4BCUA

Satellite tobacco necrosis virus (stnv) virus like particle in complex with the b3 aptamer
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
188
structure length
188
Chain Sequence
RKSATMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAITVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGATAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords COAT PROTEIN
publication title Sequence-Specific, RNA-Protein Interactions Overcome Electrostatic Barriers Preventing Assembly of Satellite Tobacco Necrosis Virus Coat Protein.
pubmed doi rcsb
source organism Tobacco necrosis satellite virus
total genus 53
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03898 TNV_CP Satellite tobacco necrosis virus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bcuA00
5BNOA 1RUJ3 1AR83 5JZGB 1VBD3 1RMU2 1EAH1 4Z92B 4YVSA 2IZWA 1NG0A 2X5IB 1ND2C 1MQTA 1VRH1 2RR12 1C8M3 2XBO3 2BUKA 4FTSA 2WFF1 1R1A2 5A32B 1QQP2 1WCDJ 1NCQC 2XBO2 1R083 5K0UA 1FPN3 2RS12 1HRI2 1RUG3 1PO11 1AR93 1QJX3 2WZR3 4CEYC 1NCQB 1VBC1 4RQPA 1RB8G 1ND3C 1F8VA 2WZR2 1RVF1 4Q4X1 1VB2A 1PIV1 5ACA1 1BBT3 2HWC1 3VBFC 2BFUS 2R042 3NAPA 5DDJ3 1ASJ3 4CEYB 1QJU3 3LOBA 5BNPC 1VBE1 1ND3B 1ZBA3 1ZBA2 4WM8A 4JGZC 3CJIA 4CDWA 5BNPB 1EAH2 1CD3G 1RUI2 1VRH3 1RMU1 1RUE1 4N53A 4GH4C 1B35A 2WFF3 1W39A 2RS51 1EV11 1OOPA 3JB8A 4CDQC 4N43B 2FZ2A 3VBOC 4JGZB 1GFF2 4Q4Y3 2RR11 4Q4V1 1ZBE3 1R1A1 1PO22 4GH4B 3VBSA 5FOJB 1HXS2 1PO12 4GMP3 1VBC3 2GSYA 5LK7B 1FMD2 4CDQB 2RS11 3VBOB 5ABJA 1RVF3 4Q4X3 5ACA3 1E57A 1PIV3 1X33A 5FMOL 5A33B 5GKAC 4PDWA 1COV2 1PVC3 4WM7B 3VBRA 1R092 4CEWA 2HWC2 3DPRC 1VBE3 1H8TA 4RS5C 5L7OC 3ZFEB 2R071 5CFDB 1PGL2 4RFT0 4YVWC 3VDDC 1AR62 2R041 4GB31 1AUYA 2R062 1NCRA 2HWB1 3DPRB 4AEDA 4RS5B 1RMU3 1D4M1 3VDDB 2VQ0A 1RUD2 1RUE2 5BNOB 2BPA2 4LLFA 1RUI1 2RS52 2RR13 1EV12 4BCUA 4FTEA 1R1A3 4JGYC 4CDXC 1RUF1 5C4WA 4Q4V2 1QQP3 3JBG1 1A6CA 1DDLA 2RS13 2BBVA 1HRI3 1PO21 5CFCC 2X5IA 4JGYB 4CDXB 1HXS1 1VBB2 3ZFGA 3TN91 1FMD1 2RM21 2GH8A 5D8AA 5A32A 1F2NA 5C9AC 1BEV1 5CFCB 2R043 4GB33 4CDUC 1ND2A 4RQPB 1RHI2 1COV1 1R091 2R072 4IV1C 3VBUC 1AYM2 4GB32 2HWE2 1PGL1 1AR61 2PLV1 5C8CC 5BNNC 5C9AB 2R061 2HWB2 3CJIC 2BFUL 4CDUB 1D4M2 4IV1B 3VBUB 1EAH3 3HAGA 1NA1C 1RUI3 1QJY2 4N43C 2RS32 4EJRA 4Y5Z0 1RUD1 4CEYA 5BNNB 5C8CB 1ND3A 3CJIB 1POV0 1HX6A 1HQNA 2RMU1 1RUF2 1TMF2 3VBFA 1NA1B 3JBG2 1V9U1 1RUH1 1RUC1 4FSJA 1PO23 4RHV1 5J96B 4RR3C 1MEC1 1HXS3 5BNPA 1VBA2 1PO13 3TN93 4QPIC 1FMD3 1QJZA 1NOVA 4WM7C 3TN92 4IV3A 4QPGC 2RM22 4PDWC 1NY72 1VBB1 3ZFEC 4RR3B 5CFDC 1AR72 1TME2 3ZFFC 1COV3 1BEV2 1FOD2 1R093 2MEV2 3VBHC 2HWC3 4QPIB 4GH4A 2ZTNA 1AR63 4QPGB 1C8M1 3J8F2 1RHI1 2R063 4PDWB 4CEWB 4CDQA 2DF7A 2ZZQA 3VBOA 1AYM1 5J98B 2PLV2 3ZFFB 2Y26A 1K5MA 3VBHB 2HWE1 1R081 1SMVA 2WS92 5AC91 4FTBA 5BNOC 5A33A 1FPN1 1NCRB 2HWF2 1RUD3 1AYN1 1QJX1 3M8LA 4NWWA 1RUE3 4Q4W2 4YVSC 4AEDB 2XPJA 2RS53 1MQTC 1EV13 1X36A 1QJY1 1AL22 2RS31 1C8NA 3JD72 4SBVA 2RMU2 4RHV3 2HWD2 4Q4V3 2WLPA 1BBT1 3DPRA 1V9U2 4RS5A 5L7OA 1RUH2 1RUC2 4RHV2 4YVSB 1ASJ1 1TMF1 4YVWA 3VDDA 1MEC2 5K0UC 1MQTB 1OHFA 3ZFGC 5JZGA 1OPOA 1VBB3 1VBA1 5D8AC 4RQPC 1RUJ2 1Z7S1 1AR82 1VBD2 5K0UB 3ZFGB 1NY71 1AR71 1RHI3 1TME1 3NAPC 5D8AB 1FOD1 2R073 2MEV1 1AYM3 1C8M2 2HWE3 4JGYA 4CDXA 5AC93 4Q4Y1 1ND2B 3J8F1 1VB4A 2HWB3 1ZBE1 2WWSA 1R082 5AC92 1VAKA 3NAPB 1BMV1 1AYN3 4YVWB 1NCQA 1FPN2 1D4M3 4WM8C 1POV1 1RUG2 5CFCA 1AR92 2WS91 4GMP1 4CDWC 1AYN2 1QJX2 1QJY3 2RS33 2HWF1 4N53C 4NWVA 1B35C 4Q4W1 1PGW2 1OOPC 5C9AA 1RUF3 4WM8B 1AL21 1PVC1 1TMF3 3JD71 3IDEA 4GMP0 1BBT2 3JBG3 4CDWB 4CDUA 5DDJ2 2HWD1 1ASJ2 4N53B 4IV1A 3VBUA 1B35B 3VBSC 1VBA3 1QJU2 4Y4YA 1HRV1 3VBFB 4IV3C 1OOPB 5C8CA 5BNNA 1Z7S3 5ABJC 1CJDA 2RM23 1Z7S2 3FBMA 1AR73 3VBSB 1TME3 1BEV3 1FOD3 1NA1A 2QQPA 2MEV3 4CEWC 3VBRC 1RUJ1 1VRH2 1AR81 4N43A 4JGZA 1VBD1 4IV3B 1H8TC 5ABJB 2WFF2 2TBVA 3J8F3 1K5MC 1NCRC 2PLV3 4Q4Y2 1QQP1 3VBRB 1ZBE2 2XBO1 2ZAHA 1POV3 1IHMA 2WS93 4RR3A 4AEDC 1BMV2 1H8TB 5FMOS 1HRI1 1AL0G 2HWF3 4QPIA 1VBC2 1K5MB 3JB4C 4Q4W3 4WM7A 1RUG1 1AR91 4QPGA 3ZXAC 1RVF2 4Q4X2 5ACA2 1PIV2 1AL23 3JD73 3ZFEA 5CFDA 2WZR1 3ZFFA 2RMU3 2HWD3 2FZ1A 1PVC2 3VBHA 5C4WC 1PGW1 1V9U3 3S6PA 1VBE2 1RUH3 1RUC3 1HRV3 1M06G 5JZGC 1MEC3 5DDJ1 1HRV2 2X5IC 5L7OB 1QJU1 5C4WB 1ZBA1
chains in the Genus database with same CATH superfamily
1RC6A 2DCZA 2G9ZA 3ES4A 4OUMA 4Y20A 2JECA 4GWNA 5GZDA 4DUWA 1C57A 2WQ4A 5FZ0A 2DVFA 5CVRA 4FAGA 1WGPA 4QWNA 4BQ2A 4A44A 3X29B 5A70A 3D8CA 1KITA 3Q8CA 4U36A 2W94A 2YXSA 4WVMA 2IZWA 4PBOA 4NIAA 3AMQA 4XFCA 5F6KA 4W6WA 1MQTA 2CWSA 2I74A 1CGPA 3VHPA 2RR12 3J7MA 1OLQA 1W0NA 1ZA4A 3LD8A 5FZGA 2BUKA 5K9YA 3DYMA 3I2KA 5BUVA 1R1A2 5LA2A 4OFGA 1H9PA 5A32B 2CAUA 5BV6A 1QQP2 1FT9A 2FDHA 4D94A 3PUAA 3LA2A 3NL1A 2K0GA 3SH4A 2WRAA 3K75B 2GZWA 4BQ3A 4LBQB 1CJPA 1HB1A 2D6MA 2E7AA 1FPN3 2RS12 4OUEA 3BOWA 1Y43B 4IGPA 1N1YA 4AK3A 1PO11 3PUSA 4K40A 4AFBA 2D7FA 2YY1A 3GALA 3WF1A 2VOXA 4P9GA 4R9CA 5T5JA 1W99A 1O6UA 2HH9A 1T6BX 3VV1A 3JQWA 2FCTA 2YB7A 1F8VA 2WZR2 2B42B 4ZHNA 4QX0A 4KU7A 3SLIA 3UGFA 4Q4X1 4CCCA 1WLDA 1BBT3 5FMCA 2ZEYA 3NAPA 5CKNA 1LJ7A 1S0BA 1QIQA 2PAEA 4HKLA 4XJWA 1QJU3 4R52A 4FXGB 2DCTA 4YGBA 4AQSA 1CPNA 4OI1A 2WO2A 5FPXA 4AQTA 5ANNA 4EZ4A 4F83A 5GM0A 1H2KA 1Z78A 1DGRN 4LA3A 4QPYA 3TNPB 1PGSA 1ULOA 2GP5A 1ZBA2 2J1RA 5F8PA 4Z2WA 3I59B 4RYDA 5J36A 5IJRA 2E63A 1MZ6A 4WM8A 1HQWA 1OC1A 3DECA 3FE5A 1AX2A 1CD3G 4DEQA 4AI8A 1VRH3 3LGRA 3VKLA 3SKVA 2P3YA 3BIWE 3HQUA 4LKDA 4GH4C 3RWNA 4I01A 4AHYA 1UF2C 2ZJCA 3C7EA 4XILA 5E1RA 4E4HA 1UPIA 2D44A 5L9VA 1OOPA 2D6NA 4CDQC 2FZ2A 1AX0A 3BGAA 3K4AA 1BVP1 1JMUB 2RR11 2ZHKA 1UY1A 3MLLA 3ILNA 2WBKA 3FJSA 1YHFA 5DPNA 1R1A1 3KV6A 4OHZA 1G9AA 3MV11 4GH4B 3VBSA 3RJ2X 4QQ2A 1NKGA 1KRIA 2GNBA 3H9AA 3JUUA 4K8FA 5I8YA 1XU2A 1VBC3 2E51A 1IPKA 5A7PA 1FMD2 2B8MA 4MV2A 2RS11 2YFUA 2D3PA 5F39A 3OGGA 4CDQB 2IXJA 1G8WA 1UU6A 5F5IA 1JZ7A 1X33A 1J3RA 2DFCA 4WVVA 1BCXA 1IS3A 3EYPA 3G7DA 2JIGA 5I91A 4CCLA 1QDOA 4CEWA 5FUIA 1V0AA 2XB6C 1JOJA 4IE0A 3T3YA 4B7KA 4PI2A 2OXBA 4ES8A 1VBE3 1RJ7A 2E53A 4YYOA 5A3LA 4GWJA 3E6BA 4Z8BA 4QDSA 3ZFEB 3UESA 4LBNA 5IFPA 3UKVA 2F17A 3ZO0B 1DZRA 3AFGA 3KB5A 3ZOIA 2RVAA 5K8SA 1AXYA 1LR5A 3B00A 3DGTA 2B39A 3NRUA 2C4XA 2FBEA 4XDQA 5FYIA 4QX1A 4UXAA 3FL7A 4CP0A 2N7GA 2QQVA 1GUIA 2VZ1A 2DBNA 1A8MA 1S0FA 4E8DA 2HYKA 3J4UH 3MF6A 1D4M1 5F5CA 4P00B 3HT2A 1LGBA 3PUHA 5F6LB 1LOCA 4HN0A 4AGRA 1WKYA 1WZXA 3AMMA 2BWCA 5FPZA 4CCEA 4LTAA 3MIFA 4JKLA 4QGNA 1QOSA 4OLLA 4CZSA 3FHIB 5JOWA 1CX1A 3AM2A 4LUKA 3T2QA 5FRAA 2CL2A 5LA0A 5HPOA 1D7PM 3AMHA 2RHPA 3OPZA 2VZTA 3PIJA 1SLAA 4M3CA 4IEZA 1SFNA 4CCOA 2B5HA 5KXEA 2DTWA 2IC1A 3LKJA 2XJQA 3VGIA 5IK4A 3BI3A 5G05L 1LHWA 3DKWA 4MUVA 2BWAA 4AG4A 4J1WA 3E97A 3VDCA 3CQOA 1VBB2 2Y60A 3ZFGA 1ENXA 2RDSA 4EROA 3BOPA 3NVCA 3FFZA 3ZYFA 3USUB 5IAXA 1FMD1 4ASKA 4BLIA 3AYAA 3AYCA 3I7DA 5A32A 3T2TA 1F2NA 5C9AC 3L2HA 5FP8A 4E4SA 2TUNA 1UMIA 4GB33 4LBQA 4AAPA 2PYTA 1DF0A 4CDUC 4LULA 4MX3A 4YG3A 1BHGA 3VBUC 3T4VA 5BNQA 5GKAC 2UURA 3ES1A 5J37A 5I0UA 4QU1A 2PLV1 5C9AB 4PQ9A 3L9JT 1E5HA 5JOXA 3OOXA 2A3YA 3CJIC 1QNWA 2OS2A 4CDUB 1F31A 2JEMA 1ODNA 3IZOA 3ORJA 3ZMOA 4RGAA 3LOIA 2BVBA 4NVPA 1D2SA 3EB7A 3IN9A 3VBUB 3WVJA 3CO2A 3URFA 4FOVA 3HAGA 1UXXX 2GNMA 4I02A 4D7TA 2RS32 4EJRA 4FPJA 1J84A 2B4KA 4LBJA 2ZGOA 4Z82A 5C3OA 3DEMA 4QKDA 2CTVA 5CA6A 2J1TA 1YEWA 3CJIB 1I5ZA 2OX0A 4DZGA 1TNRA 4LO6B 4FCAA 2CDPA 4AQ2A 1GP5A 1WMXA 4NHXA 3JBG2 3I59A 4QMAA 4NOTA 1RUH1 4FSJA 4RHV1 4LLOA 4Q0QA 2HEVF 3RYPA 1WCUA 4LK6A 5FLHA 3HMYA 1VBA2 2D6PA 4QDQA 5JSRA 3KWVA 1DG6A 1NLQA 2BNMA 3L2YA 5DAPA 5FXVA 1PM4A 3TN93 2WYSA 4L92A 1UYXA 2IWGB 3O1TA 5AFEA 5DMYA 1RL3A 1C5IA 2VNOA 4C0HA 4IV3A 1Y4WA 2ERFA 4QPGC 4W6YA 2AH2A 3MZHA 4W65A 2GP3A 5HCAA 1VBB1 3MICA 1RXGA 1UN1A 2HJIA 2R32A 3DCQA 1AR72 5SV5A 2XKOA 1TME2 4G4FA 4W6XA 1BYHA 1COV3 1BEV2 4FO9A 2VUCA 4OUSA 1IOAA 3MPBA 3VD3A 5KHGA 2VMDA 3RZZA 2PFWA 4KWLA 1A78A 2TNFA 2VQTA 4GH4A 1UKRA 2UWCA 2ZTNA 1ZZ6A 3T1LA 5FZBA 3I8TA 1NQJA 4QPGB 2YYOA 3OUIA 1Q5OA 3AJZA 5FMDA 1KFXL 4XCBA 4CDQA 2DF7A 4D6SA 3E6CC 4AF9A 4XUNA 1UQXA 1YFUA 5FP3A 1OLMA 3AKRA 3VB9A 4XPVA 2VAUA 1N47A 4IGOA 2DWRA 2PN5A 2WZEA 1W06A 2WS92 2XVGA 3M3QA 2DU0A 1LOEA 3DYOA 1XC6A 5IK7A 4FTBA 3FC0A 1FPN1 1QOTA 1NCRB 1CAWB 2OYZA 2PQSA 2R6QA 3T2PA 3AX4A 1W8OA 4K8RB 3K51A 5A3OA 2P4EA 4FVVA 5DUXA 2D3RA 1EY2A 4BIOA 4YVSC 4AEDB 1U5IA 5FZFA 5FZIA 2SBAA 4A7YA 4DEVA 1NLRA 2RS31 3KV5A 3N7LA 3PU3A 4XXPA 5IVBA 1DQ4A 4N90A 4SBVA 1AXZA 2FMYA 2P17A 2RMU2 3USSA 1XYNA 4LPLA 2J1EA 4MOAA 4HMZA 4Q4V3 1IKQA 3UGHA 3WXPA 4M3CF 3HN1A 1BBT1 2NQYA 3W59A 1SQ4A 2NN8A 4FOYA 4YVSB 1ULEA 2Z79A 2ZCWA 4PLNA 3MPPG 1Q8VA 2BEOA 2YU1A 2W47A 4PHZA 5JZGA 3AZVA 5FZEA 3KS7A 2PQQA 1OPOA 4Y1UA 4QHZA 5AFBA 1VBA1 3PLQA 3I3EA 4LBQD 4OMDA 5C8CC 1KDKA 4S2GA 1V6NA 2WN2A 3H8UA 3WLUA 5JI9A 1AR82 3T0AA 3ZYIB 2ZX1A 5F3IA 3A7QA 1LOGA 4P9LA 2W68A 1V00A 5CAZA 5FFOC 2OPKA 4DY3A 3N7JA 4DXZA 2IUWA 4Y1XA 1AR71 3GZTB 1TME1 3PURA 3V65A 5FDBA 3RSJA 3G6JB 3O1RA 3N4MA 3EXUA 1AYM3 4X8PA 3WDUA 1RINA 2YG0A 3AP4A 4CXXA 4Y3OA 4LK7A 4GIQA 3POJA 3QACA 3RI8A 1NQDA 2VMEA 3RYKA 1X9TA 1MS8A 3RS6A 3V0AA 1UOBA 2HWB3 3USUA 5EYXA 3PVOA 2GMPA 1XNTA 5LASA 1SLIA 4BM8A 1AJOA 5AC92 1VAKA 4XF4A 1AYN3 4I0AA 1SDWA 1GMMA 3ATGA 3LA7A 3UKNA 2WS91 4XF0A 2PHXA 5ERLA 4C1XA 2YC4A 3H8RA 3WCRA 2ZEZA 5ISLA 2GC0A 3VKMA 1VMFA 3THTA 4NWVA 4QM8A 3SCHA 3WW1A 4ZZ8A 3U07A 5F2WA 4ZU4A 4I2OA 5DAXA 4BISA 2ZX2A 5A1FA 3PVNA 5KHKA 1PGW2 1WMDA 1FNYA 1A3KA 2DCYA 4ZPIA 2Y6HA 5C9AA 3I49A 4V2WA 4YPJA 5APAA 3IDCB 3RZJA 4XC9A 1EPWA 2QQLA 2XHKA 4CDUA 1DGWX 5IWFA 2XXZA 2VCCA 4NIDA 4QQLA 3DKQA 1ASJ2 4QGLA 4KG8A 3VBUA 3FWEA 5DAVA 3NKGA 1STMA 3NJXA 4RGGA 1VALA 1H1IA 4HOOA 3AYDA 3JXSA 3I2OA 5FK7A 2XJUA 3OJBA 1Z7S3 4XJAA 1B09A 1JU4A 4FFGA 4R9BA 1BJQA 1X8MA 3POBA 4HG6B 1CJDA 2ID4A 4GWMA 3VHNA 4BK5A 5BY5A 2CGPA 4LHLA 4NPMA 2B9UA 1UMZA 2D3SA 2OZ6A 3ENRA 3DYPA 4NROA 2VULA 3WSOA 3FBMA 3AKTA 2D6OX 5FZ8A 3U4SA 1J59A 1O3QA 4C0BA 1FOD3 4RA0A 5IHRA 2V5DA 3B93A 2FCUA 2EA7A 1AR81 3M2MA 5I8SA 1OA3A 5GZFA 2OIIA 1N1VA 3HBKA 4EN0A 3RYRA 1OPMA 1EPZA 2BJSA 2KM2A 4NAMA 4QAWA 1CZSA 4OVEA 5DUUA 4DS0A 2TBVA 1WCKA 1N1TA 2JG8C 2PELA 1O3TA 2A6XA 4A7ZA 4I30A 3WNXA 4I0WB 4Q4Y2 1UY2A 5H9RA 4DXSA 2XBO1 2VTFA 3SNMA 1RXFA 1BMV2 2ZACA 1UKGA 4A41A 2IVIB 4Y26A 1AL0G 1UAIA 2D40A 2VPVA 4J6GA 3I3MA 5JLVA 2ZKNA 4M0NA 3BODA 3U75A 3OF1A 2QCSB 4AFAA 2JD4A 4AI3A 1MZ5A 2VOWA 4CTEA 4QPGA 1RVF2 4OCTA 5ACA2 2YROA 3T2OA 1W9YA 3TBDA 2VZVA 2XJVA 4RFRB 2HWD3 2LRPA 3CF6E 1PVC2 1GZCA 2ZHLA 1PGW1 2CYFA 2UY8A 1V9U3 1UYZA 3TEXA 5A80A 1X82A 3O1VA 1I5PA 3HNYM 4F8AA 2J1UA 1MEC3 2XWBB 4P9JA 1UW8A 5JIUA 3FFQA 2JDYA 4JVAA 1HRV2 3KGLA 4HFSA 4HZFA 4K1YA 2IXHA 4XXAA 2QBXA 4ZS2A 4E4DX 4JHTA 2VD7A 2CGNA 2X5IC 4JX0A 1R64A 4Q1PA 4XQDA 4BXFA 1DQ6A 5L7OB 1WA6X 1US2A 1RTVA 1O5LA 2YBKA 2XR4A 2OUJA 4GJZA 4YVWB 4OQ8A 2CU5A 3LEMA 4KH9A 1NYWA 1RUJ3 4AVCA 3C7HA 3LSDA 4YM0A 5LBEA 2EICA 4CU7A 4QX3A 5FYCA 3WQ0A 1YI9A 3PVBB 4XZPA 3CZJA 5A1AA 3OEBA 4N8MA 5KBFA 2GALA 4YVSA 5J48A 1GQHA 1NG0A 2X5IB 1SBDA 3KF5A 1UNBA 2PHWA 3HOBA 3MV01 3W21A 2P3IA 4XFGA 4BQ1A 2NP0A 2VR4A 2IXCA 4FTSA 2QQNA 5F5AA 3PJYA 1DGRA 2EF6A 2HYXA 2XJSA 2GN7A 4E2GA 3ZXGA 1MACA 5KR7A 1ZRCA 4YM3A 4AI1A 5LA9A 3W9AA 4JRLA 3W5MA 4JDMA 2ES3A 2G1MA 2VC9A 1KEXA 3MUY1 4NE9A 1W8UA 1HRI2 1SEFA 1RUG3 1YJKA 2L9LA 1GP6A 3RZMA 4LHKA 2ZGMA 1QJX3 2KD7A 3UJQA 2O8OA 4AHWA 4BMBA 2WZR3 2VW0A 2WNVB 3AZWA 4FQ4A 5JDBA 4AHZA 2ZMLA 4CEYC 4YSFA 2WJSA 4NJ4A 4QQHA 2CAVA 5FZOA 1RB8G 3UK9A 4NIIA 5G04L 5GZCA 4YNIA 5A3NA 5HCHA 4QXCA 2BVVA 5DG1A 2VZPA 1RVF1 3H3ZA 3BVCA 1VB2A 5ACA1 5FY9A 1S55A 3ETPA 3UGGA 3VBFC 4ARYA 2YGMA 4R9DA 5DDJ3 3ZXLA 1C1FA 4Q8KA 1FYUA 1YIFA 3ZX7A 4CEYB 5EZWA 1SZBA 5BNPC 3WNMA 4CYDA 4JKKA 5LA1A 2JDKA 2OQ7A 1ZBA3 2A6YA 2ZX0A 4RSUA 1W28A 3ACHA 3BCWA 1GLHA 4Q0VA 3GZUC 4UFMA 4WBBA 3ASIA 5LBBA 4JGZC 3H42B 4QX5A 4RL7A 5BNPB 3PMSA 4ASMB 5LEJA 3N9NA 2W52A 1W6NB 3B3QE 4TLFA 2WFF3 3CLPA 2BNNA 1CQ9A 2FQPA 2FDIA 1W9WA 1OLRA 1ZNPA 3LEKA 3NNLA 3VKOA 3ZM8A 3S7EA 5KXCA 2YBSA 1JS9A 4N43B 4WM7B 4JGZB 1GFF2 5FZKA 4FOQA 4H3WA 2AUYA 2ZGRA 4Q4V1 4W4ZA 4J1XA 1ZBE3 1T6GC 3KT4A 3LB9A 4DUVA 1WMFA 3ACGA 4BJ0A 2ILMA 4URTA 1PMJX 1W2UA 5I93A 2BOJA 2ZMKA 1PO12 4HLTA 2GSYA 3FLPA 5LK7B 4XMIA 4BMEA 1OH3A 1O3RA 4XUQA 2WIIB 1MS0A 4E2SA 3N9QA 1E57A 1PIV3 2E32A 4XW3A 1F15A 3H7YA 4NR1A 4ZY9A 5LEKA 5FMOL 5A33B 1YWKA 2ZEXA 3JU9A 2EIBA 3AVSA 3I3QA 1QEXA 1S2EA 3M3CA 1R092 2CHHA 1WCSA 3OYWB 2JDPA 4H55A 1C3HA 1DLLA 2B46X 4B4RA 1W6QA 2A6VA 4RS5C 2VMGA 4NHLA 4LBMA 5FYHA 2ZAAA 4YFWA 4RFT0 3E1F1 3VDDC 3U0ZA 2JG8A 1AUYA 4GULA 5C5TA 4KI5M 2QTWB 4W8JA 3VZMA 1LAJA 3B9CA 3AMNA 4JHZA 3MUZ1 1REEA 1UY3A 4BU2A 2HWB1 4FFIA 4IETA 3S5QA 1ULPA 3U78A 3H0OA 4IXLA 4RS5B 4MGKE 5A6QA 3ALQA 1RMU3 3SH3A 2BV4A 3O12A 3VDDB 4WZCA 4NHKA 1RUD2 3PTYA 1YQ2A 2W08A 3FHQA 3MI8A 4V1PA 4QB2A 2P5BA 3KSCA 2G9FA 4QX7A 3WHTA 4E9KA 5I8TA 2VMCA 5BNOB 2W1SA 1PNFA 3ETQA 3KV9A 1S0DA 1IS6A 3MBWA 3NNMA 4BCUA 1ZRDA 1U5ZA 4CU8A 3LZZA 1GZWB 1ZRRA 3T30A 2ET7A 2I2SA 1Q56A 1QMJA 3O7OA 4Q1RA 4YZ1A 1CZTA 1H1AA 3O1SA 2DURA 4UW4A 1DZQA 1VR3A 4ISQA 2W9XA 2WWUA 5CNAA 4BPZA 4MADA 1HW5A 4KG0A 4QQOA 4CRQA 1O8PA 3IIAA 5CEHA 2IXLA 5CFCC 5FLIA 4NRPA 2X5IA 4QQPA 2WABA 2EIGA 2Y34A 3ZSJA 3RZHA 3PIGA 3WQ1A 3H1WA 2R30A 1ULCA 2ARBA 2ZBJA 2GH8A 1ULGA 3VD5A 5HXMA 4HETA 1PX3A 4XEZA 3M3OA 2MNGA 3P3NA 1LU1A 4YRDA 2WNUB 2K46A 3IMNA 3K4ZA 2E9QA 5CFCB 5JVVA 2DVAA 3OSDA 1PZ8A 2R043 4ATEA 1I9RA 3ILRA 4RQPB 4PF5A 1RHI2 3PHMA 5FBJA 4A3XA 3OB8A 3VDAA 2HEYF 4DRRA 1R091 4XUOA 3WOGA 1Q8OA 1JHNA 4B4QA 2E26A 1N3QA 1REDA 5FYYA 5F3EA 1IG0A 4LITA 2XL9A 3OD4A 4DPNA 3I2JA 3ZSEA 3MIHA 2VOTA 2BFUL 2D5FA 3POEA 3U10A 2ZGNA 3WDTA 2KXLA 1D4M2 3AVRA 4COZA 5FY7A 1IZ3A 1ODMA 2QZ2A 1EAH3 3LPFA 1UPSA 1RUI3 1YCIA 5EXOA 4PI0A 1QJY2 2G9GA 3VL9A 4XAEA 1GZ9A 3WG3A 1RUD1 3KCXA 4CEYA 1M4WA 1JBCA 2C9KA 5JXGA 1D2QA 1O91A 2X10A 4S2DA 1K12A 2QQWA 5KXBA 3LIGA 1F4AA 1GOFA 5FPVA 2J7MA 2YGLA 5LK5A 4CUGA 2GNTA 3WV6A 1QXRA 3VBFA 4G9SB 4XZUG 4BLJA 4B1MA 1V9U1 5C3QA 4OULA 1GYKA 4UBHA 1PO23 1ZZ7A 4DIQA 4LR4A 3LQCA 1LTEA 4LIUA 3POYA 1MEC1 4UW5A 1HXS3 5BNPA 5JWPA 2Q1MA 1OA2A 4FP2A 1HB2A 5LATA 4E2QA 4QPIC 1VJ2A 1YIPA 4EWDA 1F9KA 5FUNA 3THPA 1P8JA 1W6NA 4UI9L 1FV3A 1KGYA 2VBDA 4I3GA 1YQ5A 3OD0A 3ZN6B 3T09A 4K9SA 3SCFA 1W2TA 3GZAA 2WC2A 4XOGA 1GNZA 4YLZA 2Q8CA 2YC0A 4KWUA 2IFWA 3ZFEC 4YW5A 2VNGA 1JZ5A 4LHSA 2MEV2 4E4ZA 2DUQA 2HWC3 4QPIB 4LOTA 2YZ4A 4P08A 3BU0A 1WW6A 2Y64A 2WO1A 4HK8A 3WQBA 1UZZA 1OUXA 2PMWB 2QVSB 1AR63 3NJZA 4P9WA 3IBMA 4EQVA 3J8F2 1RHI1 2R063 1EUTA 2ZZQA 3QLQA 1UCXA 4B3NA 5A3TA 1LULA 4B8EA 5J98B 2PLV2 5JIAA 2Y6KA 5FYBA 2J1AA 4ITCA 1SMVA 5FXXA 4BK4A 2E7TA 1XU1A 5BXXA 5A33A 1KFUL 1G9CA 2XUMA 5CU1A 1ENRA 3KVBA 2HWF2 1VRBA 3OYWA 2OA2A 1UX7A 4DOUA 5F37A 1QJX1 1OBNA 3DXTA 1RUE3 4Q4W2 5L73A 1CAXB 4Z07A 3MO4A 1QHDA 4XCAA 3HIFA 2RS53 4C91A 1L7QA 1EV13 1QJY1 1AL22 4R9AA 2E7QA 3WG4A 1LEDA 1S0JA 3N7KA 4PQQA 2I07B 4FPGA 1OKQA 4MVTA 5A6YA 3FLRA 2VM9A 2LS6A 1LGCA 4H7MA 3SXWA 1URXA 3ELNA 4RS5A 3ZIXA 3VUOA 1RUH2 4HPKB 4RHV2 1KS5A 1JYCA 2DVDA 3C7OA 3VDDA 5K0UC 4D0QA 1J3QA 3N35A 1CESA 1OHFA 2W91A 3CIHA 3AZYA 4B4PA 4QT6A 4AAXA 4DY5A 3HQXA 3SITA 5M0TA 3BN6A 1WBFA 3QH6A 3WG1A 1AF9A 3Q9OA 3VD9A 5D8AC 1PZ9A 2Y33A 4CP9B 5BYNA 3FUOA 1GZWA 1TQ5A 3ME2A 5LB6A 4FPYA 3RVHA 2JE9A 2W3JA 1WMEA 2XG3A 1XE8A 4UW3A 3T1MA 1BLZA 3I54A 1MVQA 5K0UB 3D3AA 3EBRA 3AMPA 3ZSKA 4HXCA 3KQRA 1LHUA 2WQ8A 3I2HA 3IAQA 1CVNA 3WNLA 4O7XA 2AGSA 5D8AB 1OVSA 1QGLA 2R073 2D43A 2MEV1 2WSVA 4AVAA 5F3CA 3ZSLA 2J1SA 4AFDA 5JR7B 1XSQA 1Y9GA 5I0TA 2HWE3 3POGA 4YW7A 2VZ3A 5AC93 1S1AA 1ND2B 2WLQA 3KT7A 4UW6A 3J8F1 5C3RA 5JCTA 1ZBE1 5GJ6A 1OH4A 4GALA 3HPNA 1HQLA 4LE4A 5EPAA 5T5PA 3F2ZA 1LRHA 1FPN2 2B7YA 1AHSA 4BQ4A 1QNYA 2DU1A 3ACFA 5JMCA 5J1XA 1POV1 5J09A 5CFCA 3OGJA 5IW0A 4CDWC 1UL9A 1JYWA 3WUCA 1V70A 2XJRA 1CAVB 2ZX3A 3WX5A 4YW1A 5FWJA 2HWF1 3ILFA 4N53C 3N9LA 4XFBA 2P1BA 4L9BA 5DZEA 3VZNA 1BVVA 2EIEA 4F3JA 4JTNA 4INDA 2C24A 4K6BA 4Q4W1 5DG2A 3U14A 1OURA 5D1IA 3QCWA 1RUF3 3P3PA 3NO8A 1VMJA 2JDUA 3WW3A 1AL21 1TMF3 1VPHA 4CDWB 3IDEA 1BBT2 2BNOA 3GBWA 3NQHA 4FAHA 3MW3A 5HBAA 1KS4A 2DFBA 1ZZ8A 1NX9A 2OT7A 2Z42A 4I0BA 4N53B 1GWMA 1L3JA 1QJU2 3ZPYA 4X8NA 4DB5A 1JN2P 3CHXA 2J1VA 2JDAA 4DXRA 1W0OA 3SKJE 4ZU5A 4DXTA 4B29A 3LIHA 5ABJC 1DU3D 2A5ZA 4XFIA 2JXAA 2HBUA 1WBLA 2RM23 2Y38A 4GD4A 5EJ1B 2A71A 5J7MA 1XJAA 1H30A 1VRH2 2BGOA 4W50A 2QQOA 3M4FA 4Q27A 1H8TC 5ABJB 2XJPA 3ZXJA 2ARCA 3A23A 4Q8LA 4E27A 2PHDA 1MZFA 4MLOA 2WAOA 1K5MC 1ONAA 1JUHA 1V6KA 5FJKA 4YW3A 1NCRC 1RJ8A 4OYUA 5L9RA 1MS5A 4BHPA 3GJAA 4TYSA 1DQ0A 3BTYA 1SFPA 3VD4A 5H9SA 2ZAHA 3KGZA 4IERA 1JZ3A 2XJTA 5I0RA 4AEDC 5CG8A 1H8TB 1WUVA 2Y6FA 3E6DA 2LTNA 5FMOS 5B2GB 4TXWA 1WCQA 4QPIA 4ONUA 1VBC2 1K5MB 5CB7A 3JB4C 4D8MA 2W87A 3IWZA 4Y1YA 3WP4A 4GXLA 5FQ0B 2FHRA 4XF3A 4C90A 4EWEA 1HJFA 1YFYA 4A3ZA 3AB0A 3JD73 3ZFEA 2P6HA 2ZGQA 1OFSA 2XHNA 3H1YA 4GZ9A 3U37A 1UIJA 1H4GA 4LMFA 4IUGA 1XNCA 2Z5WA 2HKXA 3S6PA 1VBE2 1RUC3 1HRV3 2Z2SB 1YJLA 3GGLA 3TWIA 1M06G 5D21A 1CIWA 4YZ5A 1H6XA 1SDDB 3WNNA 5HCBA 1G6NA 1FXZA 2NMOA 4Z1VA 2ZPXA 1CAXA 3HQRA 5FXWA 3AJYA 4XUPA 1BZWA 1QJU1 3I2FA 1XOYA 1G9FA 3R6SA 4NHMA 2H6BA 4P5HA 1JYVA 1VBD3 3HNBM 3LEIA 1X7NA 4NHYA 1EAH1 2YPJA 1ENQA 1S4CA 4L2NA 4Z92B 1T2XA 4HPKA 3HNMA 3K2OA 1N3OA 2H6CA 2WWJA 4OZXA 5FO8B 4DO0A 4META 3FLTA 2DVBA 4FPFA 3ZDVA 1LESA 2A3XA 2ZMNA 1HKDA 1VRH1 4IEXA 1C8M3 1EP0A 4OZOA 4OHYA 4MHUA 3MLKA 3AL6A 1GR3A 1XRUA 2QZ3A 2Q1ZB 2QFEA 4CP9A 2ET1A 3OGVA 3O1OA 3IDAA 2ZHNA 1V6JA 1NCQC 2XBO2 3IPVB 2PTMA 3MF9A 3R4UA 2V4VA 1R083 4Q26A 5FTTC 5JR2A 5L36A 3SQOA 3SEPA 5K0UA 4AYUA 1JZ4A 1SPPB 1YXWA 2P2KA 1WW4A 3NKTA 3R4SA 2VBPA 1JUIA 4JAAA 5A7WB 4Y1ZA 1AR93 5EJZB 1G9DA 1V6LA 1EUUA 4AFCA 2O8QA 3AYEA 2X05A 3R4DB 5CYYA 2DCKA 3ZIWA 2OZJA 1QH6A 2JICA 1OXCA 1NCQB 1QKQA 1VBC1 2ADEA 3H50A 3LDKA 4DINB 1VE0A 1S0CA 4TN7A 2VJXA 4Y22B 5CIRA 1RYYA 1WW7A 5FZ3A 4QXKA 1ZREA 3I2DA 2D5HA 2P37A 1J1TA 1V6MA 3MIDA 3AZXA 4HKWA 5LRRA 3MYXA 2HWC1 3EJKA 4XBNA 4C1WA 1CX4A 1UYPA 2BFUS 1HJGA 2RDRA 2UYAA 3QBQA 1SLCA 4R4XA 3V56A 3VL8A 4AVSA 5A3UA 3HVDA 3LWCA 2VOKA 3KD4A 3LOBA 1VBE1 4O9GA 1QJFA 1Q8SA 5FY0A 1CWPA 4MGTA 4IE6A 5SV8A 4EN9B 2Q8EA 5EQUA 1XPWA 3LE0A 2W1WA 3OY8B 1HDKA 2BW8A 5IUQA 1YI7A 4GKXA 5FPLA 3WD5A 3LCPA 1DLCA 4AHXA 3KVAA 2HBTA 3KT1A 2WNEA 1SBEA 3CJIA 1NAEA 3D0JA 3VLBB 4CDWA 4CVUA 4URAA 4EWAA 2D98A 1XNKA 4YW2A 3A21A 4YM2A 5FZMA 1RUE1 2XWJB 4IE4A 4N53A 3SC7X 5A3MA 1GV9A 1CONA 1W6OB 4PCRA 1W39A 4TZDA 1YQ8A 2RS51 5T5LA 1EV11 2JE7A 3RJRA 3U11A 3I3BA 1O7FA 5HI0A 2ZZJA 1JHJA 3JB8A 2C1FA 4QXHA 4L0PA 4L97A 3WCSA 3VBOC 1YO8A 1GP4A 1QU0A 2Y8KA 3S57A 2VZUA 2WINB 4XTMA 3P6BA 5FY8A 2YMZA 3RNSA 4NIGA 3ZKYA 2KR2A 1XE7A 1MR5A 4RD7A 5KHIA 2ARAA 2W46A 2E33A 4CXYA 3WNKA 2WFPA 4AI2A 2YC2A 1DCSA 1CR7A 5FO7B 4LO5B 4FPOB 1CAUB 2V09A 3VZKA 3LEGA 3VBOB 3ZR6A 5ABJA 4CUBA 2WZPP 2UY9A 1C4RA 5E8AA 3V64A 2P34A 3D0SA 4Q4X3 2JX9A 5LBCA 3A4UA 4QB6A 4D3WA 3PUQA 4D6RA 3V0BB 1RUOA 1F5FA 3HN3A 1W2NA 2AEYA 2VCAA 3WINE 3FN9A 4HT1T 1COV2 3NV1A 2UYBA 2ZGSA 3PL0A 4LO7A 4AWDA 3DPRC 5FPAA 1HB4A 1H8TA 2LM3A 5L7OC 5IK8A 2VQUA 3OG2A 4BXSV 2R071 3Q8FA 4XABA 4NAOA 5CFDB 4YVWC 4CP2A 4GB31 3VDBA 4N9IA 1LCLA 1CAWA 1NCRA 3DF0A 4R8HA 4MXWB 2CSGA 3FBYA 3NV2A 1ZA7A 1XYPA 2WSUA 3DPRB 4AEDA 2PA7A 1GOGA 5FAXA 4CUAA 2I45A 3PVEA 4BOWA 2CV6A 4K20A 1UOJA 1VIWB 3PUIA 3E5UA 4WVZA 2Q8OA 3UL2A 1JYNA 5E89A 2JWPA 4BYYA 1AVBA 1DHKB 5JXIA 5FPUA 4BQ5A 3FMGA 2JD9A 3I4IA 2WNOA 1SBFA 1QH7A 3IAPA 2BPA2 4S2FA 1K3IA 2P6CA 2RR13 4IGQA 3ZDSA 2ZKLA 1PHMA 1GKBA 3JQXA 3POIA 4LO8A 1HB3A 1R1A3 3M3IA 4JGYC 1RUF1 1Q3EA 2VGDA 2XQXA 4AEKA 4CDXC 4Q4V2 1QQP3 1XB9A 2XVLA 2JDZA 3TOJA 4M3CB 3U4XA 2PHLA 5LWBA 2WNVC 1W90A 2BERA 3NWKA 2RS13 3HBZA 2QJVA 3DXUA 2RJLA 4P02B 5LY1A 3VKFC 5IVJA 3BB6A 4AGVA 4NRMA 4JGYB 3ZYPA 4CDXB 4M4PA 3RDIA 4P5YA 2AC1A 5DABA 3TN91 4OQ9A 3LA3A 2RM21 4Q5OA 5FXZA 4CCMA 1RITA 4LKSA 4YG6A 1QY4A 2NMNA 4WV8A 1UXZA 3GZEA 3RGBA 5FO9B 4UT5A 5IVYA 3IPVA 3I2GA 3THDA 3KQ4B 1W8HA 5F5QA 2QQUA 2ARXA 2WQZC 1W8WA 4OI4A 1OD3A 4A7KA 1COV1 4K3UA 3DV8A 1SCSA 2CGOA 4IV1C 1AYM2 5F2SA 2JJ6A 3ZVXA 5LCWL 1JYIA 2YUEA 3O1MA 1N3PA 1LKNA 3UJOA 4Q2FA 5C6CA 2VZSA 1TE1B 3ST7A 2HWB2 3QH7A 3RZLA 4P9XA 2OUHA 2PHTA 4FFHA 1H2NA 4Y22A 5IYYA 2V72A 4LBOA 4DFSA 5JXJA 1Q8PA 1F5JA 4IV1B 3J7NA 4CP1A 5FP7A 2QDNA 4N43C 2ORZA 2GMMA 3AP7A 3WNPA 3GCWA 4KNCA 3J7HA 4Y5Z0 5CKQA 3O5SA 4KWJA 3ACIA 2VXRA 2DBIA 4IEYA 1HX6A 1W8FA 2W1UA 3E5XA 3NV4A 1HQNA 4XUTA 5EP9A 3NNJA 3OBTA 2D6KA 4XQ4A 3B7MA 3OY8A 2KA3A 1KD7A 4Q29A 4XDOA 1YC61 4M00A 4A4AA 2C0ZA 5JMOA 2ZGPA 1RUC1 2WAAA 4EN8B 5J96B 4RR3C 2BQPA 4L99A 1PK6C 1G9BA 1MVEA 3MFCA 3J9SA 1GBGA 1DP0A 1FMD3 1QJZA 2CDOA 3D5OA 5FZ6A 4WM7C 4I3PA 1Y3TA 3MW4A 1VAMA 4HN1A 1KQRA 2MHFA 3ZYGA 3RFRA 4COYA 1NY72 2VVEA 4RR3B 1REFA 4FPKA 3W20A 1GWKA 4YWAA 4DRVA 3OBRA 3ZFFC 2BU9A 1PK6B 1FOD2 3WDXA 2ETEA 1EYBA 2LROA 4PDWA 3BUCA 3H3LA 4QM9A 3N9MA 1VMHA 3OPWA 1HIXA 2F6BA 4OI2A 3PDQA 3C8XA 4X6RB 3AZZA 3WQ7A 1CAUA 1C8M1 2Z4FA 1ZRFA 1TEIA 4CEWB 1W6MB 1UZVA 2H0BA 3RWKX 3VBOA 4EV0A 1WWYA 5A7NA 1AYM1 3C3VA 1YNAA 2JKXA 1BKZA 3ZFFB 2Y26A 3H3UA 3K3NA 4YZ3A 5C5UA 5A3PA 4IEPA 1R081 3V0BA 5F7UA 3INAA 4KL1A 3WW4A 4LO4B 5AVAA 5BNOC 5CBLA 2OQ6A 4MH0E 4CSWA 4GWIA 3HEIA 4IEWA 4AR2A 3KZ4C 4DNYA 4LUMA 4OHWA 1AYN1 3M8LA 4ORFA 3UETA 3WF3A 3HR9A 2W2IA 2JIJA 3NNGA 4LBLA 3ZXFA 4HANA 3BTAA 5C3SA 3NV3A 3ITQA 1X36A 4K7JA 4YM1A 4JQTA 1UU4A 2EALA 2R1BA 1GICA 4BH9A 2A1XA 2WT1A 2ZOEB 4MXWA 4CA9A 4WZFA 4RHV3 3GM8A 2HWD2 1OT5A 1OSGA 2WLPA 2BOIA 3DPRA 1DQ5A 3BPZA 1V9U2 1ULFA 4AVTA 5L7OA 2VVFA 3MLJA 3NJYA 2GN3A 4YVWA 1MEC2 2AR6A 3WEZA 5GLZA 3KMHA 3ZFGC 4AXOA 3T0DA 2FD8A 2YPDA 4OHVA 1POQA 4NMIA 1VBB3 3WDWA 2IXIA 4OI0A 2VW1A 2WNUC 1W05A 4CUCA 3WG2A 2WA3A 4RQPC 3KF3A 3CZUA 4HVOA 2O1QA 3AC0A 5K4LA 1RUJ2 1Z7S1 3RG0A 5JXHA 4PLOA 1HV1A 4ASLA 1JH5A 1R1ZA 4P14A 2NLRA 2QDRA 4LE3A 4PIYA 1UU5A 3ZFGB 1NY71 1GNYA 5EJ3A 1ULDA 2VCMA 1DYPA 2XLGA 4FP3A 3UKTA 2PXJA 1C5HA 1ENSA 3B69A 3MFAA 1XYOA 1FOD1 4KBBA 4KMQA 5TSWA 5IVCA 1LECA 2QQJA 1LU2A 3ZYRA 2Y6LA 3SISA 1IPJA 3KHCA 4JGYA 1HV0A 3CNAA 5EWSA 2FMDA 4B1LA 4CDXA 4V2VA 4FPEA 2R0FA 4ES9A 1JOBA 1LNSA 1VB4A 4MO3M 4AE2A 5JPMB 1A34A 3MIGA 2HLEA 4Q0SA 3LAGA 1PM7A 2WNVA 2VTXA 2ZGUA 4MG2A 4IEUA 1FV2A 3ZSMA 1ZX5A 4XBLA 1RUG2 3AKQA 1OQDA 3MHZA 2VCBA 3K3OA 5FOBB 1XNAA 1QJX2 5IT6A 1PMHX 4AFMA 4H7LA 2RS33 5FYZA 2XVKA 4ISRA 5HXVA 3GF6A 4CPBA 4PBPA 1B35C 5FYMA 3SCGA 1JZ6A 5JPNB 4PIZA 3ZN4A 3WW2A 5JI7A 5L9BA 2V73A 3ROUA 4ZONA 4GMP0 3NMBA 3JBG3 2H0VA 1SLBA 4UOJA 4AQ6A 1UMHA 2V4AA 4D7SA 2IVJA 1WLWA 5B4XA 1W9SA 1BQPA 2HWD1 5DDJ2 4AVBA 3D4KA 3PMEA 4IV1A 5D2AA 1HLCA 1B35B 3F95A 2W5FA 1VBA3 3S30A 4AGGA 4Y4YA 1CIYA 4M3CE 1J1LA 4IV3C 1JOPA 4LKEA 3GBFA 5FYTA 3MIEA 1CPMA 2YFZA 2EXKA 4LA2A 2DTYA 2WO7A 3VN4A 1DGLA 1K5JA 2R49A 1D0GA 5KHHA 1DQ2A 1W2OA 4FI9A 1XBFA 1YYNA 1AR73 2QUOA 3Q8BA 1TME3 4JQRA 4DQAA 3BKZA 1BEV3 1JU3A 2LUWA 5JOZA 5LBFA 3VBRC 1RUJ1 4N43A 5IVFA 4JGZA 1AXKA 4IV3B 1MS9A 1OD5A 1UWWA 2CNAA 1W9TA 2WFF2 2CWMA 4XJUA 1ZZBA 3EMRA 5F32A 4F7ZA 4AL9A 2GC3A 2VQAA 1TZOA 1W6PB 4RN5A 4AZZA 3IIIA 5C7GA 3T08A 1ALYA 4LEJA 2Q4SA 5FYVA 1QQP1 3ZR5A 4UF0B 3VBRB 5HV4A 1ZBE2 5KHJA 2D93A 4XIOA 1IHMA 2WS93 4RR3A 4O9EA 3RPQA 1S2KA 4ZKTB 1PK6A 2ORXA 4Y5TA 4QKBA 2GMEA 1JI6A 3WDYA 4WM7A 3POSA 3UV9A 2WA4A 1RUG1 1S0GA 1L7LA 1UO9A 3IMMA 2ENRA 3VHOA 3ZXAC 2VNVA 3WNOA 1DGWA 1PIV2 1W6MA 1AZDA 2JB8A 2XLAA 5CG9A 2WZR1 3GHMA 4AEJA 3TEZA 3FX3A 3IB3A 1VLNA 2RMU3 2XQRA 2X09A 3ZFFA 4K21A 5EHDA 2FDGA 2ZHMA 3HWJA 5GLTA 3RI9A 5C4WC 3B02A 1DZTA 2WT2A 3GJBA 1LB2A 4YGEA 1V6OA 3A0KA 1XQNA 4GA9A 4CCKA 5JZGC 1UZ0A 3ZXEA 3UYJA 1N1SA 5K7PA 1YRZA 4XQWA 1Q8QA 5T3NA 3D6EA 4IE7A 5DDJ1 2RE9A 1LOFC 4YG0A 4XBQA 3APBA 3N3HA 1Y9MA 3AKPA 4XAAA 2Y6JA 1ST8A 4YZ4A 3O1PA 3WF0A 1QXJA 5C4WB 4K1ZA 1AJKA 2VE1A 3WDVA 4A45A 1ZBA1 4PT6A 1OFNA 5E6HA 3P5BA 5BNOA 1AR83 3KHBA 5JZGB 2VMFA 3RZGA 2XMLA 1RMU2 1ZM1A 3OUHA 4X6QB 1A8DA 1H6YA 3B5LB 5KXDA 4MGZE 5GLWA 1ND2C 2DUPA 3OUJA 4D69A 2EVXA 4JZRA 1GOHA 1H9WA 4QGMA 1JZ8A 5FP4A 2OW4A 4R4ZA 2A75A 2E6VA 1APNA 2XBO3 2WFF1 1IG3A 5T55A 2PHUA 1KJLA 2Q1FA 1LENA 5HCFA 1WCDJ 1GANA 1MZEA 4UFKA 2O14A 4LJHA 4LBKA 5IATA 1XSRA 1LHOA 4CPBD 5LW9A 2FDFA 2R0HA 3GXUA 4KWKA 1X8EA 4QU2A 4UWDA 5KC6A 2QQMA 2G4IA 3LFIA 4XETA 2PHFA 3T4HB 1OLME 1GQGA 3MW2A 3AP6A 4QPWA 5H9QA 4IEOA 3VZLA 3V0AB 1V6IA 2WNUA 4C8DA 4FBFA 2YDEA 3B01A 5FZ9A 4B7EA 2ZA9A 1FAYA 3AL5A 4RQPA 5JUVA 3AP5A 1ND3C 3WR0A 2JENA 3CEWA 1UZYA 3PJQA 5FZ4A 2JE8A 4JRAA 2W39A 1PIV1 3CL1A 3K46A 4N7UA 5FZHA 1RIRA 3CMGA 2R042 5DQ0A 2X53S 3NNFA 4Q0PA 3K77A 2XKPA 3RZKA 4XJ9A 1ASJ3 1DYOA 3WF4A 4BIFA 4ET7A 3PNAA 4NO4A 4Y33A 3SHRA 3O1UA 2CY6A 4XE9A 2GAUA 2BDRA 2WDBA 5AVPA 4UFHA 1ND3B 1LEMA 2F4PA 1PZ7A 1W04A 2A70A 4CE8A 2VU9A 4NN0A 1HN0A 3B9IA 3N36A 5FR3A 1S0EA 2JG9C 4XFAA 3BTZA 5LZ6A 1OI6A 1UX6A 3THCA 1LOBA 1WLCA 4NPLA 1EAH2 1ZZCA 1RUI2 3WUDA 1FNZA 1RMU1 3ACLA 1B35A 3M70A 2JG9B 1YFWA 2VY0A 1GQPA 3KCYA 4DMIA 1QXPA 4G3YC 2BP6A 4OHXA 1WA4A 3QD6A 1XNBA 4Q4Y3 3HD8B 1E5RA 3R0RA 4LIVA 3I97A 5FZ1A 4FFFA 3ZN6A 2Z69A 3O14A 4IDZA 1PO22 2ZXQA 5FOJB 2BZDA 1HXS2 3FHAA 4QKFA 3TRSB 1BK1A 2WZ8A 4GMP3 3WP5A 3H8XA 1PVXA 4TSVA 5CISA 2EXHA 1LODA 1OKOA 4P9IA 1LGNA 1TVGA 4Y4RA 2W1QA 2JKBA 1RVF3 3FUQA 5ACA3 5FZ7A 4MZUA 3IT8A 1PNGA 1W6PA 1W8ZA 1RUNA 2WT0A 1I1EA 3AXEA 5FJHA 4CU9A 1OVPA 1WW5A 5B4NA 1PVC3 4UF0A 3VBRA 4MXVA 2R16A 5FP9A 1GZTA 2HWC2 1OUSA 1DFQA 1Y9QA 4KGGA 1NXMA 4UBGA 3B94A 3J26N 2F4LA 4XF9A 4XJZA 2DV9A 2IXKA 1PGL2 4EZHA 1AR62 4SLIA 1J83A 2R041 4TWTA 2DUOA 4YGCA 4I09A 2R062 5FY4A 1IQAA 1XXNA 4PLMA 2BBAA 2J42A 2IFRA 2JDMA 2JB4A 2GU9A 1DYKA 1SLTA 2VNRA 1OA4A 1NZIA 4IQPA 1VAVA 2E31A 5CZKA 5FMBA 2Q8DA 4BDVB 3LFMA 3P1IA 4IW3A 3WZ1A 4ZZ5A 3BYWA 3C7GA 5A3WA 3CU7A 5DZGA 3HJRA 1W3XA 2VQ0A 1G86A 2W95A 1YLLA 2ZABA 2B9VA 5JSOA 3IM0A 2C9AA 2GH2A 1RUE2 1K45A 4JDNA 5CADA 5E16A 2XL7A 5GZEA 4LLFA 1RUI1 1S2BA 2RS52 4IL7A 1CZVA 1EV12 3JCIA 1UY4A 4FTEA 1QDCA 1XE0A 3O0XA 4EE2A 3OGSA 1KXGA 2ATFA 5J3UA 5C4WA 3GDBA 1NE6A 1W0PA 4YGDA 4FPHA 1E5IA 2NM1A 3JBG1 5C3PA 4BQXA 2NZ9A 3ECQA 4IE5A 5GLVA 4YW4A 1A6CA 1DDLA 2BBVA 1HRI3 4D7YA 1FI2A 4XFFA 5A6XA 2YBPA 3M1HA 1J58A 1LOFA 1PO21 4ZXKA 4N7IA 4JKMA 4M4RA 3C7FA 3N7MA 4FQZA 2GC2A 1HXS1 2XONA 4S2HA 4YZ2A 2AACA 1ZRIA 4QX8A 1CN1A 1JW6A 3OBZA 1DBNA 5FLJA 5D8AA 1L7RA 2GNDA 5IK5A 1IPSA 4QDRA 2VBBA 1OMIA 3H7JA 2RDNA 2W0XA 5FZLA 1FX5A 5FUPA 1ZZ9A 1BEV1 2GC1A 2JDHA 2JDNA 2A6WA 2VZQA 1O4TA 3S5AA 5FK8A 1ND2A 4HBNA 5FZOB 3W5NA 4A6OA 2D6LX 5FKCA 3LDRA 2UU8A 3TYJA 5F9TA 2R072 4CXWA 2XGXA 5EV7A 4GB32 2LW8A 5IVVA 1OQEA 5H9PA 2HWE2 4UFLA 5BPXA 3RMXA 3KCCA 1PGL1 1AR61 3ZYHA 4M0HA 2VECA 2ZEWA 4XYXA 1U12A 5FZAA 5BNNC 2VZOA 5CKMA 2R061 2YV8A 4IEQA 5FV3A 1CAVA 1IGOA 2WKKA 1YFXA 2WUHA 1Y7BA 2B45X 3IKWA 3ZN5A 2QNKA 2RDQA 3OGRA 4LNVA 3ZXKA 1JZ2A 4L8QA 2PAKA 3VD7A 1NA1C 3HT1A 4COVA 2Q30A 4AVVA 2C6SA 3O0WA 2EXJA 5C8CB 5BNNB 4MGYE 3I2IA 4TLGA 4COWA 1ND3A 5C33A 1POV0 1U5YA 1YUDA 2XLFA 3DUIA 4XURA 3W58A 4COUA 5DAWA 2EAKA 4PJYA 2FDKA 2A7AA 2BTVC 5A7QA 3JZVA 1RUF2 1SFYA 2RMU1 3GCXA 1LHNA 1S0IA 4KBZA 5FZCA 1TMF2 2RJ2A 1NA1B 1U5XA 4XFHA 4JCKA 4FXKB 3N9PA 3WF2A 5LRSA 3BPSA 2AENA 2VXJA 4RGKA 4MGSA 4BZ4A 5E88A 1UOFA 1PO13 1OF4A 1NE4A 1QF3A 2VG9A 3MIBA 4HK9A 3GNEA 4IEVA 3RQ0A 4HVRA 4NPRA 4UFJA 1NOVA 1D0HA 3ABZA 4MGIE 4BB3A 1PMIA 2JG9A 2Q0AA 4UAPA 1PX4A 2VUAA 4XHBA 1GNHA 3R05A 2P3JA 4XIKA 3TN92 3WHUA 4AW7A 2RM22 5C70A 3SH5A 4PDWC 1LOAA 4FPCA 2TEPA 3EO6A 5CFDC 1IS5A 1C28A 4A42A 4Y24A 2C26A 1QOOA 1R093 2XDVA 5IVEA 3M7AA 3VBHC 1FATA 4Y5SA 4M01A 2VUDA 5F3GA 1SACA 4QHBA 1SG3A 5T5OA 2MPFA 3VZOA 1UYYA 1SHWB 3WT3A 2UWAA 4J25A 3RMYA 5JOYA 1O5UA 2VH9A 1X50A 3FZ3A 2VUJA 2VW2A 3MGUA 3PTRB 4PDWB 4QHOA 3BTXA 1GWLA 3D82A 4HVQA 4MYEA 3POFA 1W6QB 4QXBA 1K5MA 2DVGA 3VBHB 2HWE1 5FKBA 5AC91 1BK0A 5FQ0A 2BGCA 2JG8B 2A3WA 4ATFA 1TNFA 1WLTA 2XH6A 1RUD3 5ANQA 2AREA 1O59A 2X29A 1MS4A 2ZGKA 2LALA 1G7YA 4NWWA 1H4HA 2W92A 4FT8A 3OCPA 4FPLA 3SMHA 4BE3A 2XPJA 1UZWA 1DIWA 1WD4A 1MQTC 1HN1A 1NZCA 4LKFA 1J3PA 4GKYA 1IKPA 4Z2AA 4BQWA 1C8NA 3JD72 3KV4A 5KWRA 1W03A 1JTZX 4Y20B 2QE3A 5GZGA 1MS1A 5T50A 5GLUA 2QKDA 4H14A 3AP9A 4BQYA 4QX2A 1O3SA 3MDPA 2VL4A 5FYUA 3VZJA 3Q8AA 3H8OA 1RUC2 4JDOA 3AXDA 1ASJ1 4L11A 2ZS6B 3PU8A 4JC1A 1TMF1 4WVMB 4XHXA 3UT0A 4ZS3A 1JYTA 1NUKA 2EXIA 3C2UA 1MQTB 2P3KA 2WL1A 1IS4A 3BU7A 2BGPA 2DDUA 2GDFA 2PAMA 4YFZA 1AX1A 4XTPA 4CCJA 1JXNA 3AKSA 4UYBA 4CU6A 4KGQA 3LDBA 4QD2A 3EHKA 1F4HA 2AEZA 2SLIA 5FWEA 4O61A 4ZXEA 4A6SA 3S0MA 2ZGTA 1VBD2 2PHRA 4UFIA 1US3A 3ZLIA 4MHRA 3UNPA 1H0BA 3K48A 2XOMA 5JAXA 4GQ7A 4LHNA 2C5DA 3GHNA 4KQ7A 2YHJA 1I3HA 5A7OA 3TNQA 3Q8EA 1D4VB 1Z0HA 1RHI3 2WN3A 3NAPC 5FREA 4FOWA 3CKHA 4AOCA 4NIHA 1IQDC 4LXLA 2AYHA 1C8M2 4NRQA 5DUVA 3TAYA 3O0VA 1SPPA 3OBAA 2NYYA 1I6XA 4E8CA 4Y1VA 5A7WA 4Q4Y1 5DN2A 3SEEA 2VO5A 2WWSA 3T0BA 3POWA 3ZPOA 4PF1A 1R082 3NSTA 2XUEA 4HL0A 4WVWA 1W8NA 4HSLA 1Q43A 3NAPB 1BMV1 1UD1A 2X8KA 2A6ZA 2QQKA 1NCQA 1NXD1 2RJKA 3BALA 3OTFA 1D4M3 1UY0A 4HKOA 1O4ZA 3ON7A 5DUWA 4WM8C 4EN6B 3TEWA 4LOSA 5EIYB 1AR92 4GMP1 1W8TA 1NLSA 3A22A 2QQIA 4LQRA 1AYN2 4ARXA 1QJY3 4XDPA 4PIXA 2O0OA 3WP6A 3N9OA 4CCNA 4OMCA 4BA6A 1JODA 5FY1A 3U1XA 4LT5A 1ACCA 5FZDA 2WR9A 5DAQA 3IDBB 2WO3A 4O65A 4Q0UA 2VTXJ 1OOPC 5I0SA 1GU3A 3ZYBA 2NPIA 2Y0IA 3S7IA 2D97A 4WM8B 4AI0A 4D6QA 1PVC1 1RGSA 3DL3A 4XACA 2BYVE 3JD71 1C1LA 5EYYA 2Y0OA 5T54A 3RRDA 3DN7A 4AI9A 3QOPA 1O4YA 3VBSC 2BRTA 4LORA 4ZU7A 1UIKA 2EIDA 1NT0A 3MEPA 1XNDA 4QB1A 1OQ1A 2DYCA 1HRV1 1U0AA 2EAAA 2A73B 1H1MA 3CDZB 3EQEA 1MPXA 1OOPB 3VBFB 2RV9A 5C8CA 5BNNA 3ZKUA 3ZYJB 2V5YA 4XJ8A 3TEYA 4GAZA 3TB0A 2FDJA 1MS3A 1W6OA 1Z7S2 2VMIA 1W2AX 4NUBA 4XF1A 3VBSB 3ZXDA 1NA1A 3GYDA 4TTGA 4JV4A 2J22A 2MEV3 3AFKA 3J7LA 4MSVA 5DZFA 4CEWC 5L19A 2VVDA 5FIXA 1TG7A 1VBD1 5DXDA 1WD3A 5IFTA 5F1RA 4A2UA 4XMAA 4HONA 5C8WA 4P9YA 2DCJA 4U2AA 1KDMA 1YQ6A 3J8F3 5I0DA 5EFUA 3ZMNA 4JTOA 1DQ1A 4IESA 2ADDA 2PLV3 2R1DA 2VOVA 2WYFA 5KC5A 5IAVA 3A0NA 1O8SA 2ZGLA 5T52A 5JSPA 1GSLA 1POV3 2OVUA 1OF3A 1VP6A 3WY6A 3I3DA 3KLSA 3GBGA 1HRI1 2HWF3 2RG4A 5A1LA 5A7SA 3VKNA 4GJYA 1F35A 1ZVFA 1X9PA 3AK0A 2VMHA 1QWRA 3LPGA 2Q5TA 2G19A 2UWBA 3OEAA 4Q4W3 1BXHA 2QQPA 1W3VA 2AZ5A 1AR91 2FCVA 3CBNA 3M3EA 3NJVA 1W9FA 5GALA 4Q4X2 5C71A 1UOGA 1AL23 1SCRA 1YQCA 4BWOA 5CFDA 3CJXA 5FPBA 3LF7A 3KM5A 1JYXA 5FY5A 3E5QA 4EYUA 4AEMA 4YARA 2FZ1A 2R7EB 3LSEA 3VBHA 2ZX4A 4KU8A 3H1MA 4H2AA 5FBZA 1KJRA 3VHRA 4YW6A 2OPWA 1RUH3 5FCCA 4EN7B 1ZYBA 4MGQA 2K2SA 2VZRA 2YU2A 1H2MA 1K42A 2OKXA 3K4DA 4N9HA 1H2LA 2K9ZA 3OPTA 3NW4A 4QKNA 2Y6GA 4CCDA 4DUXA 4HSJA 5HV0A 5FYSA 3BIEA 5A6ZA 1LHVA 1H8VA 3WP3A 1E5SA 1SLLA 2HEWF 1QJEA 4XVHA 5LY2A
chains in the Genus database with same CATH topology
1RC6A 2DCZA 3ES4A 4OUMA 4Y20A 2JECA 4GWNA 5GZDA 1C57A 2WQ4A 2DVFA 5CVRA 4FAGA 1WGPA 3X29B 3D8CA 1KITA 4U36A 2YXSA 4WVMA 2IZWA 4PBOA 3AMQA 4XFCA 5F6KA 4W6WA 1MQTA 2CWSA 2I74A 1CGPA 3VHPA 2RR12 1OLQA 1ZA4A 2BUKA 5BUVA 1R1A2 4OFGA 1H9PA 5A32B 2CAUA 5BV6A 1QQP2 1FT9A 4D94A 3LA2A 3NL1A 2K0GA 3SH4A 2GZWA 4LBQB 1CJPA 2E7AA 2D6MA 1FPN3 2RS12 3BOWA 1Y43B 1N1YA 4AK3A 1PO11 4K40A 4AFBA 2D7FA 2YY1A 3GALA 2VOXA 4P9GA 4R9CA 5T5JA 3VV1A 3JQWA 1F8VA 2WZR2 2B42B 4KU7A 3SLIA 4Q4X1 1WLDA 1BBT3 3NAPA 1LJ7A 1S0BA 2PAEA 4HKLA 4XJWA 1QJU3 4R52A 4FXGB 2DCTA 4YGBA 4AQSA 1CPNA 4OI1A 5FPXA 4AQTA 4F83A 5GM0A 1H2KA 1Z78A 1DGRN 4LA3A 4QPYA 3TNPB 1PGSA 1ZBA2 4Z2WA 3I59B 5J36A 2E63A 1MZ6A 4WM8A 1HQWA 3FE5A 1AX2A 1CD3G 4AI8A 1VRH3 3LGRA 3VKLA 3BIWE 3RWNA 4GH4C 4AHYA 4I01A 1UF2C 2ZJCA 4XILA 5E1RA 1UPIA 2D44A 1OOPA 2D6NA 4CDQC 2FZ2A 1AX0A 3MLLA 1BVP1 2RR11 2ZHKA 3ILNA 3FJSA 1YHFA 1R1A1 4OHZA 1G9AA 4GH4B 3VBSA 3RJ2X 4QQ2A 1KRIA 2GNBA 3H9AA 4K8FA 5I8YA 1XU2A 1VBC3 2E51A 1IPKA 1FMD2 2B8MA 4MV2A 2RS11 4CDQB 2D3PA 3OGGA 2IXJA 1G8WA 1UU6A 1X33A 1J3RA 2DFCA 4WVVA 1BCXA 1IS3A 3G7DA 5I91A 1QDOA 4CEWA 2XB6C 1JOJA 4B7KA 4ES8A 1VBE3 1RJ7A 2E53A 4YYOA 5A3LA 3E6BA 4Z8BA 3ZFEB 4LBNA 3UKVA 3ZO0B 1DZRA 3AFGA 3KB5A 5K8SA 1AXYA 1LR5A 3B00A 3DGTA 2B39A 4XDQA 2FBEA 4UXAA 4CP0A 2N7GA 1A8MA 1S0FA 2HYKA 3J4UH 3MF6A 1D4M1 3HT2A 1LGBA 5F6LB 1LOCA 4HN0A 4AGRA 3AMMA 2BWCA 5FPZA 4LTAA 3MIFA 4QGNA 1QOSA 4OLLA 4CZSA 3FHIB 5JOWA 3AM2A 4LUKA 5FRAA 2CL2A 3AMHA 2RHPA 3OPZA 1SLAA 4M3CA 4IEZA 1SFNA 5KXEA 2B5HA 2DTWA 2IC1A 3LKJA 2XJQA 3VGIA 5IK4A 1LHWA 3DKWA 4MUVA 2BWAA 4AG4A 4J1WA 3E97A 1VBB2 3ZFGA 4EROA 1ENXA 3BOPA 3NVCA 3FFZA 3USUB 1FMD1 4BLIA 3AYAA 3AYCA 3I7DA 5A32A 3T2TA 1F2NA 5C9AC 3L2HA 4E4SA 2TUNA 4GB33 4LBQA 4CDUC 2PYTA 1DF0A 4LULA 4MX3A 4YG3A 3VBUC 5BNQA 2UURA 3ES1A 5J37A 5I0UA 2PLV1 5C9AB 4PQ9A 3L9JT 5JOXA 2A3YA 3CJIC 1QNWA 4CDUB 1F31A 2JEMA 3ZMOA 4RGAA 3LOIA 2BVBA 4NVPA 1D2SA 3WVJA 3IN9A 3VBUB 3CO2A 3URFA 4FOVA 3HAGA 4D7TA 2GNMA 4I02A 2RS32 4EJRA 4FPJA 4LBJA 2ZGOA 4Z82A 5CA6A 2CTVA 3CJIB 1I5ZA 4DZGA 1TNRA 4LO6B 4FCAA 4AQ2A 3JBG2 3I59A 4QMAA 4NOTA 1RUH1 4FSJA 4RHV1 4LLOA 4Q0QA 2HEVF 3RYPA 5FLHA 3HMYA 1VBA2 2D6PA 5JSRA 1DG6A 3L2YA 2BNMA 3TN93 4L92A 2IWGB 5AFEA 1RL3A 1C5IA 2VNOA 4C0HA 4IV3A 4W6YA 2ERFA 4QPGC 2AH2A 3MZHA 4W65A 5HCAA 1VBB1 3MICA 1UN1A 2HJIA 2R32A 5SV5A 1AR72 2XKOA 1TME2 4G4FA 4W6XA 1BYHA 1COV3 1BEV2 4FO9A 4OUSA 1IOAA 3MPBA 5KHGA 3RZZA 2PFWA 4KWLA 1A78A 2TNFA 4GH4A 1UKRA 2UWCA 2ZTNA 1ZZ6A 3T1LA 3I8TA 1NQJA 4QPGB 2YYOA 1Q5OA 3AJZA 1KFXL 4CDQA 2DF7A 3E6CC 4AF9A 1YFUA 3AKRA 4XPVA 1N47A 2DWRA 2PN5A 2XVGA 3M3QA 2WS92 2DU0A 1LOEA 4FTBA 5IK7A 3FC0A 1FPN1 1QOTA 1NCRB 1CAWB 2OYZA 2R6QA 3AX4A 3K51A 4FVVA 5DUXA 2D3RA 1EY2A 4BIOA 4YVSC 4AEDB 1U5IA 2SBAA 4A7YA 1NLRA 2RS31 3N7LA 4XXPA 1DQ4A 4N90A 4SBVA 1AXZA 2FMYA 2P17A 2RMU2 3USSA 1XYNA 4AWDA 4HMZA 4Q4V3 1IKQA 3WXPA 4M3CF 3HN1A 1BBT1 2NQYA 3W59A 1SQ4A 2NN8A 4FOYA 4YVSB 1ULEA 2Z79A 2ZCWA 4PLNA 3MPPG 1Q8VA 2BEOA 5JZGA 3AZVA 3KS7A 2PQQA 1OPOA 4Y1UA 5AFBA 1VBA1 3PLQA 4LBQD 1KDKA 4S2GA 1V6NA 3WLUA 3H8UA 5JI9A 1AR82 3ZYIB 2ZX1A 1LOGA 4P9LA 2W68A 1V00A 5CAZA 5FFOC 2OPKA 4DY3A 3N7JA 4DXZA 1AR71 3GZTB 1TME1 3V65A 5FDBA 3N4MA 3RSJA 3G6JB 3EXUA 1AYM3 4X8PA 3WDUA 1RINA 3AP4A 4GIQA 3QACA 3RI8A 1NQDA 3RYKA 1MS8A 3RS6A 3V0AA 3USUA 2HWB3 5EYXA 3PVOA 2GMPA 4BM8A 1SLIA 1AJOA 5AC92 1VAKA 4XF4A 1AYN3 4I0AA 1SDWA 3ATGA 3LA7A 3UKNA 2WS91 4XF0A 2PHXA 4C1XA 3WCRA 2GC0A 3VKMA 3THTA 4NWVA 4QM8A 3SCHA 3WW1A 3U07A 4ZU4A 4I2OA 2ZX2A 3PVNA 5KHKA 1PGW2 1WMDA 1FNYA 1A3KA 2DCYA 5C9AA 3IDCB 1EPWA 4CDUA 2XHKA 1DGWX 4QQLA 4QGLA 1ASJ2 4KG8A 3VBUA 3FWEA 3NKGA 4RGGA 1VALA 1H1IA 3AYDA 2XJUA 3OJBA 1Z7S3 4XJAA 1B09A 4R9BA 1BJQA 1X8MA 3VHNA 2CGPA 1CJDA 4GWMA 5BY5A 4LHLA 2B9UA 1UMZA 2D3SA 2OZ6A 3ENRA 2VULA 3FBMA 3AKTA 2D6OX 1J59A 1O3QA 4C0BA 1FOD3 4RA0A 3B93A 3M2MA 5I8SA 2EA7A 1AR81 4EN0A 1OA3A 5GZFA 2OIIA 1N1VA 3RYRA 1OPMA 1EPZA 2KM2A 4OVEA 5DUUA 4DS0A 2TBVA 1WCKA 1N1TA 2JG8C 2PELA 1O3TA 2A6XA 4A7ZA 4I30A 3WNXA 4I0WB 4Q4Y2 5H9RA 2XBO1 3SNMA 1BMV2 2ZACA 1UKGA 4Y26A 1AL0G 1UAIA 2D40A 2VPVA 4J6GA 5JLVA 2ZKNA 4M0NA 3BODA 3OF1A 2QCSB 4AFAA 2JD4A 4AI3A 1MZ5A 2VOWA 4CTEA 4QPGA 1RVF2 5ACA2 2YROA 3TBDA 2XJVA 2HWD3 3CF6E 1PVC2 1GZCA 2ZHLA 1PGW1 2CYFA 2UY8A 1V9U3 1X82A 1MEC3 2XWBB 4P9JA 1UW8A 5JIUA 3FFQA 4JVAA 1HRV2 3KGLA 4HFSA 4HZFA 4K1YA 2IXHA 4XXAA 4E4DX 2X5IC 2CGNA 4Q1PA 5L7OB 4XQDA 1DQ6A 1RTVA 1O5LA 2OUJA 4YVWB 4KH9A 1NYWA 1RUJ3 4AVCA 3LSDA 4YM0A 3WQ0A 1YI9A 3PVBB 4XZPA 5KBFA 2GALA 4YVSA 5J48A 1GQHA 1NG0A 2X5IB 1SBDA 2PHWA 2P3IA 4XFGA 4BQ1A 2NP0A 2IXCA 4FTSA 3PJYA 1DGRA 2EF6A 2XJSA 2GN7A 4E2GA 3ZXGA 1MACA 1ZRCA 4YM3A 4AI1A 3W9AA 4JRLA 4JDMA 2ES3A 1HRI2 1SEFA 1RUG3 1YJKA 4LHKA 2ZGMA 1QJX3 3UJQA 2O8OA 4AHWA 4BMBA 2WZR3 2VW0A 2WNVB 3AZWA 4FQ4A 5JDBA 4AHZA 2ZMLA 4CEYC 4YSFA 2WJSA 4QQHA 2CAVA 1RB8G 3UK9A 5GZCA 4YNIA 2BVVA 5DG1A 1RVF1 3H3ZA 1VB2A 5ACA1 1S55A 3VBFC 2YGMA 4R9DA 5DDJ3 3ZXLA 1C1FA 4Q8KA 1FYUA 1YIFA 3ZX7A 4CEYB 5EZWA 5BNPC 4CYDA 1ZBA3 2A6YA 2ZX0A 4RSUA 3BCWA 1GLHA 4Q0VA 3GZUC 4WBBA 3ASIA 4JGZC 4RL7A 4QX5A 5BNPB 3PMSA 4ASMB 5LEJA 2W52A 1W6NB 3B3QE 4TLFA 2WFF3 3CLPA 2BNNA 1CQ9A 2FQPA 1OLRA 1ZNPA 3VKOA 5KXCA 3S7EA 4N43B 4JGZB 1GFF2 4FOQA 4H3WA 2AUYA 2ZGRA 4Q4V1 4J1XA 1ZBE3 1T6GC 3KT4A 3LB9A 1WMFA 2ILMA 4URTA 1W2UA 5I93A 2ZMKA 1PO12 4HLTA 2GSYA 3FLPA 5LK7B 4XMIA 4BMEA 1O3RA 4E2SA 2WIIB 1MS0A 1E57A 1PIV3 4XW3A 3H7YA 4NR1A 5LEKA 5FMOL 5A33B 1YWKA 3M3CA 3JU9A 3O12A 4PDWA 4WM7B 5GKAC 3OYWB 1R092 1WCSA 4H55A 1C3HA 1DLLA 2B46X 4B4RA 1W6QA 2A6VA 4RS5C 2VMGA 4NHLA 4LBMA 2ZAAA 4YFWA 4RFT0 3VDDC 3U0ZA 2JG8A 1AUYA 4GULA 3VZMA 3B9CA 3AMNA 1REEA 2HWB1 4IETA 3H0OA 4IXLA 4RS5B 4MGKE 3ALQA 1RMU3 3SH3A 3VDDB 4WZCA 4NHKA 1RUD2 3PTYA 2W08A 3MI8A 4V1PA 3KSCA 2G9FA 3WHTA 4E9KA 5I8TA 5BNOB 1PNFA 3ETQA 1S0DA 1IS6A 1ZRDA 4BCUA 1U5ZA 3LZZA 1GZWB 1ZRRA 2ET7A 2I2SA 1Q56A 1QMJA 3O7OA 4Q1RA 4YZ1A 1H1AA 2DURA 4UW4A 1DZQA 1VR3A 4ISQA 5CNAA 4BPZA 1HW5A 4KG0A 4QQOA 4CRQA 3IIAA 2IXLA 5CFCC 5FLIA 2X5IA 4QQPA 2EIGA 3ZSJA 3WQ1A 3H1WA 2R30A 1ULCA 2ARBA 2ZBJA 2GH8A 1ULGA 4HETA 4XEZA 3M3OA 2MNGA 3P3NA 1LU1A 4YRDA 2WNUB 3IMNA 2E9QA 5CFCB 5JVVA 2DVAA 1PZ8A 2R043 4ATEA 1I9RA 3ILRA 4RQPB 4PF5A 1RHI2 3PHMA 4A3XA 2HEYF 4DRRA 1R091 3WOGA 1Q8OA 1JHNA 4B4QA 1N3QA 1REDA 2XL9A 3OD4A 4DPNA 3ZSEA 3MIHA 2BFUL 2D5FA 3U10A 2ZGNA 3WDTA 2KXLA 1D4M2 4COZA 1IZ3A 2QZ2A 1EAH3 1UPSA 1RUI3 1YCIA 5EXOA 1QJY2 2G9GA 3VL9A 1GZ9A 3WG3A 1RUD1 3KCXA 4CEYA 1M4WA 1JBCA 1D2QA 1O91A 4S2DA 5KXBA 2YGLA 5LK5A 2GNTA 3WV6A 1QXRA 3VBFA 4G9SB 4BLJA 1V9U1 4OULA 1GYKA 4UBHA 1PO23 1ZZ7A 4LR4A 1LTEA 3POYA 1MEC1 4UW5A 1HXS3 5BNPA 5JWPA 2Q1MA 1OA2A 4FP2A 4E2QA 4QPIC 1VJ2A 1YIPA 4EWDA 1F9KA 3THPA 1W6NA 3ZN6B 1FV3A 4I3GA 3OD0A 4K9SA 3SCFA 3GZAA 2WC2A 4XOGA 1GNZA 4YLZA 2YC0A 2IFWA 3ZFEC 4YW5A 2VNGA 2MEV2 4E4ZA 2DUQA 2HWC3 4QPIB 2YZ4A 1WW6A 4HK8A 1UZZA 2QVSB 3NJZA 1AR63 4P9WA 3IBMA 3J8F2 1RHI1 2R063 2ZZQA 3QLQA 1UCXA 4B3NA 1LULA 4B8EA 5J98B 2PLV2 5JIAA 4ITCA 1SMVA 2E7TA 1XU1A 5BXXA 5A33A 1KFUL 1G9CA 2XUMA 5CU1A 1ENRA 3OYWA 2HWF2 2OA2A 4DOUA 1QJX1 1RUE3 4Q4W2 5L73A 1CAXB 4Z07A 1QHDA 3HIFA 2RS53 4C91A 1EV13 1QJY1 1AL22 4R9AA 2E7QA 3WG4A 1LEDA 1S0JA 3N7KA 2I07B 4FPGA 1OKQA 4MVTA 3FLRA 1LGCA 4H7MA 3SXWA 1URXA 3ELNA 4RS5A 3ZIXA 3VUOA 1RUH2 4HPKB 4RHV2 1KS5A 1JYCA 2DVDA 3VDDA 5K0UC 1J3QA 3N35A 1CESA 1OHFA 4B4PA 3AZYA 4QT6A 4DY5A 3HQXA 3SITA 1WBFA 3QH6A 3WG1A 1AF9A 3Q9OA 5D8AC 1PZ9A 3FUOA 1GZWA 1TQ5A 3ME2A 4FPYA 2JE9A 5IT6A 1WMEA 2XG3A 1XE8A 4UW3A 3T1MA 3I54A 1MVQA 5K0UB 3EBRA 3AMPA 3ZSKA 3KQRA 1LHUA 1CVNA 2AGSA 5D8AB 2WSVA 1QGLA 2R073 2D43A 2MEV1 4AVAA 3ZSLA 4AFDA 5JR7B 5I0TA 2HWE3 5AC93 1S1AA 1ND2B 2WLQA 3KT7A 4UW6A 3J8F1 5JCTA 1ZBE1 5GJ6A 4GALA 1HQLA 4LE4A 5T5PA 1LRHA 1FPN2 2B7YA 1AHSA 5JMCA 1QNYA 2DU1A 1POV1 5J09A 5CFCA 3OGJA 4CDWC 1UL9A 3WUCA 1V70A 2XJRA 1CAVB 2ZX3A 3WX5A 4YW1A 2HWF1 3ILFA 4N53C 4XFBA 3VZNA 4L9BA 5DZEA 1BVVA 4F3JA 4JTNA 4INDA 4K6BA 4Q4W1 5DG2A 5D1IA 3QCWA 1RUF3 3P3PA 3NO8A 3WW3A 1AL21 1TMF3 4CDWB 3IDEA 1BBT2 2BNOA 3GBWA 4FAHA 3MW3A 5HBAA 1KS4A 2DFBA 1ZZ8A 4I0BA 2Z42A 4N53B 1L3JA 1QJU2 3ZPYA 4X8NA 4DB5A 1JN2P 1W0OA 4ZU5A 4B29A 5ABJC 1DU3D 2A5ZA 4XFIA 2JXAA 1WBLA 2RM23 2Y38A 2A71A 5J7MA 1H30A 1VRH2 3M4FA 4Q27A 1H8TC 5ABJB 2XJPA 3ZXJA 4Q8LA 4E27A 2PHDA 1MZFA 4MLOA 1K5MC 1ONAA 1JUHA 1V6KA 4YW3A 1NCRC 1RJ8A 1MS5A 4BHPA 4TYSA 1DQ0A 5H9SA 2ZAHA 3KGZA 4IERA 2XJTA 5I0RA 4AEDC 5CG8A 1H8TB 1WUVA 3E6DA 2LTNA 5FMOS 5B2GB 4QPIA 4ONUA 1VBC2 1K5MB 5CB7A 3JB4C 3IWZA 4Y1YA 3WP4A 4GXLA 5FQ0B 2FHRA 4XF3A 4C90A 4EWEA 1YFYA 3AB0A 3JD73 3ZFEA 2ZGQA 1OFSA 3H1YA 1UIJA 1H4GA 1XNCA 2Z5WA 2HKXA 3S6PA 1VBE2 1RUC3 1HRV3 2Z2SB 1YJLA 3TWIA 1M06G 1CIWA 4YZ5A 5HCBA 1G6NA 1FXZA 2NMOA 4Z1VA 2ZPXA 1CAXA 3AJYA 1BZWA 1QJU1 3R6SA 1G9FA 4NHMA 2H6BA 4P5HA 1VBD3 1X7NA 1EAH1 2YPJA 1ENQA 4L2NA 4Z92B 4HPKA 1N3OA 2H6CA 4OZXA 5FO8B 4META 3FLTA 2DVBA 4FPFA 1LESA 2A3XA 2ZMNA 1HKDA 1VRH1 4IEXA 1C8M3 1EP0A 4OHYA 3MLKA 1GR3A 1XRUA 2QZ3A 2Q1ZB 2QFEA 2ET1A 2ZHNA 1V6JA 1NCQC 2XBO2 3IPVB 2PTMA 3MF9A 3R4UA 4Q26A 1R083 5FTTC 5L36A 5K0UA 4AYUA 1YXWA 2P2KA 1WW4A 3NKTA 3R4SA 1JUIA 4JAAA 4Y1ZA 1AR93 1G9DA 1V6LA 4AFCA 2O8QA 3AYEA 3R4DB 2DCKA 3ZIWA 2OZJA 1QH6A 2JICA 1NCQB 1QKQA 1VBC1 3H50A 4DINB 1S0CA 5CIRA 4Y22B 1WW7A 4QXKA 1ZREA 3I2DA 2D5HA 2P37A 1J1TA 1V6MA 3MIDA 3AZXA 4HKWA 5LRRA 3MYXA 2HWC1 3EJKA 4XBNA 4C1WA 1CX4A 2BFUS 2UYAA 3QBQA 1SLCA 4R4XA 3V56A 3VL8A 4AVSA 3LWCA 2VOKA 3KD4A 3LOBA 1VBE1 4O9GA 1Q8SA 5SV8A 4EN9B 3OY8B 1HDKA 2BW8A 5IUQA 1YI7A 4GKXA 3WD5A 3LCPA 4AHXA 3KT1A 2WNEA 1SBEA 3CJIA 3D0JA 3VLBB 4CDWA 4EWAA 2D98A 1XNKA 4YW2A 4YM2A 1RUE1 2XWJB 4N53A 5A3MA 1GV9A 1CONA 1W6OB 4PCRA 1W39A 4TZDA 2RS51 5T5LA 3RJRA 1EV11 2JE7A 3U11A 1O7FA 5HI0A 2ZZJA 3JB8A 2C1FA 4L97A 3WCSA 3VBOC 1YO8A 1QU0A 4XTMA 2WINB 2YMZA 3RNSA 1XE7A 1MR5A 4RD7A 5KHIA 2WFPA 4AI2A 5FO7B 1CR7A 4LO5B 4FPOB 1CAUB 2V09A 3VZKA 3VBOB 5ABJA 2WZPP 2UY9A 1C4RA 5E8AA 3V64A 2P34A 3D0SA 4Q4X3 2JX9A 3A4UA 4D3WA 3V0BB 1RUOA 1F5FA 3WINE 4HT1T 1COV2 3NV1A 2UYBA 2ZGSA 4LO7A 3DPRC 1H8TA 2LM3A 5L7OC 5IK8A 2R071 5CFDB 4YVWC 4CP2A 4GB31 4N9IA 1LCLA 1CAWA 1NCRA 3DF0A 4R8HA 4MXWB 3FBYA 3NV2A 1XYPA 2WSUA 3DPRB 4AEDA 2PA7A 5FAXA 2I45A 3PVEA 4BOWA 2CV6A 4K20A 1VIWB 3UL2A 2Q8OA 3E5UA 4WVZA 5E89A 4BYYA 1AVBA 1DHKB 3FMGA 3I4IA 1SBFA 1QH7A 2BPA2 4S2FA 2RR13 3ZDSA 2ZKLA 1PHMA 1GKBA 3JQXA 4LO8A 1R1A3 3M3IA 4JGYC 1RUF1 <