9Y A;  3TNQ A;  1YI7 A;  4WVW A;  3K77 A;  1Z7S 1;  4I0A A;  4RD7 A;  4EWE A;  5C4W A;  1KDK A;  3ZFG B;  1LGN A;  1QGL A;  5B2G B;  4A44 A;  4DY3 A;  2XKP A;  3PJY A;  4KWJ A;  5DDJ 2;  3NKT A;  4AI0 A;  2QQK A;  4I02 A;  4GZ9 A;  2ORX A;  4NWW A;  1BBT 1;  1ENQ A;  4GD4 A;  3I2J A;  3WP3 A;  1EUT A;  2QDN A;  3OUI A;  3NV4 A;  1V6L A;  4UFI A;  5BNN C;  4LOR A;  1G9D A;  2ARX A;  5HCB A;  5LEJ A;  4KG0 A;  1BBT 2;  2LS6 A;  3PVB B;  5A80 A;  1GOF A;  1QJE A;  1WMF A;  2RE9 A;  2XJV A;  4IEW A;  4F8A A;  1QJF A;  2PHU A;  4LHL A;  3LDR A;  4XBQ A;  3FUQ A;  4LUM A;  2BBA A;  1GAN A;  2HWF 1;  3J9S A;  1F9K A;  1TMF 1;  4QM9 A;  3ZFE A;  2VZP A;  3CJI B;  4O61 A;  4IUG A;  4XHX A;  5L36 A;  4KH9 A;  4YG6 A;  2R32 A;  1GWL A;  3EXU A;  3W59 A;  3E6C C;  2A3W A;  4K1Y A;  4D6S A;  3VDB A;  5CNA A;  1RGS A;  3VHP A;  1CWP A;  1KJR A;  3M4F A;  1UPS A;  2YRO A;  4CPB A;  3FHA A;  3ZXJ A;  1S0I A;  3N9P A;  4FFF A;  2ZX0 A;  1NY7 1;  4COU A;  1LGB A;  5FXZ A;  1DZQ A;  4MHR A;  2LAL A;  1PZ7 A;  3B93 A;  3ZDS A;  4Q4Y 1;  5APA A;  1KEX A;  1W6M A;  3H8U A;  2J1E A;  2JWP A;  1K12 A;  5L19 A;  1ND2 B;  2JIC A;  1VBC 3;  4CRQ A;  4P9W A;  1G8W A;  1Y7B A;  2BWC A;  1K5M B;  2Q1F A;  1HQN A;  2VOT A;  4J1W A;  4K20 A;  4AI8 A;  4R9B A;  1E5I A;  4CDW A;  2FDJ A;  2JE9 A;  2QQO A;  2WWS A;  2YC4 A;  3PUS A;  3NV3 A;  2E33 A;  3D4K A;  3JBG 1;  4K7J A;  2ZGQ A;  1IHM A;  3LOB A;  2WNV A;  3RJR A;  1RHI 2;  4FAH A;  1UIK A;  4LE3 A;  3UJO A;  4S2H A;  3OPZ A;  1OVS A;  4EWD A;  4K6B A;  1OHF A;  3KLS A;  4Y22 A;  2QKD A;  4QXH A;  1JHN A;  2E7T A;  3NMB A;  3VBO C;  1DGW A;  3KSC A;  5CKM A;  4PBO A;  3HNY M;  4NHM A;  3THC A;  1R09 2;  2DCJ A;  1TVG A;  2RS3 3;  2X5I A;  2CGN A;  4GMP 3;  5C33 A;  4Z1V A;  5DUV A;  5BNO B;  2HWD 2;  5LRR A;  2A3Y A;  1JOD A;  1ZZ9 A;  1V6I A;  1UXX X;  4BK5 A;  5E89 A;  4QGL A;  3P1I A;  5FY0 A;  2A5Z A;  5FPZ A;  5EIY B;  3B9I A;  3LD8 A;  1ODN A;  4XUO A;  5L7O B;  2WO7 A;  1H8V A;  1FT9 A;  1PM4 A;  2R16 A;  5A7O A;  5FR3 A;  1UNB A;  2PXJ A;  3I3Q A;  2FHR A;  4BME A;  5CFD B;  1O3S A;  2ZXQ A;  3LCP A;  4E4Z A;  5LWB A;  3O1M A;  2WZE A;  3KGZ A;  1O8S A;  1YWK A;  2VQU A;  1AX1 A;  1UPI A;  2WS9 3;  5GKA C;  4IE4 A;  1GSL A;  1AR6 1;  1RJ8 A;  1LR5 A;  1W0O A;  3DUI A;  3QH7 A;  3WZ1 A;  1VBD 1;  1JUI A;  3POI A;  4XF0 A;  1WW4 A;  2PHL A;  3OGS A;  4D7S A;  4JRL A;  4XUT A;  2QQI A;  1LOF C;  1GU3 A;  2PHX A;  4MGY E;  3H1M A;  4YW2 A;  3NNM A;  1MS8 A;  1WW7 A;  1W9W A;  4F3J A;  3KWV A;  3BU0 A;  4DNY A;  5FP3 A;  1HN0 A;  4FTB A;  1OD5 A;  5SV5 A;  3AZV A;  3POY A;  4R9C A;  2PYT A;  1Q3E A;  2R07 3;  5JR7 B;  4LBM A;  3EHK A;  5T5O A;  4Q1R A;  3D0J A;  4NIH A;  1CAV B;  4LOT A;  3E5U A;  4LA3 A;  3HEI A;  4M3C A;  5C8C B;  3LKJ A;  4QX3 A;  2JDY A;  5JOW A;  5C3R A;  4DEQ A;  4JQT A;  2OVU A;  4MSV A;  1R1Z A;  5A33 B;  2J7M A;  4KNC A;  1W0N A;  2HWE 3;  1W2T A;  4CUA A;  1ZZB A;  3H3L A;  2D6L X;  2WN3 A;  5KC6 A;  1OOP C;  1NUK A;  3HMY A;  3MIE A;  4XIO A;  1LOF A;  4YW1 A;  3VKL A;  1SBF A;  2D6O X;  1J3P A;  2DCY A;  2Q30 A;  3Q8F A;  5A7S A;  3T2O A;  5LEK A;  5L9R A;  2NP0 A;  1HXS 1;  3WDU A;  1R64 A;  4GQ7 A;  1W2A X;  4CCD A;  2ID4 A;  1AL0 G;  2IC1 A;  3VD7 A;  4D7Y A;  2QFE A;  4DUX A;  1ZRC A;  5I0S A;  4LBK A;  2MEV 3;  2A1X A;  2B42 B;  3Q8B A;  1GNY A;  2ZAC A;  2WAO A;  2Z4F A;  2ZA9 A;  3HBZ A;  4XXP A;  3ZXD A;  5IFP A;  2HBT A;  4QGM A;  1S2K A;  2GNT A;  3SIS A;  2RJL A;  3J8F 2;  4DXT A;  1LOC A;  5JAX A;  2ZEX A;  5FQ0 B;  4E9K A;  5FYT A;  1GFF 2;  1AR8 1;  1Y9M A;  1UX6 A;  3H3U A;  3H1W A;  3HR9 A;  4Q4V 2;  4TXW A;  1GOG A;  2HEY F;  3D0S A;  2WZR 2;  3HNM A;  4FFG A;  3TOJ A;  1UW8 A;  3F95 A;  4HZF A;  1JUH A;  1W8T A;  1U12 A;  3ZYJ B;  2G9G A;  4XXA A;  3O1O A;  4LBJ A;  4H14 A;  4OZO A;  4DUW A;  3X29 B;  4JGY B;  1FYU A;  1ZA4 A;  3D82 A;  2CHH A;  2P17 A;  2X5I B;  1QU0 A;  4FPC A;  4YG0 A;  3H7J A;  4XJ8 A;  1HRV 1;  3LSD A;  2R04 1;  1YQ2 A;  4Z07 A;  3ZXG A;  5B4X A;  3ZLI A;  1O5L A;  1RMU 1;  3VBS C;  4M4P A;  2P2K A;  2GMM A;  4JDM A;  4XQW A;  1QXR A;  2XVL A;  1XSR A;  4PF5 A;  3WX5 A;  2GNM A;  3RMX A;  4YYO A;  2CGP A;  4XE9 A;  4OHW A;  1RTV A;  2V72 A;  4R9D A;  1W6P A;  4OCT A;  2JIJ A;  1LES A;  1KDM A;  2QJV A;  3OG2 A;  4RS5 C;  3UGG A;  4M4R A;  4LBQ B;  4AHY A;  1DLC A;  3H7Y A;  1XNT A;  4UYB A;  4XUR A;  5AFE A;  2OPK A;  2PA7 A;  4IDZ A;  1FPN 1;  4UF0 B;  4I2O A;  1XB9 A;  2ILM A;  1VBA 2;  2YU1 A;  1LOA A;  5IAT A;  4YM1 A;  2D3P A;  1ZRR A;  1S0B A;  2ZKL A;  5JIA A;  1N3O A;  1C1F A;  1TE1 B;  2IVI B;  1Q5O A;  2XB6 C;  1ACC A;  5ABJ B;  4P9L A;  1MZ5 A;  1D2Q A;  1TMF 3;  4ZPI A;  4I01 A;  3R05 A;  5FYM A;  4AED A;  3PIG A;  4IE5 A;  1W28 A;  4BMB A;  1UKG A;  1XJA A;  2VBD A;  2OKX A;  4CPB D;  1HLC A;  4QXB A;  1MVQ A;  1RIT A;  2MNG A;  2ZAH A;  4K9S A;  4ZHN A;  5JOY A;  3DKW A;  2J1R A;  4TSV A;  2FDG A;  4KGG A;  4AGG A;  5FWJ A;  3S7E A;  3RQ0 A;  4AF9 A;  3O1U A;  2P3I A;  3GGL A;  3RS6 A;  5C9A C;  4WVM A;  4QX2 A;  4PT6 A;  3S0M A;  4U36 A;  3ZSL A;  4LKS A;  4XHB A;  2CWM A;  2RR1 2;  5I0D A;  5I93 A;  2YGL A;  3M3C A;  4Y20 A;  3AKQ A;  4OFG A;  1LHN A;  2Q1M A;  3OGG A;  4QX0 A;  2UUR A;  2ZTN A;  1W99 A;  3KQR A;  1CON A;  3N9N A;  3GM8 A;  4H55 A;  1TEI A;  1GYK A;  1FX5 A;  1IPK A;  2WC2 A;  2ZGR A;  2G4I A;  4YZ4 A;  1MEC 1;  1RUD 3;  4GJZ A;  1LB2 A;  2YBK A;  1RL3 A;  3KV9 A;  1F5J A;  4NWV A;  1YLL A;  2VME A;  3WY6 A;  1Q8O A;  1DQ2 A;  2PQS A;  3D5O A;  2A75 A;  1ZZ6 A;  2XKO A;  2C4X A;  3A22 A;  2EXH A;  3FUO A;  2IZW A;  4PIX A;  4BHP A;  4CCJ A;  4Y33 A;  5KHK A;  1NYW A;  2WWJ A;  4NO4 A;  5CG9 A;  3ZPY A;  4XPV A;  1AR7 2;  3FLP A;  5E16 A;  5ACA 2;  2ERF A;  2JG9 A;  2X09 A;  3M70 A;  3K4A A;  1Q8V A;  1LCL A;  3JZV A;  5H9Q A;  1W06 A;  3VDD B;  2RR1 1;  3CF6 E;  3N35 A;  4KWK A;  3WEZ A;  4AED B;  4AVB A;  3I54 A;  1DBN A;  3CHX A;  1H4H A;  1QJU 1;  4EE2 A;  1FOD 3;  3O14 A;  4MVT A;  2UYB A;  1FPN 2;  1FXZ A;  1RUI 1;  1CAU B;  1YJK A;  4XFC A;  2R49 A;  5LK7 B;  2YU2 A;  3H3Z A;  3JB8 A;  4PI0 A;  5DZE A;  4NE9 A;  4QXC A;  4YZ5 A;  4Q4W 1;  1BQP A;  2RVA A;  3IIA A;  5DZG A;  5T5P A;  4EZ4 A;  4UF0 A;  3N9L A;  3RDI A;  3OD4 A;  4QPI C;  4TYS A;  1WW5 A;  4YSF A;  1MZF A;  2W47 A;  4BQ2 A;  1DGR A;  3BB6 A;  4IEX A;  4Z8B A;  5FYC A;  2XHN A;  4XFG A;  5LA0 A;  3ACF A;  1PO2 2;  3CL1 A;  2CNA A;  2GC0 A;  3P6B A;  1RUF 1;  1QOT A;  1WLC A;  1F4H A;  1IZ3 A;  3UET A;  4Y1Z A;  1Z7S 2;  1OLR A;  3DCQ A;  4W65 A;  2WNO A;  3ROU A;  3ZKY A;  2DVG A;  5KC5 A;  1AHS A;  2E7Q A;  1L7R A;  2WNU C;  3DF0 A;  1EPW A;  3OBZ A;  2DBN A;  3PUI A;  4NHY A;  3VKN A;  3ZKU A;  1YQ8 A;  2ZX1 A;  1V9U 1;  3U1X A;  2R06 1;  4U2A A;  3JU9 A;  3LZZ A;  5DMY A;  4IQP A;  1XSQ A;  2DUO A;  2ORZ A;  2R0H A;  1XU1 A;  5FMO L;  3V0A A;  1BJQ A;  2VUJ A;  1JOB A;  3U4S A;  2OUH A;  2XQR A;  3J8F 1;  4MGK E;  2ET7 A;  2AGS A;  3R4S A;  2BYV E;  1W3V A;  4BLI A;  3A0K A;  2K0G A;  2WS9 2;  4N53 B;  5EJZ B;  3SC7 X;  2J1U A;  2V09 A;  2UWB A;  1KS5 A;  3MW3 A;  1V6J A;  1NLR A;  2XJT A;  3VZM A;  4XMA A;  3RZJ A;  1NA1 B;  5DZF A;  5JDB A;  2V4V A;  1JZ5 A;  1YIF A;  1VLN A;  3K3N A;  3H1Y A;  1AVB A;  3I8T A;  3AMH A;  3PLQ A;  3U0Z A;  2YY1 A;  5T50 A;  3VBF B;  1GWM A;  2AR6 A;  2IXH A;  4EQV A;  4XJU A;  2BFU S;  4UFK A;  5FZO A;  1JU3 A;  1HJG A;  3KV4 A;  1JZ2 A;  1O3Q A;  4HK9 A;  1F35 A;  1C8M 1;  4M0H A;  5C3O A;  3B7M A;  2B46 X;  4DOU A;  2K2S A;  1SHW B;  5E1R A;  4QKB A;  2UWA A;  5IFT A;  3IDC B;  5J98 B;  2XBO 2;  4Z82 A;  4GB3 2;  4C1W A;  4PIY A;  1NAE A;  1RUJ 1;  5A1F A;  2XVG A;  1VBD 2;  1C3H A;  1COV 2;  1XNA A;  2H0B A;  1IG0 A;  4AQS A;  1XYO A;  5L9V A;  1S0E A;  3ST7 A;  3WF3 A;  1ZZ7 A;  3FLT A;  1RUD 1;  2HH9 A;  5K8S A;  4B4Q A;  5JPM B;  1COV 1;  3AJZ A;  3JUU A;  3LA3 A;  1W6Q A;  4YZ3 A;  2IUW A;  5A1L A;  1IS5 A;  4EZH A;  3WDW A;  1HW5 A;  1AR9 1;  2BU9 A;  4ZXE A;  5A7N A;  1POQ A;  3LDB A;  5DUU A;  1VMH A;  3GAL A;  3RSJ A;  5HCH A;  2A7A A;  4P08 A;  4RA0 A;  5C8C A;  4KBB A;  1LUL A;  2EIE A;  3A23 A;  3TB0 A;  4UFM A;  2IFW A;  3B02 A;  1RUC 3;  4OUE A;  3HQU A;  4QU1 A;  4IE6 A;  5FZ4 A;  1GNH A;  1DQ6 A;  4FPG A;  4Q0V A;  4MHU A;  1IS6 A;  1UMI A;  5FRE A;  4CDU A;  3O0X A;  1ZZC A;  1SBD A;  2VZQ A;  1UY0 A;  2GND A;  4UOJ A;  4Y4Y A;  2DF7 A;  4CCK A;  4EJR A;  4AFB A;  2A73 B;  1SLL A;  4LR4 A;  4ORF A;  4Q0P A;  3VBH A;  1QOO A;  5FY9 A;  2OPW A;  2BWA A;  3PUQ A;  3T2T A;  2EIB A;  2C5D A;  5GLV A;  2Y64 A;  5A6X A;  2IXI A;  2JDN A;  2OXB A;  4RR3 A;  1ZM1 A;  2Y0O A;  5DG1 A;  4N43 C;  1ZBE 2;  2C0Z A;  5FXV A;  4FI9 A;  4GUL A;  4OI1 A;  3PIJ A;  2X29 A;  1UYZ A;  1MEC 2;  3CIH A;  2J1S A;  3MF6 A;  3INA A;  2WFF 3;  1S4C A;  4RQP B;  1OLQ A;  4BIS A;  1PO1 3;  1JYC A;  2DUQ A;  2TBV A;  1YJL A;  3QLQ A;  4YVW C;  1BLZ A;  2RG4 A;  4OUM A;  5EYX A;  3SH5 A;  4AAP A;  1LAJ A;  4QQH A;  4NIA A;  1PZ9 A;  1EV1 2;  2VMI A;  2YBP A;  3IT8 A;  1RUH 2;  3ZMO A;  2VTX J;  1PMH X;  2D3R A;  4WZF A;  2OW4 A;  3ZIW A;  1C5H A;  2BEO A;  5CAD A;  2XBO 1;  5FYY A;  2HBU A;  2R0F A;  3KMH A;  5J37 A;  4E4S A;  2PHD A;  3BVC A;  3VD5 A;  2ZCW A;  2PN5 A;  1J3R A;  3ZN6 A;  4IEY A;  2ZGO A;  4LKE A;  1A8D A;  1FMD 1;  5FZ6 A;  4BQ1 A;  2JX9 A;  1JHJ A;  1VB2 A;  1RUF 3;  5FZO B;  2QVS B;  5FYS A;  2HWF 2;  1AL2 3;  2Q8E A;  3RNS A;  4A7Y A;  1AJO A;  1EAH 2;  3EBR A;  5FV3 A;  2EAL A;  3T09 A;  4TZD A;  1XXN A;  1BEV 2;  2RM2 3;  1SPP A;  3U37 A;  1IS3 A;  1G9F A;  4CU7 A;  3ZXK A;  5D8A B;  1ZRI A;  1UY2 A;  4R9A A;  3ZYB A;  1X8E A;  3TRS B;  3AYC A;  3GJB A;  1D4M 3;  1H2N A;  1S0D A;  5JI7 A;  5F3C A;  1JZ4 A;  5FY8 A;  1BCX A;  2Y60 A;  4ERO A;  2DV9 A;  2W3J A;  2V5D A;  3ZFE B;  4BQY A;  1RUE 1;  4MGZ E;  1WBF A;  1MS3 A;  1O4Z A;  2DYC A;  3AX4 A;  1L7Q A;  2VEC A;  3C3V A;  1JH5 A;  3TN9 1;  2QQV A;  3T4V A;  5BUV A;  1CX4 A;  1H8T B;  5IUQ A;  4IXL A;  5JXH A;  3ES1 A;  5LRS A;  4Q4W 2;  1HB1 A;  3UGF A;  3E1F 1;  2WZP P;  1UX7 A;  1VP6 A;  4YVS C;  2DTW A;  4ZKT B;  2YBS A;  1U5Y A;  1AYM 2;  4X6Q B;  2P5B A;  3PVE A;  4O7X A;  3I59 B;  3I3M A;  3MF9 A;  1ND3 C;  2W1U A;  2BBV A;  1W8W A;  1BKZ A;  3KZ4 C;  1QJU 3;  3MIH A;  2GNB A;  5FZH A;  4A42 A;  4CU6 A;  4WM8 A;  5AC9 2;  5KHJ A;  2BOI A;  1J59 A;  1RVF 1;  2RDQ A;  1UZW A;  4AK3 A;  1ZX5 A;  3RFR A;  2WO1 A;  4OI2 A;  4Y5S A;  1Q43 A;  1WD3 A;  3DYM A;  5LK5 A;  2DWR A;  2W39 A;  2VXJ A;  4MZU A;  3WXP A;  2TUN A;  4QT6 A;  1LHO A;  1IKP A;  1VBB 1;  1MAC A;  4GWN A;  4QPG A;  5CB7 A;  2F4L A;  2H6B A;  4AWD A;  3EB7 A;  4JTN A;  2H0V A;  1K45 A;  4AI9 A;  4LIT A;  3WSO A;  5DDJ 3;  2DCK A;  2VZR A;  5C9A A;  3AP9 A;  3NAP B;  5GZC A;  2RS1 3;  4ASK A;  1SZB A;  1JYW A;  3PL0 A;  1JOP A;  5FOJ B;  1RB8 G;  1XE8 A;  4P9I A;  1W6N A;  3WD5 A;  4MYE A;  2JDP A;  3WW4 A;  5A6Y A;  4DMI A;  2BNM A;  3ZFF A;  1FAT A;  3UKV A;  2WA4 A;  1LHW A;  4AHX A;  1GZ9 A;  4HXC A;  3OB8 A;  2VBP A;  2FD8 A;  2D5H A;  4E2S A;  3WNM A;  3ZIX A;  3FN9 A;  4A7K A;  1CX1 A;  1BVV A;  2OT7 A;  3MGU A;  3WNK A;  3FJS A;  4W8J A;  4LK6 A;  1X9T A;  4DPN A;  1O59 A;  5KHH A;  4FOV A;  1RUC 1;  3U78 A;  4AEK A;  4J25 A;  2KXL A;  3WHU A;  2CAU A;  2OA2 A;  2ET1 A;  4JC1 A;  1RUH 3;  2ZMK A;  4YWA A;  2VOX A;  4IGP A;  5LW9 A;  1VAV A;  3SHR A;  4IEU A;  4Y22 B;  1NX9 A;  1JU4 A;  4FPF A;  4NN0 A;  5I0U A;  1H30 A;  2BGP A;  1VPH A;  3A21 A;  1AR9 3;  2JJ6 A;  1V0A A;  3FFQ A;  3SH4 A;  2JKX A;  3S5Q A;  1I5Z A;  3I2F A;  3WUD A;  3CJI C;  2G1M A;  3BKZ A;  1VBC 2;  1CIY A;  1REF A;  2KD7 A;  2RMU 1;  2QQM A;  1YFX A;  4EV0 A;  3JBG 3;  1POV 1;  2WKK A;  2E6V A;  4V2W A;  1HRV 3;  3THT A;  2CTV A;  4CCO A;  4Z2W A;  1YFW A;  3IM0 A;  3KQ4 B;  3TEW A;  4LQR A;  1DQ1 A;  2ZZQ A;  2Q8O A;  4MGI E;  5FPU A;  3NWK A;  5F8P A;  5JSR A;  4BXS V;  1V6K A;  2X5I C;  1OKQ A;  1SDD B;  3MW4 A;  4AFM A;  3HIF A;  5F9T A;  1B35 C;  3PMS A;  3POW A;  1AR8 3;  3NNJ A;  3ZFG C;  4UBH A;  2VZV A;  1YYN A;  5BY5 A;  1R09 3;  3I3B A;  2B45 X;  1IQA A;  5CKQ A;  5FPV A;  3RYP A;  3VD9 A;  1IG3 A;  3WQ0 A;  1QOS A;  4D0Q A;  3CJI A;  4XIL A;  5FK8 A;  1W9T A;  1CGP A;  2WNU A;  1QH6 A;  3RG0 A;  1X36 A;  2P34 A;  4CDX A;  4JKM A;  1AYM 3;  3HT2 A;  3WW1 A;  2TEP A;  4PLN A;  4XJA A;  5KBF A;  2ZAB A;  4K3U A;  2ZGN A;  1OH3 A;  5JZG C;  5A32 B;  3BOP A;  1D4M 1;  3PDQ A;  2QUO A;  2XG3 A;  3IKW A;  4LLO A;  5BNO A;  4KI5 M;  1SEF A;  2HWC 3;  4N90 A;  4OQ8 A;  5A6Z A;  3FHQ A;  4DRV A;  4NJ4 A;  1UO9 A;  1ULC A;  4ARX A;  3PU8 A;  3OPT A;  5DAB A;  2D40 A;  1W9F A;  2WZ8 A;  5IAX A;  3K4D A;  5FAX A;  5ANN A;  1ND2 A;  3VZL A;  3MV0 1;  4LMF A;  2JIG A;  2CDO A;  3J26 N;  3WQ1 A;  2W68 A;  3DYP A;  3VZN A;  4N53 C;  3MID A;  3WUC A;  1RJ7 A;  5FTT C;  4HKL A;  4K1Z A;  3POF A;  2I74 A;  4BK4 A;  1WA4 A;  4W6X A;  2W87 A;  3ACH A;  3LPG A;  4CDW C;  2WT0 A;  4YW5 A;  1JZ6 A;  2ARA A;  1OPO A;  2WQ4 A;  2Y6J A;  3SCH A;  4CXW A;  1YCI A;  4DUV A;  5IK8 A;  4EN0 A;  3K3O A;  1JYT A;  2IXJ A;  2Y6H A;  3P5B A;  5FQ0 A;  1PVC 1;  3AVR A;  2ZS6 B;  3HNB M;  4LHN A;  1BMV 1;  1GZW A;  1W9Y A;  2KM2 A;  2GP5 A;  1UZZ A;  3BUC A;  1PO1 1;  1E57 A;  1GKB A;  1X33 A;  4X8N A;  3U14 A;  2GP3 A;  2XLG A;  4P14 A;  4CDQ B;  1REE A;  4KU7 A;  1TME 2;  2ZHN A;  2EA7 A;  2R6Q A;  3SH3 A;  5A3N A;  3CBN A;  4NPR A;  4CP1 A;  4M3C F;  2UYA A;  1XE0 A;  2ZX4 A;  3ACL A;  1MR5 A;  3D8C A;  4LKD A;  5LAT A;  1I5P A;  3AC0 A;  5LCW L;  3ZMN A;  4XFF A;  2A6V A;  1LU2 A;  3OSD A;  5F5A A;  3W21 A;  5E6H A;  5IYY A;  3W5M A;  5FPA A;  3LPF A;  1ZRE A;  1CQ9 A;  4ZZ8 A;  3NL1 A;  4AQ6 A;  2K46 A;  3IPV A;  1R09 1;  2Q4S A;  1AR6 2;  3AP6 A;  4NMI A;  2VUA A;  4XAA A;  4ATF A;  2RDS A;  3AYD A;  1MS1 A;  1RUE 2;  1V70 A;  1QEX A;  2ZBJ A;  4B3N A;  1QXP A;  4XAC A;  2GMP A;  2JD9 A;  2YC2 A;  3B69 A;  3RVH A;  3OBT A;  4AVV A;  4DO0 A;  1X9P A;  4AG4 A;  2P3Y A;  1RHI 1;  4QPW A;  1ZNP A;  1WCQ A;  5L73 A;  1OQE A;  2JG9 B;  2YUE A;  1XYN A;  4C0B A;  3ZSM A;  2OZ6 A;  4J1X A;  2QQP A;  3E6B A;  4MGQ A;  1LED A;  4B29 A;  1POV 3;  3H8X A;  2IVJ A;  2D7F A;  2Y6K A;  3WDY A;  1S0G A;  4CCM A;  4QHO A;  3VBO B;  1H2K A;  1NA1 A;  1WUV A;  2VXR A;  3U75 A;  3WG3 A;  4TWT A;  1ULG A;  3V0B B;  2A6X A;  4P9G A;  2FCT A;  2ZEY A;  3AL6 A;  3OF1 A;  4ZU4 A;  5T5J A;  4Q29 A;  2RS3 1;  4GIQ A;  5D8A C;  5ISL A;  4DFS A;  1VE0 A;  5I8Y A;  1SCR A;  5DAQ A;  1VBC 1;  2WNV C;  3HJR A;  2OZJ A;  3K51 A;  4TLF A;  3AFK A;  3O1V A;  3SXW A;  1NCR C;  5FDB A;  1CN1 A;  1VJ2 A;  1XBF A;  1L7L A;  4XTM A;  3S7I A;  4FPH A;  1OA3 A;  2QTW B;  4G3Y C;  4D8M A;  4BB3 A;  3I2K A;  1SLC A;  3VDA A;  2JDU A;  3N3H A;  3ZYI B;  1TNR A;  1LGC A;  3VZO A;  1GOH A;  1IPS A;  1UOG A;  2WIN B;  3AKT A;  4M0N A;  4BZ4 A;  2W5F A;  5FMB A;  4PF1 A;  4MXW A;  1CJP A;  3AMN A;  1R1A 1;  5A7P A;  3VBU A;  5IVV A;  1OD3 A;  3VBS A;  2WFF 2;  4XF9 A;  3O1S A;  3MZH A;  2Y26 A;  4XMI A;  1WLT A;  1VIW B;  1VAK A;  4QX7 A;  3G6J B;  4AHW A;  1N3P A;  4HG6 B;  2Z69 A;  2OX0 A;  3ZPO A;  4GAZ A;  4E27 A;  4DQA A;  4DY5 A;  3KCX A;  1JYV A;  1J3Q A;  2VY0 A;  3PVO A;  1CAW A;  5DG2 A;  3A4U A;  4CDW B;  4N43 A;  2JG9 C;  5A3U A;  1LRH A;  1NCR A;  4OYU A;  4UW4 A;  4E2Q A;  4OMD A;  2HYX A;  3BIE A;  2GU9 A;  4ZU5 A;  3SEP A;  2VZT A;  3MO4 A;  4FQ4 A;  1WME A;  3ZR5 A;  3UYJ A;  2FZ2 A;  1UZV A;  1YI9 A;  4OI0 A;  1BHG A;  3M3Q A;  5C7G A;  2XPJ A;  1H1I A;  3TWI A;  5FBJ A;  4XYX A;  1JBC A;  1UY3 A;  1NCR B;  4TN7 A;  3IZO A;  5F2W A;  4AQT A;  3MBW A;  4CP9 A;  5CKN A;  1UY4 A;  3LE0 A;  1CZT A;  4F7Z A;  1SG3 A;  1AXZ A;  1CR7 A;  3KCY A;  3GHN A;  4IV3 A;  1D0H A;  1KQR A;  2XUE A;  4LIV A;  4Y5T A;  1SMV A;  1W6M B;  2BER A;  3VDD A;  4WVV A;  2GC3 A;  5C8W A;  2ZAA A;  3GCW A;  2ARC A;  3KF5 A;  3ZO0 B;  4CP9 B;  3O7O A;  1CAW B;  2PHW A;  4QDQ A;  2FCV A;  4L92 A;  2I07 B;  4XFB A;  5FZ0 A;  1T2X A;  4ES9 A;  1UYX A;  5CA6 A;  1RUD 2;  3MIB A;  4RR3 C;  4KG8 A;  3KV6 A;  1HQL A;  1QJX 3;  4L8Q A;  4CXY A;  4OMC A;  1GQG A;  4FXG B;  5AC9 1;  4XVH A;  5K4L A;  5C5T A;  5EXO A;  4F83 A;  1C8N A;  4CEW A;  4GXL A;  4N9H A;  4LLF A;  4QPY A;  3VBU B;  4DXZ A;  4WM8 C;  2VCB A;  4NAM A;  4CU8 A;  4MGT A;  5C5U A;  3ZN6 B;  1SLA A;  1ZVF A;  4LBO A;  4UI9 L;  3VBR B;  1RUE 3;  3BPZ A;  1X7N A;  2HWE 2;  4NVP A;  1LEM A;  1C5I A;  4WVZ A;  4NUB A;  4LEJ A;  1HXS 3;  1ZBE 1;  4H2A A;  4QX1 A;  5A3T A;  3CQO A;  1WLW A;  4CP0 A;  3B01 A;  1W05 A;  1POV 0;  1KIT A;  1UZY A;  1W8O A;  1QY4 A;  1ZBA 2;  4BQ3 A;  2QZ2 A;  3OYW B;  4XIK A;  2F6B A;  3MLK A;  2TNF A;  4XUP A;  1ULF A;  3N36 A;  1EV1 1;  4EN6 B;  3EYP A;  4BQ5 A;  2WLP A;  1N47 A;  4FTS A;  4XZP A;  1DP0 A;  2AH2 A;  2VU9 A;  3BAL A;  3K48 A;  3I2O A;  2YB7 A;  4LO4 B;  2PHF A;  4R4X A;  3CDZ B;  1PZ8 A;  1BXH A;  3ZFE C;  3MFA A;  1QNY A;  1AR8 2;  4HPK B;  4QQP A;  1JYX A;  1FMD 2;  3N7L A;  3VBH B;  1OF3 A;  1ZBA 1;  1ALY A;  1KD7 A;  1NQD A;  1QHD A;  1VBA 1;  3K4Z A;  4Q4X 3;  5LBB A;  1JYN A;  1QXJ A;  2Y6L A;  4MO3 M;  3ZN4 A;  4COV A;  2ES3 A;  1VBD 3;  2NZ9 A;  2VL4 A;  4ZS3 A;  1SFN A;  4ITC A;  4C91 A;  2GH2 A;  1RUH 1;  1ASJ 3;  1AX0 A;  2VNR A;  4QHZ A;  4LO5 B;  4FPJ A;  1W6O A;  2JG8 A;  3LQC A;  4OUS A;  3USS A;  2B4K A;  2EID A;  4XCB A;  5BNN B;  1R08 2;  3VBR C;  1OPM A;  1XNK A;  1RUO A;  4DS0 A;  1AYN 3;  2QBX A;  3GBW A;  2A6Y A;  2VAU A;  1OBN A;  4A2U A;  2PLV 2;  5JWP A;  4L0P A;  5LBE A;  3CZU A;  3IMM A;  3ZYH A;  4FOY A;  1N1T A;  3LWC A;  1OSG A;  4K40 A;  3P3N A;  4UW5 A;  3VHR A;  1O7F A;  3AMQ A;  5ACA 3;  2MPF A;  4MV2 A;  1MQT B;  1W04 A;  5FXX A;  2VUC A;  4LBN A;  3U07 A;  2XVK A;  4XFI A;  4CSW A;  3LSE A;  4JTO A;  1WWY A;  1YXW A;  4YM0 A;  5FZB A;  4QQ2 A;  3LFM A;  1UU6 A;  5EJ3 A;  5GLU A;  2EVX A;  5FYZ A;  3SQO A;  1VRB A;  3M1H A;  3RMY A;  3RYK A;  2J1T A;  5L7O C;  4FVV A;  2X8K A;  1FOD 2;  3P3P A;  4X8P A;  3O12 A;  1RUJ 3;  1VBE 2;  4Y1Y A;  5FMO S;  4DIQ A;  2RS5 1;  4BJ0 A;  3VDC A;  1NXD 1;  1DZR A;  3JQW A;  4KL1 A;  5FMD A;  2P3K A;  5FLH A;  2DVF A;  2E51 A;  2VMC A;  2JEN A;  2Z5W A;  5D8A A;  5HXV A;  3ZYG A;  1FNZ A;  4Q26 A;  2VQT A;  1B09 A;  3TBD A;  1HB3 A;  3VHO A;  2CDP A;  2KR2 A;  3APB A;  1M06 G;  2I45 A;  5DUX A;  1NLQ A;  4XUN A;  2WUH A;  1QQP 2;  5CIR A;  3S30 A;  3AVS A;  1MS0 A;  3PHM A;  3FBM A;  1V9U 2;  5BNP C;  2OQ7 A;  4OHV A;  1YUD A;  2PTM A;  5BNP A;  2VQ0 A;  1PIV 3;  3PTY A;  3DXU A;  5FY1 A;  2D93 A;  1PVC 2;  4HKW A;  3VHN A;  4FPK A;  1WBL A;  4HSJ A;  4FAG A;  2JXA A;  4QHB A;  4YW7 A;  1HV1 A;  3S6P A;  1HQW A;  3OGJ A;  4BH9 A;  2GC2 A;  3I59 A;  3M7A A;  5FY7 A;  3CO2 A;  3N7M A;  2BFU L;  2Y8K A;  1QWR A;  3Q8E A;  1C1L A;  4L99 A;  4RQP C;  5C71 A;  5JOX A;  3DEM A;  1QJZ A;  3VL8 A;  4AXO A;  1HRI 3;  4BCU A;  2CV6 A;  3CU7 A;  1DQ0 A;  3BU7 A;  2XLF A;  4JRA A;  2HWF 3;  3SEE A;  5CFC C;  3POE A;  3UT0 A;  3WDT A;  3LA2 A;  3CMG A;  1KXG A;  1NG0 A;  1PNF A;  2XWJ B;  3I4I A;  3HBK A;  2ZGU A;  3AKP A;  2DU1 A;  3NST A;  1GNZ A;  4YM2 A;  5FUN A;  2PAK A;  3RYR A;  1SBE A;  2LRP A;  2NN8 A;  1HKD A;  4XDQ A;  2JDZ A;  1EPZ A;  3ZDV A;  4Y1U A;  4YVW A;  4H3W A;  4D69 A;  4YFZ A;  1VRH 2;  3I3E A;  2WYS A;  3HQX A;  3ZYR A;  3SMH A;  4AVS A;  4Q4Y 2;  1Z78 A;  2XBO 3;  3ACG A;  1PGW 1;  4W4Z A;  3ZVX A;  4LO7 A;  3POS A;  3I7D A;  4Q5O A;  4DB5 A;  3ZXF A;  4Q4W 3;  1YRZ A;  4WM7 C;  1FI2 A;  3M3O A;  3WHT A;  4Y26 A;  1AYN 1;  1WCD J;  1ENR A;  5JLV A;  1E5H A;  4RFT 0;  4X6R B;  1QJU 2;  3N4M A;  3IBM A;  2WO2 A;  3WP6 A;  2AAC A;  1TZO A;  4XW3 A;  3QD6 A;  3J7N A;  3WW3 A;  3L9J T;  3KCC A;  3BPS A;  4XDP A;  5BPX A;  3HAG A;  3JBG 2;  1AR6 3;  4AED C;  1DU3 D;  3BYW A;  3ZFF B;  1VMF A;  2WII B;  1VBA 3;  4Q4X 1;  5F3I A;  3VBU C;  4PIZ A;  1YEW A;  1RVF 3;  4K8F A;  2VNO A;  4UWD A;  1ENX A;  2FMY A;  4S2F A;  3AZW A;  4ARY A;  4AR2 A;  4YPJ A;  4UW6 A;  2DVB A;  2HWB 2;  3PJQ A;  1OKO A;  2WBK A;  4XOG A;  1X82 A;  2CGO A;  5J48 A;  1YFY A;  2E31 A;  3ILR A;  1NCQ A;  2DUR A;  3MFC A;  4KQ7 A;  5F5I A;  1GWK A;  2DCZ A;  3E97 A;  3WF2 A;  3U4X A;  1OH4 A;  4A6O A;  4ZU7 A;  3OUJ A;  4QQL A;  4YVW B;  2BZD A;  3FBY A;  1W39 A;  2C6S A;  5BNQ A;  2BTV C;  4Y24 A;  1QIQ A;  3KF3 A;  3LIH A;  4FCA A;  4RN5 A;  1K5M C;  5FUI A;  1MEC 3;  2WO3 A;  1K5M A;  1WCS A;  4MG2 A;  5ABJ A;  3HN1 A;  3VB9 A;  4E2G A;  4WV8 A;  2CL2 A;  1RYY A;  5FYV A;  5K0U B;  3C7G A;  1ZBE 3;  5I8S A;  4OLL A;  4LHS A;  1ST8 A;  4HVQ A;  3H0O A;  3ZM8 A;  2VW2 A;  3GNE A;  2ZGL A;  4CDQ A;  3DGT A;  3VDD C;  4QM8 A;  5GM0 A;  1CVN A;  3JD7 3;  5FXW A;  5CBL A;  2DFB A;  5SV8 A;  1AX2 A;  2VCC A;  1QF3 A;  3LEM A;  3OCP A;  4AYU A;  4E8D A;  1NT0 A;  2VNG A;  3D6E A;  5IWF A;  4Q2F A;  3WW2 A;  1UOB A;  2VO5 A;  1YNA A;  2HWB 1;  3HT1 A;  3MYX A;  1JTZ X;  2VGD A;  4YVS A;  1QJX 1;  4IV1 C;  2B7Y A;  2XDV A;  3MW2 A;  1TQ5 A;  4HT1 T;  4QB1 A;  3VKM A;  1YFU A;  2WQZ C;  5CU1 A;  2P6C A;  3Q8A A;  4NID A;  2NM1 A;  3O0W A;  3VLB B;  1A34 A;  5C8C C;  2B9V A;  1DG6 A;  1F15 A;  1OOP A;  2FDF A;  5T54 A;  2XJU A;  5C4W B;  5F2S A;  1BEV 3;  1JN2 P;  1YO8 A;  2OII A;  2RM2 2;  5BNP B;  1QJY 2;  1B35 B;  3S57 A;  3M3I A;  5EP9 A;  3ZYP A;  4EN7 B;  3FL7 A;  4Z2A A;  1O6U A;  4LIU A;  3BTZ A;  5CIS A;  1DGL A;  2QE3 A;  2C9A A;  4UFL A;  3WF0 A;  4C0H A;  3WR0 A;  5EV7 A;  3JCI A;  4HK8 A;  5I8T A;  2YYO A;  1Q8Q A;  4FO9 A;  3GBF A;  3NRU A;  1H2M A;  1G9A A;  1GMM A;  1SLT A;  3I2D A;  5A3L A;  4HL0 A;  2XGX A;  1STM A;  3WP4 A;  3THD A;  1LU1 A;  1W8F A;  1CAU A;  4Z92 B;  4W6Y A;  2X05 A;  3NKG A;  4RGG A;  1M4W A;  2W1W A;  2YG0 A;  3I3D A;  1O4T A;  3AMP A;  5ACA 1;  1PIV 1;  2GME A;  2WNU B;  2JE8 A;  3BOD A;  5LA2 A;  3G7D A;  2PAM A;  1LOD A;  4BXF A;  2JB4 A;  1N1V A;  3NW4 A;  1BZW A;  3T2P A;  2Q0A A;  5FZE A;  1R1A 3;  3AB0 A;  3WG1 A;  1PK6 B;  1UYY A;  5A6Q A;  4GKX A;  3RZM A;  4PJY A;  1US2 A;  4L11 A;  4PI2 A;  4Y20 B;  4YAR A;  3O1P A;  1Z7S 3;  2XJQ A;  3WNO A;  5D2A A;  3RGB A;  1GP6 A;  2DCT A;  2KA3 A;  5IVC A;  2MEV 1;  1ENS A;  2BVV A;  2VOW A;  3V65 A;  1D0G A;  2GSY A;  2NYY A;  3DN7 A;  1XU2 A;  4LO8 A;  4JQR A;  4QX5 A;  5GLW A;  4RR3 B;  3N9M A;  1Y9Q A;  1OOP B;  5BNN A;  1RVF 2;  5FZK A;  1HXS 2;  5JR2 A;  2XWB B;  2MEV 2;  2CYF A;  1MZE A;  3TEX A;  2C26 A;  1I3H A;  3MPB A;  3UGH A;  2PMW B;  3PNA A;  4HN0 A;  1JW6 A;  3DPR C;  2EAK A;  3WQB A;  4A41 A;  2HWE 1;  2ZOE B;  4GWI A;  3A7Q A;  4OHX A;  2WAA A;  5JMO A;  4LO6 B;  4QX8 A;  3I2H A;  2RR1 3;  3IDB B;  4XJ9 A;  2GAU A;  3K75 B;  4FBF A;  2ZEW A;  4PCR A;  1W8N A;  4FXK B;  4BIO A;  3HQR A;  4AHZ A;  5C6C A;  1PGW 2;  3WF4 A;  3T0A A;  2VC9 A;  5F6K A;  3ETQ A;  5ANQ A;  4LE4 A;  1RHI 3;  3THP A;  1CZV A;  5FLJ A;  1WKY A;  2XQX A;  4KWL A;  1O5U A;  2OS2 A;  4PLM A;  4AE2 A;  1J83 A;  1KGY A;  2AEN A;  4N7U A;  2ZZJ A;  1KFX L;  4I3P A;  4NRM A;  3LGR A;  4JZR A;  5FY4 A;  5H9S A;  1RIR A;  4FFI A;  2WRA A;  3BOW A;  2AUY A;  1W6P B;  1KFU L;  4YW3 A;  5FZM A;  4C1X A;  1LOB A;  2NMN A;  3B9C A;  4S2G A;  3DV8 A;  3JQX A;  1LJ7 A;  3ON7 A;  2ZX2 A;  1PVC 3;  5I91 A;  1P8J A;  3EMR A;  4N8M A;  4ZZ5 A;  4LT5 A;  3AZZ A;  5HI0 A;  2IWG B;  4IEQ A;  4LK7 A;  5KXB A;  1DCS A;  4OVE A;  4CEY A;  4CXX A;  1GLH A;  2VUD A;  4BPZ A;  4CEY C;  4DIN B;  4DXS A;  1AR9 2;  3BCW A;  5KHI A;  3ACI A;  5FKC A;  3KT1 A;  5LY2 A;  1H8T C;  3POB A;  1ONA A;  4QDR A;  2ZGM A;  1JI6 A;  5BNO C;  4AGV A;  2HJI A;  5FIX A;  1K5J A;  2IXK A;  1HRV 2;  1WW6 A;  3KB5 A;  2VZU A;  1W6N B;  3S5A A;  3CKH A;  5GZD A;  4B1L A;  2HWD 1;  2WNV B;  3FLR A;  2GZW A;  2Z79 A;  5KXD A;  5EZW A;  5JSO A;  2DTY A;  1MZ6 A;  1ZYB A;  2Z2S B;  3E6D A;  3IB3 A;  4YM3 A;  3KHC A;  4N53 A;  1RUC 2;  1HX6 A;  4URT A;  3ZOI A;  3VBR A;  1HB4 A;  3MPP G;  5F37 A;  1EAH 1;  2I2S A;  4IE0 A;  3ZSE A;  1W8Z A;  3NVC A;  1H6X A;  1OA4 A;  2JEC A;  2VH9 A;  3H9A A;  2A3X A;  3I49 A;  1NOV A;  2Y38 A;  4QPI B;  4R52 A;  3JB4 C;  3MLJ A;  4MLO A;  1NY7 2;  4RGK A;  4Y3O A;  1JZ8 A;  5F6L B;  2QQL A;  1DLL A;  4WM7 B;  5DAW A;  1WLD A;  4W6W A;  4WBB A;  4NHL A;  5FZC A;  1UU4 A;  1XQN A;  2VQA A;  4PBP A;  2ZJC A;  4GWM A;  4BLJ A;  1UWW A;  1XND A;  1Q8S A;  3WIN E;  4ATE A;  1C8M 2;  4HN1 A;  2G9F A;  1O3R A;  5C3Q A;  4K8R B;  4I30 A;  4LNV A;  1EUU A;  1US3 A;  1D7P M;  3K2O A;  3ZX7 A;  5DAP A;  4P5H A;  3T1M A;  1J1L A;  4HLT A;  4PDW B;  3GCX A;  1RUI 3;  3WDV A;  3ECQ A;  1V6M A;  1PMJ X;  1APN A;  4M3C B;  4LBQ A;  1V6O A;  3ZN5 A;  3ATG A;  4CDU C;  1LTE A;  2J42 A;  4PQ9 A;  3LB9 A;  1DYO A;  2CWS A;  3RJ2 X;  4EWA A;  1VB4 A;  2L9L A;  1UOF A;  3PUH A;  2BJS A;  2CSG A;  4IET A;  5BXX A;  5LY1 A;  4XCA A;  5F3E A;  3TYJ A;  2VUL A;  2ADD A;  3VBF C;  4BM8 A;  5FZA A;  3POJ A;  4D94 A;  2ZMN A;  4BQX A;  4YW4 A;  4NHK A;  5T55 A;  3AP4 A;  1HIX A;  1S0F A;  5G05 L;  1I6X A;  4N43 B;  5CFC B;  1K42 A;  4SBV A;  4NHX A;  3RWN A;  5K0U A;  1OQ1 A;  5KWR A;  2XJS A;  3WCR A;  2WYF A;  2QQJ A;  4OZX A;  2EXK A;  2EXJ A;  2YV8 A;  2ENR A;  3USU A;  1LKN A;  5FYU A;  1LEN A;  1WA6 X;  4XQ4 A;  4H7M A;  2YFU A;  1W2U A;  2WZR 3;  3GJA A;  3ZYF A;  5JXG A;  1RED A;  1OC1 A;  4SLI A;  3OD0 A;  3FC0 A;  2VOK A;  3AP5 A;  4AFD A;  3N9Q A;  3Q8C A;  4E4H A;  1BBT 3;  2JKB A;  4FP2 A;  4CP2 A;  1U5I A;  3LFI A;  5F3G A;  3GYD A;  5EQU A;  3KVB A;  1F5F A;  1PO2 1;  1VRH 3;  2NPI A;  2J1A A;  2VZO A;  4WZC A;  5F39 A;  2VZ1 A;  4CTE A;  1IGO A;  4ONU A;  5F1R A;  2VD7 A;  3BTA A;  4MGS A;  1PO1 2;  1WD4 A;  2PHR A;  3O0V A;  4MET A;  3OJB A;  4O65 A;  3J7M A;  5AFB A;  3HOB A;  4CDX C;  5GJ6 A;  1RUN A;  4IEZ A;  4A3X A;  5K0U C;  1XYP A;  2YHJ A;  1OA2 A;  1H2L A;  3GF6 A;  3AJY A;  3EQE A;  4JGZ B;  4A3Z A;  5FZD A;  1EYB A;  1JS9 A;  1LOG A;  2PHT A;  4QKN A;  5A7W B;  2C24 A;  2BGO A;  4A6S A;  4ASL A;  2UWC A;  5J3U A;  5JPN B;  1U0A A;  1XE7 A;  2LW8 A;  3LF7 A;  3MIC A;  3QAC A;  1CAX A;  4GB3 1;  4JHZ A;  3SCG A;  5LZ6 A;  1ULE A;  2F4P A;  3MUZ 1;  4IV3 C;  3LIG A;  4CEW B;  1VBB 3;  2Y33 A;  1H9W A;  3NJX A;  3IPV B;  3H8O A;  4XZU G;  3AFG A;  3WG4 A;  4CYD A;  5H9P A;  4E4D X;  3T0D A;  3L2H A;  2WSV A;  2D6N A;  1PGS A;  2ZGS A;  1YC6 1;  2JG8 C;  1O4Y A;  3TEZ A;  4NRO A;  3OBR A;  5JVV A;  5JUV A;  4HBN A;  4BYY A;  4ISR A;  1WMX A;  2RS1 1;  4XF3 A;  4XUQ A;  4GA9 A;  2ADE A; 
#chains in the Genus database with same CATH homology
 4NRQ A;  4NRP A;  4ZHN A;  3O1O A;  3O1R A;  2FDJ A;  4IE0 A;  4IDZ A;  5F8P A;  3O1P A;  3O1S A;  3RZL A;  2IUW A;  4NPM A;  3I49 A;  4QKN A;  3BTY A;  4NJ4 A;  4CXX A;  5DAB A;  3BUC A;  4JHT A;  3RZH A;  3T3Y A;  3I3Q A;  3KHB A;  3O1T A;  3O1V A;  4RFR B;  4NIH A;  4QKB A;  4NID A;  4ZS2 A;  3H8O A;  2FD8 A;  2FDI A;  4IE7 A;  3BKZ A;  3O1M A;  2FDK A;  4MG2 A;  3T4V A;  4NRM A;  4IE5 A;  4CXY A;  2FDG A;  4ZS3 A;  3BIE A;  2FDF A;  3S5A A;  3RZG A;  4IE6 A;  4IE4 A;  4NII A;  3H8X A;  3BTX A;  3BI3 A;  3LFM A;  3RZK A;  4NIG A;  4NRO A;  4QKD A;  4QHO A;  4OCT A;  3H8R A;  3S57 A;  3RZJ A;  2FDH A;  4MGT A;  3T4H B;  4QKF A;  3KHC A;  4O7X A;  3I3M A;  4NPL A;  4CXW A;  3I2O A;  3BTZ A;  4O61 A;  3O1U A;  3RZM A;  3BU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...