4BCUA

Satellite tobacco necrosis virus (stnv) virus like particle in complex with the b3 aptamer
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
188
structure length
188
Chain Sequence
b'RKSATMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAITVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGATAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN
publication title Sequence-Specific, RNA-Protein Interactions Overcome Electrostatic Barriers Preventing Assembly of Satellite Tobacco Necrosis Virus Coat Protein.
pubmed doi rcsb
source organism Tobacco necrosis satellite virus
molecule tags Virus
total genus 53
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03898 TNV_CP Satellite tobacco necrosis virus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bcuA00
1RUF3 1RUJ3 2R043 5ACA2 2GSYA 5D8AA 1HX6A 4JGYC 2R063 2HWE3 5DDJ3 4JGYB 1HRV3 1AL22 4Q4X1 1RUC2 1QJY3 1HQNA 1PVC3 1VBB3 2QQPA 1ND3C 1IHMA 1ND3B 5BNOC 1AL23 5J98B 1R081 4YVWB 1CJDA 5ACA3 2MEV2 1AR72 4CDXA 1VBD1 1D4M1 4Q4V2 1AR81 1RUC3 4CEYA 1EAH2 1EV12 2HWD2 1TMF3 2RS51 1F2NA 1R091 5AC92 1RVF3 1NA1C 1ND2B 1BEV2 4RFT0 1NY71 2PLV2 4N43A 5FMOL 4RR3C 2RM21 3VBHA 3CJIB 1RHI3 2MEV3 1AR73 1ASJ3 1H8TA 1R1A2 3JB8A 3ZFFC 3ZFFB 4Q4V3 4CDWB 1EAH3 1EV13 3ZFEC 4CDQB 1RUH3 5CFCC 1VRH3 2WZR1 1FMD1 1BEV3 1ZBE1 2PLV3 4Y5Z0 1R1A3 1ZBA3 3J8F1 1PO23 2R072 2RMU1 2WLPA 2WFF2 3VBSC 4QPGC 4JGYA 1COV1 1RUI2 3VBSB 1PGL1 4RQPB 3VBUC 1RMU3 1X36A 1VBC1 5ABJC 1HRI1 1ND3A 5K0UB 2HWF2 1B35C 5BNOA 2R073 1MEC2 2HWB3 1MQTB 4JGZB 2WFF3 1RUI3 2X5IC 5FMOS 4Q4W2 5BNPB 2HWF3 1NA1A 4GH4C 3VBRC 1MEC3 1NCRC 4Z92B 4GH4B 3VBRB 1NCRB 1RUF1 1NCQA 1RUJ1 2R041 4RR3A 3ZFFA 1PO12 2R061 3DPRB 2HWE1 1VAKA 5C9AC 1HRV1 3ZFEA 5C9AB 2GH8A 1AR92 5CFCA 1AR62 2WS92 1M06G 1C8M3 1VBB1 1AL21 5DDJ2 1FPN2 2WWSA 3JD73 1QJY2 1RUD2 5GKAC 1PO13 4RS5C 1PVC2 4NWVA 3JBG3 3S6PA 1AR93 4FSJA 3VBSA 2XPJA 4QPGA 2HWC3 1FPN3 3VBUA 4FTSA 4GB32 1RUD3 1TMF2 3VBFC 5ABJA 3VBFB 4CDUB 1A6CA 1B35A 1K5MC 1EV11 1Z7S2 4YVWC 4WM7C 1RVF2 2HWD1 1K5MB 4WM7B 1VBA1 1NG0A 3TN92 5AC91 1RHI2 3NAPA 1ASJ2 2X5IA 4PDWC 4GB33 4PDWB 1RUG2 4IV1C 1BBT2 1NOVA 4IV3B 1R1A1 1RUH2 4IV1B 1VRH2 1PGW2 4FTBA 1ND2C 1Z7S3 5L7OB 3CJIC 3TN93 1OOPC 5BNNC 1OOPB 1ZBA2 5BNNB 4CDWC 4NWWA 5C9AA 4CDQC 5C8CB 1PO22 1RUG3 4YVSB 1BBT3 3VDDB 4CEWC 1QJZA 4CEWB 1TME2 2R071 1POV1 1HXS2 1V9U1 2BBVA 5A32A 1WCDJ 1PIV2 1RMU2 4FTEA 2WFF1 4RS5A 4Q4X3 1RUI1 2DF7A 2RS52 2HWB2 2ZAHA 1TME3 2HWF1 4AEDB 4RQPC 1HXS3 1RUE2 5C4WB 3M8LA 1PIV3 2VQ0A 1VBD3 3VBFA 5CFDB 2RS53 3ZFGB 5K0UC 4QPIB 4YVWA 1MQTC 1W39A 4JGZC 1SMVA 4N53B 4Q4W1 1ZBE2 4RHV1 1RUE3 4Q4Y1 2RM23 2RR11 4PDWA 1QJX1 1X33A 5D8AB 2RS12 3JB4C 5BNPC 1QJU2 1VBE2 4EJRA 1C8M2 1ND2A 2WZR3 1E57A 1AR91 1AR61 1BMV1 2WS91 4WM8C 1FMD3 3CJIA 4WM8B 1OOPA 1ZBE3 3JD72 1F8VA 3DPRC 2FZ2A 1OHFA 1CD3G 4CDWA 5DDJ1 4GMP0 4CDQA 1FPN1 1VBC2 3J8F3 3JBG2 1AYM2 1QJY1 2RS13 1RUD1 4CDXB 1QJU3 1VBE3 1PVC1 4CEYB 3LOBA 2HWC2 5ACA1 1QQP2 3ZXAC 1FOD2 4N43C 4N43B 1VBC3 2BUKA 2XBO2 3VBHB 1AYM3 1RUC1 1H8TB 1TMF1 4RQPA 1Z7S1 2BPA2 1RVF1 2IZWA 1QQP3 1FOD3 3TN91 1RHI1 2MEV1 1AYN2 1AR71 1ASJ1 2RS32 4CDUC 5K0UA 4Q4V1 2XBO3 1EAH1 1MQTA 1BBT1 4JGZA 1RUH1 1VRH1 2TBVA 4GMP3 1BEV1 2PLV1 4IV3C 1AYN3 2RS33 1RB8G 5BNPA 1ZBA1 1C8NA 1PGW1 5LK7B 1PO21 4GH4A 3VBRA 5A33B 1NCRA 5L7OC 4WM8A 5BNOB 1TME1 3DPRA 4Q4X2 1HXS1 5C8CC 4YVSC 3VDDC 1PIV1 1RMU1 1R082 4SBVA 1VBA2 2Y26A 2HWB1 1NA1B 1VBD2 1D4M2 1POV0 3HAGA 1AR82 1NCQC 1RUE1 5JZGC 1NCQB 4RR3B 5JZGB 1R092 1DDLA 2HWD3 2BFUL 1R083 3ZFEB 4AEDC 1NY72 5CFCB 1VBA3 5C4WC 5AC93 1MEC1 2RM22 3VBOC 5CFDC 1D4M3 1AR83 3VBOB 3ZFGC 4CDUA 4QPIC 1K5MA 4WM7A 2WZR2 4BCUA 1R093 2RS11 4N53C 1QJU1 1FMD2 1VBE1 5FOJB 1C8M1 1V9U2 2FZ1A 1AL0G 5D8AC 3J8F2 4IV3A 4QPGB 4IV1A 3JD71 1PO11 3VBUB 5A33A 2RMU2 3JBG1 1AYM1 5L7OA 5ABJB 1COV2 1POV3 1V9U3 1B35B 1PGL2 5BNNA 2HWC1 5C8CA 1VB4A 1QQP1 3NAPC 4YVSA 1FOD1 3VDDA 4CDXC 1HRI2 1OPOA 3NAPB 4CEWA 2X5IB 4CEYC 2ZZQA 4LLFA 2RMU3 2XBO1 4RHV2 1COV3 4Q4Y2 2BFUS 2RR12 1QJX2 5J96B 5JZGA 4GMP1 1VB2A 3VBHC 1H8TC 1HRI3 4GB31 3IDEA 1AYN1 2RS31 1AUYA 1GFF2 4AEDA 1BMV2 1RUF2 4Q4W3 1RUJ2 2R042 5C4WA 4RHV3 4Y4YA 4Q4Y3 3VBOA 2R062 5CFDA 2HWE2 3FBMA 2RR13 1QJX3 3ZFGA 1HRV2 4QPIA 5A32B 2ZTNA 1RUG1 4RS5B 1VBB2 4N53A 1AR63 2WS93
chains in the Genus database with same CATH superfamily
4XABA 1AX0A 4DB5A 3MGUA 3BB6A 1HX6A 1IKPA 5KXBA 4JGYC 2R063 5FR3A 2HWE3 2DVAA 2R30A 4M4RA 5DDJ3 5F32A 2BV4A 4AFBA 1HRV3 3M2MA 2G4IA 2E26A 1F35A 1RUC2 1QJY3 2VNGA 4QB1A 4IEXA 3SH5A 5CA6A 2WO1A 4YW5A 2VR4A 1UY2A 4YLZA 4A2UA 2YBPA 1CVNA 5FAXA 1FNZA 1H9WA 2O8QA 4L2NA 2QQPA 1IHMA 5IAXA 5E6HA 5BNOC 3DL3A 2PTMA 2D93A 4UW5A 1TVGA 5ACA3 1A78A 2UY9A 3AKSA 1T6GC 1SLIA 3PTYA 3GJAA 1WKYA 2MEV2 4PI2A 1DGWX 2IXLA 2VOXA 1UXZA 2IFWA 1W6QB 3D4KA 4CEYA 1EV12 5EYXA 1ZX5A 2RS51 2VXJA 1YI9A 3E6BA 1S2BA 4AVSA 4CCMA 4FPEA 1H30A 3PMSA 1OFSA 4YG0A 1J59A 2RDNA 3ZOIA 1RVF3 2XUMA 5BV6A 5B4NA 1LULA 3CMGA 2ZBJA 4OQ8A 4LO5B 1S0DA 4CRQA 2FDFA 1GBGA 4O61A 3AMMA 5I91A 3KMHA 2BOIA 4D6QA 3ZFFC 4MGTA 4AQSA 3OD4A 1OI6A 3UGGA 1W8TA 4CDWB 1EAH3 3EMRA 1IQDC 4QM8A 4XXPA 5H9RA 4BH9A 3CZUA 1GYKA 2E7QA 2GZWA 5FMBA 3LDRA 1VRH3 1XE7A 2WZR1 2F17A 5HCFA 3EJKA 4CE8A 1FMD1 4KI5M 1BEV3 4FXGB 3UKNA 3AXEA 5FZEA 2PLV3 1BLZA 1W04A 3ZDSA 4R4ZA 2ATFA 1R1A3 3IPVB 2YU1A 2ZMLA 4JQRA 1UZZA 4V1PA 4ZZ5A 3BVCA 1MVQA 2PHFA 5GLTA 1WLDA 3URFA 4YZ3A 2Y0OA 2WNUC 1BHGA 1SLCA 1U5YA 4Y1YA 1UOJA 1WCQA 3VBSB 3WDXA 4QXBA 4RQPB 3O1MA 1PGL1 1X8MA 1OLQA 1RMU3 2VMEA 4LLOA 1QXRA 3ZSEA 1JZ2A 1ZRCA 4P08A 5GLWA 3SEEA 4BQ4A 3C7EA 4DPNA 5IT6A 1ND3A 1S1AA 1NLQA 3CU7A 4LT5A 5FWEA 5HXVA 4DUXA 5CNAA 1GP5A 4ZS3A 4PT6A 1MEC2 5EHDA 3JU9A 2HWB3 1MQTB 4ITCA 1QNWA 2XXZA 4P9GA 2VD7A 1A34A 3AFKA 1W8WA 5F8PA 1ULGA 4BE3A 4QGMA 1SLBA 3MIDA 2X5IC 1RYYA 4CU8A 1FV3A 3AYDA 2XMLA 3OPTA 2H6CA 3D0SA 4X6RB 1DYOA 2X53S 1OKOA 5AVPA 3IDAA 4I09A 4FI9A 5FYHA 2E31A 4BXSV 1YEWA 5IUQA 3C2UA 4MO3M 5BNPB 2HWF3 4I01A 2VUJA 3VBRC 5A80A 4Y1ZA 1YFXA 3KT1A 4Z92B 2VBPA 1LB2A 1QH6A 1RUJ1 2R041 3O1TA 3H3LA 4KH9A 3RI9A 2A7AA 3ZN6B 3AJYA 4LR4A 2VMFA 4AEJA 2ET1A 3B93A 5C9AB 2GH8A 1W05A 1CAUA 3THPA 5CFCA 2YU2A 2WS92 3SKJE 3PURA 2Z69A 1C8M3 1LGCA 2ZGMA 5I93A 1J58A 1MS5A 3S57A 2DUPA 2GNTA 2EVXA 1EPWA 4OHYA 3GXUA 4YM1A 2QQOA 1W3XA 4U36A 3RWKX 5GKAC 5IVEA 1SBDA 3HBKA 4HOOA 3BIWE 5JI7A 1APNA 3P5BA 3WX5A 3AP9A 2JDZA 1XYPA 2WR9A 1AXKA 1QXJA 1CX1A 3LGRA 4Q1PA 1XQNA 2UYBA 3JCIA 1OA4A 4XFGA 1CJPA 3MZHA 1GUIA 2XPJA 3LPFA 4PLNA 3AJZA 2WT2A 3ROUA 1CAXA 1JMUB 2MNGA 1W6NB 3T0AA 1KS5A 1TMF2 5ABJA 4Y20A 1Y7BA 1Y9MA 5FZ6A 4AEKA 2R1BA 1B35A 1K5MC 2HLEA 1W9FA 1PK6B 1Z7S2 4WM7C 5DPNA 4N90A 2C1FA 4E2SA 3WDYA 1UQXA 1OVSA 5F5CA 3SQOA 3T4HB 3TN92 2ORXA 5AC91 5HCAA 1RHI2 3NAPA 2Y60A 1XYNA 1ASJ2 2ZGQA 1QJEA 2VNRA 1W2NA 4RD7A 3ZX7A 4DY3A 1JZ3A 2WNVB 4PDWC 2EAAA 3VBHA 4IV3B 5LBEA 1GQGA 1RUH2 2VO5A 2UWCA 4TLFA 1PGW2 2DDUA 4FTBA 3T3YA 4AHXA 4ORFA 4Q2FA 4LJHA 4HPKA 3K3NA 4YW3A 1XE8A 2Q1MA 5KHIA 3U78A 2B8MA 1K12A 3FL7A 3HT1A 4MXVA 3DCQA 5DUWA 1NXMA 5BNNC 1ZZ6A 2ZEXA 5CZKA 2YC0A 3WDUA 4XJ8A 1WW6A 4L9BA 4OULA 4NHKA 3RYKA 3KT7A 3VKNA 3RZMA 2SBAA 1RUG3 4YVSB 2ENRA 2VNVA 3W21A 4K21A 3FFZA 1SLTA 3MIGA 5HV4A 2IWGB 2LW8A 3G7DA 4FPGA 4IEZA 1V9U1 3P6BA 4MHUA 4OUMA 4BA6A 5A32A 5KC5A 2RJKA 4CCCA 3V65A 3AL5A 4B1LA 4FTEA 2WA3A 4XUNA 1PM4A 4Q4X3 4RN5A 5FQ0A 3TNPB 5I0DA 4JRLA 1TEIA 3DN7A 5EJZB 5FMDA 1YJKA 2DFBA 1KS4A 5FYVA 4ASLA 4CYDA 4XF3A 4YM0A 4LHLA 3MLKA 1JBCA 3LKJA 5DUUA 2RVAA 1HW5A 4LBQD 1SACA 3AP5A 2GC1A 3ZKUA 2WO2A 4A44A 2ZEWA 2GAUA 4IXLA 4UW6A 3KLSA 3CO2A 4QKNA 3VBFA 1MS1A 5CFDB 3WW3A 4XDOA 3BOPA 1W90A 2G9FA 1WMFA 5K0UC 3KZ4C 1OFNA 3DKWA 4YPJA 4BDVB 3A4UA 5A3MA 2F4LA 4LO4B 2DTWA 4JGZC 5KXEA 5FXWA 1UY1A 1Y3TA 4N53B 3GBWA 4Q4W1 2JG9B 4XTMA 1ZBE2 2BJSA 1YLLA 2JDPA 2RM23 1NUKA 2EXHA 3FHQA 4MUVA 5I0UA 4OI0A 1GWLA 1MACA 3K77A 1ZRFA 5I0SA 4XHBA 4HVQA 1UYPA 3JB4C 3QACA 3WDWA 1VBE2 4ATEA 2QQLA 4EJRA 4XHXA 1ND2A 2ZGLA 4XQDA 3GGLA 3P3NA 4DXTA 2BWCA 4WZCA 2RDRA 1AR91 3HOBA 1AX2A 4G4FA 3RDIA 5E8AA 4YZ4A 4JQTA 4WM8B 3UT0A 2XKPA 1OOPA 3JD72 4BQ1A 3DPRC 1NAEA 5C70A 1BZWA 2VGDA 3O0VA 2O8OA 3PIGA 5DDJ1 1UO9A 3LPGA 3S5QA 4PIXA 1NT0A 4CDQA 3JBG2 3A7QA 2P1BA 1QJY1 2I74A 1RUD1 4CDXB 3KV5A 3J7HA 2Y33A 1QIQA 1REEA 2W08A 5LA0A 4QB6A 3LOBA 1XNBA 1K3IA 3ZKYA 4XXAA 5ACA1 3I59B 3ZXAC 3MLJA 4JKMA 4P02B 3RMYA 4YZ5A 1CZTA 5A3LA 2D6MA 1RC6A 1EYBA 3I2KA 5C3SA 3BI3A 1VBC3 2BVVA 2GN7A 1AYM3 2VUAA 1Y9GA 4YGCA 1HKDA 2P37A 1UOGA 4AGRA 1XNDA 1A8DA 3EBRA 1WW7A 1YUDA 5FY0A 2BPA2 1RVF1 3WD5A 4YYOA 5EV7A 1K42A 3VZOA 1VE0A 1LCLA 3POFA 2ZGTA 2R16A 1MZ5A 3OYWA 4WVZA 3VHRA 1DU3D 4UFHA 3POIA 1EAH1 1Q3EA 1UMHA 1LEDA 1TG7A 2VNOA 4M3CB 1DYKA 3CJXA 3MEPA 1VRH1 2QVSB 3BALA 1SFYA 2WN3A 4HL0A 4BYYA 5L19A 2ZGNA 5B4XA 4R4XA 1BEV1 4URTA 1ULCA 2XKOA 2PLV1 1WLWA 4ZZ8A 5CU1A 3VD9A 2E32A 5JXGA 2QQKA 4RGKA 4YZ2A 1XU2A 3HNYM 3KCYA 4O7XA 3MYXA 1C8NA 2WBKA 4BU2A 5JPMB 4MV2A 1NZIA 1RITA 2DVFA 4BLJA 3O12A 5J3UA 3VBRA 5A33B 2W9XA 3B5LB 3E5UA 5A6QA 3IDBB 5LRSA 1NZCA 5JR2A 4BQYA 3GCXA 5BNOB 1TME1 2WQ8A 4XETA 1CQ9A 2CDOA 3U0ZA 2IVJA 4Y3OA 3BU0A 4GALA 1PIV1 2CY6A 1RMU1 2J42A 3T4VA 4FFGA 4LHSA 3A0NA 5GLZA 2JG8A 1UCXA 4WVWA 3VKFC 2VZVA 1W9WA 1ZRRA 1N1YA 5FMCA 4GZ9A 1RUOA 2HWB1 2XWBB 3SITA 1NLSA 2EIGA 4RGAA 1CX4A 4EN6B 1VBD2 2XHKA 3I3BA 3HAGA 3UJQA 1AR82 3KS7A 1RUE1 5A7NA 2VZ3A 3B01A 1W9TA 3LIGA 5FZDA 1EUUA 2PAEA 4JKKA 1U5IA 2A5ZA 4PHZA 3ZVXA 4FOWA 1GMMA 5CKQA 4BK5A 1C3HA 4Z2WA 4UT5A 5FKBA 1E5IA 1VBA3 1FATA 4R9CA 1E5SA 3ETPA 4I30A 4M3CE 4DY5A 1WCUA 2GC3A 3M3EA 3RS6A 3HMYA 3GJBA 4CXYA 4ZHNA 1F15A 1H2MA 1HQLA 4GWMA 3ZXLA 4CDUA 4QPIC 5F39A 5IK5A 2HEYF 3ZYFA 2YBKA 4D69A 4Q0PA 1K5MA 4QXHA 4WM7A 3KSCA 4CXWA 4P9JA 3AMQA 1LU1A 2RS11 1PZ9A 4OHXA 3AK0A 1QJU1 3OY8A 4WVMB 1C8M1 3OBAA 3LA7A 3OBRA 3J7NA 3R0RA 4AL9A 3S5AA 2VE1A 5CEHA 4ISQA 4LA2A 2WNUB 4XF4A 2OA2A 5FXZA 2QQIA 5IYYA 2C9AA 3AZVA 5CBLA 3WR0A 2ZGOA 4K40A 1OSGA 3K2OA 4FFFA 2ZCWA 3OGSA 4IEPA 1DQ0A 5L7OA 1GWKA 3GYDA 4DRVA 1B09A 5BNNA 5HV0A 4AYUA 2YFUA 4IEWA 2NP0A 4NIDA 1KQRA 5C8CA 1QQP1 1OVPA 4MGYE 1FOD1 2W95A 1GOFA 5E16A 3ENRA 3H3UA 2X5IB 4CEYC 5JVVA 1ULFA 1W6PA 5DAXA 2XBO1 3WNMA 2KXLA 5DZFA 3N3HA 1W6OB 2W3JA 4RHV2 3MV11 4LEJA 1HB4A 5EXOA 3VLBB 2Z79A 4Q4Y2 3WQ7A 5FZHA 4P5HA 1LR5A 2FHRA 2RR12 4UFLA 2W68A 5JZGA 3LFIA 4E4DX 4K6BA 1L7RA 1I1EA 1E5HA 4GXLA 3IDEA 2CSGA 4H3WA 3DEMA 1GFF2 2VM9A 2W1UA 2WZPP 5IW0A 3MPBA 2JDNA 3T2QA 1RUF2 5GLUA 3NJYA 4OI1A 5LB6A 2HKXA 5LRRA 2ILMA 3N9MA 3WG1A 2NZ9A 4QB2A 3IN9A 3MICA 3ETQA 4E8CA 3VBOA 1T2XA 1W8UA 1QJX3 3DXUA 4DOUA 2ZGPA 1RTVA 3WP5A 4E4SA 2CDPA 1XB9A 2QZ3A 3WG4A 1UOFA 2OPWA 2ZTNA 4Y4RA 2V4VA 3D3AA 1O3QA 3FBYA 5CAZA 3WQ0A 1RUG1 4ASKA 1VBB2 1QNYA 1LHOA 4C91A 5FJHA 1AL22 2WS93 2F4PA 2W47A 1RUJ3 1QXPA 1KJRA 2R043 4QDRA 3RFRA 3WF4A 1O3TA 4DUWA 5IK8A 5ERLA 2P3IA 4ZU5A 3GBGA 2EALA 1F4AA 2WLQA 3N9OA 4NPMA 5FZIA 2C9KA 1W8OA 2XL9A 4Q4X1 2GP3A 3CQOA 4JDOA 3KQRA 1SCRA 3TWIA 3ATGA 4I02A 1HQNA 3V0BB 1GNHA 1ND3C 5GM0A 4LNVA 1PHMA 3JXSA 5J98B 4H7MA 5BYNA 2ZGSA 1R081 1H6XA 1UN1A 1KXGA 4A7YA 4FPKA 1KGYA 1H9PA 3D0JA 3ZXGA 3VV1A 4GWNA 1HV1A 3J7LA 3LIHA 2GC0A 2JE8A 1YC61 3I3EA 4Q4V2 4ZXEA 1AXZA 1DQ5A 1C28A 1ULDA 4IGQA 1TMF3 2ZGKA 4EV0A 1UMZA 2BGPA 4P9LA 4PIYA 1MZEA 3WUCA 4M3CF 4FFHA 1R091 4UW4A 1FX5A 3UYJA 1WW4A 1MR5A 1C57A 3UNPA 2I45A 1NY71 3IAPA 2JDKA 1Z0HA 5DAQA 5FZ1A 1Q8OA 2DCZA 1W8HA 1DG6A 1RHI3 2ADEA 1UY4A 2RM21 1AR73 1ASJ3 1H8TA 3JB8A 4QGNA 4ZS2A 3WP4A 4N7UA 1UY3A 4OLLA 2JEMA 2XLGA 3GCWA 1JS9A 4UFIA 5FLJA 3OGVA 4LPLA 2VU9A 5A3TA 1RUH3 5CFCC 2P5BA 1L7QA 5A1AA 3KB5A 1IS4A 3E5QA 4COZA 2JDHA 3VZJA 3C7FA 4GKXA 1YFWA 3W58A 1UMIA 3NV1A 4JDMA 4PF1A 3I2HA 4HLTA 4Y5Z0 5IAVA 1ENQA 3PLQA 5LZ6A 3MFAA 4IETA 1YQ5A 4QM9A 5JUVA 4MGKE 2RV9A 5JMCA 4Y5SA 1BXHA 1PX3A 5DAPA 2R072 3QD6A 4LUMA 4LUKA 4EWDA 4H55A 1F31A 2RMU1 5FBJA 3ILFA 1ZZ8A 2H0VA 3VKMA 3L2YA 2J1UA 3OUHA 2WFF2 3IZOA 4AOCA 4CCEA 1COV1 1LKNA 1RUI2 4EZHA 2VAUA 4XUTA 2EF6A 1PM7A 3K4AA 3I49A 2C24A 1VBC1 1QU0A 4CXXA 1DGLA 2EXIA 5ABJC 4CPBD 1US3A 5LATA 5K0UB 1UKGA 4F3JA 1B35C 2FDHA 4MSVA 1PNFA 5KHHA 4CTEA 1O91A 3LD8A 1MZ6A 2A70A 4IEUA 1W06A 4JGZB 4UFKA 4ARYA 2OVUA 1LOGA 4LBQB 3U75A 3I3MA 4AVBA 2OX0A 2FDJA 2DCKA 2J1VA 3HIFA 2Y6KA 5FMOS 4X8NA 5HBAA 1S0JA 5FK8A 4CA9A 5DG2A 3M3CA 1TE1B 2VZPA 1H1AA 4GJZA 1NA1A 1NCRC 2PAMA 1KITA 5FTTC 4GH4B 2W0XA 2PQQA 1VP6A 2OYZA 2RJ2A 5L36A 4CUGA 3VHNA 4O9EA 1ZVFA 4D7YA 1PO12 3WZ1A 3DPRB 4OUSA 1OUSA 2XR4A 3ZXFA 2J1RA 1UX7A 3ZFEA 4E2QA 4NOTA 2R0FA 3OGRA 4L0PA 2ZPXA 3WF0A 3NJVA 1AR62 4FPJA 4QQOA 4ARXA 3M7AA 3BOWA 4COYA 3R4UA 1I3HA 1PMJX 1R64A 2XH6A 1YWKA 1DHKB 4IE7A 5DN2A 4HG6B 1FPN2 1F5FA 1D2SA 2WWSA 3IPVA 1W2AX 4JKLA 3JD73 4CSWA 2OUHA 4HBNA 4XDQA 5A7WB 3MLLA 1RJ8A 4PF5A 4HKWA 2YBSA 4KQ7A 3WXPA 5EIYB 4UF0B 4EZ4A 3JBG3 1QMJA 4AHWA 1AR93 1PVXA 5FYYA 5JXIA 4MH0E 4MGSA 2BNMA 4HN0A 3KHCA 2Z42A 3VBSA 4NR1A 4QPGA 4MG2A 1IG0A 1CAVB 4MYEA 2Q8CA 2IXHA 5FY5A 1QGLA 3VBUA 2B4KA 3WF2A 2EXKA 4GIQA 2CGOA 5FZCA 4CVUA 4GB32 4L97A 5C3RA 1RUD3 5IVCA 1L7LA 2ZKLA 3VBFC 3MIHA 3JZVA 2VBDA 1FI2A 3PJYA 4AAPA 1G9BA 3HNMA 3WT3A 4EWEA 5T5LA 1EV11 1UW8A 4LHNA 1O3RA 4CP0A 2LALA 4S2DA 1JOBA 1F5JA 1VBA1 2B9UA 3NKTA 3U14A 3LEMA 5CVRA 2W87A 1KFUL 1XU1A 4QT6A 2ID4A 2DBIA 3NJXA 4YM2A 5F5IA 4ET7A 4XUOA 3FWEA 1ZYBA 4OZOA 4IV1C 1JN2P 1BBT2 1NOVA 2EIEA 2VL4A 3ILNA 3O1RA 2WT0A 3R05A 2ZGUA 4XDPA 1ND2C 1WLCA 2VY0A 3OGJA 3Q8CA 5SV8A 2VC9A 4NHYA 4Y26A 1GNZA 3K46A 4AFDA 3H1MA 1GQPA 3BUCA 2Y6HA 3ZSKA 1RGSA 2EXJA 5FY1A 2FMDA 1OOPC 3GZUC 4UWDA 1WW5A 5G04L 1H2KA 5BNQA 4NWWA 5C9AA 5EYYA 4CDQC 1OKQA 3AZXA 2V72A 1PO22 4H7LA 4CEWC 2JDUA 2OZJA 1HIXA 4PQQA 1HQWA 2WO3A 2VH9A 2Q5TA 4OVEA 4A7ZA 4FAHA 3MPPG 1HXS2 5DZGA 4CCJA 2VMGA 4HVOA 4B7KA 3DYPA 3RZJA 1ENXA 1RUNA 1JHJA 5LASA 3FHAA 1JYIA 4ONUA 1DIWA 5IHRA 2KM2A 2DF7A 2RS52 4N9IA 4FCAA 5EWSA 1ENSA 4L92A 5FRAA 5FY8A 1QOOA 3LDKA 5FYTA 5LWBA 1UWWA 1OPMA 2ZXQA 1TME3 3Q8AA 4JC1A 5CG9A 4DMIA 1LAJA 2RG4A 3BIEA 3G6JB 3LAGA 2TEPA 5GZEA 1W2TA 1JYTA 2GMMA 1NKGA 2HBTA 2X29A 4OHVA 1PIV3 2P3JA 1C5HA 2VQ0A 2DCTA 1VBD3 2EIDA 4HN1A 4HFSA 1N3PA 4PBPA 4J1XA 4OZXA 4B1MA 4QPIB 2A3XA 3J26N 4WV8A 3USUB 4BIOA 1FAYA 4YVWA 2VTXJ 2WIIB 2VZTA 4MLOA 1BKZA 2DUOA 4IEYA 1REDA 2GNDA 1MS4A 1YQCA 2YFZA 3PVOA 1GZWB 1LODA 1J1LA 1RUE3 2WNVA 4JTNA 5FREA 1WD3A 3KF3A 5FZFA 3W59A 2BW8A 4K8FA 1QJX1 2CHHA 3LDBA 1SFPA 4M00A 1W6MB 5LEJA 4LOTA 2I2SA 1CIWA 5I8YA 2ORZA 2QQNA 3FLRA 3WCRA 1LHNA 3V0AB 4YRDA 3CBNA 2CNAA 2XWJB 4NAOA 5T54A 2WUHA 3VD7A 2ZS6B 2A6WA 4C90A 2WS91 5C3OA 1BMV1 4E8DA 1W99A 3CJIA 4IUGA 3X29B 1K45A 2GNMA 4K1YA 4B8EA 1F8VA 2AYHA 1PZ8A 3HQUA 4F8AA 3SCFA 4Q0SA 1CD3G 3HBZA 4GMP0 2ZEZA 3DECA 3GZEA 3CL1A 2D6PA 5C71A 2RS13 5E1RA 2HEWF 1QJU3 3ZPYA 5IFTA 1ST8A 4CEYB 4UBGA 1O5LA 2JG8C 2QQJA 2PAKA 4QXKA 1GWMA 1YXWA 3MFCA 4PI0A 2VZSA 4QX5A 3OG2A 1VALA 5FJKA 3W5NA 4JHTA 4KU7A 4N43C 1RIRA 3AZZA 4NVPA 2DYCA 4ES8A 1C1FA 1XJAA 2W92A 3IAQA 4QX8A 4LULA 1TMF1 2D6LX 3H0OA 3EQEA 2ARAA 4GQ7A 1FNYA 1C4RA 2X05A 1UYXA 1Z7S1 4BMEA 4XF0A 5DUVA 4AI2A 1SDWA 2D3PA 4Y24A 2IZWA 1QQP3 3ZYPA 4BQ5A 1FOD3 1UNBA 5LBFA 1WMXA 1HN1A 3TN91 1RHI1 1ZZ7A 1AYN2 1AR71 1ASJ1 1OQEA 2BNNA 2RS32 3CHXA 3NL1A 5A3OA 3LZZA 5L9BA 4CDUC 1OH3A 2K2SA 5L9VA 2XBO3 2Q8DA 5HCBA 3OEBA 1MS0A 1CZVA 1U5ZA 3GDBA 1MS8A 4MHRA 1RUH1 2JG9A 4DQAA 3WNNA 1XOYA 2XOMA 2OZ6A 2Y6FA 5A7OA 5LY2A 2F6BA 3NMBA 1XBFA 5FPXA 4AVTA 4NIIA 2NPIA 4HKLA 1GOGA 4K9SA 3BU7A 1V70A 2GN3A 3LEGA 5FY4A 4GWIA 1TNRA 2WRAA 3UGFA 1DBNA 3BTAA 3RRDA 1KDMA 4YSFA 1I9RA 3BPSA 3ST7A 3S0MA 1NCRA 4A3ZA 5L7OC 4QU1A 4WM8A 2P2KA 4LK6A 4QX7A 1X82A 4B4QA 1KD7A 3FHIB 2UU8A 1OT5A 3AYAA 3M3IA 4Q1RA 1S55A 4CP9A 1Q8VA 1MS3A 5FZOA 2VXRA 3FE5A 2OW4A 1IZ3A 4MZUA 3ZYRA 5C8CC 4AEMA 1YIPA 4PJYA 2ADDA 2A73B 3B3QE 1MPXA 2QNKA 1YRZA 3JQXA 3KV4A 4LIVA 4ASMB 1JZ5A 5ANQA 5H9SA 5JOXA 5T5JA 3VD5A 2VOWA 3PNAA 1SHWB 1OXCA 3SH3A 5E89A 2QE3A 2PHXA 2OT7A 3MI8A 3PJQA 3RGBA 2AR6A 4YGEA 1D4M2 1K5JA 3AVRA 1MZFA 3LWCA 1NCQC 5FZ8A 3UESA 4E2GA 5JZGC 1NX9A 5FZLA 4I3PA 1DLLA 4TZDA 4KWUA 1SQ4A 3T09A 4QX2A 3VDAA 4I0AA 3ITQA 5LEKA 3WNLA 4XPVA 4NHXA 1G6NA 3RJ2X 5FZ0A 1BQPA 2BFUL 1R083 1MVEA 3ASIA 3IMMA 3K48A 5K7PA 1LU2A 1CAUB 3M70A 5CFCB 1N1VA 4AZZA 4CU7A 4HK8A 3VBOC 2C6SA 1H4HA 3VDCA 2VBBA 4XFBA 4Y1XA 2X10A 5KWRA 2BBAA 3U4SA 1V6LA 4Q0VA 3LA2A 4JDNA 5CIRA 2VZUA 3WP6A 5DMYA 2A6ZA 2AACA 1R093 4NPRA 1VBE1 1J3PA 1BK1A 5FOJB 1V9U2 4M0HA 1IPKA 3T08A 5M0TA 2Y6GA 1JH5A 5KHJA 4GWJA 4EQVA 2OPKA 1POQA 2D43A 3AP7A 3J7MA 5CISA 1YIFA 2V4AA 1O8PA 3J8F2 2WN2A 4IV1A 3JD71 4KWLA 4Q26A 4LKDA 4BISA 3ME2A 1V6KA 4XW3A 2AH2A 2D44A 3KV6A 4ZU4A 4CUCA 5A33A 4RYDA 3JBG1 1QF3A 3ON7A 1GKBA 2CU5A 4DEQA 5ABJB 4Z07A 4Y20B 3I2GA 4AI9A 1W9YA 1HB1A 4IE0A 1POV3 2XUEA 5IJRA 1B35B 1UIJA 1TQ5A 2E63A 4Q0UA 2RDQA 4J25A 4LE3A 3C7OA 3FLPA 5JR7B 3ZSMA 1AX1A 4P9XA 3VDDA 2VMDA 3ZM8A 4XF1A 2CGNA 1HRI2 3NAPB 4CEWA 5FPAA 1SPPA 3ZMNA 3WNOA 5F3CA 5IVJA 2JB8A 4KGQA 4NIGA 5K4LA 4JVAA 2UWBA 3GZAA 4AE2A 5KHKA 2RMU3 3U4XA 2P34A 2X09A 2GNBA 1QDOA 3MUY1 4LOSA 4H2AA 1E5RA 1COV3 3DXTA 2X8KA 2E9QA 3ELNA 5FUPA 5J96B 3RZHA 2VVFA 2W1QA 4HPKB 4WVVA 3VBHC 1G9AA 1H8TC 3WNPA 1UD1A 1XNCA 4RFRB 1JU3A 3TYJA 4Y33A 1AUYA 2BERA 3E5XA 2ET7A 5F3GA 4TWTA 4AEDA 3INAA 3WLUA 5C4WA 4C1WA 2ZKNA 2BVBA 2QKDA 2XVKA 4A4AA 2R6QA 5KC6A 1UZYA 4NMIA 2R062 2QTWB 2HWE2 3FBMA 2AC1A 4BZ4A 4CCKA 4ZKTB 2BDRA 4P5YA 3ZFGA 1HRV2 1WMDA 5A32B 4B29A 2FD8A 4BQ2A 2IXKA 3WG2A 2VQTA 4F7ZA 2DFCA 3HQRA 5A6YA 4D7SA 2BYVE 4XF9A 3SNMA 5FQ0B 3W9AA 4FPCA 3B94A 2BGCA 3MW4A 1VMJA 4FFIA 3KQ4B 2BP6A 1AR63 1SZBA 2KD7A 2R1DA 4MXWB 5ACA2 3RZZA 1XC6A 1CPMA 3ACFA 2GSYA 5D8AA 1Y4WA 5JXHA 1L3JA 2WO7A 3HD8B 5F6KA 4DO0A 3HNBM 4JGYB 4K3UA 3VZKA 2QBXA 1WA6X 1W3VA 3OTFA 3OGGA 3VB9A 1DGRA 4QKDA 2FMYA 4KU8A 4A3XA 4XQ4A 1WCSA 3DF0A 4AFMA 4YFWA 2QDNA 1CJDA 2GH2A 4LKFA 3UETA 3VKLA 2AENA 1DCSA 2XG3A 1ZZBA 4GA9A 3H7JA 1BJQA 4OCTA 1JUHA 1VBD1 1JZ6A 2PMWB 1AR81 1RUC3 2GDFA 1EAH2 5F5QA 3V64A 5LBCA 4EN9B 4KNCA 2HWD2 2VOKA 3ES4A 5FY9A 1F2NA 1STMA 1W2UA 1WZXA 3RI8A 3VHPA 3POWA 1QY4A 3J9SA 1AXYA 3MUZ1 1NA1C 1ND2B 2XQRA 3AZYA 1BEV2 1ZZCA 2ES3A 2VMHA 1DF0A 2E53A 2JD9A 4HZFA 3PUHA 1LOCA 4JCKA 2PLV2 4N43A 2BU9A 3U37A 3TEWA 2QCSB 2AZ5A 2MEV3 2AUYA 2PFWA 3IM0A 1R1A2 1UU5A 3ZFFB 4RGGA 2Q8OA 1EV13 1D4VB 3ZFEC 1DZTA 4CDQB 1OD5A 5J09A 1J83A 1RL3A 1W2OA 2H6BA 4QHBA 2WZEA 3RZGA 5IWFA 1GZ9A 3O0XA 5JSOA 4FQZA 5FUIA 3ACHA 4O65A 5DAVA 5HPOA 1JODA 2ZX2A 5ISLA 5J1XA 2OKXA 2OS2A 2RJLA 4FT8A 5EPAA 1FT9A 2G1MA 4NPLA 4CP1A 4XE9A 3WVJA 2QZ2A 1PO23 3BTYA 4S2FA 3WNXA 5FWJA 1IQAA 2OUJA 3EB7A 1GNYA 2P6CA 3T0BA 4AGVA 5E88A 5T3NA 4L11A 2MPFA 2CWMA 5FBZA 2VMCA 3VBSC 4QPGC 3KM5A 1Q8PA 5CG8A 1ZRIA 4JAAA 5FP7A 3OCPA 3OJBA 4V2WA 3VBUC 2PELA 3PVEA 1SFNA 4HKOA 3KGLA 1QWRA 4F83A 3PTRB 2D97A 2HWF2 2PA7A 2VVDA 3PU3A 4LMFA 2VZRA 1WBLA 5AVAA 1DLCA 1GR3A 1XYOA 2UWAA 4K1ZA 5TSWA 4OI2A 1IS3A 2JWPA 2D7FA 3AB0A 4BQXA 1O5UA 3FN9A 1G9FA 1W0OA 4FOQA 1AZDA 3WQ1A 5FPZA 1LJ7A 3BCWA 3WDVA 3ZXDA 3GNEA 1RINA 3O0WA 2PQSA 4YW2A 5HI0A 2DVBA 1YO8A 1S0IA 4G3YC 4W6YA 5F3EA 3ZYIB 1QH7A 4AFCA 1KDKA 5I0TA 2R49A 4KBBA 3AP4A 3ZN4A 1MEC3 1OLMA 3VBRB 3U10A 1RUF1 1NCQA 1UKRA 4RR3A 5FP9A 4META 2DCYA 1O6UA 3TEYA 4M01A 4QGLA 4XBNA 5T50A 1S0CA 4NO4A 3PU8A 1OURA 5C9AC 5DAWA 5FYUA 3UK9A 4HANA 4Q27A 2IXIA 1SLLA 4BOWA 3H8RA 1UX6A 3HN3A 2H0BA 1M06G 1JOJA 4QDQA 1LOFA 1VBB1 3FZ3A 1LHWA 4GD4A 1X50A 3POSA 3T2TA 3WQBA 5JDBA 1MS9A 3ZIXA 1AL21 3EHKA 3POGA 1ZRDA 2J1EA 2NM1A 3IWZA 3H9AA 4HMZA 4ZPIA 3VZNA 5DG1A 4AVAA 4CCOA 1IKQA 2WDBA 3AMPA 1PVC2 2Y6JA 2XHNA 4JV4A 4XCBA 5D2AA 4A41A 5C3QA 2VCMA 2YXSA 3S6PA 2CV6A 4FSJA 4R9DA 3MIEA 2BOJA 3W20A 2A6VA 2JX9A 3ECQA 3NJZA 4IE4A 1RJ7A 1LEMA 2I07B 1UY0A 2JB4A 4MX3A 4K20A 1XNAA 1GSLA 2E33A 3RSJA 4Z1VA 1NE6A 5FP8A 3T2OA 4AWDA 4BB3A 3LEKA 2E6VA 3BN6A 4FTSA 1WA4A 4OMDA 4CCNA 3GZTB 1ZA7A 4URAA 4LK7A 4XIOA 3IKWA 2CAUA 4ISRA 4XYXA 2B5HA 1S0GA 4CDUB 3AKTA 3QBQA 5LCWL 1GANA 4YVWC 1N1TA 3ZPOA 1K5MB 5FLIA 1JUIA 4WM7B 3H1WA 3ZSJA 1S0BA 4XJ9A 1VAMA 4LBQA 4W8JA 1PMHX 4V2VA 1NG0A 3OY8B 5FZ3A 1JYCA 2JDYA 2BZDA 2WNVC 2WJSA 3HQXA 2WSVA 2JE9A 1GP4A 2ZJCA 3O5SA 4FQ4A 3ZN5A 4FP3A 3THCA 4N8MA 2GMPA 2K46A 4P14A 1RUG2 4PDWB 1XXNA 1ONAA 1O7FA 1Y43B 1JZ8A 1LECA 3ALQA 1Z7S3 5FO7B 4FP2A 3H8XA 3QH7A 1PMIA 5L7OB 1BYHA 3CJIC 4MADA 3TN93 4XFFA 4KWJA 3ZDVA 1YFYA 4XOGA 4NIHA 1DP0A 4HK9A 3DKQA 4Y22A 3ZYBA 1ZBA2 3H7YA 2ZHMA 3THDA 3VL8A 5F2WA 2VW1A 5BNNB 1JYNA 3O1OA 4XVHA 2GP5A 5C8CB 2NLRA 3EO6A 3Q8EA 2GALA 3DV8A 4TXWA 4NRQA 5FO8B 1WBFA 2P6HA 4XBQA 1VIWB 3GALA 1W6PB 2R071 1POV1 2R0HA 2AGSA 1IPSA 1OC1A 1VRBA 2XONA 3KCXA 1WCDJ 2A75A 2BBVA 2N7GA 1O3SA 2WFF1 4RS5A 1RUI1 4W6WA 4AI3A 1Q8QA 3FUOA 4FPFA 3THTA 2DU1A 2G19A 3KVBA 5LK5A 1UAIA 3ABZA 1JTZX 1NYWA 3UKVA 5L9RA 4CU6A 2ZX0A 1WD4A 3IDCB 4O9GA 5T55A 4D3WA 2V5DA 1YYNA 1SBFA 3I2FA 1CAVA 1HJFA 2G9ZA 4AR2A 1GICA 2IUWA 3RNSA 2VZOA 3EXUA 3FFQA 1JYXA 1H2LA 1I5ZA 1REFA 2WC2A 2QDRA 4IGOA 3VDBA 4QX0A 1S2EA 2Y6LA 4JTOA 4NROA 1OA3A 1JU4A 1W8ZA 4I0WB 4EYUA 2WWJA 3ES1A 3PVBB 2XJPA 4YW1A 4YZ1A 3TOJA 2JG9C 3E6CC 1SMVA 4KL1A 3D5OA 2D6OX 3RMXA 3HN1A 3ZYHA 4BMBA 1W6QA 1W8NA 3PDQA 2PXJA 1X9TA 4FPYA 1FXZA 4NRPA 1D0HA 1PZ7A 2BWAA 4I0BA 1JW6A 4AVCA 4W4ZA 3IB3A 3P1IA 4KG8A 3OEAA 3K75B 1YQ8A 4NAMA 5D1IA 3TRSB 4LE4A 4LO6B 3CLPA 1AR61 4A7KA 2WSUA 4WM8C 5T52A 1DQ4A 3K4DA 4AQ2A 1WGPA 4C0HA 1R1ZA 1OF4A 1AHSA 1LENA 4AI0A 1ZBE3 2BNOA 4PIZA 4Q0QA 5FYZA 3ZIWA 2W2IA 4CDWA 4E27A 4NIAA 2QFEA 3ZR5A 3DGTA 1FPN1 1VBC2 1W28A 2WT1A 3J8F3 2HBUA 3D8CA 1AYM2 2Y64A 4EWAA 2Q30A 4WBBA 5EZWA 5BY5A 1VBE3 4YGDA 1UF2C 2WNOA 3SCGA 4BLIA 1ULEA 4M0NA 2C5DA 3Q8BA 3ZSLA 3BPZA 4LQRA 2LTNA 1NQJA 2HWC2 2XQXA 5FPVA 3N7KA 2L9LA 3I8TA 4S2HA 4FPLA 1YNAA 2WAOA 3PMEA 4QKBA 4FAGA 2QQMA 3MO4A 1GP6A 2BUKA 1CAWB 4KMQA 3VBHB 1RUC1 3APBA 4LORA 1H8TB 2D6KA 2NMNA 3ORJA 3LSDA 4UOJA 3KV9A 5FYBA 4AHZA 4ZONA 4J1WA 1VMHA 2VCCA 2DBNA 4LBKA 4XIKA 5FZKA 4RQPA 5DUXA 4LBNA 3WF3A 3WUDA 3MHZA 4P9IA 1H4GA 3BKZA 3T1LA 2BRTA 2UYAA 3F2ZA 2Y8KA 3NVCA 4XACA 2MEV1 2RDSA 5FOBB 4R8HA 5C6CA 4BJ0A 1O59A 4ES9A 2XL7A 3WG3A 3J4UH 3V56A 1HB3A 1MQTA 4AI1A 4XTPA 1BBT1 5A1FA 3PUIA 5FYCA 4XC9A 5JLVA 2J1SA 4R9BA 5FY7A 4NJ4A 4OHWA 5A7SA 1GU3A 2ERFA 3AYCA 3BYWA 3CF6E 3I3QA 3M3QA 4Q8LA 4Q5OA 2JIGA 3AX4A 1W6MA 4FOYA 3ZYGA 4CZSA 1W0PA 3MW2A 5BNPA 4COWA 1RB8G 2XLFA 4P00B 3NV4A 4E9KA 1PO21 2YZ4A 3LB9A 1G9CA 4NE9A 1G8WA 1ZNPA 1WLTA 1YJLA 5EFUA 2QQVA 3FLTA 4SLIA 3ZN6A 3T2PA 1UZ0A 1HXS1 3K3OA 5T5PA 4L8QA 1LNSA 1GLHA 2ZABA 3UGHA 3VDDC 5A3NA 5IFPA 5C33A 5A3UA 3VN4A 2VTFA 4DFSA 1UXXX 1XRUA 1OA2A 3I4IA 3OUIA 1VBA2 2Y26A 1WWYA 1H2NA 2CWSA 3SMHA 3HT2A 3VKOA 1QDCA 2ARCA 1NA1B 5DXDA 1O8SA 3NV2A 3ACIA 3P3PA 4HETA 2LUWA 4AGGA 5FUNA 5LY1A 2K0GA 1JI6A 3A0KA 2HWD3 3SC7X 3ZFEB 4AEDC 4G9SB 2VPVA 1DFQA 5GJ6A 5B2GB 5C4WC 1MEC1 5C8WA 3E6DA 2XGXA 1W6NA 4CUBA 1DZRA 1LOBA 2B39A 5FZGA 3WEZA 1H8VA 1AR83 3ZFGC 1W0NA 2DCJA 3RZLA 3FX3A 4A42A 4BQWA 1PK6A 5CKNA 2WZR2 1JZ7A 3E97A 1DGRN 1SEFA 2KR2A 4PQ9A 2YUEA 4FVVA 3M1HA 5EJ1B 1FMD2 1CR7A 4W50A 2G9GA 2VW0A 2ZMKA 2VULA 3ZYJB 2WNEA 4YW6A 1U0AA 1AL0G 2QQWA 5D8AC 5I0RA 2VUCA 4IV3A 4QPGB 3L9JT 5F2SA 5GZFA 2XVLA 4QD2A 4LBOA 2RE9A 3I3DA 3VBUB 5A7QA 3TBDA 1OQDA 4TYSA 2C4XA 4LBMA 4QPWA 3O1SA 4ZY9A 1GZTA 5FZ7A 4LIUA 1XE0A 2A3YA 2WQ4A 2VOVA 4NRMA 5A3WA 1PGL2 4OMCA 1ULOA 4I3GA 1FV2A 3HVDA 2FCVA 5FPBA 2VCAA 1VB4A 3AP6A 4YVSA 4OYUA 3POJA 5FLHA 1OPOA 5A70A 3BODA 2Y38A 3OF1A 2TNFA 4LLFA 4IE6A 1VMFA 4D7TA 1V6NA 2B9VA 2CYFA 3Q9OA 1CGPA 4PBOA 2YG0A 4A6OA 4QHOA 3I7DA 4LKSA 5CKMA 3RVHA 1QJX2 2VMIA 4GMP1 1VB2A 3S7EA 2J1TA 3GBFA 4DZGA 1CIYA 3SCHA 5CADA 3WP3A 1AYN1 1G7YA 2RS31 2Q4SA 2LROA 2DURA 2PN5A 2V73A 4HSLA 3BTXA 1BMV2 3EYPA 3FC0A 3NNFA 1RUJ2 2R042 4N7IA 3TAYA 1YI7A 4RHV3 4IE5A 3BTZA 1ACCA 3C7HA 4Q4Y3 1VJ2A 1HDKA 2R7EB 4A6SA 5CFDA 2FDKA 2RHPA 2D5FA 2RR13 4OQ9A 4Z2AA 3OBZA 1EP0A 1WCKA 5L73A 5JMOA 4B4RA 3VHOA 4N53A 1LGNA 4NUBA 4XJWA 3E1F1 2BEOA 1PGW1 1M4WA 1RUF3 4NN0A 3QH6A 1GV9A 3AC0A 3B02A 1GOHA 4X6QB 5FCCA 4DEVA 1CONA 5I8TA 3CEWA 3H8UA 3ZMOA 4YNIA 3WY6A 3N9PA 1PVC3 2O1QA 1VBB3 1S4CA 2ZGRA 4IEQA 4AAXA 2EIBA 3KT4A 5C7GA 1ND3B 2B42B 1AL23 2QJVA 5KBFA 2IC1A 2VZ1A 4YVWB 1F4HA 2D98A 4CU9A 3WHTA 3NWKA 2W1SA 2WINB 1OMIA 3TNQA 3MV01 1AR72 4TTGA 4CDXA 1QOSA 1V6OA 2CL2A 3MF9A 4FO9A 1D4M1 4LXLA 1ULPA 2E7AA 2HJIA 4XFIA 3POEA 5FYSA 4CPBA 5JOWA 1IGOA 4AFAA 2ZA9A 4H14A 3B69A 4DUVA 2PHWA 2DVGA 3I59A 3AL6A 2BQPA 2NYYA 1KJLA 1S2KA 3DUIA 5AC92 3NNMA 4B7EA 3C8XA 5DQ0A 4BK4A 4PLMA 1V6MA 2W94A 4RFT0 1EY2A 5FMOL 5F9TA 5FPLA 4OI4A 4RR3C 4GKYA 4C0BA 3CJIB 2XJVA 4QQ2A 1LHVA 3AZWA 2ZX4A 4Q4V3 2GC2A 2ZAAA 1F9KA 4Y1UA 1UPIA 1VR3A 4UXAA 4GAZA 4XILA 5J37A 3KCCA 4XJAA 4DXZA 3F95A 4UI9L 4D94A 2NQYA 1P8JA 1LOFC 1XPWA 5IVVA 1GQHA 1XNKA 2VJXA 5BUVA 2FDIA 1UYYA 1ZBE1 3IMNA 5A3PA 2JDMA 3LSEA 3CKHA 2EAKA 1BCXA 3M3OA 4OFGA 1Q5OA 5LA2A 2CGPA 4FXKB 1ZBA3 4Q29A 4M3CA 3J8F1 3K51A 4XURA 1AVBA 1FYUA 1QOTA 1XSQA 2YGLA 3AM2A 4AF9A 4AVVA 4D6RA 4MXWA 3A23A 1HV0A 1IS5A 3AMHA 2WKKA 1O4ZA 3N9QA 1QJFA 2YC4A 3KF5A 2JENA 2WLPA 4D8MA 4C1XA 4D0QA 4JGYA 2A6XA 4KGGA 2C0ZA 1OLRA 2VG9A 4XFCA 4YM3A 3TB0A 5H9PA 1YFUA 3N35A 2A3WA 3MIFA 1CAXB 1U5XA 1X36A 1Z78A 3NNLA 4YG6A 4Z82A 1HRI1 2WA4A 1HJGA 4HONA 4AQ6A 1LTEA 3LA3A 3SH4A 3UJOA 5BNOA 5SV5A 2R073 3LF7A 2D40A 1JYWA 2CAVA 1PX4A 1H6YA 2WFF3 4N9HA 1N3OA 4YWAA 1RUI3 1ZZ9A 4W65A 5HCHA 4IDZA 2D3SA 2TUNA 1OBNA 2HYXA 2KA3A 2XB6C 3JUUA 4MOAA 5JSRA 3RYRA 1JZ4A 2YV8A 1ALYA 3PIJA 1NE4A 5EP9A 3HR9A 3U07A 2JXAA 3QCWA 4Q4W2 3H1YA 4P9WA 3WDTA 3PUAA 5FZ4A 3JQWA 4IERA 2Y34A 4GH4C 3T1MA 2XLAA 3AXDA 3POYA 5GLVA 2FDGA 1NCRB 4QKFA 1J3RA 4LHKA 4IQPA 4DNYA 4PCRA 5JOYA 3WW1A 2PHUA 1C5IA 2YYOA 3ZFFA 1ENRA 1N47A 1VLNA 3N4MA 2R061 2FCTA 1DZQA 2HWE1 4JZRA 1VAKA 4CP9B 1HRV1 3IIIA 5FZOB 5FYIA 4W6XA 3VUOA 1AR92 3NNGA 2IXJA 2B46X 1ODMA 2YPJA 5ANNA 1HN0A 2YDEA 3BGAA 5G05L 4OUEA 3ACLA 3WW4A 5A1LA 4BM8A 3CDZB 4P9YA 4D6SA 2K9ZA 5DDJ2 1LHUA 2Z5WA 1EUTA 3KWVA 3CNAA 4IEOA 3MBWA 1QJY2 3GF6A 2E51A 4QAWA 3R6SA 3VL9A 1RUD2 3C7GA 1PO13 3MDPA 3MIBA 4HSJA 4RS5C 5BPXA 4BXFA 3OPZA 2IXCA 4NWVA 5JWPA 4WVMA 1LESA 2VOTA 1OD3A 4COVA 2XJQA 5A6XA 2JIJA 4LA3A 1Y9QA 3LCPA 5KXCA 1EPZA 2WNUA 4E4ZA 1LRHA 5F5AA 4EN0A 2VUDA 1RXGA 3NQHA 4BWOA 2PHTA 3SISA 2D5HA 1H1IA 2HWC3 5FK7A 4YARA 1FPN3 3I2DA 2GMEA 3LEIA 4U2AA 3S30A 5H9QA 3SXWA 4XZPA 1Q43A 1D7PM 3O1VA 3VBFB 1C1LA 1A6CA 1NQDA 1LOEA 1RVF2 2HWD1 3AKRA 1UPSA 2NMOA 4M4PA 5FIXA 3V0AA 4QQHA 4KG0A 5JI9A 2GU9A 5JXJA 1G86A 4IW3A 5KXDA 4L99A 1XSRA 1CN1A 3SKVA 3IBMA 1KEXA 2W5FA 3C3VA 5FZBA 2X5IA 3ZXKA 1TNFA 5FDBA 5FO9B 1AJKA 2VQUA 4GB33 4XBLA 2VZQA 1OH4A 1R1A1 4KWKA 4IV1B 1W6OA 4CCDA 4C8DA 1VRH2 1CPNA 5GZGA 2WZ8A 2ARXA 2JE7A 2Q8EA 1UU4A 5BXXA 4QPYA 1ZREA 3VD4A 3ZLIA 2UURA 2ZZJA 1AF9A 1LGBA 3I97A 3SHRA 3FUQA 3VD3A 1BVP1 1Q56A 2WWUA 4QQPA 4TN7A 4ATFA 5IATA 1OOPB 2AREA 5JIAA 2WQZC 4CDWC 3N9NA 4JRAA 3AMNA 2ZX1A 1BBT3 2PYTA 3VDDB 1QJZA 1A3KA 1U12A 3DYMA 3GHMA 4NHMA 4XQWA 4CEWB 1SPPB 3WSOA 5JSPA 5T5OA 1S0FA 2DTYA 3KGZA 1TME2 3FMGA 2D3RA 3LFMA 5F37A 3SLIA 4XMAA 1OF3A 3OOXA 2OQ7A 4BHPA 1W03A 1D2QA 1PIV2 3RWNA 1RMU2 1ZA4A 4Q8KA 4XJZA 3H50A 3N9LA 1J84A 3I2JA 4AW7A 3ZXJA 1YQ2A 4PLOA 4YW4A 2C26A 2HH9A 3RYPA 3OUJA 2HWB2 4MVTA 4XMIA 2Q1FA 3PVNA 2ZAHA 3N7MA 5FZ9A 2ARBA 2HWF1 4AEDB 1CESA 2DV9A 4RQPC 1HXS3 5KR7A 1RUE2 3WOGA 1NXD1 3T0DA 3AVSA 4XUPA 2LM3A 3AKPA 3M8LA 3QLQA 5C4WB 1BK0A 4XJUA 1UOBA 3PUQA 3V0BA 5FZAA 2WABA 4R52A 4A45A 2RS53 2XVGA 1X8EA 3ZFGB 1RXFA 2W39A 2WYFA 3OYWB 4QHZA 4UAPA 3O7OA 2DUQA 3I2IA 3HWJA 4YW7A 1MQTC 2FQPA 1W39A 2BTVC 4ZXKA 1AJOA 3MF6A 1OUXA 4RHV1 4IESA 4Q4Y1 1V6JA 1V6IA 3ILRA 2RR11 2YMZA 4PDWA 2FCUA 1X33A 3AFGA 4Y1VA 5D8AB 2ETEA 3I54A 2VW2A 3OSDA 2Z2SB 3NO8A 2RS12 5A7PA 4R9AA 3WF1A 1QJU2 4BIFA 5BNPC 5J48A 4IGPA 3VZLA 5J7MA 5JCTA 1C8M2 4WZFA 4XAEA 4LBJA 2WZR3 5IVFA 2JDAA 3UL2A 1E57A 2WYSA 1SBEA 4FPOB 2PHRA 3T30A 1FMD3 2OIIA 4AHYA 1HB2A 4GJYA 4DRRA 4AQTA 5J36A 3FJSA 5IVYA 2FZ2A 1OHFA 3ZO0B 2LRPA 4DXSA 1SCSA 2YHJA 1UYZA 2V09A 3HPNA 4LBLA 5LA9A 4EN7B 2ZEYA 4QQLA 3RPQA 4BQ3A 2Q1ZB 1N1SA 1PVC1 1WMEA 2QUOA 4K8RB 2IFRA 4RSUA 5F6LB 5HXMA 3N7LA 4AI8A 3LE0A 2ZOEB 3I2OA 1W8FA 2P3YA 5F1RA 2JG8B 4XCAA 4HVRA 1QQP2 1HLCA 2W91A 1FOD2 4FBFA 3RJRA 1SLAA 2VCBA 1QKQA 4HXCA 1LOAA 2PHLA 3WHUA 1WUVA 1J1TA 1IOAA 4N43B 3ZR6A 2VVEA 5FYMA 1IG3A 4EROA 2XBO2 4DINB 2ZACA 4X8PA 3AKQA 3GHNA 5IVBA 2DVDA 2BGOA 4NHLA 2JECA 4JHZA 5JOZA 3WINE 1OQ1A 3KVAA 3A21A 3LOIA 1ZM1A 2P3KA 3IT8A 4LITA 5CB7A 4EN8B 4LO8A 3H3ZA 3USSA 2J7MA 2YB7A 2XJRA 5FFOC 5LA1A 1UZVA 5IK4A 5K0UA 3B9IA 4Q4V1 1PK6C 1O4TA 5FKCA 5AFBA 4XUQA 4CCLA 4JGZA 4MGZE 2J1AA 1DQ6A 2TBVA 3UKTA 4B4PA 4EE2A 2JJ6A 4GMP3 3U11A 2ZX3A 1ODNA 1JXNA 4HT1T 4YGBA 4LTAA 1JHNA 4IV3C 4DXRA 4KBZA 1AYN3 2RS33 1O4YA 1QHDA 2ZHNA 1ZBA1 5IK7A 1JOPA 5LK7B 5EQUA 4IL7A 4GH4A 3CIHA 4LKEA 3L2HA 3VGIA 3OB8A 3KHBA 4Y5TA 3DYOA 3DPRA 2ZMNA 4Q4X2 1QEXA 1TZOA 4QX3A 2YY1A 3B00A 1URXA 4CP2A 2YGMA 4YVSC 4CUAA 4RA0A 3PUSA 4UYBA 4Z8BA 3CZJA 3OBTA 3PHMA 2AEZA 4GULA 5K8SA 3SEPA 4IEVA 1R082 5DZEA 3N36A 1UIKA 2HEVF 1BVVA 4SBVA 3O1PA 4TLGA 3NW4A 1W9SA 3S7IA 3N7JA 4RL7A 5A7WA 5C5UA 1DYPA 3TEZA 1POV0 3NKGA 1UZWA 1XNTA 4UF0A 1CAWA 1NCQB 2E7TA 3A22A 3IIAA 2D6NA 4RR3B 4E4HA 4ZU7A 3O14A 5JZGB 1PNGA 2WFPA 3H8OA 2EICA 1I5PA 2W1WA 2Y0IA 1R092 3Q8FA 4MGIE 5A6ZA 5C3PA 3LQCA 5FPUA 2IVIB 1DDLA 4B3NA 2CTVA 2A6YA 3R4DB 2EA7A 1NY72 2MHFA 3D82A 3GM8A 5F3IA 5AC93 2RM22 1PGSA 2W52A 5FXVA 2ZHKA 4DS0A 2XJSA 2JKBA 1D4M3 2YROA 5CFDC 1VPHA 3VBOB 1VAVA 3B7MA 5DABA 5APAA 1SDDB 2P17A 4XZUG 1J3QA 1S0EA 3ACGA 1H0BA 4I2OA 2A71A 4QMAA 4MGQA 4QU2A 3H42B 2B7YA 1N3QA 4BCUA 2XJUA 4LO7A 4XFAA 3RZKA 4N53C 5FXXA 3RG0A 2AEYA 5LW9A 2NN8A 3PL0A 4OHZA 4XFHA 3WCSA 5K9YA 2FZ1A 2HYKA 2JKXA 2Z4FA 2VTXA 4UFJA 1DQ2A 4DIQA 3K4ZA 2DWRA 3AYEA 3M4FA 1KFXL 5GALA 1PO11 5D21A 4FOVA 4AG4A 2Q0AA 1NLRA 2VQAA 5JIUA 1UL9A 2RMU2 2J22A 1AYM1 3UV9A 2JICA 4K7JA 4YG3A 5FZMA 4INDA 5GZDA 2O0OA 1COV2 1V9U3 3HJRA 3MW3A 4QXCA 3ZXEA 1IPJA 1V0AA 3U1XA 5EJ3A 2HWC1 4AXOA 1H1MA 2QQUA 2SLIA 3NAPC 3WW2A 4COUA 2FBEA 1DGWA 1YCIA 2WAAA 4FPHA 3NRUA 2A1XA 4UFMA 4CDXC 4QX1A 3TEXA 3POBA 5AFEA 5JAXA 5JPNB 1A8MA 2WL1A 2ZZQA 2R32A 1OLME 5LBBA 3WV6A 2XJTA 1V00A 1YHFA 2LS6A 3RQ0A 1IS6A 1G9DA 1CWPA 5FP3A 3B9CA 1I6XA 2OQ6A 5KHGA 4UBHA 3R4SA 3W5MA 4QWNA 3VZMA 2BFUS 3OPWA 3HEIA 1X7NA 1JYVA 2XDVA 5FV3A 2YC2A 2YPDA 4XEZA 1D0GA 4AK3A 2OXBA 3D6EA 2P4EA 2DU0A 2ZHLA 2V5YA 4YFZA 1CZSA 1HRI3 1US2A 3WNKA 4QDSA 4GB31 4Y22B 3NNJA 5GZCA 1UU6A 1T6BX 3KD4A 4XAAA 4J6GA 2VECA 1DQ1A 4Q4W3 5F7UA 5CYYA 2W46A 2PHDA 2B45X 4Y4YA 3O1UA 1KRIA 3QOPA 3OD0A 4S2GA 5I8SA 1X9PA 2JD4A 4JX0A 4QPIA 3USUA 2UY8A 4UW3A 5FP4A 3NSTA 3NV3A 2O14A 4BPZA 1SG3A 5C5TA 4RS5B 1YQ6A 4TSVA 1GZCA 1Q8SA 1GZWA
chains in the Genus database with same CATH topology
1AX0A 4DB5A 3MGUA 3BB6A 1HX6A 1IKPA 5KXBA 4JGYC 2R063 2HWE3 2DVAA 2R30A 5DDJ3 4AFBA 1HRV3 3M2MA 2G4IA 2VNGA 1RUC2 3SH5A 1QJY3 5CA6A 3V0AA 4IEXA 4YW5A 4A2UA 4YLZA 1CVNA 5FAXA 1FNZA 1H9WA 2O8QA 4L2NA 2QQPA 1IHMA 5BNOC 3DL3A 2PTMA 2D93A 4UW5A 5ACA3 1A78A 2UY9A 3AKSA 1T6GC 1SLIA 3PTYA 2MEV2 1DGWX 2IXLA 2VOXA 2IFWA 1W6QB 3D4KA 4CEYA 1EV12 5EYXA 1ZX5A 2RS51 4AVSA 1YI9A 3E6BA 1S2BA 4FPEA 1H30A 3PMSA 1OFSA 4YG0A 1J59A 1RVF3 2XUMA 5BV6A 1LULA 2ZBJA 4LO5B 1S0DA 4CRQA 1GBGA 3AMMA 5I91A 3KMHA 3ZFFC 4AQSA 3OD4A 1OI6A 4CDWB 1EAH3 4QM8A 5H9RA 4XXPA 4BH9A 1GYKA 2E7QA 2GZWA 1VRH3 1XE7A 2WZR1 5HCFA 3EJKA 1FMD1 1BEV3 4FXGB 3UKNA 3AXEA 2PLV3 3ZDSA 4R4ZA 2ATFA 1R1A3 3IPVB 2ZMLA 4JQRA 1UZZA 4V1PA 1MVQA 2PHFA 5GLTA 1WLDA 3URFA 4YZ3A 2Y0OA 2WNUC 1SLCA 1U5YA 4Y1YA 3VBSB 3WDXA 1PGL1 4RQPB 1X8MA 1OLQA 1RMU3 4LLOA 1QXRA 3ZSEA 1ZRCA 5GLWA 4DPNA 5IT6A 1ND3A 1S1AA 3CU7A 4LT5A 5HXVA 5CNAA 1MEC2 3JU9A 2HWB3 1MQTB 4ITCA 1QNWA 4P9GA 3AFKA 1ULGA 4BE3A 4QGMA 1SLBA 3MIDA 2X5IC 1FV3A 3AYDA 2H6CA 3D0SA 4X6RB 2X53S 5AVPA 4I09A 5IUQA 3C2UA 5BNPB 2HWF3 4I01A 2VUJA 3VBRC 4Y1ZA 1YFXA 3KT1A 4Z92B 1LB2A 1QH6A 1RUJ1 2R041 4KH9A 3RI9A 2A7AA 3ZN6B 3AJYA 4LR4A 4AEJA 2ET1A 3B93A 5C9AB 2GH8A 3THPA 1CAUA 5CFCA 2WS92 2Z69A 1C8M3 1LGCA 2ZGMA 5I93A 1J58A 1MS5A 2DUPA 2GNTA 2EVXA 1EPWA 4OHYA 4YM1A 4U36A 5GKAC 1SBDA 3BIWE 5JI7A 1APNA 3WX5A 3AP9A 2JDZA 1XYPA 1AXKA 1QXJA 3LGRA 4Q1PA 1XQNA 2UYBA 3JCIA 1OA4A 4XFGA 1CJPA 3MZHA 2XPJA 4PLNA 3AJZA 2WT2A 3ROUA 1CAXA 2MNGA 1W6NB 1KS5A 1TMF2 5ABJA 4Y20A 1Y7BA 4AEKA 2R1BA 1B35A 1K5MC 1Z7S2 1PK6B 4WM7C 4N90A 2C1FA 4E2SA 3WDYA 5AC91 3TN92 5KHJA 5HCAA 1RHI2 3NAPA 1XYNA 1ASJ2 2ZGQA 2VNRA 4RD7A 3ZX7A 4DY3A 2WNVB 4PDWC 2EAAA 3VBHA 4IV3B 1GQGA 1RUH2 2UWCA 4TLFA 1PGW2 4FTBA 4AHXA 4ORFA 4Q2FA 4HPKA 4YW3A 5KHIA 1XE8A 2Q1MA 2B8MA 3HT1A 4MXVA 5DUWA 1NXMA 5BNNC 1ZZ6A 2YC0A 3WDUA 4XJ8A 1WW6A 4L9BA 4OULA 4NHKA 3RYKA 3KT7A 3VKNA 2SBAA 1RUG3 4YVSB 2ENRA 4K21A 3FFZA 1SLTA 3MIGA 2IWGB 3G7DA 4FPGA 4IEZA 1V9U1 4BA6A 4OUMA 5KC5A 5A32A 2RJKA 3V65A 4FTEA 2WA3A 4Q4X3 5FQ0A 3TNPB 4JRLA 1TEIA 3DN7A 1YJKA 2DFBA 1KS4A 4ASLA 4CYDA 4XF3A 4YM0A 4LHLA 3MLKA 1JBCA 3LKJA 5DUUA 1HW5A 4LBQD 1SACA 3AP5A 2GC1A 2GAUA 4IXLA 4UW6A 3KLSA 3CO2A 3VBFA 1MS1A 5CFDB 3WW3A 3BOPA 5K0UC 2G9FA 1WMFA 3KZ4C 1OFNA 3DKWA 3A4UA 5A3MA 4LO4B 2DTWA 4JGZC 5KXEA 1Y3TA 4N53B 3GBWA 4Q4W1 2JG9B 4XTMA 1ZBE2 1YLLA 4MUVA 2RM23 5I0UA 2EXHA 4OI0A 1MACA 1ZRFA 5I0SA 4XHBA 4HVQA 3JB4C 3QACA 3WDWA 1VBE2 4ATEA 4EJRA 4XHXA 1ND2A 2ZGLA 4XQDA 3P3NA 2BWCA 4WZCA 1AR91 1AX2A 4G4FA 3RDIA 5E8AA 4YZ4A 4WM8B 2XKPA 1OOPA 3JD72 4BQ1A 3DPRC 1BZWA 2VGDA 3O0VA 2O8OA 5DDJ1 4CDQA 4PIXA 3JBG2 1QJY1 2I74A 1RUD1 4CDXB 1REEA 2W08A 3LOBA 1XNBA 4XXAA 5ACA1 3I59B 3ZXAC 3MLJA 3RMYA 4YZ5A 5A3LA 2D6MA 1RC6A 1EYBA 1VBC3 2BVVA 2GN7A 1AYM3 2VUAA 4YGCA 1HKDA 2P37A 4AGRA 1XNDA 1A8DA 3EBRA 1WW7A 1YUDA 2BPA2 1RVF1 3WD5A 4YYOA 5EV7A 3VZOA 1LCLA 2ZGTA 2R16A 1MZ5A 3OYWA 4WVZA 3VHRA 1DU3D 1EAH1 1Q3EA 1LEDA 2VNOA 4M3CB 1DYKA 3CJXA 3MEPA 1VRH1 2QVSB 3BALA 1SFYA 4HL0A 4BYYA 5L19A 2ZGNA 4R4XA 1BEV1 4URTA 1ULCA 2XKOA 2PLV1 1WLWA 5CU1A 4YZ2A 1XU2A 3KCYA 3MYXA 1C8NA 5JPMB 4MV2A 1RITA 2DVFA 4BLJA 3O12A 5J3UA 3VBRA 5A33B 3B5LB 3E5UA 3IDBB 5LRSA 1NZCA 5BNOB 1TME1 4XETA 1CQ9A 3U0ZA 4GALA 1PIV1 2CY6A 1RMU1 3A0NA 5GLZA 2JG8A 1UCXA 4WVWA 3VKFC 1ZRRA 1N1YA 1RUOA 2HWB1 2XWBB 3SITA 1NLSA 2EIGA 4RGAA 1CX4A 4EN6B 1VBD2 2XHKA 3HAGA 3UJQA 1AR82 3KS7A 1RUE1 3B01A 2PAEA 1U5IA 2A5ZA 3ZVXA 4FOWA 1C3HA 4Z2WA 1VBA3 1FATA 4R9CA 4I30A 4M3CE 4DY5A 2GC3A 3M3EA 3RS6A 3HMYA 1H2MA 1HQLA 4GWMA 3ZXLA 4CDUA 4QPIC 5IK5A 2HEYF 4D69A 4Q0PA 1K5MA 4WM7A 3KSCA 4P9JA 3AMQA 1LU1A 2RS11 1PZ9A 4OHXA 3AK0A 1QJU1 3OY8A 4WVMB 1C8M1 3LA7A 3OBRA 3R0RA 4ISQA 4LA2A 2WNUB 4XF4A 2OA2A 2C9AA 3AZVA 5CBLA 3WR0A 2ZGOA 4K40A 1OSGA 2ZCWA 4IEPA 1DQ0A 5L7OA 3GYDA 4DRVA 1B09A 5BNNA 4AYUA 4IEWA 2NP0A 1KQRA 5C8CA 1QQP1 4MGYE 1FOD1 5E16A 3ENRA 3H3UA 2X5IB 4CEYC 5JVVA 1ULFA 1W6PA 2XBO1 2KXLA 5DZFA 3N3HA 1W6OB 4RHV2 4LEJA 5EXOA 3VLBB 3WQ7A 2Z79A 4Q4Y2 4P5HA 1LR5A 2FHRA 2RR12 2W68A 5JZGA 4E4DX 4K6BA 1I1EA 4GXLA 3IDEA 4H3WA 1GFF2 2WZPP 3MPBA 1RUF2 5GLUA 4OI1A 2HKXA 5LRRA 2ILMA 3WG1A 2NZ9A 3IN9A 3MICA 3ETQA 3VBOA 1QJX3 4DOUA 2ZGPA 1RTVA 3WP5A 4E4SA 2QZ3A 3WG4A 2ZTNA 1O3QA 3FBYA 5CAZA 3WQ0A 1RUG1 1VBB2 1QNYA 1LHOA 4C91A 1AL22 2WS93 2F4PA 1RUJ3 1QXPA 1KJRA 2R043 1O3TA 5IK8A 4ZU5A 2P3IA 3GBGA 2EALA 2WLQA 2XL9A 4Q4X1 4JDOA 3KQRA 1SCRA 3TWIA 3ATGA 4I02A 1HQNA 3V0BB 1GNHA 1ND3C 5GM0A 4LNVA 1PHMA 5BYNA 5J98B 4H7MA 2ZGSA 1R081 1UN1A 1KXGA 4A7YA 4FPKA 1H9PA 3D0JA 3ZXGA 3VV1A 4GWNA 1HV1A 2GC0A 4Q4V2 1AXZA 1DQ5A 1C28A 1ULDA 1TMF3 2ZGKA 4EV0A 1UMZA 4PIYA 4P9LA 1MZEA 3WUCA 4M3CF 1R091 4UW4A 1FX5A 1WW4A 1MR5A 1C57A 2I45A 1NY71 1Z0HA 1Q8OA 2DCZA 2RM21 1DG6A 1RHI3 3H0OA 4QGNA 4RL7A 1AR73 1ASJ3 1H8TA 3JB8A 3WP4A 4N7UA 4OLLA 2JEMA 2XLGA 5FLJA 2VU9A 1RUH3 5CFCC 3KB5A 1IS4A 3E5QA 4COZA 3VZJA 4GKXA 1YFWA 3W58A 3NV1A 4JDMA 4HLTA 4Y5Z0 1ENQA 3PLQA 3MFAA 4IETA 4QM9A 4MGKE 5JMCA 1BXHA 2R072 3QD6A 4LUMA 4LUKA 4EWDA 4H55A 1F31A 2RMU1 3ILFA 1ZZ8A 2H0VA 3VKMA 3L2YA 2WFF2 1COV1 1LKNA 1RUI2 2EF6A 1PM7A 1VBC1 1QU0A 1DGLA 2EXIA 5ABJC 5K0UB 1UKGA 4F3JA 1B35C 4MSVA 1PNFA 5KHHA 4CTEA 1O91A 1MZ6A 2A70A 4IEUA 4JGZB 2OVUA 1LOGA 4LBQB 4AVBA 2DCKA 3HIFA 5FMOS 4X8NA 5HBAA 1S0JA 5DG2A 3M3CA 1TE1B 1H1AA 1NA1A 1NCRC 2PAMA 1KITA 5FTTC 4GH4B 2W0XA 2PQQA 1VP6A 2OYZA 5L36A 3VHNA 4O9EA 1ZVFA 4D7YA 1PO12 3WZ1A 3DPRB 4OUSA 3ZXFA 3ZFEA 4E2QA 4NOTA 2R0FA 2ZPXA 1AR62 4FPJA 4QQOA 3M7AA 3BOWA 4COYA 3R4UA 1I3HA 2XH6A 1YWKA 1DHKB 1FPN2 1F5FA 1D2SA 2WWSA 3IPVA 3JD73 2OUHA 4HBNA 4XDQA 3MLLA 1RJ8A 4PF5A 4HKWA 4KQ7A 3WXPA 3JBG3 1QMJA 4AHWA 1AR93 1PVXA 4MH0E 2BNMA 4HN0A 2Z42A 3VBSA 4NR1A 4QPGA 1CAVB 4MYEA 2IXHA 1QGLA 3VBUA 2EXKA 4GIQA 2CGOA 4GB32 4L97A 1RUD3 2ZKLA 3VBFC 3MIHA 3JZVA 3PJYA 1FI2A 1G9BA 3WT3A 4EWEA 5T5LA 1EV11 1UW8A 4LHNA 1O3RA 4CP0A 2LALA 4S2DA 1F5JA 1VBA1 2B9UA 3NKTA 5CVRA 1KFUL 1XU1A 4QT6A 4YM2A 3FWEA 1ZYBA 4IV1C 1JN2P 1BBT2 1NOVA 3ILNA 2WT0A 3R05A 2ZGUA 1ND2C 1WLCA 2VY0A 3OGJA 5SV8A 4Y26A 1GNZA 4AFDA 3H1MA 3ZSKA 1RGSA 2EXJA 2FMDA 1OOPC 3GZUC 1WW5A 1H2KA 5BNQA 4NWWA 5C9AA 5EYYA 4CDQC 1OKQA 3AZXA 4H7LA 1PO22 4CEWC 2OZJA 1HIXA 1HQWA 2VH9A 2Q5TA 4OVEA 4A7ZA 4FAHA 3MPPG 1HXS2 5DZGA 2VMGA 4HVOA 4B7KA 1ENXA 1RUNA 1JYIA 4ONUA 1DIWA 2KM2A 2DF7A 2RS52 4N9IA 4FCAA 5EWSA 1ENSA 4L92A 5FRAA 1QOOA 1OPMA 1TME3 4JC1A 5CG9A 4DMIA 3G6JB 3LAGA 2TEPA 5GZEA 2GMMA 2X29A 4OHVA 1PIV3 2P3JA 1C5HA 2VQ0A 2DCTA 1VBD3 4HN1A 4HFSA 1N3PA 4PBPA 4J1XA 4OZXA 4QPIB 2A3XA 3J26N 4WV8A 3USUB 4BIOA 1FAYA 4YVWA 2WIIB 4MLOA 1BKZA 2DUOA 4IEYA 1REDA 2GNDA 1MS4A 3PVOA 1GZWB 1LODA 1J1LA 1RUE3 2WNVA 4JTNA 5FREA 1WD3A 3W59A 2BW8A 4K8FA 1QJX1 4M00A 1W6MB 5LEJA 2I2SA 1CIWA 5I8YA 3FLRA 3WCRA 1LHNA 3V0AB 4YRDA 2CNAA 2XWJB 5T54A 2ZS6B 2A6WA 4C90A 2WS91 1BMV1 3CJIA 3X29B 2GNMA 4K1YA 4B8EA 1F8VA 2AYHA 1PZ8A 4F8AA 3SCFA 4Q0SA 1CD3G 3HBZA 4GMP0 3CL1A 2D6PA 2RS13 5E1RA 2HEWF 1QJU3 3ZPYA 4CEYB 4UBGA 1O5LA 2JG8C 2PAKA 4QXKA 3MFCA 1YXWA 4QX5A 1VALA 4N43C 4KU7A 4ES8A 1RIRA 3AZZA 4NVPA 2DYCA 1C1FA 4LULA 1TMF1 2D6LX 3EQEA 4GQ7A 1FNYA 1C4RA 1Z7S1 4BMEA 4XF0A 5DUVA 4AI2A 1SDWA 2D3PA 4Y24A 2IZWA 1QQP3 3ZYPA 1FOD3 3TN91 1RHI1 1ZZ7A 1AYN2 1AR71 1ASJ1 1OQEA 2BNNA 2RS32 3NL1A 4CDUC 3LZZA 2K2SA 2XBO3 5HCBA 1MS0A 1U5ZA 1MS8A 1RUH1 2JG9A 4DQAA 2OZ6A 2F6BA 5FPXA 4AVTA 2NPIA 4HKLA 4K9SA 3BU7A 1V70A 2GN3A 1TNRA 1DBNA 3BTAA 3RRDA 1KDMA 4YSFA 1I9RA 3ST7A 3S0MA 1NCRA 5L7OC 4WM8A 2P2KA 1X82A 4B4QA 1KD7A 3FHIB 2UU8A 3AYAA 3M3IA 4Q1RA 1S55A 1Q8VA 1MS3A 2VXRA 3FE5A 2OW4A 1IZ3A 4MZUA 3ZYRA 5C8CC 4AEMA 1YIPA 4PJYA 2A73B 3B3QE 2QNKA 3JQXA 1YRZA 4ASMB 5H9SA 5JOXA 5T5JA 2VOWA 3PNAA 3SH3A 5E89A 2QE3A 2PHXA 3MI8A 3PJQA 2AR6A 4YGEA 1D4M2 3LWCA 4E2GA 1MZFA 1NCQC 5JZGC 4I3PA 1DLLA 4TZDA 1SQ4A 4I0AA 5LEKA 4XPVA 1G6NA 3RJ2X 1BQPA 2BFUL 1R083 1MVEA 3ASIA 3K48A 5K7PA 1LU2A 1CAUB 3M70A 5CFCB 1N1VA 4HK8A 3VBOC 1H4HA 4XFBA 4Y1XA 5KWRA 1V6LA 4Q0VA 3LA2A 4JDNA 5CIRA 3WP6A 2A6ZA 1R093 4NPRA 1VBE1 1J3PA 1BK1A 5FOJB 1V9U2 4M0HA 1IPKA 1JH5A 2OPKA 2D43A 3AP7A 1YIFA 3J8F2 4IV1A 3JD71 4KWLA 4Q26A 3ME2A 1V6KA 4XW3A 2AH2A 2D44A 4ZU4A 5A33A 3JBG1 1QF3A 1GKBA 5ABJB 4Z07A 4Y20B 1POV3 1B35B 1UIJA 1TQ5A 2E63A 4Q0UA 5JR7B 4LE3A 3FLPA 3ZSMA 1AX1A 4P9XA 3VDDA 4XF1A 2CGNA 1HRI2 3NAPB 4CEWA 3ZMNA 4KGQA 4JVAA 2UWBA 3GZAA 4AE2A 5KHKA 2RMU3 3U4XA 2P34A 2GNBA 1QDOA 1COV3 2X8KA 2E9QA 3ELNA 5J96B 2VVFA 4HPKB 4WVVA 3VBHC 1G9AA 1H8TC 1UD1A 1XNCA 3TYJA 1AUYA 3E5XA 2ET7A 4TWTA 4AEDA 3INAA 3WLUA 5C4WA 4C1WA 2ZKNA 2BVBA 2QKDA 2XVKA 2R6QA 5KC6A 1UZYA 2R062 4BZ4A 2HWE2 3FBMA 4ZKTB 3ZFGA 1HRV2 1WMDA 5A32B 4B29A 2IXKA 3WG2A 4F7ZA 2DFCA 4D7SA 2BYVE 4XF9A 3SNMA 5FQ0B 3W9AA 4FPCA 3B94A 2BGCA 3MW4A 1AR63 2R1DA 4MXWB 5ACA2 3RZZA 1CPMA 2GSYA 5D8AA 1L3JA 3HD8B 5F6KA 4JGYB 4K3UA 3VZKA 3OTFA 3OGGA 1DGRA 2FMYA 4KU8A 4A3XA 4XQ4A 1WCSA 3DF0A 4AFMA 4YFWA 2QDNA 1CJDA 2GH2A 3VKLA 2AENA 2XG3A 1ZZBA 4GA9A 3H7JA 1BJQA 1JUHA 1VBD1 1AR81 1RUC3 2GDFA 1EAH2 5F5QA 3V64A 4EN9B 4KNCA 2HWD2 2VOKA 3ES4A 1F2NA 1W2UA 3RI8A 3VHPA 3POWA 1QY4A 3J9SA 1AXYA 1NA1C 1ND2B 3AZYA 4B4RA 1BEV2 1ZZCA 2ES3A 2VMHA 1DF0A 2E53A 4HZFA 4JCKA 1LOCA 2PLV2 4N43A 2QCSB 2AZ5A 2MEV3 2AUYA 2PFWA 3IM0A 1R1A2 1UU5A 3ZFFB 4RGGA 2Q8OA 1EV13 1D4VB 3ZFEC 1DZTA 4CDQB 1OD5A 5J09A 1RL3A 2H6BA 4QHBA 1GZ9A 3O0XA 5JSOA 4FQZA 2ZX2A 4FT8A 2RJLA 1FT9A 4CP1A 4XE9A 3WVJA 2QZ2A 1PO23 4S2FA 3WNXA 1IQAA 2OUJA 4AGVA 5E88A 5T3NA 4L11A 2MPFA 2CWMA 5FBZA 3VBSC 4QPGC 3KM5A 1Q8PA 5CG8A 4JAAA 3VBUC 3OCPA 3OJBA 2PELA 3PVEA 1SFNA 4HKOA 3KGLA 1QWRA 4F83A 2D97A 2HWF2 2PA7A 2VVDA 1WBLA 5AVAA 1GR3A 1XYOA 4K1ZA 2UWAA 5TSWA 4OI2A 1IS3A 2D7FA 3AB0A 1O5UA 4FOQA 1G9FA 1W0OA 1AZDA 3WQ1A 5FPZA 1LJ7A 3BCWA 3WDVA 3ZXDA 3GNEA 1RINA 3O0WA 4YW2A 5HI0A 2DVBA 1YO8A 1S0IA 4G3YC 4W6YA 3ZYIB 4AFCA 1QH7A 1KDKA 5I0TA 2R49A 4KBBA 3AP4A 3ZN4A 1MEC3 3VBRB 3U10A 1RUF1 1NCQA 1UKRA 4RR3A 4META 2DCYA 4M01A 4QGLA 4XBNA 5T50A 1S0CA 4NO4A 5C9AC 4BOWA 3UK9A 4HANA 4Q27A 2IXIA 1SLLA 1UX6A 2H0BA 1M06G 1JOJA 1LOFA 1VBB1 3FZ3A 1LHWA 3T2TA 1X50A 3POSA 5JDBA 1MS9A 3ZIXA 1AL21 3EHKA 1ZRDA 2NM1A 3IWZA 3H9AA 4HMZA 3VZNA 5DG1A 4AVAA 1IKQA 3AMPA 1PVC2 4JV4A 2YXSA 3S6PA 2CV6A 4FSJA 4R9DA 3MIEA 2A6VA 2JX9A 3ECQA 3NJZA 1RJ7A 1LEMA 2I07B 4MX3A 4K20A 1GSLA 4Z1VA 3RSJA 1NE6A 4AWDA 2E6VA 4FTSA 1WA4A 3GZTB 4XIOA 3IKWA 2CAUA 4ISRA 4XYXA 2B5HA 1S0GA 4CDUB 3AKTA 3QBQA 1GANA 4YVWC 1N1TA 1K