3JUUA

Crystal structure of porphyranase b (porb) from zobellia galactanivorans
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
268
structure length
268
Chain Sequence
EAPHFKPGEDPRQPHQEWKLIENMSDEFEGKKIDEKKWQISGQGWIGRAPGLFLAENISLNNGSLQITTTMLPEPIVKNNKTYTHGGGYVGSRNGMTYGYYECEMKANKTFMSSTFWLINEGKDRLGCDKRTTELDIQESVGQITNDADWMKYFDQTMNSNTHSRNIPEGCEYEKGSSKGKAELGGKAYEDFHVYGVWWKSKDEIIFFLDGKMQSKVTPPADFDIEMYLRMVVETYDWNPVPKDGGMTGSKEDRTTTYNWVRSWQLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/carbohydrate
molecule keywords porphyranase B
publication title Transfer of carbohydrate-active enzymes from marine bacteria to Japanese gut microbiota.
pubmed doi rcsb
source organism Zobellia galactanivorans
total genus 64
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 3.2.1.178: Beta-porphyranase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3juuA00
1QU0A 3POSA 2GNBA 3ENRA 1S0FA 1G9CA 4FPLA 2CWMA 1LENA 2XG3A 2VW0A 3GALA 2D3SA 2DTYA 2W52A 4GKXA 4RA0A 3M3EA 2WT0A 1MS1A 2DWRA 2LTNA 2SBAA 3R4UA 3RMXA 1QGLA 1G9DA 3AYDA 1I3HA 2AH2A 2P3IA 3LCPA 5GLTA 3POWA 3FUQA 1F9KA 4YZ3A 3WDUA 3WV6A 1AZDA 1V6NA 1R1ZA 1W6QA 4Y24A 5F9TA 3W59A 1N1SA 3R4SA 1WW5A 4WZFA 4Z8BA 1Q8OA 2ENRA 1GANA 5CA6A 3QCWA 3ZSLA 2TEPA 2E7QA 5LK5A 3VKLA 4YW2A 3ZSKA 1SACA 1QOTA 3M3QA 1LU1A 2A71A 3ZVXA 2NN8A 1RITA 5GM0A 4FPOB 3WZ1A 1A78A 4M3CF 5IT6A 2A70A 2D44A 2ZBJA 1S0EA 2UU8A 3HN1A 1LGBA 1MZ5A 1NXD1 5EXOA 5H9QA 5T5PA 2P37A 3N7MA 4AVTA 1S0CA 3WUDA 1JBCA 2ARXA 2G4IA 5H9RA 1BYHA 2H0BA 4FPGA 3A0NA 4LBLA 2P3KA 3D5OA 2C9AA 2UURA 2GMMA 4FPJA 3WDWA 5CB7A 3R05A 4WVWA 3WCSA 2DURA 2WT1A 4Q8LA 5JLVA 2ZACA 1MS8A 3WNXA 4PBPA 3AJZA 3ZXKA 3RQ0A 4Y22A 2A5ZA 1MS0A 1JYCA 2FHRA 3D4KA 2ZGUA 3HR9A 1V6LA 2D43A 3AP5A 5IK7A 2B7YA 1QF3A 5E88A 1CONA 2NP0A 4XTPA 3QLQA 1IS6A 2WLQA 5T5JA 2YY1A 5GALA 5GZCA 5E89A 1KITA 3UK9A 2A6WA 4XMIA 3IN9A 5GZFA 5GZEA 1LOBA 1ULEA 4XDQA 4R9AA 1O4YA 5T50A 3WDXA 2JKBA 3D6EA 4ISRA 2D6NA 4AGRA 4XBLA 1GV9A 4CZSA 1LU2A 1MVEA 1EPWA 1LHNA 5BYNA 1W0PA 2R0HA 4Y20B 1KJRA 2C5DA 2E51A 3AZZA 1Q8QA 1UMZA 1V6KA 2R16A 5DZGA 3UJOA 4ATFA 3V0AA 2AREA 3WLUA 1ENQA 4W65A 3B69A 3I4IA 1RINA 3JUUA 1SLTA 2CTVA 4XE9A 4XHXA 1JOJA 1SBDA 2CL2A 3AYCA 1DFQA 4K21A 5DUXA 4BLIA 1I1EA 1B09A 4Y1XA 4U2AA 1MVQA 1KQRA 4ATEA 5JVVA 4YM3A 4FOYA 1W6PA 3U4XA 1DLLA 2DYCA 1DQ6A 2EXHA 2DVAA 4TZDA 5IUQA 4Y26A 1CESA 3MPPG 2AYHA 4Y1ZA 3FFZA 5GZDA 3A4UA 1YXWA 3C2UA 4JRAA 1ENRA 1W6MB 1GZWB 1ULDA 2XB6C 3ILFA 2A6VA 3VV1A 1HDKA 4XXPA 4U36A 3POYA 4YGBA 1ONAA 4FPYA 4DS0A 4M01A 2D3PA 4FVVA 2WT2A 2SLIA 2ZKNA 4GALA 4LBMA 4FPKA 3IM0A 4XMAA 2EXIA 1W6PB 1AF9A 3SNMA 1V6OA 4FOVA 1S1AA 1WBFA 1H9WA 2PHRA 1LOFA 3AK0A 1SCSA 4FPCA 5AVAA 1YO8A 2DU0A 3BOPA 3W58A 4OZXA 2VH9A 4F83A 2WJSA 4BOWA 4XJWA 2ZHNA 3OJBA 4YZ2A 3VUOA 1IS4A 1DGLA 3L2YA 1LOAA 2A6YA 4Y1UA 5F5QA 5GLUA 4YW1A 2ZMKA 4YM1A 3M2MA 1YI7A 2PHUA 2W08A 2KM2A 3KM5A 3PVEA 2DTWA 2GN7A 2AENA 1PZ9A 4XBQA 1JN2P 1WLDA 3ZYPA 2YROA 5SV8A 3NV1A 5JOZA 3RG0A 2P34A 1JXNA 4YM2A 4YGEA 1LHUA 1S0DA 2DVFA 4UW4A 4JCKA 4Q8KA 5DG1A 1IOAA 5L73A 1LOCA 1UX6A 4NOTA 3ZPYA 5KXEA 5IK8A 1WBLA 1QNWA 3M1HA 2Q5TA 2R49A 4XBNA 5DZFA 1DIWA 2CYFA 1QOOA 2EF6A 4YLZA 2ZABA 5JDBA 4FPFA 4FPEA 3KQRA 4BM8A 1GZ9A 3AZVA 1GBGA 5DG2A 1J1TA 1G9FA 2D6MA 4FQ4A 2ZGRA 1JUIA 4BQ1A 2E53A 3OPZA 4P9WA 2ZGSA 5DUWA 1D0HA 2NYYA 1GYKA 4M3CE 1DZQA 1C1FA 5T52A 3RRDA 2D6OX 2OW4A 1DQ2A 1UAIA 3AZWA 3JU9A 3T1LA 1FYUA 4IQPA 1LTEA 1ZA4A 4L8QA 5EYXA 1SCRA 2DUQA 3ZSMA 5KXDA 3PMEA 3SLIA 4XTMA 2OUJA 3BIWE 1FATA 3T2TA 2AGSA 2DU1A 1IKQA 3N7JA 5CAZA 1W6NA 1VLNA 3PVOA 2D3RA 4YG6A 5FREA 2NMNA 2PELA 1NLSA 1HLCA 3FLPA 3O0VA 4UW5A 1ZM1A 2P3JA 3OBRA 4D69A 3WG1A 1MACA 2UWBA 1DQ5A 2YXSA 3WDYA 4NO4A 5KXBA 4FP2A 3BTAA 2PHTA 1WW6A 4Y20A 3M3OA 1DBNA 5HCAA 2ZHLA 3SITA 1DHKB 2EXJA 1QOSA 4H55A 4YG0A 1F31A 4PQ9A 4CRQA 5T54A 4PCRA 2NMOA 2D7FA 3OGGA 4MYEA 1GICA 3CNAA 3FBYA 1DQ4A 2JJ6A 5H9SA 1W6NB 2GNTA 2JECA 2A3XA 1CIWA 1KDKA 4Q1RA 4YW5A 2D6LX 1S0JA 4XIKA 1LJ7A 4P14A 4UW3A 4C1XA 1AXYA 1LGNA 1FV3A 1BXHA 5EWSA 2GMEA 4XZPA 1Q56A 1Q8VA 3ILRA 4TYSA 3AJYA 1N3PA 3O0XA 2R1DA 2DV9A 2NZ9A 4XILA 3UL2A 3O12A 1W6MA 1GZWA 2JE7A 1VALA 2PHFA 1LOEA 1BQPA 2ZGOA 3O5SA 1AXKA 1Q8PA 4R9DA 3SH3A 1SBEA 3VKOA 1Z78A 4FPHA 3VKFC 3WG4A 3ZXJA 1FNZA 3IPVB 2LALA 1H30A 1LEMA 1FV2A 1AX2A 1GNHA 3B00A 3AXDA 4DRVA 5JOXA 2D6KA 4WV8A 4DFSA 5IK4A 4WVVA 1O4ZA 1QKQA 1WW7A 2VW2A 4LBNA 4XYXA 2EIGA 2ZGMA 1SLLA 3Q9OA 1SBFA 1MS9A 1W6OB 4YW3A 4AWDA 1VIWB 1WLWA 3OYWA 2V73A 3RS6A 1WD4A 4K20A 1YIFA 1ULCA 4K1ZA 1LOFC 1D2SA 4YZ1A 4AYUA 1V6JA 2A7AA 4M00A 1SFYA 3PVNA 3AXEA 1PZ7A 2ZHMA 4M3CA 3WOGA 3ZXEA 3V0BA 5FRAA 1OFSA 3TB0A 4YM0A 3I8TA 2WSVA 2GALA 1UL9A 4Q2FA 1Q8SA 3FUOA 3N7KA 2R0FA 1U0AA 2NM1A 3MEPA 2R1BA 1LODA 3OYWB 2EXKA 4XJ9A 5HCFA 1CR7A 4FOQA 1FNYA 3SH5A 2ZA9A 4KBBA 1C57A 1HQWA 1BKZA 2VUAA 3A0KA 1CQ9A 3AP9A 4SLIA 1F5FA 2OVUA 3ILNA 3OBTA 4GXLA 4JC1A 1MS3A 2ZGTA 1DYKA 4I30A 4DQAA 1JYIA 2ZAAA 1W0OA 4ASMB 4BLJA 1LESA 3AP4A 3IMNA 4M3CB 3TAYA 2GDFA 4ZKTB 4P9YA 3V0BB 1MS4A 4YGCA 4LBJA 2GMPA 1CVNA 3USUB 5IK5A 2UWAA 1HKDA 4R9CA 1FX5A 2I2SA 3INAA 3OY8A 1SLAA 2WQZC 1GLHA 1AX1A 4XJ8A 2JE9A 4GWMA 5T55A 2WKKA 1N1TA 3DGTA 1IS3A 4XJUA 5KXCA 1JW6A 1V6MA 3O0WA 3BODA 4XJZA 1G7YA 2V5YA 3AYEA 1DQ1A 3WUCA 1QMJA 2A75A 5DUUA 1G9AA 3NWKA 3UJQA 1G9BA 2DUPA 4YZ4A 4DPNA 4HL0A 4Q26A 1BZWA 3OY8B 4Y1VA 1RIRA 3MW2A 3M3CA 2ZMLA 1CN1A 3B01A 1Y7BA 1LGCA 2ZGKA 4R9BA 5DUVA 1N3QA 3WHTA 1WUVA 3LSEA 2A6XA 1QDOA 1HQLA 1S0IA 2JD4A 4XIOA 1QNYA 5CNAA 2W39A 3SH4A 2DVGA 2ZZJA 1UN1A 3AFKA 4BMBA 1N3OA 5JOWA 2YV8A 4C1WA 4K1YA 2FMDA 1KDMA 1N47A 2D6PA 2VXRA 2JDZA 3FLRA 1N1VA 1UPSA 3N7LA 1W6QB 1SLBA 1OQ1A 2VU9A 3SISA 4AGVA 3MW3A 1S0BA 2Z42A 3GNEA 1GSLA 3H0OA 3NV3A 2A3WA 2A6ZA 3ASIA 2ES3A 5DZEA 2AR6A 2PHXA 1TEIA 1WCSA 5T5OA 1AX0A 4HANA 1KJLA 4YFZA 3IKWA 4XXAA 5CBLA 4GA9A 5E8AA 4LBQA 1BJQA 1MR5A 2WSUA 4P9XA 3HMYA 1APNA 1GZCA 2ARBA 1QDCA 4LBQD 1GKBA 3WDVA 3NV2A 3B3QE 4ISQA 1UZZA 4RL7A 4PF5A 3VKNA 4YZ5A 4CTEA 2A3YA 2ZGPA 3IPVA 1XQNA 1ENSA 1PZ8A 3B9CA 2ZGNA 4BMEA 1FAYA 3WVJA 1N1YA 4Y1YA 4YW4A 4YG3A 1URXA 1VAMA 2ERFA 1AJOA 5GLVA 3V65A 3WCRA 1AJKA 5JMCA 4FP3A 4PBOA 4LBQB 4Q1PA 1VAVA 1CPMA 4LBKA 2RHPA 1W6OA 3LSDA 1OKQA 2ZMNA 2DVDA 4XHBA 2VW1A 4ZXKA 5T5LA 3ZSJA 3ZXLA 1CPNA 4Y22B 5HCBA 1MZ6A 1A3KA 2BQPA 3AP6A 1AXZA 1LULA 1Z0HA 2HYKA 4YFWA 2DUOA 1LOGA 2GNDA 2EAKA 3AZYA 1WLCA 1UZYA 3VKMA 1C4RA 4AVSA 3WHUA 2GN3A 3ATGA 3PJQA 3WDTA 2CY6A 1S0GA 1A8DA 1JHNA 1DYPA 3N36A 4ITCA 2PHWA 3RMYA 1ULFA 2DVBA 1V6IA 2ZHKA 2YMZA 4XJAA 3T1MA 1WW4A 1G8WA 5H9PA 2GNMA 3DUIA 3V64A 4UW6A 1X50A 3USUA 3AZXA 1H9PA 1YRZA 3WG2A 4DRRA 3V0AB 3MW4A 4Q27A 2OUHA 4GKYA 3ZYRA 1LCLA 5EYYA 4BPZA 1IS5A 3WG3A 5JOYA 1YYNA 1GNZA 3AX4A 5GLZA 2UWCA 4GWNA 2CWSA 2EALA 1LHOA 1V00A 1WD3A 2AUYA 1AVBA 1SLCA 1SLIA 5GZGA 4AGGA 4XOGA 1G86A 4LBOA 3NV4A 2ZGLA 1MS5A 5GLWA 5DXDA 2YZ4A 2ZGQA 3APBA 2E6VA 2WNEA 1LECA 1LEDA 1ULGA 1LHVA 2CNAA 2E7TA 4FQZA 1IKPA 3N3HA 3RSJA 1DQ0A 1KRIA 2P2KA 3ZXFA 4AVVA 3AYAA 2W68A 4FOWA 1C1LA 1CJPA 4YGDA 1UKGA 3N35A 5GJ6A 3FLTA 2VY0A 1LHWA 3AP7A
chains in the Genus database with same CATH superfamily
4NHMA 1B35C 1U5YA 4HKLA 3ZDSA 1CAXB 1Q5OA 1LENA 2ZKLA 4M4PA 4CCDA 5KHKA 1K12A 2D3SA 3ACIA 3ME2A 1UX7A 4GKXA 1TNRA 2XKOA 1UY2A 3I2DA 3PUIA 4RA0A 3CHXA 2LTNA 3RMXA 3R4UA 3HBZA 4B7EA 5JXGA 1Q3EA 1QGLA 2JDKA 1SDDB 3AYDA 4Z07A 1I3HA 2J1AA 2WZR3 1J59A 5LEJA 3VDAA 5DDJ1 5L7OC 4YZ3A 4CDUB 3WDUA 3DECA 5CKMA 1AYM3 3FX3A 1F35A 1RUF3 2PHLA 2J1RA 4QQ2A 2Y64A 4WZFA 4Z8BA 3NQHA 1O3TA 4AQSA 1D0GA 3WP4A 3VBSB 4Q0SA 4OLLA 4A3XA 1XU2A 2E7QA 3ZSKA 3VKLA 4YW2A 2CDOA 4CA9A 1SACA 5FPAA 1QOTA 1LU1A 2A71A 4CDWB 4FPOB 4IE7A 4IV1B 1O59A 4Q0UA 4E4ZA 5IT6A 2W1QA 1WMFA 1NZIA 1SZBA 2R6QA 1PM7A 3AMQA 2RS33 3WUDA 4YYOA 4HVOA 2D98A 1MQTA 2CHHA 1AYM2 4QPIB 3HBKA 5CU1A 3PURA 1W8HA 4Q4W3 2ZX3A 2JG9B 2ZX4A 2DFCA 1GOFA 5KC6A 2YG0A 4FPJA 1OPMA 5CB7A 1ZBE3 5CADA 5A3WA 5JZGA 3CJXA 4DEQA 1SHWB 1UYXA 1OLRA 3TNQA 1XE8A 3ZXKA 2A5ZA 1YQCA 3X29B 2GSYA 3KHBA 2P1BA 3ZDVA 1VR3A 2VD7A 3D4KA 3MHZA 4JTOA 1OMIA 5FZIA 2W46A 2RS32 5DAXA 5BUVA 1V6LA 2D43A 1XYNA 2O1QA 1QF3A 1CONA 3OGRA 2H6BA 4RYDA 1IS6A 2IXCA 2QNKA 3I3DA 4LORA 3UNPA 3WSOA 2HEVF 4BQ2A 3WNNA 3VD4A 3CLPA 3N9MA 1KITA 3P3PA 1ZBE2 4NHXA 4A44A 3VDBA 1VPHA 5FKCA 4G4FA 4LJHA 5T50A 1OVSA 2VVEA 1PGL2 3ALQA 4MHRA 4XBLA 5LY2A 1F8VA 3OSDA 3PUAA 1COV3 1LU2A 5JR7B 1GQHA 4CZSA 1ZZBA 4EE2A 5JXHA 3B94A 4Y20B 2EAAA 2E51A 4IGOA 3WXPA 4FTSA 1DG6A 1VBC2 1ALYA 1OVPA 3UJOA 4B4PA 3WLUA 4IE4A 1ENQA 1BLZA 1ST8A 4QD2A 3ZFEB 3ZO0B 3SEEA 1X8EA 2CTVA 1BBT1 2WNUA 5LA9A 3IIIA 1FT9A 4NIAA 2YB7A 1I1EA 3FJSA 3GHMA 3MZHA 4XUNA 1MVQA 5FZMA 2BDRA 2WFF1 4FOYA 1W6PA 5ERLA 3U4XA 2DYCA 1YFYA 1AUYA 1IQAA 2FDJA 5A6YA 4HG6B 5LEKA 3MFAA 2G19A 1CESA 4C90A 4GH4B 4Y1ZA 2Z69A 5GZDA 3A4UA 4IL7A 1SDWA 1RVF1 1ULDA 4ZU5A 1OA4A 5KR7A 4RHV2 2G9ZA 1ONAA 3DCQA 1JI6A 5LWBA 3T4HB 5I8YA 2SLIA 4PLNA 4A45A 3NMBA 4XMAA 3IM0A 1DU3D 1JHJA 1YQ5A 2EXIA 2ILMA 1AF9A 3PU8A 1ODNA 1R083 1RMU2 4BH9A 1LR5A 5A70A 2XL9A 2JDNA 2OX0A 3BOPA 3W58A 4OZXA 1TE1B 2VH9A 3ZR6A 4F83A 4GULA 4AHWA 4XJWA 5JXJA 1PO23 3TNPB 3OJBA 4AR2A 2RR13 4YZ2A 4AVCA 1R091 4XF3A 5A7PA 5ACA3 2VZTA 2WDBA 1Z7S1 1F2NA 4LO7A 1UZ0A 5IVFA 2JG8A 2B42B 1YI7A 3DEMA 4LEJA 2WWJA 1PVC2 3PVEA 3WNPA 2K9ZA 4QX2A 4RD7A 3NAPC 1XXNA 1R082 2VUCA 1XYPA 2RMU1 5FZOA 1MZEA 3ZFFB 5SV8A 1RUE2 4I0WB 3A23A 2P4EA 1RUI3 1S0DA 2DVFA 3BPSA 4JCKA 4UW4A 2E32A 2QQMA 3FL7A 5IW0A 5DG1A 2RDNA 2RM21 1PO22 3KF5A 4A2UA 4NOTA 5KXEA 5DN2A 2RR12 3H50A 4CU8A 5IK8A 1WBLA 2Y38A 3WNLA 2R7EB 4COYA 3VD3A 3NJXA 5FPVA 2ZEYA 3WW3A 5DZFA 1WKYA 3BN6A 4A3ZA 4WBBA 1MZFA 2ZABA 5JDBA 3PU3A 4AFCA 3KQRA 1MQTC 3O1SA 1UKRA 4WVMA 1GZ9A 2TUNA 1GBGA 2Q1ZB 1G9FA 2D6MA 3OOXA 4FQ4A 1M4WA 1QHDA 4XEZA 4NROA 4XFGA 3VD7A 1PK6C 3WY6A 4BQ1A 2GH8A 4DOUA 5F3CA 4P9WA 1NE6A 1K5JA 3NNLA 4OI1A 3WF1A 1AR81 2WLPA 2X5IA 3RRDA 1UOGA 3EB7A 3I2KA 2YPDA 3S5AA 4NN0A 3JU9A 1ZRDA 1JODA 5K0UA 1DGRN 5C8WA 5JSRA 3BUCA 2YGLA 1AR93 4W6WA 3T30A 1OA3A 4L8QA 2F4LA 3OGJA 2DUQA 5JWPA 4MG2A 3KLSA 3T4VA 3WQ1A 2WUHA 4XTMA 3BIWE 1VP6A 2LM3A 4O65A 4CP1A 1REDA 1W2TA 2DU1A 2F17A 3N7JA 3WF4A 4PIZA 3PVOA 5CAZA 1NCQB 4WM7A 4OHWA 1HLCA 3FLPA 4I0BA 1ZM1A 2WQ4A 4D69A 3IBMA 3WG1A 3ZYBA 2YXSA 4NO4A 4O9EA 4QM8A 3KQ4B 4RGGA 3UGHA 1JYWA 2DBNA 1JOBA 1O7FA 1VRH2 4XFAA 1YQ6A 3VBRC 4NRMA 3ZFGB 3M3OA 1DBNA 2ARCA 4H55A 2JICA 4YG0A 1F31A 5EJZB 1RYYA 1EYBA 2D7FA 5EV7A 3RYPA 1GICA 5CISA 1DQ4A 3TOJA 2X09A 2JJ6A 1H1AA 4COUA 1TVGA 5A3MA 3K51A 1OOPB 5EQUA 4FFFA 2XH6A 5BXXA 4QKNA 3KB5A 4JX0A 3PUSA 4BE3A 2WNUC 1LJ7A 4C1XA 3IZOA 5DDJ2 3LZZA 2GMEA 3E97A 4TN7A 5I93A 5FZKA 2PAKA 5CEHA 3MIGA 4JKLA 4XILA 3O12A 3UL2A 4CEWA 3VHOA 3SH3A 1LOEA 1NY72 3VBHB 4HETA 4DRVA 1XNAA 3K2OA 5JI7A 1YQ2A 4HZFA 1LEMA 3DKQA 1AX2A 1XE0A 5EJ1B 4FXKB 4EWAA 4TTGA 5BNQA 1UMHA 3A7QA 3ELNA 4LO6B 5CZKA 1REFA 4DFSA 2VOVA 3AMPA 3POFA 5C70A 2VW2A 4S2HA 2VZ1A 5FZ8A 4MOAA 2NLRA 2FDIA 1FI2A 2V5DA 3Q9OA 3WP6A 1SBFA 3DPRA 1MS9A 4YW3A 1QIQA 1VIWB 1WLWA 3OYWA 4IEVA 5BNNC 3RS6A 4COVA 5CFCA 1LRHA 3OF1A 4K1ZA 2NPIA 5A7WA 4YZ1A 2VZOA 1SFYA 3JBG1 4M00A 3WNKA 3PVNA 4BXSV 1YHFA 3HNMA 2Q0AA 2Q8EA 5FRAA 3TB0A 4CDXA 4FXGB 5FCCA 4QGNA 4NRQA 3ZKYA 2HWC3 2PXJA 1HJGA 3P6BA 4YM0A 4K40A 3VZNA 1KS5A 1NX9A 3FUOA 3N7KA 2CAVA 1FMD1 3N9OA 5SV5A 4AXOA 2O14A 4Q0PA 1OLMA 5A3UA 1NA1C 1CR7A 4FOQA 2V72A 3J7LA 2HWD1 1J1LA 4HBNA 5KHHA 3WW2A 2VUAA 3AP9A 1CQ9A 1F5FA 2EIBA 1HXS1 3ILNA 3OBTA 4GXLA 5C3SA 2P6HA 3I59A 2ZAAA 1RUD1 4I3PA 4BK4A 2P17A 4FAHA 4ZKTB 5FPZA 1YEWA 1T6GC 2NQYA 1IPSA 2O0OA 2ZXQA 1US3A 2XL7A 3ZIWA 1W8FA 2VR4A 5IK5A 2RJLA 2IVJA 2UWAA 3LWCA 4UBHA 5F5IA 1JYXA 1A8MA 1OUSA 3J8F1 4V2VA 3PHMA 4QKDA 2XUEA 2HWC2 2WQZC 1GLHA 5J7MA 4GWMA 1N1TA 4H7MA 1CAVB 4XJUA 3B93A 1W06A 3BALA 3O0WA 2C26A 2GC0A 2V5YA 3D3AA 4LQRA 4Q0QA 3LEMA 3S57A 5DPNA 5M0TA 1BBT2 5I0UA 4AQTA 2VNOA 1UY4A 3GZTB 1UY0A 2OYZA 3OY8B 5A1FA 2VMHA 4QHOA 5J09A 1RIRA 2OQ6A 3MW2A 2BNMA 1TG7A 5G04L 4P9IA 1ULPA 5FY0A 3T3YA 3B5LB 1QQP1 1LGCA 1QJX3 2FQPA 5FYMA 4NE9A 5K0UC 4FCAA 5AFBA 4R9BA 5DUVA 1D4M3 2ZAHA 4C8DA 1NLQA 4CPBA 3BGAA 4XUQA 3W21A 3ZYGA 5IFPA 1AL21 1CZTA 1HQLA 1S0IA 1UMIA 2JD4A 1CZVA 1O6UA 1O4TA 1QNYA 3OEBA 3SCGA 2ZZJA 2WWUA 3FWEA 1BMV2 2JENA 3LPGA 4MH0E 1HRV1 2JDZA 3FLRA 3ZX7A 1N1VA 3N7LA 1QJY1 2WO7A 4HPKB 5JSOA 4JGYB 5C33A 3LDKA 1JOPA 1RUOA 1GSLA 3NO8A 2A6ZA 4RS5B 4QKFA 1O5LA 1TEIA 4A6SA 4CU9A 1K42A 1WCSA 5FR3A 5HV4A 2ADDA 3PTYA 3KVAA 4CXXA 2R32A 3UKNA 5ABJA 1SPPA 4CXYA 5KHIA 1R092 5FWEA 5A6ZA 1OT5A 2IVIB 2WSUA 3HMYA 2ZTNA 3BKZA 4CP9B 3UT0A 4ASKA 3WDVA 5FY7A 4IV3A 3VHNA 2FBEA 4IEOA 4PF5A 3SCHA 4QPGB 2A3YA 2ZGPA 3VKNA 4UF0B 3IPVA 5FBJA 4CCCA 1PZ8A 1W8NA 1YJKA 2J1UA 5FWJA 3LA7A 4LIVA 2VQAA 4CCKA 1HN1A 4YG3A 4AQ2A 5L19A 3WCRA 4EN6B 5JMCA 5GLVA 5FZAA 4E4SA 2FZ1A 3G6JB 3LE0A 3POJA 3BI3A 1JYTA 4LBQB 1UU5A 2XJQA 4B7KA 2RM22 1W90A 4LBKA 5C4WA 3MIFA 1W6OA 2RS53 2DVDA 3GZAA 3U1XA 4ZZ5A 2H0VA 4HN0A 1VAKA 4XFCA 4JGZB 1MZ6A 2VOTA 2G1MA 2BQPA 2VO5A 5CFCB 1Z0HA 4LKDA 5F7UA 4UI9L 3EO6A 1UOJA 3K4AA 5C3RA 1T2XA 2O8OA 1XSQA 3LA3A 3C3VA 3KVBA 4HN1A 1L7LA 3FBMA 1W05A 1AR82 3WDTA 2QZ2A 1JHNA 3RJ2X 4ITCA 3VBOC 3RMYA 5LBFA 1ULFA 3GHNA 4N43A 1V6IA 1VMFA 4XJAA 2DF7A 4OHVA 3T2QA 2YHJA 3DUIA 5JPMB 4UW6A 2WZR1 1H2LA 2QFEA 4K6BA 5FP7A 1VBE3 3WW4A 1C28A 4XFIA 4DRRA 1W2OA 3WG2A 4R4ZA 3V0AB 1AYM1 2OUHA 3DN7A 1RUF1 4BPZA 4QU2A 2Q4SA 1GOGA 3FC0A 5GLZA 4DINB 2UWCA 5EJ3A 3RI9A 1KEXA 4E8CA 3C7HA 2AUYA 5LA2A 1VB4A 1AVBA 1SLCA 1WCKA 5GZGA 4AGGA 4LBOA 5AC93 2VNGA 4Y4RA 5GLWA 5LCWL 5IVCA 3VBFA 1VBE2 4OHXA 4RGKA 2J1SA 2VBBA 2RS31 3MF9A 3RSJA 3PJYA 2LRPA 1HV1A 4AI2A 5LA1A 3AYAA 4Q4W1 5C3OA 1OPOA 1OC1A 4HLTA 4OI2A 4CDUA 5T3NA 4DMIA 1UD1A 2KXLA 1ZNPA 1LHWA 2VY0A 2BWCA 5FMDA 1ZBE1 3O1TA 3S5QA 2WIIB 2GNBA 4RN5A 5BNOC 4KBZA 3OPTA 3VBSA 5HBAA 4EN9B 2OA2A 5AC92 1MS1A 2DWRA 1OBNA 4AEDB 4CDWA 4XUOA 4JV4A 4UXAA 3VL8A 2VMFA 2JDUA 1E5RA 5E16A 4IV1A 4AG4A 3LDBA 3I2HA 4JDNA 4AVAA 2PMWB 3WX5A 1R1ZA 5F9TA 4LA3A 2VAUA 4ZS3A 3W59A 4IXLA 4Q4X3 5LB6A 3R4SA 1FMD3 3IWZA 4CDQC 2G9FA 3OBZA 2ENRA 1GANA 2QQJA 4MHUA 5FZBA 4Q4V3 3QCWA 4QPIA 3TN93 1DP0A 3SCFA 3IDCB 3OUHA 5JSPA 5L7OA 5LK5A 2VZQA 3MIEA 4ARYA 3M3QA 3QOPA 5FAXA 3ZVXA 5FY8A 3T0BA 4BXFA 3HQRA 3P5BA 1GZTA 1PO13 2Q8OA 4BCUA 1U12A 4M3CF 4MXWB 3ZOIA 2WNVC 2D44A 1COV1 1GWLA 2ZBJA 5CFDB 2QZ3A 1LGBA 1MZ5A 5T5PA 5HI0A 2P37A 3P1IA 4AQ6A 1I6XA 5ABJC 5J96B 1RXGA 2G4IA 5H9RA 1HJFA 4OQ9A 4Q4X2 1FMD2 1DZRA 2H0BA 2RV9A 4FPGA 3A0NA 4LBLA 2P3KA 4IV3C 4NR1A 3TN92 2C9AA 3E6CC 3HNYM 3WDWA 3NNFA 3R05A 1HXS2 2E31A 1EPZA 3S0MA 4QB1A 3ZYJB 1RUD2 1VRBA 2BRTA 4Q8LA 1ZZ6A 3ZIXA 5DAWA 4KG0A 5FZLA 3RNSA 4Y22A 2K2SA 1NQJA 3PIJA 2FHRA 1K3IA 2IXLA 1ZRIA 3J8F2 3BU7A 2P6CA 4QQOA 4K3UA 3RJRA 5E88A 4LE4A 2VQTA 4XTPA 3WP5A 2WLQA 3U78A 5GALA 3ZFEA 1NXMA 4KU7A 3LFIA 1ODMA 2A6WA 3AKSA 1Y43B 5GZEA 5EIYB 1UPIA 1NKGA 1R081 1OQDA 5FYUA 4R9AA 3WDXA 2JKBA 2XVKA 3MIDA 4ISRA 2D6NA 2PAEA 4RQPB 5I8SA 4GJYA 1LHNA 2VQUA 3IIAA 2R0HA 4ORFA 4H2AA 1PO21 3AZZA 1V6KA 1JZ6A 2R16A 5C71A 2RR11 5FXWA 4QQPA 2XPJA 1PMIA 4CE8A 5ACA1 2BP6A 3GJAA 3JUUA 2BNNA 5FV3A 3J26N 4AI9A 4XE9A 4XHXA 2JDHA 5D1IA 4K21A 1DFQA 2VZUA 2QQOA 2XHKA 1TQ5A 2CU5A 4XQWA 5FLIA 1GWKA 3RWKX 5LRRA 4YM3A 2VMEA 1PIV3 2ZX2A 4QHZA 2VCAA 1F4HA 1RUI1 4NHKA 1I9RA 2W3JA 1QJY2 5A32B 3MPPG 5F3EA 3VLBB 3WQ7A 4CEYB 5C8CB 1YXWA 2EIEA 2OZ6A 2VTFA 3C2UA 4S2GA 1ENRA 3DKWA 1W6MB 4QDQA 5IHRA 2XB6C 3PVBB 4QPYA 3ITQA 1HDKA 4XXPA 4YGBA 4DS0A 1GMMA 3URFA 1UXXX 4GALA 2ZKNA 4LMFA 3EJKA 4PI0A 3J7HA 4FPKA 4LA2A 4RR3B 4XFFA 3VZJA 2PN5A 1OKOA 4GAZA 3POBA 3I3MA 1PX4A 1H9WA 2PHRA 4CDUC 4FPCA 1SCSA 1NAEA 2G9GA 3ZYFA 1PIV2 1YO8A 4DXTA 5IAXA 3JD73 3KCCA 5L9BA 2RVAA 3DYMA 1BK0A 4IEYA 4NIGA 5CKQA 1C5IA 4Y5Z0 5FZGA 3VBSC 3MI8A 2IXJA 1BEV3 1LOAA 4OFGA 4Y1UA 5F5QA 4CDWC 3I49A 1AR91 3S7EA 4Q5OA 2ZMKA 2OKXA 4IV1C 5B4XA 2PHUA 4E4DX 2KM2A 3EMRA 3GJBA 4YVSB 2GN7A 1PZ9A 2VUJA 2QCSB 2BV4A 1WLDA 2BBAA 3ZYPA 3LB9A 3NV1A 4XUTA 5JOZA 4QPIC 2JWPA 1DGWA 1JXNA 5D21A 1ACCA 1LHUA 3JD72 4QDSA 3NAPA 5JAXA 5EZWA 4BQ3A 1IOAA 2BYVE 3M70A 1ASJ3 1UX6A 3UKTA 3KV6A 1NY71 5JUVA 4CUGA 2VULA 4QWNA 1QNWA 3M1HA 5IYYA 2Q5TA 4ES9A 4GQ7A 5C3QA 5B2GB 4FPFA 4FPEA 1PX3A 4KU8A 3H7JA 3I2IA 1H0BA 1J1TA 3O7OA 2WZR2 4P5HA 1DGWX 1JUIA 1XRUA 3OPZA 5DUWA 2ET1A 2NYYA 1RUF2 5C3PA 1XNBA 1ASJ2 2D6OX 1PHMA 1PK6A 2Y0OA 2HYXA 1YIPA 2PLV3 4YSFA 3ZFGA 2H6CA 5JR2A 1XBFA 2RDSA 4QMAA 1IPKA 3N9NA 5EYXA 3ZSMA 5KXDA 1U5ZA 5A33B 3KMHA 4AK3A 3TEZA 2OUJA 4C0BA 2VCMA 4NAMA 3H8OA 1IKQA 1VLNA 4YG6A 3OPWA 5FREA 1J3PA 1OOPA 1NLSA 2PELA 3IT8A 3O0VA 4UW5A 5FQ0B 2Y6JA 3WF3A 1O3QA 3ZFEC 5GKAC 1C3HA 4CVUA 3USSA 4XAAA 3WDYA 5CG8A 4FP2A 2PHTA 2WO2A 4Q4W2 2KR2A 4OCTA 3TWIA 4J25A 3ZXAC 3WNOA 2YU2A 5HCAA 2ZHLA 4CRQA 2LROA 5T54A 4W4ZA 2PLV2 4Y3OA 3OGGA 4A6OA 3VBUB 3VBHA 3VBRA 5FOBB 1CD3G 4JZRA 2GNTA 2HWC1 2BNOA 1KDKA 1W0NA 4GH4C 1CJDA 4YW5A 5F37A 1VBA3 2D6LX 1SG3A 2BU9A 4KI5M 1S0JA 4QX3A 1W2UA 3JXSA 1AXYA 5FK8A 1BXHA 3FFQA 2ZEXA 4JKKA 5F3IA 2PQQA 4TYSA 2YFUA 3AJYA 4RGAA 2R1DA 2NZ9A 3ZPOA 3D0JA 1GZWA 2XR4A 4ATFA 1BQPA 3VN4A 1Q8PA 4RFT0 1XNDA 3PIGA 2FCTA 4CU6A 3OUIA 3VKFC 1FNZA 3AVRA 3ES4A 1OI6A 3C7EA 1T6BX 2HWB3 4XACA 4YWAA 2JX9A 2QQNA 2D6KA 4WV8A 2WZPP 4MXVA 4YARA 5IK4A 5E6HA 1VBA2 1COV2 4LBNA 1E5HA 3H9AA 4PDWB 2VECA 2PTMA 1RGSA 2ZGMA 4W50A 3HNBM 4ZU4A 3J9SA 1BMV1 1OF4A 1WD4A 4K20A 4KQ7A 2C6SA 3M7AA 2R073 4MGQA 4QGMA 4AYUA 1W8UA 4N8MA 2Y6GA 4JKMA 3MLLA 4QXHA 3UGFA 4BA6A 4O7XA 2BGCA 5BNNA 3HT2A 3ZFFC 4Q29A 3WOGA 3ZXEA 4R4XA 3C7FA 1OFSA 1TME3 2WO3A 4HK9A 3J7MA 3D8CA 1QJX1 4AFMA 4ASLA 2GALA 2YYOA 2MEV3 3QH6A 4Q2FA 1D4M1 1D2QA 1Q8SA 4TLGA 4AL9A 5C5TA 2R0FA 2NM1A 4XJ9A 3SISA 3IDBB 4PHZA 3ZN4A 4E4HA 3N4MA 5D8AB 4KBBA 1FPN3 2HJIA 4CYDA 4WM8A 4JHZA 3EBRA 2ZGTA 4AW7A 3PMSA 3R4DB 1DF0A 1W0OA 2J1VA 2R072 1XU1A 3IMNA 4UFLA 1NA1A 4P9YA 3V0BB 1MS4A 5F5AA 1HX6A 2GMPA 4MVTA 3USUB 4IERA 3RZZA 3OEAA 5FXVA 3INAA 3OY8A 1TME2 2OZJA 4XDOA 3NL1A 1IQDC 2JE9A 2MEV2 3PL0A 5T55A 3DGTA 1IS3A 5CVRA 4EZ4A 1JW6A 2AEZA 3LA2A 4OUMA 4QB2A 4I02A 1BVVA 1CGPA 2WS93 1DQ1A 3H1MA 3WUCA 1BCXA 1NCRB 5ACA2 5JPNB 1G9AA 3NWKA 5FZ1A 3UJQA 3TEWA 4AI8A 3AB0A 2B5HA 5FZ6A 1W9YA 2E7AA 1UWWA 2YPJA 2A73B 1H4HA 4FFHA 2BERA 1GP5A 5A6XA 3OGVA 1JZ8A 1CN1A 3B01A 1UW8A 4QHBA 1POV0 1W8WA 5F3GA 5J48A 3HPNA 3KGLA 1BK1A 3T2PA 2ZGKA 4MZUA 3WF0A 1RUI2 3N9PA 4HPKA 3FHAA 4JGYA 3RYKA 3WHTA 3ZFGC 1AL0G 3LSEA 1PNGA 2A6XA 2LUWA 4PF1A 2AEYA 5BNPB 1CAWA 2RS51 2WS92 3WT3A 4NIDA 3AFKA 3BOWA 4HONA 4GB33 4H14A 1N3OA 5JOWA 2YV8A 3MIBA 4HK8A 3BPZA 1OOPC 1P8JA 4L99A 2VPVA 5A3LA 3E5XA 2GC1A 3BTZA 1DYOA 5FYHA 3KCXA 4LULA 1WMEA 3ETQA 4YVWB 5EP9A 1SLBA 4QPGA 5LW9A 1KFUL 3MW3A 1S0BA 1EV13 4QXKA 2A3WA 2ARAA 4YW7A 4GMP0 3VD9A 4Y4YA 4MUVA 4Y33A 1WA6X 2VBPA 4KGGA 1AX0A 5T5OA 3VBHC 1QH6A 2R063 5CBLA 1YJLA 5J37A 4LBQA 5ISLA 4KWKA 3ZKUA 1E5SA 4P9XA 4GB32 5J1XA 1ND2B 1AR92 2ARBA 5F2WA 3EYPA 4E27A 1QDCA 4LBQD 3NV2A 3B3QE 1VBE1 3HVDA 4L9BA 3VZOA 4YZ5A 1QEXA 4HT1T 3B9CA 4JGZA 4PQQA 2LW8A 2Y6LA 4CCJA 3P3NA 4YW4A 1EV12 1URXA 3VDDA 1IG3A 2ERFA 1AJOA 3RWNA 5JZGB 1JUHA 1E57A 3SMHA 4Q1PA 3GBFA 3NNJA 2B4KA 5A3NA 1OKQA 2ZMNA 1YI9A 3T0AA 5AC91 4ZXKA 1MPXA 3PTRB 3ZXLA 2W47A 1C8M3 4S2FA 1AXZA 1LULA 2HYKA 3MGUA 2BZDA 5FZ3A 4CUAA 4UWDA 4AEKA 3AZYA 4RFRB 1UYZA 1XOYA 2VZVA 3D82A 4EYUA 1C4RA 5FP8A 3U4SA 3I54A 4GWIA 3WHUA 3B9IA 1UF2C 4HVRA 3CMGA 4PIXA 1CAUA 2IUWA 4N90A 3WQ0A 4YPJA 1S0GA 1DYPA 3N36A 2J22A 4IW3A 5FPXA 2DVBA 2FZ2A 3L9JT 4FSJA 4AI0A 2HLEA 1V70A 4XQDA 4P9GA 5KBFA 3TRSB 1H2MA 1H6YA 5A6QA 5HXMA 3VBOA 4HSLA 3SEPA 1X50A 4WM8C 2C4XA 1H9PA 1YRZA 2Q30A 1OA2A 3AM2A 3MW4A 4I01A 4Q27A 4GKYA 3HQXA 4Y5SA 1HB3A 3ZYRA 4Q4X1 4GWJA 3LF7A 4FTEA 3M3IA 4G3YC 1YYNA 1GNZA 3AX4A 4Q4V1 3TN91 3H8UA 2W1WA 2W1UA 4GIQA 4XFBA 1Y3TA 3GBWA 2R043 4GWNA 1OF3A 1XYOA 2X8KA 4X8PA 4A7ZA 4B1MA 3IAQA 4LPLA 4LUMA 2FDFA 1PO11 4XOGA 4D6QA 1OLQA 1G86A 4ZHNA 2OPWA 3I97A 3WP3A 1AR73 1QY4A 2RS13 4D7YA 2PHDA 2WNEA 1YWKA 1LECA 2VCBA 1YUDA 2WA4A 3UV9A 5A7OA 1I5PA 1LHVA 4FQZA 3THPA 4NMIA 2ORZA 1GP6A 2QQKA 5FZEA 1CX1A 2GP5A 3ZXFA 4AVVA 3DXUA 4PLOA 2W68A 4ET7A 1WCDJ 3CEWA 2Q8DA 1DGRA 3CBNA 3NJVA 3N35A 3JB4C 2BUKA 1OHFA 2Y34A 3BODA 3FN9A 2R042 4IEXA 1QWRA 3POSA 1KXGA 4L2NA 3VZLA 3ENRA 3UESA 5A1LA 1G9CA 3NKGA 2CWMA 3GALA 5K4LA 3ZXDA 1JZ4A 2LS6A 4E2SA 4V1PA 5A3TA 1H8TA 2W52A 2VZ3A 3E5QA 3M3EA 3LKJA 4JGYC 2UYBA 1PGSA 1BHGA 2RS12 2JDAA 4N53B 5BNOA 2E26A 3QD6A 2D5HA 3FUQA 1F9KA 4NHLA 2J7MA 1AZDA 1J84A 1W6QA 1W8OA 4N9IA 5FIXA 5LA0A 1XE7A 1N1SA 4BIFA 1Q8OA 5C5UA 1ZVFA 2R30A 2JG8B 5FJKA 4IDZA 2XGXA 4H3WA 3ZSLA 3NRUA 4Q4Y3 2JD9A 1C8NA 4CDQA 2C1FA 4MX3A 4QPGC 4BK5A 3WZ1A 4I3GA 1A78A 5K8SA 3MDPA 4XCBA 3I3QA 2AZ5A 3BIEA 5FOJB 1S0EA 5F5CA 3HN1A 1NXD1 5FYCA 2VCCA 5H9QA 5FPBA 3N7MA 3JQXA 3KCYA 4K9SA 4AVTA 1QJX2 5I0DA 1UYPA 2ARXA 3VZMA 1D4M2 2WNVA 3RZHA 4L97A 3MFCA 4NUBA 1RUJ3 1W03A 2BFUL 2Q1FA 4HOOA 1GQPA 2UURA 3MV11 4Q4Y2 1RC6A 4JGZC 5F6LB 3E5UA 3SKVA 4WVWA 5C9AB 4WVMB 1NT0A 1OLME 2DURA 2JDPA 5JLVA 1MS8A 3VDDC 3I7DA 2HH9A 1PIV1 2WO1A 4PBPA 3AJZA 4QXBA 1OQEA 3Q8CA 1NYWA 3THDA 3VGIA 4QAWA 2VOKA 1MS0A 4EJRA 4PT6A 2X5IB 3AKQA 3ETPA 2HWE3 2ZGUA 4XF9A 4AVBA 3HR9A 3AP5A 4LHLA 5IK7A 5K0UB 4H7LA 2W9XA 2ZOEB 5GZCA 3DYPA 4CCNA 4XMIA 2GAUA 1HRI3 3E6DA 4MV2A 4W6YA 4UFKA 1LOBA 4CSWA 1X36A 1O4YA 4AI1A 1AHSA 1PGW1 4WM7B 4AGRA 1RUH3 4EQVA 1QXJA 3JD71 3AMNA 3MPBA 4LHNA 4QU1A 5KC5A 1EPWA 5BYNA 1W0PA 4KNCA 1VBD3 2IXIA 3MUY1 4MGZE 1KJRA 3ECQA 4QGLA 4XQ4A 1Q8QA 2VMGA 5FO8B 3NNGA 5L9VA 2B9VA 3RDIA 2AREA 1J3RA 1BEV1 5K7PA 3B69A 4TWTA 3LQCA 1SLTA 1ZREA 3VDCA 2CSGA 3LEGA 2CL2A 2JKXA 3AYCA 3SQOA 5DUXA 3VD5A 4BLIA 2RS52 4EWDA 4M0NA 2YBSA 3T0DA 1B09A 4Y1XA 4BISA 4CUCA 5IFTA 1XSRA 1KQRA 4ATEA 2VMCA 5JVVA 5LZ6A 3N9LA 3GBGA 1DLLA 2WFPA 1DQ6A 2EXHA 2Q1MA 4NPLA 1UU4A 4TZDA 2O8QA 2XVLA 1VMHA 4ZXEA 4QPWA 3C7OA 3IB3A 4JRLA 1ASJ1 2OT7A 4JRAA 4CEWB 4FBFA 4ZONA 3ILFA 3VV1A 4QX5A 3POYA 5LY1A 4FPYA 4M01A 2D3PA 3PUQA 3TYJA 4LBMA 4LO4B 2Q8CA 4AEDC 1NG0A 3UKVA 1ND3B 4AZZA 4Z2AA 4EN8B 1CAXA 3SNMA 2CAUA 4DY5A 4IUGA 1WBFA 2WABA 1OSGA 3AK0A 5AVAA 2FDKA 2CGNA 2DU0A 2YFZA 2D97A 5I8TA 2OS2A 3DPRB 4R8HA 5FYBA 1STMA 2XQRA 4BOWA 4P9LA 1WWYA 5BPXA 1OH4A 1W99A 2XLGA 2ZHNA 4K8FA 2EA7A 1K5MB 2RE9A 2RDQA 3LAGA 1H8TC 4S2DA 2DDUA 3Q8AA 1IS4A 5FMOL 1DGLA 2IWGB 3L2YA 1DLCA 2CV6A 2PLV1 4AFBA 3V56A 5GLUA 1ZZCA 4YW1A 3VHRA 1UIJA 4YM1A 3M2MA 4BB3A 2W08A 5HPOA 2FD8A 3KM5A 1RHI3 4A42A 2DTWA 4B4RA 4CDXB 2JXAA 1YLLA 2AENA 4XBQA 3JCIA 1QJU3 1RUNA 5FP3A 1EAH3 1JH5A 3AMHA 3M8LA 1TMF3 2P34A 3LD8A 4YM2A 4YGEA 4YW6A 2X53S 1LB2A 3MIHA 2EICA 1PMJX 3CU7A 1UNBA 5EHDA 5L73A 2DCTA 3I59B 3D0SA 3ZPYA 3RZJA 1SQ4A 3NJYA 2JG9A 2YC2A 2XDVA 2CYFA 2Z79A 1QOOA 3F95A 3I3BA 3KV5A 5LBEA 5CKNA 1ZRFA 4INDA 4OHZA 4BU2A 2WNOA 3LFMA 4LE3A 4XC9A 3AZVA 3T09A 1VBA1 1QJU2 4NHYA 1ZX5A 2XONA 2XWBB 4RSUA 5A33A 4E9KA 3LEKA 2XJRA 5HCHA 4EWEA 4TSVA 1TMF2 3IDEA 5F1RA 2ZGSA 1X9TA 3LDRA 2WZ8A 1RXFA 4M3CE 4AHZA 5APAA 5FQ0A 1C1FA 3U11A 4XVHA 1KGYA 2OW4A 1UAIA 3AZWA 4Q4V2 4UAPA 3U75A 3ZMNA 1W3XA 4LKSA 1QJZA 5KHGA 1QXRA 1ZA4A 1IG0A 1JZ2A 4RQPC 4FO9A 2HWB1 3PMEA 4L92A 3VL9A 1PO12 3SLIA 3K3OA 2ETEA 3ZN5A 4AHXA 4JTNA 2VQ0A 1WLTA 3VBUA 1PM4A 4BQXA 2PQSA 5FYYA 2HWF3 3IAPA 4DO0A 2OPKA 3KWVA 5FLHA 2P3JA 5A1AA 2PA7A 2MHFA 2UWBA 4KWUA 1H1IA 4WVZA 1DQ5A 4W6XA 2RJ2A 5KXBA 4TLFA 5FKBA 3BTAA 5ANNA 5A7SA 1WW6A 4Y20A 4AE2A 2VZSA 2R071 2XHNA 4OI4A 5JIAA 1DHKB 4PQ9A 2NMOA 1JMUB 2W94A 2XUMA 4FT8A 4MYEA 3FBYA 1YFXA 5IAVA 1GUIA 3MF6A 1W6NB 3CZUA 5H9SA 1TME1 2JECA 4CEYC 4CP2A 2MEV1 5C8CC 2FCUA 5FBZA 5FZDA 3SC7X 4UW3A 2VTXJ 3R0RA 1LGNA 2V4VA 1FV3A 3HAGA 1NUKA 2B46X 4KH9A 4XZPA 1FPN1 3K48A 1Q56A 5A7QA 4GH4A 1KFXL 2IFWA 4KMQA 1N3PA 3O0XA 4PDWA 4RR3C 2VVFA 2DV9A 1OH3A 3O5SA 1UYYA 2PHFA 4NWVA 2MPFA 4R9DA 4UFIA 1Z78A 3J7NA 3ZXJA 3WG4A 1RUC3 5CYYA 3IPVB 3H1WA 2LALA 4F8AA 1H30A 2OQ7A 2RJKA 5DMYA 1GNHA 3AXDA 5JOXA 1X82A 2XMLA 2GC2A 3TEYA 4I2OA 2HEYF 3I2OA 5FZ7A 1GWMA 1SLLA 1IHMA 5JIUA 5C4WB 1LKNA 2WS91 4IGQA 1W6OB 4E2QA 2DCKA 2Y6HA 2F6BA 5L36A 1S55A 2V73A 3B7MA 1H4GA 3FMGA 1POV3 1YIFA 3K75B 5EFUA 3WW1A 4CUBA 1ZZ7A 2AC1A 2DFBA 2JEMA 3J4UH 1V6JA 2MNGA 3WF2A 3AXEA 3TBDA 1PZ7A 1U5XA 4N9HA 3V0BA 2XLAA 3EXUA 3OUJA 2XXZA 5FJHA 2WSVA 1UL9A 4JAAA 3ABZA 3FHIB 5FMCA 3ZFFA 3MEPA 4LK7A 3SH5A 3BVCA 2ZA9A 3CF6E 3NVCA 2KD7A 4XURA 3KGZA 1AYN3 1HQWA 1BKZA 1PNFA 2W5FA 4N43B 2OVUA 4GB31 4DQAA 1MS3A 2ZPXA 3GCWA 4K8RB 4BDVB 1A6CA 3OD4A 2XJVA 3AP4A 1MEC3 1RJ7A 2QBXA 4M3CB 3TAYA 5FY4A 1NCRA 2YUEA 2WQ8A 4GMP3 1DCSA 3AKRA 1NE4A 4LBJA 4DEVA 1CZSA 3ORJA 1AR63 1QJFA 3AKPA 2ZZQA 1VMJA 2HBUA 4UT5A 2I2SA 1PGW2 3BTYA 1EV11 3K46A 4XJ8A 2JG9C 2WKKA 4CCLA 2DBIA 1W39A 3QH7A 1V6MA 2D93A 2IXKA 1REEA 2YU1A 4LLFA 5FPUA 3H3ZA 4XJZA 1IZ3A 1G7YA 2R061 1AYN2 5A7NA 3AYEA 3POEA 1BEV2 1QMJA 2A75A 2ZEZA 5DUUA 4A7KA 4DUXA 1G9BA 4D6RA 4Z82A 4YZ4A 5BNPA 4OULA 4HL0A 4J1WA 1MEC2 4O61A 1BZWA 2W0XA 3VBFB 3CJIB 3ES1A 5FY1A 4D8MA 3KT1A 2XWJB 4UFHA 3WD5A 3M3CA 3RZGA 1AR62 4P08A 4UFJA 4NIIA 4KL1A 2XJTA 2X29A 1ZZ9A 5FY5A 3I2FA 4DUWA 4YVWA 1NCQA 4ZZ8A 1N3QA 4OUEA 3C7GA 1WUVA 1W8TA 5F32A 3UGGA 5FTTC 5FYSA 3LGRA 5FY9A 5IJRA 2PAMA 5DAVA 1EUTA 3RYRA 2EIDA 1UN1A 3VBUC 4BMBA 3ZN6B 1JZ5A 5C7GA 4L0PA 4C1WA 1B35B 4E8DA 1S2BA 4K1YA 2JDYA 1C8M1 1HV0A 3BB6A 5FUPA 3RI8A 2GC3A 1ND2A 1UPSA 3THTA 2ZCWA 1JU3A 4FFGA 3MUZ1 2BEOA 2DCZA 4HKWA 4IEQA 4F7ZA 2VU9A 4AGVA 3JQWA 3OBAA 2Z42A 2HEWF 3H0OA 4AHYA 4EZHA 4NAOA 5L7OB 3HEIA 2ES3A 5DZEA 2PHXA 1UU6A 3BTXA 2TNFA 2W1SA 3NNMA 3I2JA 3NSTA 1KJLA 2D40A 3IKWA 4KGQA 4XXAA 3O1PA 3GGLA 1R1A3 3O1OA 1BJQA 1MR5A 5LATA 4PLMA 3DL3A 3QBQA 2Y6FA 1ZRRA 4OQ8A 2XOMA 2D5FA 2UYAA 4ARXA 4NJ4A 1VBB3 4LOTA 1XQNA 1ENSA 5FDBA 4PDWC 5E1RA 1FAYA 4J1XA 4N7UA 4BMEA 4HMZA 4URTA 3K3NA 4HSJA 3ZXGA 1GNYA 1WCQA 1VBC3 2JDMA 4BWOA 1UOBA 1NZCA 2Z5WA 1W2NA 3V65A 4LO8A 1AJKA 2R041 4FP3A 4PBOA 4BIOA 2Y26A 1X8MA 1GU3A 1VAVA 1CPMA 4FI9A 1V0AA 4XCAA 3T2OA 2RHPA 4NRPA 3N9QA 3WINE 1R1A2 3THCA 4COWA 5T5LA 2VBDA 4XFHA 5J3UA 1AR71 5LK7B 3NW4A 2RS11 3OTFA 4Y22B 4B1LA 3FE5A 1RUG3 3AP6A 5IVBA 1VBB2 2DUOA 1LOGA 3AC0A 5FUNA 3RGBA 2EAKA 1OD3A 5D8AC 1G6NA 1QXPA 2WINB 3BYWA 1UZYA 3NJZA 4AVSA 2ZEWA 1F15A 1H6XA 4LITA 2FMYA 3LEIA 4RHV3 5A3PA 2GN3A 3ATGA 3PJQA 2XJUA 4LXLA 1Y9GA 3WEZA 2CY6A 3GM8A 5ANQA 2FCVA 2PHWA 4E2GA 4F3JA 3RZKA 2ZHKA 4NPRA 4O9GA 1F5JA 1G8WA 3GF6A 1RMU3 2GNMA 3MO4A 2BTVC 5FK7A 4FTBA 3O1RA 1GR3A 5IVVA 3DYOA 1RUG2 2IXHA 2HWB2 1XNKA 2BOIA 3CO2A 3H3UA 3OD0A 2B9UA 5BY5A 3AZXA 1ZBA3 1EUUA 4OHYA 2QQVA 4IE6A 1LCLA 5EYYA 1IS5A 1R64A 3WG3A 1V9U3 3LPFA 2WAOA 3GXUA 1NCRC 1M06G 2BGOA 4CXWA 3KHCA 1CAVA 2GP3A 4Q4Y1 1LHOA 2J1EA 2XJPA 3ZMOA 1WD3A 4KG8A 4QQHA 1SLIA 5IVYA 2XBO3 2AACA 3K4DA 1PVC3 2K46A 4LKFA 3NV4A 2VTXA 4G9SB 4PJYA 4R52A 4WZCA 5FYZA 5FFOC 2YZ4A 2E6VA 3E1F1 2FDHA 4P9JA 1GOHA 1RUE3 1ULGA 1W04A 2CNAA 4MGIE 1RL3A 1UZVA 1IKPA 2E7TA 5FMBA 1DQ0A 3JZVA 2ZX0A 5DABA 2B39A 4OVEA 1L7RA 1ZBA2 2P2KA 4N53A 2QUOA 4FOWA 4BQYA 5BNPC 1CJPA 4MGYE 1RUJ1 1UKGA 1V9U2 4Z92B 5CG9A 1FPN2 2ZMLA 1QU0A 1VJ2A 2BJSA 3R6SA 1S0FA 3CL1A 5LASA 3ZYIB 4FPLA 2XG3A 4IETA 1JYVA 2VW0A 2XBO2 4JVAA 5KHJA 2KA3A 1WMDA 4NPMA 2DTYA 1YQ8A 3GZUC 3O1VA 2WT0A 4YVWC 1NCQC 1QH7A 2SBAA 1G9DA 4IGPA 1DZTA 4UOJA 1FOD3 2AH2A 2P3IA 4C0HA 3LCPA 3KF3A 1YCIA 5GLTA 2HWE1 2VXJA 3POWA 5FYVA 4DXZA 4Z2WA 5D2AA 4Y24A 1V6NA 1VE0A 2DCYA 3S30A 3WV6A 3RZMA 4XZUG 5CIRA 1WW5A 3GYDA 4P02B 3T08A 2ORXA 1W9SA 2WYFA 4LHKA 5CA6A 2YC0A 2Y0IA 4RS5A 1ND2C 3ZLIA 2TEPA 1HRI1 2VC9A 2WYSA 3WNMA 4BQWA 3MBWA 3HOBA 1NOVA 2XLFA 2VL4A 2NN8A 1RITA 5GM0A 4M4RA 3CDZB 1RUH1 3AVSA 5C9AA 4BYYA 2BPA2 4CP9A 2A70A 1U5IA 2Z4FA 3LIGA 4XUPA 4B3NA 4DXSA 3NAPB 1FOD2 2UU8A 4CP0A 1A34A 1VBD1 5EXOA 5KWRA 3G7DA 4UF0A 1S0CA 5JZGC 1JBCA 3JB8A 1VRH3 1BYHA 3CZJA 1HIXA 3M4FA 4ONUA 1CIYA 3AKTA 1RB8G 5AFEA 2ZJCA 3D5OA 1S4CA 2GMMA 4DY3A 4DXRA 1E5IA 4MO3M 4V2WA 4URAA 4AFDA 3WCSA 2WT1A 3K77A 2BFUS 2ZACA 4LKEA 4XW3A 3WNXA 3ZYHA 1W2AX 3OCPA 1OFNA 4KWLA 3RQ0A 4TXWA 1MQTB 2WN2A 1JYCA 2WR9A 4A41A 2EVXA 2VUDA 3PUHA 5DDJ3 2DCJA 1D7PM 2BGPA 1EP0A 1RTVA 1PK6B 2B7YA 2JIGA 5HXVA 2NP0A 3W5NA 3QLQA 5T5JA 1UY3A 2CGOA 2YY1A 2WWSA 3WQBA 5E89A 2R062 3UK9A 3IN9A 2I07B 5GZFA 4D7SA 3LIHA 1ULEA 4XDQA 3E6BA 3POGA 5J98B 3D6EA 1Y9QA 2WL1A 3RFRA 1GV9A 4JHTA 2VMIA 2BOJA 3HJRA 1MVEA 2PYTA 4JQTA 2J42A 3GCXA 2C5DA 3Q8EA 1UMZA 3V0AA 3AMMA 4W65A 4FAGA 3I4IA 1O8PA 1RINA 4OI0A 1UOFA 3O14A 4CCOA 1SFNA 5KXCA 4MGSA 1JOJA 1SBDA 3KZ4C 3VBRB 1RHI1 5F8PA 2I74A 1ULOA 3AL5A 2QJVA 4U2AA 3W9AA 1QJU1 2UY8A 1JTZX 1EAH1 1ND3A 1UIKA 2VZPA 4NVPA 1C8M2 1ZA7A 1TMF1 2DVAA 1DDLA 1UQXA 3AFGA 5IUQA 4Y26A 3MV01 3AL6A 1W8ZA 2AYHA 2VOWA 1WZXA 3FFZA 4OUSA 1OURA 4XF1A 2WNUB 4I0AA 4QXCA 1GZWB 1XJAA 1K45A 3C8XA 1W28A 2BVVA 2A6VA 2J1TA 4U36A 1HW5A 1K5MA 3Q8FA 5LRSA 4FVVA 4QM9A 4DB5A 2WT2A 3Q8BA 3LOIA 1W6PB 4AAXA 4N53C 4JDMA 1V6OA 4FOVA 1UO9A 4JDOA 1S1AA 2FDGA 2JIJA 5FZ4A 1LOFA 1ZYBA 4AEJA 3OGSA 4NWWA 4AEDA 4B8EA 1XC6A 2ZS6B 1IGOA 2F4PA 5IATA 4GZ9A 2WJSA 4MSVA 2JG8C 2WAAA 4META 1XPWA 4UYBA 5JXIA 3VUOA 4HXCA 4QX7A 2RG4A 2A6YA 4B4QA 2XVGA 1BBT3 4EROA 5BNNB 2Y60A 2QQUA 3HN3A 2E9QA 5FMOS 2V4AA 2IC1A 5FO9B 1IPJA 4PIYA 1I5ZA 2JB4A 1JN2P 1AR72 1HB4A 2YROA 2HWF1 4D7TA 2WFF3 5I0SA 4MXWA 3O1MA 4RS5C 3RG0A 1QJEA 3U10A 5CFDA 4WM8B 5FZ9A 4Q8KA 2Y33A 4XPVA 4QT6A 1LOCA 5FLJA 5IWFA 2C9KA 1RVF3 4XDPA 5FO7B 1NA1B 3SHRA 4BHPA 1JS9A 2VJXA 4OZOA 2W2IA 5BV6A 5C9AC 2R49A 4XBNA 3ZR5A 1DIWA 4MADA 4YLZA 2EF6A 5FYTA 5FZOB 2W95A 3VHPA 3ACFA 4P00B 5FZHA 4BM8A 2QE3A 2C24A 5DG2A 2X5IC 5JMOA 2BWAA 2Y6KA 2ZGRA 2WFF2 1SMVA 4QDRA 4ZS2A 2E53A 3S7IA 1D0HA 4IE5A 4LT5A 2QQWA 1GYKA 1GP4A 2QVSB 2VMDA 1DZQA 5T52A 1JZ7A 2QQIA 3O1UA 5I0TA 3KS7A 4A4AA 1S2KA 1DQ2A 1RVF2 4CPBD 3T1LA 1R093 1FYUA 1J3QA 2VNVA 4IQPA 1LTEA 1Z7S3 2C0ZA 1RUC1 3DF0A 5DAPA 4WM7C 3RPQA 1NQDA 1SCRA 4BQ5A 4BJ0A 4HVQA 1CX4A 1FATA 1VB2A 2YDEA 2AGSA 1YFWA 4IESA 4ZY9A 3T2TA 1W6NA 1ENXA 1LNSA 2D3RA 2RMU3 2NMNA 2Z2SB 3PLQA 1GFF2 3OBRA 4RQPA 4L11A 1MACA 1CAWB 4OYUA 3KD4A 1POV1 2RM23 3W20A 1RUJ2 1HB2A 3SITA 2EXJA 4KWJA 1QOSA 1JU4A 4PCRA 3FLTA 4CU7A 1Z7S2 4CCEA 3CNAA 2QQLA 5FZFA 1YNAA 1Y4WA 3RZLA 4X8NA 3HQUA 1W9TA 4CCMA 1CIWA 2A3XA 2WC2A 3ON7A 4Q1RA 1WCUA 1J58A 3KT7A 2RMU2 4K7JA 4XIKA 4P14A 4CEWC 4XABA 5EWSA 2HWE2 5A32A 1AYN1 1CWPA 4CEYA 1Q8VA 3ILRA 3FHQA 2CGPA 1AR83 1Q43A 1SEFA 5C8CA 5FXXA 1UCXA 1ND3C 1W6MA 2JE7A 1MEC1 1VALA 3DXTA 2ZGOA 4LUKA 1WA4A 1AXKA 1YFUA 2ID4A 1C5HA 1SBEA 3VKOA 4GMP1 4NIHA 1HRI2 4FPHA 2BW8A 4ES8A 4AEMA 1AR61 2VE1A 4RR3A 2V09A 1FV2A 3B00A 4MGTA 3DPRC 2GH2A 1RUH2 4XETA 4QX0A 3VDDB 3CIHA 1O4ZA 1QKQA 4WVVA 1WW7A 3B02A 5CFCC 1K5MC 4IEPA 1VBD2 2OXBA 2ADEA 4XYXA 2EIGA 4DNYA 1JZ3A 4AWDA 4M0HA 3KV9A 2GZWA 1ULCA 2WA3A 1LOFC 2VG9A 4QX1A 2X05A 3SKJE 1S2EA 1D2SA 2YBKA 3DV8A 4CDXC 2VM9A 3F2ZA 2A7AA 2P3YA 1O5UA 2VNRA 2ZHMA 4ZPIA 4M3CA 5FP4A 3SXWA 4BZ4A 2ET7A 4YVSA 4D0QA 3W5MA 1HQNA 2PFWA 4YNIA 2P5BA 3I8TA 5I91A 1O91A 4LK6A 5DZGA 1NLRA 1U0AA 4N7IA 2R1BA 1LODA 1CAUB 2EXKA 1EY2A 3KT4A 3OYWB 5HCFA 1FNYA 1HB1A 2B8MA 1JYNA 2JB8A 1C57A 4COZA 3A0KA 2E33A 2E63A 4MGKE 3I3EA 4SLIA 5A7WB 4DUVA 3HIFA 4JC1A 1BVP1 1DYKA 4I30A 4AAPA 1JYIA 3TEXA 1OXCA 3ZM8A 1LESA 4ASMB 4BLJA 2GDFA 2RDRA 5J36A 4OMDA 4IEZA 5A80A 4YGCA 3VBOB 2JE8A 5CFDC 5DQ0A 1CVNA 4LLOA 2HBTA 4BQ4A 1HKDA 3CJIA 1FX5A 4R9CA 3MLJA 4D94A 1SLAA 1OUXA 4X6RB 3NKTA 1AX1A 2YC4A 4C91A 4DIQA 2A1XA 1O3SA 3MICA 2QQPA 4QX8A 1X9PA 4LR4A 3EQEA 4P5YA 5FZCA 1R1A1 4LTAA 3WR0A 3KV4A 2DUPA 3BU0A 2HKXA 4DPNA 1PGL1 4Q26A 4LNVA 2I45A 5HV0A 1H2NA 4FFIA 3U07A 1RHI2 3ZN6A 1L7QA 3JBG3 2BVBA 4Y1VA 1O8SA 1B35A 1VBB1 3S6PA 4MLOA 1L3JA 3GDBA 3POIA 5TSWA 4B29A 4D3WA 1EAH2 4AF9A 1Y7BA 2VVDA 4XF0A 1VBC1 2W92A 2UY9A 4Y5TA 4A7YA 1QDOA 1ZZ8A 3HWJA 1TZOA 5CNAA 2HWD3 4XIOA 2W39A 3SH4A 2CDPA 2DVGA 2ZX1A 1H8TB 4LO5B 1HXS3 1LAJA 1RUD3 4QB6A 1W9FA 5FUIA 3U14A 3PDQA 1RUG1 2FMDA 5BNOB 1KDMA 1N47A 2D6PA 2VOXA 2VXRA 2YGMA 3ACGA 3JBG2 5A3OA 4EV0A 1W6QB 5JCTA 1Y9MA 1OD5A 3J8F3 1OQ1A 3GZEA 4LIUA 3U37A 2VZRA 1X33A 3GNEA 3L2HA 3NV3A 2B45X 3ASIA 4J6GA 4D6SA 2XJSA 1FXZA 2AR6A 1H8VA 1WMXA 4RHV1 4IE0A 1TNFA 4HANA 2X10A 4JQRA 4CDQB 4YFZA 2HWD2 3QACA 5F6KA 3EHKA 4GA9A 4UFMA 5E8AA 3VZKA 4LHSA 1XB9A 1APNA 1GZCA 1PVXA 1RMU1 1X7NA 2K0GA 4W8JA 1KD7A 1GKBA 3K4ZA 4ISQA 1UZZA 4RL7A 4HFSA 2TBVA 5IVJA 4CTEA 1W3VA 5FPLA 1PMHX 3A21A 3U0ZA 1ZBA1 2ZGNA 2W87A 1YC61 2WNVB 3WVJA 1KS4A 2HWF2 3CQOA 1N1YA 1QQP3 4Y1YA 1V9U1 5C4WC 5I0RA 2XKPA 1VAMA 4IEWA 1ZRCA 5ABJB 3CKHA 1SPPB 3H7YA 5FYIA 3ST7A 2WN3A 3KSCA 1AL23 2XBO1 5B4NA 2GU9A 1PVC1 3LSDA 2ATFA 3ACLA 5DAQA 4DZGA 3IMMA 4IV3B 4XHBA 2VW1A 3ACHA 3I2GA 3ZSJA 1CPNA 5HCBA 1XNCA 1A3KA 3RVHA 1RUE1 4AI3A 1HRV3 4PI2A 4YFWA 1F4AA 1QJY3 2GNDA 4EN7B 2QKDA 5FXZA 1QQP2 1SFPA 1WLCA 3VKMA 5IVEA 3H1YA 4N43C 2BBVA 2OIIA 1O3RA 4XF4A 1WGPA 3A22A 3IDAA 1H1MA 5D8AA 5L9RA 1GQGA 1A8DA 1AL22 2W91A 4YVSC 4LOSA 5FZ0A 3HT1A 3UYJA 4EN0A 1POQA 2IZWA 5LBCA 2YMZA 1UXZA 3T1MA 4Q0VA 1WW4A 1W9WA 5EPAA 5H9PA 1RUC2 1D4VB 4I09A 3FZ3A 3UETA 3V64A 1FOD1 4GD4A 1UZWA 3OG2A 3LOBA 1HRV2 3USUA 2WBKA 4OMCA 4SBVA 4AOCA 5LBBA 1HN0A 1US2A 3OB8A 3ZSEA 3HD8B 5JOYA 4GJZA 5G05L 3ROUA 4QKBA 2CWSA 2EALA 2VGDA 2XQXA 1V00A 2YBPA 4HKOA 4XAEA 3VBFC 1H2KA 3CJIC 5C6CA 5JI9A 2L9LA 2WZEA 2ZGLA 1MS5A 1RJ8A 3MYXA 3PNAA 5F2SA 4QQLA 4IEUA 5DXDA 3H8RA 2ZGQA 3APBA 2N7GA 3VB9A 4ZU7A 1XNTA 1LEDA 2Y8KA 5K9YA 3N3HA 4X6QB 1KRIA 5AVPA 4AFAA 2QDRA 4YRDA 4Z1VA 2WRAA 3H8XA 1VRH1 3H3LA 5F39A 1C1LA 2IFRA 4YGDA 2QTWB 4UBGA 1UY1A 3H42B 5FP9A 1J83A 5GJ6A 3BCWA 2QDNA 3MLKA 3AP7A
chains in the Genus database with same CATH topology
4NHMA 1B35C 1U5YA 4HKLA 3ZDSA 1CAXB 1Q5OA 1LENA 2ZKLA 5KHKA 2D3SA 3ME2A 4GKXA 1TNRA 2XKOA 3I2DA 4RA0A 4B7EA 2LTNA 3RMXA 3R4UA 3HBZA 1Q3EA 1QGLA 3AYDA 4Z07A 1I3HA 2WZR3 1J59A 5LEJA 5DDJ1 5L7OC 4YZ3A 4CDUB 3WDUA 1AYM3 3FX3A 1RUF3 2PHLA 4QQ2A 4WZFA 4Z8BA 1O3TA 4AQSA 1D0GA 3WP4A 3VBSB 4Q0SA 4OLLA 4A3XA 1XU2A 2E7QA 3ZSKA 3VKLA 4YW2A 1SACA 1QOTA 1LU1A 2A71A 4CDWB 4FPOB 4IV1B 4Q0UA 4E4ZA 5IT6A 1WMFA 2R6QA 1PM7A 3AMQA 2RS33 3WUDA 4YYOA 4HVOA 2D98A 1MQTA 5CU1A 1AYM2 4QPIB 5FFOC 4Q4W3 2ZX3A 2JG9B 2ZX4A 2DFCA 5KC6A 4FPJA 1OPMA 5CB7A 1ZBE3 5CADA 5JZGA 3CJXA 1OLRA 3TNQA 1XE8A 3ZXKA 2A5ZA 3X29B 2GSYA 1VR3A 4JTOA 3D4KA 1OMIA 2RS32 5BUVA 1V6LA 2D43A 1XYNA 2O1QA 1QF3A 1CONA 2H6BA 1IS6A 2IXCA 2QNKA 2HEVF 3CLPA 1KITA 3P3PA 1ZBE2 4G4FA 5T50A 1PGL2 2VVEA 3ALQA 4XBLA 1F8VA 4CZSA 5JR7B 1COV3 1LU2A 1GQHA 1ZZBA 3B94A 4Y20B 2EAAA 2E51A 3WXPA 4FTSA 1DG6A 1VBC2 1ALYA 3UJOA 4B4PA 3WLUA 1ENQA 3ZFEB 4QD2A 3ZO0B 1X8EA 2CTVA 1BBT1 2WNUA 1FT9A 1I1EA 3FJSA 3GHMA 3MZHA 1MVQA 2WFF1 4FOYA 1W6PA 3U4XA 2DYCA 1YFYA 1AUYA 1IQAA 5LEKA 3MFAA 1CESA 4C90A 4GH4B 4Y1ZA 2Z69A 5GZDA 3A4UA 4IL7A 1SDWA 1RVF1 1ULDA 4ZU5A 1OA4A 4RHV2 1ONAA 5I8YA 2SLIA 4PLNA 4XMAA 3IM0A 1DU3D 2EXIA 2ILMA 1AF9A 1R083 1RMU2 4BH9A 1LR5A 2XL9A 3BOPA 3W58A 4OZXA 1TE1B 2VH9A 4F83A 4GULA 4AHWA 4XJWA 1PO23 3TNPB 3OJBA 2RR13 4YZ2A 4AVCA 1R091 4XF3A 5ACA3 1Z7S1 1F2NA 4LO7A 2JG8A 2B42B 1YI7A 4LEJA 1PVC2 3PVEA 2K9ZA 4RD7A 3NAPC 1XXNA 1R082 1XYPA 2RMU1 1MZEA 3ZFFB 5SV8A 1RUE2 4I0WB 1RUI3 1S0DA 2DVFA 4UW4A 4JCKA 5DG1A 2RM21 1PO22 4A2UA 4NOTA 5KXEA 2RR12 3H50A 5IK8A 1WBLA 2Y38A 4COYA 3WW3A 5DZFA 4WBBA 1MZFA 2ZABA 5JDBA 4AFCA 3KQRA 1MQTC 1UKRA 4WVMA 1GZ9A 2TUNA 1GBGA 2Q1ZB 1G9FA 2D6MA 4FQ4A 4XEZA 1M4WA 1QHDA 4XFGA 4BQ1A 1PK6C 3WY6A 4DOUA 2GH8A 4P9WA 1NE6A 4OI1A 1AR81 2WLPA 2X5IA 3RRDA 4NN0A 3JU9A 1ZRDA 5K0UA 1DGRN 5C8WA 5JSRA 2YGLA 1AR93 4W6WA 1OA3A 4L8QA 3OGJA 2DUQA 5JWPA 3KLSA 3WQ1A 4XTMA 3BIWE 2LM3A 1VP6A 4CP1A 1REDA 2DU1A 5CAZA 3N7JA 4PIZA 3PVOA 1NCQB 4WM7A 4OHWA 1HLCA 3FLPA 4I0BA 1ZM1A 2WQ4A 4D69A 3IBMA 3WG1A 2YXSA 4NO4A 4O9EA 4QM8A 4RGGA 4XFAA 1O7FA 1VRH2 3VBRC 3ZFGB 3M3OA 1DBNA 4H55A 2JICA 4YG0A 1F31A 1EYBA 2D7FA 5EV7A 3RYPA 1GICA 1DQ4A 3TOJA 2JJ6A 1H1AA 4COUA 5A3MA 3K51A 1OOPB 2XH6A 5BXXA 3KB5A 4BE3A 2WNUC 1LJ7A 4C1XA 5DDJ2 3LZZA 2GMEA 3E97A 5I93A 2PAKA 3MIGA 4XILA 3UL2A 3O12A 4CEWA 3VHOA 3SH3A 1LOEA 1NY72 3VBHB 4HETA 4DRVA 5JI7A 4HZFA 1LEMA 1AX2A 4FXKB 4EWAA 5BNQA 3ELNA 4LO6B 4DFSA 1REFA 2VOVA 3AMPA 2VW2A 4S2HA 2NLRA 1FI2A 3WP6A 3Q9OA 1SBFA 3DPRA 1MS9A 4YW3A 5BNNC 1VIWB 1WLWA 3OYWA 4IEVA 3RS6A 4COVA 5CFCA 1LRHA 3OF1A 4K1ZA 2NPIA 4YZ1A 3JBG1 1SFYA 4M00A 3PVNA 1YHFA 2Q0AA 5FRAA 3TB0A 4CDXA 4FXGB 5FCCA 4QGNA 2HWC3 4YM0A 4K40A 3VZNA 1KS5A 3FUOA 3N7KA 2CAVA 1FMD1 5SV5A 4AXOA 4Q0PA 1NA1C 1CR7A 4FOQA 2HWD1 1J1LA 4HBNA 5KHHA 3WW2A 2VUAA 3AP9A 1CQ9A 1F5FA 3ILNA 1HXS1 3OBTA 4GXLA 3I59A 2ZAAA 1RUD1 4I3PA 4FAHA 2P17A 4ZKTB 5FPZA 2NQYA 1T6GC 2O0OA 2XL7A 3ZIWA 5IK5A 2RJLA 2UWAA 3LWCA 4UBHA 1A8MA 3J8F1 3PHMA 5J7MA 2HWC2 2WQZC 1GLHA 4GWMA 1N1TA 4H7MA 1CAVB 4XJUA 3B93A 3BALA 3O0WA 2GC0A 2V5YA 4Q0QA 1BBT2 5I0UA 4AQTA 2VNOA 3GZTB 2OYZA 3OY8B 5J09A 2VMHA 1RIRA 3MW2A 2BNMA 4P9IA 3B5LB 1QQP1 1LGCA 1QJX3 2FQPA 5K0UC 4FCAA 5AFBA 4R9BA 5DUVA 1D4M3 2ZAHA 3ZYGA 1AL21 1HQLA 1S0IA 2JD4A 1QNYA 1O4TA 3SCGA 2ZZJA 3FWEA 1BMV2 2JENA 4MH0E 1HRV1 2JDZA 3FLRA 3ZX7A 1N1VA 3N7LA 1QJY1 4HPKB 5JSOA 4JGYB 5C33A 1RUOA 1GSLA 3NO8A 2A6ZA 4RS5B 1O5LA 1TEIA 1WCSA 3PTYA 2R32A 3UKNA 5ABJA 5KHIA 1R092 2WSUA 3HMYA 2ZTNA 3WDVA 4IV3A 3VHNA 2FBEA 4IEOA 4PF5A 3SCHA 4QPGB 2A3YA 2ZGPA 3VKNA 3IPVA 1PZ8A 1YJKA 3LA7A 2VQAA 4YG3A 4AQ2A 5L19A 3WCRA 4EN6B 5JMCA 5GLVA 4E4SA 2FZ1A 3G6JB 4LBQB 1UU5A 2XJQA 4B7KA 2RM22 4LBKA 5C4WA 3MIFA 1W6OA 2RS53 2DVDA 3GZAA 2H0VA 4HN0A 1VAKA 4XFCA 4JGZB 1MZ6A 2BQPA 1Z0HA 3EO6A 2O8OA 3LA3A 3C3VA 4HN1A 3FBMA 1AR82 3WDTA 2QZ2A 1JHNA 3RJ2X 4ITCA 3VBOC 3RMYA 1ULFA 3GHNA 4N43A 1V6IA 4XJAA 2DF7A 4OHVA 2YHJA 3DUIA 5JPMB 4UW6A 2WZR1 1H2LA 2QFEA 4K6BA 1VBE3 3WW4A 1C28A 4XFIA 4DRRA 3WG2A 4R4ZA 3V0AB 1AYM1 2OUHA 3DN7A 1RUF1 4BPZA 4QU2A 2Q4SA 3FC0A 5GLZA 4DINB 2UWCA 5EJ3A 3RI9A 2AUYA 1VB4A 1AVBA 1SLCA 1WCKA 5GZGA 4AGGA 4LBOA 5AC93 2VNGA 5GLWA 3VBFA 1VBE2 4OHXA 2RS31 3MF9A 3RSJA 3PJYA 1HV1A 4AI2A 3AYAA 4Q4W1 1OPOA 4HLTA 4OI2A 4CDUA 5T3NA 4DMIA 1UD1A 2VY0A 1ZNPA 2KXLA 1LHWA 2BWCA 1ZBE1 2WIIB 2GNBA 5BNOC 3VBSA 5HBAA 4EN9B 2OA2A 5AC92 1MS1A 2DWRA 4AEDB 4CDWA 4JV4A 4UXAA 3VL8A 5E16A 4IV1A 4AG4A 4JDNA 4AVAA 3WX5A 1R1ZA 5F9TA 4LA3A 3W59A 4IXLA 4Q4X3 4CDQC 3R4SA 1FMD3 3IWZA 2G9FA 2ENRA 1GANA 4Q4V3 3QCWA 4QPIA 3TN93 5JSPA 3SCFA 3IDCB 5L7OA 5LK5A 3MIEA 3M3QA 3QOPA 5FAXA 3ZVXA 1PO13 2Q8OA 4BCUA 1U12A 4M3CF 4MXWB 2WNVC 2D44A 1COV1 2ZBJA 5CFDB 2QZ3A 1LGBA 1MZ5A 5T5PA 5HI0A 2P37A 4AQ6A 1I6XA 5ABJC 5J96B 2G4IA 5H9RA 4Q4X2 1FMD2 1DZRA 2H0BA 4FPGA 3A0NA 4LBLA 2P3KA 4IV3C 4NR1A 3TN92 2C9AA 3E6CC 3WDWA 3R05A 1HXS2 1EPZA 3S0MA 3ZYJB 1RUD2 4Q8LA 3ZIXA 1ZZ6A 4KG0A 3RNSA 4Y22A 2K2SA 1NQJA 2FHRA 2IXLA 3J8F2 3BU7A 4QQOA 4K3UA 3RJRA 5E88A 4LE4A 4XTPA 3WP5A 2WLQA 5GALA 3ZFEA 1NXMA 4KU7A 2A6WA 3AKSA 1Y43B 5GZEA 1UPIA 1R081 1OQDA 4R9AA 3WDXA 2JKBA 2XVKA 3MIDA 4ISRA 2D6NA 2PAEA 4RQPB 5I8SA 1LHNA 3IIAA 2R0HA 4ORFA 1PO21 3AZZA 1V6KA 2R16A 2RR11 4QQPA 2XPJA 1PMIA 5ACA1 3JUUA 2BNNA 3J26N 4XE9A 4XHXA 5D1IA 4K21A 1DFQA 2XHKA 1TQ5A 4XQWA 5FLIA 5LRRA 4YM3A 1PIV3 2ZX2A 4NHKA 3VLBB 1RUI1 5A32B 1I9RA 4CEYB 1QJY2 3WQ7A 3MPPG 5C8CB 1YXWA 2OZ6A 3C2UA 4S2GA 1ENRA 3DKWA 1W6MB 2XB6C 3PVBB 4QPYA 1HDKA 4XXPA 4YGBA 4DS0A 3URFA 4GALA 2ZKNA 4RR3B 3EJKA 4XFFA 4FPKA 4LA2A 3VZJA 2PN5A 1H9WA 2PHRA 4CDUC 4FPCA 1SCSA 2G9GA 1PIV2 1YO8A 3JD73 3KCCA 4IEYA 1C5IA 4Y5Z0 3VBSC 3MI8A 2IXJA 1BEV3 1LOAA 4OFGA 4Y1UA 5F5QA 4CDWC 1AR91 3S7EA 2ZMKA 4IV1C 4E4DX 2PHUA 2KM2A 4YVSB 2GN7A 1PZ9A 2VUJA 2QCSB 1WLDA 3ZYPA 3LB9A 3NV1A 5JOZA 4QPIC 1DGWA 1JXNA 3JD72 1LHUA 3NAPA 5JAXA 5EZWA 1IOAA 2BYVE 3M70A 1ASJ3 1UX6A 3UKTA 1NY71 2VULA 1QNWA 3M1HA 2Q5TA 4ES9A 4GQ7A 5B2GB 4FPFA 4FPEA 4KU8A 3H7JA 1H0BA 1J1TA 3O7OA 2WZR2 4P5HA 1DGWX 1JUIA 1XRUA 3OPZA 5DUWA 2ET1A 2NYYA 1RUF2 1XNBA 1ASJ2 2D6OX 1PHMA 1PK6A 2Y0OA 2PLV3 1YIPA 4YSFA 3ZFGA 2H6CA 4QMAA 1IPKA 5EYXA 3ZSMA 5KXDA 1U5ZA 5A33B 3KMHA 4AK3A 2OUJA 4C0BA 1IKQA 1VLNA 4YG6A 5FREA 1J3PA 1OOPA 1NLSA 2PELA 3IT8A 3O0VA 4UW5A 5FQ0B 1O3QA 3ZFEC 5GKAC 1C3HA 3USSA 3WDYA 5CG8A 4FP2A 2PHTA 3ZXAC 4Q4W2 3TWIA 5HCAA 2ZHLA 4CRQA 5T54A 2PLV2 3OGGA 3VBUB 3VBHA 3VBRA 5FOBB 1CD3G 2GNTA 2HWC1 2BNOA 1KDKA 4GH4C 1CJDA 4YW5A 1VBA3 2D6LX 1S0JA 1W2UA 1AXYA 1BXHA 3FFQA 2PQQA 4TYSA 3AJYA 4RGAA 2R1DA 2NZ9A 3D0JA 1GZWA 4ATFA 1BQPA 3VN4A 1Q8PA 4RFT0 1XNDA 3VKFC 1FNZA 3ES4A 1OI6A 2HWB3 2JX9A 2D6KA 4WV8A 2WZPP 4MXVA 4YARA 5IK4A 1VBA2 1COV2 4LBNA 3H9AA 4PDWB 2VECA 2PTMA 1RGSA 2ZGMA 4ZU4A 3J9SA 1BMV1 1WD4A 4K20A 4KQ7A 3M7AA 2R073 4QGMA 4AYUA 3MLLA 4BA6A 2BGCA 5BNNA 3HT2A 3ZFFC 4Q29A 3WOGA 3ZXEA 4R4XA 1OFSA 1TME3 4HK9A 3D8CA 1QJX1 4AFMA 4ASLA 2GALA 2YYOA 2MEV3 3QH6A 4Q2FA 1D4M1 1D2QA 1Q8SA 2R0FA 2NM1A 4XJ9A 3SISA 3IDBB 3ZN4A 3N4MA 5D8AB 4KBBA 1FPN3 2HJIA 4CYDA 4WM8A 3EBRA 2ZGTA 4AW7A 3PMSA 3R4DB 1DF0A 1W0OA 2R072 1XU1A 3IMNA 1NA1A 4P9YA 3V0BB 1MS4A 1HX6A 2GMPA 4MVTA 3USUB 4IERA 3RZZA 3INAA 3OY8A 1TME2 2OZJA 3NL1A 2JE9A 2MEV2 5T55A 3DGTA 1IS3A 5CVRA 1JW6A 3LA2A 4OUMA 4I02A 1BVVA 1CGPA 2WS93 1DQ1A 3H1MA 3WUCA 1BCXA 1NCRB 5ACA2 5JPNB 1G9AA 3NWKA 3UJQA 4AI8A 3AB0A 2B5HA 2E7AA 2YPJA 2A73B 1H4HA 1CN1A 3B01A 1UW8A 4QHBA 1POV0 5J48A 3KGLA 1BK1A 2ZGKA 4MZUA 1RUI2 4HPKA 4JGYA 3ZFGC 3RYKA 3WHTA 1AL0G 3LSEA 1PNGA 2A6XA 2LUWA 5BNPB 1CAWA 2RS51 2WS92 3WT3A 3AFKA 3BOWA 4GB33 4H14A 1N3OA 5JOWA 2YV8A 3MIBA 4HK8A 3BPZA 1OOPC 4L99A 2VPVA 5A3LA 3E5XA 2GC1A 3KCX