1RUG3

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52035
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rug300
2X5IC 4YVWC 1PO12 1QJU2 4IV3A 2IZWA 1MEC3 3VDDB 2BFUL 1QJY3 1Z7S1 1H8TA 1ND3B 1EAH1 5A33A 5BNOC 1B35C 2BBVA 4N53B 2BFUS 4SBVA 5BNPA 1RUC3 2RMU2 1C8M2 1R091 2HWC3 3JBG1 1RMU3 4RR3B 4Q4V1 4JGZC 5AC92 1VRH1 2ZZQA 1BMV1 2Y26A 2RS52 3VBSA 1VBD2 3VBHA 3JD72 1FPN2 1DDLA 1VBE2 1Z7S3 4EJRA 5C9AC 4WM8C 4Q4Y1 1EAH3 2R062 1HXS2 3NAPC 1AR82 4Z92B 1RUF2 2RS11 3VBRB 1ZBE1 1R093 3JBG3 1D4M1 4YVSC 4Q4V3 3JB4C 1VRH3 4RQPB 1CJDA 1V9U2 1ASJ1 5CFCA 4CDUC 2XPJA 3ZFFC 5CFDA 1AR91 1RUJ1 3VBFA 2X5IA 4YVWA 1VAKA 3M8LA 1TME1 4Q4Y3 3ZFEC 1AUYA 1RUH1 1FMD2 4GH4B 1M06G 4CEYB 1FOD2 2HWB2 4QPGC 4RS5C 1QJX2 2WS92 4CDQB 1RUD2 2RS13 4AEDC 5BNOA 1GFF2 1B35A 1ZBE3 1NCRB 1HX6A 3VBUB 1D4M3 1RB8G 1QJY2 2RM21 1ASJ3 1NOVA 1RVF2 2HWE1 2BPA2 1AR93 1RUJ3 1HRV2 1TME3 3ZXAC 1RUH3 4IV3B 1VBB1 1RUE2 1POV0 5BNNB 5D8AC 2R041 3IDEA 5C9AA 5JZGC 1NA1C 3NAPA 5A33B 1MQTC 3ZFGC 1AYN1 4CEWB 1SMVA 2WFF1 2RM23 5ACA2 2HWE3 1C8NA 5L7OC 2RS31 4BCUA 1AL21 3VBSB 3VBHB 4JGYB 4CDUA 1VBB3 4FTBA 2R043 1RHI2 4IV1B 3VDDC 5A32A 4QPGA 4RS5A 1AYN3 1ND3C 2WFF3 1OHFA 4AEDA 4FTSA 1HRI1 2HWF1 1ZBA1 4N53C 4CDWB 2WZR2 1POV1 1EV12 3J8F1 2RS33 4RR3C 2MEV1 1AL23 1BBT1 1K5MB 4Q4X1 1RUI1 3TN92 1NG0A 2WWSA 5D8AA 1COV1 1NA1A 1ASJ2 2PLV2 1HRI3 2HWF3 1MQTA 1ZBA3 2RR12 1B35B 5C4WB 1AR71 1BEV2 3ZFGA 1RUJ2 1POV3 2ZTNA 3J8F3 1PO11 4N43B 1PGW1 2MEV3 2ZAHA 1BBT3 4RQPC 4Q4X3 5L7OA 5ABJA 1NY72 1RUI3 4WM7A 1PVC1 1TMF1 3HAGA 1COV3 1VBA2 2RM22 1AYM1 3VDDA 4GH4C 2RMU1 1VBC2 2HWE2 3NAPB 1C8M1 4CDQC 1AR73 4Q4W2 5AC91 1ND3A 2XBO2 2RS51 1NCRC 1PO13 3VBUC 1VBB2 1VBD1 1R082 4GB32 1OOPB 3JD71 4N53A 1NCQB 1ND2B 5GKAC 1VBE1 1AR62 4CDXB 4RR3A 2R061 1MEC2 1QQP1 1AYN2 1PO21 5K0UC 4PDWB 3CJIB 1PVC3 1TMF3 3VBOB 4JGZA 1RUF1 4IV3C 2QQPA 3DPRC 1AYM3 2RMU3 1C8M3 1QJZA 3S6PA 5BNNC 4FSJA 5A32B 5AC93 2RS32 1HQNA 1IHMA 2RS53 1AL22 1RUC2 1VB4A 4WM8A 2HWC2 1VBD3 1H8TB 1RMU2 2R071 4CEWC 3JD73 1E57A 2DF7A 1PGL1 1VBE3 4NWWA 4QPIC 4Y5Z0 2R063 1QQP3 1PO23 5BNPB 1FMD1 5LK7B 1FOD1 2HWB1 2WS91 1QJX1 1RUG1 1A6CA 1Z7S2 4YVSA 2TBVA 1RUD1 1RUF3 5FOJB 2GSYA 2HWF2 1EAH2 3VBSC 3VBHC 4JGYC 3J8F2 5C8CC 4IV1C 3ZFFA 3JB8A 4GH4A 1CD3G 1BBT2 1R092 3JBG2 3ZFEA 1RVF1 2R073 4CDQA 4Q4V2 1VRH2 1BMV2 1PIV1 2HWD1 4CDWC 1HRV1 1NCRA 3VBUA 1FMD3 1FOD3 1RUE1 2HWB3 1COV2 2WS93 1QJX3 1RUG3 4GMP0 1RUD3 5L7OB 4Q4Y2 5ABJB 4LLFA 1K5MC 5K0UA 4WM7B 5CFCB 2WLPA 2RS12 3FBMA 1R1A1 1PGW2 3DPRA 5CFDB 3VBFB 2X5IB 1ZBE2 4YVWB 5BNNA 1RVF3 5ACA1 1D4M2 2BUKA 1PIV3 2HWD3 5JZGA 1HRV3 5C4WC 4RHV1 1PVC2 1TMF2 4CEWA 5BNOB 1RUE3 5DDJ1 4N43C 1AR92 1AYM2 3VBRC 1RHI1 1TME2 4QPIA 1RUH2 1QJU1 4JGZB 1R1A3 5J98B 4JGYA 1F8VA 5ACA3 2WZR1 5C8CA 4IV1A 4NWVA 1EV11 4GMP1 1QQP2 1PO22 5C9AB 4WM8B 4RHV3 4CEYC 2VQ0A 5DDJ3 1RHI3 1OOPC 4CDWA 1F2NA 1NCQC 1X33A 1ND2C 3TN91 1QJU3 1FPN1 4CDXC 2R042 4YVSB 2R072 4PDWC 1K5MA 1W39A 3CJIC 2PLV1 3VBOC 1PGL2 2FZ2A 1HXS1 2RR11 5CFDC 1BEV1 1AR81 2WZR3 4CDUB 1EV13 2WFF2 4GMP3 3ZFFB 5J96B 4RFT0 3ZFEB 1RUG2 4QPGB 4RS5B 1NY71 1H8TC 5C4WA 3TN93 4AEDB 1V9U1 1FPN3 4N43A 3VBRA 1VBA1 5BNPC 4FTEA 1VBC1 2PLV3 5K0UB 1HXS3 2RR13 1BEV3 1AR83 4Q4W1 1PIV2 4RQPA 2HWD2 1X36A 2XBO1 3DPRB 1HRI2 1ZBA2 1R081 4GB31 1AR61 1VB2A 5D8AB 3LOBA 5JZGB 2MEV2 1NA1B 1MEC1 4CEYA 1V9U3 1QJY1 1MQTB 1R1A2 4Q4X2 3ZFGB 1VBA3 1OOPA 5FMOL 1NCQA 1RUI2 4Y4YA 1ND2A 4QPIB 1VBC3 2FZ1A 4Q4W3 1AL0G 4CDXA 5ABJC 1WCDJ 2XBO3 4RHV2 1RUC1 4PDWA 3CJIA 1OPOA 4WM7C 5FMOS 2HWC1 3VBOA 1R083 1RMU1 4GB33 5CFCC 1AR72 5DDJ2 2GH8A 1AR63 5C8CB 3VBFC
chains in the Genus database with same CATH superfamily
3FC0A 3S57A 3MFCA 4YZ4A 1HJFA 1QJU2 1YQ5A 4KWJA 5FQ0B 4HONA 1VAMA 2VTFA 4XF9A 4OULA 3ZN4A 2BNNA 2WFPA 1Z7S1 5JR7B 3Q8FA 4A6OA 2YGLA 3OBAA 4JX0A 1CONA 5FYCA 4AG4A 4FPLA 5BNOC 4KNCA 2Y6GA 2E9QA 1V6MA 4HKLA 2XJSA 2VNGA 1H0BA 3R6SA 2BFUS 2G4IA 2JG9C 1IQDC 3E6BA 3NSTA 2NQYA 1AXKA 4V1PA 3TAYA 5BNPA 1LGNA 3IIIA 4CUBA 2K2SA 1I1EA 1YFWA 4FOYA 4WVMA 4NIAA 4OI2A 2XR4A 5GLUA 3VHOA 5FZ4A 1H6XA 1QXJA 1XNCA 2BOIA 1BMV1 1WZXA 2RS52 2V72A 4QXBA 1O3SA 3KQ4B 4PIYA 2LRPA 1VBD2 3VBHA 3HT2A 3JD72 3Q8EA 1XU2A 1MZEA 1SFYA 3A0KA 3HBZA 1VBE2 3ALQA 1OPMA 4U36A 1OH4A 1YRZA 2DTWA 2P3IA 4Y1VA 5DUXA 4PBOA 2VMHA 3WW2A 4MG2A 4XEZA 2R062 3H1YA 1YCIA 3SISA 4HLTA 1XYPA 1X9PA 4XIKA 4UW4A 4OZXA 2W9XA 2RS11 3AMHA 1HV1A 3P3NA 3VD7A 1UKRA 2CGPA 1U5ZA 2PFWA 1DLCA 2YG0A 3E1F1 3JUUA 2JECA 1D4M1 4U2AA 4Q4V3 1WUVA 4MGSA 3JB4C 1D7PM 2YV8A 1VRH3 2Z79A 4YGBA 5IYYA 5IFTA 3H3ZA 2PN5A 2Q8EA 3AKRA 3VD3A 1G9AA 1ZRIA 4AR2A 1ASJ1 1UKGA 4CZSA 4CDUC 2Q0AA 3CQOA 3NJXA 5LA9A 2D6LX 4QQOA 2ZMNA 3VLBB 2DFCA 2JDNA 5FZOB 3ZN6B 2VXJA 2WO7A 3RVHA 3ZFEC 1KD7A 5CAZA 5DG1A 4XCAA 5FY1A 5IVVA 2RDRA 2J1SA 1FOD2 5JOXA 2VGDA 2HWB2 5FYSA 4AZZA 1QJX2 4FP2A 5LY2A 4DRRA 1S1AA 1RUD2 2CL2A 2BYVE 4H7MA 2W2IA 3CHXA 5BNOA 3GBWA 3A0NA 2YU2A 5KBFA 4XYXA 2YU1A 3WF2A 3OUIA 3BB6A 3VDBA 3GZTB 5HXVA 1MZ6A 2JG9A 2QNKA 1YYNA 1DHKB 3C8XA 3T3YA 1REFA 2PQSA 2FDFA 5LBCA 1OXCA 2CYFA 5I0UA 1UAIA 2BBAA 2HWE1 1FATA 3C7EA 2VL4A 4CA9A 3HEIA 4Q26A 1POQA 2GZWA 5F8PA 1J59A 3LDKA 2ZEXA 2P3JA 3H1WA 4NR1A 3ZXAC 4YZ2A 1VP6A 1RUH3 2VR4A 5FZLA 5FMBA 3ZSEA 1OD5A 3B93A 4M3CF 3H1MA 4GZ9A 4LBJA 3SNMA 5JZGC 2Z42A 4JC1A 1Q8OA 1CESA 2C9KA 3WP3A 3BTZA 1JS9A 1ZZ9A 3IMMA 4PF5A 2CAVA 3ILRA 4P9GA 5C3RA 3OPTA 3RI8A 5FXZA 3VV1A 4C1WA 2IVIB 2AR6A 4YRDA 3AXDA 4DB5A 1DZTA 3GJBA 4AAPA 1LB2A 4XOGA 1JOPA 4UF0A 3FUOA 3KGZA 1IG3A 5FKCA 1BQPA 1JZ8A 4CXXA 2NN8A 4XDOA 4BCUA 1SPPA 2D40A 2QDRA 2OUHA 1DYKA 3PJQA 3VBSB 4CDUA 2PELA 2IWGB 4J1WA 1SG3A 4K1YA 1W9SA 1NZCA 2GNBA 2D6OX 3O1VA 2VU9A 4KBZA 1YQCA 1AYN3 1MS3A 1OKQA 2PXJA 4JRLA 2QUOA 4D6RA 1JYXA 3O0XA 4FTSA 3AP7A 2IUWA 4XUOA 3VZNA 1HRI1 3IB3A 1ZBA1 3MUZ1 5F2SA 1LGBA 1QY4A 2VZRA 3KT4A 2B9UA 3JZVA 3N7LA 2J1UA 2BW8A 3HIFA 5FK8A 2QCSB 3AZWA 3BKZA 2PA7A 4FOVA 2VBPA 4HPKA 4JHTA 4MXWB 2MEV1 1YC61 1LR5A 4P9JA 4YPJA 1DQ2A 1K5MB 3BTYA 3U11A 4BMBA 3OGGA 2NPIA 5GLZA 4K6BA 2B9VA 2G9ZA 1WLCA 3NW4A 3OD4A 3OPWA 4JDMA 4R4ZA 2DTYA 5A3LA 2C9AA 4LBLA 2VOWA 3K4AA 1D2SA 4IEUA 3LEKA 4QHBA 1SLBA 4B7KA 1VR3A 2FDKA 4MSVA 4X6RB 2GDFA 4LITA 1ENXA 1UY4A 4HKOA 2WO1A 3PJYA 4QX7A 4H2AA 1PMIA 4XJZA 1QKQA 3IM0A 3QH7A 4JDOA 3WNMA 2F17A 1OLQA 3POGA 1B35B 3OYWB 5LATA 1AR71 3LZZA 4N7IA 5C4WB 4XBQA 1BXHA 2GMPA 4AAXA 5J7MA 3GBGA 4OYUA 2ZTNA 3ME2A 3NJZA 2XL7A 4E8DA 4P00B 2VD7A 5KWRA 2X8KA 4KGGA 4A7YA 5JIUA 1BBT3 1JUIA 3V0BA 5ERLA 4CPBD 4FAGA 1V0AA 1W05A 1W8UA 3K48A 1W28A 3AC0A 2ATFA 3I2DA 5LA1A 4QPYA 4Y1ZA 4CP2A 3MIGA 5JI7A 4Z1VA 1YEWA 3HAGA 4YGDA 1BJQA 1NLRA 2C24A 5DZFA 4YW1A 2MHFA 3C7HA 3Q9OA 2B46X 5FQ0A 1VBA2 3U0ZA 2VMGA 4YNIA 1GOHA 2RM22 3O12A 5C6CA 4N90A 3KHBA 3NAPB 1DIWA 1QNYA 4IE0A 3WG1A 1BYHA 3MV01 1CJPA 2UYBA 4AHWA 4Q4W2 2X09A 3ZM8A 4OQ8A 4NMIA 3SH4A 3BPSA 3FX3A 2ZS6B 3KCCA 1CAWB 1WCQA 2BVVA 4YWAA 2VUAA 3ZLIA 5A70A 1QOTA 3VZLA 1R082 1Q5OA 4FPFA 4GB32 4UXAA 3SCGA 2P3YA 3HQXA 1W8FA 2XQRA 1RUOA 4AFBA 3NO8A 4QDRA 3JCIA 5DMYA 3T08A 3WV6A 2VCMA 4OI1A 2WAAA 2PHXA 4R9DA 2AH2A 3I3DA 2KA3A 3CKHA 1MEC2 1JMUB 1QQP1 2JDPA 5K0UC 4AFDA 5GZGA 4UBGA 3WP4A 2OQ7A 2YY1A 1WCKA 4WZFA 3AKQA 5FOBB 1KGYA 2DUQA 3ZR6A 1JU3A 2OX0A 4CYDA 2NMNA 1N1VA 2OVUA 2X53S 3A21A 3OSDA 3QCWA 3GJAA 5A32B 1GQGA 4XTMA 5EZWA 4HSLA 4ZKTB 2QDNA 2RS53 5CZKA 1RUC2 2V4AA 5CYYA 3DECA 1C5HA 2HWC2 1VBD3 1H8TB 1S2KA 2R071 1SCRA 3JD73 1UOJA 4BIOA 2WL1A 5K7PA 1PGL1 1VALA 2JXAA 3QLQA 5A7PA 1VBE3 2WBKA 1CVNA 3POWA 5FO9B 2WQ4A 2LROA 4XFIA 4O9GA 1H2NA 1OVSA 4MGYE 1IS6A 1PX3A 1RYYA 4GXLA 1CIWA 3WP5A 1QWRA 3O1MA 1V6IA 2R063 2WABA 2R49A 1PO23 5C8WA 5LK7B 2JICA 4Q0SA 5EJZB 4MGZE 2DUOA 4BQ3A 2GC1A 3W20A 2QQNA 5BV6A 1HQWA 1EAH2 1LOEA 1WBFA 2HWF2 2PHRA 2VNOA 1U5XA 2WO3A 3KT7A 3LIGA 3OF1A 4Y1XA 2CDPA 5JVVA 4EN8B 2J7MA 4OMDA 2VVFA 3OY8B 4FFGA 4IGQA 4ITCA 4UOJA 3J8F2 4YM0A 5FZOA 3ZN6A 3BPZA 5F7UA 5DUVA 5FYZA 3MYXA 3F95A 3K51A 4HK9A 1FX5A 3JB8A 5CEHA 1CD3G 1Y7BA 2VMEA 1Q8QA 5E89A 1R092 2P37A 1RVF1 4PQ9A 3WZ1A 4H3WA 3HNYM 3LD8A 1Y9MA 1J3RA 1UQXA 2OA2A 4M01A 1UYXA 1I3HA 4B4QA 1CAUB 1HRV1 3ZPYA 2EIBA 3EBRA 3VBSC 2W47A 3GM8A 4LBKA 3MW4A 4GULA 4XFCA 1EPWA 2A71A 1FOD3 1COV2 2HWB3 1QJX3 1N1SA 3BOPA 4R8HA 3O5SA 2UYAA 1RUD3 2O0OA 5L7OB 2ARBA 2XJVA 5ABJB 5LRSA 5JSOA 1K5MC 2P2KA 5K0UA 4CU7A 1W03A 3CIHA 4YGEA 4XQ4A 5A7WB 3UT0A 5IATA 1W2NA 1RUNA 2WLPA 1GNYA 3PUIA 1R1A1 4AHXA 1H9WA 2VCCA 4LT5A 3MPPG 1PM7A 4SLIA 3T2TA 4NN0A 2X5IB 4YVWB 3ATGA 1UMIA 3NV2A 2ZJCA 4LORA 1A3KA 1IQAA 1LU1A 3MICA 4XZUG 1IPKA 1FNZA 4BU2A 4EN0A 1PIV3 3B69A 4IDZA 4WVZA 3ZSMA 5C4WC 1VLNA 1TMF2 5FYBA 1BKZA 2FQPA 3FFZA 4XJUA 1JZ3A 1NQDA 5CIRA 5KXEA 5IAVA 4NOTA 4DQAA 2Q5TA 2C26A 1AYM2 5JXIA 1RHI1 4Y5TA 1TME2 5FZIA 5F6LB 2DCYA 1T6BX 3J7LA 1O5LA 3U14A 4DUWA 4DZGA 2HEYF 1UOFA 5H9RA 3AXEA 3RPQA 3GHNA 3FLPA 4YZ1A 4D94A 1IS5A 5I0DA 3TB0A 5C33A 4FPCA 4JGZB 4XABA 4B4PA 2OQ6A 3AP5A 3O1OA 2JIJA 2CV6A 4P9YA 5CKNA 1UCXA 4HVOA 4L11A 4OVEA 1G8WA 3NNGA 5EHDA 1F8VA 3NJYA 4LO8A 1UX6A 1JHJA 2UWBA 3I54A 3KVAA 5DXDA 4YM3A 2ZHKA 2RVAA 4KQ7A 4UFIA 3LKJA 5JXHA 5JWPA 2RE9A 2XHKA 5C9AB 4A3XA 5T55A 5LEJA 5DAQA 2ID4A 5FP3A 1XYOA 3DEMA 4DXSA 5BUVA 2OXBA 2ZGMA 1PHMA 4AGRA 2QQOA 1US3A 2Y6JA 3M3CA 3RZKA 3N35A 3AMMA 1BCXA 3WDTA 1URXA 1G9CA 2ZGUA 4UFMA 4XBNA 4NPLA 1YNAA 1W8OA 4OI4A 4X8NA 4NRMA 3SXWA 2ARXA 2KD7A 1C57A 4AI1A 1DQ4A 1K5MA 5KXDA 2VPVA 3CU7A 4JQTA 1HXS1 3R4DB 2WNUC 3J4UH 3RNSA 3RFRA 4CRQA 4P02B 3I3EA 1DYPA 3ZFFB 2EXIA 4QGLA 3OUHA 4NJ4A 5F37A 5J96B 1O7FA 5E6HA 4CVUA 5FY4A 1DGWX 3K77A 4PIZA 2HYXA 3OGSA 1J84A 4E2QA 5FWEA 1H8TC 2CTVA 2XHNA 3OYWA 5FP8A 5C4WA 2YMZA 1C5IA 4FOWA 1YUDA 1V9U1 3PTRB 1AX0A 5A3UA 2DVAA 1FPN3 1J3QA 2R1BA 2D6NA 2VW0A 1KS4A 3N3HA 5FZBA 2A6XA 3AVRA 1EUTA 4FTEA 2PHLA 1S0DA 1D4VB 2HBUA 2FHRA 5DAPA 4LOTA 5JMOA 3AP6A 1XXNA 1AR83 4LHLA 2G9FA 2IFWA 4LO6B 4XURA 3T1LA 2XLFA 1NUKA 5A7OA 3LA3A 3N9OA 5A80A 1LENA 4LBQB 5H9PA 1H1AA 4YYOA 1REDA 5IVJA 4FQZA 5FLHA 4LO7A 3KHCA 2JE9A 2WR9A 4IERA 3KGLA 4A6SA 1K3IA 4IW3A 1NA1B 4IXLA 1OF4A 4P9XA 4NVPA 4Y24A 4DFSA 2I45A 2VZVA 1CAWA 4UW5A 2BGCA 3ZYPA 3PVEA 5J36A 4Q4X2 1ENQA 2J1TA 4PI0A 2XG3A 5FZ6A 1UD1A 2DFBA 3OCPA 3SC7X 3ZYBA 1VBA3 2J1AA 3I3BA 4JRAA 4D0QA 1GZTA 4AK3A 2B7YA 1OLRA 5IVFA 1CZSA 1UPSA 3ZYIB 2YZ4A 2YYOA 4PLOA 4Q5OA 2ZCWA 4Q4W3 3ASIA 5FAXA 3WNLA 5ABJC 1GU3A 3K3OA 3WW3A 1UL9A 4UW6A 1GP4A 3Q8BA 4LA2A 2BGPA 4RHV2 4TXWA 3USUB 2WSUA 1CGPA 5FV3A 5BNQA 1R083 4W50A 5T5OA 4GB33 4H55A 2WNUA 4NIIA 1WMEA 4L0PA 2E33A 3BVCA 4BK5A 4L9BA 2GNDA 5C8CB 4UFKA 2Z2SB 2X5IC 4YVWC 5LBBA 3M3EA 4LUKA 3TYJA 2Y6KA 4DEVA 4Z2WA 4DUXA 1MEC3 3I8TA 1W6NB 1SBDA 2BFUL 3N9PA 2ET7A 2YHJA 3HPNA 1RXFA 2JDZA 5JI9A 1H8TA 1WKYA 3V56A 5IK8A 3SITA 2PMWB 5A33A 1SDDB 2GC2A 4K9SA 1X50A 5A3TA 2RDSA 3GZUC 1V6NA 1YQ2A 5FZMA 2C1FA 1LNSA 2PQQA 5BY5A 2BBVA 1S55A 1UOBA 4N53B 4AVAA 3AX4A 4G3YC 3HR9A 3I3MA 1X8EA 2FDJA 1RUC3 3WDUA 4ASLA 4XF3A 1C8M2 2HWC3 4HANA 3THCA 3RRDA 3ST7A 5LCWL 4RR3B 4Q4V1 3S30A 5F3IA 4JGZC 3W9AA 2YFZA 1VRH1 1MS9A 1U12A 4DUVA 3HVDA 2VZ3A 4XDPA 4YW2A 1O3TA 2WO2A 1DZRA 4ARYA 3ZYRA 2C0ZA 4EWEA 3WVJA 1E5HA 2P34A 5C9AC 1FXZA 1IKPA 1EAH3 4BQ5A 4Q0VA 1IKQA 3U4SA 1PZ7A 1UIKA 1XNDA 4MH0E 4Z92B 2CY6A 1UYPA 4JKMA 1CAUA 1RUF2 4FO9A 3UKNA 1W0PA 1UYZA 2MPFA 3POBA 3M4FA 1RXGA 4L92A 1H2LA 1R093 4FCAA 3U10A 2B39A 4AFCA 5KR7A 1DGLA 2F4PA 1ZRRA 1HLCA 4O65A 4NE9A 4RQPB 4IEVA 5H9SA 1YI7A 3MLKA 3S7EA 3O1SA 1MZ5A 3DYOA 3B5LB 3HN1A 2DWRA 2H6BA 5A7WA 3AJZA 1Y3TA 3AL6A 3VHPA 3U1XA 2QKDA 3GXUA 5F1RA 2ZGLA 4XFBA 3D0JA 3L9JT 3WP6A 5L19A 1GP6A 4BB3A 2XPJA 2WT1A 4OZOA 1FNYA 3ZFFC 3AKPA 3QOPA 5A7SA 5DG2A 2X5IA 2QQVA 1WCSA 4MGIE 1WWYA 3DGTA 4XAAA 4YVWA 1RUH1 5KHIA 1J3PA 1AXZA 1H6YA 1FMD2 4GH4B 4PT6A 4JQRA 2ETEA 3RZJA 1M06G 2WS92 5D1IA 5FO8B 2FD8A 3GDBA 2VAUA 4ZU5A 2YUEA 2D98A 2RG4A 1WCUA 1GFF2 4UWDA 4Q1PA 3PTYA 3FWEA 1HX6A 1AX1A 5L9RA 3UV9A 4AWDA 4UT5A 2R32A 4I0AA 1RB8G 3IMNA 3BIWE 4OUMA 2JB4A 3BUCA 2VECA 1UO9A 1YQ8A 3MIEA 3EJKA 4HBNA 4AEJA 2CGNA 2WSVA 3BU0A 1QJY2 1NOVA 4XETA 4QX0A 2FCUA 1KS5A 2BPA2 3THDA 4LE4A 4PI2A 2D43A 3GALA 4MOAA 1RUJ3 1GLHA 2ZOEB 1TME3 2DUPA 3S5AA 4XPVA 2ZPXA 4QQHA 4IV3B 1XNAA 5FMDA 4CCKA 3CBNA 2R7EB 5DAWA 1C4RA 4Y3OA 1WA6X 3AB0A 1POV0 5BNNB 4OHVA 3IPVB 5C9AA 1NA1C 2AACA 5C3QA 1GUIA 2HEVF 1BVP1 5E8AA 3ZYGA 1JODA 4K8FA 1IOAA 3WNKA 1YO8A 3LPFA 1AHSA 4QB1A 1UMZA 4I2OA 1MS0A 1AYN1 1NAEA 2ZX1A 5A3PA 4QQLA 1ACCA 4BHPA 3O1UA 1NE6A 1V70A 2ENRA 5KHJA 1US2A 1QGLA 1S0JA 2YBSA 4Z2AA 3I49A 4PJYA 3GCWA 4E2GA 2IVJA 1L7LA 2BP6A 4XILA 1QHDA 1FV2A 1VMHA 2E32A 4PF1A 4CCCA 4RYDA 2E51A 3RDIA 4B1MA 1S4CA 4M4PA 2VMDA 4KBBA 4D7SA 4FBFA 4MVTA 2W0XA 1VBB3 2IXCA 2PAEA 3EYPA 3ZIWA 4YSFA 2AUYA 4CCDA 5DABA 2A6YA 4GQ7A 1LHNA 2XJQA 2ZGOA 2K9ZA 5FWJA 3TEXA 5CVRA 4OI0A 2O8QA 1P8JA 2SLIA 2RJLA 2TUNA 4IEQA 2QQKA 2Q8DA 2ZHNA 3H0OA 4NIDA 5GALA 3ACFA 4Q0QA 4KG8A 1LESA 2PAMA 4NHLA 3WEZA 1LECA 5LEKA 4N53C 3KVBA 5IWFA 2E63A 4CCOA 2NYYA 3KCYA 1IS3A 3WCRA 4BYYA 2DCKA 2Y34A 4FPYA 1Y9QA 1CZVA 1EV12 5FO7B 2RS33 3K4ZA 4Q0UA 4RR3C 1W90A 1AL23 2EALA 1BBT1 5FJKA 1W06A 1W8WA 1TNFA 4CUAA 5HV0A 2ZHMA 1C3HA 3QACA 3VL8A 2P1BA 4JVAA 3AK0A 5FXVA 3LB9A 4BQ2A 5DAVA 3DXTA 2BTVC 3MW3A 1NG0A 3GZEA 2BEOA 2JE8A 1JYNA 4JV4A 3ACGA 3MF9A 4GJZA 1UOGA 4BQYA 3E5UA 3RZGA 4CSWA 1N47A 1ULCA 1NA1A 4FPEA 4IEXA 4META 1ASJ2 4TN7A 2IXLA 2UU8A 1W3VA 2VO5A 3T30A 2PLV2 2LM3A 3LGRA 1DLLA 1N1YA 1ZRFA 3MIHA 2RR12 4XJWA 4DMIA 1W2AX 3KV4A 5FPVA 1JYIA 2YC0A 4F8AA 1POV3 3FJSA 4FAHA 3MV11 2VULA 2AENA 3V0AB 4XXPA 1JZ2A 2OT7A 4RQPC 1BZWA 4YLZA 3USUA 3O14A 4Q4X3 4EWDA 4OHYA 4AQSA 1NY72 1SLCA 5DPNA 2DBIA 4DS0A 2E7AA 1EYBA 4WVWA 1F4HA 3J7NA 3VN4A 2W94A 1XE7A 3VKFC 3VD4A 1PK6B 1XU1A 4TSVA 1NKGA 1Y43B 4IUGA 4XCBA 4AHYA 2W46A 3CLPA 5I0RA 1W6NA 4GH4C 2HWE2 2HBTA 2LALA 1L7QA 4NRQA 3W5MA 4QB6A 3D0SA 4IE6A 3H8UA 1JXNA 5F5QA 1DGWA 2JDAA 2XBO2 4ZS2A 2RS51 4C1XA 3WSOA 1YLLA 3MO4A 1ONAA 3NV1A 4MYEA 4D8MA 2DCJA 5FLJA 3TRSB 1VBD1 4I01A 4N53A 3ELNA 3JD71 2XDVA 3N4MA 1ND2B 4FFHA 4P9WA 3WDYA 3WW4A 4XJAA 5GKAC 1VBE1 4MGQA 4YW6A 4CDXB 1T2XA 2C6SA 4RR3A 2R061 1ODNA 1XC6A 1PO21 3ZMNA 1ZZ8A 3PL0A 2OIIA 2ZGPA 3FE5A 4DEQA 1PVC3 3VBOB 3MF6A 4HOOA 3C3VA 3KCXA 4KWKA 4HVRA 4IV3C 4Q2FA 1C8M3 3S6PA 4JKKA 1JW6A 3UK9A 4CTEA 5BNNC 5LWBA 4FSJA 1OD3A 3ZMOA 4C0HA 1MS4A 3PMSA 3TEWA 2XKOA 1SLTA 4AEMA 4HVQA 2V73A 2PAKA 1RMU2 1V6KA 1JYWA 3DYMA 1E57A 2DF7A 2Y64A 3HQUA 3S5QA 1UXXX 4PQQA 5FZDA 1OH3A 3PU8A 4LK7A 4ZZ5A 2OUJA 1H2MA 4YZ3A 5JOZA 4QX8A 1OA4A 5KHKA 4Y5Z0 3V64A 5DN2A 3DV8A 4N7UA 2FDHA 2OPKA 1FOD1 2WIIB 4UBHA 2HWB1 3POFA 1QJX1 2W91A 2CWMA 1L3JA 1RUD1 1RUF3 2CGOA 4NIHA 5E88A 1KFUL 4W4ZA 5H9QA 1QDOA 1OQEA 1IPJA 4LA3A 4YW4A 3VHRA 4E9KA 4L99A 4AI3A 4CCNA 4QKFA 2B8MA 1WA4A 3RG0A 4GH4A 5GZFA 4LKEA 5KHHA 5HBAA 4AF9A 3JBG2 3ZFEA 3B3QE 4XFHA 5KXCA 4QM8A 4M0HA 5LRRA 2W87A 1PIV1 2WYFA 5JDBA 3RWKX 1Z0HA 2WT2A 4CP1A 4BQWA 1FMD3 1AZDA 4LE3A 5DQ0A 2YBKA 4M3CB 4CP0A 2WS93 1NYWA 1RUG3 4FT8A 5FIXA 4K1ZA 3UGFA 3WF1A 2ZHLA 3I2OA 4Q4Y2 3ROUA 5DZGA 1APNA 1V6JA 2QQWA 4DINB 1CPNA 4CUCA 3OG2A 4DOUA 2OS2A 3ES4A 4MADA 4LEJA 4WM7B 5A1AA 5CFCB 3H8OA 4UI9L 3W58A 1LOFC 2G1MA 3L2YA 3OB8A 1WD3A 5FKBA 2QQIA 1ZBE2 4CUGA 1R64A 4XC9A 5BNNA 1I5PA 5KXBA 4EYUA 4E4ZA 1H1MA 2R1DA 1GWMA 2BUKA 1BK1A 4D7TA 2HWD3 1GZWB 5JZGA 1GZCA 1QXPA 2WN2A 5CA6A 1S0FA 2D93A 1HIXA 3IZOA 4XBLA 1HN0A 3RI9A 1VAVA 1AR92 1UPIA 1UZYA 1RJ8A 1W6MB 1HJGA 4QKBA 4CCEA 2YFUA 4ZXEA 5FY9A 5LK5A 4QGMA 5EV7A 5JOYA 4JHZA 4QQPA 1KDMA 1VRBA 5A1FA 5J98B 4QPWA 5LA0A 5FYHA 1UMHA 3DKQA 3GNEA 4YFWA 3HT1A 1PK6C 1F4AA 1GQPA 1NZIA 2ZX3A 2UWCA 2VZTA 5C70A 3WR0A 2VCBA 1JTZX 2CAUA 4RSUA 2WWJA 3VL9A 1IZ3A 2BZDA 1O4ZA 4BA6A 1QQP2 3VZJA 4DXZA 4WM8B 2A3XA 4K3UA 3K2OA 5G05L 4QB2A 2D3RA 3P5BA 1BLZA 3T0DA 1IG0A 2HYKA 2VH9A 4AFMA 2VQ0A 2A70A 3I4IA 5DDJ3 5T5JA 3O1RA 1C1LA 3AMPA 1TZOA 5DAXA 5IJRA 1VPHA 3MW2A 4KH9A 3ITQA 1ND2C 1OA3A 2QJVA 1NX9A 1OI6A 4B8EA 2V09A 4PLMA 1QJU3 1ODMA 3H9AA 5A3WA 2WLQA 1FPN1 4CDXC 2R042 4NAOA 4H7LA 4YVSB 4EZ4A 2R072 4W6XA 3IIAA 3VBOC 1ULOA 2R0HA 4DY5A 1PGL2 4NUBA 2FZ2A 5T54A 1PZ8A 1AR81 1JYCA 2IFRA 4IGPA 1F5FA 1LOFA 1EV13 2IC1A 2WFF2 3P6BA 5FRAA 2Q30A 1OA2A 2DVBA 2ZA9A 3AZYA 4QHOA 5JOWA 1LOAA 4RFT0 4NHXA 4KGQA 4XHXA 1OLMA 4G9SB 3CDZB 3ON7A 2I74A 3H8XA 3BU7A 5HCBA 3ZXJA 3HOBA 3VZOA 3OEBA 4COYA 3FBYA 5EFUA 4R9CA 3GF6A 4AEDB 3POJA 1SCSA 4TZDA 1WMXA 3GHMA 4FI9A 2XGXA 2BQPA 3H7JA 4RGAA 4XXAA 3SH3A 2CHHA 2AEZA 3VDCA 3UKTA 4MXVA 1VBA1 3M7AA 4Q29A 5A6ZA 3X29B 2I07B 3KWVA 1UIJA 2PLV3 3O1PA 4AVCA 3AYCA 3W5NA 2RR13 1O5UA 4Q4W1 4LXLA 1F9KA 1RITA 1W0OA 3P1IA 3MEPA 5K4LA 3WUDA 4AVBA 3DPRB 2VBBA 2VE1A 4LULA 1R081 2NZ9A 4R4XA 3N9QA 4GB31 4W65A 3UJQA 1PK6A 1EY2A 4AI2A 2OPWA 3KV5A 3E97A 1W0NA 1S2EA 3H3UA 2Y60A 4LKSA 4UYBA 2XUEA 1K45A 4RGKA 5D8AB 3SQOA 5FDBA 2V5DA 1H8VA 1MEC1 1RTVA 3KV6A 4EE2A 1KDKA 4GWMA 1R1A2 2B5HA 3A7QA 4KU8A 4C0BA 3KMHA 3DCQA 4HETA 1S2BA 3PIGA 3ZFGB 3GZAA 2LS6A 3GCXA 5JPMB 1RUI2 3K3NA 3KSCA 1ND2A 4QPIB 4Y4YA 4A41A 4RL7A 3OGRA 1TE1B 5JPNB 1VMJA 4BM8A 1AL0G 4CDXA 2CNAA 2XBO3 3WNNA 2Y0OA 3DUIA 1RUC1 2BU9A 5FP4A 3ZXFA 3WW1A 4WM7C 3VBOA 2HWC1 4HT1T 1OUSA 1SEFA 5CFCC 4Y1UA 3FZ3A 2GH8A 4PIXA 1W3XA 1LOGA 2GMEA 2PHWA 1WW4A 1PO12 1ZREA 1FAYA 3THTA 2YBPA 3RGBA 3C7FA 3VDDB 3ZIXA 1BK0A 5AFEA 4FXGB 4Z82A 4Y1YA 5FJHA 5IVBA 2YPDA 2RDNA 2NP0A 4F3JA 1JHNA 1EAH1 1C28A 1SHWB 2ORZA 4RGGA 2WKKA 1B35C 3H7YA 4KWUA 3LCPA 4BQ4A 3ACIA 4TLGA 1V6LA 4SBVA 4XF0A 4BH9A 5FYUA 1DQ0A 4E4SA 1YFXA 3CMGA 4AW7A 4YZ5A 2RMU2 5FZAA 3WNOA 1R091 3GYDA 1RMU3 2WAOA 2WZ8A 1BHGA 3LA7A 5AC92 5HXMA 3RS6A 2ZZQA 4LBMA 4NHYA 3IDBB 5SV5A 1WMDA 1MPXA 2Y26A 4FPJA 3EB7A 1UY0A 4TLFA 3FN9A 5IUQA 3BCWA 2DURA 4NPMA 3VBSA 1OBNA 3HNMA 1YQ6A 2ZEZA 3OD0A 3N7KA 4AEKA 4AQTA 4KMQA 5FPLA 4C8DA 2AYHA 4ISQA 5FPXA 4WM8C 4ZY9A 4AYUA 1OUXA 1KXGA 1A78A 1HXS2 3NAPC 1LRHA 4MHUA 3TNQA 3UYJA 2FDIA 4NHMA 2UWAA 2AGSA 3Q8AA 5AVPA 4CCJA 1ZRDA 4EZHA 5GZCA 3VBRB 1W8HA 1SLIA 2VVEA 3NNJA 1KFXL 5J48A 3FLRA 3QBQA 1S0CA 4M3CA 4QMAA 5I8YA 1YIPA 3JBG3 4QM9A 2GAUA 4YVSC 1LEMA 2LTNA 3FFQA 3LA2A 4I0BA 1SACA 4K21A 4LHNA 2E31A 2OW4A 4Y22B 1UWWA 4COZA 1CJDA 2A3YA 4MXWA 3UGGA 4CU6A 1D0GA 1F5JA 1V9U2 4DXTA 5F9TA 1G7YA 5CFCA 1RL3A 4XDQA 1UZ0A 4D7YA 5FTTC 2JDKA 3ZR5A 4BPZA 4YM1A 3ACLA 4R52A 1RUJ1 2XL9A 5FZEA 1ZZ7A 3MIFA 1VAKA 4Q4Y3 1TME1 5IW0A 1UZWA 2XB6C 1XOYA 5T50A 3RZLA 2LUWA 2W1SA 3CO2A 3PLQA 2A6WA 2XOMA 4JTNA 2VM9A 5F5AA 4CEYB 4CDQB 3HNBM 3LPGA 4D6QA 1GZWA 2XJRA 2AEYA 2Y6HA 3Q8CA 4CE8A 1HQLA 1N3PA 3AMQA 1JBCA 2OZ6A 3I7DA 3MBWA 3URFA 4AEDC 2A3WA 1W2UA 1CAVB 5L36A 3ORJA 1B35A 1XB9A 1ZBE3 2VJXA 3VBUB 3AP4A 5I8TA 4IEWA 1TVGA 3FLTA 3GGLA 1LOCA 5GZEA 3AVSA 5HCHA 1OC1A 2ZBJA 1O8SA 4I09A 5JMCA 1G6NA 4F7ZA 3ABZA 4E4DX 1XJAA 1G9DA 1K42A 3RSJA 1AR93 1YIFA 1AJOA 3N7MA 4X6QB 5HCFA 2JDMA 2XWBB 2VBDA 4AI0A 3POIA 3NV3A 2EA7A 5CBLA 4JZRA 1VBB1 5IK5A 1RUE2 1YI9A 5D8AC 3C7OA 3T1MA 1W8NA 2Y33A 3DN7A 4ZU4A 3WDVA 4JAAA 2A1XA 2BV4A 2JIGA 2P17A 1V00A 3NAPA 3ZYJB 1ZRCA 5DUUA 1MR5A 4C91A 1PVXA 1OFNA 3ZFGC 2VOKA 3EXUA 2ZGTA 4CEWB 4F83A 5JAXA 5EP9A 1LODA 1SQ4A 2XONA 3FUQA 4XW3A 2P3KA 1FT9A 4W8JA 5C5TA 5C71A 4ZXKA 2RM23 4ATFA 5ACA2 3RJRA 4LPLA 4QX5A 1Z78A 1W9TA 3AFKA 1PZ9A 5L7OC 2RS31 1XSQA 1EUUA 2ZKNA 2V4VA 2UURA 3E5XA 2DVGA 2GC3A 1AL21 1K5JA 2EXJA 2EXHA 3VBHB 4JGYB 4B1LA 4FTBA 2EIDA 3ES1A 5C3SA 3CF6E 2R043 3VD5A 3ZXEA 5F5IA 4FPOB 1B09A 5J37A 2VZUA 5GM0A 4IV1B 5I0TA 3VDDC 3I2KA 5A32A 2R16A 1GP5A 5FZGA 1VIWB 1GMMA 4LIUA 3AP9A 1HV0A 2WFF3 4JKLA 3HMYA 4AEDA 3U78A 2YDEA 2ZXQA 3TOJA 1G86A 2ZGQA 3B7MA 1NT0A 4N8MA 2JDHA 3M3OA 2WZR2 3LIHA 4X8PA 2RV9A 1POV1 1MS5A 2VOTA 2WUHA 3BTAA 5A6QA 1DU3D 2PHUA 2GP3A 3AYEA 2B42B 1KRIA 1JI6A 2WA3A 2W08A 2IXIA 1DBNA 2D3PA 2K0GA 2H0VA 3LQCA 3MGUA 1DQ5A 1HB4A 1Q8SA 3ZN5A 3ZO0B 4HN1A 5FZ8A 1TQ5A 1CN1A 3AM2A 4Q4X1 4RN5A 1ULDA 4XZPA 5DUWA 2EVXA 4D69A 4EN6B 3I2HA 3TN92 1D0HA 3OY8A 1I6XA 4GKXA 2WWSA 1DG6A 4XTPA 4AFAA 5FP7A 5FUPA 1F31A 5D8AA 4IL7A 3MFAA 3SEPA 1UYYA 1H4HA 4QDSA 1W8TA 2EIEA 2UY8A 2VUJA 5JXGA 2HWF3 5FYMA 3ETPA 4CPBA 1BEV2 3ZFGA 2VVDA 4QU2A 3J26N 4Z07A 4XIOA 3J8F3 3C7GA 2A6VA 3T2PA 5FLIA 5K9YA 1Q43A 2TEPA 1PGW1 4LK6A 1ZM1A 3TWIA 5FFOC 2QZ3A 2ZAHA 3LEMA 3WG3A 4QHZA 5E16A 5HPOA 2GNMA 5F32A 5FZ9A 2F4LA 4CCLA 2VXRA 5ABJA 5L7OA 3O1TA 4LLOA 4OUEA 4XMAA 1RUI3 3KV9A 2ZACA 2D6KA 3OGVA 5I8SA 1UZZA 1PVC1 3B02A 5BPXA 3VB9A 1SBFA 5GJ6A 1QOOA 3CEWA 3W21A 3U37A 1COV3 1STMA 2XVLA 4P9LA 3T4VA 4URTA 3VDDA 1VBC2 2VZQA 1C8M1 1GZ9A 4CDQC 1FYUA 3OUJA 3I2FA 4BQXA 3LOIA 1KJLA 2WWUA 3E5QA 3OEAA 2Q1FA 3HD8B 4Y5SA 1PO13 3VBUC 3BN6A 2PHFA 4DIQA 1HB3A 1NCQB 3U07A 1CAXB 2ES3A 2HKXA 5E1RA 5L9BA 1AR62 5SV8A 4G4FA 1JZ4A 1AJKA 3LSEA 1T6GC 2VQAA 4GKYA 4K20A 2IXHA 3DL3A 4LTAA 2X10A 4OUSA 4CCMA 1AYN2 3QH6A 3AZVA 4PDWB 1LGCA 1GSLA 1TMF3 4ISRA 5F39A 4LIVA 4JGZA 1RUF1 2BWCA 1DF0A 2XUMA 1QH7A 1Q8VA 3KLSA 4IE4A 4K7JA 4OCTA 2QQPA 1AYM3 3OGJA 2YB7A 2RMU3 4ES9A 1QJZA 3A4UA 4HN0A 4AE2A 5AFBA 5AC93 1OQ1A 4MV2A 1IHMA 4BMEA 1VB4A 1Q8PA 5FR3A 2NMOA 4L8QA 3E6CC 4IETA 4CEWC 5AVAA 2WQ8A 3AJYA 4QT6A 2GU9A 4NWWA 2WINB 3JXSA 3K4DA 3N36A 2KR2A 4Y22A 5G04L 1FMD1 4QKDA 1YHFA 3ZXGA 5J1XA 1Z7S2 2WS91 1RUG1 1LHOA 3J7MA 4XVHA 2TBVA 5FOJB 4I3GA 3ECQA 2GSYA 2WQZC 3VBHC 4JGYC 2J1RA 5EJ1B 2EAAA 2Q1MA 2R0FA 3KF5A 3CJXA 2NLRA 1ZZ6A 5C8CC 4IV1C 4LKFA 2ZGKA 3ZFFA 4AI8A 1GYKA 1W2TA 2W39A 5B4XA 1BBT2 4XACA 1QOSA 3C2UA 4CDQA 3U4XA 5D2AA 2Y8KA 4AVTA 1BMV2 1XPWA 3SEEA 1VE0A 2Y0IA 2HWD1 1HN1A 3VBUA 1YWKA 2CSGA 2XJUA 1CR7A 1UF2C 2ZKLA 5CB7A 5FYVA 3LEIA 4BK4A 3V0BB 4ZHNA 4GMP0 1JUHA 2D6MA 5JSRA 3T4HB 2XVKA 4AHZA 4EN9B 4Y20B 4XUPA 4BOWA 3CNAA 4MX3A 3M2MA 2IXKA 4YARA 2W92A 3R05A 2ARAA 4KU7A 4WZCA 1DCSA 4M0NA 1OFSA 1G9BA 1QJFA 2RS12 3CZJA 3FBMA 1XRUA 1LHWA 3WG2A 4I3PA 3WD5A 2AC1A 2GN7A 3VZMA 3SLIA 5CFDB 5BXXA 2D5FA 4XQDA 3VBFB 1JYTA 3LDBA 1D4M2 4LBQA 4AL9A 5BYNA 2VNRA 3ZVXA 1GV9A 3BGAA 4NROA 4OFGA 4NHKA 3KS7A 2R6QA 3ILNA 1UU6A 2EICA 3LEGA 1ENRA 3WF4A 4CEWA 1WW7A 3B9IA 5FY8A 3ZYHA 2CWSA 4BISA 5T3NA 1W6QB 1RUE3 2ILMA 5DDJ1 4QU1A 1NXD1 1JOBA 1OLME 5IK7A 3POSA 2QQMA 1QJU1 4YFZA 3L2HA 2WRAA 2WA4A 3B94A 3LWCA 2A73B 2XWJB 3IDAA 3M1HA 3NNLA 5F5CA 4B3NA 3D4KA 4CU8A 1J58A 5JIAA 4JGYA 1QF3A 3VHNA 4C90A 1REEA 5ACA3 2ZMLA 4XE9A 2GALA 5EJ3A 3WQ0A 4IV1A 4NWVA 5C8CA 1EV11 4I0WB 3SKVA 1QMJA 2ZX4A 1ULGA 1PO22 2GN3A 2BNOA 2ZX0A 5A3MA 3DF0A 4NO4A 3ACHA 5FZHA 4RHV3 2XLAA 5FZCA 1W9FA 2DVDA 3N9LA 4ZZ8A 2ZGNA 1W2OA 1VMFA 1IGOA 1S0BA 4YW3A 1XSRA 3D5OA 1IS4A 1F2NA 1NCQC 1X33A 1CIYA 1CPMA 3NMBA 3CZUA 3PUHA 3ZKYA 1LOBA 5FY5A 2OKXA 4XAEA 1UW8A 4RA0A 5KC5A 4LO5B 4MO3M 4IEPA 4ONUA 4PDWC 2X29A 3ZXKA 4A2UA 3BTXA 2PLV1 4GWIA 3B9CA 2GH2A 3BYWA 2RR11 2I2SA 3POYA 2WZR3 2VUCA 3R4UA 4L2NA 2XKPA 4GMP3 3B00A 1R1ZA 4HKWA 4ASMB 1GOGA 2ET1A 4YG3A 4ATEA 1RC6A 5LBEA 4IEYA 2PHTA 5FPBA 4MGKE 3T09A 4Y4RA 4QPGB 2D5HA 1NY71 4QDQA 4RS5B 2J1EA 5IVYA 1WLWA 4J1XA 3OBRA 3TN93 3WDXA 3AL5A 5CG9A 4XF4A 3ZDSA 3ZPOA 4MUVA 3IT8A 1Y9GA 3BODA 3NNFA 2Q4SA 4LO4B 1QU0A 3OBZA 3FHQA 4XJ8A 2FCVA 5FYTA 3SCFA 1W8ZA 4XMIA 2EXKA 4LNVA 3ZKUA 5K0UB 3LFMA 4ARXA 1BEV3 1PIV2 2QFEA 1JOJA 4RQPA 2B45X 1X36A 4TTGA 2XBO1 3FHAA 2D3SA 1UXZA 1X9TA 1XNTA 3KZ4C 2BRTA 3NVCA 4LOSA 1HRI2 2VQUA 1ZBA2 4E8CA 2YROA 5FXXA 5JCTA 3I97A 1SDWA 2Y6LA 3IAPA 1U5YA 1MVQA 3LOBA 2MEV2 3D3AA 2HEWF 1TNRA 2JDUA 4Q8LA 4XFFA 4DXRA 4HZFA 3O0VA 3F2ZA 5FZ0A 1MQTB 2KXLA 5B4NA 4O7XA 3RMYA 2JB8A 3WQ1A 3VKOA 4UW3A 4N9HA 3AKSA 1NCQA 3HJRA 3FL7A 4YW7A 1O4YA 1VBC3 4YGCA 1CAXA 5J09A 4INDA 1UN1A 2FZ1A 3PUSA 4KWLA 3WLUA 3WF0A 3ZXLA 2JJ6A 5CG8A 1HB2A 2LW8A 5A1LA 4BE3A 2AZ5A 2O1QA 3AZXA 5EIYB 1W6PB 2JEMA 3UL2A 4PDWA 1O59A 2DV9A 5FMOS 2ZZJA 1RMU1 5FZ3A 1AR72 4ASKA 4M3CE 1AR63 2IXJA 1D2QA 2WNVB 5CFDC 3VBFC 3I59B 2W3JA 1O91A 4IV3A 4OQ9A 2D6PA 2IZWA 4OHXA 1F35A 3WUCA 3MIDA 1QJY3 3IPVA 3OOXA 1QNWA 1WMFA 3IKWA 1ND3B 2VZPA 4P14A 4BWOA 3HBKA 1FI2A 2D44A 1XYNA 1ULFA 3N9MA 1PNFA 3OBTA 3VKMA 2L9LA 1GICA 2ERFA 3WCSA 3IN9A 5A7NA 3JBG1 3NNMA 5EQUA 1S0EA 3APBA 5FYYA 4BLJA 4COWA 5A3NA 3MLLA 4OHWA 2FBEA 4IE5A 1S0IA 1S0GA 1QJEA 5LB6A 3J9SA 4QAWA 1K12A 2WNEA 3HQRA 1FPN2 5JLVA 1TEIA 2ZABA 2NM1A 1DDLA 3ZSJA 1XE0A 1W6OB 2FCTA 1Z7S3 4XUNA 4EJRA 4MZUA 2WNOA 4Q4Y1 2BGOA 2RJ2A 2YGMA 2WN3A 4IESA 3H8RA 1AR82 1SZBA 3PU3A 2V5YA 1CQ9A 1WLDA 1JZ5A 1ULEA 2YC4A 3BI3A 4A7ZA 2A7AA 1DFQA 5LASA 2HH9A 2W68A 5C3OA 1UZVA 3H3LA 4AXOA 4J6GA 1ZA7A 1ZBE1 2Z5WA 3KD4A 1AVBA 3BOWA 4LMFA 1KITA 4AVSA 1GOFA 4J25A 4Y20A 1F15A 2DCZA 2Z4FA 1WD4A 2PHDA 4YW5A 2EF6A 1W04A 1H2KA 5FZ7A 3WX5A 4PHZA 4XUTA 5CFDA 1AR91 1LTEA 4WV8A 3VBFA 3M8LA 4Q27A 1OT5A 3M3QA 3B01A 1AUYA 4IE7A 2WDBA 1YJKA 2RDQA 4DY3A 2Z69A 4QPGC 3D6EA 4RS5C 3JU9A 1TG7A 1HKDA 3VKLA 2FMDA 5I91A 4S2DA 2RS13 4MGTA 4GD4A 3G7DA 5JXJA 4A7KA 4AGVA 1JZ7A 1GBGA 1W6QA 1NCRB 3HN3A 1D4M3 4E27A 4KL1A 5GLTA 5LY1A 5FUIA 3MIBA 1O8PA 4QKNA 2ZX2A 4LBOA 5FPZA 1HB1A 3IDCB 2VW2A 3A22A 3V0AA 2ARCA 1ASJ3 1RVF2 2QZ2A 2RM21 4LJHA 4Z8BA 5APAA 3TBDA 4JDNA 1YFYA 1LKNA 2WNUB 4QD2A 4R9AA 3I2GA 1HRV2 3NJVA 3WQBA 1E5RA 4COVA 4QGNA 4NIGA 2J22A 2PTMA 2R041 4FFIA 3IDEA 3O0WA 4LHKA 4QXCA 3RQ0A 5FPUA 1AF9A 2P6HA 4DPNA 4O61A 1O3RA 2D7FA 2GNTA 1QIQA 3AKTA 4KI5M 1SFNA 2W95A 1MQTC 5A33B 2VY0A 3I2IA 2DDUA 2J42A 2P6CA 1CZTA 3POEA 2QBXA 3NWKA 3R0RA 1OMIA 2ZMKA 5CKQA 1SMVA 2Y6FA 5C5UA 2GMMA 5FBJA 5HCAA 2WFF1 3DYPA 2ZGRA 2O8OA 2GP5A 4DO0A 2VC9A 4Q0PA 1SLLA 2HWE3 1YFUA 2HLEA 3IBMA 1PM4A 1C8NA 3UESA 4A4AA 4GALA 3WT3A 4PCRA 1XBFA 4JCKA 1EPZA 2WZPP 2YC2A 1O3QA 3NKTA 4ES8A 2WNVC 4GA9A 3RWNA 2UY9A 2JENA 4EROA 1SBEA 3SH5A 1MS8A 1RHI2 4MHRA 3S7IA 2DCTA 2PYTA 3T2QA 5IT6A 1JYVA 2VMCA 2DBNA 3DKWA 1UY3A 5FMCA 5IFPA 4QPGA 4RS5A 3SCHA 1MACA 1ND3C 2E7TA 2VZ1A 3DXUA 4PLNA 1Y4WA 3M70A 1QXRA 1A8DA 3K75B 5EXOA 4OHZA 1OHFA 4I02A 5L9VA 1CX4A 2HWF1 1AX2A 4W6YA 4Y26A 4CDWB 1DP0A 3NL1A 4FP3A 4YM2A 2JD4A 3I3QA 3UKVA 4CXWA 4XHBA 3SHRA 2VNVA 2ADDA 3ZOIA 1ZVFA 3J8F1 4A3ZA 1H30A 5CKMA 5F2WA 1ZZBA 3ZX7A 3WY6A 5F3EA 2DYCA 2CDOA 4AQ2A 5LZ6A 3MDPA 4GJYA 2VW1A 1GWKA 2JG8B 5FYIA 3PIJA 1SLAA 4PBPA 2C4XA 1U0AA 3ZXDA 1RUI1 1J1TA 4FPHA 5GLWA 1XQNA 5FZFA 1J1LA 4DRVA 3TEZA 2EAKA 4FVVA 4NPRA 4QX1A 4E2SA 2Y38A 5LW9A 4FPKA 2DVFA 1COV1 2VQTA 1RINA 2QTWB 3LDRA 1RGSA 2O14A 1HRI3 1MQTA 1ZBA3 3N9NA 3AYAA 3VD9A 4LBQD 1H4GA 3RZHA 4BXFA 4Q8KA 1RUJ2 3AMNA 4XQWA 1NQJA 2TNFA 1XNBA 4V2VA 3WNPA 2XMLA 3VGIA 5D21A 1PO11 2XQXA 2HJIA 4N43B 3PURA 4D6SA 2EIGA 2MEV3 1QDCA 1PX4A 4I30A 3RZZA 3MZHA 3ENRA 4YG0A 4HG6B 5EYYA 1W6PA 1N3QA 1O6UA 1V6OA 4GIQA 1JH5A 2DU1A 1X7NA 3RMXA 3NRUA 3LFIA 4HFSA 4WM7A 1X82A 2WNVA 1TMF1 5A6YA 2W5FA 1PMJX 3I59A 3INAA 2QQLA 4R9BA 1X8MA 5CU1A 1SFPA 1GANA 1AYM1 2RMU1 4P08A 2SBAA 1H1IA 5LA2A 1FV3A 3UNPA 5FP9A 5EWSA 1AR73 1W9WA 1XNKA 3PVOA 1WW5A 1J83A 5AC91 1ND3A 4E4HA 2W1WA 2WJSA 3WOGA 1KJRA 5FPAA 3PUQA 4LQRA 2B4KA 1NCRC 2N7GA 2QQUA 1VBB2 3O7OA 5B2GB 1OOPB 2J1VA 4AGGA 4AVVA 2A5ZA 1WBLA 4AOCA 4K8RB 2VZOA 3K46A 5FBZA 4CP9B 4LHSA 5IK4A 1LHUA 1W6MA 3PVNA 5FUNA 1IPSA 3OJBA 4N9IA 5GLVA 3CJIB 1HDKA 3PVBB 1GR3A 1OF3A 2JD9A 4FXKB 3TEYA 2E6VA 2D97A 1EP0A 3DPRC 3BIEA 5C3PA 1QEXA 1W6OA 1PGSA 1VJ2A 5FY0A 2VCAA 4O9EA 5JR2A 2RS32 3D8CA 1HQNA 1NLQA 1UU5A 2AREA 1ALYA 2WC2A 3UJOA 3IAQA 4BJ0A 5T52A 1AL22 1CWPA 4WM8A 1CX1A 3ZYFA 1DQ6A 2GC0A 1LAJA 3PNAA 3VKNA 1WGPA 3PHMA 5F6KA 5F3GA 3JQWA 1WLTA 2ADEA 4HMZA 2QE3A 3QD6A 2BDRA 4OMCA 4ZU7A 3T0AA 2YPJA 2FDGA 1I9RA 4BLIA 4DNYA 1W9YA 2G19A 4FPGA 2YXSA 3FMGA 4QPIC 3VDAA 3MLJA 1QQP3 4UFHA 5BNPB 5FK7A 1O4TA 1L7RA 2WZEA 4XFAA 3SKJE 4YVSA 1A6CA 2ORXA 4WVMB 5M0TA 3EMRA 3HWJA 5CNAA 4Y33A 4EWAA 2KM2A 2F6BA 4CXYA 4A42A 4ZS3A 5IAXA 3N7JA 3USSA 3M3IA 5FZKA 4QWNA 2VG9A 1A34A 5LBFA 2JE7A 4S2GA 4IGOA 3UETA 4S2FA 1RJ7A 4WBBA 4BIFA 2JDYA 4YG6A 4M00A 4BDVB 1LJ7A 2R073 3CL1A 3WG4A 4Q4V2 3PDQA 1VRH2 4RFRB 1GKBA 3R4SA 2W1QA 4B4RA 2MNGA 4CDWC 1OKOA 1NCRA 2H6CA 2W52A 1GWLA 4GWNA 1A8MA 1G9FA 3V65A 3NKGA 4HK8A 1RUE1 3IWZA 2JKXA 4ET7A 3RJ2X 1LULA 3KT1A 1YXWA 1Q3EA 2Q1ZB 1DGRN 1E5IA 4LLFA 1GNHA 3H50A 4UFJA 3JQXA 4XF1A 5FY7A 2JG8C 1ULPA 3OTFA 3LAGA 4FFFA 3EO6A 1PGW2 2OYZA 4IEZA 3DPRA 1KQRA 4WVVA 4B7EA 2BNMA 1BVVA 1RVF3 3KQRA 3RYRA 1N3OA 3NV4A 4HSJA 4QXKA 5ACA1 5ISLA 5J3UA 2VUDA 2XJTA 5ANQA 3ETQA 2BERA 5HV4A 4ORFA 4XUQA 1HRV3 2A75A 1PVC2 4RHV1 3WQ7A 1NXMA 4B29A 2VZSA 5BNOB 2E7QA 5K8SA 1UX7A 2QVSB 1ZYBA 4N43C 4UAPA 2Q8CA 3VBRC 3RYPA 3T0BA 2RHPA 5EPAA 4GWJA 4QPIA 2JG9B 2VTXA 1RUH2 4QXHA 1OURA 3J7HA 5T5LA 5IHRA 3GBFA 4RD7A 1LU2A 3OPZA 1OSGA 5A7QA 3WDWA 4BZ4A 2A6ZA 3AFGA 4A44A 1OQDA 3LF7A 5EYXA 5GZDA 4JTOA 1R1A3 4NRPA 4NAMA 5IVCA 2XH6A 3MUY1 3BALA 3KF3A 4COUA 2JX9A 4D3WA 5I93A 2BJSA 4TYSA 5IVEA 2FMYA 4XJ9A 4LUMA 1DZQA 2XXZA 3WNXA 2H0BA 2WZR1 2XVGA 3A23A 2JWPA 4TWTA 2WYSA 4GMP1 3AYDA 1ZA4A 2E53A 2XJPA 3EQEA 1H9PA 1ZZCA 1JN2P 3MI8A 4IQPA 4LR4A 3RZMA 2ZEWA 3THPA 4CEYC 4FOQA 3ZSLA 5KHGA 4P5YA 2C5DA 2BVBA 5KC6A 3WXPA 1RHI3 1OOPC 4AQ6A 4CDWA 1DQ1A 1AXYA 5L73A 4OLLA 1ZNPA 2E26A 3TN91 2BOJA 4IEOA 4ZONA 4LKDA 2JKBA 5FCCA 4ZPIA 1ZX5A 5FZ1A 3WINE 2VTXJ 4UF0B 3D82A 1PMHX 1Q56A 1UY2A 5JUVA 1MVEA 4URAA 1RIRA 4Q1RA 3VUOA 3I2JA 3RYKA 1W39A 3CJIC 2Q8OA 4BQ1A 4L97A 1SPPB 4UFLA 2JG8A 1BEV1 4S2HA 4CU9A 4CDUB 1U5IA 3KB5A 4HXCA 2P5BA 2XLGA 5FREA 1C1FA 2R30A 3PUAA 5A3OA 4V2WA 2BWAA 4LBNA 2ZEYA 2WT0A 1MS1A 1RUG2 3PMEA 3ZFEB 1OVPA 2X05A 5CISA 1ENSA 1ST8A 3MHZA 3UGHA 1GNZA 2OZJA 3NQHA 3AZZA 5F3CA 5HI0A 4A45A 3WHTA 1E5SA 1QH6A 4N43A 3VBRA 1JZ6A 1YJLA 1UU4A 2P4EA 5BNPC 4P9IA 2DU0A 3WHUA 1VBC1 3W59A 2QQJA 1PNGA 1HXS3 4HPKB 4BXSV 2W1UA 5JSPA 1GQHA 3G6JB 2HWD2 1MZFA 3T2OA 5C7GA 4K40A 3FHIB 5A6XA 4QX2A 1WW6A 3EHKA 5FXWA 3H42B 2VMFA 2VOXA 3U75A 5T5PA 1HW5A 1AR61 1VB2A 1LEDA 3LSDA 5JZGB 1DGRA 3ILFA 1UY1A 1W99A 2ZGSA 4CEYA 1NLSA 1V9U3 3P3PA 4M4RA 1UNBA 1QJY1 3SMHA 3WF3A 5I0SA 4P5HA 1I5ZA 1M4WA 4EQVA 2G9GA 5TSWA 3E6DA 1NE4A 4QX3A 1KEXA 1OOPA 5FMOL 4KG0A 1CAVA 2RJKA 4QQ2A 3ZSKA 4EV0A 3KM5A 4W6WA 2CU5A 1LCLA 2ZAAA 4FQ4A 4XFGA 2VOVA 4CP9A 1XE8A 4HL0A 3LE0A 5DZEA 1N1TA 4AI9A 1WCDJ 5ANNA 5CADA 3TNPB 4MLOA 3S0MA 4GAZA 3VZKA 3CJIA 1DYOA 1OPOA 1JU4A 2VMIA 4H14A 5DDJ2 4EN7B 2K46A 1LHVA 3ZDVA 3MPBA
chains in the Genus database with same CATH topology
3FC0A 3MFCA 4YZ4A 1QJU2 4KWJA 5FQ0B 1VAMA 4XF9A 4OULA 3ZN4A 2BNNA 2WFPA 1Z7S1 5JR7B 2YGLA 1CONA 4AG4A 4FPLA 5BNOC 4KNCA 2E9QA 1V6MA 4HKLA 2XJSA 2VNGA 1H0BA 3R6SA 2BFUS 2G4IA 2JG9C 3E6BA 3NSTA 2NQYA 1AXKA 4V1PA 3TAYA 5BNPA 1LGNA 2K2SA 1I1EA 1YFWA 4FOYA 4WVMA 3VHOA 4OI2A 5GLUA 1QXJA 1XNCA 1BMV1 1O3SA 2RS52 4PIYA 1VBD2 3VBHA 3HT2A 3JD72 1XU2A 1MZEA 1SFYA 3A0KA 3HBZA 1VBE2 3ALQA 1OPMA 4U36A 1YRZA 2DTWA 2P3IA 4Y1VA 5DUXA 4PBOA 2VMHA 3WW2A 4XEZA 2R062 3H1YA 1YCIA 3SISA 4HLTA 1XYPA 4XIKA 4UW4A 4OZXA 2RS11 3AMHA 1HV1A 3P3NA 1UKRA 2CGPA 1U5ZA 2PFWA 3JUUA 2JECA 1D4M1 4U2AA 4Q4V3 1WUVA 3JB4C 2YV8A 1VRH3 2Z79A 4YGBA 3H3ZA 2PN5A 1G9AA 3AKRA 1ASJ1 1UKGA 4CZSA 4CDUC 2Q0AA 2D6LX 4QQOA 2ZMNA 3VLBB 2DFCA 3ZN6B 3ZFEC 1KD7A 5CAZA 5DG1A 5JOXA 1FOD2 2VGDA 2HWB2 1QJX2 4FP2A 4DRRA 1S1AA 1RUD2 2CL2A 2BYVE 4H7MA 5BNOA 3GBWA 3A0NA 5KBFA 4XYXA 3BB6A 3GZTB 5HXVA 1MZ6A 2JG9A 2QNKA 1YYNA 1DHKB 1REFA 2CYFA 5I0UA 1UAIA 2HWE1 1FATA 4Q26A 2GZWA 1J59A 2P3JA 3H1WA 4NR1A 3ZXAC 4YZ2A 1VP6A 1RUH3 3ZSEA 1OD5A 3B93A 4M3CF 3H1MA 4LBJA 3SNMA 5JZGC 2Z42A 4JC1A 1Q8OA 1CESA 3WP3A 1ZZ9A 4PF5A 2CAVA 3ILRA 4P9GA 3RI8A 3VV1A 4C1WA 2AR6A 4YRDA 3AXDA 4DB5A 1DZTA 1LB2A 4XOGA 3FUOA 3KGZA 1BQPA 2NN8A 4BCUA 2D40A 2QDRA 2OUHA 1DYKA 3PJQA 3VBSB 4CDUA 2PELA 2IWGB 4J1WA 4K1YA 1NZCA 2GNBA 2D6OX 2VU9A 1AYN3 1MS3A 1OKQA 4JRLA 2QUOA 3O0XA 4FTSA 3AP7A 3VZNA 1HRI1 1ZBA1 1LGBA 1QY4A 3KT4A 3N7LA 2B9UA 3JZVA 2BW8A 3HIFA 2QCSB 3AZWA 2PA7A 4FOVA 4HPKA 4MXWB 2MEV1 1LR5A 4P9JA 1DQ2A 1K5MB 3U11A 4BMBA 3OGGA 2NPIA 5GLZA 4K6BA 3OD4A 4JDMA 1WLCA 3NW4A 5A3LA 4R4ZA 2DTYA 2C9AA 4LBLA 2VOWA 1D2SA 4IEUA 4QHBA 1SLBA 4B7KA 1VR3A 4MSVA 4X6RB 2GDFA 1ENXA 4HKOA 3PJYA 4XJZA 1PMIA 1QKQA 3IM0A 3QH7A 4JDOA 1OLQA 1B35B 3OYWB 5C4WB 1AR71 3LZZA 4N7IA 4XBQA 1BXHA 2GMPA 5J7MA 3GBGA 2ZTNA 3ME2A 3NJZA 2XL7A 5KWRA 2X8KA 4KGGA 4A7YA 5JIUA 1BBT3 1JUIA 3V0BA 4FAGA 3K48A 2ATFA 3I2DA 4QPYA 4Y1ZA 4CP2A 3MIGA 5JI7A 4Z1VA 3HAGA 4YGDA 1BJQA 1NLRA 5DZFA 4YW1A 2MHFA 3Q9OA 3U0ZA 2B46X 5FQ0A 1VBA2 2VMGA 4YNIA 2RM22 3O12A 5C6CA 4N90A 3NAPB 1DIWA 1QNYA 3WG1A 1BYHA 1CJPA 2UYBA 4AHWA 4Q4W2 3SH4A 3FX3A 2ZS6B 3KCCA 1CAWB 2BVVA 2VUAA 1QOTA 3VZLA 1R082 1Q5OA 4FPFA 4GB32 4UXAA 3SCGA 1RUOA 3HQXA 4AFBA 3NO8A 3JCIA 3WV6A 4OI1A 2PHXA 4R9DA 2AH2A 2KA3A 1MEC2 1QQP1 5K0UC 4AFDA 5GZGA 4UBGA 3WP4A 2YY1A 1WCKA 4WZFA 3AKQA 5FOBB 2DUQA 4CYDA 2NMNA 1N1VA 2OVUA 2X53S 3QCWA 5A32B 1GQGA 4XTMA 5EZWA 4HSLA 4ZKTB 2QDNA 2RS53 1RUC2 1C5HA 2HWC2 1VBD3 1H8TB 1S2KA 2R071 1SCRA 3JD73 4BIOA 2WL1A 5K7PA 1PGL1 1VALA 2JXAA 3QLQA 1VBE3 1CVNA 3POWA 5FO9B 2WQ4A 4XFIA 4O9GA 1H2NA 4MGYE 1IS6A 3WP5A 4GXLA 1CIWA 1QWRA 1V6IA 2R063 2R49A 1PO23 5C8WA 5LK7B 2JICA 4Q0SA 4MGZE 2DUOA 2GC1A 5BV6A 1HQWA 1EAH2 1LOEA 1WBFA 2HWF2 2PHRA 2VNOA 1U5XA 3KT7A 3OF1A 4Y1XA 5JVVA 4EN8B 2VVFA 3OY8B 4ITCA 3J8F2 4YM0A 3ZN6A 3BPZA 5DUVA 3MYXA 3K51A 4HK9A 1FX5A 3JB8A 1CD3G 1Y7BA 1Q8QA 5E89A 1R092 2P37A 1RVF1 4PQ9A 3WZ1A 4H3WA 1J3RA 2OA2A 4M01A 1I3HA 4B4QA 1CAUB 1HRV1 3ZPYA 3VBSC 3EBRA 4LBKA 3MW4A 4GULA 4XFCA 1EPWA 2A71A 1FOD3 1COV2 2HWB3 1QJX3 1N1SA 3BOPA 4R8HA 3O5SA 2UYAA 1RUD3 2O0OA 5L7OB 2ARBA 2XJVA 5ABJB 5LRSA 5JSOA 1K5MC 2P2KA 5K0UA 4YGEA 4XQ4A 1RUNA 2WLPA 1R1A1 4AHXA 1H9WA 4LT5A 3MPPG 1PM7A 4SLIA 3T2TA 4NN0A 2X5IB 4YVWB 3ATGA 3NV2A 2ZJCA 1A3KA 1IQAA 1LU1A 3MICA 4EN0A 1IPKA 1FNZA 1PIV3 3B69A 4WVZA 3ZSMA 5C4WC 1VLNA 1TMF2 1BKZA 2FQPA 3FFZA 4XJUA 1NQDA 5CIRA 5KXEA 4DQAA 4NOTA 2Q5TA 1AYM2 1RHI1 1TME2 5F6LB 2DCYA 1O5LA 4DZGA 2HEYF 5H9RA 3AXEA 3RPQA 3GHNA 3FLPA 4YZ1A 4D94A 1IS5A 3TB0A 5C33A 4FPCA 4JGZB 4B4PA 3AP5A 2CV6A 4P9YA 1UCXA 4HVOA 4L11A 4OVEA 1G8WA 1F8VA 4LO8A 1UX6A 2UWBA 3I54A 5DXDA 4YM3A 2ZHKA 4KQ7A 3LKJA 5JWPA 2RE9A 2XHKA 5C9AB 4A3XA 5T55A 5LEJA 1XYOA 5BUVA 2ZGMA 1PHMA 4AGRA 3M3CA 3N35A 3AMMA 1BCXA 3WDTA 1URXA 1G9CA 2ZGUA 4XBNA 1YNAA 4OI4A 4X8NA 3SXWA 2ARXA 1C57A 4AI1A 1DQ4A 1K5MA 5KXDA 2VPVA 3CU7A 1HXS1 3R4DB 2WNUC 3J4UH 3RNSA 4CRQA 1DYPA 3ZFFB 2EXIA 4QGLA 5J96B 1O7FA 1DGWX 4PIZA 4E2QA 1H8TC 2CTVA 3OYWA 5C4WA 2YMZA 1C5IA 4FOWA 1YUDA 1V9U1 1AX0A 2DVAA 1FPN3 1J3QA 2R1BA 2D6NA 2VW0A 1KS4A 3N3HA 2A6XA 4FTEA 2PHLA 1S0DA 1D4VB 2FHRA 3AP6A 1XXNA 1AR83 4LHLA 2G9FA 2IFWA 4LO6B 3T1LA 2XLFA 3LA3A 1LENA 4LBQB 5H9PA 1H1AA 4YYOA 1REDA 4FQZA 5FLHA 4LO7A 2JE9A 4IERA 3KGLA 4IXLA 1NA1B 4P9XA 4Y24A 4NVPA 4DFSA 2I45A 1CAWA 4UW5A 2BGCA 3ZYPA 3PVEA 5J36A 4Q4X2 1ENQA 2XG3A 1UD1A 2DFBA 3OCPA 1VBA3 4JRAA 4AK3A 2B7YA 1OLRA 1UPSA 3ZYIB 2YZ4A 2YYOA 4PLOA 2ZCWA 4Q4W3 3ASIA 5FAXA 5ABJC 3WW3A 1UL9A 4UW6A 4LA2A 4RHV2 3USUB 2WSUA 1CGPA 5BNQA 1R083 5T5OA 4GB33 4H55A 2WNUA 1WMEA 4L9BA 2GNDA 5C8CB 2Z2SB 2X5IC 4YVWC 3M3EA 4LUKA 3TYJA 4Z2WA 1MEC3 3I8TA 1W6NB 1SBDA 2BFUL 2ET7A 2YHJA 2JDZA 5JI9A 1H8TA 5IK8A 3V56A 3SITA 5A33A 2GC2A 4K9SA 1X50A 3GZUC 1V6NA 2C1FA 2PQQA 5BY5A 2BBVA 1S55A 4N53B 4AVAA 3AX4A 4G3YC 3HR9A 1X8EA 1RUC3 3WDUA 4ASLA 4XF3A 1C8M2 2HWC3 4HANA 3RRDA 3ST7A 4RR3B 4Q4V1 3S30A 3W9AA 4JGZC 1VRH1 1MS9A 1U12A 4YW2A 1O3TA 1DZRA 3ZYRA 2C0ZA 4EWEA 3WVJA 2P34A 5C9AC 1FXZA 1IKPA 1EAH3 4Q0VA 1IKQA 1PZ7A 1UIKA 1XNDA 4MH0E 4Z92B 2CY6A 1CAUA 1RUF2 4FO9A 3UKNA 1W0PA 2MPFA 4L92A 3M4FA 3U10A 1H2LA 1R093 4FCAA 4AFCA 2B39A 1DGLA 2F4PA 1ZRRA 1HLCA 4RQPB 3S7EA 4IEVA 5H9SA 1YI7A 3MLKA 1MZ5A 3B5LB 3HN1A 2DWRA 2H6BA 3AJZA 1Y3TA 3VHPA 2QKDA 5F1RA 2ZGLA 4XFBA 3D0JA 3L9JT 3WP6A 5L19A 2XPJA 2WT1A 3ZFFC 1FNYA 3AKPA 3QOPA 5DG2A 2X5IA 4MGIE 1WCSA 4YVWA 3DGTA 1RUH1 5KHIA 1J3PA 1AXZA 1FMD2 4GH4B 1M06G 4JQRA 2ETEA 2WS92 5D1IA 5FO8B 4ZU5A 2YUEA 2D98A 1GFF2 4Q1PA 3PTYA 3FWEA 1HX6A 1AX1A 3UV9A 4AWDA 2R32A 4I0AA 1RB8G 3IMNA 3BIWE 4OUMA 2VECA 3MIEA 3EJKA 4HBNA 4AEJA 2CGNA 2WSVA 1QJY2 1NOVA 4XETA 1KS5A 2BPA2 4LE4A 2D43A 3GALA 1RUJ3 1GLHA 2ZOEB 1TME3 2DUPA 4XPVA 2ZPXA 4QQHA 4IV3B 1C4RA 3AB0A 1POV0 5BNNB 4OHVA 3IPVB 5C9AA 1NA1C 2HEVF 1BVP1 5E8AA 3ZYGA 4K8FA 1IOAA 1YO8A 1AHSA 4I2OA 1UMZA 1MS0A 1AYN1 2ZX1A 4QQLA 4BHPA 1NE6A 1V70A 2ENRA 5KHJA 1QGLA 1S0JA 4PJYA 4E2GA 4XILA 1QHDA 1FV2A 2E51A 3RDIA 4KBBA 4D7SA 4FBFA 4MVTA 2W0XA 1VBB3 2IXCA 2PAEA 3ZIWA 4YSFA 2AUYA 2A6YA 4GQ7A 1LHNA 2XJQA 2ZGOA 2K9ZA 4OI0A 5CVRA 2O8QA 2SLIA 2RJLA 2TUNA 4IEQA 2ZHNA 3H0OA 5GALA 4Q0QA 4KG8A 1LESA 2PAMA 4NHLA 1LECA 5LEKA 4N53C 2E63A 2NYYA 3KCYA 1IS3A 3WCRA 4BYYA 2DCKA 4FPYA 1Y9QA 1EV12 5FO7B 2RS33 4Q0UA 4RR3C 1AL23 2EALA 1BBT1 1TNFA 2ZHMA 1C3HA 3QACA 3VL8A 4JVAA 3AK0A 3LB9A 2BTVC 3MW3A 1NG0A 2BEOA 4JV4A 3MF9A 3E5UA 1N47A 1ULCA 1NA1A 4FPEA 4IEXA 4META 1ASJ2 2IXLA 2UU8A 2PLV2 2LM3A 3LGRA 1DLLA 1N1YA 1ZRFA 3MIHA 2RR12 4XJWA 4DMIA 1JYIA 2YC0A 4F8AA 1POV3 3FJSA 4FAHA 2VULA 2AENA 3V0AB 4XXPA 4RQPC 1BZWA 4YLZA 3USUA 3O14A 4Q4X3 4EWDA 4OHYA 4AQSA 1NY72 1SLCA 4DS0A 2E7AA 1EYBA 4WVWA 3VN4A 1XE7A 3VKFC 1PK6B 1XU1A 4TSVA 1Y43B 4AHYA 5I0RA 3CLPA 1W6NA 4GH4C 2HWE2 2LALA 3D0SA 3H8UA 1JXNA 5F5QA 1DGWA 2XBO2 2RS51 4C1XA 1YLLA 4MYEA 1ONAA 3NV1A 2DCJA 5FLJA 3TRSB 1VBD1 4I01A 4N53A 3ELNA 3JD71 3N4MA 1ND2B 3WW4A 4P9WA 3WDYA 4XJAA 5GKAC 1VBE1 4CDXB 4RR3A 2R061 1PO21 3ZMNA 1ZZ8A 2OIIA 2ZGPA 3FE5A 1PVC3 3VBOB 3MF6A 3C3VA 3KCXA 4KWKA 4HVRA 4IV3C 4Q2FA 1C8M3 3S6PA 5BNNC 1JW6A 3UK9A 4CTEA 4FSJA 3ZMOA 4C0HA 1MS4A 3PMSA 2XKOA 1SLTA 4AEMA 4HVQA 2V73A 2PAKA 1RMU2 1V6KA 1E57A 2DF7A 2OUJA 1H2MA 4YZ3A 5JOZA 1OA4A 5KHKA 4Y5Z0 3V64A 3DV8A 4N7UA 2OPKA 1FOD1 2WIIB 4UBHA 2HWB1 1QJX1 2CWMA 1L3JA 1RUD1 1RUF3 2CGOA 5E88A 1KFUL 5H9QA 1QDOA 1OQEA 1IPJA 4LA3A 4YW4A 3VHRA 4E9KA 4L99A 4AI3A 2B8MA 1WA4A 3RG0A 4GH4A 5GZFA 5KHHA 5HBAA 4AF9A 3JBG2 3ZFEA 3B3QE 4XFHA 5KXCA 4QM8A 4M0HA 5LRRA 1PIV1 5JDBA 1Z0HA 2WT2A 4CP1A 1FMD3 1AZDA 4LE3A 4M3CB 4CP0A 2WS93 1NYWA 1RUG3 4FT8A 4K1ZA 2ZHLA 4Q4Y2 3ROUA 5DZGA 1APNA 1V6JA 4DINB 1CPNA 4DOUA 3ES4A 4LEJA 4WM7B 5CFCB 3W58A 1LOFC 3L2YA 1WD3A 1ZBE2 5BNNA 5KXBA 4E4ZA 1H1MA 2R1DA 2BUKA 1BK1A 4D7TA 2HWD3 1GZWB 5JZGA 1GZCA 1QXPA 5CA6A 1S0FA 2D93A 1HIXA 4XBLA 3RI9A 1VAVA 1AR92 1UPIA 1UZYA 1RJ8A 1W6MB 5JOYA 5LK5A 4QGMA 5EV7A 4QQPA 1KDMA 5J98B 3GNEA 4YFWA 3HT1A 1PK6C 2ZX3A 2UWCA 3WR0A 1JTZX 2CAUA 4RSUA 3VL9A 1IZ3A 1O4ZA 4BA6A 1QQP2 3VZJA 4DXZA 4WM8B 2A3XA 4K3UA 2D3RA 2HYKA 2VH9A 4AFMA 2VQ0A 2A70A 3I4IA 5DDJ3 5T5JA 1C1LA 3AMPA 3MW2A 4KH9A 1ND2C 1OA3A 2QJVA 1OI6A 4B8EA 2V09A 4PLMA 1QJU3 3H9AA 2WLQA 1FPN1 4CDXC 2R042 4H7LA 4YVSB 2R072 4W6XA 3IIAA 3VBOC 2R0HA 4DY5A 1PGL2 2FZ2A 5T54A 1PZ8A 1AR81 1JYCA 2IFRA 1F5FA 1LOFA 1EV13 2IC1A 2WFF2 5FRAA 2Q30A 1OA2A 2DVBA 2ZA9A 3AZYA 5JOWA 1LOAA 4RFT0 4KGQA 4XHXA 4G9SB 2I74A 3BU7A 5HCBA 3ZXJA 3VZOA 4COYA 3FBYA 5EFUA 4R9CA 3GF6A 4AEDB 1SCSA 4TZDA 3GHMA 2XGXA 2BQPA 3H7JA 4RGAA 4XXAA 3SH3A 3UKTA 4MXVA 1VBA1 3M7AA 4Q29A 3X29B 2I07B 1UIJA 2PLV3 4AVCA 3AYCA 2RR13 1O5UA 4Q4W1 1F9KA 1RITA 1W0OA 3MEPA 3WUDA 4AVBA 3DPRB 4LULA 4R4XA 4W65A 1R081 2NZ9A 3UJQA 4GB31 1PK6A 1EY2A 4AI2A 3E97A 3H3UA 5D8AB 5FDBA 1H8VA 1MEC1 1RTVA 1KDKA 4GWMA 1R1A2 2B5HA 4KU8A 4C0BA 3KMHA 4HETA 3ZFGB 1S2BA 3GZAA 5JPMB 1RUI2 3KSCA 4Y4YA 1ND2A 4QPIB 4RL7A 1TE1B 5JPNB 4BM8A 1AL0G 4CDXA 2CNAA 2XBO3 2Y0OA 3DUIA 1RUC1 3ZXFA 3WW1A 4WM7C 3VBOA 2HWC1 4HT1T 1SEFA 5CFCC 4Y1UA 3FZ3A 2GH8A 4PIXA 1LOGA 2GMEA 2PHWA 1WW4A 1PO12 1ZREA 1FAYA 3THTA 3VDDB 3ZIXA 5AFEA 4FXGB 4Z82A 4Y1YA 2NP0A 4F3JA 1JHNA 1EAH1 1C28A 4RGGA 2WKKA 1B35C 3H7YA 3LCPA 1V6LA 4SBVA 4XF0A 4BH9A 1DQ0A 4E4SA 1YFXA 4AW7A 4YZ5A 2RMU2 1R091 3GYDA 1RMU3 3LA7A 5AC92 3RS6A 2ZZQA 4LBMA 3IDBB 5SV5A 1WMDA 2Y26A 4FPJA 4TLFA 5IUQA 3BCWA 2DURA 3VBSA 3OD0A 3N7KA 4AEKA 4AQTA 2AYHA 4ISQA 5FPXA 4WM8C 4AYUA 1KXGA 1A78A 1HXS2 3NAPC 1LRHA 3TNQA 4NHMA 2UWAA 2AGSA 5AVPA 1ZRDA 5GZCA 3VBRB 1SLIA 2VVEA 1KFXL 5J48A 3FLRA 3QBQA 1S0CA 4M3CA 4QMAA 5I8YA 1YIPA 3JBG3 4QM9A 2GAUA 4YVSC 1LEMA 2LTNA 3FFQA 3LA2A 4I0BA 1SACA 4K21A 4LHNA 2OW4A 4Y22B 4COZA 1CJDA 2A3YA 4MXWA 1D0GA 1F5JA 1V9U2 5F9TA 1G7YA 5CFCA 1RL3A 4XDQA 4D7YA 5FTTC 4BPZA 4YM1A 3ACLA 4R52A 1RUJ1 2XL9A 1ZZ7A 3MIFA 1VAKA 4Q4Y3 1TME1 2XB6C 5T50A 2LUWA 3CO2A 3PLQA 4CEYB 2A6WA 4JTNA 4CDQB 1GZWA 2XJRA 1HQLA 1N3PA 3AMQA 1JBCA 2OZ6A 3I7DA 3URFA 4AEDC 5L36A 2A3WA 1W2UA 1CAVB 1B35A 1ZBE3 3VBUB 3AP4A 5I8TA 4IEWA 3FLTA 1LOCA 5GZEA 2ZBJA 4I09A 5JMCA 1G6NA 4F7ZA 4E4DX 1G9DA 3RSJA 1AR93 1YIFA 1AJOA 3N7MA 4X6QB 5HCFA 4AI0A 2XWBB 3NV3A 2EA7A 5CBLA 5IK5A 1VBB1 1RUE2 1YI9A 5D8AC 3T1MA 3DN7A 4ZU4A 3WDVA 4JAAA 2P17A 1V00A 3NAPA 3ZYJB 1ZRCA 5DUUA 1MR5A 4C91A 1PVXA 1OFNA 3ZFGC 2VOKA 3EXUA 2ZGTA 4CEWB 4F83A 5JAXA 1LODA 1SQ4A 3FUQA 4XW3A 2P3KA 1FT9A 4ZXKA 2RM23 4ATFA 5ACA2 3RJRA 4QX5A 1Z78A