4ZHNA

Crystal structure of alkb t208a mutant protein in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
200
structure length
200
Chain Sequence
LAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLAFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DFT Studies of the Rate-Limiting Step in the Reaction Cycle of the Fe/2OG Dioxygenase AlkB and Related Experimental Studies
rcsb
source organism Escherichia coli (strain k12)
molecule tags Oxidoreductase/dna
molecule keywords methylated trinucleotide DNA T-meA-T
total genus 55
structure length 200
sequence length 200
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2015-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4zhnA00
2FDJA 3I3QA 4QKFA 4CXXA 3BIEA 4NIGA 3O1MA 3T3YA 4OCTA 4CXWA 4CXYA 3RZKA 3BTZA 5DABA 3O1TA 3BKZA 3S57A 3S5AA 4O61A 3LFMA 3O1OA 4IE5A 4QKDA 2FDFA 4QKNA 3KHCA 4O7XA 4QHOA 3O1RA 2FDGA 3KHBA 4IE0A 3RZMA 4NROA 2FD8A 4QKBA 4NIIA 3H8RA 3I2OA 3RZHA 4IE4A 4MG2A 2FDIA 2IUWA 4RFRB 3I49A 4IDZA 3BTYA 2FDHA 2FDKA 3T4VA 4NRQA 4NPMA 4NRPA 3RZJA 3I3MA 4IE7A 3BUCA 4ZS3A 4JHTA 3H8OA 3RZLA 3O1PA 3O1UA 4IE6A 4NPLA 3O1VA 4NRMA 5F8PA 3H8XA 3T4HB 3RZGA 3BU0A 4ZS2A 4MGTA 4NIDA 4NIHA 4ZHNA 3BTXA 3O1SA 4NJ4A 3BI3A
chains in the Genus database with same CATH superfamily
5IW0A 4YM3A 3H1WA 4OCTA 5A6XA 2ZGKA 4AFDA 4S2HA 4MYEA 3ZYGA 4D3WA 2RM22 4XFCA 5E88A 3MLKA 5FZ8A 3IDAA 3ZM8A 5GLUA 3N9LA 2CAUA 3EO6A 3OPZA 1HRI1 1R1ZA 4KG8A 5I8SA 3TYJA 1LNSA 1VAKA 3UJOA 5C3PA 2EALA 1MEC3 2WYFA 4QX5A 2WT0A 3HBZA 4E2SA 1UY2A 4UFLA 1O3TA 4ASLA 3VN4A 1PM4A 4S2DA 1S2KA 3T1LA 4P9LA 2ZZJA 3WW2A 3WW4A 2VG9A 1X33A 4XUPA 3IMNA 3N7KA 4I09A 3H50A 1AYN1 1QH6A 2ZGNA 3FUOA 3RQ0A 1RVF2 1TG7A 5FPBA 3WY6A 1KS4A 4Z2AA 2RS53 3T0DA 5F3IA 2E31A 3ACLA 2J1RA 4MSVA 2WINB 1GP6A 2DFCA 4GH4A 3RWNA 4YW7A 3Q8FA 3AYDA 4D6QA 1ZVFA 2WBKA 5DPNA 1K3IA 3HNYM 5LWBA 4TZDA 1LB2A 2JD9A 1I6XA 1D7PM 3A0NA 1ONAA 4PLNA 3WQ1A 1VE0A 1OQ1A 4E27A 1RTVA 1VRH1 2Y6LA 3H9AA 4M3CF 3RYRA 4AQTA 3G7DA 1MQTB 1OURA 1ENQA 1PIV2 4MGSA 4AEDA 1KDMA 2R042 3H8XA 2JENA 4J1XA 3U4XA 4MGTA 3VHNA 4CCOA 1A78A 5LRRA 2R0FA 5A6ZA 1RUG2 1IS3A 4XXPA 5FYVA 4D0QA 4N90A 1ND2B 2XWJB 4YLZA 3ZMNA 2XH6A 1G9AA 1WA6X 3P1IA 1M4WA 1RUE3 2Y38A 3WQ0A 4IE5A 3K2OA 3EHKA 1O7FA 3QCWA 5FYTA 1LHUA 1VMHA 3JZVA 3WNMA 1GR3A 1O91A 3LE0A 1RUOA 4Q4V3 1BK1A 1D4M2 3E5XA 5F3GA 2JB4A 3MO4A 5C71A 5SV8A 1WCQA 2DTYA 5KBFA 3AZZA 2E63A 3AZWA 3SCGA 5GALA 3OGJA 2OKXA 3ZIXA 3OY8A 4DUXA 3KM5A 4XDPA 2FCTA 3PDQA 5GZCA 1MZFA 3OY8B 1DG6A 3ZXJA 3OOXA 5FZHA 4JHZA 3I4IA 1UKRA 1UZYA 4HK8A 4Q1RA 1UL9A 3WINE 2C1FA 4QHBA 4DUVA 2ZX4A 1UU6A 2J1TA 3HBKA 2FDGA 5JXIA 2XWBB 4LLFA 1AYM2 2WZR1 3MHZA 2VAUA 5LY2A 4QXKA 4W50A 5E89A 4FFHA 4HMZA 4PIZA 5ERLA 3C2UA 1CZTA 4YVSB 4KWJA 4EN7B 4HXCA 2RM23 4ZU5A 4P9GA 4GAZA 3KT4A 2C24A 2V73A 1UOGA 5EP9A 2JX9A 2XLAA 3NWKA 4XMAA 2RS33 4YVWC 2F6BA 1GWLA 1PZ9A 2Q8EA 2OUHA 4JCKA 3ZYHA 1LULA 1LHVA 4ISQA 4ZU4A 5FDBA 2QE3A 3ZR6A 1LKNA 5FY4A 1QKQA 1ZBA3 2NQYA 4DY5A 5BYNA 1AR92 3APBA 1CVNA 4JKMA 5AVPA 1GWKA 2IWGB 2EF6A 1IS6A 1YIFA 3CIHA 3PVEA 2Y6HA 4AGGA 5H9PA 3LA3A 3AP9A 3I49A 1PK6A 2GMEA 1S0JA 4Q4V2 4I0BA 1EUTA 4L11A 3OG2A 4Z2WA 4HFSA 1HXS2 5M0TA 1QWRA 4DY3A 2WSVA 1W9FA 2CV6A 1W8NA 4HANA 3ILNA 3PJQA 3B00A 1HB2A 1N1YA 2ZZQA 4LBOA 4E4HA 1W39A 2DVBA 4JTNA 1WMXA 2WQZC 3NAPA 4Q4W2 5GKAC 1IGOA 1MZEA 2WNEA 5A7SA 1BK0A 4CDQC 4FOYA 2ZACA 3UNPA 3UETA 1KRIA 4XF4A 2D7FA 5DN2A 1ULDA 1LENA 2DBNA 1AL22 1L7RA 5LA0A 3BIWE 3JD71 3PVBB 3E1F1 5CU1A 5EHDA 4BPZA 1O3RA 1QJX3 3PUQA 4GQ7A 3GJBA 1DGLA 3GCWA 3CMGA 4PJYA 5DUVA 3TAYA 1R083 3FFZA 1DGWX 1WZXA 3OBRA 4BQ4A 3VZJA 2P3IA 1ZZ7A 4LIUA 1PO23 4QX3A 4K7JA 5FP8A 1UMZA 2VVFA 2VULA 5JOXA 3ME2A 1X8EA 3AMHA 2I74A 1QU0A 4COZA 2JG8A 3EMRA 5FY1A 2WO7A 5FLIA 3QH6A 5J3UA 3FC0A 2ZCWA 4AI2A 2P3YA 4KQ7A 1RUI2 3FX3A 4Y1UA 2Q5TA 2JICA 2KA3A 4AR2A 1SLBA 1S0CA 1CIYA 2XMLA 3OF1A 4BU2A 3VBRB 5C7GA 1D2QA 3SQOA 3WG3A 5I91A 4YYOA 1COV1 3IDEA 1CZSA 3AKTA 3OGSA 3T30A 2VMIA 4MUVA 4S2FA 1X8MA 2R49A 4ITCA 3WF4A 2ZGUA 5DAXA 4IESA 3SHRA 1GQPA 1NT0A 1FMD2 5CFDB 4PBPA 3VKOA 2Z2SB 3WCRA 5HCHA 2K2SA 4HPKB 2YC4A 4LEJA 1N3PA 1H1MA 1AJOA 4FSJA 1ST8A 1OQEA 1GLHA 1XU2A 2RS51 4G3YC 5F32A 1HB1A 3AVSA 1UMIA 3RYKA 1GQHA 1EUUA 1N47A 4XJZA 3VDDA 2FZ2A 3MEPA 1WLDA 4DNYA 3GF6A 3N3HA 4QKBA 1OPOA 1WMEA 3TEZA 3LD8A 3F95A 4IV3B 2ZEZA 2GC1A 2WA4A 1W05A 2CGOA 4FI9A 5JSPA 4XHXA 1MEC1 1SPPA 1ZM1A 2ZHMA 3BYWA 3IKWA 1S0FA 3EBRA 5F39A 1OMIA 4R4ZA 3TNPB 1LEMA 3WW1A 1V6OA 5FYZA 3AFGA 5C4WA 5ABJC 5IT6A 4COYA 5AVAA 2XJQA 4MGYE 2VECA 5GLWA 1JUHA 5KHIA 3POBA 2HWF2 2GALA 1VMJA 4LO5B 2PHWA 5IK8A 3VB9A 2R041 1H0BA 1ZX5A 3KVBA 4PLMA 1OPMA 1W99A 2PN5A 2XPJA 3OEAA 3I59A 1ZBE1 5FZ4A 3POIA 2MEV3 2PQQA 4KH9A 5FP3A 3HMYA 1LODA 3TEYA 5IWFA 4F83A 1ZBA2 1Q8QA 2P5BA 1VBA1 2B4KA 5E6HA 2HEYF 3AYCA 4NPMA 4I30A 1MS9A 3T0AA 4IE7A 4LBQB 3BN6A 1O4ZA 2DCKA 3KCCA 5DDJ2 1PO22 4KNCA 4E8DA 1RUH1 3CZUA 5CIRA 5EJ1B 1NX9A 4JKKA 2JXAA 4EWEA 2RJKA 4DZGA 2G4IA 3JBG3 3QOPA 1JYNA 2BERA 4F8AA 1GZTA 3KGLA 3ZOIA 4FP3A 4N43A 3PUHA 4GB32 2WNVB 2NMNA 2GNTA 2QQUA 5C9AB 3K75B 1XU1A 5HXVA 1IZ3A 5A3WA 4D94A 4PDWA 2BFUS 1NUKA 5FYCA 3RZKA 2QBXA 5LEJA 2ET7A 4K1ZA 1AZDA 2W87A 3ZFGA 1LJ7A 3ZFGC 1OFNA 4LULA 5A7QA 2W08A 5JXJA 1ZRFA 2JKXA 1QJU3 2BFUL 1SFPA 3RZLA 1H2NA 2Q8DA 2VZRA 3J7LA 4FFGA 2GC0A 1RHI3 2ARXA 2O14A 1OD5A 3AL5A 2GMPA 1ZREA 1YHFA 3CKHA 1DYPA 3M3CA 4XTPA 4MHUA 1DZTA 1JODA 1CAVA 5C4WB 4RN5A 1RMU1 4LPLA 5HXMA 3KT7A 2FQPA 2QQMA 1ENSA 2IXCA 1YLLA 2XUMA 1AR82 1XNBA 1TVGA 3T2OA 2RMU2 2FCUA 1LOFA 4CP0A 4EN0A 5J37A 1PK6B 3N35A 1WD3A 3OJBA 3BB6A 3VKMA 4NO4A 5FPAA 4M3CA 3D6EA 4LE3A 4JVAA 2F17A 1KEXA 3GNEA 3T0BA 1XNCA 2B8MA 1VALA 3TWIA 2O8OA 1KJRA 3HIFA 2QQPA 1S2BA 2BBAA 1UW8A 2IZWA 1C8NA 3WNNA 2QQKA 5A6QA 1KQRA 1W6MA 1H8TB 2WQ4A 4N9IA 3ES1A 1D0GA 4Y5SA 4CPBD 1ZA7A 5K4LA 1DGRA 1NXD1 1B35C 2ZPXA 4NJ4A 2ID4A 4QKFA 3JBG2 4XFGA 2BNMA 1EPZA 5IFTA 1R64A 2VD7A 4MGIE 4LQRA 4FPEA 4DOUA 3LFMA 3GCXA 1PM7A 5FY7A 1IQDC 4C0HA 4UAPA 4KWKA 4Q0UA 1RUI3 2C9AA 1WLWA 3IPVA 3Q8BA 4FTBA 2BW8A 1ZRIA 1N3QA 3ACHA 3I2FA 1YYNA 1AL21 1XQNA 4NRQA 5FZ0A 1V6IA 4XUOA 5F5CA 4XJAA 3AC0A 4Z1VA 3WT3A 4NPLA 5FZ7A 4CEYA 1F2NA 4JGYC 4RA0A 3VHPA 1HLCA 1WW6A 2JG8B 4YGCA 3TRSB 4BMBA 4QPYA 1M06G 5CBLA 1AR63 1QJY3 2R073 2JDKA 2JDNA 1D2SA 5D8AC 3URFA 5IVVA 1NAEA 1YFWA 1W2AX 3BIEA 3VD5A 3BOPA 4TXWA 1JW6A 1JHNA 5I93A 1PVC2 4HL0A 2ZAHA 2DURA 4M3CE 1OF4A 3FN9A 1YFUA 4AI1A 1W3VA 1AR61 1QJY1 2R071 3SISA 3SEEA 5A70A 3KHBA 5JZGC 4I0AA 1SLIA 4LLOA 2WQ8A 2VPVA 4FCAA 1MS1A 4URAA 3ZVXA 3RZJA 3I2DA 3H1YA 1DCSA 3PUSA 2CDOA 1COV2 2HWC2 2WNVC 4YG0A 2Y33A 3H3LA 1Z7S2 4YW4A 1DF0A 2D93A 2W1UA 2J1EA 4N7IA 5FUPA 4QX8A 1NCQB 2FBEA 3MYXA 4CEWB 2ZTNA 1EV11 1PO13 1Y9GA 1FMD1 4BH9A 1BMV1 1FV2A 1OF3A 2MPFA 2IXJA 3LA7A 3SH5A 2CDPA 2D6NA 1DYOA 2QFEA 5HI0A 4X6QB 4XVHA 4SBVA 5BNNB 1MS5A 3QBQA 3DGTA 1BEV3 1HIXA 2PHLA 3FWEA 5LBBA 3OD0A 4IE4A 4FQZA 4S2GA 1OOPC 3OSDA 3PTRB 4XQWA 2NZ9A 4J25A 3VBSA 5GZEA 1LR5A 5JUVA 3THDA 1YCIA 1JU4A 2Y0IA 4W65A 3NW4A 3O1UA 1W90A 4XC9A 5T5PA 5G04L 1E5SA 2VQTA 3WQ7A 1CAXA 4P00B 3AMNA 1WGPA 4YW3A 4NIHA 4GXLA 1R1A2 4B4RA 3TNQA 3ZO0B 2VH9A 4IE0A 3VD4A 1CESA 3DECA 1CAXB 1I5ZA 1XYOA 1SACA 4QPIA 1AYM3 4XFAA 2C0ZA 3ETPA 1URXA 2B46X 2VQUA 3W58A 1JZ3A 1LTEA 4Y22A 5FTTC 2A6WA 2XBO3 5L36A 2PLV3 3B9IA 5BNQA 1UOFA 4OFGA 2RG4A 1ZBE2 4P9JA 4UF0A 2YB7A 4DUWA 2WC2A 4IEYA 4OHVA 1UPIA 3SITA 1VBA2 4GJZA 5BUVA 1AL23 4YVWA 2YU1A 3U14A 1D4M1 3DF0A 2BVBA 4WM8B 2SBAA 1B09A 3T4HB 5J36A 3VV1A 1XYPA 4XJUA 4Q0PA 5F2SA 3RJ2X 1CAVB 4CDWC 1XNTA 5BXXA 3WNKA 1G9CA 3I2HA 3ZYRA 4QGNA 1GICA 4Q26A 4Y22B 3GDBA 1FOD1 3ZYFA 4QKNA 5T3NA 3HN3A 2XQXA 3FUQA 3THPA 2CTVA 4YFWA 3BPSA 3VDDB 2ZEXA 1IS4A 2ZS6B 3TN93 5A1AA 3AP5A 3AK0A 1VBB3 5C8WA 4YW1A 1X50A 3VKFC 1RUNA 1AR93 1YQ2A 1YNAA 2ENRA 1Z7S3 1YWKA 3ILFA 1YI9A 3VBFC 5FZ6A 1H8VA 5IVEA 1NCRA 1LESA 5F5AA 1AL0G 2CU5A 2QDRA 3WP3A 3DV8A 3IT8A 3RSJA 2WAAA 1P8JA 5KXEA 4AXOA 4KBBA 1K5MB 3NNGA 4D7YA 1WLCA 1D0HA 5FZ3A 2BYVE 4YNIA 4BZ4A 4CU8A 2RJ2A 1CONA 2XLFA 5FP4A 5JR7B 4F7ZA 1RVF3 1PMIA 5D8AA 5FOJB 4QX2A 4RS5B 3T09A 1FATA 2WZPP 2GN3A 4P9XA 2ZMNA 3UESA 2W2IA 4CEYC 5GM0A 1H2LA 4E9KA 2A6ZA 4GWIA 3NSTA 4UT5A 5HV4A 3OPWA 4Q4V1 3S7IA 5A7OA 4NHYA 3AKQA 1FOD3 1OUXA 2A7AA 2EAAA 2ZX0A 2W52A 1REEA 2AR6A 3WCSA 1NCRC 2EXIA 2VUAA 5EYYA 3AZVA 3O1OA 1S0DA 3FL7A 3DKQA 4TLFA 5A33B 1V6LA 4ES9A 3MPPG 1BHGA 4LHKA 1KITA 3VZMA 4ES8A 4EZ4A 1TME3 3PIJA 3ZPYA 2NMOA 1E5IA 2K46A 5JSOA 1Y9QA 1PGW1 4X6RB 3PNAA 1WKYA 4Q4X3 4RSUA 4Z07A 3FLTA 3USUB 5HCBA 1HW5A 4MLOA 4QD2A 5A1LA 4YPJA 3D5OA 3WG4A 2AC1A 2ZKNA 5L7OA 4XW3A 1FX5A 4TN7A 1H30A 1W3XA 2WNUB 3L2HA 4IV1B 3PMSA 2WO1A 3C8XA 2RVAA 3LFIA 3S5QA 3H7YA 1U5YA 4R9AA 1UYXA 5I0UA 1W2TA 4BA6A 3T2TA 2P17A 1US2A 4Q8KA 2VZVA 2VO5A 4LA2A 3WDUA 3KB5A 4P08A 1PNGA 3E97A 1DLCA 3THTA 5FV3A 1S1AA 3UK9A 1SDWA 2OIIA 3H8OA 5FBZA 1WLTA 1IS5A 1REFA 3M4FA 1VBE1 2NM1A 4GZ9A 4XQ4A 5DAQA 5FAXA 4PHZA 2H0VA 2JDPA 1LECA 4PT6A 3H7JA 2KR2A 2VOWA 3VDBA 2VW2A 5FMOS 3AL6A 5BNNA 3VBUA 4QU2A 1LOAA 5E1RA 4QB2A 4BLJA 3HJRA 5I0TA 4RGKA 3WQBA 4GJYA 4XCAA 2RR11 3WZ1A 1FPN3 3U75A 3VL8A 2OYZA 1RIRA 2PHXA 4OHZA 2CGNA 4KU8A 5JI9A 1K5JA 3M3QA 5FZ9A 4P9WA 4DRRA 5C8CC 1ZRCA 3NRUA 2G19A 3CQOA 4XF0A 1NYWA 1SBEA 1ZZCA 1CAUB 1SLAA 1UU4A 2HWF3 2OW4A 2VM9A 1QDCA 4WM8A 2D5FA 5LK5A 4EV0A 3SNMA 5C5UA 2PFWA 2XOMA 5ACA2 4L0PA 1CAUA 5DAWA 4IW3A 2C4XA 3MIGA 2MNGA 3WDYA 1Y3TA 1LU2A 2WS93 4FPFA 4AYUA 1D4VB 4BQYA 1E5HA 1RUJ3 4NWWA 4UXAA 3SCHA 4DXSA 2K9ZA 4AEMA 2D3PA 2TUNA 4COUA 4D69A 3H8RA 1RUD1 2X10A 3LPGA 2HWB2 2IFRA 4K8FA 3WUCA 2Y6GA 3DYPA 4QGLA 4JQTA 3VHRA 2XKOA 1ZZ9A 1R081 4PLOA 4QQLA 1VBC2 3CBNA 5FZFA 5A3LA 5JXHA 4WM7B 2GH2A 5FZOB 4QQ2A 3W20A 4DEVA 4BQ2A 5A3UA 4PF5A 3AXEA 2RDQA 2OA2A 3NV3A 1NLQA 1YJLA 3Q8EA 4B4PA 4CEWC 5FY5A 1DYKA 1CJDA 4YZ1A 3BTZA 2UURA 3POWA 1NY72 4R9CA 5F3EA 3I59B 3AB0A 4LHLA 5JIAA 5C8CA 4YG3A 3KV6A 3LEKA 1F8VA 2FDFA 2R061 4BWOA 5IVBA 2OQ7A 2PQSA 1W03A 2ZKLA 4Z82A 2X29A 4FPOB 3AVRA 1WCSA 4FPJA 2Y6JA 4IGOA 2WFF1 5DUUA 4FTSA 2DUPA 5I0DA 2PMWB 3I2KA 1R1A3 3VBOC 4EJRA 1IKPA 2D6LX 1JYIA 3S57A 5FIXA 3BKZA 1QXJA 1ZZ6A 2VOXA 3OBAA 4Q8LA 4Y1XA 2JD4A 4K1YA 2Y60A 3HD8B 3OUHA 1SFNA 1ZA4A 2JDHA 1GSLA 3GHNA 1W6QA 4LO4B 1F15A 1C4RA 1W9TA 1ZNPA 5FOBB 2R32A 1QJU1 3PL0A 1POV3 3K51A 4CDQB 1UZ0A 2JIJA 4UW4A 3W5NA 1CX1A 4CDUC 1K5MC 1N1TA 4A6SA 3LSEA 2B7YA 3LPFA 5KWRA 4CRQA 1DQ2A 3D82A 3ZLIA 2X53S 4QPWA 1UZZA 1DGWA 2E32A 1JZ2A 3O1SA 2WS91 2NYYA 5L9RA 3POGA 2WNUA 3A0KA 5FZOA 4MHRA 1TMF2 1AVBA 1I5PA 2RE9A 5T5OA 3I54A 2C26A 2Y26A 3N9NA 3JBG1 4LBQD 1SEFA 4ATEA 2CSGA 2WA3A 3HQRA 2HWC3 2YGMA 4Z8BA 4FTEA 4ORFA 2C5DA 4Y3OA 4AI8A 5GLTA 3RZMA 3C7FA 1CZVA 2YY1A 5DG1A 1JOBA 1S2EA 5HBAA 5JPNB 2VQAA 3OUJA 3DXTA 3FBMA 4V2VA 2IC1A 1A34A 4Q4Y2 2HEWF 1J83A 4LBKA 2VL4A 2MHFA 1NA1C 4UW3A 4ZY9A 4PF1A 3VDCA 5HV0A 2A6XA 3VBHA 1PMJX 4W6WA 1F35A 2FCVA 3RJRA 3VBRC 4CCDA 1TMF3 1S4CA 1C5IA 1RUE1 3NQHA 1AX1A 1C8M2 5JOYA 4BOWA 3H3ZA 3KV4A 1JHJA 2E7QA 2W46A 4YSFA 1SBFA 3ZN4A 4GALA 3KWVA 3GZUC 2D6KA 1KD7A 3K3OA 4D6SA 4NHXA 4IEOA 3RG0A 3NMBA 4YGEA 5DAVA 5KC6A 2ZEWA 2DYCA 3O5SA 3R0RA 2G9FA 5JR2A 5G05L 1FPN2 4Q4X1 3WNXA 4I2OA 1LU1A 1BBT2 3UGGA 1W9WA 2J1UA 3RVHA 2BNOA 2RDRA 4IQPA 4AAPA 4CYDA 4WM7C 2ZOEB 1OSGA 1VBD3 3EJKA 4B1MA 1VB2A 2VCAA 4AEDC 2LS6A 3ZYBA 4BQXA 1AX0A 4Q1PA 2HWC1 2VU9A 1WBFA 5CB7A 4XETA 4AW7A 3V0BA 1VBE2 4HZFA 4IV1A 5IAXA 5KHHA 3W9AA 1QXRA 1T6BX 3TOJA 2WO2A 1UKGA 5GZFA 3ACGA 2XB6C 3VBRA 1OI6A 2UU8A 3NNMA 4AHZA 5C3SA 2HKXA 1V9U3 1QDOA 4QU1A 4YW5A 1AXZA 4XE9A 5GZGA 1POV1 1IPSA 1R092 5BNPA 4C0BA 1KFXL 1HRI3 1RUC2 1T6GC 4QPGB 2JECA 4DXRA 4WM7A 3J4UH 1VBB2 1XOYA 2LM3A 4A7KA 3MLLA 1NCQC 3KQRA 2ORXA 4CDWA 4HBNA 5L7OB 5C6CA 4IL7A 5JCTA 4W4ZA 3FHAA 3HEIA 1R1A1 2C6SA 2JDUA 4E4DX 4JGZA 3LF7A 1VBC3 5ACA1 1W9SA 4TLGA 4H14A 3TB0A 5FYHA 2WFF3 2WKKA 3WSOA 2J1SA 3J26N 2L9LA 2QQNA 5L7OC 1WCUA 3NV2A 5EFUA 1O3QA 5D21A 5FY9A 2J1AA 4RHV1 3B94A 1IPKA 1OT5A 3VBFA 1F5JA 3W59A 4M01A 4XFIA 4CUGA 3K4AA 5EWSA 2UY8A 4LO7A 1WBLA 1J84A 2JE7A 3IIAA 3L9JT 4Y20A 1EP0A 3C7OA 1RITA 2HYXA 2LW8A 4NIDA 2BBVA 3IN9A 3KGZA 2B45X 4PBOA 4OYUA 3SH3A 4DEQA 5C3OA 4JTOA 2WDBA 5FWJA 2BRTA 3HQUA 1HQLA 4IEQA 4CXWA 1YJKA 1V9U2 4AVAA 4E4SA 4WZFA 4Y24A 4OI2A 4JDNA 3NV1A 2Z42A 3OUIA 1LHNA 4C91A 4KGQA 1GNYA 2O8QA 2PELA 3MDPA 1NY71 4YVSA 2VOKA 4P14A 4ZXKA 2VZQA 5FZAA 3P3NA 5LASA 4ZONA 1GV9A 4MXVA 4MXWA 3GXUA 4ISRA 4P02B 3VLBB 1YUDA 4LTAA 2ZAAA 2YZ4A 3E6BA 3WG2A 3WLUA 2R062 2VNRA 2VMEA 3MZHA 1QXPA 3NO8A 2DF7A 1I1EA 3JB4C 2VZTA 5A7NA 2P3KA 2CYFA 2ILMA 3FHIB 4PQ9A 1W8FA 3WNLA 1Z78A 2RHPA 2WO3A 1L3JA 3WDTA 4K40A 1TQ5A 1UCXA 2WFF2 3M70A 1QOOA 1UIKA 3UGHA 3GZEA 5IK4A 4LUKA 2QDNA 3JCIA 4GH4B 2E6VA 1U5XA 3K46A 4LHNA 4FPCA 1JI6A 4I3PA 1XBFA 3TN92 3A7QA 1PX4A 2VNVA 4PQQA 2DFBA 4OMCA 3KZ4C 4YM2A 4CUCA 3VDAA 3ZYIB 3OYWA 3M8LA 3LOBA 1BZWA 2YMZA 1SLCA 1JBCA 2D6OX 3LA2A 1VB4A 3POFA 3U11A 5DUWA 1QJU2 1UY1A 2YBPA 2VOVA 1W04A 2BWCA 1V6MA 2MEV1 5FPVA 3VBSC 3P6BA 4BM8A 2XGXA 4EWDA 3WF0A 1L7LA 3UV9A 2RS32 4LBJA 3ZSMA 3ITQA 2VOTA 1CGPA 1RUF1 3CDZB 2H6CA 5FMDA 1LGNA 4K21A 2WS92 1ASJ2 1EV13 1PO11 3VZOA 5C3RA 4JDOA 1U12A 1IOAA 3VGIA 3QH7A 4LBMA 3ZXAC 3PVNA 4K8RB 3VL9A 1V6JA 4M3CB 4AVSA 5CKNA 4Q27A 2YC0A 3NNJA 1W6QB 2RJLA 5DZEA 4ZKTB 1AX2A 3VZKA 4CSWA 2DVGA 3O1PA 5C9AC 5FPXA 1YO8A 4H55A 1GNHA 3WG1A 1C1FA 1Y7BA 2Q0AA 3WDVA 2E7AA 3NAPC 2VCBA 3B5LB 1NQJA 5FR3A 4BQWA 4KWLA 2VQ0A 5FRAA 1WW5A 4UBGA 3ZYJB 4B29A 3HOBA 5BNOC 5BNOA 3CEWA 1VP6A 4DQAA 4XZPA 2QUOA 4DXZA 4FXGB 1YFXA 3J9SA 4CP2A 5JIUA 5EV7A 3ZKUA 2EAKA 4RYDA 2W95A 3R4DB 4LT5A 1DZRA 4ARXA 2JDYA 1GANA 3GZAA 3RPQA 2WZ8A 3DUIA 5A3MA 2GC2A 5GLVA 2DUOA 1A6CA 3NVCA 3OYWB 2HWD3 1OLME 4OULA 1H1IA 3WF1A 3LSDA 3MLJA 4J1WA 3RZGA 3WHUA 1Q3EA 5EIYB 4NN0A 3ACIA 1CAWB 5L73A 1W6NB 4XUTA 2W39A 4YM1A 4Y4RA 4H7LA 1QJZA 3PJYA 2E53A 5A3NA 3NJZA 1HJFA 1Q8OA 2JG9B 1XSQA 2Z5WA 2ZMKA 3NJXA 4YW2A 3RMYA 2QZ3A 4A44A 2RV9A 3HQXA 4JGZB 4IV3A 4QHOA 2I45A 5IVCA 1PGSA 3SEPA 1OLRA 2B9UA 3CJIC 4KG0A 4Q4Y3 3U07A 3E5QA 4IEXA 5FZEA 3PUAA 2WIIB 4GA9A 1LGBA 1O5UA 2YROA 3UYJA 5FY0A 5IATA 2E26A 5IAVA 2Y0OA 1A3KA 3I2GA 5CEHA 2UWCA 2GDFA 2FMDA 4IE6A 5EQUA 5FP9A 4GH4C 5F3CA 1DQ0A 1EAH2 1RVF1 1SBDA 1RJ8A 3U37A 3B02A 3JD73 2GNDA 1JU3A 4KI5M 4O9GA 1W6NA 3EYPA 3VHOA 3ZR5A 3I3EA 2BOIA 3LEIA 3O1VA 1TE1B 1NG0A 3CL1A 2HWB3 5LA1A 3WD5A 4QT6A 1RUF3 1Q56A 2AEZA 5I0RA 3I2IA 2BUKA 2VZOA 1RUJ2 1MS8A 1GYKA 2IXKA 2VVDA 4FXKB 1QIQA 4PIXA 4FPKA 1G7YA 1YQ8A 4CCKA 2HEVF 4RS5C 4BQ3A 3CHXA 3RGBA 1AXYA 1JZ8A 2RS12 1RHI1 2ATFA 3E6DA 3VBSB 4CCCA 3BTYA 1OH3A 2VCMA 4RHV3 1LOFC 5FZBA 3I3MA 3VZLA 1OD3A 2Z69A 3ZSKA 4BE3A 5A6YA 1RUD2 1RUG1 2XL9A 3ENRA 2ZABA 2A3WA 3RYPA 5KHKA 1WMFA 4AEDB 1CQ9A 5GJ6A 1R082 5LA2A 1Q8SA 4BXSV 3BU0A 5J1XA 1VBC1 2EXHA 1UZVA 4QDSA 2CGPA 4ZZ5A 1KJLA 2F4LA 2VMHA 2A5ZA 4HPKA 2XR4A 3POYA 4QHZA 2ZGSA 2Q8CA 4JC1A 5FYBA 4Q29A 5FCCA 3FZ3A 1LOCA 5KC5A 2XLGA 2GAUA 3MUZ1 4INDA 5FP7A 5FYSA 4CP1A 1W6OA 3PHMA 1F4HA 1KFUL 1NLRA 1O3SA 2ORZA 4FVVA 4ASKA 4UBHA 1MVQA 4LBQA 4LUMA 1JOPA 4JX0A 1W06A 2DV9A 2HWE2 4H3WA 2EICA 4P9IA 5IUQA 2WYSA 4TYSA 4QB1A 3WUDA 2WLPA 1DQ4A 1OKOA 2CL2A 2P4EA 4UW6A 2UY9A 2RR13 1IHMA 4LJHA 1O59A 3ZFFA 3ZSLA 2YDEA 3M3OA 3LIHA 2XHKA 3AXDA 4AFMA 5I0SA 3JXSA 3FE5A 2Q30A 3FHQA 3RMXA 1QF3A 4HONA 3DCQA 1WUVA 5C3QA 1REDA 1XRUA 1AYM1 2BGOA 2WZR2 4CUAA 4H2AA 3ZPOA 4XACA 4CU6A 2UYAA 1US3A 4XILA 3DYOA 2YPJA 1T2XA 2XVGA 1PHMA 2D97A 3BU7A 1DU3D 3PLQA 4CP9A 5IK7A 1Q8VA 2OPWA 1OC1A 1BYHA 3RZHA 4XJ8A 1RUG3 1JH5A 4QWNA 2TBVA 3S7EA 5T5JA 2W0XA 2D40A 3CU7A 1SCSA 3M1HA 1J59A 5BNPC 1VBA3 1W8WA 5A7PA 1QY4A 2R16A 2VUJA 1HQNA 2XUEA 3GALA 5CG9A 3NAPB 3T2QA 3GBGA 2WT1A 3ROUA 1VRH2 2QJVA 4QGMA 1TME2 5APAA 2J7MA 2VZUA 4NUBA 4BQ1A 3VD3A 3PURA 4MZUA 3O1TA 2Q1ZB 1YI7A 3K77A 3KSCA 4XDQA 5EJZB 3ZN6A 2I2SA 4U36A 4OI0A 1TMF1 1J3QA 2DUQA 3HT1A 4IGPA 1IKQA 2BGPA 5FLHA 2BNNA 5C9AA 3V56A 1J58A 1Q5OA 4DRVA 1UF2C 3WXPA 5K7PA 5FYUA 2OXBA 2IUWA 4XHBA 2FDHA 5CADA 5JDBA 2JKBA 3VDDC 2RDSA 1S0IA 4MVTA 4IEVA 4XCBA 4AQ6A 2XJTA 2VZ3A 2G9GA 1JUIA 3AJZA 4Q4W1 2TEPA 4YM0A 4CE8A 1W6MB 1QGLA 2QQIA 3I8TA 4XJWA 1YQCA 3R4UA 4M0HA 2W1QA 4Q4Y1 1W0PA 1AUYA 4DINB 1W8UA 2JB8A 1Y43B 1NE6A 3PU8A 3WP4A 2ZHNA 1HB3A 1GWMA 1DHKB 1EYBA 1POQA 3ZN6B 1OLMA 1AYN3 2W9XA 3WDXA 3WR0A 4PDWB 1E57A 4A6OA 2NP0A 2WAOA 4HVRA 3KCXA 1UYZA 3VUOA 3RFRA 4CDXA 1SFYA 4UOJA 2AACA 2B42B 3OGRA 3HN1A 3INAA 3C7EA 3KMHA 1H4GA 1UOJA 2XJSA 4XDOA 1CWPA 4N9HA 2ZX3A 5ABJA 5C4WC 4OUMA 1PX3A 3PIGA 4HT1T 4FPGA 5J7MA 4OQ9A 1PIV3 4CCMA 4Q5OA 1DIWA 2W1SA 2R7EB 1JYXA 1PGL2 1RUI1 4JGYB 4QXBA 2WZEA 4HKWA 3BTXA 5EJ3A 1HQWA 1UX6A 4UI9L 4WVWA 1JTZX 1G9DA 3V0AB 4HK9A 3ECQA 5J98B 1NZIA 4A45A 4N53C 2X09A 3CF6E 1XSRA 4B3NA 4UFKA 4OZXA 4AL9A 2A75A 3OBTA 3ZSEA 5ANQA 1H2MA 2QTWB 5F7UA 1AR91 3JU9A 4BCUA 4QDQA 5AFBA 2YG0A 2WWSA 5LK7B 1AHSA 1HV1A 1OQDA 1J1TA 3DYMA 5FFOC 4BIFA 1WCKA 3T08A 1BMV2 2ARBA 4FAGA 4OQ8A 5LBEA 4GKYA 5CNAA 3ZIWA 5CFDA 1LHWA 4CEWA 1OKQA 1LRHA 3CO2A 3MPBA 1CX4A 3OBZA 4ZS2A 3V0AA 3VBOB 5F5QA 1RUC1 3BTAA 3I3QA 4NWVA 5H9SA 4DO0A 5CA6A 4QX0A 4GWMA 2J22A 5DZFA 1UAIA 4QQPA 4F3JA 3UT0A 3MFAA 2JG8C 5B4NA 3M3EA 4AI0A 4W6YA 1ALYA 3RWKX 1V0AA 1W8OA 4AVBA 4CDUB 2VW0A 3I97A 5LATA 5TSWA 4FBFA 2PHFA 2PA7A 1UU5A 1XYNA 3LQCA 4DFSA 5KXCA 1C28A 3LGRA 1SLLA 2AGSA 2WZR3 3H1MA 4JZRA 4B1LA 5A32A 1O4YA 1HB4A 3A22A 5SV5A 1BLZA 1OXCA 1O8SA 4YARA 3O14A 2OVUA 3OB8A 5JPMB 2VXRA 2VBDA 1H4HA 4LIVA 4XZUG 4XF3A 4IEPA 4PI0A 1OH4A 1ZBA1 3MIDA 3WDWA 3AJYA 4AF9A 4YVSC 5ANNA 3LIGA 5IVJA 2XHNA 4B4QA 1HRV2 1AR83 3W5MA 2IXIA 4XJ9A 4CCLA 1Y4WA 1H8TC 4R9BA 1APNA 2W92A 5FZGA 4JRLA 1QNYA 5DDJ1 3UKVA 1NE4A 2AH2A 4G9SB 5H9RA 1KS5A 5CYYA 5EXOA 1OUSA 1KGYA 2RM21 2ZX2A 3OPTA 4HG6B 5KR7A 1DQ1A 1UOBA 2D5HA 2XVLA 3LDKA 3PU3A 1SLTA 5L9VA 3B01A 1RGSA 3N7MA 4PDWC 1HKDA 3AKSA 3IDCB 1PK6C 4AWDA 2YBSA 5EPAA 1LEDA 1UNBA 4RR3B 3CZJA 1QQP2 2QNKA 1QH7A 5F1RA 2P3JA 2YFZA 3ALQA 3IWZA 3SC7X 2CWSA 2Y8KA 3N9OA 5JSRA 5FO7B 4ZPIA 1MPXA 3IAQA 2W1WA 4A41A 2IXLA 1J3RA 3HT2A 2BPA2 1I3HA 2WNOA 1C1LA 2RS52 3N9MA 4Y5Z0 4IERA 1VBE3 3WF2A 4A7ZA 1HDKA 4CVUA 1AR73 2KXLA 3POSA 1RJ7A 3JB8A 4NOTA 4CZSA 1QOTA 1ND2C 3ZFFC 5KXBA 5C70A 4UF0B 3UJQA 3ZXLA 3C7GA 2P6CA 3D4KA 1QHDA 4C8DA 5F9TA 4GWJA 5JOZA 5FO9B 2WRAA 5K0UC 3VKLA 4BK4A 5FPZA 2PAEA 3RRDA 3TEWA 2XJVA 4YZ4A 5CISA 1DGRN 5B4XA 2LTNA 2Z79A 2MEV2 3PMEA 4LBNA 4TTGA 2ARCA 1C3HA 2V72A 4AOCA 5IFPA 3LWCA 4ONUA 3USSA 1Q43A 1ZZ8A 2VW1A 1DP0A 2HWF1 3ORJA 4P5YA 4R8HA 2B5HA 2VNOA 4C1XA 4N43C 3K3NA 4FPYA 5FYIA 3X29B 1V6KA 2EIBA 5JXGA 1UXZA 3ZMOA 2ZGLA 1A8MA 3LDBA 5JWPA 2VBBA 4RFT0 4C90A 1XNAA 3S30A 1SPPB 4ASMB 1JZ5A 3MBWA 1F31A 2VZ1A 5JI7A 4AQ2A 2WUHA 4XIKA 1U5ZA 5FXZA 3WHTA 1QJEA 2OZ6A 5T54A 1POV0 4QX7A 4CDXB 1F4AA 4LITA 3U0ZA 4XBQA 3H42B 1K5MA 3FBYA 5ABJB 4NROA 4XIOA 4BYYA 4IGQA 5CFCC 4EROA 2ZHKA 2Q1MA 4MGKE 1NKGA 5K8SA 1PMHX 3IAPA 3WNOA 4QQHA 4PCRA 3CNAA 1W8HA 4RGGA 2DVDA 1XJAA 4L92A 4PIYA 3GBWA 4LO6B 1QJX1 2D3SA 1MZ6A 3FLPA 1OBNA 4AHXA 4EZHA 3R4SA 2HWE3 3O7OA 3ES4A 5FUIA 3A23A 1GQGA 4OUEA 5A7WB 2WN2A 4LKSA 4MV2A 4Q2FA 3T3YA 4Q0QA 4P9YA 2E9QA 4K6BA 3GJAA 3ZFEB 1ENXA 5BNOB 4EN6B 3VBUC 1ND3B 2GP3A 1TEIA 4CCNA 2DVAA 3H0OA 1GUIA 4NIIA 1Z7S1 4Y4YA 3HNMA 3UKNA 1AR72 1ND3A 3Q9OA 1FXZA 1YXWA 3CJIA 1CPMA 5F5IA 2CHHA 1GP4A 2XL7A 3LAGA 1UYYA 2E51A 4KGGA 5CKQA 3WX5A 3I2JA 1UQXA 3THCA 2ZGPA 4KU7A 2XJUA 4CA9A 1UN1A 5DXDA 2BTVC 2XJRA 3IDBB 4I01A 3N36A 5A7WA 5CVRA 1G9BA 2BZDA 3IM0A 4AG4A 3HAGA 1ENRA 2PYTA 3MW2A 2VE1A 1BXHA 3ZX7A 2Y64A 2C9KA 4OI1A 2BU9A 4MGQA 3CLPA 4TSVA 2D44A 1EY2A 2VVEA 3L2YA 3OCPA 1PZ7A 4LNVA 4XFHA 3CJIB 3D3AA 1KXGA 3WP6A 1Q8PA 1O6UA 1H6YA 2PAKA 4EWAA 4ZXEA 1W0OA 3CJXA 3JD72 1UD1A 4OHWA 3VKNA 4CEYB 1DLLA 1RHI2 4QPGA 4GKXA 1HRV3 1HXS3 4B7KA 4AHYA 5DQ0A 5JOWA 1QOSA 1LHOA 4META 3HWJA 1GZ9A 3I7DA 1NOVA 2FD8A 2BJSA 5A3OA 1H8TA 3TBDA 1EPWA 1H2KA 4QB6A 4CCJA 2YYOA 3MIBA 2VUCA 5IHRA 4NAOA 3O0WA 3RI9A 1VLNA 2HWB1 4KBZA 1OA4A 2HWD2 4N53B 3K4DA 4W6XA 4J6GA 2J1VA 5F6KA 2WWUA 1H1AA 2BVVA 1HN0A 2WL1A 2JEMA 1VPHA 5FXXA 1PVC1 4IDZA 3QACA 1WA4A 2DCZA 3T4VA 3KT1A 1ULCA 4EE2A 1KDKA 3BUCA 1QJY2 1S0EA 2O0OA 2R072 1YFYA 4YFZA 2R063 4CDUA 1AR62 2AUYA 1FNZA 2VTXA 5FZLA 4AI3A 3S0MA 3MIFA 4HN1A 2YU2A 2G9ZA 1NLSA 5JMOA 1PVXA 1BEV1 2VBPA 3AMPA 1XNDA 4FPHA 1HX6A 5CFCB 3ZXDA 4LK6A 3VBUB 4YGDA 1TNRA 4W8JA 2PXJA 2QQJA 2AEYA 3R05A 4K3UA 3RZZA 2XXZA 2YFUA 4NHLA 4QQOA 2A71A 2ARAA 1WW4A 2WNVA 2YGLA 1HJGA 1GBGA 5JZGA 1UXXX 2EXJA 5C8CB 5FZCA 2VTFA 3AFKA 4XFFA 4WVVA 2EIDA 2NLRA 3AKPA 1XE0A 4QAWA 1H9WA 2DU0A 2VUDA 2PTMA 2WLQA 1J3PA 5KHJA 3AMQA 3MFCA 2HLEA 2VMDA 3C3VA 2P34A 1UO9A 2ZGOA 1AF9A 4CU9A 1VMFA 3NNLA 4NE9A 2KD7A 2XBO1 4N43B 4FAHA 4HVQA 1GZWA 5A32B 1IG3A 1NCQA 5FO8B 4EQVA 1SZBA 4CXYA 4ZU7A 5IYYA 3LKJA 1YRZA 3P3PA 4M4RA 4QKDA 4I0WB 4BXFA 5CZKA 3MV11 5K0UB 2N7GA 4NAMA 1BJQA 1UYPA 2O1QA 4XF1A 2WR9A 1VBD1 2ZX1A 2A3XA 3ELNA 4E8CA 4FFIA 4JDMA 2FDKA 5FZKA 4NRPA 5DUXA 2LROA 1NA1B 1ULGA 5DMYA 4H7MA 3AYAA 4MH0E 2VXJA 5JVVA 1U0AA 3RS6A 4D7TA 5ACA3 4FPLA 5BNNC 4U2AA 5AC92 2JE9A 3HNBM 1B35A 2UYBA 2XDVA 5FXWA 2A3YA 2YBKA 2BEOA 4EN8B 2A6YA 4ZHNA 2RDNA 4I02A 2GMMA 4RR3C 4HKLA 4NMIA 4I3GA 2E33A 4M00A 3ZSJA 5CFCA 4HKOA 5F6LB 4AE2A 4LO8A 4B8EA 4JRAA 3A4UA 5HPOA 1CJPA 3S5AA 4Q0SA 5K0UA 1G86A 3RI8A 1DDLA 5LW9A 2ETEA 1PGW2 3K48A 3NKGA 2WWJA 1XPWA 2X05A 4GB31 4XUNA 2D6PA 2WSUA 4AZZA 1FNYA 1FOD2 1STMA 4A4AA 5FWEA 5J09A 3WV6A 3B93A 4LA3A 1LOBA 3LEGA 4RS5A 4URTA 4CUBA 1UY4A 4D8MA 5DDJ3 1W2UA 1C8M3 1VAVA 2DVFA 3ETQA 4Q0VA 5ISLA 2DCTA 4A3XA 1QJX2 3F2ZA 3DKWA 4CXXA 2RS13 4AEKA 5IVYA 1SCRA 5LY1A 4FT8A 4GMP3 3SLIA 2IVJA 3IPVB 2XJPA 4A3ZA 2Y6FA 5C33A 2YV8A 1RMU2 3KCYA 5D8AB 2PHTA 2HH9A 1RC6A 3AP6A 1NQDA 4MG2A 4IV1C 1LCLA 2P1BA 2VZSA 1V00A 5LA9A 3NJYA 4AVTA 4E4ZA 1RB8G 1WMDA 2RMU1 3LB9A 1UMHA 2D98A 2CAVA 1VJ2A 1SDDB 1AR71 3AX4A 2ERFA 3OTFA 3SCFA 4D6RA 3O0XA 4YZ2A 1WW7A 2JDZA 4XBLA 2I07B 3DPRC 3E6CC 1YEWA 3UL2A 4Y5TA 5BPXA 3RNSA 5A3PA 3OGVA 2EXKA 4LKFA 1K42A 3MW4A 5I8YA 1FV3A 1FT9A 1XE7A 2JDMA 4DB5A 1XXNA 4O61A 3J7HA 5LRSA 4QM8A 4XUQA 3O1RA 4XEZA 4OI4A 4XYXA 4HETA 2YXSA 4IEUA 2A1XA 2QVSB 2XONA 4BISA 5HCAA 4LMFA 1VBB1 2SLIA 3B3QE 2G1MA 3J8F3 1SMVA 5T52A 3MV01 1MQTC 5T50A 5IJRA 2D3RA 1F9KA 4QMAA 4AGVA 2P2KA 2XKPA 1FYUA 4CDWB 2AYHA 1X36A 2W94A 5D1IA 2H6BA 3VBOA 4GULA 2LUWA 4GWNA 1O5LA 1W2NA 4LE4A 1DBNA 2YHJA 3WW3A 1V6NA 5JZGB 2ZGRA 1JZ4A 4RHV2 3KF5A 3I3DA 4MXWB 1LOGA 3SKJE 1HRV1 1W8ZA 1XNKA 3B69A 1H6XA 2GSYA 1VRBA 2AZ5A 4UW5A 3ZDVA 3P5BA 2HBUA 3ACFA 2QQVA 3H3UA 4MX3A 2R6QA 5FMCA 4AAXA 3MUY1 2VNGA 2BP6A 5CKMA 1W28A 3FJSA 1BBT3 1CN1A 1HN1A 5LBCA 2DCJA 4LK7A 3N9PA 3VD9A 1F5FA 1ZZBA 1BEV2 1W0NA 3B9CA 3LEMA 5AC93 4AGRA 1QQP1 4FQ4A 3DXUA 2D43A 1ASJ3 1EV12 1YQ6A 5FLJA 3ATGA 1JYTA 4C1WA 4QPGC 1ZRDA 1S55A 4A7YA 1D4M3 1OOPB 4KWUA 1E5RA 4Q4W3 4GMP0 5A80A 5FZMA 4LHSA 1N1VA 4A42A 2V5YA 1NA1A 3C7HA 3MICA 1X82A 5LZ6A 1ZYBA 2CNAA 2ZJCA 5BV6A 1COV3 2K0GA 1JZ7A 2ADDA 1YC61 1UY0A 2QQOA 1W9YA 3ABZA 3J7MA 3KV5A 3AKRA 2VCCA 4RQPB 1SHWB 3AM2A 4WZCA 1S0BA 2BOJA 2FZ1A 3SH4A 4CTEA 1RYYA 4Y1YA 3ON7A 3AMMA 4B7EA 1OFSA 4GD4A 1GNZA 2OX0A 3KS7A 5FQ0B 1WD4A 1FMD3 3W21A 4XBNA 2NN8A 1G8WA 2IXHA 4PI2A 1XC6A 4YG6A 5FXVA 5BY5A 4SLIA 4K20A 2XQRA 4N53A 1HV0A 3SXWA 2OZJA 2Y6KA 4IETA 1CR7A 2GP5A 2Q1FA 3G6JB 4IXLA 3M2MA 4XFBA 4YZ3A 5B2GB 1OVPA 4UYBA 1DQ5A 1ULPA 1GMMA 3VBHB 2X5IA 1V70A 1AXKA 1RL3A 1UIJA 1VBD2 3GYDA 4NPRA 2ZXQA 4XAAA 3BGAA 4YWAA 3ST7A 5GLZA 2QKDA 5CG8A 5F8PA 3NL1A 5LB6A 3T1MA 3R6SA 2BGCA 4X8NA 4XAEA 4XF9A 4LORA 3Q8AA 3T2PA 5FZ1A 5J96B 4Z92B 4A2UA 5FJKA 3OGGA 5AC91 2UWAA 5FQ0A 1MR5A 5DZGA 1JN2P 3GHMA 5FYYA 1N3OA 2DU1A 4MOAA 5I8TA 3O0VA 1ULEA 2DDUA 4QPIB 2OUJA 1S0GA 1QEXA 4Y26A 4AHWA 2R1BA 1OVSA 2BV4A 4OLLA 4RFRB 5FKCA 3TEXA 4QDRA 4BK5A 4OHXA 3EXUA 4FOWA 4ZS3A 4JHTA 5T5LA 4XOGA 1RUE2 4UFMA 5JLVA 2W91A 5IVFA 4OVEA 4NRMA 1PNFA 3WF3A 1RXGA 5E16A 1X7NA 1XB9A 2DCYA 3U78A 3DEMA 4WM8C 3HR9A 1OHFA 4GIQA 2PHRA 2FMYA 4EYUA 1N1SA 4IUGA 4RQPA 1YIPA 4FO9A 5T55A 5A33A 1TZOA 3N9QA 4Q4X2 4BDVB 2ES3A 1BBT1 4O7XA 1JYCA 2Q4SA 1ODNA 4FOVA 2AREA 2VZPA 1JYWA 1CPNA 4COVA 2GNBA 2NPIA 4L8QA 3N7LA 2W5FA 4HOOA 3OEBA 4BQ5A 2OQ6A 4L9BA 1G6NA 1PVC3 2JDAA 3BVCA 3J7NA 2DWRA 3JUUA 1SQ4A 3VD7A 5KXDA 1NZCA 2WN3A 3MIHA 2X5IB 1R093 1MS3A 5KHGA 3DN7A 3ZXGA 3Q8CA 3IB3A 3ILRA 4WV8A 1ULOA 2ZGQA 4YRDA 2ZA9A 2WT2A 1B35B 3LDRA 5A1FA 3V0BB 3KF3A 1UWWA 2GZWA 4EN9B 1RMU3 2EVXA 2AENA 4BHPA 1X9TA 1O8PA 2BDRA 4CPBA 1GKBA 3D8CA 3U10A 1ACCA 1R091 2EA7A 2W47A 5FREA 3E5UA 4ATFA 2Z4FA 4L97A 3J8F1 1EAH1 4N7UA 2ZMLA 4V1PA 5FUNA 1JMUB 2KM2A 3MW3A 2OT7A 4QXHA 2IFWA 2PLV2 4HLTA 3DPRA 3POEA 1QNWA 2ZHLA 5DAPA 5FZDA 2WABA 3PUIA 3U4SA 1BCXA 1OA3A 4LKEA 1GFF2 2Y34A 3DPRB 1ZRRA 3GBFA 1Z0HA 3GZTB 1WWYA 4AVVA 2FDIA 1IG0A 4WVZA 4Y1ZA 5H9QA 2CWMA 4GMP1 4AEJA 4DMIA 4Y33A 5L9BA 3MF9A 4WVMA 2QZ2A 2ET1A 2RS11 1CIWA 5FPUA 5FKBA 1JOJA 3AZYA 4OZOA 3A21A 1U5IA 4HN0A 2XVKA 1J1LA 2QQLA 2YUEA 3FFQA 4JQRA 4YZ5A 2HWD1 3D0JA 3U1XA 3NKTA 2WFPA 3D0SA 3EB7A 1MQTA 1VRH3 4LBLA 3V64A 3POJA 1DFQA 2RMU3 3WNPA 4IEZA 2YPDA 2X8KA 4JAAA 5FMBA 3ZFFB 4UWDA 4LOTA 1V9U1 1FPN1 3BODA 4FP2A 1CAWA 3GGLA 3USUA 1ND2A 2J42A 4LOSA 3MF6A 5AFEA 2WNUC 1GOFA 1VR3A 2R043 1UY3A 1HRI2 1RUC3 2BQPA 2HWE1 2VTXJ 1GZCA 4QX1A 1BKZA 3ASIA 5F37A 1RUH3 5JAXA 1DZQA 3B7MA 4XABA 3I3BA 4L99A 2D6MA 3IZOA 5K9YA 3MGUA 4Y20B 2RR12 4JV4A 4XMIA 4AFBA 4E2GA 2P37A 4XXAA 5HCFA 3JQXA 2QCSB 3JQWA 1AYN2 2PHDA 4R52A 3K4ZA 4RR3A 4MGZE 5FBJA 4AI9A 5A3TA 1UZWA 2DTWA 2VMGA 3ZDSA 2FDJA 4N8MA 4ET7A 3VBHC 4OUSA 3ZYPA 2XBO2 1VAMA 3BOWA 3FLRA 1K12A 4M0NA 5CFDC 2UWBA 2E7TA 4HVOA 2JJ6A 3WOGA 4BLIA 2X5IC 1IPJA 1MEC2 2VC9A 4X8PA 2YC2A 5D2AA 5FZIA 1PIV1 1OOPA 2VY0A 3PVOA 4IV3C 1W6OB 2W3JA 2V09A 1MS0A 2QQWA 4HSLA 5IK5A 3KD4A 3ZN5A 1TME1 1OA2A 1GP5A 1RXFA 4R9DA 4YVWB 4NHMA 1RUF2 5BNPB 2TNFA 5GZDA 2ADEA 4AVCA 1FAYA 4WBBA 1ASJ1 1PO12 3VZNA 4K9SA 5EYXA 2IVIB 1K45A 1A8DA 5LBFA 4DS0A 4NIGA 1QQP3 1GZWB 1UX7A 4CU7A 5C5TA 2OS2A 2VGDA 2BWAA 4NHKA 2R30A 3ZKYA 3WVJA 1MVEA 4V2WA 4RGAA 3OD4A 2HYKA 3AZXA 4MADA 4DXTA 3ZFGB 1MZ5A 2H0BA 3LZZA 1QMJA 4M4PA 4RD7A 2HJIA 4COWA 1G9FA 3I2OA 2EIGA 4R4XA 4LXLA 1PO21 3NNFA 1RUH2 3AP7A 2W68A 3H8UA 2VR4A 4NR1A 2JG9C 3GM8A 1PZ8A 4AFCA 3ZFEC 2GN7A 1EAH3 4FOQA 4RL7A 2B9VA 4QPIC 4D7SA 5FK8A 1CD3G 3BCWA 4G4FA 4UFIA 5FK7A 4IEWA 2GC3A 5L19A 4FFFA 1X9PA 1NCRB 3KV9A 2F4PA 1I9RA 1LAJA 1DQ6A 1GOHA 4XTMA 2R1DA 1JXNA 1BVP1 4NIAA 4CP9B 1O4TA 2GU9A 4RQPC 4ZZ8A 2ZEYA 2XG3A 3MI8A 3UGFA 4DIQA 3M3IA 2VMCA 1OLQA 1JYVA 2A6VA 3KVAA 4LR4A 2R0HA 2VJXA 2V4VA 3DL3A 2JIGA 4MO3M 5FPLA 1Y9MA 1PGL1 1MS4A 5EZWA 3UKTA 1BVVA 1GOGA 3TN91 4YGBA 2CY6A 1TNFA 4CDQA 1RUD3 4BMEA 4O65A 2ZGMA 4QXCA 3RDIA 2V5DA 3KLSA 1AJKA 2VMFA 4KL1A 1AR81 2B39A 4ARYA 2FHRA 3N4MA 3N7JA 3O1MA 5CAZA 3WP5A 2V4AA 4AFAA 4NVPA 1SG3A 4WVMB 1H9PA 5DABA 3ZFEA 1W6PA 4CDXC 2JG9A 1BQPA 3KHCA 3ZXKA 3SKVA 2RS31 1W6PB 5FYMA 2JE8A 1W8TA 1FI2A 1HXS1 1VIWB 3QD6A 4O9EA 3ZXEA 4AQSA 4BB3A 5DG2A 2WJSA 2LRPA 5E8AA 3IMMA 1JS9A 1NXMA 2PHUA 3J8F2 3PTYA 4QM9A 1LGCA 1MACA 1WCDJ 3HVDA 4LKDA 2Q8OA 5J48A 5F2WA 1C57A 2PAMA 4JKLA 4DPNA 4JGZC 4YW6A 3S6PA 2PLV1 1RUJ1 2ZBJA 5FY8A 3IIIA 5JMCA 3KQ4B 3V65A 2GNMA 4XPVA 4UFJA 4JGYA 1YQ5A 3SMHA 1L7QA 3O12A 5LCWL 2EIEA 2OPKA 2HBTA 4XQDA 4XURA 3NJVA 4HSJA 1QJFA 3LCPA 1C5HA 1C8M1 5LEKA 1ND3C 4KMQA 3ZXFA 4BIOA 2A73B 3MIEA 4OMDA 1ULFA 4P5HA 1LOEA 3IBMA 5FJHA 1ODMA 1XE8A 4CCEA 1IQAA 3BALA 3WEZA 3NV4A 2P6HA 3AP4A 3FMGA 3LOIA 2DBIA 4UFHA 2GH8A 4L2NA 3M7AA 4AK3A 2A70A 1GU3A 3BPZA 4OHYA 3QLQA 2JWPA 4GB33 3VBFB 4E2QA 3EQEA 1W2OA 3HPNA 4BJ0A 4Y1VA 1RINA 5FMOL 1UPSA 2LALA 3AYEA 4TWTA 1JZ6A 2ZGTA 1ZBE3 3BI3A
chains in the Genus database with same CATH topology
2FDJA 3I3QA 4QKFA 4CXXA 3BIEA 4NIGA 3O1MA 3T3YA 4OCTA 4CXWA 4CXYA 3RZKA 3BTZA 5DABA 3O1TA 3BKZA 3S57A 3S5AA 4O61A 3LFMA 3O1OA 4IE5A 4QKDA 2FDFA 4QKNA 3KHCA 4O7XA 4QHOA 3O1RA 2FDGA 3KHBA 4IE0A 3RZMA 4NROA 2FD8A 4QKBA 4NIIA 3H8RA 3I2OA 3RZHA 4IE4A 4MG2A 2FDIA 2IUWA 4RFRB 3I49A 4IDZA 3BTYA 2FDHA 2FDKA 3T4VA 4NRQA 4NPMA 4NRPA 3RZJA 3I3MA 4IE7A 3BUCA 4ZS3A 4JHTA 3H8OA 3RZLA 3O1PA 3O1UA 4IE6A 4NPLA 3O1VA 4NRMA 5F8PA 3H8XA 3T4HB 3RZGA 3BU0A 4ZS2A 4MGTA 4NIDA 4NIHA 4ZHNA 3BTXA 3O1SA 4NJ4A 3BI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FDJ A;  3I3Q A;  4QKF A;  4CXX A;  3BIE A;  4NIG A;  3O1M A;  3T3Y A;  4OCT A;  4CXW A;  4CXY A;  3RZK A;  3BTZ A;  5DAB A;  3O1T A;  3BKZ A;  3S57 A;  3S5A A;  4O61 A;  3LFM A;  3O1O A;  4IE5 A;  4QKD A;  2FDF A;  4QKN A;  3KHC A;  4O7X A;  4QHO A;  3O1R A;  2FDG A;  3KHB A;  4IE0 A;  3RZM A;  4NRO A;  2FD8 A;  4QKB A;  4NII A;  3H8R A;  3I2O A;  3RZH A;  4IE4 A;  4MG2 A;  2FDI A;  2IUW A;  4RFR B;  3I49 A;  4IDZ A;  3BTY A;  2FDH A;  2FDK A;  3T4V A;  4NRQ A;  4NPM A;  4NRP A;  3RZJ A;  3I3M A;  4IE7 A;  3BUC A;  4ZS3 A;  4JHT A;  3H8O A;  3RZL A;  3O1P A;  3O1U A;  4IE6 A;  4NPL A;  3O1V A;  4NRM A;  5F8P A;  3H8X A;  3T4H B;  3RZG A;  3BU0 A;  4ZS2 A;  4MGT A;  4NID A;  4NIH A;  4ZHN A;  3BTX A;  3O1S A;  4NJ4 A;  3BI3 A; 
#chains in the Genus database with same CATH topology
 5IW0 A;  4YM3 A;  3H1W A;  4OCT A;  5A6X A;  2ZGK A;  4AFD A;  4S2H A;  4MYE A;  3ZYG A;  4D3W A;  2RM2 2;  4XFC A;  5E88 A;  3MLK A;  5FZ8 A;  3IDA A;  3ZM8 A;  5GLU A;  3N9L A;  2CAU A;  3EO6 A;  3OPZ A;  1HRI 1;  1R1Z A;  4KG8 A;  5I8S A;  3TYJ A;  1LNS A;  1VAK A;  3UJO A;  5C3P A;  2EAL A;  1MEC 3;  2WYF A;  4QX5 A;  2WT0 A;  3HBZ A;  4E2S A;  1UY2 A;  4UFL A;  1O3T A;  4ASL A;  3VN4 A;  1PM4 A;  4S2D A;  1S2K A;  3T1L A;  4P9L A;  2ZZJ A;  3WW2 A;  3WW4 A;  2VG9 A;  1X33 A;  4XUP A;  3IMN A;  3N7K A;  4I09 A;  3H50 A;  1AYN 1;  1QH6 A;  2ZGN A;  3FUO A;  3RQ0 A;  1RVF 2;  1TG7 A;  5FPB A;  3WY6 A;  1KS4 A;  4Z2A A;  2RS5 3;  3T0D A;  5F3I A;  2E31 A;  3ACL A;  2J1R A;  4MSV A;  2WIN B;  1GP6 A;  2DFC A;  4GH4 A;  3RWN A;  4YW7 A;  3Q8F A;  3AYD A;  4D6Q A;  1ZVF A;  2WBK A;  5DPN A;  1K3I A;  3HNY M;  5LWB A;  4TZD A;  1LB2 A;  2JD9 A;  1I6X A;  1D7P M;  3A0N A;  1ONA A;  4PLN A;  3WQ1 A;  1VE0 A;  1OQ1 A;  4E27 A;  1RTV A;  1VRH 1;  2Y6L A;  3H9A A;  4M3C F;  3RYR A;  4AQT A;  3G7D A;  1MQT B;  1OUR A;  1ENQ A;  1PIV 2;  4MGS A;  4AED A;  1KDM A;  2R04 2;  3H8X A;  2JEN A;  4J1X A;  3U4X A;  4MGT A;  3VHN A;  4CCO A;  1A78 A;  5LRR A;  2R0F A;  5A6Z A;  1RUG 2;  1IS3 A;  4XXP A;  5FYV A;  4D0Q A;  4N90 A;  1ND2 B;  2XWJ B;  4YLZ A;  3ZMN A;  2XH6 A;  1G9A A;  1WA6 X;  3P1I A;  1M4W A;  1RUE 3;  2Y38 A;  3WQ0 A;  4IE5 A;  3K2O A;  3EHK A;  1O7F A;  3QCW A;  5FYT A;  1LHU A;  1VMH A;  3JZV A;  3WNM A;  1GR3 A;  1O91 A;  3LE0 A;  1RUO A;  4Q4V 3;  1BK1 A;  1D4M 2;  3E5X A;  5F3G A;  2JB4 A;  3MO4 A;  5C71 A;  5SV8 A;  1WCQ A;  2DTY A;  5KBF A;  3AZZ A;  2E63 A;  3AZW A;  3SCG A;  5GAL A;  3OGJ A;  2OKX A;  3ZIX A;  3OY8 A;  4DUX A;  3KM5 A;  4XDP A;  2FCT A;  3PDQ A;  5GZC A;  1MZF A;  3OY8 B;  1DG6 A;  3ZXJ A;  3OOX A;  5FZH A;  4JHZ A;  3I4I A;  1UKR A;  1UZY A;  4HK8 A;  4Q1R A;  1UL9 A;  3WIN E;  2C1F A;  4QHB A;  4DUV A;  2ZX4 A;  1UU6 A;  2J1T A;  3HBK A;  2FDG A;  5JXI A;  2XWB B;  4LLF A;  1AYM 2;  2WZR 1;  3MHZ A;  2VAU A;  5LY2 A;  4QXK A;  4W50 A;  5E89 A;  4FFH A;  4HMZ A;  4PIZ A;  5ERL A;  3C2U A;  1CZT A;  4YVS B;  4KWJ A;  4EN7 B;  4HXC A;  2RM2 3;  4ZU5 A;  4P9G A;  4GAZ A;  3KT4 A;  2C24 A;  2V73 A;  1UOG A;  5EP9 A;  2JX9 A;  2XLA A;  3NWK A;  4XMA A;  2RS3 3;  4YVW C;  2F6B A;  1GWL A;  1PZ9 A;  2Q8E A;  2OUH A;  4JCK A;  3ZYH A;  1LUL A;  1LHV A;  4ISQ A;  4ZU4 A;  5FDB A;  2QE3 A;  3ZR6 A;  1LKN A;  5FY4 A;  1QKQ A;  1ZBA 3;  2NQY A;  4DY5 A;  5BYN A;  1AR9 2;  3APB A;  1CVN A;  4JKM A;  5AVP A;  1GWK A;  2IWG B;  2EF6 A;  1IS6 A;  1YIF A;  3CIH A;  3PVE A;  2Y6H A;  4AGG A;  5H9P A;  3LA3 A;  3AP9 A;  3I49 A;  1PK6 A;  2GME A;  1S0J A;  4Q4V 2;  4I0B A;  1EUT A;  4L11 A;  3OG2 A;  4Z2W A;  4HFS A;  1HXS 2;  5M0T A;  1QWR A;  4DY3 A;  2WSV A;  1W9F A;  2CV6 A;  1W8N A;  4HAN A;  3ILN A;  3PJQ A;  3B00 A;  1HB2 A;  1N1Y A;  2ZZQ A;  4LBO A;  4E4H A;  1W39 A;  2DVB A;  4JTN A;  1WMX A;  2WQZ C;  3NAP A;  4Q4W 2;  5GKA C;  1IGO A;  1MZE A;  2WNE A;  5A7S A;  1BK0 A;  4CDQ C;  4FOY A;  2ZAC A;  3UNP A;  3UET A;  1KRI A;  4XF4 A;  2D7F A;  5DN2 A;  1ULD A;  1LEN A;  2DBN A;  1AL2 2;  1L7R A;  5LA0 A;  3BIW E;  3JD7 1;  3PVB B;  3E1F 1;  5CU1 A;  5EHD A;  4BPZ A;  1O3R A;  1QJX 3;  3PUQ A;  4GQ7 A;  3GJB A;  1DGL A;  3GCW A;  3CMG A;  4PJY A;  5DUV A;  3TAY A;  1R08 3;  3FFZ A;  1DGW X;  1WZX A;  3OBR A;  4BQ4 A;  3VZJ A;  2P3I A;  1ZZ7 A;  4LIU A;  1PO2 3;  4QX3 A;  4K7J A;  5FP8 A;  1UMZ A;  2VVF A;  2VUL A;  5JOX A;  3ME2 A;  1X8E A;  3AMH A;  2I74 A;  1QU0 A;  4COZ A;  2JG8 A;  3EMR A;  5FY1 A;  2WO7 A;  5FLI A;  3QH6 A;  5J3U A;  3FC0 A;  2ZCW A;  4AI2 A;  2P3Y A;  4KQ7 A;  1RUI 2;  3FX3 A;  4Y1U A;  2Q5T A;  2JIC A;  2KA3 A;  4AR2 A;  1SLB A;  1S0C A;  1CIY A;  2XML A;  3OF1 A;  4BU2 A;  3VBR B;  5C7G A;  1D2Q A;  3SQO A;  3WG3 A;  5I91 A;  4YYO A;  1COV 1;  3IDE A;  1CZS A;  3AKT A;  3OGS A;  3T30 A;  2VMI A;  4MUV A;  4S2F A;  1X8M A;  2R49 A;  4ITC A;  3WF4 A;  2ZGU A;  5DAX A;  4IES A;  3SHR A;  1GQP A;  1NT0 A;  1FMD 2;  5CFD B;  4PBP A;  3VKO A;  2Z2S B;  3WCR A;  5HCH A;  2K2S A;  4HPK B;  2YC4 A;  4LEJ A;  1N3P A;  1H1M A;  1AJO A;  4FSJ A;  1ST8 A;  1OQE A;  1GLH A;  1XU2 A;  2RS5 1;  4G3Y C;  5F32 A;  1HB1 A;  3AVS A;  1UMI A;  3RYK A;  1GQH A;  1EUU A;  1N47 A;  4XJZ A;  3VDD A;  2FZ2 A;  3MEP A;  1WLD A;  4DNY A;  3GF6 A;  3N3H A;  4QKB A;  1OPO A;  1WME A;  3TEZ A;  3LD8 A;  3F95 A;  4IV3 B;  2ZEZ A;  2GC1 A;  2WA4 A;  1W05 A;  2CGO A;  4FI9 A;  5JSP A;  4XHX A;  1MEC 1;  1SPP A;  1ZM1 A;  2ZHM A;  3BYW A;  3IKW A;  1S0F A;  3EBR A;  5F39 A;  1OMI A;  4R4Z A;  3TNP B;  1LEM A;  3WW1 A;  1V6O A;  5FYZ A;  3AFG A;  5C4W A;  5ABJ C;  5IT6 A;  4COY A;  5AVA A;  2XJQ A;  4MGY E;  2VEC A;  5GLW A;  1JUH A;  5KHI A;  3POB A;  2HWF 2;  2GAL A;  1VMJ A;  4LO5 B;  2PHW A;  5IK8 A;  3VB9 A;  2R04 1;  1H0B A;  1ZX5 A;  3KVB A;  4PLM A;  1OPM A;  1W99 A;  2PN5 A;  2XPJ A;  3OEA A;  3I59 A;  1ZBE 1;  5FZ4 A;  3POI A;  2MEV 3;  2PQQ A;  4KH9 A;  5FP3 A;  3HMY A;  1LOD A;  3TEY A;  5IWF A;  4F83 A;  1ZBA 2;  1Q8Q A;  2P5B A;  1VBA 1;  2B4K A;  5E6H A;  2HEY F;  3AYC A;  4NPM A;  4I30 A;  1MS9 A;  3T0A A;  4IE7 A;  4LBQ B;  3BN6 A;  1O4Z A;  2DCK A;  3KCC A;  5DDJ 2;  1PO2 2;  4KNC A;  4E8D A;  1RUH 1;  3CZU A;  5CIR A;  5EJ1 B;  1NX9 A;  4JKK A;  2JXA A;  4EWE A;  2RJK A;  4DZG A;  2G4I A;  3JBG 3;  3QOP A;  1JYN A;  2BER A;  4F8A A;  1GZT A;  3KGL A;  3ZOI A;  4FP3 A;  4N43 A;  3PUH A;  4GB3 2;  2WNV B;  2NMN A;  2GNT A;  2QQU A;  5C9A B;  3K75 B;  1XU1 A;  5HXV A;  1IZ3 A;  5A3W A;  4D94 A;  4PDW A;  2BFU S;  1NUK A;  5FYC A;  3RZK A;  2QBX A;  5LEJ A;  2ET7 A;  4K1Z A;  1AZD A;  2W87 A;  3ZFG A;  1LJ7 A;  3ZFG C;  1OFN A;  4LUL A;  5A7Q A;  2W08 A;  5JXJ A;  1ZRF A;  2JKX A;  1QJU 3;  2BFU L;  1SFP A;  3RZL A;  1H2N A;  2Q8D A;  2VZR A;  3J7L A;  4FFG A;  2GC0 A;  1RHI 3;  2ARX A;  2O14 A;  1OD5 A;  3AL5 A;  2GMP A;  1ZRE A;  1YHF A;  3CKH A;  1DYP A;  3M3C A;  4XTP A;  4MHU A;  1DZT A;  1JOD A;  1CAV A;  5C4W B;  4RN5 A;  1RMU 1;  4LPL A;  5HXM A;  3KT7 A;  2FQP A;  2QQM A;  1ENS A;  2IXC A;  1YLL A;  2XUM A;  1AR8 2;  1XNB A;  1TVG A;  3T2O A;  2RMU 2;  2FCU A;  1LOF A;  4CP0 A;  4EN0 A;  5J37 A;  1PK6 B;  3N35 A;  1WD3 A;  3OJB A;  3BB6 A;  3VKM A;  4NO4 A;  5FPA A;  4M3C A;  3D6E A;  4LE3 A;  4JVA A;  2F17 A;  1KEX A;  3GNE A;  3T0B A;  1XNC A;  2B8M A;  1VAL A;  3TWI A;  2O8O A;  1KJR A;  3HIF A;  2QQP A;  1S2B A;  2BBA A;  1UW8 A;  2IZW A;  1C8N A;  3WNN A;  2QQK A;  5A6Q A;  1KQR A;  1W6M A;  1H8T B;  2WQ4 A;  4N9I A;  3ES1 A;  1D0G A;  4Y5S A;  4CPB D;  1ZA7 A;  5K4L A;  1DGR A;  1NXD 1;  1B35 C;  2ZPX A;  4NJ4 A;  2ID4 A;  4QKF A;  3JBG 2;  4XFG A;  2BNM A;  1EPZ A;  5IFT A;  1R64 A;  2VD7 A;  4MGI E;  4LQR A;  4FPE A;  4DOU A;  3LFM A;  3GCX A;  1PM7 A;  5FY7 A;  1IQD C;  4C0H A;  4UAP A;  4KWK A;  4Q0U A;  1RUI 3;  2C9A A;  1WLW A;  3IPV A;  3Q8B A;  4FTB A;  2BW8 A;  1ZRI A;  1N3Q A;  3ACH A;  3I2F A;  1YYN A;  1AL2 1;  1XQN A;  4NRQ A;  5FZ0 A;  1V6I A;  4XUO A;  5F5C A;  4XJA A;  3AC0 A;  4Z1V A;  3WT3 A;  4NPL A;  5FZ7 A;  4CEY A;  1F2N A;  4JGY C;  4RA0 A;  3VHP A;  1HLC A;  1WW6 A;  2JG8 B;  4YGC A;  3TRS B;  4BMB A;  4QPY A;  1M06 G;  5CBL A;  1AR6 3;  1QJY 3;  2R07 3;  2JDK A;  2JDN A;  1D2S A;  5D8A C;  3URF A;  5IVV A;  1NAE A;  1YFW A;  1W2A X;  3BIE A;  3VD5 A;  3BOP A;  4TXW A;  1JW6 A;  1JHN A;  5I93 A;  1PVC 2;  4HL0 A;  2ZAH A;  2DUR A;  4M3C E;  1OF4 A;  3FN9 A;  1YFU A;  4AI1 A;  1W3V A;  1AR6 1;  1QJY 1;  2R07 1;  3SIS A;  3SEE A;  5A70 A;  3KHB A;  5JZG C;  4I0A A;  1SLI A;  4LLO A;  2WQ8 A;  2VPV A;  4FCA A;  1MS1 A;  4URA A;  3ZVX A;  3RZJ A;  3I2D A;  3H1Y A;  1DCS A;  3PUS A;  2CDO A;  1COV 2;  2HWC 2;  2WNV C;  4YG0 A;  2Y33 A;  3H3L A;  1Z7S 2;  4YW4 A;  1DF0 A;  2D93 A;  2W1U A;  2J1E A;  4N7I A;  5FUP A;  4QX8 A;  1NCQ B;  2FBE A;  3MYX A;  4CEW B;  2ZTN A;  1EV1 1;  1PO1 3;  1Y9G A;  1FMD 1;  4BH9 A;  1BMV 1;  1FV2 A;  1OF3 A;  2MPF A;  2IXJ A;  3LA7 A;  3SH5 A;  2CDP A;  2D6N A;  1DYO A;  2QFE A;  5HI0 A;  4X6Q B;  4XVH A;  4SBV A;  5BNN B;  1MS5 A;  3QBQ A;  3DGT A;  1BEV 3;  1HIX A;  2PHL A;  3FWE A;  5LBB A;  3OD0 A;  4IE4 A;  4FQZ A;  4S2G A;  1OOP C;  3OSD A;  3PTR B;  4XQW A;  2NZ9 A;  4J25 A;  3VBS A;  5GZE A;  1LR5 A;  5JUV A;  3THD A;  1YCI A;  1JU4 A;  2Y0I A;  4W65 A;  3NW4 A;  3O1U A;  1W90 A;  4XC9 A;  5T5P A;  5G04 L;  1E5S A;  2VQT A;  3WQ7 A;  1CAX A;  4P00 B;  3AMN A;  1WGP A;  4YW3 A;  4NIH A;  4GXL A;  1R1A 2;  4B4R A;  3TNQ A;  3ZO0 B;  2VH9 A;  4IE0 A;  3VD4 A;  1CES A;  3DEC A;  1CAX B;  1I5Z A;  1XYO A;  1SAC A;  4QPI A;  1AYM 3;  4XFA A;  2C0Z A;  3ETP A;  1URX A;  2B46 X;  2VQU A;  3W58 A;  1JZ3 A;  1LTE A;  4Y22 A;  5FTT C;  2A6W A;  2XBO 3;  5L36 A;  2PLV 3;  3B9I A;  5BNQ A;  1UOF A;  4OFG A;  2RG4 A;  1ZBE 2;  4P9J A;  4UF0 A;  2YB7 A;  4DUW A;  2WC2 A;  4IEY A;  4OHV A;  1UPI A;  3SIT A;  1VBA 2;  4GJZ A;  5BUV A;  1AL2 3;  4YVW A;  2YU1 A;  3U14 A;  1D4M 1;  3DF0 A;  2BVB A;  4WM8 B;  2SBA A;  1B09 A;  3T4H B;  5J36 A;  3VV1 A;  1XYP A;  4XJU A;  4Q0P A;  5F2S A;  3RJ2 X;  1CAV B;  4CDW C;  1XNT A;  5BXX A;  3WNK A;  1G9C A;  3I2H A;  3ZYR A;  4QGN A;  1GIC A;  4Q26 A;  4Y22 B;  3GDB A;  1FOD 1;  3ZYF A;  4QKN A;  5T3N A;  3HN3 A;  2XQX A;  3FUQ A;  3THP A;  2CTV A;  4YFW A;  3BPS A;  3VDD B;  2ZEX A;  1IS4 A;  2ZS6 B;  3TN9 3;  5A1A A;  3AP5 A;  3AK0 A;  1VBB 3;  5C8W A;  4YW1 A;  1X50 A;  3VKF C;  1RUN A;  1AR9 3;  1YQ2 A;  1YNA A;  2ENR A;  1Z7S 3;  1YWK A;  3ILF A;  1YI9 A;  3VBF C;  5FZ6 A;  1H8V A;  5IVE A;  1NCR A;  1LES A;  5F5A A;  1AL0 G;  2CU5 A;  2QDR A;  3WP3 A;  3DV8 A;  3IT8 A;  3RSJ A;  2WAA A;  1P8J A;  5KXE A;  4AXO A;  4KBB A;  1K5M B;  3NNG A;  4D7Y A;  1WLC A;  1D0H A;  5FZ3 A;  2BYV E;  4YNI A;  4BZ4 A;  4CU8 A;  2RJ2 A;  1CON A;  2XLF A;  5FP4 A;  5JR7 B;  4F7Z A;  1RVF 3;  1PMI A;  5D8A A;  5FOJ B;  4QX2 A;  4RS5 B;  3T09 A;  1FAT A;  2WZP P;  2GN3 A;  4P9X A;  2ZMN A;  3UES A;  2W2I A;  4CEY C;  5GM0 A;  1H2L A;  4E9K A;  2A6Z A;  4GWI A;  3NST A;  4UT5 A;  5HV4 A;  3OPW A;  4Q4V 1;  3S7I A;  5A7O A;  4NHY A;  3AKQ A;  1FOD 3;  1OUX A;  2A7A A;  2EAA A;  2ZX0 A;  2W52 A;  1REE A;  2AR6 A;  3WCS A;  1NCR C;  2EXI A;  2VUA A;  5EYY A;  3AZV A;  3O1O A;  1S0D A;  3FL7 A;  3DKQ A;  4TLF A;  5A33 B;  1V6L A;  4ES9 A;  3MPP G;  1BHG A;  4LHK A;  1KIT A;  3VZM A;  4ES8 A;  4EZ4 A;  1TME 3;  3PIJ A;  3ZPY A;  2NMO A;  1E5I A;  2K46 A;  5JSO A;  1Y9Q A;  1PGW 1;  4X6R B;  3PNA A;  1WKY A;  4Q4X 3;  4RSU A;  4Z07 A;  3FLT A;  3USU B;  5HCB A;  1HW5 A;  4MLO A;  4QD2 A;  5A1L A;  4YPJ A;  3D5O A;  3WG4 A;  2AC1 A;  2ZKN A;  5L7O A;  4XW3 A;  1FX5 A;  4TN7 A;  1H30 A;  1W3X A;  2WNU B;  3L2H A;  4IV1 B;  3PMS A;  2WO1 A;  3C8X A;  2RVA A;  3LFI A;  3S5Q A;  3H7Y A;  1U5Y A;  4R9A A;  1UYX A;  5I0U A;  1W2T A;  4BA6 A;  3T2T A;  2P17 A;  1US2 A;  4Q8K A;  2VZV A;  2VO5 A;  4LA2 A;  3WDU A;  3KB5 A;  4P08 A;  1PNG A;  3E97 A;  1DLC A;  3THT A;  5FV3 A;  1S1A A;  3UK9 A;  1SDW A;  2OII A;  3H8O A;  5FBZ A;  1WLT A;  1IS5 A;  1REF A;  3M4F A;  1VBE 1;  2NM1 A;  4GZ9 A;  4XQ4 A;  5DAQ A;  5FAX A;  4PHZ A;  2H0V A;  2JDP A;  1LEC A;  4PT6 A;  3H7J A;  2KR2 A;  2VOW A;  3VDB A;  2VW2 A;  5FMO S;  3AL6 A;  5BNN A;  3VBU A;  4QU2 A;  1LOA A;  5E1R A;  4QB2 A;  4BLJ A;  3HJR A;  5I0T A;  4RGK A;  3WQB A;  4GJY A;  4XCA A;  2RR1 1;  3WZ1 A;  1FPN 3;  3U75 A;  3VL8 A;  2OYZ A;  1RIR A;  2PHX A;  4OHZ A;  2CGN A;  4KU8 A;  5JI9 A;  1K5J A;  3M3Q A;  5FZ9 A;  4P9W A;  4DRR A;  5C8C C;  1ZRC A;  3NRU A;  2G19 A;  3CQO A;  4XF0 A;  1NYW A;  1SBE A;  1ZZC A;  1CAU B;  1SLA A;  1UU4 A;  2HWF 3;  2OW4 A;  2VM9 A;  1QDC A;  4WM8 A;  2D5F A;  5LK5 A;  4EV0 A;  3SNM A;  5C5U A;  2PFW A;  2XOM A;  5ACA 2;  4L0P A;  1CAU A;  5DAW A;  4IW3 A;  2C4X A;  3MIG A;  2MNG A;  3WDY A;  1Y3T A;  1LU2 A;  2WS9 3;  4FPF A;  4AYU A;  1D4V B;  4BQY A;  1E5H A;  1RUJ 3;  4NWW A;  4UXA A;  3SCH A;  4DXS A;  2K9Z A;  4AEM A;  2D3P A;  2TUN A;  4COU A;  4D69 A;  3H8R A;  1RUD 1;  2X10 A;  3LPG A;  2HWB 2;  2IFR A;  4K8F A;  3WUC A;  2Y6G A;  3DYP A;  4QGL A;  4JQT A;  3VHR A;  2XKO A;  1ZZ9 A;  1R08 1;  4PLO A;  4QQL A;  1VBC 2;  3CBN A;  5FZF A;  5A3L A;  5JXH A;  4WM7 B;  2GH2 A;  5FZO B;  4QQ2 A;  3W20 A;  4DEV A;  4BQ2 A;  5A3U A;  4PF5 A;  3AXE A;  2RDQ A;  2OA2 A;  3NV3 A;  1NLQ A;  1YJL A;  3Q8E A;  4B4P A;  4CEW C;  5FY5 A;  1DYK A;  1CJD A;  4YZ1 A;  3BTZ A;  2UUR A;  3POW A;  1NY7 2;  4R9C A;  5F3E A;  3I59 B;  3AB0 A;  4LHL A;  5JIA A;  5C8C A;  4YG3 A;  3KV6 A;  3LEK A;  1F8V A;  2FDF A;  2R06 1;  4BWO A;  5IVB A;  2OQ7 A;  2PQS A;  1W03 A;  2ZKL A;  4Z82 A;  2X29 A;  4FPO B;  3AVR A;  1WCS A;  4FPJ A;  2Y6J A;  4IGO A;  2WFF 1;  5DUU A;  4FTS A;  2DUP A;  5I0D A;  2PMW B;  3I2K A;  1R1A 3;  3VBO C;  4EJR A;  1IKP A;  2D6L X;  1JYI A;  3S57 A;  5FIX A;  3BKZ A;  1QXJ A;  1ZZ6 A;  2VOX A;  3OBA A;  4Q8L A;  4Y1X A;  2JD4 A;  4K1Y A;  2Y60 A;  3HD8 B;  3OUH A;  1SFN A;  1ZA4 A;  2JDH A;  1GSL A;  3GHN A;  1W6Q A;  4LO4 B;  1F15 A;  1C4R A;  1W9T A;  1ZNP A;  5FOB B;  2R32 A;  1QJU 1;  3PL0 A;  1POV 3;  3K51 A;  4CDQ B;  1UZ0 A;  2JIJ A;  4UW4 A;  3W5N A;  1CX1 A;  4CDU C;  1K5M C;  1N1T A;  4A6S A;  3LSE A;  2B7Y A;  3LPF A;  5KWR A;  4CRQ A;  1DQ2 A;  3D82 A;  3ZLI A;  2X53 S;  4QPW A;  1UZZ A;  1DGW A;  2E32 A;  1JZ2 A;  3O1S A;  2WS9 1;  2NYY A;  5L9R A;  3POG A;  2WNU A;  3A0K A;  5FZO A;  4MHR A;  1TMF 2;  1AVB A;  1I5P A;  2RE9 A;  5T5O A;  3I54 A;  2C26 A;  2Y26 A;  3N9N A;  3JBG 1;  4LBQ D;  1SEF A;  4ATE A;  2CSG A;  2WA3 A;  3HQR A;  2HWC 3;  2YGM A;  4Z8B A;  4FTE A;  4ORF A;  2C5D A;  4Y3O A;  4AI8 A;  5GLT A;  3RZM A;  3C7F A;  1CZV A;  2YY1 A;  5DG1 A;  1JOB A;  1S2E A;  5HBA A;  5JPN B;  2VQA A;  3OUJ A;  3DXT A;  3FBM A;  4V2V A;  2IC1 A;  1A34 A;  4Q4Y 2;  2HEW F;  1J83 A;  4LBK A;  2VL4 A;  2MHF A;  1NA1 C;  4UW3 A;  4ZY9 A;  4PF1 A;  3VDC A;  5HV0 A;  2A6X A;  3VBH A;  1PMJ X;  4W6W A;  1F35 A;  2FCV A;  3RJR A;  3VBR C;  4CCD A;  1TMF 3;  1S4C A;  1C5I A;  1RUE 1;  3NQH A;  1AX1 A;  1C8M 2;  5JOY A;  4BOW A;  3H3Z A;  3KV4 A;  1JHJ A;  2E7Q A;  2W46 A;  4YSF A;  1SBF A;  3ZN4 A;  4GAL A;  3KWV A;  3GZU C;  2D6K A;  1KD7 A;  3K3O A;  4D6S A;  4NHX A;  4IEO A;  3RG0 A;  3NMB A;  4YGE A;  5DAV A;  5KC6 A;  2ZEW A;  2DYC A;  3O5S A;  3R0R A;  2G9F A;  5JR2 A;  5G05 L;  1FPN 2;  4Q4X 1;  3WNX A;  4I2O A;  1LU1 A;  1BBT 2;  3UGG A;  1W9W A;  2J1U A;  3RVH A;  2BNO A;  2RDR A;  4IQP A;  4AAP A;  4CYD A;  4WM7 C;  2ZOE B;  1OSG A;  1VBD 3;  3EJK A;  4B1M A;  1VB2 A;  2VCA A;  4AED C;  2LS6 A;  3ZYB A;  4BQX A;  1AX0 A;  4Q1P A;  2HWC 1;  2VU9 A;  1WBF A;  5CB7 A;  4XET A;  4AW7 A;  3V0B A;  1VBE 2;  4HZF A;  4IV1 A;  5IAX A;  5KHH A;  3W9A A;  1QXR A;  1T6B X;  3TOJ A;  2WO2 A;  1UKG A;  5GZF A;  3ACG A;  2XB6 C;  3VBR A;  1OI6 A;  2UU8 A;  3NNM A;  4AHZ A;  5C3S A;  2HKX A;  1V9U 3;  1QDO A;  4QU1 A;  4YW5 A;  1AXZ A;  4XE9 A;  5GZG A;  1POV 1;  1IPS A;  1R09 2;  5BNP A;  4C0B A;  1KFX L;  1HRI 3;  1RUC 2;  1T6G C;  4QPG B;  2JEC A;  4DXR A;  4WM7 A;  3J4U H;  1VBB 2;  1XOY A;  2LM3 A;  4A7K A;  3MLL A;  1NCQ C;  3KQR A;  2ORX A;  4CDW A;  4HBN A;  5L7O B;  5C6C A;  4IL7 A;  5JCT A;  4W4Z A;  3FHA A;  3HEI A;  1R1A 1;  2C6S A;  2JDU A;  4E4D X;  4JGZ A;  3LF7 A;  1VBC 3;  5ACA 1;  1W9S A;  4TLG A;  4H14 A;  3TB0 A;  5FYH A;  2WFF 3;  2WKK A;  3WSO A;  2J1S A;  3J26 N;  2L9L A;  2QQN A;  5L7O C;  1WCU A;  3NV2 A;  5EFU A;  1O3Q A;  5D21 A;  5FY9 A;  2J1A A;  4RHV 1;  3B94 A;  1IPK A;  1OT5 A;  3VBF A;  1F5J A;  3W59 A;  4M01 A;  4XFI A;  4CUG A;  3K4A A;  5EWS A;  2UY8 A;  4LO7 A;  1WBL A;  1J84 A;  2JE7 A;  3IIA A;  3L9J T;  4Y20 A;  1EP0 A;  3C7O A;  1RIT A;  2HYX A;  2LW8 A;  4NID A;  2BBV A;  3IN9 A;  3KGZ A;  2B45 X;  4PBO A;  4OYU A;  3SH3 A;  4DEQ A;  5C3O A;  4JTO A;  2WDB A;  5FWJ A;  2BRT A;  3HQU A;  1HQL A;  4IEQ A;  4CXW A;  1YJK A;  1V9U 2;  4AVA A;  4E4S A;  4WZF A;  4Y24 A;  4OI2 A;  4JDN A;  3NV1 A;  2Z42 A;  3OUI A;  1LHN A;  4C91 A;  4KGQ A;  1GNY A;  2O8Q A;  2PEL A;  3MDP A;  1NY7 1;  4YVS A;  2VOK A;  4P14 A;  4ZXK A;  2VZQ A;  5FZA A;  3P3N A;  5LAS A;  4ZON A;  1GV9 A;  4MXV A;  4MXW A;  3GXU A;  4ISR A;  4P02 B;  3VLB B;  1YUD A;  4LTA A;  2ZAA A;  2YZ4 A;  3E6B A;  3WG2 A;  3WLU A;  2R06 2;  2VNR A;  2VME A;  3MZH A;  1QXP A;  3NO8 A;  2DF7 A;  1I1E A;  3JB4 C;  2VZT A;  5A7N A;  2P3K A;  2CYF A;  2ILM A;  3FHI B;  4PQ9 A;  1W8F A;  3WNL A;  1Z78 A;  2RHP A;  2WO3 A;  1L3J A;  3WDT A;  4K40 A;  1TQ5 A;  1UCX A;  2WFF 2;  3M70 A;  1QOO A;  1UIK A;  3UGH A;  3GZE A;  5IK4 A;  4LUK A;  2QDN A;  3JCI A;  4GH4 B;  2E6V A;  1U5X A;  3K46 A;  4LHN A;  4FPC A;  1JI6 A;  4I3P A;  1XBF A;  3TN9 2;  3A7Q A;  1PX4 A;  2VNV A;  4PQQ A;  2DFB A;  4OMC A;  3KZ4 C;  4YM2 A;  4CUC A;  3VDA A;  3ZYI B;  3OYW A;  3M8L A;  3LOB A;  1BZW A;  2YMZ A;  1SLC A;  1JBC A;  2D6O X;  3LA2 A;  1VB4 A;  3POF A;  3U11 A;  5DUW A;  1QJU 2;  1UY1 A;  2YBP A;  2VOV A;  1W04 A;  2BWC A;  1V6M A;  2MEV 1;  5FPV A;  3VBS C;  3P6B A;  4BM8 A;  2XGX A;  4EWD A;  3WF0 A;  1L7L A;  3UV9 A;  2RS3 2;  4LBJ A;  3ZSM A;  3ITQ A;  2VOT A;  1CGP A;  1RUF 1;  3CDZ B;  2H6C A;  5FMD A;  1LGN A;  4K21 A;  2WS9 2;  1ASJ 2;  1EV1 3;  1PO1 1;  3VZO A;  5C3R A;  4JDO A;  1U12 A;  1IOA A;  3VGI A;  3QH7 A;  4LBM A;  3ZXA C;  3PVN A;  4K8R B;  3VL9 A;  1V6J A;  4M3C B;  4AVS A;  5CKN A;  4Q27 A;  2YC0 A;  3NNJ A;  1W6Q B;  2RJL A;  5DZE A;  4ZKT B;  1AX2 A;  3VZK A;  4CSW A;  2DVG A;  3O1P A;  5C9A C;  5FPX A;  1YO8 A;  4H55 A;  1GNH A;  3WG1 A;  1C1F A;  1Y7B A;  2Q0A A;  3WDV A;  2E7A A;  3NAP C;  2VCB A;  3B5L B;  1NQJ A;  5FR3 A;  4BQW A;  4KWL A;  2VQ0 A;  5FRA A;  1WW5 A;  4UBG A;  3ZYJ B;  4B29 A;  3HOB A;  5BNO C;  5BNO A;  3CEW A;  1VP6 A;  4DQA A;  4XZP A;  2QUO A;  4DXZ A;  4FXG B;  1YFX A;  3J9S A;  4CP2 A;  5JIU A;  5EV7 A;  3ZKU A;  2EAK A;  4RYD A;  2W95 A;  3R4D B;  4LT5 A;  1DZR A;  4ARX A;  2JDY A;  1GAN A;  3GZA A;  3RPQ A;  2WZ8 A;  3DUI A;  5A3M A;  2GC2 A;  5GLV A;  2DUO A;  1A6C A;  3NVC A;  3OYW B;  2HWD 3;  1OLM E;  4OUL A;  1H1I A;  3WF1 A;  3LSD A;  3MLJ A;  4J1W A;  3RZG A;  3WHU A;  1Q3E A;  5EIY B;  4NN0 A;  3ACI A;  1CAW B;  5L73 A;  1W6N B;  4XUT A;  2W39 A;  4YM1 A;  4Y4R A;  4H7L A;  1QJZ A;  3PJY A;  2E53 A;  5A3N A;  3NJZ A;  1HJF A;  1Q8O A;  2JG9 B;  1XSQ A;  2Z5W A;  2ZMK A;  3NJX A;  4YW2 A;  3RMY A;  2QZ3 A;  4A44 A;  2RV9 A;  3HQX A;  4JGZ B;  4IV3 A;  4QHO A;  2I45 A;  5IVC A;  1PGS A;  3SEP A;  1OLR A;  2B9U A;  3CJI C;  4KG0 A;  4Q4Y 3;  3U07 A;  3E5Q A;  4IEX A;  5FZE A;  3PUA A;  2WII B;  4GA9 A;  1LGB A;  1O5U A;  2YRO A;  3UYJ A;  5FY0 A;  5IAT A;  2E26 A;  5IAV A;  2Y0O A;  1A3K A;  3I2G A;  5CEH A;  2UWC A;  2GDF A;  2FMD A;  4IE6 A;  5EQU A;  5FP9 A;  4GH4 C;  5F3C A;  1DQ0 A;  1EAH 2;  1RVF 1;  1SBD A;  1RJ8 A;  3U37 A;  3B02 A;  3JD7 3;  2GND A;  1JU3 A;  4KI5 M;  4O9G A;  1W6N A;  3EYP A;  3VHO A;  3ZR5 A;  3I3E A;  2BOI A;  3LEI A;  3O1V A;  1TE1 B;  1NG0 A;  3CL1 A;  2HWB 3;  5LA1 A;  3WD5 A;  4QT6 A;  1RUF 3;  1Q56 A;  2AEZ A;  5I0R A;  3I2I A;  2BUK A;  2VZO A;  1RUJ 2;  1MS8 A;  1GYK A;  2IXK A;  2VVD A;  4FXK B;  1QIQ A;  4PIX A;  4FPK A;  1G7Y A;  1YQ8 A;  4CCK A;  2HEV F;  4RS5 C;  4BQ3 A;  3CHX A;  3RGB A;  1AXY A;  1JZ8 A;  2RS1 2;  1RHI 1;  2ATF A;  3E6D A;  3VBS B;  4CCC A;  3BTY A;  1OH3 A;  2VCM A;  4RHV 3;  1LOF C;  5FZB A;  3I3M A;  3VZL A;  1OD3 A;  2Z69 A;  3ZSK A;  4BE3 A;  5A6Y A;  1RUD 2;  1RUG 1;  2XL9 A;  3ENR A;  2ZAB A;  2A3W A;  3RYP A;  5KHK A;  1WMF A;  4AED B;  1CQ9 A;  5GJ6 A;  1R08 2;  5LA2 A;  1Q8S A;  4BXS V;  3BU0 A;  5J1X A;  1VBC 1;  2EXH A;  1UZV A;  4QDS A;  2CGP A;  4ZZ5 A;  1KJL A;  2F4L A;  2VMH A;  2A5Z A;  4HPK A;  2XR4 A;  3POY A;  4QHZ A;  2ZGS A;  2Q8C A;  4JC1 A;  5FYB A;  4Q29 A;  5FCC A;  3FZ3 A;  1LOC A;  5KC5 A;  2XLG A;  2GAU A;  3MUZ 1;  4IND A;  5FP7 A;  5FYS A;  4CP1 A;  1W6O A;  3PHM A;  1F4H A;  1KFU L;  1NLR A;  1O3S A;  2ORZ A;  4FVV A;  4ASK A;  4UBH A;  1MVQ A;  4LBQ A;  4LUM A;  1JOP A;  4JX0 A;  1W06 A;  2DV9 A;  2HWE 2;  4H3W A;  2EIC A;  4P9I A;  5IUQ A;  2WYS A;  4TYS A;  4QB1 A;  3WUD A;  2WLP A;  1DQ4 A;  1OKO A;  2CL2 A;  2P4E A;  4UW6 A;  2UY9 A;  2RR1 3;  1IHM A;  4LJH A;  1O59 A;  3ZFF A;  3ZSL A;  2YDE A;  3M3O A;  3LIH A;  2XHK A;  3AXD A;  4AFM A;  5I0S A;  3JXS A;  3FE5 A;  2Q30 A;  3FHQ A;  3RMX A;  1QF3 A;  4HON A;  3DCQ A;  1WUV A;  5C3Q A;  1RED A;  1XRU A;  1AYM 1;  2BGO A;  2WZR 2;  4CUA A;  4H2A A;  3ZPO A;  4XAC A;  4CU6 A;  2UYA A;  1US3 A;  4XIL A;  3DYO A;  2YPJ A;  1T2X A;  2XVG A;  1PHM A;  2D97 A;  3BU7 A;  1DU3 D;  3PLQ A;  4CP9 A;  5IK7 A;  1Q8V A;  2OPW A;  1OC1 A;  1BYH A;  3RZH A;  4XJ8 A;  1RUG 3;  1JH5 A;  4QWN A;  2TBV A;  3S7E A;  5T5J A;  2W0X A;  2D40 A;  3CU7 A;  1SCS A;  3M1H A;  1J59 A;  5BNP C;  1VBA 3;  1W8W A;  5A7P A;  1QY4 A;  2R16 A;  2VUJ A;  1HQN A;  2XUE A;  3GAL A;  5CG9 A;  3NAP B;  3T2Q A;  3GBG A;  2WT1 A;  3ROU A;  1VRH 2;  2QJV A;  4QGM A;  1TME 2;  5APA A;  2J7M A;  2VZU A;  4NUB A;  4BQ1 A;  3VD3 A;  3PUR A;  4MZU A;  3O1T A;  2Q1Z B;  1YI7 A;  3K77 A;  3KSC A;  4XDQ A;  5EJZ B;  3ZN6 A;  2I2S A;  4U36 A;  4OI0 A;  1TMF 1;  1J3Q A;  2DUQ A;  3HT1 A;  4IGP A;  1IKQ A;  2BGP A;  5FLH A;  2BNN A;  5C9A A;  3V56 A;  1J58 A;  1Q5O A;  4DRV A;  1UF2 C;  3WXP A;  5K7P A;  5FYU A;  2OXB A;  2IUW A;  4XHB A;  2FDH A;  5CAD A;  5JDB A;  2JKB A;  3VDD C;  2RDS A;  1S0I A;  4MVT A;  4IEV A;  4XCB A;  4AQ6 A;  2XJT A;  2VZ3 A;  2G9G A;  1JUI A;  3AJZ A;  4Q4W 1;  2TEP A;  4YM0 A;  4CE8 A;  1W6M B;  1QGL A;  2QQI A;  3I8T A;  4XJW A;  1YQC A;  3R4U A;  4M0H A;  2W1Q A;  4Q4Y 1;  1W0P A;  1AUY A;  4DIN B;  1W8U A;  2JB8 A;  1Y43 B;  1NE6 A;  3PU8 A;  3WP4 A;  2ZHN A;  1HB3 A;  1GWM A;  1DHK B;  1EYB A;  1POQ A;  3ZN6 B;  1OLM A;  1AYN 3;  2W9X A;  3WDX A;  3WR0 A;  4PDW B;  1E57 A;  4A6O A;  2NP0 A;  2WAO A;  4HVR A;  3KCX A;  1UYZ A;  3VUO A;  3RFR A;  4CDX A;  1SFY A;  4UOJ A;  2AAC A;  2B42 B;  3OGR A;  3HN1 A;  3INA A;  3C7E A;  3KMH A;  1H4G A;  1UOJ A;  2XJS A;  4XDO A;  1CWP A;  4N9H A;  2ZX3 A;  5ABJ A;  5C4W C;  4OUM A;  1PX3 A;  3PIG A;  4HT1 T;  4FPG A;  5J7M A;  4OQ9 A;  1PIV 3;  4CCM A;  4Q5O A;  1DIW A;  2W1S A;  2R7E B;  1JYX A;  1PGL 2;  1RUI 1;  4JGY B;  4QXB A;  2WZE A;  4HKW A;  3BTX A;  5EJ3 A;  1HQW A;  1UX6 A;  4UI9 L;  4WVW A;  1JTZ X;  1G9D A;  3V0A B;  4HK9 A;  3ECQ A;  5J98 B;  1NZI A;  4A45 A;  4N53 C;  2X09 A;  3CF6 E;  1XSR A;  4B3N A;  4UFK A;  4OZX A;  4AL9 A;  2A75 A;  3OBT A;  3ZSE A;  5ANQ A;  1H2M A;  2QTW B;  5F7U A;  1AR9 1;  3JU9 A;  4BCU A;  4QDQ A;  5AFB A;  2YG0 A;  2WWS A;  5LK7 B;  1AHS A;  1HV1 A;  1OQD A;  1J1T A;  3DYM A;  5FFO C;  4BIF A;  1WCK A;  3T08 A;  1BMV 2;  2ARB A;  4FAG A;  4OQ8 A;  5LBE A;  4GKY A;  5CNA A;  3ZIW A;  5CFD A;  1LHW A;  4CEW A;  1OKQ A;  1LRH A;  3CO2 A;  3MPB A;  1CX4 A;  3OBZ A;  4ZS2 A;  3V0A A;  3VBO B;  5F5Q A;  1RUC 1;  3BTA A;  3I3Q A;  4NWV A;  5H9S A;  4DO0 A;  5CA6 A;  4QX0 A;  4GWM A;  2J22 A;  5DZF A;  1UAI A;  4QQP A;  4F3J A;  3UT0 A;  3MFA A;  2JG8 C;  5B4N A;  3M3E A;  4AI0 A;  4W6Y A;  1ALY A;  3RWK X;  1V0A A;  1W8O A;  4AVB A;  4CDU B;  2VW0 A;  3I97 A;  5LAT A;  5TSW A;  4FBF A;  2PHF A;  2PA7 A;  1UU5 A;  1XYN A;  3LQC A;  4DFS A;  5KXC A;  1C28 A;  3LGR A;  1SLL A;  2AGS A;  2WZR 3;  3H1M A;  4JZR A;  4B1L A;  5A32 A;  1O4Y A;  1HB4 A;  3A22 A;  5SV5 A;  1BLZ A;  1OXC A;  1O8S A;  4YAR A;  3O14 A;  2OVU A;  3OB8 A;  5JPM B;  2VXR A;  2VBD A;  1H4H A;  4LIV A;  4XZU G;  4XF3 A;  4IEP A;  4PI0 A;  1OH4 A;  1ZBA 1;  3MID A;  3WDW A;  3AJY A;  4AF9 A;  4YVS C;  5ANN A;  3LIG A;  5IVJ A;  2XHN A;  4B4Q A;  1HRV 2;  1AR8 3;  3W5M A;  2IXI A;  4XJ9 A;  4CCL A;  1Y4W A;  1H8T C;  4R9B A;  1APN A;  2W92 A;  5FZG A;  4JRL A;  1QNY A;  5DDJ 1;  3UKV A;  1NE4 A;  2AH2 A;  4G9S B;  5H9R A;  1KS5 A;  5CYY A;  5EXO A;  1OUS A;  1KGY A;  2RM2 1;  2ZX2 A;  3OPT A;  4HG6 B;  5KR7 A;  1DQ1 A;  1UOB A;  2D5H A;  2XVL A;  3LDK A;  3PU3 A;  1SLT A;  5L9V A;  3B01 A;  1RGS A;  3N7M A;  4PDW C;  1HKD A;  3AKS A;  3IDC B;  1PK6 C;  4AWD A;  2YBS A;  5EPA A;  1LED A;  1UNB A;  4RR3 B;  3CZJ A;  1QQP 2;  2QNK A;  1QH7 A;  5F1R A;  2P3J A;  2YFZ A;  3ALQ A;  3IWZ A;  3SC7 X;  2CWS A;  2Y8K A;  3N9O A;  5JSR A;  5FO7 B;  4ZPI A;  1MPX A;  3IAQ A;  2W1W A;  4A41 A;  2IXL A;  1J3R A;  3HT2 A;  2BPA 2;  1I3H A;  2WNO A;  1C1L A;  2RS5 2;  3N9M A;  4Y5Z 0;  4IER A;  1VBE 3;  3WF2 A;  4A7Z A;  1HDK A;  4CVU A;  1AR7 3;  2KXL A;  3POS A;  1RJ7 A;  3JB8 A;  4NOT A;  4CZS A;  1QOT A;  1ND2 C;  3ZFF C;  5KXB A;  5C70 A;  4UF0 B;  3UJQ A;  3ZXL A;  3C7G A;  2P6C A;  3D4K A;  1QHD A;  4C8D A;  5F9T A;  4GWJ A;  5JOZ A;  5FO9 B;  2WRA A;  5K0U C;  3VKL A;  4BK4 A;  5FPZ A;  2PAE A;  3RRD A;  3TEW A;  2XJV A;  4YZ4 A;  5CIS A;  1DGR N;  5B4X A;  2LTN A;  2Z79 A;  2MEV 2;  3PME A;  4LBN A;  4TTG A;  2ARC A;  1C3H A;  2V72 A;  4AOC A;  5IFP A;  3LWC A;  4ONU A;  3USS A;  1Q43 A;  1ZZ8 A;  2VW1 A;  1DP0 A;  2HWF 1;  3ORJ A;  4P5Y A;  4R8H A;  2B5H A;  2VNO A;  4C1X A;  4N43 C;  3K3N A;  4FPY A;  5FYI A;  3X29 B;  1V6K A;  2EIB A;  5JXG A;  1UXZ A;  3ZMO A;  2ZGL A;  1A8M A;  3LDB A;  5JWP A;  2VBB A;  4RFT 0;  4C90 A;  1XNA A;  3S30 A;  1SPP B;  4ASM B;  1JZ5 A;  3MBW A;  1F31 A;  2VZ1 A;  5JI7 A;  4AQ2 A;  2WUH A;  4XIK A;  1U5Z A;  5FXZ A;  3WHT A;  1QJE A;  2OZ6 A;  5T54 A;  1POV 0;  4QX7 A;  4CDX B;  1F4A A;  4LIT A;  3U0Z A;  4XBQ A;  3H42 B;  1K5M A;  3FBY A;  5ABJ B;  4NRO A;  4XIO A;  4BYY A;  4IGQ A;  5CFC C;  4ERO A;  2ZHK A;  2Q1M A;  4MGK E;  1NKG A;  5K8S A;  1PMH X;  3IAP A;  3WNO A;  4QQH A;  4PCR A;  3CNA A;  1W8H A;  4RGG A;  2DVD A;  1XJA A;  4L92 A;  4PIY A;  3GBW A;  4LO6 B;  1QJX 1;  2D3S A;  1MZ6 A;  3FLP A;  1OBN A;  4AHX A;  4EZH A;  3R4S A;  2HWE 3;  3O7O A;  3ES4 A;  5FUI A;  3A23 A;  1GQG A;  4OUE A;  5A7W B;  2WN2 A;  4LKS A;  4MV2 A;  4Q2F A;  3T3Y A;  4Q0Q A;  4P9Y A;  2E9Q A;  4K6B A;  3GJA A;  3ZFE B;  1ENX A;  5BNO B;  4EN6 B;  3VBU C;  1ND3 B;  2GP3 A;  1TEI A;  4CCN A;  2DVA A;  3H0O A;  1GUI A;  4NII A;  1Z7S 1;  4Y4Y A;  3HNM A;  3UKN A;  1AR7 2;  1ND3 A;  3Q9O A;  1FXZ A;  1YXW A;  3CJI A;  1CPM A;  5F5I A;  2CHH A;  1GP4 A;  2XL7 A;  3LAG A;  1UYY A;  2E51 A;  4KGG A;  5CKQ A;  3WX5 A;  3I2J A;  1UQX A;  3THC A;  2ZGP A;  4KU7 A;  2XJU A;  4CA9 A;  1UN1 A;  5DXD A;  2BTV C;  2XJR A;  3IDB B;  4I01 A;  3N36 A;  5A7W A;  5CVR A;  1G9B A;  2BZD A;  3IM0 A;  4AG4 A;  3HAG A;  1ENR A;  2PYT A;  3MW2 A;  2VE1 A;  1BXH A;  3ZX7 A;  2Y64 A;  2C9K A;  4OI1 A;  2BU9 A;  4MGQ A;  3CLP A;  4TSV A;  2D44 A;  1EY2 A;  2VVE A;  3L2Y A;  3OCP A;  1PZ7 A;  4LNV A;  4XFH A;  3CJI B;  3D3A A;  1KXG A;  3WP6 A;  1Q8P A;  1O6U A;  1H6Y A;  2PAK A;  4EWA A;  4ZXE A;  1W0O A;  3CJX A;  3JD7 2;  1UD1 A;  4OHW A;  3VKN A;  4CEY B;  1DLL A;  1RHI 2;  4QPG A;  4GKX A;  1HRV 3;  1HXS 3;  4B7K A;  4AHY A;  5DQ0 A;  5JOW A;  1QOS A;  1LHO A;  4MET A;  3HWJ A;  1GZ9 A;  3I7D A;  1NOV A;  2FD8 A;  2BJS A;  5A3O A;  1H8T A;  3TBD A;  1EPW A;  1H2K A;  4QB6 A;  4CCJ A;  2YYO A;  3MIB A;  2VUC A;  5IHR A;  4NAO A;  3O0W A;  3RI9 A;  1VLN A;  2HWB 1;  4KBZ A;  1OA4 A;  2HWD 2;  4N53 B;  3K4D A;  4W6X A;  4J6G A;  2J1V A;  5F6K A;  2WWU A;  1H1A A;  2BVV A;  1HN0 A;  2WL1 A;  2JEM A;  1VPH A;  5FXX A;  1PVC 1;  4IDZ A;  3QAC A;  1WA4 A;  2DCZ A;  3T4V A;  3KT1 A;  1ULC A;  4EE2 A;  1KDK A;  3BUC A;  1QJY 2;  1S0E A;  2O0O A;  2R07 2;  1YFY A;  4YFZ A;  2R06 3;  4CDU A;  1AR6 2;  2AUY A;  1FNZ A;  2VTX A;  5FZL A;  4AI3 A;  3S0M A;  3MIF A;  4HN1 A;  2YU2 A;  2G9Z A;  1NLS A;  5JMO A;  1PVX A;  1BEV 1;  2VBP A;  3AMP A;  1XND A;  4FPH A;  1HX6 A;  5CFC B;  3ZXD A;  4LK6 A;  3VBU B;  4YGD A;  1TNR A;  4W8J A;  2PXJ A;  2QQJ A;  2AEY A;  3R05 A;  4K3U A;  3RZZ A;  2XXZ A;  2YFU A;  4NHL A;  4QQO A;  2A71 A;  2ARA A;  1WW4 A;  2WNV A;  2YGL A;  1HJG A;  1GBG A;  5JZG A;  1UXX X;  2EXJ A;  5C8C B;  5FZC A;  2VTF A;  3AFK A;  4XFF A;  4WVV A;  2EID A;  2NLR A;  3AKP A;  1XE0 A;  4QAW A;  1H9W A;  2DU0 A;  2VUD A;  2PTM A;  2WLQ A;  1J3P A;  5KHJ A;  3AMQ A;  3MFC A;  2HLE A;  2VMD A;  3C3V A;  2P34 A;  1UO9 A;  2ZGO A;  1AF9 A;  4CU9 A;  1VMF A;  3NNL A;  4NE9 A;  2KD7 A;  2XBO 1;  4N43 B;  4FAH A;  4HVQ A;  1GZW A;  5A32 B;  1IG3 A;  1NCQ A;  5FO8 B;  4EQV A;  1SZB A;  4CXY A;  4ZU7 A;  5IYY A;  3LKJ A;  1YRZ A;  3P3P A;  4M4R A;  4QKD A;  4I0W B;  4BXF A;  5CZK A;  3MV1 1;  5K0U B;  2N7G A;  4NAM A;  1BJQ A;  1UYP A;  2O1Q A;  4XF1 A;  2WR9 A;  1VBD 1;  2ZX1 A;  2A3X A;  3ELN A;  4E8C A;  4FFI A;  4JDM A;  2FDK A;  5FZK A;  4NRP A;  5DUX A;  2LRO A;  1NA1 B;  1ULG A;  5DMY A;  4H7M A;  3AYA A;  4MH0 E;  2VXJ A;  5JVV A;  1U0A A;  3RS6 A;  4D7T A;  5ACA 3;  4FPL A;  5BNN C;  4U2A A;  5AC9 2;  2JE9 A;  3HNB M;  1B35 A;  2UYB A;  2XDV A;  5FXW A;  2A3Y A;  2YBK A;  2BEO A;  4EN8 B;  2A6Y A;  4ZHN A;  2RDN A;  4I02 A;  2GMM A;  4RR3 C;  4HKL A;  4NMI A;  4I3G A;  2E33 A;  4M00 A;  3ZSJ A;  5CFC A;  4HKO A;  5F6L B;  4AE2 A;  4LO8 A;  4B8E A;  4JRA A;  3A4U A;  5HPO A;  1CJP A;  3S5A A;  4Q0S A;  5K0U A;  1G86 A;  3RI8 A;  1DDL A;  5LW9 A;  2ETE A;  1PGW 2;  3K48 A;  3NKG A;  2WWJ A;  1XPW A;  2X05 A;  4GB3 1;  4XUN A;  2D6P A;  2WSU A;  4AZZ A;  1FNY A;  1FOD 2;  1STM A;  4A4A A;  5FWE A;  5J09 A;  3WV6 A;  3B93 A;  4LA3 A;  1LOB A;  3LEG A;  4RS5 A;  4URT A;  4CUB A;  1UY4 A;  4D8M A;  5DDJ 3;  1W2U A;  1C8M 3;  1VAV A;  2DVF A;  3ETQ A;  4Q0V A;  5ISL A;  2DCT A;  4A3X A;  1QJX 2;  3F2Z A;  3DKW A;  4CXX A;  2RS1 3;  4AEK A;  5IVY A;  1SCR A;  5LY1 A;  4FT8 A;  4GMP 3;  3SLI A;  2IVJ A;  3IPV B;  2XJP A;  4A3Z A;  2Y6F A;  5C33 A;  2YV8 A;  1RMU 2;  3KCY A;  5D8A B;  2PHT A;  2HH9 A;  1RC6 A;  3AP6 A;  1NQD A;  4MG2 A;  4IV1 C;  1LCL A;  2P1B A;  2VZS A;  1V00 A;  5LA9 A;  3NJY A;  4AVT A;  4E4Z A;  1RB8 G;  1WMD A;  2RMU 1;  3LB9 A;  1UMH A;  2D98 A;  2CAV A;  1VJ2 A;  1SDD B;  1AR7 1;  3AX4 A;  2ERF A;  3OTF A;  3SCF A;  4D6R A;  3O0X A;  4YZ2 A;  1WW7 A;  2JDZ A;  4XBL A;  2I07 B;  3DPR C;  3E6C C;  1YEW A;  3UL2 A;  4Y5T A;  5BPX A;  3RNS A;  5A3P A;  3OGV A;  2EXK A;  4LKF A;  1K42 A;  3MW4 A;  5I8Y A;  1FV3 A;  1FT9 A;  1XE7 A;  2JDM A;  4DB5 A;  1XXN A;  4O61 A;  3J7H A;  5LRS A;  4QM8 A;  4XUQ A;  3O1R A;  4XEZ A;  4OI4 A;  4XYX A;  4HET A;  2YXS A;  4IEU A;  2A1X A;  2QVS B;  2XON A;  4BIS A;  5HCA A;  4LMF A;  1VBB 1;  2SLI A;  3B3Q E;  2G1M A;  3J8F 3;  1SMV A;  5T52 A;  3MV0 1;  1MQT C;  5T50 A;  5IJR A;  2D3R A;  1F9K A;  4QMA A;  4AGV A;  2P2K A;  2XKP A;  1FYU A;  4CDW B;  2AYH A;  1X36 A;  2W94 A;  5D1I A;  2H6B A;  3VBO A;  4GUL A;  2LUW A;  4GWN A;  1O5L A;  1W2N A;  4LE4 A;  1DBN A;  2YHJ A;  3WW3 A;  1V6N A;  5JZG B;  2ZGR A;  1JZ4 A;  4RHV 2;  3KF5 A;  3I3D A;  4MXW B;  1LOG A;  3SKJ E;  1HRV 1;  1W8Z A;  1XNK A;  3B69 A;  1H6X A;  2GSY A;  1VRB A;  2AZ5 A;  4UW5 A;  3ZDV A;  3P5B A;  2HBU A;  3ACF A;  2QQV A;  3H3U A;  4MX3 A;  2R6Q A;  5FMC A;  4AAX A;  3MUY 1;  2VNG A;  2BP6 A;  5CKM A;  1W28 A;  3FJS A;  1BBT 3;  1CN1 A;  1HN1 A;  5LBC A;  2DCJ A;  4LK7 A;  3N9P A;  3VD9 A;  1F5F A;  1ZZB A;  1BEV 2;  1W0N A;  3B9C A;  3LEM A;  5AC9 3;  4AGR A;  1QQP 1;  4FQ4 A;  3DXU A;  2D43 A;  1ASJ 3;  1EV1 2;  1YQ6 A;  5FLJ A;  3ATG A;  1JYT A;  4C1W A;  4QPG C;  1ZRD A;  1S55 A;  4A7Y A;  1D4M 3;  1OOP B;  4KWU A;  1E5R A;  4Q4W 3;  4GMP 0;  5A80 A;  5FZM A;  4LHS A;  1N1V A;  4A42 A;  2V5Y A;  1NA1 A;  3C7H A;  3MIC A;  1X82 A;  5LZ6 A;  1ZYB A;  2CNA A;  2ZJC A;  5BV6 A;  1COV 3;  2K0G A;  1JZ7 A;  2ADD A;  1YC6 1;  1UY0 A;  2QQO A;  1W9Y A;  3ABZ A;  3J7M A;  3KV5 A;  3AKR A;  2VCC A;  4RQP B;  1SHW B;  3AM2 A;  4WZC A;  1S0B A;  2BOJ A;  2FZ1 A;  3SH4 A;  4CTE A;  1RYY A;  4Y1Y A;  3ON7 A;  3AMM A;  4B7E A;  1OFS A;  4GD4 A;  1GNZ A;  2OX0 A;  3KS7 A;  5FQ0 B;  1WD4 A;  1FMD 3;  3W21 A;  4XBN A;  2NN8 A;  1G8W A;  2IXH A;  4PI2 A;  1XC6 A;  4YG6 A;  5FXV A;  5BY5 A;  4SLI A;  4K20 A;  2XQR A;  4N53 A;  1HV0 A;  3SXW A;  2OZJ A;  2Y6K A;  4IET A;  1CR7 A;  2GP5 A;  2Q1F A;  3G6J B;  4IXL A;  3M2M A;  4XFB A;  4YZ3 A;  5B2G B;  1OVP A;  4UYB A;  1DQ5 A;  1ULP A;  1GMM A;  3VBH B;  2X5I A;  1V70 A;  1AXK A;  1RL3 A;  1UIJ A;  1VBD 2;  3GYD A;  4NPR A;  2ZXQ A;  4XAA A;  3BGA A;  4YWA A;  3ST7 A;  5GLZ A;  2QKD A;  5CG8 A;  5F8P A;  3NL1 A;  5LB6 A;  3T1M A;  3R6S A;  2BGC A;  4X8N A;  4XAE A;  4XF9 A;  4LOR A;  3Q8A A;  3T2P A;  5FZ1 A;  5J96 B;  4Z92 B;  4A2U A;  5FJK A;  3OGG A;  5AC9 1;  2UWA A;  5FQ0 A;  1MR5 A;  5DZG A;  1JN2 P;  3GHM A;  5FYY A;  1N3O A;  2DU1 A;  4MOA A;  5I8T A;  3O0V A;  1ULE A;  2DDU A;  4QPI B;  2OUJ A;  1S0G A;  1QEX A;  4Y26 A;  4AHW A;  2R1B A;  1OVS A;  2BV4 A;  4OLL A;  4RFR B;  5FKC A;  3TEX A;  4QDR A;  4BK5 A;  4OHX A;  3EXU A;  4FOW A;  4ZS3 A;  4JHT A;  5T5L A;  4XOG A;  1RUE 2;  4UFM A;  5JLV A;  2W91 A;  5IVF A;  4OVE A;  4NRM A;  1PNF A;  3WF3 A;  1RXG A;  5E16 A;  1X7N A;  1XB9 A;  2DCY A;  3U78 A;  3DEM A;  4WM8 C;  3HR9 A;  1OHF A;  4GIQ A;  2PHR A;  2FMY A;  4EYU A;  1N1S A;  4IUG A;  4RQP A;  1YIP A;  4FO9 A;  5T55 A;  5A33 A;  1TZO A;  3N9Q A;  4Q4X 2;  4BDV B;  2ES3 A;  1BBT 1;  4O7X A;  1JYC A;  2Q4S A;  1ODN A;  4FOV A;  2ARE A;  2VZP A;  1JYW A;  1CPN A;  4COV A;  2GNB A;  2NPI A;  4L8Q A;  3N7L A;  2W5F A;  4HOO A;  3OEB A;  4BQ5 A;  2OQ6 A;  4L9B A;  1G6N A;  1PVC 3;  2JDA A;  3BVC A;  3J7N A;  2DWR A;  3JUU A;  1SQ4 A;  3VD7 A;  5KXD A;  1NZC A;  2WN3 A;  3MIH A;  2X5I B;  1R09 3;  1MS3 A;  5KHG A;  3DN7 A;  3ZXG A;  3Q8C A;  3IB3 A;  3ILR A;  4WV8 A;  1ULO A;  2ZGQ A;  4YRD A;  2ZA9 A;  2WT2 A;  1B35 B;  3LDR A;  5A1F A;  3V0B B;  3KF3 A;  1UWW A;  2GZW A;  4EN9 B;  1RMU 3;  2EVX A;  2AEN A;  4BHP A;  1X9T A;  1O8P A;  2BDR A;  4CPB A;  1GKB A;  3D8C A;  3U10 A;  1ACC A;  1R09 1;  2EA7 A;  2W47 A;  5FRE A;  3E5U A;  4ATF A;  2Z4F A;  4L97 A;  3J8F 1;  1EAH 1;  4N7U A;  2ZML A;  4V1P A;  5FUN A;  1JMU B;  2KM2 A;  3MW3 A;  2OT7 A;  4QXH A;  2IFW A;  2PLV 2;  4HLT A;  3DPR A;  3POE A;  1QNW A;  2ZHL A;  5DAP A;  5FZD A;  2WAB A;  3PUI A;  3U4S A;  1BCX A;  1OA3 A;  4LKE A;  1GFF 2;  2Y34 A;  3DPR B;  1ZRR A;  3GBF A;  1Z0H A;  3GZT B;  1WWY A;  4AVV A;  2FDI A;  1IG0 A;  4WVZ A;  4Y1Z A;  5H9Q A;  2CWM A;  4GMP 1;  4AEJ A;  4DMI A;  4Y33 A;  5L9B A;  3MF9 A;  4WVM A;  2QZ2 A;  2ET1 A;  2RS1 1;  1CIW A;  5FPU A;  5FKB A;  1JOJ A;  3AZY A;  4OZO A;  3A21 A;  1U5I A;  4HN0 A;  2XVK A;  1J1L A;  2QQL A;  2YUE A;  3FFQ A;  4JQR A;  4YZ5 A;  2HWD 1;  3D0J A;  3U1X A;  3NKT A;  2WFP A;  3D0S A;  3EB7 A;  1MQT A;  1VRH 3;  4LBL A;  3V64 A;  3POJ A;  1DFQ A;  2RMU 3;  3WNP A;  4IEZ A;  2YPD A;  2X8K A;  4JAA A;  5FMB A;  3ZFF B;  4UWD A;  4LOT A;  1V9U 1;  1FPN 1;  3BOD A;  4FP2 A;  1CAW A;  3GGL A;  3USU A;  1ND2 A;  2J42 A;  4LOS A;  3MF6 A;  5AFE A;  2WNU C;  1GOF A;  1VR3 A;  2R04 3;  1UY3 A;  1HRI 2;  1RUC 3;  2BQP A;  2HWE 1;  2VTX J;  1GZC A;  4QX1 A;  1BKZ A;  3ASI A;  5F37 A;  1RUH 3;  5JAX A;  1DZQ A;  3B7M A;  4XAB A;  3I3B A;  4L99 A;  2D6M A;  3IZO A;  5K9Y A;  3MGU A;  4Y20 B;  2RR1 2;  4JV4 A;  4XMI A;  4AFB A;  4E2G A;  2P37 A;  4XXA A;  5HCF A;  3JQX A;  2QCS B;  3JQW A;  1AYN 2;  2PHD A;  4R52 A;  3K4Z A;  4RR3 A;  4MGZ E;  5FBJ A;  4AI9 A;  5A3T A;  1UZW A;  2DTW A;  2VMG A;  3ZDS A;  2FDJ A;  4N8M A;  4ET7 A;  3VBH C;  4OUS A;  3ZYP A;  2XBO 2;  1VAM A;  3BOW A;  3FLR A;  1K12 A;  4M0N A;  5CFD C;  2UWB A;  2E7T A;  4HVO A;  2JJ6 A;  3WOG A;  4BLI A;  2X5I C;  1IPJ A;  1MEC 2;  2VC9 A;  4X8P A;  2YC2 A;  5D2A A;  5FZI A;  1PIV 1;  1OOP A;  2VY0 A;  3PVO A;  4IV3 C;  1W6O B;  2W3J A;  2V09 A;  1MS0 A;  2QQW A;  4HSL A;  5IK5 A;  3KD4 A;  3ZN5 A;  1TME 1;  1OA2 A;  1GP5 A;  1RXF A;  4R9D A;  4YVW B;  4NHM A;  1RUF 2;  5BNP B;  2TNF A;  5GZD A;  2ADE A;  4AVC A;  1FAY A;  4WBB A;  1ASJ 1;  1PO1 2;  3VZN A;  4K9S A;  5EYX A;  2IVI B;  1K45 A;  1A8D A;  5LBF A;  4DS0 A;  4NIG A;  1QQP 3;  1GZW B;  1UX7 A;  4CU7 A;  5C5T A;  2OS2 A;  2VGD A;  2BWA A;  4NHK A;  2R30 A;  3ZKY A;  3WVJ A;  1MVE A;  4V2W A;  4RGA A;  3OD4 A;  2HYK A;  3AZX A;  4MAD A;  4DXT A;  3ZFG B;  1MZ5 A;  2H0B A;  3LZZ A;  1QMJ A;  4M4P A;  4RD7 A;  2HJI A;  4COW A;  1G9F A;  3I2O A;  2EIG A;  4R4X A;  4LXL A;  1PO2 1;  3NNF A;  1RUH 2;  3AP7 A;  2W68 A;  3H8U A;  2VR4 A;  4NR1 A;  2JG9 C;  3GM8 A;  1PZ8 A;  4AFC A;  3ZFE C;  2GN7 A;  1EAH 3;  4FOQ A;  4RL7 A;  2B9V A;  4QPI C;  4D7S A;  5FK8 A;  1CD3 G;  3BCW A;  4G4F A;  4UFI A;  5FK7 A;  4IEW A;  2GC3 A;  5L19 A;  4FFF A;  1X9P A;  1NCR B;  3KV9 A;  2F4P A;  1I9R A;  1LAJ A;  1DQ6 A;  1GOH A;  4XTM A;  2R1D A;  1JXN A;  1BVP 1;  4NIA A;  4CP9 B;  1O4T A;  2GU9 A;  4RQP C;  4ZZ8 A;  2ZEY A;  2XG3 A;  3MI8 A;  3UGF A;  4DIQ A;  3M3I A;  2VMC A;  1OLQ A;  1JYV A;  2A6V A;  3KVA A;  4LR4 A;  2R0H A;  2VJX A;  2V4V A;  3DL3 A;  2JIG A;  4MO3 M;  5FPL A;  1Y9M A;  1PGL 1;  1MS4 A;  5EZW A;  3UKT A;  1BVV A;  1GOG A;  3TN9 1;  4YGB A;  2CY6 A;  1TNF A;  4CDQ A;  1RUD 3;  4BME A;  4O65 A;  2ZGM A;  4QXC A;  3RDI A;  2V5D A;  3KLS A;  1AJK A;  2VMF A;  4KL1 A;  1AR8 1;  2B39 A;  4ARY A;  2FHR A;  3N4M A;  3N7J A;  3O1M A;  5CAZ A;  3WP5 A;  2V4A A;  4AFA A;  4NVP A;  1SG3 A;  4WVM B;  1H9P A;  5DAB A;  3ZFE A;  1W6P A;  4CDX C;  2JG9 A;  1BQP A;  3KHC A;  3ZXK A;  3SKV A;  2RS3 1;  1W6P B;  5FYM A;  2JE8 A;  1W8T A;  1FI2 A;  1HXS 1;  1VIW B;  3QD6 A;  4O9E A;  3ZXE A;  4AQS A;  4BB3 A;  5DG2 A;  2WJS A;  2LRP A;  5E8A A;  3IMM A;  1JS9 A;  1NXM A;  2PHU A;  3J8F 2;  3PTY A;  4QM9 A;  1LGC A;  1MAC A;  1WCD J;  3HVD A;  4LKD A;  2Q8O A;  5J48 A;  5F2W A;  1C57 A;  2PAM A;  4JKL A;  4DPN A;  4JGZ C;  4YW6 A;  3S6P A;  2PLV 1;  1RUJ 1;  2ZBJ A;  5FY8 A;  3III A;  5JMC A;  3KQ4 B;  3V65 A;  2GNM A;  4XPV A;  4UFJ A;  4JGY A;  1YQ5 A;  3SMH A;  1L7Q A;  3O12 A;  5LCW L;  2EIE A;  2OPK A;  2HBT A;  4XQD A;  4XUR A;  3NJV A;  4HSJ A;  1QJF A;  3LCP A;  1C5H A;  1C8M 1;  5LEK A;  1ND3 C;  4KMQ A;  3ZXF A;  4BIO A;  2A73 B;  3MIE A;  4OMD A;  1ULF A;  4P5H A;  1LOE A;  3IBM A;  5FJH A;  1ODM A;  1XE8 A;  4CCE A;  1IQA A;  3BAL A;  3WEZ A;  3NV4 A;  2P6H A;  3AP4 A;  3FMG A;  3LOI A;  2DBI A;  4UFH A;  2GH8 A;  4L2N A;  3M7A A;  4AK3 A;  2A70 A;  1GU3 A;  3BPZ A;  4OHY A;  3QLQ A;  2JWP A;  4GB3 3;  3VBF B;  4E2Q A;  3EQE A;  1W2O A;  3HPN A;  4BJ0 A;  4Y1V A;  1RIN A;  5FMO L;  1UPS A;  2LAL A;  3AYE A;  4TWT A;  1JZ6 A;  2ZGT A;  1ZBE 3;  3BI3 A; 
#chains in the Genus database with same CATH homology
 2FDJ A;  3I3Q A;  4QKF A;  4CXX A;  3BIE A;  4NIG A;  3O1M A;  3T3Y A;  4OCT A;  4CXW A;  4CXY A;  3RZK A;  3BTZ A;  5DAB A;  3O1T A;  3BKZ A;  3S57 A;  3S5A A;  4O61 A;  3LFM A;  3O1O A;  4IE5 A;  4QKD A;  2FDF A;  4QKN A;  3KHC A;  4O7X A;  4QHO A;  3O1R A;  2FDG A;  3KHB A;  4IE0 A;  3RZM A;  4NRO A;  2FD8 A;  4QKB A;  4NII A;  3H8R A;  3I2O A;  3RZH A;  4IE4 A;  4MG2 A;  2FDI A;  2IUW A;  4RFR B;  3I49 A;  4IDZ A;  3BTY A;  2FDH A;  2FDK A;  3T4V A;  4NRQ A;  4NPM A;  4NRP A;  3RZJ A;  3I3M A;  4IE7 A;  3BUC A;  4ZS3 A;  4JHT A;  3H8O A;  3RZL A;  3O1P A;  3O1U A;  4IE6 A;  4NPL A;  3O1V A;  4NRM A;  5F8P A;  3H8X A;  3T4H B;  3RZG A;  3BU0 A;  4ZS2 A;  4MGT A;  4NID A;  4NIH A;  4ZHN A;  3BTX A;  3O1S A;  4NJ4 A;  3BI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...