1J1LA

Crystal structure of human pirin: a bcl-3 and nuclear factor i interacting protein and a cupin superfamily member
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
288
structure length
288
Chain Sequence
SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pirin
publication title Crystal structure of human pirin: an iron-binding nuclear protein and transcription cofactor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 71
structure length 288
sequence length 288
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02678 Pirin Pirin
A PF05726 Pirin_C Pirin C-terminal cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1j1lA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1j1lA01
3FZ3A 2OA2A 2ET1A 2GZWA 4K8FA 3H1WA 2UYBA 1X7NA 3E6BA 1CAWA 4I02A 2PQQA 3OD0A 1CAUA 4YSFA 1CAXB 1DZTA 2D5HA 5EFUA 4FBFA 3FWEA 4EWEA 2XGXA 5JSRA 2CGPA 1O3RA 4N9IA 4QGNA 2H6BA 2QJVA 3QACA 2MNGA 2PAKA 1UIJA 1LR5A 3CF6E 3RZZA 4HSJA 3EQEA 3IDCB 2FMYA 2HJIA 3E5XA 4AVAA 2ET7A 4QGMA 4R52A 3L2HA 3LZZA 1O4TA 3NKTA 2V09A 5JR7B 1WA4A 4KU8A 1I5ZA 2PHLA 4L2NA 5C8WA 1CAVA 1L3JA 4LUKA 3H8UA 5FCCA 5FQ0A 3EO6A 4UBHA 3I7DA 2BYVE 3CLPA 4MX3A 5F1RA 1CGPA 1O5UA 1IPJA 2GAUA 2PAMA 3BB6A 3NL1A 3NSTA 5T3NA 2N7GA 2Z69A 4IEYA 2Q30A 1ZZBA 4WVZA 3E6DA 1SQ4A 4EV0A 5JSOA 2IC1A 1Y3TA 2PTMA 2MHFA 5LEKA 2K0GA 3BU7A 1ZRDA 4PIZA 5JSPA 4META 2XL7A 4QX5A 3HT1A 1QXRA 3CJXA 4WZCA 5KHKA 1FT9A 3OCPA 1O5LA 3UKVA 4XF9A 1GQHA 3SCHA 1DGRA 3R6SA 5BY5A 1UW8A 4MGYE 3RNSA 3PVBB 1RUNA 1FXZA 3OF1A 1YUDA 1RUOA 3HIFA 2D40A 3NVCA 4N9HA 4MZUA 3I59A 1JUHA 3PNAA 4XF0A 5I8SA 4BYYA 4Q0UA 1FI2A 5JCTA 4HMZA 1WLTA 1YWKA 1ZZ8A 4XFGA 1VR3A 1TQ5A 4R8HA 5FLJA 3H1YA 5BPXA 1OI6A 4LEJA 4Z07A 3SHRA 1SFNA 1I6XA 1HW5A 1EPZA 4IESA 2H0VA 5J3UA 5KHGA 4YYOA 3FE5A 4XFAA 4Z82A 3U0ZA 4AVCA 4ZU4A 1LRHA 2O1QA 4HBNA 3D0SA 3E5UA 3ETQA 1Y9QA 5HI0A 4IETA 1J1LA 1O3TA 4EWAA 3G7DA 5FPZA 3QOPA 1Q5OA 4YNIA 2K9ZA 1XE8A 2CAUA 3EHKA 1X8EA 1O7FA 2CV6A 1IPKA 4KU7A 1UD1A 1GQGA 1WGPA 3NJZA 3SMHA 4KL1A 2MPFA 3IWZA 2B8MA 3DV8A 4XF3A 2XLAA 4FAGA 5KBFA 2Y0OA 2D93A 3DL3A 4TLFA 1RC6A 3RPQA 3HQXA 3KCCA 1QY4A 2KXLA 4HVQA 3BPZA 2ETEA 4RD7A 4XFHA 4IEVA 5LEJA 3JZVA 1OMIA 4EWDA 4LULA 3M70A 4XFIA 2B5HA 2XKPA 4HN1A 4Q0VA 3D0JA 1YFUA 2OYZA 4AQ6A 3KMHA 4MUVA 1ZX5A 2XHKA 4A2UA 2GC0A 2UY9A 1J58A 3LA3A 1ZVFA 4I0AA 4MGZE 4FT8A 2IXKA 3FJSA 4L11A 4ONUA 2EA7A 1H1MA 1PMIA 5BV6A 4P9GA 3RYKA 4XFFA 1YFYA 1O3SA 3RYPA 3TNQA 5CADA 3KGZA 3ELNA 4H7LA 5C6CA 3DN7A 3M3IA 4I0BA 4UBGA 3I59B 4YARA 3WW3A 5I8TA 2IXIA 1OFNA 5AVPA 3VHRA 2HKXA 4I01A 1RGSA 4QXKA 1RTVA 2PYTA 5KHHA 2XL9A 1NXMA 3ROUA 2UYAA 3S0MA 4J1XA 1UCXA 4BH9A 1ZNPA 4O9EA 4IEWA 1PM7A 3KSCA 5J48A 3S7EA 4ORFA 4FAHA 2ZKLA 2GC1A 2Q4SA 1ZREA 3TNPB 2QCSB 5LRSA 4ZU5A 3B02A 2EVXA 3HT2A 5I0RA 2IXJA 2Q0AA 1YFWA 2BNOA 1EY2A 4I09A 1LKNA 3SXWA 3GYDA 4PIYA 3E97A 4JTOA 3MZHA 4QM8A 4Q0QA 2FQPA 4IEOA 4YRDA 5I0TA 1CAWB 3MPBA 3BCWA 3EBRA 1CAUB 1NZCA 5KHIA 2BEOA 4QM9A 3IBMA 4E2QA 4IEZA 5JAXA 3LA2A 4E2GA 2BNNA 2VQAA 2UY8A 4IEUA 4PIXA 1QWRA 3LA7A 2QVSB 2P17A 1ZZ9A 3H7YA 2GH2A 4WBBA 1UIKA 1UPIA 4IEXA 1O3QA 3MDPA 2ZCWA 3I54A 4DINB 1ZRRA 5LRRA 3H7JA 4UXAA 3FHIB 5I8YA 3IIAA 4LTAA 4XFBA 5FLIA 4XF4A 1CX4A 1NE4A 4MH0E 4HZFA 1YLLA 2WFPA 4PJYA 5D1IA 1XRUA 5J7MA 2GC2A 4OLLA 4XFCA 5CVRA 4ZU7A 4J1WA 4LLOA 3FX3A 4IERA 2GC3A 3KGLA 3S7IA 2D5FA 1X8MA 3CO2A 4Q29A 3SCFA 2GU9A 4JV4A 1CAVB 4XETA 3WW1A 4F7ZA 1VP6A 3CEWA 5FQ0B 5E16A 4KWJA 3H9AA 3UKTA 3ACLA 4XEZA 2PFWA 3WW4A 5FPXA 3MYXA 2CAVA 3PLQA 3UKNA 2XLGA 2IXLA 1J3QA 3NW4A 5BUVA 1ZZCA 2PAEA 4IEQA 3D82A 2XKOA 5I0UA 4AQ2A 1OD5A 4BIFA 4EROA 2BNMA 4F8AA 3O14A 5K8SA 1DZRA 3ES1A 5FDBA 2F4PA 4BHPA 4Q0SA 5I91A 3LOIA 1SEFA 2DCTA 4O9GA 2IXHA 4Q0PA 1LB2A 1DGWA 4I3PA 4AXOA 1J3PA 3EJKA 4HSLA 5I93A 1Q3EA 1CAXA 4KWKA 2QNKA 5E1RA 2OZ6A 3DKWA 2WC2A 4JVAA 1RL3A 2IXCA 2Z2SB 3C3VA 3ZDSA 4MGKE 1VJ2A 4QGLA 1J59A 4HVRA 1ZRFA 3IDBB 1V70A 2PA7A 3ES4A 1H1IA 2BGCA 3H50A 3E6CC 4HLTA 4NVPA 3N4MA 3ST7A 4D7TA 4OFGA 4X6QB 5EZWA 3E5QA 1ZRCA 2I45A 4MGIE 3FFQA 3CL1A 3GBFA 3LWCA 1YHFA 4B29A 1Q43A 3USSA 3RDIA 5FLHA 1QXJA 2OZJA 2B9UA 2XLFA 4KWLA 3U11A 2H6CA 4AVBA 2ATFA 4GULA 4MV2A 3OTFA 4D7SA 2Q1ZB 4LA3A 1NYWA 1YFXA 1U12A 2C0ZA 1EYBA 4E2SA 4HVOA 5KHJA 1J3RA 2VECA 2O8QA 4IEPA 3OGJA 4JTNA 2EAAA 2QDRA 1ZZ7A 1NE6A 4HN0A 4XF1A 5CU1A 3RYRA 2E9QA 1ZZ6A 1EP0A 5BXXA 4QMAA 1XE7A 1G6NA 4X6RB 4LA2A 3WW2A 3U10A 4I2OA 5I0SA 2OPKA 3SCGA 4LUMA 2VPVA 4CYDA 3H1MA 3LAGA 3H3ZA 3BALA 2PHDA 1X82A 3H3UA
chains in the Genus database with same CATH superfamily
4FVVA 3FZ3A 3ALQA 1JODA 2D3SA 2OA2A 4U36A 1IGOA 2OW4A 5DZGA 4AWDA 3Q8EA 1O59A 3ZYIB 1W28A 2JE9A 1EAH3 4KBBA 1BJQA 1M4WA 4OI2A 3VBUB 1SFYA 1RUD2 1RUH3 2QQJA 2R043 1LGCA 3R4DB 1G9CA 2NM1A 3ZVXA 5DN2A 2PQQA 3D4KA 5DAVA 4YSFA 5LCWL 3NRUA 5A7PA 5JI9A 2RR11 4XAAA 3VBSA 1ULDA 5ACA2 1W2UA 3POFA 2XGXA 2ZX4A 1O4ZA 3UYJA 2CGPA 3T1MA 4ASMB 4N9IA 1WCUA 3I2OA 2D6MA 5A3WA 5F5AA 2VZQA 4P08A 3VB9A 2E7QA 2P5BA 1H2LA 4RFRB 1K3IA 1S2EA 2HLEA 2W87A 2PAKA 4LBQA 2VMEA 3X29B 2PHUA 5FYTA 1IKQA 4HSJA 4IGPA 4B1MA 2AREA 2G9FA 5L9BA 1W6MB 4A3ZA 4YW2A 4AVAA 2IZWA 1NCQA 3I2KA 2ET7A 3A0KA 3ATGA 3Q8AA 4QGMA 2RS53 3GM8A 4OCTA 5FREA 2A5ZA 3QD6A 1H8TC 2AH2A 3NKTA 4CU9A 1OFSA 1SBDA 1IS6A 2V09A 1RVF2 4O7XA 5JR7B 4COYA 2G9ZA 2IUWA 2PHLA 5FY9A 2QDNA 2BRTA 3ZN6B 5C8WA 1COV3 1WW6A 4YZ4A 2QQPA 1DCSA 1L3JA 2Y60A 3HBZA 3VDDC 3VKNA 4HKOA 3EO6A 4NMIA 5FXWA 1S0BA 5IFPA 2BYVE 2R062 3EB7A 5F1RA 2I2SA 4PLOA 3ZYBA 4ZZ8A 2PLV3 2LUWA 1O5UA 4E4HA 1SBEA 1C28A 1D2QA 1W2TA 4O61A 5A6YA 3SNMA 1Y9MA 1LHUA 1IOAA 1QKQA 2VBBA 3BB6A 4HXCA 3MUY1 4SLIA 5LBBA 3KT7A 3NSTA 4CU8A 5HBAA 5IATA 3RZLA 3PMEA 1N47A 1C8M2 4BWOA 5LY1A 1RUG2 2N7GA 4WVZA 5FIXA 3LDRA 4J6GA 4DFSA 4H2AA 1Z7S1 2PTMA 1VMFA 2RDNA 4ARYA 5LEKA 3THCA 1YC61 3T2QA 3PU3A 3BU7A 5ACA3 5FMOS 5C8CC 1RYYA 4IE6A 4PIZA 1VRBA 5JSPA 4RGKA 1W9FA 4NN0A 4QX5A 5C4WB 1O4YA 2WS93 4QHOA 1W6PB 1UKRA 4LQRA 3LKJA 3CJXA 4WZCA 5L9RA 1SLCA 1VRH2 1DF0A 3PVOA 3T2PA 2OUHA 1J84A 3HNBM 3LB9A 1W6OA 3N9PA 3VKOA 4PT6A 1W05A 3MLJA 2VAUA 2XPJA 3R6SA 3ECQA 1BBT2 2DFCA 4GZ9A 1RUOA 1POV0 3EXUA 2D40A 4M00A 5LA2A 3BTXA 2RM21 3C7GA 3ZYGA 3WHUA 1GZWB 4D6RA 3NQHA 1SZBA 3N9LA 5JCTA 5ACA1 4HMZA 2D3RA 5K0UA 1WMXA 1PNFA 1TQ5A 2HBTA 2G19A 4TYSA 3WNMA 4LEJA 4NRPA 4QX7A 3QH6A 1WLWA 2WUHA 5IW0A 1XYOA 3ZYJB 1ENQA 2H0VA 5J3UA 1PIV2 1IG3A 1TMF3 4G3YC 2ORXA 2WN3A 2IFWA 3K4DA 4KWUA 4XJWA 4YZ3A 1MVEA 2WNEA 2GMMA 1LAJA 4LBQB 3IDEA 3WINE 2VNOA 3ETQA 5JI7A 4XTMA 3O7OA 2YY1A 3VKFC 3KV6A 4IETA 1XE0A 4EWAA 1TEIA 1KFXL 4OZOA 5K4LA 3ZSMA 2QQNA 4Y4YA 1GKBA 1ND2A 4UW5A 1ZYBA 3QOPA 1KS5A 2K9ZA 3U37A 3LOBA 4CDWA 5FYCA 5FY5A 4PBPA 1X8EA 1C57A 2CV6A 1IPKA 1K5MB 1UD1A 2RS31 2XUEA 3NJZA 1AR71 1HJFA 2JG9B 2ZKNA 3GBGA 2B8MA 3I2HA 2Q8OA 3DV8A 5IYYA 1ZBA1 2VUAA 4XF3A 2XLAA 3C8XA 4NIAA 1UKGA 4LBMA 1ZBE3 2RS13 4UFKA 3TBDA 4TLFA 3T0AA 3HQXA 4P9XA 1HRV3 1NLRA 3M1HA 3PMSA 1GNYA 4RS5A 5T5LA 3MUZ1 4HVQA 3WLUA 1GLHA 3SLIA 1POQA 4QX2A 4RD7A 1GYKA 1EAH2 1UY0A 2VE1A 3MF9A 5A3MA 1C8M1 3ZYFA 4EWDA 1RUG1 3SEEA 1RUH2 1UY4A 2A3XA 2R042 5CYYA 3OPTA 4LHLA 4P9IA 2VVDA 3VD7A 2YV8A 3HNMA 4ISQA 1DIWA 2B5HA 5A7QA 4UF0B 3V0AA 2F17A 3I3QA 1Z0HA 4Q0VA 1JYVA 3PHMA 4LO6B 1YFUA 4LE4A 1P8JA 4QHBA 4AQ6A 3KMHA 4MUVA 2GNBA 3BOPA 1EV11 5J37A 1GZCA 1SLBA 2GC0A 2UY9A 1J58A 5F39A 1HRI1 1F4HA 3WXPA 4MGZE 5E6HA 3ZFEA 3ZIXA 4BIOA 2IXKA 4YPJA 4LIUA 4N8MA 4BU2A 3EMRA 5LBCA 1LTEA 4CP1A 2ZTNA 3U14A 4N90A 4QX1A 4ONUA 1C1FA 1NG0A 3ILNA 1WBFA 2ZACA 2EA7A 3O0VA 4CCOA 4E4ZA 1H1MA 2R16A 5FKBA 4WM8B 5DZFA 1PX3A 1CJPA 4P9GA 3VBOB 5FR3A 5JZGC 1DYPA 4B1LA 1BVVA 4YFZA 1NT0A 1YCIA 1OH4A 2VNRA 4JC1A 3RMYA 2RS52 3RYPA 1HB4A 3AYDA 3ELNA 2DU1A 2WNVC 1JUIA 2KD7A 1ONAA 2OIIA 2ZGSA 3WG3A 4TSVA 4CDXC 3M3CA 5KR7A 3M3IA 4I0BA 3AVSA 5FPUA 3NJXA 4CDUA 2ZHLA 3WQ0A 5IAVA 2WBKA 1UQXA 3GXUA 1UO9A 5FXZA 1OFNA 3WW3A 1CJDA 1COV2 2HKXA 3K4ZA 4I01A 4QXKA 1SLAA 3VBHB 5FO8B 4XUOA 5KC5A 4AFAA 1J1TA 1W9YA 1DG6A 1V9U1 3ZXDA 4CSWA 2DU0A 1C1LA 1HXS3 1HV1A 1R1A2 2QTWB 1PZ7A 2HWF3 4QX0A 1UCXA 5C3PA 4O9EA 3OPZA 4COVA 5CFCB 4OMCA 1OLMA 4MG2A 3VBRA 3ORJA 2WT0A 5FY4A 3RI9A 5J48A 2YFZA 4ORFA 1HN1A 2ZKLA 2HEVF 3M3QA 2Q4SA 3OOXA 2P3YA 1C5IA 1MS1A 4GKYA 1JHNA 3ACHA 2TNFA 4ET7A 4E9KA 2Q1FA 4KMQA 1JZ4A 1VBE1 3O1OA 2NLRA 2BNOA 2GH8A 1NCRC 4WVVA 3DPRB 4BQ1A 4IQPA 3IAPA 2DTYA 4JGZC 4IE0A 3AXEA 1PVC1 4KBZA 1K5JA 3TRSB 4YRDA 4COZA 1QJFA 2WS92 1SG3A 5T5PA 2XWBB 1F2NA 4Q4W3 2Z42A 3EBRA 4AI1A 1CAUB 1NZCA 4MGQA 3I49A 2BEOA 4E2QA 2W91A 3IBMA 4E2GA 3ITQA 4CEYC 3O1RA 5JOZA 4QXBA 1DLCA 2QKDA 4PIXA 5A7SA 5JDBA 3S5QA 1ULEA 5A3NA 3H7YA 1N3OA 5A3PA 1SLTA 1AYN3 2Q5TA 1QJU3 1PGW2 4RS5B 1UIKA 3T09A 2W1UA 1GOHA 1UPIA 2B46X 4IEXA 4EN6B 4CCKA 1UOJA 5B4NA 5ABJB 3RVHA 4YW6A 3O1MA 3MDPA 4DINB 4Y3OA 1CZSA 3MPPG 5JVVA 1EUTA 1QMJA 1BYHA 3OY8A 4LTAA 1AYM1 1U5IA 1F31A 4BJ0A 5BYNA 5D1IA 1XRUA 2XQXA 5FAXA 4XFCA 4PDWC 4CEWC 2XMLA 1OLQA 2BTVC 3B00A 3H42B 4GH4A 4Y5SA 3VBFA 3WCSA 4UOJA 3OBRA 2TBVA 1GWLA 4FFGA 1TMF2 3OG2A 2GMPA 4HG6B 3ZFEB 3AC0A 4AF9A 5CEHA 2D5FA 1HIXA 2R7EB 2X5IA 3KVAA 1AX1A 1CAVB 3WW1A 5C33A 4CP9A 1RJ8A 4C0BA 5E16A 2CWSA 3RJ2X 3LIHA 1PO11 4HL0A 2BOJA 1W8TA 2CDOA 3J7MA 2PFWA 2PN5A 2Y0IA 4KG0A 4F3JA 4RR3C 1SLIA 5A6QA 2WABA 1VPHA 4HOOA 3MBWA 4K1ZA 1DQ1A 5A33B 2DCKA 3UKNA 4G9SB 3C7HA 4NO4A 2OQ7A 3T4HB 3J8F2 2EAKA 3WQ7A 2IXLA 1TZOA 4XMIA 1J3QA 4DRRA 5DAWA 3C7OA 2ZGPA 5CG9A 1HQWA 1BXHA 4BQ2A 5BUVA 1Z78A 3FMGA 2V5DA 3J7NA 1ZZCA 3PTRB 1S55A 5F6LB 1KEXA 3WX5A 4CTEA 1ZBE2 2VO5A 2ENRA 2YC0A 3D82A 1R1A1 3P6BA 5GZEA 1GBGA 3WUCA 1HRV2 1GQPA 4ASKA 1OD5A 1GUIA 4FXGB 4HONA 4Q8LA 4QPIA 2BNMA 4EROA 1E5RA 1D4VB 4HT1T 2VGDA 1KFUL 3DYOA 3O14A 5K8SA 1BZWA 1W6NB 3ES1A 1YQCA 4XZUG 5FZHA 5BNOC 2VTFA 4BHPA 4Q0SA 5CB7A 4NHXA 3K3NA 4LR4A 1FMD1 4O9GA 1RHI3 2EXIA 5IHRA 2IXHA 4Q0PA 1MQTC 5LWBA 2D97A 4K20A 5FP4A 3OSDA 1Y4WA 3TWIA 3MV01 3J7LA 2BGPA 1F9KA 1LOFC 4I3PA 1OHFA 2W2IA 4HSLA 1QJY3 1R64A 4Q1PA 4OYUA 3ZYPA 4ZONA 3WF4A 1VAVA 2WS91 1DP0A 4PQ9A 4FCAA 2R1BA 4LKSA 4IL7A 5FYIA 1K12A 4SBVA 3ZPOA 2YU2A 1H8TA 1FNZA 4ISRA 1PO21 3ZDSA 5CA6A 2VMHA 1AX2A 1IG0A 4BISA 4HVRA 4D0QA 1J59A 4BOWA 2JKXA 4JZRA 1V70A 4OZXA 4S2GA 1ACCA 4UW3A 3ZR6A 3ES4A 3FLTA 2ZGNA 3VDDA 2BJSA 1H1IA 5FJKA 3WDYA 3SH5A 5FPVA 2D6PA 2WNUA 4C91A 4NHMA 4YZ5A 2FD8A 2VC9A 4P5HA 1L7QA 1LODA 1W04A 3WF1A 2QUOA 5GJ6A 3UV9A 2ZHMA 4D7TA 4NRMA 3CIHA 4S2DA 4X6QB 4M3CA 1GP5A 3OEAA 3TN93 1HXS2 1H4HA 5EZWA 2HWF2 3LPGA 3KB5A 1TMF1 4CZSA 2GDFA 1GFF2 3BOWA 2JDHA 1B09A 3APBA 4B29A 2Z5WA 3USSA 4DQAA 3I3MA 4HFSA 3RZMA 3M7AA 4DNYA 5FZ6A 4MLOA 5C8CA 1QXJA 2OZJA 1OSGA 4XQWA 1ULOA 4KWLA 5FZGA 1XNAA 2GN7A 2H6CA 4M4PA 5IVEA 2W94A 3FC0A 4GULA 3OTFA 3AP7A 2Q1ZB 3I2DA 4K3UA 4Y1UA 1NYWA 1YFXA 5FZLA 3RS6A 4AVTA 1FAYA 4LO8A 1LESA 1NQJA 5A3UA 1X9TA 3J8F1 4XHBA 4E2SA 3DEMA 1D0HA 5J96B 4Q4W2 5F8PA 4YG3A 2WNOA 1AL21 4NIDA 3VZMA 4Z2AA 1NA1C 4LHNA 3OGJA 5FYYA 4FTSA 2QDRA 2B45X 4XOGA 1ZBE1 4NJ4A 1AR61 1BCXA 4JQTA 1DGLA 2QZ2A 4UT5A 1HRV1 4W4ZA 3ZXLA 5A32A 4QMAA 1XE7A 2R30A 4X6RB 1AYN2 4FPYA 4LA2A 1MACA 1QJU2 1UZYA 4YW7A 3Q9OA 4XDQA 2QQOA 4YVWC 2CGNA 2W0XA 4IV1B 5HV0A 3U4XA 3SCGA 4ES8A 4J25A 4MGTA 1DZQA 3O0XA 1H9WA 4A7KA 1JYIA 2V4AA 2A71A 1SPPA 4R9BA 2XJPA 2XUMA 2ET1A 1QOTA 2GZWA 3J9SA 4CUCA 2UYBA 1AF9A 4LBJA 1X7NA 3P5BA 4GMP0 1FATA 5A80A 5A7WA 1H2MA 2BP6A 3TB0A 1ZM1A 3AVRA 3I2FA 4KNCA 3OD0A 3THDA 1RUJ3 1DZTA 1W9TA 4TXWA 4LKEA 2X53S 2D5HA 1PK6C 2A73B 3FWEA 4D7YA 1JN2P 3GHMA 1VMHA 5FO7B 1O3RA 1LEMA 4LOTA 4XUPA 3WG2A 3HNYM 3ZM8A 5FFOC 4L99A 3QACA 3AXDA 5T54A 5CAZA 2WZR1 4XCAA 1UZ0A 1UIJA 3AYAA 3GF6A 5FZCA 3BTAA 1PM4A 1Y7BA 4QU1A 5FY1A 4CDUC 2HJIA 4UYBA 1CR7A 5IVFA 2EIBA 2GNMA 4LE3A 1HB3A 4R52A 4AGVA 2Q1MA 1AR93 3LZZA 4GB33 5GZGA 3WNLA 1JHJA 1HKDA 3WUDA 2Z79A 3W21A 4JCKA 1XNCA 2P34A 3KS7A 2HWF1 4NR1A 1WA4A 3LD8A 4KU8A 3T2OA 4COUA 5A1AA 4MHUA 3VDBA 2XVLA 1STMA 5AVAA 2FDKA 1YI7A 4H55A 5CKQA 1UY3A 3MW2A 3JBG3 1KJLA 4BQ5A 2XJSA 5FQ0A 4UBHA 4W6WA 3WCRA 2YPDA 3CLPA 4MX3A 4W6XA 1OUXA 2LALA 1CGPA 1RITA 2FBEA 1F5JA 1IPJA 2VMFA 2GAUA 4FPJA 4XXPA 1QGLA 1W99A 5H9SA 4E8DA 5T3NA 3CBNA 2PQSA 2AEZA 1QJY2 1CZVA 2Z69A 3CU7A 1ZZBA 1APNA 2E63A 1POV3 2YGLA 1SQ4A 4EV0A 5JZGA 2V73A 3LF7A 3TEZA 2WO1A 1IS3A 4KGGA 4QDSA 2IC1A 1ASJ3 1O8SA 4GMP1 4Q4Y3 1RB8G 4ARXA 2VUDA 3NNJA 4LT5A 1U5YA 4FFIA 3OGSA 4FPCA 3H8OA 1OQEA 3IKWA 4BQ3A 5F5CA 5ABJC 2WNVA 4PHZA 5DAQA 2VTXJ 4CDXA 2XL7A 1QQP1 2VOKA 1QXRA 1AYN1 2L9LA 1W0NA 1ULFA 3GNEA 4I3GA 2OQ6A 4OI0A 2JD4A 1FT9A 1LENA 4XF9A 3Q8CA 4D94A 1GICA 3LDBA 1UL9A 5F9TA 3AJYA 1OF4A 3R4UA 2VBDA 1LNSA 3WF0A 1TME3 3ZN4A 1R093 1OC1A 4MGYE 2D6OX 3DCQA 1FXZA 4QAWA 1RUNA 1ODMA 4DPNA 5LZ6A 4ZY9A 2HWC3 4L92A 3SEPA 3HIFA 5L73A 3NVCA 3WQ1A 3TN92 3GGLA 4Y22B 2JECA 5FZOA 3AMHA 5FYHA 4A45A 1YQ8A 3HPNA 2BOIA 3WDVA 4ZZ5A 1WLTA 1YWKA 2WZEA 3MO4A 5LBFA 4Q5OA 2VJXA 5CISA 1REEA 4UWDA 4R8HA 5FLJA 1NCRA 1PGL2 3KHCA 1OI6A 2A3YA 3ABZA 4HANA 4HK8A 4JGZA 4YW3A 1BVP1 1I6XA 2ZZQA 3TAYA 1EPZA 2X09A 1CONA 4W50A 3JB8A 2QQUA 2YUEA 3GZEA 4YYOA 1VBA1 1WWYA 5LB6A 4MO3M 5JXIA 5K9YA 5FBZA 2O1QA 4HBNA 1REFA 2CY6A 3AP6A 3D0SA 4M3CE 2ZHKA 3WDXA 5I0DA 1VBC1 2W46A 4LO7A 2BQPA 2R1DA 3S57A 4FPOB 4OHZA 2VD7A 3G7DA 3MIGA 3NNLA 3VL9A 1F5FA 3K48A 4IE4A 5A7NA 1Q5OA 1LOEA 3NJYA 4R9DA 2W95A 4YNIA 1YIPA 1IS4A 4ZS2A 4QDQA 4QPIC 1O7FA 4KU7A 1GQGA 1WGPA 5FZ9A 1BHGA 5A1FA 4NOTA 4KL1A 4JRAA 1VAMA 2MPFA 3ZMNA 5JLVA 2LTNA 2FDIA 1UU4A 2RDRA 2WJSA 2KR2A 4FPFA 5F5IA 2YXSA 5FMCA 5KBFA 2Y0OA 5AC92 2DUOA 3RMXA 5KXBA 4MSVA 1X33A 1XOYA 2X10A 3KCCA 2KXLA 1VB4A 4PDWA 4CEWA 4DZGA 1BEV3 1VB2A 4RA0A 2ZPXA 5DDJ1 1CIYA 3IPVB 3MF6A 5LEJA 1N1SA 1OMIA 1R083 3JZVA 4YVSB 3FHQA 2W1QA 2Y38A 1ND3B 3NKGA 3I8TA 4LULA 4Y20B 4AOCA 1NLSA 3N9QA 2WKKA 5GKAC 1RUJ2 2D6NA 3M70A 4BDVB 4HN1A 2DYCA 2BDRA 5EYXA 4XMAA 5EHDA 1RUC3 1MEC3 2R0HA 4LNVA 2OYZA 1SDWA 4DOUA 5F5QA 5FWJA 3ACGA 2DBNA 2ZBJA 3AMPA 2MEV3 2CTVA 4RR3A 4FFHA 2D44A 1UY1A 3B69A 4A2UA 1T2XA 2C9KA 2UURA 4B3NA 1ZVFA 2VTXA 2WNVB 2VQTA 3N35A 1O91A 1H9PA 2XXZA 4FT8A 2C1FA 3IB3A 2C9AA 2C26A 1RUI3 4Q4X3 2YC2A 2GNDA 4H14A 5FP3A 3WP5A 3AYCA 1PMIA 3MIFA 2WINB 4YGCA 4ZPIA 5C3OA 4K1YA 3RYKA 4AGGA 3NAPA 1OXCA 2WNUC 4XFFA 1YFYA 5E89A 4GWJA 1NY71 3VDCA 5IAXA 4DS0A 2O0OA 4JGYA 2ZHNA 2VVFA 4A6SA 2FCVA 1AR92 5FRAA 1QDCA 1FPN1 5CADA 3THTA 4CCMA 1JTZX 4JDNA 5BNOA 4YZ2A 2JG8C 2ZMNA 5LATA 5C6CA 4XZPA 3U1XA 2D3PA 4UBGA 3OGRA 4B7EA 2AACA 2PXJA 5JOYA 4AEDB 4HKWA 5JIUA 2VOTA 3JBG2 1MQTA 1QHDA 2JE7A 2Q8EA 1H1AA 2W08A 3ZLIA 1AR83 3UGGA 5GLUA 3UK9A 5C9AB 1LOFA 5GLWA 4CXYA 2XL9A 4IXLA 2WFF1 1A8MA 3ROUA 1JZ3A 4L8QA 5FJHA 1JYNA 1RUE3 1NCRB 5A6ZA 3HR9A 2WDBA 3D3AA 4NIHA 4BH9A 4BQXA 2A3WA 4MXWA 3MGUA 4QQ2A 2VVEA 4BQWA 1N1VA 3BN6A 1MR5A 3ZFGB 3S7EA 3C2UA 3UJQA 2VCCA 3POIA 2BPA2 2W1WA 3JB4C 2GC1A 4AHZA 1ZREA 4QX3A 2YROA 3NV4A 2QCSB 3TNPB 3WT3A 4CEYB 1ASJ2 4OUSA 5LRSA 4ZU5A 3B02A 1GSLA 1OOPA 4MADA 4Q4Y2 2Q0AA 2VW1A 4EN9B 1YFWA 4I09A 3HEIA 4PIYA 1V6IA 4AL9A 1KD7A 1RUD1 3MW3A 1HB1A 4QU2A 3DF0A 4QM8A 1OPOA 1LU2A 1S0EA 2XJRA 3MPBA 1IKPA 2BFUS 1D4M3 3KT1A 4LITA 3RZKA 2LRPA 4UFJA 3VBSB 5D8AC 2ZGUA 5AC91 2VQAA 2BBVA 2DTWA 2XHNA 1AZDA 3LA7A 2DVDA 1LU1A 1TME2 1R092 1ZZ9A 2J7MA 1N1TA 2YMZA 1QEXA 2ZGQA 2B42B 1YYNA 5T52A 1DQ2A 4OQ9A 3SH4A 4MYEA 2CU5A 2W5FA 5DUXA 4CPBD 3HJRA 2GH2A 1PGSA 2ZOEB 1XBFA 3N9MA 4WBBA 3J26N 3GZTB 2EXHA 2LM3A 2WO3A 1QU0A 3I54A 5FWEA 4JDMA 3POGA 3RZHA 2HBUA 4UXAA 3FHIB 2HWB3 3LEKA 4XFBA 5EJ3A 1W6QA 5I8YA 5L9VA 1DDLA 1CX4A 1CVNA 1NCQB 1NE4A 1UPSA 1XU1A 3LSDA 3PUHA 4JX0A 3HVDA 2VMCA 4MH0E 3LDKA 3ZXGA 4BK4A 4OLLA 4TTGA 1OA3A 1T6BX 2VY0A 4RR3B 1RVF1 1OBNA 3BODA 4I0WB 5CVRA 5H9PA 4CE8A 4DB5A 1KQRA 2RG4A 4LXLA 4EN0A 2VNVA 3FX3A 1UYZA 2GC3A 3KGLA 4IERA 2KA3A 4JRLA 5T5JA 1X8MA 4CXXA 1QDOA 3KV9A 1I3HA 1NA1A 1WW7A 3AKQA 3I2IA 4Q29A 1KDMA 4JV4A 1XYNA 4GKXA 4XETA 4LMFA 2R061 4KI5M 4V2VA 3WNNA 5HPOA 1W8UA 3WV6A 1A8DA 4KWJA 2WRAA 1T6GC 1AUYA 2J1AA 4JHZA 3A22A 3UKTA 4Q4V3 3WNKA 3HWJA 4XEZA 1DFQA 3WW4A 1HQNA 3AK0A 1LOAA 3ASIA 3NNGA 3PIJA 3POSA 4GA9A 1G9FA 1GR3A 3CJIC 4FTEA 3JD73 4RHV3 2XLGA 2VW2A 2J22A 4DXTA 3TEWA 2PMWB 4NWWA 2DCZA 4FQ4A 4CUAA 4AAPA 4FPKA 3SH3A 1W2NA 3USUA 2K46A 5DZEA 1UX6A 5IVYA 1W2AX 4XYXA 4PI0A 5B4XA 2Q8CA 2BBAA 3VZNA 4AQ2A 2J1SA 4BIFA 3ZO0B 1BEV2 1JI6A 2UWAA 4F8AA 4BQ4A 4E27A 1OD3A 4NE9A 4WZFA 2R0FA 1PK6A 1VRH1 1S2KA 4INDA 1C3HA 2F4PA 3WNOA 1RUF3 1UU5A 5F2WA 1NUKA 2DCTA 1BKZA 1W6OB 3ILRA 3POWA 4JKKA 1BBT1 1RUC2 1QH7A 1MEC2 2Y64A 2AGSA 3KV5A 2XONA 1DQ4A 4XC9A 3N7KA 1BK1A 1OA4A 4RL7A 2NYYA 3IIIA 2WIIB 5FZMA 2MEV2 1PMHX 4QQHA 2YHJA 5I93A 1Q3EA 2P3JA 3MEPA 3WY6A 4AI9A 4AVSA 4KWKA 2BVBA 2QNKA 2OZ6A 5G04L 3O1SA 1O6UA 1QJX3 1MS5A 2VM9A 5L7OA 1RUI2 3FN9A 4GXLA 1AL0G 1SCRA 2K2SA 3WG1A 4DRVA 5K0UB 4CA9A 2Z2SB 2ARXA 2BU9A 3RI8A 2PLV2 1R091 2R073 1VJ2A 4QGLA 5FMBA 5FUNA 5FZIA 1YQ2A 4DUXA 1K42A 1PIV1 4YM2A 4DY5A 5FZ8A 5C7GA 2QQIA 3T2TA 3VUOA 2Y6LA 3RSJA 4HLTA 4S2FA 1VMJA 1Y9GA 3AFGA 3M3OA 1AVBA 4YFWA 4YWAA 5F6KA 5FBJA 2XQRA 4OFGA 1AR82 5FP8A 3WEZA 1DQ6A 1JOPA 3B01A 1W6QB 3AX4A 1UY2A 1RUE2 2JDAA 1ND2B 1W8OA 1JYXA 4IE5A 2I45A 5DPNA 2GNTA 1AHSA 4NIGA 4CDWB 2VZVA 3FFQA 4CDQC 5DAPA 1YHFA 2ZGTA 3V64A 4QKFA 3AMNA 4GALA 3VHOA 1GWMA 4RGAA 1LHVA 1V6MA 2B9UA 2XLFA 3U11A 4JKMA 3LEIA 4FFFA 3IMMA 1AJOA 5IK5A 4QD2A 1QF3A 3J7HA 3KVBA 3ZXEA 2DVFA 1EAH1 1JU3A 1YO8A 4A41A 5JUVA 3V0BA 1JOBA 5T50A 1MVQA 1RUH1 2R041 1U12A 3UGHA 4AFDA 3B9CA 1EYBA 4MXVA 1WZXA 3KD4A 2CL2A 4W6YA 3BTYA 4LK6A 2E7AA 4JTNA 2O8QA 4IEPA 4Y1ZA 3V0AB 4ZS3A 2EAAA 3WD5A 4AZZA 3POJA 2OVUA 3KCYA 2JDNA 5LA1A 5HV4A 3GDBA 1BEV1 4AI0A 1LOBA 1HQLA 2ZABA 5FZ3A 2VUJA 2OPKA 5FMOL 2BUKA 5IWFA 4OI4A 2XBO3 4Z1VA 4PI2A 1C8NA 3LAGA 5FYMA 1UMZA 1UZWA 2J1TA 5CZKA 3KZ4C 4LORA 4QB2A 1QXPA 1EPWA 1RUC1 1TNRA 2HWB2 2VOVA 2VXJA 2RHPA 4V1PA 4Y5Z0 1D2SA 3ENRA 3I3EA 2RS51 4K8FA 2WZPP 3H1WA 4EN8B 3K4AA 4JHTA 1LHWA 5LK7B 4AG4A 5F3EA 1UYXA 3E6BA 5DUVA 1CAWA 4I02A 3VZJA 2R32A 5A3LA 3OEBA 1WCDJ 4XQ4A 1NXD1 2PHRA 2QQWA 5EFUA 4XQDA 1COV1 4FBFA 1RUI1 4CDUB 1U0AA 4EWEA 3BU0A 5JSRA 3GZUC 4FOQA 4YVWA 3ZFFA 2GP5A 1REDA 4QGNA 3NMBA 1QH6A 2QQLA 2RS12 3NAPC 2H6BA 3ZSLA 3HQRA 4LHKA 3RWNA 2PLV1 3T0BA 3K77A 5IJRA 1CZTA 2VZ3A 1DHKB 4JGYC 2MNGA 4N43A 2RJKA 4Q4V2 3LIGA 3ZDVA 2ZEYA 4P9LA 2HWD3 4HPKA 3NJVA 4YGBA 5E8AA 3ZXAC 4BMEA 2FDFA 4Q1RA 3VBRB 4YW5A 2G1MA 3RZZA 3S30A 1A3KA 1C5HA 1WMDA 2RDQA 3JD72 3EQEA 3ETPA 3P3NA 2FMYA 2ZGOA 4YM1A 3N9NA 3E5XA 4NHLA 3T08A 3WF2A 2VOWA 1V6KA 1KRIA 3O12A 2VMGA 2ZJCA 2G4IA 3L2HA 1PHMA 1AR81 1O4TA 4UFIA 5LK5A 1KS4A 2CHHA 1UX7A 1EUUA 3IAQA 3N36A 4UFLA 4LOSA 1Q56A 4OHWA 2RR13 1AXYA 4NAMA 3AM2A 4LUKA 4UFHA 3H8UA 4NAOA 4AGRA 3WDWA 4W65A 1OT5A 3I7DA 1WMEA 3VKMA 1RUF2 4EJRA 5FYVA 1X36A 3ZSEA 4A7YA 3RG0A 3T1LA 1OOPC 3RFRA 3PURA 1US2A 1UYPA 4XACA 2PAMA 1PGW1 5GLTA 3NL1A 3O0WA 3OD4A 3OB8A 4XPVA 3TEYA 3DECA 3MIEA 3OUJA 2G9GA 4URAA 2ZX1A 4LO5B 4TWTA 4RFT0 3WP6A 3AJZA 3E6DA 4C0HA 4F83A 4DO0A 3B5LB 4ASLA 1Y3TA 3VHPA 1QJX2 2ZMKA 1VBD3 4WM8C 2OKXA 1W8HA 3VBOC 2MHFA 5E88A 1N1YA 2K0GA 5T55A 3FFZA 3MFAA 5IUQA 1ZRDA 5FXVA 2P6HA 3OY8B 5JPMB 2HYXA 1UOFA 2JG8A 4META 4RQPC 4RSUA 5JXJA 1RINA 2R072 2PHXA 3VL8A 2NPIA 4ATEA 4MHRA 1S0FA 4G4FA 1HDKA 5A7OA 3OCPA 1O5LA 4GH4B 3VBFB 2WA3A 3UKVA 4DEVA 5FZEA 4DUVA 4RYDA 2A6XA 2E33A 1UAIA 1DGRA 4I30A 3A21A 2X5IB 5BY5A 2XDVA 1O8PA 3HN3A 3PVBB 3RNSA 4CP9B 2P3IA 4N9HA 1JUHA 3I59A 3ZR5A 4B4QA 2Y6KA 1WLCA 2EIDA 3PNAA 1Z7S3 1FI2A 3K51A 1MS9A 1S0IA 2SLIA 1ZZ8A 4XFGA 1VR3A 3C7EA 2R6QA 3DUIA 2JDZA 4DMIA 2RS11 4Z07A 1SMVA 3SHRA 3WP3A 1SFNA 5FYZA 4OVEA 1HW5A 4Q2FA 5SV8A 5AFEA 4Q4V1 2JDMA 1S0DA 1OH3A 4QPIB 3ZXKA 3FE5A 5DABA 2JDUA 5IT6A 4Z82A 3U0ZA 4ZU4A 1LRHA 5FZBA 5ISLA 5D8AA 5A3OA 3PU8A 4K8RB 1JW6A 3OBAA 1B35A 3JD71 3UNPA 2LROA 4WM7C 5HI0A 3KV4A 1ST8A 1J1LA 1DGRN 1YJKA 2ARAA 5FPLA 1JYTA 1O3TA 3FBYA 3K75B 4XHXA 3SKJE 2VUCA 4DUWA 4YW4A 3N9OA 1W0OA 2RM23 3K2OA 1MS0A 4XBQA 4YGEA 5IK8A 2CWMA 4BE3A 2XVKA 2WN2A 1LHOA 3VD9A 4GIQA 3TEXA 4S2HA 5F3CA 2ERFA 1OQ1A 1OF3A 1U5ZA 2RJ2A 4JDOA 3A4UA 2VMIA 4AQTA 2NMOA 2D6LX 4Z8BA 3WSOA 2XBO2 1WBLA 2YPJA 1LOGA 1RUF1 2D93A 3D5OA 5LY2A 1RC6A 3LGRA 4K6BA 1QOOA 4NHYA 4O65A 5GALA 1H8TB 1ENRA 1QY4A 4AFBA 1U5XA 3BGAA 4XAEA 4CCNA 3BPZA 1H30A 4B8EA 2FDHA 3P1IA 2EF6A 3UETA 4XFHA 5GLVA 3E1F1 4IEVA 5FY7A 2AUYA 2P2KA 2HH9A 1H2KA 1NZIA 3ON7A 4TZDA 2W68A 2DV9A 3M3EA 4NROA 4NUBA 3VDDB 3IMNA 1UYYA 2BGOA 1W06A 2XKPA 1CESA 1IHMA 2DBIA 4H7MA 1IQDC 5L7OC 1KJRA 2I07B 2WNUB 3MIBA 2VH9A 3MICA 1KITA 2B4KA 5DAXA 1ZX5A 5C70A 3H8RA 1XU2A 1FYUA 5GM0A 1CX1A 1RMU3 1HXS1 2XHKA 5HCFA 3CJIA 2WWUA 3LA3A 1G9DA 4I0AA 4M3CB 2OX0A 2RS33 4C1WA 1AR73 4JQRA 4L11A 2ZA9A 4XILA 1A34A 3OUIA 3MHZA 1ZBA3 2HWD2 4XABA 3VGIA 2DFBA 2DCYA 2RMU3 2ZAHA 2WLQA 3ZXJA 4CPBA 1S2BA 4CCLA 5BV6A 1G9BA 5B2GB 4OHYA 3AFKA 1RHI2 2FCTA 2VCBA 3CDZB 5C8CB 1O3SA 2A1XA 1Q8SA 3VBUA 3O1UA 5FKCA 1GOGA 1L7LA 2P1BA 2ORZA 2Y6GA 4H7LA 3AL5A 4AK3A 4AR2A 3DN7A 2C4XA 3FL7A 3I59B 5JOXA 1ODNA 2RR12 3AZWA 2P6CA 4Q4W1 4ZKTB 5I8TA 4GD4A 2AZ5A 3RQ0A 5CFDC 5L36A 2DDUA 2OT7A 2XB6C 5C3RA 5F2SA 2QQKA 3JQXA 2PYTA 1EV13 3WNXA 4QQLA 4D6QA 3S0MA 2V5YA 3S5AA 3JXSA 3LFIA 5JOWA 4BLIA 3T3YA 3UGFA 1HRI3 1Y43B 2FZ2A 2JB4A 4CCJA 2GSYA 1QJU1 4IEWA 4LJHA 4LPLA 2Y6HA 4OQ8A 4LKDA 3KSCA 5H9QA 5A32B 3HMYA 1QOSA 1W6MA 3FUOA 2ADDA 4XUTA 1LCLA 4IW3A 4LIVA 1X50A 2EVXA 1MS8A 5I0RA 1VBD2 4ZXEA 2YBSA 2RJLA 3VV1A 3FUQA 2JX9A 1EY2A 2P4EA 2QQMA 2WSUA 3GYDA 1SPPB 4JTOA 1LULA 1FX5A 5J98B 3MZHA 5DXDA 4Q0QA 2E7TA 3ZN6A 2FQPA 3AZVA 2A6ZA 5ANNA 5I0TA 1F15A 1G8WA 2P37A 4GAZA 4K40A 2CSGA 4P9WA 5A7WB 4BM8A 5A6XA 3B9IA 2ZEWA 3I2GA 4CRQA 4R4ZA 5KHIA 4IEZA 3OPWA 4EQVA 1DU3D 3LA2A 2BNNA 5BNPC 4JAAA 5G05L 1V9U3 5EWSA 1H0BA 2E6VA 4AQSA 3AYEA 2ZX0A 2BZDA 1UU6A 2P17A 3VD3A 3KQRA 1H6YA 1CPMA 1ULCA 4FP3A 4CDQA 3TYJA 5F7UA 5FOJB 2VG9A 4YGDA 4R4XA 1MZ6A 5FXXA 1XYPA 5A1LA 3PUIA 3DYMA 2H0BA 1ZRRA 1UF2C 5LRRA 3U4SA 1V6OA 1Z7S2 1OKQA 3OBZA 3PJQA 1CPNA 1XC6A 5GZFA 1VBE3 3IDAA 4OUEA 1YJLA 4YG6A 4Z92B 5FLIA 4XF4A 3ILFA 5C3QA 3ZFFC 1YLLA 2WWSA 2WFPA 1H2NA 2JD9A 1JOJA 4PJYA 1W6PA 2GC2A 4GWNA 4V2WA 5J7MA 1BQPA 2PHTA 1PVC3 1VBB3 2JIGA 4QPGC 4J1WA 4LLOA 4N43C 3W20A 1WCQA 4AYUA 2ILMA 3AZYA 1NQDA 4OULA 2JDPA 3T4VA 3ZSJA 2GU9A 3WHTA 5FZFA 2FDJA 4F7ZA 1V6LA 1E5IA 3CEWA 5FQ0B 1I1EA 1RHI1 3UESA 1F4AA 2VNGA 1MPXA 2A75A 3H9AA 2X05A 1KGYA 4IGQA 2E51A 5FUPA 1TVGA 3PVEA 3POBA 4Y1YA 4KQ7A 2RM22 1GZWA 2SBAA 4MOAA 4YG0A 1QJY1 2W52A 2ZEZA 3VD5A 3WVJA 3U78A 2BV4A 1UXZA 2CAVA 4XUQA 3R05A 4QQPA 1W03A 4IV1C 1AX0A 3KCXA 4QPYA 5JZGB 4XVHA 4NIIA 2JXAA 1AYM3 2B7YA 1BMV2 2VULA 3AP4A 3AP9A 1VIWB 3NNFA 4IEQA 3LEGA 5FYUA 2B39A 5FZDA 3IN9A 4B4PA 2WQ4A 2OXBA 5LA9A 4CDXB 3ZYHA 3B93A 4YLZA 2IWGB 1VE0A 4OHVA 3LCPA 4EZ4A 5FDBA 3JCIA 2OPWA 4AHYA 1W8NA 4IV3C 3BVCA 4ZXKA 5DUUA 5J09A 4HK9A 4OMDA 4P00B 1RJ7A 1UMHA 1LOCA 4D3WA 2CDPA 3A0NA 5K7PA 1BK0A 3SQOA 1OURA 4XJ8A 3KF5A 3OYWA 1PO13 3BTZA 1VBD1 4DXSA 5JR2A 5BNNC 4GB32 3LQCA 4AI8A 5CBLA 1JYWA 3EJKA 3C7FA 3TN91 1K5MA 2WQ8A 1RMU2 4COWA 1CAXA 2JG9A 1MS3A 3KHBA 2DVAA 3MLLA 1YRZA 2RS32 1AR72 1LGBA 5FZOB 1DGWX 4FPEA 1XSQA 4LK7A 3DKWA 4QXHA 2RV9A 1ZBA2 1HV0A 3LPFA 2RDSA 3ME2A 2RMU2 5FO9B 1PGL1 2ZGMA 1Q8VA 1LHNA 3BIWE 1R1A3 2IXCA 3AKPA 5TSWA 2HEYF 5IVCA 3GJBA 4FPHA 3ZKYA 3PUSA 1TE1B 2J42A 4JGZB 1OVSA 3SKVA 3GCWA 3IDBB 1UNBA 5JMCA 4HKLA 5CNAA 3DYPA 2Y33A 2UWBA 3B94A 4Y33A 1XNKA 1YXWA 3KLSA 4CDQB 4UF0A 5D2AA 3WZ1A 4C1XA 2ZGRA 1LGNA 3H50A 1FMD3 1URXA 3K46A 1NX9A 1WW4A 5C5UA 5CG8A 2Y8KA 1ENSA 1W0PA 1WCKA 4CCCA 3N4MA 1RXFA 3ZXFA 3ST7A 2CYFA 4IUGA 3M2MA 1EV12 4CUGA 4URTA 1JS9A 4XJUA 2D43A 3ZPYA 1HRI2 2X29A 4FO9A 3HAGA 4K7JA 5IFTA 4N7UA 5DG2A 4LBLA 2VR4A 3CL1A 3GBFA 3GCXA 4WM8A 1VALA 1W8ZA 4XCBA 4XIKA 3VBOA 4E4DX 3AMQA 1Q43A 1E5HA 4AEKA 1E5SA 4C90A 2NN8A 3RDIA 1B35C 4LBOA 2TUNA 5FLHA 1PO23 1ALYA 4QB6A 3WP4A 4DIQA 4RQPA 2DCJA 5BNNB 3CZUA 2XOMA 4QT6A 4TN7A 5FPBA 1G86A 4PDWB 4CEWB 2HWC2 4MV2A 2CGOA 1V6NA 2VQ0A 1PMJX 3L9JT 4D7SA 1E57A 3R4SA 2O8OA 2VZTA 1WD3A 3KF3A 5FP9A 1RUJ1 3VBHA 2QQVA 1KXGA 3KM5A 3F2ZA 5IVBA 3HN1A 3HBKA 1DLLA 5KHJA 3OJBA 3DGTA 1BMV1 2Y26A 1ZZ7A 5CU1A 4XF1A 4ZHNA 1V9U2 3RYRA 4BPZA 2VZRA 5CFCA 5C3SA 1EP0A 5BXXA 1PZ9A 5FZAA 3AZZA 1G6NA 4EYUA 4AAXA 2DVBA 1SBFA 1SLLA 3Q8BA 2VCAA 1HN0A 4R9AA 3WW2A 2DURA 4I2OA 1I5PA 3ZMOA 5I0SA 4P14A 2JDYA 4QWNA 2B9VA 1DYOA 4LUMA 1XPWA 1ZA4A 1YQ5A 3H0OA 1OKOA 4XDPA 2FMDA 2ZGKA 3H3ZA 4LLFA 4FQZA 1DBNA 5FZ0A 2O14A 1NE6A 1ZA7A 3H3UA 3NNMA 3PTYA 4JKLA 4UAPA 2ARCA 5FMDA 3DPRA 4CU6A 1VBE2 3NAPB 4ATFA 2W47A 5JMOA 4M01A 1AR91 3OYWB 3VZKA 4GB31 2HEWF 1GNHA 4JGYB 3TOJA 2W92A 1RMU1 1WA6X 4N53C 4XW3A 3JU9A 4QKNA 1L7RA 5HXVA 3ZN5A 1PVC2 1VBB2 1CAUA 3J8F3 4WM7A 1YEWA 5BNOB 1CAXB 3W5MA 1YNAA 1S4CA 5KXEA 3DXUA 1AL23 3JBG1 4QKBA 1DQ5A 2J1UA 1C4RA 2RMU1 2WA4A 2XJQA 2ZEXA 1MQTB 3I97A 1AR63 4AVVA 3P3PA 3V65A 1JXNA 2AENA 2QJVA 4L9BA 4AI3A 5F37A 4Y5TA 3VBUC 1ZRIA 3AKSA 2D6KA 5ABJA 2GP3A 4MXWB 1JZ5A 1R082 5J1XA 1LR5A 3BKZA 1J83A 4BQYA 3CF6E 1QNYA 4M0NA 1POV1 2BVVA 4XBNA 3IDCB 1ASJ1 2WLPA 4Q4Y1 2BERA 1FNYA 2KM2A 3I2JA 1WCSA 1WUVA 1IZ3A 1SCSA 1AYM2 4A6OA 1OOPB 3VKLA 3URFA 3GZAA 2NZ9A 2NMNA 2UWCA 3AB0A 4GWMA 3WF3A 3PUQA 1H4GA 4CU7A 4YVSC 1I5ZA 4L2NA 1ND3C 2HWE3 4PF1A 4R9CA 4MGSA 2IVIB 1YIFA 3LEMA 1CAVA 5F32A 4Q4X2 1NOVA 5FCCA 2Y34A 4IGOA 2IFRA 4NPLA 1WD4A 3JQWA 4OUMA 1X9PA 1OPMA 3MI8A 4AEJA 2DUPA 1JZ2A 1LJ7A 2W1SA 3BPSA 1F8VA 1TME1 1PO12 2JB8A 1JMUB 5FY0A 4RQPB 3HD8B 5H9RA 3KQ4B 2HWC1 2WZR3 3N7JA 3PIGA 5A33A 3O5SA 3KWVA 3MV11 4IEYA 2Q30A 2Y6JA 3D8CA 5JSOA 1XJAA 2BWCA 5FK8A 3Q8FA 3VD4A 1JZ7A 3N3HA 4AEMA 2YDEA 4UW4A 4MVTA 2FDGA 1FV2A 5SV5A 2X8KA 3DKQA 3T0DA 2VCMA 3IM0A 5FV3A 5JXHA 5GZCA 1WKYA 3HT1A 2YYOA 1W6NA 4QKDA 3B3QE 3D6EA 2ID4A 5KHKA 2JICA 2YU1A 4XDOA 3CZJA 2JEMA 3O1VA 5CFDA 5F3GA 4CUBA 5BNQA 1GQHA 3SCHA 4AEDC 4D69A 1H8VA 1NA1B 2XVGA 3K3OA 1FMD2 4KG8A 1UW8A 5C9AC 4LBQD 4XIOA 4XXAA 3OF1A 1YUDA 2EALA 5KWRA 3HQUA 2VU9A 5C4WC 1WMFA 3PDQA 3POEA 4MZUA 3WDUA 5J36A 1VBB1 4YVWB 5HCHA 2VZUA 4XF0A 4IE7A 5EQUA 5I8SA 3LFMA 4Q0UA 3ZFGC 4GMP3 4BYYA 3VHNA 1G9AA 2YGMA 4WM7B 5IVVA 1NAEA 1D4M2 5HXMA 1XXNA 3F95A 3G6JB 4X8PA 4EE2A 3MLKA 1UN1A 3H1YA 4XURA 5BPXA 4E4SA 2WAOA 4UW6A 1CQ9A 1D7PM 1PO22 5HCBA 1MZ5A 4P5YA 3USUB 1QQP3 1LECA 2VOXA 3ZOIA 3THPA 4IESA 5KHGA 3H8XA 4FSJA 3VZOA 4D8MA 3O1PA 3QH7A 4XFAA 1R081 2D7FA 4AVCA 2GALA 1VLNA 5C4WA 4AE2A 1V6JA 5BNPA 4UI9L 1PK6B 1CWPA 3E5UA 1FOD3 1Y9QA 3VBSC 4B4RA 2QE3A 4PQQA 2EXKA 1MEC1 3BYWA 5A3TA 5FPZA 4FOVA 5KXCA 2OUJA 4FTBA 2MEV1 4Z2WA 2J1EA 1XE8A 2ZAAA 2CAUA 1QNWA 2VW0A 1OVPA 2Z4FA 3EHKA 3W5NA 3SMHA 3IWZA 4PBOA 1GANA 4LBNA 1FV3A 1PNGA 4Q4X1 2I74A 3LSEA 1W8FA 4FAGA 5L7OB 2XJVA 1GP6A 3DL3A 4AFCA 1AXZA 2UU8A 3RPQA 2AYHA 1UWWA 1JBCA 3V56A 4YW1A 4A44A 1NCQC 2AEYA 4QPGA 2BFUL 2YC4A 4PF5A 2ETEA 5FZKA 4IDZA 1VBA3 4Y1XA 2PHFA 3POYA 1UZVA 4KGQA 1K5MC 2CNAA 4AI2A 2JG9C 2TEPA 5IK4A 4NWVA 3AKRA 4RHV2 4XFIA 1VBC3 1PZ8A 1W2OA 3NO8A 4EN7B 3BIEA 4FXKB 3QBQA 1AL22 3D0JA 4K21A 4LHSA 2V72A 1KDKA 5CKNA 4PCRA 3FBMA 2YFUA 1WLDA 2E31A 3PL0A 4W8JA 1AR62 2BW8A 2XJUA 1RUE1 1WW5A 4XJ9A 2WO7A 5FTTC 3ZX7A 5DG1A 1W3XA 2PELA 1GP4A 2OS2A 5ANQA 4IV1A 4BCUA 1OLRA 3FJSA 4WV8A 5ERLA 3N7MA 2BWAA 4BA6A 4NPMA 1PVXA 3FHAA 4C8DA 1ENXA 2P3KA 3ACIA 3AMMA 4A7ZA 4CCDA 5CFDB 2NQYA 5DMYA 4QB1A 5KXDA 2J1RA 5EJZB 4AHWA 4P9JA 1V0AA 5DDJ3 3TNQA 2WT1A 3W9AA 3KGZA 5DQ0A 3CNAA 3WOGA 1HJGA 3OGVA 4IV3A 3SISA 5A70A 3U07A 1GU3A 1GNZA 1QIQA 4OHXA 3CQOA 3VN4A 4FOYA 3V0BB 4YARA 1Q8OA 5JWPA 2WSVA 2F6BA 2HWE2 2IXIA 1W3VA 2QBXA 4CCEA 5AVPA 1I9RA 1UXXX 5F3IA 1D4M1 1RGSA 3VHRA 3U75A 5FK7A 1RTVA 5BNNA 1NKGA 5KHHA 2WO2A 1XNDA 1NXMA 3OBTA 2WZ8A 2UYAA 3RZJA 4XJZA 3NV2A 4J1XA 4YZ1A 4QQOA 2GMEA 2FCUA 2RVAA 1JU4A 2GN3A 1ZNPA 2JIJA 1W39A 3JUUA 4FP2A 1PM7A 4P02B 2VXRA 2WZR2 3AP5A 3BI3A 4FAHA 3AZXA 5EP9A 2E53A 1TG7A 3M4FA 2YZ4A 2JJ6A 3VBHC 5BNPB 3UT0A 2ZGLA 4FOWA 3CMGA 3HT2A 2HWB1 4XJAA 5K0UC 2IXJA 2J1VA 2YBKA 3GBWA 1LKNA 1FPN3 1ULPA 3SXWA 2V4VA 3E97A 2VBPA 3EYPA 2HYKA 1GZTA 4M0HA 3M8LA 5CFCC 3W59A 2NP0A 4IEOA 1F35A 4M4RA 1CAWB 2D98A 3MIDA 4Y1VA 3BCWA 3RZGA 3VLBB 5L19A 4M3CF 2WYSA 4QM9A 2WT2A 2LW8A 5JAXA 2VZOA 1JZ8A 3A23A 4ES9A 2WFF3 2UY8A 4IEUA 4NPRA 1QWRA 2A6YA 2QVSB 4XTPA 3ZFFB 2W39A 1UOBA 3DPRC 2XH6A 1S0GA 3NV3A 5T5OA 1ND2C 1UMIA 2ZS6B 4QPGB 4PLNA 3GALA 3GJAA 4N43B 1OA2A 4L0PA 5DUWA 1YI9A 4CDWC 1O3QA 3RJRA 4BZ4A 5EIYB 4HPKB 2ZCWA 1LEDA 1HX6A 4RHV1 2VZ1A 3H7JA 1S0CA 2XWJB 4TLGA 1GV9A 4UFMA 2FZ1A 3IIAA 1CD3G 1OLME 4GJYA 3FLRA 2AC1A 4HZFA 1Q8PA 2XG3A 3CHXA 3FLPA 1RUD3 4BLJA 1VAKA 2C6SA 4RS5C 1MS4A 1QQP2 1GOFA 2RE9A 1OQDA 1SHWB 2F4LA 2ZX2A 4ZU7A 2ARBA 4RGGA 5FY8A 3S7IA 1TNFA 3CO2A 3WG4A 2VMDA 3PUAA 3MFCA 5D21A 3SCFA 3VDAA 1BLZA 4DEQA 2ES3A 5AC93 4BK5A 4HETA 1VP6A 1FOD2 2W3JA 5KC6A 2YBPA 2XR4A 1IQAA 4YM3A 3ACLA 3I3BA 2VL4A 1XQNA 4Y22A 5LW9A 3J4UH 4DY3A 5FPXA 4BB3A 2E26A 3MYXA 4ITCA 1AJKA 4XBLA 1QJZA 4Q27A 4A3XA 3IZOA 4NRQA 4CP2A 3OGGA 2WR9A 3PLQA 4WVMA 3ZFEC 4A4AA 1W9WA 5C71A 1YQ6A 1JH5A 1IPSA 4IV3B 2HWE1 1QJX1 1ULGA 4GQ7A 2E32A 4QHZA 4BMBA 1XNBA 5C5TA 3INAA 3NW4A 3QCWA 3SITA 1W9SA 5FZ4A 2PAEA 4GJZA 3N7LA 3QLQA 4N53A 1OUSA 4H3WA 2XKOA 3CKHA 4PLMA 5I0UA 2Q8DA 1RVF3 4BXSV 5IVJA 2R071 3L2YA 4OI1A 2WWJA 5FPAA 1DYKA 2JG8B 5FZ1A 3AKTA 4Y4RA 3LE0A 1DQ0A 2DF7A 4X8NA 1DZRA 1NLQA 1VBA2 5IK7A 2JDKA 3H3LA 3ZKUA 5GLZA 2WAAA 4GWIA 5FUIA 5FZ7A 5I91A 4L97A 1XSRA 2R063 3LOIA 3VZLA 1SEFA 3IT8A 1A78A 5APAA 3KT4A 3T30A 2R49A 3PJYA 3O1TA 4E8CA 1VBC2 1XB9A 2QZ3A 3HOBA 3UJOA 4DXZA 1LB2A 1GZ9A 4FPGA 3MW4A 1RIRA 3R0RA 1DGWA 4YM0A 3S6PA 4BXFA 5JPNB 4U2AA 1SDDB 2XJTA 2EIEA 2ZXQA 1J3PA 4AFMA 1C8M3 2YB7A 4AXOA 1RUG3 1S0JA 1MZFA 5E1RA 4WVWA 4LO4B 1CN1A 3ZSKA 4K9SA 4Y26A 3RWKX 3SC7X 5M0TA 2A6VA 4N7IA 1IS5A 1SACA 1AXKA 5EYYA 5AFBA 3VBRC 2EXJA 2YG0A 2VQUA 1SFPA 2WC2A 1W8WA 4B7KA 1D0GA 1US3A 2JWPA 4JVAA 4FPLA 5GZDA 5EV7A 2ZX3A 1RL3A 1S1AA 4KH9A 4DXRA 5FYSA 4AW7A 3C3VA 4MGKE 1V00A 3IPVA 1MZEA 2C5DA 4QXCA 4YVSA 5LBEA 3WDTA 1ZRFA 5DDJ2 1ND3A 3DXTA 3I4IA 4QPWA 2PA7A 4Y20A 1VRH3 3PVNA 2DUQA 2FHRA 1XNTA 4LBKA 5EPAA 4Q26A 1A6CA 4AHXA 4XE9A 5JIAA 2BGCA 3ZIWA 2ADEA 2QFEA 4CVUA 3E6CC 1QJEA 1G7YA 5D8AB 2Y6FA 1BBT3 4NVPA 5HCAA 1B35B 2EIGA 1HB2A 4Q8KA 1JZ6A 3ACFA 2IVJA 4XUNA 3WNPA 3E5QA 1K45A 1ZRCA 2ZZJA 2A6WA 5LASA 4MGIE 3RRDA 4FI9A 1CIWA 2W9XA 3B7MA 4A42A 3WQBA 1GMMA 3LWCA 2JENA 2XBO1 5CIRA 1N3QA 1Q8QA 2A70A 1FOD1 3MIHA 3W58A 1NY72 4QDRA 5FOBB 2VZPA 4AVBA 2DVGA 2ATFA 1PIV3 3ZYRA 2DWRA 2ZMLA 4CP0A 1FPN2 1W90A 4LA3A 4P9YA 2C0ZA 4AEDA 1UOGA 3VBFC 1UZZA 4GH4C 1JYCA 4QX8A 2AR6A 4HVOA 2EICA 1PX4A 3OUHA 4RN5A 4WVMB 5C9AA 5LA0A 3NV1A 1RXGA 5CKMA 4CXWA 1J3RA 2VECA 3AL6A 3GHNA 2X5IC 3WR0A 2JKBA 2LS6A 4HN0A 4NHKA 3NWKA 2WFF2 5JXGA 1M06G 2VZSA 2E9QA 2WL1A 1ZZ6A 1N3PA 4D6SA 2WQZC 3I3DA 3UL2A 5EJ1B 3BUCA 3ZFGA 4EZHA 4N53B 5EXOA 1H6XA 2JE8A 3CJIB 3U10A 1R1ZA 5FP7A 4LKFA 3RGBA 1GWKA 1HLCA 2C24A 2HWD1 3A7QA 2A7AA 2VPVA 4CEYA 4Y24A 4CYDA 3H1MA 2PHWA 3BALA 2WYFA 2PHDA 1X82A 5FYBA
chains in the Genus database with same CATH topology
4FVVA 3FZ3A 3ALQA 2OA2A 2D3SA 4U36A 1IGOA 2OW4A 5DZGA 4AWDA 3ZYIB 2JE9A 1EAH3 4KBBA 1BJQA 1M4WA 4OI2A 3VBUB 1SFYA 1RUD2 1RUH3 2R043 1LGCA 3R4DB 1G9CA 2NM1A 3ZVXA 2PQQA 3D4KA 4YSFA 5JI9A 2RR11 3VBSA 1ULDA 5ACA2 1W2UA 2XGXA 2ZX4A 1O4ZA 2CGPA 3T1MA 4ASMB 4N9IA 2D6MA 2E7QA 1H2LA 2PAKA 4LBQA 3X29B 2PHUA 1IKQA 4HSJA 2AREA 2G9FA 1W6MB 4YW2A 4AVAA 2IZWA 1NCQA 2ET7A 3A0KA 3ATGA 4QGMA 2RS53 5FREA 2A5ZA 3QD6A 1H8TC 2AH2A 3NKTA 1OFSA 1SBDA 1IS6A 2V09A 1RVF2 5JR7B 4COYA 2PHLA 2QDNA 3ZN6B 5C8WA 1COV3 1WW6A 4YZ4A 2QQPA 1L3JA 3HBZA 3VDDC 3VKNA 4HKOA 3EO6A 1S0BA 2BYVE 2R062 5F1RA 2I2SA 4PLOA 2PLV3 2LUWA 1O5UA 1SBEA 1C28A 1D2QA 3SNMA 1LHUA 1IOAA 1QKQA 3BB6A 4SLIA 5J36A 5HBAA 3KT7A 3NSTA 3PMEA 1N47A 1C8M2 4BWOA 1RUG2 2N7GA 4WVZA 4J6GA 4DFSA 1Z7S1 2PTMA 5LEKA 3BU7A 5FMOS 5C8CC 4PIZA 5JSPA 4NN0A 4QX5A 5C4WB 1O4YA 2WS93 1W6PB 1UKRA 3LKJA 3CJXA 4WZCA 1SLCA 1VRH2 1DF0A 3PVOA 2OUHA 3LB9A 1W6OA 3VKOA 3MLJA 2XPJA 3R6SA 3ECQA 1BBT2 2DFCA 1RUOA 1POV0 3EXUA 2D40A 4M00A 2RM21 3ZYGA 3WHUA 1GZWB 5JCTA 5ACA1 4HMZA 2D3RA 5K0UA 1PNFA 1TQ5A 4TYSA 4LEJA 3QH6A 1WLWA 1XYOA 3ZYJB 1ENQA 2H0VA 5J3UA 1PIV2 1TMF3 4G3YC 2IFWA 4YZ3A 4XJWA 1MVEA 2WNEA 2GMMA 4LBQB 3IDEA 3WINE 2VNOA 3ETQA 5JI7A 4XTMA 3O7OA 2YY1A 3VKFC 4IETA 4EWAA 1TEIA 1KFXL 3ZSMA 4Y4YA 1GKBA 1ND2A 4UW5A 1ZYBA 3QOPA 1KS5A 2K9ZA 3LOBA 4CDWA 4PBPA 1X8EA 1C57A 2CV6A 1IPKA 1K5MB 1UD1A 2RS31 3NJZA 1AR71 3GBGA 2JG9B 2ZKNA 2B8MA 2Q8OA 3DV8A 1ZBA1 2VUAA 4XF3A 2XLAA 1UKGA 4LBMA 1ZBE3 2RS13 3TBDA 4TLFA 3HQXA 4P9XA 1HRV3 1NLRA 3M1HA 3PMSA 4RS5A 5T5LA 4HVQA 3WLUA 1GLHA 3SLIA 4RD7A 1GYKA 1EAH2 3MF9A 5A3MA 1C8M1 4EWDA 1RUG1 1RUH2 2A3XA 2R042 4LHLA 4P9IA 2VVDA 2YV8A 4ISQA 1DIWA 2B5HA 3V0AA 4Q0VA 1Z0HA 3PHMA 4LO6B 1YFUA 4LE4A 4QHBA 4AQ6A 3KMHA 4MUVA 2GNBA 3BOPA 1EV11 5J37A 1GZCA 1SLBA 2GC0A 2UY9A 1J58A 1HRI1 3WXPA 3ZFEA 4MGZE 3ZIXA 4BIOA 2IXKA 1LTEA 4CP1A 2ZTNA 4N90A 4ONUA 1C1FA 1NG0A 3ILNA 1WBFA 2ZACA 2EA7A 3O0VA 4E4ZA 1H1MA 2R16A 4WM8B 5DZFA 1CJPA 4P9GA 3VBOB 5JZGC 1DYPA 1BVVA 4YFZA 1YCIA 2VNRA 4JC1A 3RMYA 2RS52 3RYPA 3AYDA 3ELNA 2DU1A 2WNVC 1JUIA 2ZGSA 1ONAA 2OIIA 3WG3A 4CDXC 4TSVA 3M3CA 3M3IA 4I0BA 4CDUA 2ZHLA 3WQ0A 3WW3A 1OFNA 1CJDA 1COV2 2HKXA 4I01A 4QXKA 3VBHB 1SLAA 5FO8B 5KC5A 4AFAA 1J1TA 1DG6A 1V9U1 3ZXDA 2DU0A 1C1LA 1HXS3 1HV1A 1R1A2 1PZ7A 2HWF3 1UCXA 4O9EA 3OPZA 4COVA 5CFCB 3VBRA 5J48A 2WT0A 3RI9A 4ORFA 2ZKLA 2HEVF 3M3QA 2Q4SA 1C5IA 1MS1A 4GKYA 1JHNA 2TNFA 4E9KA 1VBE1 2NLRA 2BNOA 2GH8A 1NCRC 4WVVA 3DPRB 4BQ1A 4IQPA 4JGZC 2DTYA 3AXEA 1PVC1 3TRSB 4YRDA 4COZA 2WS92 5T5PA 2XWBB 1F2NA 4Q4W3 2Z42A 3EBRA 4AI1A 1CAUB 1NZCA 2BEOA 4E2QA 3IBMA 4E2GA 4CEYC 5JOZA 2QKDA 4PIXA 5JDBA 1ULEA 3H7YA 1N3OA 1SLTA 1AYN3 2Q5TA 1QJU3 1PGW2 4RS5B 1UIKA 1UPIA 4IEXA 2B46X 4EN6B 5ABJB 3MDPA 4DINB 3MPPG 5JVVA 1QMJA 1BYHA 3OY8A 4LTAA 1AYM1 1U5IA 1F31A 5BYNA 5D1IA 1XRUA 5FAXA 4XFCA 4PDWC 4CEWC 3B00A 1OLQA 2BTVC 3VBFA 4GH4A 3WCSA 3OBRA 2TBVA 4AF9A 1TMF2 2GMPA 3ZFEB 2D5FA 1HIXA 2X5IA 1AX1A 1CAVB 3WW1A 5C33A 1RJ8A 4C0BA 5E16A 2CWSA 3RJ2X 1PO11 4HL0A 4F3JA 2PFWA 2PN5A 2Y0IA 4KG0A 4RR3C 1SLIA 4K1ZA 1DQ1A 5A33B 2DCKA 3UKNA 4G9SB 3WQ7A 4NO4A 3J8F2 2EAKA 2IXLA 4XMIA 1J3QA 4DRRA 2ZGPA 5CG9A 1HQWA 1BXHA 5BUVA 1Z78A 3FMGA 5F6LB 4CTEA 1ZZCA 1S55A 3WX5A 1ZBE2 2ENRA 2YC0A 3D82A 1R1A1 5GZEA 1GBGA 3WUCA 1HRV2 1OD5A 4FXGB 4Q8LA 4QPIA 4EROA 2BNMA 4HT1T 1D4VB 2VGDA 1KFUL 3O14A 5K8SA 1BZWA 1W6NB 3ES1A 5BNOC 4BHPA 4Q0SA 5CB7A 4LR4A 1FMD1 4O9GA 1RHI3 2EXIA 2IXHA 4Q0PA 1MQTC 2D97A 4K20A 3TWIA 1F9KA 1LOFC 4I3PA 1OHFA 4HSLA 1QJY3 4Q1PA 3ZYPA 1VAVA 2WS91 4PQ9A 4FCAA 2R1BA 4IL7A 4SBVA 1H8TA 1FNZA 4ISRA 1PO21 3ZDSA 5CA6A 2VMHA 1AX2A 1J59A 4HVRA 4BOWA 1V70A 4OZXA 4S2GA 4UW3A 3ES4A 3FLTA 2ZGNA 3VDDA 1H1IA 3WDYA 3SH5A 2D6PA 2WNUA 4C91A 4NHMA 4YZ5A 4P5HA 1LODA 2QUOA 5GJ6A 3UV9A 2ZHMA 4D7TA 4S2DA 4X6QB 4M3CA 3TN93 1HXS2 1H4HA 5EZWA 2HWF2 3KB5A 1TMF1 4CZSA 2GDFA 1GFF2 3BOWA 1B09A 3APBA 4B29A 2Z5WA 3USSA 4DQAA 4HFSA 3M7AA 4DNYA 5C8CA 4MLOA 1QXJA 2OZJA 1OSGA 4XQWA 4KWLA 2GN7A 2H6CA 3FC0A 4GULA 3OTFA 3AP7A 2Q1ZB 3I2DA 4K3UA 4Y1UA 1NYWA 1YFXA 3RS6A 4AVTA 1FAYA 4LO8A 1LESA 1NQJA 3J8F1 4XHBA 4E2SA 5J96B 1D0HA 4Q4W2 4YG3A 1AL21 3VZMA 1NA1C 4LHNA 3OGJA 4FTSA 2QDRA 2B45X 4XOGA 1ZBE1 1AR61 1BCXA 1DGLA 2QZ2A 1HRV1 3ZXLA 5A32A 4QMAA 1XE7A 2R30A 4X6RB 1AYN2 4FPYA 4LA2A 1MACA 1QJU2 1UZYA 3Q9OA 4XDQA 4YVWC 2CGNA 2W0XA 4IV1B 3U4XA 3SCGA 4ES8A 1DZQA 3O0XA 1H9WA 4A7KA 1JYIA 2A71A 4R9BA 2XJPA 2XUMA 2ET1A 1QOTA 2GZWA 3J9SA 2UYBA 1AF9A 4LBJA 1X7NA 4GMP0 1FATA 1H2MA 3TB0A 1ZM1A 4KNCA 3OD0A 1RUJ3 1DZTA 2X53S 2D5HA 1PK6C 2A73B 3FWEA 4D7YA 1JN2P 3GHMA 5FO7B 1O3RA 1LEMA 3WG2A 5FFOC 4L99A 3QACA 3AXDA 5T54A 5CAZA 2WZR1 1UIJA 3AYAA 3GF6A 3BTAA 1Y7BA 4CDUC 2HJIA 1CR7A 2GNMA 4LE3A 4R52A 4AGVA 2Q1MA 1AR93 3LZZA 4GB33 5GZGA 1HKDA 3WUDA 2Z79A 4JCKA 1XNCA 2P34A 3KS7A 2HWF1 4NR1A 1WA4A 4KU8A 4COUA 2XVLA 5AVAA 1YI7A 4H55A 3MW2A 3JBG3 1KJLA 2XJSA 5FQ0A 4UBHA 4W6WA 3WCRA 3CLPA 4MX3A 4W6XA 2LALA 1CGPA 1RITA 2FBEA 1F5JA 1IPJA 2GAUA 4FPJA 4XXPA 1QGLA 5H9SA 5T3NA 1QJY2 2Z69A 3CU7A 1ZZBA 1APNA 2E63A 1POV3 2YGLA 1SQ4A 4EV0A 5JZGA 2V73A 1IS3A 4KGGA 2IC1A 1ASJ3 4GMP1 4Q4Y3 1RB8G 1U5YA 4FPCA 1OQEA 3IKWA 2WNVA 4CDXA 2XL7A 1QQP1 2VOKA 1QXRA 1AYN1 1ULFA 3GNEA 4I3GA 4OI0A 2JD4A 1FT9A 1LENA 4XF9A 4D94A 1GICA 1UL9A 5F9TA 3AJYA 3R4UA 3ZN4A 1TME3 1R093 4MGYE 2D6OX 1RUNA 1FXZA 4DPNA 2HWC3 4L92A 3HIFA 5L73A 3NVCA 3WQ1A 3TN92 4Y22B 2JECA 3AMHA 3WDVA 1WLTA 1YWKA 1REEA 4R8HA 5FLJA 1NCRA 1PGL2 1OI6A 2A3YA 4HANA 4HK8A 4JGZA 4YW3A 1BVP1 1I6XA 2ZZQA 3TAYA 1EPZA 1CONA 3JB8A 2YUEA 4YYOA 1VBA1 5K9YA 5FBZA 2O1QA 4HBNA 1REFA 2CY6A 3AP6A 3D0SA 4M3CE 2ZHKA 3WDXA 1VBC1 4LO7A 2BQPA 2R1DA 4FPOB 4OHZA 3MIGA 3G7DA 3VL9A 1F5FA 3K48A 1Q5OA 1LOEA 4R9DA 4YNIA 1YIPA 1IS4A 4QPIC 1O7FA 4KU7A 1GQGA 1WGPA 5JLVA 4NOTA 4KL1A 4JRAA 1VAMA 2MPFA 3ZMNA 2LTNA 1UU4A 2WJSA 4FPFA 2YXSA 5KBFA 2Y0OA 5AC92 2DUOA 3RMXA 5KXBA 4MSVA 1X33A 3KCCA 2KXLA 1VB4A 4PDWA 4CEWA 4DZGA 1BEV3 1VB2A 4RA0A 2ZPXA 5DDJ1 3IPVB 3MF6A 5LEJA 1N1SA 1OMIA 1R083 3JZVA 4YVSB 2Y38A 1ND3B 3NKGA 3I8TA 4LULA 4Y20B 1NLSA 2WKKA 5GKAC 1RUJ2 2D6NA 3M70A 4HN1A 2DYCA 5EYXA 4XMAA 1RUC3 1MEC3 2R0HA 4LNVA 2OYZA 1SDWA 4DOUA 5F5QA 2ZBJA 3AMPA 2MEV3 2CTVA 4RR3A 2D44A 3B69A 4A2UA 2UURA 4B3NA 1ZVFA 2WNVB 3N35A 1O91A 1H9PA 4FT8A 2C1FA 2C9AA 1RUI3 4Q4X3 2GNDA 4H14A 3WP5A 3AYCA 1PMIA 3MIFA 2WINB 4YGCA 4K1YA 3RYKA 4AGGA 3NAPA 2WNUC 4XFFA 1YFYA 5E89A 1NY71 4DS0A 2O0OA 4JGYA 2ZHNA 2VVFA 1AR92 5FRAA 1QDCA 1FPN1 5CADA 3THTA 1JTZX 4JDNA 5BNOA 4YZ2A 2JG8C 2ZMNA 5C6CA 4XZPA 2D3PA 4UBGA 4B7EA 5JOYA 4AEDB 4HKWA 5JIUA 3JBG2 1MQTA 1QHDA 2JE7A 1H1AA 2W08A 5C9AB 1AR83 3UK9A 5GLUA 1LOFA 5GLWA 2XL9A 4IXLA 2WFF1 1A8MA 3ROUA 1I1EA 4L8QA 1RUE3 1NCRB 3HR9A 4BH9A 2A3WA 4MXWA 3MGUA 4QQ2A 2VVEA 1N1VA 1MR5A 3ZFGB 3S7EA 3C2UA 3UJQA 2BPA2 3JB4C 2GC1A 4AHZA 1ZREA 2YROA 3NV4A 2QCSB 3TNPB 3WT3A 4CEYB 1ASJ2 4OUSA 5LRSA 4ZU5A 3B02A 1GSLA 1OOPA 4Q4Y2 2Q0AA 2VW1A 4EN9B 1YFWA 4I09A 4PIYA 1V6IA 1KD7A 1RUD1 3MW3A 4QU2A 3DF0A 4QM8A 1OPOA 1LU2A 1S0EA 2XJRA 3MPBA 1IKPA 2BFUS 1D4M3 3KT1A 3VBSB 5D8AC 2ZGUA 5AC91 2VQAA 2BBVA 2DTWA 1AZDA 3LA7A 2YMZA 1LU1A 1TME2 1R092 1ZZ9A 2DVDA 1N1TA 2ZGQA 5T52A 3SH4A 2B42B 1YYNA 1DQ2A 4MYEA 5DUXA 2GH2A 1PGSA 2ZOEB 4WBBA 3J26N 3GZTB 2EXHA 2LM3A 1QU0A 3I54A 4JDMA 4UXAA 3FHIB 2HWB3 5EJ3A 4XFBA 5I8YA 1W6QA 1DDLA 1CX4A 1CVNA 1NCQB 1NE4A 1UPSA 1XU1A 3LSDA 4MH0E 3ZXGA 4OLLA 1OA3A 2VY0A 4RR3B 1RVF1 4I0WB 3BODA 5CVRA 5H9PA 4DB5A 1KQRA 4EN0A 3FX3A 4IERA 2GC3A 3KGLA 4JRLA 2KA3A 5T5JA 1X8MA 1QDOA 1I3HA 1NA1A 1WW7A 3AKQA 4Q29A 1KDMA 4JV4A 1XYNA 4GKXA 4XETA 2R061 3WV6A 1A8DA 4KWJA 1T6GC 1AUYA 3UKTA 4Q4V3 3HWJA 4XEZA 1DFQA 3WW4A 1HQNA 3AK0A 1LOAA 3ASIA 3POSA 4GA9A 4YVWA 1G9FA 1GR3A 3CJIC 4FTEA 3JD73 4RHV3 2XLGA 2VW2A 4NWWA 2DCZA 4FQ4A 4FPKA 3SH3A 3USUA 5DZEA 1UX6A 4XYXA 3VZNA 4AQ2A 4BIFA 3ZO0B 1BEV2 2UWAA 4F8AA 4E27A 4WZFA 2R0FA 1PK6A 1VRH1 1S2KA 4INDA 1C3HA 2F4PA 1RUF3 1UU5A 2DCTA 1BKZA 1W6OB 3ILRA 3POWA 1BBT1 1RUC2 1QH7A 1MEC2 2AGSA 1DQ4A 3N7KA 1BK1A 1OA4A 4RL7A 2NYYA 2WIIB 2MEV2 4QQHA 2YHJA 5I93A 1Q3EA 2P3JA 3MEPA 3WY6A 4AVSA 4KWKA 2BVBA 2QNKA 2OZ6A 1QJX3 1MS5A 5L7OA 1RUI2 4GXLA 1AL0G 1SCRA 2K2SA 3WG1A 4DRVA 5K0UB 2Z2SB 2ARXA 3RI8A 2PLV2 1R091 2R073 1VJ2A 4QGLA 1PIV1 4YM2A 4DY5A 3T2TA 3VUOA 3RSJA 4HLTA 4S2FA 3AFGA 3M3OA 1AVBA 4YFWA 5F6KA 4OFGA 1AR82 1DQ6A 3B01A 1W6QB 3AX4A 1RUE2 1ND2B 2I45A 2GNTA 1AHSA 4CDWB 3FFQA 4CDQC 1YHFA 2ZGTA 3V64A 3AMNA 4GALA 3VHOA 4RGAA 1LHVA 1V6MA 2B9UA 2XLFA 3U11A 1AJOA 5IK5A 4QD2A 1QF3A 3ZXEA 2DVFA 1EAH1 1YO8A 3V0BA 5T50A 1MVQA 1RUH1 2R041 1U12A 4AFDA 3B9CA 1EYBA 4MXVA 3KD4A 2CL2A 4W6YA 2E7AA 4JTNA 2O8QA 4IEPA 4Y1ZA 3V0AB 2EAAA 3WD5A 2OVUA 3KCYA 1BEV1 4AI0A 1LOBA 1HQLA 2ZABA 2VUJA 2OPKA 5FMOL 2BUKA 4OI4A 2XBO3 4Z1VA 1C8NA 3LAGA 1UMZA 3KZ4C 1QXPA 2VOVA 1RUC1 1TNRA 2HWB2 1EPWA 4V1PA 2RHPA 4Y5Z0 1D2SA 3ENRA 2RS51 4K8FA 2WZPP 3H1WA 4EN8B 1LHWA 5LK7B 4AG4A 3VZJA 3E6BA 5DUVA 1CAWA 4I02A 2R32A 5A3LA 1WCDJ 4XQ4A 1NXD1 2PHRA 5EFUA 4XQDA 1COV1 4FBFA 1RUI1 4CDUB 1U0AA 4EWEA 5JSRA 3GZUC 4FOQA 3ZFFA 1REDA 4QGNA 1QH6A 2RS12 3NAPC 2H6BA 3ZSLA 4LHKA 3RWNA 2PLV1 1DHKB 4JGYC 2MNGA 4N43A 2RJKA 4Q4V2 4P9LA 5E8AA 2HWD3 4HPKA 4YGBA 3ZXAC 4BMEA 4Q1RA 3VBRB 4YW5A 3RZZA 3S30A 1A3KA 1C5HA 1WMDA 3JD72 3EQEA 3P3NA 2FMYA 2ZGOA 4YM1A 4NHLA 3E5XA 2VOWA 1V6KA 1KRIA 3O12A 2VMGA 2ZJCA 2G4IA 3L2HA 1PHMA 1AR81 1O4TA 5LK5A 1KS4A 3N36A 1Q56A 4OHWA 2RR13 1AXYA 3AM2A 4LUKA 3H8UA 4AGRA 3WDWA 4W65A 3I7DA 1WMEA 3VKMA 1RUF2 4EJRA 1X36A 3ZSEA 4A7YA 3RG0A 3T1LA 1OOPC 2PAMA 1PGW1 5GLTA 3NL1A 3O0WA 3OD4A 4XPVA 4LT5A 3MIEA 2G9GA 2ZX1A 4LO5B 4TWTA 4RFT0 3WP6A 3AJZA 3E6DA 4C0HA 4F83A 3B5LB 4ASLA 1Y3TA 3VHPA 1QJX2 2ZMKA 1VBD3 4WM8C 3VBOC 2MHFA 5E88A 1N1YA 2K0GA 5T55A 3FFZA 3MFAA 5IUQA 1ZRDA 3OY8B 5JPMB 2JG8A 4META 4RQPC 4RSUA 1RINA 2R072 2PHXA 3VL8A 2NPIA 4ATEA 1S0FA 4G4FA 1HDKA 3VBFB 3OCPA 1O5LA 4GH4B 2WA3A 3UKVA 2A6XA 1UAIA 1DGRA 4I30A 2X5IB 5BY5A 3RNSA 3PVBB 2P3IA 4N9HA 1JUHA 3I59A 4B4QA 1WLCA 3PNAA 1Z7S3 1FI2A 3K51A 1MS9A 1S0IA 2SLIA 1ZZ8A 4XFGA 1VR3A 2R6QA 3DUIA 2JDZA 4DMIA 2RS11 4Z07A 1SMVA 3SHRA 3WP3A