4BCUA

Satellite tobacco necrosis virus (stnv) virus like particle in complex with the b3 aptamer
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
188
structure length
188
Chain Sequence
RKSATMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAITVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGATAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN
publication title Sequence-Specific, RNA-Protein Interactions Overcome Electrostatic Barriers Preventing Assembly of Satellite Tobacco Necrosis Virus Coat Protein.
pubmed doi rcsb
source organism Tobacco necrosis satellite virus
molecule tags Virus
total genus 53
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03898 TNV_CP Satellite tobacco necrosis virus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bcuA00
4QPIC 1NA1B 1VB2A 1AYM2 2RMU3 1AR73 1NCRA 1TME3 2IZWA 2BFUL 5CFCB 3ZXAC 1H8TB 1PVC2 1C8M2 1VRH3 3VBHA 4RS5C 1TMF1 1RUF1 5C4WA 1X36A 4CDQC 1V9U3 2PLV1 4Z92B 1QQP1 2R061 3J8F2 4WM7B 2WS91 4JGYA 1COV3 2HWD1 4RQPB 2HWE1 1HRI2 3J8F3 5K0UC 4Q4Y2 1RUJ2 1RMU1 4JGZC 1HRI3 1QJY3 4CDXC 5L7OC 4Q4Y3 1AYN2 4AEDB 1ZBE3 4RR3C 4CEYB 5ACA2 1D4M1 4YVWA 4YVSB 1BMV2 1NA1A 3CJIC 5BNPB 5ABJB 1RUH3 1NY72 5ACA3 4GMP1 1FMD3 2DF7A 2RS53 5JZGC 2RM21 1PIV1 4N43B 4Y5Z0 5CFCA 1E57A 1H8TA 1ND2B 4IV3B 1EV11 5C8CB 1BBT2 1HRV2 1RVF1 2RS32 1AL21 4WM7A 1RUI3 1A6CA 1VBE3 4IV1B 4RQPA 4Q4W2 1BBT3 1BMV1 1PGL2 3VBOC 1RUD2 1FPN3 5J96B 1ASJ2 1AR83 2RR13 1VBD2 4AEDA 1BEV1 2HWF2 2R042 4CEYA 4JGZB 4LLFA 4CDUB 4FTBA 4YVSA 3JBG2 2RS13 2WZR2 5BNPA 2Y26A 5ABJA 1VBA3 1RUG1 4RR3B 2WZR3 1C8NA 5BNNB 4WM8B 4N43A 3CJIB 2HWC2 1ND2A 4IV3A 4GB31 5AC91 5BNOB 5C8CA 2X5IA 1VBC3 1RUC1 5CFDC 4IV1A 1EAH1 1VBB1 1K5MC 1PO13 1OOPC 1QJU3 4CEWC 1OPOA 1RHI2 3ZFGB 2VQ0A 5FMOS 1RUE1 1AR63 1MQTC 1B35C 1NOVA 3VBOB 4JGZA 4CDUA 3M8LA 2R071 1TMF2 3VBRB 1OHFA 2PLV2 1VAKA 1ZBA3 1HXS3 1QQP2 2R062 4GH4B 1Z7S1 3FBMA 4NWWA 4GMP0 2WS92 1R083 3VBFC 1RUF3 2HWD2 2HWE2 5BNNA 4WM8A 2PLV3 2R063 1PO23 1R1A1 1FOD3 4QPGC 2MEV1 1RMU2 4Q4V3 1NCQC 4Q4X1 5BNOA 2HWB1 4BCUA 1AUYA 1AYM3 1R091 2FZ1A 4EJRA 4N53C 5D8AC 1D4M2 1MEC1 4FTEA 1POV0 1F8VA 1PVC3 3ZFGA 1C8M3 2TBVA 3VBUC 2XBO1 3JD71 5FMOL 1D4M3 1K5MB 5C9AB 2RM22 1AR91 5J98B 1PIV2 3VBOA 3JB4C 5A32B 1EV12 3VBRA 4CDWC 2RM23 4PDWC 4GH4A 1RUJ3 1RVF2 1AL22 1EV13 3NAPB 1ND3B 1AYN3 3ZFEC 2RMU1 2ZAHA 1AR71 1TME1 3VBSB 3VBFB 1SMVA 4QPIB 1VRH1 1PGW1 2GH8A 1BEV2 5FOJB 5A33B 5DDJ1 1V9U1 1BEV3 3VDDC 1COV1 1RUG2 1HRV3 3DPRC 4RS5B 5C9AA 1POV1 2RS33 4CDQB 3TN92 1QJY1 4Q4W3 1NCRC 4GB32 5A32A 5AC92 3S6PA 1NG0A 2FZ2A 3VBHC 1ZBE1 5K0UB 3LOBA 1RUC2 1RUD3 3NAPA 1ASJ3 2ZTNA 1ND3A 5C4WC 1EAH2 4CDWB 1VBB2 4CDXB 1VBD3 5L7OB 1RUH1 2WFF1 2WWSA 1RUC3 2HWF3 2R043 4JGYC 3IDEA 3VBSA 1FMD1 2RS51 1RUE2 3JBG3 3TN91 2QQPA 4QPIA 1F2NA 2BUKA 5JZGB 2HWC3 2R072 1RUI1 1VBE1 4YVWC 1Z7S2 4RS5A 2R073 1NA1C 4CDQA 4RHV1 1FPN1 1AR81 2RR11 1R1A2 3DPRB 2MEV2 1CJDA 1RHI3 4Q4X2 2HWB2 5CFCC 5K0UA 1R092 2BPA2 2BFUS 4CDXA 2RS11 4CDWA 2HWB3 5L7OA 1W39A 4WM7C 1MEC2 1VBA1 4RQPC 4RR3A 2XBO2 3JD72 1TMF3 3CJIA 1M06G 1QQP3 1AR92 2XBO3 2WS93 3JD73 2HWD3 2HWE3 1VBC1 5JZGA 4AEDC 1AR93 1RMU3 1PO11 4YVSC 1QJU1 2XPJA 5ABJC 1QJX1 4Q4V2 2RMU2 5CFDB 1AR72 1AR61 1TME2 4N43C 1OOPB 4CEWB 1ND2C 2GSYA 4IV3C 4FSJA 4GMP3 1VRH2 1PGW2 5C8CC 2X5IC 2WLPA 4NWVA 5DDJ2 1MQTB 1V9U2 1PIV3 1ZBA1 1HXS1 1B35B 4IV1C 1CD3G 1R081 1COV2 5DDJ3 1PO21 1DDLA 3ZFFC 1RVF3 1AL23 1QJZA 1FOD1 1VB4A 4Q4V1 1QJY2 1POV3 1AYM1 4CDUC 1ZBE2 4QPGB 1NCQB 1PVC1 1HQNA 1C8M1 1RUH2 2WFF2 3JB8A 4FTSA 5CFDA 4SBVA 5BNNC 1K5MA 4WM8C 1FMD2 2RS52 1OOPA 3J8F1 4N53B 5D8AB 4CEWA 2WFF3 3VBUB 1HRI1 1RUG3 2ZZQA 5BNOC 1IHMA 3TN93 1MQTA 4Q4Y1 1RUJ1 1B35A 1RUI2 1VBE2 4GB33 5AC93 2X5IB 1AYN1 3ZFGC 5ACA1 4PDWB 4RHV2 3VBFA 1FPN2 1EAH3 1VBB3 1AR82 2RR12 1NY71 3ZFFB 3ZFEB 4RHV3 1WCDJ 1RUE3 4QPGA 5A33A 3VBRC 1NCQA 2RS12 4GH4C 1VBA2 1BBT1 1HRV1 2RS31 4N53A 5D8AA 4Q4W1 3VDDB 3VBUA 1Z7S3 1PGL1 1VBC2 1H8TC 1RUD1 1ASJ1 1R1A3 1NCRB 1VBD1 2MEV3 1PO12 4Q4X3 1HX6A 1QJU2 2HWF1 2R041 4PDWA 2BBVA 1X33A 1R093 3VBHB 1QJX2 3JBG1 2WZR1 5C9AC 5C4WB 3HAGA 1MEC3 4Y4YA 3ZFFA 3ZFEA 1AR62 1QJX3 4JGYB 1AL0G 1RB8G 2HWC1 1ZBA2 1HXS2 5LK7B 4CEYC 3NAPC 5GKAC 1ND3C 1R082 1RUF2 4RFT0 5BNPC 1PO22 1GFF2 3VDDA 3VBSC 1FOD2 4YVWB 3DPRA 1RHI1
chains in the Genus database with same CATH superfamily
2FMDA 2W1QA 4NOTA 2Z5WA 1NA1B 2VH9A 5I0SA 3MFAA 1AYM2 2ARAA 4UBHA 2QQVA 1CAXA 1KS4A 4IEQA 3GZUC 3PU3A 3L2HA 5LW9A 3O1RA 4I3GA 5L19A 5DAXA 1GZWA 1XNAA 3BGAA 2UY8A 1PZ9A 1W03A 3BIWE 4GWNA 5C3PA 3ZXAC 1IS5A 3PL0A 1C8M2 1VRH3 3VBHA 4B8EA 5JIAA 4RS5C 3ZYJB 1LNSA 2PLV1 2KR2A 2PHXA 5FZEA 3AJYA 1LTEA 2VU9A 3BALA 1QIQA 3WX5A 2HWD1 2VOWA 4DY3A 2HWE1 1UZVA 1Y9QA 5H9PA 2YROA 4S2HA 3J8F3 1S2KA 4NMIA 1QF3A 1ENQA 4QD2A 4IEWA 4MGKE 4GZ9A 1RUJ2 2IFWA 3RZLA 2DCTA 3VKLA 1UY0A 2VMFA 2DCZA 2IXKA 5F8PA 1RUNA 5CA6A 3RNSA 3EMRA 5FYCA 3VD3A 1CAWB 4W65A 2B4KA 3WP6A 1RXGA 4KL1A 3ILFA 1W9YA 3WVJA 2D6LX 4AAXA 2VMIA 5BNPB 1W6QB 5ABJB 1RUH3 1DFQA 5FYMA 1NY72 5DAQA 4FPLA 5CEHA 2ID4A 4GMP1 5FYSA 4DUVA 2G1MA 5T52A 2ZGRA 2DF7A 1GUIA 3LDKA 4JZRA 1VE0A 1PIV1 2W1UA 1WWYA 5JSPA 1DZTA 2J1AA 5CFCA 3ZXDA 1AF9A 1GBGA 1H8TA 3OF1A 1Q8SA 4J1WA 3GBGA 2QQWA 3E5QA 2BGCA 3ZKUA 1JOBA 3NV3A 4IEXA 2VVDA 5DPNA 3MO4A 2A1XA 1I5PA 2PHRA 3UJOA 4QT6A 1GOGA 3O1UA 4OI4A 2B42B 1SLBA 1JS9A 3NO8A 3OPTA 4AHWA 1Q43A 4KG0A 1DGWA 4YW3A 3UYJA 2D7FA 4JRLA 2ZXQA 4Q29A 3VBOC 1W3VA 2A3XA 2GC1A 3ATGA 3D8CA 4R9AA 4E9KA 3PTYA 1MS0A 1W9TA 2SLIA 5BNQA 1S55A 1MS8A 2CHHA 3HT2A 4XCAA 2VPVA 3E6DA 5FZ8A 4AQSA 4OHVA 3ZYRA 4AEDA 2VO5A 4FQ4A 4UW6A 3FE5A 2HWF2 2R042 4JGZB 3RYKA 1UQXA 1ALYA 1O4ZA 4LLFA 4QXKA 4UF0B 3IMNA 4GAZA 1O6UA 4Z82A 4YVSA 4Q0QA 3JBG2 5FZHA 2WNVA 1VP6A 3APBA 1YHFA 1XE8A 1AX0A 2A6ZA 4PF5A 3IDBB 1W6OA 3VZMA 4RR3B 2FCTA 2WL1A 1NYWA 2BQPA 2LALA 2OQ6A 2VNOA 2WZR3 5FPXA 5FBJA 4WM8B 2NQYA 4N43A 2ZJCA 3CJIB 2HWC2 2NM1A 4EN6B 1D4VB 4H7MA 1NXMA 1V6NA 1N3OA 5KBFA 3TAYA 4XF9A 3AYDA 1GZCA 3WW4A 1L3JA 2V72A 2X5IA 3U07A 3NNMA 4OYUA 5HI0A 4LA3A 3DXTA 4GKXA 2PELA 1F9KA 3I49A 4Z1VA 4IV1A 4Y1ZA 3WDTA 3I3DA 2UURA 1PO13 2J1SA 2QUOA 2ZX3A 5CU1A 1OPOA 1MVQA 2EICA 2C1FA 2ERFA 2VE1A 2PHLA 4XQWA 3RQ0A 4FFFA 3KHCA 1ODMA 1UF2C 3QOPA 1MQTC 1O4YA 4QHBA 2XL7A 3WHTA 2YPJA 1SFNA 5A7PA 4XAAA 1O91A 3BOWA 3HMYA 5FUIA 1UYXA 4KH9A 1TMF2 1GICA 2JG8B 4FFHA 1ZBA3 3OBAA 4NWWA 2AGSA 2V5DA 4YW7A 1D2QA 2VJXA 5CADA 4GMP0 3AZZA 1V00A 4AHYA 4LBOA 3SH3A 3RSJA 4AE2A 3PUQA 2IC1A 3POYA 1VJ2A 1HN1A 2LTNA 3ME2A 1V6MA 3VDAA 2BNMA 1FOD3 3H7JA 3SCGA 3N36A 4P9XA 1SFPA 4QPGC 4Q4V3 3VKOA 2ZBJA 3T4VA 3AFGA 3L2YA 5E16A 1OI6A 2DFCA 4NIIA 2FZ1A 5F3EA 3RZGA 2PHWA 4FPOB 2VQTA 2D3SA 3NJVA 5C7GA 1BZWA 1PZ7A 1UZWA 2JDYA 4QPWA 1YQ2A 2RDSA 1QKQA 3NNLA 1Q5OA 3HN3A 2XBO1 5FK7A 2G19A 2VULA 3VGIA 1D4M3 1RYYA 5J09A 1K5MB 1WW6A 3MF9A 3POGA 2QQUA 2DVFA 4OI2A 4QB1A 1CQ9A 2I45A 3S30A 5F9TA 2FDIA 3GJAA 3JB4C 2VCBA 2YPDA 1IOAA 5ANQA 4XF3A 4DIQA 2CYFA 4UYBA 1I1EA 1NAEA 5FZ6A 3VBRA 2RM23 2JECA 1GP5A 1JZ6A 2QQLA 3R4UA 3ZIWA 3URFA 1AL22 2GC2A 4YZ2A 1LGNA 1NT0A 3OY8B 5FO7B 5FP4A 4LOTA 5JI7A 2P6CA 4LO7A 3A7QA 2ZGKA 1QXJA 1AYN3 5FAXA 4J25A 4DOUA 1UO9A 1SACA 1BJQA 1KGYA 3RI9A 4O7XA 1UMHA 2A5ZA 2VQUA 5M0TA 1WUVA 4K1ZA 3VBFB 1HDKA 4MXWA 1OF3A 1GWMA 1JZ7A 5IAVA 1YI9A 1VRH1 1UN1A 3LQCA 2VNVA 3Q8AA 5FOJB 2KA3A 4UFIA 4YM1A 1NE4A 3HQRA 3LD8A 5DDJ1 3JQWA 3WQBA 3GF6A 2B39A 4BXFA 3P3NA 5C3QA 3AVSA 4LBQA 4R4ZA 2DU1A 5FLHA 5LRRA 3K51A 5A7WA 4YZ4A 1ACCA 2NLRA 5FY8A 4CZSA 1W8UA 1RUG2 1HRV3 3BYWA 4RS5B 2QKDA 1JYIA 3ETQA 2X8KA 5LY2A 1POV1 2PXJA 3TN92 2W3JA 2ZGTA 3AYCA 1KDKA 3D4KA 4N9IA 5GLTA 1HV0A 4BK5A 5FXWA 1OVSA 2MHFA 2R49A 1EPZA 4GB32 1LHOA 3I2HA 5FRAA 5AC92 1H6XA 2UWBA 5BUVA 4RGKA 3VD5A 2PHFA 3LPFA 4O9GA 1UIJA 3LOBA 5FPUA 2WAAA 1RUC2 3PMSA 3PURA 2JDMA 4D7TA 4EE2A 4YSFA 5IK7A 3U37A 2ZTNA 1ND3A 5C4WC 4MO3M 3HNMA 3HQUA 1VBB2 4PJYA 3R6SA 1RUH1 1W8NA 1RJ8A 3WF1A 4BHPA 4JGYC 5KC6A 3IDEA 1YJLA 4OMDA 4TSVA 1RUE2 4QKBA 4BMEA 2VCAA 5LK5A 4YYOA 4YZ1A 3TN91 1NZCA 4AF9A 3D5OA 4ES9A 1LOBA 2VCCA 2ORXA 2Q1FA 1NQJA 2VXRA 3O0VA 1N1SA 1STMA 1XNBA 2Q30A 5FDBA 2YC2A 4H55A 1YFUA 2VC9A 3JUUA 5EYYA 3QCWA 2CWMA 4Y26A 1UW8A 3ECQA 5A3MA 4Z2AA 4IEYA 4IEZA 1Q8PA 1UYPA 4FXKB 1MS1A 1OQDA 1SPPA 2JDAA 2WO3A 4HKOA 3AMMA 1R1A2 3DKQA 3DPRB 3U75A 3O1VA 4Q4X2 4HPKA 1BK0A 2FCUA 2WIIB 2CU5A 2JX9A 1GZTA 2EA7A 3M3CA 5APAA 4BOWA 2BFUS 5EJZB 4BJ0A 4F83A 3ZYPA 4CDWA 4CDXA 2HWB3 1CX1A 4FPFA 4AXOA 1MEC2 5IJRA 1W2UA 3I4IA 3K46A 1OLRA 4RQPC 2F17A 1JHNA 1FNYA 4R9CA 4AW7A 2W39A 3JD72 3SXWA 3WQ7A 4QKDA 4AVCA 3OCPA 4BMBA 3NKGA 2DVDA 4I0AA 4OUSA 3R4DB 1AR92 4YM0A 2WS93 5F3CA 5AVAA 1W6MA 1DGRA 1ULPA 5T5LA 1W8FA 5EHDA 1QDOA 3MW2A 4K8FA 5FZOB 3KT4A 2ZGPA 2CNAA 3GHMA 4M01A 3DYMA 3O12A 1U5YA 3IDCB 2QTWB 1RMU3 2ADDA 1PO11 3A4UA 3POEA 4Q0SA 4UAPA 1PK6A 2ORZA 4HVOA 3U10A 1WCSA 4QGMA 2BV4A 1HJFA 2YG0A 4LQRA 2GNTA 2D6KA 1GNHA 2P2KA 4I0WB 5DQ0A 1ND2C 3QH7A 4D8MA 2W52A 1Q56A 2XJSA 3IT8A 3T2TA 1PGW2 5C8CC 3CF6E 2WN2A 1GR3A 3LZZA 2QBXA 5BPXA 3AP7A 4NWVA 5DUUA 5FPVA 3FLPA 1MQTB 1SCRA 1V9U2 1ZBA1 2CV6A 3WQ0A 3RI8A 1COV2 2Z79A 3LFMA 5DUVA 5FXVA 2Q8DA 4AI0A 3UKVA 4CPBA 1MS9A 5FZ4A 2XH6A 3T30A 4XW3A 4XJZA 5IK4A 2XONA 1RVF3 1ENRA 3SITA 1S2EA 1FOD1 1VB4A 3OGGA 3BTAA 4Q4V1 1QJY2 2GNBA 2BGOA 4XJUA 4HVRA 5A1AA 1H6YA 2AYHA 2BU9A 2L9LA 1UU4A 3K3OA 5G05L 1W9FA 2VR4A 3PMEA 3EHKA 4QPGB 4CP1A 3BPSA 1CVNA 1MACA 1UMZA 2ZOEB 3KWVA 2ADEA 5DUXA 2C9AA 5LY1A 5FZIA 3OJBA 2EXJA 5C3RA 3NV4A 2ZGMA 4FPKA 4JKMA 5BNNC 1FMD2 4QX2A 3VZLA 2WFF3 5FO8B 3U11A 4M0NA 2VZ1A 3RZHA 2HEYF 1WW4A 3DUIA 3I59B 1UXZA 4Q4Y1 2GZWA 3IDAA 2YU2A 4AI1A 1JBCA 3WF4A 1VBE2 4XFBA 4XFCA 3ACHA 5FREA 4E2QA 2OVUA 2X5IB 5T3NA 1AYN1 3ACLA 3LCPA 1O3RA 2IWGB 4EN9B 4Q1RA 1JU3A 1W0OA 2VTFA 1EUUA 5T54A 1EAH3 4XEZA 2YY1A 2ET7A 3PUHA 4GA9A 3USSA 2PQSA 2JENA 2ZEWA 4K6BA 3JCIA 3POJA 4GULA 2WJSA 4RHV3 2GC3A 4XJ8A 4CTEA 3LB9A 5F2WA 1MZFA 2OUHA 1OA3A 1OXCA 1QMJA 5A7NA 5T50A 4AK3A 1G86A 3KCXA 2Q1ZB 1W99A 4BQ2A 3WP4A 1VBA2 5LB6A 2GC0A 1BBT1 1HRV1 4XFHA 1QH7A 4BK4A 3VDCA 1UIKA 4ZZ5A 3ASIA 1T6BX 2DVBA 2OW4A 3H42B 5D8AA 1KDMA 3M3OA 3NL1A 4LIVA 2ZGQA 4GXLA 3V56A 1E5RA 3UKTA 1Z7S3 2VL4A 3NW4A 5IVYA 3MYXA 4A6SA 1DQ2A 3AFKA 3MEPA 4AVVA 1OURA 1XSQA 4NIDA 1ULEA 4G9SB 3NJYA 3UNPA 4IEUA 2ZPXA 2MEV3 4NAOA 3RWKX 3ON7A 3OYWA 3IM0A 2ZGNA 3KT7A 4PDWA 3ZYBA 1S0GA 3V0BA 3J7LA 1R093 3ACGA 1QJX2 4LUKA 1ZRFA 4BQYA 3FHIB 3KD4A 4FAGA 2I74A 2JDZA 3PU8A 4YZ3A 5C4WB 3AMQA 2IUWA 5F5QA 5LZ6A 3RGBA 3ZFEA 1HW5A 5AFBA 2CGOA 1SEFA 3U1XA 1H4HA 1X50A 4JGYB 3WG1A 5KXEA 4XXAA 3GHNA 3RDIA 4MVTA 1JMUB 4B4RA 3BKZA 2PN5A 3THPA 3AMPA 2OA2A 4HOOA 1HXS2 2D3RA 3VKMA 3Q8BA 4AFDA 5GKAC 5C8WA 5LK7B 4IEPA 3USUA 1FNZA 4LEJA 1WMXA 5IVEA 1VRBA 4R9DA 5BNPC 2NP0A 2D6NA 1JYVA 1JXNA 3OD0A 2D40A 2WSUA 1PO22 5T5PA 2VBPA 3VBSC 4CCMA 4NE9A 4FVVA 4QX3A 1DQ4A 4QM9A 2W95A 3D82A 1HKDA 4QPIC 3WP5A 3VHNA 5A3TA 1BYHA 3TRSB 2J1RA 2QQMA 4CVUA 3RYPA 3ZSMA 4KNCA 4CP9A 4I2OA 3LA3A 3VHPA 2WT2A 1YIPA 1T6GC 2H0VA 5FWEA 3LEMA 5D21A 1PVC2 4R52A 5F37A 5KR7A 1HB4A 3WDXA 3HNBM 1X36A 4XETA 1N1TA 4Z92B 1G9DA 1XQNA 2R061 2WAOA 4AQ2A 5JMOA 2WS91 3GM8A 1H9PA 1XB9A 4RQPB 3CDZB 2VNGA 1HRI2 4JCKA 4TXWA 5L9VA 2BWCA 2NYYA 4LBJA 5B2GB 1VMJA 5FXXA 2WR9A 5K0UC 1C5HA 1DP0A 4LKSA 1H4GA 1RMU1 3IWZA 3POIA 4JGZC 1DLLA 5HV0A 1JODA 4WVMB 5L7OC 1SZBA 3HQXA 4V2WA 3I3EA 4ISQA 3CL1A 2C0ZA 1YNAA 2JIJA 1H9WA 3NV2A 3V64A 3A0KA 4AAPA 4RR3C 4CEYB 5FP3A 5ACA2 4YVWA 5KWRA 2E7AA 3CJIC 2QQJA 1RGSA 4R8HA 2PMWB 4GIQA 3DV8A 4Y5TA 1WZXA 2UY9A 2AUYA 1LRHA 5JZGC 1ZRRA 1F4HA 2VGDA 1REFA 4NHYA 2CTVA 2LRPA 2G9ZA 4XPVA 1M4WA 4Y4RA 5LBFA 1E57A 1ND2B 1W2NA 1LOCA 4F8AA 4Y24A 3NWKA 1MPXA 1VIWB 3IZOA 4HBNA 1EV11 1F31A 3ZR5A 3N4MA 3NKTA 5F39A 5C8CB 3ZVXA 4MOAA 1RVF1 2RS32 1LEDA 4WM7A 2Y60A 1OFSA 1RUI3 2ZX0A 1A6CA 2VMEA 4ZXEA 4Q4W2 1ZRDA 4A2UA 3RMYA 1LKNA 5LCWL 1GQHA 1UOFA 2DYCA 3FLTA 4XIOA 3N9LA 3MHZA 5EXOA 4M3CA 1VMFA 4JKLA 1LB2A 1PGL2 1V6LA 2WYSA 2AACA 1GQPA 1RUD2 1YQ8A 2OT7A 3AZXA 5FKBA 2IXHA 2RR13 3PIGA 4BPZA 4JQTA 5DAVA 3N9QA 2N7GA 1W6PA 4LA2A 1BEV1 4IGQA 3MF6A 4BQ1A 2Q8CA 1NLQA 4FTBA 3S7IA 2XVLA 1V6KA 2RS13 4F3JA 2XQXA 2A75A 4RSUA 2GAUA 1YWKA 4K8RB 3O1OA 4Q8LA 3TEZA 1DZRA 2JDPA 1FI2A 2W1WA 1JZ8A 3THCA 3VDBA 4LHLA 4XJWA 5BNNB 1N3PA 1REDA 3WF0A 3LWCA 3NNJA 1W04A 2FBEA 4IV3A 4QX1A 3OGSA 3SH4A 1YC61 5FZ0A 3ILRA 4ASKA 2G4IA 2VZPA 4A7ZA 5CFDC 1UY2A 2QCSB 3LIHA 4OHZA 3ORJA 4KBZA 4DINB 1EAH1 4XUTA 1K5MC 3MDPA 1OOPC 1PK6B 2WNUC 1RHI2 3NNFA 3OUHA 4V2VA 4DFSA 3J9SA 1UCXA 3FZ3A 5FMOS 2DUQA 4E4HA 3PJQA 3M1HA 1D0GA 2VZOA 3KVAA 4DUXA 1QXRA 1AR63 5EZWA 2BGPA 1UYYA 2GP5A 3WDUA 1B35C 1O5UA 1NOVA 3C8XA 4XDQA 3JQXA 3ZO0B 5HXVA 3M8LA 1XBFA 2R071 5GZCA 3NJZA 2AH2A 2BVBA 2W94A 3I2IA 4Q0UA 5AVPA 2PLV2 4A6OA 3UT0A 1Z7S1 1DQ5A 1AHSA 3VBFC 4JVAA 5IVJA 1RUF3 2HWD2 3G7DA 2HWE2 5DZEA 5I0RA 1W6NB 5FXZA 3ES1A 3AX4A 3MLLA 4P9IA 3H0OA 2WC2A 1SCSA 2MEV1 5BNOA 3I2JA 4INDA 1SLCA 1NUKA 1XU1A 1AUYA 2XJVA 3GZTB 1UY3A 1UYZA 1R091 1W06A 2JD9A 2YHJA 3IIIA 3LA2A 5C3OA 2WO7A 5JOWA 5LWBA 4LPLA 1HB2A 4LBQD 3FUOA 3CQOA 1GOFA 4KWKA 3LEGA 3ZSJA 1F8VA 2DTWA 3ZFGA 5JOXA 1ZNPA 3VBUC 2WZPP 3R05A 2PHDA 5FMOL 2LS6A 1PX4A 2WUHA 4P9GA 1QNWA 1OUSA 1DYKA 1W8ZA 1FYUA 1PIV2 4N7IA 3VBOA 2C4XA 1U5ZA 1GU3A 5A32B 2PFWA 4XUQA 4CUAA 4H3WA 4XF1A 3WEZA 1SBEA 2YXSA 2ZEZA 4GH4A 1KRIA 3T1MA 2W68A 3FHQA 5FP7A 5FMBA 3DECA 5FPAA 4FCAA 1C28A 5FZ1A 5IHRA 1XYOA 1OQ1A 3CMGA 2XJRA 4E4SA 4Q2FA 2Y6FA 1LCLA 5FJHA 4EWAA 3VBSB 1X9PA 3BCWA 2ES3A 4SLIA 2VECA 3CO2A 1A34A 4CUBA 3VZOA 4QPIB 3DCQA 5FZLA 5KHHA 2YB7A 2GH8A 4XAEA 2BW8A 4CCKA 1OD3A 4GWJA 2VBDA 1ZVFA 1YJKA 1W0NA 2VZRA 2ZGLA 3NJXA 4XACA 1LR5A 4LLOA 5FZKA 4XBLA 5IFPA 4UWDA 5CVRA 4RGAA 4XUPA 2W46A 3NRUA 4MADA 4GJYA 4W50A 3WNXA 3PVEA 4QXCA 3KT1A 3LAGA 4Y1YA 1FXZA 1R64A 3DPRC 4MUVA 1CESA 4LIUA 3CHXA 5C9AA 4Y1XA 2RDRA 3N7MA 5CYYA 1F5FA 4QM8A 4WZCA 3N9PA 4BIOA 4DXTA 4MG2A 1T2XA 3ZSKA 5HBAA 3LGRA 3O1SA 2NZ9A 4XCBA 3FUQA 4CCCA 3KGZA 2CDPA 3OOXA 3POFA 1NG0A 2UWCA 4IE5A 4CU6A 1O7FA 5A7OA 1LGBA 3VBHC 1GP6A 1PNFA 4Y22A 3VZKA 3I2GA 4CCLA 5K0UB 3NAPA 1ASJ3 3NVCA 4HKWA 1JHJA 3W5NA 4DRVA 2VUDA 1VBD3 5L7OB 5LA0A 4QHOA 2WWSA 3OB8A 5C5UA 2K46A 1RUC3 3DYPA 4GD4A 4RL7A 3O14A 1CAVA 2Y33A 2VOTA 5FP9A 3K4DA 5SV8A 2BP6A 3MLJA 2XKPA 2FCVA 4IGPA 3GXUA 1LOFA 3OPWA 4KWUA 2VW2A 3OBRA 3AZVA 2VOXA 2BUKA 3A22A 2IXLA 3Q9OA 4AQTA 5C6CA 2BNNA 5JZGB 3RZKA 1WGPA 5C3SA 3TWIA 1RUI1 3H7YA 4UFHA 4D7SA 4E4DX 1U5XA 3CJXA 3IB3A 3OGVA 1TZOA 1UU5A 4NUBA 4FQZA 2X10A 5FPZA 2X29A 4YRDA 2ZMNA 2OUJA 1AX2A 4CDQA 2ENRA 3H3ZA 2A6WA 4LO8A 1V6OA 1G6NA 2RDQA 1LHVA 3K3NA 5IUQA 2XQRA 2RR11 1WMDA 2VW1A 5A3NA 5FZ9A 2P17A 2XB6C 4KI5M 5JDBA 1NKGA 5CFCC 1UU6A 2WA3A 2GNDA 2DV9A 2JXAA 3H1MA 3OUIA 2BPA2 4CP0A 2TNFA 2EIBA 2R0FA 1WA4A 1MVEA 2NMOA 2RS11 4AEJA 2JIGA 2TUNA 2VOKA 1XNTA 3V0AB 3AM2A 5LBBA 2JKBA 5FY1A 3T4HB 3N35A 4M3CF 2XBO2 4CPBD 3ZOIA 4Z2WA 2PAEA 4CXXA 2PHUA 4Y1VA 1QQP3 4NO4A 3J4UH 3WF3A 3JD73 2J42A 2DUOA 2E31A 3DN7A 1CAUB 3IAQA 5DAWA 2QQIA 4IUGA 4KU8A 2J1VA 5FZAA 4AEDC 1L7QA 1AR93 3HNYM 3JXSA 5JAXA 4S2DA 2K9ZA 2ZEYA 4YWAA 5F3GA 1OC1A 2WO2A 2VZQA 2OXBA 4YVSC 2XVGA 2Q5TA 4AEKA 4ONUA 4BE3A 5FYUA 5H9QA 2WNVC 2JEMA 4CU7A 2C9KA 5GALA 2X53S 1XE0A 2EAAA 5ERLA 1ZA7A 3O1PA 5CFDB 1K42A 3QH6A 1CPMA 1WBLA 5GZDA 5C33A 1CGPA 4COZA 4ZU7A 1AR61 1JUIA 5CZKA 1A3KA 5GJ6A 5LA1A 4N43C 1OOPB 3ACFA 4AFBA 2WNUB 4NIHA 1US2A 1MS4A 5DAPA 3BI3A 4XFIA 4HK8A 1VRH2 2YUEA 2BRTA 4NVPA 2X5IC 4IE7A 1MZEA 3WR0A 1QHDA 1YLLA 2XG3A 5DDJ2 4AL9A 1G9CA 1B35B 2QFEA 4IV1C 5JCTA 3AP5A 3S0MA 4P5HA 4FT8A 1IQAA 1PZ8A 3ST7A 4FPCA 5CB7A 5AFEA 3ZKYA 1D7PM 4XQDA 4XF0A 3IBMA 1OKQA 3VKFC 4A4AA 3H50A 1FV3A 3DGTA 2ARXA 2D93A 2DBNA 3WG4A 3IMMA 5A6QA 2LUWA 1H2LA 1HQLA 2P3YA 2W0XA 4LMFA 5IVFA 5I91A 4M3CB 3NQHA 4L92A 5A1LA 4RD7A 1N1YA 1SLIA 1H8VA 4QPYA 1ENSA 1XXNA 4PF1A 1UD1A 1W6PB 5FPLA 4D3WA 4Y20A 2JG9A 4AI8A 1RUH2 1QEXA 3C2UA 3IAPA 4AEMA 2BTVC 3TYJA 4FTSA 4PIZA 2DFBA 1WBFA 4AFCA 2B46X 1UPSA 1LESA 2VTXA 4QGNA 3J8F1 4CEWA 3TEWA 2PAKA 5FZMA 5KHJA 4LHNA 2Q8EA 4OUEA 3KF3A 3VBUB 1H0BA 1LOGA 4LNVA 3RPQA 4QQ2A 3ZSLA 2OS2A 5JR7B 5IYYA 3FC0A 1FAYA 3UKNA 4FP3A 4Y5SA 2AENA 2VAUA 4FPEA 3E5UA 3TBDA 4LITA 4YW5A 4LHSA 4D6QA 3RZMA 2FDFA 1OA4A 3IPVB 2BVVA 4JHTA 4OQ9A 2P5BA 3ZYIB 4HXCA 1JUHA 3B9IA 3BOPA 3ZFFB 1O4TA 2RVAA 3FMGA 4XYXA 5JMCA 3FFQA 3POBA 2ZACA 1WCDJ 1OSGA 1GNYA 1KITA 5F5IA 4MHRA 4AHXA 2VMHA 3S7EA 3VBRC 1NCQA 4PI0A 4O9EA 3ZXEA 2D6MA 4Y3OA 1JYWA 5FK8A 3WNPA 4D94A 5T55A 1UOGA 4NRQA 3UL2A 4CCEA 4NPMA 4QXBA 2JDNA 4YPJA 2VUCA 2XJQA 3C7OA 4N53A 1ONAA 5FV3A 3ZXGA 3BIEA 5FY7A 3MZHA 4OULA 3LF7A 4FAHA 1OLMA 2ZAAA 5DZGA 4CRQA 2CAUA 2WT1A 1HJGA 4LOSA 5L9BA 5FY9A 4ZY9A 3RG0A 2GALA 3EYPA 3CBNA 5ANNA 2B8MA 2XR4A 2V09A 4OHYA 3B7MA 4FXGB 4OLLA 4RYDA 4UW5A 1CAXB 1ASJ1 4UI9L 5BXXA 1NXD1 1VBD1 1PO12 1C1LA 1GWKA 1BCXA 1GZWB 2D6OX 5A3UA 4IETA 5C5TA 3ZR6A 1GWLA 4OI1A 3VBHB 4BYYA 5DABA 2FDKA 1IS6A 4KGQA 2WZR1 3I2DA 1PGSA 3GNEA 2XGXA 2C5DA 1ULFA 1LEMA 1ZRIA 4M3CE 1I5ZA 2OQ7A 4PIYA 4PQ9A 4Y4YA 1QJX3 3W20A 5FPBA 3W59A 3ZYFA 2XWBB 4BIFA 1AL0G 2DCJA 4QWNA 4BQ5A 1YO8A 4XJ9A 2B45X 2EIEA 4JDOA 2YFZA 3MV01 3H3UA 4YG3A 1JOPA 4YNIA 1ZBA2 2LM3A 4MGZE 4CEYC 2Y6GA 2VZUA 3H8UA 3KCYA 1ND3C 3RJ2X 5J1XA 2ET1A 5H9RA 1JH5A 5DMYA 5FZCA 1U5IA 2Z69A 4OZOA 3VDDA 4AGRA 1D2SA 3LSDA 1FOD2 3SMHA 3PLQA 2R1DA 4Q4V2 3WLUA 4R4XA 3A23A 2E33A 1H30A 2ARBA 1WMEA 3I2KA 3S5QA 2RMU3 1AR73 1NCRA 3M3EA 1TME3 2Y6HA 2IZWA 1DHKB 3WW3A 4LO6B 3DKWA 1JYCA 2BFUL 2Q1MA 2ARCA 1Y4WA 1REEA 3RFRA 5CFCB 5J48A 1H8TB 3DF0A 4DB5A 1LHUA 3PJYA 1DZQA 4QDQA 3WNLA 3RYRA 2D97A 4M4PA 4EWDA 1OA2A 5FYYA 4AI2A 3W21A 1QQP1 5FQ0A 3OD4A 4OUMA 3HBKA 2AEZA 2I07B 2PQQA 4B4PA 3GBWA 2DUPA 3GZEA 4ATFA 3AL6A 2JB4A 3GALA 4IL7A 4N7UA 4RGGA 5A3PA 3KVBA 2ZS6B 1I9RA 3AK0A 3ILNA 4JDNA 5C71A 1XPWA 4LT5A 2P37A 2ZKNA 3OUJA 4Q4Y2 4ZS2A 5G04L 3VHRA 5I8TA 5JWPA 4NIGA 2R6QA 4Q8KA 1HRI3 2WWJA 3GZAA 5IWFA 4CDXC 4I0BA 3U4XA 1UWWA 4EN8B 4IEOA 3VV1A 4A41A 1AYN2 3KHBA 4AEDB 5JXHA 4YARA 1ZBE3 3SEPA 1WLWA 3SCHA 1D4M1 2P3JA 2ZHNA 4AWDA 1WD3A 2WQ8A 3ZN6A 2EALA 4YVSB 3WCRA 4Q5OA 1BMV2 1G8WA 1NA1A 2WNVB 2XHKA 4J1XA 3C7HA 4G4FA 3O5SA 4HZFA 1LULA 2JDHA 5ACA3 2WINB 1W6OB 3C7EA 2RV9A 2HEWF 4XHXA 1J83A 2RS53 1GP4A 3WT3A 3WXPA 4JTOA 1X82A 2RM21 4ZKTB 4N43B 2Q8OA 3P6BA 4HG6B 4HVQA 4X6QB 1IG0A 2ZKLA 4AVBA 3VZNA 3WW2A 4QQHA 3W9AA 2QDNA 1BBT2 1HRV2 1PK6C 3ZXJA 2VMCA 5A3OA 3IKWA 2R16A 3I3QA 5KHGA 3I8TA 4IV1B 3ZX7A 5E88A 4IQPA 2BOJA 2QQNA 5LBCA 5CKNA 1BMV1 1G9BA 5FZBA 4HK9A 4Q26A 4TLGA 3J7NA 5GM0A 3V65A 1QDCA 3WQ1A 2D3PA 4B7KA 2VZVA 1OUXA 4RA0A 3SNMA 2G9FA 2WQZC 4LE3A 4ZXKA 1FPN3 5JPNB 3MPPG 1AR83 3O0WA 5FIXA 5JUVA 1ZZ9A 3CU7A 3RWNA 4D69A 3RRDA 1WA6X 1CAWA 1PHMA 2AZ5A 4PHZA 2PHTA 3SISA 2P3KA 3MUZ1 1JTZX 3VZJA 2XKOA 4HN0A 3SH5A 3B3QE 4A7YA 5BNPA 1W6QA 3OPZA 4AG4A 2Y26A 5ABJA 5K9YA 1RL3A 3AP9A 4W6XA 1KXGA 2DWRA 2YC0A 4RFRB 1C8NA 3MIHA 2YBKA 1W8WA 1CPNA 1ST8A 2SBAA 2YFUA 4GJZA 1I6XA 2P1BA 3ES4A 3WNOA 4H7LA 1JU4A 1N47A 2YGLA 2H6CA 4YG0A 1VBC3 2WABA 1K3IA 5IFTA 3ALQA 3LIGA 1G9AA 2V73A 2ZGOA 3I2FA 4K1YA 1BK1A 5JOYA 2C24A 2WZ8A 1NX9A 4A7KA 1DGLA 4UFKA 1S0EA 4NAMA 1QJU3 3BPZA 2A73B 4I30A 4XE9A 3ZLIA 5FR3A 5JPMB 4ITCA 5FY4A 1XC6A 2VQ0A 3R0RA 4L9BA 4QU1A 3VL8A 4MLOA 4JTNA 3ZDVA 5EJ1B 4M4RA 2EVXA 1LENA 4KWLA 3TEYA 5A80A 3AZWA 2XUMA 3CIHA 4QKNA 3N7LA 1PM7A 4COVA 3QBQA 1BXHA 4JGZA 1QJEA 3TNQA 2QZ3A 3SKJE 4CDUA 4UF0A 3GYDA 2NN8A 5JXJA 3VBRB 2DCYA 3E6BA 5CBLA 2E26A 1J3RA 4DNYA 1OHFA 1VAKA 4KWJA 4O65A 4YW6A 1NE6A 1VMHA 2R062 3FBMA 2A6XA 3I54A 2ZGSA 4QDRA 1KFXL 5J3UA 2WS92 2WSVA 1R083 4XZPA 4NHMA 4CCNA 4WM8A 1LJ7A 2WYFA 1WCQA 2PLV3 3I3BA 4P5YA 4LKDA 4P00B 4QX5A 5HXMA 1GANA 3N3HA 4HETA 4UFMA 4XFFA 5C70A 1RMU2 5E8AA 2HWB1 4BCUA 4MXWB 3AMNA 1OFNA 1C4RA 1NLRA 1AYM3 2EIGA 4XBQA 3B94A 1OMIA 1ZZCA 2V5YA 2RHPA 1H1MA 3OG2A 4W6WA 1O59A 3WSOA 4EJRA 2FQPA 1URXA 5D8AC 3WV6A 3BB6A 2FMYA 4MV2A 4LBQB 1GKBA 3KV4A 1C8M3 2TBVA 1OD5A 4GALA 5A7WB 1QOOA 2Y64A 5CG9A 3HEIA 2O8OA 3A21A 3SEEA 4EZ4A 4XMAA 1UKGA 3K4AA 5J98B 1BHGA 1YIFA 5EFUA 1SLLA 2XJUA 1OLQA 3ABZA 3BTXA 1EV12 4MHUA 4HT1T 4UW3A 2JG8A 1NLSA 4GQ7A 4PDWC 1RUJ3 1RVF2 3T2OA 3ZN4A 3I97A 4NPLA 1UX6A 1Y43B 1ND3B 3MBWA 3ZFEC 4MYEA 1JZ4A 2X05A 2RMU1 2ZAHA 1AR71 1LOAA 5JR2A 1TME1 4ZPIA 2WZEA 3LOIA 1S0IA 1ZYBA 4QXHA 1AJOA 3AVRA 2C26A 3AP4A 1SMVA 1SBDA 1N3QA 5LEJA 3N7JA 1TEIA 3LEIA 4RN5A 1BEV2 1CN1A 1QJFA 1Y9GA 4V1PA 1D0HA 5FMCA 3ZXLA 4A42A 4ET7A 1ZZBA 4COUA 4HONA 1GSLA 2EXKA 5I93A 1W28A 4C8DA 4CUCA 5CISA 3KV9A 2Y38A 3AKSA 4QX7A 2A71A 1EYBA 4B29A 3SHRA 4A45A 3HOBA 4AFAA 2VZTA 5EPAA 3CNAA 1SHWB 1SPPB 3C7FA 4XMIA 2CWSA 4XILA 3EJKA 3S6PA 2A3WA 1E5HA 4HPKB 1ZBE1 3N9OA 3OY8A 4QMAA 3FL7A 2Q4SA 4IXLA 1EP0A 3WW1A 3ELNA 1EAH2 4CDWB 4CDXB 4L99A 5LA2A 2WFF1 4FBFA 2HWF3 1CZVA 2R043 1DYOA 5TSWA 4KBBA 1C57A 4XBNA 1JN2P 4META 2RS51 4BDVB 1HB1A 5HPOA 3JBG3 3UESA 1UKRA 4XC9A 1S1AA 2PYTA 2QJVA 2QQPA 4P9YA 4Y33A 4J6GA 4QX0A 2XWJB 3B00A 1WD4A 5EJ3A 4EZHA 1CIWA 2JE9A 1JZ3A 2QNKA 4K3UA 1W6MB 5F5AA 1UZ0A 2VM9A 5FTTC 2MPFA 3TB0A 1WCKA 1Q8OA 2HWC3 2OZJA 1KQRA 2R072 3CZUA 2CAVA 2IXIA 3Q8EA 2VY0A 2I2SA 1YEWA 2ZMLA 5BYNA 1E5IA 1SQ4A 4XURA 3X29B 4YVWC 1Z7S2 3J26N 3KLSA 4RS5A 1ULOA 2OKXA 4AVSA 2IVJA 1OH3A 2GMEA 4DXSA 4K21A 4XIKA 1ULDA 4RHV1 1AXKA 5SV5A 1FATA 1K5JA 1FPN1 4LUMA 2ETEA 2UYBA 1AR81 3RZJA 1YRZA 2XXZA 5B4NA 3JU9A 2JWPA 1CJDA 2MEV2 3OEBA 2YU1A 4WZFA 4YLZA 3WUCA 2UU8A 3OSDA 1B09A 3INAA 5K7PA 3H9AA 4B1LA 1R092 2D98A 2GP3A 3M4FA 4CCJA 3K75B 1QWRA 1X8EA 4NRPA 1W39A 3ZMNA 1SFYA 4WM7C 4XZUG 3UJQA 3QD6A 5JLVA 2W91A 3B69A 1YI7A 1HLCA 5FOBB 2WLQA 2WWUA 4E8DA 3AXDA 3ITQA 1TMF3 4FO9A 4XFGA 3THTA 1DG6A 3IIAA 5HV4A 3BN6A 1Y9MA 1GZ9A 2Y6JA 2ZCWA 2XBO3 4JHZA 1QOTA 4H14A 2E63A 1Z0HA 5B4XA 3VL9A 1DYPA 1VBC1 4X8PA 1UXXX 4ISRA 4MGIE 2OIIA 4P9JA 1EUTA 1YFWA 5EWSA 3W58A 3BTZA 2YGMA 2J1TA 1GNZA 3RS6A 1W0PA 4IEVA 1IKPA 3Q8CA 1XRUA 4K40A 4JAAA 4QGLA 4DXZA 1QJU1 2XPJA 1W9SA 3M3IA 3UV9A 5GLUA 4FOWA 4XABA 5J36A 1JZ5A 2QE3A 4MGQA 2VNRA 4EV0A 1FX5A 3D0JA 5FMDA 4DPNA 3AL5A 5JOZA 1KD7A 2D43A 2ZX1A 3AKTA 3MICA 2GSYA 4IV3C 4IE0A 3MUY1 4H2AA 3AP6A 4MXVA 5FWJA 3BVCA 3KF5A 4GWIA 1HN0A 1UOJA 4HKLA 5FP8A 4AGVA 1ZX5A 2WLPA 5A6XA 1PMJX 1YYNA 4BA6A 4CDUB 1V70A 1V6JA 5DXDA 2W9XA 3BTYA 1R081 4JKKA 4WV8A 5DDJ3 3N7KA 1XOYA 3CEWA 5CIRA 3WG3A 4PBOA 3WHUA 3ZFFC 1AL23 5IK5A 2Y6KA 3T2PA 3AYEA 1ULCA 4LK6A 2BBAA 4KGGA 5FZOA 4XUNA 1POV3 4OFGA 1AYM1 2JB8A 2F6BA 4PLMA 2JE8A 2Q0AA 1BLZA 4ZS3A 5GZEA 5LBEA 2HYKA 1C5IA 3ETPA 5KXDA 1XYNA 3Q8FA 2GH2A 4CUGA 3WY6A 1W2AX 1CIYA 1WW5A 2CGNA 3POWA 2ZHLA 1C8M1 4MGTA 5GZGA 2O0OA 2WN3A 2Y34A 3JB8A 5FZDA 5F6LB 2HYXA 2HBTA 1YQ6A 4DZGA 3WNKA 4OMCA 5D8AB 4WVZA 1HB3A 4YG6A 4IW3A 3M3QA 1ZZ8A 2MNGA 1S0BA 1RUG3 2ZZQA 5BNOC 1RUOA 2VZSA 1TG7A 1K12A 2W08A 4URAA 3MLKA 3TN93 2NMNA 4NPRA 1MQTA 1JI6A 1H2KA 1RUJ1 4JDMA 4LE4A 1YFXA 2KXLA 1RUI2 1XYPA 4I02A 5EV7A 2D6PA 4GB33 3T09A 5A6ZA 5AC93 1CWPA 4LORA 4X6RB 5F3IA 1SDWA 3T2QA 2BZDA 2Z42A 2FD8A 4IGOA 4C90A 4NJ4A 3OYWB 4KG8A 4B1MA 1YQ5A 1YFYA 3AMHA 3ZFGC 4PDWB 4LJHA 4P02B 3V0BB 3AKQA 4C91A 2OX0A 2GNMA 1X8MA 4NHLA 1VBB3 2YYOA 4NIAA 2RR12 1NY71 1O5LA 3KS7A 4X8NA 3ZFEB 4TLFA 4PIXA 4KQ7A 4U2AA 4DMIA 3LFIA 1DQ0A 5D2AA 2O1QA 2WNEA 3EXUA 1CX4A 3KB5A 1RUE3 5JSOA 5IT6A 2BNOA 2FDHA 5FYVA 4QPGA 5A33A 5HCAA 1RIRA 4QHZA 2RS12 4GH4C 4LBNA 2CGPA 1LODA 1GMMA 1L7RA 2HLEA 3GDBA 3N9NA 3RZZA 4E2SA 3EB7A 3USUB 2OPKA 2BWAA 3LSEA 4E4ZA 1POQA 4EN0A 4HFSA 4FOVA 4WBBA 1YQCA 2J7MA 5T5JA 3O1TA 1PM4A 3F95A 4COWA 1CZTA 1QH6A 5DZFA 2XVKA 3I59A 5IATA 3WDYA 4D6RA 4CCDA 4LHKA 1AXZA 1DBNA 4AZZA 1H8TC 4FPGA 3EQEA 4Q27A 4HMZA 1R1A3 4PBPA 3WG2A 4ES8A 2ZX4A 1O3QA 4YGCA 4Q4X3 4CP9B 1JOJA 4NN0A 1AXYA 2HWF1 2R041 3QACA 3SQOA 2RE9A 2JJ6A 2Y6LA 2VMGA 1US3A 1XSRA 1MS3A 4JC1A 5FYIA 4G3YC 4ATEA 1O3SA 3PTRB 2BBVA 3T0DA 5EYXA 3JBG1 1LHNA 1HV1A 4IE6A 3KZ4C 5C9AC 4CU8A 1MEC3 1AR62 4LBKA 2YMZA 4DEVA 4YGEA 5L73A 3QLQA 3AZYA 3F2ZA 2W2IA 1QU0A 3ZXKA 5LEKA 2HWC1 2P6HA 2K0GA 2FHRA 4PLNA 4JV4A 2VQAA 4C1WA 4Q0VA 4IE4A 1OBNA 4C1XA 3NAPC 1MR5A 3IN9A 2VOVA 1RUF2 4NRMA 4E27A 1CR7A 4YM2A 3B9CA 5JXGA 4I01A 3HT1A 3PUAA 2VUAA 4AVAA 1R1ZA 1G7YA 4K20A 2ZABA 4YVWB 4BQWA 3J7HA 3ZN5A 1VB2A 3A0NA 4W8JA 3VLBB 1LOFC 2A6VA 1UNBA 4CU9A 3LE0A 4DQAA 1TVGA 2J1EA 4HL0A 1VPHA 1NQDA 3PVOA 4LBMA 4C0BA 4D7YA 5CKMA 4BQXA 1OF4A 1W90A 1DGWX 3CLPA 1TMF1 1ZZ6A 1RUF1 2DVGA 3KSCA 4URTA 2OYZA 5C4WA 3OTFA 4CDQC 3UETA 1V9U3 3E6CC 3MW4A 3J8F2 4WM7B 4XF4A 3T0BA 4TWTA 4P14A 4LKFA 3U0ZA 4JGYA 5E6HA 1COV3 5H9SA 5ISLA 1SDDB 1IPKA 1VR3A 4DEQA 2V4VA 4AVTA 3WNMA 1XJAA 4AR2A 2NPIA 3FLRA 1SBFA 1LECA 1S4CA 2P3IA 4XVHA 5DG1A 3ZDSA 2Z4FA 2VUJA 1C3HA 5FY0A 5IVCA 3HN1A 1QJY3 2KD7A 4OQ8A 4M00A 4BISA 3P3PA 5F32A 1PNGA 2ATFA 4Q4Y3 1AVBA 2AR6A 2EXHA 4QAWA 2D5HA 4CXYA 2BOIA 2W47A 2KM2A 2BDRA 3MFCA 3H3LA 1MZ6A 3E1F1 3J7MA 1FV2A 4BWOA 1KJLA 5DN2A 4QB2A 5EIYB 3WUDA 5FO9B 2VBBA 3K4ZA 4FPYA 1X9TA 1TNFA 1FMD3 2H6BA 1RITA 2VCMA 1MZ5A 2WQ4A 3KV6A 2WO1A 4UFLA 4Y5Z0 5GLVA 3T0AA 3JZVA 1W3XA 4ZZ8A 4IV3B 4IERA 5HCBA 2XLGA 2TEPA 2DBIA 2RJKA 2XJTA 1VAVA 3D6EA 1AL21 1ZA4A 5KHIA 4NR1A 1E5SA 4HSLA 1VBE3 4RQPA 1BBT3 3ZSEA 1WLCA 3WOGA 3C3VA 4AFMA 4W6YA 3DL3A 2G9GA 3HD8B 2JICA 1UY4A 4YM3A 5J96B 5LRSA 1O3TA 4WVMA 1ASJ2 3MIDA 4N90A 1EPWA 1QOSA 3POSA 4Q0PA 3LKJA 1JZ2A 1VBD2 5FZGA 2P34A 4EN7B 2BJSA 1WCUA 5FYHA 4FPHA 3MI8A 3UGFA 4BLJA 3HR9A 1DGRN 2IXCA 3DXUA 4CEYA 4C0HA 5FBZA 2B7YA 1S0CA 2IFRA 4BQ3A 1GLHA 1IS4A 2VMDA 1CJPA 2WZR2 4XQ4A 3G6JB 1JYNA 1SG3A 1UZYA 1VBA3 2B9VA 4EYUA 1RUG1 2WFPA 4DO0A 5IVBA 1WLTA 4ZONA 1OVPA 1OPMA 2DCKA 1IZ3A 1ND2A 1DCSA 4I09A 1RXFA 4GB31 5AC91 3NSTA 3GGLA 4Z07A 3FFZA 3HVDA 1LHWA 3WCSA 1Q3EA 5BNOB 5C8CA 1FT9A 4OHWA 1W05A 2JG9C 1RUC1 3S5AA 2ZZJA 4CE8A 3PIJA 4XHBA 1V6IA 4QDSA 1VBB1 2VG9A 3AB0A 3O7OA 3BU0A 4PI2A 1V0AA 5K4LA 3H1YA 3AYAA 4CEWC 4ZHNA 1H1IA 2HJIA 5JVVA 4L97A 3ZFGB 3U78A 2K2SA 1RUE1 4LO4B 4LTAA 4AYUA 4B3NA 5I8YA 2Y0IA 3GCXA 1DF0A 1WW7A 1TE1B 3RJRA 2DTYA 1XNCA 5FY5A 4D0QA 2WBKA 1RJ7A 2YC4A 3MIGA 4NROA 5LATA 3VBOB 4BM8A 4QB6A 4UBGA 4ASLA 4YGBA 1XNDA 3O0XA 3PVNA 4BXSV 1A78A 3KGLA 4YW1A 3MIEA 3LDRA 2C6SA 4NHKA 2EXIA 5FUNA 3HPNA 1UOBA 1W8OA 3EO6A 4TN7A 1JYTA 4GH4B 3DYOA 1HXS3 1QQP2 1W8HA 4JRAA 4Q1PA 3PVBB 3PUIA 5LASA 1S2BA 5GZFA 5JSRA 5JXIA 2FDJA 5BNNA 4F7ZA 1SLTA 3MV11 1S0FA 3MW3A 2R063 1PO23 1GQGA 1OKOA 2GN7A 3LDBA 4KU7A 4XXPA 3WF2A 4DS0A 1R1A1 2ZGUA 4YZ5A 2XDVA 5A3LA 2A3YA 5FYTA 1NCQC 2E9QA 4Q4X1 3DEMA 1G9FA 3I2OA 2ZHMA 2F4LA 2J1UA 5CAZA 4BLIA 1EY2A 2HBUA 1C1FA 1MS5A 1ZM1A 3MGUA 1Z78A 2VVFA 4FPJA 1LAJA 5HCFA 1VLNA 1DQ6A 2LW8A 4N53C 3TEXA 1D4M2 1MEC1 5IVVA 4FTEA 5L9RA 3KQRA 5F2SA 1ENXA 3FJSA 1POV0 2ZMKA 1PVC3 1DIWA 1OQEA 2E51A 5FZ3A 3JD71 4FFIA 2ZA9A 3B02A 1PVXA 1UX7A 1W2TA 3AC0A 3SC7X 4AGGA 3H8OA 4BH9A 3KM5A 1RINA 3MPBA 5I8SA 2GMMA 3GJBA 5C9AB 2R1BA 5CNAA 2RM22 1AR91 1H2NA 4GWMA 2BYVE 4QQLA 3RMXA 3C7GA 4CXWA 3T3YA 4PT6A 3VHOA 5CKQA 3WNNA 2XL9A 4JQRA 2WDBA 1ZZ7A 1GV9A 4CDWC 4E2GA 5IAXA 3K48A 3PNAA 1DLCA 4Y22B 3VD9A 1EV13 4A3XA 3NAPB 3OGJA 4LULA 5J7MA 4XFAA 3KMHA 1XNKA 3ZPOA 4K7JA 1APNA 1W6NA 2GMPA 4MGSA 4MH0E 4WVVA 1VALA 3UK9A 1CAVB 4BQ4A 4K9SA 4ORFA 4L0PA 2XLFA 1AX1A 5T5OA 4AI3A 4B7EA 1U0AA 4S2FA 1J1TA 2O8QA 1H1AA 4FOQA 3ZIXA 4CYDA 4PLOA 3H8XA 1PGW1 4AQ6A 1ZRCA 2F4PA 2PAMA 2JE7A 5A33B 4ARXA 3ENRA 1V9U1 4ASMB 1HQWA 2YZ4A 4DUWA 2JD4A 1BEV3 3VDDC 2JDKA 1COV1 2D44A 1JYXA 1CONA 1YCIA 4I3PA 2VXJA 2YBPA 2WKKA 4CP2A 2OZ6A 2RS33 4CDQB 2R0HA 1U12A 1J59A 1DU3D 1WKYA 1S0JA 3LEKA 1QJY1 4Q4W3 4DY5A 3CKHA 1NCRC 5F7UA 5FYBA 5A32A 3M70A 1Y3TA 3S57A 3BUCA 3E5XA 2Y0OA 4GKYA 1WMFA 2GDFA 2FZ2A 2QZ2A 5FKCA 1RUD3 4UFJA 5A1FA 1O8SA 3VB9A 1IGOA 1IPSA 4FI9A 2ZEXA 2V4AA 4FOYA 3R4SA 1BQPA 4XDPA 3VBSA 1FMD1 3AXEA 3TNPB 1TNRA 2BEOA 1SLAA 4LO5B 2BERA 5GLWA 4XJAA 4QPIA 1YUDA 4Z8BA 3EBRA 1F5JA 2XMLA 4ARYA 1LOEA 1F35A 4UT5A 1F2NA 4D6SA 3WP3A 1J3QA 2ZX2A 3FWEA 2HEVF 4CCOA 1KJRA 1QNYA 2YDEA 4N8MA 3VUOA 1Q8VA 1J58A 1H2MA 1VBE1 3THDA 1W2OA 3AJZA 3OEAA 4OI0A 5A6YA 1I3HA 4EQVA 3I3MA 3OBTA 3OBZA 2HH9A 1KFUL 2R073 4XTPA 4DRRA 1IKQA 1NA1C 5IW0A 1ODNA 4JX0A 2Z2SB 4BU2A 4TYSA 1LGCA 3FN9A 4FP2A 2EIDA 3U14A 3OGRA 1PMIA 3ROUA 5A7SA 1RHI3 4QQPA 1GYKA 4YGDA 2HWB2 4P9WA 5K0UA 4AOCA 5LA9A 1BVVA 4XDOA 3P5BA 4XTMA 4UOJA 5D1IA 3WINE 2QVSB 5HCHA 5EP9A 5L7OA 1TQ5A 4FFGA 4LXLA 3E97A 3B93A 1UY1A 4B4QA 4COYA 1VBA1 5KC5A 1RTVA 2B9UA 2A6YA 3D3AA 4Y1UA 1IPJA 4RR3A 5A3WA 1X7NA 2GU9A 2JDUA 1VAMA 2RJLA 3CJIA 4YW4A 1M06G 2YBSA 2HWD3 2CDOA 1ULGA 2HWE3 2PA7A 5DUWA 5KXBA 5JZGA 4XUOA 4A44A 4E8CA 4L8QA 4P9LA 1UL9A 2IVIB 3M2MA 3O1MA 4HLTA 4U36A 3VD4A 3ZMOA 1HIXA 2EF6A 4QKFA 5ABJC 4Y20B 2JG9B 1QY4A 1QJX1 3GCWA 3FHAA 3KCCA 4OZXA 2CL2A 3CZJA 3VN4A 1W9WA 2RMU2 2WT0A 5FLIA 1AR72 4LR4A 1TME2 4A3ZA 2LROA 3SLIA 3VD7A 4TTGA 2WA4A 3K77A 2E53A 4CEWB 3LA7A 2J22A 4MZUA 4MGYE 4FSJA 2E32A 1AZDA 2IXJA 4IESA 4GMP3 2R7EB 3NV1A 5L36A 1YXWA 3W5MA 2W5FA 4L11A 5I0DA 4IDZA 1PIV3 3V0AA 1HXS1 2DURA 3PUSA 3B5LB 3BU7A 1CD3G 5FJKA 1N1VA 4P08A 4QX8A 4M0HA 3T1LA 1PO21 1DDLA 1UAIA 2XUEA 5FLJA 3RVHA 1QJZA 1IQDC 5JI9A 1CAUA 2UWAA 4LK7A 2UYAA 4EWEA 4OCTA 4AI9A 1LU2A 1J84A 2AREA 5F6KA 2FDGA 3B01A 1NZIA 4HSJA 2XOMA 5K8SA 2EAKA 3M7AA 4CDUC 5BY5A 1ZBE2 1LU1A 2ZHKA 2E7QA 3ACIA 4OHXA 1J1LA 1NCQB 2DDUA 5F5CA 4UXAA 2XLAA 1PVC1 1HQNA 2QQKA 4UW4A 4BB3A 1A8DA 4O61A 2WFF2 3SCFA 3HJRA 1WLDA 1IG3A 5CFDA 2R32A 4KMQA 1QGLA 3AKRA 4SBVA 2A7AA 4S2GA 5FFOC 1K5MA 4W4ZA 4WM8C 2RS52 1OOPA 4N53B 2AC1A 5KHKA 5J37A 2WNUA 2CY6A 5F1RA 1L7LA 1DQ1A 3P1IA 2H0BA 1HRI1 1JW6A 1A8MA 3UGGA 1P8JA 5EQUA 2VD7A 4MX3A 3MIBA 1IHMA 4XOGA 4LBLA 5KXCA 1Q8QA 4YW2A 1QXPA 2YV8A 3WZ1A 1B35A 1S0DA 4TZDA 3WDVA 5FZFA 2E7TA 2W87A 1KEXA 3LPGA 5BV6A 4QQOA 4N9HA 3VKNA 5ACA1 3H1WA 4RHV2 3KV5A 2WRAA 2JKXA 2X09A 3PDQA 1FPN2 3T08A 5I0UA 5DG2A 3VBFA 3H8RA 1AR82 2O14A 4PQQA 4QU2A 1K45A 3AKPA 2RG4A 3GBFA 3HWJA 5E1RA 5FZ7A 4L2NA 2HKXA 2RDNA 4NHXA 4HANA 2JG8C 2DVAA 4PCRA 3TOJA 3ZYGA 2E6VA 2VZ3A 5A70A 1OH4A 2B5HA 4YFZA 2AEYA 4ZU4A 5I0TA 2RS31 1KS5A 2VTXJ 5FYZA 2Y8KA 4DXRA 5A7QA 3U4SA 5IK8A 4Q4W1 4ZU5A 3KQ4B 3NNGA 3VDDB 3VBUA 1PX3A 2PTMA 1F4AA 3MIFA 5FUPA 1UZZA 1CZSA 3UGHA 1UMIA 1PGL1 1VBC2 4R9BA 5GLZA 1BVP1 1RUD1 3K2OA 2CSGA 2DU0A 2VW0A 1NCRB 1Y7BA 4OVEA 3ZPYA 2QQOA 4YFWA 1HX6A 1QJU2 2XHNA 3PHMA 1AJKA 1RC6A 3IPVA 1J3PA 2ILMA 1X33A 5E89A 2R30A 3FX3A 1F15A 1BKZA 5CG8A 4CA9A 4HN1A 1GOHA 3HAGA 4BZ4A 3ZFFA 2GN3A 4MSVA 3NMBA 5FCCA 2OPWA 5FQ0B 4CSWA 3ZXFA 1OT5A 3BODA 3SKVA 1RB8G 1O8PA 3ZYHA 3N9MA 3ZM8A 4AHZA 2D5FA 2RJ2A 3WD5A 1XE7A 3FBYA 2XJPA 2W1SA 1XU2A 3L9JT 5JIUA 1R082 1IS3A 1W8TA 2P4EA 2W92A 4RFT0 2WNOA 3HBZA 3I7DA 3WDWA 4WVWA 1ZREA 2VVEA 3HIFA 3D0SA 1GFF2 2A70A 4LKEA 1UPIA 1OLME 4EROA 2QDRA 1PMHX 3ZN6B 3DPRA 1RHI1
chains in the Genus database with same CATH topology
2FMDA 4NOTA 2Z5WA 1NA1B 2VH9A 5I0SA 3MFAA 1AYM2 4UBHA 1CAXA 1KS4A 4IEQA 3GZUC 3L2HA 4I3GA 5L19A 1GZWA 2UY8A 1PZ9A 3BIWE 4GWNA 3ZXAC 1IS5A 1C8M2 1VRH3 3VBHA 4B8EA 5JIAA 4RS5C 3ZYJB 2PLV1 2PHXA 3AJYA 1LTEA 2VU9A 3BALA 3WX5A 2HWD1 2VOWA 4DY3A 2HWE1 1Y9QA 5H9PA 2YROA 4S2HA 3J8F3 1S2KA 1QF3A 1ENQA 4QD2A 4IEWA 4MGKE 1RUJ2 2IFWA 2DCTA 3VKLA 2DCZA 2IXKA 1RUNA 5CA6A 1CAWB 4W65A 3WP6A 4KL1A 3WVJA 3ILFA 2D6LX 2VMIA 5BNPB 1W6QB 5ABJB 1RUH3 1DFQA 1NY72 4FPLA 4GMP1 5T52A 2ZGRA 2DF7A 1PIV1 5JSPA 1DZTA 5CFCA 3ZXDA 1AF9A 1GBGA 1H8TA 3OF1A 1Q8SA 4J1WA 3GBGA 3E5QA 2BGCA 3NV3A 4IEXA 2VVDA 2PHRA 3UJOA 4QT6A 4OI4A 2B42B 1SLBA 3NO8A 4AHWA 1Q43A 4KG0A 1DGWA 4YW3A 2D7FA 4JRLA 4Q29A 3VBOC 2A3XA 2GC1A 3ATGA 3D8CA 4R9AA 4E9KA 3PTYA 1MS0A 2SLIA 5BNQA 1S55A 1MS8A 3HT2A 2VPVA 3E6DA 4AQSA 4OHVA 3ZYRA 4AEDA 4FQ4A 4UW6A 3FE5A 2HWF2 2R042 4JGZB 3RYKA 4Z82A 1ALYA 1O4ZA 4LLFA 4QXKA 3RNSA 3IMNA 4CDUB 4YVSA 4Q0QA 3JBG2 2WNVA 1VP6A 3APBA 1YHFA 1XE8A 1AX0A 2A6ZA 4PF5A 3IDBB 1W6OA 3VZMA 4RR3B 2WL1A 1NYWA 2BQPA 2LALA 2VNOA 2WZR3 5FPXA 4WM8B 2NQYA 4N43A 2ZJCA 3CJIB 2HWC2 2NM1A 4EN6B 1D4VB 4H7MA 1NXMA 1V6NA 1N3OA 5KBFA 3TAYA 4XF9A 3AYDA 1GZCA 3WW4A 1L3JA 2X5IA 3U07A 5HI0A 4LA3A 4GKXA 2PELA 1F9KA 4Z1VA 4IV1A 4Y1ZA 3WDTA 2UURA 1PO13 2QUOA 2ZX3A 5CU1A 1OPOA 1MVQA 2C1FA 2ERFA 2PHLA 4XQWA 3RQ0A 1UF2C 3QOPA 1MQTC 1O4YA 4QHBA 2XL7A 3WHTA 2YPJA 1SFNA 1O91A 3BOWA 3HMYA 4KH9A 1TMF2 1GICA 2JG8B 1ZBA3 4NWWA 2AGSA 1D2QA 5CADA 4GMP0 3AZZA 1V00A 4AHYA 4LBOA 3SH3A 3RSJA 4AE2A 2IC1A 3POYA 1VJ2A 2LTNA 3ME2A 1V6MA 2BNMA 1FOD3 3H7JA 3SCGA 3N36A 4P9XA 4QPGC 3VKOA 4Q4V3 2ZBJA 3AFGA 3L2YA 5E16A 1OI6A 2DFCA 2FZ1A 2PHWA 4FPOB 2D3SA 1BZWA 1PZ7A 1QKQA 1Q5OA 2XBO1 3VGIA 2VULA 5J09A 1D4M3 1K5MB 1WW6A 3MF9A 2DVFA 4OI2A 1CQ9A 2I45A 3S30A 5F9TA 3JB4C 1IOAA 4XF3A 2CYFA 3VBRA 2RM23 2JECA 3R4UA 3ZIWA 3URFA 1AL22 2GC2A 4YZ2A 1LGNA 3OY8B 5FO7B 5JI7A 4LO7A 2ZGKA 1QXJA 1AYN3 5FAXA 4DOUA 1SACA 1BJQA 3RI9A 2A5ZA 1WUVA 4K1ZA 3VBFB 1HDKA 4MXWA 1YI9A 1VRH1 1UN1A 5FOJB 2KA3A 4YM1A 1NE4A 5DDJ1 3JQWA 3GF6A 2B39A 3P3NA 4LBQA 4R4ZA 2DU1A 5FLHA 5LRRA 3K51A 4YZ4A 2NLRA 4CZSA 1RUG2 1HRV3 4RS5B 2QKDA 1JYIA 3ETQA 2X8KA 1POV1 3TN92 2ZGTA 3AYCA 1KDKA 3D4KA 4N9IA 5GLTA 1HV0A 2MHFA 2R49A 1EPZA 4GB32 1LHOA 5AC92 5FRAA 2UWBA 5BUVA 2PHFA 4O9GA 1UIJA 3LOBA 1RUC2 3PMSA 4D7TA 4YSFA 5IK7A 2ZTNA 1ND3A 5C4WC 1VBB2 4PJYA 3R6SA 1RUH1 1RJ8A 5KC6A 4BHPA 4JGYC 3IDEA 1YJLA 4TSVA 1RUE2 4BMEA 5LK5A 4YYOA 4YZ1A 3TN91 1NZCA 4AF9A 3D5OA 4ES9A 1LOBA 1NQJA 2VXRA 3O0VA 1N1SA 1XNBA 2Q30A 5FDBA 4H55A 1YFUA 3JUUA 5EYYA 3QCWA 2CWMA 4Y26A 1UW8A 3ECQA 5A3MA 4IEYA 4IEZA 1Q8PA 4FXKB 1MS1A 1OQDA 4HKOA 3AMMA 1R1A2 3DPRB 4Q4X2 4HPKA 2WIIB 2JX9A 2EA7A 3M3CA 4BOWA 4F83A 2BFUS 3ZYPA 4CDWA 4CDXA 2HWB3 4FPFA 4AXOA 1MEC2 1W2UA 3I4IA 1OLRA 4RQPC 1JHNA 1FNYA 4R9CA 4AW7A 2W39A 3JD72 3SXWA 3WQ7A 4AVCA 3OCPA 4BMBA 3NKGA 2DVDA 4I0AA 4OUSA 3R4DB 1AR92 4YM0A 2WS93 5AVAA 1W6MA 1DGRA 5T5LA 1QDOA 3MW2A 4K8FA 3KT4A 2ZGPA 2CNAA 3GHMA 4M01A 3O12A 1U5YA 3IDCB 1RMU3 1PO11 3A4UA 4Q0SA 1PK6A 4HVOA 3U10A 1WCSA 4QGMA 2GNTA 2D6KA 1GNHA 2P2KA 4I0WB 1ND2C 3QH7A 2W52A 1Q56A 2XJSA 3IT8A 3T2TA 1PGW2 5C8CC 3CF6E 1GR3A 3LZZA 5BPXA 3AP7A 4NWVA 5DUUA 3FLPA 1MQTB 1SCRA 1V9U2 1ZBA1 2CV6A 3WQ0A 3RI8A 1COV2 2Z79A 5DUVA 4AI0A 3UKVA 1MS9A 2XH6A 4XW3A 4XJZA 5IK4A 1RVF3 1ENRA 3SITA 1FOD1 1VB4A 3OGGA 3BTAA 4Q4V1 1QJY2 2GNBA 4XJUA 4HVRA 2AYHA 1UU4A 3PMEA 3EHKA 4QPGB 4CP1A 1CVNA 1MACA 1UMZA 2ZOEB 5DUXA 2C9AA 3OJBA 2EXJA 3NV4A 2ZGMA 4FPKA 5BNNC 1FMD2 3VZLA 2WFF3 5FO8B 3U11A 4M0NA 2HEYF 1WW4A 3DUIA 3I59B 4Q4Y1 2GZWA 4AI1A 1JBCA 1VBE2 4XFBA 4XFCA 5FREA 4E2QA 2OVUA 2X5IB 5T3NA 1AYN1 3ACLA 3LCPA 1O3RA 2IWGB 4EN9B 4Q1RA 1W0OA 5T54A 1EAH3 4XEZA 2YY1A 2ET7A 4GA9A 3USSA 2JENA 4K6BA 3JCIA 4GULA 2WJSA 4RHV3 2GC3A 4XJ8A 4CTEA 3LB9A 1MZFA 2OUHA 1OA3A 5T50A 1QMJA 4AK3A 1G86A 3KCXA 2Q1ZB 3WP4A 1VBA2 2GC0A 1BBT1 1HRV1 4XFHA 1QH7A 1UIKA 3ASIA 5D8AA 2DVBA 2OW4A 1KDMA 3M3OA 3NL1A 2ZGQA 4GXLA 3V56A 3UKTA 1Z7S3 3NW4A 3MYXA 1DQ2A 3AFKA 3MEPA 4AVVA 1ULEA 4G9SB 4IEUA 2ZPXA 2MEV3 3OYWA 3IM0A 2ZGNA 3KT7A 4PDWA 1S0GA 3V0BA 1R093 1QJX2 4LUKA 1ZRFA 3FHIB 3KD4A 4FAGA 2I74A 2JDZA 4YZ3A 5C4WB 3AMQA 5F5QA 3ZFEA 1HW5A 5AFBA 2CGOA 1SEFA 1H4HA 1X50A 4JGYB 3WG1A 5KXEA 4XXAA 3GHNA 3RDIA 4MVTA 4B4RA 2PN5A 3THPA 3AMPA 2OA2A 3VKMA 1HXS2 2D3RA 4AFDA 5C8WA 5LK7B 5GKAC 4IEPA 3USUA 1FNZA 4LEJA 4R9DA 2NP0A 5BNPC 2D6NA 1JXNA 3OD0A 2D40A 2WSUA 1PO22 5T5PA 3VBSC 4FVVA 1DQ4A 4QM9A 4QPIC 3D82A 1HKDA 3WP5A 3VHNA 1BYHA 3TRSB 3RYPA 3ZSMA 4KNCA 4I2OA 3LA3A 3VHPA 2WT2A 1YIPA 1T6GC 2H0VA 1PVC2 4R52A 3WDXA 1X36A 4XETA 1N1TA 4Z92B 1G9DA 1XQNA 2R061 4AQ2A 2WS91 1H9PA 4RQPB 2VNGA 1HRI2 4JCKA 2BWCA 2NYYA 4LBJA 5B2GB 5K0UC 1C5HA 1H4GA 1RMU1 3IWZA 4JGZC 1DLLA 4WVMB 5L7OC 3HQXA 4ISQA 3CL1A 2C0ZA 1YNAA 1H9WA 3NV2A 3V64A 3A0KA 5ACA2 4RR3C 4CEYB 4YVWA 5KWRA 2E7AA 3CJIC 1RGSA 4R8HA 4GIQA 3DV8A 2UY9A 2AUYA 1LRHA 5JZGC 1ZRRA 2VGDA 1REFA 2CTVA 1I1EA 4XPVA 1M4WA 1E57A 1ND2B 4F8AA 1LOCA 4Y24A 3NWKA 1VIWB 4HBNA 1EV11 1F31A 3N4MA 3NKTA 5C8CB 3ZVXA 1RVF1 2RS32 1LEDA 4WM7A 1OFSA 1RUI3 2ZX0A 1A6CA 4Q4W2 1ZRDA 4A2UA 3RMYA 1LKNA 1GQHA 2DYCA 3FLTA 4XIOA 5EXOA 1PGL2 4M3CA 1LB2A 1V6LA 1RUD2 3AZXA 2IXHA 2RR13 4BPZA 2N7GA 1W6PA 4LA2A 1BEV1 3MF6A 4BQ1A 4FTBA 3S7IA 2XVLA 1V6KA 2RS13 4F3JA 2A75A 4RSUA 2GAUA 1YWKA 4Q8LA 1DZRA 1FI2A 4LHLA 4XJWA 5BNNB 1N3PA 1REDA 3LWCA 2FBEA 4IV3A 3SH4A 3ILRA 2G4IA 4A7ZA 5CFDC 2QCSB 4OHZA 4DINB 1EAH1 1K5MC 3MDPA 1OOPC 1PK6B 2WNUC 1RHI2 4DFSA 3J9SA 1UCXA 3FZ3A 5FMOS 2DUQA 3PJQA 3M1HA 1D0GA 1QXRA 1AR63 5EZWA 3WDUA 1B35C 1O5UA 1NOVA 4XDQA 3JQXA 3ZO0B 5HXVA 3M8LA 2R071 5GZCA 3NJZA 2AH2A 2BVBA 4Q0UA 5AVPA 2PLV2 1Z7S1 1DQ5A 1AHSA 3VBFC 4JVAA 1RUF3 2HWD2 3G7DA 2HWE2 5DZEA 5I0RA 1W6NB 3ES1A 3AX4A 3MLLA 4P9IA 3H0OA 2WC2A 1SCSA 2MEV1 5BNOA 4INDA 1SLCA 1XU1A 1AUYA 2XJVA 3GZTB 3LA2A 2YHJA 1R091 5KC5A 5JOWA 4LBQD 3FUOA 4KWKA 3ZSJA 1F8VA 2DTWA 3ZFGA 5JOXA 1ZNPA 3VBUC 2WZPP 3R05A 2PHDA 5FMOL 4P9GA 1QNWA 1DYKA 1FYUA 1PIV2 4N7IA 3VBOA 1U5ZA 5A32B 2PFWA 4H3WA 4XF1A 1SBEA 2YXSA 4GH4A 1KRIA 3T1MA 2W68A 4FCAA 1C28A 1XYOA 1OQ1A 2XJRA 4E4SA 4Q2FA 1LCLA 4EWAA 3VBSB 3BCWA 2ES3A 4SLIA 2VECA 3CO2A 3VZOA 4QPIB 5KHHA 2GH8A 2BW8A 1ZVFA 1YJKA 2ZGLA 1LR5A 4LLOA 4XBLA 5CVRA 4RGAA 3WNXA 3PVEA 3KT1A 3LAGA 4Y1YA 1FXZA 3DPRC 4MUVA 1CESA 5C9AA 4Y1XA 3N7MA 1F5FA 4QM8A 4WZCA 4BIOA 3ZSKA 5HBAA 3LGRA 2NZ9A 3FUQA 3KGZA 1NG0A 2UWCA 1O7FA 3VZKA 1LGBA 3VBHC 1PNFA 5K0UB 4Y22A 3NAPA 1ASJ3 3NVCA 4HKWA 4DRVA 1VBD3 5L7OB 2WWSA 1RUC3 4RL7A 3O14A 1CAVA 5SV8A 3MLJA 2XKPA 1LOFA 2VW2A 3OBRA 3AZVA 2VOXA 2BUKA 3Q9OA 2IXLA 4AQTA 5C6CA 5JZGB 2BNNA 1WGPA 3TWIA 1RUI1 3H7YA 4D7SA 4E4DX 1U5XA 3CJXA 1UU5A 4FQZA 5FPZA 2X29A 4YRDA 2ZMNA 2OUJA 1AX2A 4CDQA 2ENRA 3H3ZA 2A6WA 4LO8A 1V6OA 1G6NA 1LHVA 5IUQA 2RR11 1WMDA 2VW1A 2P17A 2XB6C 5JDBA 5CFCC 1UU6A 2WA3A 2GNDA 2DV9A 2JXAA 3H1MA 2BPA2 4CP0A 2TNFA 2R0FA 1WA4A 1MVEA 2NMOA 2RS11 4AEJA 2TUNA 2VOKA 3V0AB 3AM2A 2JKBA 3N35A 4M3CF 2XBO2 4Z2WA 2PAEA 2PHUA 4Y1VA 1QQP3 4NO4A 3J4UH 3JD73 2DUOA 3DN7A 1CAUB 4KU8A 4AEDC 1AR93 5JAXA 4S2DA 2K9ZA 4YVSC 2XVGA 2Q5TA 4AEKA 4ONUA 4BE3A 5H9QA 2WNVC 2JEMA 5GALA 2X53S 2EAAA 5CFDB 3QH6A 1CPMA 1WBLA 5GZDA 5C33A 1CGPA 4COZA 4ZU7A 1AR61 1JUIA 1A3KA 5GJ6A 4N43C 1OOPB 4AFBA 2WNUB 1MS4A 4XFIA 4HK8A 1VRH2 2YUEA 4NVPA 2X5IC 1MZEA 3WR0A 1QHDA 1YLLA 2XG3A 5DDJ2 1G9CA 1B35B 2QFEA 4IV1C 5JCTA 3AP5A 3S0MA 4P5HA 4FT8A 1IQAA 1PZ8A 3ST7A 4FPCA 5CB7A 5AFEA 4XQDA 4XF0A 3IBMA 1OKQA 3VKFC 3H50A 1FV3A 3DGTA 2ARXA 2D93A 3WG4A 2LUWA 1H2LA 1HQLA 2W0XA 5I91A 4M3CB 4L92A 4RD7A 1N1YA 1SLIA 1H8VA 4QPYA 1ENSA 1XXNA 1UD1A 1W6PB 4D3WA 4Y20A 2JG9A 4AI8A 1RUH2 3C2UA 4FTSA 4AEMA 2BTVC 3TYJA 4PIZA 2DFBA 1WBFA 4AFCA 2B46X 1UPSA 1LESA 4QGNA 3J8F1 4CEWA 2PAKA 5KHJA 4LHNA 3VBUB 1H0BA 1LOGA 4LNVA 3RPQA 4QQ2A 3ZSLA 5JR7B 3FC0A 1FAYA 3UKNA 4FP3A 2AENA 4FPEA 3E5UA 3TBDA 4YW5A 1OA4A 3IPVB 2BVVA 3ZYIB 1JUHA 3B9IA 3BOPA 3ZFFB 1O4TA 4XYXA 3FMGA 5JMCA 3FFQA 2ZACA 1WCDJ 1OSGA 1KITA 4AHXA 2VMHA 3S7EA 3VBRC 1NCQA 3ZXEA 4O9EA 2D6MA 4D94A 5T55A 3UL2A 2XJQA 4N53A 1ONAA 3ZXGA 3MZHA 4OULA 4FAHA 2ZAAA 5DZGA 4CRQA 2CAUA 2WT1A 3RG0A 2GALA 2B8MA 2V09A 4OHYA 3B7MA 4FXGB 4OLLA 4UW5A 5BXXA 1CAXB 1ASJ1 1NXD1 1VBD1 1PO12 1C1LA 1BCXA 1GZWB 2D6OX 4IETA 4OI1A 3VBHB 4BYYA 1IS6A 4KGQA 2WZR1 3I2DA 1PGSA 3GNEA 2XGXA 2C5DA 1ULFA 1LEMA 4M3CE 4PQ9A 1I5ZA 4Y4YA 4PIYA 1QJX3 3W59A 2XWBB 4BIFA 1AL0G 2DCJA 1YO8A 4XJ9A 2B45X 4JDOA 3H3UA 4YG3A 4YNIA 1ZBA2 2LM3A 4MGZE 4CEYC 3H8UA 3KCYA 1ND3C 3RJ2X 2ET1A 5H9RA 1JH5A 1U5IA 2Z69A 3VDDA 4AGRA 1D2SA 3LSDA 1FOD2 3SMHA 3PLQA 2R1DA 4Q4V2 3WLUA 4R4XA 1H30A 2ARBA 1WMEA 2RMU3 1AR73 1NCRA 3M3EA 1TME3 2IZWA 1DHKB 3WW3A 4LO6B 3DKWA 1JYCA 2BFUL 2Q1MA 1REEA 5J48A 5CFCB 1H8TB 3DF0A 4DB5A 1LHUA 3PJYA 1DZQA 3RYRA 2D97A 4EWDA 1OA2A 4AI2A 1QQP1 5FQ0A 3OD4A 4OUMA 2PQQA 2I07B 4B4PA 3GBWA 2DUPA 4ATFA 3GALA 4IL7A 4N7UA 4RGGA 2ZS6B 1I9RA 3AK0A 3ILNA 4JDNA 4LT5A 2P37A 2ZKNA 4Q4Y2 5I8TA 3VHRA 5JWPA 2R6QA 4Q8KA 1HRI3 3GZAA 3U4XA 4CDXC 4I0BA 4EN8B 4IEOA 3VV1A 1AYN2 4AEDB 4YARA 1ZBE3 1WLWA 3SCHA 1D4M1 2P3JA 2ZHNA 4AWDA 1WD3A 3ZN6A 2EALA 4YVSB 3WCRA 1BMV2 1G8WA 1NA1A 2WNVB 2XHKA 4J1XA 4G4FA 3O5SA 4HZFA 1LULA 5ACA3 2WINB 1W6OB 2HEWF 4XHXA 2RS53 3WT3A 3WXPA 4JTOA 1X82A 2RM21 4ZKTB 4N43B 2Q8OA 4HVQA 4X6QB 2ZKLA 4AVBA 3VZNA 3WW2A 4QQHA 3W9AA 2QDNA 1BBT2 1HRV2 1PK6C 3ZXJA 3IKWA 2R16A 5KHGA 3I8TA 4IV1B 3ZX7A 5E88A 4IQPA 1BMV1 1G9BA 5GM0A 4HK9A 4Q26A 3V65A 1QDCA 3WQ1A 2D3PA 4B7KA 4RA0A 3SNMA 2G9FA 2WQZC 4LE3A 4ZXKA 1FPN3 5JPNB 3MPPG 1AR83 3O0WA 1ZZ9A 3CU7A 3RWNA 4D69A 3RRDA 2AZ5A 1CAWA 1PHMA 2PHTA 3SISA 2P3KA 1JTZX 3VZJA 2XKOA 4HN0A 3SH5A 3B3QE 4A7YA 5BNPA 1W6QA 3OPZA 4AG4A 2Y26A 5ABJA 5K9YA 1RL3A 3AP9A 4W6XA 1KXGA 2DWRA 2YC0A 1C8NA 3MIHA 1CPNA 2SBAA 1I6XA 3ES4A 4H7LA 1N47A 2YGLA 2H6CA 4YG0A 1VBC3 3ALQA 1G9AA 2V73A 2ZGOA 4K1YA 1BK1A 5JOYA 4A7KA 1DGLA 1S0EA 1QJU3 3BPZA 2A73B 4I30A 4XE9A 5JPMB 4ITCA 2VQ0A 3R0RA 4L9BA 3VL8A 4MLOA 4JTNA 2EVXA 1LENA 4KWLA 3AZWA 2XUMA 3N7LA 1PM7A 4COVA 3QBQA 1BXHA 4JGZA 3TNQA 2QZ3A 4CDUA 3GYDA 2NN8A 3VBRB 2DCYA 3E6BA 5CBLA 1J3RA 4DNYA 1OHFA 1VAKA 4KWJA 1NE6A 2R062 3I54A 3FBMA 2A6XA 2ZGSA 1KFXL 5J3UA 2WS92 2WSVA 1R083 4XZPA 4NHMA 4WM8A 1LJ7A 2PLV3 4QX5A 1GANA 3N3HA 4HETA 4XFFA 1RMU2 5E8AA 2HWB1 4BCUA 4MXWB 3AMNA 1OFNA 1C4RA 1NLRA 1AYM3 2EIGA 4XBQA 3B94A 1OMIA 1ZZCA 2V5YA 2RHPA 1H1MA 4W6WA 4EJRA 2FQPA 1URXA 5D8AC 3WV6A 3BB6A 2FMYA 4MV2A 4LBQB<