3JUUA

Crystal structure of porphyranase b (porb) from zobellia galactanivorans
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
268
structure length
268
Chain Sequence
EAPHFKPGEDPRQPHQEWKLIENMSDEFEGKKIDEKKWQISGQGWIGRAPGLFLAENISLNNGSLQITTTMLPEPIVKNNKTYTHGGGYVGSRNGMTYGYYECEMKANKTFMSSTFWLINEGKDRLGCDKRTTELDIQESVGQITNDADWMKYFDQTMNSNTHSRNIPEGCEYEKGSSKGKAELGGKAYEDFHVYGVWWKSKDEIIFFLDGKMQSKVTPPADFDIEMYLRMVVETYDWNPVPKDGGMTGSKEDRTTTYNWVRSWQLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords porphyranase B
publication title Transfer of carbohydrate-active enzymes from marine bacteria to Japanese gut microbiota.
pubmed doi rcsb
source organism Zobellia galactanivorans
molecule tags Hydrolase/carbohydrate
total genus 64
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 3.2.1.178: Beta-porphyranase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3juuA00
1DBNA 2RHPA 4FQ4A 1GKBA 2P3IA 2VW0A 3M3OA 4FPHA 1SBEA 2GMPA 2A6ZA 1HQWA 1VIWB 1ULCA 1FX5A 1LOBA 5CAZA 1MVQA 1LODA 3UJQA 1LOFC 4FPGA 1F9KA 1MR5A 4RL7A 1SACA 1S1AA 5T54A 5E89A 1I1EA 2AGSA 1BJQA 4AWDA 4FPOB 2DUOA 1EPWA 2D3RA 2E7QA 3D4KA 4Y26A 1JBCA 1ULGA 1D2SA 5HCAA 4YM2A 4ISQA 4YW1A 4YM1A 5DZGA 1H30A 2PELA 5T5LA 3SLIA 1DLLA 2ZHMA 2EXHA 4AYUA 2LALA 2V5YA 2KM2A 5EXOA 5GZCA 3T1LA 4Y20B 1GANA 3B01A 1GZCA 2AR6A 5H9PA 4R9CA 3WG1A 5GM0A 2VXRA 4XMAA 3AZZA 1GV9A 1YRZA 3WDVA 4BMEA 1UN1A 3C2UA 2WSUA 5T52A 1LGNA 1KJRA 1LEDA 1N3PA 1QOSA 2AUYA 1YIFA 5T5PA 3GNEA 1O4ZA 3KM5A 2D6KA 2E7TA 5KXDA 1LECA 2YROA 3B3QE 4KBBA 4Y22B 4PQ9A 4FPYA 2A3XA 4YW5A 1W6QA 4P9XA 1ENRA 2YV8A 3O0XA 3WNXA 1S0DA 3N36A 2R0FA 3MW3A 4FPFA 1FNZA 2PHFA 3V0BA 1KJLA 1PZ8A 1V6KA 1SFYA 2JDZA 3GALA 3HR9A 3V0AB 1OFSA 3AYAA 3N7LA 3AX4A 1C57A 1IOAA 1ENQA 3AYCA 1YXWA 2WJSA 1SLBA 4YW2A 1IKQA 1DHKB 1MZ6A 5GLZA 2ES3A 3APBA 4BOWA 2NP0A 1ENSA 3M1HA 1Y7BA 3POSA 4YGEA 5IK5A 1FV2A 4PF5A 1DYPA 1JOJA 2UURA 2GMEA 2TEPA 1N3OA 4BMBA 5E8AA 3I8TA 5L73A 1QGLA 1W6NA 1RINA 3UK9A 2UU8A 1S0EA 3RSJA 2UWBA 3VUOA 1N1VA 1PZ9A 2EXJA 1SLIA 2W39A 3Q9OA 4K1ZA 3OPZA 5GLTA 1S0JA 3QCWA 1DQ2A 4FOWA 2CY6A 1GLHA 1UZZA 2D6NA 1MS9A 1LOAA 2EF6A 3ZPYA 1WCSA 2ZAAA 3CNAA 1BQPA 1S0CA 2E6VA 2FHRA 5GLVA 4YZ1A 1C4RA 1AJKA 1ONAA 1RITA 3R4SA 4XIOA 3ZSMA 1LOEA 2R1BA 1MS3A 1ULEA 2WQZC 3AP5A 1QDOA 3ZXEA 1G9CA 4ISRA 2G4IA 3AFKA 4YM3A 2ZGQA 2GMMA 4LBLA 2A6WA 1SBFA 3BOPA 3B69A 3WVJA 3T2TA 1CJPA 3NV2A 5GLUA 1CR7A 3AP4A 3M3CA 4FPLA 4ZXKA 5H9RA 2Q5TA 3ILNA 4YG0A 4XILA 2WKKA 4Y1XA 3FFZA 2DVGA 4GXLA 1G9FA 2CWMA 5DUUA 2A3YA 4BLJA 5IK4A 4P14A 5HCBA 4TYSA 1JW6A 5FRAA 2DYCA 2VH9A 3NV1A 2DVBA 4ITCA 4ASMB 2NM1A 4NOTA 3N7MA 1UZYA 1CONA 3USUA 4PCRA 1VALA 1PZ7A 4DS0A 1FNYA 1MS8A 2ZGTA 1WBFA 3AZYA 4FPKA 3RRDA 1G9BA 3WDYA 1Q8PA 1IS4A 2D44A 2JE7A 1Q8QA 2ZMLA 4R9AA 1N47A 1N1SA 3M3QA 4M3CF 1W6OA 4L8QA 1BXHA 2YZ4A 5GJ6A 4BM8A 1LGBA 2JE9A 3O0VA 4XHBA 4YLZA 1IS5A 2JD4A 4YGDA 4FOVA 2DTWA 4XTPA 4Y24A 4HL0A 1CVNA 2ZGKA 4FPJA 3PVOA 1LOFA 1JYCA 2PHRA 5GZDA 2ZMNA 1IS3A 1IS6A 1KQRA 2DWRA 3DUIA 3NV3A 3KQRA 2PHTA 3A4UA 1JN2P 1JYIA 2Z42A 4Y1UA 3PMEA 1GNZA 4Q8KA 4LBMA 1H9PA 4R9BA 4AVTA 1AJOA 1JHNA 2NZ9A 2A71A 2CNAA 1DQ0A 3FBYA 3R05A 1GBGA 5JLVA 1DFQA 1QNYA 1SLAA 2P34A 2ZACA 2E53A 3INAA 1AX1A 3LSEA 2YXSA 1N1TA 4K21A 2R0HA 4YFZA 5H9SA 1IKPA 1MZ5A 5DUVA 4BLIA 1GSLA 2GALA 2ZZJA 3A0KA 1UMZA 3ENRA 2LTNA 1Q8VA 3A0NA 5HCFA 2E51A 3FLTA 3N35A 1Q8OA 4Q26A 1LOGA 1AXZA 3O12A 1QNWA 2D6MA 4XZPA 1TEIA 5GLWA 4Y20A 4LBQB 4M00A 5DG2A 1WD4A 4XIKA 3ZXJA 2A70A 2BQPA 1MS0A 4OZXA 4XDQA 3R4UA 1KDKA 1APNA 5DG1A 5EYXA 4AGRA 2GNDA 2UWCA 1AXKA 3H0OA 1LJ7A 1YI7A 4WVWA 2VUAA 4GA9A 1WW6A 2D6PA 1NXD1 3MEPA 3OYWB 4XXPA 2DV9A 2GNMA 1Q8SA 1DQ5A 4Q2FA 3RMXA 3VKLA 4M3CE 1DQ1A 1KITA 1V6IA 4NO4A 3V0AA 2V73A 2ZABA 1NLSA 2XG3A 2D3SA 2ZGOA 1CPMA 2NYYA 1C1LA 3SITA 1WLWA 1AZDA 1DYKA 1W0OA 2EIGA 1GICA 5CB7A 1Z0HA 4GWMA 3IM0A 3OJBA 5E88A 3O5SA 3RQ0A 1LU2A 4K1YA 4YM0A 1ULDA 2WT1A 1UKGA 5DUWA 5LK5A 1A78A 4AVVA 3WHUA 3OGGA 3JU9A 3WUDA 2WT2A 1V6JA 1AX2A 1WW5A 5GZEA 1UL9A 5T5OA 4C1WA 5SV8A 4IQPA 5IK7A 4Q8LA 3RS6A 3OBTA 2PHXA 3SH5A 4PBPA 3AP9A 3WV6A 3W59A 1H9WA 1GZWA 1LTEA 2NN8A 1LGCA 1V6LA 2WT0A 4XBLA 1GNHA 1WLDA 5F9TA 4DPNA 2PHWA 1UAIA 2PHUA 1BZWA 4XJUA 1LULA 2CTVA 1QMJA 4CTEA 2HYKA 2ZGNA 1G9AA 1C1FA 2C9AA 3ZYPA 3SNMA 3NV4A 3N3HA 1VAMA 1G9DA 2D6LX 4YFWA 4M01A 2CWSA 1LHVA 2AREA 3WDUA 2I2SA 3ATGA 5JOZA 4YZ2A 1KRIA 3AP6A 4XJ8A 2ZGPA 5CBLA 4PBOA 3MPPG 3AP7A 1U0AA 5T50A 2W52A 1LOCA 2JECA 3AJYA 1JUIA 3AXEA 4LBQD 3AK0A 4YG6A 3WDTA 4SLIA 5BYNA 4WZFA 3MW2A 2A6YA 2ZGRA 2DVDA 3AXDA 3WLUA 3N7JA 5JDBA 1AF9A 1AXYA 1V6OA 3IPVB 3NWKA 2GNTA 4DFSA 1DZQA 4JC1A 5AVAA 3RMYA 3BODA 2ZMKA 1CQ9A 3TAYA 1WW4A 3WZ1A 2OUHA 2P3JA 3FLRA 4HANA 5CA6A 2GDFA 2EXKA 2R49A 2DTYA 2OW4A 3OBRA 2W68A 5DZFA 2W08A 3PVEA 3V65A 1JXNA 3WCSA 5JMCA 2VY0A 1W6PB 4FVVA 1F5FA 1QU0A 1Z78A 2A6VA 1Q56A 3WG4A 1OKQA 3TB0A 3IMNA 1N3QA 3VKFC 1S0BA 4W65A 2D7FA 1HQLA 4M3CB 3IKWA 3POWA 2R16A 3AZXA 4XOGA 5T55A 1DQ6A 1W6MB 2JKBA 2ZHLA 3UL2A 4FP2A 2VW1A 2EXIA 1V6NA 2R1DA 2SLIA 5KXBA 2ZGUA 4UW4A 3OY8B 5CNAA 4MYEA 2ZKNA 4FPEA 4LBOA 2NMOA 4ZKTB 3PJQA 5T5JA 2YMZA 1SLLA 2ERFA 3FUOA 5JOWA 3VV1A 3VKOA 4ATEA 3WDXA 1X50A 3WG2A 3IN9A 3HMYA 1S0IA 4DRVA 3ZXLA 1FAYA 1URXA 2WLQA 2P3KA 5F5QA 1SCRA 2ENRA 1MS1A 4XBQA 3D5OA 2ZGLA 1CIWA 2UWAA 3L2YA 3QLQA 1BKZA 2OVUA 1S0FA 1WD3A 3WHTA 2H0BA 3BTAA 4Z8BA 3DGTA 1SCSA 4Y1VA 4GWNA 1W0PA 2YY1A 4YGCA 3SH4A 3W58A 1MS5A 1VAVA 3WOGA 4LBQA 1R1ZA 4YZ5A 3N7KA 1VLNA 1LCLA 4R9DA 5EWSA 4XHXA 2A7AA 4UW5A 1SLCA 4Y22A 3AYDA 1SBDA 2ZHNA 2VW2A 3WUCA 1UPSA 2XB6C 4LBNA 2B7YA 4CRQA 4XXAA 2A6XA 1CPNA 2CYFA 2D6OX 4K20A 4U2AA 4Y1ZA 4P9WA 3SISA 4Q1PA 1LESA 4AGGA 3AJZA 3VKMA 3ZYRA 1W6QB 1ZM1A 3OYWA 1MVEA 3WCRA 1CESA 4GALA 3VKNA 1FV3A 2ZGMA 3V0BB 3MW4A 4BQ1A 1DIWA 1KDMA 4FOQA 1A8DA 2ZGSA 5DXDA 2DVAA 1ULFA 4AVSA 4XJZA 2AH2A 1WLCA 4XE9A 1RIRA 2WSVA 3ZXFA 5KXEA 1WBLA 5IK8A 1O4YA 1LENA 2WNEA 5JOYA 1A3KA 4JRAA 5JOXA 2A3WA 2DUPA 2VU9A 5GZFA 2AENA 3M2MA 1F31A 4Q27A 4WVVA 1G7YA 4Q1RA 2C5DA 3ZXKA 3ZSLA 2EAKA 1W6NB 4UW6A 4F83A 1QOOA 4UW3A 4D69A 1BYHA 1I3HA 5GZGA 4FP3A 5EYYA 3T1MA 1LHWA 2P37A 1GYKA 1CN1A 1J1TA 1DQ4A 2GN3A 3ASIA 4WV8A 3B00A 4I30A 2ZHKA 5IUQA 5GALA 1HDKA 1QOTA 3ILFA 2ZBJA 4H55A 1S0GA 3AYEA 5IT6A 3SH3A 1LU1A 2GN7A 4JCKA 1GZWB 4FQZA 1MS4A 5JVVA 1XQNA 4LBJA 4XYXA 1B09A 3AZWA 3AZVA 1G8WA 5DZEA 4YW4A 4C1XA 4XJ9A 3UJOA 2DUQA 1LHNA 1GZ9A 5KXCA 2ZA9A 1G86A 3JUUA 1AX0A 2AYHA 2DVFA 1FYUA 1LHOA 1YYNA 1YO8A 1UX6A 4YW3A 4XTMA 1LHUA 4CZSA 4YZ3A 4DQAA 1SLTA 4DRRA 3PVNA 1HLCA 1FATA 3WDWA 4YGBA 3LCPA 1V00A 3IPVA 2EALA 3O0WA 1QDCA 1LEMA 3B9CA 4RA0A 2D3PA 2A5ZA 4TZDA 3ZVXA 1HKDA 4GKXA 5H9QA 4ATFA 1WW7A 4U36A 1QF3A 1D0HA 3USUB 2DU1A 4FPCA 4P9YA 3I4IA 2FMDA 1DGLA 4XJWA 4BPZA 2ARBA 3ZSKA 3LSDA 2CL2A 1MACA 2ARXA 4XJAA 2OUJA 4XMIA 3D6EA 1W6OB 3WG3A 1W6PA 1WUVA 2DURA 4XBNA 1V6MA 3BIWE 3M3EA 1N1YA 3POYA 1OQ1A 4GKYA 3ILRA 3FLPA 4YZ4A 2D43A 5FREA 3FUQA 5DUXA 4M3CA 2DU0A 2JJ6A 3U4XA 4AGVA 1W6MA 4LBKA 4YG3A 2SBAA 2P2KA 4FOYA 1ZA4A 1AVBA 3V64A 3ZSJA 3OY8A 2NMNA 3RG0A 1QKQA 2GNBA 3HN1A 4Y1YA 2A75A
chains in the Genus database with same CATH superfamily
1GKBA 2JDHA 2WS92 5A32A 2P3IA 2CHHA 1VB4A 1R092 3S5QA 3EO6A 4GQ7A 1VIWB 4UBHA 1FX5A 4JKLA 3UJQA 1DYOA 1H6YA 1HXS3 1LOFC 2Y0IA 4IE7A 4LLFA 4Q4Y2 3WP4A 5T54A 1AR62 5FV3A 3TBDA 1JI6A 1BJQA 1XE8A 1O6UA 4O61A 2E7QA 1EPWA 2DUOA 2MEV3 2Q30A 2VE1A 3D4KA 3F95A 4Y26A 3ZFGB 3MLLA 4CDQC 4YM2A 3PHMA 5J3UA 2BDRA 4YW1A 5L36A 4NHYA 1H30A 2BW8A 1E5RA 2PELA 1VRH1 1O59A 2OQ6A 2ZHMA 4AYUA 2LALA 2V5YA 5C5UA 4Y20B 2N7GA 2VBPA 4AQ2A 2Y0OA 3FHAA 3RDIA 3ORJA 2BTVC 4XUQA 3SCFA 3ZX7A 3PUQA 2B8MA 1LGNA 4AR2A 3SMHA 5FZLA 1LEDA 2JB4A 1VBA1 2W92A 2D6KA 1QJY1 2HWC1 3DV8A 1UPIA 5FPLA 4E4SA 5FPUA 4LUKA 4KBBA 4IV1C 4LK7A 2W2IA 1GR3A 2JEMA 1ENRA 2VL4A 5HI0A 1X7NA 1QJU2 4COYA 1FNZA 4DXTA 2PHFA 3K2OA 1KJLA 1X82A 3AC0A 1SFYA 3HR9A 3S30A 1OFSA 3AYAA 3SEPA 3AX4A 4K9SA 1IOAA 1L3JA 2LRPA 2JDMA 1KD7A 3ACGA 5FWJA 2J7MA 4NPRA 2JD9A 4BOWA 1UU6A 1RHI1 5FZDA 2BFUL 3M1HA 2A73B 2E26A 5FY0A 2VOWA 4YGEA 4A2UA 1FV2A 5IK5A 2UURA 2HEWF 1SPPA 4LE3A 4P9LA 4QPYA 5E16A 2XJSA 3WW4A 1H8VA 2Q1ZB 2YU2A 3IMMA 4OQ8A 3ZDSA 1F4AA 1OLME 2UU8A 1S0EA 5EJ1B 5FR3A 1N1VA 5CEHA 4OI2A 1QJY3 1B35B 2WN2A 2R30A 4MGZE 3OD4A 5FYZA 5A6YA 2W39A 3Q9OA 1OOPC 1AYN1 3OPZA 5GLTA 5JR2A 4QQLA 1TMF1 2HLEA 1RYYA 2RJLA 3AKTA 2D6NA 1LOAA 2EF6A 1CAXA 2E6VA 5GLVA 1PX4A 1C4RA 3R4SA 3UYJA 1HX6A 1MS3A 1ULEA 3AP5A 3P3NA 1PHMA 3ZXEA 4QPIC 3VD4A 2G4IA 4YM3A 1RUI3 2D93A 2XGXA 3BU0A 4NJ4A 4CXWA 3BI3A 5DQ0A 1EYBA 1I5ZA 1STMA 4S2HA 1ZRDA 2W0XA 1GMMA 1WLTA 3HAGA 3AP4A 3MICA 1C5IA 4FFFA 4TN7A 5H9RA 5LBEA 1NY72 4IERA 3KLSA 1UY0A 4HONA 3ILNA 1UWWA 4OYUA 4YG0A 3IBMA 4YPJA 5JSOA 4EWAA 1DGWX 3A7QA 1G9FA 5JXJA 2A3YA 1FMD2 2VOKA 4P14A 3VBRA 5LEKA 5HCBA 1JYXA 5FRAA 2DVBA 4ITCA 4HBNA 4WM8B 4NIGA 2GU9A 4JZRA 4A44A 4QKNA 3USUA 2CGOA 1FNYA 2WO3A 3FHQA 4ZU5A 3WDYA 2IXIA 3GCWA 2IXCA 4KWKA 2D44A 3T08A 1Q8QA 2PAKA 4IXLA 4R9AA 4MXWB 5D8AC 2BOIA 3RJRA 2Z2SB 4M3CF 5DDJ1 1V0AA 3K3NA 1LGBA 2GH2A 4IW3A 3O0VA 4AFCA 3I2JA 3AMQA 3OGSA 3VDDA 3GHNA 5BNNC 2JD4A 2W1SA 3IDBB 1MQTC 4GB31 4YGDA 3WQ1A 1C3HA 1MPXA 2ZZQA 4QX3A 1ND3C 2V5DA 1HQNA 2R073 4NHKA 4X8PA 3RWKX 5A7OA 4ZY9A 2ZMNA 1JZ3A 4NRMA 2DWRA 2RS53 1RUC2 4HVQA 3AKPA 3IB3A 3KQRA 5JIAA 3A4UA 4A4AA 3PJYA 4Q8KA 1H8TB 1AJOA 1JHNA 2NZ9A 2A71A 2HYXA 3FBYA 4NUBA 1D4M1 3HJRA 1DFQA 2CAUA 1RUJ1 4D7YA 2E53A 4QKDA 3RNSA 4NIDA 1UX7A 3LSEA 2YXSA 1N1TA 4UBGA 4YRDA 3ZYJB 1W9FA 3WY6A 2ZAHA 1RXFA 4QQOA 4JKKA 4BB3A 4WZCA 1W2UA 2ATFA 1UMZA 2VZ3A 3LKJA 1NUKA 3LEIA 4NMIA 5AC91 4DZGA 4N53C 5FZOA 1Q8OA 4Q26A 1H2KA 4JGYB 1AXZA 4Y5Z0 1QNWA 2D6MA 2IWGB 4Q4W1 4Z2WA 2YU1A 3MF6A 4HFSA 2EA7A 5GLWA 5DG2A 4LBQB 2BVBA 4AHYA 1WD4A 4DB5A 3ZXJA 2BQPA 1MS0A 1TNFA 4KU7A 5DG1A 2PXJA 1LJ7A 3D3AA 2XDVA 2GP3A 1W2TA 2P6HA 1NLRA 5CU1A 1MEC3 2V4VA 2MHFA 2RS11 2AEYA 1NXD1 5F6LB 1JOPA 1HN1A 1F4HA 5EQUA 2DV9A 2CAVA 3I49A 4UWDA 1QJX2 1QHDA 3HWJA 4LHKA 1V6IA 2K2SA 5I8SA 1PO13 5LRRA 3VDCA 3BALA 4IE4A 2VTXJ 2XBO2 2JIJA 2WNUB 3GCXA 3POGA 4L0PA 5BNOC 1RUE1 2UY8A 1FOD3 1H2LA 2ZGOA 4F7ZA 4IV3A 5CISA 3RVHA 1Z0HA 3CJIB 4XDOA 3B02A 2JDNA 3OEBA 1KXGA 4S2FA 3ACLA 2OT7A 1LU2A 4YM0A 3B5LB 1ULDA 2RM22 3ZN6A 5IAXA 5LK5A 5DUWA 3HT2A 4P00B 4AVVA 3AKQA 3OGGA 2F17A 2ADEA 4HXCA 5A3TA 1RVF2 3JU9A 1YFXA 4JGZB 3UV9A 4FTEA 3M70A 4BQYA 4IQPA 4XURA 2Q8CA 4E8DA 1O7FA 3RS6A 2JDPA 3J7MA 3O1RA 4PBPA 1CJDA 1DF0A 1NT0A 1KGYA 1UYPA 2NN8A 1LGCA 1V6LA 2WT0A 1ASJ3 4XBLA 1WLDA 1X36A 3ZKYA 5FMBA 3E5QA 4QM8A 5C9AA 5I8TA 4N43B 2CTVA 1QMJA 1UKRA 3W21A 4G9SB 1CAWB 1HRI3 1XNTA 3KQ4B 4K40A 4W6XA 1G9AA 4RFT0 3ZYPA 4XDPA 3I3DA 3KF5A 1HB4A 1VAMA 1G9DA 5IVEA 2CWSA 2AREA 1HB3A 1OA3A 5FZIA 2VOTA 2RS32 4YZ2A 4UFHA 5F5AA 4AHWA 5CBLA 3TNQA 4PBOA 3O1PA 5C4WC 2AEZA 2ZS6B 2J22A 3ON7A 2ID4A 4IL7A 4LBQD 4MO3M 3CKHA 4QGNA 2YPJA 3DKWA 4YG6A 4CPBA 2ETEA 5BYNA 4WZFA 3BU7A 2Q8OA 1XYPA 1HW5A 3PUIA 3QD6A 5FZ3A 1Y4WA 3N9LA 3VBUB 3E97A 3WLUA 4V1PA 4AW7A 1XNCA 3VBFA 1OD5A 3GBFA 1AYM3 3K48A 1DZQA 3HBZA 1W39A 3TEYA 2HWE3 2ZMKA 3RYKA 4AI0A 3C3VA 3IDCB 3ETPA 4XVHA 3FLRA 5IFPA 5FP7A 4N7UA 1U5YA 2R49A 1ZBE1 2OW4A 2XUMA 4OUEA 2G1MA 1ZBA2 3PVEA 3WCSA 2HWB3 5JMCA 4LXLA 3ZDVA 2VY0A 2FDHA 1W6PB 1NG0A 4XF0A 4MUVA 3LIHA 4IEPA 3RFRA 4BXFA 1COV1 1Q56A 1V70A 4K3UA 4I2OA 2W46A 4WVMB 3VKFC 1S0BA 4DMIA 1CWPA 1VRBA 1EAH2 1HQLA 3IKWA 4XOGA 1DQ6A 1W6MB 4ES8A 5CIRA 1PM7A 1QEXA 2QQNA 2QZ2A 2JG9C 2ZGUA 5FLJA 3LEMA 2PA7A 1ZVFA 2ZKNA 2QQOA 4FPEA 1BLZA 2WFF2 1OF3A 1Z7S2 4XFFA 5A32B 5F8PA 1EUUA 3O1MA 2FD8A 4UI9L 4CU6A 4LT5A 1Y9QA 3MIHA 1ZZ9A 3WF1A 4ATEA 4CCEA 1X50A 4DRVA 5DN2A 1VBC2 3ZXLA 3VZJA 3MV01 1PGW2 2XHNA 4PT6A 2XJRA 5KHHA 2ENRA 1REDA 3JD72 4IGOA 2ZGLA 1ZZCA 3L2YA 2WZEA 4I0BA 2W1QA 5SV5A 1A6CA 1E5SA 1JTZX 1V9U1 3MDPA 4A3XA 3DGTA 5JIUA 1W90A 4Y1VA 4BYYA 1R1ZA 2XJTA 4KMQA 1IQAA 2R042 3GZUC 3NNJA 4IV1B 5ACA2 2LROA 3N9QA 3CQOA 1GOHA 2KR2A 5DAVA 2XB6C 3WF2A 2B7YA 1Q43A 5FZBA 2XL9A 2D6OX 3M8LA 4Y1ZA 1YQ2A 3M7AA 1AR71 2FDGA 5C3OA 2KXLA 5HXVA 2VJXA 1ZM1A 3M4FA 1CESA 4QB6A 1RMU3 1PVXA 5FWEA 4A6OA 3EXUA 3VKNA 1RUF1 2ZGMA 3SEEA 4E2GA 1UZ0A 3AMMA 1A8DA 1RUG3 3VHOA 4NHMA 2DVAA 5IVCA 4YWAA 1ULFA 1US2A 4AHXA 3KD4A 5FO8B 1JZ6A 1O4YA 1SHWB 1HN0A 1VBE3 3RYRA 1QH6A 3JZVA 3HQUA 2DUPA 2VU9A 3NMBA 1SPPB 3LOBA 3M2MA 2RR12 4IEUA 4CYDA 1LAJA 1B35A 4Q1RA 5JPNB 3OPTA 3ZSLA 2RMU3 2EAKA 1WKYA 2DCTA 2KD7A 2DCZA 4B4RA 4UW6A 5KC6A 1POV3 1K12A 1W2OA 2VECA 4QX0A 1W8OA 2WNVA 3F2ZA 2Q8EA 3IT8A 1PGL1 1Q5OA 4MGIE 5FY7A 5GZGA 4FP3A 2P37A 5KHIA 1H1IA 1Y3TA 4IEVA 1DQ4A 2Y6FA 3ASIA 3NQHA 1QWRA 2ZHKA 5IUQA 5EHDA 3R4DB 3ILFA 4H55A 1CAXB 3DPRC 4QWNA 3T09A 4LOTA 4I09A 1JZ5A 2GN7A 2PLV2 2VC9A 3MIBA 1K45A 5CFCC 5F32A 3LIGA 2E32A 1VBD3 1B09A 3AZWA 4NIIA 4BWOA 4MGSA 2G9GA 4XJ9A 1EY2A 1H1MA 2DUQA 4LMFA 4Y4RA 2WZR1 2IXLA 1NE4A 3HPNA 3L2HA 5LA1A 1DGWA 4DXZA 3T0AA 1BBT3 2PQSA 4HK9A 3WSOA 4Q4V2 3AL6A 1U5IA 3FJSA 4EN6B 5IWFA 1WMXA 1AR83 1UX6A 2HBTA 2VZQA 4CZSA 4YZ3A 4FTBA 1FPN1 4HN1A 2QE3A 2WL1A 3IDAA 1L7LA 1X8EA 3CO2A 1FATA 1RUD1 4FXGB 5EFUA 2Q8DA 5FMOS 2FZ1A 3WDWA 1V00A 1KFUL 3VBRB 3FBMA 2GC2A 5J37A 5CVRA 1LEMA 1WMDA 2BGPA 4AHZA 1KEXA 1NLQA 1OVPA 5FXZA 5IVBA 1LRHA 4XUPA 3K4ZA 4ATFA 5A70A 1XXNA 2DBIA 3J9SA 4DNYA 3USUB 1TME1 2WO7A 4FPCA 4P9YA 5LY2A 4D6QA 2PAEA 3T2PA 3U1XA 3LSDA 2VAUA 4DY3A 2CL2A 3J8F2 5KC5A 4QHZA 1AUYA 1MACA 1R091 2BWAA 3VHNA 4YVWA 5LRSA 1GOFA 4RGKA 4UYBA 3VDDB 1W3XA 4GKYA 2YC0A 2D43A 3MYXA 5FP8A 5K9YA 3U4XA 4AGVA 4LBKA 4LLOA 3USSA 4K8RB 2XJVA 2BUKA 5IYYA 2YB7A 5A3OA 4CEYC 3KCCA 1M4WA 2IUWA 1AVBA 1BEV3 2V09A 4A7KA 4ARYA 4AXOA 5FAXA 4AI8A 5A3PA 1QKQA 4EROA 2Q1FA 4PI0A 4P9GA 2A75A 5EPAA 2RHPA 4FQ4A 1G6NA 4LUMA 2FCVA 3MFCA 5FZ9A 1D4VB 1F5JA 1ULCA 5CAZA 1IQDC 3W9AA 4JTNA 1TME3 3NL1A 4RL7A 4MVTA 1SACA 1S1AA 5E89A 1YIPA 2AGSA 2BERA 2WS93 5E6HA 4AWDA 1W03A 2D3RA 2W1UA 1R093 4HT1T 1UXZA 1JBCA 1ULGA 1D2SA 5CKMA 4JHTA 2WQ4A 5I0SA 1JZ2A 5JAXA 1XYNA 5FBJA 4WBBA 4XQWA 4LA3A 2DFCA 4ASKA 1HV0A 3TEXA 1UY1A 5DZGA 1RB8G 5FZOB 2Y38A 5LCWL 4Q4Y3 1AR63 5A7SA 2WNOA 3T1LA 3NAPA 3B01A 1GZCA 1XSRA 3OPWA 2QQLA 2MNGA 2VXRA 4XMAA 1UOJA 1GQPA 3AZZA 1RUG2 4HKLA 1AL23 3SCHA 1BHGA 4Y5TA 2WSUA 5JZGC 2PN5A 1KJRA 1QOSA 5LBCA 5T5PA 3ZKUA 4B3NA 5JXHA 1AR92 3KM5A 4XQ4A 4ZZ5A 3H8OA 2E7TA 3EYPA 3CL1A 2ZX3A 2YROA 3B3QE 1VBE2 2QQWA 4H14A 5DABA 2XOMA 5FKBA 1W6QA 1GP6A 1NE6A 2YV8A 1XU1A 3O0XA 1RJ7A 2R0FA 4HN0A 3WQBA 1O3RA 3MW3A 4WM7C 1OLRA 5HPOA 1PZ8A 1V6KA 3V0BA 3DYOA 3ZLIA 4NPMA 4O9GA 3C7GA 4PF1A 1HRV2 2WJSA 4B1MA 1SLBA 4YW2A 5GLZA 2ES3A 4IV3B 1RUH2 1PIV1 4AVCA 4BH9A 1QJU3 4DEVA 1JOBA 1CZVA 3S5AA 4CXXA 4R4XA 5A6ZA 1VBB2 4PF5A 1DYPA 1ULOA 1PNGA 3ZN6B 2J1SA 2KA3A 2TEPA 4BMBA 1VR3A 3I8TA 5JSRA 4AI9A 2GC1A 5L73A 5J09A 4JV4A 1QGLA 2GP5A 4AAXA 1RINA 1QH7A 2W9XA 2I45A 4Q4X2 3VUOA 1K3IA 2XKPA 4AEDC 4COVA 1PZ9A 1I9RA 2C0ZA 2EXJA 3LDRA 4D0QA 2HWF1 2WO2A 2OX0A 3HT1A 1ZREA 3GZTB 1S0JA 1DQ2A 3IAQA 1ND2A 2CY6A 1GLHA 4FFGA 1MS9A 1TQ5A 3JQXA 4QX8A 3I3EA 3ZPYA 3CNAA 2VO5A 2FHRA 3JBG1 5FYTA 1FMD1 2ADDA 2C9KA 3NNFA 3K4DA 1ONAA 3U10A 3WF0A 5C9AB 1LOEA 4RN5A 1EV12 4A3ZA 3SQOA 4ISRA 1M06G 5FFOC 5G04L 3CDZB 5C3SA 2GMMA 2E9QA 4W6WA 4LBLA 2A6WA 2HWD2 4LORA 2Y8KA 3B69A 2B9VA 2WO1A 2Z79A 1CJPA 4XUTA 3T2TA 3WVJA 5B2GB 5BV6A 2C24A 5I91A 3KF3A 4R4ZA 4A6SA 2DF7A 4IEXA 3POJA 1OPOA 2Q5TA 2PAMA 3POBA 4YSFA 3WD5A 3PVBB 3I2IA 1XSQA 2WQ8A 2BNMA 3KMHA 3K51A 2X29A 5IAVA 3VBFB 3K75B 3C7OA 5C8CC 1HXS1 3NV1A 2WAAA 4QU1A 3MIDA 5EJZB 4NOTA 2W1WA 3OF1A 1IPSA 1RXGA 3RZLA 3UKNA 1POQA 2MEV1 5JUVA 3DEMA 1X33A 1REFA 1YFWA 1PX3A 3C7FA 5FP9A 3LWCA 3CMGA 1IPJA 4GZ9A 1W3VA 1BEV2 4YYOA 4E2SA 2K9ZA 1Q8PA 1IS4A 3N9MA 1GQGA 4ZU4A 3ZMOA 1N1SA 2VVDA 4NN0A 3M3QA 5DAWA 5GKAC 3TYJA 1BXHA 4BM8A 1J59A 1R1A2 2TBVA 2JE9A 3O1VA 2JICA 4QX2A 5FUPA 1K42A 2ZEWA 4FOVA 4OLLA 2DTWA 2AZ5A 4LK6A 4XTPA 2VUCA 2VNOA 4Y24A 4HL0A 4UOJA 1WA4A 2GAUA 1LOFA 5GZDA 1Q3EA 4DXSA 2XLAA 2BBAA 3T2QA 3NV3A 5A3NA 2PHTA 2IVJA 5AFEA 3UGHA 2RJ2A 4CDQA 2V4AA 2A1XA 1D2QA 2C26A 1W9WA 1SDDB 3KZ4C 4QDRA 1O3TA 1JYIA 4R9BA 1GP4A 4QQHA 3H8XA 3DXTA 3BKZA 4CDWC 2ZACA 2IC1A 1RUC3 4PDWC 2DBNA 4FI9A 2BV4A 4GAZA 4K21A 3VZLA 3NNMA 3NSTA 1ALYA 5K0UC 1AL22 1GFF2 4BLIA 1GSLA 3ACHA 2ZZJA 3WR0A 5A7QA 4FFHA 4XFGA 3A0NA 2IZWA 4K8FA 5FYYA 3FLTA 3N35A 4QT6A 4CSWA 1LOGA 1UOBA 3BPZA 4IV1A 2XONA 1QQP2 3VBHC 4GH4C 2OZ6A 3A22A 4MG2A 1HJGA 3I2DA 2BOJA 5FLHA 2QFEA 4OZXA 3R4UA 1PO22 1BMV2 5FK8A 4HK8A 3BTXA 4CPBD 5EYXA 2GNDA 1W8FA 4HPKA 3UKVA 1EUTA 2J42A 3H0OA 2WAOA 1YI7A 1GWKA 3GJAA 4NVPA 4WVWA 1XU2A 5FZKA 5T3NA 1O4TA 2VUAA 3E6CC 4GA9A 1WW6A 5I0RA 2X09A 4AFMA 3MZHA 1HJFA 5FQ0A 4XXPA 4JHZA 3RMXA 4KH9A 2XLFA 3VKLA 1YI9A 4JTOA 2XJQA 1KITA 3WW1A 3W5MA 3V0AA 1RUI1 4RHV2 2XH6A 1FI2A 3CHXA 1CPMA 2NYYA 1C1LA 2UY9A 1UZVA 2YHJA 3JQWA 1AZDA 4KI5M 4MLOA 3NJVA 3SITA 1DYKA 2EIGA 1RJ8A 1GICA 1QJX3 1XE7A 2BNNA 2H6BA 4GWMA 5CB7A 4ARXA 3GYDA 1OOPA 5C33A 3KV5A 2XBO3 1ODNA 1UKGA 4YVSC 3UKTA 3RZMA 3MUZ1 1A78A 1ZYBA 2C6SA 1V6JA 1AX2A 1H6XA 1PVC2 1WW5A 5GZEA 2RS31 5L9BA 4C1WA 2GSYA 2WNVB 4QKFA 5FJHA 3ZFFC 1HB1A 4QPIA 2RM23 1SDWA 3FHIB 3AP9A 4ZONA 1W28A 1H9WA 4CP9A 1RVF3 4WVZA 1H0BA 4DPNA 3MIGA 1UAIA 2PHUA 5CYYA 3SHRA 3U14A 3KHBA 2JWPA 1LULA 1ACCA 4LKDA 4XJUA 4AVAA 3TN92 1YFYA 3VZKA 5AFBA 2FDFA 4AE2A 2D6LX 2VULA 4M01A 3U0ZA 2R071 5JOZA 3V56A 3LF7A 5JWPA 2VCAA 2ZGPA 2WIIB 2RS51 1OFNA 5FZ8A 3SKJE 5T50A 4QPWA 1LOCA 5LW9A 1PMJX 3AK0A 2A6YA 5BUVA 2Y26A 2RS33 2CGNA 4PIXA 4NAOA 2WINB 3AXDA 3H3ZA 3N7JA 5D8AA 1XNKA 3ALQA 1AXYA 4JVAA 4X6QB 3ZYIB 1NCRC 3WP5A 3S0MA 4SBVA 4DFSA 5BNNA 4NIHA 3RMYA 1X9PA 2I07B 1MQTA 1XNBA 1W0NA 3BODA 3PUHA 3TAYA 1WW4A 1O5UA 1QJZA 4E27A 1XOYA 2RVAA 4FCAA 4HANA 1ND3A 2GDFA 5B4NA 2EXKA 3THPA 1I6XA 4CU7A 1J1LA 2QQIA 3VZMA 1JXNA 4ZPIA 4BK4A 4GD4A 2VMHA 4YVWB 3BCWA 4Z2AA 1QU0A 4ZHNA 3VGIA 5I8YA 1VBC1 1VAKA 3VHPA 1PGW1 1N3QA 3HVDA 4N9IA 2VMDA 1ZBA3 4RGGA 4B8EA 5FP4A 1NOVA 4LEJA 2R16A 5T55A 5C7GA 2XXZA 4W6YA 2LW8A 3E5UA 4N7IA 1CAVA 4COZA 3H1YA 1C8NA 4RR3C 4RYDA 1MEC1 3VD5A 4BDVB 1U12A 4DUWA 4LBOA 2FMYA 1EAH3 3PJQA 4ZKTB 2YMZA 5C3QA 5F5IA 1SLLA 1E5HA 4N53A 3FUOA 2FZ2A 1VE0A 5JOWA 1CD3G 3VKOA 1PO11 2R041 3WG2A 3IN9A 1OI6A 2Y6JA 3VBOC 1FOD1 3GGLA 4CE8A 1E57A 2WLQA 4ZS2A 5F5QA 2WFF3 3LEKA 3H9AA 3T0BA 1Z7S3 3D5OA 4HMZA 4XF9A 1CIWA 1U5ZA 3QLQA 4CCJA 4QPGC 3KT1A 2BGCA 4IGQA 2X10A 4PIYA 5FLIA 1VBC3 5FYUA 1WD3A 3Q8CA 4NHLA 4HVRA 3HNYM 2YY1A 1F35A 3J7LA 2JKXA 4X8NA 1TZOA 1VAVA 4YGCA 5FCCA 3JD73 3I2OA 1SZBA 3FZ3A 3NAPB 2WZPP 4FSJA 4R9DA 2QQJA 4OFGA 4MZUA 5BXXA 3AYDA 1U5XA 1SBDA 1FXZA 3RJ2X 1UPSA 3S57A 5BNOA 4XXAA 1ASJ1 2CYFA 1UD1A 4K20A 3EBRA 3ECQA 4P9WA 5FY5A 3EJKA 5L7OC 2X5IC 3LA2A 3AJZA 4MX3A 2R043 1VJ2A 1W6QB 3N9NA 3ZYRA 4C0HA 5ACA3 3WCRA 1HRI1 5CFDC 2IXHA 4GALA 4X6RB 1PGSA 5JXGA 3ZFEC 3V0BB 1DIWA 4FOQA 3H42B 4NE9A 4P9JA 2ZGSA 4QXBA 3WXPA 2VQUA 3L9JT 4NWVA 4E4ZA 2OQ7A 4XE9A 1VRH2 2RG4A 2WSVA 4A7YA 1UIJA 2PQQA 3ZXFA 4C8DA 5IK8A 3GJBA 3MFAA 5IVVA 2WNEA 1ZZ6A 5C5TA 5JOYA 4JRAA 1PK6C 4LO5B 4MH0E 4MV2A 1S55A 3PTYA 3BN6A 2A3WA 3UGFA 2VNGA 5GZFA 3TRSB 1ZRRA 2QQVA 3J7HA 3MHZA 1F31A 3MBWA 3PU8A 4I0WB 1G7YA 4Q27A 2C5DA 4O9EA 2HEYF 2F4LA 3S6PA 1VBA2 1AYM1 5M0TA 1NKGA 2HWC2 2XHKA 3N9PA 4ES9A 1UYZA 2HWE1 4IGPA 1W8NA 3URFA 1I3HA 4ASLA 3ACFA 3JXSA 4UFIA 4RQPC 4BCUA 1JU4A 2RR13 4PHZA 5HCHA 1GYKA 4JX0A 1CN1A 1TE1B 4LO6B 2YUEA 1ND2B 3FN9A 4KL1A 2D40A 4XACA 2WZ8A 5BNPC 2ET1A 2H0VA 1YC61 2XR4A 3LB9A 5C4WA 2VCBA 2HWB1 5GALA 4CCOA 2ZBJA 4AF9A 4EN8B 4DXRA 4Q0SA 1WCUA 1GZWB 3I59A 3Q8BA 5JVVA 1XQNA 2RDNA 1RHI2 4YW4A 4TWTA 3THTA 3WF3A 4C1XA 3DF0A 3AMNA 3MGUA 4PLNA 2Y6GA 4KQ7A 5FZ7A 4PLMA 1K5MC 1G86A 3ABZA 1AX0A 2VTXA 2UYBA 2PLV3 3G7DA 2DVFA 4XFAA 2ZX2A 4GJZA 2VZPA 2JDAA 5IATA 1YEWA 4LULA 1LHUA 3H7YA 4BXSV 1GZTA 1WCQA 3KCYA 3NO8A 1HLCA 2VUDA 2VBBA 3DL3A 1OD3A 1AYN2 4Q4V3 1TMF2 2EIEA 3IPVA 3VD7A 3O0WA 3AVRA 1QDCA 1ODMA 3DYMA 4IE5A 2QVSB 2YBSA 3B9CA 2EIBA 4CDUC 2A5ZA 4NRPA 3I2KA 3ZVXA 2VZRA 5ISLA 4AZZA 2I74A 2FDKA 2P17A 1WW7A 1QF3A 4QB2A 4KBZA 3FX3A 2CV6A 4ORFA 4XJWA 2VM9A 2J1EA 1UOFA 2JG9A 4URTA 4XJAA 4CEWA 4XMIA 1UYXA 3D6EA 4PLOA 2DURA 5BY5A 1V6MA 3M3EA 1C5HA 4JDMA 4B7EA 2GZWA 3ILRA 3FLPA 4CEWC 1ZA7A 3HQXA 4M3CA 2JX9A 3J8F3 4B4PA 4W50A 1TVGA 3T4VA 4CDXC 4IEQA 4KWJA 3B9IA 4M0HA 2SBAA 4LJHA 4FOYA 1ZA4A 3K77A 1CIYA 3ZSJA 3OY8A 3U07A 3RG0A 4J1WA 2WR9A 3HN1A 1C8M2 4PDWB 4Y1YA 4CDQB 2GNMA 4CCMA 1DBNA 5ABJC 1RMU1 4EQVA 2BYVE 2JG8C 3M3OA 4FPHA 3FMGA 1VMFA 1SBEA 2GMPA 4HZFA 2VNRA 3H50A 1HQWA 2RDSA 3LDBA 1LOBA 1RUG1 1SMVA 5FMDA 2VMFA 1LODA 3H8UA 4FPGA 5FYHA 1MR5A 3LEGA 2P3YA 5J36A 2Q4SA 2B45X 5DDJ2 5LA2A 2R063 4FPOB 1WMEA 1OVSA 1VP6A 5FPAA 4QD2A 1VBE1 3NNLA 5HCAA 3KV6A 2VQTA 3GBGA 5FYMA 3ZN4A 4GB32 3PIGA 1AL0G 4YM1A 5T5LA 1NA1A 3X29B 1DLLA 1WWYA 2EXHA 2RMU1 3E1F1 5FZMA 1PM4A 4IEYA 3AKRA 3LDKA 5F2WA 1POV1 1GANA 3DXUA 3HNMA 3QACA 3VN4A 4R9CA 3CIHA 3WG1A 2CGPA 3WDVA 1GV9A 1YRZA 1NA1C 1RUH1 4KGGA 4XEZA 4XETA 1UN1A 3C2UA 3WQ7A 3ZFGC 4HPKB 4LQRA 4D7TA 2LM3A 4XF3A 4L99A 1D7PM 1N3PA 3HEIA 1YIFA 1QIQA 2YFUA 1O4ZA 3GNEA 1D4M2 1LECA 1BK1A 1RUJ2 3QBQA 4MADA 4Y22B 4BA6A 4PQ9A 4FPYA 2A3XA 4YW5A 4IEZA 4P9XA 2BWCA 1S0DA 3N36A 4OI1A 5FQ0B 1VBD1 1AR93 3GALA 3KVBA 1OLQA 2JDZA 3VD9A 3V0AB 4RSUA 5AC92 2AACA 3N7LA 4CP1A 2UYAA 1ENQA 3AYCA 3NKTA 1BBT1 3H3LA 1YXWA 1RL3A 1UY4A 1DHKB 1MZ6A 3APBA 3K3OA 4Q4W2 3CBNA 3LFMA 1A34A 1O91A 1OA2A 1AR81 3VZOA 4LIVA 5FYVA 1Y7BA 3POSA 1OOPB 3DKQA 4LE4A 4ONUA 3CZJA 2NLRA 2GMEA 1WMFA 1N3OA 1HRV3 5E8AA 3PL0A 4EWDA 4Z1VA 3DPRA 1RUH3 4ZS3A 4LITA 1R083 1W6NA 2BGOA 4J25A 3I2HA 3RSJA 2UWBA 5FBZA 5CFCA 2HWD1 1VBB3 5EP9A 5A7NA 4QPIB 2RS12 1SLIA 5KHGA 3T2OA 2R32A 4OZOA 3QCWA 3G6JB 4FOWA 4V2VA 4CP9B 1X9TA 3WF4A 3ZSEA 4Q4X3 4LO4B 4BJ0A 2BU9A 4YZ1A 1S0CA 3R6SA 1RUE2 3ITQA 4XIOA 1W9SA 3ZSMA 2WQZC 4LTAA 1G9CA 1QDOA 1Y9MA 2XJUA 3OTFA 3OUIA 5F37A 3FL7A 3GDBA 3AFKA 3JB4C 1QJFA 1NAEA 5FOJB 3JB8A 4CP0A 2ZCWA 5L9VA 5FZGA 1QXPA 1BEV1 3NV2A 1CR7A 4MGQA 1EV13 3NJYA 1R64A 5FOBB 4ZXKA 2WLPA 5EV7A 4CCNA 1W2NA 4XILA 2WKKA 3VHRA 3FFZA 2HWD3 5LA0A 2VZ1A 4GXLA 2CWMA 5D8AB 5DUUA 4LO7A 1JZ7A 2BNOA 2DYCA 2VH9A 5E1RA 1KS5A 2EVXA 2OA2A 2NM1A 3O14A 4JKMA 4ASMB 5BNNB 2FCUA 1MQTB 1UMIA 4MHRA 2WS91 4FAHA 2ARAA 2Q1MA 3VDBA 3N7MA 4GJYA 1CONA 5DAPA 4PCRA 1VALA 5FP3A 1PZ7A 1ND3B 5J1XA 3AZYA 4IE0A 4CCDA 1G9BA 2ZJCA 4CEYA 4ET7A 4UAPA 2ZMLA 5APAA 1N47A 4Q4Y1 1AR61 4OQ9A 4L8QA 3B93A 1OF4A 5FKCA 5FDBA 4YLZA 4LIUA 3S7IA 1OH4A 1IS5A 4WM8C 5FPVA 2DCJA 4BQ3A 5IVJA 1CAUA 2Z5WA 2XWBB 1AL21 1UU5A 1BVP1 1GWMA 3T4HB 2Y6KA 4DEQA 2PYTA 2QQKA 2PHRA 1R1A3 2D5FA 1A8MA 1CAVB 1IS3A 1IS6A 2R062 5FO9B 5EIYB 1JN2P 1GWLA 2Z42A 4Y1UA 1O3SA 2X53S 3J7NA 1H9PA 4AVTA 5KR7A 4LA2A 2CNAA 4N53B 3R05A 2WYFA 5JLVA 1QNYA 3J26N 1SLAA 2P34A 4UT5A 1ZBE2 1AX1A 5IVYA 1HB2A 2Y64A 1OMIA 4QB1A 4AOCA 2O1QA 5A80A 4AEJA 1MZ5A 1DCSA 5J7MA 1QJU1 5CG9A 5FYBA 1COV2 3ENRA 1H8TC 1Q8VA 5JZGA 1RC6A 4BHPA 2WRAA 2E51A 2P6CA 2PMWB 2XKOA 4KG0A 3OOXA 4AI2A 1DGRA 3FFQA 2OZJA 1O5LA 4M00A 4QU2A 4FXKB 4BIOA 4XDQA 4AFBA 4WM7A 1APNA 2G9ZA 4K7JA 4OMDA 5A7WA 1BK0A 1ZRIA 2X5IB 5FY1A 1AXKA 4AGRA 3QH6A 1QQP3 4CCLA 5A3UA 3WINE 4A7ZA 1ENXA 2P1BA 5BNOB 3I7DA 4JGYC 2W3JA 4NHXA 4TLFA 5I0UA 2BFUS 1PO23 2D6PA 2D98A 2B39A 4LO8A 5I0TA 1W8HA 2DCYA 1Q8SA 1DQ5A 4Q2FA 4XCBA 4MHUA 4M3CE 3BB6A 1R082 2V73A 4AQSA 2XQXA 5FTTC 3RZHA 2ZEXA 1V9U2 3OBAA 5ERLA 2VVEA 2D3SA 4AEDA 1OQDA 4F3JA 4XABA 3IM0A 3OJBA 2Z69A 5C6CA 5E88A 1JUHA 3RQ0A 2B46X 1XNDA 4RHV3 4NWWA 2WT1A 4LR4A 2WUHA 1HIXA 4P9IA 4H3WA 2FDJA 2WNUC 3WUDA 2WT2A 1T2XA 1UL9A 1ZX5A 1IZ3A 1NY71 1LR5A 5SV8A 1AR72 1SFPA 3B7MA 4QQ2A 2NPIA 5F39A 3CJIC 3OBTA 2BRTA 3OUJA 3Q8AA 4DO0A 1OSGA 4MSVA 1GZWA 5FPBA 1UY3A 1LTEA 1RUF2 4G4FA 4IETA 5A33A 2QUOA 4QAWA 1YJLA 1GNHA 1PVC3 4AK3A 5CKQA 3U4SA 2PHWA 2JDKA 5C4WB 2ZTNA 5LBFA 3SKVA 3VB9A 2JB8A 4JGZC 1BZWA 3I54A 4CTEA 3I59B 4QDQA 3EB7A 3D0JA 3GZAA 3MIEA 1C1FA 2C9AA 1UCXA 2P5BA 4HETA 4UFJA 5F3IA 3NV4A 5B4XA 4H2AA 3SNMA 3ZR6A 4ZXEA 5FZHA 5C8CA 2VZOA 1KRIA 4PIZA 1J3QA 2F4PA 3HIFA 4BE3A 3A23A 3P6BA 4D6SA 3ZYGA 1U0AA 3NRUA 3TN93 2JECA 3AJYA 1JUIA 4N43C 3ME2A 3WP3A 3ZYBA 5KBFA 1W9TA 3MW2A 2QTWB 4QX5A 1PGL2 3QOPA 2ZGRA 3KGZA 3POEA 5JDBA 3A21A 3OGVA 4W8JA 3WW2A 1AF9A 1L7QA 1RUC1 4AQTA 3IPVB 3NWKA 3RZGA 1CX1A 1KS4A 2O8QA 4JC1A 5AVAA 5FZ4A 3WZ1A 4OI4A 2RJKA 4CCCA 1US3A 3LA7A 4XFHA 1JU3A 1H2NA 2CDOA 1Y43B 2F6BA 3I2FA 5CA6A 4MGTA 1YQ8A 3OBRA 3WX5A 3AMPA 1VMJA 2JG9B 4RGAA 3WT3A 2WZR2 4XFBA 4CEWB 5FMOL 2E31A 4FVVA 2A6VA 3WG4A 1OKQA 3IMNA 1QJEA 2EAAA 3E6BA 3LA3A 3AFGA 2D7FA 5IW0A 4QQPA 3TNPB 4M3CB 1FPN2 4PDWA 5FZ0A 4AG4A 4CDWA 2ZHLA 2OYZA 1PMIA 4FP2A 1W06A 2EXIA 1V6NA 2R1DA 1RUD2 2SLIA 5K0UA 5KXBA 2VOVA 4FFIA 4P5HA 4UW4A 3OY8B 5CNAA 4MYEA 1DU3D 2YGMA 5A3LA 1YCIA 4K6BA 3EMRA 4NIAA 3VV1A 1POV0 3I3QA 4IEOA 3VBHA 4GH4A 4AQ6A 1S0IA 1QXRA 1YNAA 3UETA 5FY4A 5FXVA 5IJRA 4BISA 2XMLA 4PQQA 1FAYA 1GP5A 1URXA 2HH9A 2LUWA 2P3KA 5F7UA 1SCRA 3ROUA 1QJX1 2UWAA 1IGOA 4RD7A 1BKZA 2OVUA 4COUA 1S0FA 2XBO1 3THCA 2B4KA 1CZTA 3WHTA 4Z8BA 4OI0A 1SCSA 1NA1B 5FIXA 4GWNA 1W0PA 1YUDA 3SH4A 1MS5A 3WOGA 1PNFA 4YZ5A 4CDXA 1T6BX 1LCLA 2EIDA 4XHXA 2A7AA 4UW5A 2ZX4A 3TOJA 1SLCA 2RM21 1H2MA 1F8VA 5F6KA 4Y22A 2DCKA 2ZHNA 2VW2A 4OHXA 1F2NA 4YNIA 2BP6A 1UO9A 5FYIA 4LBNA 3DYPA 5CZKA 5LZ6A 4QGMA 4CRQA 3NKGA 1RVF1 2A6XA 4XF1A 3WQ0A 1CPNA 2FBEA 1JODA 4U2AA 4HVOA 4QHBA 4CU9A 4XFCA 2G19A 3SISA 3WNNA 1C28A 1LESA 5JPMB 3ZN5A 1WGPA 4HKWA 3OYWA 2WWSA 1HV1A 4HOOA 4KU8A 5HBAA 2Y6LA 1O3QA 1OH3A 4YVSA 3MW4A 4BQ1A 1KDMA 3LPFA 5FZAA 2YBKA 1J3RA 3O1UA 5DXDA 5FY8A 2J1RA 4AVSA 4XJZA 5LK7B 2VMGA 1J84A 3ZFFA 1WBLA 4D7SA 4L11A 1LENA 1PMHX 4CUGA 2XWJB 5JOXA 3RYPA 1RUNA 5ANNA 1LNSA 2MPFA 2J1TA 3BGAA 2AENA 4QXHA 4WVVA 2D5HA 3ZXKA 1VRH3 1DZTA 3CF6E 3DPRB 4C90A 4EZHA 1W6NB 2VZUA 2ILMA 4F83A 3ZIXA 4M0NA 1QOOA 4UW3A 4JDOA 5CFCB 4Q0VA 4D69A 4HG6B 4Q0PA 4GMP1 4YW7A 2JIGA 5EYYA 3ZOIA 3T1MA 5A6QA 1LHWA 2OPKA 4LNVA 1J1TA 1YFUA 2GN3A 1OBNA 5L9RA 1VBA3 4I30A 4BQWA 2HWC3 5LB6A 1QOTA 1ZNPA 3AYEA 1SQ4A 3SH3A 3OGJA 4JCKA 3U75A 2BBVA 3I3MA 1PIV2 4LBJA 4XYXA 3KHCA 3AZVA 4XUOA 1ZBA1 3BPSA 3NVCA 3O7OA 5KXCA 1NCRA 3JUUA 2AYHA 4QX1A 4I3GA 2WABA 3ZYHA 5JSPA 4EV0A 1LHOA 4HSLA 4QGLA 1YYNA 3IZOA 1YO8A 1RHI3 5IHRA 3GBWA 1EAH1 1YQ6A 5IFTA 1SFNA 1SLTA 3S7EA 3AM2A 3P5BA 3PVNA 4AEKA 5JXIA 1NXMA 1O8PA 3MO4A 2ZXQA 2HWF2 4FT8A 3KV9A 2VG9A 4Y33A 4GMP3 3LCPA 4YGBA 5JI7A 2X05A 3ES4A 3FE5A 2EALA 4XZUG 5L19A 4H7LA 4FBFA 4OHVA 3O1OA 2XJPA 4LHSA 4AAPA 2WFF1 1HKDA 3JBG2 5H9QA 2L9LA 4B1LA 4XQDA 1Z7S1 4U36A 3J4UH 2DU1A 1AYN3 3I4IA 4R8HA 1C8M1 1DGLA 2W5FA 1TMF3 4BPZA 4BU2A 3AMHA 5K8SA 3BTYA 1YJKA 2ARBA 4M4PA 4CEYB 4RR3A 4BZ4A 1UF2C 3RI8A 3TWIA 3VBRC 3OB8A 4PI2A 1XNAA 1WUVA 1J58A 3JD71 4XBNA 4ZU7A 1UNBA 1N1YA 4UFLA 3VDAA 3ACIA 1IPKA 2IFRA 1CGPA 1XJAA 3OGRA 1CAUB 1O8SA 3FUQA 3IDEA 5DUXA 5C8WA 4L97A 3TEWA 4GWJA 2DU0A 2JJ6A 2WC2A 1H4GA 2Y34A 2YBPA 4YG3A 3AL5A 2VQAA 3VBOA 2P2KA 2QJVA 4GIQA 5JI9A 1OURA 3V64A 4D94A 2NMNA 3UNPA 1CZSA 2GNBA 1HXS2 2VVFA 5K7PA 4QPGA 5ACA1 2E7AA 3VDDC 4MXVA 2VW0A 1JH5A 1BVVA 2MEV2 2A6ZA 3P1IA 2WBKA 4AEMA 4CP2A 1TNRA 3RZJA 1MVQA 4HLTA 2WYSA 1C8M3 1I1EA 1F9KA 1SG3A 2Z4FA 3VBSA 3MLKA 4M4RA 1E5IA 3WNPA 5J48A 3HBKA 2BJSA 2ET7A 5TSWA 4DINB 5CG8A 4S2DA 5JZGB 4ISQA 3VBSC 4CUCA 3SLIA 4BQ4A 3C8XA 4XUNA 5L7OA 1ST8A 2VZSA 2X5IA 5DDJ3 4QM9A 1KFXL 2KM2A 1ULPA 4N8MA 4XAEA 5EXOA 4AFDA 5GZCA 4W4ZA 5CFDA 2JE8A 2AR6A 1JYTA 5FYSA 4GB33 5H9PA 4LKFA 4WM7B 5GM0A 3CZUA 3CLPA 3ZFEA 2RR11 4BMEA 5A7WB 1OKOA 4CUAA 5T52A 4LHLA 2Y6HA 4TSVA 5I0DA 1MZFA 2AUYA 2OIIA 1WZXA 3C7HA 3GM8A 2XL7A 2V72A 3K46A 2IVIB 5D1IA 3ETQA 1ZRCA 1QXJA 2VXJA 2RDQA 3BYWA 1PK6A 3WNXA 4OULA 4MGYE 5FYCA 4HSJA 1ZZBA 4C0BA 3O1TA 4FPFA 5EZWA 4AL9A 1D4M3 4IESA 1RUJ3 4UF0A 5ANQA 1C57A 1VPHA 3TEZA 2PLV1 3KWVA 1IKQA 5FJKA 5F3GA 3O1SA 4AEDB 2IFWA 3BUCA 4RQPA 3OG2A 4IUGA 1ENSA 3PNAA 4ZZ8A 2NP0A 1TG7A 4QKBA 3PLQA 2VQ0A 5AC93 1JOJA 1QJY2 1OPMA 3WP6A 3POIA 3RPQA 5BNPA 1GOGA 4I3PA 1NCQA 2W94A 4Q4V1 1EP0A 4Q4W3 3T3YA 2K0GA 3UK9A 4EN7B 4OUMA 5I93A 2YYOA 1WCKA 3BVCA 2YPDA 4BQXA 2EICA 4IV3C 1W8WA 2VZVA 4Y3OA 1NCQC 1OQEA 2ZEYA 3KT7A 4K1ZA 3H8RA 2O14A 1F15A 1K5MA 2ARCA 3Q8EA 3MPBA 1UZZA 3MIFA 5A33B 1RUI2 1W8TA 4UFKA 5AVPA 1WCSA 2ZAAA 5A6XA 1BQPA 5KWRA 3LAGA 4B4QA 2RS13 1D0GA 1AJKA 1RITA 4L9BA 3WW3A 3DECA 1OXCA 2R1BA 4BQ5A 1Y9GA 2YGLA 3I97A 4FTSA 3C7EA 4OUSA 3J8F1 2ZGQA 1XB9A 1LKNA 2K46A 5C8CB 1NYWA 4CDUA 1SBFA 3BOPA 1UOGA 1RUE3 3LFIA 4S2GA 1H4HA 4RS5A 5GLUA 1IG0A 3CJXA 5C9AC 3M3CA 4J1XA 2IXJA 2QZ3A 2Q0AA 2VGDA 4Y1XA 3ZXGA 2DVGA 4RS5C 2OKXA 5K4LA 1JZ4A 4F8AA 1YQ5A 3OCPA 4BLJA 5IK4A 5KHKA 2GH8A 4TYSA 1JW6A 3NNGA 4LHNA 1QY4A 4FO9A 5FZCA 5FK7A 2R061 2VPVA 3PUSA 4JAAA 1UZYA 1NQJA 4OHZA 3KCXA 4DS0A 1UIKA 1MS8A 2ZGTA 1IG3A 1WBFA 3LGRA 4FPKA 3OSDA 3AKSA 3HD8B 4H7MA 3RRDA 2W47A 5BNQA 5C3PA 2JE7A 3WNMA 4HKOA 4KGQA 2YG0A 2VUJA 2R072 1W6OA 3VBFC 2YZ4A 5GJ6A 2E33A 3SC7X 4OCTA 2Y60A 4XHBA 5ABJA 4I02A 2RS52 3E5XA 3KS7A 4RFRB 5LEJA 2CDPA 2JG8A 1W04A 2ZOEB 1YHFA 1CVNA 2VNVA 2ZGKA 2RV9A 3K4AA 3PVOA 4FPJA 4PJYA 3RWNA 4CCKA 1JYCA 2VBDA 3PIJA 1KQRA 5K0UB 3DUIA 2DDUA 3D8CA 3KV4A 4C91A 4DY5A 3POFA 3KGLA 3PMEA 4KG8A 1GNZA 4E4DX 1VMHA 2QQMA 4LBMA 5C71A 5FXWA 3ZO0B 4COWA 2ZX1A 1DQ0A 1AR91 2IXKA 1GBGA 4QXCA 2YC4A 1J83A 3INAA 4QMAA 3VBHB 3MV11 1YWKA 4GH4B 3HNBM 3W20A 4R52A 1OHFA 3U78A 1JZ8A 2XQRA 2R0HA 3SCGA 4YFZA 5H9SA 1IKPA 3RI9A 3VL9A 4MOAA 5DUVA 3ZFGA 4DOUA 5F2SA 2GALA 1YQCA 3IIAA 4A42A 3A0KA 5FY9A 2LTNA 1OT5A 5HCFA 4B7KA 3MUY1 1ZBE3 1OUXA 1ZZ8A 2J1UA 1HRV1 5A1AA 5F3CA 4AI3A 3O12A 2DFBA 4XZPA 1R081 1TEIA 2XVGA 4TLGA 1X8MA 4Y20A 5DMYA 4NR1A 4XIKA 1COV3 2A70A 1MEC2 2PHDA 1VBB1 4A45A 4EN0A 2WA3A 1KDKA 1T6GC 2VMIA 3BTZA 1WCDJ 2FCTA 1JHJA 3NW4A 1JYNA 2UWCA 1XRUA 2FQPA 4Y4YA 4QX7A 2YDEA 3T0DA 4XAAA 3WUCA 1JMUB 1PO12 1ZRFA 2ZKLA 4Q4X1 4IEWA 1BCXA 4MGKE 4META 3Q8FA 1FOD2 3H7JA 3MEPA 3OYWB 4OMCA 4NPLA 5IVFA 4P02B 4YVSB 1DQ1A 4NO4A 5A1LA 4D8MA 5HV4A 1DZRA 2ZABA 4L2NA 1NLSA 2XG3A 4BK5A 4GMP0 5LY1A 2HBUA 1WLWA 2G9FA 3LZZA 5FZ6A 3ZFFB 4Z92B 1EV11 1W0OA 3KB5A 2WFPA 5FPZA 4DIQA 3U11A 2B5HA 3O5SA 4D6RA 3GHMA 4K1YA 2OXBA 2R7EB 1V9U3 3ZXDA 4Q0UA 5KHJA 1NQDA 5FZFA 2AC1A 2O8OA 3WHUA 5FUNA 4OVEA 4OHYA 4G3YC 5LWBA 2QDRA 1ASJ2 2ZPXA 4XCAA 5T5OA 2JENA 5IK7A 5EJ3A 2CSGA 4IDZA 4Q8LA 2PHXA 2P4EA 3SH5A 1HRI2 3WV6A 3W59A 5J98B 2PTMA 3VL8A 1EPZA 5F9TA 3FWEA 3WNOA 4EWEA 1B35C 1GU3A 2VMCA 1AR73 3IAPA 2E63A 3MI8A 4LPLA 4EYUA 1OC1A 4DUXA 3RZKA 1SEFA 4OHWA 2HYKA 2GC0A 2WNVC 2ZGNA 3H3UA 5C3RA 1FT9A 4Z07A 3ZIWA 1RUF3 3N3HA 4QDSA 1GUIA 4YFWA 3WDUA 1LHVA 4KWUA 5FZEA 3PDQA 2I2SA 3ATGA 1RUOA 1NCRB 3AP6A 4XJ8A 1R1A1 2C1FA 2XPJA 5KXDA 4JQRA 3MPPG 3AP7A 2YC2A 4NROA 2W52A 1AYM2 3AXEA 3ZPOA 5LBBA 3WDTA 4QXKA 3PUAA 2HWE2 4SLIA 3R0RA 3UGGA 3WEZA 2DVDA 3KVAA 4YARA 5C70A 4TTGA 4KWLA 3FC0A 1V6OA 2W95A 3NJZA 2GNTA 1UXXX 4WM8A 2HWB2 1XYOA 5A7PA 1CQ9A 3JCIA 5FZ1A 1NX9A 2OUHA 2P3JA 3ZMNA 4CVUA 2VCCA 4LKEA 5G05L 2DTYA 3BIEA 3VD3A 1W9YA 2W68A 3ST7A 2OS2A 2W08A 4MXWA 5DZFA 2BVVA 4RR3B 2VTFA 1W99A 3V65A 3N4MA 3H1WA 4E4HA 1GNYA 3B94A 3EHKA 1F5FA 1Z78A 1YLLA 2BEOA 2QBXA 3IIIA 2VMEA 2WA4A 3P3PA 4O7XA 4TXWA 2WN3A 3TB0A 2H6CA 3WNLA 4UXAA 1RGSA 4W65A 3LE0A 3BOWA 5FXXA 3CU7A 3POWA 2WZR3 3AZXA 3UL2A 2JKBA 2W87A 1QQP1 2LS6A 4CDWB 3KT4A 2VW1A 1L7RA 1JYWA 5A3WA 3RZZA 3VBOB 4BQ2A 3ELNA 2HKXA 1UW8A 4I01A 1PO21 2ORZA 3I3BA 3NJXA 4YVWC 2ZX0A 5JR7B 2RE9A 2QQPA 1BMV1 3LQCA 2NMOA 4QPGB 1H8TA 2YFZA 5T5JA 1FPN3 4N90A 3U37A 3W5NA 3MF9A 2ERFA 4EN9B 1XC6A 3AB0A 4CUBA 1RUD3 3OEAA 5LATA 3WDXA 4CU8A 4UFMA 5CADA 3HMYA 3AVSA 1UMHA 5FPXA 2JXAA 2XUEA 3OD0A 4AFAA 1OLMA 2VCMA 3M3IA 3VBSB 3T30A 2B9UA 3RGBA 1DP0A 3PURA 1MS1A 4XBQA 1UU4A 1DLCA 3OUHA 2JDYA 4RHV1 4E8CA 5JMOA 1W8UA 3EQEA 3MLJA 4GULA 2H0BA 3BTAA 4JGYA 4XW3A 4Q29A 5L7OB 4AVBA 3W58A 4A41A 4LBQA 4INDA 3N7KA 2O0OA 3OBZA 1WA6X 1JS9A 1VLNA 5CFDB 5EWSA 4JDNA 4LKSA 3ZFEB 3WNKA 4Y5SA 1RMU2 5FO7B 2VR4A 2FDIA 1W2AX 4P5YA 1PVC1 3QH7A 3ZXAC 3HN3A 4P08A 2D97A 4GWIA 3LD8A 1RTVA 2J1VA 4KNCA 4Q1PA 4AGGA 4YW6A 3VKMA 4LOSA 5F1RA 1MVEA 1MZEA 1PK6B 1XPWA 3NAPC 4D3WA 1FV3A 1XE0A 3PU3A 2BPA2 1ZZ7A 4V2WA 2WDBA 4N9HA 5FMCA 3ZR5A 4UF0B 2C4XA 4DUVA 1S2KA 2WNUA 3IWZA 2NQYA 2AH2A 1WLCA 2VD7A 1RIRA 3N9OA 4NAMA 1AHSA 2ORXA 2RMU2 1K5JA 5LASA 5KXEA 4JRLA 3CJIA 3TN91 2TUNA 4RQPB 1LB2A 3E6DA 1A3KA 1S4CA 3PTRB 3THDA 3LOIA 2R6QA 5HV0A 5BNPB 2HJIA 2VZTA 4URAA 1JYVA 1NCQB 2X8KA 4XF4A 4BIFA 1S2EA 2RDRA 4JGZA 1NZIA 1P8JA 4CA9A 1OA4A 1IHMA 1DDLA 3VLBB 4J6GA 1BYHA 4QHOA 2HEVF 2WWJA 4EZ4A 2B42B 5D2AA 4Q0QA 5HXMA 1VBD2 4B29A 1K5MB 3DN7A 4WV8A 3B00A 3CEWA 1OUSA 1HDKA 2QQUA 5IT6A 1S0GA 2GC3A 4N43A 1BBT2 1CX4A 1LU1A 1NZCA 1XBFA 1UZWA 2BZDA 4L92A 1CAWA 1MS4A 4FQZA 1W05A 3GF6A 2PHLA 3HOBA 1UY2A 5J96B 3I2GA 5DZEA 1AR82 1G8WA 1UYYA 2JDUA 3H1MA 3KSCA 2OPWA 3UJOA 3UT0A 1LHNA 1GZ9A 2TNFA 1W8ZA 1H1AA 2XLGA 3ZM8A 2ZA9A 1ND2C 1J3PA 4CDUB 1DGRN 1GQHA 1FYUA 4RS5B 1I5PA 5BPXA 1PIV3 2ZEZA 4EE2A 2PFWA 4XC9A 3HQRA 4YW3A 4XTMA 1REEA 2XVLA 5F3EA 4DQAA 4DRRA 4Q5OA 4E2QA 4O65A 5DAQA 3GZEA 2QKDA 5F5CA 3VBUA 3VZNA 2Y33A 4Z82A 3SXWA 4JQTA 3LPGA 4RA0A 2D3PA 4TZDA 1VB2A 4IE6A 4CXYA 4GKXA 5LA9A 3VBUC 2J1AA 3D0SA 4FAGA 1S2BA 2HWF3 3UESA 1D0HA 5CKNA 4E9KA 2FMDA 4CDXB 2W91A 3ZSKA 4NRQA 3DCQA 4XPVA 2ARXA 2QDNA 2CU5A 2OUJA 4EJRA 1W6OB 3JBG3 1W6PA 3WG3A 2QNKA 1FMD3 3BIWE 3POYA 1OQ1A 5ABJB 3GXUA 5JCTA 5FUIA 4WVMA 4YZ4A 5FREA 2JG8B 4XFIA 1DG6A 2QCSB 2VOXA 5DAXA 5D21A 5DPNA 1W6MA 3D82A 5A3MA 4I0AA 2WWUA 3PMSA 2XVKA 1UQXA 3ZYFA 1TME2 4AI1A 4FPLA 5A1FA 3ES1A
chains in the Genus database with same CATH topology
1GKBA 2WS92 5A32A 2P3IA 1VB4A 1R092 3EO6A 4GQ7A 1VIWB 4UBHA 1FX5A 3UJQA 1HXS3 1LOFC 4LLFA 2Y0IA 4Q4Y2 3WP4A 5T54A 1AR62 3TBDA 1BJQA 1XE8A 2DUOA 1EPWA 2E7QA 2Q30A 2MEV3 3D4KA 4Y26A 3ZFGB 4CDQC 3MLLA 4YM2A 3PHMA 5J3UA 5L36A 4YW1A 1H30A 2BW8A 2PELA 1VRH1 2ZHMA 4AYUA 2LALA 2V5YA 4Y20B 2N7GA 4AQ2A 2Y0OA 3RDIA 2BTVC 3SCFA 3ZX7A 2B8MA 1LGNA 3SMHA 1LEDA 1VBA1 2D6KA 1QJY1 2HWC1 3DV8A 1UPIA 4E4SA 5KXDA 4LUKA 4KBBA 4IV1C 1GR3A 2JEMA 1ENRA 5HI0A 1X7NA 1QJU2 4COYA 1FNZA 2PHFA 1KJLA 1X82A 3HR9A 1SFYA 3S30A 1OFSA 3AYAA 3AX4A 4K9SA 1IOAA 1L3JA 1KD7A 4NPRA 4BOWA 1UU6A 1RHI1 2BFUL 3M1HA 2A73B 2VOWA 4YGEA 4A2UA 1FV2A 5IK5A 2UURA 2HEWF 4QPYA 4LE3A 4P9LA 5E16A 2XJSA 3WW4A 1H8VA 2Q1ZB 3ZDSA 2UU8A 1S0EA 1N1VA 4OI2A 1QJY3 1B35B 4MGZE 2R30A 3OD4A 2W39A 3Q9OA 1OOPC 1AYN1 3OPZA 5GLTA 4QQLA 1TMF1 2RJLA 3AKTA 2D6NA 1LOAA 2EF6A 1CAXA 2E6VA 5GLVA 1C4RA 3R4SA 1HX6A 1MS3A 1ULEA 3AP5A 3P3NA 1PHMA 3ZXEA 4QPIC 2G4IA 4YM3A 1RUI3 2D93A 2XGXA 1EYBA 1I5ZA 1ZRDA 4S2HA 2W0XA 1WLTA 3HAGA 3AP4A 3MICA 1C5IA 5H9RA 1NY72 4IERA 3KLSA 5JSOA 3ILNA 4YG0A 3IBMA 4EWAA 1DGWX 1G9FA 2A3YA 1FMD2 2VOKA 4P14A 3VBRA 5LEKA 5HCBA 5FRAA 2DVBA 4ITCA 4HBNA 4WM8B 2GU9A 3USUA 2CGOA 1FNYA 4ZU5A 3WDYA 2IXIA 2IXCA 4KWKA 2D44A 1Q8QA 2PAKA 4IXLA 4R9AA 4MXWB 5D8AC 3RJRA 2Z2SB 4M3CF 5DDJ1 4AFCA 1LGBA 2GH2A 3O0VA 3AMQA 3VDDA 5BNNC 3GHNA 2JD4A 3IDBB 1MQTC 4GB31 4YGDA 3WQ1A 1C3HA 2ZZQA 1ND3C 1HQNA 2R073 4NHKA 4X8PA 2ZMNA 2DWRA 2RS53 1RUC2 4HVQA 3AKPA 5JIAA 3KQRA 3A4UA 3PJYA 4Q8KA 1H8TB 1AJOA 1JHNA 2NZ9A 2A71A 3FBYA 1D4M1 1DFQA 2CAUA 1RUJ1 4D7YA 2E53A 3RNSA 3LSEA 2YXSA 1N1TA 4UBGA 4YRDA 3ZYJB 3WY6A 2ZAHA 4QQOA 4WZCA 1W2UA 2ATFA 1UMZA 3LKJA 5AC91 4DZGA 4N53C 1Q8OA 4Q26A 1H2KA 4JGYB 1AXZA 4Y5Z0 1QNWA 2D6MA 2IWGB 4Q4W1 4Z2WA 3MF6A 4HFSA 2EA7A 5GLWA 5DG2A 4LBQB 2BVBA 4AHYA 1WD4A 4DB5A 3ZXJA 2BQPA 1MS0A 1TNFA 4KU7A 5DG1A 1LJ7A 1NLRA 5CU1A 1MEC3 2MHFA 2RS11 1NXD1 5F6LB 2DV9A 2CAVA 1QJX2 1QHDA 3HWJA 4LHKA 1V6IA 2K2SA 5I8SA 1PO13 5LRRA 3BALA 2XBO2 2WNUB 5BNOC 1RUE1 2UY8A 1FOD3 1H2LA 2ZGOA 4F7ZA 4IV3A 1Z0HA 3CJIB 3B02A 4S2FA 1KXGA 3ACLA 1LU2A 4YM0A 3B5LB 1ULDA 2RM22 3ZN6A 5LK5A 5DUWA 3HT2A 4AVVA 3AKQA 3OGGA 1RVF2 3JU9A 1YFXA 4JGZB 3UV9A 4FTEA 3M70A 4IQPA 1O7FA 3RS6A 4PBPA 1CJDA 1DF0A 2NN8A 1LGCA 1V6LA 2WT0A 1ASJ3 4XBLA 1WLDA 1X36A 3E5QA 4QM8A 5C9AA 5I8TA 4N43B 2CTVA 1QMJA 1UKRA 4G9SB 1CAWB 1HRI3 1G9AA 4K40A 4W6XA 4RFT0 3ZYPA 1VAMA 1G9DA 2CWSA 2AREA 1OA3A 2RS32 4YZ2A 4AHWA 5CBLA 3TNQA 4PBOA 5C4WC 2ZS6B 4LBQD 4IL7A 4QGNA 2YPJA 3DKWA 4YG6A 2ETEA 5BYNA 4WZFA 3BU7A 2Q8OA 1XYPA 1HW5A 3QD6A 3VBUB 3WLUA 3E97A 4V1PA 4AW7A 1XNCA 3VBFA 1OD5A 3GBFA 1AYM3 3K48A 1DZQA 3HBZA 1W39A 2HWE3 2ZMKA 3RYKA 4AI0A 3C3VA 3IDCB 3FLRA 4N7UA 1U5YA 2R49A 1ZBE1 2OW4A 2XUMA 1ZBA2 3PVEA 3WCSA 2HWB3 5JMCA 2VY0A 1W6PB 1NG0A 4XF0A 4MUVA 4IEPA 1COV1 1Q56A 1V70A 4K3UA 4I2OA 4WVMB 3VKFC 1S0BA 4DMIA 1EAH2 1HQLA 3IKWA 4XOGA 1DQ6A 1W6MB 4ES8A 5CIRA 1PM7A 2QZ2A 2JG9C 2ZGUA 5FLJA 2PA7A 1ZVFA 2ZKNA 4FPEA 2WFF2 1Z7S2 4XFFA 5A32B 4LT5A 1Y9QA 3MIHA 1ZZ9A 4ATEA 1X50A 4DRVA 1VBC2 3ZXLA 3VZJA 1PGW2 2XJRA 5KHHA 2ENRA 1REDA 3JD72 2ZGLA 1ZZCA 3L2YA 4I0BA 5SV5A 1A6CA 1JTZX 1V9U1 3MDPA 4A3XA 3DGTA 5JIUA 4Y1VA 4BYYA 1R1ZA 2XJTA 1IQAA 2R042 3GZUC 4IV1B 5ACA2 2XB6C 2B7YA 1Q43A 2XL9A 2D6OX 3M8LA 4Y1ZA 3M7AA 1AR71 2KXLA 5HXVA 3M4FA 1ZM1A 1CESA 1RMU3 1PVXA 3EXUA 3VKNA 1RUF1 2ZGMA 4E2GA 3AMMA 1A8DA 1RUG3 3VHOA 4NHMA 2DVAA 1ULFA 4AHXA 3KD4A 5FO8B 1O4YA 1VBE3 3RYRA 1QH6A 3JZVA 2DUPA 2VU9A 3LOBA 3M2MA 2RR12 4IEUA 4CYDA 1B35A 4Q1RA 5JPNB 3ZSLA 2RMU3 2EAKA 2DCTA 5KC6A 2DCZA 4B4RA 4UW6A 1POV3 2VECA 2WNVA 3IT8A 1PGL1 1Q5OA 4MGIE 5GZGA 4FP3A 2P37A 5KHIA 1H1IA 1Y3TA 4IEVA 1DQ4A 3ASIA 1QWRA 2ZHKA 5IUQA 3R4DB 3ILFA 4H55A 1CAXB 3DPRC 4I09A 2GN7A 2PLV2 3MIBA 5CFCC 4BWOA 1VBD3 1B09A 3AZWA 2G9GA 4XJ9A 1EY2A 1H1MA 2DUQA 2WZR1 2IXLA 1NE4A 3L2HA 1DGWA 4DXZA 1BBT3 4HK9A 4Q4V2 1U5IA 3FJSA 4EN6B 1AR83 1UX6A 4CZSA 4YZ3A 4FTBA 1FPN1 4HN1A 2QE3A 2WL1A 3CO2A 1X8EA 1FATA 1RUD1 4FXGB 5EFUA 5FMOS 2FZ1A 3WDWA 1V00A 1KFUL 3VBRB 3FBMA 2GC2A 5J37A 5CVRA 1LEMA 1WMDA 4AHZA 1LRHA 4ATFA 1XXNA 3J9SA 4DNYA 3USUB 1TME1 4FPCA 4P9YA 2PAEA 3LSDA 4DY3A 2CL2A 3J8F2 5KC5A 1AUYA 1MACA 1R091 2BWAA 3VHNA 4YVWA 5LRSA 3VDDB 4GKYA 2YC0A 2D43A 3MYXA 5K9YA 3U4XA 4AGVA 4LBKA 4LLOA 3USSA 2XJVA 2BUKA 4CEYC 3KCCA 1M4WA 1AVBA 1BEV3 2V09A 4A7KA 4AXOA 5FAXA 4AI8A 1QKQA 4EROA 4P9GA 2A75A 2RHPA 4FQ4A 1G6NA 4LUMA 3MFCA 1D4VB 1F5JA 1ULCA 5CAZA 3W9AA 4JTNA 1TME3 3NL1A 4RL7A 4MVTA 1SACA 1S1AA 5E89A 1YIPA 2AGSA 2WS93 4AWDA 4HT1T 2D3RA 1R093 1M06G 1JBCA 1ULGA 1D2SA 5I0SA 2WQ4A 5JAXA 1XYNA 4WBBA 4XQWA 4LA3A 2DFCA 1RB8G 1HV0A 5DZGA 2Y38A 4Q4Y3 1AR63 3T1LA 3NAPA 3B01A 1GZCA 2MNGA 2VXRA 4XMAA 3AZZA 1RUG2 4HKLA 1AL23 3SCHA 2WSUA 5JZGC 2PN5A 1KJRA 1QOSA 5T5PA 1AR92 3KM5A 4XQ4A 2E7TA 3CL1A 2ZX3A 2YROA 3B3QE 1VBE2 4H14A 1W6QA 1NE6A 2YV8A 1XU1A 3O0XA 1RJ7A 2R0FA 4HN0A 1O3RA 3MW3A 4WM7C 1OLRA 3V0BA 1PZ8A 1V6KA 4O9GA 1HRV2 2WJSA 1SLBA 4YW2A 5GLZA 2ES3A 4IV3B 1RUH2 1PIV1 4AVCA 4BH9A 1QJU3 4R4XA 1VBB2 4PF5A 1DYPA 1PNGA 3ZN6B 2KA3A 2TEPA 4BMBA 1VR3A 3I8TA 5JSRA 2GC1A 5L73A 5J09A 4JV4A 1QGLA 1RINA 1QH7A 2I45A 4Q4X2 3VUOA 4AEDC 2XKPA 4COVA 1PZ9A 1I9RA 2C0ZA 2EXJA 2HWF1 3HT1A 1ZREA 3GZTB 1S0JA 1DQ2A 1ND2A 2CY6A 1GLHA 1MS9A 1TQ5A 3JQXA 3ZPYA 3CNAA 2FHRA 3JBG1 1FMD1 5C9AB 1ONAA 3U10A 1LOEA 1EV12 4ISRA 5FFOC 2GMMA 2E9QA 4W6WA 4LBLA 2A6WA 2HWD2 3B69A 2Z79A 3WVJA 3T2TA 1CJPA 5B2GB 5I91A 4R4ZA 2DF7A 4IEXA 1OPOA 2Q5TA 2PAMA 4YSFA 3WD5A 3PVBB 2BNMA 3KMHA 3K51A 2X29A 3VBFB 5C8CC 1HXS1 3NV1A 3MIDA 4NOTA 3OF1A 3UKNA 2MEV1 1X33A 1REFA 1YFWA 3LWCA 1IPJA 1BEV2 4YYOA 4E2SA 2K9ZA 1Q8PA 1IS4A 4ZU4A 1GQGA 3ZMOA 1N1SA 2VVDA 4NN0A 3M3QA 1J59A 5GKAC 3TYJA 1BXHA 4BM8A 1R1A2 2TBVA 2JE9A 2JICA 4FOVA 4OLLA 2DTWA 2AZ5A 4XTPA 2VNOA 4Y24A 4HL0A 1WA4A 2GAUA 1LOFA 5GZDA 1Q3EA 2XLAA 3NV3A 2PHTA 5AFEA 4CDQA 1JYIA 1D2QA 3KZ4C 1O3TA 4R9BA 4QQHA 4CDWC 2ZACA 2IC1A 1RUC3 4PDWC 4K21A 3VZLA 3NSTA 1ALYA 5K0UC 1AL22 1GFF2 4BLIA 1GSLA 2ZZJA 3WR0A 4XFGA 3A0NA 2IZWA 4K8FA 3FLTA 3N35A 4QT6A 1LOGA 3BPZA 4IV1A 1QQP2 3VBHC 4GH4C 2OZ6A 3I2DA 5FLHA 2QFEA 4OZXA 3R4UA 1PO22 1BMV2 4HK8A 5EYXA 2GNDA 3UKVA 4HPKA 3H0OA 5T3NA 1YI7A 4WVWA 3E6CC 4NVPA 1XU2A 1O4TA 2VUAA 4GA9A 1WW6A 5I0RA 4AFMA 3MZHA 5FQ0A 4XXPA 3RMXA 4KH9A 2XLFA 3VKLA 1YI9A 4JTOA 2XJQA 1KITA 3WW1A 3V0AA 1RUI1 4RHV2 2XH6A 1FI2A 1CPMA 2NYYA 1C1LA 2UY9A 2YHJA 3JQWA 4MLOA 1AZDA 3SITA 4B3NA 5BV6A 3S0MA 1DYKA 2EIGA 1RJ8A 1GICA 1QJX3 1XE7A 2BNNA 2H6BA 4GWMA 5CB7A 3GYDA 1OOPA 5C33A 2XBO3 1UKGA 4YVSC 3UKTA 1A78A 1ZYBA 1V6JA 1AX2A 1PVC2 1WW5A 5GZEA 4C1WA 2RS31 2GSYA 2WNVB 3ZFFC 4QPIA 2RM23 1SDWA 3FHIB 3AP9A 1H9WA 1RVF3 4WVZA 1H0BA 4DPNA 3MIGA 1UAIA 2PHUA 3SHRA 4XJUA 1LULA 4AVAA 3TN92 1YFYA 3VZKA 5AFBA 4AE2A 2D6LX 2VULA 4M01A 3U0ZA 2R071 5JOZA 3V56A 5JWPA 2ZGPA 2WIIB 2RS51 1OFNA 5T50A 1LOCA 3AK0A 2A6YA 5BUVA 2Y26A 2RS33 2CGNA 4PIXA 2WINB 3AXDA 3H3ZA 3N7JA 5D8AA 1XNKA 3ALQA 1AXYA 4JVAA 4X6QB 3ZYIB 1NCRC 3WP5A 4SBVA 4DFSA 5BNNA 3RMYA 2I07B 1MQTA 1XNBA 3BODA 3TAYA 1WW4A 1O5UA 1QJZA 4E27A 4FCAA 4HANA 1ND3A 2GDFA 2EXKA 3THPA 1I6XA 1J1LA 3VZMA 1JXNA 2VMHA 4YVWB 3BCWA 1QU0A 3VGIA 5I8YA 1VBC1 1VAKA 3VHPA 1PGW1 1N3QA 4N9IA 4RGGA 1ZBA3 4B8EA 1NOVA 4LEJA 2R16A 5T55A 4W6YA 3E5UA 4N7IA 1CAVA 4COZA 3H1YA 1C8NA 4RR3C 1MEC1 1U12A 4LBOA 2FMYA 1EAH3 3PJQA 4ZKTB 2YMZA 1SLLA 4N53A 3FUOA 2FZ2A 5JOWA 1CD3G 3VKOA 1PO11 2R041 3WG2A 3IN9A 1OI6A 3VBOC 1FOD1 1E57A 2WLQA 5F5QA 2WFF3 3H9AA 1Z7S3 3D5OA 4HMZA 4XF9A 1CIWA 1U5ZA 3QLQA 4QPGC 3KT1A 2BGCA 4PIYA 5FLIA 1VBC3 1WD3A 4NHLA 4HVRA 2YY1A 4YGCA 5FCCA 4X8NA 1VAVA 3JD73 3FZ3A 3NAPB 2WZPP 4FSJA 4R9DA 4OFGA 4MZUA 5BXXA 3AYDA 1U5XA 1SBDA 1FXZA 3RJ2X 1UPSA 5BNOA 4XXAA</