4BCUA

Satellite tobacco necrosis virus (stnv) virus like particle in complex with the b3 aptamer
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
188
structure length
188
Chain Sequence
RKSATMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAITVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGATAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN
publication title Sequence-Specific, RNA-Protein Interactions Overcome Electrostatic Barriers Preventing Assembly of Satellite Tobacco Necrosis Virus Coat Protein.
pubmed doi rcsb
source organism Tobacco necrosis satellite virus
molecule tags Virus
total genus 53
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03898 TNV_CP Satellite tobacco necrosis virus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bcuA00
3CJIC 5DDJ2 4Q4W3 5C9AC 2RS32 4RHV2 3VBOA 3HAGA 1HX6A 1PVC3 1AR91 1RUF1 1HXS1 1RUF3 1VB2A 1VBB3 4WM7C 5C8CB 1AR81 1BEV2 1QJY1 2R042 5AC92 1OOPC 1QJY3 1BMV2 1NCRC 1IHMA 2RMU2 4N53C 4CDQB 1PO12 4IV3C 4JGZC 1MQTB 4CEWB 1RUE1 1VBC2 1ZBA1 4FTEA 1AR61 1AR63 2QQPA 4LLFA 1R083 1TMF2 1Z7S1 4CEYB 2HWE2 1HRV2 1QJU2 3CJIA 5ABJB 1QQP2 5C9AA 1MQTC 1MEC1 3NAPA 5L7OC 1D4M1 1MEC3 1EAH2 1D4M3 4YVWB 5BNOC 1VBA2 1C8M3 5FMOS 3J8F2 5C4WC 2FZ2A 1PO21 1VB4A 2RR12 4N53A 4CDXB 5ACA2 4JGZA 5D8AC 1TME1 1FMD2 4RS5B 1TME3 2R072 2MEV3 2PLV1 4RQPC 2PLV3 1PGW2 2HWB2 1X36A 1NCQC 1RUI1 3VBFC 3VBRC 4CDXC 1RUI3 1EV13 1RUH1 5L7OA 4RS5C 3JD72 2HWC2 5BNOA 5K0UA 1FPN1 1AYN2 5C4WA 1FPN3 1RVF2 1VRH2 5GKAC 4GB33 1QJX2 1RUJ2 5DDJ1 1AR72 1HRI2 2RS31 4RHV1 5DDJ3 5D8AA 4YVSC 2RS33 4RHV3 3CJIB 2RS51 2HWF1 4Q4Y2 1PIV2 5C9AB 3NAPB 4RR3A 2HWF3 4RQPA 1BEV1 2R041 2R062 1BEV3 3VBUA 5J98B 2WFF2 2R043 4JGYA 5AC93 1PO11 2RMU3 1NCQA 1PO13 3VBFA 3VBRA 5J96B 4AEDC 3DPRC 1RMU2 1RUG2 1AYM2 1VBC3 1R092 4GH4C 4JGZB 1VBE2 1BBT2 3NAPC 1PVC1 1VBB1 1RUD2 1VBD2 4QPIC 1COV1 1V9U2 1TMF3 1COV3 2HWE1 1HRV1 2BFUS 1QJU1 2HWE3 4NWWA 1HRV3 1QJU3 1QQP1 2ZZQA 3JB4C 3VDDA 1QQP3 4YVSA 1EAH3 5L7OB 1VBA1 2WS92 3J8F1 1VBA3 1HQNA 3J8F3 2XPJA 1ZBE2 5BNOB 5K0UB 2RM22 5FMOL 2RR13 5C4WB 1R081 2XBO2 5ACA1 1K5MA 1FMD1 5ACA3 4CDUC 1POV1 4AEDA 3DPRA 1FMD3 1POV3 2R071 3FBMA 2R073 4GH4A 1F2NA 5D8AB 1OHFA 2WLPA 3ZFEC 4QPGA 4RR3B 4RQPB 2X5IA 4QPIA 2HWB3 2HWD1 1C8M1 5K0UC 3VBUB 2HWD3 1B35C 1ND2B 1ND3C 1W39A 4JGYB 4Y4YA 1AR92 1ASJ2 3JD71 5FOJB 1HXS2 1NCQB 1VAKA 3VBRB 3VBFB 1AUYA 3JD73 1AR82 2HWC1 3ZFGA 2HWC3 4BCUA 5CFCC 1AYN1 2MEV1 3S6PA 1AYN3 1OPOA 1RVF1 1VRH1 1CD3G 1NY72 4RR3C 1R1A2 1RVF3 1VRH3 3TN92 1QJX1 1RUJ1 2Y26A 1QJX3 3VBUC 1CJDA 1RUE2 1RUJ3 1ND2C 4JGYC 1AR73 1HRI3 4CDUA 1X33A 1ZBA2 2BUKA 4EJRA 1EV11 3VDDB 4Q4Y3 1PIV3 4YVSB 3ZFEA 1NA1A 1PGL2 1Z7S2 2R061 2WFF1 2BPA2 2R063 2WFF3 1F8VA 4GMP1 4GMP3 3JB8A 1B35A 1ND3A 1RMU1 1RUG1 1D4M2 4CDWA 4GB31 4NWVA 1RMU3 1RUG3 1C8NA 4FSJA 1AYM3 4Q4V2 5A33A 1K5MB 1VBE1 1R093 1BBT1 4AEDB 3DPRB 1VBE3 3VDDC 1BBT3 1QJZA 1H8TA 1PO22 1A6CA 5CFCA 4GH4B 1RUD1 1VBD1 5CFDC 1RUD3 1NOVA 1VBD3 1FOD2 1V9U3 4N43A 4QPGB 3VBHA 2X5IB 4QPIB 5AC91 1BMV1 1ND2A 2RMU1 2BFUL 2DF7A 3JBG2 1K5MC 2TBVA 2WS91 1POV0 1VBC1 2WS93 3ZFGB 2RM23 1AL22 4QPGC 2XBO1 1RUH2 2XBO3 1TMF1 2X5IC 2RS12 4CDUB 1RUC2 5BNNC 4PDWB 1EAH1 5CFDA 2WZR2 3ZFEB 1NA1B 3ZFGC 5BNPA 4SBVA 2RR11 1ASJ1 4IV1A 2RS52 1AR93 2HWF2 5A32A 5LK7B 1ASJ3 1HXS3 1B35B 1ND3B 2BBVA 3ZFFA 4CDWB 1AR83 5A33B 4PDWC 3LOBA 5JZGA 1NY71 1H8TB 1R1A1 3TN91 4Q4X2 5CFCB 1GFF2 1NA1C 1R1A3 3TN93 1PGW1 1RHI2 4FTBA 2HWB1 4N43B 1RUE3 2VQ0A 4GMP0 4Q4W2 3VBHB 1ZBA3 2ZAHA 1PVC2 5C8CC 4CDWC 1RUF2 1VBB2 1PGL1 5BNNA 1COV2 2GH8A 1Z7S3 3VBSA 1NG0A 4CDQC 4WM8A 1H8TC 1QJY2 4CEWC 4N43C 4Q4V1 4WM7A 3VBHC 4Q4V3 1WCDJ 1AR71 1HRI1 2WWSA 1OOPA 1PO23 1NCRA 1AR62 4FTSA 4PDWA 4Q4Y1 1E57A 1PIV1 4RFT0 4CEYC 1FOD1 1R082 4IV3A 1FOD3 5ABJC 1DDLA 5CFDB 1RB8G 5BNPB 3VBOB 2IZWA 4YVWC 3JBG1 3ZXAC 1MEC2 3JBG3 4IV1B 5C8CA 5A32B 4Z92B 1AYM1 2ZTNA 3ZFFB 1R091 2GSYA 2HWD2 1C8M2 4CDQA 1AL21 3M8LA 5JZGB 1AL23 1SMVA 1MQTA 1RUH3 1V9U1 4CEWA 5BNPC 1AL0G 3VBOC 1TME2 2RS11 1RUC1 2MEV2 2RS13 4IV1C 1RUC3 4Y5Z0 2PLV2 3ZFFC 2WZR1 5BNNB 4CEYA 2WZR3 3VBSB 5ABJA 5JZGC 1ZBE1 3IDEA 4WM8B 1ZBE3 2RM21 1RUI2 1EV12 2RS53 4YVWA 4WM7B 1M06G 4Q4X1 1OOPB 1FPN2 1NCRB 4Q4X3 1RHI1 4CDXA 4N53B 4GB32 1RHI3 3VBSC 2FZ1A 4RS5A 4IV3B 4WM8C 4Q4W1
chains in the Genus database with same CATH superfamily
4FFHA 4IL7A 4I30A 4YRDA 4MGSA 3AKRA 1DF0A 4Q4W3 4UWDA 5DDJ2 3VDCA 4NIAA 5IVBA 1I9RA 5FPBA 2D6OX 3W5NA 4QMAA 3C7OA 3OF1A 1PVC3 1MS4A 2Q1FA 3JQXA 2CGPA 4G4FA 4XAAA 1VBB3 2CNAA 4W6YA 4XXPA 3ZKUA 5C8CB 4E2GA 4QHZA 1DGWA 5DG1A 5C33A 1S0EA 2VM9A 3WG2A 1QJY1 3AP7A 1WCQA 3IKWA 3KGLA 1QJY3 2KD7A 4LK7A 5IHRA 1PX3A 2WZ8A 4KI5M 2W46A 3VZNA 2KM2A 3D82A 2UURA 2Y6FA 4IV3C 5AVPA 3T09A 4CCOA 1DQ5A 2A71A 4CEWB 2EAKA 5FKBA 1QJFA 1ZZ6A 2YV8A 3I2IA 3HBKA 4KWJA 5L9RA 1DYPA 1ZBA1 4FTEA 1RUNA 1OLME 3P5BA 1DZQA 3PNAA 4Q1PA 5FZKA 2EAAA 3IIIA 3AK0A 4A45A 3VKMA 2WL1A 1WLDA 1TMF2 1Z7S1 2ZEXA 1ZVFA 5DUWA 4KBZA 1QJU2 2HLEA 3QBQA 3ES1A 5ABJB 5HV4A 1V6OA 2X05A 1QQP2 1LCLA 2VCBA 1MQTC 3VDAA 5C9AA 2ZZJA 3W9AA 5L7OC 1W03A 1S0BA 4XCBA 4YLZA 4SLIA 4OHWA 5DAPA 3I3DA 4AFDA 4ZZ5A 5I8YA 3GNEA 2BWCA 4LE4A 4YVWB 2WFPA 4BQ4A 5BNOC 1VBA2 4JQRA 3BTAA 1VJ2A 1XJAA 3J8F2 5LW9A 3VL8A 5F5IA 1JODA 4HN0A 4Y22A 5IATA 2RR12 2BWAA 2PHUA 1IPKA 5FXWA 1KFXL 4MHUA 2AREA 4N53A 1AX2A 4EN0A 3QD6A 3TEWA 5FJKA 3PIGA 2RDNA 4FQ4A 3WDUA 2DV9A 4XOGA 4JGZA 3H1YA 1O5LA 2P2KA 5A7OA 1NUKA 4QQ2A 3PUHA 3BUCA 4XMAA 1QIQA 4XW3A 3D3AA 5DZEA 5JI9A 1UIJA 5FZHA 3MV01 5B4XA 1JBCA 3AL6A 4YW1A 4B3NA 4AI9A 1WA4A 2XL9A 3OBAA 1QXJA 5FPAA 2HWB2 3KT1A 1X36A 1RUI1 1ACCA 2DVGA 4U36A 1RUI3 5KHGA 1WD4A 4RN5A 3VKOA 1PM7A 2Q30A 3NSTA 4OMCA 3WV6A 5I91A 3NJVA 4XJ8A 5JXGA 2D6PA 3UKNA 1MPXA 3U11A 2BYVE 2IXIA 4YG0A 4BQ5A 2HWC2 2VBDA 2VQTA 2FDHA 1EP0A 1QKQA 5FK7A 3U10A 1OH4A 1AYN2 1V6NA 2SBAA 4A42A 4TSVA 1W9FA 5JMOA 4OHYA 5K7PA 1PMIA 1LB2A 1JI6A 5HI0A 2X8KA 3WQBA 1D0HA 1QJX2 1WW5A 2BRTA 3OCPA 3VHOA 4AE2A 1UU5A 1RUJ2 4YSFA 2AYHA 1AR72 1AX0A 1HRI2 1PK6A 2O8QA 2VZTA 4RHV1 3SCHA 3NJXA 2JKBA 2VUJA 4Q2FA 4RHV3 5A1AA 1DU3D 1G9FA 4HVQA 5JSPA 3KV5A 4P9WA 1NZIA 3WW4A 4HPKA 1V00A 1LAJA 3FN9A 2VVFA 1BEV1 5T5LA 2IFWA 5F2SA 4AI2A 1Z78A 3POYA 2DVAA 1BEV3 3I8TA 2WT2A 5FMCA 3ZOIA 2OZ6A 2ZJCA 5AC93 3DL3A 5EYYA 3ZYRA 1L7LA 2RMU3 2LS6A 1FYUA 3AYDA 1NCQA 1YUDA 2V4VA 1MZ5A 3BPZA 5T5JA 3RSJA 2A6XA 3VBRA 3CIHA 4CP9A 5IYYA 1GOGA 2Y38A 3DPRC 1QH6A 4U2AA 5FV3A 3WSOA 4E9KA 2WBKA 2ARCA 5FYHA 4IE5A 1LHUA 4QPWA 1R092 2YU2A 4QU1A 4OI2A 1BBT2 4X6QB 2PA7A 4K7JA 1JZ6A 3AP6A 2V4AA 1LESA 3DECA 3AZZA 5A6YA 5JPNB 1UYPA 1Q8PA 1IS4A 1FNZA 4GQ7A 5CB7A 1ZYBA 1QDOA 3MW2A 1SBDA 2ZPXA 2CWMA 1NLQA 2GN7A 3ZO0B 4D3WA 1HRV1 3WNLA 3RMYA 4JKLA 4NWWA 2XJRA 1HRV3 1XNBA 3LPFA 5K8SA 1BVP1 4YWAA 1U5IA 3PMSA 3LEIA 2BGOA 1U5YA 1F15A 2P6HA 1UY3A 3FL7A 2GAUA 1EAH3 5FP8A 5L7OB 2CL2A 2Y6JA 4BK4A 3FLRA 3A23A 2Z2SB 2DURA 1ZNPA 3PHMA 4XDPA 3SISA 3OBTA 3F2ZA 3N9NA 1S1AA 3HQXA 5BNOB 1X8EA 4UT5A 1G6NA 2VMHA 3QOPA 1EUTA 1HW5A 1LOFC 5LBBA 3M3QA 3BTXA 4CDQA 4XHBA 2JDYA 2JB8A 4QX8A 3RWNA 1POV1 4HKLA 4KBBA 3T2PA 2AZ5A 4HBNA 1POV3 1M4WA 1L3JA 1UU6A 2WNVA 3FBMA 3MHZA 2XJSA 2NQYA 4YM2A 3OPWA 4COYA 1LENA 3W21A 2QE3A 1OHFA 2Y6GA 3EBRA 2R7EB 2WKKA 3ZFEC 1PNGA 4CU7A 2VZPA 3I3MA 3EQEA 5GLTA 1AZDA 1C5IA 4CPBD 3VZMA 1H30A 1YHFA 2YY1A 4M01A 3PVNA 4QPIA 4R4ZA 4RGAA 2HWD1 4HXCA 1H2NA 4C1WA 4XQWA 2VUDA 4CSWA 4FSJA 2HWD3 5J1XA 2B9VA 1ND2B 1W39A 5H9QA 1W8WA 4DUWA 4E2QA 2QVSB 2ZHKA 1VAKA 1YLLA 4IEXA 5CG8A 4IEOA 4H14A 4Q0UA 3I2HA 4LJHA 4UI9L 2QQKA 2DYCA 2YZ4A 5FZ1A 1PK6C 2ZX3A 3ZFGA 1YIPA 5KC5A 3FZ3A 2JDPA 4YZ3A 5LRRA 3SEPA 5EIYB 2DTWA 3LSEA 4BIOA 3S6PA 2WINB 5LZ6A 2J42A 1ZZ8A 1DGLA 1R1A2 2I07B 1IPJA 3LIHA 4MO3M 4B8EA 5FR3A 4K1ZA 2W5FA 4I0WB 5LRSA 3SHRA 2ZX0A 2VU9A 3I4IA 2ZMNA 3J26N 1UKGA 2QBXA 1X33A 1ZBA2 2OX0A 4NR1A 3ZXDA 5F5AA 1UL9A 1G9BA 1LOAA 3LFMA 2H0VA 4BQ2A 3APBA 1JYXA 4GXLA 2X09A 1MVEA 3CU7A 4N90A 1YNAA 5L19A 1Z7S2 2R061 3CQOA 4ATFA 2VL4A 1I3HA 2R063 4AYUA 3MIHA 3IN9A 4GMP1 3FHQA 4O9EA 2YDEA 1DQ1A 2VULA 2XMLA 4GMP3 2PHLA 3GM8A 5E6HA 1A3KA 4DY3A 2A6ZA 3JB8A 1ND3A 3T4VA 1LRHA 1Y3TA 3MDPA 4GULA 4LULA 3SNMA 3WQ1A 4GB31 4EE2A 3J4UH 1UOGA 2IXKA 4CYDA 4LNVA 4DOUA 1X8MA 2WSUA 1W06A 4WVZA 2XL7A 3DPRB 2IWGB 4BZ4A 4TN7A 3FLTA 2PHFA 4LBQA 1QJZA 1ZM1A 4MG2A 5EZWA 1LR5A 2BNMA 2D40A 5CFCA 1RUD1 1N1SA 3KCCA 3RG0A 4D69A 5FZFA 1RUD3 1NOVA 2PHDA 3OBZA 3TEYA 2VW0A 1V9U3 4QPGB 1WW7A 2A75A 4XQ4A 4JQTA 1W6MB 2F17A 4S2HA 4OI1A 2D6LX 2VXJA 3TBDA 4NPRA 1YEWA 1W2UA 2Y0OA 4MOAA 3LA7A 1W28A 2WNUA 1K42A 1P8JA 3ZKYA 2CV6A 5HXVA 3WNKA 2V5DA 3B01A 3KLSA 1GNZA 4E4HA 5L9VA 2ILMA 4ZXKA 3WHTA 1IG0A 2IC1A 4TXWA 4OCTA 1NXMA 1VBC1 2WNVC 1GLHA 3CNAA 5BY5A 3AX4A 4I0AA 1HB4A 3BI3A 3KB5A 2R0FA 4QGNA 5FY8A 2Y6HA 1H8VA 1AL22 1NLRA 1WCUA 3PURA 4AVBA 5H9RA 3PDQA 4FFGA 2VZUA 2JG9A 4M4PA 2E26A 2ARAA 3AZXA 4IEVA 4LMFA 4AVAA 3J7HA 2W95A 1FXZA 5DUUA 1DGRN 3MO4A 4COZA 2J7MA 4FP2A 5TSWA 2DFBA 1JXNA 2ADEA 5E88A 1KD7A 5FYSA 3RGBA 1JYIA 5A7NA 1VP6A 3M4FA 4AGVA 4MADA 3IMMA 4PCRA 3WW2A 4XJZA 4FI9A 4LR4A 2XG3A 2XQXA 2E31A 3SCGA 5FO8B 1XE0A 2WZR2 3ZFEB 1NA1B 3ZFGC 1UYXA 1VR3A 3WCSA 3WF0A 4Y1XA 5FZ8A 4IGQA 3WY6A 2W47A 5IVCA 5A7PA 1ASJ1 1ODNA 3EJKA 1AR93 1UNBA 1ASJ3 4CP2A 1HXS3 5FY9A 4MYEA 1JZ4A 1DCSA 3U78A 1AR83 3NVCA 4ORFA 5A33B 5C3QA 1G9CA 1OD3A 4MGTA 1Q8QA 4B4RA 4A6OA 4S2DA 4P9GA 1O3RA 3DV8A 3WD5A 5F2WA 1SFNA 3WX5A 2GDFA 3TN91 5HCAA 2A5ZA 4LXLA 4XYXA 3B02A 4BPZA 3TN93 4G3YC 1PGW1 1OD5A 4Q0VA 1RHI2 2V73A 3SCFA 3POWA 1T6GC 1CJPA 4XJ9A 4CUCA 1R64A 5FY7A 1ZRCA 4O61A 1CZSA 2RDSA 4WVMA 1OQ1A 4OYUA 1VALA 3VZKA 3VBHB 1LECA 1XXNA 1GP5A 1TNFA 3A0KA 3HNYM 3IIAA 3MLLA 4JV4A 5A3UA 3T2OA 5JXHA 4EZHA 3ZXJA 1RTVA 3KT7A 5BNNA 4D7TA 5F3CA 5J09A 1OKQA 4Y3OA 4NOTA 1RXFA 4Z2WA 1XNCA 2WNEA 2WA4A 4FOWA 5FP4A 3CHXA 3H8RA 2Y64A 2LROA 1DZRA 2G9GA 1UAIA 3QCWA 3WVJA 2HYKA 2VZ3A 1W9TA 2VO5A 3KM5A 4LLOA 1VLNA 1S0FA 4EWEA 4M3CB 4Q4V1 3A4UA 4WM7A 5A3OA 2VY0A 2EICA 4Q4V3 5BNQA 4AF9A 1TQ5A 1K12A 3B5LB 2K9ZA 1IQDC 3PUAA 4WZCA 1UY0A 2J1UA 1OOPA 1NCRA 3L2YA 1AR62 4I01A 4PDWA 1H6XA 1GZ9A 1PIV1 4P9IA 4YG3A 1DYOA 5I8TA 3LOIA 4IE6A 1FOD1 2HEVF 2VOKA 4AWDA 4I09A 3TEXA 4TTGA 3A22A 3B7MA 1FOD3 3P6BA 2QQWA 4LKEA 2QQVA 1F31A 4IEQA 5DAXA 3SXWA 4ASKA 4NHXA 2FQPA 4I0BA 5BNPB 1W8OA 2J22A 3FUQA 2VXRA 2P3IA 2PAMA 4XDQA 2YROA 4JVAA 3QH7A 4IV1B 5C8CA 1K45A 4LORA 1LGCA 5I0DA 4Z92B 1J1TA 1AYM1 2BVVA 4MX3A 3ES4A 2FHRA 3VHNA 3ZFFB 3CEWA 1Q8SA 2HWD2 1XC6A 2QUOA 2C24A 4A2UA 4DXZA 1OSGA 2VH9A 4XF9A 5JZGB 5H9SA 1RUH3 5FJHA 4CEWA 3GALA 1HIXA 1F4AA 5DZFA 1N1TA 3M1HA 4C90A 3CMGA 3OGJA 3RFRA 4LO7A 1UMIA 4CCLA 1U5XA 1UOFA 4Y5Z0 1KS5A 3V0BB 3JXSA 3HPNA 3J7LA 4JX0A 1GZWB 5GM0A 3RYPA 3FWEA 2DCTA 1CAVA 4MXVA 4UFKA 2AACA 3M70A 4XJWA 2J1TA 5DZGA 5ABJA 3IDEA 3U4XA 4XF3A 2CGOA 2RM21 4QX3A 3ZXLA 4GWJA 4OMDA 1YO8A 5IJRA 1WLTA 4CU6A 1LTEA 2RS53 2DCJA 3UT0A 4DPNA 3TRSB 5FPVA 2ZGTA 2V5YA 4YVWA 2WZPP 5A7WB 4CCCA 1A34A 3B9IA 3TB0A 4PHZA 2OKXA 2R16A 1ZRRA 2DBNA 1JOBA 5DAWA 4BIFA 1M06G 1LOBA 1H6YA 1SLLA 4YW7A 3RS6A 1FPN2 4OI0A 2A1XA 2UWCA 4QB6A 5FBJA 5ANQA 4GB32 1XOYA 5FZOB 2CHHA 1I5PA 3VHPA 3KT4A 5A7SA 2OVUA 1SLAA 4EN7B 4XIOA 1W8ZA 4UW6A 2RS32 3D0JA 3GZUC 1YFUA 1TNRA 3USUA 3VBOA 3WDXA 2R1DA 3HAGA 4BE3A 4BQXA 1QEXA 2P5BA 2P6CA 3JZVA 1C1FA 3IMNA 2D6NA 2VAUA 1UZZA 3DGTA 4WM7C 2FCUA 3NNLA 1GWKA 1WA6X 2W92A 2VZSA 1ULFA 1DFQA 1NYWA 2ZHMA 3H3LA 2R042 2CAUA 5DUVA 4CU8A 1OOPC 1UY4A 2YMZA 1NCRC 2AEZA 1IHMA 3HNMA 4FQZA 2J1AA 3K77A 1SLTA 3LF7A 3PU8A 5G05L 3T08A 4FOYA 2PELA 3N7KA 2GP3A 4XFHA 5JR2A 2A6WA 4XACA 3D6EA 1RUE1 1VBC2 3ZIXA 2ARBA 3WF1A 5JOWA 5CKMA 5FOBB 2OQ6A 4MSVA 4AEMA 4ATEA 1ULEA 1SLCA 3RZHA 4HKWA 4V2VA 1DYKA 1HDKA 2J1SA 1RC6A 2B45X 2WUHA 3HBZA 4XMIA 2VC9A 4HOOA 1XB9A 4LLFA 4K8RB 1TVGA 2J1VA 4W6WA 1Q8VA 1AXYA 4FAGA 1W6QB 4JRLA 3MLKA 1GV9A 3SQOA 4ET7A 3AMPA 2HWE2 5T55A 4Q5OA 1CX4A 5FLHA 1UYZA 3H7YA 3HN1A 3U75A 1MEC1 1W6NB 4NIIA 1MEC3 3KV6A 4QX0A 4KH9A 4YGEA 3IM0A 1VMHA 5FTTC 4CVUA 2CAVA 1O91A 1C8M3 1ENSA 5F3IA 1Q3EA 4OQ9A 2VTXJ 1PO21 3OY8B 1BKZA 4INDA 2JENA 1OLMA 3GYDA 3IT8A 4QKFA 1ZA7A 1YI7A 3C7GA 1IZ3A 3MPBA 5FQ0B 5C3PA 4UAPA 4XUNA 3HVDA 4QPYA 2QCSB 2A7AA 5D8AC 1FMD2 1W04A 4RS5B 2Q8OA 1JHJA 2QQLA 4KWLA 3FJSA 2R072 5JAXA 3LSDA 4NUBA 5KR7A 1GP4A 2MEV3 5IFPA 2PLV1 2ZX4A 3PMEA 2OYZA 3HR9A 4GAZA 2ORZA 2PLV3 5FRAA 3GJAA 1UD1A 1PGW2 2JDAA 5L9BA 1ODMA 2FBEA 2I2SA 4QHBA 4S2GA 3LD8A 3TOJA 4PIZA 5FPLA 2OXBA 1OPMA 1J58A 1W9YA 1GU3A 2YBKA 3ZN4A 4AXOA 4NIDA 3ZXFA 5FPZA 1BYHA 2W08A 4IEYA 5IVJA 4XFCA 4YGCA 3W58A 5J3UA 5L7OA 4QX1A 2B9UA 2BEOA 2ERFA 3SKJE 5CADA 2W2IA 3ZSEA 2O1QA 2QKDA 3NKTA 4URTA 3GF6A 2GNDA 2VNVA 3R4UA 4UFHA 5BNOA 3H50A 2F4LA 1EUUA 3K4AA 1UW8A 3N9PA 4H7LA 4ASMB 3BVCA 3NW4A 3LB9A 2A3XA 3GCWA 4LOSA 3K51A 4A4AA 1Z0HA 1Q5OA 1JYCA 1RVF2 1VRH2 4Q0PA 5GKAC 4EN8B 3AMQA 3WINE 4FPHA 3HQUA 4YM3A 1CVNA 4DEQA 5EHDA 1W6OB 3OUHA 1KJRA 2OW4A 2V09A 3Q8BA 4WVWA 1V6LA 3HT1A 3VN4A 4YVSC 5I93A 1QWRA 4XF1A 5KBFA 1YRZA 4XFGA 1LHWA 1PIV2 3NAPB 4LIVA 2K46A 3AZWA 2PHTA 3H42B 5IVVA 1O4YA 2W1WA 4HANA 5LCWL 2VCAA 3RI8A 3GHMA 1WD3A 4KGQA 1OA4A 5J98B 2WFF2 3T2TA 3BU0A 4YGBA 1H1AA 2GU9A 1MZEA 4R9AA 3WUDA 4AR2A 4FP3A 1PO11 1NKGA 1Q8OA 5FY1A 4KWKA 4UYBA 1OC1A 1PO13 2PAEA 5D21A 3PUIA 4FOVA 4ZU5A 5B2GB 5HV0A 5J96B 4QQHA 3VZOA 4E2SA 5HCHA 1AYM2 3W59A 5FYZA 4GH4C 4RA0A 3ITQA 3NL1A 1OQEA 3MIFA 4NIGA 2WO1A 1HQLA 1S0JA 2R49A 1PVC1 2EXIA 2PQQA 1O3SA 1QOTA 1VBB1 3U14A 3PUSA 1VBD2 2O0OA 2WQ4A 3I2FA 3ILRA 3WP6A 4ZU7A 5CKQA 5F37A 2JDKA 2PAKA 4N9HA 5LA0A 4P9YA 1WLWA 1Y7BA 1JW6A 4FPEA 3X29B 4MZUA 1C4RA 3HNBM 3M3EA 4RSUA 4KGGA 3UGGA 1RITA 2ZBJA 2ZZQA 5FXZA 1S4CA 1JYWA 4COWA 5JSRA 1N3PA 1JZ7A 1QGLA 5LATA 1OVPA 4MXWB 3ZYPA 3TYJA 3K3OA 3MBWA 3S5AA 1W6PB 2Y8KA 2WS92 2ZA9A 3GCXA 4JHZA 3UKTA 2ZGKA 4Y20B 4R9CA 1FT9A 1IOAA 5K0UB 5AFBA 2RM22 4KNCA 1TE1B 2RDRA 5AFEA 4AI1A 3RMXA 4OQ8A 3MZHA 2P4EA 2XBO2 2AEYA 5DQ0A 5ACA1 4NAMA 1ULDA 2HJIA 2BQPA 2LALA 5ACA3 4CDUC 3MICA 3DPRA 4QX7A 4L11A 3KQRA 4Y1YA 5DAQA 3INAA 3MW3A 4CPBA 4MH0E 5GZDA 4LKSA 2XJUA 4FPLA 5D8AB 2WAAA 4NE9A 2WLPA 5JLVA 3VD4A 4QPGA 4EYUA 2WO2A 4EWAA 3CDZB 4RR3B 2PMWB 1BXHA 3PTRB 2ZGUA 2Q8CA 2JEMA 3T0AA 1AJKA 1LU2A 1OFNA 4XC9A 4H7MA 1LODA 1OUXA 4EQVA 1BK1A 3WF3A 4Z82A 1G7YA 2LUWA 4KQ7A 4JGYB 3MLJA 5JOXA 4ASLA 2BV4A 5J37A 4NHLA 2BVBA 1I5ZA 3JD71 1AUYA 2F6BA 3JD73 4IERA 4LO4B 3OGVA 5E16A 4Y4RA 1O8PA 2JX9A 1RL3A 2GMPA 1GSLA 2B42B 2H6BA 5I0UA 1OPOA 1VPHA 4E4ZA 1CD3G 5A3LA 1SHWB 3OJBA 4P14A 3AYAA 3FX3A 5JUVA 2IFRA 3I2KA 1LOFA 1YFXA 4UFLA 4B1MA 2XJPA 2Y26A 1BCXA 5GZCA 2R30A 1CJDA 1RUE2 4UF0B 3K3NA 1ND2C 3IAPA 5T3NA 2EIDA 1J84A 4P00B 4K40A 2NLRA 2EXJA 3OGRA 1QJEA 3BPSA 2W39A 1X9PA 2YYOA 2XVKA 1NE4A 1US2A 4JRAA 2DUOA 3OEBA 4EJRA 2GALA 4C0HA 4Q4Y3 1SPPB 4YVSB 1V0AA 4DIQA 4JTOA 1NA1A 4R52A 3ZFEA 1PGL2 4XFFA 2BPA2 1NT0A 4LO6B 1QOOA 2OZJA 1PM4A 1S2EA 2E7TA 5KWRA 1UXZA 2WQZC 4XDOA 1RMU1 1RUG1 1TEIA 4PIXA 1FATA 4O65A 4MGZE 3RVHA 1RMU3 1RUG3 3OOXA 4XURA 3VB9A 4XQDA 4AAXA 5FPUA 1JZ3A 4OHVA 5A33A 4XE9A 1VBE1 3DXTA 3ETPA 4RGKA 4V2WA 1VBE3 5I0RA 5M0TA 1PO22 1C57A 5JIUA 1CQ9A 5EYXA 4ES9A 4GH4B 2CYFA 3VZJA 4DRVA 5CFDC 1UMZA 4NROA 2ZGNA 5E1RA 2JKXA 3WP4A 4AHYA 1SBFA 3VBHA 1RGSA 1O7FA 4Z1VA 5AC91 2E63A 2WAOA 4NMIA 4DXTA 1PZ7A 4IEWA 2FCTA 2P17A 3U0ZA 4CXYA 2RMU1 4UBHA 3Q8CA 2BP6A 2E7QA 2VOWA 4FPFA 1EYBA 3JBG2 3HQRA 3I49A 4BXFA 1MZFA 2X53S 4OHZA 5EQUA 1POV0 1A8DA 1CIWA 4FPCA 1ZRFA 4I3GA 4AHZA 4WZFA 2EXHA 2YGMA 1G86A 3W20A 3USSA 1ZRIA 4QPGC 4Y1ZA 4XFAA 3ZMOA 5FY0A 5FO9B 4CRQA 1RIRA 4J1WA 1ZX5A 3S7IA 1XNTA 4NRPA 5LA9A 1JH5A 1O5UA 4A7YA 3N36A 3ZPYA 4DRRA 4Z2AA 5E89A 1Y9MA 5FAXA 2RS12 1V70A 1YJKA 2Z69A 1RUC2 4XXAA 4CDUB 2MNGA 4FXGB 2W0XA 4BISA 3AMNA 1W3VA 2G19A 3D0SA 1EAH1 2CY6A 3WDWA 2Q1MA 1CZTA 4QGLA 5BNPA 1SDDB 1DZTA 2VTXA 5G04L 1QU0A 1PNFA 2UYAA 4PI2A 4IV1A 5FZCA 3Q9OA 3RPQA 3T30A 4IDZA 2GP5A 3L9JT 3ZFFA 5BV6A 3WXPA 1KEXA 5A6QA 3ZSJA 5A6ZA 4LKDA 4MV2A 3WDTA 1W0OA 1X7NA 1JOJA 1H0BA 2JECA 2WRAA 4IXLA 5LK5A 5JZGA 3LOBA 1NY71 1H8TB 3ACLA 1JUHA 4Q4X2 1NXD1 3WNXA 1NA1C 4AFMA 3AFGA 2RV9A 5CZKA 3I54A 3ZDVA 3R0RA 4N43B 2ADDA 1OQDA 1U0AA 4AVSA 2VQ0A 3C7EA 4GMP0 4Q4W2 2E33A 4LPLA 1OF3A 2WN2A 1WMXA 3N9QA 1GZWA 1XE8A 2ZAHA 1PVC2 2P3KA 2PTMA 3H3UA 4LBJA 4EN9B 4EROA 4YM0A 1VBB2 2PYTA 3AVSA 5GLVA 2VBBA 5FUIA 2VNGA 3T1LA 4AQ6A 4CUBA 3VD9A 3AKSA 3KZ4C 4ZXEA 2GH8A 4QDRA 2LTNA 2QTWB 1N1YA 1WWYA 3OUJA 1WGPA 3UKVA 5EXOA 1WBFA 1XBFA 4BHPA 1QJY2 1W0PA 2W1SA 5EP9A 5IW0A 5K9YA 2GMEA 4P9JA 3DF0A 4QAWA 4ZPIA 3ORJA 5FZDA 3I2OA 3ETQA 4JTNA 3OSDA 5A7WA 4QHOA 4DMIA 2RJKA 2WLQA 3PVBB 3U1XA 3SH5A 3POEA 1H2KA 3CJXA 3E5UA 3VBHC 4BLJA 3RZLA 2VGDA 1MACA 4GALA 1JUIA 3LDBA 2YC4A 5JOZA 4N7UA 4FTSA 4QM8A 4DO0A 1O3QA 4AHXA 1N47A 4CEYC 5FO7B 5FZOA 5I0TA 4F8AA 5LWBA 3ZYIB 3GBGA 4JCKA 2WT1A 1MR5A 3GBWA 5IK4A 5CFDB 4URAA 1DDLA 4XTMA 2AH2A 4CCNA 2FDGA 3NJYA 1C1LA 5CAZA 3H3ZA 1BVVA 4XBNA 4XEZA 4UW4A 1E5HA 2Q8DA 3T0BA 3WG4A 3ZXAC 3IZOA 4PF5A 4LITA 5A32B 4FAHA 2VQAA 3AMHA 3K48A 4K3UA 4Z07A 1UPSA 1RUOA 3WG3A 1W8NA 2RJLA 1JN2P 2EA7A 3O1OA 3GGLA 2HBTA 5FZBA 1SMVA 4M3CE 2OS2A 1HB3A 1KRIA 3BN6A 1V9U1 2VZVA 4W8JA 5A3TA 5BNPC 4CCKA 1DGRA 4BMEA 1PGSA 1UU4A 2QQMA 1QOSA 4XBQA 3KHCA 5JXJA 5FYCA 4IV1C 3B3QE 1GQPA 3BIWE 1CR7A 3N7JA 1GANA 3GJBA 3ZFFC 1W6QA 2C1FA 1GOFA 1W2OA 4LHLA 4TLFA 1ENRA 4YNIA 4ZU4A 2BBAA 1UN1A 3RZKA 3FC0A 3EYPA 4NAOA 4BQ3A 3PL0A 3VBSB 5JZGC 1ZBE1 5SV5A 4WM8B 2ZACA 3KD4A 3H7JA 2ZAAA 1W6NA 1HN0A 4Q29A 1ZBE3 2WN3A 1RUI2 4YZ2A 2R32A 3T3YA 4Q26A 5EJZB 4MGQA 4AZZA 4GJYA 2Z5WA 4OUEA 2RVAA 2DU0A 3UL2A 3OY8A 1DP0A 1MS3A 2MHFA 1ENXA 2WJSA 1V6IA 4LEJA 1XU2A 1I6XA 2LM3A 2XLFA 3NNJA 3O1TA 5EWSA 2B39A 2W1UA 2QDNA 2ZGQA 5B4NA 5F3GA 4N53B 4DQAA 5FQ0A 2C4XA 2W91A 2QQUA 5CIRA 2EIBA 2FZ1A 4RS5A 4JKMA 4AVTA 3CJIC 4AQSA 2WWJA 4QWNA 4YGDA 4NRMA 4RHV2 4PBOA 5FY5A 4ISQA 4Q0QA 4XBLA 4AQ2A 1RUF1 5FYYA 1AR91 4RYDA 3B93A 1OLRA 1HXS1 1RUF3 4DXSA 3OB8A 1OXCA 2JWPA 1XNKA 5LEJA 1AR81 2ZX2A 1BEV2 3MUY1 4UOJA 4LBNA 2DCZA 3AP9A 2VOVA 3RJ2X 3VD5A 4AW7A 5AC92 3O1SA 3S5QA 2UWBA 1UQXA 3ZXGA 2RMU2 3WHUA 1GNHA 2IXJA 2BERA 2VZOA 1AX1A 4LO5B 1ZZBA 5FZMA 1AVBA 3AP4A 3BODA 4JDMA 3LCPA 5JIAA 4ARXA 5A70A 1A8MA 1JZ8A 1O3TA 2GNTA 3SH4A 1REDA 3CF6E 3RZMA 3PIJA 1CONA 1W90A 2Y34A 2VUAA 1W99A 5CYYA 1W0NA 3ROUA 3VZLA 5T54A 4XILA 1JHNA 2QQPA 1CAWB 2FMDA 5A80A 3ZSLA 4AGRA 2VNRA 4BU2A 1R083 1ST8A 4ZZ8A 4XZUG 1W6OA 2Q5TA 4P9LA 5BXXA 1FV3A 3UETA 5JOYA 2XWJB 5DUXA 1XU1A 4LTAA 4CEYB 1LEDA 5KHKA 3WT3A 2EIEA 3WOGA 2JE8A 3AKTA 1BK0A 1HRV2 1WKYA 1WMFA 3VD3A 2Z79A 1CAUB 2RG4A 3ZVXA 4A3ZA 3NAPA 2NN8A 2ZX1A 3QLQA 2ET1A 2XHNA 4M0HA 4CTEA 5GZGA 2OPWA 3RYKA 4HONA 4M3CF 1EAH2 3UGHA 4DS0A 3SEEA 1JYVA 2Q8EA 2CSGA 1LULA 2N7GA 3P3NA 1JS9A 3N9OA 4JZRA 5FMOS 4XJUA 5C4WC 2FZ2A 3IWZA 3ZM8A 2J1RA 2D6MA 2K2SA 3I2JA 4H3WA 1UO9A 3O0WA 1DQ6A 1O4TA 2R0HA 3VKLA 3CL1A 3I3QA 4CDXB 3T1MA 4B7KA 1H9WA 3LDKA 3NKGA 3OUIA 1TME1 3D4KA 2RHPA 3CBNA 2ZGOA 4DUXA 2XJTA 1TME3 5FZ4A 1PVXA 2JB4A 3ZMNA 4DXRA 5FYVA 2YG0A 2W52A 2X10A 4UW5A 3AYEA 2W9XA 3PVEA 4RQPC 1O4ZA 2H6CA 3KS7A 2ATFA 4QXKA 5FCCA 4F7ZA 3EXUA 1GBGA 4AFCA 3HIFA 3ZN5A 2B7YA 2LW8A 4YM1A 4HLTA 5C70A 3V0AB 1SLIA 2K0GA 3RJRA 3VBFC 2Y33A 4D6QA 4HSJA 1EV13 5IT6A 4HFSA 1RUH1 4MXWA 5LBEA 4B1LA 4RS5C 1C3HA 1W6PA 1S2KA 5FBZA 3P3PA 5LY1A 4PJYA 4Y20A 4X8PA 5C8WA 2ZHLA 3FUOA 4FPKA 5K0UA 4CA9A 2G9ZA 1QHDA 5F9TA 5HCFA 1GZCA 2IUWA 2OIIA 1TG7A 3MW4A 3MF6A 1QMJA 1L7RA 3UV9A 1N3OA 2PN5A 3UGFA 4PLNA 4YARA 2TEPA 5DDJ1 4KU7A 4LE3A 3AYCA 1GWMA 1POQA 3P1IA 4QDSA 3KF5A 5DDJ3 1BJQA 5D8AA 4FCAA 3WCRA 2XKOA 3CJIB 2RS51 1XPWA 4M00A 4BJ0A 4CP1A 1V6KA 5FUPA 4RR3A 2W68A 1W9WA 3PU3A 5FWEA 4A6SA 5A3MA 2WC2A 3ACFA 1S0IA 2R062 4PF1A 5SV8A 4YZ5A 5GALA 4JGYA 4YZ1A 1VE0A 4TYSA 3IBMA 5LASA 3BKZA 4QX5A 1GICA 2ZS6B 4GJZA 2VOXA 4RD7A 3W5MA 5FYBA 1FNYA 4Y26A 4AEDC 2GNBA 5DN2A 3MUZ1 4FFFA 4BQYA 2PQSA 4WBBA 4AFAA 5J36A 1ALYA 4D6SA 2PXJA 1Y9QA 3FE5A 4ZY9A 2GC1A 4GWMA 1OI6A 3IDAA 1ULOA 2D93A 3NAPC 3OBRA 4Y5SA 1LU1A 5CU1A 4OZOA 1SLBA 4ES8A 2ZHNA 3A0NA 1RUD2 2QZ3A 3ABZA 3CKHA 1K3IA 1KJLA 4XF4A 5F3EA 4OUSA 1COV1 1V9U2 1YWKA 4UF0A 1ZRDA 1TMF3 3LQCA 3FLPA 1COV3 3M3IA 2BFUS 1QJU1 4L8QA 4XCAA 2A73B 2Y6LA 5EJ3A 1QJU3 1QQP1 4XETA 1UF2C 4PBPA 1DGWX 1QQP3 1SPPA 2JXAA 4YVSA 3N35A 4L2NA 1MS0A 1XSQA 4L97A 4OLLA 4LHNA 4R8HA 2VCMA 1VBA1 2ZOEB 5GLUA 4WV8A 5ERLA 1F35A 2YPDA 3J8F1 2OUHA 1VBA3 3WEZA 1SCSA 4D0QA 4DEVA 2KA3A 1EPWA 3E1F1 3J8F3 1ZBE2 4YG6A 1Y43B 3HD8B 1W3XA 3WR0A 2JE9A 3RZZA 4XTPA 2RR13 1MS8A 2CGNA 2YUEA 3V65A 3DYMA 4EV0A 1VIWB 5C4WB 1CESA 3D5OA 4LA3A 2YC2A 4K6BA 1SG3A 4V1PA 3THTA 4BOWA 1KQRA 3GZEA 5ISLA 1CN1A 4GA9A 1CX1A 4ZKTB 1UX7A 4LT5A 4GH4A 2VW1A 1F2NA 3ENRA 2JG8C 5T5PA 1S0CA 4CCJA 4QU2A 2RDQA 2W3JA 1H1MA 5L73A 5LEKA 3IDBB 5CISA 3RZGA 5F32A 3O1RA 4RQPB 1UOJA 4XUPA 3O1PA 1N3QA 2HWB3 1SFPA 1C8M1 1CAXB 5K0UC 5IAVA 2D44A 3VBUB 1G9AA 1PMJX 1B35C 2XKPA 4ITCA 4Y4YA 2YXSA 1AR92 4KU8A 2YFZA 4PLOA 5JXIA 1ASJ2 1HXS2 2ENRA 2QQOA 3VBFB 1WCSA 4R9DA 2ZABA 5CBLA 5J48A 3LA3A 1AR82 2HWC1 4O9GA 1D0GA 3M3OA 2HWC3 4D94A 2DUQA 4BCUA 1ZZ9A 1AYN1 2MEV1 3EHKA 1REFA 1STMA 1AYN3 2OQ7A 3SLIA 5DABA 4RR3C 2VR4A 5DMYA 1IKPA 1IPSA 1LKNA 1N1VA 2IXLA 4OFGA 1QJX1 4UW3A 3TN92 3BIEA 4UFMA 1RUJ1 4CZSA 1OA3A 1QJX3 1NE6A 1QDCA 3ZN6B 1MS9A 5JVVA 1FI2A 1RUJ3 2WNOA 1GQGA 3OD4A 1SCRA 1AR73 4JGYC 1HRI3 2D7FA 3KVAA 5FP7A 4XABA 4BQ1A 5APAA 4IE0A 4CDUA 5CG9A 1JZ2A 2GZWA 3FHAA 1GOHA 4C8DA 2BOJA 1WBLA 4GIQA 3VDDB 2DVFA 1GMMA 2ZEZA 1A78A 2A6YA 5FZIA 3ZSKA 2IXCA 4AFBA 4NO4A 2XLAA 5A1LA 1URXA 1S0DA 3TEZA 2UU8A 1F8VA 4OVEA 3Q8FA 1OH3A 1US3A 1WW4A 1LJ7A 2BU9A 5IUQA 4NRQA 3MYXA 3LEGA 1MS5A 2E6VA 2UY8A 4AI3A 3ME2A 3POJA 4Q4V2 5ANNA 1G8WA 1K5MB 1R093 1BBT1 3AB0A 3FHIB 1QY4A 3ECQA 4AEDB 4CCEA 1BBT3 4ARYA 1H8TA 2OPKA 3FBYA 1A6CA 3S7EA 1T2XA 4AVVA 4QKDA 3WQ7A 1OT5A 4IE4A 5C3RA 4IGPA 3ACIA 3A7QA 2GNMA 5F6KA 3JQWA 1ULGA 1FOD2 4N43A 3AZYA 3KWVA 3NNGA 1WZXA 1F5FA 2X5IB 1F9KA 3TNQA 1BMV1 1ND2A 2AGSA 4KG0A 4HSLA 2YGLA 3ATGA 3I7DA 2UY9A 3MI8A 4DINB 3GXUA 3MIGA 5A3PA 2XR4A 1CWPA 2NPIA 1W8TA 3HEIA 1OBNA 2BZDA 2KXLA 4META 1OF4A 4YZ4A 3OYWB 5A3WA 2D43A 1BQPA 5KXDA 3C2UA 4BQWA 2QQJA 2P34A 2Y6KA 1W9SA 2YPJA 4S2FA 5FZLA 1QXPA 1RUH2 4YFWA 3DXUA 5FIXA 3E6DA 4WVVA 2WA3A 4I3PA 4BLIA 5BUVA 3MEPA 1GQHA 2A6VA 3E97A 3N9LA 1JMUB 4M4RA 4BMBA 2FDIA 5HCBA 4BM8A 4D7YA 5KC6A 3VUOA 4QKBA 4PDWB 5FXXA 2A3YA 3O12A 1W8HA 2JG8B 4HT1T 5CFDA 3ZYFA 3T0DA 3FMGA 1GNYA 3F95A 3AL5A 1J59A 1QNWA 1NLSA 4HG6B 5FLIA 4EN6B 3J7NA 3B00A 3WNNA 3AP5A 2DVBA 2RS52 5A32A 1KGYA 4LIUA 5LK7B 1IKQA 4UFIA 4N7IA 1B35B 3THPA 1Q56A 2BBVA 4CDWB 1GP6A 3AKPA 4YW5A 2CDOA 3K75B 4AOCA 3QH6A 3H8OA 2FMYA 1RXGA 5DAVA 4DNYA 4IW3A 4LUKA 2JDMA 4NVPA 2VE1A 3VD7A 1R1A1 4YW3A 4IGOA 2MPFA 5DXDA 1GFF2 1R1A3 4OUMA 1SZBA 3HJRA 4FTBA 4Q4W1 5KHIA 3ZXKA 3AC0A 3CO2A 4LBKA 5D1IA 1W6MA 4HKOA 1OUSA 4P9XA 5CEHA 1SACA 1IS3A 4AQTA 2FDFA 4HZFA 3EB7A 3URFA 5IVEA 1ZBA3 2YBSA 4QXCA 4HMZA 1UXXX 3OEAA 3H9AA 4PIYA 1UZWA 2QQNA 4I2OA 3PJQA 4W4ZA 2XB6C 3LAGA 4RL7A 2DBIA 1COV2 4L92A 4BXSV 1UIKA 1Z7S3 1CGPA 4AI8A 2ZEWA 3HN3A 3VBSA 4CDQC 2WIIB 1CAVB 3UESA 4WM8A 1H8TC 3ALQA 3IDCB 2B46X 4LHKA 5FYTA 4FBFA 1XYOA 4MLOA 3PJYA 3BTZA 1W05A 1SEFA 1BLZA 4N43C 3AJZA 3HT2A 3BGAA 5IVYA 3QACA 4GKXA 2CDPA 2IXHA 4ZHNA 1E5SA 1GUIA 2VTFA 5FK8A 5KXCA 4PQ9A 3K46A 1PHMA 4Q4Y1 5EPAA 1RJ8A 3H8UA 5C71A 3N7LA 4E4SA 5IFTA 1QNYA 3C7FA 3T4HB 2AENA 2Y0IA 2C6SA 4BYYA 3ZXEA 3S0MA 4OI4A 5EV7A 3USUB 3EO6A 3VBOB 3S57A 1UY2A 2IZWA 5DG2A 4CUGA 1MEC2 2BTVC 1UMHA 3MFAA 2GC0A 1ULCA 3J7MA 5I8SA 1Q43A 2GSYA 1C8M2 1W2AX 4IESA 4IUGA 3ST7A 3LEMA 4OHXA 4KL1A 1AL21 4UFJA 2HKXA 2XWBB 1E5IA 3M8LA 1AL23 2ZGSA 3IPVB 3I3EA 4MGYE 3H1WA 3KV9A 2OT7A 1NAEA 3I59B 1GZTA 2DTYA 2KR2A 5FP9A 3VL9A 4BA6A 2EF6A 3ZDSA 3ZLIA 4GD4A 1U5ZA 4XFBA 5K4LA 1VMFA 2BNNA 3O7OA 2MEV2 2ORXA 4Q0SA 2BJSA 1CAWA 2H0BA 2UWAA 4QX2A 2IVJA 1Y9GA 1ULPA 2PLV2 3ZYJB 1W8UA 3HWJA 4QQLA 2WZR1 1DLLA 4AEKA 4L9BA 1S2BA 4CEYA 4Y1UA 4CCMA 2NM1A 2NMNA 2WZR3 2I74A 3SC7X 2P37A 1CAUA 3WP5A 3O1MA 2BGCA 2DDUA 2OUJA 5F5QA 3R05A 2EIGA 4ZS3A 2JDHA 3BOPA 4FT8A 4XPVA 2XJQA 2ZCWA 3M2MA 4M3CA 2LRPA 4QQPA 1LOEA 5F7UA 2XDVA 4Y1VA 3AJYA 4W6XA 5FP3A 2W94A 3ZPOA 3O0XA 3RYRA 1J3QA 4UBGA 1H4HA 2VOTA 4NIHA 3B94A 4CDXA 1RHI1 3FFZA 4LHSA 3RRDA 2B5HA 2VMDA 2WR9A 1RHI3 1BZWA 1TZOA 3VBSC 2DVDA 1KDKA 5CKNA 4IV3B 4N9IA 4WM8C 4IEPA 4B7EA 3HMYA 2WYSA 2GN3A 5KHJA 5IAXA 1C28A 2JICA 5C9AC 2QDRA 1SDWA 4CUAA 1HX6A 4P02B 1JYTA 4A7KA 4H55A 3RDIA 3RI9A 5LA1A 1VB2A 3SITA 3KMHA 4BH9A 3LGRA 2DCKA 3OG2A 3Q8AA 1OMIA 4QDQA 1O59A 3V0AA 3MV11 4J1XA 2BOIA 3ZYBA 1BMV2 2ARXA 2ES3A 4N53C 4CDQB 4H2AA 4QGMA 1PO12 3BU7A 3BALA 2QQIA 1DQ4A 4NN0A 4O7XA 4NPMA 1EPZA 4JGZC 5FZAA 1MQTB 2ZMKA 4BB3A 3MF9A 4FPYA 3ILFA 2VZRA 1XYNA 1AR61 2YBPA 4D6RA 4XUOA 3V0BA 1X50A 1V6MA 1AR63 2D3PA 2P3JA 3DKQA 4AEJA 3NMBA 3WW1A 3WNMA 4CCDA 4DFSA 4BDVB 2DCYA 1S55A 2Z4FA 1SFYA 5FPXA 1V6JA 3ZR6A 5T5OA 1REEA 2Q0AA 3SMHA 5GJ6A 1OKOA 2VG9A 1WUVA 3CJIA 1DQ0A 4KG8A 2DFCA 3WUCA 1D4M1 1KXGA 5DPNA 4YFZA 4JDNA 1D4M3 2D5HA 4I02A 1YJLA 1XSRA 1LHOA 1YI9A 3BOWA 2W1QA 3NQHA 1MZ6A 2WT0A 3AKQA 4HK9A 4MGIE 1DIWA 4UXAA 4A7ZA 2E9QA 1VB4A 3ASIA 4R9BA 1H9PA 2BGPA 3BTYA 4CP0A 1H1IA 3GZAA 1DBNA 2WO3A 5CVRA 2NYYA 1J1LA 3TWIA 4E27A 5ACA2 2RE9A 2WABA 3J9SA 3JUUA 4AK3A 3DEMA 2UYBA 3ZYHA 1XQNA 1FAYA 1LGBA 2XUMA 5FLJA 1W2TA 3IAQA 2VCCA 5J7MA 3VDBA 2JD9A 2VZQA 2ID4A 1S0GA 2QFEA 1ZA4A 2YHJA 1Y4WA 2GH2A 4AAPA 4Z8BA 1HJGA 2E51A 2HEWF 4LUMA 4YW4A 1VMJA 4AG4A 4RGGA 1YQ2A 4DB5A 1NCQC 3VBRC 1U12A 5D2AA 5F1RA 4YW2A 2ZGRA 4CDXC 3OGSA 3LIGA 3OPTA 3DCQA 3NV4A 3C3VA 5LBFA 3JD72 3CZJA 1LOGA 1YQ5A 4NHMA 1JYNA 4JDOA 1KFUL 2AR6A 1LEMA 1WMDA 5FFOC 3MPPG 3G7DA 2DU1A 1FPN1 1OURA 2WDBA 1QXRA 5C4WA 1FPN3 3TAYA 2FD8A 4GB33 2TUNA 4PT6A 2QJVA 3POGA 4P08A 1YC61 1B09A 5FXVA 3ZX7A 4HETA 2XUEA 2E32A 2RS31 1HLCA 4QKNA 3LWCA 3I2GA 4JAAA 2RS33 1DQ2A 2VJXA 1YXWA 3PVOA 1UZ0A 2HWF1 2AUYA 2ZKLA 4Q4Y2 5C9AB 1AXZA 2HWF3 3WG1A 1LHVA 4IEZA 4RQPA 2VMFA 3WW3A 5F39A 2ET7A 5FZ7A 3K2OA 1CAXA 2R041 4Y5TA 1NQJA 1YQ6A 1D4VB 3VBUA 2HBUA 1D7PM 3GZTB 3RZJA 2R043 1KDMA 4TZDA 2Q4SA 3BYWA 1ZREA 1WMEA 2C9KA 3B69A 2FDKA 4ZONA 3ZSMA 5FDBA 4R4XA 4QD2A 4Y22B 3U07A 5JI7A 3VBFA 3WDYA 3E6CC 3E6BA 2B4KA 4A41A 1ONAA 5C7GA 3GBFA 1RMU2 1RUG2 2VD7A 1LOCA 3M7AA 3NJZA 1NZCA 2WYFA 1IS6A 3O0VA 5CNAA 1VBC3 1O8SA 4K8FA 1F4HA 4JGZB 4XUQA 1VBE2 3LKJA 3POBA 2P3YA 3CLPA 2BW8A 1UPIA 2F4PA 1K5JA 1HQWA 1AJOA 4GWNA 4DUVA 4W50A 3M3CA 1VAVA 2XVGA 4TLGA 4QPIC 3RQ0A 1HV0A 3ZN6A 3UNPA 1H2MA 4IEUA 2HWE1 4HVRA 2YU1A 4COVA 1R1ZA 3O5SA 5EFUA 1VRBA 2HWE3 3JB4C 3V64A 3VDDA 4KMQA 3WDVA 1JU3A 4XF0A 3PLQA 5CA6A 3NV2A 4QT6A 4PI0A 4ZS2A 5T52A 3DYOA 1HQNA 4ISRA 2RJ2A 3BB6A 3H0OA 1NX9A 4MHRA 2JIGA 2XPJA 2XXZA 3IB3A 5I0SA 5FMOL 4XJAA 2X29A 3HOBA 2E7AA 3VKNA 4X8NA 4OULA 1R081 1UZVA 4DZGA 2PFWA 1WW6A 1K5MA 5BPXA 1C5HA 1FMD1 1SQ4A 2WZEA 3T2QA 5A3NA 4AEDA 1YFWA 1FMD3 2VW2A 3WZ1A 2FDJA 2R071 3UK9A 5C3SA 1EY2A 1PK6B 2R073 4X6RB 1QH7A 4P5YA 4L0PA 3KVBA 1XNAA 4HPKB 2J1EA 2EVXA 5LB6A 2X5IA 3N7MA 2XGXA 4Q8LA 4RFRB 4XZPA 2D6KA 2ZMLA 1ND3C 3O1VA 4XVHA 2VZ1A 3RNSA 1UCXA 2I45A 3OD0A 5L36A 5FOJB 4E8CA 1NCQB 3VBRB 5HXMA 4CP9B 2NMOA 1KITA 3OYWA 5HBAA 1OVSA 4QQOA 3UJQA 3KV4A 3ZR5A 4EWDA 2DUPA 5CFCC 2DWRA 4QXBA 1CPNA 1RVF1 1VRH1 2D5FA 1NY72 2PHWA 3LEKA 4XFIA 1RVF3 1VRH3 4NHYA 2WO7A 2ZGMA 1UWWA 1SBEA 2VVDA 4K1YA 3VBUC 4FPGA 5IK5A 4PQQA 3FFQA 3ELNA 3GDBA 2WNUC 1F5JA 2C5DA 3UJOA 3LPGA 5GLWA 4COUA 2BUKA 3N4MA 1VAMA 3GHNA 1CPMA 4YYOA 1EV11 4FOQA 1PIV3 2SLIA 2JG8A 4GKYA 4MGKE 3C8XA 1CIYA 1H2LA 2WFF1 3TNPB 1YIFA 4P5HA 3C7HA 2WFF3 5F5CA 5JMCA 2GMMA 2C0ZA 5BYNA 4E8DA 4F3JA 3ON7A 2JG9C 2XH6A 5JCTA 5JPMB 2C26A 4D7SA 4FPOB 1B35A 4LOTA 4E4DX 1D4M2 1UZYA 1LGNA 4TWTA 3B9CA 4NWVA 4XIKA 3WQ0A 1YQCA 4CDWA 2TNFA 1C8NA 4AGGA 1DG6A 1AYM3 3PUQA 2XHKA 3WNOA 1JTZX 2C9AA 2D3RA 4Q1RA 5LA2A 1RJ7A 3DUIA 4CE8A 3SKVA 3VDDC 3RWKX 2WNVB 1GWLA 4K21A 4AVCA 3WNPA 4D8MA 1GYKA 3N9MA 1T6BX 1VBD1 3H1MA 3LA2A 3K4ZA 4GWIA 1VBD3 4M0NA 1AHSA 4LBQD 2VECA 1OA2A 3CZUA 3ZIWA 2Q1ZB 4EZ4A 3POIA 5E8AA 1AF9A 2G1MA 4QPIB 5FMDA 5FYMA 1J3RA 5JWPA 4B4PA 1MS1A 3R6SA 5FWJA 2BFUL 1RINA 2DF7A 1XNDA 2IVIB 3MIDA 2XOMA 2XJVA 3NNFA 1CZVA 1K5MC 2TBVA 2HEYF 2JJ6A 3KCXA 2WS91 2ZGPA 3ILNA 5C3OA 5IVFA 4CU9A 2WS93 3BCWA 1NQDA 1HN1A 2O8OA 3MIBA 5FYIA 3ZFGB 1LHNA 2YB7A 2R6QA 2RM23 4BK5A 2XBO1 2WWUA 4LA2A 5A1FA 3PTYA 3D8CA 4JC1A 2XBO3 3LDRA 1GR3A 1OFSA 1TMF1 2X5IC 5GLZA 2WSVA 3I97A 2CWSA 1WLCA 1OLQA 1ZZ7A 5LY2A 2NP0A 1APNA 1YCIA 2GC2A 3E5QA 1YQ8A 2JDUA 4LBMA 4W65A 5C5TA 2VMEA 3ACGA 5FUNA 2G9FA 5BNNC 3DYPA 5C6CA 3WF2A 2D3SA 3O1UA 3AM2A 5KHHA 1UY1A 4NJ4A 1UX6A 1RYYA 5FY4A 2L9LA 4QB2A 3WP3A 2JDZA 5F8PA 1KS4A 5FMBA 5HPOA 5FREA 2D98A 4N8MA 4SBVA 2ETEA 2RR11 1JU4A 1HJFA 2Z42A 3AXDA 3NWKA 3O14A 2HWF2 3OTFA 1JOPA 3R4SA 4C1XA 4DY5A 1ND3B 2ZGLA 5IK8A 2P1BA 4J25A 4NHKA 5C5UA 2WQ8A 3I2DA 3U37A 1G9DA 2VMGA 4LK6A 1FX5A 3K4DA 3AXEA 4FVVA 4LBOA 4LBLA 2Y60A 4PDWC 1YYNA 3E5XA 4J6GA 5IK7A 4IETA 1X82A 4LQRA 2BNOA 3IPVA 4LBQB 2PHXA 4XHXA 5FZEA 2G4IA 2YFUA 1E5RA 5FZ3A 5CFCB 3I59A 1IGOA 1W8FA 2A70A 4NPLA 3NV3A 2GC3A 3VLBB 4HK8A 2HWB1 1RUE3 3POFA 4Q27A 5GZFA 3THCA 3KSCA 5JDBA 5FKCA 4PLMA 1AXKA 1MVQA 2ZKNA 1J83A 2XVLA 1L7QA 2WNUB 4K9SA 5C8CC 5FZGA 4CDWC 3LFIA 1HV1A 1RUF2 4QM9A 1PGL1 4A3XA 1BHGA 4Y24A 2PHRA 3JCIA 1UYYA 3V56A 2EXKA 2CU5A 1NG0A 3LZZA 3ZYGA 3OPZA 2XQRA 4Q8KA 1PX4A 2HH9A 2JD4A 2QZ2A 4B4QA 5KXEA 2B8MA 3ACHA 3L2HA 4YW6A 4C0BA 4CEWC 1D2QA 3POSA 1UOBA 3NRUA 2R1BA 2VMIA 1ZZCA 1H4GA 2A3WA 4JKKA 2JG9B 1J3PA 1WCDJ 1AR71 1HRI1 4QB1A 2WWSA 3NNMA 3NO8A 2O14A 4FXKB 3THDA 2FCVA 1PO23 2VNOA 3KCYA 1E57A 2YC0A 5EJ1B 4RFT0 1R082 3MIEA 4XAEA 5IWFA 2E53A 3SH3A 4IV3A 5JSOA 1D2SA 3NV1A 4QXHA 2VMCA 5H9PA 5ABJC 4AI0A 5JR7B 1RB8G 1LNSA 3OGGA 3WF4A 4IE7A 3N3HA 3MGUA 1X9TA 4AL9A 2VUCA 4YVWC 3JBG1 2XONA 3JBG3 1QF3A 1WCKA 4F83A 2ZTNA 4HN1A 4YPJA 1R091 1ENQA 4HL0A 2JDNA 3A21A 3AFKA 3AZVA 4FO9A 1DHKB 4GZ9A 1PZ8A 4K20A 2ZXQA 4MVTA 4OZXA 4ONUA 1PMHX 2ZEYA 3U4SA 1MQTA 5A6XA 5A7QA 5F6LB 2JIJA 1PZ9A 1AL0G 3H8XA 1IS5A 4A44A 4CXWA 1HB1A 3VBOC 5AVAA 2CTVA 1TME2 5FYUA 2QNKA 2RS11 4KWUA 4B29A 4CXXA 1RUC1 1XRUA 4IQPA 1IG3A 4WVMB 2RS13 1I1EA 1RUC3 4AHWA 4JHTA 3KF3A 1IQAA 1W2NA 3KQ4B 3VGIA 3VKFC 1XYPA 3KHBA 1HKDA 5FZ6A 3G6JB 5BNNB 4C91A 4HVOA 1XE7A 1FV2A 4LKFA 2OA2A 2XLGA 5KXBA 2NZ9A 3I3BA 2V72A 3EMRA 4BWOA 3MFCA 2D97A 3R4DB 1EV12 4XUTA 2VVEA 3LE0A 2BDRA 2W87A 4FPJA 1YFYA 3S30A 1JZ5A 1GKBA 3AMMA 5FZ0A 3WLUA 4WM7B 2AC1A 4Y33A 3KGZA 2VQUA 4FFIA 4L99A 3UYJA 2VBPA 2EALA 2VPVA 1DLCA 5LBCA 4G9SB 4Q4X1 5GZEA 1OOPB 5T50A 1NCRB 4Q4X3 3VV1A 1HB2A 2JE7A 3Q8EA 5FZ9A 3JU9A 1O6UA 3DKWA 1UKRA 4LO8A 3DN7A 3VHRA 2HYXA 4MUVA 3AVRA
chains in the Genus database with same CATH topology
4IL7A 4I30A 4YRDA 5DDJ2 3AKRA 1DF0A 4Q4W3 1I9RA 2D6OX 4QMAA 3OF1A 1PVC3 1MS4A 3JQXA 2CGPA 4G4FA 1VBB3 2CNAA 4W6YA 4XXPA 5C8CB 4E2GA 1DGWA 5DG1A 5C33A 1S0EA 3WG2A 1QJY1 3AP7A 3IKWA 3KGLA 1QJY3 3VZNA 2KM2A 3D82A 2UURA 4IV3C 5AVPA 1DQ5A 2A71A 4CEWB 2EAKA 1ZZ6A 2YV8A 4KWJA 1DYPA 1ZBA1 4FTEA 1RUNA 1DZQA 3PNAA 4Q1PA 2EAAA 3AK0A 3VKMA 2WL1A 1WLDA 1TMF2 1Z7S1 1ZVFA 5DUWA 1QJU2 3QBQA 3ES1A 5ABJB 1V6OA 1QQP2 1LCLA 5C9AA 1MQTC 5L7OC 2ZZJA 3W9AA 1S0BA 4YLZA 4SLIA 4OHWA 4AFDA 5I8YA 3GNEA 2BWCA 4LE4A 4YVWB 2WFPA 5BNOC 1VBA2 4JQRA 3BTAA 1VJ2A 3J8F2 3VL8A 4HN0A 4Y22A 2RR12 2BWAA 2PHUA 1IPKA 1KFXL 2AREA 4N53A 1AX2A 4EN0A 3QD6A 3WDUA 4FQ4A 2DV9A 4XOGA 4JGZA 3H1YA 1O5LA 2P2KA 4QQ2A 4XMAA 4XW3A 5DZEA 5JI9A 1UIJA 1JBCA 4YW1A 4B3NA 1WA4A 2XL9A 1QXJA 2HWB2 3KT1A 1X36A 1RUI1 2DVGA 4U36A 1RUI3 5KHGA 1WD4A 3VKOA 1PM7A 2Q30A 3NSTA 3WV6A 5I91A 4XJ8A 2D6PA 3UKNA 3U11A 2BYVE 2IXIA 4YG0A 2HWC2 1EP0A 1QKQA 3U10A 2SBAA 1AYN2 1V6NA 4TSVA 4OHYA 5K7PA 1PMIA 1LB2A 5HI0A 2X8KA 1D0HA 1QJX2 1WW5A 3OCPA 4AE2A 3VHOA 1UU5A 1RUJ2 4YSFA 2AYHA 1AR72 1AX0A 1HRI2 1PK6A 2O8QA 4RHV1 3SCHA 2JKBA 2VUJA 4Q2FA 4RHV3 1DU3D 1G9FA 4HVQA 5JSPA 4P9WA 3WW4A 4HPKA 1V00A 2VVFA 1BEV1 5T5LA 2IFWA 4AI2A 1Z78A 3POYA 2DVAA 1BEV3 3I8TA 2WT2A 2OZ6A 2ZJCA 5AC93 3DL3A 5EYYA 3ZYRA 2RMU3 1FYUA 3AYDA 1NCQA 1YUDA 3BPZA 1MZ5A 5T5JA 3RSJA 3VBRA 2A6XA 2Y38A 3DPRC 1QH6A 4U2AA 4E9KA 1LHUA 1R092 4OI2A 1BBT2 4X6QB 2PA7A 4K7JA 3AP6A 1LESA 3AZZA 5JPNB 1Q8PA 1IS4A 1FNZA 4GQ7A 5CB7A 1ZYBA 1QDOA 3MW2A 1SBDA 2ZPXA 2CWMA 2GN7A 3ZO0B 4D3WA 1HRV1 3RMYA 4NWWA 2XJRA 1HRV3 1XNBA 5K8SA 1BVP1 1U5IA 3PMSA 1U5YA 2GAUA 1EAH3 5L7OB 2CL2A 3FLRA 2Z2SB 2DURA 1ZNPA 3PHMA 3SISA 3OBTA 1S1AA 3HQXA 5BNOB 1X8EA 1G6NA 2VMHA 3QOPA 1HW5A 1LOFC 3M3QA 4XHBA 3RWNA 1POV1 4HKLA 4KBBA 2AZ5A 4HBNA 1POV3 1M4WA 1L3JA 1UU6A 2WNVA 3FBMA 4COYA 2XJSA 2NQYA 4YM2A 1LENA 2QE3A 1OHFA 3EBRA 2WKKA 3ZFEC 1PNGA 3EQEA 5GLTA 1AZDA 1C5IA 3VZMA 1H30A 1YHFA 2YY1A 4M01A 3PVNA 4QPIA 4R4ZA 4RGAA 2HWD1 4C1WA 1H2NA 4XQWA 2HWD3 1ND2B 1W39A 5H9QA 4E2QA 2QVSB 2ZHKA 1VAKA 1YLLA 4IEXA 5CG8A 4IEOA 4H14A 4Q0UA 2DYCA 2YZ4A 1PK6C 2ZX3A 3ZFGA 1YIPA 5KC5A 3FZ3A 4YZ3A 5LRRA 2DTWA 3LSEA 4BIOA 3S6PA 2WINB 1ZZ8A 1DGLA 1R1A2 2I07B 1IPJA 4B8EA 4K1ZA 4I0WB 5LRSA 3SHRA 2ZX0A 2VU9A 3I4IA 2ZMNA 3J26N 1UKGA 1X33A 1ZBA2 4NR1A 3ZXDA 1UL9A 1G9BA 1LOAA 2H0VA 3APBA 4GXLA 1MVEA 3CU7A 4N90A 1YNAA 5L19A 1Z7S2 2R061 4ATFA 1I3HA 2R063 4AYUA 3MIHA 3IN9A 4GMP1 4O9EA 2YDEA 1DQ1A 2VULA 4GMP3 2PHLA 4DY3A 1A3KA 2A6ZA 3JB8A 1ND3A 1LRHA 1Y3TA 3MDPA 4GULA 4LULA 3SNMA 3WQ1A 4GB31 3J4UH 2IXKA 4CYDA 4LNVA 4DOUA 1X8MA 2WSUA 4WVZA 2XL7A 3DPRB 2IWGB 4BZ4A 3FLTA 2PHFA 4LBQA 1QJZA 1ZM1A 5EZWA 1LR5A 2BNMA 2D40A 5CFCA 1RUD1 1N1SA 3KCCA 3RG0A 4D69A 1RUD3 1NOVA 2PHDA 2VW0A 1V9U3 4QPGB 1WW7A 2A75A 4XQ4A 1W6MB 3TBDA 4S2HA 4OI1A 2D6LX 4NPRA 1W2UA 2Y0OA 3LA7A 2WNUA 2CV6A 5HXVA 3B01A 3KLSA 1GNZA 2ILMA 4ZXKA 3WHTA 2IC1A 1NXMA 1VBC1 2WNVC 1GLHA 3CNAA 5BY5A 3AX4A 4I0AA 3KB5A 2R0FA 4QGNA 1H8VA 1AL22 1NLRA 4AVBA 5H9RA 2JG9A 3AZXA 4IEVA 4AVAA 1FXZA 5DUUA 1DGRN 4COZA 4FP2A 5TSWA 2DFBA 1JXNA 5E88A 1KD7A 1JYIA 1VP6A 3M4FA 4AGVA 4PCRA 3WW2A 4XJZA 4LR4A 2XG3A 3SCGA 5FO8B 2WZR2 3ZFEB 1NA1B 3ZFGC 1VR3A 3WCSA 4Y1XA 3WY6A 1ASJ1 3EJKA 1AR93 1ASJ3 4CP2A 1HXS3 4MYEA 1AR83 3NVCA 4ORFA 5A33B 1G9CA 1Q8QA 4B4RA 4S2DA 4P9GA 1O3RA 3DV8A 3WD5A 3WX5A 1SFNA 5HCAA 2GDFA 3TN91 2A5ZA 4XYXA 3B02A 4BPZA 3TN93 4G3YC 1PGW1 1OD5A 4Q0VA 1RHI2 2V73A 3SCFA 3POWA 1T6GC 1CJPA 4XJ9A 1ZRCA 4WVMA 3VZKA 1OQ1A 1VALA 3VBHB 1LECA 1XXNA 1TNFA 3IIAA 3A0KA 3MLLA 4JV4A 3ZXJA 1RTVA 3KT7A 5BNNA 4D7TA 5J09A 1OKQA 4NOTA 4Z2WA 1XNCA 2WNEA 2WA4A 4FOWA 1DZRA 2G9GA 1UAIA 3QCWA 3WVJA 2HYKA 3KM5A 4LLOA 1VLNA 1S0FA 4EWEA 4M3CB 4Q4V1 3A4UA 4WM7A 2VY0A 4Q4V3 5BNQA 4AF9A 1TQ5A 3B5LB 2K9ZA 4WZCA 1OOPA 1NCRA 3L2YA 1AR62 4I01A 4PDWA 4YG3A 1GZ9A 1PIV1 4P9IA 5I8TA 3LOIA 4AWDA 1FOD1 2HEVF 2VOKA 4I09A 3B7MA 1FOD3 1F31A 4IEQA 3SXWA 2FQPA 4I0BA 5BNPB 3FUQA 2VXRA 2P3IA 2PAMA 4XDQA 2YROA 4JVAA 3QH7A 4IV1B 5C8CA 1LGCA 4Z92B 1J1TA 1AYM1 2BVVA 4MX3A 3ES4A 2FHRA 3VHNA 3ZFFB 3CEWA 1Q8SA 2HWD2 2QUOA 4A2UA 4DXZA 1OSGA 2VH9A 4XF9A 5JZGB 5H9SA 1RUH3 4CEWA 3GALA 1HIXA 5DZFA 1N1TA 3M1HA 4C90A 3OGJA 4LO7A 1U5XA 4Y5Z0 1KS5A 3V0BB 5GM0A 1GZWB 3RYPA 3FWEA 2DCTA 1CAVA 4MXVA 3M70A 4XJWA 5DZGA 5ABJA 3IDEA 3U4XA 4XF3A 2CGOA 2RM21 3ZXLA 1YO8A 1WLTA 1LTEA 2RS53 2DCJA 4DPNA 3TRSB 2ZGTA 2V5YA 4YVWA 2WZPP 3B9IA 3TB0A 2R16A 1ZRRA 4BIFA 1M06G 1LOBA 1SLLA 3RS6A 1FPN2 4OI0A 2UWCA 4GB32 3VHPA 3KT4A 4EN7B 2OVUA 1SLAA 4XIOA 4UW6A 2RS32 3D0JA 3GZUC 1YFUA 1TNRA 3USUA 3VBOA 3WDXA 2R1DA 3HAGA 4BE3A 3JZVA 4WM7C 1C1FA 3IMNA 2D6NA 1UZZA 3DGTA 2ZHMA 1ULFA 1DFQA 1NYWA 2R042 2CAUA 5DUVA 1OOPC 2YMZA 1NCRC 1IHMA 4FQZA 1SLTA 4FOYA 2PELA 3N7KA 4XFHA 2A6WA 3D6EA 1RUE1 1VBC2 3ZIXA 2ARBA 5JOWA 5FOBB 4MSVA 4AEMA 4ATEA 1ULEA 1SLCA 4HKWA 1DYKA 1HDKA 1RC6A 2B45X 3HBZA 4XMIA 4LLFA 4W6WA 1Q8VA 1AXYA 4FAGA 1W6QB 4JRLA 3MLKA 1GV9A 3AMPA 2HWE2 5T55A 1CX4A 5FLHA 3H7YA 3HN1A 1MEC1 1W6NB 1MEC3 4KH9A 4YGEA 3IM0A 5FTTC 2CAVA 1O91A 1C8M3 1ENSA 1Q3EA 1PO21 3OY8B 1BKZA 4INDA 2JENA 3GYDA 3IT8A 1YI7A 1IZ3A 3MPBA 5FQ0B 4QPYA 2QCSB 2A7AA 5D8AC 1FMD2 2Q8OA 4RS5B 4KWLA 3FJSA 2R072 5JAXA 3LSDA 2MEV3 2PLV1 2ZX4A 3PMEA 2OYZA 3HR9A 2PLV3 5FRAA 1UD1A 1PGW2 2FBEA 2I2SA 4QHBA 4S2GA 3TOJA 4PIZA 1OPMA 1J58A 4AXOA 3ZN4A 3ZXFA 5FPZA 1BYHA 2W08A 4IEYA 4XFCA 4YGCA 3W58A 5J3UA 5L7OA 5CADA 2B9UA 2BEOA 2ERFA 3ZSEA 2O1QA 2QKDA 3NKTA 4URTA 3GF6A 2GNDA 3R4UA 5BNOA 3H50A 1UW8A 4ASMB 4H7LA 3NW4A 3LB9A 2A3XA 3K51A 1Z0HA 1Q5OA 1JYCA 1RVF2 1VRH2 4Q0PA 5GKAC 4EN8B 3AMQA 3WINE 4FPHA 4YM3A 1CVNA 1W6OB 1KJRA 2OW4A 2V09A 4WVWA 1V6LA 3HT1A 3VN4A 4YVSC 5I93A 1QWRA 4XF1A 5KBFA 1YRZA 4XFGA 1LHWA 1PIV2 3NAPB 3AZWA 2PHTA 1O4YA 4HANA 3RI8A 3GHMA 1WD3A 4KGQA 1OA4A 5J98B 2WFF2 3T2TA 4YGBA 1H1AA 2GU9A 1MZEA 4R9AA 3WUDA 4FP3A 1PO11 1Q8OA 4KWKA 1PO13 2PAEA 5B2GB 5J96B 4FOVA 4ZU5A 4QQHA 3VZOA 4E2SA 1AYM2 3W59A 4GH4C 4RA0A 3NL1A 1OQEA 3MIFA 1HQLA 1S0JA 2R49A 1PVC1 2EXIA 2PQQA 1O3SA 1QOTA 1VBB1 3WP6A 1VBD2 2O0OA 2WQ4A 3ILRA 4ZU7A 2PAKA 4N9HA 4P9YA 1WLWA 1Y7BA 1JW6A 4FPEA 3X29B 4MZUA 1C4RA 3M3EA 4RSUA 4KGGA 1RITA 2ZBJA 2ZZQA 4COWA 5JSRA 1N3PA 1QGLA 4MXWB 3ZYPA 3TYJA 1W6PB 2WS92 2ZA9A 3UKTA 2ZGKA 4Y20B 4R9CA 1FT9A 1IOAA 5K0UB 5AFBA 2RM22 4KNCA 1TE1B 5AFEA 4AI1A 3RMXA 3MZHA 2XBO2 5ACA1 1ULDA 2HJIA 2BQPA 2LALA 5ACA3 4CDUC 3MICA 3DPRA 4L11A 3KQRA 4Y1YA 3INAA 3MW3A 4MH0E 5GZDA 5D8AB 2XJUA 4FPLA 2WLPA 5JLVA 4QPGA 4EWAA 4RR3B 1BXHA 2ZGUA 2JEMA 1AJKA 1LU2A 1OFNA 4H7MA 1LODA 1BK1A 4Z82A 1G7YA 2LUWA 4KQ7A 4JGYB 3MLJA 5JOXA 4ASLA 5J37A 4NHLA 2BVBA 1I5ZA 3JD71 1AUYA 2F6BA 3JD73 4IERA 4LO4B 5E16A 2JX9A 1RL3A 2GMPA 1GSLA 2B42B 2H6BA 5I0UA 1OPOA 4E4ZA 1CD3G 5A3LA 3OJBA 4P14A 3AYAA 3FX3A 2IFRA 1LOFA 1YFXA 2XJPA 2Y26A 1BCXA 5GZCA 2R30A 1CJDA 1RUE2 5T3NA 1ND2C 4K40A 2NLRA 2EXJA 2W39A 2YYOA 2XVKA 4JRAA 1NE4A 4EJRA 2DUOA 2GALA 4C0HA 4Q4Y3 4YVSB 4JTOA 1NA1A 4R52A 3ZFEA 1PGL2 4XFFA 2BPA2 4LO6B 1QOOA 2OZJA 2E7TA 5KWRA 2WQZC 1RMU1 1RUG1 1TEIA 4PIXA 1FATA 4MGZE 1RMU3 1RUG3 4FSJA 4XQDA 4OHVA 5A33A 4XE9A 1VBE1 5I0RA 1VBE3 1PO22 1C57A 5JIUA 1CQ9A 5EYXA 4ES9A 4GH4B 2CYFA 3VZJA 4DRVA 5CFDC 1UMZA 2ZGNA 5E1RA 4AHYA 3WP4A 1SBFA 3VBHA 1RGSA 1O7FA 4Z1VA 5AC91 2E63A 1PZ7A 4IEWA 2P17A 3U0ZA 2RMU1 4UBHA 2E7QA 2VOWA 4FPFA 1EYBA 3JBG2 1MZFA 2X53S 4OHZA 1POV0 1A8DA 1CIWA 4FPCA 1ZRFA 4I3GA 4AHZA 4WZFA 2EXHA 2YGMA 1G86A 3USSA 4Y1ZA 4QPGC 4XFAA 3ZMOA 5FO9B 4CRQA 1RIRA 4J1WA 1ZX5A 3S7IA 1JH5A 1O5UA 4A7YA 3N36A 3ZPYA 4DRRA 5E89A 5FAXA 2RS12 1V70A 1YJKA 2Z69A 1RUC2 4XXAA 4CDUB 2MNGA 4FXGB 2W0XA 3AMNA 3D0SA 1EAH1 2CY6A 3WDWA 2Q1MA 4QGLA 5BNPA 1DZTA 1QU0A 1PNFA 2UYAA 4IV1A 3Q9OA 3RPQA 3L9JT 5BV6A 3ZFFA 3WXPA 3ZSJA 4MV2A 3WDTA 1W0OA 1X7NA 1JOJA 1H0BA 2JECA 4IXLA 5LK5A 3LOBA 5JZGA 1NY71 1H8TB 3ACLA 1JUHA 4Q4X2 1NXD1 3WNXA 1NA1C 4AFMA 3AFGA 3I54A 3R0RA 4N43B 1OQDA 1U0AA 4AVSA 2VQ0A 4GMP0 4Q4W2 1GZWA 1XE8A 2ZAHA 1PVC2 2P3KA 2PTMA 3H3UA 4LBJA 4EN9B 4EROA 4YM0A 1VBB2 2PYTA 5GLVA 2VNGA 3T1LA 4AQ6A 3AKSA 3KZ4C 2GH8A 2LTNA 1N1YA 1WGPA 3UKVA 5EXOA 1WBFA 4BHPA 1QJY2 1W0PA 5K9YA 2GMEA 4P9JA 3DF0A 3ETQA 4JTNA 4DMIA 2RJKA 2WLQA 3PVBB 3SH5A 1H2KA 3CJXA 3E5UA 3VBHC 4BLJA 2VGDA 1MACA 4GALA 1JUIA 5JOZA 4N7UA 4FTSA 4QM8A 1O3QA 4AHXA 1N47A 4CEYC 5FO7B 5I0TA 4F8AA 3ZYIB 3GBGA 4JCKA 2WT1A 1MR5A 3GBWA 5IK4A 5CFDB 1DDLA 4XTMA 2AH2A 1C1LA 5CAZA 3H3ZA 1BVVA 4XBNA 4XEZA 4UW4A 3WG4A 3ZXAC 4PF5A 5A32B 4FAHA 2VQAA 3AMHA 3K48A 4K3UA 4Z07A 1UPSA 1RUOA 3WG3A 2RJLA 1JN2P 2EA7A 1SMVA 4M3CE 1KRIA 1V9U1 5BNPC 1DGRA 4BMEA 1PGSA 1UU4A 4XBQA 1QOSA 4IV1C 3B3QE 3BIWE 1CR7A 3N7JA 1GANA 3ZFFC 1W6QA 2C1FA 4LHLA 4YNIA 4TLFA 1ENRA 4ZU4A 1UN1A 3FC0A 3VBSB 5JZGC 1ZBE1 5SV5A 4WM8B 2ZACA 3KD4A 3H7JA 2ZAAA 1W6NA 4Q29A 1ZBE3 1RUI2 4YZ2A 2R32A 4Q26A 2Z5WA 2DU0A 3UL2A 3OY8A 1MS3A 2MHFA 1ENXA 2WJSA 1V6IA 4LEJA 1XU2A 1I6XA 2LM3A 2XLFA 5EWSA 2B39A 5FQ0A 2QDNA 2ZGQA 4DQAA 4N53B 5CIRA 2FZ1A 4RS5A 4AVTA 3CJIC 4AQSA 4YGDA 4RHV2 4PBOA 4ISQA 4Q0QA 4XBLA 4AQ2A 1RUF1 1AR91 3B93A 1OLRA 1HXS1 1RUF3 1XNKA 5LEJA 1AR81 2ZX2A 1BEV2 4LBNA 2DCZA 3AP9A 2VOVA 3RJ2X 4AW7A 5AC92 2UWBA 3ZXGA 2RMU2 3WHUA 1GNHA 2IXJA 1AX1A 4LO5B 1ZZBA 1AVBA 3AP4A 3BODA 4JDMA 3LCPA 5JIAA 1O3TA 1A8MA 2GNTA 3SH4A 1REDA 3CF6E 1CONA 2VUAA 3ROUA 3VZLA 5T54A 4XILA 1JHNA 2QQPA 1CAWB 2FMDA 3ZSLA 4AGRA 2VNRA 1R083 1W6OA 2Q5TA 4P9LA 5BXXA 1FV3A 5JOYA 2XWJB 5DUXA 1XU1A 4LTAA 4CEYB 1LEDA 5KHKA 3WT3A 3WOGA 3AKTA 1HRV2 1WMFA 2Z79A 1CAUB 3ZVXA 3NAPA 2NN8A 2ZX1A 3QLQA 2ET1A 4M0HA 4CTEA 5GZGA 3RYKA 4DS0A 4M3CF 1EAH2 1LULA 2N7GA 3P3NA 5FMOS 4XJUA 5C4WC 2FZ2A 3IWZA 2D6MA 2K2SA 4H3WA 3O0WA 1DQ6A 1O4TA 2R0HA 3VKLA 3CL1A 4CDXB 3T1MA 4B7KA 1H9WA 3NKGA 1TME1 3D4KA 2RHPA 2ZGOA 2XJTA 1TME3 1PVXA 3ZMNA 2W52A 4UW5A 3AYEA 3PVEA 4RQPC 1O4ZA 2H6CA 3KS7A 2ATFA 4QXKA 5FCCA 4F7ZA 3EXUA 1GBGA 4AFCA 3HIFA 3ZN5A 2B7YA 4YM1A 4HLTA 3V0AB 1SLIA 2K0GA 3RJRA 3VBFC 4HSJA 1EV13 5IT6A 4HFSA 1RUH1 4MXWA 4RS5C 1C3HA 1W6PA 1S2KA 5FBZA 3P3PA 4PJYA 4Y20A 4X8PA 5C8WA 2ZHLA 3FUOA 4FPKA 5K0UA 1QHDA 5F9TA 5HCFA 1GZCA 2OIIA 3UV9A 3MW4A 3MF6A 1QMJA 1N3OA 2PN5A 4PLNA 4YARA 2TEPA 5DDJ1 4KU7A 4LE3A 3AYCA 5DDJ3 1BJQA 5D8AA 4FCAA 3WCRA 2XKOA 3CJIB 2RS51 4M00A 4CP1A 1V6KA 4RR3A 2W68A 5A3MA 2WC2A 1S0IA 2R062 4YZ5A 5SV8A 5GALA 4JGYA 4YZ1A 4TYSA 3IBMA 4QX5A 1GICA 2ZS6B 2VOXA 4RD7A 1FNYA 4Y26A 4AEDC 2GNBA 4WBBA 4AFAA 5J36A 1ALYA 1Y9QA 3FE5A 2GC1A 4GWMA 1OI6A 3NAPC<