4ZHNA

Crystal structure of alkb t208a mutant protein in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
200
structure length
200
Chain Sequence
LAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLAFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methylated trinucleotide DNA T-meA-T
publication title DFT Studies of the Rate-Limiting Step in the Reaction Cycle of the Fe/2OG Dioxygenase AlkB and Related Experimental Studies
rcsb
source organism Escherichia coli (strain k12)
molecule tags Oxidoreductase/dna
total genus 55
structure length 200
sequence length 200
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2015-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4zhnA00
3RZGA 4CXXA 3T4VA 4IDZA 5F8PA 4NIHA 3I3MA 3I3QA 3RZHA 4O61A 3O1UA 4JHTA 4QKBA 4MG2A 3BTXA 3S5AA 2FDFA 4NRMA 4O7XA 3RZJA 3O1MA 3H8RA 4QKFA 3BTYA 4ZS3A 3O1PA 5DABA 2FDGA 4IE5A 3BUCA 3BI3A 4NRPA 4NPMA 3O1TA 3BU0A 4NIIA 4QKNA 3RZMA 3T4HB 4IE6A 4CXYA 4QHOA 3H8OA 2FDKA 4NIGA 4ZS2A 3I2OA 3KHBA 3O1RA 3O1SA 3I49A 4IE7A 4RFRB 4NPLA 4IE0A 2IUWA 3BIEA 3LFMA 4NIDA 3O1OA 3H8XA 2FDIA 3S57A 3RZLA 4NRQA 3O1VA 3RZKA 3KHCA 4CXWA 4IE4A 3T3YA 4NJ4A 4OCTA 4MGTA 3BTZA 2FDHA 4NROA 4ZHNA 3BKZA 4QKDA 2FDJA 2FD8A
chains in the Genus database with same CATH superfamily
4PCRA 4QD2A 2WZ8A 1LOBA 4LNVA 4YVWA 3ACHA 5DDJ1 4BLIA 5J48A 4HKOA 1W2TA 3EQEA 1AJKA 2JG8C 4D69A 1NOVA 2O8OA 4NHYA 4W50A 5C4WB 5L7OA 3I3QA 2AEZA 2HH9A 1OVSA 3DCQA 3UJOA 1CZTA 1CGPA 3POSA 1GP4A 4LBQD 3ZFEC 2NLRA 1BEV3 4WV8A 1H0BA 1J58A 3S7EA 3C7OA 4PIYA 2DWRA 3OG2A 4P9XA 1ZA4A 5CKNA 2BQPA 4WVMA 4MGSA 1N1SA 3GHNA 1X33A 4RQPA 5K0UA 4L2NA 4LA3A 1TME3 5FZEA 1KRIA 5ABJB 5E89A 3SISA 2R071 4NOTA 2WZR2 1LJ7A 1ULGA 4JDOA 1R091 2X29A 2W08A 4CCMA 2D93A 4BQ2A 2ZGSA 4QXCA 1H4GA 2GMMA 4IV1A 1BYHA 4XW3A 5FRAA 3VD4A 2CAVA 1O3QA 5F3EA 5GLWA 2P34A 2FZ1A 4QPIA 4XZPA 4GMP0 1NLSA 3TWIA 4F8AA 4CCDA 2PQSA 5GLTA 2EA7A 4Q4X1 4Q0SA 4Q0QA 4ZONA 5FAXA 2Z69A 5FUIA 3LIGA 3EXUA 4NIIA 1LOCA 3ILRA 4Y1UA 3P5BA 1JYTA 1NZCA 4DUWA 2RV9A 1DDLA 2P2KA 1RC6A 3P6BA 1FATA 1L3JA 4XBNA 3HNBM 1FNYA 1OKOA 3OUJA 1NE6A 2R043 1DCSA 2ZTNA 4HPKB 2OQ7A 3I54A 2ORXA 4CDQB 1JZ5A 5HBAA 3CDZB 5FOBB 4RHV2 2ZHLA 1CIYA 2ZX3A 5FYBA 4AI8A 1K5MA 3TEWA 2YFZA 2A6XA 4YVWC 2AENA 3DYPA 3LCPA 4M3CE 1PVC2 2JB8A 1LB2A 4EJRA 1WLCA 2ZCWA 5FP8A 3ZFFB 1D4VB 5FYIA 1YXWA 2P3JA 1LTEA 4OMDA 3I3BA 3NV1A 1PO11 1UYXA 2TBVA 2WIIB 1H2NA 2FCUA 2VXRA 3BIEA 5C9AA 4DQAA 1N3PA 1NY71 3WP3A 1AXYA 3HN1A 1SBEA 4NUBA 5FFOC 1UIJA 2PLV1 3UKNA 4CU8A 5JR2A 3H8XA 4AVVA 2ZX0A 1B35A 1ULCA 4HVQA 2JECA 2GC0A 1C57A 3P3NA 3VKFC 5KXBA 2BFUS 2XKOA 2JG9B 1W03A 1C28A 3B01A 1XE8A 2R30A 4IV1C 4RGGA 4YZ1A 2ET1A 2JE7A 4NPRA 1UU4A 3ECQA 3SITA 5LB6A 4J1XA 3OBZA 4QPIC 4X8PA 2HWD1 3AZXA 4XF3A 4XMAA 1RITA 2I74A 5FMOS 2RJ2A 3NNGA 2WINB 1KS4A 4D7SA 1DQ6A 2VZRA 1W28A 1J1TA 1DP0A 2C0ZA 2KA3A 4GMP1 3ACIA 2XJRA 1Z78A 1PIV3 4AFBA 2QQMA 2X5IA 1W9TA 2QQKA 4Q4Y2 1MQTC 2A70A 5A6YA 4FPLA 5C7GA 1DLCA 1HLCA 2X10A 3GBWA 1OFSA 3MICA 4AAXA 2G9FA 4LO8A 4S2HA 1GR3A 2YGLA 4IV3B 5DAQA 2I45A 5FPZA 2RR13 2ENRA 1FAYA 4P9LA 1ND2A 2WZPP 3ZPYA 1ND3A 2FCVA 4ZZ8A 1OPOA 2QQNA 2HLEA 3AYDA 2ZJCA 1CPNA 3FL7A 3ZIXA 2H6BA 4K9SA 3ZSEA 1GQGA 4CP9A 2DBIA 1K5MC 2C4XA 1HRI2 3L2YA 4XHXA 4FQZA 1REFA 5C8CA 5KR7A 3IMNA 4ISQA 3VBSC 1XNKA 5FYHA 3S5QA 4EZ4A 3HD8B 4JGZB 5IVVA 3WNMA 2IFWA 2PQQA 5FMDA 3ZYFA 1SEFA 1E57A 2ADEA 2VVDA 5CFDB 4NIAA 3LEKA 2SLIA 1K5JA 4Y5Z0 3Q8EA 5C9AC 1JUHA 1UY2A 3J7MA 3GZUC 4WVZA 1ZBE3 1LOEA 4MLOA 1W6PB 4PBOA 2XBO1 4HXCA 2Y38A 4JRAA 5C4WA 4XDQA 3IDEA 3WR0A 4FQ4A 1B35C 1CJDA 5H9SA 4I30A 1SFPA 4OUMA 2OPKA 3NV4A 1SFNA 1VRH2 2ZKNA 1JOPA 4ZKTB 5D1IA 1AR91 2YPJA 3OGGA 3RYKA 4JKLA 1XSRA 1MEC2 2DTYA 4PLOA 1JW6A 4M0HA 5FXZA 1UYZA 2VBPA 1JODA 1YO8A 2DYCA 5ABJA 1NYWA 2CAUA 3BOWA 3I2HA 2NP0A 1LHOA 2TUNA 1HV1A 4ZS2A 3P1IA 4QX0A 1RUG1 3TN91 4KQ7A 1I5ZA 3MBWA 4BA6A 2XL7A 4Z92B 4N8MA 3AP7A 1H8VA 3ZYRA 4E4ZA 4KI5M 1FMD1 4XTMA 4HBNA 4COYA 5I8TA 4YW3A 2RDNA 5IVJA 2ZXQA 4YWAA 1ND2C 5APAA 4I0BA 4B3NA 5EIYB 5J3UA 4GH4A 2AACA 4UFKA 3UESA 1DQ2A 5D8AB 4N7IA 1UU6A 1YQ6A 3V56A 3D82A 2BW8A 4ZPIA 1CAVB 3QLQA 4PIXA 3JD72 2XDVA 4CE8A 2PHWA 2WNVB 4NIDA 2EIEA 2NMNA 5BNPB 4HPKA 1BK1A 4MHUA 3EO6A 4MXVA 5FZOA 2RM21 1OOPB 1UYPA 2VZQA 1JU3A 1ZM1A 1QJU3 1IHMA 2ARBA 2C6SA 1N47A 3WD5A 5BV6A 5L36A 5C8WA 3KV4A 2FQPA 3M70A 4FCAA 1SDDB 2E6VA 4R9AA 1OMIA 5C4WC 1OSGA 4OVEA 3ZFFA 2Z4FA 2GP5A 4AI2A 1OXCA 2D5FA 4KU8A 3AZVA 4UW5A 5FP3A 1VBA3 1SFYA 2O8QA 3GCXA 4LO5B 4COUA 2ZPXA 4PT6A 4CUGA 2JXAA 4I0WB 4XHBA 1XNTA 2EIDA 4PI2A 1XU2A 1URXA 2JDUA 5ABJC 4M01A 4OFGA 2J1VA 3FLPA 4YZ4A 3AFGA 1W6QB 5FZ0A 1ULEA 5KHJA 2PHDA 2RJLA 3K51A 4R9DA 1YYNA 5FMBA 3MLLA 4YLZA 3J8F1 2JG9A 4CDWA 2QQUA 3BPSA 2PN5A 2W68A 1CIWA 2VMEA 2TEPA 4BHPA 4RFT0 2IXCA 4QU1A 5K7PA 4LLFA 1QOOA 1FXZA 1POV1 3IT8A 2XLGA 4PHZA 4FAHA 1POQA 3ORJA 3DPRA 1BZWA 1FT9A 2XG3A 3POFA 4OUSA 4AFMA 1ST8A 4LT5A 1OC1A 1JZ8A 1ZX5A 1S2EA 3Q8BA 5T5LA 5BNOC 5FLJA 1JZ2A 1EP0A 2ZX4A 4P5YA 1PM4A 5I0RA 4EE2A 3TNQA 2Y0OA 1S0DA 1YCIA 3INAA 3JBG2 5DABA 4IV3A 4LBNA 3VZJA 2FDGA 2RS52 3OOXA 4D6QA 4XQWA 3WZ1A 4CDQC 1PX3A 4UT5A 1LENA 4MGIE 3MIFA 5JXHA 3FN9A 3N9PA 3L2HA 1JN2P 2ZOEB 4XF1A 5LBCA 1LHWA 2RE9A 3LSEA 2ATFA 1J3QA 4YSFA 3HIFA 1F2NA 1H2MA 1VBD2 4D7YA 3IAPA 1ZRRA 1RVF3 2CL2A 4Q5OA 4WM8B 3ES4A 3ZFFC 4JGZA 2O1QA 3KF5A 3ZXFA 2EXHA 3RI9A 3MPPG 1RMU2 4COVA 1LULA 2LRPA 1FI2A 1J3RA 4FSJA 5FZ3A 1RUJ3 1MS9A 3MUY1 3GALA 1LCLA 4PF5A 3VV1A 4JX0A 3WG1A 2LALA 4E4SA 1DZRA 1COV1 1R64A 5FLHA 4KNCA 1W6PA 2WNUC 5J09A 2V4VA 2XJUA 4DZGA 1WCSA 2WAAA 3RYPA 1XXNA 4EN8B 1CWPA 3KB5A 1VIWB 4XACA 2MEV1 2MPFA 4L92A 3R4SA 3IIAA 3WF4A 3VZLA 5IFPA 4XBLA 4YGEA 2YPDA 4YG6A 5IVCA 1NXMA 2C1FA 2EIGA 5KXCA 1CAUA 4IEXA 4LJHA 3VKLA 3UGGA 4WBBA 2NPIA 3FMGA 3K4DA 3UT0A 3KV5A 4O65A 1UYYA 1RUE2 3ZN6B 3LFMA 3N7JA 4AWDA 2OIIA 4TXWA 1WCDJ 5HCFA 5A7PA 3N7MA 3ZYPA 2O14A 2P37A 2HWF1 1O7FA 3MLJA 1I1EA 4DEVA 4HFSA 3IWZA 3V65A 2KD7A 1PGSA 3OEAA 3KS7A 2BJSA 2XWBB 2PHTA 5FZ6A 2PFWA 1NA1A 3ZSLA 1JMUB 5FTTC 1UPSA 1AVBA 1Q8QA 4YM3A 1DFQA 1XE0A 2DVGA 2G4IA 1UY4A 1OD3A 3D6EA 1ASJ3 4RSUA 4AVAA 4LBKA 5BUVA 1MZFA 3MIHA 1JZ6A 2JKXA 3DV8A 5D8AA 3M4FA 3SKVA 4CU7A 4QM9A 2IXKA 3OBAA 3WUDA 1UOBA 2OS2A 3H7JA 3AC0A 4KGGA 3ZFGB 4B1LA 2EXJA 5JZGA 4OI1A 3GXUA 2VM9A 2WFF2 2WNVA 4FFIA 4AGRA 1H6XA 1H9PA 2FDJA 2K2SA 3A0NA 4YZ5A 1V6OA 4JGZC 5BNPA 1X9PA 3USUB 4BWOA 2RS31 1HRI1 1NQDA 1U5IA 2ZGOA 5CFDC 5F9TA 3FHQA 3MHZA 1OOPA 1V70A 4MOAA 5FBJA 2AGSA 1EY2A 1F4AA 1O4ZA 3B93A 2YGMA 1AR82 5FK7A 1R082 3POBA 5LASA 1SMVA 3HBKA 3LF7A 4URTA 4A6SA 1IPJA 3DL3A 3EJKA 3WQ0A 1KD7A 2PAMA 3WCSA 3AVRA 5JUVA 2A1XA 1D4M1 2ZEXA 2WDBA 1RUC1 2HWC3 1EV12 2ARCA 4LK7A 1WD3A 3VDDB 3IIIA 4COWA 4Z2AA 5CG8A 1TNRA 4AHZA 5C33A 1ODNA 1J1LA 2UU8A 2A73B 3CQOA 4KWLA 4AVTA 4D3WA 1U5YA 1VBE1 1PMJX 2EAKA 1VRH1 1W3XA 1ZZ7A 1V9U2 4Q4V2 2C9AA 1W6QA 1GBGA 3Q8CA 2VECA 5FZ7A 2AH2A 5LY2A 3BUCA 2R32A 2VNOA 3D5OA 4LHNA 4NPMA 2JJ6A 4Q27A 5FY4A 3FZ3A 3O1TA 1ULDA 1AX0A 1QHDA 3SEEA 4AW7A 2VUJA 3J7LA 2OZ6A 1DZTA 1XYOA 1MS4A 2ZMNA 3O12A 4XFGA 2FCTA 1JZ3A 1QNWA 2XVGA 2AYHA 2VZSA 1OQDA 3EYPA 3E5UA 4IESA 4MZUA 4H3WA 1O3TA 1TZOA 2BZDA 1PZ8A 5B2GB 2GN7A 5BNNC 2YFUA 4K20A 3JD73 4NHMA 5ISLA 1AYN1 5CNAA 2VG9A 4OUEA 4BMEA 4LE4A 4V2WA 2Y6FA 4UFLA 3MUZ1 3FWEA 2WNVC 1HRV1 1QIQA 4O9EA 4QM8A 5FBZA 2J1UA 4ATEA 3ELNA 3HJRA 3IBMA 5FK8A 4XFFA 5BNPC 1MACA 1QJZA 4EN6B 2QTWB 3VBUB 4YFWA 3PDQA 2OT7A 1OOPC 1SCSA 3W59A 3N9MA 1UZZA 4I3GA 5KC6A 5F2WA 3LDBA 3PU8A 4FPGA 5C3OA 1DQ1A 4XFBA 3A23A 3N9OA 4LIVA 5E88A 2Y6LA 4QX2A 2KXLA 2UWBA 2WO1A 4NPLA 4RR3B 4QMAA 5BNQA 5IK7A 1IKQA 3OYWA 4WM8A 1TME2 2IUWA 3PVEA 4UWDA 4G4FA 2LROA 5EJ3A 1W0OA 3U37A 1AR71 2Y60A 4NHXA 1VLNA 1EUTA 1GP5A 1WW6A 2Y34A 5EYXA 4AEMA 5J7MA 5HXMA 2VY0A 3OCPA 2V73A 4XUQA 5DAVA 4CUCA 2PXJA 3LB9A 5A3UA 3KHCA 1QJX3 1AR61 2VE1A 1TNFA 2JIGA 1GNHA 3HVDA 2YMZA 5FZGA 4P9IA 3PMSA 1X36A 2C5DA 4LHLA 4AXOA 5CAZA 1S0FA 1S4CA 4EN7B 2VMCA 3N3HA 1OURA 2ZGKA 3CMGA 1F5JA 4EN9B 4IL7A 4FTBA 1LGBA 4S2FA 2D98A 2YROA 4QXBA 3J7NA 2HEWF 1HXS1 3ZN6A 1ZBA3 4NROA 4ZHNA 2PMWB 1VAMA 4TZDA 3DXTA 2R042 1SLAA 4Q0UA 1RUI1 4R9BA 5CKMA 5IT6A 5GKAC 2B8MA 1GNZA 1SCRA 2RS13 4WZFA 5CU1A 1VBB1 3APBA 2ZHKA 3JBG3 5JIAA 4P00B 3ES1A 1YIPA 3GJAA 3SLIA 4A2UA 1DHKB 5LRSA 1W05A 3F2ZA 1UU5A 2W94A 4Q1RA 4YRDA 4MVTA 3LEGA 1RJ8A 1RINA 2BTVC 4CEYB 1W8OA 2OXBA 3KQRA 3IAQA 5L73A 2PHFA 1G9FA 1BLZA 2VMGA 3URFA 1YUDA 2D6MA 5IVFA 3J9SA 2HWB1 4AEJA 3ZFGA 2RS51 4GD4A 4IEUA 4P9WA 4DRVA 3LD8A 1S0EA 5FYTA 4A44A 3U14A 4YM0A 1H30A 3IMMA 1IQDC 3WW2A 3USUA 4GA9A 1OH3A 1AL21 1ALYA 4N7UA 3KT4A 1NZIA 4XJ8A 4MXWB 1MVQA 3A22A 2R16A 5DZGA 3TEZA 4YARA 5JOZA 5BPXA 1W8WA 4JQTA 4L99A 1IPSA 2P3YA 5FXWA 4CA9A 4XTPA 1WLDA 1Q3EA 3ABZA 4PLMA 2XVKA 5A70A 1JBCA 1G8WA 1Y4WA 2UYBA 4LA2A 5FZMA 2OYZA 2CDPA 1C5HA 2B4KA 1UWWA 2KR2A 3RJ2X 1BBT1 2IZWA 2P6HA 3T4HB 3VDDA 4TN7A 2JDHA 4CCNA 4CXYA 3ALQA 3RGBA 1GWMA 4UW3A 3A0KA 3M3QA 1PIV2 1RUE3 5FYVA 3U10A 3WX5A 2FDKA 3I2DA 4NIGA 1MS1A 5JPNB 4AHYA 4LKFA 5A6ZA 1W8UA 4YM1A 3IB3A 3D0SA 1H1AA 1GV9A 1OHFA 1DYPA 4O9GA 1IQAA 3DYOA 1PO21 2WLPA 2RR12 2P17A 1OKQA 3UGFA 4I2OA 3MGUA 4NVPA 4AQTA 1GU3A 4XF4A 3J26N 4S2DA 3SCGA 1JYVA 1SLIA 5HXVA 3T09A 3VBSB 3WF3A 3ZVXA 4GALA 4WVWA 4GULA 4KBBA 1DQ5A 4XIOA 3VD3A 4LHKA 3ETPA 2D3RA 3TBDA 1RUF1 4IE0A 1R1A3 1ULFA 3MI8A 1O5LA 5FUPA 1SQ4A 2D7FA 3E5XA 5T5PA 4A7ZA 5A3LA 1NG0A 3KCYA 4PLNA 4CDXB 1GQPA 3ZFGC 1N1VA 1OQEA 4FFHA 5CEHA 4Z1VA 2BVBA 2RMU1 2ZX2A 2JG8A 4RGAA 5J98B 1ZBE2 2WS91 1W2UA 4BXSV 1LKNA 3BVCA 1US3A 2ZA9A 2VQAA 1GYKA 3BN6A 4C91A 5JSRA 3WV6A 2W92A 1S0JA 1RHI1 1C8M3 2VBDA 5IAXA 2WQ4A 1VBC1 2JDPA 2QKDA 1RIRA 3OBTA 1DGWA 5F1RA 2Y6HA 4RA0A 5E6HA 4XXPA 2VMIA 2XHNA 1C3HA 3ZXEA 4AHWA 3NAPB 4BJ0A 4E4DX 1B09A 2VZTA 5LK7B 1RUH1 1HDKA 2R061 3OGRA 1W9YA 5F2SA 4CSWA 5LBFA 3VDDC 4Q0VA 3KV6A 4QT6A 3WUCA 4DXTA 1V9U3 2D43A 5FZ9A 1PGW2 3FBYA 1QQP2 3AKPA 3ZYHA 5HI0A 2P6CA 2EXKA 3V0AB 4H7LA 2XH6A 2ZGTA 4QQHA 2YYOA 5A7WB 4BPZA 1PVXA 3HMYA 1AXZA 5IW0A 4DINB 5FV3A 1F8VA 3E6BA 3RRDA 3FFQA 4Y1YA 3V0BB 1CVNA 2GAUA 1WZXA 3NNMA 2QZ3A 4AF9A 3DXUA 4QPYA 4LK6A 1LGCA 2WQ8A 3PVBB 4XJUA 2VUCA 3L9JT 4GJZA 5FPAA 4OHZA 5AC93 3VL8A 1RB8G 1ZRFA 2ZX1A 1PGL2 2GN3A 5T3NA 2K9ZA 3H42B 5FO9B 2NQYA 3JXSA 2D6PA 1Z7S3 1AJOA 3VHPA 2XJQA 1W0NA 1QJU2 1TMF1 1YC61 2WZEA 2ZEWA 1OLMA 5F5IA 3WQ1A 4NAMA 1SBFA 3H1YA 3T0DA 3POYA 3MIEA 4CEYA 5F3CA 3GHMA 2YZ4A 4LLOA 3VBUC 3NJVA 3RI8A 3LAGA 1FPN3 1V6KA 1XYPA 2QFEA 5EJ1B 1K45A 4QKNA 1VBA2 1OLQA 2HBUA 4V1PA 3UJQA 2VMHA 5GZDA 4CCOA 2Q0AA 1JYNA 3RG0A 5IJRA 4XIKA 4XAEA 5IHRA 4OQ8A 4CCCA 4AEKA 4RR3C 5F5CA 2RVAA 1SLBA 5LA1A 3ZYIB 1WWYA 3AZYA 1G9BA 4QX7A 1SG3A 4AAPA 3I2IA 4XQ4A 4DRRA 1BEV1 4AQSA 2Y8KA 3F95A 1BVP1 2R1BA 1CAWA 3I2FA 1RGSA 4W6XA 4YW1A 1GZTA 3N9LA 4J25A 4MXWA 5F32A 2R073 4Y5SA 3O1SA 4BZ4A 3B69A 4A7YA 3MFCA 5JVVA 1R093 3H50A 3ZYBA 2YG0A 1MZ5A 4GB31 2ZGQA 4LBQA 1M4WA 3WF1A 1YQCA 4IE7A 2WAOA 2WNEA 3P3PA 1QDCA 5JLVA 4RFRB 5BNOB 1C1FA 1QXRA 1E5HA 1MQTA 3OGVA 1Y7BA 2D3PA 5IK4A 4Q4X3 2CWSA 4UXAA 1ENRA 1S1AA 1Q8VA 4L97A 3NKGA 1TG7A 1W39A 1PM7A 2WT0A 3MW3A 2NYYA 1U5ZA 1MPXA 3ME2A 5F6KA 3ZSMA 5C5UA 1WBLA 2Q30A 3LZZA 4PQQA 3CJXA 1CZSA 3ZYJB 4A3XA 3LA3A 3NNJA 2ZEYA 2IVJA 3POIA 3RZKA 1H8TB 2HJIA 4MADA 4CXWA 3VDCA 4YM2A 3H9AA 3LE0A 1XRUA 2XHKA 3VBSA 3PURA 2R0FA 2ZABA 1KEXA 3I7DA 2Q1ZB 1OBNA 4Q26A 4CEYC 3UGHA 1V00A 1GZCA 1AUYA 1RVF2 4DMIA 1O8SA 1GFF2 3QD6A 4XJ9A 1PMIA 3VKNA 2FDHA 3AM2A 4DOUA 1ONAA 4AFAA 1W8HA 1VPHA 4PBPA 1MZ6A 2GP3A 2WNUB 1RUJ2 4H7MA 1VAKA 4LO4B 3WQ7A 1RUNA 4GJYA 2I2SA 4BYYA 3ZDVA 4MH0E 3R05A 1HB3A 3T4VA 5J1XA 4BQWA 2FMDA 5B4XA 4IEPA 1V6LA 2PLV3 5T5JA 1G7YA 1LRHA 1IOAA 3SQOA 2OW4A 3WXPA 3IDAA 4A42A 3O1UA 4QKBA 3I4IA 4Z82A 3ZDSA 4XAAA 1AYM1 1KFXL 2F4LA 2YDEA 5JSOA 4XJWA 4ITCA 3C8XA 3O1MA 4DNYA 1AX1A 4E8CA 2HWD3 2B7YA 2ORZA 5LEJA 3O1PA 5CVRA 5I8YA 1HV0A 4GMP3 2WT1A 5C5TA 5FZDA 4E9KA 4AK3A 3KGZA 3ZR5A 2LW8A 3T2QA 5A7WA 4JTOA 2BVVA 5GZGA 1CR7A 4Y5TA 1ASJ2 2CTVA 2XL9A 4XABA 5FQ0A 3WP4A 1OA3A 3IKWA 1Q56A 1HX6A 4RL7A 4AI0A 3V0BA 2B9UA 4BXFA 2VMFA 2E63A 2D3SA 3BCWA 2ZHMA 4BDVB 4QGLA 3RS6A 2ZGRA 5J96B 5LZ6A 1W6MB 4GZ9A 4CDXC 2VNGA 1PHMA 5FMCA 1RJ7A 1W2NA 1I9RA 1SLTA 2MHFA 3ETQA 2DU0A 4HG6B 5K8SA 5FZKA 3OPTA 3NL1A 3I2KA 2YC0A 4IGOA 3VKOA 4YFZA 2HWC2 4XETA 5DPNA 4Y1ZA 1H2KA 1CONA 1O8PA 1QJFA 1EAH1 3NAPC 5A33B 1AR93 1OA4A 1YFWA 2VW2A 2C26A 3PNAA 5EQUA 3ATGA 1JI6A 3MF9A 5FDBA 1QQP3 3U07A 3TAYA 2PHXA 3PUHA 1DGRA 1RUD1 1YI9A 2P5BA 3ZXAC 3TN93 2BOIA 5LEKA 1RUG3 2CNAA 1HB4A 3M1HA 2DFCA 3OPWA 2RDQA 3LIHA 1ZZ9A 2W5FA 1VMHA 1JOJA 4INDA 2BNMA 4SBVA 5FY7A 1QJY2 4OZOA 1FMD3 3WVJA 5BNOA 5BNNB 4MGTA 1WCQA 1WCKA 2QBXA 2WFPA 4CPBD 3T2TA 3BTZA 1VMFA 3NO8A 4LHSA 3KMHA 5KXEA 3DEMA 2VOWA 2WO7A 3HT2A 3SH5A 2B46X 3K3OA 3VGIA 3GZEA 1HQWA 4BQ5A 5AFEA 3LOBA 1NE4A 4HT1T 4LUKA 3AKTA 4CDQA 5FY1A 1CD3G 3WW1A 4QGNA 4JKMA 3EHKA 2OQ6A 3WLUA 3CF6E 3S0MA 3QACA 3I2GA 4QWNA 4E27A 1A34A 5CISA 1UKRA 4LKDA 4MGKE 1H9WA 4HONA 2VD7A 2RM23 4BK5A 4MG2A 3ZSJA 4XFHA 3OGJA 4LULA 3OUIA 2OX0A 3RYRA 1FOD2 3PTYA 4HN0A 2FDFA 3KSCA 3C3VA 2GNTA 4EWDA 2CU5A 2DDUA 2BBVA 1U0AA 4QKFA 4I01A 3B94A 2WNUA 2A7AA 1KGYA 2QQJA 1MS8A 5IUQA 4BU2A 4AG4A 4UYBA 1ZZCA 2UY9A 3AFKA 5L19A 3SEPA 4BMBA 2LUWA 5IWFA 3WT3A 4Q4W2 4TLGA 4HSJA 4ZXKA 4G9SB 4IUGA 1EPWA 1QJX2 5A3PA 2DUOA 2O0OA 2WZR1 1LEMA 2HEVF 2NZ9A 3WG4A 2QQPA 4IXLA 3IDBB 4KH9A 1JHNA 1BQPA 2LM3A 3LFIA 2VZ1A 5IVYA 3J8F3 5LK5A 3TRSB 5L9VA 4YW4A 3AX4A 3VD9A 3K2OA 1ZBA2 2HWE2 4YZ2A 1HJFA 2EICA 4FFGA 4W65A 3TOJA 1DBNA 1OLME 1I3HA 1QDOA 4LKSA 1C1LA 3VZOA 1ZNPA 1POV3 3GF6A 2B42B 1Y3TA 2RS12 3THPA 3MEPA 1JUIA 2VVEA 3FUOA 2A6YA 3PJYA 5SV5A 1NQJA 1OA2A 5FZHA 5KBFA 1VAVA 1WGPA 4AYUA 4NN0A 2XGXA 4Y33A 4OLLA 1YLLA 5FZCA 4RD7A 2PHRA 1SLCA 3N4MA 4XC9A 1H8TC 3KVAA 4X6QB 4RGKA 4A45A 3AB0A 3FFZA 3E1F1 3B9CA 2IXIA 4NHLA 4RHV1 2E7AA 3GCWA 1QJEA 2VNVA 4Y1XA 1O4TA 3ZXLA 5LRRA 5DQ0A 1OI6A 5FY5A 3O1OA 5CFDA 3DN7A 3FC0A 4B7KA 3KF3A 1PVC1 4EV0A 1APNA 1W6MA 2XLAA 4RS5B 5A1AA 4ZY9A 4Q8LA 5FY0A 1QEXA 4EYUA 3KV9A 2VULA 4Y3OA 3E6DA 2WUHA 2D6OX 4QB2A 2F4PA 5JPMB 2DV9A 1CX4A 1TEIA 3BPZA 1COV3 4LIUA 2AREA 4LMFA 5JXGA 1ZRCA 5FZAA 3ILFA 2ES3A 2RJKA 4XZUG 3LEIA 2XOMA 3B5LB 3G6JB 1WMEA 4Y4RA 2MEV3 3PU3A 5F3GA 4M3CB 4P5HA 4FPFA 3WNKA 1AZDA 1MS5A 2WWUA 4PJYA 4GKYA 3VZNA 1D7PM 2XJVA 1WMXA 5DZEA 1MZEA 1DGLA 1NCQB 5A33A 2VZ3A 4CZSA 2FD8A 2YBSA 3K77A 4UW6A 3PUIA 2W1UA 3FLTA 1S0CA 1WKYA 2PYTA 5L7OC 4HOOA 5I0TA 5F5QA 3U75A 2WBKA 3ACLA 1CAXB 4AOCA 3WW4A 1IS4A 2W52A 3PTRB 2EALA 1Q43A 5FWEA 1MR5A 2HWF3 1X9TA 4LKEA 4Q4Y1 4UFHA 1ZRDA 1IS5A 3SH4A 4U36A 2JE8A 2WNOA 3HR9A 1KITA 5BNNA 4CP2A 1R1A2 4ZU7A 1RXFA 4E8DA 1CAVA 3RZJA 2IFRA 1UIKA 4QX3A 4AVCA 1XOYA 3MDPA 4BM8A 4HKWA 1STMA 4BQ4A 2E33A 1O3RA 4NWVA 1LAJA 3I3MA 4R9CA 5FJHA 4XMIA 4JTNA 1NXD1 3WDYA 4KG0A 4W6YA 4PI0A 4K8RB 1BK0A 4CUBA 4HK9A 1C8M2 2A75A 2RDSA 1W6NB 2RS33 2WABA 1BMV2 1MVEA 1OVPA 2CHHA 3H1MA 2G1MA 2A3WA 2Q1MA 5A3MA 1C4RA 5ERLA 3WEZA 3ZOIA 4DY5A 1S2BA 3NRUA 4HZFA 2LTNA 2PAEA 3K3NA 5I0SA 2R0HA 5A7OA 1CPMA 3O7OA 1YHFA 2W1WA 5FREA 1D4M3 4OHWA 4AGGA 1NLRA 3E6CC 2J1EA 3EMRA 4QU2A 2JDZA 3WY6A 1LEDA 4IETA 3AP6A 4AEDB 3ZMNA 1MEC1 3U4XA 2GMPA 1F15A 4XJAA 1LGNA 2HKXA 1YFXA 1LOFC 1UZVA 4W6WA 3KD4A 1Y9MA 2G9GA 2JICA 4UW4A 1VBE3 4AI3A 3NNFA 1RXGA 1SZBA 1UF2C 2E9QA 3CL1A 4R52A 5CA6A 3VBOB 4FP2A 3MIDA 3OY8B 4LPLA 3VBRB 1SDWA 1VP6A 2OZJA 2D5HA 1GZWB 3RNSA 1A8MA 3ZLIA 1DGWX 1QJY3 4XUNA 4EZHA 1UMZA 3PMEA 1QWRA 3OSDA 4WM7B 3VZKA 5I93A 5I91A 5IK8A 2VQ0A 4XOGA 3GM8A 5AC92 4MSVA 2XMLA 1XJAA 3AL5A 3AMPA 3O0VA 5GM0A 2FDIA 5LWBA 1X8MA 5LY1A 3PJQA 1Z7S2 3CLPA 4FO9A 3RDIA 4H2AA 3KQ4B 3FHAA 1W8FA 1WLWA 3RQ0A 5JI9A 3JB8A 1JS9A 1AYN3 2JX9A 2YXSA 2ZGLA 3BU7A 1G86A 1VALA 3JD71 5EZWA 3C7HA 3NJZA 1HRV3 2ARXA 1HB1A 3ASIA 4GXLA 1FPN2 4XVHA 1RTVA 4CDUB 5DDJ2 5IVBA 2CWMA 4OCTA 3W21A 2VZVA 4RN5A 3GZTB 1AHSA 2JD4A 3IDCB 1FOD3 3BB6A 3NVCA 4EN0A 2EIBA 3VDAA 5T52A 3WNOA 3M3IA 4GIQA 3M8LA 3OBRA 4CXXA 2FMYA 1L7LA 3D3AA 4CU9A 3AVSA 1GOHA 5F6LB 2R072 1S0BA 2XVLA 5IATA 3WDWA 1AR73 5C3RA 4Q4W3 1R092 4O61A 1J83A 3CHXA 3THCA 4E2SA 3M3EA 2V5YA 4LUMA 4CYDA 4D8MA 3AYAA 3VKMA 4JV4A 5JWPA 3AYCA 4MHRA 2V72A 1XPWA 3T08A 2Y33A 4HSLA 5CADA 1AR63 4M3CA 5F5AA 4NRMA 1NUKA 2HWE3 4Q4X2 4YG3A 2IWGB 5JMCA 4FT8A 3RWNA 3JQXA 1HIXA 3BGAA 3FBMA 3WW3A 4AZZA 3BALA 5FXVA 2JENA 4M00A 4QAWA 1HXS3 5IYYA 2R1DA 2V09A 2BRTA 2VZOA 1CAXA 1ZRIA 4QX1A 2VOTA 2YU2A 1PMHX 2Z5WA 1PK6C 5G05L 4CEWB 4B4QA 2XXZA 1KJRA 3GJBA 5JAXA 3T1LA 1VBB3 4LBOA 2QQVA 5HCBA 4URAA 4FPYA 1YNAA 1UPIA 3MO4A 2QE3A 3D4KA 3POJA 5HV4A 3JBG1 3RZZA 3HOBA 4NR1A 4JDNA 4YZ3A 3T2OA 4AI9A 4C8DA 1N1YA 4DXZA 2WL1A 3OEBA 1ZREA 1H1MA 4IEVA 5FO8B 3I2OA 2WO2A 1GANA 3KWVA 1F35A 1XB9A 3NV2A 4IEWA 4L9BA 4OZXA 2HWB3 3J7HA 1PO12 4P9YA 5FZ4A 1LHUA 1WLTA 2HYXA 2WYFA 2WWSA 3NJXA 3X29B 1Y9QA 4QGMA 3ZXJA 4M4PA 5L7OB 1D0HA 1VBD1 3ZXKA 4YW6A 1NY72 3R4UA 4N53B 1KQRA 2VCBA 4RS5C 1YQ5A 2PLV2 4QPWA 5DUWA 1RMU1 1RUOA 3WDXA 1US2A 2XWJB 1FX5A 2BGCA 1AL23 1PX4A 2IC1A 2PAKA 3JQWA 1GLHA 4YNIA 2EVXA 5GLVA 2Q8OA 5LW9A 4FOQA 5K0UB 1T6GC 1W06A 5ACA3 5KHKA 1C5IA 1TVGA 2Y0IA 4K6BA 2DU1A 4BQYA 5KHGA 2F6BA 3LGRA 3OGSA 2ET7A 5HCAA 4AE2A 3ZSKA 2B39A 4Z07A 4ZZ5A 4R8HA 4BOWA 2HWD2 1ZZ6A 3GNEA 3ZX7A 1BBT3 5HV0A 4L8QA 1K12A 1J84A 2A6VA 3OTFA 1YQ2A 2XJSA 3ON7A 4XFAA 1NCQC 4K8FA 4NRQA 4YGBA 1WA4A 1QXJA 2WKKA 3Q8AA 5FPVA 5BXXA 4GWNA 4ZU4A 3B7MA 1RUE1 2MNGA 4Q2FA 5CZKA 3JU9A 4AI1A 3ITQA 1ACCA 4JDMA 2CV6A 2GU9A 3D8CA 2QQIA 2WN3A 1U12A 1PO23 1WD4A 2DTWA 3CJIB 2QDNA 3OY8A 2QQWA 4DUXA 5CBLA 1GZWA 4P02B 3CNAA 4XBQA 5EFUA 5JXIA 2CSGA 1H1IA 4MYEA 2P3KA 3I3DA 4JCKA 4IQPA 4WM7A 4Y22B 5K9YA 5EV7A 4UI9L 1G9CA 1RUF3 3CZJA 2VO5A 4IW3A 5EXOA 3RZGA 3WOGA 3MW2A 4IDZA 5FUNA 3CEWA 2ZGUA 1HKDA 2WJSA 4KMQA 4TTGA 1OFNA 1W6OB 2YC2A 3VBUA 2ZAAA 1SHWB 4ARYA 2OVUA 2WFF1 3CBNA 2RMU3 1XBFA 4OULA 1R1ZA 2WLQA 3S7IA 1JYIA 5FP9A 1NCRC 2UURA 3WDVA 4CDUA 2XBO2 2XB6C 1LECA 1V6MA 5KHHA 5AVAA 1NX9A 1CN1A 3Q8FA 4RR3A 2GZWA 2JDKA 4META 3U11A 4NO4A 2EXIA 1RHI3 4W4ZA 4HETA 5FY8A 4J1WA 1VBC3 4A6OA 1AR81 1R081 5KHIA 1QNYA 1AR92 3BTYA 2CY6A 1GMMA 4IEQA 4LITA 4Y4YA 2VXJA 3ZR6A 1YFYA 1JYCA 2W87A 2ERFA 2D6LX 5C3PA 1YJKA 3U0ZA 3NWKA 1WMDA 3S6PA 1OQ1A 1EV11 1RUH3 3POEA 4LBJA 2R063 4FBFA 3I8TA 2D40A 1XNBA 3TN92 4BIOA 1RUG2 3QCWA 2W46A 4AEDC 4P08A 4K7JA 4PDWB 1WW4A 2BEOA 3PLQA 4MV2A 3AJYA 3LPGA 4LEJA 1N1TA 1W9FA 1GZ9A 1V9U1 2QVSB 4Q4V1 3RZMA 1FMD2 1UO9A 4EWEA 2J7MA 2QCSB 3VBOC 4Y24A 4TWTA 5GLUA 3VBRC 2N7GA 3KLSA 2X5IB 3TNPB 1TQ5A 5A3WA 3HQUA 3WCRA 3KT7A 4QXKA 5F3IA 4WM7C 1UW8A 2K0GA 2WQZC 3VL9A 3Q9OA 3LPFA 5FYZA 4UBGA 1UXXX 1HQNA 2ZAHA 3M7AA 4LORA 1LU2A 3LDKA 4M4RA 4ZU5A 1YEWA 1BHGA 3VDBA 2RHPA 2YBKA 5C6CA 2TNFA 1GOFA 5F37A 5FPXA 3NSTA 4BQXA 2RM22 2E26A 4JRLA 3BYWA 5BYNA 1TMF3 1NT0A 5DDJ3 3RVHA 2E53A 1BJQA 2GH8A 4CDUC 1W8NA 3FLRA 3AXDA 2ZGPA 3OB8A 5J36A 1IG0A 4NAOA 4HL0A 5FPBA 5CIRA 3E5QA 1REEA 4R4XA 1DF0A 1FPN1 1I6XA 5I0UA 5DAXA 2W39A 2AC1A 4A7KA 3RZLA 3TEYA 4D0QA 2ZZQA 4N53A 4EQVA 2GC2A 2YBPA 1TME1 1AXKA 4H14A 4XCAA 1JHJA 2OUHA 4OHYA 3AP5A 3FJSA 2JIJA 3LEMA 4KG8A 4P14A 3SNMA 4ASMB 3WDUA 2J1RA 4XURA 5A7NA 2XQRA 3J8F2 1A6CA 1IS3A 5FJKA 3TEXA 4D7TA 1WCUA 2Y6GA 2VQTA 3A7QA 4GB33 5F39A 4IERA 5FPUA 2GMEA 2YC4A 3BOPA 4BE3A 4FPHA 2Q5TA 3ENRA 3THDA 4XXAA 5JOYA 1H4HA 2D44A 3VD5A 1OF4A 1A3KA 3WNXA 4OYUA 2ETEA 2GH2A 3SC7X 4P9GA 2GC3A 4I0AA 5LBEA 5F8PA 3RMYA 1JOBA 5GJ6A 2ZKLA 4XF9A 2G19A 2DVBA 2QZ2A 3K75B 2VW0A 3VZMA 5DMYA 1V6IA 1PNGA 1ZYBA 3AK0A 4GH4B 3VHNA 2R041 2AUYA 5ANQA 3CJIA 2J42A 1QY4A 4HANA 4CUAA 4CEWC 3BTXA 4MO3M 2DVFA 2QDRA 3S5AA 4NHKA 2E51A 4YG0A 3JB4C 4Y22A 1H6YA 5GZEA 1P8JA 2EAAA 5EJZB 2NM1A 4LOSA 4E2QA 4CDXA 4QX8A 3ZM8A 4I3PA 1O5UA 3AMMA 4QHZA 4JVAA 5FZOB 5DXDA 4A41A 1PO13 4IE5A 4AL9A 4YGCA 3UYJA 1KJLA 1GP6A 1W2AX 1V6NA 1SPPB 2XJPA 4XYXA 1W6OA 3OUHA 1YRZA 4BB3A 3UETA 1GWKA 2ZZJA 2RDRA 2LS6A 2VC9A 1ZZ8A 2Y64A 4GWJA 4KL1A 4OMCA 3KVBA 4V2VA 4N53C 4QQLA 1COV2 1S2KA 3MLKA 4Y1VA 4ET7A 3CO2A 3K46A 2XKPA 3B9IA 3GDBA 5IAVA 1YQ8A 2MEV2 2CGNA 3NAPA 2DCYA 4XUOA 4RQPC 5K0UC 4TLFA 2HBTA 3NKTA 2GALA 2RG4A 1L7RA 3FHIB 3NW4A 2DCKA 3ZKUA 2UY8A 2B9VA 1EYBA 4ONUA 1S55A 2Q8CA 4OI2A 3WP5A 3N9QA 1AYM3 4IEYA 1AL0G 3KHBA 4CDWB 1V0AA 4I09A 4R4ZA 1AF9A 2BERA 3I97A 3V0AA 2L9LA 2H6CA 5I8SA 4AVBA 3LKJA 3KCXA 4K1YA 3RMXA 1PIV1 1RL3A 2IVIB 3KGLA 4PDWA 2EF6A 2HWF2 5GZFA 3H8OA 1W9SA 2AZ5A 3LSDA 5E16A 2BFUL 2ARAA 4N43B 3GYDA 1A78A 3DPRB 2V5DA 1DGRN 2C9KA 1ENSA 2VQUA 3O0WA 3HNYM 3MV01 3CJIC 2RR11 1CJPA 1WBFA 2D6KA 5FMOL 1ODMA 3WDTA 1KS5A 1FV3A 1L7QA 1XNDA 5C3QA 2ZACA 3NJYA 4LBMA 1CX1A 3HNMA 1DQ4A 4Q29A 3W58A 3R0RA 2A5ZA 2BPA2 4AQ2A 2VUAA 1Q8OA 5FYCA 3I59B 3KZ4C 2DURA 2VTXJ 5FOJB 1JYXA 2RS32 3FE5A 2BDRA 3G7DA 4PF1A 4CTEA 3THTA 5DUXA 4E2GA 2F17A 1W8TA 1UZYA 2XBO3 1QXPA 1UNBA 1ZBE1 5LA2A 4IEOA 5EHDA 3NV3A 5T54A 2WRAA 3ILNA 5K4LA 3VUOA 1ZZBA 3VB9A 2Q4SA 4WVVA 1UKGA 4XQDA 4EWAA 1IGOA 4N9HA 3PL0A 1Y9GA 1D4M2 1W0PA 4FFFA 1UOJA 2WN2A 4XUPA 1RUC2 3TYJA 4FPJA 4BISA 3UK9A 1Q8PA 1UOGA 3WSOA 2NN8A 4DPNA 2B45X 4OQ9A 4UFJA 1EAH3 2PTMA 1VB4A 1KFUL 1VBE2 3FX3A 1CAUB 3KT1A 5J37A 2CGOA 2YY1A 3PIJA 1UD1A 3MPBA 4YVSB 3SHRA 5JXJA 3ZXGA 1UAIA 3PVOA 1NAEA 2BOJA 4XUTA 4C90A 1QOSA 3LDRA 4PDWC 4YW5A 1D0GA 2WO3A 1VB2A 2J1SA 1PGW1 5FYSA 1RUD3 4JGYB 1QQP1 4Y20B 5FYMA 5D21A 2W0XA 4X8NA 3GBFA 1LODA 5KC5A 4FPKA 2VMDA 5IVEA 3T0BA 4FOYA 5AFBA 2DCJA 1HN1A 3M3OA 2P4EA 3I2JA 2W1SA 2X5IC 4JZRA 3WP6A 4ES9A 4QPGB 2XUMA 4ARXA 1DZQA 5FXXA 4C1WA 1POV0 2E7QA 5DZFA 4UAPA 3N35A 1PNFA 4MX3A 1NA1B 5C71A 2WR9A 3K4ZA 3HPNA 1AYN2 1UXZA 1H8TA 1UN1A 2VZUA 5EWSA 5JCTA 1OPMA 1ND3C 2DVDA 4FPOB 1J59A 1HRV2 2ADDA 1D2SA 1DLLA 1RYYA 3GBGA 3N9NA 5LBBA 1PGL1 4C0BA 5FZIA 3ROUA 4M3CF 2BWCA 3H3UA 4GWMA 2IXHA 1JYWA 4CPBA 5IFTA 2VTXA 3R6SA 5C8CC 5JZGB 1Z0HA 1QJU1 3MF6A 3JCIA 1J3PA 3C7GA 3WINE 2BNNA 3ZKYA 2YV8A 5A1FA 4HMZA 2UWCA 3OF1A 4YPJA 3IM0A 2Q8EA 3RSJA 1VBA1 4A3ZA 4DXSA 1UL9A 1SPPA 4JC1A 3TB0A 1AR72 1EUUA 3KM5A 5FZ1A 4KWJA 4BLJA 3ZMOA 3I49A 2XQXA 3JZVA 4AHXA 1CQ9A 2XPJA 4FOWA 2Y6KA 4KWKA 3S30A 1XSQA 1W2OA 3C7EA 2W95A 1LNSA 1ULOA 5L9RA 3WNNA 1AR62 2V4AA 2ZBJA 1ENQA 2HEYF 2Q8DA 2KM2A 4OI4A 2WZR3 3KCCA 2JWPA 3N7LA 1M06G 2VL4A 3DKWA 1K3IA 4XPVA 2DCTA 1O6UA 4LR4A 4XCBA 5LA0A 4HVRA 2WSVA 1UZ0A 4A4AA 1HXS2 2VU9A 1PK6B 3SMHA 3W9AA 1YFUA 2ZGNA 3AZZA 1F4HA 1RUI2 2HYKA 5IK5A 1UCXA 2GDFA 2OA2A 1I5PA 1N3OA 4UF0B 1VBB2 3OD4A 4N43A 3T3YA 4Q8KA 2VCCA 3CU7A 5A32B 5GALA 3MZHA 4GH4C 3VBHB 1GOGA 2GNDA 1ZVFA 4B4PA 4XE9A 1VE0A 1U5XA 1XYNA 3WNPA 5ANNA 2HWB2 3HN3A 4L11A 1QGLA 3AJZA 3UKVA 4JKKA 4FOVA 4RHV3 1LR5A 2W1QA 2VTFA 3B00A 2VZPA 3LWCA 3O14A 4FXGB 4YYOA 3VN4A 2BGPA 2VNRA 3HEIA 4CU6A 1RVF1 4U2AA 1O3SA 2D6NA 4LO7A 2JD9A 3ACFA 4YW7A 3I59A 3ZN5A 3RZHA 1QF3A 1PVC3 1PZ7A 4CP0A 1AL22 4XILA 1K42A 1RUJ1 4AR2A 3AMNA 4L0PA 4ZXEA 4COZA 3OYWB 5ACA2 2DUPA 2Z42A 3A21A 4FPEA 4IGPA 5DAPA 3RJRA 3PUSA 1S0IA 4O7XA 4MGZE 1UX6A 3H8RA 4GAZA 4QDSA 5T5OA 4ES8A 4LBLA 4KWUA 4G3YC 4JAAA 1BBT2 1W3VA 4ZS3A 4AGVA 1LOFA 4PQ9A 4LE3A 5A6QA 2G9ZA 2VH9A 2ZHNA 2WA3A 3BI3A 3MIGA 4IGQA 1JZ7A 4CDWC 1GQHA 3T30A 1LHVA 4YVSA 4DIQA 2JG9C 3BIWE 2YUEA 4QHBA 5FKBA 3IN9A 1ULPA 4XDPA 1PO22 3HBZA 3ZN4A 5EP9A 5G04L 2ZMLA 4HK8A 1Q8SA 3DGTA 2I07B 4JGYA 4Y20A 1LU1A 1A8DA 2IXJA 2WSUA 2E7TA 4N43C 3WHUA 3DUIA 4LXLA 1BXHA 1G6NA 1H2LA 1O59A 3DPRC 3HT1A 5LATA 4FAGA 4DUVA 1X8EA 4Q4Y3 5JIUA 1UMIA 1UOFA 3K4AA 2X05A 1KXGA 1GKBA 5FWJA 4E4HA 3WNLA 4J6GA 2IXLA 2ZMKA 4QPGA 1RUF2 1ASJ1 5CFCB 5JMOA 3ZO0B 4CVUA 2A3XA 1JH5A 1X7NA 4W8JA 1QU0A 4K40A 4CCEA 5A6XA 1FYUA 1XNAA 3U1XA 1YJLA 2P3IA 4IV3C 1DG6A 1NCRB 4M0NA 2RMU2 2QQOA 3U4SA 2WS92 1HRI3 2QJVA 2X8KA 2Y6JA 4I02A 5TSWA 2R49A 2YHJA 1DQ0A 1CESA 2BP6A 2PA7A 1RHI2 2P1BA 1MS0A 2A3YA 1KDMA 2C24A 3DKQA 3MW4A 4FP3A 5H9QA 5H9RA 3VBFB 4DEQA 2WYSA 1VBC2 5FIXA 4B4RA 5I0DA 3UNPA 3ST7A 3D0JA 4H55A 2GC1A 5C70A 4QB1A 4DXRA 2GNMA 1RUC3 5BY5A 5KWRA 2XJTA 2CYFA 1XQNA 3NQHA 5DUUA 3IZOA 2ILMA 3HWJA 2JDAA 2BNOA 4QQPA 2HWC1 5FZBA 5JOWA 5DAWA 1RUH2 1GICA 2WA4A 2R062 3W5MA 2W2IA 2NMOA 3WF2A 5FCCA 5A7QA 2PELA 4MGYE 2VCMA 1VRH3 3H7YA 4BCUA 3GZAA 1GUIA 3AKRA 3IPVB 5A7SA 1Y43B 4NJ4A 1MEC3 4Q0PA 1LESA 4YVSC 5FZFA 3OJBA 3PIGA 1D2QA 1BCXA 1T2XA 1UZWA 3T2PA 4FI9A 3AMQA 2VAUA 1WW7A 1G9AA 3BKZA 4CRQA 3AKSA 4JGYC 1QH6A 3CKHA 4IEZA 3ZIWA 4DS0A 3MIBA 4FTEA 4C1XA 3H3LA 2Z2SB 1QMJA 2B5HA 2W3JA 4LO6B 4K1ZA 4QDQA 1LOGA 1PK6A 1QJY1 2VJXA 4NIHA 2VUDA 4QPGC 1F31A 4B29A 4B7EA 5CG9A 3V64A 2YB7A 2JDNA 5F7UA 3NNLA 2DF7A 1NA1C 3UL2A 4UF0A 4QQ2A 1HN0A 3LOIA 4JHTA 5D2AA 5DUVA 4UOJA 5A32A 1TMF2 4HVOA 1NKGA 3K48A 4GKXA 3DECA 1IS6A 5FO7B 3LA2A 4K3UA 5D8AC 3VBHA 1V6JA 4CCKA 2VOKA 2OUJA 1C8NA 4QX5A 5A1LA 5M0TA 5A3NA 4NWWA 5JZGC 4NE9A 2SBAA 4BQ1A 2JG8B 3PVNA 4UFIA 1YWKA 1T6BX 4RS5A 2FBEA 3ZFEB 4CCJA 5T50A 4NRPA 1FOD1 2XR4A 4XDOA 2CGPA 4FTSA 3MV11 2H0BA 4QXHA 1BEV2 3PUAA 4SLIA 1E5SA 3B02A 4BH9A 1TE1B 3AKQA 3H1WA 3O5SA 3R4DB 4D94A 3HAGA 3UKTA 3RWKX 4CCLA 3PUQA 3QBQA 1CZVA 4GB32 4Q4W1 3WF0A 2DBNA 4CP1A 1UY0A 1QJX1 2E31A 1WUVA 5CB7A 4D6SA 1NCQA 1LHNA 4F3JA 1OUSA 4PIZA 4DFSA 3I3EA 1IKPA 2WC2A 3LA7A 4DB5A 5E8AA 3U78A 1QH7A 5H9PA 1SBDA 2R6QA 5A3TA 3VHOA 1WMFA 1ZBA1 2HWE1 5FLIA 1RUI3 4QDRA 3AP4A 4KGQA 2A71A 3ZYGA 1FV2A 1DIWA 1WW5A 2GNBA 1YI7A 2RS11 5FY9A 1BKZA 4LOTA 3C7FA 4BK4A 1OLRA 2J1TA 4EROA 5KXDA 3H0OA 4ORFA 2WWJA 2Q1FA 3E97A 1HB2A 2ID4A 1DU3D 4UBHA 3VBHC 4KU7A 4AFDA 4C0HA 5FZLA 1E5IA 2OPWA 3SCFA 1W8ZA 3OPZA 3S57A 2YU1A 2VVFA 5CFCA 1Q5OA 4XFCA 3W20A 4YVWB 4D6RA 2RS53 2DCZA 5L9BA 3O1VA 3AL6A 2VR4A 5JSPA 2X09A 4UFMA 4B8EA 3BTAA 2Z79A 5GLZA 1NCRA 3RFRA 3DF0A 3RPQA 3CIHA 4FVVA 1UMHA 3FUQA 1VMJA 4KBZA 5FKCA 1W6NA 4OHXA 3NMBA 2W47A 3A4UA 3MFAA 1MS3A 4WVMB 1VBD3 4RQPB 1JU4A 2GSYA 2BGOA 2BWAA 5C3SA 3PHMA 3BODA 1O91A 3POGA 3VBFA 1RMU3 1REDA 4WM8C 4QKDA 1HJGA 2VOXA 3ACGA 1IPKA 5FP7A 2BYVE 1UQXA 2BBAA 4LQRA 5LA9A 3GGLA 1F9KA 1CAWB 3M3CA 1AYM2 1OH4A 4IV1B 1VRBA 2A6ZA 3J4UH 5CKQA 5T55A 5ACA1 4AVSA 4AEDA 4YGDA 3CZUA 4XJZA 4QPIB 3AXEA 4Y26A 3WG3A 5SV8A 3W5NA 1SLLA 2A6WA 4TSVA 2UYAA 3HQRA 4LBQB 3EB7A 5JR7B 3T0AA 4QB6A 1GSLA 2J1AA 3SXWA 2X53S 3QH6A 3VBOA 5DG1A 3IPVA 2JE9A 1XNCA 5GZCA 3VBRA 3VHRA 2DVAA 4XFIA 4RYDA 1MQTB 1W9WA 4K21A 1IZ3A 2QNKA 2ZEZA 1DYKA 4ISRA 4QQOA 2JEMA 4F83A 1OF3A 1OT5A 4B1MA 5B4NA 4JQRA 2ZS6B 1E5RA 2ZGMA 3JUUA 1VJ2A 4JHZA 5A3OA 3USSA 1EPZA 4N90A 1XE7A 2JKBA 4AFCA 4HN1A 4ATFA 3HQXA 4NMIA 4AQ6A 1BVVA 3POWA 5FP4A 4XF0A 1UX7A 1QOTA 1K5MB 1R1A1 5JI7A 2JDMA 2JDYA 1AX2A 5CFCC 2VOVA 1XC6A 2DFBA 2JB4A 3EBRA 4FPCA 2FZ2A 4HKLA 4OHVA 2J22A 2Y26A 3AZWA 4X6RB 5CYYA 3BU0A 5FZ8A 1OUXA 2WS93 3DYMA 5HPOA 1X82A 1GWLA 1IG3A 3N7KA 5EYYA 1O4YA 4IE6A 4BQ3A 2VCAA 3VLBB 1QKQA 2VPVA 4P9JA 4QHOA 5C9AB 5JDBA 1ZA7A 2UWAA 2WFF3 1C8M1 2D97A 4WZCA 3SH3A 5JOXA 2VGDA 3ZPOA 2XLFA 3H8UA 3VBFC 2FHRA 5FYUA 2WT2A 1B35B 3QH7A 4Z2WA 4Z8BA 1BMV1 2QQLA 4DO0A 3O1RA 5HCHA 3ZFEA 5EPAA 3SKJE 3UV9A 1W04A 1JZ4A 3M2MA 2PHUA 1AR83 1EAH2 1R083 2BU9A 2DUQA 1ENXA 1S0GA 1JTZX 3SCHA 1WA6X 4HLTA 2AR6A 4DY3A 4GWIA 4F7ZA 3B3QE 3AMHA 3N36A 2OKXA 1EV13 5AVPA 1FNZA 1W90A 1UY1A 1RUD2 1PZ9A 4LTAA 4TYSA 4Q1PA 5LCWL 4MGQA 4ASKA 4OI0A 4YW2A 2W91A 1G9DA 3VD7A 4GQ7A 2QUOA 3AP9A 3C2UA 4Q4V3 2AEYA 2XUEA 2W9XA 3WG2A 1F5FA 1LOAA 2BUKA 1X50A 2K46A 2E32A 4MUVA 1DYOA 2VW1A 1ND2B 2BV4A 4S2GA 2PHLA 3QOPA 3AYEA 1ND3B 1VR3A 2XONA 3OD0A 1HW5A 2CDOA 2R7EB 3T1MA 5FYYA 2H0VA 4IE4A 4CEWA 4CP9B 5DN2A 1GNYA 4XEZA 5FQ0B 1YIFA 3WHTA 1KDKA 4FXKB 5AC91 5C8CB 5FR3A 1SACA 3ZXDA 3O0XA 5FPLA 5A80A 1Z7S1 3LQCA 5E1RA 4ASLA 1UY3A 3H3ZA 1JXNA 4N9IA 3MYXA 1OD5A 4BIFA 2VBBA 3WQBA 1XU1A 1N3QA 1HQLA 1NLQA 5DG2A 1W99A
chains in the Genus database with same CATH topology
3RZGA 4CXXA 3T4VA 4IDZA 5F8PA 4NIHA 3I3MA 3I3QA 3RZHA 4O61A 3O1UA 4JHTA 4QKBA 4MG2A 3BTXA 3S5AA 2FDFA 4NRMA 4O7XA 3RZJA 3O1MA 3H8RA 4QKFA 3BTYA 4ZS3A 3O1PA 5DABA 2FDGA 4IE5A 3BUCA 3BI3A 4NRPA 4NPMA 3O1TA 3BU0A 4NIIA 4QKNA 3RZMA 3T4HB 4IE6A 4CXYA 4QHOA 3H8OA 2FDKA 4NIGA 4ZS2A 3I2OA 3KHBA 3O1RA 3O1SA 3I49A 4IE7A 4RFRB 4NPLA 4IE0A 2IUWA 3BIEA 3LFMA 4NIDA 3O1OA 3H8XA 2FDIA 3S57A 3RZLA 4NRQA 3O1VA 3RZKA 3KHCA 4CXWA 4IE4A 3T3YA 4NJ4A 4OCTA 4MGTA 3BTZA 2FDHA 4NROA 4ZHNA 3BKZA 4QKDA 2FDJA 2FD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZG A;  4CXX A;  3T4V A;  4IDZ A;  5F8P A;  4NIH A;  3I3M A;  3I3Q A;  3RZH A;  4O61 A;  3O1U A;  4JHT A;  4QKB A;  4MG2 A;  3BTX A;  3S5A A;  2FDF A;  4NRM A;  4O7X A;  3RZJ A;  3O1M A;  3H8R A;  4QKF A;  3BTY A;  4ZS3 A;  3O1P A;  5DAB A;  2FDG A;  4IE5 A;  3BUC A;  3BI3 A;  4NRP A;  4NPM A;  3O1T A;  3BU0 A;  4NII A;  4QKN A;  3RZM A;  3T4H B;  4IE6 A;  4CXY A;  4QHO A;  3H8O A;  2FDK A;  4NIG A;  4ZS2 A;  3I2O A;  3KHB A;  3O1R A;  3O1S A;  3I49 A;  4IE7 A;  4RFR B;  4NPL A;  4IE0 A;  2IUW A;  3BIE A;  3LFM A;  4NID A;  3O1O A;  3H8X A;  2FDI A;  3S57 A;  3RZL A;  4NRQ A;  3O1V A;  3RZK A;  3KHC A;  4CXW A;  4IE4 A;  3T3Y A;  4NJ4 A;  4OCT A;  4MGT A;  3BTZ A;  2FDH A;  4NRO A;  4ZHN A;  3BKZ A;  4QKD A;  2FDJ A;  2FD8 A; 
#chains in the Genus database with same CATH topology
 4PCR A;  4QD2 A;  2WZ8 A;  1LOB A;  4LNV A;  4YVW A;  3ACH A;  5DDJ 1;  4BLI A;  5J48 A;  4HKO A;  1W2T A;  3EQE A;  1AJK A;  2JG8 C;  4D69 A;  1NOV A;  2O8O A;  4NHY A;  4W50 A;  5C4W B;  5L7O A;  3I3Q A;  2AEZ A;  2HH9 A;  1OVS A;  3DCQ A;  3UJO A;  1CZT A;  1CGP A;  3POS A;  1GP4 A;  4LBQ D;  3ZFE C;  2NLR A;  1BEV 3;  4WV8 A;  1H0B A;  1J58 A;  3S7E A;  3C7O A;  4PIY A;  2DWR A;  3OG2 A;  4P9X A;  1ZA4 A;  5CKN A;  2BQP A;  4WVM A;  4MGS A;  1N1S A;  3GHN A;  1X33 A;  4RQP A;  5K0U A;  4L2N A;  4LA3 A;  1TME 3;  5FZE A;  1KRI A;  5ABJ B;  5E89 A;  3SIS A;  2R07 1;  4NOT A;  2WZR 2;  1LJ7 A;  1ULG A;  4JDO A;  1R09 1;  2X29 A;  2W08 A;  4CCM A;  2D93 A;  4BQ2 A;  2ZGS A;  4QXC A;  1H4G A;  2GMM A;  4IV1 A;  1BYH A;  4XW3 A;  5FRA A;  3VD4 A;  2CAV A;  1O3Q A;  5F3E A;  5GLW A;  2P34 A;  2FZ1 A;  4QPI A;  4XZP A;  4GMP 0;  1NLS A;  3TWI A;  4F8A A;  4CCD A;  2PQS A;  5GLT A;  2EA7 A;  4Q4X 1;  4Q0S A;  4Q0Q A;  4ZON A;  5FAX A;  2Z69 A;  5FUI A;  3LIG A;  3EXU A;  4NII A;  1LOC A;  3ILR A;  4Y1U A;  3P5B A;  1JYT A;  1NZC A;  4DUW A;  2RV9 A;  1DDL A;  2P2K A;  1RC6 A;  3P6B A;  1FAT A;  1L3J A;  4XBN A;  3HNB M;  1FNY A;  1OKO A;  3OUJ A;  1NE6 A;  2R04 3;  1DCS A;  2ZTN A;  4HPK B;  2OQ7 A;  3I54 A;  2ORX A;  4CDQ B;  1JZ5 A;  5HBA A;  3CDZ B;  5FOB B;  4RHV 2;  2ZHL A;  1CIY A;  2ZX3 A;  5FYB A;  4AI8 A;  1K5M A;  3TEW A;  2YFZ A;  2A6X A;  4YVW C;  2AEN A;  3DYP A;  3LCP A;  4M3C E;  1PVC 2;  2JB8 A;  1LB2 A;  4EJR A;  1WLC A;  2ZCW A;  5FP8 A;  3ZFF B;  1D4V B;  5FYI A;  1YXW A;  2P3J A;  1LTE A;  4OMD A;  3I3B A;  3NV1 A;  1PO1 1;  1UYX A;  2TBV A;  2WII B;  1H2N A;  2FCU A;  2VXR A;  3BIE A;  5C9A A;  4DQA A;  1N3P A;  1NY7 1;  3WP3 A;  1AXY A;  3HN1 A;  1SBE A;  4NUB A;  5FFO C;  1UIJ A;  2PLV 1;  3UKN A;  4CU8 A;  5JR2 A;  3H8X A;  4AVV A;  2ZX0 A;  1B35 A;  1ULC A;  4HVQ A;  2JEC A;  2GC0 A;  1C57 A;  3P3N A;  3VKF C;  5KXB A;  2BFU S;  2XKO A;  2JG9 B;  1W03 A;  1C28 A;  3B01 A;  1XE8 A;  2R30 A;  4IV1 C;  4RGG A;  4YZ1 A;  2ET1 A;  2JE7 A;  4NPR A;  1UU4 A;  3ECQ A;  3SIT A;  5LB6 A;  4J1X A;  3OBZ A;  4QPI C;  4X8P A;  2HWD 1;  3AZX A;  4XF3 A;  4XMA A;  1RIT A;  2I74 A;  5FMO S;  2RJ2 A;  3NNG A;  2WIN B;  1KS4 A;  4D7S A;  1DQ6 A;  2VZR A;  1W28 A;  1J1T A;  1DP0 A;  2C0Z A;  2KA3 A;  4GMP 1;  3ACI A;  2XJR A;  1Z78 A;  1PIV 3;  4AFB A;  2QQM A;  2X5I A;  1W9T A;  2QQK A;  4Q4Y 2;  1MQT C;  2A70 A;  5A6Y A;  4FPL A;  5C7G A;  1DLC A;  1HLC A;  2X10 A;  3GBW A;  1OFS A;  3MIC A;  4AAX A;  2G9F A;  4LO8 A;  4S2H A;  1GR3 A;  2YGL A;  4IV3 B;  5DAQ A;  2I45 A;  5FPZ A;  2RR1 3;  2ENR A;  1FAY A;  4P9L A;  1ND2 A;  2WZP P;  3ZPY A;  1ND3 A;  2FCV A;  4ZZ8 A;  1OPO A;  2QQN A;  2HLE A;  3AYD A;  2ZJC A;  1CPN A;  3FL7 A;  3ZIX A;  2H6B A;  4K9S A;  3ZSE A;  1GQG A;  4CP9 A;  2DBI A;  1K5M C;  2C4X A;  1HRI 2;  3L2Y A;  4XHX A;  4FQZ A;  1REF A;  5C8C A;  5KR7 A;  3IMN A;  4ISQ A;  3VBS C;  1XNK A;  5FYH A;  3S5Q A;  4EZ4 A;  3HD8 B;  4JGZ B;  5IVV A;  3WNM A;  2IFW A;  2PQQ A;  5FMD A;  3ZYF A;  1SEF A;  1E57 A;  2ADE A;  2VVD A;  5CFD B;  4NIA A;  3LEK A;  2SLI A;  1K5J A;  4Y5Z 0;  3Q8E A;  5C9A C;  1JUH A;  1UY2 A;  3J7M A;  3GZU C;  4WVZ A;  1ZBE 3;  1LOE A;  4MLO A;  1W6P B;  4PBO A;  2XBO 1;  4HXC A;  2Y38 A;  4JRA A;  5C4W A;  4XDQ A;  3IDE A;  3WR0 A;  4FQ4 A;  1B35 C;  1CJD A;  5H9S A;  4I30 A;  1SFP A;  4OUM A;  2OPK A;  3NV4 A;  1SFN A;  1VRH 2;  2ZKN A;  1JOP A;  4ZKT B;  5D1I A;  1AR9 1;  2YPJ A;  3OGG A;  3RYK A;  4JKL A;  1XSR A;  1MEC 2;  2DTY A;  4PLO A;  1JW6 A;  4M0H A;  5FXZ A;  1UYZ A;  2VBP A;  1JOD A;  1YO8 A;  2DYC A;  5ABJ A;  1NYW A;  2CAU A;  3BOW A;  3I2H A;  2NP0 A;  1LHO A;  2TUN A;  1HV1 A;  4ZS2 A;  3P1I A;  4QX0 A;  1RUG 1;  3TN9 1;  4KQ7 A;  1I5Z A;  3MBW A;  4BA6 A;  2XL7 A;  4Z92 B;  4N8M A;  3AP7 A;  1H8V A;  3ZYR A;  4E4Z A;  4KI5 M;  1FMD 1;  4XTM A;  4HBN A;  4COY A;  5I8T A;  4YW3 A;  2RDN A;  5IVJ A;  2ZXQ A;  4YWA A;  1ND2 C;  5APA A;  4I0B A;  4B3N A;  5EIY B;  5J3U A;  4GH4 A;  2AAC A;  4UFK A;  3UES A;  1DQ2 A;  5D8A B;  4N7I A;  1UU6 A;  1YQ6 A;  3V56 A;  3D82 A;  2BW8 A;  4ZPI A;  1CAV B;  3QLQ A;  4PIX A;  3JD7 2;  2XDV A;  4CE8 A;  2PHW A;  2WNV B;  4NID A;  2EIE A;  2NMN A;  5BNP B;  4HPK A;  1BK1 A;  4MHU A;  3EO6 A;  4MXV A;  5FZO A;  2RM2 1;  1OOP B;  1UYP A;  2VZQ A;  1JU3 A;  1ZM1 A;  1QJU 3;  1IHM A;  2ARB A;  2C6S A;  1N47 A;  3WD5 A;  5BV6 A;  5L36 A;  5C8W A;  3KV4 A;  2FQP A;  3M70 A;  4FCA A;  1SDD B;  2E6V A;  4R9A A;  1OMI A;  5C4W C;  1OSG A;  4OVE A;  3ZFF A;  2Z4F A;  2GP5 A;  4AI2 A;  1OXC A;  2D5F A;  4KU8 A;  3AZV A;  4UW5 A;  5FP3 A;  1VBA 3;  1SFY A;  2O8Q A;  3GCX A;  4LO5 B;  4COU A;  2ZPX A;  4PT6 A;  4CUG A;  2JXA A;  4I0W B;  4XHB A;  1XNT A;  2EID A;  4PI2 A;  1XU2 A;  1URX A;  2JDU A;  5ABJ C;  4M01 A;  4OFG A;  2J1V A;  3FLP A;  4YZ4 A;  3AFG A;  1W6Q B;  5FZ0 A;  1ULE A;  5KHJ A;  2PHD A;  2RJL A;  3K51 A;  4R9D A;  1YYN A;  5FMB A;  3MLL A;  4YLZ A;  3J8F 1;  2JG9 A;  4CDW A;  2QQU A;  3BPS A;  2PN5 A;  2W68 A;  1CIW A;  2VME A;  2TEP A;  4BHP A;  4RFT 0;  2IXC A;  4QU1 A;  5K7P A;  4LLF A;  1QOO A;  1FXZ A;  1POV 1;  3IT8 A;  2XLG A;  4PHZ A;  4FAH A;  1POQ A;  3ORJ A;  3DPR A;  1BZW A;  1FT9 A;  2XG3 A;  3POF A;  4OUS A;  4AFM A;  1ST8 A;  4LT5 A;  1OC1 A;  1JZ8 A;  1ZX5 A;  1S2E A;  3Q8B A;  5T5L A;  5BNO C;  5FLJ A;  1JZ2 A;  1EP0 A;  2ZX4 A;  4P5Y A;  1PM4 A;  5I0R A;  4EE2 A;  3TNQ A;  2Y0O A;  1S0D A;  1YCI A;  3INA A;  3JBG 2;  5DAB A;  4IV3 A;  4LBN A;  3VZJ A;  2FDG A;  2RS5 2;  3OOX A;  4D6Q A;  4XQW A;  3WZ1 A;  4CDQ C;  1PX3 A;  4UT5 A;  1LEN A;  4MGI E;  3MIF A;  5JXH A;  3FN9 A;  3N9P A;  3L2H A;  1JN2 P;  2ZOE B;  4XF1 A;  5LBC A;  1LHW A;  2RE9 A;  3LSE A;  2ATF A;  1J3Q A;  4YSF A;  3HIF A;  1F2N A;  1H2M A;  1VBD 2;  4D7Y A;  3IAP A;  1ZRR A;  1RVF 3;  2CL2 A;  4Q5O A;  4WM8 B;  3ES4 A;  3ZFF C;  4JGZ A;  2O1Q A;  3KF5 A;  3ZXF A;  2EXH A;  3RI9 A;  3MPP G;  1RMU 2;  4COV A;  1LUL A;  2LRP A;  1FI2 A;  1J3R A;  4FSJ A;  5FZ3 A;  1RUJ 3;  1MS9 A;  3MUY 1;  3GAL A;  1LCL A;  4PF5 A;  3VV1 A;  4JX0 A;  3WG1 A;  2LAL A;  4E4S A;  1DZR A;  1COV 1;  1R64 A;  5FLH A;  4KNC A;  1W6P A;  2WNU C;  5J09 A;  2V4V A;  2XJU A;  4DZG A;  1WCS A;  2WAA A;  3RYP A;  1XXN A;  4EN8 B;  1CWP A;  3KB5 A;  1VIW B;  4XAC A;  2MEV 1;  2MPF A;  4L92 A;  3R4S A;  3IIA A;  3WF4 A;  3VZL A;  5IFP A;  4XBL A;  4YGE A;  2YPD A;  4YG6 A;  5IVC A;  1NXM A;  2C1F A;  2EIG A;  5KXC A;  1CAU A;  4IEX A;  4LJH A;  3VKL A;  3UGG A;  4WBB A;  2NPI A;  3FMG A;  3K4D A;  3UT0 A;  3KV5 A;  4O65 A;  1UYY A;  1RUE 2;  3ZN6 B;  3LFM A;  3N7J A;  4AWD A;  2OII A;  4TXW A;  1WCD J;  5HCF A;  5A7P A;  3N7M A;  3ZYP A;  2O14 A;  2P37 A;  2HWF 1;  1O7F A;  3MLJ A;  1I1E A;  4DEV A;  4HFS A;  3IWZ A;  3V65 A;  2KD7 A;  1PGS A;  3OEA A;  3KS7 A;  2BJS A;  2XWB B;  2PHT A;  5FZ6 A;  2PFW A;  1NA1 A;  3ZSL A;  1JMU B;  5FTT C;  1UPS A;  1AVB A;  1Q8Q A;  4YM3 A;  1DFQ A;  1XE0 A;  2DVG A;  2G4I A;  1UY4 A;  1OD3 A;  3D6E A;  1ASJ 3;  4RSU A;  4AVA A;  4LBK A;  5BUV A;  1MZF A;  3MIH A;  1JZ6 A;  2JKX A;  3DV8 A;  5D8A A;  3M4F A;  3SKV A;  4CU7 A;  4QM9 A;  2IXK A;  3OBA A;  3WUD A;  1UOB A;  2OS2 A;  3H7J A;  3AC0 A;  4KGG A;  3ZFG B;  4B1L A;  2EXJ A;  5JZG A;  4OI1 A;  3GXU A;  2VM9 A;  2WFF 2;  2WNV A;  4FFI A;  4AGR A;  1H6X A;  1H9P A;  2FDJ A;  2K2S A;  3A0N A;  4YZ5 A;  1V6O A;  4JGZ C;  5BNP A;  1X9P A;  3USU B;  4BWO A;  2RS3 1;  1HRI 1;  1NQD A;  1U5I A;  2ZGO A;  5CFD C;  5F9T A;  3FHQ A;  3MHZ A;  1OOP A;  1V70 A;  4MOA A;  5FBJ A;  2AGS A;  1EY2 A;  1F4A A;  1O4Z A;  3B93 A;  2YGM A;  1AR8 2;  5FK7 A;  1R08 2;  3POB A;  5LAS A;  1SMV A;  3HBK A;  3LF7 A;  4URT A;  4A6S A;  1IPJ A;  3DL3 A;  3EJK A;  3WQ0 A;  1KD7 A;  2PAM A;  3WCS A;  3AVR A;  5JUV A;  2A1X A;  1D4M 1;  2ZEX A;  2WDB A;  1RUC 1;  2HWC 3;  1EV1 2;  2ARC A;  4LK7 A;  1WD3 A;  3VDD B;  3III A;  4COW A;  4Z2A A;  5CG8 A;  1TNR A;  4AHZ A;  5C33 A;  1ODN A;  1J1L A;  2UU8 A;  2A73 B;  3CQO A;  4KWL A;  4AVT A;  4D3W A;  1U5Y A;  1VBE 1;  1PMJ X;  2EAK A;  1VRH 1;  1W3X A;  1ZZ7 A;  1V9U 2;  4Q4V 2;  2C9A A;  1W6Q A;  1GBG A;  3Q8C A;  2VEC A;  5FZ7 A;  2AH2 A;  5LY2 A;  3BUC A;  2R32 A;  2VNO A;  3D5O A;  4LHN A;  4NPM A;  2JJ6 A;  4Q27 A;  5FY4 A;  3FZ3 A;  3O1T A;  1ULD A;  1AX0 A;  1QHD A;  3SEE A;  4AW7 A;  2VUJ A;  3J7L A;  2OZ6 A;  1DZT A;  1XYO A;  1MS4 A;  2ZMN A;  3O12 A;  4XFG A;  2FCT A;  1JZ3 A;  1QNW A;  2XVG A;  2AYH A;  2VZS A;  1OQD A;  3EYP A;  3E5U A;  4IES A;  4MZU A;  4H3W A;  1O3T A;  1TZO A;  2BZD A;  1PZ8 A;  5B2G B;  2GN7 A;  5BNN C;  2YFU A;  4K20 A;  3JD7 3;  4NHM A;  5ISL A;  1AYN 1;  5CNA A;  2VG9 A;  4OUE A;  4BME A;  4LE4 A;  4V2W A;  2Y6F A;  4UFL A;  3MUZ 1;  3FWE A;  2WNV C;  1HRV 1;  1QIQ A;  4O9E A;  4QM8 A;  5FBZ A;  2J1U A;  4ATE A;  3ELN A;  3HJR A;  3IBM A;  5FK8 A;  4XFF A;  5BNP C;  1MAC A;  1QJZ A;  4EN6 B;  2QTW B;  3VBU B;  4YFW A;  3PDQ A;  2OT7 A;  1OOP C;  1SCS A;  3W59 A;  3N9M A;  1UZZ A;  4I3G A;  5KC6 A;  5F2W A;  3LDB A;  3PU8 A;  4FPG A;  5C3O A;  1DQ1 A;  4XFB A;  3A23 A;  3N9O A;  4LIV A;  5E88 A;  2Y6L A;  4QX2 A;  2KXL A;  2UWB A;  2WO1 A;  4NPL A;  4RR3 B;  4QMA A;  5BNQ A;  5IK7 A;  1IKQ A;  3OYW A;  4WM8 A;  1TME 2;  2IUW A;  3PVE A;  4UWD A;  4G4F A;  2LRO A;  5EJ3 A;  1W0O A;  3U37 A;  1AR7 1;  2Y60 A;  4NHX A;  1VLN A;  1EUT A;  1GP5 A;  1WW6 A;  2Y34 A;  5EYX A;  4AEM A;  5J7M A;  5HXM A;  2VY0 A;  3OCP A;  2V73 A;  4XUQ A;  5DAV A;  4CUC A;  2PXJ A;  3LB9 A;  5A3U A;  3KHC A;  1QJX 3;  1AR6 1;  2VE1 A;  1TNF A;  2JIG A;  1GNH A;  3HVD A;  2YMZ A;  5FZG A;  4P9I A;  3PMS A;  1X36 A;  2C5D A;  4LHL A;  4AXO A;  5CAZ A;  1S0F A;  1S4C A;  4EN7 B;  2VMC A;  3N3H A;  1OUR A;  2ZGK A;  3CMG A;  1F5J A;  4EN9 B;  4IL7 A;  4FTB A;  1LGB A;  4S2F A;  2D98 A;  2YRO A;  4QXB A;  3J7N A;  2HEW F;  1HXS 1;  3ZN6 A;  1ZBA 3;  4NRO A;  4ZHN A;  2PMW B;  1VAM A;  4TZD A;  3DXT A;  2R04 2;  1SLA A;  4Q0U A;  1RUI 1;  4R9B A;  5CKM A;  5IT6 A;  5GKA C;  2B8M A;  1GNZ A;  1SCR A;  2RS1 3;  4WZF A;  5CU1 A;  1VBB 1;  3APB A;  2ZHK A;  3JBG 3;  5JIA A;  4P00 B;  3ES1 A;  1YIP A;  3GJA A;  3SLI A;  4A2U A;  1DHK B;  5LRS A;  1W05 A;  3F2Z A;  1UU5 A;  2W94 A;  4Q1R A;  4YRD A;  4MVT A;  3LEG A;  1RJ8 A;  1RIN A;  2BTV C;  4CEY B;  1W8O A;  2OXB A;  3KQR A;  3IAQ A;  5L73 A;  2PHF A;  1G9F A;  1BLZ A;  2VMG A;  3URF A;  1YUD A;  2D6M A;  5IVF A;  3J9S A;  2HWB 1;  4AEJ A;  3ZFG A;  2RS5 1;  4GD4 A;  4IEU A;  4P9W A;  4DRV A;  3LD8 A;  1S0E A;  5FYT A;  4A44 A;  3U14 A;  4YM0 A;  1H30 A;  3IMM A;  1IQD C;  3WW2 A;  3USU A;  4GA9 A;  1OH3 A;  1AL2 1;  1ALY A;  4N7U A;  3KT4 A;  1NZI A;  4XJ8 A;  4MXW B;  1MVQ A;  3A22 A;  2R16 A;  5DZG A;  3TEZ A;  4YAR A;  5JOZ A;  5BPX A;  1W8W A;  4JQT A;  4L99 A;  1IPS A;  2P3Y A;  5FXW A;  4CA9 A;  4XTP A;  1WLD A;  1Q3E A;  3ABZ A;  4PLM A;  2XVK A;  5A70 A;  1JBC A;  1G8W A;  1Y4W A;  2UYB A;  4LA2 A;  5FZM A;  2OYZ A;  2CDP A;  1C5H A;  2B4K A;  1UWW A;  2KR2 A;  3RJ2 X;  1BBT 1;  2IZW A;  2P6H A;  3T4H B;  3VDD A;  4TN7 A;  2JDH A;  4CCN A;  4CXY A;  3ALQ A;  3RGB A;  1GWM A;  4UW3 A;  3A0K A;  3M3Q A;  1PIV 2;  1RUE 3;  5FYV A;  3U10 A;  3WX5 A;  2FDK A;  3I2D A;  4NIG A;  1MS1 A;  5JPN B;  4AHY A;  4LKF A;  5A6Z A;  1W8U A;  4YM1 A;  3IB3 A;  3D0S A;  1H1A A;  1GV9 A;  1OHF A;  1DYP A;  4O9G A;  1IQA A;  3DYO A;  1PO2 1;  2WLP A;  2RR1 2;  2P17 A;  1OKQ A;  3UGF A;  4I2O A;  3MGU A;  4NVP A;  4AQT A;  1GU3 A;  4XF4 A;  3J26 N;  4S2D A;  3SCG A;  1JYV A;  1SLI A;  5HXV A;  3T09 A;  3VBS B;  3WF3 A;  3ZVX A;  4GAL A;  4WVW A;  4GUL A;  4KBB A;  1DQ5 A;  4XIO A;  3VD3 A;  4LHK A;  3ETP A;  2D3R A;  3TBD A;  1RUF 1;  4IE0 A;  1R1A 3;  1ULF A;  3MI8 A;  1O5L A;  5FUP A;  1SQ4 A;  2D7F A;  3E5X A;  5T5P A;  4A7Z A;  5A3L A;  1NG0 A;  3KCY A;  4PLN A;  4CDX B;  1GQP A;  3ZFG C;  1N1V A;  1OQE A;  4FFH A;  5CEH A;  4Z1V A;  2BVB A;  2RMU 1;  2ZX2 A;  2JG8 A;  4RGA A;  5J98 B;  1ZBE 2;  2WS9 1;  1W2U A;  4BXS V;  1LKN A;  3BVC A;  1US3 A;  2ZA9 A;  2VQA A;  1GYK A;  3BN6 A;  4C91 A;  5JSR A;  3WV6 A;  2W92 A;  1S0J A;  1RHI 1;  1C8M 3;  2VBD A;  5IAX A;  2WQ4 A;  1VBC 1;  2JDP A;  2QKD A;  1RIR A;  3OBT A;  1DGW A;  5F1R A;  2Y6H A;  4RA0 A;  5E6H A;  4XXP A;  2VMI A;  2XHN A;  1C3H A;  3ZXE A;  4AHW A;  3NAP B;  4BJ0 A;  4E4D X;  1B09 A;  2VZT A;  5LK7 B;  1RUH 1;  1HDK A;  2R06 1;  3OGR A;  1W9Y A;  5F2S A;  4CSW A;  5LBF A;  3VDD C;  4Q0V A;  3KV6 A;  4QT6 A;  3WUC A;  4DXT A;  1V9U 3;  2D43 A;  5FZ9 A;  1PGW 2;  3FBY A;  1QQP 2;  3AKP A;  3ZYH A;  5HI0 A;  2P6C A;  2EXK A;  3V0A B;  4H7L A;  2XH6 A;  2ZGT A;  4QQH A;  2YYO A;  5A7W B;  4BPZ A;  1PVX A;  3HMY A;  1AXZ A;  5IW0 A;  4DIN B;  5FV3 A;  1F8V A;  3E6B A;  3RRD A;  3FFQ A;  4Y1Y A;  3V0B B;  1CVN A;  2GAU A;  1WZX A;  3NNM A;  2QZ3 A;  4AF9 A;  3DXU A;  4QPY A;  4LK6 A;  1LGC A;  2WQ8 A;  3PVB B;  4XJU A;  2VUC A;  3L9J T;  4GJZ A;  5FPA A;  4OHZ A;  5AC9 3;  3VL8 A;  1RB8 G;  1ZRF A;  2ZX1 A;  1PGL 2;  2GN3 A;  5T3N A;  2K9Z A;  3H42 B;  5FO9 B;  2NQY A;  3JXS A;  2D6P A;  1Z7S 3;  1AJO A;  3VHP A;  2XJQ A;  1W0N A;  1QJU 2;  1TMF 1;  1YC6 1;  2WZE A;  2ZEW A;  1OLM A;  5F5I A;  3WQ1 A;  4NAM A;  1SBF A;  3H1Y A;  3T0D A;  3POY A;  3MIE A;  4CEY A;  5F3C A;  3GHM A;  2YZ4 A;  4LLO A;  3VBU C;  3NJV A;  3RI8 A;  3LAG A;  1FPN 3;  1V6K A;  1XYP A;  2QFE A;  5EJ1 B;  1K45 A;  4QKN A;  1VBA 2;  1OLQ A;  2HBU A;  4V1P A;  3UJQ A;  2VMH A;  5GZD A;  4CCO A;  2Q0A A;  1JYN A;  3RG0 A;  5IJR A;  4XIK A;  4XAE A;  5IHR A;  4OQ8 A;  4CCC A;  4AEK A;  4RR3 C;  5F5C A;  2RVA A;  1SLB A;  5LA1 A;  3ZYI B;  1WWY A;  3AZY A;  1G9B A;  4QX7 A;  1SG3 A;  4AAP A;  3I2I A;  4XQ4 A;  4DRR A;  1BEV 1;  4AQS A;  2Y8K A;  3F95 A;  1BVP 1;  2R1B A;  1CAW A;  3I2F A;  1RGS A;  4W6X A;  4YW1 A;  1GZT A;  3N9L A;  4J25 A;  4MXW A;  5F32 A;  2R07 3;  4Y5S A;  3O1S A;  4BZ4 A;  3B69 A;  4A7Y A;  3MFC A;  5JVV A;  1R09 3;  3H50 A;  3ZYB A;  2YG0 A;  1MZ5 A;  4GB3 1;  2ZGQ A;  4LBQ A;  1M4W A;  3WF1 A;  1YQC A;  4IE7 A;  2WAO A;  2WNE A;  3P3P A;  1QDC A;  5JLV A;  4RFR B;  5BNO B;  1C1F A;  1QXR A;  1E5H A;  1MQT A;  3OGV A;  1Y7B A;  2D3P A;  5IK4 A;  4Q4X 3;  2CWS A;  4UXA A;  1ENR A;  1S1A A;  1Q8V A;  4L97 A;  3NKG A;  1TG7 A;  1W39 A;  1PM7 A;  2WT0 A;  3MW3 A;  2NYY A;  1U5Z A;  1MPX A;  3ME2 A;  5F6K A;  3ZSM A;  5C5U A;  1WBL A;  2Q30 A;  3LZZ A;  4PQQ A;  3CJX A;  1CZS A;  3ZYJ B;  4A3X A;  3LA3 A;  3NNJ A;  2ZEY A;  2IVJ A;  3POI A;  3RZK A;  1H8T B;  2HJI A;  4MAD A;  4CXW A;  3VDC A;  4YM2 A;  3H9A A;  3LE0 A;  1XRU A;  2XHK A;  3VBS A;  3PUR A;  2R0F A;  2ZAB A;  1KEX A;  3I7D A;  2Q1Z B;  1OBN A;  4Q26 A;  4CEY C;  3UGH A;  1V00 A;  1GZC A;  1AUY A;  1RVF 2;  4DMI A;  1O8S A;  1GFF 2;  3QD6 A;  4XJ9 A;  1PMI A;  3VKN A;  2FDH A;  3AM2 A;  4DOU A;  1ONA A;  4AFA A;  1W8H A;  1VPH A;  4PBP A;  1MZ6 A;  2GP3 A;  2WNU B;  1RUJ 2;  4H7M A;  1VAK A;  4LO4 B;  3WQ7 A;  1RUN A;  4GJY A;  2I2S A;  4BYY A;  3ZDV A;  4MH0 E;  3R05 A;  1HB3 A;  3T4V A;  5J1X A;  4BQW A;  2FMD A;  5B4X A;  4IEP A;  1V6L A;  2PLV 3;  5T5J A;  1G7Y A;  1LRH A;  1IOA A;  3SQO A;  2OW4 A;  3WXP A;  3IDA A;  4A42 A;  3O1U A;  4QKB A;  3I4I A;  4Z82 A;  3ZDS A;  4XAA A;  1AYM 1;  1KFX L;  2F4L A;  2YDE A;  5JSO A;  4XJW A;  4ITC A;  3C8X A;  3O1M A;  4DNY A;  1AX1 A;  4E8C A;  2HWD 3;  2B7Y A;  2ORZ A;  5LEJ A;  3O1P A;  5CVR A;  5I8Y A;  1HV0 A;  4GMP 3;  2WT1 A;  5C5T A;  5FZD A;  4E9K A;  4AK3 A;  3KGZ A;  3ZR5 A;  2LW8 A;  3T2Q A;  5A7W A;  4JTO A;  2BVV A;  5GZG A;  1CR7 A;  4Y5T A;  1ASJ 2;  2CTV A;  2XL9 A;  4XAB A;  5FQ0 A;  3WP4 A;  1OA3 A;  3IKW A;  1Q56 A;  1HX6 A;  4RL7 A;  4AI0 A;  3V0B A;  2B9U A;  4BXF A;  2VMF A;  2E63 A;  2D3S A;  3BCW A;  2ZHM A;  4BDV B;  4QGL A;  3RS6 A;  2ZGR A;  5J96 B;  5LZ6 A;  1W6M B;  4GZ9 A;  4CDX C;  2VNG A;  1PHM A;  5FMC A;  1RJ7 A;  1W2N A;  1I9R A;  1SLT A;  2MHF A;  3ETQ A;  2DU0 A;  4HG6 B;  5K8S A;  5FZK A;  3OPT A;  3NL1 A;  3I2K A;  2YC0 A;  4IGO A;  3VKO A;  4YFZ A;  2HWC 2;  4XET A;  5DPN A;  4Y1Z A;  1H2K A;  1CON A;  1O8P A;  1QJF A;  1EAH 1;  3NAP C;  5A33 B;  1AR9 3;  1OA4 A;  1YFW A;  2VW2 A;  2C26 A;  3PNA A;  5EQU A;  3ATG A;  1JI6 A;  3MF9 A;  5FDB A;  1QQP 3;  3U07 A;  3TAY A;  2PHX A;  3PUH A;  1DGR A;  1RUD 1;  1YI9 A;  2P5B A;  3ZXA C;  3TN9 3;  2BOI A;  5LEK A;  1RUG 3;  2CNA A;  1HB4 A;  3M1H A;  2DFC A;  3OPW A;  2RDQ A;  3LIH A;  1ZZ9 A;  2W5F A;  1VMH A;  1JOJ A;  4IND A;  2BNM A;  4SBV A;  5FY7 A;  1QJY 2;  4OZO A;  1FMD 3;  3WVJ A;  5BNO A;  5BNN B;  4MGT A;  1WCQ A;  1WCK A;  2QBX A;  2WFP A;  4CPB D;  3T2T A;  3BTZ A;  1VMF A;  3NO8 A;  4LHS A;  3KMH A;  5KXE A;  3DEM A;  2VOW A;  2WO7 A;  3HT2 A;  3SH5 A;  2B46 X;  3K3O A;  3VGI A;  3GZE A;  1HQW A;  4BQ5 A;  5AFE A;  3LOB A;  1NE4 A;  4HT1 T;  4LUK A;  3AKT A;  4CDQ A;  5FY1 A;  1CD3 G;  3WW1 A;  4QGN A;  4JKM A;  3EHK A;  2OQ6 A;  3WLU A;  3CF6 E;  3S0M A;  3QAC A;  3I2G A;  4QWN A;  4E27 A;  1A34 A;  5CIS A;  1UKR A;  4LKD A;  4MGK E;  1H9W A;  4HON A;  2VD7 A;  2RM2 3;  4BK5 A;  4MG2 A;  3ZSJ A;  4XFH A;  3OGJ A;  4LUL A;  3OUI A;  2OX0 A;  3RYR A;  1FOD 2;  3PTY A;  4HN0 A;  2FDF A;  3KSC A;  3C3V A;  2GNT A;  4EWD A;  2CU5 A;  2DDU A;  2BBV A;  1U0A A;  4QKF A;  4I01 A;  3B94 A;  2WNU A;  2A7A A;  1KGY A;  2QQJ A;  1MS8 A;  5IUQ A;  4BU2 A;  4AG4 A;  4UYB A;  1ZZC A;  2UY9 A;  3AFK A;  5L19 A;  3SEP A;  4BMB A;  2LUW A;  5IWF A;  3WT3 A;  4Q4W 2;  4TLG A;  4HSJ A;  4ZXK A;  4G9S B;  4IUG A;  1EPW A;  1QJX 2;  5A3P A;  2DUO A;  2O0O A;  2WZR 1;  1LEM A;  2HEV F;  2NZ9 A;  3WG4 A;  2QQP A;  4IXL A;  3IDB B;  4KH9 A;  1JHN A;  1BQP A;  2LM3 A;  3LFI A;  2VZ1 A;  5IVY A;  3J8F 3;  5LK5 A;  3TRS B;  5L9V A;  4YW4 A;  3AX4 A;  3VD9 A;  3K2O A;  1ZBA 2;  2HWE 2;  4YZ2 A;  1HJF A;  2EIC A;  4FFG A;  4W65 A;  3TOJ A;  1DBN A;  1OLM E;  1I3H A;  1QDO A;  4LKS A;  1C1L A;  3VZO A;  1ZNP A;  1POV 3;  3GF6 A;  2B42 B;  1Y3T A;  2RS1 2;  3THP A;  3MEP A;  1JUI A;  2VVE A;  3FUO A;  2A6Y A;  3PJY A;  5SV5 A;  1NQJ A;  1OA2 A;  5FZH A;  5KBF A;  1VAV A;  1WGP A;  4AYU A;  4NN0 A;  2XGX A;  4Y33 A;  4OLL A;  1YLL A;  5FZC A;  4RD7 A;  2PHR A;  1SLC A;  3N4M A;  4XC9 A;  1H8T C;  3KVA A;  4X6Q B;  4RGK A;  4A45 A;  3AB0 A;  3FFZ A;  3E1F 1;  3B9C A;  2IXI A;  4NHL A;  4RHV 1;  2E7A A;  3GCW A;  1QJE A;  2VNV A;  4Y1X A;  1O4T A;  3ZXL A;  5LRR A;  5DQ0 A;  1OI6 A;  5FY5 A;  3O1O A;  5CFD A;  3DN7 A;  3FC0 A;  4B7K A;  3KF3 A;  1PVC 1;  4EV0 A;  1APN A;  1W6M A;  2XLA A;  4RS5 B;  5A1A A;  4ZY9 A;  4Q8L A;  5FY0 A;  1QEX A;  4EYU A;  3KV9 A;  2VUL A;  4Y3O A;  3E6D A;  2WUH A;  2D6O X;  4QB2 A;  2F4P A;  5JPM B;  2DV9 A;  1CX4 A;  1TEI A;  3BPZ A;  1COV 3;  4LIU A;  2ARE A;  4LMF A;  5JXG A;  1ZRC A;  5FZA A;  3ILF A;  2ES3 A;  2RJK A;  4XZU G;  3LEI A;  2XOM A;  3B5L B;  3G6J B;  1WME A;  4Y4R A;  2MEV 3;  3PU3 A;  5F3G A;  4M3C B;  4P5H A;  4FPF A;  3WNK A;  1AZD A;  1MS5 A;  2WWU A;  4PJY A;  4GKY A;  3VZN A;  1D7P M;  2XJV A;  1WMX A;  5DZE A;  1MZE A;  1DGL A;  1NCQ B;  5A33 A;  2VZ3 A;  4CZS A;  2FD8 A;  2YBS A;  3K77 A;  4UW6 A;  3PUI A;  2W1U A;  3FLT A;  1S0C A;  1WKY A;  2PYT A;  5L7O C;  4HOO A;  5I0T A;  5F5Q A;  3U75 A;  2WBK A;  3ACL A;  1CAX B;  4AOC A;  3WW4 A;  1IS4 A;  2W52 A;  3PTR B;  2EAL A;  1Q43 A;  5FWE A;  1MR5 A;  2HWF 3;  1X9T A;  4LKE A;  4Q4Y 1;  4UFH A;  1ZRD A;  1IS5 A;  3SH4 A;  4U36 A;  2JE8 A;  2WNO A;  3HR9 A;  1KIT A;  5BNN A;  4CP2 A;  1R1A 2;  4ZU7 A;  1RXF A;  4E8D A;  1CAV A;  3RZJ A;  2IFR A;  1UIK A;  4QX3 A;  4AVC A;  1XOY A;  3MDP A;  4BM8 A;  4HKW A;  1STM A;  4BQ4 A;  2E33 A;  1O3R A;  4NWV A;  1LAJ A;  3I3M A;  4R9C A;  5FJH A;  4XMI A;  4JTN A;  1NXD 1;  3WDY A;  4KG0 A;  4W6Y A;  4PI0 A;  4K8R B;  1BK0 A;  4CUB A;  4HK9 A;  1C8M 2;  2A75 A;  2RDS A;  1W6N B;  2RS3 3;  2WAB A;  1BMV 2;  1MVE A;  1OVP A;  2CHH A;  3H1M A;  2G1M A;  2A3W A;  2Q1M A;  5A3M A;  1C4R A;  5ERL A;  3WEZ A;  3ZOI A;  4DY5 A;  1S2B A;  3NRU A;  4HZF A;  2LTN A;  2PAE A;  3K3N A;  5I0S A;  2R0H A;  5A7O A;  1CPM A;  3O7O A;  1YHF A;  2W1W A;  5FRE A;  1D4M 3;  4OHW A;  4AGG A;  1NLR A;  3E6C C;  2J1E A;  3EMR A;  4QU2 A;  2JDZ A;  3WY6 A;  1LED A;  4IET A;  3AP6 A;  4AED B;  3ZMN A;  1MEC 1;  3U4X A;  2GMP A;  1F15 A;  4XJA A;  1LGN A;  2HKX A;  1YFX A;  1LOF C;  1UZV A;  4W6W A;  3KD4 A;  1Y9M A;  2G9G A;  2JIC A;  4UW4 A;  1VBE 3;  4AI3 A;  3NNF A;  1RXG A;  1SZB A;  1UF2 C;  2E9Q A;  3CL1 A;  4R52 A;  5CA6 A;  3VBO B;  4FP2 A;  3MID A;  3OY8 B;  4LPL A;  3VBR B;  1SDW A;  1VP6 A;  2OZJ A;  2D5H A;  1GZW B;  3RNS A;  1A8M A;  3ZLI A;  1DGW X;  1QJY 3;  4XUN A;  4EZH A;  1UMZ A;  3PME A;  1QWR A;  3OSD A;  4WM7 B;  3VZK A;  5I93 A;  5I91 A;  5IK8 A;  2VQ0 A;  4XOG A;  3GM8 A;  5AC9 2;  4MSV A;  2XML A;  1XJA A;  3AL5 A;  3AMP A;  3O0V A;  5GM0 A;  2FDI A;  5LWB A;  1X8M A;  5LY1 A;  3PJQ A;  1Z7S 2;  3CLP A;  4FO9 A;  3RDI A;  4H2A A;  3KQ4 B;  3FHA A;  1W8F A;  1WLW A;  3RQ0 A;  5JI9 A;  3JB8 A;  1JS9 A;  1AYN 3;  2JX9 A;  2YXS A;  2ZGL A;  3BU7 A;  1G86 A;  1VAL A;  3JD7 1;  5EZW A;  3C7H A;  3NJZ A;  1HRV 3;  2ARX A;  1HB1 A;  3ASI A;  4GXL A;  1FPN 2;  4XVH A;  1RTV A;  4CDU B;  5DDJ 2;  5IVB A;  2CWM A;  4OCT A;  3W21 A;  2VZV A;  4RN5 A;  3GZT B;  1AHS A;  2JD4 A;  3IDC B;  1FOD 3;  3BB6 A;  3NVC A;  4EN0 A;  2EIB A;  3VDA A;  5T52 A;  3WNO A;  3M3I A;  4GIQ A;  3M8L A;  3OBR A;  4CXX A;  2FMY A;  1L7L A;  3D3A A;  4CU9 A;  3AVS A;  1GOH A;  5F6L B;  2R07 2;  1S0B A;  2XVL A;  5IAT A;  3WDW A;  1AR7 3;  5C3R A;  4Q4W 3;  1R09 2;  4O61 A;  1J83 A;  3CHX A;  3THC A;  4E2S A;  3M3E A;  2V5Y A;  4LUM A;  4CYD A;  4D8M A;  3AYA A;  3VKM A;  4JV4 A;  5JWP A;  3AYC A;  4MHR A;  2V72 A;  1XPW A;  3T08 A;  2Y33 A;  4HSL A;  5CAD A;  1AR6 3;  4M3C A;  5F5A A;  4NRM A;  1NUK A;  2HWE 3;  4Q4X 2;  4YG3 A;  2IWG B;  5JMC A;  4FT8 A;  3RWN A;  3JQX A;  1HIX A;  3BGA A;  3FBM A;  3WW3 A;  4AZZ A;  3BAL A;  5FXV A;  2JEN A;  4M00 A;  4QAW A;  1HXS 3;  5IYY A;  2R1D A;  2V09 A;  2BRT A;  2VZO A;  1CAX A;  1ZRI A;  4QX1 A;  2VOT A;  2YU2 A;  1PMH X;  2Z5W A;  1PK6 C;  5G05 L;  4CEW B;  4B4Q A;  2XXZ A;  1KJR A;  3GJB A;  5JAX A;  3T1L A;  1VBB 3;  4LBO A;  2QQV A;  5HCB A;  4URA A;  4FPY A;  1YNA A;  1UPI A;  3MO4 A;  2QE3 A;  3D4K A;  3POJ A;  5HV4 A;  3JBG 1;  3RZZ A;  3HOB A;  4NR1 A;  4JDN A;  4YZ3 A;  3T2O A;  4AI9 A;  4C8D A;  1N1Y A;  4DXZ A;  2WL1 A;  3OEB A;  1ZRE A;  1H1M A;  4IEV A;  5FO8 B;  3I2O A;  2WO2 A;  1GAN A;  3KWV A;  1F35 A;  1XB9 A;  3NV2 A;  4IEW A;  4L9B A;  4OZX A;  2HWB 3;  3J7H A;  1PO1 2;  4P9Y A;  5FZ4 A;  1LHU A;  1WLT A;  2HYX A;  2WYF A;  2WWS A;  3NJX A;  3X29 B;  1Y9Q A;  4QGM A;  3ZXJ A;  4M4P A;  5L7O B;  1D0H A;  1VBD 1;  3ZXK A;  4YW6 A;  1NY7 2;  3R4U A;  4N53 B;  1KQR A;  2VCB A;  4RS5 C;  1YQ5 A;  2PLV 2;  4QPW A;  5DUW A;  1RMU 1;  1RUO A;  3WDX A;  1US2 A;  2XWJ B;  1FX5 A;  2BGC A;  1AL2 3;  1PX4 A;  2IC1 A;  2PAK A;  3JQW A;  1GLH A;  4YNI A;  2EVX A;  5GLV A;  2Q8O A;  5LW9 A;  4FOQ A;  5K0U B;  1T6G C;  1W06 A;  5ACA 3;  5KHK A;  1C5I A;  1TVG A;  2Y0I A;  4K6B A;  2DU1 A;  4BQY A;  5KHG A;  2F6B A;  3LGR A;  3OGS A;  2ET7 A;  5HCA A;  4AE2 A;  3ZSK A;  2B39 A;  4Z07 A;  4ZZ5 A;  4R8H A;  4BOW A;  2HWD 2;  1ZZ6 A;  3GNE A;  3ZX7 A;  1BBT 3;  5HV0 A;  4L8Q A;  1K12 A;  1J84 A;  2A6V A;  3OTF A;  1YQ2 A;  2XJS A;  3ON7 A;  4XFA A;  1NCQ C;  4K8F A;  4NRQ A;  4YGB A;  1WA4 A;  1QXJ A;  2WKK A;  3Q8A A;  5FPV A;  5BXX A;  4GWN A;  4ZU4 A;  3B7M A;  1RUE 1;  2MNG A;  4Q2F A;  5CZK A;  3JU9 A;  4AI1 A;  3ITQ A;  1ACC A;  4JDM A;  2CV6 A;  2GU9 A;  3D8C A;  2QQI A;  2WN3 A;  1U12 A;  1PO2 3;  1WD4 A;  2DTW A;  3CJI B;  2QDN A;  3OY8 A;  2QQW A;  4DUX A;  5CBL A;  1GZW A;  4P02 B;  3CNA A;  4XBQ A;  5EFU A;  5JXI A;  2CSG A;  1H1I A;  4MYE A;  2P3K A;  3I3D A;  4JCK A;  4IQP A;  4WM7 A;  4Y22 B;  5K9Y A;  5EV7 A;  4UI9 L;  1G9C A;  1RUF 3;  3CZJ A;  2VO5 A;  4IW3 A;  5EXO A;  3RZG A;  3WOG A;  3MW2 A;  4IDZ A;  5FUN A;  3CEW A;  2ZGU A;  1HKD A;  2WJS A;  4KMQ A;  4TTG A;  1OFN A;  1W6O B;  2YC2 A;  3VBU A;  2ZAA A;  1SHW B;  4ARY A;  2OVU A;  2WFF 1;  3CBN A;  2RMU 3;  1XBF A;  4OUL A;  1R1Z A;  2WLQ A;  3S7I A;  1JYI A;  5FP9 A;  1NCR C;  2UUR A;  3WDV A;  4CDU A;  2XBO 2;  2XB6 C;  1LEC A;  1V6M A;  5KHH A;  5AVA A;  1NX9 A;  1CN1 A;  3Q8F A;  4RR3 A;  2GZW A;  2JDK A;  4MET A;  3U11 A;  4NO4 A;  2EXI A;  1RHI 3;  4W4Z A;  4HET A;  5FY8 A;  4J1W A;  1VBC 3;  4A6O A;  1AR8 1;  1R08 1;  5KHI A;  1QNY A;  1AR9 2;  3BTY A;  2CY6 A;  1GMM A;  4IEQ A;  4LIT A;  4Y4Y A;  2VXJ A;  3ZR6 A;  1YFY A;  1JYC A;  2W87 A;  2ERF A;  2D6L X;  5C3P A;  1YJK A;  3U0Z A;  3NWK A;  1WMD A;  3S6P A;  1OQ1 A;  1EV1 1;  1RUH 3;  3POE A;  4LBJ A;  2R06 3;  4FBF A;  3I8T A;  2D40 A;  1XNB A;  3TN9 2;  4BIO A;  1RUG 2;  3QCW A;  2W46 A;  4AED C;  4P08 A;  4K7J A;  4PDW B;  1WW4 A;  2BEO A;  3PLQ A;  4MV2 A;  3AJY A;  3LPG A;  4LEJ A;  1N1T A;  1W9F A;  1GZ9 A;  1V9U 1;  2QVS B;  4Q4V 1;  3RZM A;  1FMD 2;  1UO9 A;  4EWE A;  2J7M A;  2QCS B;  3VBO C;  4Y24 A;  4TWT A;  5GLU A;  3VBR C;  2N7G A;  3KLS A;  2X5I B;  3TNP B;  1TQ5 A;  5A3W A;  3HQU A;  3WCR A;  3KT7 A;  4QXK A;  5F3I A;  4WM7 C;  1UW8 A;  2K0G A;  2WQZ C;  3VL9 A;  3Q9O A;  3LPF A;  5FYZ A;  4UBG A;  1UXX X;  1HQN A;  2ZAH A;  3M7A A;  4LOR A;  1LU2 A;  3LDK A;  4M4R A;  4ZU5 A;  1YEW A;  1BHG A;  3VDB A;  2RHP A;  2YBK A;  5C6C A;  2TNF A;  1GOF A;  5F37 A;  5FPX A;  3NST A;  4BQX A;  2RM2 2;  2E26 A;  4JRL A;  3BYW A;  5BYN A;  1TMF 3;  1NT0 A;  5DDJ 3;  3RVH A;  2E53 A;  1BJQ A;  2GH8 A;  4CDU C;  1W8N A;  3FLR A;  3AXD A;  2ZGP A;  3OB8 A;  5J36 A;  1IG0 A;  4NAO A;  4HL0 A;  5FPB A;  5CIR A;  3E5Q A;  1REE A;  4R4X A;  1DF0 A;  1FPN 1;  1I6X A;  5I0U A;  5DAX A;  2W39 A;  2AC1 A;  4A7K A;  3RZL A;  3TEY A;  4D0Q A;  2ZZQ A;  4N53 A;  4EQV A;  2GC2 A;  2YBP A;  1TME 1;  1AXK A;  4H14 A;  4XCA A;  1JHJ A;  2OUH A;  4OHY A;  3AP5 A;  3FJS A;  2JIJ A;  3LEM A;  4KG8 A;  4P14 A;  3SNM A;  4ASM B;  3WDU A;  2J1R A;  4XUR A;  5A7N A;  2XQR A;  3J8F 2;  1A6C A;  1IS3 A;  5FJK A;  3TEX A;  4D7T A;  1WCU A;  2Y6G A;  2VQT A;  3A7Q A;  4GB3 3;  5F39 A;  4IER A;  5FPU A;  2GME A;  2YC4 A;  3BOP A;  4BE3 A;  4FPH A;  2Q5T A;  3ENR A;  3THD A;  4XXA A;  5JOY A;  1H4H A;  2D44 A;  3VD5 A;  1OF4 A;  1A3K A;  3WNX A;  4OYU A;  2ETE A;  2GH2 A;  3SC7 X;  4P9G A;  2GC3 A;  4I0A A;  5LBE A;  5F8P A;  3RMY A;  1JOB A;  5GJ6 A;  2ZKL A;  4XF9 A;  2G19 A;  2DVB A;  2QZ2 A;  3K75 B;  2VW0 A;  3VZM A;  5DMY A;  1V6I A;  1PNG A;  1ZYB A;  3AK0 A;  4GH4 B;  3VHN A;  2R04 1;  2AUY A;  5ANQ A;  3CJI A;  2J42 A;  1QY4 A;  4HAN A;  4CUA A;  4CEW C;  3BTX A;  4MO3 M;  2DVF A;  2QDR A;  3S5A A;  4NHK A;  2E51 A;  4YG0 A;  3JB4 C;  4Y22 A;  1H6Y A;  5GZE A;  1P8J A;  2EAA A;  5EJZ B;  2NM1 A;  4LOS A;  4E2Q A;  4CDX A;  4QX8 A;  3ZM8 A;  4I3P A;  1O5U A;  3AMM A;  4QHZ A;  4JVA A;  5FZO B;  5DXD A;  4A41 A;  1PO1 3;  4IE5 A;  4AL9 A;  4YGC A;  3UYJ A;  1KJL A;  1GP6 A;  1W2A X;  1V6N A;  1SPP B;  2XJP A;  4XYX A;  1W6O A;  3OUH A;  1YRZ A;  4BB3 A;  3UET A;  1GWK A;  2ZZJ A;  2RDR A;  2LS6 A;  2VC9 A;  1ZZ8 A;  2Y64 A;  4GWJ A;  4KL1 A;  4OMC A;  3KVB A;  4V2V A;  4N53 C;  4QQL A;  1COV 2;  1S2K A;  3MLK A;  4Y1V A;  4ET7 A;  3CO2 A;  3K46 A;  2XKP A;  3B9I A;  3GDB A;  5IAV A;  1YQ8 A;  2MEV 2;  2CGN A;  3NAP A;  2DCY A;  4XUO A;  4RQP C;  5K0U C;  4TLF A;  2HBT A;  3NKT A;  2GAL A;  2RG4 A;  1L7R A;  3FHI B;  3NW4 A;  2DCK A;  3ZKU A;  2UY8 A;  2B9V A;  1EYB A;  4ONU A;  1S55 A;  2Q8C A;  4OI2 A;  3WP5 A;  3N9Q A;  1AYM 3;  4IEY A;  1AL0 G;  3KHB A;  4CDW B;  1V0A A;  4I09 A;  4R4Z A;  1AF9 A;  2BER A;  3I97 A;  3V0A A;  2L9L A;  2H6C A;  5I8S A;  4AVB A;  3LKJ A;  3KCX A;  4K1Y A;  3RMX A;  1PIV 1;  1RL3 A;  2IVI B;  3KGL A;  4PDW A;  2EF6 A;  2HWF 2;  5GZF A;  3H8O A;  1W9S A;  2AZ5 A;  3LSD A;  5E16 A;  2BFU L;  2ARA A;  4N43 B;  3GYD A;  1A78 A;  3DPR B;  2V5D A;  1DGR N;  2C9K A;  1ENS A;  2VQU A;  3O0W A;  3HNY M;  3MV0 1;  3CJI C;  2RR1 1;  1CJP A;  1WBF A;  2D6K A;  5FMO L;  1ODM A;  3WDT A;  1KS5 A;  1FV3 A;  1L7Q A;  1XND A;  5C3Q A;  2ZAC A;  3NJY A;  4LBM A;  1CX1 A;  3HNM A;  1DQ4 A;  4Q29 A;  3W58 A;  3R0R A;  2A5Z A;  2BPA 2;  4AQ2 A;  2VUA A;  1Q8O A;  5FYC A;  3I59 B;  3KZ4 C;  2DUR A;  2VTX J;  5FOJ B;  1JYX A;  2RS3 2;  3FE5 A;  2BDR A;  3G7D A;  4PF1 A;  4CTE A;  3THT A;  5DUX A;  4E2G A;  2F17 A;  1W8T A;  1UZY A;  2XBO 3;  1QXP A;  1UNB A;  1ZBE 1;  5LA2 A;  4IEO A;  5EHD A;  3NV3 A;  5T54 A;  2WRA A;  3ILN A;  5K4L A;  3VUO A;  1ZZB A;  3VB9 A;  2Q4S A;  4WVV A;  1UKG A;  4XQD A;  4EWA A;  1IGO A;  4N9H A;  3PL0 A;  1Y9G A;  1D4M 2;  1W0P A;  4FFF A;  1UOJ A;  2WN2 A;  4XUP A;  1RUC 2;  3TYJ A;  4FPJ A;  4BIS A;  3UK9 A;  1Q8P A;  1UOG A;  3WSO A;  2NN8 A;  4DPN A;  2B45 X;  4OQ9 A;  4UFJ A;  1EAH 3;  2PTM A;  1VB4 A;  1KFU L;  1VBE 2;  3FX3 A;  1CAU B;  3KT1 A;  5J37 A;  2CGO A;  2YY1 A;  3PIJ A;  1UD1 A;  3MPB A;  4YVS B;  3SHR A;  5JXJ A;  3ZXG A;  1UAI A;  3PVO A;  1NAE A;  2BOJ A;  4XUT A;  4C90 A;  1QOS A;  3LDR A;  4PDW C;  4YW5 A;  1D0G A;  2WO3 A;  1VB2 A;  2J1S A;  1PGW 1;  5FYS A;  1RUD 3;  4JGY B;  1QQP 1;  4Y20 B;  5FYM A;  5D21 A;  2W0X A;  4X8N A;  3GBF A;  1LOD A;  5KC5 A;  4FPK A;  2VMD A;  5IVE A;  3T0B A;  4FOY A;  5AFB A;  2DCJ A;  1HN1 A;  3M3O A;  2P4E A;  3I2J A;  2W1S A;  2X5I C;  4JZR A;  3WP6 A;  4ES9 A;  4QPG B;  2XUM A;  4ARX A;  1DZQ A;  5FXX A;  4C1W A;  1POV 0;  2E7Q A;  5DZF A;  4UAP A;  3N35 A;  1PNF A;  4MX3 A;  1NA1 B;  5C71 A;  2WR9 A;  3K4Z A;  3HPN A;  1AYN 2;  1UXZ A;  1H8T A;  1UN1 A;  2VZU A;  5EWS A;  5JCT A;  1OPM A;  1ND3 C;  2DVD A;  4FPO B;  1J59 A;  1HRV 2;  2ADD A;  1D2S A;  1DLL A;  1RYY A;  3GBG A;  3N9N A;  5LBB A;  1PGL 1;  4C0B A;  5FZI A;  3ROU A;  4M3C F;  2BWC A;  3H3U A;  4GWM A;  2IXH A;  1JYW A;  4CPB A;  5IFT A;  2VTX A;  3R6S A;  5C8C C;  5JZG B;  1Z0H A;  1QJU 1;  3MF6 A;  3JCI A;  1J3P A;  3C7G A;  3WIN E;  2BNN A;  3ZKY A;  2YV8 A;  5A1F A;  4HMZ A;  2UWC A;  3OF1 A;  4YPJ A;  3IM0 A;  2Q8E A;  3RSJ A;  1VBA 1;  4A3Z A;  4DXS A;  1UL9 A;  1SPP A;  4JC1 A;  3TB0 A;  1AR7 2;  1EUU A;  3KM5 A;  5FZ1 A;  4KWJ A;  4BLJ A;  3ZMO A;  3I49 A;  2XQX A;  3JZV A;  4AHX A;  1CQ9 A;  2XPJ A;  4FOW A;  2Y6K A;  4KWK A;  3S30 A;  1XSQ A;  1W2O A;  3C7E A;  2W95 A;  1LNS A;  1ULO A;  5L9R A;  3WNN A;  1AR6 2;  2V4A A;  2ZBJ A;  1ENQ A;  2HEY F;  2Q8D A;  2KM2 A;  4OI4 A;  2WZR 3;  3KCC A;  2JWP A;  3N7L A;  1M06 G;  2VL4 A;  3DKW A;  1K3I A;  4XPV A;  2DCT A;  1O6U A;  4LR4 A;  4XCB A;  5LA0 A;  4HVR A;  2WSV A;  1UZ0 A;  4A4A A;  1HXS 2;  2VU9 A;  1PK6 B;  3SMH A;  3W9A A;  1YFU A;  2ZGN A;  3AZZ A;  1F4H A;  1RUI 2;  2HYK A;  5IK5 A;  1UCX A;  2GDF A;  2OA2 A;  1I5P A;  1N3O A;  4UF0 B;  1VBB 2;  3OD4 A;  4N43 A;  3T3Y A;  4Q8K A;  2VCC A;  3CU7 A;  5A32 B;  5GAL A;  3MZH A;  4GH4 C;  3VBH B;  1GOG A;  2GND A;  1ZVF A;  4B4P A;  4XE9 A;  1VE0 A;  1U5X A;  1XYN A;  3WNP A;  5ANN A;  2HWB 2;  3HN3 A;  4L11 A;  1QGL A;  3AJZ A;  3UKV A;  4JKK A;  4FOV A;  4RHV 3;  1LR5 A;  2W1Q A;  2VTF A;  3B00 A;  2VZP A;  3LWC A;  3O14 A;  4FXG B;  4YYO A;  3VN4 A;  2BGP A;  2VNR A;  3HEI A;  4CU6 A;  1RVF 1;  4U2A A;  1O3S A;  2D6N A;  4LO7 A;  2JD9 A;  3ACF A;  4YW7 A;  3I59 A;  3ZN5 A;  3RZH A;  1QF3 A;  1PVC 3;  1PZ7 A;  4CP0 A;  1AL2 2;  4XIL A;  1K42 A;  1RUJ 1;  4AR2 A;  3AMN A;  4L0P A;  4ZXE A;  4COZ A;  3OYW B;  5ACA 2;  2DUP A;  2Z42 A;  3A21 A;  4FPE A;  4IGP A;  5DAP A;  3RJR A;  3PUS A;  1S0I A;  4O7X A;  4MGZ E;  1UX6 A;  3H8R A;  4GAZ A;  4QDS A;  5T5O A;  4ES8 A;  4LBL A;  4KWU A;  4G3Y C;  4JAA A;  1BBT 2;  1W3V A;  4ZS3 A;  4AGV A;  1LOF A;  4PQ9 A;  4LE3 A;  5A6Q A;  2G9Z A;  2VH9 A;  2ZHN A;  2WA3 A;  3BI3 A;  3MIG A;  4IGQ A;  1JZ7 A;  4CDW C;  1GQH A;  3T30 A;  1LHV A;  4YVS A;  4DIQ A;  2JG9 C;  3BIW E;  2YUE A;  4QHB A;  5FKB A;  3IN9 A;  1ULP A;  4XDP A;  1PO2 2;  3HBZ A;  3ZN4 A;  5EP9 A;  5G04 L;  2ZML A;  4HK8 A;  1Q8S A;  3DGT A;  2I07 B;  4JGY A;  4Y20 A;  1LU1 A;  1A8D A;  2IXJ A;  2WSU A;  2E7T A;  4N43 C;  3WHU A;  3DUI A;  4LXL A;  1BXH A;  1G6N A;  1H2L A;  1O59 A;  3DPR C;  3HT1 A;  5LAT A;  4FAG A;  4DUV A;  1X8E A;  4Q4Y 3;  5JIU A;  1UMI A;  1UOF A;  3K4A A;  2X05 A;  1KXG A;  1GKB A;  5FWJ A;  4E4H A;  3WNL A;  4J6G A;  2IXL A;  2ZMK A;  4QPG A;  1RUF 2;  1ASJ 1;  5CFC B;  5JMO A;  3ZO0 B;  4CVU A;  2A3X A;  1JH5 A;  1X7N A;  4W8J A;  1QU0 A;  4K40 A;  4CCE A;  5A6X A;  1FYU A;  1XNA A;  3U1X A;  1YJL A;  2P3I A;  4IV3 C;  1DG6 A;  1NCR B;  4M0N A;  2RMU 2;  2QQO A;  3U4S A;  2WS9 2;  1HRI 3;  2QJV A;  2X8K A;  2Y6J A;  4I02 A;  5TSW A;  2R49 A;  2YHJ A;  1DQ0 A;  1CES A;  2BP6 A;  2PA7 A;  1RHI 2;  2P1B A;  1MS0 A;  2A3Y A;  1KDM A;  2C24 A;  3DKQ A;  3MW4 A;  4FP3 A;  5H9Q A;  5H9R A;  3VBF B;  4DEQ A;  2WYS A;  1VBC 2;  5FIX A;  4B4R A;  5I0D A;  3UNP A;  3ST7 A;  3D0J A;  4H55 A;  2GC1 A;  5C70 A;  4QB1 A;  4DXR A;  2GNM A;  1RUC 3;  5BY5 A;  5KWR A;  2XJT A;  2CYF A;  1XQN A;  3NQH A;  5DUU A;  3IZO A;  2ILM A;  3HWJ A;  2JDA A;  2BNO A;  4QQP A;  2HWC 1;  5FZB A;  5JOW A;  5DAW A;  1RUH 2;  1GIC A;  2WA4 A;  2R06 2;  3W5M A;  2W2I A;  2NMO A;  3WF2 A;  5FCC A;  5A7Q A;  2PEL A;  4MGY E;  2VCM A;  1VRH 3;  3H7Y A;  4BCU A;  3GZA A;  1GUI A;  3AKR A;  3IPV B;  5A7S A;  1Y43 B;  4NJ4 A;  1MEC 3;  4Q0P A;  1LES A;  4YVS C;  5FZF A;  3OJB A;  3PIG A;  1D2Q A;  1BCX A;  1T2X A;  1UZW A;  3T2P A;  4FI9 A;  3AMQ A;  2VAU A;  1WW7 A;  1G9A A;  3BKZ A;  4CRQ A;  3AKS A;  4JGY C;  1QH6 A;  3CKH A;  4IEZ A;  3ZIW A;  4DS0 A;  3MIB A;  4FTE A;  4C1X A;  3H3L A;  2Z2S B;  1QMJ A;  2B5H A;  2W3J A;  4LO6 B;  4K1Z A;  4QDQ A;  1LOG A;  1PK6 A;  1QJY 1;  2VJX A;  4NIH A;  2VUD A;  4QPG C;  1F31 A;  4B29 A;  4B7E A;  5CG9 A;  3V64 A;  2YB7 A;  2JDN A;  5F7U A;  3NNL A;  2DF7 A;  1NA1 C;  3UL2 A;  4UF0 A;  4QQ2 A;  1HN0 A;  3LOI A;  4JHT A;  5D2A A;  5DUV A;  4UOJ A;  5A32 A;  1TMF 2;  4HVO A;  1NKG A;  3K48 A;  4GKX A;  3DEC A;  1IS6 A;  5FO7 B;  3LA2 A;  4K3U A;  5D8A C;  3VBH A;  1V6J A;  4CCK A;  2VOK A;  2OUJ A;  1C8N A;  4QX5 A;  5A1L A;  5M0T A;  5A3N A;  4NWW A;  5JZG C;  4NE9 A;  2SBA A;  4BQ1 A;  2JG8 B;  3PVN A;  4UFI A;  1YWK A;  1T6B X;  4RS5 A;  2FBE A;  3ZFE B;  4CCJ A;  5T50 A;  4NRP A;  1FOD 1;  2XR4 A;  4XDO A;  2CGP A;  4FTS A;  3MV1 1;  2H0B A;  4QXH A;  1BEV 2;  3PUA A;  4SLI A;  1E5S A;  3B02 A;  4BH9 A;  1TE1 B;  3AKQ A;  3H1W A;  3O5S A;  3R4D B;  4D94 A;  3HAG A;  3UKT A;  3RWK X;  4CCL A;  3PUQ A;  3QBQ A;  1CZV A;  4GB3 2;  4Q4W 1;  3WF0 A;  2DBN A;  4CP1 A;  1UY0 A;  1QJX 1;  2E31 A;  1WUV A;  5CB7 A;  4D6S A;  1NCQ A;  1LHN A;  4F3J A;  1OUS A;  4PIZ A;  4DFS A;  3I3E A;  1IKP A;  2WC2 A;  3LA7 A;  4DB5 A;  5E8A A;  3U78 A;  1QH7 A;  5H9P A;  1SBD A;  2R6Q A;  5A3T A;  3VHO A;  1WMF A;  1ZBA 1;  2HWE 1;  5FLI A;  1RUI 3;  4QDR A;  3AP4 A;  4KGQ A;  2A71 A;  3ZYG A;  1FV2 A;  1DIW A;  1WW5 A;  2GNB A;  1YI7 A;  2RS1 1;  5FY9 A;  1BKZ A;  4LOT A;  3C7F A;  4BK4 A;  1OLR A;  2J1T A;  4ERO A;  5KXD A;  3H0O A;  4ORF A;  2WWJ A;  2Q1F A;  3E97 A;  1HB2 A;  2ID4 A;  1DU3 D;  4UBH A;  3VBH C;  4KU7 A;  4AFD A;  4C0H A;  5FZL A;  1E5I A;  2OPW A;  3SCF A;  1W8Z A;  3OPZ A;  3S57 A;  2YU1 A;  2VVF A;  5CFC A;  1Q5O A;  4XFC A;  3W20 A;  4YVW B;  4D6R A;  2RS5 3;  2DCZ A;  5L9B A;  3O1V A;  3AL6 A;  2VR4 A;  5JSP A;  2X09 A;  4UFM A;  4B8E A;  3BTA A;  2Z79 A;  5GLZ A;  1NCR A;  3RFR A;  3DF0 A;  3RPQ A;  3CIH A;  4FVV A;  1UMH A;  3FUQ A;  1VMJ A;  4KBZ A;  5FKC A;  1W6N A;  4OHX A;  3NMB A;  2W47 A;  3A4U A;  3MFA A;  1MS3 A;  4WVM B;  1VBD 3;  4RQP B;  1JU4 A;  2GSY A;  2BGO A;  2BWA A;  5C3S A;  3PHM A;  3BOD A;  1O91 A;  3POG A;  3VBF A;  1RMU 3;  1RED A;  4WM8 C;  4QKD A;  1HJG A;  2VOX A;  3ACG A;  1IPK A;  5FP7 A;  2BYV E;  1UQX A;  2BBA A;  4LQR A;  5LA9 A;  3GGL A;  1F9K A;  1CAW B;  3M3C A;  1AYM 2;  1OH4 A;  4IV1 B;  1VRB A;  2A6Z A;  3J4U H;  5CKQ A;  5T55 A;  5ACA 1;  4AVS A;  4AED A;  4YGD A;  3CZU A;  4XJZ A;  4QPI B;  3AXE A;  4Y26 A;  3WG3 A;  5SV8 A;  3W5N A;  1SLL A;  2A6W A;  4TSV A;  2UYA A;  3HQR A;  4LBQ B;  3EB7 A;  5JR7 B;  3T0A A;  4QB6 A;  1GSL A;  2J1A A;  3SXW A;  2X53 S;  3QH6 A;  3VBO A;  5DG1 A;  3IPV A;  2JE9 A;  1XNC A;  5GZC A;  3VBR A;  3VHR A;  2DVA A;  4XFI A;  4RYD A;  1MQT B;  1W9W A;  4K21 A;  1IZ3 A;  2QNK A;  2ZEZ A;  1DYK A;  4ISR A;  4QQO A;  2JEM A;  4F83 A;  1OF3 A;  1OT5 A;  4B1M A;  5B4N A;  4JQR A;  2ZS6 B;  1E5R A;  2ZGM A;  3JUU A;  1VJ2 A;  4JHZ A;  5A3O A;  3USS A;  1EPZ A;  4N90 A;  1XE7 A;  2JKB A;  4AFC A;  4HN1 A;  4ATF A;  3HQX A;  4NMI A;  4AQ6 A;  1BVV A;  3POW A;  5FP4 A;  4XF0 A;  1UX7 A;  1QOT A;  1K5M B;  1R1A 1;  5JI7 A;  2JDM A;  2JDY A;  1AX2 A;  5CFC C;  2VOV A;  1XC6 A;  2DFB A;  2JB4 A;  3EBR A;  4FPC A;  2FZ2 A;  4HKL A;  4OHV A;  2J22 A;  2Y26 A;  3AZW A;  4X6R B;  5CYY A;  3BU0 A;  5FZ8 A;  1OUX A;  2WS9 3;  3DYM A;  5HPO A;  1X82 A;  1GWL A;  1IG3 A;  3N7K A;  5EYY A;  1O4Y A;  4IE6 A;  4BQ3 A;  2VCA A;  3VLB B;  1QKQ A;  2VPV A;  4P9J A;  4QHO A;  5C9A B;  5JDB A;  1ZA7 A;  2UWA A;  2WFF 3;  1C8M 1;  2D97 A;  4WZC A;  3SH3 A;  5JOX A;  2VGD A;  3ZPO A;  2XLF A;  3H8U A;  3VBF C;  2FHR A;  5FYU A;  2WT2 A;  1B35 B;  3QH7 A;  4Z2W A;  4Z8B A;  1BMV 1;  2QQL A;  4DO0 A;  3O1R A;  5HCH A;  3ZFE A;  5EPA A;  3SKJ E;  3UV9 A;  1W04 A;  1JZ4 A;  3M2M A;  2PHU A;  1AR8 3;  1EAH 2;  1R08 3;  2BU9 A;  2DUQ A;  1ENX A;  1S0G A;  1JTZ X;  3SCH A;  1WA6 X;  4HLT A;  2AR6 A;  4DY3 A;  4GWI A;  4F7Z A;  3B3Q E;  3AMH A;  3N36 A;  2OKX A;  1EV1 3;  5AVP A;  1FNZ A;  1W90 A;  1UY1 A;  1RUD 2;  1PZ9 A;  4LTA A;  4TYS A;  4Q1P A;  5LCW L;  4MGQ A;  4ASK A;  4OI0 A;  4YW2 A;  2W91 A;  1G9D A;  3VD7 A;  4GQ7 A;  2QUO A;  3AP9 A;  3C2U A;  4Q4V 3;  2AEY A;  2XUE A;  2W9X A;  3WG2 A;  1F5F A;  1LOA A;  2BUK A;  1X50 A;  2K46 A;  2E32 A;  4MUV A;  1DYO A;  2VW1 A;  1ND2 B;  2BV4 A;  4S2G A;  2PHL A;  3QOP A;  3AYE A;  1ND3 B;  1VR3 A;  2XON A;  3OD0 A;  1HW5 A;  2CDO A;  2R7E B;  3T1M A;  5FYY A;  2H0V A;  4IE4 A;  4CEW A;  4CP9 B;  5DN2 A;  1GNY A;  4XEZ A;  5FQ0 B;  1YIF A;  3WHT A;  1KDK A;  4FXK B;  5AC9 1;  5C8C B;  5FR3 A;  1SAC A;  3ZXD A;  3O0X A;  5FPL A;  5A80 A;  1Z7S 1;  3LQC A;  5E1R A;  4ASL A;  1UY3 A;  3H3Z A;  1JXN A;  4N9I A;  3MYX A;  1OD5 A;  4BIF A;  2VBB A;  3WQB A;  1XU1 A;  1N3Q A;  1HQL A;  1NLQ A;  5DG2 A;  1W99 A; 
#chains in the Genus database with same CATH homology
 3RZG A;  4CXX A;  3T4V A;  4IDZ A;  5F8P A;  4NIH A;  3I3M A;  3I3Q A;  3RZH A;  4O61 A;  3O1U A;  4JHT A;  4QKB A;  4MG2 A;  3BTX A;  3S5A A;  2FDF A;  4NRM A;  4O7X A;  3RZJ A;  3O1M A;  3H8R A;  4QKF A;  3BTY A;  4ZS3 A;  3O1P A;  5DAB A;  2FDG A;  4IE5 A;  3BUC A;  3BI3 A;  4NRP A;  4NPM A;  3O1T A;  3BU0 A;  4NII A;  4QKN A;  3RZM A;  3T4H B;  4IE6 A;  4CXY A;  4QHO A;  3H8O A;  2FDK A;  4NIG A;  4ZS2 A;  3I2O A;  3KHB A;  3O1R A;  3O1S A;  3I49 A;  4IE7 A;  4RFR B;  4NPL A;  4IE0 A;  2IUW A;  3BIE A;  3LFM A;  4NID A;  3O1O A;  3H8X A;  2FDI A;  3S57 A;  3RZL A;  4NRQ A;  3O1V A;  3RZK A;  3KHC A;  4CXW A;  4IE4 A;  3T3Y A;  4NJ4 A;  4OCT A;  4MGT A;  3BTZ A;  2FDH A;  4NRO A;  4ZHN A;  3BKZ A;  4QKD A;  2FDJ A;  2FD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...