1RUG3

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52035
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rug300
1PO12 5D8AB 4IV3B 1R091 3JBG1 5DDJ3 1NA1C 2PLV1 5D8AA 4IV3A 5FMOL 1BEV1 2RS52 3M8LA 4Q4V2 1C8M3 1MEC3 2HWB3 1QJX3 1FOD3 1VBB1 2GSYA 1VBD1 1FMD3 1R082 4FTBA 1EV12 1R1A1 5J96B 1R092 4CEWC 4PDWB 1RUC1 2PLV2 5K0UC 4PDWA 1TMF1 3VBHB 3DPRB 3ZFGB 4GMP1 3VBHA 3DPRA 1VBB2 1AR73 3ZFGA 1A6CA 2WS93 5BNPC 3VBFC 1AYM1 5BNNB 4FTEA 1AL23 1R1A2 4WM7C 1RUE3 4JGYB 5C8CB 2X5IC 1H8TC 1TME3 1Z7S1 2RMU2 5BNNA 1RUC2 4JGYA 4RS5B 5C8CA 2MEV1 1VBA1 2RS13 2Y26A 2X5IA 5FOJB 4RS5A 1MQTC 2R043 4Q4Y1 1ZBE3 1VBC2 1OHFA 2R063 1AYM2 1MQTA 4RFT0 2RS33 3VBUC 1RUJ1 5J98B 1Z7S2 2MEV2 4YVWB 1VBA2 3TN91 3J8F2 1VBE1 4YVWA 4AEDB 1OOPB 2RS53 3CJIC 1F2NA 2WFF1 4IV1B 4CDUB 1AL0G 4AEDA 1OOPA 4IV1A 4CDUA 1VAKA 1R083 4RR3C 3ZXAC 4Q4X3 1EV13 3HAGA 1QJY1 5L7OB 3TN92 1RUF3 3ZFEC 1RVF1 1VBE2 5L7OA 4WM8B 1AUYA 2WFF2 1ND3C 2HWE2 4WM8A 4RHV1 1VBB3 4FTSA 4N43C 1QJU1 1ZBA1 3VBSB 1QJY2 2RMU3 2GH8A 1HRV1 1PGL1 3VBSA 5CFCC 2DF7A 1RVF2 2ZZQA 1HXS3 2FZ1A 1BBT1 1OPOA 1QQP1 1PVC3 4RHV2 1VBC3 4NWWA 1V9U1 3VDDC 4FSJA 2WWSA 1PIV1 5ACA1 1NY71 1COV1 1QJU2 1AR83 1WCDJ 1RUI1 1ZBA2 1HRI1 1NCQB 4N53C 1HRV2 1NCQA 1AYN1 4SBVA 1BBT2 2HWF1 1RMU1 3J8F3 2HWD1 1QQP2 1NA1B 3JD71 4GB31 1FPN1 1RUG3 1V9U2 1NA1A 1PIV2 5ACA2 1NY72 1COV2 5C9AC 1HRI2 1RHI1 1CD3G 2WZR1 1RUH3 2RR11 1AYN2 3JBG2 1RUD1 4QPGC 2R071 3TN93 5A33B 2HWF2 4CEWB 1RMU2 2IZWA 4GMP0 2HWC3 1BEV2 2HWD2 3JD72 5K0UB 4GB32 5A33A 4CEWA 4Q4W1 5AC91 1AR61 5C4WC 2HWE3 5K0UA 4YVSC 1VBD2 1POV3 3VBOC 1RHI2 1VRH1 5BNPB 2WZR2 3VBFB 4YVSA 2R072 4WM7B 1AR91 2X5IB 5BNPA 3VBFA 1TMF2 4WM7A 4Q4W2 1H8TA 2XPJA 4CDXC 2RM21 5BNOC 1MQTB 5JZGC 2XBO3 1PO23 1B35C 3FBMA 1EAH3 1HRV3 3VBUB 1AR92 1PO13 4CDWC 1CJDA 1D4M1 2BUKA 3VBUA 4Q4Y2 1QQP3 5CFDC 4Q4V3 1POV0 3CJIB 1E57A 1MEC1 2HWB1 1QJX1 1FOD1 1HRI3 1K5MC 1RUJ2 3CJIA 1FMD1 4RR3B 1ASJ1 1R093 3JBG3 1D4M2 3ZFFC 2PLV3 4RR3A 1QJZA 1SMVA 4GH4C 1BEV3 3ZFEB 3ZFEA 2HWB2 1QJX2 1FOD2 1ND3B 1VBD3 1AR71 1FMD2 2WS91 4RQPC 4CDQC 1ASJ2 1ND3A 1R1A3 1AL21 4N43B 1RUE1 1TME1 1RUC3 2BFUL 4N43A 4QPIC 1TMF3 5CFCB 2RS11 1BMV1 2BBVA 4GMP3 5FMOS 2R041 4LLFA 5CFCA 1VB2A 4JGZC 2WS92 5ABJC 1AYM3 2BPA2 3NAPC 3VDDB 2FZ2A 1AL22 2RS31 1ND2C 1Z7S3 1RUE2 1TME2 1PGL2 4N53B 3VDDA 4CEYC 5A32B 2MEV3 1VBA3 3VBRC 2RS12 4N53A 1BMV2 5A32A 4Q4Y3 1NCRC 1X36A 2R042 1RUI2 1NOVA 1RUJ3 5C9AB 5D8AC 4Q4X1 4IV3C 5C9AA 1EV11 1D4M3 1DDLA 4QPGB 1M06G 1VBE3 1RUF1 3JB4C 4QPGA 1FPN2 2WFF3 5C4WB 4YVSB 2WLPA 2ZTNA 4Q4X2 5C4WA 3VBOB 1ASJ3 4PDWC 2RR12 1QJY3 1GFF2 1RUD2 2RMU1 2VQ0A 3VBOA 1H8TB 4Z92B 2QQPA 3VBHC 1RVF3 1RUF2 3DPRC 4Y5Z0 3ZFGC 1HXS1 5AC92 1AR62 1F8VA 5GKAC 4RHV3 4CDXB 1PVC1 1VBC1 5BNOB 5BNNC 5JZGB 1C8NA 4CDXA 1QJU3 4JGYC 1ZBA3 1VRH2 5C8CC 1AR81 5BNOA 5JZGA 1B35B 1NG0A 1PGW1 4RS5C 1B35A 4CDWB 1HXS2 5DDJ1 1BBT3 4NWVA 2RM22 3J8F1 4CDWA 1PVC2 3IDEA 1IHMA 5CFDB 1V9U3 4Y4YA 1RUG1 1PIV3 1X33A 5ACA3 1C8M1 1COV3 1RUI3 1AR82 5CFDA 1PGW2 1K5MB 4YVWC 1AYN3 1RUH1 1K5MA 5DDJ2 2BFUS 2HWF3 1RMU3 3ZFFB 4AEDC 1OOPC 2HWD3 2HWC1 3JD73 4GB33 4IV1C 4CDUC 1HQNA 4GH4B 1FPN3 3ZFFA 1RUG2 1C8M2 1HX6A 1MEC2 2HWE1 4GH4A 1POV1 2ZAHA 1RHI3 4EJRA 5L7OC 2WZR3 2RR13 4RQPB 1RUD3 4CDQB 1RUH2 2R073 4WM8C 4RQPA 4CDQA 2HWC2 4BCUA 4Q4W3 4QPIB 5AC93 1AR63 1ZBE1 4QPIA 1AR72 3VBSC 4JGZB 2R061 5LK7B 2XBO1 1W39A 1VRH3 1PO21 5ABJB 3NAPB 4JGZA 1EAH1 1AR93 3S6PA 1ND2B 1PO11 5ABJA 3NAPA 4CEYB 1VB4A 1ND2A 3VBRB 2RM23 4CEYA 1ZBE2 2RS51 1NCRB 4Q4V1 3VBRA 2R062 2XBO2 3JB8A 1NCQC 1NCRA 1PO22 2TBVA 2RS32 1RB8G 1R081 1EAH2 3LOBA
chains in the Genus database with same CATH superfamily
5F2WA 1CGPA 2PAKA 1R091 1J3PA 2HH9A 1ENXA 4QQLA 5T3NA 3K2OA 3T2OA 1NA1C 5FMOL 3CL1A 1BEV1 4FT8A 1QH6A 1JYXA 3IMMA 2KA3A 4OQ9A 1GNZA 1SCRA 1OF4A 4NN0A 1XU1A 1UCXA 4CP1A 5LA1A 1VBB1 2QQUA 5L36A 1GOHA 4E2GA 5BYNA 1VBD1 2W52A 1LOBA 1W8ZA 4P9GA 1BVVA 1RXGA 3JUUA 4YGEA 1OURA 1R1A1 5DN2A 2EAAA 4BPZA 3AMPA 5J96B 4LIVA 4PDWB 1KRIA 2E6VA 3ATGA 4XF4A 1ZA4A 1RUC1 4I01A 2PLV2 1UZWA 1ENRA 4FFFA 1TMF1 4RL7A 4A7YA 1LOGA 4XJ8A 5KXCA 5J09A 4GMP1 2BGCA 5F9TA 3AKTA 3H3ZA 3HMYA 2I07B 3L9JT 1UYPA 2WS93 2MPFA 3OBTA 4LORA 3S5QA 5BNPC 3ZXLA 1Y3TA 2Y60A 2XWBB 4P9LA 4AW7A 4JGYB 5C8CB 1H8TC 5FK8A 3M3IA 5BNNA 5FP7A 2ZGRA 4RS5B 5JVVA 2BWCA 2P6CA 5GJ6A 1VBA1 4TZDA 3AMMA 1V6LA 1URXA 3S30A 2ADEA 2R043 4Q4Y1 2DCKA 2VZ3A 3OD0A 4Q8KA 2WNVB 4DOUA 3WDUA 1GMMA 4XCAA 4ZU5A 3C8XA 2D93A 2P37A 3CKHA 3VD3A 1AYM2 4BU2A 1MQTA 2VZ1A 4Y3OA 2E7QA 2XKOA 3UGGA 4GJYA 4ES8A 4IEZA 4CUGA 1V6OA 1GQGA 4IEVA 3AK0A 1DQ6A 1V70A 4YVWB 4YW6A 2ZGPA 2X09A 1W2NA 1GR3A 2O0OA 3JXSA 4MYEA 2EIEA 4Q0VA 1FNYA 4R8HA 3CJIC 2VMHA 4BQ3A 3NQHA 4DNYA 4LUMA 2WFF1 3PLQA 4IV1B 4QX8A 5FRAA 4BQXA 5FZEA 3HN3A 1DYOA 4D7TA 4FPLA 3SCFA 4AEDA 1OOPA 2VU9A 2ZACA 1WD3A 3RZKA 5FYTA 1CESA 4CDUA 2EXJA 3ZXAC 4RR3C 1GP5A 5LRSA 5JOWA 4XAEA 3G7DA 3A0NA 2WC2A 1D4VB 1UF2C 5FV3A 1EV13 2VW1A 3BKZA 1F4AA 4S2FA 5GZCA 3ZO0B 5KHIA 4DEVA 3AYDA 3AYCA 1Q43A 2QUOA 3PUHA 4Q2FA 4TN7A 3ZFEC 5EYXA 5L7OA 2JE7A 2J1SA 1QH7A 3WR0A 1NX9A 2BTVC 4BYYA 3N7JA 1OVPA 1LTEA 2ZKNA 2A6VA 3GXUA 1AVBA 2VUCA 3ZSMA 2R0HA 5J37A 5K9YA 5JMCA 1KITA 4RHV1 1VBB3 4D0QA 2GN3A 3ETPA 4FPCA 4XURA 4HG6B 4NIHA 1HN1A 5C7GA 2RJKA 3PVNA 5JPNB 1XNTA 1O91A 2BZDA 3CHXA 3BYWA 1N1VA 4H2AA 4LBOA 4HANA 3WP5A 1JZ4A 3U1XA 1TQ5A 2RMU3 1TVGA 4J1XA 5CG8A 4KGQA 2WNUB 3W58A 5JLVA 4IE4A 2FD8A 1PGL1 2VUAA 5K8SA 1JYTA 1SFPA 4XE9A 2DF7A 3WNOA 1RVF2 2ZZQA 3KLSA 5JR7B 4AI8A 4R52A 4AQ6A 1PMIA 4IEYA 1JZ7A 1ZRCA 4CCMA 3BODA 5J36A 1BBT1 4N9HA 1LECA 1LHVA 1QJFA 2E33A 4MZUA 4OUSA 4D6QA 3H50A 3E97A 2NPIA 1SDWA 1VBC3 2LW8A 2ZHMA 4NWWA 3ZLIA 1UW8A 2ZGMA 1UZVA 4KQ7A 3VDDC 1WGPA 4OMDA 2WWSA 1PIV1 3SKJE 3PJQA 1NY71 3U14A 5ACA1 3RZGA 1ZBA2 2HYKA 2J42A 2JG8C 4RGKA 1HRI1 1NCQB 4N53C 3VD4A 2C26A 5HCFA 1HRV2 1UMZA 2CAVA 4SBVA 1XXNA 2W1SA 1L7QA 4L92A 5DUVA 2QQMA 3FL7A 3TEXA 3ZSEA 5LASA 4CXYA 3L2YA 4PLMA 3I3MA 4COYA 4AHZA 4CU9A 1QQP2 4WZFA 1CZVA 1PHMA 4HSJA 1ULGA 4NIAA 3ZYHA 4CPBA 1GU3A 4IETA 2A71A 4Y20A 5AVAA 3ZR6A 2NYYA 2VTXJ 1ACCA 1BK1A 2N7GA 1COV2 2X10A 5GLUA 1SLLA 2WWUA 5HV4A 5LK5A 5FZ8A 4CCOA 2JKBA 4P9IA 3AJYA 4C91A 4NMIA 1V6IA 2D43A 2XVLA 2WZR1 5A3NA 1RUH3 2KD7A 4LTAA 4RGAA 2HWF2 3ZPYA 4CEWB 1RMU2 4Q0PA 2AACA 2VOKA 5C9AA 4P02B 3U10A 1BEV2 3KQRA 2W1UA 5A3TA 5K0UB 1ZRDA 3TNQA 2R6QA 1GP4A 2ZHKA 3ZSLA 1EUTA 5AC91 3WT3A 4N90A 3WNMA 3ZYJB 3M3QA 2HWE3 2AREA 3VHPA 2X05A 3ZSJA 4YVSC 4ASMB 4AFMA 1OLQA 2E31A 1VBD2 3GCWA 5IFPA 5KXDA 2VW0A 2A3WA 5JXHA 4PT6A 4FAGA 4NUBA 2YUEA 3DV8A 2DCZA 2TNFA 3D0JA 3NWKA 2VQAA 3O0WA 3LZZA 3H1MA 1XYNA 1TMF2 5CYYA 3O1MA 3M1HA 4QKBA 4WM7A 1FXZA 2CV6A 2W94A 5FPVA 2RDSA 3BU7A 2V5DA 1ULCA 1ULFA 3GBFA 4YFZA 5FO9B 4WV8A 4ZXKA 2ZMKA 2D5HA 2BVVA 3WG3A 4BQYA 4WVWA 3K4DA 4IE0A 3ZIXA 1EAH3 1W28A 1H30A 2DTYA 2RJLA 3M3CA 4LO7A 3ZYIB 5IK8A 5FY9A 4CDWC 1OPMA 5FMCA 2BGOA 5HCAA 4YM2A 1QXJA 4XUQA 2PHRA 3WHUA 3IAQA 4NVPA 4Q4Y2 2AC1A 4BQ2A 4AVVA 5B4XA 2ET1A 2WO2A 1MPXA 4AAXA 4AVTA 4LOSA 1MEC1 5A1FA 2HWB1 1Q8SA 1FOD1 5F5CA 1HRI3 1K5MC 3WX5A 2ZGOA 3M3OA 3NJYA 3KCCA 1FMD1 1N1TA 4PLOA 4R9CA 1W8NA 4XQWA 3VZMA 4CTEA 2ZGTA 3U37A 1D2SA 3ACLA 1K42A 1DHKB 3UK9A 1D4M2 5DQ0A 5IWFA 3ZFFC 5C70A 4M3CE 3T0BA 1DIWA 1W6PA 2P17A 2P3JA 4EZ4A 1GZWB 4MX3A 1WUVA 2RHPA 2PA7A 1UPIA 2C9AA 3CQOA 4HK8A 4K3UA 4MG2A 2D6OX 3ZN6A 1QJX2 5FZOB 1E5RA 4B4RA 2W46A 1AR71 4BLJA 4DPNA 2JDAA 2Y0OA 4HKLA 3TOJA 3I4IA 4CDQC 3BIWE 1G9AA 3U78A 1ASJ2 4BMEA 3OUHA 3J7NA 1W9FA 2AR6A 2AENA 1XYOA 2XQRA 1BVP1 3I97A 2K46A 2AUYA 2IXJA 1TME1 2W2IA 5F6KA 4XUNA 1ZNPA 3KS7A 4N43A 3KT1A 4QPIC 1O7FA 4ZPIA 1UN1A 5FJKA 3THPA 5IVVA 2A6XA 1U0AA 1Z0HA 2WN2A 4PIXA 5FMOS 1W8OA 2ZGUA 4HPKB 5CFCA 3PUIA 4NHXA 4TWTA 4XZUG 1VB2A 3DXTA 4OI0A 2P6HA 1Q8QA 3KM5A 4UOJA 2C0ZA 1G9DA 4C1XA 1LJ7A 3IDCB 1RTVA 5IVEA 3BUCA 1J1TA 1AL22 3J26N 1ND2C 1Z7S3 1RUE2 3KCYA 3LFIA 3LDRA 3DCQA 1BZWA 1MS0A 2X8KA 1PGL2 4CEYC 1I3HA 4ASKA 5IATA 4HOOA 4ZY9A 3L2HA 4MXVA 3PJYA 1MVQA 3U11A 3QCWA 3NSTA 1NCRC 1Y9GA 4RYDA 4QQOA 2E32A 4UW3A 4Y1VA 1Y4WA 1SBDA 2VZUA 3C3VA 5JI9A 2OT7A 3Q8BA 1UMHA 4FPHA 5FQ0B 1NOVA 4YG0A 4AZZA 5C9AB 4HMZA 3LPFA 4R9AA 3EJKA 1SDDB 3MLKA 3OGJA 2GMEA 3ZM8A 4GULA 5FLHA 3CJXA 4PCRA 1DLLA 5KC5A 1DDLA 2XJTA 4QPGB 4YG3A 2RDQA 3HBZA 1M06G 4NPMA 1VBE3 1RUF1 2JDUA 2G4IA 1UPSA 3WDXA 1S0DA 2OA2A 1GZ9A 2A6YA 1ZVFA 3BCWA 3D8CA 1LHOA 3QD6A 5FZBA 3UGHA 4AGRA 5FKBA 3NNLA 4HK9A 4EN0A 5A6QA 1W6QB 3RG0A 2GDFA 2IXLA 1VIWB 5FMBA 1UY3A 1LGBA 4DRRA 3KD4A 5IYYA 3NMBA 3CNAA 1H4HA 3H8RA 4FO9A 1NXD1 1X9TA 3ZMNA 5J1XA 5GZDA 4K21A 2FMDA 3HQXA 1GZCA 4OHVA 3UJQA 1DYPA 1W3VA 3WP4A 3WQ1A 2ARBA 3AYEA 2V5YA 3H3LA 5A7NA 1N3QA 4Y5Z0 2DVFA 1PGSA 4XEZA 1W03A 1HXS1 3PVBB 2BP6A 2XVKA 3B02A 5AC92 2JDZA 2W1WA 1GQHA 1FV3A 1PNGA 4P5YA 1Y9QA 3E5QA 4CDXB 4E8DA 3KB5A 4MVTA 1PVC1 5K4LA 5KBFA 3ZDVA 1CX1A 2YDEA 1MS5A 5BNNC 3FFQA 3VDCA 1VALA 2JEMA 1I9RA 1YNAA 4QKNA 3ZYBA 4CUCA 5BNOA 2XG3A 3HNYM 2MNGA 1B35B 1PGW1 1S0BA 1ZM1A 1XOYA 3ALQA 5E88A 3N7MA 5KXBA 3H3UA 1PNFA 3I2FA 4LBLA 3NW4A 3TB0A 3ZKUA 4BE3A 3KF3A 3N9MA 4COWA 5DDJ1 5FZAA 1JUIA 1T2XA 2PHWA 5BNQA 4NWVA 3WY6A 2FDFA 2CGNA 1I6XA 3MUY1 2Y6HA 5A7SA 1Q3EA 5DZEA 3UNPA 1V9U3 3A0KA 1CAXA 1X33A 5H9QA 1C8M1 3U07A 1A8DA 1J84A 3ZSKA 1UOBA 3KVAA 3WDTA 1AR82 2VVEA 1UXZA 2XUEA 2IWGB 1IPSA 1OD5A 1SFYA 2D6MA 3KVBA 2XL9A 4EN6B 3IZOA 3VHNA 1KD7A 1AYN3 3MV01 4NIDA 3QH7A 4DEQA 3THDA 2D3PA 4AEDC 1OOPC 4ES9A 2HWD3 2YFZA 4AEKA 4C90A 4AXOA 4CDUC 2R0FA 4WVZA 5DAPA 4GH4B 1FPN3 4IEPA 3D6EA 3FX3A 1RUG2 1MEC2 1CAUA 3VHOA 2WYSA 4IE5A 4WBBA 1RC6A 3RYPA 4C1WA 2EF6A 1POV1 5JXIA 1SQ4A 1UZ0A 2ZAHA 1LB2A 1RHI3 1DGRA 4JQTA 5L7OC 4UFMA 2RR13 2UWAA 2FCVA 4RQPB 1RUD3 4XMAA 4OYUA 2EXHA 2B9UA 2R073 4CA9A 4QB1A 1U5XA 3USSA 2J1VA 5EJ1B 1X82A 1G9BA 1MS3A 2HWC2 2VMEA 3OF1A 4L11A 4AHWA 4YM1A 4KI5M 4DY3A 4LR4A 2VD7A 4RD7A 5LBEA 1ZBE1 1UOFA 3KHBA 1SLTA 5JI7A 1AR72 3MYXA 4Q8LA 5E6HA 1ENSA 5I93A 4C8DA 4JGZB 3MZHA 5IVFA 3OGGA 1W3XA 5ABJB 3H42B 5FYCA 3O1SA 2IFWA 1AR93 5EJ3A 3JQWA 4FXKB 2VMFA 1XYPA 4DXRA 4M00A 3FZ3A 1OFNA 3H7YA 2E7TA 4Q5OA 2PQSA 5G04L 5CEHA 2Z79A 2ZHLA 2RM23 3ZX7A 1XU2A 2GNBA 2DU1A 3VZKA 5I91A 3VBRA 3MW3A 2YHJA 4JAAA 4CU8A 3DYMA 1ZA7A 3AKPA 1O4ZA 1PO22 2QQNA 2DCJA 3B93A 3LOIA 4LXLA 5T5PA 1Q5OA 4UFKA 1RB8G 1SACA 1CZTA 4QHBA 1OA2A 2OUJA 1I5PA 3OG2A 4MH0E 5EJZB 1DLCA 4IUGA 3RZZA 1PO12 2VGDA 5A1AA 3N7LA 2ZGKA 2XGXA 4IV3B 3TYJA 5LY2A 1ODNA 1W6OA 2J1TA 1CN1A 5DDJ3 1Q8PA 4EWEA 2PLV1 5D8AA 4HFSA 3I2GA 1BXHA 3ACHA 3ZPOA 2W08A 2Q5TA 1C4RA 5C3PA 1UOGA 3APBA 4Q4V2 2VQTA 4FOYA 3T0DA 2PHFA 3ILNA 2AYHA 1C8M3 1YIFA 5J48A 1WW7A 2DYCA 2H6CA 1UY2A 4QPWA 1TEIA 4CUAA 1H2NA 5C8WA 4PLNA 5CG9A 2IUWA 3LPGA 1AF9A 1R082 2DCYA 5DAWA 1VR3A 2ETEA 3H8UA 2ERFA 4QX7A 2ADDA 1EY2A 1U5IA 2B7YA 2PHTA 1SPPB 2B39A 3BTAA 4YW5A 1WWYA 2A3YA 4GALA 3WF1A 1STMA 2OS2A 3DPRB 2QDNA 2E63A 2R7EB 3RZHA 4LITA 2C5DA 4MHUA 5FZKA 3VBHA 3OEAA 4TYSA 1A34A 1PX3A 5F3CA 1X50A 4FXGB 2D97A 3MIBA 3ZFGA 4A41A 1NXMA 1EUUA 2JD9A 2DUOA 1AYM1 1S0IA 4G9SB 4FOWA 5CU1A 4F7ZA 3I2HA 3I2DA 2J1AA 4WM7C 2X5IC 1D2QA 2QQOA 4GZ9A 2W47A 1NQDA 2QNKA 5FP9A 3GZAA 3UL2A 4BXFA 4KH9A 5T5LA 2RS13 1AJKA 3OJBA 3KMHA 4DZGA 1PK6B 5A3WA 4HL0A 2A6ZA 1VAVA 4LE4A 1YEWA 1ZBE3 4YZ4A 1OHFA 1W05A 2EVXA 2HEWF 5I8YA 2C24A 2RVAA 2NMNA 2WN3A 4I09A 4XDQA 2D40A 3SLIA 1EPZA 1RUJ1 4AL9A 5JCTA 2WIIB 2Y6KA 4ZHNA 1JU4A 3PDQA 4ZZ5A 2AGSA 2WR9A 2MEV2 4OI4A 1J3RA 1UMIA 1LAJA 1DF0A 2E9QA 4LHLA 3HT1A 3PU3A 5L73A 1LOCA 5H9RA 4COVA 4FPGA 1YJLA 4NHMA 1SBFA 5SV8A 4QXBA 4JKKA 2GP3A 2W68A 5E16A 1LODA 1E5SA 4XHBA 2R30A 5FZHA 3OUJA 4CU6A 5LY1A 2JKXA 1QXPA 2QQKA 3DYOA 3GZUC 3BIEA 4UT5A 1O3RA 3R05A 4QWNA 2JG9A 2ZXQA 4MO3M 3U4XA 1VAKA 1S0FA 3WNNA 5JR2A 4Q4X3 1G9FA 1UY1A 2ZX1A 2YYOA 1OSGA 2BDRA 1ZRIA 3WDWA 1BJQA 1DQ2A 4K7JA 1HKDA 1QXRA 2WSVA 3KSCA 1W6MA 4IEWA 5A7PA 3UETA 1RVF1 4HN0A 4AI9A 4LIUA 4WM8B 4XF0A 4XIKA 2XJUA 4E2QA 1X7NA 4AI2A 2BYVE 2D7FA 1R64A 3KV5A 1L7RA 3CZUA 3ZXKA 4G3YC 3VHRA 1FNZA 2CU5A 3MGUA 3AVRA 1X9PA 4LO8A 1MZEA 3MI8A 5LWBA 5DXDA 4N43C 5BY5A 1MZ6A 4QGNA 1V00A 1ZBA1 1MS4A 4QB6A 1WLWA 1QJY2 1PM4A 4M3CA 4BQWA 2GZWA 1NE6A 1HRV1 4JTOA 3GZEA 3VBSA 5CFCC 3POEA 3G6JB 5I0UA 3MFAA 4A3XA 2VULA 4DUWA 3KGZA 3ZXGA 1QQP1 5FWJA 3T2TA 4QU1A 3VZLA 5JAXA 2K9ZA 3EYPA 4FSJA 4PBOA 3AZZA 1QJEA 1W06A 1COV1 1QJU2 1WCDJ 4GWJA 1RUI1 1WLTA 2J1EA 3CLPA 4W8JA 4YFWA 2D6KA 1AXKA 4R9DA 4KG8A 4YNIA 3K75B 5FZDA 5FBZA 4AVBA 4A3ZA 2KM2A 1XNDA 1UYZA 1WD4A 5E8AA 4DUXA 4FOVA 3AKRA 2HWF1 4XHXA 1RMU1 2VC9A 4UXAA 5JSOA 1QDCA 1NA1B 4LO6B 2YBKA 3IIAA 4YM0A 1S0JA 1DGWA 1G9CA 2GC0A 5CKMA 1SFNA 3GZTB 2BWAA 3AZWA 2G9FA 4W4ZA 4B3NA 1DZRA 2MHFA 1CD3G 3AP4A 4CCKA 3CDZB 1S2KA 4CP2A 1HIXA 5FOBB 1APNA 2IZWA 4GMP0 3R6SA 4B8EA 3V0AA 3HOBA 3JD72 4GB32 4QXHA 5A33A 4YW2A 1AR61 3MFCA 5EQUA 5L19A 5CBLA 4AQTA 5JPMB 4BIFA 4AHXA 2G19A 3WW3A 1IPJA 3ZXFA 1C1LA 1S2EA 1W6QA 5CISA 2W5FA 3M4FA 4KU7A 5BNPB 3N7KA 4EYUA 1WLCA 1S1AA 4AAPA 2XVGA 1YLLA 1WW4A 5FY0A 4MLOA 5FYVA 5LA0A 1KXGA 3SNMA 3VBFA 3F2ZA 5AFEA 3N9NA 2GMMA 4H55A 2VL4A 4Q4W2 1AXZA 5KHKA 5I0TA 1C5IA 4FFHA 4XJ9A 5CADA 5BNOC 5F7UA 4BM8A 3MF9A 2ZJCA 1N47A 3HNMA 4F3JA 1RUNA 2OPWA 2ZA9A 4KMQA 2XBO3 1LRHA 2Y34A 1YXWA 4HVQA 3FBMA 1QEXA 5F32A 1HRV3 2TEPA 4PI2A 3O0XA 1ZZ6A 4I30A 3H1WA 5FIXA 5FYZA 2FDKA 5EPAA 4W6YA 4EN9B 3B69A 1D4M1 2BUKA 3VBUA 2PELA 2ZGQA 2JDHA 1LULA 4LBMA 2ZX3A 5IVCA 4BA6A 4FQZA 1J1LA 2EIDA 2NN8A 4R9BA 1QQP3 3I3DA 4GKYA 4XBLA 5FUNA 3HR9A 5FR3A 1O4TA 1UAIA 2XOMA 2JIJA 4TTGA 3CJIB 2LROA 3UKVA 1E57A 3OY8A 2VZOA 4UW6A 4B7KA 4CCDA 1QJX1 1WMFA 2WQZC 4XFFA 5IK7A 2QBXA 2CSGA 1RUJ2 4OMCA 3OBZA 5FYUA 5L9BA 1SHWB 1W8FA 3MLJA 4RFRB 4XJWA 2WL1A 4X8PA 4RR3B 1ASJ1 1CVNA 3I2KA 4OZXA 4XW3A 3WG1A 1R093 2D6NA 2TUNA 4IL7A 3ZYPA 1PM7A 4OVEA 1O3TA 4BISA 4Y22A 1DGLA 1QJZA 1BLZA 3MV11 4HXCA 4Z82A 5IK4A 1BEV3 4AR2A 1JZ6A 3LCPA 4LA2A 3ROUA 3ZFEB 4OLLA 4LHKA 2F4PA 2H0BA 1HW5A 2VECA 3FLTA 3W5MA 3DKQA 4K1ZA 3ZYRA 3AKSA 4PF5A 3RYRA 3BTXA 1VBD3 4MHRA 2VUJA 4KWJA 1J3QA 4K8RB 4YYOA 1ZZBA 5EV7A 4NIIA 4CP0A 5KHGA 1ND3A 4S2GA 1R1A3 2Q1ZB 1T6BX 3FWEA 1AL21 1WLDA 5A6YA 5BUVA 1RUE1 1WMXA 4OZOA 1RUC3 4C0BA 3NNMA 4OHYA 4WVMA 1SLIA 2E7AA 3SMHA 2EXIA 2QQVA 1US3A 2XR4A 4F8AA 1ONAA 1TMF3 3RWKX 5FPXA 1V6KA 3B9CA 1LHWA 5F8PA 3T08A 2B46X 4GMP3 1LU2A 1GLHA 3NJZA 4D94A 1SG3A 3T1MA 1OFSA 3GALA 3NV4A 3NVCA 1CQ9A 1OKOA 3X29B 3TEZA 2GAUA 3AB0A 3DXUA 2WS92 5D21A 2BPA2 3VDDB 4HSLA 2FZ2A 1OLRA 4S2HA 4BQ5A 2RS31 1H0BA 2JG8B 2VZRA 2IC1A 4N53B 1OQEA 3E1F1 5A32B 4AYUA 3MPBA 4UI9L 1LEDA 1VBA3 1LR5A 5IT6A 3VBRC 3U75A 3AZXA 4QKDA 4WVVA 4AOCA 4Q4Y3 4YW4A 3WUDA 5EIYB 2R042 3V0BB 1H4GA 2J1UA 4LBJA 1RITA 5IAVA 1CIYA 4EN7B 3USUA 1K45A 4P9JA 2DUQA 1JXNA 4OULA 3AXEA 5DZGA 1RUI2 2A6WA 2EXKA 5F39A 2W39A 1AXYA 1ZX5A 5D8AC 4FBFA 2ZBJA 2BQPA 2OQ6A 5GZEA 3MF6A 3M2MA 4BJ0A 1D4M3 1XPWA 5FPAA 1O8PA 4RSUA 1QGLA 2FCUA 5C71A 2P3YA 3OYWA 4LA3A 3VZOA 1HB4A 4MV2A 1IQDC 2WABA 3JB4C 3PMEA 4JZRA 2WFF3 3VD7A 3I59B 2Q0AA 1D0HA 4HETA 4LE3A 4LULA 2EAKA 2JECA 2Y38A 2JE8A 2R49A 4NROA 3RYKA 5C4WB 4YW7A 4YVSB 1IS6A 3D0SA 4HKWA 4LBQB 2WLPA 1YQ2A 4UFIA 3RI9A 2D5FA 2VVDA 1ASJ3 2VW2A 2DVDA 4META 4CCEA 3K51A 1F5JA 1TE1B 3OB8A 4FP2A 4ATFA 2VQ0A 3VBOA 2Q4SA 3IAPA 4IGQA 3VBHC 3DL3A 3ZFGC 2DBNA 3PNAA 3VUOA 1AR62 1F8VA 2RV9A 4NJ4A 5GKAC 4RHV3 4XJZA 4S2DA 3WF3A 5M0TA 3DKWA 1A78A 2WNEA 3N3HA 5JIAA 1C8NA 1GYKA 1NQJA 4HKOA 5I8TA 3ME2A 5KHHA 4JV4A 4NHLA 2WNOA 1AR81 1H6XA 3MIHA 4L99A 5LBCA 5JZGA 1JOJA 1NG0A 2J1RA 2WINB 5LEKA 3KV9A 1U12A 1XE8A 4QDQA 3IBMA 3POBA 5FZ7A 1CAVA 1MS9A 1LOFA 5E89A 4D8MA 5FZFA 3K3NA 5JUVA 4CDWB 2YBPA 4NRPA 4Y5SA 1BBT3 1CAWA 2QZ2A 4ATEA 5FPLA 4BB3A 2XHNA 3J8F1 3NNFA 5FAXA 5LBFA 2QQWA 3SH5A 4KWUA 4D7SA 1VJ2A 3E6DA 2CAUA 2E26A 4JKMA 4Q29A 1N1YA 1RUG1 1PIV3 4QKFA 4Y4YA 5ACA3 3MIFA 3O1RA 3OSDA 1BKZA 3BTZA 1E5IA 4BWOA 1REEA 2QKDA 5CFDA 1CZSA 4UF0A 3THTA 4Y1UA 1KS5A 2VNRA 1K5MB 3O14A 2VPVA 3IPVA 3WEZA 1LGNA 5LATA 2QQLA 1IKQA 3T4HB 4Z1VA 4QAWA 1BYHA 3QACA 4LK7A 5FZ9A 4DUVA 1F9KA 5LB6A 3ZFFB 4KBBA 2AH2A 1WKYA 2HWC1 1CONA 3AMHA 4Y4RA 4BMBA 2JG9C 3VKLA 1HQNA 3O5SA 3AP7A 2Z42A 1NZIA 2PTMA 4P9WA 2BJSA 3POSA 4FVVA 5L9RA 3MO4A 2PN5A 2VXJA 1JN2P 2P1BA 5DPNA 3H9AA 1POQA 1ZZ9A 4XQDA 2JIGA 4CCJA 3ASIA 3Q8CA 2WZR3 5ANQA 2ZCWA 1UU4A 4CDQB 1W04A 2B9VA 1RUH2 4XOGA 5JIUA 4HLTA 4CSWA 3RDIA 3JQXA 1J83A 3MIDA 2HEVF 2YGLA 4GQ7A 4QPIB 5AC93 1H1MA 5FK7A 3THCA 1V6MA 4DMIA 3POIA 2QQJA 1XRUA 2ZS6B 3WCSA 4EWAA 4COUA 1KS4A 4XABA 5C3OA 1OLME 4QX3A 4AGVA 1O3QA 3JZVA 3DF0A 1OQDA 3VBSC 4XJUA 5JDBA 4AEMA 4MXWA 1PO21 2YU1A 3AMQA 1HB3A 1ND2B 2VMCA 3NV2A 4CXXA 1PO11 2P4EA 4Y1YA 1XSRA 3QBQA 3R4DB 5FPBA 3GF6A 3NAPA 1QOOA 4CEYB 1SLCA 3S7EA 4LBKA 4RGGA 1Q8VA 3H1YA 3AM2A 1LEMA 5FY5A 1NCRB 3NKTA 4Q4V1 2VY0A 1GOGA 1HQLA 3VV1A 4FPYA 4HN1A 3H8XA 2R062 1UU6A 1NAEA 2A75A 3IM0A 3MLLA 2PHXA 2RS32 2ZZJA 4DQAA 1LOEA 2F17A 3I3QA 1R081 1EAH2 2Z2SB 5A7WA 2CTVA 1IGOA 3GJAA 1MR5A 1W6NA 3A21A 3ON7A 3POWA 4KWLA 1P8JA 1H2KA 3JBG1 3I3EA 2WT1A 4Q0SA 4DXZA 1S4CA 3BI3A 2ZEXA 2KR2A 2IFRA 3O1PA 1OMIA 3LDKA 4B29A 2RS52 2HJIA 3M8LA 3PUAA 1SZBA 2VUDA 4WZCA 3WG2A 3AFGA 3EB7A 5CZKA 3JCIA 3KWVA 1MEC3 2V72A 1NLSA 1REFA 1JHNA 1FOD3 2HWB3 4XETA 2JDYA 5FYMA 4OI1A 3V65A 1UIJA 5A70A 2GSYA 1BHGA 1FMD3 3N36A 4MSVA 5FYHA 4AF9A 4XDOA 3FMGA 4YARA 1PX4A 3DEMA 5FREA 4NHKA 3C7EA 4FPOB 1KDMA 1M4WA 4QB2A 3T09A 3GJBA 3POYA 4PDWA 4XTPA 4Q0UA 2BERA 3WNXA 2OVUA 1O5LA 4CUBA 2WUHA 1DQ4A 2JXAA 5JWPA 2A7AA 4XF1A 2VTFA 5LEJA 1AR73 1A6CA 2VZTA 4N7IA 3BGAA 4CP9B 3MDPA 4QPYA 3N9PA 2OIIA 3ECQA 3VBFC 4LPLA 5BNNB 1N3OA 3FHAA 3ZR5A 4FTEA 4Z07A 3HT2A 3CU7A 3RI8A 1TME3 4A6SA 1DQ0A 3WDYA 3B5LB 1YUDA 4YSFA 2EIBA 2H0VA 4JGYA 3SCHA 5C8CA 2MEV1 4HZFA 1ZRFA 3RFRA 3RJ2X 5FOJB 4E4ZA 3SKVA 4RS5A 4GA9A 1MQTC 4XXPA 5FBJA 4MGZE 3V56A 3IMNA 3IT8A 4BLIA 1UX7A 1W9SA 4GKXA 1KFUL 3PUSA 1NZCA 4AFAA 4UW4A 4W50A 3UJOA 2WNVA 5E1RA 3H7JA 1DGRN 1UYYA 1WMEA 2QZ3A 2DURA 3VBUC 1YCIA 2YV8A 5J98B 1Z7S2 1RYYA 4PIZA 5K7PA 2DVBA 1OH4A 1H9PA 2CDPA 3CF6E 3U4SA 1HLCA 3MHZA 4FQ4A 3ZMOA 1WA6X 1VMFA 4QHOA 2K2SA 1NUKA 3J8F2 1VP6A 4YVWA 4KG0A 5FLIA 1YI7A 1VLNA 5FUPA 1AJOA 1OOPB 4AEDB 1F2NA 5BPXA 3FC0A 3SQOA 1GKBA 4CDUB 1S2BA 1AL0G 1GSLA 1Z78A 2FBEA 3VDBA 1B09A 4IV1A 1H2MA 2WYFA 3HBKA 1R083 5DAVA 1JUHA 2XB6C 3MUZ1 4EZHA 3HAGA 1QJY1 1H6YA 2Q30A 3KZ4C 1LESA 1UY4A 4L0PA 3ZN4A 2GNMA 3TN92 5L7OB 4YG6A 5GM0A 1SLBA 5D2AA 4AFCA 1RUF3 2QJVA 1VBE2 4OQ8A 2JDPA 3WVJA 4CVUA 3DECA 4QX0A 1MACA 2Y6GA 3BPSA 3MW2A 1ND3C 4JDMA 5GZFA 2PAEA 2ES3A 2YC4A 4LLOA 4FTSA 1GANA 1A8MA 1OQ1A 1JYWA 2YGMA 5DG1A 1QJU1 4L2NA 2BEOA 5T5OA 2ORXA 2Q8DA 4K40A 5BXXA 2GH8A 3W21A 2VZSA 3DGTA 3I8TA 3PTYA 4I0WB 5IJRA 2DUPA 1W8TA 1TZOA 4AVSA 4Q27A 4NOTA 2DFBA 1PMHX 4OI2A 1HXS3 2FZ1A 2WNUA 1OT5A 4K8FA 3ZN5A 1K12A 2XJSA 3O0VA 4XVHA 1PVC3 4J6GA 1GBGA 1ALYA 2EICA 3OD4A 3K3OA 4QX1A 1IG0A 1US2A 2GC3A 1OBNA 3HEIA 3D3AA 1NCQA 4DY5A 4EQVA 2YC0A 2ZX2A 5CVRA 3AL6A 4Y20B 3C7HA 3AVSA 4RA0A 1W8UA 2ZX0A 3J7HA 3JD71 4GB31 2PXJA 5T5JA 4Z2WA 5DUUA 1DFQA 1V9U2 3V0BA 3DN7A 5EYYA 3LQCA 2NZ9A 3BVCA 1JODA 1J58A 1PZ9A 2HBTA 3CO2A 5GALA 1JHJA 1CPMA 3WQBA 5I8SA 1UQXA 2YXSA 3KT7A 5IK5A 1AYN2 3JBG2 1ULOA 4ISQA 1W99A 3K4ZA 5FTTC 4NAMA 2YPDA 3VZJA 4ONUA 4EV0A 4NIGA 2OPKA 1HJGA 1NLRA 4DO0A 2HWD2 1UIKA 3LEGA 5F3GA 4CEWA 4Q4W1 5G05L 4IEUA 5FZ6A 1QMJA 1YFXA 4DRVA 5K0UA 2HYXA 3LE0A 5T55A 2YFUA 4LUKA 5TSWA 2YU2A 3RGBA 3LA3A 4FPFA 3SHRA 3PVOA 1POV3 4ITCA 4D6SA 4URAA 4AGGA 3VBOC 4M4PA 1KDKA 1RUOA 2ZOEB 1LCLA 3WQ7A 1RHI2 2IXIA 4ARYA 1VRH1 2D98A 3F95A 2QVSB 4M01A 4YVSA 4CCLA 3O1TA 2RJ2A 3HWJA 3ITQA 2R072 4WM7B 3VD9A 2X5IB 2NM1A 1S0CA 2RE9A 3PIGA 1Y7BA 3VN4A 4FOQA 1YO8A 4Z2AA 4GJZA 2VZPA 4UFJA 2C4XA 4LQRA 2NQYA 4BIOA 2QFEA 2E51A 4BXSV 1UKRA 3HQUA 3ZOIA 5JZGC 3WW2A 3P6BA 4L8QA 4XFCA 1C57A 2C9KA 4CZSA 5DABA 3VDAA 1LOFC 1YFUA 4LBNA 4I2OA 1UX6A 4XF3A 4E2SA 1OD3A 3FN9A 5F3EA 2YZ4A 3POJA 5IFTA 4UFLA 4H7MA 1ULEA 1AR92 2P5BA 3HVDA 4CCNA 5GLTA 1CJDA 1DQ1A 1GNYA 2LTNA 3TAYA 1R1ZA 4QX5A 1OUSA 4NRQA 2JD4A 2CNAA 3HD8B 4JKLA 4K1YA 5FZ1A 5CFDC 3T30A 1H9WA 5FXVA 1F4HA 5KR7A 5GLWA 2NP0A 2ARCA 2JENA 3BU0A 3NKGA 3N9QA 3VL8A 1ENQA 2LM3A 1EP0A 2P3IA 3GM8A 5HI0A 4IE6A 1J59A 4QDSA 4DXTA 3P5BA 2BW8A 1W6PB 4AVAA 3HN1A 3SH3A 2PLV3 4KL1A 3ZN6B 1LHUA 4LMFA 1GP6A 3M7AA 4O9GA 3GYDA 5FYIA 1JYIA 2JDMA 1GZWA 1DG6A 1VAMA 2Y6JA 4JVAA 2JX9A 5FXWA 3UKTA 3FLRA 5FO7B 2WS91 4LHNA 4URTA 4XF9A 4P9XA 3RPQA 4N7UA 5FZOA 4Y24A 4B1MA 1JW6A 4N43B 2Y6FA 3P1IA 4V2VA 2UU8A 2YBSA 3FE5A 1KQRA 3AP6A 4PQQA 5GLVA 4PBPA 3ZXEA 2XJVA 3A23A 4Q1RA 5F5IA 5SV5A 2VBDA 2DWRA 5CFCB 1K3IA 2XH6A 1HB2A 1U5YA 1N3PA 2UYBA 2WA3A 3AXDA 2ARAA 4IE7A 5FPUA 2BBVA 2R041 4N8MA 5ERLA 4GD4A 4CCCA 4XMIA 1ZREA 3WF0A 1BK0A 2WQ8A 2Z5WA 4HPKA 5A3OA 3RWNA 1FX5A 1AYM3 2DDUA 4IW3A 3PVEA 1D0GA 3NAPC 1UU5A 4AI3A 1UL9A 3EO6A 4AK3A 2VG9A 2O14A 2VR4A 3BPZA 1W2TA 5F2SA 2VMDA 3LA2A 3TNPB 3NO8A 3M70A 2RS12 3RJRA 5C33A 1BMV2 2D44A 5EP9A 2W3JA 1OLMA 1FYUA 1X36A 5JOYA 4TLGA 5A3PA 5FKCA 2WKKA 1NKGA 4QXKA 3WDVA 3E6BA 5KC6A 3CBNA 2VZQA 4OCTA 5F1RA 1RUJ3 1SEFA 1T6GC 1WA4A 4IDZA 3MEPA 3T0AA 5A3MA 5FQ0A 2NMOA 4YZ1A 1ODMA 2UY8A 3RS6A 1EV11 3IWZA 2B8MA 1IOAA 1QKQA 4TLFA 5FYBA 3WNKA 4BDVB 5JSPA 1XC6A 4QGLA 3WP6A 1JMUB 4MGSA 4PHZA 1W2UA 5A7OA 2EIGA 3Q8AA 4UBHA 3NJVA 3T2PA 1UZYA 1JI6A 1XNCA 3N35A 1OVSA 4QPGA 2I45A 3S57A 4FI9A 3BALA 5F3IA 1WCUA 3OPWA 1U5ZA 3SCGA 1UO9A 1CX4A 5JXJA 3TEWA 2ZMNA 1IG3A 1YQCA 4Q4X2 1CJPA 2VNVA 4QGMA 4ZXEA 3O1OA 3Q9OA 1N1SA 4PDWC 5ANNA 3N9LA 4W6XA 4EE2A 1IKPA 4L97A 5B2GB 4L9BA 2RMU1 5C4WC 5FY1A 5I0SA 3VL9A 1JYNA 1H8TB 4Z92B 2QQPA 4ZZ8A 1RVF3 3QOPA 5FXXA 2P2KA 2GALA 1X8MA 1G6NA 4GWNA 3KF5A 4QDRA 2KXLA 5FP8A 5LW9A 1O3SA 1VBC1 4XCBA 5BNOB 1S55A 2A3XA 2W92A 4CDXA 4FPJA 2CWSA 4JGYC 3C2UA 1ZBA3 1VRH2 2WRAA 5C8CC 1W0PA 1ZYBA 1QOTA 3C7OA 3AMNA 3M3EA 2CWMA 2WT0A 4I02A 4RS5C 4XBNA 3WW4A 1GV9A 1B35A 1AX2A 4DIQA 4AI1A 2XWJB 4LKDA 2WNVC 5C5TA 2W91A 1CAXB 2WLQA 2YB7A 4GIQA 1H2LA 3POFA 3PL0A 2BOJA 4OHXA 1L7LA 3IDEA 2XDVA 1IHMA 3WV6A 5DZFA 1HJFA 3I3BA 3ZYFA 5CA6A 5HPOA 1ZRRA 1COV3 4QMAA 3BB6A 1RUI3 5I0RA 4MADA 2FDJA 3CIHA 2Q1MA 4YVWC 2P34A 2B45X 1WW6A 1RUH1 1TG7A 4JHTA 3A7QA 1JZ8A 3P3NA 2W9XA 2BFUS 2HWF3 1RJ8A 1RMU3 4IERA 5JXGA 1HV1A 4BZ4A 2YMZA 1CAUB 2IXKA 3MICA 3OGRA 4I0AA 4IV1C 5HCHA 1CWPA 1O8SA 3E5UA 3FUOA 5JSRA 2DU0A 4LJHA 5FPZA 1HX6A 4CXWA 5KXEA 2HWE1 3IDBB 3Q8EA 4GH4A 2GP5A 5DG2A 2WAOA 2EA7A 1XJAA 2D3RA 1XE7A 1AX1A 3E5XA 3GNEA 3I2JA 3JU9A 3W9AA 2LS6A 3SITA 4XFIA 2WZEA 2BBAA 3UGFA 1JH5A 3CMGA 2O8QA 2BVBA 1G86A 1Y9MA 4XIOA 4RQPA 2WAAA 3NNGA 1W2OA 3BOWA 4J1WA 4BCUA 2PFWA 4COZA 1V6NA 4QD2A 3J9SA 1AR63 2Z4FA 3WLUA 1AZDA 5GLZA 1LENA 2J7MA 4BQ1A 4E4SA 2FDIA 5EXOA 3IDAA 4JC1A 2ZKLA 2R061 3ELNA 4M0NA 2YG0A 2XJPA 4YWAA 2HEYF 4F83A 5FZ0A 2WNUC 2ZMLA 3RNSA 4ISRA 1DGWX 1WCKA 4IEOA 1EAH1 1G7YA 4JGZA 1BCXA 1QHDA 3O12A 3RRDA 3S6PA 4BK4A 3ILFA 5ABJA 2GH2A 5FUIA 4KWKA 5HCBA 1GWLA 1VB4A 2B4KA 4D7YA 5LA9A 2V73A 4CRQA 1KJRA 3VBRB 4Z8BA 2A5ZA 4HVRA 2WDBA 5FZCA 4P00B 3WF2A 2RS51 3TRSB 5A3LA 5IHRA 2LALA 3KHCA 4JX0A 3IB3A 5A1LA 2XBO2 3JB8A 1NCQC 3BOPA 5IVJA 1NE4A 3SEPA 3ZXDA 2WWJA 3N4MA 1IQAA 4CU7A 1W0OA 3IN9A 3LFMA 2BNMA 1W6OB 3RSJA 3PIJA 5IUQA 2DVGA 4CP9A 3LOBA 3R4SA 2SLIA 1E5HA 5D8AB 5FCCA 3T2QA 5IVBA 2W1QA 5FY7A 3UV9A 1ZZ8A 4IV3A 3OEBA 2A70A 1WZXA 4FCAA 2Y6LA 4SLIA 1FATA 3KV6A 2YPJA 1RINA 3PUQA 1QNYA 1JOBA 2CHHA 5IVYA 2ZABA 1QJX3 2C6SA 4O7XA 3LA7A 3LDBA 4YRDA 4CE8A 3WZ1A 4UW5A 4P08A 4FTBA 1AHSA 1EV12 3OPTA 1R092 4CEWC 2Y33A 1W8HA 3DYPA 1O4YA 3HPNA 2G9GA 3WNPA 2Q8CA 1FV2A 2QDRA 1OA4A 5AFBA 5K0UC 4KBZA 4XJAA 3VBHB 1SPPA 2VE1A 1PZ7A 3ORJA 3ZFGB 3PU8A 4DFSA 4JTNA 2IXHA 3VB9A 2WA4A 3J4UH 5HXVA 3DPRA 1HQWA 1VBB2 3ACFA 2W95A 2JDNA 2CGOA 3KQ4B 4NPRA 2ZEWA 4NHYA 4XUOA 2LRPA 2FCTA 5A3UA 4QM8A 1AL23 1HV0A 4EWDA 1R1A2 3D5OA 1RUE3 3LGRA 1H1IA 1Z7S1 2RMU2 4OFGA 4B1LA 4JRLA 4W65A 5LBBA 1RUC2 2I2SA 3MIGA 2VCCA 2GN7A 4K20A 4U2AA 2VOTA 1QWRA 3A4UA 5FP3A 2Y26A 1DZQA 2FDGA 2VCBA 2X5IA 3LEMA 3S0MA 1IS5A 2FDHA 4CPBD 5FP4A 5CKQA 1PK6A 4Y26A 1VBC2 1WCQA 3A22A 2DFCA 4YW1A 1V6JA 1X8EA 2R063 4E4DX 1YWKA 1W8WA 5EHDA 4RFT0 1MZ5A 2RS33 2V4AA 2ZPXA 2UY9A 2ATFA 3R0RA 3C7GA 2PHDA 4IESA 4IGPA 5CNAA 1ST8A 4YGBA 2YY1A 3T4VA 3ZDSA 1W0NA 2CY6A 3K48A 3O1UA 3TBDA 2DV9A 4OUMA 4B7EA 2PQQA 4XFHA 4HT1T 1GWKA 3ZIWA 5CKNA 1VBA2 1Q8OA 5FMDA 3TN91 3LIGA 4ZU4A 3IKWA 1UNBA 3W20A 3B7MA 1YC61 4LKFA 1VBE1 3GBGA 4YGCA 3ES1A 4LO5B 5KWRA 2WJSA 4QQHA 2RS53 4A44A 3GDBA 5APAA 2JG9B 3AYAA 2BGPA 4QM9A 1XBFA 3W5NA 1H8VA 4XFAA 2Q1FA 5FFOC 4OUEA 2QE3A 2JDKA 4J25A 5C5UA 4XZPA 3B00A 5LCWL 1W6MB 3I2IA 3AC0A 1DCSA 4ARXA 2B42B 2ENRA 2VNGA 4IEQA 2LUWA 5HBAA 2VNOA 2ZAAA 3MIEA 5DAQA 4OHWA 2JICA 1NYWA 1JYVA 4R4XA 4MOAA 4XC9A 3WXPA 4YLZA 3V64A 2B5HA 1AUYA 2O1QA 2WFF2 5FY4A 1QNWA 2VCMA 1W90A 3FUQA 3LSEA 2HWE2 4Q26A 4WM8A 3AL5A 4QXCA 5AVPA 4M4RA 3RMXA 3LD8A 3WQ0A 3FLPA 4U36A 5IAXA 3LEIA 2Z69A 4M3CB 4NE9A 4YPJA 2BRTA 2QQIA 1QIQA 2JB8A 4NR1A 4MGTA 3VBSB 4AQ2A 2VBBA 3SH4A 1YJKA 1YIPA 2VOXA 2IVIB 3Q8FA 3WF4A 2VCAA 2CL2A 1YI9A 2R16A 3NV3A 2VJXA 5T52A 1WBLA 1OH3A 4AG4A 4XUTA 4KNCA 3WG4A 1JU3A 4H3WA 1OPOA 4BOWA 1I1EA 1LNSA 4IXLA 1L3JA 4XUPA 5DMYA 5I0DA 1ZZ7A 3LEKA 3H8OA 4RHV2 3B3QE 4QHZA 4A42A 4AE2A 1C5HA 4DB5A 1DU3D 1V9U1 3SXWA 1KFXL 4PIYA 1LOAA 2VH9A 1O59A 1AR83 1XE0A 3TEYA 2JE9A 3HIFA 3KT4A 4X6RB 2UWCA 1LU1A 4P9YA 3ENRA 1W9YA 5LZ6A 1Y43B 4O65A 4ET7A 1AYN1 5EFUA 4YM3A 4XYXA 5ISLA 1OXCA 2O8OA 3OCPA 2Y64A 4DXSA 1BBT2 3UKNA 3S5AA 3OTFA 4I3GA 3J8F3 4Y1XA 3WW1A 1KGYA 2HWD1 4AHYA 2ZGNA 1W9WA 1FPN1 2E53A 2HBUA 4HONA 1RUG3 1XB9A 2XMLA 5DUWA 2Q8OA 2R32A 2XXZA 3NL1A 1NA1A 1PIV2 3ZVXA 1NY72 1SBEA 5ACA2 5C9AC 4JCKA 1TNFA 2XONA 1HRI2 5DAXA 5H9PA 3TWIA 1IPKA 1ZZCA 2VVFA 4LOTA 3KCXA 2GNTA 4N9IA 4QQPA 4AFBA 1UYXA 2PHUA 1NLQA 1RHI1 3D4KA 3FFZA 4JDOA 2WZPP 3WP3A 4FAHA 2RR11 2XLFA 3NV1A 1RUD1 4QPGC 5FYSA 3V0AB 2R071 3TN93 3GHNA 3K4AA 3SC7X 5A33B 1W2AX 5KHJA 1PZ8A 2HWC3 1OA3A 4LKEA 2GC1A 1IS4A 4FP3A 3ACGA 4QT6A 1UWWA 2EALA 1H1AA 3PMSA 3PURA 4XILA 5FXZA 2UYAA 4INDA 2VAUA 3DUIA 4LO4B 1VMJA 3ST7A 5C3QA 1XQNA 4IGOA 1XNKA 1WW5A 5L9VA 1UOJA 3BN6A 4QX2A 1QY4A 4NO4A 3AX4A 3CZJA 4IEXA 4CYDA 1FAYA 2RDRA 2WZR2 2YROA 4P14A 1GNHA 2AEZA 3EBRA 3GCXA 3VBFB 5FO8B 4BH9A 5JMOA 3J7MA 3UYJA 1AR91 2OZ6A 2P3KA 5DUXA 5BNPA 2VZVA 5J3UA 5A6ZA 1HDKA 2WBKA 4LNVA 1C28A 1H8TA 2XPJA 4CDXC 3AJZA 5EWSA 2RM21 1VRBA 2ID4A 3LF7A 4O61A 3MPPG 1MQTB 1GWMA 1DYKA 2OZJA 5B4NA 2ZEYA 4LT5A 1MS8A 1RGSA 4XBQA 4XFBA 4H14A 2K0GA 1PO23 2QTWB 2V09A 1B35C 1HN0A 4NPLA 4V2WA 2ET7A 3I7DA 4GWMA 3VBUB 4JQRA 1F31A 1PO13 4ASLA 4JRAA 2CYFA 5HV0A 4XFGA 3I54A 4Y5TA 1XNAA 2DVAA 4GWIA 2BNNA 1YFWA 4ZU7A 1RJ7A 4M3CF 2C1FA 4LHSA 1WBFA 4R4ZA 5HXMA 3OY8B 4Q4V3 1EYBA 3RQ0A 1POV0 1XNBA 3ACIA 1YQ5A 3P3PA 4XTMA 5EZWA 2AZ5A 5GZGA 3INAA 4KU8A 3H0OA 1QU0A 2DTWA 4ZONA 3URFA 2WO3A 2X29A 3CJIA 5FDBA 4MGKE 5JOZA 2IVJA 3NRUA 4Y22B 1K5JA 4Y1ZA 2NLRA 5C3RA 3JBG3 1JYCA 2R1DA 4A6OA 4LKSA 2AEYA 5FZMA 4RR3A 3RZJA 1SMVA 4GH4C 1G8WA 1EPWA 2ZGLA 1O6UA 2XHKA 2XJRA 4B4PA 1SLAA 3HQRA 4MGYE 1C3HA 2PHLA 5CIRA 3BTYA 3RZLA 4EN8B 2Y8KA 4D6RA 4E8CA 5A80A 2D3SA 2J22A 3ZFEA 2HWB2 5FJHA 3VKFC 1FOD2 3OBAA 3ABZA 1ND3B 2VBPA 2ZX4A 4YZ5A 1JZ2A 1FMD2 1GUIA 1LHNA 4JDNA 4RQPC 4WVMB 4AI0A 1OI6A 3PHMA 1KEXA 2G9ZA 3OUIA 4PF1A 3MW4A 3FHQA 3WHTA 2BFUL 4UAPA 2FHRA 3AFKA 3LSDA 4BHPA 3VLBB 4ZS3A 2D6LX 1YRZA 4PI0A 3S7IA 1JZ3A 2RS11 1BMV1 1RXFA 2A73B 1JBCA 5FZLA 4LLFA 4PQ9A 1UY0A 1V0AA 4JGZC 1JOPA 2BNOA 2V4VA 3B94A 4MGIE 5ABJC 1S0EA 1FI2A 2VXRA 2PAMA 3J7LA 4MGQA 3GBWA 5F37A 1OUXA 1TME2 5CB7A 2ZGSA 2QCSB 3LKJA 3VDDA 3ZXJA 3QH6A 2XLAA 2Q8EA 1A3KA 2SBAA 2MEV3 3T3YA 3WINE 2F4LA 4DINB 2JG8A 5T50A 5CAZA 1REDA 4YGDA 4N53A 2GU9A 4G4FA 5A32A 2UURA 3RMYA 3USUB 5FZGA 4A45A 3QLQA 5F6LB 3RVHA 1JS9A 1DBNA 2CDOA 3HJRA 4D69A 1TNRA 3CEWA 3R4UA 5FWEA 4D3WA 4X6QB 1MZFA 4AFDA 2JB4A 3VKOA 1WCSA 3AP5A 4HBNA 2PMWB 2G1MA 3LWCA 1GOFA 3IIIA 4FPEA 4Q4X1 3U0ZA 4IV3C 2I74A 2WO1A 4Q1PA 3OOXA 4XXAA 1HB1A 3OYWB 1FT9A 2JWPA 4FFGA 4IQPA 1GICA 1GQPA 4HVOA 4Y33A 3AZYA 2DBIA 1OC1A 2UWBA 1IS3A 2ZHNA 4XACA 2D6PA 4K9SA 4LEJA 1W9TA 1CR7A 1FPN2 1QF3A 3AP9A 4UYBA 3B01A 2WSUA 4AQSA 2GMPA 4LBQD 3AZVA 4ZS2A 2WT2A 5LA2A 5F5QA 4H7LA 4AVCA 3I59A 3ETQA 2GNDA 4ORFA 1LKNA 2ZTNA 5C4WA 1QDOA 3VBOB 4B4QA 2VMGA 2PYTA 2RR12 3EHKA 1QJY3 4GAZA 1GFF2 1RUD2 2DCTA 4KGGA 1XSQA 4LBQA 4M0HA 5FLJA 3RZMA 3EMRA 1YYNA 5BV6A 2VQUA 1RUF2 2R1BA 2F6BA 1DP0A 2X53S 3B9IA 3DPRC 1JTZX 3LAGA 4A7ZA 2OUHA 2VTXA 4DS0A 4X8NA 5FZIA 1F35A 1LGCA 1MS1A 1OKQA 2WQ4A 2HLEA 3UESA 5LRRA 5JZGB 5H9SA 1AX0A 1QJU3 1CAVB 4V1PA 1Q56A 5FYYA 3LIHA 2OQ7A 1YQ6A 2ORZA 2IXCA 1CAWB 3VGIA 2RDNA 2Y0IA 2XL7A 4A4AA 4C0HA 2FMYA 4A2UA 4FPKA 1PK6C 4XDPA 1CPNA 1HXS2 2W0XA 3OGSA 3KGLA 5IW0A 4RN5A 4E9KA 4AEJA 1DQ5A 2OXBA 2RM22 2HKXA 4OHZA 2OX0A 3O7OA 3OBRA 4CDWA 1ULPA 4UFHA 1VE0A 5C3SA 1PVC2 4K6BA 3VKMA 5CFDB 4UF0B 2H6BA 5F5AA 3ZKYA 3GHMA 1CIWA 2WFPA 1YQ8A 3FBYA 3IPVB 4LK6A 1OF3A 2W87A 3UT0A 4TSVA 4XQ4A 1PGW2 4UWDA 4NRMA 1C1FA 1RL3A 2ILMA 3OGVA 4PJYA 4BK5A 3D82A 4YZ2A 5JOXA 2BV4A 3HNBM 1K5MA 3K77A 5DDJ2 1VPHA 2VOWA 3AKQA 3I2OA 2BOIA 1UKGA 1GZTA 3JD73 2XKPA 1NT0A 4GB33 4UBGA 1IZ3A 4XAAA 3ZFFA 2ZEZA 4XPVA 3T1LA 3O1VA 2VOVA 4QQ2A 1C8M2 4BQ4A 3K46A 2XQXA 3W59A 4A7KA 3FJSA 1D7PM 4E27A 4JHZA 4P5HA 1JZ5A 3SEEA 3LB9A 4W6WA 1PMJX 5T54A 4EJRA 2RG4A 3WUCA 4I3PA 1RIRA 3WNLA 1O5UA 2L9LA 1WMDA 3SISA 2A1XA 4WM8C 4CDQA 1DZTA 3WD5A 1YFYA 2VMIA 1QOSA 2OW4A 4AWDA 2CGPA 4Q4W3 4FFIA 4GXLA 5FY8A 3VKNA 3PTRB 4QU2A 3WOGA 2VO5A 1MVEA 1YHFA 5FZ4A 5C6CA 4QPIA 4MXWB 3GGLA 3ILRA 4Q0QA 1BQPA 3MBWA 2WO7A 5LK7B 2XBO1 1W39A 1VRH3 3C7FA 5FZ3A 2FQPA 3KV4A 1ULDA 1UD1A 3POGA 2ARXA 3EQEA 3NAPB 2VM9A 3VD5A 1KJLA 1UXXX 4YW3A 3ES4A 4I0BA 2JJ6A 4O9EA 3ZYGA 1ND2A 2XLGA 3OPZA 4MUVA 1F15A 1F5FA 3WCRA 3NNJA 2XUMA 1S0GA 1SCSA 4CEYA 5J7MA 2XJQA 4E4HA 1ZBE2 3FHIB 5A7QA 3VZNA 3EXUA 4EROA 5A6XA 2OYZA 4NAOA 4ZKTB 4TXWA 1PVXA 3NJXA 2OKXA 2YC2A 4YZ3A 5D1IA 5A7WB 3I49A 1I5ZA 1NCRA 1UZZA 2TBVA 2BU9A 1W6NB 3E6CC 2GC2A 2WZ8A 3WSOA 1VMHA 3N9OA
chains in the Genus database with same CATH topology
1CGPA 2PAKA 1R091 1J3PA 4QQLA 1ENXA 5T3NA 1NA1C 5FMOL 3CL1A 1BEV1 4FT8A 1QH6A 2KA3A 1GNZA 1SCRA 4NN0A 1XU1A 1UCXA 4CP1A 1VBB1 5L36A 4E2GA 5BYNA 1VBD1 2W52A 1LOBA 4P9GA 1BVVA 3JUUA 4YGEA 1R1A1 5J96B 4BPZA 2EAAA 3AMPA 4PDWB 1KRIA 2E6VA 3ATGA 4XF4A 1ZA4A 1RUC1 4I01A 2PLV2 1ENRA 1TMF1 4RL7A 4A7YA 1LOGA 4XJ8A 5KXCA 5J09A 4GMP1 2BGCA 5F9TA 3AKTA 3H3ZA 3HMYA 2I07B 3L9JT 2WS93 2MPFA 3OBTA 5BNPC 3ZXLA 1Y3TA 2XWBB 4P9LA 4AW7A 4JGYB 5C8CB 1H8TC 3M3IA 5BNNA 2ZGRA 4RS5B 5JVVA 2BWCA 5GJ6A 4TZDA 1VBA1 3AMMA 1V6LA 1URXA 3S30A 2R043 4Q4Y1 2DCKA 3OD0A 4Q8KA 2WNVB 4DOUA 3WDUA 4ZU5A 2D93A 2P37A 1AYM2 1MQTA 4ES8A 2E7QA 2XKOA 4IEZA 1V6OA 1GQGA 4IEVA 3AK0A 1DQ6A 1V70A 4YVWB 2ZGPA 1GR3A 2O0OA 4MYEA 4Q0VA 4R8HA 1FNYA 4DNYA 3CJIC 2VMHA 5KXBA 4LUMA 2WFF1 3PLQA 4IV1B 5FRAA 4D7TA 4FPLA 3SCFA 4AEDA 1OOPA 2VU9A 2ZACA 1WD3A 1CESA 4CDUA 2EXJA 3ZXAC 4RR3C 5JOWA 3G7DA 3A0NA 2WC2A 1D4VB 1UF2C 1EV13 2VW1A 4S2FA 5GZCA 3ZO0B 5KHIA 3AYDA 3AYCA 1Q43A 2QUOA 4Q2FA 3ZFEC 5L7OA 5EYXA 2JE7A 1QH7A 3WR0A 2BTVC 4BYYA 3N7JA 1LTEA 2ZKNA 2A6VA 1AVBA 3ZSMA 2R0HA 5J37A 5K9YA 5JMCA 1KITA 4RHV1 1VBB3 2GN3A 4FPCA 2RJKA 3PVNA 5JPNB 1O91A 1N1VA 4LBOA 3WP5A 4HANA 1TQ5A 2RMU3 4J1XA 5CG8A 4KGQA 2WNUB 3W58A 5JLVA 1PGL1 2VUAA 5K8SA 4XE9A 2DF7A 4AQ6A 1RVF2 2ZZQA 3KLSA 5JR7B 4AI8A 4R52A 4C90A 1PMIA 4IEYA 1ZRCA 3BODA 5J36A 1BBT1 4N9HA 1LECA 1LHVA 4MZUA 4OUSA 3H50A 3E97A 2NPIA 1SDWA 1VBC3 2ZHMA 4NWWA 1UW8A 2ZGMA 3VDDC 4KQ7A 3ZXDA 1WGPA 2WWSA 1PIV1 5ACA1 3PJQA 1NY71 1ZBA2 2HYKA 2JG8C 1HRI1 1NCQB 4N53C 5HCFA 1HRV2 1UMZA 2CAVA 4SBVA 1XXNA 4L92A 5DUVA 3ZSEA 3L2YA 4PLMA 4COYA 4AHZA 1QQP2 4WZFA 4HSJA 1PHMA 1ULGA 4IETA 2A71A 4Y20A 5AVAA 2NYYA 1BK1A 2N7GA 1COV2 5GLUA 1SLLA 5LK5A 2JKBA 4P9IA 3AJYA 4C91A 1V6IA 2D43A 2XVLA 2WZR1 1RUH3 4LTAA 4RGAA 2HWF2 3ZPYA 4CEWB 1RMU2 4Q0PA 2VOKA 3U10A 1BEV2 3KQRA 5K0UB 1ZRDA 3TNQA 2R6QA 3ZSLA 2ZHKA 5AC91 3WT3A 4N90A 5C4WC 3ZYJB 3M3QA 2HWE3 2AREA 3VHPA 3ZSJA 4ASMB 4YVSC 4AFMA 1OLQA 1VBD2 5KXDA 2VW0A 2A3WA 4FAGA 2YUEA 3DV8A 2DCZA 2TNFA 3D0JA 3NWKA 2VQAA 3O0WA 3LZZA 3H1MA 1XYNA 1TMF2 3M1HA 4WM7A 1FXZA 2CV6A 3BU7A 1ULCA 1ULFA 3GBFA 4YFZA 5FO9B 4WV8A 4ZXKA 2ZMKA 2D5HA 2BVVA 3WG3A 4WVWA 3ZIXA 1EAH3 1H30A 2DTYA 2RJLA 3M3CA 4LO7A 3ZYIB 5IK8A 4CDWC 1OPMA 5HCAA 4YM2A 1QXJA 3WHUA 2PHRA 4NVPA 4Q4Y2 4AVVA 2ET1A 4AVTA 1MEC1 2HWB1 1Q8SA 1FOD1 1HRI3 1K5MC 3WX5A 2ZGOA 3M3OA 4R9CA 3KCCA 1FMD1 1N1TA 4PLOA 4XQWA 3VZMA 4ASLA 4CTEA 2ZGTA 1D2SA 3ACLA 1DHKB 3UK9A 1D4M2 3ZFFC 4M3CE 1DIWA 1W6PA 2P17A 2P3JA 1GZWB 4MX3A 1WUVA 2RHPA 2PA7A 1UPIA 2C9AA 4HK8A 4K3UA 2D6OX 3ZN6A 1QJX2 4B4RA 1AR71 4BLJA 4DPNA 2Y0OA 4HKLA 3TOJA 3I4IA 4CDQC 3BIWE 1G9AA 1ASJ2 4BMEA 2AENA 2AR6A 1XYOA 1BVP1 5F6KA 2AUYA 2IXJA 1TME1 1ZNPA 3KS7A 4N43A 3KT1A 4QPIC 1O7FA 1UN1A 3THPA 2A6XA 1U0AA 1Z0HA 4PIXA 5FMOS 2ZGUA 4HPKB 5CFCA 4TWTA 1VB2A 4OI0A 1Q8QA 3KM5A 1G9DA 2C0ZA 4C1XA 1LJ7A 3IDCB 1RTVA 1J1TA 1AL22 3J26N 1ND2C 1Z7S3 1RUE2 3KCYA 1BZWA 1MS0A 2X8KA 1PGL2 4CEYC 1I3HA 3L2HA 4MXVA 3PJYA 1MVQA 3U11A 3QCWA 3NSTA 1NCRC 4QQOA 4UW3A 4Y1VA 1SBDA 3C3VA 5JI9A 5FQ0B 4FPHA 1NOVA 4YG0A 5C9AB 4HMZA 4R9AA 3EJKA 3MLKA 3OGJA 2GMEA 4GULA 5FLHA 3CJXA 4PCRA 1DLLA 5KC5A 1DDLA 2XJTA 4QPGB 4YG3A 3HBZA 1M06G 1VBE3 1RUF1 2G4IA 1UPSA 3WDXA 1S0DA 2OA2A 1GZ9A 2A6YA 1ZVFA 3BCWA 3D8CA 1LHOA 3QD6A 4AGRA 4EN0A 4HK9A 1W6QB 3RG0A 2GDFA 2IXLA 1VIWB 1LGBA 4DRRA 3KD4A 3CNAA 1H4HA 4FO9A 1NXD1 3ZMNA 5GZDA 4K21A 2FMDA 3HQXA 1GZCA 4OHVA 3UJQA 1DYPA 3WP4A 3WQ1A 2ARBA 3AYEA 2V5YA 1N3QA 4Y5Z0 2DVFA 1PGSA 4XEZA 1HXS1 3PVBB 3B02A 2XVKA 5AC92 2JDZA 1GQHA 1FV3A 1PNGA 1Y9QA 3E5QA 4CDXB 3KB5A 4MVTA 1PVC1 5KBFA 2YDEA 1MS5A 5BNNC 3FFQA 1VALA 2JEMA 1I9RA 1YNAA 5BNOA 2XG3A 2MNGA 1B35B 1PGW1 1S0BA 1ZM1A 3ALQA 5E88A 3N7MA 3H3UA 1PNFA 4LBLA 3NW4A 3TB0A 4BE3A 4COWA 5DDJ1 1JUIA 2PHWA 5BNQA 4NWVA 3WY6A 2CGNA 1I6XA 1Q3EA 5DZEA 1V9U3 3A0KA 1CAXA 1X33A 5H9QA 1C8M1 3U07A 1A8DA 3ZSKA 3WDTA 1AR82 2VVEA 2IWGB 1OD5A 1SFYA 2D6MA 4EN6B 2XL9A 3VHNA 1KD7A 1AYN3 3QH7A 2D3PA 4AEDC 1OOPC 4ES9A 2HWD3 4AEKA 4AXOA 4CDUC 2R0FA 4WVZA 4GH4B 1FPN3 4IEPA 3D6EA 3FX3A 1RUG2 1MEC2 1CAUA 3VHOA 4WBBA 1RC6A 3RYPA 4C1WA 2EF6A 1POV1 1SQ4A 1LB2A 2ZAHA 1RHI3 1DGRA 5L7OC 2RR13 2UWAA 4RQPB 1RUD3 4XMAA 2EXHA 2B9UA 2R073 1U5XA 3USSA 1X82A 1G9BA 1MS3A 2HWC2 3OF1A 4L11A 4AHWA 4YM1A 4DY3A 4LR4A 4RD7A 1ZBE1 1SLTA 5JI7A 1AR72 3MYXA 4Q8LA 1ENSA 5I93A 4JGZB 3MZHA 3OGGA 5ABJB 2IFWA 1AR93 5EJ3A 3JQWA 4FXKB 1XYPA 4M00A 3FZ3A 1OFNA 3H7YA 2E7TA 2Z79A 2ZHLA 2RM23 3ZX7A 1XU2A 2GNBA 2DU1A 3VZKA 5I91A 3VBRA 3MW3A 2YHJA 4JAAA 3AKPA 3B93A 1O4ZA 1PO22 3LOIA 2DCJA 5T5PA 1Q5OA 1RB8G 1SACA 4QHBA 1OA2A 2OUJA 4MH0E 3RZZA 1PO12 2VGDA 3N7LA 2ZGKA 2XGXA 4IV3B 3TYJA 1W6OA 5DDJ3 1CN1A 1Q8PA 4EWEA 2PLV1 5D8AA 4HFSA 1BXHA 2W08A 2Q5TA 1C4RA 4Q4V2 3APBA 4FOYA 2PHFA 3ILNA 2AYHA 1C8M3 1YIFA 5J48A 1WW7A 2DYCA 2H6CA 5C8WA 1TEIA 1H2NA 4PLNA 5CG9A 1AF9A 1R082 2DCYA 1VR3A 2ETEA 3H8UA 2ERFA 1EY2A 1U5IA 2B7YA 2PHTA 2B39A 3BTAA 4YW5A 2A3YA 4GALA 3DPRB 2QDNA 2E63A 2C5DA 3VBHA 4TYSA 1X50A 4FXGB 2D97A 3MIBA 3ZFGA 1NXMA 2DUOA 1AYM1 1S0IA 4G9SB 4FOWA 5CU1A 4F7ZA 3I2DA 4WM7C 2X5IC 1D2QA 1NQDA 2QNKA 3UL2A 3GZAA 4KH9A 5T5LA 2RS13 1AJKA 3OJBA 3KMHA 4DZGA 1PK6B 4HL0A 2A6ZA 1VAVA 4LE4A 1ZBE3 4YZ4A 1OHFA 2EVXA 2HEWF 5I8YA 2NMNA 4I09A 4XDQA 2D40A 3SLIA 1EPZA 1RUJ1 5JCTA 2WIIB 2AGSA 2MEV2 4OI4A 1J3RA 1DF0A 2E9QA 4LHLA 3HT1A 5L73A 1LOCA 5H9RA 4COVA 4FPGA 1YJLA 4NHMA 1SBFA 5SV8A 2W68A 5E16A 1LODA 4XHBA 2R30A 1QXPA 3GZUC 1O3RA 3R05A 2JG9A 3U4XA 1VAKA 1S0FA 4Q4X3 1G9FA 2ZX1A 2YYOA 1OSGA 3WDWA 1BJQA 1DQ2A 4K7JA 1HKDA 1QXRA 2WSVA 3KSCA 1W6MA 4IEWA 1RVF1 4HN0A 4WM8B 4XF0A 4XIKA 2XJUA 4E2QA 1X7NA 4AI2A 2BYVE 2D7FA 3ZXKA 4G3YC 3VHRA 1FNZA 3MGUA 4LO8A 1MZEA 3MI8A 5DXDA 4N43C 5BY5A 1MZ6A 4QGNA 1V00A 1ZBA1 1MS4A 1WLWA 1QJY2 4M3CA 2GZWA 1NE6A 1HRV1 4JTOA 3VBSA 5CFCC 3G6JB 5I0UA 3MFAA 4A3XA 2VULA 3KGZA 3ZXGA 1QQP1 3T2TA 3VZLA 5JAXA 2K9ZA 4FSJA 4PBOA 3AZZA 1COV1 1QJU2 1WCDJ 1RUI1 1WLTA 3CLPA 4YFWA 2D6KA 1AXKA 4R9DA 4KG8A 4YNIA 5FBZA 4AVBA 2KM2A 1XNDA 1WD4A 5E8AA 4FOVA 3AKRA 2HWF1 4XHXA 1RMU1 4UXAA 5JSOA 1QDCA 1NA1B 4LO6B 3IIAA 4YM0A 1S0JA 1DGWA 1G9CA 2GC0A 1SFNA 3GZTB 2BWAA 3AZWA 2G9FA 4B3NA 1DZRA 2MHFA 1CD3G 3AP4A 1S2KA 4CP2A 1HIXA 5FOBB 1APNA 2IZWA 4GMP0 3R6SA 4B8EA 3V0AA 3JD72 4GB32 5A33A 4YW2A 1AR61 3MFCA 5L19A 5CBLA 4AQTA 5JPMB 4BIFA 4AHXA 3WW3A 1IPJA 3ZXFA 1C1LA 1W6QA 3M4FA 4KU7A 5BNPB 3N7KA 1WLCA 1S1AA 2XVGA 1YLLA 1WW4A 4MLOA 1KXGA 3SNMA 3VBFA 5AFEA 2GMMA 4H55A 4Q4W2 1AXZA 5KHKA 5I0TA 1C5IA 5CADA 4XJ9A 5BNOC 4BM8A 3MF9A 2ZJCA 1N47A 4F3JA 1RUNA 2ZA9A 2XBO3 1LRHA 1YXWA 4HVQA 3FBMA 1HRV3 2TEPA 3O0XA 1ZZ6A 4I30A 3H1WA 4W6YA 4EN9B 3B69A 1D4M1 2BUKA 3VBUA 2PELA 2ZGQA 1LULA 4LBMA 2ZX3A 4BA6A 4FQZA 1J1LA 2NN8A 4R9BA 1QQP3 4GKYA 4XBLA 3HR9A 1O4TA 1UAIA 3CJIB 3UKVA 4B7KA 1E57A 3OY8A 4UW6A 1QJX1 1WMFA 2WQZC 4XFFA 5IK7A 1RUJ2 3MLJA 4XJWA 2WL1A 4X8PA 4RR3B 1ASJ1 1CVNA 4XW3A 4OZXA 3WG1A 1R093 2D6NA 2TUNA 4IL7A 3ZYPA 1PM7A 4OVEA 1O3TA 4Y22A 1DGLA 1QJZA 4Z82A 5IK4A 1BEV3 3LCPA 4LA2A 3ROUA 3ZFEB 4OLLA 4LHKA 2F4PA 2H0BA 1HW5A 2VECA 3FLTA 4K1ZA 3ZYRA 3AKSA 4PF5A 3RYRA 1VBD3 2VUJA 4KWJA 1J3QA 4YYOA 1ZZBA 5EV7A 4CP0A 5KHGA 1ND3A 4S2GA 1R1A3 2Q1ZB 3FWEA 1AL21 1WLDA 5BUVA 1RUE1 1RUC3 4C0BA 4OHYA 4WVMA 1SLIA 2E7AA 3SMHA 2EXIA 4F8AA 1ONAA 1TMF3 5FPXA 1V6KA 3B9CA 1LHWA 2B46X 4GMP3 1LU2A 1GLHA 3NJZA 4D94A 3T1MA 1OFSA 3GALA 3NV4A 3NVCA 1CQ9A 3X29B 2GAUA 3AB0A 2WS92 2BPA2 3VDDB 4HSLA 2FZ2A 1OLRA 4S2HA 2RS31 1H0BA 2JG8B 2IC1A 4N53B 1OQEA 5A32B 4AYUA 3MPBA 1LEDA 1VBA3 1LR5A 5IT6A 3VBRC 3AZXA 4WVVA 4Q4Y3 4YW4A 3WUDA 3V0BB 2R042 1H4GA 4LBJA 1RITA 4EN7B 3USUA 4P9JA 2DUQA 1JXNA 4OULA 3AXEA 5DZGA 1RUI2 2A6WA 2EXKA 2W39A 1AXYA 1ZX5A 5D8AC 4FBFA 2ZBJA 2BQPA 5GZEA 3MF6A 3M2MA 1D4M3 4RSUA 1QGLA 3OYWA 4LA3A 3VZOA 4MV2A 3JB4C 3PMEA 2WFF3 3I59B 2Q0AA 1D0HA 4HETA 4LE3A 4LULA 2EAKA 2JECA 2Y38A 2R49A 5C4WB 3RYKA 4YVSB 1IS6A 3D0SA 4HKWA 4LBQB 2WLPA 3RI9A 2D5FA 2VW2A 1ASJ3 2VVDA 2DVDA 4META 3K51A 1F5JA 1TE1B 4FP2A 4ATFA 2VQ0A 3VBOA 2Q4SA 3VBHC 3DL3A 3ZFGC 3PNAA 3VUOA 1AR62 1F8VA 5GKAC 4RHV3 4XJZA 4S2DA 3DKWA 1A78A 2WNEA 3N3HA 5JIAA 1C8NA 1GYKA 1NQJA 4HKOA 5I8TA 3ME2A 5KHHA 4JV4A 4NHLA 3MIHA 1AR81 4L99A 5JZGA 1JOJA 1NG0A 2WINB 5LEKA 1U12A 1XE8A 3IBMA 1CAVA 1MS9A 1LOFA 5E89A 4CDWB 1BBT3 1CAWA 2QZ2A 4ATEA 3J8F1 5FAXA 3SH5A 4D7SA 1VJ2A 3E6DA 2CAUA 4Q29A 1N1YA 1RUG1 1PIV3 4Y4YA 5ACA3 3MIFA 1BKZA 4BWOA 1REEA 2QKDA 5CFDA 3THTA 4Y1UA 1KS5A 2VNRA 1K5MB 3O14A 2VPVA 3IPVA 1LGNA 1IKQA 4Z1VA 1BYHA 3QACA 1F9KA 3ZFFB 4KBBA 2AH2A 2HWC1 4BMBA 1CONA 3AMHA 2JG9C 3VKLA 1HQNA 3O5SA 3AP7A 2Z42A 2PTMA 4P9WA 3POSA 4FVVA 2PN5A 1JN2P 3H9AA 1ZZ9A 4XQDA 3ASIA 2WZR3 2ZCWA 1UU4A 4CDQB 1RUH2 4XOGA 5JIUA 4HLTA 3RDIA 3JQXA 3MIDA 2HEVF 2YGLA 4GQ7A 4QPIB 5AC93 1H1MA 1V6MA 4DMIA 2ZS6B 1XRUA 3WCSA 4EWAA 4COUA 1KS4A 4AGVA 1O3QA 3JZVA 3DF0A 1OQDA 3VBSC 4XJUA 5JDBA 4AEMA 4MXWA 1PO21 3AMQA 1ND2B 3NV2A 1PO11 4Y1YA 3QBQA 3R4DB 3GF6A 3NAPA 1QOOA 4CEYB 1SLCA 3S7EA 4LBKA 4RGGA 1Q8VA 3H1YA 3AM2A 1LEMA 1NCRB 3NKTA 4Q4V1 2VY0A 1HQLA 3VV1A 4FPYA 4HN1A 2R062 1UU6A 2A75A 3IM0A 3MLLA 2PHXA 2RS32 2ZZJA 4DQAA 1LOEA 1R081 1EAH2 2Z2SB 2CTVA 1IGOA 1MR5A 1W6NA 3POWA 4KWLA 5LRSA 4Q0SA 4DXZA 1H2KA 3JBG1 2WT1A 2IFRA 1OMIA 4B29A 2RS52 2HJIA 3M8LA 3WG2A 4WZCA 3AFGA 3JCIA 1MEC3 4OI1A 1NLSA 1REFA 1JHNA 1FOD3 2HWB3 4XETA 3V65A 1UIJA 2GSYA 1FMD3 3N36A 4MSVA 4AF9A 3FMGA 4YARA 5FREA 4NHKA 4FPOB 1KDMA 1M4WA 3POYA 4PDWA 4XTPA 4Q0UA 3WNXA 2OVUA 1O5LA 1DQ4A 2JXAA 5JWPA 2A7AA 4XF1A 5LEJA 1AR73 1A6CA 4N7IA 3MDPA 4QPYA 2OIIA 3ECQA 3VBFC 5BNNB 1N3OA 4FTEA 4Z07A 3HT2A 3CU7A 3RI8A 1TME3 1DQ0A 3WDYA 3B5LB 1YUDA 4YSFA 4JGYA 2H0VA 3SCHA 5C8CA 2MEV1 4HZFA 1ZRFA 3RJ2X 5FOJB 4E4ZA 4RS5A 4GA9A 1MQTC 4XXPA 4MGZE 3V56A 3IMNA 3IT8A 4BLIA 4GKXA 1KFUL 1NZCA 4AFAA 4UW4A 3UJOA 2WNVA 5E1RA 3H7JA 1DGRN 1WMEA 2QZ3A 2DURA 3VBUC 1YCIA 2YV8A 5J98B 1Z7S2 4PIZA 5K7PA 2DVBA 1H9PA 3CF6E 1HLCA 4FQ4A 3ZMOA 2K2SA 3J8F2 1VP6A 4YVWA 4KG0A 5FLIA 1YI7A 1VLNA 4AEDB 1AJOA 1OOPB 1F2NA 5BPXA 3FC0A 1GKBA 4CDUB 1S2BA 1AL0G 1GSLA 1Z78A 2FBEA 1B09A 4IV1A 1H2MA 1R083 1JUHA 2XB6C 3HAGA 1QJY1 2Q30A 3KZ4C 3ZN4A 1LESA 5L7OB 2GNMA 3TN92 4YG6A 5GM0A 1SLBA 4AFCA 1RUF3 2QJVA 1VBE2 3WVJA 1MACA 3MW2A 1ND3C 4JDMA 5GZFA 2PAEA 2ES3A 4LLOA 4FTSA 1GANA 1A8MA 1OQ1A 2YGMA 5DG1A 1QJU1 4L2NA 2BEOA 5T5OA 4K40A 5BXXA 2GH8A 3DGTA 3I8TA 3PTYA 4I0WB 2DUPA 4AVSA 4Q27A 4NOTA 2DFBA 4OI2A 1HXS3 2FZ1A 2WNUA