3JUUA

Crystal structure of porphyranase b (porb) from zobellia galactanivorans
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
268
structure length
268
Chain Sequence
b'EAPHFKPGEDPRQPHQEWKLIENMSDEFEGKKIDEKKWQISGQGWIGRAPGLFLAENISLNNGSLQITTTMLPEPIVKNNKTYTHGGGYVGSRNGMTYGYYECEMKANKTFMSSTFWLINEGKDRLGCDKRTTELDIQESVGQITNDADWMKYFDQTMNSNTHSRNIPEGCEYEKGSSKGKAELGGKAYEDFHVYGVWWKSKDEIIFFLDGKMQSKVTPPADFDIEMYLRMVVETYDWNPVPKDGGMTGSKEDRTTTYNWVRSWQLVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords porphyranase B
publication title Transfer of carbohydrate-active enzymes from marine bacteria to Japanese gut microbiota.
pubmed doi rcsb
source organism Zobellia galactanivorans
molecule tags Hydrolase/carbohydrate
total genus 64
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 3.2.1.178: Beta-porphyranase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3juuA00
2ZGSA 2ES3A 4YM0A 1LU2A 1DQ1A 2A6WA 3WCSA 3SH5A 4XIKA 4GALA 4K20A 5L73A 1G9CA 2NMOA 4UW4A 1J1TA 3D6EA 4ZKTB 2ZBJA 4DRRA 5IK7A 1FAYA 2DURA 1RIRA 1LGCA 2D6NA 3A4UA 3UJQA 2G4IA 3MEPA 2A6ZA 1QDOA 3IMNA 2TEPA 1JUIA 1LU1A 4YG6A 3AJZA 4P14A 2GMPA 4YM3A 1DQ0A 4YM1A 5GJ6A 1AJKA 4M01A 1FNZA 3ENRA 3O0WA 4Y22A 4XIOA 5T52A 3T1LA 4PBOA 4YG0A 4CTEA 2E7TA 4M3CF 2LALA 4FPLA 5EYYA 2CL2A 4BMEA 3TB0A 2W68A 3WDTA 2YV8A 2NMNA 4XYXA 3LSEA 3VV1A 1S0GA 4YGBA 5IK5A 4XJ9A 3OYWB 4ITCA 1AX0A 1FATA 1V6MA 1WLDA 5DG1A 3FLRA 1BJQA 1WD3A 1LESA 1UAIA 1NXD1 2E6VA 2LTNA 1SFYA 1SLCA 3GNEA 4HL0A 3B01A 1C1FA 2PHFA 1IKQA 4R9AA 3M3OA 1CPMA 4FOWA 1CPNA 1WBFA 5T55A 5CAZA 4M00A 1VLNA 1WCSA 2JE7A 2VW1A 3IM0A 3RS6A 1N1VA 4FP2A 1U0AA 1VALA 4RA0A 2AENA 1ZA4A 2VW2A 1UMZA 3BIWE 1GYKA 3UJOA 3WLUA 1W6QA 3WG4A 1TEIA 3JUUA 3ILRA 5KXBA 1CIWA 1SLLA 4R9BA 5T50A 4R9DA 3W58A 2PELA 2A6VA 4AVTA 5EYXA 4YW3A 2ZHLA 4JRAA 5E88A 2I2SA 4PF5A 1O4YA 2B7YA 5KXDA 2NN8A 2EAKA 3WVJA 4GWNA 4D69A 1I3HA 1AXKA 1UZYA 2WSVA 2ZGMA 3M2MA 4LBLA 5F9TA 4Y22B 3ZXEA 2VUAA 2P3KA 2A70A 2W08A 1VAVA 1YO8A 4LBMA 1QOTA 2DVBA 1LOFA 3WUCA 3M3EA 3OY8A 2A75A 4XTMA 4FPGA 1GZWA 3MPPG 2RHPA 3R4UA 2DU1A 5HCFA 1Q8PA 4DRVA 2OW4A 3SISA 1IS6A 2PHRA 5JMCA 2GMMA 1CONA 4H55A 1S0CA 1DFQA 1HKDA 1LHVA 1MS0A 3FUOA 1LOEA 1GANA 4YM2A 5JOXA 3JU9A 4AWDA 4P9WA 5CNAA 2DVDA 4P9XA 1WUVA 3VKNA 1C4RA 4UW5A 1UPSA 3R4SA 1HLCA 2ZABA 4YZ3A 3BOPA 1MS4A 1SACA 2ZGKA 2P2KA 3OGGA 4XE9A 5EXOA 3V0BA 5IK8A 3ZYRA 1W6NA 5LK5A 1DQ2A 1QNYA 3HR9A 4XMIA 1DBNA 1MZ5A 1ULGA 2SLIA 1W6QB 4GA9A 5HCAA 5EWSA 4UW6A 2ZHKA 3POSA 1LODA 3ATGA 4HANA 4MYEA 3V0AA 3WDXA 4AVVA 3SLIA 4Q8KA 2WT2A 3R05A 3FLTA 1KITA 4BLIA 4LBKA 1DQ6A 4AGRA 1GICA 2R1BA 4AGVA 5GZGA 2ARBA 2EXIA 1CJPA 3N3HA 1GZCA 4XXPA 3N35A 3WUDA 1H30A 1UN1A 1S0EA 2A6XA 3UL2A 3APBA 1DYKA 1ZM1A 4L8QA 3AZVA 4ATFA 4Q1PA 3BODA 4LBJA 2WNEA 2GN3A 3OY8B 4M3CA 1W6PA 1AVBA 1GZWB 1N1SA 5HCBA 1SLTA 3SH3A 4C1WA 4W65A 3ZSMA 3QCWA 5F5QA 1GKBA 4LBNA 1WW4A 5DZEA 1X50A 2DWRA 1FNYA 2ENRA 4UW3A 4ASMB 1I1EA 3SITA 1G9AA 4JC1A 2EALA 4NO4A 2Q5TA 4LBOA 1OKQA 1WD4A 3KQRA 1PZ7A 1EPWA 1V6LA 2P3IA 3B9CA 1LULA 4Q1RA 4XJ8A 3POWA 3V0BB 1Q8QA 3USUB 1W6NB 1SCRA 3NV1A 1JHNA 5GLZA 4I30A 3M1HA 2JJ6A 1LHUA 3ILNA 2VH9A 1N47A 1QOOA 4PBPA 4BM8A 1AXYA 2D3SA 2H0BA 3V0AB 1JXNA 4IQPA 1YYNA 3VKLA 3RMXA 2OUJA 3INAA 1WLCA 2D6PA 3GALA 4GXLA 3I4IA 4WVWA 2EXJA 4U36A 3W59A 4YZ1A 2DV9A 3PVEA 2WT0A 4FVVA 1RITA 1LCLA 4GKYA 4PQ9A 2XG3A 3ZXLA 3MW3A 1KQRA 2ZGLA 2PHWA 2VU9A 3M3CA 3O12A 1ENRA 2E7QA 3I8TA 3IN9A 5T5PA 1H9PA 4Q8LA 1MS3A 3AYDA 2D6KA 2FMDA 4M3CB 1W6PB 4JCKA 2ZZJA 4GWMA 1SBFA 1AXZA 1V6KA 2WJSA 3AK0A 1SLIA 5KXEA 1URXA 1MZ6A 2WT1A 1IS5A 3H0OA 2PHUA 2CYFA 4FQ4A 1AX1A 1D0HA 2OVUA 2WKKA 3AZXA 3AZYA 1N3PA 3NV2A 4FOQA 1W6OA 5CB7A 4WVVA 1A3KA 1APNA 2D7FA 1F5FA 3UK9A 5H9SA 2UWAA 1G9FA 2YXSA 5IK4A 2ZHMA 2YY1A 2PHXA 3LCPA 1YRZA 3ZXFA 2V73A 4Y20A 1QKQA 1G7YA 4YLZA 4BMBA 2NYYA 2WSUA 2ZGPA 4NOTA 4YFZA 2A3YA 4YGCA 3O5SA 2CNAA 3DGTA 3WDVA 4Y1ZA 3ZPYA 3N7LA 5GLVA 5T5OA 1Q8VA 3ZSJA 3ASIA 3O0XA 2R1DA 3AZWA 1JW6A 3IPVA 4XJUA 1Z78A 2FHRA 2C9AA 1LEDA 3OBTA 4FQZA 2YZ4A 1FX5A 1G9BA 2R0HA 4XJAA 2ZKNA 1KRIA 2JDZA 3VKFC 2R0FA 4Y1VA 4XTPA 2GNMA 2GN7A 4YW2A 1D2SA 1S0FA 3PJQA 1CQ9A 1AX2A 1G86A 4FPFA 3L2YA 2VY0A 1S0IA 5GZEA 1DZQA 1S0DA 4FPYA 3AP6A 4FPJA 3WG2A 4YW5A 1JYIA 1FV3A 4BPZA 4XBNA 5DG2A 2R16A 1MVEA 1O4ZA 1W6OB 2AH2A 4YFWA 1VAMA 1KDKA 4YGDA 2GDFA 3N7JA 3NWKA 1S1AA 1UZZA 2VXRA 4DPNA 2DVAA 3OBRA 4Y20B 1Q8SA 3WOGA 3WCRA 4Y1XA 1DGLA 1G8WA 3AFKA 4Q2FA 3WG1A 3AJYA 2D6OX 1W0PA 3CNAA 1JYCA 2ZGUA 1MACA 4Y24A 2ZGNA 3IPVB 1GBGA 1LOAA 4WV8A 2VW0A 3ZXKA 4TYSA 2E51A 5DUXA 1DHKB 1WW6A 2UWBA 2GNTA 3RG0A 1MS5A 2GALA 2UWCA 5IUQA 1SCSA 3ZSKA 3MW2A 3AYCA 4Y1YA 3D4KA 1W6MA 1YIFA 2NP0A 3WDWA 1QGLA 1QOSA 1OFSA 3N7KA 1Q56A 5GALA 4YW4A 1R1ZA 3WHUA 4FPHA 4FPOB 3OPZA 2CY6A 1N1YA 1JBCA 2ZMNA 4YZ2A 1LEMA 5DUVA 4XJZA 3RQ0A 3ZSLA 1WBLA 2A6YA 1YI7A 1BQPA 2W52A 2DVFA 4K21A 4ISQA 3WV6A 3WDYA 3VKMA 3FBYA 2EF6A 1GNHA 3V65A 4AGGA 5FREA 2ZMKA 1DQ4A 1S0JA 1AJOA 1BXHA 1DQ5A 2SBAA 2ZACA 2HYKA 2D3PA 1N3OA 4XZPA 1BKZA 3V64A 4RL7A 3TAYA 2ZAAA 3KM5A 4FOVA 4AVSA 1MS9A 2ERFA 1V6IA 5CA6A 3WHTA 2P34A 1GLHA 5KXCA 2ZGOA 4XMAA 5DZFA 1Y7BA 1LGBA 2UU8A 2EIGA 1LHNA 5DUUA 3RSJA 4XOGA 2GMEA 1SBEA 3ILFA 3ZXJA 1ULDA 1CN1A 3O0VA 5GLTA 1V00A 1FV2A 2AR6A 3WZ1A 1WW7A 1QNWA 5SV8A 3BTAA 2GNBA 5E8AA 1W6MB 4AYUA 2KM2A 1GV9A 5DXDA 4R9CA 3AP4A 3RMYA 5GZCA 1GZ9A 4FPCA 2EXHA 3RRDA 2DTYA 1LECA 2DYCA 1WLWA 4ISRA 3AZZA 1A8DA 2AREA 1ULEA 2D44A 2AYHA 1ENSA 2DUQA 4YZ5A 1H9WA 1UKGA 3ZYPA 2DVGA 1W0OA 4LBQD 4XDQA 3AYAA 4XJWA 4KBBA 1PZ8A 1LGNA 3AXDA 1UX6A 2E53A 2XB6C 3M3QA 3WG3A 1IOAA 1QF3A 1GNZA 1RINA 3AYEA 1GSLA 4Y26A 5DZGA 2A3WA 1LJ7A 3ZVXA 1ENQA 1LENA 1OQ1A 4YZ4A 1KJLA 1LOBA 3FFZA 1KDMA 3VUOA 5JOWA 3NV4A 4Y1UA 2NM1A 4TZDA 1MS8A 1LOCA 2AUYA 2DUOA 5FRAA 4F83A 2PHTA 1NLSA 3Q9OA 2GNDA 1QU0A 2YMZA 5H9PA 3T1MA 1DIWA 3N36A 4BOWA 5GM0A 4DFSA 5GLWA 1Q8OA 3D5OA 2P37A 3B3QE 1LHOA 3C2UA 4BQ1A 3PVOA 4DS0A 1HDKA 2D6MA 2P3JA 3SH4A 4BLJA 2DUPA 2D43A 1MR5A 2W39A 1LTEA 2ZMLA 1AF9A 4GKXA 4XHXA 1QMJA 3T2TA 2ZHNA 1LOFC 4LBQA 1DYPA 1F31A 2JKBA 4YW1A 4XILA 1V6NA 4OZXA 2UURA 1SLBA 3IKWA 5GZFA 3VKOA 2WQZC 3WDUA 2CTVA 3AP9A 4PCRA 5T54A 3WNXA 3LSDA 4CRQA 1FYUA 1QDCA 4Q26A 5H9RA 4CZSA 1LOGA 3N7MA 1SBDA 1B09A 2JE9A 2DTWA 3HN1A 4Z8BA 4FPEA 3A0KA 2A3XA 2ZGTA 5E89A 1ONAA 1VIWB 5T5JA 1LHWA 2D3RA 5JDBA 2ZA9A 3AX4A 4P9YA 1MVQA 1V6OA 1V6JA 1AZDA 3FLPA 5H9QA 2CWSA 3AP5A 4WZFA 2ZGQA 1XQNA 4U2AA 1N1TA 1ULFA 3HMYA 3B00A 5IT6A 5GLUA 2EXKA 2CWMA 3NV3A 5JLVA 4DQAA 4XXAA 1WW5A 1PZ9A 2DU0A 4FP3A 1MS1A 3USUA 1F9KA 4C1XA 1HQWA 5AVAA 2A7AA 1Z0HA 4XHBA 1YXWA 3OJBA 1A78A 2AGSA 4K1YA 1C57A 2Z42A 2R49A 4K1ZA 4XBLA 4XBQA 4ZXKA 1UL9A 1IS3A 2JECA 5CBLA 3SNMA 3DUIA 1JN2P 1HQLA 4FPKA 1CESA 1G9DA 2D6LX 2YROA 2OUHA 3POYA 1IS4A 4LBQB 5T5LA 2A71A 5DUWA 3MW4A 1C1LA 2A5ZA 1IKPA 4YGEA 2ARXA 4Q27A 2NZ9A 3QLQA 3AXEA 3AP7A 5BYNA 2BQPA 4ATEA 3B69A 3U4XA 5JVVA 3PVNA 5GZDA 4M3CE 5JOZA 3OYWA 1BYHA 2JD4A 1JOJA 1CVNA 1DLLA 1N3QA 1BZWA 3A0NA 4SLIA 5JOYA 1CR7A 2WLQA 2C5DA 4FOYA 1ULCA 4YG3A 1SLAA 3FUQA 2ZGRA 2V5YA 1KJRA 3PMEA 1S0BA
chains in the Genus database with same CATH superfamily
3IDEA 1V70A 1XNAA 2ZGSA 3JD71 4J6GA 2ES3A 2N7GA 1RJ8A 4NWWA 4QKFA 4WM7A 2C26A 3RWNA 1DQ1A 2Y6KA 4CUBA 1SG3A 1VMJA 1YQCA 5CKMA 2XVKA 1RUI2 2NMOA 4AHZA 5K8SA 3D6EA 1AR91 1UZVA 5IK7A 4C90A 1BCXA 1RIRA 1L7QA 2D6NA 3ACFA 4LJHA 3WQ1A 2G4IA 3K3NA 4ARXA 1ZBA1 4MXWB 1C5IA 1EP0A 2BVVA 2VZRA 2WNOA 3FFQA 4DUWA 3IMNA 4MHRA 1J83A 1XNTA 2HWB3 2VQAA 3E6DA 4MSVA 1VRH1 1ZRDA 4CUGA 1RUJ1 5FTTC 4IW3A 1MQTB 1NX9A 1PGL1 3IMMA 1AJKA 5FZ4A 1IG0A 3IT8A 1RHI3 1WMEA 2LS6A 4Y5TA 1JOBA 1FMD3 3H42B 1UX7A 3D8CA 3DV8A 4M3CF 4FTBA 3H1YA 3VDAA 1RMU1 3R4DB 4BQWA 5J48A 2W9XA 5ABJA 4XYXA 1PMJX 3LSEA 4CP1A 1XSQA 2PHDA 4OLLA 4QHOA 5IK5A 2HWE2 4XJ9A 2UY9A 3S5AA 1AX0A 5JR7B 1WLDA 3D82A 1BJQA 3FLRA 2LTNA 5LBBA 4N9HA 1C1FA 3UKNA 2PHFA 2FDFA 1IKQA 5DAQA 4CCLA 1CPMA 2XJQA 1CPNA 5FYZA 5T55A 3CU7A 3RDIA 1VPHA 2JE7A 2VW1A 5I93A 4QGNA 5A7QA 2ZPXA 2RS32 3ZFFB 1HX6A 4FTSA 4CCDA 1U0AA 4AEDC 4RA0A 4LA3A 4V2WA 1CAXB 2VW2A 5AFBA 1W6QA 3OBZA 5LA2A 4L9BA 2CDPA 2BYVE 2YBKA 5IVYA 5KXBA 1XYPA 1Z7S3 2DDUA 1SLLA 1WMDA 2GC1A 4QXHA 4R9BA 4X6QB 4BIOA 2WZR1 1OLRA 3N9LA 2YGMA 4LKDA 5F3EA 3U0ZA 4AVTA 5FY1A 3WXPA 2O1QA 2ZHLA 3MIEA 1AL0G 2WAAA 4GMP3 3AMPA 5A7NA 4ZU4A 3U4SA 1I3HA 5ACA3 3WD5A 1FT9A 3LB9A 3M2MA 3ZDSA 4LBLA 3LGRA 4Y22B 3ZXEA 5KC6A 5DDJ3 1OPOA 2VUAA 4IE4A 5FXWA 2J1UA 2YBPA 2W08A 1C8M2 4COWA 1QOTA 1JZ6A 5I8YA 2PHLA 1XNCA 3C7HA 3OSDA 3CO2A 4OMDA 4PIZA 3WUCA 2ILMA 2A75A 2BERA 3MZHA 4RYDA 2WNVA 2VE1A 5JMCA 2RMU1 1AL21 1OC1A 2VBPA 1O4TA 5A7PA 1S0CA 1HKDA 1H8TC 4FXKB 3U07A 5FPXA 2HKXA 3FUOA 4YM2A 5JCTA 4TWTA 5CNAA 2Q30A 1C4RA 1QJZA 5AC93 4AK3A 2H6BA 2JKXA 2Q1MA 1MS4A 3AKTA 3BOPA 2P2KA 3OGGA 5DN2A 3VBRB 5HBAA 3V0BA 1RUOA 1ZBE2 3ZYRA 4CCNA 1DQ2A 4QPWA 1W8WA 1K5MC 2WNUC 4S2GA 4UW6A 2X5IA 2YFUA 1O3TA 1NY71 2J42A 1NLRA 1XU2A 4IUGA 3U75A 3VBUA 4HANA 1HXS1 2RM23 1YI9A 2VTFA 4MOAA 4BLIA 4Z1VA 4LBKA 2FDHA 5FYMA 4Q4X2 3BU7A 1C5HA 5FMOL 5IVVA 3VD9A 3O1UA 3WW4A 1J84A 4GD4A 1FMD2 3SKVA 2RS52 4HONA 4QQOA 1DYKA 4L8QA 2VQTA 1TE1B 3AZVA 4ATFA 3BODA 5ISLA 5LEJA 5FJHA 2GN3A 2VVFA 5C5UA 2ARCA 2UYBA 3N9PA 1AVBA 2WDBA 5BNOC 5HI0A 3WP5A 1ULPA 1ODNA 2OQ6A 2VMHA 4W65A 1UYXA 3QCWA 1GKBA 4LO5B 3FBMA 3K46A 1WW4A 4LBNA 3HQUA 1B35A 1FNYA 2CDOA 1O7FA 4TLGA 4DOUA 3ORJA 3LOBA 4N53C 5F37A 1G9AA 4XFGA 3ZIWA 4HPKA 1OKQA 4P00B 4NHXA 4XPVA 1VBE2 1UKRA 4AFAA 3TN92 4LO6B 4CDUA 4XJ8A 3POWA 4B29A 1OD3A 5GLZA 3CIHA 4XF0A 4YYOA 4UT5A 3WY6A 1JZ2A 1YC61 2JJ6A 1TME3 1PK6A 3EO6A 4H3WA 1N47A 1QOOA 3MLKA 1KGYA 4HFSA 2V5DA 1JXNA 2OUJA 3PHMA 1HV1A 4AI0A 1WLCA 2D6PA 4GXLA 3W59A 4A6OA 2GP5A 5A3PA 1ZREA 3PVEA 4FVVA 4PQ9A 1RITA 4GKYA 1UYZA 1NLQA 5ACA2 2RS13 2XG3A 5FP4A 3ZXLA 3NNJA 4EN8B 4B8EA 2V09A 2IVJA 1EPZA 4N7IA 4QDRA 2IUWA 5C3PA 4HKWA 3O12A 1PNFA 1QH7A 4AAXA 4AZZA 1EY2A 3T0BA 1OSGA 3I2KA 1MZEA 3ZN6B 4C91A 4Y3OA 2E26A 2D6KA 2IXJA 5D8AA 4MX3A 1OUSA 5A3NA 2ZZJA 3FHAA 1ZRRA 4IE0A 5L9VA 2WJSA 3AK0A 1OQEA 3DPRC 5F1RA 5JSPA 3H0OA 1IS5A 3SLIA 4BQ4A 5A1FA 1GWMA 4IV1A 3AZXA 3HBKA 1ZYBA 1OH4A 1W6OA 4NHMA 1A3KA 4QPIB 4AQSA 3BU0A 1A8MA 4XETA 4AHXA 4PT6A 3T30A 4RS5C 4CCMA 4CP0A 2ZEZA 3DN7A 3LCPA 4D7YA 4DO0A 2WUHA 2V73A 2WWUA 4PF1A 1G7YA 2VGDA 5FZ6A 3U10A 1ZZ9A 2XUEA 2ZGPA 2RM22 2BWCA 2CNAA 3WSOA 2VO5A 4Y1ZA 1AR83 3N7LA 2YU2A 4OULA 3ZPYA 3ZPOA 4EROA 2LUWA 4EQVA 4LKSA 4OVEA 5BXXA 4CEYC 1QJY1 3EHKA 2C9AA 3L2HA 3O7OA 3J7HA 1LEDA 4AF9A 3OBTA 2E63A 2Q8OA 3MICA 1VBA3 1G9BA 3O14A 1LKNA 4F3JA 5IAXA 2ZKNA 3NAPA 2JDZA 1FPN3 4XTPA 2RVAA 2TUNA 1I5PA 3PU8A 5IFPA 3AKSA 1H0BA 5A1AA 1E5RA 1R082 5F3GA 4LNVA 4WZCA 1CQ9A 4NRPA 4WM8C 1G86A 1COV3 3H3UA 4FPFA 4QQ2A 3L2YA 3ZSEA 2VY0A 3MF9A 3VD4A 2IXCA 2WRAA 1IQAA 4BA6A 4QQLA 5HXVA 2Y6JA 3OEBA 5CFDB 1FV3A 2F4LA 3KV4A 2JDHA 3MDPA 1MVEA 4AEMA 4CDQB 2AH2A 4QM9A 4YFWA 3J4UH 4YGDA 3SHRA 4BHPA 1UYYA 3N7JA 3VBHA 3RNSA 3AKRA 4KGGA 1REDA 1S1AA 1UZZA 3G6JB 2Q8DA 1HRI2 4PQQA 4PJYA 2W1WA 4M0HA 4OUSA 2RDNA 3TEYA 3H8UA 3WCRA 1X33A 3NNLA 1G8WA 4NROA 5F39A 2WFF3 5CFCB 1UU6A 3T2OA 4EYUA 2HWD1 2D6OX 1W0PA 4BCUA 3S7EA 1H2LA 4Y24A 2ZGNA 2D97A 1NG0A 4QGLA 3ZXKA 3NJZA 1IPKA 1QJX1 1IPJA 2JG8C 3E5UA 4LHNA 1AYN3 2WQ4A 3K51A 4ES9A 3AYCA 4LA2A 1RL3A 1ZRFA 1W6MA 4R8HA 3K2OA 3VBFA 3KGZA 1W06A 3T3YA 3DKQA 5DAXA 3WDWA 4CCEA 1W9TA 4JQRA 1OFSA 5M0TA 3N7KA 5BV6A 3OGJA 5FFOC 1R1ZA 3WHUA 3T2QA 1F15A 1TMF2 1JBCA 1LNSA 3N9NA 3JBG2 3POBA 1W2TA 4JDMA 3ZSLA 4CEWB 4XAEA 2A6YA 1RUG1 4L2NA 2VZOA 5JZGB 3WV6A 2VL4A 2MEV3 3EBRA 5CYYA 1AYM2 3V65A 2PAEA 5FREA 4A2UA 2FZ2A 2RDSA 1BEV2 3I2IA 4QQPA 2BTVC 3MLJA 5FBJA 3ZYFA 2SBAA 1WA6X 2HYKA 2WYSA 1AR73 1BKZA 5BY5A 5FZAA 1GU3A 4KU8A 4FOVA 3ZR5A 3CL1A 1PIV1 2P34A 3IB3A 1CX1A 2HLEA 5E16A 5DUUA 2EIGA 2NQYA 3ZFFA 3TRSB 1H2KA 1W39A 2GMEA 2WO3A 1SBEA 2WC2A 5JI7A 1RUE3 3KF5A 1RVF2 1F4AA 5FP3A 4K9SA 4AVCA 5FCCA 1HRV2 2D5FA 3B7MA 4CCJA 4CXWA 1JZ3A 2FDGA 2GNBA 3HT2A 1JUHA 1ZZCA 2BNNA 3H8OA 1COV2 4DUVA 4IESA 2VUDA 4OMCA 1WLWA 4ISRA 3VHNA 2AREA 2VOWA 5ABJC 3TEZA 2ZX2A 2D44A 4IV3C 2EICA 4LIVA 1C3HA 1ASJ3 1UY1A 2IWGB 3ZX7A 4L97A 2FCUA 3NSTA 4MV2A 2B46X 3AYAA 4YPJA 5FXZA 5FIXA 4X8NA 2JENA 2XB6C 2QKDA 2BUKA 1C28A 1Q3EA 1LRHA 1UY3A 1W9WA 1GNZA 2WYFA 4KNCA 4NMIA 1GSLA 4HSJA 4AVBA 5C70A 3RZGA 2VMGA 5DZGA 1LJ7A 1ENQA 3M70A 4KL1A 3W5NA 2JWPA 1QJU2 3WQBA 2NM1A 3ST7A 5A33B 4SBVA 1LOCA 3N9QA 1EAH1 4GB31 1NA1B 2PHTA 3U14A 2WO7A 2XVGA 3HPNA 3Q9OA 2GNDA 1YQ6A 3WF1A 1AYN2 1HB3A 2HEYF 4BH9A 5FZGA 2ZX1A 2P37A 1W05A 1SDDB 4NE9A 1SFNA 4BQ1A 1PO23 2QFEA 2P3JA 4CU7A 3BN6A 2ZOEB 2D43A 1MR5A 1OLME 2OZ6A 2W39A 1AF9A 5C4WB 3KCXA 2B8MA 1NCQA 4LLFA 3CKHA 5FK7A 1JYTA 2W3JA 5FZDA 4LBQA 4IEQA 5LBEA 4NPRA 4XZUG 4BK5A 4D6QA 2Y0OA 4OZXA 2UURA 1SLBA 3IKWA 3OF1A 4FI9A 3ITQA 5T54A 1GQPA 1U5ZA 2HWF1 4MGTA 1FYUA 1VBB2 5H9RA 1OKOA 3N7MA 1UOBA 1W8ZA 4RR3B 2X29A 1B09A 2JE9A 2DTWA 4ZZ5A 2VPVA 4BXSV 3QH7A 5F6KA 5FZ1A 5JDBA 1RUH1 2ZA9A 5EHDA 3GDBA 2XBO3 3BOWA 3FLPA 2QBXA 3KCYA 5IVFA 1K5MA 1US3A 2LM3A 2WNUA 3AP5A 4IEZA 4S2FA 4ZZ8A 2BGCA 2XQXA 2X5IC 3HMYA 1OXCA 2WS91 3VBUC 4MGQA 5IT6A 2XLAA 1OH3A 3EMRA 1RUE2 2QUOA 2WIIB 2XKPA 3MHZA 4H2AA 4RD7A 5F3IA 4FP3A 3VLBB 2CGNA 1HQWA 3DYOA 3WF3A 4NRQA 5KHGA 2EA7A 1Z0HA 4C8DA 4QU2A 3I49A 1A78A 3D0JA 4EWAA 4K1ZA 2Z42A 3MFCA 4QT6A 4XBQA 5J3UA 2WZEA 2R061 3R6SA 4P5HA 2VOXA 4I01A 1E5HA 1EV13 4XVHA 4META 2Q1ZB 3KMHA 5C3QA 4YVWC 3U78A 5FPLA 1TVGA 5FZMA 3OB8A 3MV01 2QDNA 3BB6A 4J1WA 2RR13 4YRDA 1TME1 2A71A 1RUD1 2HH9A 3T4VA 4TSVA 2A5ZA 2ARXA 4GH4A 3QLQA 4Q27A 4DXRA 3AP7A 3LEGA 5BYNA 4PI0A 1SZBA 5IW0A 1HN1A 4MLOA 3ZXGA 1E5IA 1B35C 2OA2A 3PVNA 2R041 3JCIA 5B2GB 5CKNA 1R093 2EIDA 2VR4A 1N3QA 2VMEA 5DAWA 1E57A 4O61A 1CR7A 3P5BA 1SPPB 2VC9A 2WLQA 1MEC3 5C7GA 4CEWA 3FUQA 2GH2A 4WVZA 1D4VB 1V9U1 3KT7A 1S0BA 4EE2A 5FY8A 4QKDA 1AR92 3GCXA 4Y5Z0 2YG0A 2I74A 1LU2A 4YM0A 1OUXA 4QPIA 1ZBA2 3S30A 1ND3A 3AKQA 3SH5A 2ZEXA 4DEQA 4Q4V3 1G9CA 1VRH2 2LRPA 1RUJ2 1J1TA 4UW4A 3RZMA 1GQGA 2ZBJA 4QX5A 1FAYA 2Y38A 1XPWA 2J1TA 1PGL2 3H1WA 3Q8FA 1OI6A 4K6BA 4Q0SA 2AEYA 4UF0A 5I0UA 3DKWA 3OD4A 4MGYE 4CP9B 3E6CC 2QQUA 1T2XA 1E5SA 5FPUA 1UYPA 3OG2A 4AQTA 2ZEYA 5K0UC 4KQ7A 2VUCA 4YM1A 4TLFA 3UKTA 3CEWA 4JTNA 2YC4A 1FNZA 5D8AC 3ZDVA 3DXUA 5F5IA 2D40A 5T52A 3T1LA 3ACGA 5JMOA 4BWOA 3AVSA 3LEKA 4KWLA 4WVMA 1AR81 4BMEA 1SMVA 3WT3A 4XDOA 3WDTA 1Q5OA 5A6YA 1JMUB 4YGBA 4OQ9A 3TNPB 4FCAA 4IV1C 3OYWB 1YFWA 2JIJA 3LPGA 1FATA 1GQHA 2WFPA 3NRUA 4QX8A 1K42A 4HL0A 2Q0AA 2ET1A 2E6VA 5FUIA 1SLCA 4MG2A 4ZXEA 3B01A 2HYXA 1DGRN 2XBO2 4FFHA 2HWC1 2IXHA 2HEVF 1RUF1 3T0AA 2JICA 1BK1A 1QXJA 5JPNB 3IM0A 2J22A 4LKFA 2WZR2 4HOOA 1N1VA 3RFRA 4NIAA 3NNFA 1K12A 3H1MA 4O65A 1UNBA 4QXCA 2XJSA 4AQ2A 1GYKA 1RUI3 5J37A 1QH6A 3WLUA 3WG4A 4ZHNA 3POJA 2W94A 4LLOA 5C9AB 1POV1 4IERA 5T50A 2HJIA 4FTEA 2GC2A 2RE9A 2FDKA 2ZX3A 2XMLA 3HVDA 2E33A 2PTMA 2X8KA 4YW3A 2PAMA 2Y26A 4AE2A 3AMNA 2OS2A 5E88A 1FXZA 3ZOIA 5KXDA 3RYPA 5DPNA 2EAKA 3WVJA 4GWNA 1ZA7A 2WA4A 3HNBM 1UZYA 2WSVA 2RMU2 1VB4A 1AL22 2P3KA 2A70A 1LR5A 1VAVA 4LBMA 2YBSA 2DVBA 3F2ZA 4N43C 2VCCA 2G9FA 3KLSA 1BK0A 5L36A 4XTMA 3ES4A 2HWE3 1NQDA 3MPPG 2DU1A 5HCFA 4RQPA 4DRVA 4NUBA 3SISA 1IS6A 2PHRA 3ES1A 4HBNA 2GMMA 3PDQA 3ME2A 3ZFGB 1DFQA 4LK6A 1CZTA 1VB2A 1YQ2A 4Q4Y2 2BDRA 4NHKA 4W6YA 5F8PA 5LATA 3SCFA 3VBHC 5JOXA 4KWUA 2ZABA 2RS33 3C7EA 1HXS2 5EXOA 4Q4W2 3ACLA 4NHYA 5BNPA 3L9JT 1OPMA 3OGRA 4IL7A 4XMIA 1QNYA 3HR9A 5A3OA 5JUVA 2P6HA 2SLIA 2UYAA 5EWSA 2ZHKA 5FZ8A 5IAVA 3RI9A 3VZOA 3J26N 5FO9B 1XE8A 3V0AA 5J09A 4FO9A 5FZFA 4AVVA 2WT2A 3FLTA 3O1MA 3KHCA 1ZVFA 1M4WA 1BBT3 4AGRA 1X8MA 1GICA 2R1BA 2EXIA 1YLLA 3VBFC 4AI3A 2CHHA 3IDAA 3WUDA 3ZFEA 1H30A 3CZJA 5G05L 3APBA 2ADEA 1C8M3 3CJIB 4L11A 1W2UA 1MQTC 5FZ7A 1JZ4A 1U5XA 1ND2B 3POGA 4NPLA 1LAJA 3OY8B 4M3CA 1W6PA 5F2SA 4FSJA 1HB2A 1GZWB 4CDWB 3QOPA 2ZZQA 1XOYA 1BLZA 3JB4C 2ENRA 4IDZA 4UW3A 3SITA 4NO4A 2Q5TA 5FYBA 3X29B 3LAGA 3KQRA 2VVEA 5EPAA 1EPWA 1OOPB 1V6LA 4Y4YA 3B9CA 4Q1RA 1ZBE3 2W1SA 3NO8A 1W6NB 1SCRA 1JHNA 4CVUA 4GULA 1CWPA 1UF2C 3ILNA 2VH9A 4PBPA 3ZFFC 4Q5OA 1YYNA 4LHSA 3POIA 2BW8A 3M8LA 4OI0A 3INAA 3VBSB 1D4M1 4HZFA 4PIXA 4Q4X3 1QWRA 5KHIA 3IDCB 3MW3A 2W1UA 3JXSA 4LO8A 5F7UA 4K8RB 3LZZA 2ZGLA 2PHWA 3QACA 2RS53 2RJLA 4Q0VA 1UY2A 5FMCA 2QVSB 4IV3A 5FJKA 1UIKA 1KFUL 4JCKA 4JGZB 1AXZA 4HG6B 1RXGA 5KXEA 4R4XA 2QQWA 4JVAA 3HD8B 1O3RA 4HLTA 2QQOA 2PHUA 2CYFA 1D0HA 2VG9A 2WKKA 4D8MA 4GQ7A 2W92A 5J36A 5CB7A 4LMFA 1APNA 2JDYA 1GFF2 1VBE3 5A7OA 3UK9A 1R1A2 3HAGA 4YVSB 1J1LA 3TN93 5C3OA 1QEXA 2ZHMA 4B3NA 2YY1A 4QXKA 1JYNA 1VP6A 2C24A 3ZXFA 4JX0A 3FHQA 4Y20A 1QJY2 5LA0A 3DYPA 2PA7A 2WSUA 4NOTA 2A3YA 5EJ3A 5DQ0A 3DGTA 1W90A 5F6LB 3VBRC 4JKMA 2XUMA 5T5OA 1Q8VA 5JXIA 3MIFA 5LBCA 3AZWA 1BBT2 1JW6A 3IPVA 4MADA 3WNKA 4HK9A 1AR62 2FHRA 3I59B 3NQHA 1ZRCA 4FQZA 5FWEA 2ORXA 3SEEA 1UPIA 1NCQC 1OBNA 3VKFC 2AACA 2R0FA 2QQMA 4DINB 1NOVA 3AL6A 1S0FA 5I0RA 5JPMB 4I0WB 1AX2A 1JU4A 3BYWA 4DUXA 1HIXA 4CCKA 3AFGA 5GZEA 1S0DA 3IIAA 3I3QA 3WG2A 4FAGA 5IATA 1JYIA 1RC6A 2OPWA 4BPZA 3VZLA 4XBNA 1TNFA 5DG2A 5IFTA 2LW8A 4LTAA 1VAMA 1KD7A 1PMHX 3J9SA 2EVXA 4LEJA 3WW1A 2GDFA 2HWD2 5FY4A 3VL8A 3BIEA 4Z92B 1OA2A 3KWVA 4PIYA 3WX5A 3VHRA 1DGLA 1QQP1 1QJX2 4Q2FA 1OHFA 2QQVA 1NAEA 1O59A 4AEDB 3E1F1 1OF3A 1OFNA 1VBC3 2AZ5A 4QPGB 4M4PA 2BBAA 4LT5A 3B94A 2XWJB 3J8F1 5EZWA 3GBGA 4K40A 4TYSA 3SC7X 2J1VA 3BKZA 3A22A 1MEC1 1XNBA 5F32A 2UWBA 5I0TA 1MS5A 4F7ZA 4YVWA 2UWCA 1JI6A 5EV7A 5IUQA 3AC0A 1CJDA 2NLRA 3MW2A 3NW4A 1H4GA 1TZOA 2F6BA 3D4KA 4A41A 3PURA 4G9SB 4HXCA 2PLV1 4LOTA 4HVRA 1R083 1RUG2 2W0XA 4I0AA 2OYZA 4R4ZA 1PVC1 4GH4C 5GALA 1Q56A 4YW4A 3E97A 1DG6A 2XJRA 4OHZA 2ETEA 4B4RA 4FPOB 1PO13 3MUY1 5DUVA 5A7WA 4B1MA 3GXUA 4HVOA 1VAKA 1YI7A 1BQPA 4S2HA 1DP0A 2VZPA 2W52A 1O5UA 4K21A 3KS7A 1REFA 3K4AA 3WDYA 1H8TB 5L7OB 1POQA 1HQNA 2VCAA 1XB9A 3P1IA 1HRI3 5FPAA 3VZKA 4QHZA 3WW3A 3ZO0B 2ZMKA 3B02A 1DQ4A 5A3LA 3OUIA 1BXHA 2R7EB 1S4CA 1XBFA 4QPIC 4LPLA 2ZACA 4QAWA 5FMOS 4BZ4A 1ND3C 5FYIA 3V64A 5A6QA 2XXZA 4RL7A 3NMBA 3TAYA 3O1RA 2WLPA 4MVTA 2F4PA 2Q4SA 2ERFA 2PXJA 4OHVA 3ZYBA 3WHTA 5BNQA 5KXCA 2ZGOA 1PGSA 1H1IA 3I7DA 1VBD2 2R30A 1LGBA 2UU8A 3BALA 1LHNA 2B39A 4XOGA 2HBTA 4QKBA 4XFAA 5EJZB 2BRTA 5FPZA 3ZXJA 2VCBA 4D6RA 1VMFA 1S2EA 3P3NA 3O0VA 4JZRA 5K0UA 5AFEA 1GOHA 3TBDA 2B4KA 5FZOA 2YDEA 3WZ1A 4E27A 2WL1A 4CUCA 1GV9A 5DXDA 4B1LA 1GZ9A 1OURA 4B4QA 4JDOA 4JKLA 5LRRA 4E2SA 1F4HA 1RUI1 2EXHA 2DYCA 1TMF3 1DZTA 1A8DA 1ZZ6A 5FUNA 1C8NA 2ZEWA 3JBG3 1ULEA 2YC0A 2R072 2AYHA 2DUQA 4OHWA 3LA2A 5BNOB 2BVBA 1L7RA 5JWPA 1UD1A 2DVGA 3PU3A 1W0OA 3POFA 1OA4A 4LBQD 5KBFA 4XUPA 3ZXAC 4HN0A 4FFFA 1XE7A 2UY8A 2Y60A 3M3QA 3TOJA 3E5XA 1IOAA 1AYM3 1EAH2 3J7LA 4GB32 2JEMA 1BEV3 3A21A 3AYEA 3GZAA 3V56A 1UZWA 4Y26A 4AEKA 4CDQC 4D7TA 3KZ4C 3HEIA 2XWBB 1LENA 4MO3M 4YZ4A 4CDXB 3VUOA 5C33A 5APAA 4AFMA 5JOWA 3J7MA 1VBC2 4Y1UA 4TZDA 1MS8A 4FFGA 3BTYA 2AUYA 1BVVA 5FV3A 2VM9A 2Y6FA 3BPSA 1QHDA 2VZ1A 1YHFA 3FHIB 4HK8A 3UYJA 4GJYA 3I3EA 3HJRA 5H9PA 3T1MA 1DIWA 1RVF3 4DB5A 3N36A 4D94A 5GM0A 5GLWA 4AG4A 1RUC1 1HRV3 1QXPA 4LITA 3FN9A 4QWNA 5KR7A 3FC0A 3C2UA 4QMAA 4DS0A 1FOD1 3SH4A 4QX3A 3T2PA 2B9UA 1NE4A 2HWF2 4BQYA 4N43A 1TNRA 3RZJA 4ZONA 2VXJA 1W3XA 1PO12 3BI3A 1YFUA 1YEWA 1JH5A 3VB9A 3VKOA 3PLQA 3VZNA 2WQZC 3AP9A 2JIGA 4PCRA 4RQPC 3LEIA 1RUH2 3WNOA 3WNXA 3PUQA 1POV0 1QDCA 2GSYA 3DPRB 1ND2A 4CZSA 3I3DA 1GP5A 5FLJA 1W8OA 2I07B 5EFUA 4Z8BA 4CEWC 3A0KA 3KVBA 3H8RA 5F2WA 2C1FA 4P9YA 3C7FA 4QX7A 1T6BX 4RGKA 3WQ0A 1PM4A 5H9QA 5BNPC 2CWSA 4QD2A 5FOBB 1QJU3 5HCHA 4WZFA 4UOJA 2VUJA 4FBFA 1SEFA 1ZZ7A 3OGSA 1ACCA 4U2AA 1ULFA 5CEHA 5JSOA 4XFFA 4EWEA 5JLVA 2EXKA 3NV3A 4CP2A 4AW7A 4DQAA 1PZ9A 3HOBA 4K7JA 3ZMOA 4ZS3A 5BPXA 3HBZA 4AVAA 4CEYB 3OJBA 4JGYB 5D2AA 4MXWA 2R49A 4EV0A 1RUD2 2DCTA 1UL9A 2VOKA 2JECA 3ZKYA 5CBLA 3ZFEC 4F8AA 2BGOA 1JN2P 4FPKA 3S6PA 1G9DA 1DZRA 3VBSA 2JDNA 1MQTA 4P9JA 1CAUB 5A1LA 1XC6A 3NVCA 4I3PA 2VZSA 3POYA 5K7PA 4UFLA 4N8MA 5DABA 2XL9A 5ERLA 1I9RA 1IKPA 1RB8G 4CCOA 4WM8B 4YW7A 2HWB1 1VBB3 1WKYA 4ATEA 1V9U2 3AB0A 3KD4A 3TWIA 3U4XA 4URAA 3HT1A 3VHPA 3U37A 3LDRA 4CCCA 3DYMA 4PDWB 1BYHA 4UFJA 1QIQA 3E6BA 4J1XA 5FMBA 1RHI1 3WINE 1V0AA 1BZWA 1CAWB 1YCIA 3U11A 2EIEA 2G9ZA 4P9GA 4A44A 1FMD1 5JOYA 4FOYA 2RS51 4LHLA 4YG3A 5LA1A 2V5YA 3VDDB 1U12A 4QB6A 1NZCA 1EUTA 2ET7A 5BNNB 2B5HA 1UZ0A 1GZTA 3WCSA 4COUA 3LQCA 1CAXA 4K20A 5LBFA 5L73A 5C8CB 5FXVA 3RZHA 3RGBA 4ASKA 4BQ2A 1M06G 5A3UA 4ZKTB 1W2NA 3CBNA 3Q8EA 1H2MA 1LGCA 3UJQA 3VBOB 2A6ZA 1QDOA 4L99A 3KHBA 2JG8B 2TEPA 1JUIA 3TN91 5FZ0A 5C5TA 3AJZA 4NAOA 1JOPA 3KF3A 4JDNA 1RUNA 3CZUA 4P14A 2GMPA 4AFBA 4YM3A 4XAAA 1DQ0A 2WAOA 1Z7S1 4RHV2 1XSRA 1DGWA 5LK7B 4BQ5A 3OCPA 4OI2A 4Y22A 5CISA 2K0GA 5BUVA 1X82A 4YG0A 4CTEA 2E7TA 5C4WC 2E7AA 5EYYA 4B7KA 1GP6A 2CL2A 2DCJA 3TB0A 5JXHA 5FR3A 4GMP1 2HWC2 2NMNA 4Z2WA 4ONUA 2BPA2 5IHRA 1RUF2 3WNPA 2XONA 3JD73 5ACA1 4EZHA 4ITCA 4CU8A 1S2KA 1V6MA 1U5IA 2ZX0A 5DG1A 3N35A 1WD3A 1LESA 5DDJ1 1SFYA 2X10A 2QTWB 3F95A 3JZVA 1KEXA 3LIGA 5FY7A 4R9AA 3LE0A 3M3OA 1AR93 2JG9B 3BCWA 1WBFA 4FOWA 4P08A 5CAZA 4LORA 3ZLIA 1VLNA 4RGGA 4WM7B 1ZBA3 4FP2A 3VBRA 1VALA 3FL7A 1Y9QA 2AENA 1ZA4A 3I2OA 1UMZA 3BIWE 1VRH3 3QD6A 5E6HA 2J1AA 4QU1A 1RUJ3 3UJOA 3JUUA 3I54A 3C8XA 4D0QA 3SQOA 1CIWA 2VZQA 1YJKA 4R9DA 5AC91 2PELA 3ZYJB 4AL9A 3UGHA 3ALQA 1OLMA 4JRAA 2W2IA 3SEPA 1OQDA 4IE7A 1CGPA 1RMU3 4PF5A 4TN7A 5FZEA 2JD9A 2YPDA 5CG8A 5FLIA 1ST8A 3EB7A 1A34A 2JDMA 1JTZX 2ZJCA 4GJZA 2GC3A 2XR4A 1AXKA 5F9TA 4UFHA 2RM21 2VTXJ 1YO8A 2FZ1A 1F2NA 5LASA 4OHYA 2RHPA 1OT5A 1PHMA 4V2VA 5GKAC 3IWZA 1NCRB 1CONA 3ZMNA 1XRUA 1WMFA 3C7GA 1LHVA 2Z4FA 3KB5A 5FP7A 1H1AA 3RVHA 1LOEA 1ULOA 3OPWA 3JU9A 4QDSA 4AWDA 4COZA 2DVDA 2WO2A 1WUVA 1CD3G 3VKNA 4UW5A 1R081 2WZR3 3R4SA 3RWKX 4JKKA 4XE9A 2VQUA 5TSWA 1ULGA 4GA9A 4Y33A 1W6QB 5HCAA 1W3VA 3GYDA 5FZKA 2JDAA 5L19A 4S2DA 4YWAA 1LODA 3B93A 3IAQA 4MYEA 5G04L 1WCDJ 1OD5A 5CKQA 3WDXA 4Q8KA 3OPTA 3R05A 3O1TA 3RZKA 2RG4A 5KHHA 3K48A 4Q0PA 1W28A 1DQ6A 2DCYA 4AGVA 3LKJA 3DXTA 3I2DA 1J3PA 1VR3A 4XXPA 1RXFA 1GOGA 2A6XA 2RMU3 1AL23 4NAMA 3UL2A 1ZM1A 4NPMA 4XQDA 2CAVA 4LK7A 4LBJA 3ZN6A 2A73B 1ZZ8A 3JD72 3KT4A 2WBKA 2VNOA 2RS11 4AHWA 2IFWA 2FCTA 2EIBA 2YFZA 1UCXA 3RJ2X 1J3RA 1N1SA 3VD5A 3GGLA 4C1WA 1UIJA 2WNVB 3ZSMA 2W95A 3LA3A 1TG7A 3C7OA 3GHNA 1X50A 4Q4Y3 4UFKA 4ASMB 5FXXA 1UXZA 4OHXA 4LBOA 5FYUA 2DBNA 1WD4A 4O7XA 3M4FA 3P6BA 1O91A 1PZ7A 1HXS3 2XDVA 4Q4W3 4EN7B 1KFXL 5K4LA 1STMA 3I2HA 4XUTA 1LULA 5A6XA 3V0BB 3USUB 2Y6GA 1D4M2 2C6SA 2WZ8A 4XFHA 4XW3A 3KQ4B 3FJSA 3ROUA 3M1HA 3ZN5A 3OOXA 4QQHA 4XC9A 4BM8A 3GJBA 2D3SA 4COYA 2H0BA 4XF9A 3UV9A 3VKLA 4MZUA 1G6NA 3AL5A 4EN9B 1RMU2 1GMMA 4IEOA 4J25A 4LXLA 5HV0A 3I4IA 4R52A 4U36A 4D3WA 2DV9A 3CDZB 1O5LA 1S55A 2YU1A 3HIFA 3K77A 1ENRA 2E7QA 1YFXA 2VMCA 2XH6A 3I8TA 5T5PA 4PLOA 1H9PA 4AI8A 1MS3A 2JX9A 3MIDA 2XJPA 3K4DA 4H7LA 4DIQA 3MUZ1 1VBA1 1JYXA 1JHJA 1V6KA 2QE3A 3PIJA 4NIHA 4O9EA 1FPN1 1MZ6A 2WT1A 2YB7A 1K3IA 1B35B 1PMIA 2XHKA 1AX1A 1IQDC 4FQ4A 4GZ9A 3AZYA 3NV2A 1N3PA 3HQXA 4K8FA 4CDQA 4HPKB 1IPSA 2D7FA 1F5FA 1COV1 5H9SA 3ZFGC 2UWAA 4A7ZA 5LRSA 1AUYA 3ZYGA 2BFUL 4CDUB 5KC5A 1XNDA 2HEWF 3DF0A 3LFMA 2IXIA 3VGIA 5FY9A 2OKXA 3HQRA 3C3VA 4PHZA 4QX2A 4BMBA 1WZXA 1PK6B 2NYYA 5CFCA 4OCTA 5E1RA 3O5SA 4LUMA 3WDVA 5CFCC 3ZKUA 5KHKA 1CX4A 4CUAA 3UGFA 1UW8A 4XDPA 3BTZA 3ASIA 3O0XA 1O8SA 2R1DA 5DAVA 5FWJA 3DEMA 2W46A 3H9AA 5FLHA 2VMFA 4AAPA 5FYTA 5K9YA 1GNYA 2RDRA 2YZ4A 2WFF1 5D21A 2R0HA 4LHKA 4XACA 5KHJA 5HV4A 1JYWA 1X9TA 2C4XA 1U5YA 2K2SA 5FKCA 1O3SA 2BBVA 4Y1VA 3GZUC 1K45A 5IVBA 1OF4A 2GN7A 4YW2A 1D2SA 5D8AB 3IAPA 1D7PM 1AYN1 2IVIB 3RYKA 3CJIC 1S0IA 2QQJA 4NN0A 2YUEA 4AI9A 5J7MA 3CMGA 3B9IA 1ND2C 4FPJA 4XFCA 4YW5A 1F8VA 5I0SA 5J96B 3H7YA 1YUDA 2VJXA 2WN2A 3K3OA 4IV1B 1NY72 1ZZBA 1J58A 4BE3A 2R16A 1W9FA 4KWKA 1W6OB 2J1EA 3KV9A 4LE4A 4CDWC 5JZGA 1QQP2 1R1A3 4BXFA 5FZLA 4I2OA 3NWKA 4DPNA 4D7SA 2DVAA 2QDRA 1QJY3 3AMMA 1Q8SA 5A3MA 3WOGA 2KA3A 5LA9A 2XHNA 2XL7A 2YGLA 1OOPC 2BP6A 4JV4A 4N9IA 2MEV1 3UETA 3AJYA 2BOJA 2Y0IA 3GCWA 2VBDA 4GWIA 1JYCA 2VNRA 2ZGUA 4OUMA 1BHGA 1MACA 4Q0UA 1ALYA 1AR63 1GBGA 1SHWB 4W8JA 4EWDA 1OA3A 2PLV2 3AVRA 5FK8A 4DY3A 1IG3A 1DHKB 1WW6A 1AR71 2X09A 4GWJA 1PVC2 2GNTA 3RG0A 5C8CA 4NR1A 3THCA 5B4NA 2GALA 4JHZA 1SCSA 3ZSKA 4RGAA 3VBSC 3NAPB 2RDQA 4Y1YA 3UGGA 2KD7A 5A32B 3IIIA 1YIFA 2FD8A 1BMV1 3SMHA 1QGLA 1QOSA 1RUE1 2WQ8A 4KU7A 2Y6HA 1XNKA 3AM2A 5AVPA 3PMSA 2G19A 4GIQA 4YZ2A 1N1YA 2ZMNA 3LWCA 1PGW1 4XJZA 2AEZA 5C3SA 1HV0A 1XXNA 2ATFA 2DVFA 2D93A 2JB4A 3D0SA 4C0BA 4ISQA 3FBYA 2QQPA 2HWD3 2EF6A 2MNGA 4CE8A 3VBHB 3GZEA 2J7MA 1GNHA 3LOIA 1XJAA 2FQPA 4AGGA 2J1RA 1UY0A 1ASJ1 2RJ2A 1AJOA 1RJ7A 1DQ5A 4BIFA 4CXYA 2H6CA 3LPFA 1QJX3 4XEZA 3PNAA 2D3PA 3KVAA 4LE3A 2JB8A 3G7DA 5DAPA 4YVSC 3KM5A 5A33A 4L0PA 3ZYIB 4AVSA 1MS9A 1NA1A 2DFCA 5B4XA 1Y7BA 4P9LA 3RSJA 4UFIA 2F17A 1Y4WA 4IEXA 5IJRA 2CU5A 4IEPA 1PX4A 4P02B 4JHTA 2Q8EA 3O1OA 3ILFA 3T0DA 2KR2A 2WINB 5GLTA 2AR6A 4LUKA 3KSCA 1WW7A 5SV8A 3BTAA 4AYUA 1W6MB 3Q8AA 3VBFB 1RUG3 1D2QA 2RV9A 4MGKE 5C4WA 3RMYA 5KWRA 4FPCA 4A4AA 2Q8CA 3Q8BA 5FYCA 3RRDA 2CGOA 2DTYA 2VMIA 1LECA 2Y34A 4E8CA 5LZ6A 2DBIA 5FO7B 1J59A 1O6UA 2BEOA 4M4RA 5LY1A 4YZ5A 1ENSA 1PO21 3I97A 4JRLA 4QPYA 3VZJA 2A1XA 1XU1A 1H4HA 1Y3TA 5FZ3A 4XJWA 4KBBA 3AKPA 4RR3A 1UX6A 3MPBA 1RYYA 4E4DX 1PIV3 2GZWA 1QF3A 3PUSA 3THDA 2V4AA 1RINA 3EXUA 4X8PA 2A3WA 1NCRA 2IZWA 1W8NA 3GBWA 1KJLA 1LOBA 3POEA 1W8UA 1KDMA 3W5MA 4MHUA 4LOSA 4NHLA 3S5QA 1RUC2 2DUOA 2Y8KA 5FRAA 4NIGA 3VD7A 1VBD3 3T4HB 1NLSA 1FOD2 3IBMA 3OGVA 2QNKA 4GMP0 1QU0A 2YMZA 3I2FA 4Z07A 2XBO1 3N4MA 2W87A 1S2BA 4QPGC 4O9GA 4Q29A 3M3IA 2P4EA 5LWBA 2PFWA 3WF2A 3PVOA 4XURA 4NIDA 5FQ0B 3CF6E 3ECQA 1LTEA 2B45X 4BQXA 4ZU7A 1GOFA 4IE5A 4OI1A 2E32A 4EZ4A 5F5CA 3T2TA 2R6QA 1PNGA 2VBBA 1HJGA 3RYRA 4X6RB 1DYPA 1F31A 5LB6A 3THTA 2R073 3ETQA 5GZFA 5A70A 3T08A 2CTVA 1IHMA 3LD8A 1EV11 3GZTB 2Y33A 4CRQA 4ES8A 4MGIE 1US2A 1LOGA 4QM8A 3RPQA 4INDA 4HN1A 1EAH3 2RR11 4GB33 1X7NA 2VZVA 4LO4B 2QQLA 3HN1A 4FPEA 1SPPA 5JIAA 2A3XA 2ZGTA 3KT1A 3SKJE 1VIWB 5T5JA 4LIUA 1LHWA 2FMYA 4UFMA 4CU6A 3AX4A 1YNAA 1MVQA 1W2OA 5CIRA 1AZDA 4C0HA 2QZ3A 5L7OC 1DCSA 2OPKA 5FYSA 1ODMA 2ZGQA 2ADDA 4IGQA 5IYYA 1R091 1SFPA 1PM7A 1Y43B 3B00A 1JZ5A 1CZSA 5GLUA 2CWMA 3BVCA 1WW5A 4XXAA 3USUA 2DU0A 2VMDA 1MS1A 4OI4A 2OIIA 1F9KA 2PAKA 3OTFA 4Q4Y1 5SV5A 4C1XA 3Q8CA 5AVAA 1Q43A 3N9OA 1WMXA 1YXWA 4K1YA 4ZXKA 4CP9A 4XBLA 5FY5A 1IS3A 3O1VA 1DDLA 4Q4W1 1KS5A 4Q4V1 3DUIA 2HWB2 2HWF3 1CESA 1UOFA 2JDUA 1NCQB 1NQJA 5FYVA 2YROA 3FE5A 4NWVA 1IS4A 2PN5A 2W1QA 4AR2A 1UMHA 2XJUA 4KBZA 4LBQB 4N90A 4DXTA 1RHI2 4W50A 5DUWA 3MW4A 3RZZA 5FAXA 4Y5SA 4YGEA 1W8FA 2NZ9A 2X05A 4HKOA 1RUH3 3BTXA 3KV6A 4BDVB 5FP8A 3B69A 3JB8A 3BGAA 5JVVA 4CPBA 1PIV2 3OYWA 1GR3A 4XUOA 4P9IA 5JXJA 2WS93 3H50A 2JDKA 1R64A 2C5DA 1RTVA 3ZM8A 4W4ZA 2ZGRA 1I6XA 1KJRA 2OQ7A 3PMEA 2IXLA 4E2GA 2VOTA 3PTYA 1K5MB 2JXAA 2TBVA 2WNUB 4IEVA 4HKLA 4AFDA 3CHXA 2YYOA 4JAAA 2A6WA 1QJEA 2CSGA 2Z79A 2R063 5FZHA 3I3MA 4XIKA 2W91A 4GALA 2XOMA 4CDXC 3A7QA 4NIIA 4DRRA 5A3TA 2DURA 3MBWA 5C9AA 1Y9MA 3A4UA 1Z7S2 2K9ZA 4CU9A 2DCKA 1RUD3 3DCQA 4E4SA 3MEPA 4FAHA 3WP4A 4K3UA 3SXWA 1LU1A 3HWJA 2CV6A 4YG6A 4AEJA 3PJYA 3HNYM 3VZMA 3ZXDA 4AHYA 4LO7A 5FYYA 3MFAA 4CYDA 2R043 5GJ6A 1UOGA 1JU3A 5CZKA 4M01A 1KS4A 3ENRA 4DXZA 2YHJA 3O0WA 5F3CA 4XIOA 1I5ZA 4PBOA 1YJLA 4TXWA 5DDJ2 4GH4B 5FDBA 2LALA 4FPLA 1IGOA 1WA4A 2W68A 3RJRA 1V9U3 2YV8A 3VV1A 1UQXA 4P5YA 1S0GA 2D5HA 2QCSB 3J7NA 4N53B 3W20A 5CFDC 3NJYA 1WCUA 4G3YC 1H2NA 1UAIA 3GNEA 1NXD1 1D0GA 2DCZA 2PQSA 2QQKA 1DYOA 4FXGB 3ZFGA 1JS9A 3W9AA 1W8TA 3OUHA 1UU4A 2ARAA 4NVPA 3ZYHA 3JQWA 5T3NA 1XE0A 2HWE1 2Y64A 2B9VA 3PUIA 1WCSA 4M00A 4XCAA 4JQTA 2XJVA 4QKNA 3RS6A 5FOJB 5AC92 2FBEA 1DGRA 3M7AA 5FPVA 1ND3B 5A7SA 3WF0A 2OT7A 4OQ8A 1TEIA 3ILRA 5IVCA 4KWJA 3WNLA 3K75B 3K4ZA 4QB1A 4UF0B 3W58A 3ZN4A 2RS31 2A6VA 1R1A1 4WBBA 5EYXA 3O1SA 4YNIA 1QXRA 2I2SA 4I09A 4COVA 1NE6A 1O4YA 2B7YA 3W21A 2NN8A 3RZLA 3KCCA 4JGYC 4D69A 3ZIXA 5JI9A 4PI2A 4RFRB 4RHV3 2ZGMA 3PIGA 3O1PA 1VJ2A 1IZ3A 3CJIA 2ZAHA 4WVMB 2HWC3 1LOFA 1HB4A 1BBT1 1REEA 1W0NA 1RUF3 3M3EA 3OY8A 3R0RA 4OFGA 4FPGA 1AR61 5A32A 2CGPA 5I91A 1ZNPA 3WP6A 1GZWA 3R4UA 4CDWA 5EIYB 4V1PA 1Q8PA 2XLFA 1VMHA 1O8PA 2OW4A 2WS92 4AXOA 5JR2A 5JZGC 5JSRA 4H55A 4MH0E 1C8M1 1CIYA 4AI1A 1MS0A 4RS5B 3NJVA 2JDPA 4DMIA 1ENXA 1GANA 3WQ7A 4TTGA 3DECA 2QJVA 3KV5A 2HBUA 4P9WA 4PDWC 5EQUA 3WNMA 1POV3 4NJ4A 4P9XA 3A23A 4W6WA 1UPSA 1HLCA 1OOPA 2R062 4GAZA 3WP3A 4BJ0A 4YZ3A 4DNYA 1SACA 2ZGKA 4G4FA 3UKVA 3VDDC 5IK8A 1W6NA 4OYUA 5LK5A 4Z2AA 1DBNA 1MZ5A 3HNMA 3FWEA 5BNNC 4KG8A 3POSA 2XPJA 1TME2 1UWWA 3ATGA 1NKGA 4XUNA 4D6SA 5C8CC 4UYBA 1CAVB 1KITA 1ZBE1 4DY5A 3ZR6A 3GJAA 3BUCA 2R042 5GZGA 4XQ4A 1L3JA 2ARBA 2BV4A 2RS12 1CJPA 2BWAA 1GZCA 3N3HA 4IEUA 3VBOC 4CA9A 4IGOA 1UN1A 1S0EA 5IVEA 4QX0A 1WCKA 3LFIA 2O8QA 3WEZA 4B4PA 4I02A 4Q1PA 4Q4X1 1W04A 1W99A 2VCMA 2WNEA 4BYYA 3AMHA 3OUJA 4JGZA 1A6CA 1X9PA 2KXLA 1DGWX 1SLTA 3PUAA 4RQPB 5HCBA 2WWSA 3CLPA 3SH3A 1PVXA 5F5QA 4ZPIA 3S0MA 5DZEA 4FFIA 2P3YA 2K46A 2DWRA 5LW9A 1I1EA 5J1XA 2VZ3A 4JC1A 2EALA 4QX1A 4AI2A 3CQOA 4AFCA 3TEWA 4URTA 4YVSA 2L9LA 3P3PA 5IWFA 2IFRA 2P3IA 5CVRA 3MO4A 4ARYA 5FBZA 2Z2SB 5BNPB 3ACIA 1Q8QA 3UT0A 1O3QA 2JG9C 3NV1A 4XF4A 4W6XA 3N9MA 4I30A 4ZS2A 1NA1C 2X53S 1LHUA 3IDBB 4WM7C 3GBFA 1AXYA 1VBE1 3VDCA 2J1SA 3V0AB 2JE8A 4IQPA 1W8HA 1AR82 3RMXA 2ZX4A 3GALA 1YQ5A 4WVWA 2W5FA 3MV11 2EXJA 2VULA 4XABA 4YZ1A 3ELNA 4YW6A 2WT0A 3I59A 1LCLA 4QGMA 3I2JA 2VZTA 3RI8A 3MGUA 1KQRA 1VBA2 2Y6LA 3ZFEB 2VU9A 4A7YA 3M3CA 2R32A 1XYOA 3MLLA 3IN9A 4QHBA 4DZGA 1RGSA 3I3BA 1FPN2 4Q8LA 3WR0A 1EYBA 3AYDA 1VBD1 4OZOA 2FMDA 4M3CB 4E2QA 1W6PB 2GAUA 5FQ0A 1GUIA 4GWMA 1SBFA 2O8OA 5FZBA 3WW2A 1OVPA 1SLIA 1YWKA 1URXA 3MIGA 4AOCA 2XGXA 4L92A 5JOZA 3CJXA 4RR3C 1W2AX 2OVUA 2WR9A 4FOQA 4WVVA 1UY4A 1NCRC 2YXSA 1G9FA 5JAXA 2WO1A 5IK4A 3LDKA 2PHXA 1YRZA 5CFDA 1D4M3 2GC0A 2E31A 1VE0A 1QKQA 4YLZA 4CXXA 2R071 4FT8A 4UXAA 2GP3A 1W9SA 4MUVA 4RFT0 4YFZA 4AEDA 4YGCA 4UWDA 2WFF2 2OZJA 3IZOA 2P17A 4XCBA 1L7LA 2BU9A 4QPGA 5GLVA 2RJKA 3ZSJA 2G9GA 4XJUA 1Z78A 1P8JA 3FZ3A 4NRMA 1HW5A 4UI9L 1FX5A 5LY2A 2TNFA 4XJAA 5IVJA 3NKGA 2QQIA 2VD7A 4A3ZA 2Z5WA 5JIUA 1VBC1 4E9KA 3LA7A 1KRIA 5A3WA 1F35A 1NT0A 2FDJA 1NUKA 5ABJB 3VDBA 2GNMA 2BGPA 4IV3B 3AMQA 1WGPA 4LKEA 3PJQA 4B7EA 2VAUA 4HVQA 3NL1A 1YFYA 4QXBA 4ZU5A 1DZQA 4FPYA 3VL9A 3AP6A 2MPFA 5I8SA 5I0DA 3MI8A 2H0VA 3B5LB 3FMGA 1O4ZA 1KDKA 1WWYA 3UNPA 2WNVC 1H8TA 3NJXA 3PVBB 2MEV2 1W03A 1QJFA 2GU9A 5L7OA 2CAUA 1PO11 2VXRA 3OBRA 4Y20B 2GH8A 4CSWA 2ID4A 2XVLA 4Y1XA 2QZ2A 3AFKA 3WG1A 1AR72 4LQRA 1LB2A 1SQ4A 4IEYA 5FUPA 5FZ9A 3CNAA 1EUUA 2G1MA 3VHOA 1HRI1 2PMWB 3IPVB 1LOAA 4WV8A 3MIHA 2VW0A 1BMV2 2E51A 5DUXA 1TQ5A 1UOJA 1PX3A 5C8WA 3LIHA 1WLTA 3MF6A 1YIPA 3NKTA 3NNMA 1H6YA 4IE6A 1PGW2 3E5QA 5FZIA 1UU5A 2XJTA 3GHMA 5LCWL 4HMZA 2IXKA 2FDIA 2P1BA 1OLQA 4FPHA 3OPZA 2CY6A 4ORFA 4BQ3A 2NPIA 1LEMA 2QQNA 3RQ0A 1DU3D 5BNOA 3PL0A 1UMIA 1NZIA 1WBLA 1ASJ2 3H7JA 1QQP3 3TEXA 3ON7A 1KXGA 3VKMA 3ACHA 1H8VA 1YQ8A 4HSLA 1TMF1 4H7MA 1HJFA 4N53A 1X8EA 3JBG1 3J8F3 4BK4A 4RSUA 2X5IB 1S0JA 1ZRIA 4KI5M 4E8DA 4Q0QA 3VBUB 4XZPA 1N3OA 4CDXA 2ZAAA 5ANNA 4CDUC 1UO9A 4LULA 1JODA 1V6IA 5CA6A 1AYM1 1GLHA 1SDWA 5C9AC 4XF3A 1MZFA 4QB2A 4XMAA 5DZFA 1BEV1 4A3XA 2PLV3 4A42A 1PK6C 4XFBA 1PVC3 2YC2A 4BU2A 1ULDA 1CN1A 2C0ZA 4YVWB 5I8TA 1V00A 1FV2A 4E4ZA 1GWKA 3OBAA 1QNWA 5E8AA 2VNGA 4KH9A 3LDBA 2KM2A 1PO22 4R9CA 3AP4A 1WCQA 4ET7A 5GZCA 4AQ6A 1RVF1 4EN6B 2BNOA 2WABA 2WWJA 3TNQA 4EN0A 2O14A 5C3RA 5CG9A 5FKBA 1OMIA 4A6SA 1HRV1 4UAPA 3AZZA 4Y4RA 4KG0A 4RN5A 2PYTA 1GP4A 5A7WB 1H9WA 1UKGA 4Z82A 3U1XA 1DLCA 3ZYPA 1ZX5A 3MIBA 3LEMA 2P5BA 4XDQA 1MPXA 4N7UA 3DPRA 4IXLA 3SCHA 4DXSA 4MGSA 5F5AA 1PZ8A 1LGNA 3AXDA 4EJRA 2E53A 4PLMA 2ZCWA 3T09A 3WG3A 5LEKA 1XYNA 2XQRA 1F5JA 2FCVA 3OEAA 4RHV1 5FZCA 2DF7A 1UXXX 2OX0A 3ZVXA 1OQ1A 3GM8A 4A45A 3I2GA 4UBHA 3FFZA 4RS5A 4XF1A 4IGPA 3URFA 2BOIA 3NV4A 3JQXA 2MHFA 2IC1A 4F83A 3NNGA 2VNVA 4E4HA 2VVDA 3H8XA 5A6ZA 5FYHA 5FPBA 2PQQA 2I45A 1HN0A 2O0OA 4BOWA 4DFSA 5C6CA 1QJU1 2LROA 1Q8OA 2VZUA 1DF0A 3LF7A 3D5OA 3B3QE 4CEYA 1GWLA 1LHOA 4JGYA 5K0UB 2V4VA 2W47A 5FZOB 5FMDA 3EYPA 2VQ0A 1HDKA 2D6MA 2ZXQA 4XFIA 1JYVA 4BLJA 2DUPA 4OUEA 2ZMLA 4GKXA 1CAVA 1EV12 4XHXA 1NXMA 1QMJA 3UESA 1CAUA 2EAAA 5JXGA 2ZHNA 3EJKA 3NAPC 1LOFC 2BFUS 3H3ZA 3SCGA 2B42B 2JKBA 2RR12 4YW1A 4A7KA 4XILA 1V6NA 2NP0A 3VD3A 3WDUA 1JZ8A 3S57A 2ZKLA 4WM8A 1VRBA 2XLGA 2E9QA 3D3AA 3LSDA 2YPJA 4XUQA 3USSA 4XQWA 3DL3A 4LR4A 3PTRB 4HT1T 3OD0A 4Q26A 1QY4A 4PDWA 5C71A 1SBDA 3GF6A 4UBGA 4BISA 3J8F2 1R092 1CAWA 1X36A 4ZY9A 3KGLA 5E89A 2Z69A 1ONAA 3WF4A 2D3RA 1MEC2 4CPBD 3VDDA 1NYWA 1V6OA 1V6JA 1VBB1 2DFBA 2VECA 5BNNA 1RUC3 4KGQA 2BZDA 1XQNA 2C9KA 4ASLA 3QH6A 1N1TA 5CU1A 2BNMA 1FOD3 5CADA 4BB3A 4H14A 4I0BA 4Q4V2 1J3QA 4QDQA 1H6XA 5DMYA 1K5JA 1FI2A 2A7AA 2V72A 4XHBA 3VN4A 3VBOA 2AGSA 2VOVA 1C57A 3H3LA 3ETPA 2WN3A 4IEWA 2OXBA 4JTOA 2JG8A 3HN3A 5L9RA 4MGZE 3SNMA 1HQLA 4YSFA 2Q1FA 3PUHA 4IETA 2D6LX 2WA3A 4MXVA 2P6CA 5D1IA 4N43B 4PLNA 5FP9A 2OUHA 5L9BA 5FY0A 3WNNA 5FO8B 2AC1A 3S7IA 3QBQA 1HB1A 5ANQA 1BVP1 5T5LA 1C1LA 5EJ1B 3ABZA 4JGZC 1W9YA 5HPOA 3THPA 3AXEA 2D98A 5EP9A 1H1MA 2ZS6B 4KMQA 2BQPA 5HXMA 1JZ7A 1Y9GA 3EQEA 2BJSA 1CZVA 5GZDA 4M3CE 2ORZA 4HETA 4I3GA 2WZPP 2JD4A 1CVNA 1DLLA 1JOJA 2VTXA 4M0NA 2ZTNA 4SLIA 3A0NA 1T6GC 5A80A 1AHSA 3BPZA 4YARA 1ULCA 1SLAA 2XKOA 3TYJA 3MYXA 5J98B 3FX3A 4DEVA 1OVSA 2JG9A
chains in the Genus database with same CATH topology
3IDEA 1V70A 2ZGSA 3JD71 4J6GA 2ES3A 2N7GA 1RJ8A 4NWWA 4WM7A 3RWNA 1DQ1A 2XVKA 1RUI2 2NMOA 4AHZA 5K8SA 3D6EA 1AR91 5IK7A 4C90A 1BCXA 1RIRA 2D6NA 3WQ1A 2G4IA 1ZBA1 4MXWB 1C5IA 1EP0A 2BVVA 3FFQA 3IMNA 2HWB3 2VQAA 3E6DA 4MSVA 1VRH1 1ZRDA 1RUJ1 5FTTC 1MQTB 1PGL1 1AJKA 3IT8A 1RHI3 1WMEA 1FMD3 3D8CA 4M3CF 3DV8A 4FTBA 3H1YA 1RMU1 3R4DB 5J48A 5ABJA 4XYXA 3LSEA 4CP1A 2PHDA 4OLLA 5IK5A 2HWE2 4XJ9A 2UY9A 1AX0A 5JR7B 1WLDA 3D82A 1BJQA 3FLRA 2LTNA 4N9HA 1C1FA 3UKNA 2PHFA 1IKQA 1CPMA 2XJQA 1CPNA 3RDIA 5T55A 3CU7A 2JE7A 2VW1A 5I93A 4QGNA 2ZPXA 2RS32 3ZFFB 1HX6A 4FTSA 1U0AA 4AEDC 4RA0A 4LA3A 1CAXB 2VW2A 5AFBA 1W6QA 4L9BA 2BYVE 5KXBA 1XYPA 1Z7S3 2GC1A 1SLLA 1WMDA 4R9BA 4X6QB 4BIOA 2WZR1 1OLRA 2YGMA 3U0ZA 4AVTA 3WXPA 2O1QA 2ZHLA 3MIEA 1AL0G 4GMP3 3AMPA 4ZU4A 1I3HA 5ACA3 3WD5A 1FT9A 3LB9A 3M2MA 3ZDSA 4LBLA 3LGRA 4Y22B 3ZXEA 5KC6A 5DDJ3 1OPOA 2VUAA 2W08A 1C8M2 4COWA 1QOTA 5I8YA 2PHLA 1XNCA 3WUCA 3CO2A 4PIZA 2ILMA 2A75A 3MZHA 2WNVA 5JMCA 2RMU1 1AL21 1O4TA 1S0CA 1HKDA 1H8TC 4FXKB 3U07A 5FPXA 2HKXA 3FUOA 4YM2A 5JCTA 4TWTA 5CNAA 2Q30A 1C4RA 1QJZA 5AC93 4AK3A 2H6BA 2Q1MA 1MS4A 3AKTA 3BOPA 2P2KA 3OGGA 3VBRB 3V0BA 5HBAA 1RUOA 1ZBE2 3ZYRA 1DQ2A 1K5MC 2WNUC 4S2GA 4UW6A 2X5IA 1O3TA 1NY71 1NLRA 1XU2A 3VBUA 4HANA 1HXS1 2RM23 1YI9A 4BLIA 4Z1VA 4LBKA 4Q4X2 3BU7A 1C5HA 5FMOL 3WW4A 1FMD2 2RS52 4QQOA 1DYKA 4L8QA 1TE1B 3AZVA 4ATFA 3BODA 5LEJA 2GN3A 2VVFA 2UYBA 1AVBA 5BNOC 5HI0A 3WP5A 2VMHA 4W65A 3QCWA 1GKBA 4LO5B 3FBMA 4LBNA 1WW4A 1B35A 1FNYA 1O7FA 4DOUA 3LOBA 4N53C 1G9AA 4XFGA 3ZIWA 4HPKA 1OKQA 4XPVA 1VBE2 1UKRA 4AFAA 3TN92 4LO6B 4CDUA 4XJ8A 3POWA 4B29A 5GLZA 4XF0A 4YYOA 3WY6A 2JJ6A 1TME3 1PK6A 3EO6A 4H3WA 1N47A 1QOOA 3MLKA 4HFSA 1JXNA 2OUJA 3PHMA 1HV1A 4AI0A 1WLCA 2D6PA 4GXLA 3W59A 1ZREA 3PVEA 4FVVA 4PQ9A 1RITA 4GKYA 5ACA2 2RS13 2XG3A 3ZXLA 4EN8B 4B8EA 2V09A 4N7IA 1EPZA 4HKWA 3O12A 1PNFA 1QH7A 1EY2A 1OSGA 1MZEA 3ZN6B 4C91A 5D8AA 2IXJA 2D6KA 4MX3A 2ZZJA 1ZRRA 2WJSA 3AK0A 1OQEA 3DPRC 5F1RA 5JSPA 3H0OA 1IS5A 3SLIA 4IV1A 3AZXA 1ZYBA 1W6OA 4NHMA 1A3KA 4QPIB 4AQSA 1A8MA 4XETA 4AHXA 4RS5C 4CP0A 3LCPA 3DN7A 4D7YA 2V73A 1G7YA 2VGDA 3U10A 1ZZ9A 2ZGPA 2RM22 2BWCA 2CNAA 4Y1ZA 1AR83 3N7LA 4OULA 3ZPYA 4EROA 2LUWA 4OVEA 5BXXA 4CEYC 1QJY1 3EHKA 2C9AA 3L2HA 3O7OA 4AF9A 1LEDA 3OBTA 2E63A 2Q8OA 3MICA 1VBA3 1G9BA 3O14A 1LKNA 4F3JA 2ZKNA 3NAPA 2JDZA 1FPN3 4XTPA 2TUNA 3AKSA 1H0BA 1R082 4LNVA 4WZCA 1CQ9A 3ZSEA 4WM8C 1G86A 1COV3 3H3UA 4FPFA 4QQ2A 3L2YA 2VY0A 3MF9A 2IXCA 1IQAA 4BA6A 4QQLA 5HXVA 5CFDB 1FV3A 3MDPA 1MVEA 4AEMA 4CDQB 2AH2A 4QM9A 4YFWA 3J4UH 4YGDA 3SHRA 4BHPA 3N7JA 3VBHA 3RNSA 3AKRA 4KGGA 1REDA 1S1AA 1UZZA 3G6JB 1HRI2 4PJYA 4M0HA 4OUSA 3H8UA 3WCRA 1X33A 1G8WA 2WFF3 5CFCB 1UU6A 2HWD1 2D6OX 1W0PA 4BCUA 3S7EA 1H2LA 4Y24A 2ZGNA 2D97A 1NG0A 4QGLA 3ZXKA 3NJZA 1IPKA 1QJX1 1IPJA 2JG8C 3E5UA 4LHNA 1AYN3 2WQ4A 3K51A 4ES9A 3AYCA 4LA2A 1RL3A 1ZRFA 1W6MA 4R8HA 3VBFA 3KGZA 3WDWA 4JQRA 1OFSA 3N7KA 5BV6A 3OGJA 5FFOC 1R1ZA 3WHUA 1TMF2 1JBCA 3JBG2 4JDMA 3ZSLA 4CEWB 2A6YA 1RUG1 4L2NA 5JZGB 3WV6A 2MEV3 3EBRA 1AYM2 3V65A 2PAEA 5FREA 4A2UA 2FZ2A 1BEV2 4QQPA 2BTVC 3MLJA 2SBAA 2HYKA 1AR73 1BKZA 5BY5A 4KU8A 4FOVA 3CL1A 1PIV1 2P34A 5E16A 5DUUA 2EIGA 2NQYA 3ZFFA 3TRSB 1H2KA 1W39A 2GMEA 1SBEA 2WC2A 5JI7A 1RUE3 1RVF2 4K9SA 4AVCA 5FCCA 1HRV2 2D5FA 3B7MA 2GNBA 3HT2A 1JUHA 1ZZCA 2BNNA 1COV2 4IESA 1WLWA 4ISRA 3VHNA 2AREA 2VOWA 5ABJC 2ZX2A 2D44A 4IV3C 1C3HA 1ASJ3 3ZX7A 2IWGB 4L97A 3NSTA 4MV2A 2B46X 3AYAA 4X8NA 2JENA 2XB6C 2QKDA 2BUKA 1C28A 1Q3EA 1LRHA 4KNCA 1GNZA 1GSLA 4HSJA 4AVBA 2VMGA 5DZGA 1LJ7A 1ENQA 3M70A 4KL1A 1QJU2 2NM1A 3ST7A 5A33B 4SBVA 1LOCA 1EAH1 4GB31 1NA1B 2PHTA 2XVGA 3Q9OA 2GNDA 1AYN2 2HEYF 4BH9A 2ZX1A 2P37A 1SFNA 4BQ1A 1PO23 2QFEA 2P3JA 2ZOEB 2D43A 1MR5A 2W39A 2OZ6A 5C4WB 1AF9A 3KCXA 2B8MA 1NCQA 4LLFA 4LBQA 4IEQA 4NPRA 2Y0OA 4OZXA 2UURA 1SLBA 3IKWA 3OF1A 5T54A 1U5ZA 2HWF1 1FYUA 1VBB2 5H9RA 3N7MA 4RR3B 2X29A 1B09A 2JE9A 2DTWA 2VPVA 3QH7A 5F6KA 5JDBA 1RUH1 2ZA9A 2XBO3 3BOWA 3FLPA 3KCYA 1K5MA 3AP5A 2LM3A 2WNUA 4IEZA 4S2FA 2BGCA 2X5IC 3HMYA 2WS91 3VBUC 5IT6A 2XLAA 4RD7A 1RUE2 2QUOA 2WIIB 2XKPA 4FP3A 3VLBB 2CGNA 1HQWA 5KHGA 2EA7A 1Z0HA 4QU2A 1A78A 3D0JA 4EWAA 4K1ZA 2Z42A 3MFCA 4QT6A 4XBQA 5J3UA 2R061 3R6SA 4P5HA 2VOXA 4I01A 1EV13 4META 2Q1ZB 3KMHA 4YVWC 2QDNA 3BB6A 4J1WA 2RR13 4YRDA 1TME1 2A71A 1RUD1 4TSVA 2A5ZA 2ARXA 4GH4A 3QLQA 4Q27A 3AP7A 5BYNA 4MLOA 3ZXGA 1B35C 2OA2A 3PVNA 2R041 3JCIA 5B2GB 1R093 1N3QA 1E57A 1CR7A 2WLQA 1MEC3 3FUQA 2GH2A 4WVZA 1D4VB 1V9U1 3KT7A 1S0BA 1AR92 4Y5Z0 2I74A 1LU2A 4YM0A 4QPIA 1ZBA2 3S30A 1ND3A 3AKQA 3SH5A 4Q4V3 1G9CA 1VRH2 1RUJ2 1J1TA 4UW4A 1GQGA 2ZBJA 4QX5A 1FAYA 2Y38A 1PGL2 3H1WA 5I0UA 1OI6A 4K6BA 4Q0SA 3DKWA 3OD4A 4MGYE 3E6CC 4AQTA 5K0UC 4KQ7A 4YM1A 4TLFA 3UKTA 3CEWA 4JTNA 1FNZA 5D8AC 2D40A 5T52A 3T1LA 4BWOA 4KWLA 4WVMA 1AR81 4BMEA 1SMVA 3WT3A 3WDTA 1Q5OA 4YGBA 3TNPB 4FCAA 4IV1C 3OYWB 1YFWA 1FATA 1GQHA 2WFPA 4HL0A 2Q0AA 2E6VA 2ET1A 1SLCA 3B01A 1DGRN 2XBO2 2HWC1 2IXHA 2HEVF 1RUF1 2JICA 1BK1A 1QXJA 5JPNB 3IM0A 2WZR2 1N1VA 3H1MA 2XJSA 4AQ2A 1GYKA 1RUI3 5J37A 1QH6A 3WLUA 3WG4A 4LLOA 5C9AB 1POV1 4IERA 5T50A 2HJIA 4FTEA 2GC2A 2RE9A 2ZX3A 2PTMA 2X8KA 4YW3A 2PAMA 2Y26A 4AE2A 3AMNA 5E88A 1FXZA 5KXDA 3RYPA 2EAKA 3WVJA 4GWNA 2WA4A 1UZYA 2WSVA 2RMU2 1VB4A 1AL22 2P3KA 2A70A 1LR5A 1VAVA 4LBMA 2DVBA 4N43C 2G9FA 3KLSA 5L36A 4XTMA 3ES4A 2HWE3 1NQDA 3MPPG 2DU1A 5HCFA 4RQPA 4DRVA 3SISA 1IS6A 2PHRA 3ES1A 4HBNA 2GMMA 3ZFGB 3ME2A 1DFQA 1VB2A 3VBHC 4Q4Y2 4W6YA 4NHKA 3SCFA 5JOXA 2ZABA 2RS33 1HXS2 5EXOA 4Q4W2 3ACLA 5BNPA 3L9JT 1OPMA 4IL7A 4XMIA 1QNYA 3HR9A 2SLIA 2UYAA 5EWSA 2ZHKA 3RI9A 3VZOA 3J26N 5FO9B 1XE8A 3V0AA 5J09A 4FO9A 4AVVA 2WT2A 3FLTA 1ZVFA 1M4WA 1BBT3 4AGRA 1X8MA 1GICA 2R1BA 2EXIA 1YLLA 3VBFC 4AI3A 3WUDA 3ZFEA 1H30A 3APBA 3CJIB 1C8M3 4L11A 1W2UA 1MQTC 1U5XA 1ND2B 3OY8B 4M3CA 1W6PA 4FSJA 1GZWB 4CDWB 3QOPA 2ZZQA 3JB4C 2ENRA 4UW3A 3SITA 4NO4A 2Q5TA 3X29B 3LAGA 3KQRA 2VVEA 1EPWA 1OOPB 1V6LA 4Y4YA 3B9CA 4Q1RA 1ZBE3 3NO8A 1W6NB 1SCRA 1JHNA 4GULA 1UF2C 3ILNA 2VH9A 4PBPA 3ZFFC 1YYNA 2BW8A 3M8LA 4OI0A 3INAA 3VBSB 1D4M1 4HZFA 4PIXA 4Q4X3 1QWRA 5KHIA 3IDCB 3MW3A 4LO8A 3LZZA 2ZGLA 2PHWA 3QACA 2RS53 2RJLA 4Q0VA 2QVSB 4IV3A 1UIKA 1KFUL 4JCKA 4JGZB 1AXZA 5KXEA 4R4XA 4JVAA 3HD8B 1O3RA 4HLTA 2PHUA 2CYFA 1D0HA 2VG9A 2WKKA 4GQ7A 5J36A 5CB7A 1APNA 1GFF2 1VBE3 3UK9A 1R1A2 3HAGA 4YVSB 1J1LA 3TN93 2ZHMA 4B3NA 2YY1A 4QXKA 1VP6A 3ZXFA 4Y20A 1QJY2 2PA7A 2WSUA 4NOTA 2A3YA 5EJ3A 3DGTA 5F6LB 3VBRC 2XUMA 5T5OA 1Q8VA 3MIFA 3AZWA 1BBT2 1JW6A 3IPVA 4HK9A 1AR62 2FHRA 3I59B 1ZRCA 4FQZA 1UPIA 1NCQC 3VKFC 2R0FA 4DINB 1NOVA 1S0FA 5I0RA 5JPMB 4I0WB 1AX2A 1HIXA 3AFGA 5GZEA 1S0DA 3IIAA 3WG2A 4FAGA 1JYIA 1RC6A 4BPZA 3VZLA 4XBNA 1TNFA 5DG2A 4LTAA 1VAMA 1KD7A 3J9SA 4LEJA 2EVXA 3WW1A 2GDFA 2HWD2 3VL8A 4Z92B 1OA2A 4PIYA 3WX5A 3VHRA 1DGLA 1QQP1 1QJX2 4Q2FA 1OHFA 4AEDB 1OFNA 1VBC3 2AZ5A 4QPGB 4LT5A 3B94A 2XWJB 3J8F1 5EZWA 3GBGA 4K40A 4TYSA 1MEC1 1XNBA 5I0TA 2UWBA 1MS5A 4F7ZA 4YVWA 2UWCA 5EV7A 5IUQA 1CJDA 2NLRA 3MW2A 3NW4A 1H4GA 2F6BA 3D4KA 4G9SB 2PLV1 4HVRA 1R083 1RUG2 2W0XA 4I0AA 2OYZA 4R4ZA 1PVC1 4GH4C 5GALA 1Q56A 4YW4A 3E97A 1DG6A 2XJRA 4OHZA 2ETEA 4B4RA 4FPOB 1PO13 5DUVA 4HVOA 1VAKA 1YI7A 1BQPA 4S2HA 2W52A 1O5UA 4K21A 3KS7A 1REFA 3WDYA 1H8TB 5L7OB 1HQNA 1HRI3 3WW3A 3VZKA 3ZO0B 2ZMKA 3B02A 1DQ4A 5A3LA 1BXHA 4QPIC 5FMOS 4BZ4A 2ZACA 1ND3C 3V64A 4RL7A 3TAYA 2WLPA 4MVTA 2F4PA 2Q4SA 2ERFA 4OHVA 3WHTA 5BNQA 5KXCA 2ZGOA 1PGSA 1H1IA 3I7DA 1VBD2 2R30A 1LGBA 2UU8A 3BALA 1LHNA 2B39A 4XOGA 4XFAA 5FPZA 3ZXJA 3P3NA 3O0VA 5K0UA 5AFEA 3TBDA 3WZ1A 2YDEA 4E27A 2WL1A 1GV9A 5DXDA 1GZ9A 4B4QA 4JDOA 5LRRA 4E2SA 2EXHA 1RUI1 2DYCA 1TMF3 1DZTA 1A8DA 1ZZ6A 1C8NA 3JBG3 1ULE