1J1LA

Crystal structure of human pirin: a bcl-3 and nuclear factor i interacting protein and a cupin superfamily member
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
288
structure length
288
Chain Sequence
SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Pirin
publication title Crystal structure of human pirin: an iron-binding nuclear protein and transcription cofactor
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 288
sequence length 288
ec nomenclature ec 1.13.11.24: Quercetin 2,3-dioxygenase.
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02678 Pirin Pirin
A PF05726 Pirin_C Pirin C-terminal cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1j1lA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1j1lA01
4YRDA 2VECA 3D82A 4HN0A 3LA7A 1GQHA 4IERA 2V09A 2Q0AA 3KGZA 1Y3TA 1RUOA 1X8MA 4GULA 3RYPA 4FAGA 4QM8A 5I8TA 2QVSB 5FPZA 4A2UA 2H6BA 1UPIA 2DCTA 2E9QA 1ZRDA 4FT8A 4L2NA 2PHDA 2C0ZA 4J1XA 3WW3A 5JSPA 5CADA 4PIZA 5I0SA 5KHIA 5KHJA 4MGKE 2WC2A 1I5ZA 4X6RB 4XF4A 5J3UA 1PM7A 4QMAA 3WW1A 1TQ5A 1X8EA 1CAWA 1QWRA 4LULA 5LEJA 4Q0SA 4YSFA 3OGJA 4EWEA 3MYXA 1I6XA 3NJZA 4OLLA 1DZTA 2UY9A 4Q0VA 5HI0A 1ZREA 5LEKA 3H8UA 2XLAA 5JSOA 4R52A 5E1RA 1WLTA 3N4MA 3SCFA 3FE5A 1DGRA 2QDRA 4IEYA 2ZCWA 2PFWA 4META 1ZRFA 1CAUA 2B5HA 3BPZA 1O4TA 2D93A 2FQPA 2K0GA 2MHFA 2ETEA 3FZ3A 2GU9A 2BNNA 3H3UA 4IEWA 5I91A 1WA4A 4NVPA 4KWLA 3S0MA 4IEVA 4ZU7A 4O9GA 3SCHA 2D5FA 1O7FA 4OFGA 3SCGA 1EPZA 2OA2A 2BYVE 3FJSA 3SHRA 5C8WA 3ES1A 4LUMA 3WW4A 2XL7A 4XFGA 3S7EA 1CAVB 3CO2A 3H7JA 4IETA 4I2OA 3E6DA 2GC0A 5I0UA 1CAWB 3CL1A 4KL1A 3BCWA 5CU1A 1NE6A 1ZVFA 4XF0A 1X7NA 1SFNA 2PAEA 2OZ6A 3DN7A 2CV6A 2XGXA 3RZZA 3I7DA 3H3ZA 3EHKA 1YLLA 1YWKA 3CEWA 1HW5A 1LR5A 4D7SA 2B9UA 1LB2A 3GYDA 3I54A 3RYRA 2IC1A 4BYYA 2EA7A 3ST7A 2GZWA 4H7LA 2ATFA 3PVBB 1J3QA 3LAGA 2ZKLA 2XKOA 2GC3A 3USSA 1CAUB 2PAMA 3I59A 4IEZA 1ZZ6A 3ACLA 4WZCA 4DINB 2O1QA 4KWJA 3OF1A 4JVAA 3QOPA 2CAVA 4XEZA 1XE8A 2IXHA 4MGYE 1QXJA 1L3JA 1G6NA 3BU7A 2O8QA 2WFPA 3M3IA 2Q1ZB 2PA7A 4EWAA 1NXMA 3KGLA 2XLFA 3DV8A 1Q43A 3H50A 4RD7A 2BNOA 3L2HA 5AVPA 4IEQA 3UKTA 1H1MA 3NW4A 4XF3A 3R6SA 4XFAA 4JTNA 4IEOA 4EV0A 2VQAA 3FWEA 1J59A 1PMIA 1EY2A 2D5HA 4XETA 5FLIA 1YFWA 1NE4A 2HKXA 5FLHA 1V70A 1DGWA 4B29A 1O5LA 2IXKA 1RGSA 1UCXA 3LA2A 5I8YA 1O3RA 2OPKA 2PTMA 3LA3A 4HVOA 3E5UA 1UW8A 4AVBA 4HBNA 2N7GA 4ONUA 4UXAA 3H1WA 4WVZA 1VP6A 4D7TA 2Z69A 2H0VA 5I93A 3H1MA 1FI2A 3IWZA 5BY5A 4Z82A 2PHLA 1J3RA 3TNPB 1YFUA 3MZHA 3RNSA 3FX3A 3NSTA 3IDBB 1LRHA 3E5QA 2CAUA 4L11A 4WBBA 2BEOA 3TNQA 2GH2A 3U10A 1DZRA 2P17A 1VJ2A 2PYTA 1Y9QA 4IEUA 4KU8A 1SEFA 5KHKA 3E6CC 1J3PA 1Q3EA 4HVQA 3HQXA 4F7ZA 3GBFA 3KSCA 2CGPA 4IEXA 4QXKA 4HMZA 5FPXA 5FQ0A 3G7DA 2VPVA 2XKPA 1X82A 4Q0QA 4QX5A 3D0JA 4TLFA 3VHRA 4J1WA 1EP0A 3SMHA 3DKWA 5J7MA 4FBFA 1FXZA 1NYWA 3OTFA 4LA3A 4ZU4A 1WGPA 2PQQA 3BALA 1EYBA 2EVXA 1ZZCA 1ZZ9A 1ZZBA 4HSJA 1U12A 4BIFA 4X6QB 4R8HA 3ELNA 5KHHA 4BH9A 2XLGA 3C3VA 4MX3A 1CGPA 5FDBA 1J58A 3ROUA 5T3NA 2IXLA 4HLTA 1ZRCA 1CAXA 4QM9A 4K8FA 1UIKA 3E97A 5JCTA 2K9ZA 5F1RA 3EO6A 1J1LA 2B8MA 4LTAA 2D40A 4LA2A 3H9AA 2GAUA 4F8AA 1ZZ8A 1RL3A 3O14A 2MNGA 3OD0A 4PJYA 3HT2A 5J48A 3IBMA 4Q0UA 2HJIA 5JR7B 3JZVA 3NKTA 5KBFA 4Z07A 4MGIE 1OMIA 5FQ0B 1O3TA 4XFIA 1UIJA 4N9HA 1OD5A 4O9EA 1NZCA 3U11A 3PNAA 2Q30A 1UD1A 5I8SA 1JUHA 4JV4A 3EQEA 1ZZ7A 2IXJA 2OZJA 3UKNA 2BGCA 3IIAA 3I59B 3LWCA 5JSRA 4Q0PA 3RPQA 4MGZE 3LZZA 4I09A 3OCPA 2I45A 4LEJA 4MUVA 4UBGA 1RC6A 3DL3A 1YHFA 5LRRA 3MDPA 4YARA 2XHKA 3EBRA 4LLOA 2ET7A 4PIXA 4XFFA 2QJVA 1CAXB 1YFYA 2F4PA 1CAVA 1SQ4A 2QCSB 5E16A 2ET1A 3ZDSA 2FMYA 3M70A 5CVRA 2IXCA 4AQ2A 4HN1A 2XL9A 4AVAA 4XFHA 1VR3A 1FT9A 3QACA 3SXWA 1YUDA 3NL1A 3S7IA 1Q5OA 5BXXA 3KCCA 1IPKA 4AQ6A 4YYOA 4MZUA 4LUKA 4N9IA 5FLJA 5D1IA 5EZWA 4UBHA 1O3SA 3MPBA 1IPJA 1XE7A 3EJKA 3CJXA 3D0SA 4QGLA 3RDIA 3RYKA 2H6CA 4PIYA 2Z2SB 4QGMA 3ES4A 5BV6A 3U0ZA 2PAKA 4HSLA 4YNIA 2EAAA 2UYBA 4I0BA 4XF9A 4AVCA 4I0AA 1XRUA 2GC2A 4QGNA 1YFXA 3WW2A 4EWDA 3H1YA 4E2GA 4ZU5A 1H1IA 3CF6E 2BNMA 3B02A 2UY8A 3CLPA 5KHGA 3NVCA 4E2SA 2GC1A 3HT1A 5I0RA 2UYAA 4BHPA 1ZRRA 4Q29A 1O5UA 3E6BA 5LRSA 2Y0OA 1ZNPA 4KWKA 4I02A 5EFUA 3H7YA 1QXRA 2IXIA 4HZFA 5BUVA 5C6CA 1RTVA 4ORFA 5FCCA 2QNKA 5I0TA 4CYDA 4FAHA 4HVRA 1OI6A 4MH0E 1RUNA 2OYZA 1CX4A 3HIFA 3LOIA 1ZX5A 4IESA 4I01A 3ETQA 3FHIB 4AXOA 4IEPA 1O3QA 4EROA 2Q4SA 5K8SA 4JTOA 4KU7A 3BB6A 4XFBA 4E2QA 5BPXA 3FFQA 1LKNA 4MV2A 3IDCB 3UKVA 1QY4A 4P9GA 5JAXA 4XFCA 4I3PA 3PLQA 1OFNA 3E5XA 1GQGA 2MPFA 3KMHA 2KXLA 4XF1A
chains in the Genus database with same CATH superfamily
5FXXA 3ZSMA 5A3PA 3C2UA 5HXVA 1AR81 4HN0A 2CHHA 5LASA 4IERA 1GQHA 2QZ2A 3IB3A 2RS31 1Y3TA 2D44A 1CIWA 1QJX1 2VD7A 4NIDA 4AI2A 1MZFA 2B42B 3PL0A 2QVSB 1PNGA 4ASMB 4A2UA 3VD4A 5IVCA 2DCTA 2DBNA 2YPJA 4DXRA 3VV1A 3FHAA 3Q8EA 5FWJA 2QQNA 1PMHX 4J1XA 4ASLA 5FZIA 3KV4A 2W1UA 2ENRA 2D6OX 1FX5A 1ENSA 4YGEA 5KHJA 5CG9A 2WNVA 5DUWA 2J1UA 1I5ZA 4JGZC 1PM7A 1VRH1 1QJY2 1HRI3 4TN7A 1ULOA 3IM0A 2X8KA 4DB5A 1AVBA 4QMAA 4N53A 2YBPA 1TG7A 1JH5A 3AZXA 1FOD1 4AEDB 2W0XA 1HQLA 1TQ5A 3ZO0B 2WNEA 5LEJA 1KRIA 3IDEA 4FPJA 1G9CA 4Q27A 3OGJA 5A80A 1ULPA 3MYXA 4FPCA 1PZ8A 5LK5A 1F8VA 1N1VA 2J1VA 3NNLA 2DU1A 1EUUA 1QNWA 2WO1A 2JD4A 4K40A 4WVMA 2E32A 1HXS1 2OW4A 3P6BA 4JQRA 5FZDA 1ND3A 3WQ1A 3T0BA 5F3EA 1US3A 5DMYA 5E1RA 1JHNA 1WLTA 1DP0A 2VMIA 5C8CA 3K75B 3SCFA 1DGRA 2BFUS 1PGW1 3J7MA 3MF9A 4IEYA 2RM23 4M01A 3OY8A 3RVHA 5IHRA 2PHUA 4META 2W47A 4N8MA 4XUTA 1ZRFA 2W08A 1NA1B 2WO2A 1O4TA 1S0IA 3BPZA 3DPRA 2C5DA 2D93A 1NCRC 3KV9A 3BU0A 1RMU1 2ERFA 4Q5OA 2VVEA 2VVFA 3N36A 2MHFA 2ETEA 4HKOA 3FZ3A 1GFF2 1WLDA 1MZ6A 2DUOA 2Z5WA 5L73A 3S6PA 4WV8A 4BLIA 3VBRA 3SH4A 3V64A 3ZFGA 1V00A 2WZPP 4PQQA 3AB0A 3S0MA 4IEVA 2BDRA 1OA2A 1VALA 4YGBA 1DQ1A 4OFGA 1SPPB 3V56A 4TTGA 4CZSA 4AQSA 4XOGA 1EAH2 4MXWA 2BYVE 3SHRA 2DCKA 4XJUA 1OF4A 5A32A 2R062 2R0HA 1MQTC 3IMNA 4OUMA 1FMD2 3AZZA 1LOFC 1DLLA 2HWE2 2NPIA 3FL7A 5D21A 3WW4A 4RHV3 4RGGA 5A3UA 3H3LA 4Q26A 3S7EA 1NY71 1AR73 3FHQA 3LEGA 3VDDB 1MPXA 4I30A 3MF6A 1MS8A 1QGLA 4MHRA 2GC0A 5I0UA 4LOSA 5CU1A 5LBBA 1TEIA 1AXZA 5EWSA 4COVA 1OXCA 4XZPA 2R0FA 5IAVA 1R1ZA 3WF0A 5LW9A 5C4WA 1RUI1 1RUH2 4E4HA 1YLLA 4EZHA 2VZ3A 4CCCA 1CJDA 1ZBA1 2ZGMA 4R9DA 1COV2 5A7WA 2BUKA 1DQ5A 1NCQB 1GNHA 5F3IA 3RYRA 3U4XA 2EA7A 1GOHA 4H7LA 3KD4A 5JOWA 1UY0A 4UFJA 4DUXA 1BLZA 1RUG3 1LAJA 3WDVA 3RZMA 1JOJA 2VZQA 1PK6C 2XKOA 4Z2AA 1JYNA 5JXJA 2PAMA 1LHNA 2ZEZA 4GB32 1DYKA 4U2AA 1JHJA 3I3EA 2XJUA 2KM2A 4LBKA 3FMGA 4EE2A 4WZCA 4FPKA 2FCTA 4OUSA 5A3OA 1VAVA 2VNOA 4KWJA 2EF6A 4XTMA 4G3YC 4YLZA 5EQUA 1VBE2 5A1FA 2DUPA 3K46A 1UN1A 4JHZA 4Q4V2 3MUY1 2IXHA 4M3CE 2VCMA 1QXJA 3ZDVA 5FO8B 2PHWA 2LTNA 1V6LA 4YFWA 3H8XA 5IWFA 3ZXGA 5FYBA 1K5MA 1DYOA 2WFPA 3RJ2X 2BBAA 2A73B 4EWAA 1W2NA 3VZOA 1WCUA 3LE0A 3WG3A 4AEDC 4NHMA 3OPTA 2VOTA 2YY1A 1K5JA 1RUD1 4PI0A 1S0JA 2HBTA 1L7QA 2RM21 4NHKA 2PMWB 4DPNA 4IEQA 5F5IA 3WOGA 1UMHA 3R6SA 2EICA 4LBQA 4NO4A 2ZHMA 2RG4A 1LOAA 2ZABA 2BVBA 4COWA 3SKJE 1YFWA 1NE4A 2P3KA 3LQCA 1NA1C 1V70A 5JMOA 4BU2A 3HPNA 1O5LA 4QX2A 2J1TA 2WAAA 1UY1A 2ADEA 2AREA 1O59A 3ABZA 2NM1A 1ENXA 2OPKA 1BHGA 2D6NA 2PTMA 3LA3A 1YQCA 1EV13 3E5UA 2WO3A 1XPWA 1PO13 4ARYA 2N7GA 4UXAA 1F15A 3BVCA 4WVZA 5F5QA 5CFCA 2PHRA 2P37A 1WMDA 4PDWB 4AI3A 4ASKA 4UW6A 1W6NB 4D7TA 3P3PA 1JYXA 3CJIB 1KQRA 1ZBE2 5FZCA 1RB8G 1OOPA 1QNYA 3P1IA 1AXYA 2HWB2 4HK9A 5H9PA 3DXUA 5BY5A 3HMYA 2PHLA 1J3RA 3TNPB 1AYM1 5GZFA 1ZM1A 5B4XA 1GR3A 1WZXA 5IT6A 4YM2A 3VDDC 5E6HA 3RNSA 2GSYA 4K7JA 1R1A2 3LKJA 4OI1A 5KWRA 3VD5A 5DDJ1 3KM5A 3LIHA 1LRHA 3GXUA 4XAAA 3AMMA 2CAUA 1O3SA 4NN0A 4OI4A 2JX9A 5KR7A 2NZ9A 4IXLA 1YQ2A 3N7MA 1AYN1 3UJOA 1PIV1 2EIGA 3ACFA 1U5ZA 2NP0A 4HKLA 2WNVB 3AC0A 1PZ7A 1VJ2A 2E6VA 2PYTA 1D2SA 1H9PA 1NCQC 3LFMA 3U4SA 1G9BA 2AZ5A 4YW5A 3BI3A 3NV1A 4KU8A 4MGQA 4CVUA 4CEYB 1FV3A 1GZWA 1J3PA 3OUIA 2ZXQA 4D7YA 1YIFA 5CBLA 2AR6A 5C7GA 4QXKA 3MW4A 2HWF2 3SC7X 1KGYA 5FQ0A 4BQWA 3G7DA 4H7MA 2XKPA 1SLLA 3AKRA 4QU1A 4PCRA 4XJ8A 3DYMA 2Q8OA 2W1SA 4C1WA 4A4AA 2JB4A 2RV9A 4QX5A 4ZONA 2AH2A 4WVMB 5L9VA 4TLFA 1RUJ1 3VBSA 3VHRA 3GZAA 2PLV3 2D6MA 2VTXJ 4S2HA 3ZM8A 4FBFA 1FXZA 1MEC1 1BZWA 1Y9MA 3OTFA 5C8CB 2DBIA 4TYSA 1XYOA 3N7LA 4CEWA 4PLNA 4DFSA 1ZZCA 3K3OA 3MLJA 3RI9A 1JZ8A 1ZZBA 4CE8A 2ZGKA 1FYUA 2JG8A 2W91A 4XDQA 3ZFEB 1REEA 4BIFA 1UXZA 2J1AA 1U0AA 5FREA 3PVNA 4LITA 4YVSB 3C3VA 4BQ4A 2CGNA 5AFBA 3GBWA 2J1SA 1AJOA 1X9PA 2TNFA 1HRV3 2WQ8A 2JDMA 2WZ8A 2I2SA 5L9BA 3ZFGB 5LBFA 4CUBA 2XJSA 3HNBM 3I2HA 1HLCA 1OPOA 3ZIWA 4QHOA 3C7EA 5FYMA 4QM9A 1UIKA 3DF0A 5HCFA 4DXSA 3U14A 1KITA 1UYPA 1G9AA 2B8MA 2D40A 5DZGA 3ZPYA 2IVIB 2C6SA 3VBHB 4PJYA 3J8F2 3O14A 4ATFA 5J48A 1ZRIA 3HT2A 4I0WB 2NYYA 3T1LA 2Y33A 3JZVA 1OHFA 3AKQA 3NKTA 2WL1A 4AL9A 5FZ4A 3RWKX 2CU5A 4HETA 3NAPB 1Q8VA 4MGSA 4JC1A 1IKQA 3THTA 1O3TA 1OH3A 5C4WB 1AX1A 1GP6A 4JGZA 1V6KA 1R64A 1NZCA 2GMMA 2JDPA 2QTWB 5I8SA 2YPDA 4QQ2A 4PDWC 2GNDA 5FY4A 4JV4A 3W20A 1W0OA 1JMUB 5A7PA 3CJIC 1F4AA 1LTEA 1Y7BA 5IFPA 1SMVA 4EQVA 2BGCA 2JWPA 3IIAA 5JXIA 5F2WA 4G4FA 2QQLA 5JSRA 1IQDC 4K1ZA 1A8DA 4Q0PA 4QPYA 1UY4A 3ZYGA 2YC0A 1TNFA 3EYPA 3KS7A 4K6BA 1JYCA 1SZBA 4IQPA 3VL8A 1UXXX 4P5YA 1RC6A 2GN3A 5LRRA 3AMHA 1LOCA 5DABA 1AR62 3DYPA 4YARA 4OHVA 2C9AA 2YB7A 3OBRA 5FZ0A 1PMJX 4XXAA 1RUE3 1TME3 2FCVA 3AMQA 4QX8A 3F2ZA 2QJVA 1CAXB 1NCRA 3JD72 4BPZA 4GWNA 4COZA 2RR13 2WNVC 2QCSB 4BQ3A 5JOYA 5DZEA 3PTRB 4AEMA 4FTEA 1U5YA 1H0BA 3LPFA 4MHUA 3WDUA 2BWAA 5JXGA 3AMPA 2ET1A 1OD3A 2FMYA 5CVRA 3ZDSA 2DCJA 3ETPA 5SV8A 4CPBD 2XL9A 4AVAA 3O1MA 4CEYC 3NNMA 3WF2A 1UX7A 4QKDA 1FT9A 5FMOS 3AXDA 2JB8A 2PLV1 3QACA 2FBEA 1BVP1 3PUHA 3NL1A 2FDFA 4CP0A 2PELA 5T50A 4AF9A 1T6GC 3BIWE 4MGTA 2J1EA 2YYOA 1MQTA 1W3XA 5FZ8A 1LOFA 5JI7A 4MSVA 4N9IA 2WJSA 5EZWA 1C8NA 4N90A 1QJY3 5GLWA 4U36A 5C8CC 2IZWA 4EN7B 3PJQA 1ASJ3 1XE7A 4Q8LA 2EXKA 1HN0A 2VZTA 3D0SA 1HRV1 2H6CA 2QQVA 4B4RA 2XVGA 4LO5B 2JKBA 1RJ8A 5LWBA 2JKXA 1VE0A 3ZFEC 1VB2A 3T09A 1NXD1 2ZGSA 1LODA 4Y1YA 4EJRA 4YVSC 4OZOA 5ERLA 4NUBA 3AFGA 5IK7A 4W50A 2RDQA 4HSLA 1LEMA 5LA2A 2HH9A 1AF9A 2UYBA 3ZFGC 2XPJA 4F3JA 3I2FA 3FC0A 4CDXB 3QBQA 1IS4A 2GC2A 5FXWA 3WG2A 4JKMA 4EWDA 1YEWA 1PK6A 4IE5A 1UWWA 2EAKA 4ZU5A 5LY1A 1IS5A 2WFF3 4AGRA 2RDNA 3WINE 3CF6E 4FP2A 2BNMA 4BK5A 2UY8A 5EYXA 3RI8A 5KHGA 1Z78A 1CZSA 2GC1A 3QH7A 3RGBA 4DEVA 5FO9B 2V72A 5IK8A 1OQ1A 3VBHC 4E4DX 1O5UA 1YQ5A 1DGWX 3NAPC 1S0BA 1QXRA 3TN92 4C90A 1XNBA 4CUGA 3GZEA 1R082 5JXHA 3A0KA 4Y5Z0 5I0TA 2WS91 2KR2A 1UOGA 3I97A 1W9WA 3WSOA 1EAH3 3VKOA 1VLNA 5K0UA 3QLQA 2P1BA 2R063 5IVVA 1FMD3 2HWE3 1QH6A 1OLME 3ETQA 4AEDA 4FXGB 4A7YA 3T2TA 4EZ4A 2BPA2 2D98A 4CCNA 3A0NA 1ST8A 1GZWB 4JTOA 4PQ9A 1IG0A 3BB6A 3CKHA 3POYA 4Q4W2 2ZZQA 4GXLA 2E63A 3IDCB 3UKVA 5JOXA 4Q1PA 5FP3A 1TME1 5FOBB 5ABJB 4FPGA 1G86A 3O1RA 2BOIA 3WX5A 1TE1B 4XCBA 3WDXA 2RR11 1OUXA 4Q4X1 3AKPA 3W21A 1H1AA 1H2NA 4Y4YA 4A42A 1F9KA 1COV3 4OZXA 3MEPA 2WWUA 4KBBA 2VECA 5IJRA 1YJLA 2W5FA 3NV3A 5FYHA 2VNRA 4ARXA 1BEV2 1MS4A 2V09A 3I3QA 2Q0AA 4XHBA 2GH8A 3KGZA 4CEWB 1RUOA 1X8MA 4GULA 4YPJA 2HWD2 4AE2A 5CAZA 5JWPA 4QM8A 1RUF1 5FYCA 1AL21 4YFZA 1ZA4A 5FPZA 5I8TA 2W3JA 2JDAA 4GB33 1MVQA 1UPIA 3PIJA 2J1RA 3BODA 2WNUB 5FYTA 3N9MA 3U07A 2PHDA 2W95A 1OVPA 3V0AB 1CONA 5JSPA 2P2KA 1BVVA 4AI0A 1D4VB 3PUAA 5CADA 1SPPA 2DVAA 3KZ4C 4PIZA 5FYSA 2TUNA 4KG0A 1CR7A 3VZJA 5C3QA 4Q4V3 3MIFA 1ASJ1 3N35A 3I2DA 1Q56A 4X6RB 4XF4A 5EYYA 4OI0A 3OGRA 1V9U1 4FPYA 4YG0A 1KXGA 4UAPA 4ITCA 1W8FA 4KBZA 3VDDA 3PUSA 3AJZA 4LHSA 2R30A 5B4NA 1REFA 2JENA 1QJU2 5GM0A 4LULA 1TMF1 3B00A 1RXGA 5F9TA 1N1YA 2QQJA 4D69A 4YSFA 2BOJA 4P9IA 4KWUA 4XURA 1IHMA 1X36A 4NWVA 3R4DB 4AR2A 1I6XA 1Q8SA 2JDNA 3NJZA 4OLLA 3W9AA 3B93A 3L2YA 4ZS2A 5HI0A 1DFQA 2W92A 4DQAA 1PO21 1WCQA 2WFF1 4KMQA 3T0DA 3B69A 5JSOA 4D6SA 3O5SA 2OQ7A 1FATA 5AFEA 5ACA1 3AMNA 1SBDA 5H9RA 4A7ZA 3FE5A 2WQZC 4AVSA 4CDXC 1WD3A 2OS2A 1LOBA 4BCUA 4M3CA 4GZ9A 3GM8A 2VZVA 1XC6A 3VKLA 2A3WA 5FYIA 2VJXA 1FAYA 3CU7A 1HJGA 2CGOA 4IGPA 3AP4A 4A6OA 2G9FA 1U5XA 2GU9A 2BNNA 1RITA 1H8TB 1Z7S2 4IEWA 5DN2A 1SLBA 2RJKA 1JI6A 1W2TA 1BBT2 2XWBB 4O9GA 2HYKA 1GU3A 1UYYA 3GDBA 1O7FA 1UU4A 3POEA 3VBOB 1GOFA 3VKMA 2XQXA 4DMIA 1ULFA 3LDRA 2ZACA 3LF7A 3HWJA 1QOTA 4IDZA 5HBAA 1OQEA 1W8OA 2OA2A 5C8WA 1HV1A 2WBKA 3M3QA 3T0AA 1RHI2 2UU8A 4LHLA 2XL7A 3MIEA 5IVBA 1SG3A 2VTFA 3VB9A 2YMZA 3A21A 3PUIA 3H7JA 4IETA 2ADDA 1V0AA 3E6DA 3KVBA 4DNYA 3WP3A 1H2MA 3D4KA 1CAWB 4OVEA 3BCWA 5BNNB 3ZXLA 1NE6A 1W6OA 4N7IA 4XF0A 3KT4A 3LGRA 3RWNA 4IV1B 2OZ6A 2P34A 1H6XA 2XGXA 3RZZA 2C4XA 5I0DA 4BQXA 2NMOA 1MS0A 4RQPA 4BQYA 2YBKA 1KEXA 3N9NA 5FMOL 1HW5A 3WG1A 4CTEA 2B9UA 4D7SA 4P9JA 4AYUA 1VBA2 5ABJC 1D7PM 1D4M1 3JU9A 2IC1A 4IGOA 5IVFA 4BYYA 2FCUA 4M4RA 2C26A 3B3QE 5F37A 2ATFA 2RS51 1GICA 4O7XA 3LAGA 1CVNA 5FPLA 4YW1A 4AAXA 2GC3A 3USSA 4Q4Y2 1UY3A 1VPHA 2DVFA 3I59A 4IEZA 3WF1A 4CEWC 1ZZ6A 2XQRA 1JS9A 1CD3G 3ACLA 3OEBA 4JDNA 5T5LA 4AW7A 1DHKB 2ZGRA 4DINB 4UW5A 2WKKA 2Q8CA 3AVRA 2CNAA 4RFT0 4TSVA 3UGGA 4TZDA 3OF1A 3WHTA 3AYCA 2HWC2 4CXXA 1A6CA 3QOPA 1LGNA 1XU1A 4GD4A 2WNUC 2DVDA 4PI2A 4QQHA 4P02B 4L9BA 2XBO1 1C8M2 3AX4A 4PDWA 4ZPIA 1L3JA 1UZVA 2W87A 3DEMA 3MUZ1 4H3WA 1NT0A 2JDUA 3WP6A 4COYA 1CPMA 3CJIA 3T2OA 1G6NA 4XDOA 4K21A 3AFKA 5GZDA 3VLBB 1UPSA 2RMU1 1PK6B 1VAKA 1XBFA 2O8QA 2Y6FA 3I2GA 1LULA 4YM1A 3M3IA 4IV3A 2VCAA 1GNZA 1YJKA 1G7YA 4BQ1A 4CA9A 2CTVA 3J4UH 3MW3A 1XOYA 1O4ZA 5FY7A 5DAVA 4AWDA 4LO7A 4NOTA 1O4YA 2CY6A 5DQ0A 3VD3A 1RVF2 1SLAA 2VMFA 2XLFA 3GALA 4FPHA 4RSUA 4UW4A 4RD7A 2BNOA 4AI8A 2RS11 1DF0A 1UL9A 1JU3A 3UGFA 3UKTA 2YHJA 4L8QA 1Z0HA 4W65A 3ZSJA 2CSGA 3ZXFA 5FFOC 2WUHA 4KNCA 1QQP1 3B01A 2AC1A 5FZ6A 5K0UB 5JVVA 3FWEA 4FOYA 1J59A 1JZ6A 4CEYA 2D5HA 5AVAA 2P6HA 3ZXAC 5FLHA 1PVXA 3A22A 2RDRA 3NJVA 3OBTA 3Q8CA 1W9YA 4QPWA 4XQ4A 4W6XA 4AHXA 4B29A 1CWPA 3G6JB 5FP7A 2WZR1 4NROA 3ZLIA 3ZOIA 1ALYA 5IATA 2VU9A 1MZ5A 3POIA 1H8TC 5H9QA 5GZGA 1QKQA 2ARXA 4IL7A 2IFRA 3WNPA 3ACGA 2DF7A 3VBOC 2Z69A 1RJ7A 3PIGA 1H30A 5DG1A 3M1HA 2EXHA 3H1MA 1W8UA 2WT2A 1PVC1 4PBPA 3O1UA 3CNAA 3IWZA 1S0CA 4Z82A 1UY2A 5GZEA 2X05A 3RG0A 1EUTA 3ZFEA 1GLHA 3B9IA 4GKXA 1R091 3S5QA 1VBB2 4YVSA 1W8NA 3NSTA 1IS6A 5BNNC 2Q8EA 1YNAA 4SBVA 3ZXEA 4COUA 2Y8KA 5HCAA 3POBA 1W6PB 4IV1C 5FZBA 2J42A 4WBBA 2R6QA 3LFIA 2WN2A 1O91A 1AR63 1MVEA 2P17A 1PGL1 4FFIA 3KV5A 5LA1A 1H4HA 5FMDA 1W8HA 3D5OA 3OOXA 3JD73 3ZR5A 4WZFA 2A6XA 3CZUA 3VBHA 5C3OA 3BIEA 1AR92 1PZ9A 2SLIA 5KHKA 2RJ2A 1GWMA 2DTWA 4YZ1A 4XJ9A 1F35A 5FZAA 3WF3A 5AC93 3NAPA 1LOGA 4IEXA 2W1QA 3ZSEA 3D3AA 4EYUA 4HMZA 1F4HA 2KA3A 5FPXA 4AVTA 1C1LA 2C24A 2KD7A 4CU6A 4FI9A 2Q1FA 1UNBA 3TEXA 4Q0QA 5A3LA 3A4UA 4ISRA 3JXSA 2R32A 4P08A 2GALA 1YYNA 4P9LA 2JE9A 4J1WA 4XZUG 3SMHA 4DO0A 4LK7A 4UT5A 2JDZA 5J7MA 5LZ6A 2DWRA 1JOBA 3O12A 1W90A 3ZX7A 4DUWA 4AI1A 4ZU4A 2R072 4GH4A 5J1XA 3LDKA 4MYEA 3WCSA 4M3CB 1ZZ9A 2WA4A 4XPVA 4AOCA 4DS0A 2MEV2 5JIAA 2C1FA 4Z8BA 4NJ4A 2Y64A 1XJAA 5KC5A 4UF0A 3GZUC 2G4IA 2OT7A 3MV01 3ELNA 5KHHA 5K7PA 3O1SA 2FDKA 4A45A 3INAA 2YC4A 4MX3A 3VZMA 1HRI1 1J58A 3ROUA 2Y0IA 2E26A 5L36A 1VBC2 2IXLA 5L7OB 2VY0A 1N47A 1ZRCA 5FKBA 1CAXA 4A3XA 4K8FA 3E97A 5HPOA 4BMBA 5BNPB 2A6ZA 4MG2A 1NLRA 5IW0A 1XB9A 1C1FA 1HX6A 1J1LA 3CMGA 5F8PA 2JXAA 4LA2A 3LB9A 5A7NA 2GAUA 4F8AA 1ZZ8A 4QQPA 5K0UC 2MNGA 2A5ZA 3SKVA 3WD5A 4Q0UA 5GALA 3N9LA 1SHWB 2CDOA 2DFCA 2RE9A 4S2DA 2VW0A 3ILRA 1W6OB 1D0GA 1OMIA 3JB8A 1W8ZA 1XNAA 4NRQA 1OD5A 4RQPB 4B3NA 2NQYA 3AYEA 4LK6A 4YW3A 2OVUA 3LEMA 5E89A 3U11A 5A6XA 1DGRN 2ZBJA 3PNAA 2D43A 1KFUL 2VNGA 2VXJA 3ASIA 1JZ4A 2HEVF 2CWSA 1XNTA 1ZZ7A 2OZJA 3IIIA 4UOJA 5F7UA 1AR82 3VBUB 3SQOA 2D3SA 1RYYA 1XXNA 2VZ1A 2RS32 3MFCA 3A23A 1YQ8A 2UWCA 3HQUA 2EXIA 3I59B 4XCAA 4XXPA 4BE3A 4XJZA 4MGZE 4D6QA 1QJX2 5JR2A 1S4CA 4FTSA 1RUC3 2XWJB 3ENRA 4NAOA 4MUVA 5FXVA 1KDKA 5FO7B 1LHUA 5FWEA 5KC6A 5CA6A 1WMXA 3EB7A 4PBOA 1DYPA 1MACA 3EMRA 4RHV1 4CDXA 2XHKA 5T5PA 4NIGA 1QMJA 1AR71 1JODA 2DU0A 2ZHLA 4PIXA 2D6PA 1HQNA 2VBPA 1XSQA 4LBQD 1YFYA 2C9KA 2LM3A 5AC91 3IMMA 1BEV3 2CWMA 1VRH2 4IGQA 2RHPA 5A33B 4IV3B 4UWDA 2X29A 5CFDA 2HWD3 4DOUA 4IE6A 1G8WA 4XFHA 1FOD2 4N7UA 5EP9A 4NIIA 4Q1RA 4R9AA 3T3YA 5FZ7A 3SXWA 2R043 2L9LA 1YUDA 2DTYA 2ZGTA 3VDCA 5EJZB 4CCMA 4LT5A 2YU1A 4YZ5A 5A7QA 4YYOA 1RUG1 4LUKA 1GWLA 4C0HA 4BQ2A 2Q1MA 1GP4A 1JYWA 3FUQA 3WQ7A 5FLJA 1HXS2 4AQTA 2Y38A 1UU6A 1LEDA 3KCYA 4QX7A 2YC2A 4IW3A 1XQNA 2WYFA 3EJKA 1PGW2 1SLTA 3CJXA 3Q8AA 2JE7A 2J22A 2VOWA 1LHWA 3RDIA 1CZTA 4C8DA 3H42B 4KG8A 5CKNA 1C3HA 1QJU3 1S0FA 2JICA 3HOBA 2BRTA 3ES4A 1RMU2 4MVTA 3ZVXA 2A3YA 4IE0A 4INDA 4XQDA 5ABJA 3BGAA 4HXCA 1WD4A 1POV0 1XYNA 4JDOA 1GZCA 4NPLA 5FUNA 3UNPA 1C5HA 4BA6A 4LO4B 3O1PA 1NOVA 2EAAA 4Y5SA 4XF9A 1IGOA 1UMIA 3ACIA 3OUJA 3TEYA 2B9VA 5L7OC 1W9TA 5F6LB 4E2GA 3I49A 3WNXA 3NO8A 1YQ6A 4AHZA 5JIUA 1FPN3 5EIYB 1N1SA 2WN3A 1ENQA 3B02A 4GWMA 3ZYJB 5BNPC 4ISQA 3JCIA 2VUJA 3HT1A 5SV5A 3JBG3 1GSLA 2WINB 1AZDA 4YW4A 4NIAA 4W4ZA 5FZOB 1ZRRA 4BHPA 4E27A 4NIHA 3I2KA 1NY72 5CZKA 4E8CA 4Q29A 2WNUA 5CKMA 1ZNPA 4KWKA 4I02A 4XABA 5IK4A 1N3QA 4QXBA 1ZA7A 4YM3A 5BNQA 4K3UA 2IXIA 3V0AA 5FY1A 2Q5TA 5EV7A 1BBT3 4ORFA 4NHLA 2XVLA 5DZFA 3RJRA 1OLQA 1RUI2 4M3CF 1WA6X 3OB8A 3ORJA 4M00A 4RQPC 3ZFFA 3ZN5A 1OI6A 5F3GA 5FPVA 1ZBA2 2XONA 3NNGA 2BVVA 4H2AA 4LORA 2YFZA 5DAWA 1RHI3 3ZIXA 2WA3A 1BJQA 1RUC1 1WCSA 3KQ4B 3LOIA 4CCKA 4IESA 4QU2A 3S5AA 4B1LA 5FYVA 4IEPA 4EROA 1HJFA 1BMV1 1CX1A 1EV11 5K8SA 3VBUC 2YGMA 3SEEA 1PO11 4XFBA 2RDSA 2ZX2A 1VBD3 3FFQA 4XUPA 5BPXA 2JDHA 2WIIB 5GZCA 5LB6A 1S0DA 1QXPA 5ISLA 3B7MA 4I3PA 2ZHNA 3KB5A 5JDBA 2A3XA 2PXJA 3RRDA 3H8RA 3HBKA 3GHMA 3KMHA 4GJZA 4S2FA 4XDPA 2KXLA 4B7EA 4XF1A 4CYDA 5F39A 1VBA3 3N3HA 4YRDA 4TXWA 2B45X 2GMPA 3D82A 3LA7A 3IDAA 2YV8A 3AK0A 3N9OA 2VOXA 2ZGNA 3PMSA 1E5HA 5F5CA 3PDQA 1W2UA 1WWYA 4GH4B 3RYPA 2R041 4Q4Y3 4FAGA 4FTBA 3I2IA 4IV3C 3TB0A 1H8TA 2E9QA 4UF0B 4CXYA 4CU8A 2G19A 4HOOA 5D2AA 3THDA 3WHUA 4L2NA 4NPRA 4OYUA 4NRPA 3WW3A 4Y24A 3VBOA 1ACCA 4V2WA 5FZ3A 5I0SA 5KHIA 1T6BX 1B09A 2B7YA 2YZ4A 1RUD2 4FPLA 4MO3M 1C8M3 4MGKE 2WC2A 5J3UA 2RM22 4OHWA 4Y20A 5IVEA 3O1VA 2W2IA 3O0WA 5C3RA 3JUUA 3FFZA 4RL7A 4A44A 3AP6A 1X8EA 1CAWA 2XJPA 3AKTA 1POV3 4JQTA 5DUVA 1KD7A 2JIJA 5BNNA 4QHZA 4Q0SA 3C7GA 4IV1A 2DURA 3KHCA 1SACA 2ZHKA 4C91A 4XQWA 3DKQA 1DZTA 3U75A 3ZPOA 2UY9A 4Q0VA 4AK3A 3X29B 1RVF3 1LOEA 4LKDA 3J7NA 1DQ0A 1FPN1 3H8UA 3MICA 3NV4A 1DQ2A 1E5RA 4RR3A 5IFTA 3JQXA 2EALA 3POGA 3M2MA 3N4MA 2TEPA 2WT0A 4Y26A 4OUEA 3JBG1 3ZXDA 2WNOA 3TOJA 5A3MA 4BJ0A 2ZCWA 2PFWA 5FJHA 3WF4A 1J83A 4ZXKA 3UK9A 2NLRA 3HQRA 3C8XA 1S2EA 4R4XA 3H3UA 2P3IA 4QKNA 1AYM2 4E9KA 2WDBA 4RYDA 4GMP3 1W28A 1D0HA 1WA4A 4NVPA 4KWLA 2X10A 2OQ6A 2JDYA 3RZLA 2G1MA 4FO9A 5DDJ2 1XU2A 4Q8KA 3QD6A 3ZR6A 2XOMA 1OSGA 1EPZA 4QX1A 2VMEA 1QH7A 4UFMA 4Y33A 4BIOA 4CCOA 1AYN2 4LUMA 3NJYA 1PIV2 1VBD1 3SH5A 3WP4A 5F2SA 2UURA 3CO2A 4E8DA 2Y6HA 4XUOA 4KL1A 5K4LA 5CFDB 3MIGA 3ZSKA 4FFFA 4OHYA 5GLZA 3RSJA 2PAEA 1VBB3 4WM8B 2LALA 3FN9A 2FDHA 3TEZA 4L97A 4CXWA 3H3ZA 3EHKA 4BDVB 1YWKA 3CEWA 4ET7A 2Q8DA 1LR5A 3ZYPA 3K4DA 3I54A 2X53S 1GQPA 1AXKA 1SCRA 2W94A 4D6RA 3ST7A 2GZWA 4FFGA 1BK1A 1LECA 1VB4A 1ONAA 1J3QA 3PVBB 5IUQA 1RUJ2 3PU8A 5GLUA 3AZYA 3O0XA 1CAUB 1MEC2 4EN9B 2AEYA 4QD2A 4F83A 4QHBA 4GH4C 1W2AX 3ZSLA 3OBAA 4Y5TA 1ODMA 4QKFA 4NHXA 2O1QA 1DQ4A 1VMHA 3ME2A 1L7RA 3VHOA 4JVAA 4JX0A 1RUE1 2ZPXA 1HN1A 4BM8A 1QJEA 1S0GA 4Y4RA 4E4SA 4HANA 1RUH3 1ULCA 1JOPA 1XE8A 2VR4A 4XBLA 1LGCA 4LKSA 3MV11 1Q8QA 2ZEYA 2I07B 1QU0A 1N1TA 4LBLA 1POV1 5T5OA 4A6SA 4BOWA 2D6LX 2V4VA 1S55A 1H9WA 3TBDA 3JQWA 5FBZA 3U1XA 2CDPA 3WDWA 2JDKA 2R073 3HR9A 2YU2A 3GHNA 2PA7A 1UZWA 5E8AA 4QDQA 2MEV3 4L99A 4CDQB 2QBXA 1NX9A 3SLIA 2R49A 3PHMA 1AHSA 5J98B 2CL2A 1YXWA 3ACHA 4H14A 3O1OA 1X50A 4AFAA 1NLQA 1W6PA 3IN9A 4QDSA 1Q43A 3H50A 2IFWA 1VBE3 1QJY1 2ZGPA 1K45A 3L2HA 1VBC3 3NW4A 1DDLA 2E7QA 4JRAA 3UYJA 5A1AA 4LXLA 2HYXA 4XFAA 5FZGA 4JTNA 3ZFFB 4EV0A 4LHNA 2VQAA 3GNEA 4QXCA 1E57A 2TBVA 2ARBA 4WVWA 2DUQA 1KFXL 1LCLA 3N7JA 5HV0A 1DQ6A 4GMP1 4QAWA 4XETA 5FZEA 2HKXA 4YW2A 1GP5A 3S30A 1J84A 2V4AA 3MBWA 3S57A 1RGSA 2QFEA 3LA2A 3LSDA 5F32A 2VUAA 1W6QA 1XE0A 2VC9A 4YZ3A 5FP9A 4AFBA 2B39A 4AVBA 5T5JA 4ONUA 3V0BB 1V6OA 3H1WA 2VZSA 5FOJB 5EJ1B 1VP6A 4Y1XA 4AGVA 2EIEA 1UOBA 3HD8B 2H0VA 3MLLA 3H0OA 4LHKA 3MIHA 4GA9A 1FI2A 3SITA 3POSA 3GBGA 2E33A 2QQKA 4FP3A 5LA9A 4HL0A 3UV9A 3D8CA 1AR83 2ZEXA 2VMHA 3MFAA 3P3NA 3UT0A 4JDMA 4BXSV 1YFUA 3O0VA 3BUCA 3MZHA 4LNVA 3USUA 1N3OA 2VBBA 5FP8A 1QJX3 5CFDC 1GOGA 1DCSA 3NQHA 3M3CA 3IDBB 3KVAA 1LHOA 3E5QA 2ZZJA 4L92A 4WM8C 1EAH1 4C1XA 4CDUC 5CNAA 4QQLA 3RS6A 2BEOA 3TNQA 2GH2A 2PLV2 1DLCA 2R061 5FZFA 1FMD1 2W52A 2HWE1 5LA0A 4ES9A 4OHXA 2W68A 5K9YA 1NG0A 5BNPA 2OUHA 1PX3A 1Y9QA 2ZMLA 4Y20B 1ZBE3 5CKQA 2XVKA 1RXFA 4S2GA 3W5MA 1VMFA 1K12A 3M3EA 1MS5A 2HWB3 5FZLA 2HEWF 1AX2A 4HVQA 1ULGA 5FY9A 5LCWL 4XC9A 3KLSA 4F7ZA 1TNRA 1RUH1 3GBFA 1UF2C 1MS1A 3L9JT 5J96B 3OYWA 5BNOA 1A8MA 3NV2A 4ZXEA 1HRV2 1COV1 3RMXA 2VPVA 3WZ1A 1X82A 1R1A3 3V65A 5FV3A 2FZ1A 3POFA 3Q8FA 4Y22B 3D0JA 5JLVA 2Y26A 4QB6A 3CHXA 5M0TA 2VCBA 4RR3B 5CG8A 2Y6JA 1NYWA 4LA3A 1HXS3 2LROA 2VOKA 3BALA 4GALA 2OPWA 4LQRA 1CN1A 4GB31 1EYBA 4AHYA 3VBUA 3KF3A 2HLEA 4HSJA 4ZY9A 3O7OA 2QQWA 3U37A 2YROA 5DPNA 1VBE1 3N9QA 1YRZA 2ARCA 2XH6A 4QB1A 4X6QB 5CFCC 3IKWA 4YG3A 2XLGA 2BJSA 4B1MA 4BH9A 1DZQA 4CDQC 2XB6C 1WW4A 4Q4V1 5T54A 1RMU3 1OVSA 3JB4C 4FPFA 2NMNA 5JOZA 1CGPA 1RINA 2PHTA 2HWF3 3D6EA 3WXPA 4DRVA 5FDBA 2HEYF 2W46A 2ZX4A 4HKWA 1GMMA 1FNZA 3MO4A 1W9FA 4GWJA 3ZYFA 4ZS3A 3Q9OA 1W0NA 1SLIA 4LO6B 5C9AB 3KQRA 2XXZA 4XILA 5JCTA 5FIXA 2ZX1A 2K9ZA 2WS92 1HKDA 3VHPA 3ZFFC 5F1RA 2AACA 4PF1A 2ARAA 4LTAA 1WBLA 5A33A 2BERA 1RL3A 4BZ4A 4BWOA 1HB4A 4FPOB 1UYZA 5LBCA 5A3WA 3H8OA 1SBFA 4QX3A 1MR5A 2I74A 1V6NA 5KBFA 4OULA 4Z07A 4MGIE 3NKGA 2PHXA 2V5YA 1W6MB 1XNDA 1DU3D 1UIJA 1I9RA 4Y1VA 4O9EA 1TME2 1QF3A 5C70A 3PVOA 3VD9A 2Q30A 2G9GA 4FOVA 1RUI3 4C0BA 1OA3A 4D3WA 1UD1A 1JUHA 2RR12 2AEZA 2VZUA 4Q4X2 2WWSA 2P5BA 1ZBA3 3EQEA 1TVGA 2VCCA 4XBQA 3AVSA 3ITQA 2IXJA 1QIQA 3PTYA 4WVVA 1GKBA 4OCTA 2GN7A 4R9CA 3HVDA 3ZN6A 4CRQA 2WSVA 4BMEA 1JYTA 1YI9A 3CIHA 5L19A 4QDRA 2VTXA 1YI7A 3C7OA 3J8F3 2V5DA 1F31A 3KV6A 1F5FA 3RPQA 3ZN4A 4YZ2A 3LCPA 3LPGA 5DAQA 4I09A 5IAXA 1RUF2 2UWAA 1AL22 3M7AA 3MLKA 3OCPA 2I45A 1JBCA 4LEJA 1I1EA 2NN8A 3MPPG 1B35B 5KXDA 1ZBE1 5FY0A 4Y1ZA 5GJ6A 1Y9GA 2A7AA 2HWB1 3EBRA 3VKFC 4LLOA 1VIWB 2ET7A 4XFFA 4I3GA 2YGLA 4QPIA 1ASJ2 1H8VA 2VUCA 4WM7C 1CAVA 3FLPA 1GZTA 3VBFB 5E16A 1V9U2 2A75A 1C5IA 2Y6KA 4LKEA 3TRSB 1R1A1 1W0PA 1MS3A 2IXCA 5FZOA 3TAYA 2VNVA 4V2VA 1VR3A 4AG4A 5HCHA 1SFYA 3W5NA 1TMF2 4AFDA 4LIUA 3BTYA 1GBGA 2VOVA 4FSJA 3VGIA 4MADA 3AP9A 3WNLA 1CZVA 1URXA 5FUIA 3DXTA 1RUD3 2IUWA 2WABA 3OSDA 1PO22 1ENRA 2GMEA 2BGOA 2VM9A 2WFF2 3DGTA 4K1YA 4YM0A 3W59A 1JYVA 4UBHA 1W39A 3DCQA 2QUOA 4RR3C 1X9TA 2GDFA 2W1WA 4M0HA 4QXHA 4KH9A 4P9YA 5A1LA 5ACA2 3R05A 4HFSA 2O0OA 3GCXA 5ANQA 4QGLA 3RYKA 2HWF1 4IUGA 4CP2A 4FCAA 3MIDA 5FYZA 3ZXKA 2O14A 1GV9A 3OBZA 2Z2SB 4P5HA 4YVWA 4B7KA 1F5JA 2DDUA 1OF3A 2VQTA 4YG6A 5DAPA 5FK7A 4AEKA 1A3KA 2PAKA 1W6QB 4XUQA 4NWWA 1XNCA 5J09A 3OEAA 1W9SA 3POJA 4AVCA 2W39A 4QB2A 2Y34A 1N3PA 1XRUA 4QGNA 1LENA 1LNSA 5GKAC 3C7HA 4AEJA 5C9AC 5C33A 1WCKA 1OT5A 3DYOA 1I3HA 3CLPA 3K51A 3NVCA 1IQAA 2Y6LA 4AGGA 3LSEA 5LATA 2UYAA 2VMCA 4FXKB 1Q8OA 2WYSA 2A6WA 3ZKUA 4ZHNA 2R16A 1NQDA 3USUB 1AL0G 2Y0OA 4K9SA 4UFHA 5EFUA 5FKCA 1AYM3 3KT1A 4BXFA 2YDEA 3K2OA 5BUVA 4LO8A 1H4GA 1UU5A 1US2A 2VH9A 2ZGOA 3E1F1 4D8MA 4DXZA 4EN0A 3GJAA 1W06A 2QNKA 2WSUA 5DDJ3 2D97A 4HVRA 4XYXA 2XMLA 4M0NA 4LMFA 4MH0E 1UX6A 2RJLA 3J8F1 1KS4A 1E5IA 3RZKA 1RUNA 2OYZA 2WWJA 1AYN3 5JZGB 1D4M2 1PIV3 3NRUA 1ZX5A 2VAUA 2DVGA 3FHIB 3PU3A 4I01A 3IAQA 4AXOA 1S2BA 4RA0A 2RS52 4Y3OA 2Q4SA 3PJYA 3M3OA 5FXZA 2VG9A 3T2PA 5C5UA 4AAPA 2E51A 2XUEA 4FQZA 2FZ2A 4E2QA 3KF5A 1LKNA 3N9PA 4MV2A 4GAZA 3NNFA 2HBUA 1QY4A 3KWVA 1UZZA 5FJKA 3OYWB 5BNOB 5HV4A 1XNKA 1XSRA 3WR0A 5F5AA 1DBNA 3DECA 3PLQA 3E5XA 1GQGA 4QKBA 2MPFA 3WQ0A 2DYCA 3TN93 3RMYA 2LUWA 2VW1A 1C28A 1YC61 3OG2A 1R083 1B35C 3GJBA 3I2JA 3J7LA 4XACA 5FMBA 3WDYA 2AENA 1QOOA 1PHMA 1QJZA 5CIRA 3K3NA 3QCWA 2XBO2 2YFUA 1P8JA 5FZ1A 2ZS6B 1QDOA 1RUJ3 1O6UA 5T52A 2BQPA 5BYNA 1UMZA 4OI2A 3I3DA 1MEC3 2R1DA 2RMU2 3LEKA 4XMIA 5D8AB 3VBFC 1W03A 2ZMKA 2VQUA 2H6BA 3ECQA 2OX0A 3ZYIB 2PHFA 2XDVA 4N43A 1AR61 4FT8A 1GUIA 2RVAA 4Q4W3 2ZA9A 1BCXA 5F6KA 4B4PA 1ZRDA 4W6YA 2C0ZA 5IK5A 2JG9A 2ZJCA 2OUJA 1W04A 3IT8A 3JD71 2QDNA 3R0RA 5FZMA 2FDJA 3B94A 4CP9B 3UGHA 1NLSA 2RS12 1UO9A 1OBNA 1HB1A 2QQUA 5T55A 2OIIA 4LKFA 5FZHA 3WW1A 2ZTNA 5FBJA 1HB3A 3FLRA 1XYPA 2BW8A 4MOAA 1QQP2 1QWRA 1T2XA 3W58A 1UYXA 2BWCA 5A7SA 2VUDA 3NMBA 2XJTA 4WM8A 3I3MA 2VMGA 4L0PA 4TWTA 4EWEA 1H2LA 4CDUA 1PM4A 2EIBA 1OLMA 4DY3A 1VAMA 5DXDA 1IPSA 4W6WA 4B8EA 2PN5A 2WZR2 4LBJA 3M8LA 4PT6A 5A3NA 5LEKA 1LJ7A 2A1XA 2XLAA 3HAGA 4R52A 2BBVA 2ORXA 4XHXA 1BYHA 2P3YA 2XG3A 4R4ZA 2P3JA 2QDRA 2VQ0A 4QWNA 1GZ9A 1W2OA 2ZX0A 3I3BA 4XBNA 3BPSA 3HNMA 1CAUA 2B5HA 1WMEA 2PQSA 5HXMA 5FMCA 2FQPA 1Y4WA 3BOPA 1PVC2 2IVJA 2K0GA 4QPGA 3ON7A 3ZN6B 2AUYA 3O1TA 3PUQA 4YGDA 5KXCA 2D3RA 4MXVA 5IVYA 3THPA 5I91A 1F2NA 1YCIA 2E7AA 1R092 3I8TA 3T4VA 2QQMA 3AP7A 4ZU7A 1JW6A 3KHBA 3SCHA 2D5FA 3SCGA 3AZWA 2BZDA 4BLJA 5JI9A 2D6KA 5FK8A 3FJSA 1OFSA 4D94A 3ES1A 3ZKYA 2P4EA 3WNKA 4RS5A 2X5IA 3MIBA 3FLTA 1IKPA 4QPIB 3RQ0A 2YXSA 4N53B 1PGL2 2QZ3A 2R7EB 4XFGA 1CAVB 5JZGC 4I2OA 3BYWA 4CDQA 1FNYA 3CL1A 1AX0A 1ZVFA 3TN91 1X7NA 1SFNA 3WEZA 2DFBA 1R081 2D3PA 3DN7A 2CV6A 5FZ9A 1Z7S3 3I7DA 3HEIA 4HK8A 4XVHA 2AYHA 3GF6A 4B4QA 5BNOC 1LB2A 2CYFA 2Y60A 2VZRA 1ND3B 3GYDA 3T08A 1AUYA 4JAAA 4CUAA 5KXEA 4CDWA 5A7OA 4HT1T 3B9CA 4GMP0 3VN4A 3ZXJA 1WW5A 1J1TA 1UKGA 4AVVA 3NNJA 3OY8B 5DAXA 4BQ5A 2ZKLA 2G9ZA 2BFUL 4Q4W1 3DPRB 4QQOA 4XJAA 1JZ5A 3ZYHA 1AJKA 4E4ZA 3AYAA 1ND2A 3OGSA 3AKSA 5D8AC 5A3TA 3ZMNA 5EHDA 3BTXA 3MGUA 3URFA 1DIWA 4YVWB 5LK7B 3VBRB 4KQ7A 4JGYA 1JZ3A 3I2OA 4LOTA 2B4KA 2E7TA 2Z4FA 1U5IA 3V0BA 2CAVA 2XUMA 3IPVA 4GJYA 4XEZA 3WNMA 3HBZA 3U78A 2GP3A 3AZVA 4MGYE 1BEV1 3OUHA 1HV0A 3AL5A 3CZJA 5FYYA 1HRI2 4MXWB 1UAIA 2WO7A 3BU7A 1IOAA 2HWD1 4R9BA 5A32B 4NPMA 5F3CA 4XUNA 5FPBA 1X33A 1HDKA 2Q1ZB 1JYIA 3UETA 1W8TA 4W8JA 4AZZA 2GNBA 2UWBA 4PHZA 4AHWA 4XTPA 4IE4A 2WQ4A 3J26N 1WKYA 1CQ9A 1LHVA 2F4LA 2A71A 5FUPA 3IZOA 1NXMA 3KGLA 3DV8A 2O8OA 5JUVA 4DEQA 2QQIA 3POWA 1V6JA 3RFRA 2ZX3A 3MW2A 2HWC3 1BK0A 2IWGB 2ZAAA 1APNA 2VL4A 5AVPA 5A7WB 4NR1A 1H1MA 4P9WA 4XF3A 4WM7A 2WAOA 5GLVA 5CB7A 1W99A 3GZTB 4IEOA 1OUSA 2J7MA 2ID4A 1QJU1 4O65A 5HCBA 5GLTA 2E31A 1HB2A 4DZGA 1KS5A 1S0EA 2WS93 1PMIA 1EY2A 3GGLA 2Y6GA 2ZOEB 1QDCA 5FLIA 4AFCA 4CPBA 4EN8B 2JIGA 2ZEWA 5JPMB 1G9DA 4UYBA 2VE1A 1DGWA 1QJFA 3LEIA 2IXKA 4EN6B 4CCLA 4HPKA 1UCXA 5I8YA 4BB3A 1O3RA 1STMA 1D2QA 1VRBA 2ILMA 3WVJA 4XW3A 4HVOA 3WQBA 1JZ7A 1UW8A 3KT7A 4HBNA 2K2SA 4Y22A 2WRAA 3OPWA 1NKGA 4JZRA 2VBDA 5DUXA 4V1PA 4XIOA 5L9RA 1JN2P 4LPLA 5I93A 3OPZA 4JKKA 4YGCA 4RHV2 4Q4X3 2A70A 3T4HB 1K5MB 3I4IA 1V6MA 1AR72 5E88A 3EXUA 2VZPA 3J9SA 5G05L 4ATEA 1Z7S1 4GKYA 4QPIC 3AYDA 4N53C 4NRMA 3T30A 5AC92 1MS9A 1UKRA 3WDTA 4JRLA 3TWIA 3FX3A 1BBT1 4FFHA 1JU4A 4TLGA 1Q8PA 4N43B 1RUF3 3AM2A 2OKXA 1AL23 4L11A 1V6IA 2BU9A 3PVEA 2XR4A 1SDWA 1OH4A 2JG9B 1RHI1 4P9XA 4UFKA 5LBEA 3QH6A 1O8SA 3U10A 5JPNB 1IG3A 1C4RA 4YWAA 1DZRA 4LE4A 5C9AA 3VUOA 1OURA 1ND3C 4LBQB 5DG2A 4YW7A 1HIXA 4URAA 1RUG2 2D7FA 3T1MA 2Z42A 2H0BA 4IEUA 5A6ZA 3J7HA 3VHNA 4LBOA 3WV6A 1SEFA 3E6CC 2DCYA 1V9U3 1Q3EA 3BTAA 4XE9A 5B2GB 4URTA 3HQXA 3TEWA 1NZIA 1RIRA 3BN6A 1OQDA 3DPRC 3KSCA 4SLIA 2Z79A 3HN3A 4D0QA 1SCSA 2CGPA 1REDA 4CCJA 4RN5A 1VBA1 1W6MA 4JCKA 2BTVC 4CDUB 1OC1A 1TMF3 2JJ6A 3K4AA 4OQ9A 1JZ2A 1QEXA 1UOJA 4YVWC 3VBRC 3UL2A 4X8NA 2DVBA 1KJLA 4KGGA 3CQOA 1K42A 5CFCB 4DIQA 1JXNA 1OA4A 3OD4A 1EP0A 3WY6A 2OXBA 1DG6A 2F6BA 3DKWA 4Q4Y1 1GANA 1PO23 1OOPB 1WGPA 2PQQA 2EVXA 5APAA 4YW6A 1IS3A 1SLCA 3ZMOA 3VKNA 5ACA3 1U12A 2VMDA 4XJWA 3SISA 1PGSA 2R1BA 5FRAA 4QPGB 1A78A 1AR93 1PNFA 2HWC1 3NJXA 4OQ8A 4R8HA 4FQ4A 4KI5M 3WP5A 2K46A 2W9XA 2VGDA 3ALQA 2GNTA 1YIPA 4A41A 1C8M1 4A7KA 5KXBA 1OLRA 1WW7A 5G04L 2ORZA 4G9SB 4HG6B 1B35A 2ZGQA 2P6CA 3GCWA 4PLMA 3OGGA 3UJQA 3AL6A 1LU2A 2LW8A 5T3NA 5C4WC 1BKZA 4GIQA 3PURA 4KGQA 5CYYA 1O8PA 3UESA 2VVDA 4HLTA 3ZYBA 4DXTA 2BGPA 1YO8A 1VMJA 1W8WA 3AXEA 3WUCA 4NMIA 3WLUA 3BOWA 3EO6A 3VBFA 1WMFA 4RS5B 2X5IB 2LRPA 4CU9A 3CBNA 3H9AA 3SH3A 3OD0A 4PF5A 3WNNA 3IBMA 1GYKA 2HJIA 5JR7B 1RVF1 3RZGA 1RUC2 2EXJA 4K20A 4BK4A 1JUIA 1ULDA 3FUOA 4P14A 4UFIA 4Z1VA 4Z2WA 2FMDA 4P00B 1BMV2 2JECA 2FDIA 1EV12 5FQ0B 1ZREA 2XJQA 1S2KA 4XFIA 1PO12 3CDZB 2DV9A 2QQPA 3VD7A 4OHZA 4N9HA 5C3SA 1UZYA 1NUKA 5C3PA 4RFRB 3IAPA 2YG0A 3AP5A 4MLOA 4X8PA 5LY2A 5FY5A 3VBSB 3BTZA 1UQXA 3M4FA 1I5PA 1GNYA 4M4PA 1IZ3A 4AI9A 2FD8A 4NAMA 2ZGUA 4CDWB 5FY8A 1NA1A 4O61A 3FBMA 4DUVA 2X09A 3UKNA 1LESA 1D4M3 2V73A 3APBA 3LOBA 5H9SA 1K5MC 1W3VA 1M06G 2JG8B 2SBAA 2A6VA 2F17A 2RS53 3N7KA 3LWCA 1UZ0A 2WLPA 3A7QA 1ND2B 3LZZA 2DCZA 1E5SA 2R042 3K77A 5C5TA 2E53A 3R4UA 1Y43B 4IE7A 3DUIA 4JGYB 2ES3A 3DL3A 4UBGA 1YHFA 4N43C 1G9FA 1NQJA 2ZAHA 3MDPA 3TYJA 3LIGA 1A34A 3IPVB 3VDBA 3VZLA 1CPNA 1BXHA 1EPWA 2JG9C 5ANNA 5IVJA 1CESA 3ILFA 5EJ3A 2EIDA 2F4PA 2XBO3 1SQ4A 3VDAA 1UOFA 1CJPA 1H2KA 1VBB1 4LBMA 5FPAA 3PMEA 4DRRA 1ODNA 4OMCA 3WT3A 3M70A 4AQ2A 4Z92B 4GQ7A 4Q2FA 4HN1A 2RMU3 2VZOA 2RS33 4ZZ8A 4AFMA 1ZYBA 3S7IA 1Q5OA 4XMAA 1K3IA 4LR4A 4FOQA 3KCCA 4RGKA 5BXXA 1M4WA 1IPKA 2XHNA 1NCQA 1CIYA 3K4ZA 4JGZB 4XAEA 4AQ6A 2JD9A 4MZUA 3RZHA 2FDGA 1OKQA 3MI8A 2WT1A 3OGVA 4FPEA 5TSWA 1C57A 1FPN2 5D1IA 1KDMA 1SBEA 1AR91 2A6YA 4K8RB 4WM7B 3OJBA 1DGLA 4NE9A 4CCEA 5JZGA 1TZOA 1WLWA 2RS13 4Y1UA 2YUEA 4LLFA 4CSWA 3MPBA 1IPJA 4OMDA 1SDDB 3JBG2 3VZNA 4J6GA 1OOPC 3VZKA 4ZZ5A 2WZEA 2ZGLA 5JMCA 3ZYRA 2BP6A 4PIYA 3HJRA 1VRH3 3ILNA 4LJHA 1QQP3 2VULA 4H55A 4DY5A 3AJYA 1PX4A 4QGMA 4FOWA 2QKDA 4QPGC 5DUUA 5BV6A 3U0ZA 1FOD3 4HPKB 1FV2A 2WLQA 4ES8A 4A3ZA 1L7LA 4LE3A 1WUVA 5A6YA 4CUCA 3NWKA 2BV4A 4LIVA 1ULEA 3P5BA 4YNIA 3THCA 2WZR3 4I0BA 4PLOA 2B46X 1KJRA 2R071 4I0AA 2FHRA 2QQOA 4J25A 4YZ4A 5IYYA 1WBFA 1POQA 1YFXA 3KCXA 3WW2A 3WCRA 4CP1A 5FPUA 5FR3A 1OPMA 3H1YA 3T2QA 2MEV1 4UFLA 1NCRB 1H1IA 1JTZX 2JEMA 4E2SA 5D8AA 1WLCA 2YBSA 4RS5C 5I0RA 1VBD2 1PVC3 2LS6A 2X5IC 3Q8BA 1GWKA 2GP5A 1OKOA 1WCDJ 3SNMA 5J37A 1HQWA 1H6YA 1SFPA 3E6BA 5LRSA 1VBC1 5FP4A 5A6QA 4ZKTB 5CEHA 1MZEA 4XIKA 3H7YA 3HNYM 4FVVA 1R093 4JHTA 3WG4A 1S1AA 4HZFA 1LGBA 4GWIA 5C6CA 1RTVA 3BKZA 5FCCA 5L7OA 2ZMNA 4CP9A 4FAHA 1MQTB 4JKLA 4CCDA 2VW2A 5J36A 2VXRA 5FZKA 3VL9A 3RZJA 3R4SA 2ZKNA 4LBNA 5FTTC 3MHZA 3VBSC 2VO5A 2AGSA 1LU1A 3WUDA 3LDBA 1CX4A 1BQPA 3B5LB 2QE3A 3HIFA 4BISA 5A70A 5EXOA 5EPAA 4CDWC 5CISA 1QHDA 4NHYA 3WNOA 1O3QA 2JE8A 1QOSA 2XJRA 3SEPA 1WW6A 4HONA 3HN1A 3F95A 4KU7A 3LD8A 2XJVA 2JG8C 4QT6A 3FBYA 3K48A 5FAXA 5C71A 1NAEA 4RGAA 4P9GA 1ND2C 5JAXA 1W05A 4XFCA 5FYUA 1OFNA 2WR9A 4QX0A 4UI9L 3ATGA 4UW3A 2GNMA 4CU7A 3C7FA 1W6NA 4JGYC 1RUE2
chains in the Genus database with same CATH topology
3ZSMA 3C2UA 5HXVA 1AR81 4HN0A 4IERA 1GQHA 2QZ2A 2RS31 1Y3TA 2D44A 1CIWA 1QJX1 4AI2A 1MZFA 2B42B 2QVSB 1PNGA 4ASMB 4A2UA 2DCTA 2YPJA 3VV1A 4J1XA 4ASLA 2ENRA 2D6OX 1FX5A 1ENSA 4YGEA 5KHJA 5CG9A 2WNVA 5DUWA 1I5ZA 4JGZC 1PM7A 1VRH1 1QJY2 1HRI3 3IM0A 2X8KA 4DB5A 1AVBA 4QMAA 4N53A 1JH5A 3AZXA 1FOD1 4AEDB 2W0XA 1HQLA 1TQ5A 3ZO0B 2WNEA 5LEJA 1KRIA 3IDEA 4FPJA 1G9CA 4Q27A 3OGJA 3MYXA 4FPCA 1PZ8A 5LK5A 1F8VA 1N1VA 2DU1A 1QNWA 2JD4A 4K40A 4WVMA 3ZIXA 1HXS1 2OW4A 4JQRA 3WQ1A 1ND3A 5E1RA 1JHNA 1WLTA 5C8CA 2VMIA 3SCFA 1DGRA 2BFUS 1PGW1 4IEYA 3MF9A 4M01A 2RM23 3OY8A 2PHUA 4META 1ZRFA 2W08A 1NA1B 1O4TA 1S0IA 3BPZA 3DPRA 2C5DA 2D93A 1NCRC 1RMU1 2ERFA 2VVEA 2VVFA 3N36A 2MHFA 2ETEA 4HKOA 3FZ3A 1GFF2 1WLDA 1MZ6A 2DUOA 2Z5WA 5L73A 3S6PA 4WV8A 4BLIA 3VBRA 3SH4A 3V64A 3ZFGA 1V00A 2WZPP 3AB0A 3S0MA 4IEVA 1OA2A 1VALA 4YGBA 1DQ1A 4OFGA 3V56A 4CZSA 4AQSA 4XOGA 1EAH2 4MXWA 2BYVE 3SHRA 2DCKA 4XJUA 5A32A 2R062 2R0HA 1MQTC 3IMNA 4OUMA 1FMD2 3AZZA 1LOFC 1DLLA 2HWE2 2NPIA 3WW4A 4RHV3 4RGGA 4Q26A 3S7EA 1NY71 1AR73 3VDDB 4I30A 3MF6A 1MS8A 1QGLA 2GC0A 5I0UA 5CU1A 1TEIA 1AXZA 5EWSA 4COVA 4XZPA 2R0FA 1R1ZA 5C4WA 1RUI1 1RUH2 1YLLA 1CJDA 1ZBA1 2ZGMA 4R9DA 1COV2 2BUKA 1DQ5A 1NCQB 1GNHA 3RYRA 3U4XA 2EA7A 4H7LA 3KD4A 5JOWA 1RUG3 3WDVA 1JOJA 1PK6C 2XKOA 2PAMA 1LHNA 4GB32 1DYKA 4U2AA 2XJUA 2KM2A 4LBKA 3FMGA 4WZCA 4FPKA 4OUSA 1VAVA 2VNOA 4KWJA 2EF6A 4XTMA 4G3YC 4YLZA 1VBE2 2DUPA 1UN1A 4Q4V2 2IXHA 4M3CE 1QXJA 5FO8B 2PHWA 2LTNA 1V6LA 4YFWA 3ZXGA 1K5MA 2WFPA 3RJ2X 2A73B 4EWAA 3VZOA 3WG3A 4AEDC 4NHMA 2YY1A 1RUD1 1S0JA 2RM21 4NHKA 4DPNA 4IEQA 3WOGA 3R6SA 4LBQA 4NO4A 2ZHMA 1LOAA 2ZABA 2BVBA 4COWA 1YFWA 1NE4A 2P3KA 1NA1C 1V70A 1O5LA 2AREA 2NM1A 1ENXA 2OPKA 2PTMA 2D6NA 3LA3A 1EV13 3E5UA 1PO13 2N7GA 4UXAA 5F5QA 4WVZA 5CFCA 2PHRA 2P37A 1WMDA 4PDWB 4AI3A 4UW6A 1W6NB 4D7TA 3P3PA 3CJIB 1KQRA 1ZBE2 1RB8G 1OOPA 1QNYA 1AXYA 2HWB2 4HK9A 5H9PA 5BY5A 3HMYA 2PHLA 1J3RA 3TNPB 1AYM1 5GZFA 1ZM1A 1GR3A 5IT6A 4YM2A 3VDDC 3RNSA 2GSYA 4K7JA 1R1A2 3LKJA 4OI1A 5KWRA 5DDJ1 3KM5A 1LRHA 3AMMA 2CAUA 4NN0A 4OI4A 2JX9A 2NZ9A 4IXLA 3UJOA 3N7MA 1AYN1 1PIV1 2EIGA 1U5ZA 2NP0A 4HKLA 2WNVB 1PZ7A 1VJ2A 2E6VA 2PYTA 1D2SA 1H9PA 1NCQC 1G9BA 2AZ5A 4YW5A 3NV1A 4KU8A 4CEYB 1FV3A 1GZWA 1J3PA 4D7YA 1YIFA 5CBLA 2AR6A 4QXKA 3MW4A 2HWF2 5FQ0A 3G7DA 4H7MA 2XKPA 1SLLA 3AKRA 4XJ8A 4PCRA 4C1WA 2Q8OA 4QX5A 2AH2A 4WVMB 4TLFA 1RUJ1 3VBSA 3VHRA 3GZAA 2PLV3 2D6MA 4S2HA 5C8CB 4FBFA 1FXZA 1MEC1 1BZWA 3OTFA 4TYSA 1XYOA 3N7LA 4CEWA 4PLNA 4DFSA 1ZZCA 3MLJA 3RI9A 1ZZBA 2ZGKA 1FYUA 2JG8A 4XDQA 3ZFEB 1REEA 4BIFA 1U0AA 5FREA 3PVNA 4YVSB 3C3VA 2CGNA 5AFBA 3GBWA 1AJOA 2TNFA 1HRV3 3ZFGB 2I2SA 2XJSA 1HLCA 1OPOA 3ZIWA 4QM9A 1UIKA 3DF0A 5HCFA 1KITA 1G9AA 2B8MA 2D40A 5DZGA 3ZPYA 3VBHB 4PJYA 3J8F2 3O14A 4ATFA 5J48A 4I0WB 3HT2A 3T1LA 2NYYA 3JZVA 1OHFA 3AKQA 3NKTA 2WL1A 4HETA 3NAPB 1Q8VA 4JC1A 1IKQA 3THTA 1O3TA 5C4WB 1AX1A 4JGZA 1V6KA 1NZCA 2GMMA 5I8SA 4QQ2A 4PDWC 2GNDA 4JV4A 1W0OA 3CJIC 1LTEA 1Y7BA 1SMVA 2BGCA 3IIAA 4G4FA 5JSRA 4K1ZA 1A8DA 4Q0PA 4QPYA 3ZYGA 2YC0A 1TNFA 3KS7A 4K6BA 1JYCA 4IQPA 3VL8A 1RC6A 2GN3A 5LRRA 3AMHA 1LOCA 1AR62 4YARA 4OHVA 2C9AA 3OBRA 4XXAA 1RUE3 1TME3 3AMQA 2QJVA 1CAXB 1NCRA 3JD72 4BPZA 4GWNA 4COZA 2RR13 2WNVC 2QCSB 5JOYA 5DZEA 4AEMA 4FTEA 1U5YA 1H0BA 3WDUA 2BWAA 3AMPA 2ET1A 3ZDSA 2FMYA 5CVRA 2DCJA 5SV8A 2XL9A 4AVAA 4CEYC 1FT9A 5FMOS 3AXDA 2PLV1 3QACA 2FBEA 1BVP1 3NL1A 4CP0A 2PELA 5T50A 4AF9A 1T6GC 3BIWE 2YYOA 1MQTA 1LOFA 5JI7A 4MSVA 4N9IA 2WJSA 5EZWA 1C8NA 4N90A 1QJY3 5GLWA 4U36A 5C8CC 2IZWA 4EN7B 3PJQA 1ASJ3 1XE7A 4Q8LA 2EXKA 3D0SA 1HRV1 2H6CA 4B4RA 2XVGA 4LO5B 2JKBA 1RJ8A 3ZFEC 1VB2A 1NXD1 2ZGSA 1LODA 4Y1YA 4EJRA 4YVSC 5IK7A 3AFGA 4HSLA 1LEMA 2UYBA 1AF9A 3ZFGC 2XPJA 3FC0A 4CDXB 3QBQA 1IS4A 2GC2A 3WG2A 4EWDA 1PK6A 2EAKA 4ZU5A 1IS5A 2WFF3 4AGRA 3WINE 3CF6E 4FP2A 2BNMA 2UY8A 5EYXA 3RI8A 5KHGA 1Z78A 2GC1A 3QH7A 5FO9B 5IK8A 1OQ1A 3VBHC 4E4DX 1O5UA 1DGWX 3NAPC 1S0BA 1QXRA 3TN92 4C90A 1XNBA 1R082 3A0KA 4Y5Z0 5I0TA 2WS91 1EAH3 3VKOA 1VLNA 5K0UA 3QLQA 2R063 1FMD3 2HWE3 1QH6A 4AEDA 3ETQA 4FXGB 4A7YA 3T2TA 2BPA2 2D98A 3A0NA 1GZWB 4JTOA 4PQ9A 3BB6A 3POYA 4Q4W2 2ZZQA 4GXLA 2E63A 3IDCB 3UKVA 5JOXA 4Q1PA 1TME1 5FOBB 5ABJB 4FPGA 1G86A 3WX5A 1TE1B 3WDXA 2RR11 4Q4X1 3AKPA 1H1AA 1H2NA 4Y4YA 1F9KA 1COV3 4OZXA 3MEPA 4KBBA 2VECA 1YJLA 3NV3A 2VNRA 1BEV2 1MS4A 2V09A 2Q0AA 4XHBA 2GH8A 3KGZA 4CEWB 1RUOA 1X8MA 4GULA 2HWD2 4AE2A 5CAZA 5JWPA 4QM8A 1RUF1 1AL21 4YFZA 1ZA4A 5FPZA 5I8TA 4GB33 1MVQA 1UPIA 3BODA 2WNUB 3U07A 2PHDA 3V0AB 1CONA 5JSPA 2P2KA 1BVVA 4AI0A 1D4VB 5CADA 2DVAA 3KZ4C 4PIZA 2TUNA 4KG0A 1CR7A 3VZJA 4Q4V3 3MIFA 1ASJ1 3N35A 3I2DA 1Q56A 4X6RB 4XF4A 5EYYA 4OI0A 1V9U1 4FPYA 4YG0A 1KXGA 4ITCA 3VDDA 3AJZA 2R30A 1REFA 2JENA 1QJU2 5GM0A 4LULA 1TMF1 3B00A 5F9TA 1N1YA 4D69A 4YSFA 4P9IA 1IHMA 1X36A 4NWVA 3R4DB 1I6XA 1Q8SA 3NJZA 3W9AA 4OLLA 3B93A 3L2YA 5HI0A 1DFQA 4DQAA 1PO21 2WFF1 3B69A 5JSOA 3O5SA 1FATA 5AFEA 5ACA1 3AMNA 1SBDA 5H9RA 4A7ZA 3FE5A 2WQZC 4AVSA 4CDXC 1WD3A 1LOBA 4BCUA 4M3CA 3VKLA 2A3WA 1FAYA 3CU7A 2CGOA 3AP4A 2G9FA 1U5XA 2GU9A 2BNNA 1RITA 1H8TB 1Z7S2 4IEWA 1SLBA 2RJKA 1BBT2 2XWBB 4O9GA 2HYKA 5L7OA 3VKMA 1O7FA 1UU4A 3VBOB 4DMIA 1ULFA 2ZACA 3HWJA 1QOTA 5HBAA 1OQEA 2OA2A 5C8WA 1HV1A 3M3QA 1RHI2 2UU8A 4LHLA 2XL7A 3MIEA 2YMZA 3H7JA 4IETA 4DNYA 3E6DA 3WP3A 1H2MA 3D4KA 1CAWB 4OVEA 3BCWA 5BNNB 3ZXLA 1NE6A 1W6OA 4N7IA 4XF0A 3KT4A 3LGRA 3RWNA 4IV1B 2OZ6A 2P34A 2XGXA 3RZZA 2NMOA 1MS0A 4RQPA 5FMOL 1HW5A 3WG1A 4CTEA 2B9UA 4D7SA 4P9JA 4AYUA 1VBA2 5ABJC 1D4M1 3JU9A 2IC1A 4BYYA 3B3QE 2ATFA 2RS51 1GICA 3LAGA 1CVNA 4YW1A 2GC3A 3USSA 4Q4Y2 2DVFA 3I59A 4IEZA 4CEWC 1ZZ6A 3ACLA 1CD3G 4JDNA 5T5LA 4AW7A 1DHKB 2ZGRA 4DINB 4UW5A 2WKKA 4RFT0 2CNAA 4TSVA 4TZDA 3OF1A 3WHTA 3AYCA 2HWC2 1A6CA 3QOPA 1LGNA 1XU1A 2WNUC 2DVDA 4QQHA 4L9BA 2XBO1 1C8M2 3AX4A 4PDWA 1L3JA 4H3WA 3WP6A 4COYA 1CPMA 3CJIA 1G6NA 4K21A 3AFKA 5GZDA 3VLBB 1UPSA 2RMU1 1PK6B 1VAKA 2O8QA 4YM1A 1LULA 3M3IA 4IV3A 1GNZA 1YJKA 1G7YA 4BQ1A 2CTVA 3J4UH 3MW3A 1O4ZA 4AWDA 4LO7A 4NOTA 1O4YA 2CY6A 1RVF2 1SLAA 2XLFA 3GALA 4FPHA 4RSUA 4UW4A 4RD7A 2BNOA 4AI8A 2RS11 1DF0A 1UL9A 3UKTA 2YHJA 4L8QA 1Z0HA 4W65A 3ZSJA 3ZXFA 5FFOC 4KNCA 1QQP1 3B01A 5K0UB 5JVVA 3FWEA 4FOYA 1J59A 4CEYA 2D5HA 5AVAA 3ZXAC 5FLHA 1PVXA 3OBTA 4XQ4A 4W6XA 4AHXA 4B29A 3G6JB 2WZR1 1ALYA 2VU9A 1MZ5A 5H9QA 1H8TC 5GZGA 1QKQA 2ARXA 4IL7A 2IFRA 2DF7A 3VBOC 2Z69A 1RJ7A 1H30A 5DG1A 3M1HA 2EXHA 3H1MA 2WT2A 1PVC1 4PBPA 3CNAA 3IWZA 1S0CA 4Z82A 5GZEA 3RG0A 3ZFEA 1GLHA 3B9IA 4GKXA 1R091 1VBB2 4YVSA 3NSTA 1IS6A 5BNNC 1YNAA 4SBVA 3ZXEA 4COUA 5HCAA 1W6PB 4IV1C 4WBBA 2R6QA 1O91A 1AR63 1MVEA 2P17A 1PGL1 1H4HA 3D5OA 3JD73 4WZFA 2A6XA 3VBHA 1AR92 1PZ9A 2SLIA 5KHKA 2DTWA 4YZ1A 4XJ9A 5AC93 3NAPA 1LOGA 4IEXA 3ZSEA 4HMZA 2KA3A 5FPXA 4AVTA 1C1LA 4Q0QA 5A3LA 3A4UA 4ISRA 2R32A 2GALA 1YYNA 4P9LA 2JE9A 4J1WA 3SMHA 2JDZA 5J7MA 2DWRA 3O12A 3ZX7A 4AI1A 4ZU4A 2R072 4GH4A 4MYEA 3WCSA 4M3CB 1ZZ9A 2WA4A 4XPVA 4DS0A 2MEV2 5JIAA 2C1FA 4Z8BA 5KC5A 3GZUC 2G4IA 3ELNA 5KHHA 5K7PA 3INAA 4MX3A 3VZMA 1HRI1 1J58A 3ROUA 2Y0IA 5L36A 1VBC2 2IXLA 5L7OB 2VY0A 1N47A 1ZRCA 1CAXA 4A3XA 4K8FA 3E97A 4BMBA 5BNPB 2A6ZA 1NLRA 1C1FA 1HX6A 1J1LA 2JXAA 4LA2A 3LB9A 2GAUA 4F8AA 1ZZ8A 4QQPA 5K0UC 2MNGA 2A5ZA 3WD5A 4Q0UA 5GALA 2DFCA 2RE9A 4S2DA 2VW0A 3ILRA 1W6OB 1D0GA 1OMIA 3JB8A 1OD5A 4RQPB 4B3NA 2NQYA 3AYEA 4YW3A 2OVUA 5E89A 3U11A 1DGRN 2ZBJA 3PNAA 2D43A 1KFUL 2VNGA 3ASIA 2HEVF 2CWSA 1ZZ7A 2OZJA 1AR82 3VBUB 2D3SA 1XXNA 2RS32 3MFCA 3I59B 2UWCA 4XXPA 2EXIA 4BE3A 4XJZA 4MGZE 4FTSA 1QJX2 1RUC3 2XWJB 3ENRA 4MUVA 1KDKA 5FO7B 1LHUA 5KC6A 5CA6A 4PBOA 1DYPA 1MACA 4RHV1 4CDXA 2XHKA 5T5PA 1QMJA 1AR71 2DU0A 2ZHLA 4PIXA 2D6PA 1HQNA 4LBQD 1YFYA 2LM3A 5AC91 1BEV3 2CWMA 1VRH2 2RHPA 5A33B 4IV3B 2X29A 5CFDA 2HWD3 4DOUA 1G8WA 4XFHA 1FOD2 4N7UA 4Q1RA 4R9AA 3SXWA 2R043 1YUDA 2DTYA 2ZGTA 4LT5A 4YZ5A 4YYOA 1RUG1 4LUKA 4C0HA 2Q1MA 3FUQA 3WQ7A 5FLJA 1HXS2 4AQTA 2Y38A 1UU6A 1LEDA 3KCYA 1XQNA 3EJKA 1PGW2 1SLTA 3CJXA 3RDIA 2JE7A 2VOWA 1LHWA 4KG8A 1C3HA 1QJU3 1S0FA 2JICA 3ES4A 1RMU2 4MVTA 3ZVXA 2A3YA 4INDA 4XQDA 5ABJA 1WD4A 1POV0 1XYNA 4JDOA 1GZCA 1C5HA 4BA6A 4LO4B 1NOVA 2EAAA 4XF9A 1IGOA 5L7OC 5F6LB 4E2GA 3WNXA 3NO8A 4AHZA 5JIUA 1FPN3 1N1SA 3B02A 1ENQA 4GWMA 3ZYJB 5BNPC 4ISQA 3JCIA 2VUJA 3HT1A 5SV5A 3JBG3 1GSLA 2WINB 1AZDA 4YW4A 4BHPA 4E27A 1ZRRA 1NY72 4Q29A 2WNUA 1ZNPA 4KWKA 4I02A 5IK4A 1N3QA 5BNQA 3V0AA 4YM3A 4K3UA 2IXIA 2Q5TA 5EV7A 1BBT3 4ORFA 4NHLA 2XVLA 5DZFA 3RJRA 1OLQA 1RUI2 4M3CF 4M00A 4RQPC 3ZFFA 3ZN5A 4CYDA 1OI6A 1ZBA2 2BVVA 1RHI3 2WA3A 1BJQA 1RUC1 1WCSA 3LOIA 4IESA 4QU2A 4IEPA 4EROA 1BMV1 1EV11 5K8SA 3VBUC 2YGMA 1PO11 4XFBA 2ZX2A 5BPXA 1VBD3 3FFQA 2WIIB 5GZCA 1S0DA 1QXPA 3B7MA 4I3PA 2ZHNA 3KB5A 5JDBA 2A3XA 3RRDA 4B7EA 3GHMA 3KMHA 4S2FA 2KXLA 4XF1A 1VBA3 3N3HA 4YRDA 2B45X 2GMPA 3D82A 3LA7A 2YV8A 3AK0A 3PMSA 2VOXA 2ZGNA 1W2UA 4GH4B 3RYPA 2R041 4Q4Y3 4FAGA 4FTBA 4IV3C 3TB0A 1H8TA 2E9QA 3WHUA 4L2NA 4NPRA 3WW3A 4Y24A 3VBOA 5I0SA 5KHIA 1B09A 2B7YA 2YZ4A 1RUD2 4FPLA 1C8M3 4MGKE 2WC2A 5J3UA 2RM22 4OHWA 4Y20A 3O0WA 3JUUA 3FFZA 4RL7A 3AP6A 1X8EA 1CAWA 2XJPA 3AKTA 1POV3 5DUVA 1KD7A 5BNNA 4Q0SA 4IV1A 2DURA 1SACA 2ZHKA 4C91A 4XQWA 1DZTA 2UY9A 4Q0VA 4AK3A 3X29B 1RVF3 1LOEA 1DQ0A 1FPN1 3H8UA 3MICA 3NV4A 1DQ2A 4RR3A 3JQXA 2EALA 3M2MA 3N4MA 2TEPA 2WT0A 4Y26A 3JBG1 3ZXDA 3TOJA 5A3MA 2ZCWA 2PFWA 4ZXKA 3UK9A 2NLRA 4R4XA 3H3UA 2P3IA 1AYM2 4E9KA 4GMP3 1D0HA 1WA4A 4NVPA 4KWLA 4FO9A 5DDJ2 1XU2A 4Q8KA 3QD6A 1OSGA 1EPZA 1QH7A 4BIOA 1AYN2 4LUMA 1PIV2 1VBD1 3SH5A 3WP4A 2UURA 3CO2A 4KL1A 5CFDB 3MIGA 3ZSKA 4OHYA 5GLZA 3RSJA 2PAEA 1VBB3 4WM8B 2LALA 4L97A 3H3ZA 3EHKA 1YWKA 3CEWA 1LR5A 3ZYPA 3I54A 2X53S 1AXKA 1SCRA 3ST7A 2GZWA 1BK1A 1LECA 1VB4A 1ONAA 1J3QA 3PVBB 5IUQA 1RUJ2 5GLUA 3AZYA 3O0XA 1CAUB 1MEC2 4EN9B 4QD2A 4F83A 4QHBA 4GH4C 3ZSLA 2O1QA 1DQ4A 3ME2A 3VHOA 4JVAA 1RUE1 2ZPXA 4BM8A 1S0GA 4E4SA 4HANA 1RUH3 1ULCA 1XE8A 4XBLA 1LGCA 1Q8QA 2I07B 1QU0A 1N1TA 4LBLA 1POV1 5T5OA 4BOWA 2D6LX 1S55A 1H9WA 3TBDA 3JQWA 5FBZA 3WDWA 2R073 3HR9A 3GHNA 2PA7A 5E8AA 2MEV3 4L99A 4CDQB 3SLIA 2R49A 3PHMA 1AHSA 5J98B 2CL2A