1J1TA

Alginate lyase from alteromonas sp.272
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
228
structure length
228
Chain Sequence
STIPSSITSGSIFDLEGDNPNPLVDDSTLVFVPLEAQHITPNGNGWRHEYKVKESLRVAMTQTYEVFEATVKVEMSDGGKTIISQHHASDTGTISKVYVSDTDESGFNDSVANNGIFDVYVRLRNTSGNEEKFALGTMTSGETFNLRVVNNYGDVEVTAFGNSFGIPVEDDSQSYFKFGNYLQSQDPYTLDKCGEAGNSNSFKNCFEDLGITESKVTMTNVTYTRETN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Alginate Lyase
publication title Crystal Strucutre of Alginate Lyase from Alteromonas sp.272
rcsb
total genus 61
structure length 228
sequence length 228
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2002-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08787 Alginate_lyase2 Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1j1tA00
1W6MB 5E89A 1DQ0A 4XHXA 1SBEA 1GNZA 1W6OA 5AVAA 5T52A 1AX1A 1S0GA 2EAKA 4TYSA 3UK9A 4MYEA 4PQ9A 4Y1XA 3GNEA 4M00A 1TEIA 2A3YA 1MS5A 3AP7A 4JC1A 5KXEA 4BMEA 1V00A 1YXWA 3AP5A 3N7KA 1RIRA 1IKPA 1ENRA 1WD4A 3NWKA 2VU9A 1AXYA 1LHNA 3ILRA 2E51A 1VAVA 2ZA9A 5JVVA 1G9CA 1V6MA 4DQAA 2SBAA 1LGCA 1ULEA 4XYXA 5E88A 5EYXA 5IUQA 1DQ4A 1AXZA 2ZACA 3AP6A 3OYWB 4RA0A 1CESA 3M3EA 2VXRA 3ZXLA 1KQRA 3R4UA 2YZ4A 4FQZA 4Q8LA 1CR7A 2ZGOA 1G86A 4WZFA 1Q8QA 3B01A 4GA9A 1N1VA 5GALA 1JBCA 1LHUA 3IPVB 4AVVA 1N47A 5GJ6A 3JUUA 3UJQA 1SLLA 2JD4A 1UMZA 4Q27A 3ZSJA 1BYHA 3T1LA 1KDMA 1WLDA 1KJLA 2AH2A 1V6OA 2OVUA 3WUCA 3AJYA 1GYKA 3M3CA 1N3PA 2ZMLA 1OFSA 3ILNA 4XZPA 2D6MA 4YG0A 4H55A 1CN1A 4DRRA 1AVBA 1AX2A 3RSJA 2I2SA 2YY1A 3UJOA 3NV3A 2Q5TA 3B00A 2AREA 2VUAA 2ZBJA 2W68A 1UAIA 2DUOA 2A6VA 2WSUA 3SITA 2W39A 3A0KA 3WCRA 4NOTA 1IS5A 3WV6A 4XJWA 4Y22B 1DHKB 2D6LX 2ZHLA 4JCKA 4YG6A 1YI7A 4PBPA 1FV2A 1FV3A 2NN8A 2TEPA 3FFZA 2UURA 2CL2A 3DGTA 5CA6A 5DG2A 3M1HA 2VY0A 2CY6A 1DQ2A 5BYNA 1IS4A 3O12A 4XTPA 4TZDA 2GNTA 3H0OA 2R0HA 4BQ1A 4FOQA 3ZYPA 3V65A 5DUUA 4GALA 1UKGA 1I1EA 4YGEA 1FNYA 1R1ZA 3TAYA 4Y20A 2D6NA 1SCRA 1GZWB 4IQPA 2ZZJA 5DXDA 2XB6C 1AJKA 4XHBA 3CNAA 4ATEA 4YM3A 1IS3A 4UW5A 1CPMA 4XJ9A 4Y1UA 5EWSA 1LOGA 4R9BA 5JMCA 1S0BA 4Y1VA 2P3KA 3FLRA 3B9CA 3WLUA 2EXIA 2NZ9A 1GANA 1MS3A 3AP9A 1O4ZA 5F9TA 4UW4A 5T5OA 4K1YA 4AGVA 3WUDA 2WNEA 3WHUA 1W6QB 3DUIA 5HCFA 1S0JA 3OY8B 3WDUA 1FATA 3HN1A 2VW0A 1ZM1A 2DV9A 4YFWA 2DUQA 4YW4A 5GZFA 5H9QA 5T5PA 1A8DA 1G9FA 5H9PA 4M3CB 3ZXFA 3QCWA 1I3HA 1YYNA 2AR6A 1W6MA 3WOGA 4FPHA 2DVAA 4YM0A 3O5SA 5IK8A 1GNHA 5DUXA 4AYUA 1KRIA 5LK5A 1BXHA 3ASIA 3I8TA 3AZYA 2WSVA 3POSA 4XIOA 3T1MA 2DUPA 2FHRA 2R0FA 1FNZA 3OGGA 3W58A 3AFKA 3IKWA 1GICA 2XG3A 4C1WA 1F9KA 1LTEA 3GALA 2A5ZA 3NV4A 4GKYA 1DFQA 3PJQA 1W0PA 2A70A 4WVVA 4UW3A 3AXEA 4LBQB 4Q1RA 2PHTA 4AGGA 1QGLA 1APNA 4XMAA 1AX0A 3OYWA 3KM5A 3O0XA 1AXKA 4M3CE 1DYKA 1LHVA 1Q8VA 2DVFA 4ZKTB 1URXA 2A3WA 3WG4A 1QNWA 5GLWA 1DQ1A 4FPJA 1KDKA 2P2KA 3WDYA 5DZFA 2GNDA 2JDZA 4L8QA 3IPVA 4FPGA 2W52A 5CB7A 3T2TA 4F83A 3BIWE 1RITA 4GWMA 4ATFA 2NP0A 1LU1A 1SLAA 1LOFC 2PHUA 4R9CA 1DYPA 1QNYA 4RL7A 2NM1A 4YM2A 3WG1A 1CJPA 1S0CA 1QDOA 3D5OA 5EXOA 1FX5A 2P3IA 3HR9A 1PZ8A 4HANA 3ZSKA 4FP3A 1WW7A 1PZ9A 2PHXA 4P9YA 3M3OA 3ZXJA 5GZCA 4Y1ZA 5GLTA 4XIKA 1N1SA 4C1XA 4ISQA 4ZXKA 2D6PA 2AUYA 1LU2A 3MW2A 5JOYA 3V0BB 1B09A 2D3PA 2KM2A 1MACA 1MS4A 1N1TA 3APBA 2C9AA 2WT2A 4FOVA 4LBJA 5L73A 1LJ7A 2E53A 3AZWA 4XMIA 2DWRA 1SLIA 4Y22A 4Q8KA 4YW3A 2E7TA 3KQRA 2CWMA 1W6PB 2ENRA 3AP4A 1ENQA 1HQWA 1W6NB 4Q1PA 4NO4A 2JE9A 4XILA 1A78A 3IMNA 1BKZA 1MS1A 1SACA 1C57A 1NLSA 1QU0A 1AF9A 4WV8A 4DS0A 1DLLA 1ONAA 2A71A 1LOBA 4XE9A 4AGRA 2FMDA 1HKDA 2ZHMA 3OPZA 2NMNA 3NV2A 2GALA 5DUWA 4D69A 2NMOA 4I30A 1GZWA 1QDCA 1JOJA 2VW1A 4BLIA 1DZQA 2GNBA 1CONA 1ULDA 3AZZA 3SISA 3PVEA 3R05A 3VKNA 1HQLA 2GN7A 1U0AA 4XJZA 3WG2A 2A6YA 2D44A 3FUOA 3USUB 2GMPA 4BPZA 1LOFA 2YXSA 1LULA 2D6OX 3O0WA 5T5JA 1O4YA 1LOAA 1FYUA 1UL9A 1ULCA 2CTVA 5HCBA 5CAZA 3Q9OA 4YM1A 1SBDA 3RQ0A 1LENA 3WDVA 4Z8BA 1BJQA 3M3QA 3AJZA 3VKOA 3MEPA 1W6QA 1SLCA 3M2MA 5KXDA 1WLWA 4BMBA 3OY8A 4ITCA 3WCSA 5FREA 4GXLA 5CNAA 1MZ6A 1WUVA 2DYCA 1Q8PA 3A4UA 4P9XA 3SNMA 4LBLA 2GMMA 3U4XA 2DU0A 3OBTA 1G9AA 2JE7A 3N7JA 1UN1A 4M3CA 1GSLA 3AZVA 4Y24A 3WDTA 4AVTA 3V0AB 1X50A 3WDWA 1S0DA 1QOSA 1LOCA 2YROA 5DZGA 1YIFA 2UWBA 2WQZC 2D43A 1WLCA 2CYFA 1UX6A 4XBNA 5GZGA 5IK5A 4YZ3A 2UU8A 2UWAA 3POWA 3QLQA 3R4SA 1W0OA 3N36A 2VH9A 2PHWA 1LGNA 1LOEA 2UWCA 5JOWA 4R9AA 2YMZA 1V6NA 3BTAA 1PZ7A 3PVNA 5F5QA 2DVDA 1MS8A 3JU9A 5DZEA 1QMJA 1LEDA 1FAYA 3W59A 3FLPA 1WW6A 1KITA 1WBLA 3LSDA 4LBQA 4YZ5A 1WW4A 1MS0A 4YGBA 3B3QE 4XDQA 5T54A 4AWDA 1G7YA 1SFYA 1S0FA 3A0NA 1G9BA 2B7YA 3ZYRA 1KJRA 1MVQA 4YW1A 5GLVA 3WHTA 1EPWA 4FPYA 2A6WA 2P34A 2SLIA 4U2AA 3L2YA 1LESA 3VKMA 4FPCA 2ERFA 1ENSA 4YGDA 1JUIA 2WT0A 1C4RA 4XBLA 4K20A 2DURA 1XQNA 3WG3A 1NXD1 5JOZA 1DBNA 5KXBA 1JHNA 2ZABA 2VW2A 4XXPA 4XOGA 3UL2A 4AVSA 2PHFA 1Q56A 1GBGA 2WT1A 4FPLA 2GN3A 1N1YA 1QKQA 2EXHA 2GMEA 2ARBA 4XJUA 3BOPA 2DU1A 1QF3A 2OUJA 4CTEA 4JRAA 3RG0A 3N35A 4PCRA 5IK4A 2ZGQA 1Q8SA 1N3QA 5GLZA 2AENA 2ZGLA 1LODA 3AXDA 3AYCA 5IK7A 3V0BA 3IN9A 5GZDA 2PHRA 1OKQA 4YG3A 5FRAA 4YZ4A 4XXAA 5DUVA 1BZWA 1IS6A 1C1LA 1V6LA 3SLIA 4ISRA 4Q26A 1WD3A 3D4KA 1CVNA 5KXCA 2JKBA 1IKQA 3ZSLA 2PELA 1WBFA 1W6PA 1GZCA 2EALA 1W6NA 1BQPA 3OJBA 5GLUA 4FPOB 1CQ9A 3WDXA 4DPNA 2P37A 1SLBA 3AYDA 2ZHKA 2JECA 1V6JA 2R49A 1VLNA 5JOXA 1D0HA 2A7AA 5T50A 2AYHA 1JYIA 4LBKA 1N3OA 1GLHA 1MVEA 4HL0A 3BODA 5SV8A 3ZXKA 3AK0A 1S0IA 1W6OB 3ZSMA 3USUA 1UZZA 2NYYA 4YLZA 1LEMA 4SLIA 4FPKA 4CZSA 1F5FA 1LHWA 5JDBA 4P9WA 3RMYA 5EYYA 2OUHA 4FQ4A 2GDFA 2LTNA 1AZDA 1Q8OA 1GV9A 1LGBA 2ZAAA 4R9DA 3FUQA 4FVVA 1V6KA 3FBYA 1G9DA 1C1FA 3INAA 2D3RA 2W08A 4YW5A 3I4IA 4PF5A 3NV1A 3WVJA 2C5DA 1Z78A 3TB0A 1J1TA 1DGLA 2BQPA 2D3SA 2ZGUA 5IT6A 3V0AA 3B69A 2ZGMA 3RS6A 2AGSA 1Z0HA 2A75A 2ARXA 2EXJA 2GNMA 2ZGRA 4DRVA 1D2SA 2ZGKA 3SH5A 1AJOA 4XJAA 2EIGA 3AZXA 4LBMA 3VV1A 2JJ6A 1H30A 3ILFA 3LCPA 5H9SA 2V5YA 1MZ5A 1QOTA 4UW6A 3C2UA 2R1DA 4BM8A 1RINA 1ULFA 2Z42A 1VALA 2YV8A 4GKXA 5CBLA 1HLCA 2EF6A 1SLTA 2R16A 5HCAA 2ZGSA 4P14A 1H9PA 1SBFA 3VKFC 2A6XA 2WJSA 3RRDA 4FOYA 4XTMA 2D6KA 1G8WA 1WW5A 3N3HA 4Q2FA 4ASMB 4K21A 1JYCA 2HYKA 4K1ZA 3MW3A 2ES3A 1DQ5A 1YRZA 1JN2P 1QOOA 1V6IA 3AYAA 1GZ9A 5E8AA 3N7LA 3ZVXA 2P3JA 1DQ6A 4FOWA 1A3KA 2ZGNA 4M01A 1LECA 3WNXA 1JW6A 1DIWA 1UPSA 2DTWA 4LBOA 1IOAA 4WVWA 2LALA 3MPPG 4XJ8A 2E7QA 4DFSA 4FPEA 4PBOA 4YZ1A 1ZA4A 4FPFA 1YO8A 1GKBA 3LSEA 2WKKA 1MS9A 1OQ1A 1MR5A 2A3XA 1VIWB 4YW2A 2E6VA 3ATGA 1LHOA 5GM0A 3VUOA 3N7MA 3PVOA 3VKLA 2V73A 4CRQA 4Y20B 3RMXA 1LCLA 2CWSA 4YGCA 2ZGTA 3ZXEA 3AYEA 2H0BA 4U36A 2ZKNA 2D7FA 3POYA 4LBQD 2A6ZA 3WZ1A 2OW4A 4XBQA 2ZGPA 3FLTA 2CNAA 2EXKA 3AX4A 2DVBA 5T5LA 5JLVA 4BLJA 1ULGA 4OZXA 3OBRA 1VAMA 1H9WA 1F31A 1S0EA 2G4IA 4Y1YA 3IM0A 5DG1A 2ZMNA 3MW4A 5H9RA 3ENRA 3ZPYA 1S1AA 1Y7BA 1CIWA 2ZMKA 2ZHNA 4LBNA 2DTYA 4FP2A 4M3CF 1JXNA 2R1BA 4GWNA 1UZYA 3V64A 2DVGA 1CPNA 3HMYA 3SH3A 2RHPA 4BOWA 5GZEA 5T55A 4KBBA 1HDKA 3SH4A 4Y26A 4YFZA 1WCSA 1SCSA 3D6EA 2WLQA 3PMEA 4W65A 4YZ2A 3O0VA
chains in the Genus database with same CATH superfamily
1W6MB 2OQ7A 5JXGA 2O14A 4DUXA 4QWNA 1GNZA 4NJ4A 4TYSA 2J7MA 2EAKA 4IL7A 2JDHA 1ALYA 1TEIA 1QH6A 2J1TA 2GU9A 3FC0A 1AR83 2P17A 4XFAA 2OS2A 1PO22 1K42A 1UZWA 1SFNA 3AP7A 4AFAA 2RS12 4KGQA 4QXHA 4BMEA 5KC6A 2R072 3Q8BA 1XNCA 3KGZA 1IKPA 3WW1A 4AG4A 2BOIA 3LPFA 2VU9A 5JIAA 1H8TA 2XJUA 3ILRA 4MV2A 5JVVA 2YC4A 5IVBA 1LGCA 1T2XA 2BP6A 3PUSA 2E26A 3K48A 3BVCA 5LY2A 4CCOA 4RA0A 3ZYHA 3WD5A 4MXWB 3R4UA 3KZ4C 3KLSA 1FOD1 5A80A 2Q8EA 1EV11 1G86A 3N9OA 4WZFA 2P3YA 4OQ8A 3RZLA 4CVUA 1BMV2 3EYPA 1MQTC 4KBZA 4Q5OA 1JBCA 1LHUA 2Q1FA 3SQOA 4QXBA 2Y26A 4XCAA 4AVVA 4EJRA 3UJQA 1SLLA 4QKBA 1UMZA 2ZTNA 4UXAA 1OPOA 4JHZA 3ZSJA 2Y6KA 3NNLA 1U5IA 1K5MB 1KJLA 2WFF1 1RMU1 2UY8A 3VB9A 3AJYA 3F95A 1TMF3 3M3CA 3CKHA 4JDMA 3A23A 5FUPA 3T2QA 1V70A 2HEWF 1GOFA 2ZEYA 3ILNA 3MIGA 4XZPA 1O5UA 3T0DA 4CU8A 1NY71 4ORFA 4A7ZA 4H55A 2VZRA 2B9VA 3UJOA 4W50A 3I2KA 2B46X 1PVXA 1AR62 3C3VA 4ZU5A 1JI6A 4AQSA 2VM9A 3VDDC 3IT8A 5L7OC 2ARCA 2IXCA 4YVWA 4W6XA 4NE9A 3WCRA 4NOTA 3U37A 2J1RA 1AYM1 2IZWA 4LXLA 3WV6A 3NMBA 1DHKB 4GH4B 2BJSA 4JCKA 1S4CA 4B4RA 1NCQC 4XETA 3HQRA 2BW8A 4R52A 3OEBA 2OKXA 4CCCA 4BE3A 3X29B 1W9FA 3N9LA 1W90A 1HRV3 2BNOA 1IS4A 4XTPA 2HWB2 3BKZA 2HWD1 2X5IC 4BQ1A 2IC1A 4FOQA 5E6HA 1OLME 3TNQA 3ZYPA 1OXCA 1MZFA 5JI7A 4E8DA 3IDBB 5K0UC 1RUD1 4LHSA 2B5HA 3TAYA 4JTNA 4DUVA 4PLNA 1SCRA 4EZ4A 2ZZJA 5DXDA 1S2BA 2XHNA 4XHBA 4ATEA 5FY7A 5F3EA 2WWSA 4JKLA 1Z7S3 1PO11 5KHKA 1RUJ3 4GB32 2HKXA 1GMMA 1LOGA 2XLGA 1R093 1W39A 4NHKA 1Y4WA 2D93A 3WLUA 4P9LA 1MS3A 4FT8A 4RS5B 1OBNA 2J1VA 4CYDA 3VD9A 4M4PA 3LE0A 2QTWB 4RR3B 3TN91 1SHWB 2WNEA 3WHUA 5FY0A 4E4DX 1S0JA 5FZIA 4MG2A 1RUH1 3NJYA 5A1FA 5FUNA 3HN1A 4JV4A 3CJXA 4IV1C 1ZM1A 4YFWA 2Q8OA 2DUQA 5T5PA 5GZFA 5FYCA 4LLOA 5FO8B 1I6XA 1OQEA 1RL3A 3THPA 1YYNA 1A6CA 1RTVA 2WS92 4Y5SA 3UESA 1W6MA 1W99A 2C9KA 1VBB3 4FPHA 4DXSA 5I0SA 3S0MA 5IK8A 1GNHA 5DUXA 1R64A 2XBO3 3IMMA 1NE6A 1F4AA 4QX1A 5LK5A 4IEXA 2JDUA 4XFIA 4RFRB 1JU3A 1ZX5A 2FHRA 2R0FA 3E6DA 4CDQC 3PURA 4C1WA 1F9KA 1LTEA 3OPWA 3LQCA 3BOWA 4GKYA 5IWFA 3VZKA 2AACA 2RR11 3PJQA 3KGLA 2RJKA 3CO2A 1AR82 2Q0AA 2W47A 4WVVA 4DB5A 3BGAA 3ZN5A 2PHTA 1W2TA 5FJKA 1H2LA 1UYYA 3ACFA 4I0BA 1ZBA2 4M3CE 1WMEA 4MXWA 3WP3A 4QPWA 4A4AA 1L7QA 5JCTA 3WDYA 1KDKA 5FY8A 2XJVA 5DZFA 2JDZA 4BWOA 4OUSA 3BIWE 2BGPA 1AYN3 4ATFA 2PHUA 1K5MA 3M70A 5A7SA 5DABA 4RL7A 4J25A 2NM1A 2VZVA 2YPJA 5CG8A 2LUWA 3WF3A 2QQPA 4JDOA 5FYTA 1PIV2 4B1MA 2B9UA 1PHMA 1IQAA 1HN1A 4A45A 4HANA 4P5YA 4HVQA 5LA0A 1PZ9A 2PHXA 5CG9A 1HX6A 3M3OA 3TYJA 4DIQA 2J1UA 1TMF2 2WRAA 4ZU7A 4ZXKA 4OI2A 4AAXA 2AUYA 1LU2A 1W2AX 3MW2A 1COV3 1IZ3A 3PUIA 1PM7A 3VD7A 2WT2A 5L73A 3HQXA 2DWRA 3D82A 4GH4A 5FMBA 1W3VA 4YW3A 2BTVC 2VQAA 4KNCA 4XUQA 5HI0A 1W6PB 4XAAA 2JE9A 4XILA 4DY5A 2HBUA 3I49A 4MHRA 1BKZA 1SACA 5AC92 4BQXA 1DLLA 4I3GA 2A71A 4EYUA 3I2FA 5L9VA 4I3PA 2JG9B 2ZHMA 3OF1A 3ZFEB 4D69A 5L36A 4Q4W3 1HRV2 1O3TA 1Q3EA 1VE0A 5C70A 3ZMNA 1HQLA 2E33A 5LCWL 1U0AA 3AMMA 4CDUC 4QKDA 3WG2A 2D44A 4KI5M 2JDAA 5A33B 5I8SA 4BPZA 2HWF1 2YXSA 2D6OX 5KBFA 5T5JA 1HB1A 1UL9A 2CTVA 2VZOA 1ULCA 3POIA 4NRPA 1Z7S2 4GJZA 3P3NA 3WDVA 5EZWA 4Z8BA 4RS5A 5C7GA 4FFFA 1H4HA 4LO6B 3U75A 1L7RA 4RR3A 1R092 3D8CA 5KXDA 3M2MA 2C6SA 4FSJA 1WLWA 4GAZA 4QKFA 4BMBA 3U07A 5T3NA 3KQ4B 2EVXA 4ONUA 3WQ7A 5J3UA 1MZ6A 1WUVA 4IE7A 1Q8PA 3SNMA 4NROA 2KR2A 3OEAA 4A41A 3LIGA 5DAPA 1JYNA 1GSLA 3A22A 1X50A 3WDWA 4RYDA 3VBSC 1QOSA 3PIJA 2BWCA 5JXJA 1RYYA 2D43A 2E63A 2YBSA 1UX6A 1BMV1 3LOBA 3ZYIB 4DZGA 2OZ6A 3MZHA 3MF9A 3R4SA 1W0OA 2WZR3 4AEMA 4MOAA 2X10A 3GZTB 1RUC1 3PNAA 3UKTA 2R063 5FMOL 3SCGA 1ULPA 4CDXC 1LGNA 1YUDA 2UWCA 2XBO2 3BTAA 2DVDA 1MS8A 2KA3A 5EJ3A 1QMJA 4QPIC 1ND3B 5FYSA 3VHPA 1Y43B 1UU5A 4LIUA 3LZZA 1WW6A 3TWIA 1RC6A 3KHCA 4WM8C 3BB6A 3VBUB 1WW4A 3HAGA 4LR4A 4KG0A 1MS0A 3B3QE 1TE1B 3WEZA 1FT9A 3G6JB 1A34A 3A0NA 5BNOB 2C1FA 1XNTA 2B7YA 5LATA 5GLVA 3U11A 1YHFA 3KCYA 1EPWA 2A6WA 3KF5A 4B7EA 1ZRFA 4HVOA 3KV6A 3OGSA 4UT5A 3L2YA 1D4M2 2MEV1 2YU1A 3KHBA 3VDBA 1J59A 4YGDA 1JUIA 3NNMA 4CEYB 2VNOA 2QQUA 4SBVA 4TLFA 4P02B 4W6WA 3DEMA 3KCCA 4OCTA 1ASJ1 1RXGA 1K12A 2VW2A 3WNOA 1LAJA 4BQ2A 5A7QA 3FE5A 1UYXA 1M06G 3VBOC 4XJUA 1OOPB 1U5XA 3MIBA 4FFHA 3ZFFC 1GZTA 1GU3A 4XF0A 5E1RA 5FWJA 3C7EA 3CL1A 3ZYFA 5HPOA 5CFCB 1MPXA 2ZGQA 2PHDA 2VZUA 3LDKA 4IE0A 1GWMA 2ZGLA 4QPGC 5FZHA 3IN9A 4EWEA 3E97A 3DV8A 2IWGB 2VQUA 5FZ9A 4XXAA 1C1LA 3SLIA 3J7LA 4IGPA 4JKKA 3D4KA 3GCXA 2JKBA 1BBT3 3RZKA 4Q4X1 4HKLA 3ZSLA 1COV2 1W6PA 1GZCA 4AHXA 4URAA 3NNJA 3MV01 3OJBA 4FPOB 3B94A 3KCXA 3O1UA 3DXTA 4OHWA 4CXYA 2FDGA 3OGJA 4RSUA 4Q4Y3 3IAQA 1SLBA 4ZZ8A 1S2EA 3AYDA 3VD4A 2JECA 2JG9A 3NNGA 1KFXL 1D0HA 3NAPB 3ZFEA 4CU7A 1HV1A 4HT1T 2IVIB 2AYHA 3ME2A 3VBHC 1JZ2A 1PGL2 3NSTA 1QJX1 2OXBA 4HL0A 2PFWA 2CDPA 5SV8A 4D7TA 3LDBA 4YW6A 2RM21 2ZJCA 3ZSMA 3RJRA 1UZZA 5A33A 2VOKA 4LUKA 1VBE3 3JQWA 4BIFA 5JDBA 3RMYA 4ZZ5A 5EYYA 4HG6B 4LTAA 1JHJA 3WF4A 1KD7A 3HD8B 3U1XA 2D3RA 5JXIA 2YBPA 4YW5A 1HQNA 3WVJA 3H8OA 1EY2A 1CAVB 2VPVA 3NV1A 4RD7A 1DGWA 1Z78A 4B4QA 1QXPA 3GZEA 4QDQA 4P9JA 3DKWA 5IW0A 5IT6A 3FMGA 2W1WA 3B69A 5JMOA 3O1SA 1F5JA 4LUMA 5FZ8A 4PIXA 2EXJA 2A75A 3ZDSA 2GNMA 4DRVA 1D2SA 1GWKA 3PU8A 4K40A 5FPUA 3SH5A 5ABJB 2H6BA 2YFZA 1MZEA 1SQ4A 4MGSA 5D2AA 1VRBA 1NCRB 2JX9A 1RUF1 1WA6X 4LBMA 4RQPC 3W5NA 1H30A 3ILFA 5G04L 5CZKA 4BK4A 2VNVA 3K51A 4PDWB 5D8AB 1PO13 1VALA 3RZZA 1AL21 4GKXA 2YGLA 1HLCA 1ND3A 1PIV1 1SLTA 1J1LA 1W04A 1TG7A 2EF6A 2ZGSA 3EO6A 5FK8A 2IUWA 5A7WB 2HWE2 3RRDA 2QKDA 2D6KA 1WW5A 3MV11 3MDPA 3I2GA 2G9GA 1JYCA 4K21A 5BNOA 1JN2P 1V6IA 3AYAA 4BZ4A 3WSOA 3OB8A 5E8AA 4XAEA 1DQ6A 3WNXA 4RHV3 1UIJA 3IB3A 5FZGA 4AI8A 4OUEA 1IOAA 2RMU1 4CEYA 4ZHNA 3I3DA 2Q8CA 1ZA4A 4FPFA 4W6YA 3LF7A 2VJXA 2JENA 1RUE1 4NHXA 4N8MA 3LSEA 2WKKA 3KVBA 1UW8A 3I59B 2VOXA 1PVC3 4LHKA 1OQ1A 4Y4RA 1MR5A 1W8ZA 2QBXA 1VIWB 5CYYA 5APAA 5BUVA 3ATGA 1OOPA 4CCDA 3N7MA 1X82A 2RR13 3MFAA 4OFGA 2KXLA 2GC1A 3BU7A 3MIHA 4X6QB 1XYPA 3HT1A 3RMXA 2MPFA 4YGCA 2ZGTA 1GFF2 3AYEA 3DKQA 1MQTB 2J1SA 3NO8A 3KF3A 5K8SA 1VBD3 2OW4A 2DCYA 2H6CA 2VTXA 1VR3A 3ZKUA 2WZ8A 5FBJA 2I74A 4BCUA 3K4DA 5BNPC 2WIIB 2VUCA 3KVAA 2YC2A 4E4HA 3PIGA 3K2OA 3S7IA 4J1XA 4GZ9A 3ZYGA 4HN0A 4Y1YA 2K2SA 2XWJB 4B3NA 5F39A 3ENRA 1BBT2 1S1AA 5EIYB 4GMP1 2ZHNA 3QACA 4QGMA 5LA9A 1VRH2 3DYOA 2QDNA 3ALQA 4HMZA 4UFHA 3PMSA 1UY1A 4QX2A 3NAPA 5I0DA 5FP7A 5FZCA 3VD3A 4YFZA 3SH4A 4URTA 3RYKA 1WCSA 2HEVF 3VDDB 4Q4Y2 5L7OB 1AR93 4BK5A 2B39A 3H8RA 1PK6C 3O0VA 4XJWA 5E89A 5FPAA 3RWKX 1DQ0A 5FO7B 4PT6A 4Q4V2 1W9SA 2PMWB 5KHGA 5T52A 5AVAA 3UK9A 1AX1A 1NCQB 1DU3D 1S0GA 4IEOA 4PQ9A 1QJY1 4A42A 4M4RA 4N43B 1H4GA 3KV5A 5C3QA 1OURA 2A3YA 5IVEA 4N53B 3MHZA 3CHXA 5C71A 1MS5A 1V00A 1J3RA 4I01A 1C28A 4R8HA 2YGMA 3ZIXA 1RUG3 1ENRA 5AFEA 1JU4A 1VBE2 3GBFA 1RJ7A 2H0VA 3CBNA 5K0UB 1LHNA 1CAVA 4K9SA 4BIOA 2QQOA 3N9QA 3IAPA 3VBRC 1V6MA 4XYXA 1ULEA 5E88A 4DEQA 3FN9A 2QQMA 4M0NA 1DCSA 1DQ4A 2WL1A 1AXZA 2OIIA 2ZACA 2ZEXA 1CESA 2WA3A 1KQRA 4Y5Z0 4JHTA 5ABJA 4LKDA 1CR7A 2ZGOA 3U4SA 5BNQA 3GJBA 1GWLA 1NCRA 4GA9A 1EAH3 3IPVB 1BCXA 1CZSA 4OLLA 4PDWA 1XSQA 2JD4A 5D8AA 2QQKA 1W03A 3ZKYA 4Q27A 1BYHA 1TZOA 4Z92B 1WLDA 2WNUC 3C8XA 1UYZA 2W1QA 2XXZA 4QHZA 5LB6A 4IV1B 2ZMLA 4MXVA 5ERLA 5BXXA 2P4EA 2W1UA 5A7WA 4AF9A 1SPPB 1CN1A 3AKQA 3MUY1 2I2SA 1C5HA 5J36A 2AREA 2VUAA 1OMIA 2W92A 1UAIA 1U12A 1W06A 2VTXJ 4QDSA 4QQOA 2R32A 1TME2 4G4FA 2A6VA 3HOBA 5FZAA 1JODA 4Z2WA 4WVMA 4Q0UA 4CDQB 3ZN4A 2MNGA 2RVAA 2OQ6A 4Y22B 4ASLA 2ZHLA 1F2NA 4LO4B 1FV2A 2NN8A 2TEPA 3FFZA 1Y3TA 2B4KA 1NZCA 2PLV1 3P1IA 1XE7A 2CL2A 5CA6A 2HLEA 2CY6A 1DQ2A 1RUC3 2VNRA 4OQ9A 2EIDA 2GNTA 4CEWC 4AI1A 1R1A2 3ACGA 2R7EB 4CUBA 1VBA3 5JR7B 5C8CC 5DUUA 5K7PA 1F8VA 1UKGA 4HK8A 2VMEA 4YGEA 1UMIA 1I1EA 3VLBB 1PVC2 2D6NA 2RJLA 2XB6C 1AJKA 5F3CA 1EUUA 2BRTA 2Y34A 4YM3A 1MQTA 4D7SA 3ETQA 5K9YA 4OHZA 1IS3A 1CPMA 4XJ9A 3SC7X 4N9IA 2DCKA 3SMHA 4Y1UA 5EWSA 4YVSC 4PIZA 5JMCA 1ZVFA 2ZCWA 4Y1VA 2P3KA 4CPBA 1O91A 3EJKA 4QQPA 2X29A 4KWLA 4AW7A 2RS51 2EXIA 3BALA 2XH6A 3I3EA 4XURA 1JYWA 5FP8A 1UY3A 3WNMA 1IQDC 1DGRA 2MEV3 5T5OA 1HXS3 1V9U1 1SMVA 3PDQA 1W6QB 3DUIA 2Q1ZB 5BNNC 5CVRA 4FCAA 2JWPA 1GQHA 5C9AC 3T4HB 4EWAA 2DV9A 2QVSB 3VDDA 4ARYA 5L7OA 2EICA 4BISA 1I3HA 1OUXA 2AR6A 1DDLA 2WAAA 1PMJX 3WOGA 5LEKA 4P5HA 4NIDA 2VMDA 1KRIA 4AYUA 3J8F3 3AMHA 4AR2A 1GR3A 3BTZA 1NCQA 3I8TA 3AZYA 3POSA 3JBG3 4N43A 1E5RA 2R6QA 2DUPA 2JG8C 1FNZA 2Y6JA 1NX9A 3RI8A 4NVPA 4KMQA 3W58A 3AFKA 1GICA 2Y6FA 4IXLA 5C3PA 4XDPA 2BU9A 3GALA 2BFUS 2I45A 2JDNA 5FZ1A 5DPNA 2X5IA 5FCCA 3E6CC 4DINB 3HNBM 4EE2A 3PUAA 1UYPA 1YEWA 2GC3A 5K0UA 1FPN2 4XC9A 2A70A 1UMHA 4BU2A 4UW3A 3POEA 1EYBA 4AGGA 2W0XA 1C8M1 1APNA 5JPNB 4XMAA 5DDJ1 1AX0A 1PNFA 5LBCA 4AI9A 3O0XA 2OYZA 4CDUB 5LEJA 3GXUA 1LHVA 1Q8VA 1XSRA 2VR4A 4NPLA 4ZKTB 2HWC2 3NKGA 4XCBA 4ZS2A 2JDPA 2A3WA 3WG4A 1A8MA 1QNWA 4EWDA 1DQ1A 4FPJA 4UBHA 1RUOA 1XNBA 1OPMA 4Q0QA 1CAUB 1QQP2 2VZ1A 3IPVA 3KD4A 2W52A 3T2TA 3D3AA 4LT5A 2WQ8A 3ZIWA 1I9RA 5ISLA 5ACA2 1XPWA 2BZDA 2PTMA 4NPMA 2NP0A 3ABZA 1DYPA 4BB3A 1EAH2 1RUI2 4AI0A 2YYOA 3CF6E 3AM2A 4IERA 4KWJA 3POFA 4IV1A 1CJPA 5C4WC 1S0CA 5FZ4A 1BEV1 4CP1A 4TSVA 5FP3A 1SPPA 2P3IA 3HR9A 2XVLA 4DXZA 1VBC2 4FP3A 3GBGA 3MO4A 4LPLA 3VBSB 3ZXJA 2PHLA 1UIKA 4QX5A 4Y1ZA 3LA7A 3JB8A 4XIKA 5D1IA 4GMP0 4ISQA 2VBBA 1UZVA 3MLJA 5GLTA 4C1XA 2JB8A 1ZYBA 1B09A 1Y9MA 1RVF3 3HIFA 5EV7A 4XZUG 4A3XA 2Q1MA 1K5JA 1N1TA 4FOVA 4CDQA 2C9AA 5KR7A 3H1YA 1LJ7A 2VOVA 4XMIA 3QD6A 1CZTA 1UOJA 1YCIA 4Y22A 3VBFC 3RZHA 3WP6A 2WQ4A 3ZR6A 1EPZA 1HW5A 2ENRA 2ET7A 3AP4A 1HQWA 3JZVA 2OA2A 4NO4A 4Y5TA 3KWVA 1X36A 1MS1A 1REFA 4WM8B 4WV8A 3ZMOA 2GH2A 4PI0A 1ULOA 5A6ZA 4AGRA 2FMDA 1HKDA 1G6NA 3AMNA 3OPZA 2PAEA 4JVAA 2Y6HA 4I30A 1AL23 3AKRA 3EHKA 3QBQA 3ZXDA 4W8JA 2ZZQA 2RS31 1NQDA 5A6YA 1JOJA 2VW1A 1YIPA 1DZQA 4BLIA 3UGHA 1ULDA 3AZZA 1W3XA 3H50A 2A73B 3SISA 1VBA2 5FPLA 2GN7A 5CIRA 4INDA 4XACA 2DDUA 3MPBA 4CCMA 2JDMA 2WYFA 1O4YA 3JQXA 4OMDA 1CD3G 5CAZA 4FFGA 3IDEA 4YM1A 1VJ2A 2K9ZA 3BPSA 1SBDA 4L11A 4PF1A 3RQ0A 1PGSA 2GSYA 3P6BA 1FMD1 3UETA 2VVFA 3VBOB 1ZZBA 3M3QA 1GP5A 3VKOA 3WNPA 2FD8A 3MEPA 1W6QA 3ZFFB 3FHQA 4DXRA 4ITCA 5FREA 3UNPA 5CNAA 2DYCA 3A7QA 2F4PA 4TTGA 4P9IA 1TQ5A 2GMMA 2ADEA 4QPGB 1HXS2 3H3ZA 2VZ3A 1UN1A 4AVTA 1O3QA 1JH5A 5FLJA 2IXIA 2JDKA 3WDTA 1S0DA 5FYUA 2LW8A 2UWBA 4YPJA 5JR2A 1AHSA 4X8PA 5C6CA 3IDAA 4LHNA 3VHOA 1U5YA 4YZ3A 2UU8A 2UWAA 3POWA 5A3TA 3QLQA 3CIHA 3OUIA 2XUEA 4V2VA 2GZWA 4QGNA 2WWUA 1DGRN 1WWYA 3N36A 1KFUL 5FP9A 2PHWA 3J8F2 2XL7A 4ASKA 1WA4A 5JOWA 1F4HA 2B42B 3IIAA 3JBG2 1OH3A 5DZEA 1GP4A 1REEA 1LEDA 1FAYA 4CPBD 4YZ5A 1KITA 1WBLA 3KSCA 4COVA 3WW2A 3VBHB 1E5IA 1JZ4A 2P6CA 2G1MA 2FQPA 3FL7A 5T54A 3BTYA 1OA4A 1G7YA 1S0FA 3BPZA 2JIGA 4OHVA 4CDUA 1G9BA 3ETPA 1MVQA 2XPJA 1QJU3 4FPYA 3J4UH 3HBKA 2ARAA 4OYUA 4U2AA 4IGQA 2W94A 1CAUA 2FZ2A 3UYJA 3VHNA 2WT0A 4HFSA 5A3OA 1H1IA 4O9GA 2D97A 4LLFA 5A7NA 1ODMA 2FBEA 5JOZA 3FHIB 5JWPA 1JHNA 2ZABA 1QJY3 2QQJA 2BOJA 3H8UA 4HOOA 1US2A 4WM7C 2XUMA 5FWEA 3UL2A 4PLOA 1GBGA 3ACHA 2TUNA 2WT1A 2VECA 1RHI1 3AL6A 1CX4A 4FPLA 4OVEA 2GMEA 1WCQA 2O8QA 3VBSA 5BV6A 1XJAA 4CTEA 2FDKA 2YFUA 3RG0A 1R081 2P5BA 1PX3A 4IEUA 1HRI3 1N3QA 1V0AA 3GGLA 2AENA 3AXDA 3NJXA 3TEWA 2J42A 1IHMA 1OKQA 3NQHA 4RQPB 4OUMA 5DAWA 1MEC1 1V6LA 4ISRA 3VD5A 4Q26A 3PLQA 1IKQA 5CISA 3H8XA 3D0JA 2PELA 3KMHA 1TNRA 4OHYA 1RVF2 2CHHA 3R6SA 4NUBA 5FYYA 3U78A 4UBGA 5JSPA 2K0GA 4IDZA 2LS6A 4WM8A 1UU6A 1X8MA 5A3UA 1O3SA 2E31A 1NXMA 3HBZA 3S6PA 1ZBE1 5IAXA 2VQTA 1QJFA 2R041 2WR9A 4HSLA 4AFMA 4E2GA 1D0GA 4AHYA 2ZEZA 4Q29A 5IVFA 1N3OA 2BDRA 3WNNA 5F5IA 3O1TA 3H7JA 1GLHA 3ZSEA 3BODA 1WGPA 5FZMA 3DXUA 3Q8FA 3E5XA 1X8EA 2YHJA 2PYTA 4Z1VA 4CZSA 2VL4A 3NVCA 5DAVA 4G3YC 4P9WA 1PMIA 1XU1A 4K8RB 2RG4A 2LTNA 2QNKA 1AR71 3M4FA 4CA9A 1LGBA 3VBOA 2VMFA 1V6KA 2QZ2A 4XDOA 5BY5A 5GKAC 2XDVA 3OBAA 3ZFFA 1BVVA 3AVRA 3INAA 5KHHA 2O8OA 3UGGA 3I4IA 5DAQA 1O5LA 2VXJA 4BQ3A 3LEIA 2C5DA 5IYYA 2PLV3 1J1TA 4CUGA 1DGLA 2BQPA 2D3SA 4QPGA 2V4AA 4Y4YA 3DYPA 4BQ5A 4AAPA 4IUGA 2ZGMA 5A7OA 2HWC1 4IEWA 3RGBA 2XLFA 4RFT0 5F2WA 1PO21 4CCEA 1JS9A 2ZGKA 2RS11 1AJOA 5J1XA 2R071 4XJAA 2XGXA 3LEMA 4V1PA 1RUJ2 3H7YA 1L7LA 3VV1A 2JJ6A 3R4DB 3LCPA 1IPSA 5ACA1 3USSA 2V5YA 2VUDA 3IBMA 1IPJA 3SCHA 4BM8A 4I0AA 2NQYA 2ZXQA 2YV8A 4PQQA 3H1MA 4CP0A 2Q8DA 4CUAA 4S2HA 4IE4A 3EBRA 5C5TA 1VBC1 2RS53 3VBHA 1VPHA 4FOYA 1QXRA 5JZGB 2FCVA 4PLMA 1PK6B 2RDNA 1NA1C 1V9U3 4S2DA 1QOOA 1YRZA 2WA4A 3E5QA 4W4ZA 4HN1A 4MVTA 3N7LA 1HV0A 1VBB2 2P3JA 3B5LB 4FOWA 5CKQA 4M01A 4IE5A 3SXWA 3OD0A 1VB4A 4IV3C 2GC0A 1VP6A 1XE8A 4LBOA 5J98B 2ZS6B 1D7PM 4XJ8A 5I8YA 2VMIA 4FPEA 2VCBA 1X9TA 1QJU2 1NAEA 3WR0A 1YO8A 5L9RA 1ZA7A 4LMFA 1K45A 2CGPA 2Y60A 1QH7A 4RGKA 3VBRB 1AR61 2JXAA 2BV4A 2WFPA 1UF2C 4XABA 2CAVA 4LQRA 2CSGA 4YW2A 2E6VA 5LY1A 3VUOA 1W05A 4F7ZA 2V73A 3OGVA 4NPRA 5FAXA 3FHAA 2CGNA 4L97A 4X8NA 5FPBA 1NE4A 2WABA 3HNMA 3JD73 5A32B 1IG0A 1RJ8A 1XE0A 2H0BA 2VG9A 3I54A 4FFIA 4RQPA 3POYA 4U36A 4NRMA 5EQUA 5FLIA 3RWNA 2B8MA 5DDJ3 1UO9A 1HRI2 4MSVA 3FLTA 3ZLIA 2CNAA 4JKMA 3ZXAC 3HEIA 2HWB1 4BLJA 2WNUB 3ROUA 5FZDA 1AYN2 4F3JA 5DG1A 3OCPA 3IM0A 4NAMA 3AKSA 4KWKA 1Y7BA 2QQNA 1CIWA 1H6YA 1PGW2 4UOJA 2ZAHA 2EIEA 3J7NA 4FP2A 4LJHA 2R1BA 2DBNA 3SH3A 5JIUA 2GP3A 3QH7A 3N9PA 4TWTA 1UKRA 3GYDA 3LDRA 4GB31 3MIEA 5FOBB 2QQIA 2WLQA 2IFRA 1GOHA 2P6HA 2VVEA 4MZUA 3TEYA 2VGDA 2X8KA 2Y33A 5FMCA 3DF0A 3JB4C 1JYTA 4XHXA 4KGGA 3CJIC 4QX0A 1FOD3 3H3UA 4XQWA 1EV13 3IDCB 4Y1XA 3GNEA 4IW3A 4M00A 5FTTC 3CZUA 2X05A 3VL8A 4JC1A 5FOJB 1VMHA 4AQ6A 1YXWA 3N7KA 3ZPOA 2ZX3A 4YNIA 1RB8G 4CEWB 2WFF3 3GJAA 3LKJA 1WD4A 2BWAA 3WT3A 1OT5A 1RMU3 3I2DA 1AUYA 4KQ7A 1ND2C 2WS91 4ZONA 4AVBA 5C8CB 1ZNPA 2AZ5A 4A7KA 2E51A 1VAVA 2ZA9A 1TVGA 2ZX0A 4O9EA 4NIAA 4FTEA 4N90A 4Q4W2 1UCXA 2PAKA 3OYWB 2HBTA 4HPKB 4NR1A 1UOFA 3M3EA 4DUWA 2WO7A 2YZ4A 4FO9A 4FQZA 5CFDC 5JSOA 4Q8LA 4YVSB 4BH9A 3DPRC 4QHOA 1HJFA 3HT2A 4EN6B 5C5UA 1Q8QA 3B01A 5GALA 2RS33 1AR81 1AYM3 2WNVC 1OD3A 1W9TA 1LRHA 3JUUA 2QZ3A 4BQ4A 2OPKA 3N4MA 3MIDA 3T1LA 1IPKA 2QJVA 5BNNB 2AH2A 4FTBA 5J48A 4WZCA 4Z07A 2OVUA 4K6BA 3ZR5A 1ZBA1 2QQLA 3C7FA 1WLTA 5C9AB 1N3PA 4NHMA 3QOPA 3N9NA 1DZRA 4I02A 4LOTA 1DLCA 2HWD3 3GZUC 4FXGB 4QQHA 3VDAA 5JZGA 1AX2A 1PK6A 2JDYA 2IXHA 4CCJA 2YY1A 1RUD3 3NV3A 2Q5TA 3K77A 3B00A 5FZEA 2BGCA 2DUOA 5F6LB 1W8HA 1BHGA 2JG8B 2WSUA 3LIHA 1KS5A 2W39A 2VOTA 4HKWA 4QB2A 5FZLA 3SITA 3W5MA 4Y3OA 1IS5A 2WZR2 4HSJA 1XRUA 2D6LX 3I97A 2R062 4PBPA 3RVHA 2C0ZA 2YUEA 5F6KA 5F8PA 3DGTA 3KT1A 1UXXX 1HJGA 3PTRB 1TMF1 5F2SA 3M1HA 2VY0A 3VBRA 4JDNA 2JEMA 1POV0 3O12A 3TN93 4TZDA 1HIXA 3T2PA 3H0OA 4AEKA 3GZAA 3OBZA 4QMAA 1RUH3 3C7OA 5TSWA 3WXPA 4GALA 2XJRA 1FNYA 1KEXA 4WVMB 4YWAA 2PQQA 5EJ1B 3RI9A 2VZPA 2Q4SA 3Q8AA 5A32A 1F35A 5CKNA 3P5BA 1O3RA 5FYMA 4UW5A 1SFPA 3PVBB 5AC91 5IJRA 3JD72 4R9BA 2AEZA 1S0BA 2QCSB 4BA6A 2WNUA 2WC2A 2C26A 3AC0A 3CLPA 5KC5A 5C4WB 2LRPA 2ORXA 3AP9A 1O4ZA 4PHZA 1LNSA 4UW4A 1HRV1 4AGVA 1NT0A 4HBNA 1W8TA 1OHFA 4QU2A 3WDUA 1ZREA 3WW3A 4YW4A 5H9QA 1A8DA 1VB2A 1G9FA 4UI9L 5H9PA 4M3CB 4QB1A 1UOGA 1UU4A 3WW4A 3ZXFA 4BXSV 2NLRA 1RHI3 1HN0A 4JZRA 2DVAA 1Z7S1 3O5SA 3VBFB 4YSFA 1YJKA 4XEZA 1BXHA 3T1MA 1UOBA 1ENXA 1R091 4GJYA 2V5DA 4XIOA 5F5CA 1W28A 3BI3A 1NUKA 2BBAA 1W2NA 3OGGA 4CU9A 3IKWA 2ID4A 1FOD2 3MF6A 3NV4A 1EV12 3GBWA 4R4ZA 1MEC3 4MLOA 5C33A 1BVP1 3RFRA 4CEWA 2RDRA 4E27A 4JGYC 4MX3A 4XQDA 5C8CA 2FCUA 4CCKA 1ZZCA 4B4PA 2Y6GA 4AFBA 3AXEA 1J3QA 3N9MA 2Y38A 4IESA 5FPVA 2HJIA 1UZ0A 3GCWA 1RMU2 3OYWA 3KM5A 1AXKA 1QY4A 4HPKA 1DYKA 1ZBE3 1YQ2A 2CAUA 4LO8A 2R043 4YVSA 1FI2A 1JTZX 2XBO1 3M8LA 1NY72 1BK1A 2P1BA 5GLWA 5A1LA 1PMHX 2VMCA 2GNDA 4L8QA 2X5IB 2ETEA 4F83A 3LD8A 1RITA 1XNAA 3I3QA 4H2AA 4ARXA 1C5IA 2Y6LA 4O61A 1LU1A 1LOFC 4R9CA 1Q43A 4MH0E 5BNNA 4EN7B 4JTOA 1VAKA 4IEVA 1QNYA 1AYM2 3FWEA 5C9AA 2VOWA 1CWPA 4I09A 4I0WB 3D5OA 5EXOA 5FZKA 4XUOA 5IHRA 2R30A 1OLMA 1FX5A 1AR73 1PZ8A 3ZSKA 1IG3A 1QXJA 5A1AA 1X9PA 3ES1A 1D4M1 2QUOA 3OTFA 1RXFA 3WQBA 2HWD2 5JOYA 4J6GA 3V0BB 4A2UA 5EFUA 5LRSA 2JG8A 4HLTA 2KM2A 1X7NA 3K46A 1CZVA 1OA2A 3AMPA 3APBA 4AQ2A 1QJZA 1RUD2 3AZWA 4LE4A 1EP0A 4MGKE 5F3IA 3VBUC 1SLIA 2JKXA 1WCDJ 5A70A 4L9BA 2HWF3 1PO23 4E8CA 3OD4A 1YJLA 2RS13 4OZOA 1W9WA 3TEXA 1W6NB 4Q1PA 2Y8KA 4D6QA 1PO12 1A78A 3NW4A 5LA2A 1PX4A 3IMNA 5J7MA 2WZEA 1C57A 5KHIA 1J84A 3KT7A 1ONAA 3CU7A 4LA3A 5FKBA 4XE9A 2EAAA 1SEFA 4CXWA 4UFLA 3ES4A 3JCIA 2NMNA 2NMOA 2PN5A 4D6RA 3FX3A 1JMUB 2FZ1A 3M3IA 3POJA 3TN92 1QDCA 5D21A 4CSWA 3MICA 3O1MA 1COV1 3O14A 2GNBA 1CONA 1RUH2 3R05A 1OC1A 5LW9A 5DQ0A 3CQOA 2VVDA 4RHV2 2XWBB 3USUB 2GMPA 4D3WA 1LULA 3PU3A 1LOAA 1FYUA 1W8NA 5FMOS 4CXXA 5CFCC 3F2ZA 3Q9OA 4WM7B 5FZ3A 5L9BA 3OPTA 5C4WA 3HJRA 1NLRA 2CU5A 1H2KA 5EHDA 4QX3A 3PL0A 1PGL1 5FXXA 3A4UA 1GQPA 2D5FA 3ZFGC 4LBLA 4AFCA 1BK0A 1OI6A 3K3OA 2DU0A 1B35C 3CEWA 5FXVA 2RR12 3MUZ1 3N7JA 3V0AB 4M3CA 2DCTA 1STMA 1LOCA 1XNDA 2YROA 5DZGA 1UY2A 5FZ6A 3VBFA 3HN3A 2CYFA 5GZGA 5FZFA 5A6XA 1VBD2 2WO2A 2XVKA 4EN9B 1PM4A 2J1EA 4C90A 1SZBA 1HB3A 3GHNA 3I2HA 4QPYA 2UYBA 4D7YA 5FY9A 1LOEA 5IVJA 2D40A 4MO3M 2YMZA 3SKVA 5I8TA 1V6NA 2HH9A 3TNPB 3JU9A 3POBA 1ASJ3 2HWB3 3W59A 2C4XA 1UWWA 3FLPA 3LSDA 4C8DA 2BVBA 2WAOA 1D4VB 1DYOA 5CEHA 3RZGA 4Z2AA 3I7DA 2DF7A 3W9AA 5JI9A 5K4LA 1AR92 3B93A 3ZYRA 3JXSA 1ZRDA 1OLRA 2ZX4A 4BYYA 2CV6A 2SLIA 5FPXA 4NWWA 1GP6A 3VKMA 4K3UA 4CDWC 1ENSA 2VCMA 4GIQA 4PJYA 4OI0A 4JAAA 3HQUA 4Q4X3 3HNYM 4LO7A 3SEEA 3M7AA 2HWE1 4K20A 2F4LA 4H3WA 2XONA 1E5HA 5KXBA 2CDOA 1RUG2 4XXPA 5EP9A 5HCHA 4XOGA 4AVSA 4B1LA 2PHFA 1Q56A 5JSRA 4I2OA 3S7EA 3ST7A 1E57A 1QKQA 2EXHA 1OLQA 2ARBA 2W95A 4A3ZA 4L0PA 1QF3A 2OUJA 5DMYA 2YG0A 4AXOA 3CDZB 2PAMA 3N35A 4PCRA 5IK4A 3E5UA 3GHMA 5GLZA 2WS93 1LODA 1O8SA 4QKNA 1RGSA 3V0BA 1QJX3 3D0SA 5FRAA 4YG3A 4YZ4A 3H42B 1BZWA 5CKMA 2RM23 1WD3A 4N9HA 1CVNA 5ANNA 5KXCA 1XYOA 3T30A 4FAHA 1XU2A 4LITA 5DN2A 5A3NA 1W6NA 1OVPA 4O7XA 3G7DA 3ZM8A 1CQ9A 2ZEWA 3WDXA 4DPNA 2HWF2 2VC9A 1CAWB 2G9ZA 1NA1B 1V6JA 2R49A 1VLNA 1W8FA 4QX7A 1W0NA 2FCTA 4HONA 1L3JA 3ELNA 4XQ4A 5LBBA 1ZBA3 5ANQA 5T50A 5EPAA 4CDXB 2DCZA 3BTXA 4MADA 4E2QA 3TBDA 4IV3B 1MVEA 4HVRA 4QT6A 4EN0A 2ORZA 5FLHA 3AK0A 4NWVA 1YQ6A 4TXWA 1W6OB 4DOUA 4QPIB 1W2UA 1BBT1 4JX0A 4RN5A 5FPZA 5FZOA 3USUA 1LEMA 1OUSA 5FV3A 1J83A 1VRH1 2QQVA 1RUF3 2V72A 3C7GA 3RNSA 1F5FA 4NN0A 4AEDC 4NIHA 2VMHA 1WCKA 2EIBA 2WO3A 4WM7A 3THDA 2OUHA 4FQ4A 2GDFA 5FKCA 1OVSA 3NRUA 2TNFA 1Q8OA 1GV9A 2Y0OA 2JICA 2ZAAA 4JGZC 3WF1A 3FBYA 4NRQA 4Q4Y1 3NNFA 5FO9B 1RUC2 1C1FA 4AE2A 2W08A 1PIV3 5LA1A 3OUJA 3TB0A 2IXJA 4Q4V1 2VQ0A 1ZRRA 3BIEA 2XMLA 2ZGUA 2CGOA 3V0AA 3UKNA 5JPMB 3OSDA 4KU7A 4UWDA 5I0TA 3RS6A 2W9XA 1CIYA 5FUIA 3WF0A 2ARXA 3R0RA 4ZY9A 3ZYBA 3SHRA 1IGOA 2EIGA 1T6GC 2BNNA 3T0BA 3UV9A 4IE6A 2VCCA 1VBE1 4AVAA 5FY4A 2RMU3 5LASA 3U10A 3E1F1 4FAGA 4UW6A 2XQXA 3C2UA 1ULFA 2Z42A 1I5PA 3NJVA 1RUE3 3ACLA 1GNYA 5AC93 1YQ5A 2MEV2 5CBLA 1UNBA 3U0ZA 1QEXA 2R16A 4H7LA 1O7FA 3ZYJB 4AOCA 4N43C 5A3MA 1H1AA 2WJSA 4N53C 3S30A 2XR4A 3W21A 1G8WA 4Q2FA 1K3IA 1ASJ2 2J1AA 4K1ZA 2ES3A 4WVZA 4NAOA 3CJIB 3PHMA 4BJ0A 4LHLA 5A6QA 1GZ9A 1CGPA 4EN8B 1J58A 1W8UA 1CJDA 1A3KA 2ZGNA 3T3YA 3BU0A 1DIWA 3LFIA 4TN7A 1AL0G 2LALA 3MPPG 1VMFA 2BEOA 5G05L 5FXWA 2E7QA 3WINE 4DFSA 3T4VA 5HXVA 2XOMA 3BCWA 3LB9A 5M0TA 1H2MA 1ND2B 2W87A 3NKTA 1H6XA 1GKBA 4XF1A 5IVYA 1ODNA 2I07B 2UYAA 4GMP3 1MS9A 4Q4X2 5F1RA 5FYVA 1YI9A 1TME1 4ES8A 5GM0A 5LRRA 1LHOA 4MUVA 2YBKA 1YNAA 3PVOA 4FXKB 2BPA2 2WINB 3UT0A 1H8TC 5CFDB 2FMYA 1Q5OA 3DPRB 4Y20B 4C0BA 1LCLA 1YC61 2JB4A 4OMCA 3O1RA 4XUPA 3ZXEA 4C91A 3TEZA 4XVHA 2ZKNA 4RHV1 2WNVB 2A6ZA 3PUHA 3WZ1A 5B4NA 1YQ8A 2VZTA 3VGIA 2ZGPA 2EXKA 2DVBA 1H2NA 4N7UA 5FY5A 1JZ3A 1QJX2 3LPGA 1ULGA 4OZXA 1R1A1 1H9WA 1F31A 1S0EA 2G4IA 3I2IA 4D94A 1J3PA 1YWKA 1SG3A 2RM22 4M0HA 5H9RA 2ZMKA 1PVC1 4LBNA 2DTYA 4BHPA 3IIIA 1CAWA 1JXNA 1NZIA 1WMFA 3A21A 1NA1A 1UZYA 1EUTA 1CPNA 3V64A 2RHPA 4ES9A 4BOWA 5GZEA 4KBBA 3CZJA 2ZKLA 1HDKA 4E4ZA 4IETA 1SCSA 1UXZA 4CDXA 3D6EA 1ZRCA 2PXJA 3H3LA 4IV3A 3DECA 3ZX7A 4YZ2A 3LFMA 4H14A 4AI3A 5IFPA 1VBD1 2PQSA 4LEJA 4LORA 1JZ6A 1SBEA 2XHKA 1W6OA 4QPIA 1D4M3 4XF9A 1OFNA 3BN6A 4MYEA 4QM8A 3ZO0B 4AL9A 5B2GB 4NIGA 3SEPA 3OUHA 4YVWC 5KXEA 1ZZ7A 2Z4FA 3AP5A 5A7PA 1RIRA 5I0UA 4IEPA 3DYMA 1RUF2 3AMQA 3NWKA 3ORJA 3EQEA 3MLKA 1OKOA 1AXYA 1OF4A 1XYNA 3ITQA 5JAXA 2ILMA 3SCFA 1S55A 4JQRA 1G9CA 4DQAA 2SBAA 3H9AA 4RGAA 5EYXA 5IUQA 1AR91 1AL22 3AP6A 5FZBA 3VDCA 2VXRA 3FBMA 3ZXLA 1POV1 4MGIE 5C3SA 4UFKA 3U14A 4LKFA 2VCAA 5FYBA 3URFA 4UFMA 1N1VA 1LB2A 1FPN1 5A3WA 1N47A 1QIQA 5GJ6A 1Y9GA 4UYBA 4LIVA 2DCJA 1RUG1 1KDMA 1POQA 1ZZ9A 1V6OA 1OF3A 4XFGA 3WUCA 1KGYA 1GYKA 2RMU2 4QU1A 1OFSA 2C24A 4YG0A 2D6MA 4G9SB 1RUE2 5BNPB 4DRRA 1AVBA 1GUIA 3RSJA 1QQP1 3CJIA 4AHWA 4S2GA 1JZ7A 2ZBJA 2W68A 4B29A 2BUKA 3WY6A 4P08A 3RYPA 3J7MA 3A0KA 4EZHA 2OPWA 2YU2A 1EAH1 1RUI1 1UX7A 2XKPA 5FQ0B 3AL5A 3WP5A 1JUHA 4YG6A 2G9FA 1YI7A 4B7KA 3S5AA 1FV3A 4NHLA 4COUA 5FP4A 5FMDA 4JGYB 2J22A 1ND2A 2UURA 3S57A 2ATFA 5DG2A 4XFFA 1WMXA 2V4VA 5BYNA 4EV0A 5KWRA 2R0HA 2E9QA 4QB6A 4AI2A 1DF0A 4Q0VA 1XXNA 4Q0PA 3V65A 4ET7A 2RDSA 5CFDA 1R1ZA 4XUTA 4Y20A 3DPRA 5BPXA 4AHZA 4IQPA 1GZWB 2FDFA 1QHDA 5B4XA 3IZOA 3CNAA 1W2OA 1S2KA 2WZPP 4OHXA 3WP4A 2RE9A 2O1QA 2WNVA 2BVVA 3T08A 3RZMA 1WCUA 4D8MA 2WO1A 2ZX1A 4P00B 3FLRA 1NYWA 2OX0A 3B9CA 2NZ9A 1GANA 4MGYE 4OULA 2VNGA 5FYHA 4XPVA 3RDIA 5F9TA 2OZJA 2W91A 4K1YA 1QJY2 3MFCA 5FYZA 3WUDA 1UY4A 5HCFA 2NPIA 2VBDA 1K5MC 3OY8B 4V2WA 5FBZA 2WBKA 1VBA1 3ECQA 2HWE3 1FATA 4Z82A 4BQYA 2VW0A 1LKNA 1YQCA 4KG8A 4TLGA 5J96B 1D2QA 2RV9A 4HETA 1C8M3 5LBFA 4L99A 2HEYF 3J26N 4UFIA 4AEJA 3QCWA 5FK7A 2VE1A 1JOPA 3EXUA 1ZRIA 1ZZ8A 5J09A 4YM0A 5A3LA 3KV4A 4D6SA 3ASIA 4BQWA 2WSVA 2Z69A 4MGQA 1NOVA 5C8WA 4XFHA 3T09A 4LNVA 2IFWA 2XG3A 1W8OA 2A5ZA 2W1SA 4GH4C 1HXS1 2W46A 1DFQA 2YDEA 1UD1A 1W0PA 1CX1A 1GOGA 5JUVA 3W20A 3BUCA 2XJSA 4Q1RA 4LBQB 1BEV3 1QGLA 2IVJA 4NHYA 3DL3A 4PIYA 4B8EA 1UQXA 4OI4A 4WBBA 2W2IA 1KS4A 2DVFA 3VHRA 3J8F1 5FY1A 3VZNA 1DG6A 1URXA 2FDHA 2P2KA 3JBG1 5IVCA 3VZOA 4FPGA 2Z2SB 5CB7A 1O4TA 4Q0SA 3V56A 4COZA 3WQ1A 4GWMA 4K7JA 5CADA 2BFUL 5LZ6A 1SLAA 2E32A 2QFEA 3I2OA 4UF0B 2WDBA 5L19A 3LA3A 4YM2A 3WG1A 3ZFGB 1VRH3 3LWCA 4RS5C 1QDOA 3K4AA 1YLLA 1B35B 4RGGA 2ADDA 1DGWX 2KD7A 4RR3C 3TOJA 4FBFA 5GZCA 5BNPA 2PLV2 1WW7A 4P9YA 4COYA 2FDJA 2RJ2A 5LWBA 1N1SA 1NG0A 1VMJA 3AKTA 3T2OA 1O8PA 2D6PA 4MGZE 2Q30A 2LROA 5FYIA 2YPDA 4K8FA 2D3PA 2Z79A 4Q4V3 2XQRA 1MACA 1MS4A 1WZXA 4LBJA 4A7YA 4COWA 2JE8A 2E53A 3KS7A 4KH9A 5FQ0A 1QWRA 3QH6A 4IEQA 4Q8KA 4FTSA 2AC1A 2E7TA 3KQRA 2CWMA 1YFWA 4JGYA 4GQ7A 1ENQA 1O59A 1KXGA 4F8AA 1FMD3 4AVCA 1QU0A 1NLSA 4DS0A 1AF9A 3AFGA 4AFDA 4FI9A 2QQWA 1US3A 3NL1A 1JZ5A 1LOBA 1OQDA 4QXKA 4CUCA 2RS52 4C0HA 3NV2A 1O6UA 4LULA 2GALA 5DUWA 3RYRA 3PJYA 2FDIA 3NJZA 2IXLA 1V9U2 1GZWA 2N7GA 2DFCA 2XJQA 1E5SA 4O65A 1RVF1 3L9JT 4XFBA 3RJ2X 3PVEA 4CDWB 3VKNA 4XJZA 5KHJA 2A6YA 3FUOA 3LEGA 3MGUA 1LOFA 4PI2A 4QX8A 3O0WA 5LBEA 4LOSA 5HCBA 5IFTA 1NQJA 1LENA 5F32A 1H0BA 1OSGA 1ZZ6A 2OT7A 3MI8A 3TRSB 1BJQA 2VMGA 3AJZA 2GP5A 1SLCA 2XKOA 3J7HA 3OY8A 3WCSA 4GXLA 4LK6A 4P9XA 4DY3A 1C8NA 2ZOEB 1T6BX 3DCQA 4QDRA 3L2HA 5SV5A 4LA2A 3U4XA 3OBTA 2WUHA 2JE7A 2XLAA 3KT4A 1M4WA 3AZVA 4Y24A 5FIXA 3LAGA 1G9AA 1TNFA 5I91A 1REDA 2D98A 3THCA 1YIFA 1TME3 5F5AA 2WQZC 3VBUA 4XBNA 1WLCA 2DBIA 3GDBA 4E4SA 5HBAA 1C8M2 4DEVA 5IK5A 2W5FA 3EB7A 5DDJ2 2O0OA 3POGA 4A6SA 1CAXB 2VH9A 3KV9A 3VZMA 2IXKA 2X53S 4Y33A 1HB4A 4R9AA 4AQTA 5FZ0A 2Y0IA 4YW7A 4QHBA 1PZ7A 3PVNA 5F5QA 4YRDA 3UGFA 3O1OA 4QM9A 3H1WA 1WKYA 1DP0A 2QDRA 4LBQA 1R1A3 3WX5A 4L92A 2VZQA 5AVPA 2L9LA 4YGBA 1C3HA 1RUJ1 2V09A 3OG2A 1YFYA 3J9SA 4KU8A 4QD2A 4R4XA 4XDQA 4AWDA 1GQGA 1SFYA 1R083 1DZTA 1XC6A 2JG9C 5IATA 4HKOA 1XNKA 1KJRA 3ZFEC 4AZZA 4CP9B 1BEV2 4YW1A 3I2JA 1JZ8A 3RZJA 3WHTA 2P34A 4AEDB 5CFCA 2Y64A 3ZDVA 1LESA 3MBWA 4FPCA 2ERFA 3VZLA 5FFOC 2Z5WA 4JGZB 4XUNA 1C4RA 3B9IA 1FXZA 3RPQA 4XBLA 4XF4A 2DURA 1XQNA 2VD7A 3OOXA 4BXFA 4UF0A 1NXD1 3LA2A 3WG3A 1DBNA 4XW3A 3ZFGA 2K46A 2WFF2 2DFBA 1H8VA 2XVGA 2BYVE 1B35A 2GN3A 1N1YA 2VAUA 4N7IA 1VBB1 3BYWA 3BOPA 2DU1A 5JXHA 1HB2A 4JRAA 5FZ7A 4IEYA 4DNYA 5I0RA 4MGTA 1Q8SA 3WQ0A 1QJU1 3AYCA 4DMIA 5IK7A 5C3OA 5GZDA 2PHRA 4XF3A 5DUVA 1IS6A 3ZN6B 3AVSA 4EROA 2BGOA 5JZGC 2RS32 1OA3A 4IEZA 4LO5B 1WBFA 1POV3 3O7OA 2E7AA 2EALA 3O1VA 1BQPA 5GLUA 2D5HA 3KB5A 1F15A 2BERA 3S5QA 3LGRA 2P37A 4A44A 5I93A 4QAWA 1FPN3 4NIIA 2B45X 1W9YA 1I5ZA 2ZHKA 2VO5A 5JOXA 2WLPA 1ND3C 1SDDB 2A7AA 1FMD2 4H7MA 2YC0A 1HRI1 4S2FA 4JRLA 1OD5A 4KWUA 2BBVA 5HV0A 5HV4A 1JYIA 4LBKA 5E16A 4CDWA 2HWC3 4EQVA 4DXTA 1AYN1 3MYXA 3ZXKA 5BNOC 1S0IA 4AK3A 4BDVB 2UY9A 2R073 1QQP3 2NYYA 4MHUA 5DAXA 1XBFA 1U5ZA 4YLZA 1PGW1 3WF2A 4SLIA 1XOYA 4FPKA 2VUJA 2VTFA 5AFBA 1LHWA 1PNGA 5LK7B 5ACA3 2WNOA 1UPIA 2WWJA 5A3PA 4CCLA 5HXMA 2F17A 4CEYC 1AZDA 1NKGA 4LE3A 4CP2A 1RUI3 4R9DA 3FUQA 2XJPA 4FVVA 4E2SA 5IAVA 3B7MA 1G9DA 2BNMA 4PF5A 4ZS3A 1H8TB 1VBC3 4NMIA 2GH8A 4GWJA 1H1MA 3DN7A 4UAPA 3VN4A 1ST8A 1OOPC 3MIFA 2AGSA 5FZOB 4DO0A 1Z0HA 2RDQA 2ZGRA 3P3PA 4X6RB 5J37A 3OGRA 5FJHA 4HZFA 4GD4A 2YB7A 1SDWA 3AZXA 2F6BA 3I3MA 4D0QA 1CAXA 3AB0A 1ACCA 5H9SA 1MZ5A 1QOTA 2VZSA 5F3GA 4HXCA 2WN3A 2R1DA 1RINA 1JYVA 2GC2A 1X33A 4QGLA 3SKJE 4Q4W1 2WN2A 5F37A 1W8WA 3FJSA 1QJEA 3T0AA 3THTA 2MHFA 1AR63 4P14A 5HCAA 1H9PA 1SBFA 3VKFC 2A6XA 3Q8CA 1JOBA 4XTMA 4ZXEA 2XJTA 3N3HA 4E9KA 3CMGA 3I59A 3K75B 1OH4A 4ASMB 2HYKA 3MW3A 2GAUA 1DQ5A 4CU6A 5FDBA 3LOIA 2ZX2A 3NAPC 4CE8A 4CP9A 5F7UA 1RHI2 3C7HA 2PA7A 5EJZB 3ZVXA 2VULA 1LECA 2G19A 4AEDA 1JW6A 2XL9A 3EMRA 3IWZA 4YVWB 2DTWA 1UPSA 1R082 4QQLA 4WVWA 2JIJA 4A6OA 3LEKA 4JGZA 3E6BA 3Q8EA 4PBOA 3WNKA 4YZ1A 4LKSA 4META 4CCNA 1RUNA 4OI1A 4IGOA 1MEC2 3PUQA 3ON7A 1BLZA 2W3JA 4ZPIA 1WMDA 3B02A 3K3NA 3HVDA 4L2NA 2A3XA 4LK7A 2A1XA 5FXZA 3GM8A 3VKLA 2VBPA 4GWIA 3UKVA 3ZXGA 1XB9A 4CRQA 4GB33 2WZR1 4YARA 4QXCA 2X09A 2QE3A 1YFUA 2CWSA 2R061 1ZBE2 2ET1A 4JQTA 4QQ2A 3MLLA 3I3BA 2R042 5C3RA 2D7FA 4LBQD 3ZN6A 4YYOA 4KL1A 2EA7A 4XBQA 3GF6A 1LR5A 2LM3A 3FZ3A 1JYXA 3VZJA 3AX4A 4LKEA 5T5LA 5ABJC 5JLVA 4HK9A 3PTYA 1Y9QA 2TBVA 3ACIA 4ZU4A 2ZPXA 5FR3A 1NCRC 1UY0A 1VAMA 2AEYA 3OBRA 5IVVA 4UFJA 5CU1A 1YFXA 2ZMNA 3HPNA 3MW4A 3ZPYA 3ZOIA 3O1PA 4N53A 2HYXA 4PDWC 5D8AC 4GULA 4M3CF 3FFQA 4GWNA 2WYSA 2DVGA 3HMYA 2JD9A 3WNLA 1AR72 3AKPA 1NLQA 3K4ZA 4XFCA 5T55A 3VL9A 4J1WA 4Y26A 4P9GA 3JD71 3HWJA 3PMEA 4W65A 1P8JA
chains in the Genus database with same CATH topology
1W6MB 1GNZA 4TYSA 2EAKA 4IL7A 1ALYA 1TEIA 1QH6A 2GU9A 3FC0A 1AR83 2P17A 4XFAA 1PO22 3AP7A 1SFNA 4AFAA 2RS12 4KGQA 4BMEA 5KC6A 2R072 1XNCA 3KGZA 1IKPA 3WW1A 4AG4A 5JIAA 2VU9A 1H8TA 2XJUA 3ILRA 4MV2A 5JVVA 1LGCA 3K48A 4RA0A 3WD5A 4MXWB 3R4UA 3KZ4C 3KLSA 1FOD1 1EV11 1G86A 4WZFA 1BMV2 1MQTC 4EJRA 1JBCA 1LHUA 4AVVA 2Y26A 3UJQA 1SLLA 1UMZA 2ZTNA 4UXAA 1OPOA 3ZSJA 1U5IA 1K5MB 1KJLA 2WFF1 1RMU1 2UY8A 3AJYA 1TMF3 3M3CA 4JDMA 1V70A 2HEWF 3MIGA 3ILNA 4XZPA 1O5UA 1NY71 4ORFA 4A7ZA 4H55A 3UJOA 2B46X 1PVXA 1AR62 3C3VA 4ZU5A 4AQSA 3VDDC 3IT8A 5L7OC 2IXCA 4YVWA 4W6XA 3WCRA 4NOTA 1AYM1 2IZWA 3WV6A 1DHKB 4GH4B 4JCKA 4B4RA 1NCQC 4XETA 2BW8A 4R52A 4BE3A 3X29B 1HRV3 2BNOA 1IS4A 4XTPA 2HWB2 2HWD1 2X5IC 4BQ1A 2IC1A 4FOQA 3TNQA 3ZYPA 5JI7A 1MZFA 3IDBB 5K0UC 1RUD1 2B5HA 3TAYA 4JTNA 4PLNA 1SCRA 2ZZJA 5DXDA 1S2BA 4XHBA 4ATEA 2WWSA 1Z7S3 1PO11 5KHKA 1RUJ3 4GB32 2HKXA 1LOGA 2XLGA 1R093 1W39A 4NHKA 2D93A 3WLUA 4P9LA 1MS3A 4FT8A 4RS5B 4CYDA 4RR3B 3TN91 2WNEA 3WHUA 4E4DX 1S0JA 1RUH1 3HN1A 4JV4A 3CJXA 4IV1C 1ZM1A 4YFWA 2Q8OA 2DUQA 5T5PA 5GZFA 4LLOA 5FO8B 1I6XA 1OQEA 1RL3A 3THPA 1A6CA 1RTVA 1YYNA 2WS92 1W6MA 3S0MA 1VBB3 4FPHA 5I0SA 5IK8A 1GNHA 5DUXA 2XBO3 1NE6A 5LK5A 4IEXA 4XFIA 1ZX5A 2FHRA 2R0FA 3E6DA 4CDQC 4C1WA 1F9KA 1LTEA 3BOWA 4GKYA 3VZKA 2RR11 3PJQA 3KGLA 2RJKA 3CO2A 1AR82 2Q0AA 4WVVA 4DB5A 3ZN5A 2PHTA 1H2LA 4I0BA 1ZBA2 4M3CE 1WMEA 4MXWA 3WP3A 5JCTA 3WDYA 1KDKA 2XJVA 5DZFA 2JDZA 4BWOA 4OUSA 3BIWE 1AYN3 4ATFA 2PHUA 1K5MA 3M70A 4RL7A 2NM1A 2YPJA 5CG8A 2LUWA 2QQPA 4JDOA 1PIV2 2B9UA 1PHMA 1IQAA 4HANA 4HVQA 5CG9A 1PZ9A 2PHXA 1HX6A 3M3OA 3TYJA 1TMF2 4ZU7A 4ZXKA 4OI2A 2AUYA 1LU2A 3MW2A 1COV3 1IZ3A 1PM7A 2WT2A 5L73A 3HQXA 2DWRA 3D82A 4GH4A 4YW3A 2BTVC 2VQAA 4KNCA 5HI0A 1W6PB 2JE9A 4XILA 4DY5A 1BKZA 1SACA 5AC92 1DLLA 4I3GA 2A71A 4I3PA 2JG9B 2ZHMA 3OF1A 3ZFEB 4D69A 5L36A 4Q4W3 1HRV2 1O3TA 1Q3EA 3ZMNA 1HQLA 1U0AA 3AMMA 4CDUC 3WG2A 2D44A 5A33B 5I8SA 4BPZA 2HWF1 2YXSA 2D6OX 5KBFA 5T5JA 2CTVA 1UL9A 1ULCA 1Z7S2 3P3NA 3WDVA 5EZWA 4Z8BA 4RS5A 4LO6B 1H4HA 4RR3A 1R092 3D8CA 5KXDA 3M2MA 4FSJA 1WLWA 4BMBA 3U07A 5T3NA 3WQ7A 2EVXA 4ONUA 5J3UA 1MZ6A 1WUVA 3SNMA 1Q8PA 1GSLA 1X50A 3WDWA 3VBSC 1QOSA 2BWCA 2D43A 2E63A 1UX6A 1BMV1 3LOBA 3ZYIB 4DZGA 2OZ6A 3MZHA 3MF9A 3R4SA 1W0OA 2WZR3 4AEMA 3GZTB 1RUC1 3PNAA 3UKTA 2R063 5FMOL 3SCGA 4CDXC 1LGNA 1YUDA 2UWCA 2XBO2 3BTAA 2DVDA 1MS8A 2KA3A 5EJ3A 1QMJA 4QPIC 1ND3B 3VHPA 1Y43B 1UU5A 3TWIA 3LZZA 1WW6A 1RC6A 4WM8C 3BB6A 3VBUB 1WW4A 3HAGA 4LR4A 4KG0A 1MS0A 3B3QE 1TE1B 1FT9A 3G6JB 3A0NA 5BNOB 2C1FA 2B7YA 5GLVA 3U11A 1YHFA 3KCYA 1EPWA 2A6WA 4B7EA 1ZRFA 4HVOA 3L2YA 1D4M2 2MEV1 1J59A 4YGDA 1JUIA 4CEYB 2VNOA 4SBVA 4TLFA 4W6WA 3KCCA 1ASJ1 2VW2A 3FE5A 1M06G 3VBOC 4XJUA 1OOPB 1U5XA 3MIBA 3ZFFC 4XF0A 5E1RA 3CL1A 5CFCB 2ZGQA 2PHDA 4QPGC 2ZGLA 3IN9A 4EWEA 3E97A 3DV8A 2IWGB 4XXAA 1C1LA 3SLIA 3D4KA 2JKBA 1BBT3 4Q4X1 4HKLA 3ZSLA 1COV2 1W6PA 1GZCA 4AHXA 3OJBA 4FPOB 3B94A 3KCXA 4OHWA 3OGJA 4RSUA 4Q4Y3 1SLBA 3AYDA 2JECA 2JG9A 1KFXL 1D0HA 3NAPB 3ZFEA 1HV1A 4HT1T 2AYHA 3ME2A 3VBHC 1PGL2 3NSTA 1QJX1 4HL0A 2PFWA 5SV8A 4D7TA 2RM21 2ZJCA 3ZSMA 3RJRA 1UZZA 5A33A 2VOKA 4LUKA 1VBE3 3JQWA 4BIFA 5JDBA 3RMYA 5EYYA 4LTAA 1KD7A 3HD8B 2D3RA 4YW5A 1HQNA 3WVJA 1EY2A 1CAVB 2VPVA 3NV1A 4RD7A 1DGWA 1Z78A 4B4QA 1QXPA 4P9JA 3DKWA 5IT6A 3FMGA 3B69A 1F5JA 4LUMA 4PIXA 2EXJA 2A75A 3ZDSA 2GNMA 4DRVA 1D2SA 4K40A 3SH5A 5ABJB 2H6BA 1MZEA 1SQ4A 1NCRB 2JX9A 1RUF1 4LBMA 4RQPC 1H30A 3ILFA 3K51A 4PDWB 5D8AB 1PO13 1VALA 3RZZA 1AL21 4GKXA 2YGLA 1HLCA 1ND3A 1PIV1 1SLTA 1J1LA 2EF6A 3EO6A 2ZGSA 2HWE2 3RRDA 2QKDA 2D6KA 1WW5A 3MDPA 4K21A 2G9GA 1JYCA 5BNOA 1JN2P 1V6IA 3AYAA 4BZ4A 5E8AA 1DQ6A 3WNXA 4RHV3 1UIJA 4AI8A 1IOAA 2RMU1 4CEYA 1ZA4A 4FPFA 4W6YA 2JENA 1RUE1 3LSEA 2WKKA 1UW8A 3I59B 2VOXA 1PVC3 4LHKA 1OQ1A 1MR5A 1VIWB 5BUVA 3ATGA 1OOPA 3N7MA 1X82A 2RR13 3MFAA 4OFGA 2KXLA 2GC1A 3BU7A 3MIHA 4X6QB 1XYPA 3HT1A 3RMXA 2MPFA 4YGCA 2ZGTA 1GFF2 3AYEA 1MQTB 3NO8A 5K8SA 1VBD3 2OW4A 2DCYA 2H6CA 1VR3A 4BCUA 2I74A 5BNPC 2WIIB 3S7IA 4J1XA 3ZYGA 4HN0A 4Y1YA 2K2SA 2XWJB 4B3NA 3ENRA 1BBT2 1S1AA 4GMP1 2ZHNA 3QACA 4QGMA 1VRH2 2QDNA 3ALQA 4HMZA 3PMSA 3NAPA 4YFZA 3SH4A 4URTA 3RYKA 1WCSA 2HEVF 3VDDB 4Q4Y2 5L7OB 1AR93 2B39A 1PK6C 3O0VA 4XJWA 5E89A 1DQ0A 5FO7B 4Q4V2 5KHGA 5T52A 5AVAA 3UK9A 1AX1A 1NCQB 1DU3D 1S0GA 4IEOA 4PQ9A 1QJY1 4N43B 1H4GA 2A3YA 4N53B 1MS5A 1V00A 1J3RA 4I01A 1C28A 4R8HA 2YGMA 3ZIXA 1RUG3 1ENRA 5AFEA 1VBE2 3GBFA 1RJ7A 2H0VA 5K0UB 1LHNA 1CAVA 4K9SA 4BIOA 3VBRC 1V6MA 4XYXA 1ULEA 5E88A 4M0NA 1DQ4A 2WL1A 1AXZA 2OIIA 2ZACA 1CESA 2WA3A 1KQRA 4Y5Z0 5ABJA 1CR7A 2ZGOA 5BNQA 1NCRA 4GA9A 1EAH3 3IPVB 1BCXA 4OLLA 4PDWA 5D8AA 2JD4A 4Q27A 1BYHA 4Z92B 1WLDA 2WNUC 4IV1B 2ZMLA 4MXVA 5BXXA 4AF9A 1CN1A 3AKQA 2I2SA 1C5HA 5J36A 2AREA 2VUAA 1OMIA 1UAIA 1U12A 4QQOA 2R32A 1TME2 4G4FA 2A6VA 4Z2WA 4WVMA 4Q0UA 4CDQB 3ZN4A 2MNGA 4Y22B 4ASLA 2ZHLA 1F2NA 4LO4B 1FV2A 2NN8A 2TEPA 3FFZA 1Y3TA 1NZCA 2PLV1 1XE7A 2CL2A 5CA6A 2CY6A 1DQ2A 1RUC3 2VNRA 2GNTA 4CEWC 4AI1A 1R1A2 1VBA3 5JR7B 5C8CC 5DUUA 5K7PA 1F8VA 1UKGA 4HK8A 1I1EA 4YGEA 3VLBB 1PVC2 2D6NA 2RJLA 2XB6C 1AJKA 4YM3A 1MQTA 4D7SA 3ETQA 5K9YA 4OHZA 1IS3A 1CPMA 4XJ9A 3SMHA 4N9IA 2DCKA 4Y1UA 5EWSA 4YVSC 4PIZA 5JMCA 1ZVFA 2ZCWA 4Y1VA 2P3KA 1O91A 3EJKA 4QQPA 2X29A 4KWLA 4AW7A 2RS51 2EXIA 3BALA 2XH6A 1DGRA 2MEV3 5T5OA 1HXS3 1V9U1 1SMVA 1W6QB 3DUIA 2Q1ZB 5BNNC 5CVRA 4FCAA 1GQHA 5C9AC 4EWAA 2DV9A 2QVSB 3VDDA 5L7OA 1I3HA 2AR6A 1DDLA 3WOGA 5LEKA 4P5HA 1KRIA 4AYUA 3J8F3 3AMHA 1GR3A 1NCQA 3I8TA 3AZYA 3POSA 3JBG3 4N43A 2R6QA 2DUPA 2JG8C 1FNZA 3RI8A 4NVPA 3W58A 3AFKA 1GICA 4IXLA 3GALA 2BFUS 2I45A 3E6CC 2X5IA 5FCCA 4DINB 2GC3A 5K0UA 1FPN2 2A70A 4UW3A 1EYBA 4AGGA 2W0XA 1C8M1 1APNA 5JPNB 4XMAA 5DDJ1 1AX0A 1PNFA 3O0XA 2OYZA 4CDUB 5LEJA 1LHVA 1Q8VA 4ZKTB 2HWC2 3NKGA 2A3WA 3WG4A 1A8MA 1QNWA 4EWDA 1DQ1A 4FPJA 4UBHA 1RUOA 1XNBA 1OPMA 4Q0QA 1CAUB 1QQP2 3IPVA 3KD4A 2W52A 3T2TA 4LT5A 3ZIWA 1I9RA 5ACA2 2PTMA 2NP0A 1DYPA 1EAH2 1RUI2 4AI0A 2YYOA 3CF6E 3AM2A 4IERA 4KWJA 4IV1A 5C4WC 1CJPA 1S0CA 1BEV1 4CP1A 4TSVA 2P3IA 3HR9A 2XVLA 4DXZA 1VBC2 4FP3A 3GBGA 3VBSB 3ZXJA 2PHLA 1UIKA 4QX5A 4Y1ZA 3LA7A 3JB8A 4XIKA 5D1IA 4GMP0 4ISQA 5GLTA 3MLJA 4C1XA 1ZYBA 1B09A 5EV7A 1RVF3 3HIFA 4A3XA 2Q1MA 4FOVA 1N1TA 4CDQA 2C9AA 3H1YA 1LJ7A 2VOVA 4XMIA 3QD6A 1YCIA 4Y22A 3VBFC 3WP6A 2WQ4A 1EPZA 1HW5A 2ENRA 2ET7A 3AP4A 1HQWA 3JZVA 2OA2A 4NO4A 1X36A 1MS1A 1REFA 4WM8B 4WV8A 3ZMOA 2GH2A 4AGRA 2FMDA 1HKDA 1G6NA 3AMNA 3OPZA 2PAEA 4JVAA 4I30A 1AL23 3AKRA 3EHKA 3QBQA 3ZXDA 2ZZQA 2RS31 1NQDA 1JOJA 2VW1A 1YIPA 1DZQA 4BLIA 1ULDA 3AZZA 3H50A 3SISA 2A73B 1VBA2 2GN7A 5CIRA 4INDA 3MPBA 1O4YA 3JQXA 5CAZA 1CD3G 3IDEA 4YM1A 1VJ2A 2K9ZA 1SBDA 4L11A 3RQ0A 1PGSA 2GSYA 1FMD1 2VVFA 3VBOB 1ZZBA 3M3QA 3VKOA 3MEPA 1W6QA 3ZFFB 4ITCA 5FREA 5CNAA 2DYCA 2F4PA 4P9IA 1TQ5A 2GMMA 4QPGB 1HXS2 3H3ZA 4AVTA 1UN1A 1O3QA 1JH5A 5FLJA 2IXIA 3WDTA 1S0DA 2UWBA 1AHSA 4X8PA 5C6CA 4LHNA 3VHOA 1U5YA 4YZ3A 2UU8A 2UWAA 3POWA 3QLQA 2GZWA 4QGNA 1DGRN 3N36A 1KFUL 2PHWA 3J8F2 2XL7A 1WA4A 5JOWA 2B42B 3IIAA 3JBG2 5DZEA 1REEA 1LEDA 1FAYA 4YZ5A 1KITA 1WBLA 3KSCA 4COVA 3WW2A 3VBHB 2FQPA 5T54A 1OA4A 1G7YA 1S0FA 3BPZA 4CDUA 4OHVA 1G9BA 1MVQA 2XPJA 1QJU3 4FPYA 3J4UH 4U2AA 2FZ2A 1CAUA 3VHNA 2WT0A 4HFSA 1H1IA 4O9GA 2D97A 4LLFA 2FBEA 5JOZA 3FHIB 5JWPA 1JHNA 2ZABA 1QJY3 4WM7C 3H8UA 3UL2A 2XUMA 4PLOA 1GBGA 2TUNA 2WT1A 2VECA 1RHI1 4FPLA 1CX4A 4OVEA 2GMEA 2O8QA 3VBSA 5BV6A 4CTEA 3RG0A 1R081 4IEUA 1HRI3 1N3QA 2AENA 3AXDA 1IHMA 1OKQA 4RQPB 4OUMA 1MEC1 1V6LA 4ISRA 4Q26A 3PLQA 1IKQA 3D0JA 2PELA 3KMHA 1TNRA 4OHYA 1RVF2 3R6SA 4UBGA 5JSPA 2K0GA 4WM8A 1UU6A 1X8MA 1O3SA 1NXMA 3HBZA 3S6PA 1ZBE1 2R041 4HSLA 4AFMA 4E2GA 1D0GA 4AHYA 4Q29A 1N3OA 3H7JA 1GLHA 3ZSEA 3BODA 1WGPA 3E5XA 1X8EA 2YHJA