3JUUA

Crystal structure of porphyranase b (porb) from zobellia galactanivorans
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
268
structure length
268
Chain Sequence
EAPHFKPGEDPRQPHQEWKLIENMSDEFEGKKIDEKKWQISGQGWIGRAPGLFLAENISLNNGSLQITTTMLPEPIVKNNKTYTHGGGYVGSRNGMTYGYYECEMKANKTFMSSTFWLINEGKDRLGCDKRTTELDIQESVGQITNDADWMKYFDQTMNSNTHSRNIPEGCEYEKGSSKGKAELGGKAYEDFHVYGVWWKSKDEIIFFLDGKMQSKVTPPADFDIEMYLRMVVETYDWNPVPKDGGMTGSKEDRTTTYNWVRSWQLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords porphyranase B
publication title Transfer of carbohydrate-active enzymes from marine bacteria to Japanese gut microbiota.
pubmed doi rcsb
source organism Zobellia galactanivorans
molecule tags Hydrolase/carbohydrate
total genus 64
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 3.2.1.178: Beta-porphyranase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3juuA00
2EF6A 4Q26A 4XJWA 3SH5A 5LK5A 4M3CA 3RQ0A 2YMZA 3VKMA 1HQWA 2A5ZA 4DPNA 5JOZA 4GKXA 1G86A 1KQRA 2D6MA 1AJOA 2PHTA 4RA0A 3FBYA 1LCLA 4YZ3A 4XTMA 3D6EA 3MW3A 3NV3A 3O0VA 1DQ2A 1LOFA 1N47A 4XILA 3RRDA 2ZHLA 3D4KA 2ARXA 1SLBA 2CWMA 3PMEA 3T1MA 2D6LX 5DXDA 4Y1ZA 4JC1A 2DVDA 1G9BA 1IS3A 1KDMA 1S0CA 2G4IA 2GNBA 2JECA 1ENRA 3WG1A 5GLVA 1AXYA 2ZGMA 2A75A 2VXRA 1S0FA 4LBKA 3T2TA 5JOXA 5T55A 1CQ9A 1VAMA 3B9CA 1LOFC 2Q5TA 4F83A 3ZXLA 5EYXA 1YXWA 2NZ9A 3AP7A 3WZ1A 5EWSA 1DYPA 2A6ZA 1LHUA 1MACA 2CL2A 2P2KA 5JLVA 1RITA 4XXPA 2CWSA 2CYFA 5T52A 2ZAAA 1I1EA 2R1BA 3WHTA 3Q9OA 4XE9A 2R1DA 4YW1A 1IS4A 2JE7A 1DLLA 3MW2A 1I3HA 1SLTA 5FRAA 3PJQA 1FV2A 2DV9A 3UK9A 1GICA 4Y1VA 5DUUA 1C1FA 1CJPA 1OKQA 1ZM1A 2DVBA 3WHUA 4FQZA 4D69A 1WLCA 1QF3A 1S0EA 2A6WA 4GWMA 1QDOA 1SFYA 1CESA 3AYEA 3OY8A 2DUPA 3R4SA 1LOCA 4C1WA 4CRQA 1DGLA 3LSEA 4YGEA 3SITA 3I4IA 4Q27A 5CB7A 1DQ1A 3ILFA 2UURA 2VU9A 1LOEA 1UN1A 2UWBA 2A3XA 3WG4A 3O5SA 1V00A 4H55A 2DTWA 2JKBA 1S0JA 2ZGKA 1VIWB 2GNTA 1WBFA 1FYUA 2C5DA 4Y1XA 1LU1A 3C2UA 4K20A 3D5OA 2EXHA 3GNEA 3O0XA 1NXD1 2WNEA 2BQPA 5CAZA 1JBCA 3B3QE 4Y26A 3TAYA 1SCRA 3VKNA 1GZ9A 1N1SA 2ZGNA 1F9KA 5GALA 1KRIA 1SLCA 4YGCA 1MS3A 3DGTA 1AX0A 1G8WA 1Q8VA 3AXDA 3SLIA 2ZGPA 3POSA 4M3CF 2NMNA 4YZ2A 2DVAA 3INAA 4Y1UA 2NP0A 4WVWA 4BM8A 2ARBA 3AX4A 3I8TA 3IN9A 2Z42A 4XTPA 4FPJA 1FNZA 1LECA 3IM0A 1UKGA 2VY0A 3MPPG 3R05A 3AYDA 3IPVA 4XJUA 3SISA 1LENA 2WSUA 4PBOA 4UW3A 2NYYA 1W6QA 2OUJA 4XJAA 3ZPYA 4M01A 4AVTA 4FP3A 4Y22B 2DVFA 1LJ7A 1W0PA 4FOWA 2E6VA 2OUHA 5JOWA 1JOJA 1UAIA 2TEPA 4ITCA 4TYSA 1DQ0A 5EXOA 5GZFA 5GLUA 1LTEA 2R0FA 1V6NA 2ZACA 4YFWA 3PVNA 5GM0A 3POYA 1UL9A 3USUB 1V6LA 2C9AA 3WNXA 4FPCA 1G9DA 2DU1A 3ZXEA 1A78A 1A8DA 1GKBA 1N3OA 4FPGA 5CA6A 5DG2A 1GNZA 2LALA 3OY8B 5T5LA 1JW6A 1B09A 1LHOA 3B00A 3NWKA 4JRAA 5KXEA 2DYCA 4KBBA 4FOVA 3RMXA 5AVAA 2WQZC 3WDXA 1KJRA 1LOGA 3T1LA 2WT1A 3AZVA 4XZPA 1WW4A 1IOAA 4FPKA 3OYWB 1GLHA 1MS1A 1QOOA 5DZGA 1JXNA 1MR5A 2AGSA 5DZEA 3L2YA 1FV3A 2AYHA 2FMDA 4YM2A 4CTEA 2NM1A 2A6XA 1FX5A 2JE9A 1AXZA 4Q2FA 3DUIA 3IKWA 2WKKA 4Y20B 1XQNA 5IUQA 1MZ6A 1OQ1A 2LTNA 3M3QA 1LGBA 2VW2A 3W59A 4Q8LA 3FUQA 1S0DA 2UWCA 2ZHNA 4L8QA 1UZYA 5GLWA 3KM5A 3HMYA 4K21A 1QNYA 2HYKA 4XJZA 3AZWA 1UX6A 4YGBA 1UZZA 1DHKB 1N1VA 3QCWA 4K1ZA 1HDKA 2WT2A 2PELA 4ISQA 3WLUA 2GDFA 2AUYA 1YI7A 2CNAA 1GZWB 3PVEA 4LBOA 4ATFA 4P14A 2EALA 3MEPA 2GMPA 1A3KA 3WOGA 1SLLA 1S0BA 4GXLA 1W6MA 4MYEA 1G9AA 2GMEA 4RL7A 3AYCA 3IPVB 5T54A 4WZFA 3ILRA 1Q8OA 4FPYA 5KXBA 3PVOA 3V0AA 4YW2A 2DVGA 1W6NA 1FAYA 3O12A 4YG6A 2WT0A 1MVQA 3A0NA 5F9TA 3BOPA 1BJQA 3VUOA 3ZSLA 1S1AA 3FLRA 5H9RA 2ES3A 5DUXA 2A3WA 5GZGA 5H9PA 1IKQA 1D2SA 1DQ6A 1GV9A 3WDWA 3UL2A 1Q8PA 3AFKA 1W6PA 2UU8A 5T5OA 4AGVA 4LBLA 1WD3A 1LGNA 2DUOA 4HL0A 1O4ZA 2NMOA 1FNYA 4W65A 2D7FA 5L73A 1GSLA 2ZABA 4P9YA 4YZ1A 3N7JA 1HKDA 2ZGQA 3QLQA 2ERFA 3HR9A 4LBJA 2XB6C 2PHFA 3AZXA 1G9CA 4FOQA 1YIFA 2DWRA 1EPWA 1V6JA 4I30A 3FFZA 4AYUA 3AZZA 3NV2A 4Z8BA 4WV8A 4XIOA 1AVBA 3WUDA 5JDBA 1Z78A 1V6MA 1YYNA 1KITA 4OZXA 4XBNA 4AVVA 4BPZA 1GYKA 5GZEA 3AJYA 4C1XA 2PHUA 4FPLA 2ENRA 1F31A 1NLSA 2A71A 3NV1A 2YZ4A 2JD4A 1WW5A 4M3CB 1MS4A 2D3SA 1CPNA 3AK0A 3RG0A 2V73A 2R49A 4R9AA 1SBDA 2R0HA 1MZ5A 1AX1A 5GLTA 5F5QA 2D6PA 1DBNA 5E88A 4YFZA 3WDYA 5JOYA 1VAVA 1W6OA 4XHBA 4BLJA 4DRVA 1SLAA 2JJ6A 3VKOA 2KM2A 3ILNA 1LULA 2EXJA 2WLQA 1CONA 4LBQA 1Z0HA 4FQ4A 2ZGLA 4P9WA 2D44A 2D3PA 1LEDA 2ZKNA 2ZMNA 2WJSA 3ATGA 3V64A 3ASIA 3ZYRA 4Q1RA 1WLWA 1H9PA 1N3PA 3AYAA 3LSDA 1UPSA 4YZ5A 4ASMB 1CVNA 1YO8A 2H0BA 1LOAA 2VW0A 2ZGSA 3SH4A 1C1LA 1WBLA 1U0AA 3V0BA 3WDTA 1URXA 1MS0A 1DQ4A 3N36A 2ZGRA 1KJLA 1KDKA 2ZMKA 2A7AA 1TEIA 1GNHA 3IMNA 2I2SA 1V6OA 2AENA 1SCSA 1IS5A 4HANA 1YRZA 3MW4A 1LOBA 2RHPA 3RMYA 1DQ5A 3ZYPA 1LGCA 1LHVA 3HN1A 1JN2P 1GBGA 2P3JA 3VV1A 3N3HA 2AR6A 5E89A 2PHRA 3LCPA 3WCRA 1MS9A 1FATA 2D43A 1WW6A 1ULFA 1D0HA 5KXDA 1J1TA 3FUOA 2E51A 5H9SA 2P3IA 1HQLA 1WCSA 2YY1A 1ENQA 1GANA 3M3CA 5T5PA 1GZCA 1MVEA 2V5YA 4PQ9A 3TB0A 4BLIA 3B69A 3JUUA 4Q1PA 4YM0A 4ZXKA 3ZXFA 1DFQA 1SBEA 1DYKA 1QOTA 4WVVA 2UWAA 1QOSA 5GZCA 1QDCA 2EXIA 1LESA 2EIGA 4U2AA 4DQAA 1V6KA 2DU0A 3O0WA 1BKZA 2P37A 1Y7BA 4XJ9A 2CY6A 1S0GA 4DRRA 1W6OB 2ZBJA 2SBAA 4IQPA 3AP5A 4UW5A 4LBNA 4PF5A 2DUQA 1IS6A 5CNAA 1N1YA 5E8AA 4ISRA 4XXAA 2P3KA 2DTYA 1IKPA 1F5FA 1G7YA 2GN3A 4GALA 1PZ9A 1QU0A 3AP4A 4AGGA 3M1HA 2WSVA 4GKYA 3AZYA 1SLIA 4FPOB 5HCBA 2E7TA 1Q56A 3BTAA 3N35A 4BOWA 3OPZA 3V0BB 1ENSA 2JDZA 3N7MA 2D3RA 2GNMA 1W6QB 1ZA4A 2CTVA 4SLIA 4FOYA 1N1TA 3FLPA 1JYCA 3AJZA 1AJKA 5HCAA 2W39A 4AGRA 1BYHA 4PCRA 1WUVA 2AREA 3BIWE 3N7KA 5JVVA 1HLCA 1V6IA 3U4XA 3RSJA 4CZSA 2D6OX 2OW4A 3VKLA 3AXEA 4FPHA 4JCKA 4YGDA 5DZFA 3JU9A 2XG3A 3WG2A 3ZXKA 4AVSA 1ULCA 5GJ6A 2NN8A 4P9XA 2B7YA 4R9DA 1N3QA 4XMAA 4NO4A 2ZGOA 3H0OA 3BODA 2ZZJA 3OJBA 3NV4A 2D6NA 4XHXA 4FVVA 4Y22A 4YZ4A 1SACA 1AXKA 1CN1A 4YLZA 1BZWA 1WW7A 1AZDA 3WG3A 4ZKTB 4XBLA 1MS5A 1Q8SA 1CPMA 2SLIA 4GWNA 3WUCA 1VLNA 3ZVXA 1LHNA 2GN7A 1OFSA 2AH2A 2FHRA 3M3EA 3USUA 4FPEA 4PBPA 4XIKA 2EAKA 3ZSJA 1AX2A 4DS0A 1LHWA 4UW4A 4XMIA 4R9BA 2ZMLA 2EXKA 2W08A 4XOGA 2OVUA 1JHNA 3N7LA 1CIWA 4YM3A 4XJ8A 5FREA 1AF9A 2ZA9A 5DUWA 4YG3A 1O4YA 1C57A 1ULGA 2YROA 5HCFA 4Q8KA 3POWA 4LBQD 1Q8QA 3OYWA 1X50A 1W0OA 3KQRA 2A6YA 4GA9A 2W68A 1W6MB 1RIRA 4U36A 4AWDA 4TZDA 1PZ8A 3SNMA 5GLZA 1JUIA 3OGGA 3V0AB 2GMMA 4Y20A 1W6NB 2E53A 3V65A 1H30A 3WCSA 4XBQA 4YG0A 2ZHMA 2YXSA 5SV8A 4YW3A 5IK8A 3A4UA 1QMJA 4Y1YA 4K1YA 1R1ZA 4BQ1A 1QGLA 1DZQA 3OBTA 3RS6A 1G9FA 2GALA 3WDVA 1W6PB 1ULDA 2E7QA 2YV8A 1BXHA 1C4RA 4YW5A 3SH3A 3WV6A 1CR7A 3M3OA 1GZWA 3VKFC 2P34A 5KXCA 3R4UA 4M3CE 4BMEA 4XYXA 4YW4A 2W52A 3UJOA 1JYIA 2D6KA 5IK4A 3WVJA 2DURA 5IT6A 5EYYA 4BMBA 3OBRA 3A0KA 1ONAA 2A70A 2R16A 1VALA 2VW1A 3B01A 1SBFA 4FP2A 3W58A 5CBLA 5JMCA 1MS8A 2A6VA 4Y24A 5IK5A 1H9WA 5T5JA 4ATEA 3GALA 1QKQA 3ZXJA 1RINA 1ULEA 5DUVA 4DFSA 1PZ7A 2A3YA 2ZHKA 5T50A 1WD4A 5GZDA 2ZGUA 4FPFA 4M00A 4XDQA 2VUAA 5IK7A 2PHXA 1BQPA 1LODA 4LBMA 1QNWA 2VH9A 3ZSMA 3ENRA 2ZGTA 3APBA 3WDUA 1WLDA 4LBQB 3UJQA 1DIWA 5DG1A 1LU2A 2GNDA 1LEMA 5BYNA 1APNA 1S0IA 3FLTA 3AP6A 1UMZA 3CNAA 4R9CA 4YM1A 5H9QA 4UW6A 3AP9A 4NOTA 3ZSKA 3M2MA 2PHWA
chains in the Genus database with same CATH superfamily
4CDQA 3SH5A 1EAH3 4M3CA 2OKXA 1G86A 2BNMA 3IBMA 3EO6A 3POJA 1PK6A 2FZ1A 5G04L 2WO3A 3D6EA 1DQ2A 2Q0AA 2J1VA 2QZ2A 3AVRA 3O14A 4XFIA 2Q1ZB 2ZPXA 4AQ6A 2ARXA 2CWMA 5LBCA 2D6LX 3VL8A 4CDQC 4LO7A 2CSGA 1SHWB 3K75B 4RQPB 2FBEA 1M4WA 1ENRA 5DAXA 2VMHA 4ZU5A 5CFDA 1LAJA 3LQCA 1PK6C 1CQ9A 1MZFA 4F83A 3K77A 2MPFA 1H4HA 3FJSA 2VCCA 2WQ4A 2WZ8A 2ZZQA 3AM2A 3OBAA 4IGPA 5CFDC 1AR61 2LROA 2XLAA 3U4SA 2P2KA 3LA3A 1D4M2 2Y60A 2CWSA 4JDOA 1HRV2 2BRTA 1SDWA 2E32A 5C3QA 4PDWB 1HW5A 2R1BA 3THPA 1I1EA 2J1AA 2KD7A 1Y4WA 4ES9A 1ZVFA 2JE7A 3C7FA 1KS5A 2G9ZA 3GBWA 1I3HA 3LEMA 5LBFA 1EV12 3OGVA 1FV2A 3T4HB 2OPKA 3VDBA 5DUUA 2WL1A 5FIXA 3JBG1 2DVBA 5E6HA 1BBT3 1WLCA 2J7MA 1QF3A 3PUSA 5LA2A 4ES8A 2HWE3 4Q4Y2 2XDVA 4YVSB 5F6LB 3A22A 1O3SA 3CIHA 2DUPA 2VVEA 3RI8A 3WNKA 4CRQA 3LSEA 5JMOA 1FOD1 1PVXA 2YDEA 1JZ8A 2VZSA 1YQCA 3I4IA 4TLGA 4GMP1 4OVEA 2PQQA 3AB0A 2UURA 3ZDVA 1LOEA 2UWBA 4H3WA 4RN5A 4WM8A 3B94A 3O5SA 2X5IA 2UYAA 1O3QA 1AYN2 2TBVA 2ZGKA 3HEIA 5FZ0A 3MHZA 3DKQA 2PXJA 1WBFA 2PMWB 4IEPA 4Y4RA 5JR2A 3C2UA 1ZBE2 2E26A 1QJU2 3LIHA 5F3CA 2EXHA 3WP5A 2BQPA 5CAZA 1A34A 1QJEA 2CAUA 4NHYA 4WM8C 1DGRN 2ZGNA 3S5QA 2X5IC 1KRIA 1BMV1 1V9U1 5CG8A 3VBUB 5D1IA 4CPBA 2PN5A 3TEWA 4QAWA 3SLIA 4E27A 3POSA 2NMNA 5FYZA 4L2NA 1A6CA 4RHV3 5IVVA 4XW3A 4WVWA 3KV6A 5FY8A 4A7KA 3I8TA 3MYXA 4XTPA 5IWFA 3TNQA 2VY0A 1MPXA 5DPNA 2ZEXA 5J3UA 2EAAA 1H0BA 2XLFA 2WSUA 1HB4A 4BIOA 5FMDA 4OZOA 1VBA1 3ZPYA 4CCNA 4B4RA 1QEXA 5FPUA 2RS52 2HJIA 1JTZX 4Y22B 2DBNA 5FYTA 4FOWA 1DZTA 4IV1A 3WT3A 5HV4A 1WMFA 3CLPA 2WDBA 1JOJA 1QWRA 4QPGA 3K2OA 4IGQA 4ITCA 1JZ3A 4QPWA 5EXOA 1UYZA 5A3OA 4AI2A 2R0FA 2Q8OA 4QQ2A 4YNIA 4YFWA 5GM0A 3LWCA 2VQAA 2C9AA 2VQ0A 4FPCA 4NAMA 4UFHA 3KGLA 4LO8A 4BB3A 1XU2A 2NLRA 3J4UH 3GM8A 4IV1C 3THTA 3WF4A 2LALA 2PTMA 5FZHA 3OY8B 4QPGC 4RR3B 4EROA 4XFAA 3VZKA 4H14A 1LHOA 3NWKA 4JRAA 3VDCA 4QHOA 4X6QB 4KBBA 2XWJB 5FKCA 5AVAA 1GP4A 3NO8A 5FZ9A 1KJRA 1SQ4A 2W3JA 5LY1A 2WT1A 3AZVA 1GMMA 2WN3A 4F8AA 5DZGA 1RGSA 3VZJA 1R64A 4A4AA 3NAPB 3ZYIB 4YM2A 4CTEA 3E6DA 4YPJA 1X82A 1FX5A 1ZRRA 2A6XA 3I2IA 5DDJ2 3IAQA 4IERA 5A7WB 3J8F2 5I8SA 4XFHA 2WZPP 4Y20B 4KL1A 1LRHA 3MDPA 4XFBA 4D3WA 3N4MA 2LTNA 2VW2A 2RG4A 4XAEA 4Q8LA 4A44A 5F37A 1W03A 2UWCA 4FT8A 4D0QA 4NPMA 2VOWA 1JZ7A 3EXUA 1B35A 2EIDA 4BQ2A 3ZYBA 4QGMA 3LOIA 3BALA 3PL0A 3QCWA 5LA0A 4GB31 3TRSB 1JYVA 4K1ZA 3GHMA 2PYTA 2WT2A 3QH7A 4XC9A 1AL21 1NZCA 2PELA 2AUYA 1YI7A 3FFQA 4S2FA 4ATFA 4I0BA 4P14A 2ZX1A 2GMPA 2XHNA 1B35C 1G9AA 3UKVA 1CIYA 3IPVB 1IHMA 1HRI3 3K48A 4FPYA 1H1AA 1RUC1 4HONA 5FTTC 1W6NA 2JB8A 2OS2A 4NHKA 1QXRA 4HVOA 1MVQA 1UXXX 3A0NA 2MEV2 1R091 1V70A 1NA1A 3B7MA 2BNNA 4L0PA 3ZSLA 3SKVA 1QHDA 4CUCA 5LEKA 2VBDA 4P9JA 3ZYJB 4CXWA 3X29B 1NQJA 2R041 1IKQA 1GV9A 4OMCA 4AE2A 1Q8PA 1C5HA 1WCKA 1W6PA 2WS93 4AGVA 2KXLA 3GJAA 4BJ0A 1ULPA 1O4ZA 2NMOA 4W65A 5L73A 1JHJA 3JD72 4L9BA 2ZABA 1J3RA 3QBQA 1NA1C 1OHFA 3RYPA 3WNMA 4ARYA 3VD9A 1HKDA 2GC1A 3VDAA 5C9AB 2ZGQA 1W0NA 3HR9A 1CWPA 3AZXA 3MF9A 3E1F1 4QXBA 2LS6A 4BDVB 5FPXA 1EPWA 1V6JA 2ZCWA 4I30A 2HWD2 2YG0A 4KGGA 1NY72 1W9WA 4NUBA 4AYUA 1SZBA 5JDBA 2ORXA 1V6MA 4EJRA 1KITA 4OZXA 4LIUA 1OLRA 3BPSA 3CZJA 2ATFA 2J1RA 2PHUA 4YRDA 2ENRA 1H6XA 4XUQA 1F31A 5A1FA 1FI2A 5JZGB 1VBE2 3U37A 1YEWA 4M3CB 5KR7A 3AK0A 1OI6A 4CCEA 1I5ZA 2BGCA 4LHLA 1TMF3 1PK6B 1OLQA 2Q30A 5CU1A 4OUMA 3VZNA 5A1AA 4LKEA 1ND2B 3WDYA 3WXPA 3LB9A 1NG0A 5FV3A 3FHAA 4BLJA 1X7NA 3S7EA 1NLQA 4IW3A 2RVAA 4Y4YA 1RUJ2 3FX3A 4GH4A 4EZ4A 4LOTA 1RUI1 4P9WA 3U10A 2D44A 3T3YA 5CFDB 2VNOA 2ZKNA 3ASIA 4EN7B 1WLWA 3W5MA 4NJ4A 3VD3A 2CU5A 3SC7X 1UPSA 4YZ5A 4MVTA 4IEUA 1YO8A 3MUZ1 1LOAA 2VW0A 1UD1A 4GH4C 2Q4SA 1RMU1 1O91A 3V0BA 4RHV2 1URXA 1BEV2 5KBFA 1CAXA 2W1SA 2XBO3 4BXFA 1S2EA 1PX4A 3N36A 4B4QA 2WRAA 4LA2A 1PIV3 1W9YA 2I07B 4JDNA 4Q4X3 4S2HA 1OA3A 4NHMA 4HETA 1TEIA 1D2QA 1DGWX 1SCSA 4CUBA 1REDA 1YRZA 1RHI2 2PLV3 3MGUA 3MW4A 4IL7A 4O7XA 1LOBA 2VBPA 5CKQA 4JGZB 1DQ5A 5C71A 3CHXA 4QQLA 2YGLA 3E97A 3G6JB 3WCRA 4URAA 4DEQA 5KXDA 2I45A 1VJ2A 2VECA 3ZKYA 3DF0A 2P3IA 3AFGA 4BISA 1PX3A 2YY1A 4N43A 1LKNA 5T5PA 1DGWA 1GZCA 4AF9A 4NHLA 2C4XA 4COUA 5FO8B 1GU3A 2F17A 1K42A 2X05A 2O8OA 3RWNA 2X5IB 5J7MA 2EXIA 4CP0A 1PHMA 2DU0A 3O0WA 5FK8A 2VC9A 2H6CA 3D0JA 4N43C 3T2PA 1PMJX 3NJZA 4XJ9A 2UY8A 2CY6A 1GQGA 1S0GA 4M0NA 1PMIA 1YI9A 2QTWB 4MUVA 1AR71 2WNUB 3AP5A 2K9ZA 5A3TA 2WNOA 1XU1A 2HH9A 3H8XA 3IAPA 1F5FA 2GN3A 2YB7A 4JTOA 4UFJA 4D6SA 2BTVC 2VNGA 1PGW1 4N7UA 2TUNA 4N8MA 4FPOB 5A3WA 1AR82 1RUF2 2J1SA 5JIUA 1Q56A 3ZFGA 2QUOA 3OPZA 1HXS1 1AR93 3HQXA 1P8JA 4GJYA 5FMCA 4AR2A 5FZ4A 4CXYA 3LAGA 1YQ2A 2CTVA 4QX2A 5HBAA 1UYYA 1N1TA 2XHKA 2VCMA 4CVUA 2WWJA 5E16A 3LF7A 4E4SA 4IV3A 4CDWA 1K5JA 3ALQA 3ZFGC 4AGRA 1BYHA 4K9SA 4BWOA 3N7KA 1PGSA 1XSRA 2HEWF 4UT5A 1AYM1 2D6OX 1UU6A 4CUGA 3ECQA 4LE4A 4CZSA 4EWAA 4FPHA 1WCDJ 4I0WB 3N9MA 3RVHA 1KD7A 2MHFA 3WG2A 1W05A 2BOIA 4IV3C 1ULCA 1UOBA 3DYPA 3I3QA 3MLLA 4LO5B 4OFGA 4XACA 5L9RA 3VBHA 4CDWC 3TN92 4HPKA 2XOMA 2IUWA 2ZGOA 3H0OA 3JZVA 1HB2A 5K4LA 5JAXA 4XHXA 2BNOA 3OUIA 4ZZ5A 2R072 4RFT0 2VMEA 2RMU2 4AL9A 4MGKE 1D4M1 4NHXA 1MS5A 4HVQA 3VBHC 1Q8SA 1CPMA 1OD5A 2B4KA 2SLIA 5FZ8A 5IAVA 3RDIA 1HRV1 4L99A 5AC93 4KMQA 2FDFA 1LHNA 2GN7A 3USUA 3CO2A 4HZFA 4XIKA 4PBPA 1BHGA 4Q4W2 5DQ0A 2GU9A 3HWJA 1BMV2 1RUD3 1EV11 4UW4A 4BK4A 1US3A 4R9BA 2ZMLA 3KZ4C 1B35B 1CJDA 1RJ8A 2OVUA 1JHNA 3U07A 1CIWA 3KT4A 1VAKA 4XJ8A 4DEVA 5BNPA 5F5AA 3B93A 1UY4A 4Q4Y1 1BVP1 2C24A 4SBVA 5DUWA 1C8M2 2QKDA 3VHRA 4UBHA 2ET1A 4AFCA 5K0UA 4XF1A 2D5FA 1X50A 2E63A 4ZU7A 2W68A 1RIRA 4U36A 5DAVA 4TLFA 2O1QA 3IMMA 5BNPC 4GZ9A 2JDHA 3HD8B 1W6NB 4IUGA 4BU2A 2OX0A 3WCSA 5C3SA 1AYN1 1NA1B 2EA7A 2YXSA 4LORA 3MUY1 5K0UC 2D98A 5IK8A 1QMJA 3WF0A 1ZBE1 1R1ZA 1QJU1 4BQ1A 1PO11 5LK7B 4UOJA 5A70A 4RQPA 2VCBA 2RJKA 1W6PB 1L7QA 2YV8A 4TN7A 5J36A 4DNYA 4HKOA 4MXWA 1UU5A 3WNLA 1GZWA 1YCIA 4IEOA 2F4LA 2VE1A 4GWIA 1XBFA 4QHBA 4XYXA 5FY0A 2BPA2 4CDUB 5IK4A 1MQTB 2WWSA 3P6BA 4BMBA 5K9YA 4YARA 4RQPC 3ZMOA 3OUHA 4FP2A 4W6WA 1CX4A 1KS4A 5FXVA 1CD3G 4LLOA 2A6VA 1EPZA 5IK5A 2VMFA 2XH6A 3MLKA 5T5JA 1XYOA 1KGYA 5CADA 1FT9A 3PUHA 1RINA 4EE2A 1GUIA 2BWCA 4PDWA 3TEXA 2D93A 2JIGA 4JQRA 4O65A 3KF3A 5IVBA 2RS51 4QB1A 2R32A 4H2AA 4KGQA 5LA1A 4OCTA 1WD4A 5GZDA 2HYXA 4LK6A 4BIFA 3H1WA 2VUAA 5IK7A 4LKSA 5JIAA 1ASJ2 3ELNA 1QNWA 4PDWC 3ZSMA 5JPNB 4XCAA 1WLDA 3PVBB 4YVSA 4GH4B 1DIWA 5EZWA 4DUXA 1LEMA 4D94A 4IE0A 2WN2A 1APNA 3AP6A 3CNAA 4OI2A 2RM21 2BZDA 2QQUA 4UW6A 3ZFEA 2PAKA 1HB1A 2VZVA 2ZOEB 3ZYFA 3VD4A 4QKBA 4Q0QA 5I0UA 1OF4A 4QXCA 5FP9A 5IVJA 3VKMA 3RQ0A 4YVSC 4EWDA 1HQWA 3WNOA 5A6ZA 5CKNA 4UFIA 2XJSA 4GKXA 1UOGA 1KQRA 2BJSA 3I2GA 2QQNA 1XC6A 2HWF2 4OMDA 4XTMA 4COZA 3Q8CA 1CAXB 4XFGA 3O1MA 2R042 4NRPA 4V2WA 3ZFEC 1UF2C 1KXGA 5DDJ1 4A45A 2IFRA 4OQ8A 2XXZA 3CKHA 3J8F1 4XILA 4C90A 1W28A 4Z07A 1SLBA 3HBKA 3T1MA 2QVSB 1K12A 5DAPA 1WWYA 5DXDA 3P1IA 3ZDSA 4JC1A 4A7ZA 2EIBA 1KDMA 2JECA 3WG1A 3URFA 2A75A 5F3EA 2TNFA 2VXRA 4AAXA 4CP2A 5T55A 3S7IA 2QQIA 3B9CA 4QQHA 4IGOA 4IEWA 2MNGA 3VDDA 2W5FA 2Y6HA 5EWSA 5JPMB 2FQPA 3AMQA 5EPAA 5FPBA 5FJHA 2GAUA 3PHMA 3IDBB 4URTA 1MACA 4N43B 3MO4A 2FDGA 1RITA 3ZR5A 4XXPA 5T52A 4S2DA 3T0AA 2GC3A 4WZCA 3WHTA 3VDDC 2YC2A 2MEV1 1SLTA 2BVVA 4Q5OA 1MZEA 4NE9A 5F5IA 1JYWA 3DV8A 2WZEA 4UI9L 2JG8A 3UK9A 1GICA 2W1WA 1OKQA 4B4PA 1W3XA 2JDPA 2WAOA 4D69A 1OT5A 4XQDA 3CL1A 3KS7A 4IESA 1M06G 1SFYA 3TBDA 3JD71 5FY7A 3AYEA 3OY8A 3USSA 4C1WA 1GWMA 1TQ5A 4XCBA 3EQEA 3SITA 3AMMA 2JG8C 5HPOA 3CZUA 2X29A 5CB7A 1DQ1A 2HWD1 1UY0A 2ARCA 1NY71 1UZ0A 4JX0A 4B1MA 1SEFA 3VZMA 2RS13 1BBT1 2VU9A 1UN1A 3LPGA 3N9PA 4I0AA 3ZFFA 3DXUA 4XFCA 3ZFGB 2JKBA 1Z7S2 4BH9A 4HKLA 2RR13 2GNTA 4BXSV 3KB5A 5A7WA 1ULOA 1VBE1 3A21A 3ETPA 5C3RA 4K20A 3D5OA 1ZZBA 3UETA 3GNEA 4AVCA 1V0AA 3EJKA 4Y26A 4MXVA 1RUE3 1GZ9A 3ZFFC 2XJTA 1F9KA 4IV3B 5LB6A 4CDWB 2IXHA 2VQUA 2JDMA 5APAA 4QM9A 5FXWA 1F5JA 2IXKA 4PT6A 4UFLA 1AX0A 1G8WA 3OGSA 4PLOA 4EZHA 5L9VA 1JMUB 3AXDA 1RUJ1 3LA2A 1YFWA 4YZ2A 1ND3B 5C33A 2ZXQA 3INAA 1WKYA 1W39A 1EY2A 2ARBA 3JB4C 1ZRDA 3AX4A 1GP5A 1FNZA 1UKGA 4JHZA 4DUVA 3IPVA 3LFIA 3UKTA 1LENA 3ME2A 3VBFA 1RTVA 4LKFA 2OUJA 1XNTA 2E33A 3KHBA 4AVTA 1NOVA 4P9GA 1LJ7A 1W0PA 1XNKA 4RHV1 3MIFA 2E6VA 3NSTA 2OUHA 3BYWA 5JOWA 5CIRA 3PU8A 1LR5A 3C8XA 1DQ0A 5A6QA 1YFXA 2C9KA 3IT8A 4Q0PA 2DBIA 1AR72 2W94A 1R082 3PVNA 1VRH2 3USUB 3VBFC 3BIEA 4HK8A 4OULA 3HBZA 3VL9A 2B39A 4QQOA 4AFAA 2DU1A 4W6XA 4PJYA 1A8DA 1J3PA 1ZYBA 4W6YA 4Z2WA 2Y33A 1RUG2 3ACFA 2Y6JA 3B00A 1B09A 1WA6X 2VVFA 4LHNA 4OUEA 4FOVA 4XAAA 4R52A 3RMXA 3K3OA 3WDXA 1K5MA 1LOGA 2VMIA 3KV4A 1PVC2 4HFSA 5K0UB 4OHXA 4FPKA 4XEZA 5DZEA 1GLHA 1HXS2 1QOOA 5I0RA 5JZGA 1FV3A 2ET7A 3ES4A 2NM1A 4LK7A 1H2LA 2JE9A 1W2NA 3POEA 4P08A 4Q2FA 3W21A 3T08A 3KQ4B 3IKWA 2WKKA 3N9NA 1XQNA 5IUQA 3VBSB 4A42A 4YYOA 3M3QA 1K5MC 3RZHA 3W59A 1ND2A 2Q8EA 4JTNA 3WSOA 1QNYA 2HYKA 4XETA 5JZGC 1UX6A 4FI9A 1AYM2 1DHKB 1N1VA 4YVWA 4BQXA 5C5UA 2WA3A 4MOAA 3LD8A 4IE5A 4MXWB 1FPN3 3ES1A 2CNAA 1IPJA 1GZWB 3PVEA 4LBOA 4MG2A 1E5HA 1TNFA 1ZZ8A 1ND2C 3MEPA 4AI0A 1A3KA 3WOGA 1NKGA 3VZLA 3TEZA 4MYEA 3UT0A 1R1A2 4RL7A 1COV2 5T54A 3KV5A 4WZFA 4KWJA 1UPIA 2JB4A 4YW2A 1YUDA 4R8HA 1RXFA 1AR81 1RUF1 2VTXJ 2WT0A 3HNMA 4NIIA 3GZAA 1S1AA 5H9RA 1W90A 4MGYE 5BV6A 1H8TB 4HN0A 3ZIXA 3BN6A 3O1SA 2C26A 5H9PA 3OSDA 2UU8A 1ZREA 2W92A 1YFUA 4LBLA 1WD3A 1UW8A 1UKRA 2LUWA 4IEYA 1YIPA 4JGZA 5FP3A 5L9BA 4BK5A 3N7JA 4G4FA 1NE4A 1XNBA 3GCWA 4LBJA 2EICA 4FOQA 2GC0A 1XSQA 4Z8BA 4EN8B 3NV2A 3AKPA 4D7YA 1AVBA 2VXJA 1Z78A 1O3TA 4BPZA 3I2KA 5GZEA 4JGZC 4MX3A 5BPXA 3ZFEB 3TN91 4FPLA 4XVHA 3UGGA 2G9FA 2GH2A 3MBWA 3NV1A 2JDKA 2YZ4A 3D8CA 4NROA 4RFRB 1QJY3 1BVVA 2VVDA 5C70A 4AI8A 2R071 1DDLA 1VBD2 4R9AA 2RMU1 4INDA 5CVRA 5FZFA 4KWUA 4UF0B 1PO12 3MV01 5E88A 5FBZA 3OOXA 5JOYA 5BUVA 2WNUA 4DRVA 1UO9A 4Q4W1 2KM2A 3UGFA 3CBNA 1LULA 3WW3A 2CGPA 4QKFA 4JRLA 1HN0A 1Z0HA 2ZGLA 5FMOL 3DKWA 3LZZA 5J1XA 1JYXA 4BQ3A 3ATGA 3S30A 3HT1A 1TMF1 3ZYRA 3EBRA 4QHZA 2IFWA 4IDZA 1H9PA 2RS33 3AYAA 3DL3A 1VBC3 4LULA 3VDDB 2WNUC 2FCUA 1C8M1 4DXSA 2H0BA 1RUH2 4QU1A 1C1LA 3M70A 1U0AA 4AVAA 5HI0A 3WDTA 4MADA 3AKRA 2FMYA 5D8AA 3LA7A 3EMRA 1MS0A 4DINB 2E31A 2EIEA 2ZGRA 1KJLA 2ZMKA 3I2FA 3ON7A 5SV5A 2A7AA 3FWEA 2D40A 5HCHA 5JWPA 3IMNA 3ITQA 4LR4A 1W9FA 1SPPA 1O5LA 3NNJA 4AG4A 4DUWA 2A1XA 2VZTA 3RMYA 3UGHA 2JG8B 3NKGA 1QJX2 1LGCA 1WMEA 1LHVA 5D8AC 4ZZ8A 5TSWA 4RYDA 5FOJB 3ZN6B 4C0HA 3KVAA 2BOJA 2AR6A 4CU7A 2Y34A 5KWRA 2W95A 1FATA 2YUEA 1WW6A 1ULFA 1D0HA 2RM22 3HOBA 1ZBA2 2RJLA 4NPRA 1FMD2 1F15A 3NJYA 2PLV1 3I2JA 1ENQA 1TME2 2H6BA 2R063 2WO1A 3POFA 2V5YA 4PQ9A 4QX7A 5A7OA 3UKNA 4FTSA 4Q1PA 3J7LA 3OG2A 2WZR3 1C5IA 2F6BA 3LEGA 3WF1A 1ZX5A 1PO23 1UQXA 1QQP3 4I09A 5FY5A 3ZFFB 3ZR6A 5EQUA 2UWAA 2Y0IA 4OHVA 1O8SA 1J3QA 4FFGA 4DQAA 4Q0SA 1BKZA 3HIFA 1I9RA 1W8OA 3AMNA 1Y7BA 1UCXA 2BV4A 1XOYA 3QH6A 3ST7A 3BTYA 4TXWA 1EAH2 2ZEWA 1Q3EA 3IDEA 4TSVA 4UW5A 4LBNA 2Y8KA 2WO7A 1WGPA 1BLZA 1IS6A 5CNAA 5FK7A 2XMLA 2JEMA 1L7LA 4BQWA 1OH4A 1ASJ1 2DTYA 1ODNA 4HK9A 1JODA 3K4DA 4Q0UA 1W9TA 1A8MA 2RDSA 4N53A 4AHYA 2DFCA 4QB2A 4AGGA 2ZS6B 3AKTA 2WIIB 4QX3A 2WSVA 3UV9A 3AZYA 4ASLA 2E7TA 3MFCA 1REEA 3BTAA 2IXIA 2BYVE 3WP4A 1ALYA 4P9IA 4W8JA 1H4GA 1T6BX 2JDZA 2VD7A 4CEWA 3ZN5A 3GHNA 3VBFB 2QFEA 3T30A 5B4XA 1ZA4A 4E4HA 4N53C 2O14A 1NQDA 1RB8G 4Y3OA 2HWF1 3AJZA 1OPMA 4MZUA 1AR63 1WUVA 3MV11 2BFUS 2DF7A 1HLCA 4CEWC 1CZSA 1AR91 3RSJA 2GSYA 5I0DA 4JCKA 5M0TA 4YGDA 3IB3A 4E9KA 2VZUA 3JXSA 5DZFA 2XG3A 1W8TA 2XJUA 3AKSA 3KVBA 3ZXKA 1ODMA 5IVEA 1AL0G 4CDUA 2JDYA 5GJ6A 4CCLA 2BGPA 2BERA 1HB3A 1MQTA 2FDIA 4AFMA 1JZ6A 5ISLA 2EVXA 5FYYA 2W0XA 3JBG3 2VZOA 3PMSA 1POV1 3CU7A 4NMIA 1BBT2 4NO4A 2ZZJA 5C4WA 2W9XA 5A3NA 3H8RA 1K5MB 4KWKA 4ZU4A 2HWE2 2K0GA 2QZ3A 5BNOA 4BYYA 4YLZA 1BZWA 1X8MA 1XJAA 5CKMA 4CDUC 4FTBA 1RVF3 1MQTC 3IWZA 3DYMA 3POGA 4GMP3 5ACA3 3I59A 3M3EA 4NIAA 4WM7A 5C4WC 3AMHA 4DS0A 2JKXA 4XMIA 4QM8A 5BNOC 5IATA 2Y6GA 4LLFA 4OHYA 4XOGA 2VMGA 3H3LA 4BQ4A 3BCWA 4ZY9A 5HXMA 1GOFA 4MHRA 4YVWB 2UYBA 4NIHA 3GZTB 5FZEA 2ADEA 2BEOA 5AC91 1AF9A 4A3XA 4WM7C 2Q8CA 3ZO0B 1O4YA 2N7GA 2V09A 2VUCA 2B9UA 2UY9A 1JI6A 1ULGA 2QQLA 2VR4A 3GZUC 5HCFA 3RZJA 1RUD1 1V9U3 1XE8A 5LW9A 2A6YA 4KU8A 5EJZB 1PZ8A 2G1MA 3WQ0A 1JUIA 4UAPA 5IVYA 1GNYA 4CDXB 2V4AA 1NX9A 5FZDA 5DAWA 3KCYA 5ERLA 3V65A 3ACLA 3I3MA 1HN1A 1Z7S1 1TE1B 1C28A 4I01A 4YW3A 3A4UA 1JU4A 1OFNA 3F95A 3KSCA 1OXCA 1G9FA 2GALA 2IXCA 4XDOA 2OQ7A 3RS6A 1ULDA 3FE5A 1VBA3 4YW5A 1C4RA 2IC1A 3GBFA 4GJZA 1CR7A 4YW7A 3M3OA 2VO5A 3VKFC 1OQDA 2P34A 2VTXA 4M3CE 3WW4A 5KXCA 1JYIA 1K45A 4MGIE 5FZLA 3U0ZA 2D6KA 1MEC3 5IT6A 1LNSA 2WUHA 3A0KA 3FC0A 3W58A 1DF0A 2YYOA 3B01A 4UFKA 4AEDA 4V1PA 1MS8A 4E8DA 1UZVA 2Y64A 2J1UA 1JYTA 2WYSA 3H8OA 2Z69A 4X8PA 1VBB3 2R062 3OUJA 3FBMA 2A3YA 4AEDC 1WLTA 2ZHKA 5DMYA 2ZGUA 4FPFA 4K8RB 1FXZA 1NE6A 5FLJA 1LODA 4LE3A 5FPLA 5KHKA 1R081 1VRH1 3R0RA 3UYJA 2ZGTA 4ARXA 1NT0A 4QDQA 3O7OA 4PI0A 2GNDA 1YLLA 4JZRA 2GP5A 5BYNA 3FLTA 5H9QA 1UMZA 3I49A 1RUG1 3H3ZA 5BNQA 1SFPA 3WX5A 3RZZA 1L3JA 3J26N 1IPSA 1YJLA 2JENA 2JIJA 4I3PA 3ZSKA 4E8CA 5IFPA 5F6KA 3HPNA 4GB33 2EF6A 4Q26A 4XDPA 4D8MA 2C1FA 4AW7A 1UNBA 5AVPA 4HVRA 2A5ZA 1AL23 1PVC1 1NCQA 3H3UA 4JDMA 3SCHA 4Q29A 4F3JA 1AJOA 1PM4A 2PHTA 1GFF2 3OGJA 3FBYA 1RL3A 3CJXA 4RA0A 4YZ3A 3TYJA 2PFWA 4J6GA 2XJQA 2VG9A 4LMFA 4OI4A 5D8AB 5IFTA 1LOFA 2V4VA 5JSOA 1VE0A 3Q8FA 3HQUA 3RRDA 2ZHLA 3O1VA 2FCTA 3D4KA 2W91A 4FXKB 1HRI2 1REFA 4Y1ZA 2PHLA 1G9BA 1HX6A 1RUC3 2G4IA 2GNBA 3GJBA 3LKJA 1NCQC 5F7UA 5GLVA 1SPPB 4HOOA 5J96B 1R093 2XVGA 1DGRA 5JXGA 4EV0A 4LBKA 3OEBA 3LE0A 2CDPA 3T2TA 3O1TA 2WBKA 1LOFC 2Q5TA 3IIAA 1JOBA 5EYXA 1YXWA 5F5CA 1ND3A 1W8NA 2NZ9A 3AP7A 2JDNA 3RFRA 2WINB 5F1RA 1W8HA 2WS92 5CYYA 4L97A 4LUKA 2QQVA 1LHUA 3WW1A 4CXXA 4EN0A 5ANQA 1R1A1 3UESA 1COV1 2QCSB 3NW4A 3RJ2X 2HWB3 1ND3C 2ZAAA 3HJRA 3HVDA 4XE9A 4C8DA 3KCCA 1IS4A 3I3BA 2IXLA 1QJFA 2Z79A 1DLLA 2ID4A 3U75A 1W8UA 5FRAA 1CX1A 3NQHA 3RZGA 3PJQA 4L92A 4WVZA 5F9TA 2DV9A 3P3NA 4Y1VA 5LATA 4G3YC 1CJPA 2LRPA 1ZM1A 1ZZ7A 2W46A 3RYRA 1PMHX 1RVF2 1S0EA 2A6WA 4GWMA 1QDOA 4KBZA 5FP7A 5IJRA 1PGL2 4FAGA 3AL5A 1GWLA 3HNYM 4AHZA 1CESA 2RDRA 3EB7A 1TMF2 3R4SA 1LOCA 5FPZA 4DY5A 2DCZA 3MIDA 2YHJA 3BKZA 2YFUA 4Q27A 2DCTA 2I74A 4N53B 1UZWA 1X9PA 1PNFA 4PQQA 3WG4A 1O4TA 1RUI3 4DXTA 4H55A 2DTWA 3VN4A 4DIQA 3TEYA 3WF3A 3ZPOA 4IE6A 1FYUA 4CEWB 4Y1XA 3VBSA 3WQBA 1NXD1 1QIQA 1AHSA 1JBCA 3B3QE 1VBD1 2VNRA 1POV0 1SCRA 1OA2A 1RMU3 1PM7A 3H1MA 4ZXEA 2O8QA 2BUKA 5F39A 3MF6A 3DGTA 5EHDA 1IGOA 2QBXA 2XBO2 4E2QA 1Q8VA 3M7AA 3VBSC 1UOFA 2ZGPA 1BK1A 1PIV2 4M3CF 2BBAA 4Q4X2 5EFUA 5T3NA 4AZZA 4B1LA 3CJIA 3ACIA 1OC1A 4BM8A 3LEIA 4QX8A 5C3OA 1TVGA 4J25A 2GH8A 2PLV2 2Z42A 4FPJA 1CZTA 3IM0A 3R05A 3MIEA 3NRUA 3ACGA 3AYDA 3SISA 4XJUA 4K8FA 5C4WB 5FZOA 3HT2A 4PBOA 2D97A 1W6QA 1H2NA 2NYYA 3B02A 3I3EA 1MEC2 1RUH1 4M01A 4FTEA 5BNOB 5A6XA 4Q4V3 4QMAA 1H8TA 4ZPIA 1U5ZA 3LFMA 5FQ0B 5GLUA 2J1EA 4LT5A 1NZIA 1LTEA 1V6NA 3I59B 3WNXA 4WM7B 3ZIWA 1V6LA 4QQPA 1HIXA 4L11A 1VBB2 5FYIA 4CU9A 1W99A 4KH9A 1A78A 1N3OA 1UX7A 2Y38A 1RYYA 5DG2A 1NLRA 1X8EA 1GNZA 1QJX1 1H8TC 3VBOB 2WAAA 3DN7A 1JW6A 1XYPA 4MSVA 5KXEA 4JGYA 1D4VB 4NWWA 5FO9B 1CZVA 2DCYA 1ZBA1 3T1LA 1FMD1 1WW4A 5F3GA 1IOAA 3DEMA 1OOPB 1Y43B 1TME1 1WMXA 3CMGA 5IVFA 2FZ2A 1S4CA 3L2YA 2FMDA 2HEVF 3SEPA 1AXZA 3DUIA 2G19A 1JZ2A 2FDKA 4JGYC 1OQ1A 4FBFA 1NUKA 4JAAA 1LGBA 5FZGA 3ZYGA 3FUQA 1W2AX 2ZHNA 3ZMNA 4UF0A 2WWUA 4AVBA 4W4ZA 5GLWA 1YC61 3KM5A 4N90A 4BLIA 4NIDA 4K21A 3AZWA 4MGQA 1AR92 4YGBA 1UZZA 1JYNA 5FUNA 1EAH1 1HDKA 1F4HA 2RDNA 1XPWA 4NAOA 2IZWA 2GDFA 1S55A 3OBZA 5L19A 3T0DA 3KWVA 3Q8EA 3IDCB 3K3NA 3M3IA 1S0BA 1W6MA 5FZAA 4CE8A 2VOTA 4V2VA 4XZUG 3W5NA 1C3HA 3I2OA 2VMDA 1Q8OA 2VOXA 3ILRA 3PVOA 4CP1A 4AEDB 3V0AA 2DVGA 1FAYA 3O12A 4Z82A 3JB8A 3BOPA 4C91A 3NJVA 4HSJA 5F8PA 3VBRA 3MICA 2ES3A 4LXLA 3SQOA 3RYKA 5JXJA 4P00B 5JSPA 4JKKA 5GZGA 2B42B 5A80A 3WDWA 3S0MA 3UL2A 3Q8BA 3AFKA 4HMZA 3UNPA 5T5OA 5JSRA 1YQ8A 3WNNA 1W2OA 1LGNA 2BGOA 2PAEA 2HWB2 2ZEYA 4HL0A 4KWLA 1UXZA 3LDRA 2D7FA 2RV9A 4P9YA 2VUDA 3VBRC 1D4M3 3ZN6A 3QLQA 2ERFA 2JX9A 2XB6C 3DYOA 1GQHA 5AC92 2DWRA 2JICA 1GOGA 1QH6A 1YFYA 2PAMA 2AC1A 5IYYA 1YYNA 4AVVA 3GCXA 1RUD2 4CU8A 1EV13 3EYPA 3AJYA 5FMBA 3BVCA 2WA4A 3WP6A 3FZ3A 2GP3A 1X36A 2HWE1 1CPNA 1NCQB 3J7NA 4Q4Y3 3RG0A 2WFF3 4HG6B 1F4AA 1SBDA 3G7DA 5D21A 4BCUA 1W8ZA 5F5QA 1OF3A 2D6PA 1DBNA 4UBGA 1DZRA 2ILMA 1VAVA 3WW2A 4LHKA 4E2GA 3PTRB 1SLAA 2JJ6A 2VZ1A 3VKOA 4BQYA 4COWA 5AFEA 1UU4A 2EXJA 1CONA 2WLQA 1NXMA 1XYNA 1CAWB 1Q43A 1QJY1 2LM3A 5A3MA 1AYN3 5FYHA 4OHZA 2ZMNA 2WJSA 2VTFA 5FKBA 4UFMA 1IG0A 1ZBE3 1QJU3 2P5BA 3ZKUA 1CVNA 4CU6A 1DP0A 2OQ6A 4FO9A 1EP0A 3AC0A 1T2XA 4QX0A 5B2GB 1J59A 3SH4A 1LB2A 3L9JT 3PUAA 3LDBA 1WBLA 5J98B 5BNNB 4QPYA 4RGAA 4N9IA 4BQ5A 4B3NA 1KEXA 1DQ4A 5JI7A 2PQSA 5B4NA 3RWKX 3PNAA 4O9GA 3S6PA 1IPKA 1V6OA 5FUPA 1IS5A 4HANA 3NNFA 3BGAA 4A6OA 2JD9A 5FJKA 3ZYPA 2QQKA 2YC0A 2VOVA 5I8YA 3HN1A 3N9OA 4Q4V2 3ETQA 1JN2P 3KT1A 3KD4A 2P1BA 2VJXA 5C7GA 1ZRIA 3N3HA 3N9LA 5E89A 2RS53 1L7RA 1Y9QA 2PHDA 2D43A 2ZX0A 3C7EA 3HNBM 4FXGB 4P5HA 3SXWA 1J1TA 4QWNA 3FUOA 2E51A 2JG9B 2ZX2A 1WCSA 1GANA 1ZA7A 2CGNA 1VP6A 5JR7B 5A3LA 3JUUA 3CDZB 4YM0A 5KHGA 3PIGA 4QX5A 4A3ZA 3ZXFA 1DFQA 3J9SA 4K6BA 3P5BA 3WY6A 2VUJA 4FFFA 4QKNA 2XR4A 5GZCA 1QDCA 1UY2A 2EIGA 2YPJA 1J83A 4CUAA 5CFCB 5J48A 1DG6A 5FAXA 5FY4A 2R061 5FY9A 3JQXA 5L7OB 1W6OB 2SBAA 4IQPA 2VAUA 3ACHA 3WEZA 2ZAHA 1QQP1 2DUQA 5JXIA 4LA3A 2DCKA 4AHXA 5F2WA 4XXAA 2P3KA 4PHZA 1IKPA 1O59A 2Z5WA 3KV9A 5DDJ3 3VLBB 3AP4A 4LO6B 1YHFA 3E5XA 4NPLA 5A6YA 4XPVA 4AEMA 3L2HA 5C6CA 3CJIB 3M1HA 4E2SA 4GKYA 5LBEA 3KMHA 2R6QA 1SLIA 1OBNA 3ORJA 4BOWA 3SHRA 5LY2A 3SEEA 2G9GA 1ENSA 1JS9A 3K51A 1UY1A 4IE7A 3N7MA 4XUNA 4YVWC 2D3RA 3W20A 5FZOB 4CDXA 1W6QB 4OUSA 4D7TA 2QE3A 4SLIA 2VCAA 4FOYA 3BI3A 3FLPA 5IW0A 2QQPA 1S2BA 1AJKA 5HCAA 1JU3A 4XABA 4PCRA 2AREA 3BIWE 5FWEA 1I5PA 3CQOA 3IZOA 2Y6KA 1HRI1 4CDXC 2OW4A 3TWIA 5JI9A 5FPAA 3O1PA 3AXEA 2VPVA 2NQYA 2MEV3 1Q5OA 1NAEA 1SDDB 1T6GC 2XQRA 3JU9A 4AVSA 2XVLA 5JUVA 4QGNA 5A1LA 3AVSA 3K46A 3MIGA 2B7YA 2HKXA 3D0SA 3KGZA 1N3QA 1CAUA 3ABZA 3PIJA 3POIA 4HT1T 4XMAA 2OYZA 3WINE 4JGYB 5FWJA 2A73B 2BBVA 2WS91 1NCRB 1XNDA 3NV4A 2D6NA 4JV4A 4GIQA 1W8WA 4YZ4A 1SACA 1AXKA 1U5YA 1CN1A 3JD73 4META 4ZHNA 1WW7A 1AZDA 3WG3A 4ZKTB 4XBLA 1U5IA 2Z4FA 3GXUA 3WUCA 1BK0A 2J1TA 2XUMA 3ZVXA 3VGIA 1VMJA 1OFSA 2W47A 2HWD3 4XF0A 1GR3A 3DCQA 4FPEA 3OGRA 1XRUA 1YNAA 2RS12 4NWVA 4QDSA 4UYBA 2XPJA 4QT6A 4ZONA 4E4ZA 5I93A 1C8NA 1OKOA 2RR12 2WFF2 5LASA 1EYBA 1YQ5A 2BDRA 4A41A 3U4XA 1VBE3 3N7LA 4YM3A 3FMGA 1RVF1 5A32A 1AUYA 5FREA 4NRQA 1PGL1 1SMVA 5FLHA 5ACA1 4IXLA 3V56A 4NRMA 1C57A 1CAVA 1RUE2 2XJPA 4RGGA 2DDUA 4LBQD 3ZXDA 1OVSA 5KC5A 5FXXA 1Q8QA 3OYWA 3RNSA 1W0OA 2VMCA 3KQRA 4TZDA 5K8SA 1W6MB 2YBSA 3SNMA 3T2OA 2WNVB 2VM9A 2XONA 3P3PA 3OGGA 5GLZA 3VHOA 2WLPA 4AAPA 3POBA 2Y6FA 3V0AB 5FY1A 1RUJ3 3KHCA 4ZS3A 2QJVA 4XBQA 4YG0A 4BE3A 5SV8A 3FN9A 3VBRB 4D7SA 4LIVA 5DABA 4Y1YA 3ZLIA 1W04A 3THCA 4R4ZA 2W87A 5IAXA 3I97A 1DZQA 2CAVA 3OBTA 4QPIA 3A7QA 3WDVA 4JQTA 1BXHA 3ZXGA 4JKLA 3WV6A 5FLIA 1J1LA 2P6CA 3WD5A 4BMEA 4YW4A 1BEV3 2JDAA 2W52A 3S57A 4QGLA 1UIKA 2XBO1 1JOPA 5EIYB 4COVA 2BW8A 3C7OA 5EYYA 1PIV1 2CGOA 2JWPA 2VBBA 4Q4X1 4QPIC 3WF2A 1ONAA 1E57A 5CBLA 2YPDA 3KT7A 2ARAA 4M4RA 1RHI3 2B9VA 3U78A 3GALA 4QDRA 5FXZA 4HLTA 3SMHA 3ZXJA 1OMIA 1ULEA 3C7HA 3E5UA 4GAZA 4Y5TA 3TOJA 3O1OA 1OUSA 4LJHA 4DFSA 1MEC1 4FAHA 1PZ7A 4XFFA 2HWC3 2W1UA 5FPVA 4QX1A 4M00A 2WO2A 3LPFA 2VGDA 4ORFA 5A33A 3I2DA 2OXBA 5J09A 4DXRA 3NJXA 1BQPA 4LBMA 2P3YA 3APBA 4GD4A 1VBB1 1UIJA 4R4XA 3E5QA 3UJQA 5DG1A 1LU2A 1QY4A 3BPZA 1JZ4A 5FP4A 1H1MA 1VR3A 1DLCA 1O8PA 3GZEA 4KQ7A 4PIXA 4XQWA 5EP9A 5IVCA 2JE8A 3I7DA 4NOTA 3W9AA 2PHWA 4EYUA 1Y9MA 4XJWA 5LK5A 5JOZA 4AFDA 2YMZA 4DPNA 3TNPB 3ROUA 1FPN2 2D6MA 1LCLA 1JUHA 1F35A 3MW3A 5HV0A 3NV3A 3O0VA 1XNAA 1H2KA 1N47A 2XKPA 2XUEA 1VMHA 3PMEA 4HBNA 2PA7A 2JXAA 1F8VA 2ADDA 2DVDA 3OEAA 1IS3A 1S0CA 3RZMA 4EQVA 1AR83 1RUF3 4D6QA 1AXYA 2ZGMA 2IVIB 1S0FA 1D7PM 2YBPA 5JOXA 1JZ5A 1VAMA 1IQDC 3DECA 2BU9A 3OTFA 5A7PA 2CHHA 3ZXLA 2OT7A 2XJVA 5KHHA 2XWBB 5LWBA 3WZ1A 2QNKA 4AEJA 4GQ7A 1DYPA 2A6ZA 5A7QA 3WP3A 2CL2A 5ABJA 5JLVA 2B46X 2Y26A 2CYFA 3Q9OA 1O5UA 3OD0A 2R1DA 4YW1A 1G6NA 4HN1A 2CV6A 3MW2A 1FOD3 2IWGB 4RS5A 3H42B 3D82A 3PUQA 4IE4A 5FQ0A 4LHSA 2ZJCA 1XE7A 3TN93 2XL9A 5ABJC 3B5LB 3FHQA 1C1FA 4Y5SA 4FQZA 3K4AA 3WHUA 5I8TA 3M4FA 1GP6A 1O3RA 1WA4A 2HWB1 1QJY2 4GWJA 2R073 3ZN4A 2BVBA 5CZKA 1YWKA 3M8LA 2RMU3 1H6YA 3VBOA 3WR0A 4RS5C 4CCOA 1DGLA 1SG3A 2V72A 5FP8A 1I6XA 1UOJA 4B7EA 3BTZA 4YGEA 3RZKA 2OZ6A 4CEYA 2X10A 3J7HA 4K7JA 5G05L 5CG9A 3PUIA 3ILFA 4CSWA 5KC6A 2C6SA 2NPIA 4Q4W3 2IXJA 4OYUA 1W06A 4CDQB 1RC6A 2A3XA 1OOPA 5J37A 1V00A 4HKWA 3VBOC 1S0JA 2P17A 4AQ2A 1VIWB 2C0ZA 3VD5A 4AI3A 2C5DA 1LU1A 2RS32 2P4EA 5C3PA 4CEYC 2ZEZA 1VBC2 4CCDA 3O0XA 2WNEA 1ZZ9A 1C8M3 3TAYA 1OUXA 3E6BA 2WABA 3VKNA 5A7SA 1N1SA 1XB9A 1OOPC 3NNLA 4QD2A 5GALA 4CCMA 4DXZA 4OLLA 5FR3A 5JXHA 1SLCA 4YGCA 3ZX7A 4OQ9A 1MS3A 2VOKA 1GQPA 2L9LA 1HV1A 2WFPA 5I0TA 4XF3A 4YSFA 2DFBA 4CCCA 3JQWA 4XQ4A 5FCCA 5FZBA 5LRRA 2DVAA 2WYFA 2YGMA 3IIIA 4Y1UA 2NP0A 1E5RA 4AI1A 2VZRA 5EJ3A 3DPRA 3IN9A 1LECA 1IG3A 3MPPG 5FUIA 4IETA 5FZ6A 4CP9A 3BUCA 3C7GA 1CAUB 1QJZA 5I0SA 2FDJA 5LZ6A 4UW3A 4JKMA 5F2SA 5FYSA 4XJAA 1TNRA 4FP3A 2VZPA 3DXTA 1TG7A 2DVFA 4GMP0 1UYPA 4BA6A 2VL4A 2QDNA 1UAIA 3DPRC 2TEPA 1PNGA 4TYSA 2JDUA 3I54A 5GZFA 1OH3A 2ZACA 2WZR2 1UL9A 3POYA 1OQEA 2X09A 1PO22 1G9DA 4M4PA 1QQP2 4F7ZA 3ZXEA 1GKBA 4FPGA 3GYDA 2FCVA 5CA6A 3ZOIA 2HWC2 5C8CA 2VULA 3MPBA 4H7MA 4I3GA 5FMOS 5T5LA 4Q4V1 1DU3D 3PTYA 4MGZE 1OLMA 4QXHA 3FL7A 5A32B 2B8MA 2DYCA 3NVCA 4W50A 3H7YA 2R7EB 5LBBA 2WQZC 3IDAA 4WVMA 5LA9A 1CAVB 4A2UA 1YQ6A 1VRBA 4XZPA 5KHJA 1OA4A 4WM8B 3OYWB 1MS1A 1VMFA 2YC4A 1JXNA 1MR5A 2AGSA 5C8CC 2AYHA 4IEVA 4YW6A 1ASJ3 5C9AA 2E7AA 2KA3A 1BCXA 2BWAA 5A3UA 3HAGA 3H50A 3MIHA 1MZ6A 3I3DA 4FSJA 2YFZA 1RJ7A 1S0DA 1POQA 2OIIA 4L8QA 1UZYA 2OA2A 3O1UA 3HMYA 2WR9A 1H8VA 4XJZA 5C8WA 2XL7A 1RUNA 4QPIB 3RJRA 1EUTA 2XQXA 3LIGA 3ZYHA 5C9AC 1W8FA 3VHNA 1CAWA 2H0VA 4ISQA 2E9QA 3WLUA 4LEJA 1W9SA 2EALA 2HLEA 2HWF3 3PLQA 4S2GA 4AQSA 2R043 1SLLA 4I02A 4GXLA 4AQTA 4DZGA 3SCFA 4PLMA 1HJFA 1AR62 2GMEA 5FZ3A 1RXGA 3AYCA 3AKQA 4CCJA 5KXBA 1H1IA 4FFHA 4YG6A 5BNNA 3QD6A 2P6HA 4OI1A 3VUOA 1BJQA 2W2IA 1ZRFA 4O61A 3FLRA 4MHUA 5DUXA 4IV1B 2A3WA 5C5TA 4YWAA 5L36A 1OPOA 4QPGB 3QACA 2ZX3A 1DQ6A 1D2SA 4IEQA 1XNCA 1YJKA 3A23A 3JBG2 3OPTA 2WQ8A 4LUMA 1POV3 4XUTA 4QKDA 1VPHA 4UXAA 4AI9A 2Y0OA 4GULA 1DYOA 2DUOA 5BNNC 3RGBA 1X9TA 1FNYA 3KLSA 4G9SB 1GSLA 4YZ1A 5CEHA 5A33B 4O9EA 4ET7A 1FOD2 3LGRA 2PHFA 1G9CA 4Z92B 1J58A 1YIFA 1ZZCA 5ACA2 1ST8A 3FFZA 3SCGA 3AZZA 2AEYA 3ZM8A 4WV8A 3VZOA 4XIOA 3WUDA 4TTGA 2JG9A 4XBNA 2X8KA 1GYKA 2ETEA 1W2UA 3QOPA 4C1XA 1Y3TA 4JHTA 3JCIA 4EN9B 1NLSA 2A71A 1TZOA 4EN6B 2JD4A 1WW5A 4DOUA 1MS4A 2D3SA 1Y9GA 2V73A 1QH7A 2XVKA 2R49A 4EWEA 3K4ZA 2R0HA 2JG9C 1MZ5A 1AX1A 1ZRCA 5GLTA 2KR2A 5CFCA 5L7OA 1VB4A 1V9U2 1DCSA 2OZJA 4OHWA 4PIZA 4YFZA 1W6OA 4J1XA 4XHBA 1UMIA 4FFIA 3NL1A 4RSUA 2QQOA 3ILNA 1UYXA 2J42A 2RS11 4LBQA 4CYDA 4FQ4A 1UY3A 5FZKA 1U5XA 3I2HA 2HEYF 5BY5A 2D5HA 2D3PA 1LEDA 1Z7S3 2WFF1 2RR11 3V64A 3PDQA 5CFCC 5L7OC 4Q1RA 3BTXA 2QQMA 1WZXA 1N3PA 5KHIA 3LSDA 2AEZA 4Y33A 1OVPA 2XLGA 4CPBD 4ASMB 1QXPA 2QDRA 2CDOA 2Y6LA 1VBA2 2ZGSA 1RUE1 1WCQA 3H8UA 3NNGA 3OPWA 5ABJB 4AEKA 3N9QA 1NYWA 1KDKA 5IHRA 3CJIC 4DMIA 4H7LA 5K7PA 1GNHA 5FYMA 4Z1VA 2I2SA 2AENA 4ONUA 3BOWA 5FO7B 4RS5B 3BU0A 3MZHA 2RHPA 3CF6E 5BXXA 2ZX4A 3F2ZA 2OPWA 5DAQA 1GBGA 5I91A 2P3JA 3MIBA 4X8NA 3VV1A 2XGXA 2PHRA 2ZKLA 3LCPA 1MS9A 4XURA 3RI9A 1W3VA 4K40A 5H9SA 4AK3A 1HQLA 4K3UA 2Q8DA 3M3CA 3TB0A 4BHPA 1MVEA 3R6SA 3H9AA 4CEYB 4C0BA 1NCRA 4NVPA 4ZXKA 1AR73 1R083 1VRH3 3BB6A 2Z2SB 5JCTA 1UMHA 2AACA 3MI8A 4XF4A 3NMBA 1SBEA 4WBBA 1DYKA 1QOTA 4WVVA 5FYVA 2WC2A 1QOSA 1LESA 5EJ1B 3OF1A 4U2AA 1RUG3 1V6KA 3S5AA 5D2AA 1US2A 4XUOA 2P37A 4M0HA 1D0GA 4Z2AA 1NCRC 4DRRA 4GB32 2ZBJA 4N9HA 4B29A 2VQTA 5FDBA 3J7MA 1AL22 1H2MA 1PVC3 4PF5A 4E4DX 4BZ4A 5E8AA 1N1YA 1HXS3 4ISRA 4CA9A 4MH0E 5F3IA 2B5HA 2J22A 4MGSA 4IEXA 4UWDA 2BP6A 1G7YA 2XJRA 1ZNPA 4GALA 1PZ9A 1QU0A 1E5SA 3H7JA 1KFUL 3KF5A 4MV2A 3VHPA 4OI0A 4HSLA 1ZZ6A 4TWTA 1RUC2 4B7KA 1ENXA 5HCBA 5A7NA 3WQ1A 5DN2A 3DPRB 3H1YA 3N35A 1R092 3O1RA 2WNVA 4KG8A 4CP9B 3V0BB 1AYM3 1HJGA 5FZMA 2RJ2A 2GNMA 3T4VA 4LNVA 3NNMA 5FZIA 1J84A 4COYA 1KFXL 1FPN1 1XE0A 2Q1FA 3U11A 1JYCA 5HXVA 1O6UA 3OB8A 2W39A 3FHIB 3VD7A 5JVVA 3VBUA 2WNVC 4ASKA 1R1A3 1V6IA 1COV3 3R4DB 3HN3A 2XKOA 4LITA 2O0OA 5FZ7A 3VKLA 3E6CC 2RDQA 2Q1MA 4DY3A 5AFBA 4P9LA 4AHWA 5C8CB 4XF9A 2R30A 2NN8A 1HRV3 2W1QA 4P9XA 3AMPA 4R9DA 1GOHA 4NR1A 3VBUC 2YU2A 4AOCA 2DCJA 2YU1A 3SKJE 5FOBB 3GBGA 5LEJA 3BODA 3OJBA 3LOBA 3THDA 4WVMB 4AXOA 4FVVA 3PU3A 4Y22A 1W2TA 3CEWA 1WMDA 1E5IA 4XUPA 5GKAC 4QU2A 2K2SA 4KU7A 1VB2A 5FFOC 5EV7A 4D6RA 1HV0A 2RE9A 4KG0A 1S2KA 3LEKA 4GWNA 1VLNA 3GDBA 3T0BA 3ZXAC 3RZLA 1U12A 2AH2A 2FHRA 2ORZA 3PJYA 2EAKA 3ZSJA 1AX2A 1HQNA 3D3AA 4Q0VA 1RUI2 1IZ3A 1LHWA 5FYCA 4HXCA 5FZ1A 3WNPA 4LKDA 4LTAA 1EUUA 2EXKA 2QQWA 2W08A 4RR3A 4QXKA 4B8EA 4RD7A 4LO4B 1STMA 4X6RB 3U1XA 4PF1A 2ZA9A 4YG3A 3VB9A 2LW8A 1VBD3 4KNCA 4QB6A 1XXNA 2YROA 4Q8KA 1CGPA 2K46A 3POWA 5LRSA 3B9IA 1RMU2 3KCXA 4A6SA 1ACCA 1PO13 4AWDA 4GA9A 3NAPA 4RR3C 1K3IA 3ZSEA 4PI2A 2X53S 1SFNA 2GC2A 4KI5M 2GMMA 4Y20A 5A3PA 1F2NA 2E53A 2YBKA 1H30A 2QQJA 4CCKA 2ZHMA 1OLME 4MGTA 4ZS2A 1JH5A 4LOSA 1QXJA 1UWWA 2RS31 4K1YA 3NAPC 4PLNA 5E1RA 1VBC1 1QGLA 3NKTA 4NIGA 2E7QA 4IEZA 3T09A 1GZTA 3HQRA 4FCAA 4N7IA 3SH3A 1RUH3 3C3VA 5FZCA 3PURA 3R4UA 3Q8AA 2AZ5A 2ZTNA 4P02B 3T2QA 3UJOA 3GF6A 3VBHB 3WVJA 1OURA 2DURA 4P5YA 3OBRA 4HPKB 3U14A 2R16A 2A70A 2VW1A 1VALA 4A7YA 3BU7A 1SBFA 5CISA 5JMCA 1O7FA 2FD8A 4AFBA 4DO0A 4Y24A 4RGKA 5F32A 3RPQA 2GZWA 2B45X 2VNVA 1H9WA 1WCUA 4ATEA 2FDHA 1QJX3 3MFAA 1QKQA 2VZ3A 1BEV1 4LPLA 4Y5Z0 5DUVA 1OSGA 5FBJA 3WQ7A 2VZQA 2V5DA 1IQAA 4MO3M 4DB5A 2BFUL 2IVJA 1ZBA3 2RM23 5T50A 1FMD3 5LCWL 4XDQA 3OD4A 1RHI1 4J1WA 1TME3 3LDKA 4MLOA 2PHXA 2HBUA 2VH9A 2WZR1 3AL6A 5ANNA 3ENRA 4LQRA 1X33A 4NN0A 3WDUA 1PO21 5BNPB 4LBQB 4I2OA 3GGLA 2F4PA 3EHKA 1PGW2 5FYBA 1S0IA 2HWC1 4YM1A 4R9CA 4JVAA 3OCPA 3MLJA 2HBTA 3AP9A 3J8F3 5FYUA 1OD3A 3M2MA 1RUOA 3B69A 4PIYA 1GWKA
chains in the Genus database with same CATH topology
4CDQA 3SH5A 1EAH3 4M3CA 1G86A 2BNMA 3IBMA 3EO6A 1PK6A 2FZ1A 3D6EA 1DQ2A 2Q0AA 2QZ2A 3O14A 4XFIA 2Q1ZB 2ZPXA 4AQ6A 2ARXA 2CWMA 2D6LX 3VL8A 4CDQC 4LO7A 4RQPB 2FBEA 1M4WA 1ENRA 4ZU5A 2VMHA 5CFDA 1PK6C 1CQ9A 1MZFA 4F83A 2MPFA 1H4HA 3FJSA 2WQ4A 2ZZQA 3AM2A 5CFDC 1AR61 2XLAA 2P2KA 3LA3A 1D4M2 2CWSA 4JDOA 1HRV2 1SDWA 1I1EA 4PDWB 1HW5A 2R1BA 3THPA 4ES9A 1ZVFA 2JE7A 1KS5A 3GBWA 1I3HA 1EV12 1FV2A 2OPKA 5DUUA 2WL1A 3JBG1 2DVBA 1BBT3 1WLCA 1QF3A 4ES8A 2HWE3 4Q4Y2 5F6LB 4YVSB 1O3SA 4CRQA 2DUPA 2VVEA 3RI8A 3LSEA 1FOD1 1PVXA 2YDEA 3I4IA 4GMP1 4OVEA 2PQQA 3AB0A 2UURA 1LOEA 2UWBA 4H3WA 4WM8A 3B94A 3O5SA 2X5IA 2UYAA 1O3QA 1AYN2 2TBVA 2ZGKA 1WBFA 4IEPA 3C2UA 1ZBE2 1QJU2 2EXHA 3WP5A 2BQPA 5CAZA 2CAUA 4WM8C 1DGRN 2ZGNA 2X5IC 1KRIA 1BMV1 1V9U1 5CG8A 3VBUB 5D1IA 2PN5A 3SLIA 4E27A 3POSA 2NMNA 4L2NA 1A6CA 4RHV3 4XW3A 4WVWA 4A7KA 3I8TA 3MYXA 4XTPA 3TNQA 2VY0A 5J3UA 2EAAA 1H0BA 2XLFA 2WSUA 4BIOA 1VBA1 3ZPYA 4B4RA 2RS52 2HJIA 1JTZX 4Y22B 4FOWA 1DZTA 4IV1A 3WT3A 1WMFA 3CLPA 1JOJA 1QWRA 4QPGA 4ITCA 5EXOA 4AI2A 2R0FA 2Q8OA 4QQ2A 4YNIA 4YFWA 5GM0A 3LWCA 2VQAA 2C9AA 2VQ0A 4FPCA 3KGLA 4LO8A 1XU2A 2NLRA 3J4UH 4IV1C 3THTA 2LALA 2PTMA 4EROA 3OY8B 4QPGC 4RR3B 4XFAA 3VZKA 4H14A 1LHOA 3NWKA 4JRAA 4X6QB 4KBBA 2XWJB 5AVAA 3NO8A 1KJRA 1SQ4A 2WT1A 3AZVA 4F8AA 5DZGA 1RGSA 3VZJA 3NAPB 3ZYIB 4YM2A 4CTEA 3E6DA 1X82A 1FX5A 1ZRRA 2A6XA 5DDJ2 4IERA 3J8F2 5I8SA 4XFHA 2WZPP 4Y20B 4KL1A 1LRHA 3MDPA 4XFBA 4D3WA 3N4MA 2LTNA 2VW2A 4Q8LA 2UWCA 4FT8A 2VOWA 3EXUA 1B35A 4QGMA 3LOIA 3BALA 3QCWA 4GB31 3TRSB 4K1ZA 3GHMA 2PYTA 2WT2A 3QH7A 1AL21 1NZCA 2PELA 2AUYA 1YI7A 3FFQA 4S2FA 4ATFA 4I0BA 4P14A 2ZX1A 2GMPA 1B35C 1G9AA 3UKVA 3IPVB 1IHMA 1HRI3 3K48A 4FPYA 1H1AA 1RUC1 5FTTC 1W6NA 4NHKA 1QXRA 4HVOA 1MVQA 3A0NA 3B7MA 2MEV2 1R091 1V70A 1NA1A 3ZSLA 2BNNA 5F9TA 1QHDA 5LEKA 4P9JA 3ZYJB 3X29B 1NQJA 2R041 1IKQA 1GV9A 4AE2A 1Q8PA 1C5HA 1WCKA 1W6PA 2WS93 4AGVA 2KXLA 1O4ZA 2NMOA 4W65A 5L73A 3JD72 4L9BA 2ZABA 1J3RA 3QBQA 1NA1C 1OHFA 3RYPA 1HKDA 2GC1A 2ZGQA 3HR9A 3AZXA 3MF9A 5FPXA 1EPWA 1V6JA 2ZCWA 4I30A 2HWD2 4KGGA 4AYUA 1NY72 5JDBA 1V6MA 4EJRA 1KITA 4OZXA 1OLRA 2ATFA 2PHUA 4YRDA 2ENRA 1F31A 1FI2A 5JZGB 1VBE2 4M3CB 3AK0A 1OI6A 1I5ZA 2BGCA 4LHLA 1TMF3 1PK6B 1OLQA 2Q30A 5CU1A 4OUMA 3VZNA 1ND2B 3WDYA 3WXPA 3LB9A 1NG0A 4BLJA 1X7NA 3S7EA 4Y4YA 1RUJ2 3FX3A 4GH4A 4P9WA 1RUI1 3U10A 2D44A 5CFDB 2VNOA 2ZKNA 3ASIA 4EN7B 1WLWA 1UPSA 4YZ5A 4MVTA 4IEUA 1YO8A 1LOAA 2VW0A 1UD1A 4GH4C 2Q4SA 1RMU1 1O91A 3V0BA 4RHV2 1URXA 1BEV2 5KBFA 1CAXA 2XBO3 3N36A 4B4QA 4LA2A 1PIV3 2I07B 4JDNA 4Q4X3 4S2HA 1OA3A 4NHMA 4HETA 1TEIA 1D2QA 1DGWX 1SCSA 1REDA 1YRZA 1RHI2 2PLV3 3MGUA 3MW4A 4IL7A 1LOBA 4JGZB 1DQ5A 4QQLA 2YGLA 3E97A 3G6JB 3WCRA 5KXDA 2I45A 1VJ2A 2VECA 3DF0A 2P3IA 3AFGA 2YY1A 4N43A 1LKNA 5T5PA 1DGWA 1GZCA 4AF9A 4NHLA 4COUA 5FO8B 2O8OA 3RWNA 2X5IB 5J7MA 2EXIA 4CP0A 1PHMA 2DU0A 3O0WA 3ZYGA 2H6CA 3D0JA 4N43C 3NJZA 4XJ9A 2UY8A 2CY6A 1GQGA 1S0GA 4M0NA 1PMIA 1YI9A 4MUVA 1AR71 2WNUB 3AP5A 2K9ZA 1XU1A 1F5FA 2GN3A 4JTOA 2BTVC 2VNGA 1PGW1 4N7UA 2TUNA 4FPOB 1AR82 1RUF2 5JIUA 1Q56A 3ZFGA 2QUOA 3OPZA 1HXS1 1AR93 3HQXA 3LAGA 2CTVA 5HBAA 1N1TA 2XHKA 5E16A 4E4SA 4IV3A 4CDWA 3ALQA 3ZFGC 4AGRA 1BYHA 4K9SA 4BWOA 3N7KA 1PGSA 3U4XA 2HEWF 4CZSA 1AYM1 2D6OX 1UU6A 4EWAA 3ECQA 4LE4A 4FPHA 1WCDJ 4I0WB 1KD7A 2MHFA 3WG2A 4IV3C 1ULCA 4CDWC 3VBHA 3MLLA 4OFGA 4LO5B 3TN92 4HPKA 2ZGOA 3H0OA 3JZVA 5JAXA 4XHXA 2BNOA 2R072 4RFT0 2RMU2 4MGKE 1D4M1 1MS5A 4HVQA 3VBHC 1Q8SA 1CPMA 1OD5A 2SLIA 3RDIA 1HRV1 4L99A 5AC93 1LHNA 2GN7A 3USUA 3CO2A 4HZFA 4XIKA 4PBPA 4Q4W2 2GU9A 3HWJA 1BMV2 1RUD3 1EV11 4UW4A 4R9BA 2ZMLA 3KZ4C 1B35B 1CJDA 1RJ8A 2OVUA 1JHNA 3U07A 1CIWA 3KT4A 1VAKA 4XJ8A 5BNPA 3B93A 4Q4Y1 1BVP1 4SBVA 5DUWA 4AQ2A 1C8M2 2QKDA 3VHRA 4UBHA 2ET1A 4AFCA 5K0UA 4XF1A 2D5FA 1X50A 2E63A 4ZU7A 2W68A 1RIRA 4U36A 4TLFA 2O1QA 5BNPC 3HD8B 1W6NB 3WCSA 1AYN1 1NA1B 2EA7A 2YXSA 5K0UC 2D98A 5IK8A 1QMJA 1ZBE1 1R1ZA 1QJU1 4BQ1A 1PO11 5LK7B 4RQPA 2RJKA 1W6PB 2YV8A 5J36A 4DNYA 4HKOA 4MXWA 1UU5A 1GZWA 1YCIA 4IEOA 4XYXA 4QHBA 2BPA2 4CDUB 5IK4A 1MQTB 2WWSA 4BMBA 5K9YA 4YARA 4RQPC 3ZMOA 4FP2A 4W6WA 1CX4A 1KS4A 1CD3G 4LLOA 2A6VA 1EPZA 5IK5A 2XH6A 3MLKA 5T5JA 1XYOA 5CADA 1FT9A 1RINA 2BWCA 4PDWA 2D93A 4JQRA 2RS51 2R32A 4KGQA 1WD4A 5GZDA 4BIFA 3H1WA 2VUAA 5IK7A 5JIAA 1ASJ2 3ELNA 1QNWA 4PDWC 3ZSMA 5JPNB 1WLDA 3PVBB 4YVSA 4GH4B 1DIWA 5EZWA 1LEMA 4D94A 1APNA 3AP6A 3CNAA 4OI2A 2RM21 4UW6A 3ZFEA 2PAKA 2ZOEB 4Q0QA 5I0UA 3VKMA 3RQ0A 4YVSC 4EWDA 1HQWA 2XJSA 4GKXA 1KQRA 2HWF2 4XTMA 4COZA 1CAXB 4XFGA 2R042 3ZFEC 1UF2C 1KXGA 5DDJ1 2IFRA 3J8F1 4XILA 4C90A 4Z07A 1SLBA 3T1MA 2QVSB 5DXDA 3ZDSA 4JC1A 4A7ZA 1KDMA 2JECA 3WG1A 3URFA 2A75A 2TNFA 2VXRA 4CP2A 5T55A 3S7IA 3B9CA 4QQHA 4IEWA 2MNGA 3VDDA 5EWSA 5JPMB 2FQPA 3AMQA 2GAUA 3PHMA 3IDBB 4URTA 1MACA 4N43B 1RITA 4XXPA 5T52A 4S2DA 2GC3A 4WZCA 3WHTA 3VDDC 2MEV1 1SLTA 2BVVA 1MZEA 3DV8A 2JG8A 3UK9A 1GICA 1OKQA 4B4PA 4D69A 4XQDA 3CL1A 3KS7A 4IESA 1M06G 1SFYA 3TBDA 3JD71 3AYEA 3OY8A 3USSA 4C1WA 1TQ5A 3SITA 3EQEA 3AMMA 2JG8C 2X29A 5CB7A 1DQ1A 2HWD1 1NY71 1SEFA 3VZMA 2RS13 1BBT1 2VU9A 1UN1A 4I0AA 3ZFFA 4XFCA 3ZFGB 2JKBA 1Z7S2 4BH9A 4HKLA 2RR13 2GNTA 3KB5A 1VBE1 4K20A 3D5OA 1ZZBA 3GNEA 4AVCA 3EJKA 4Y26A 4MXVA 1RUE3 1GZ9A 3ZFFC 2XJTA 1F9KA 4IV3B 4CDWB 2IXHA 4QM9A 1F5JA 2IXKA 1AX0A 1G8WA 4PLOA 3AXDA 1RUJ1 3LA2A 1YFWA 4YZ2A 1ND3B 5C33A 3INAA 1W39A 1EY2A 2ARBA 3JB4C 1ZRDA 3AX4A 1FNZA 1UKGA 3IPVA 3UKTA 1LENA 3ME2A 3VBFA 1RTVA 2OUJA 4AVTA 1NOVA 4P9GA 1LJ7A 1W0PA 1XNKA 4RHV1 3MIFA 2E6VA 3NSTA 2OUHA 5JOWA 5CIRA 1LR5A 1DQ0A 1YFXA 4Q0PA 3IT8A 3USUB 1AR72 3PVNA 1R082 3VBFC 1VRH2 4HK8A 4OULA 3HBZA 3VL9A 2B39A 4QQOA 4AFAA 2DU1A 4W6XA 4PJYA 1A8DA 1J3PA 1ZYBA 4W6YA 4Z2WA 1RUG2 3B00A 1B09A 2VVFA 4LHNA 4FOVA 4R52A 3RMXA 3WDXA 1K5MA 1LOGA 2VMIA 1PVC2 4HFSA 5K0UB 4OHXA 4FPKA 4XEZA 5DZEA 1GLHA 1HXS2 1QOOA 5I0RA 5JZGA 1FV3A 2ET7A 3ES4A 2NM1A 1H2LA 2JE9A 4Q2FA 3IKWA 2WKKA 1XQNA 5IUQA 3VBSB 4YYOA 3M3QA 1K5MC 3W59A 1ND2A 4JTNA 1QNYA 2HYKA 4XETA 5JZGC 1UX6A 1AYM2 1DHKB 1N1VA 4YVWA 2WA3A 4MXWB 1FPN3 3ES1A 2CNAA 1IPJA 1GZWB 3PVEA 4LBOA 1TNFA 1ZZ8A 1ND2C 3MEPA 4AI0A 1A3KA 3WOGA 3VZLA 4MYEA 1R1A2 4RL7A 1COV2 5T54A 4WZFA 4KWJA 1UPIA 4YW2A 1YUDA 4R8HA 1AR81 1RUF1 2WT0A 3GZAA 1S1AA 5H9RA 4MGYE 5BV6A 1H8TB 4HN0A 3ZIXA 5H9PA 2UU8A 1ZREA 1YFUA 4LBLA 1WD3A 1UW8A 1UKRA 2LUWA 4IEYA 1YIPA 4JGZA 3N7JA 4G4FA 1NE4A 1XNBA 4LBJA 4FOQA 2GC0A 4Z8BA 4EN8B 3NV2A 3AKPA 4D7YA 1AVBA 1Z78A 1O3TA 4BPZA 5GZEA 4JGZC 4MX3A 5BPXA 3ZFEB 3TN91 4FPLA 2G9FA 2GH2A 3NV1A 2YZ4A 3D8CA 1QJY3 1BVVA 2VVDA 1DDLA 4AI8A 2R071 1VBD2 4R9AA 2RMU1 4INDA 5CVRA 1PO12 5E88A 5FBZA 5JOYA 5BUVA 2WNUA 4DRVA 4Q4W1 2KM2A 3WW3A 2CGPA 1LULA 4JRLA 1Z0HA 5FMOL 2ZGLA 3DKWA 3LZZA 3ATGA 3S30A 3HT1A 1TMF1 3ZYRA 3EBRA 2IFWA 1H9PA 2RS33 3AYAA 3DL3A 1VBC3 4LULA 3VDDB 2WNUC 1C8M1 2H0BA 1RUH2 1C1LA 3M70A 1U0AA 4AVAA 5HI0A 3WDTA 3AKRA 2FMYA 5D8AA 3LA7A 1MS0A 4DINB 2ZGRA 1KJLA 2ZMKA 5SV5A 2A7AA 3FWEA 2D40A 5JWPA 3IMNA 4LR4A 1O5LA 4AG4A 3RMYA 2JG8B 3NKGA 1QJX2 1LGCA 1WMEA 1LHVA 5D8AC 5TSWA 5FOJB 3ZN6B 4C0HA 2AR6A 5KWRA 1FATA 2YUEA 1WW6A 1ULFA 1D0HA 2RM22 1ZBA2 2RJLA 4NPRA 1FMD2 2PLV1 1ENQA 1TME2 2H6BA 2R063 4BLIA 3UKNA 2V5YA 4PQ9A 4FTSA 4Q1PA 2WZR3 1C5IA 2F6BA 1ZX5A 1PO23 4I09A 1QQP3 3ZFFB 2UWAA 2Y0IA 4OHVA 1J3QA 4DQAA 4Q0SA 1BKZA 3HIFA 1I9RA 3AMNA 1Y7BA 1UCXA 3QH6A 3ST7A 1EAH2 3IDEA 1Q3EA 4TSVA 4UW5A 4LBNA 1WGPA 1IS6A 5CNAA 2JEMA 2DTYA 1ASJ1 4HK9A 4Q0UA 1A8MA 4N53A 4AHYA 2DFCA 4AGGA 2ZS6B 3AKTA 2WIIB 2WSVA 3UV9A 3AZYA 4ASLA 2E7TA 3MFCA 1REEA 3BTAA 2IXIA 2BYVE 3WP4A 1ALYA 4P9IA 1H4GA 2JDZA 4CEWA 3ZN5A 3GHNA 3VBFB 2QFEA 1ZA4A 4N53C 1NQDA 1RB8G 2HWF1 3AJZA 1OPMA 4MZUA 1AR63 1WUVA 2BFUS 2DF7A 1HLCA</