4D69A

Soybean agglutinin from glycine max in complex with the antigen tn
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
234
structure length
234
Chain Sequence
AETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENESGDQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title Detection of Tumor-Associated Glycopeptides by Lectins: The Peptide Context Modulates Carbohydrate Recognition.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 49
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d69A00
1PZ9A 2D3PA 2A6ZA 5KXDA 3JUUA 4Q2FA 4JC1A 4ISRA 3ZXJA 1SLLA 3QCWA 1BXHA 1N1YA 2D3SA 2R49A 4Y26A 3M2MA 1MZ6A 3WG3A 5CAZA 3FLTA 1CPMA 1KDKA 5T52A 4F83A 4FP3A 4TZDA 1F9KA 3WHTA 2VU9A 3O0VA 1LOAA 3PVOA 4ATFA 1AJKA 4FPJA 1V6JA 1WLCA 3R4UA 2D7FA 2DWRA 2ZGRA 3L2YA 1Q8OA 2R0HA 5DZEA 2V73A 2A6XA 3INAA 4WVWA 1QKQA 3VKMA 3ZYPA 4AWDA 4Y1UA 1W6PA 1GLHA 1YI7A 1X50A 3M3QA 2CNAA 4YW4A 4XE9A 4H55A 1QNWA 4XBLA 1Q8PA 3POSA 3ZSLA 3RS6A 1S0DA 4FPYA 1UN1A 5HCFA 3BODA 1SCRA 1SLTA 1F5FA 1C1FA 3DUIA 3ZXKA 2ENRA 2CY6A 3N7MA 1WCSA 1SLBA 2ZMNA 1CONA 3OYWA 1OQ1A 3ZSJA 2LALA 3AZZA 5JOWA 2OW4A 2ES3A 3N35A 4UW5A 5CNAA 4GWNA 2YXSA 3TB0A 4LBQB 1AJOA 1LOBA 2C9AA 2R1DA 4R9CA 1BQPA 3NV1A 1W0OA 2A3WA 3ZYRA 4PCRA 2CL2A 4YW3A 3ENRA 1W6PB 5LK5A 4BOWA 2E53A 4PBOA 2CWSA 2ZABA 5FRAA 3IKWA 5GZDA 1AX1A 2DUQA 3MW2A 4Y22B 4YZ1A 2EAKA 3LCPA 4Q1RA 2DV9A 2ARXA 2DU1A 1LHWA 3RQ0A 1GZWB 4FPGA 1N1SA 4Q27A 3UL2A 1RITA 3FLPA 3R05A 4GKYA 2UWBA 3MW3A 2DU0A 5IK7A 1UX6A 3AYCA 1BZWA 4P9WA 4W65A 2EIGA 3TAYA 2DTWA 2WKKA 4YFWA 4YGDA 1CESA 4KBBA 4PBPA 2ZGNA 3I4IA 1U0AA 1Z0HA 1QU0A 4FOQA 3CNAA 2YZ4A 4FPLA 1DQ6A 2A70A 3KM5A 1ULFA 3PVNA 1V6MA 3U4XA 1LEDA 3AX4A 3WDTA 1G9CA 1LU1A 1URXA 3T1LA 1CPNA 1DGLA 1JBCA 2ZBJA 2ZMLA 1XQNA 1S0IA 3LSEA 3V0BA 4XXPA 1MACA 1GBGA 3M3EA 2OUJA 3MPPG 4BPZA 3ZSKA 4LBJA 4LBOA 2YROA 4Y20B 2DVFA 4FVVA 2NZ9A 1LGNA 2ZGQA 1H30A 2JE9A 2DUOA 4P9XA 5IK4A 4DQAA 1CR7A 3R4SA 4FPHA 4BM8A 2WSUA 4TYSA 3H0OA 4XJZA 1JN2P 2PHUA 3FFZA 3RRDA 5BYNA 3AJZA 2AGSA 2P34A 1UKGA 2Q5TA 3QLQA 4Y1XA 3WG2A 5JLVA 3ASIA 1C4RA 1G9FA 2ZHKA 1W6MA 1QGLA 3WVJA 5F5QA 2DURA 1MS1A 3RMXA 3AP4A 1PZ7A 2EXKA 1GSLA 1I3HA 1RINA 2D6MA 2WJSA 1WD4A 3IN9A 4LBMA 5CB7A 3W58A 2CWMA 4PQ9A 3AJYA 1V6KA 2D6KA 2H0BA 2ZGMA 2RHPA 1WBFA 1KDMA 3D4KA 4AYUA 2EF6A 3ILRA 1IS6A 4Y24A 2YV8A 1KJRA 1GZ9A 2E7TA 1S1AA 2NMNA 1N3PA 2R0FA 2ZACA 3O12A 3WHUA 2VY0A 2NMOA 2A6VA 1CJPA 2WT2A 3D5OA 5T50A 1N1TA 1V6LA 1MR5A 1QF3A 1D0HA 4Q1PA 3OGGA 1NXD1 4JRAA 4AVTA 5JOZA 5AVAA 1JYCA 5GLVA 4FPEA 1IKPA 1FAYA 2Z42A 5JDBA 2KM2A 1W6NA 1AF9A 3AFKA 4XHBA 1N47A 3OPZA 4NOTA 4Q8LA 1GKBA 4XXAA 3B3QE 4LBQA 3V64A 1AXZA 1QMJA 5T54A 4YM3A 1MS9A 1ULDA 2VH9A 1LTEA 1MVQA 4XMAA 2E6VA 5SV8A 2FHRA 5H9RA 4RL7A 1APNA 4XHXA 1N1VA 3AK0A 1DQ2A 5FREA 2P2KA 4Y22A 1YRZA 4FOWA 1ENQA 4DRVA 3NV3A 1VIWB 1UAIA 2ZGUA 3OY8B 5GLWA 4XIOA 3VKFC 4XBQA 1GZWA 2VW1A 3WDWA 1JYIA 2JKBA 3HN1A 3A0NA 2ZGSA 5JOYA 2GMEA 1J1TA 1UPSA 1W6NB 4P14A 5JMCA 1I1EA 4ITCA 1F31A 1GYKA 4C1WA 2EALA 1QOTA 4YFZA 3ZSMA 3BTAA 1BKZA 2W68A 3BIWE 4PF5A 5GLTA 4OZXA 3PMEA 4XDQA 3WCRA 2W52A 1LODA 3UJQA 4BMEA 4YZ4A 3GALA 3Q9OA 1SLAA 2WNEA 4AGVA 1WBLA 4JCKA 2ZGKA 2UU8A 3O0WA 5GZCA 4XIKA 1V6NA 2A6WA 4XJ9A 1RIRA 3AYAA 2A71A 2DUPA 1LENA 4Y20A 3SISA 2D6NA 3PJQA 5E88A 2XB6C 3VKOA 2VXRA 4P9YA 4YG6A 1YIFA 2ZKNA 1W6QA 2A5ZA 5L73A 5EYXA 2D6LX 1LHOA 1UZYA 1A78A 5IK8A 1MZ5A 1DYKA 2D6PA 4M3CE 3ZXFA 2ARBA 4FPKA 2V5YA 5GJ6A 1CN1A 4YW5A 1FV3A 3N7JA 4YM1A 2E7QA 2UWAA 2ZGLA 1LOCA 1CQ9A 1N3QA 1LOFC 1OKQA 4Z8BA 1UZZA 1YXWA 1S0CA 3SNMA 5T5LA 4BQ1A 1LCLA 1Q8VA 1DHKB 1LU2A 1JUIA 5HCBA 1AVBA 3ZXLA 1DYPA 1DQ1A 2DVAA 3OBRA 1LOFA 2P3IA 2ZHMA 1HQLA 1LOEA 2ZHLA 3O5SA 2AUYA 3T2TA 3WV6A 2D6OX 4M3CA 3V0AA 1SBDA 4FOYA 1JHNA 5CBLA 2GNMA 2WSVA 1W6QB 3BOPA 4XJ8A 3AXEA 1LGCA 1QOSA 3MW4A 4DPNA 2TEPA 3AP9A 1G9DA 2BQPA 2EXIA 1CIWA 1DQ0A 3FLRA 5GZFA 2A6YA 4RA0A 2VW2A 3SITA 3PVEA 2AYHA 4FQZA 1IS3A 4YG3A 1S0FA 2ZA9A 2SLIA 3FBYA 4Y1YA 2EXHA 4FPFA 5DXDA 3WDVA 3N7LA 3RMYA 3ZXEA 3V65A 4SLIA 4YLZA 4I30A 2YY1A 2GMPA 4LBLA 3UJOA 1AXKA 3M3OA 3HMYA 2B7YA 3M3CA 3N3HA 1NLSA 1ZA4A 4K20A 3NWKA 2DVBA 2A3YA 3APBA 1HKDA 4M3CB 2GDFA 3V0AB 3N7KA 3WZ1A 2NM1A 1Q8QA 4HANA 4YW2A 4CTEA 4XTMA 5T5OA 2NN8A 2PELA 5KXBA 2GNBA 4WV8A 1HLCA 1WUVA 1LHUA 3B01A 1SCSA 1ZM1A 2D43A 2R16A 2ZGTA 3IPVA 2ZAAA 2YMZA 4AVVA 3SH3A 4YZ2A 5T55A 1G9BA 1GV9A 3RG0A 3AZXA 1MS3A 5DUWA 1UMZA 3OY8A 3O0XA 1JOJA 3RSJA 3ZPYA 4MYEA 1QOOA 4GKXA 1D2SA 1TEIA 4GA9A 1LESA 5EYYA 1B09A 5CA6A 2OVUA 3ZVXA 1YO8A 1IOAA 2PHFA 1LOGA 4YZ5A 4K1YA 4Y1ZA 1HQWA 1R1ZA 1V6OA 4UW6A 1MS4A 1C1LA 5DUXA 5KXCA 1SLIA 4ISQA 5DZFA 1C57A 2P37A 4FOVA 2E51A 4D69A 3AYEA 5H9PA 5EXOA 4R9BA 3T1MA 5GALA 4R9AA 1KRIA 4XOGA 1H9PA 4FQ4A 1LJ7A 1FYUA 2AENA 5H9QA 5IT6A 4XYXA 5IUQA 2AH2A 2JECA 2D44A 1PZ8A 1O4YA 1AZDA 3IPVB 4WZFA 3SLIA 1DIWA 2ERFA 4Y1VA 2ZHNA 3VV1A 1SLCA 2DVDA 2OUHA 3AZVA 3SH4A 1DQ5A 1W0PA 3HR9A 1FATA 1H9WA 1GANA 1DZQA 2W39A 4AVSA 2P3JA 3WDYA 3OJBA 1QDCA 2C5DA 1S0GA 2DVGA 1V6IA 1WLWA 3WCSA 5JOXA 4M3CF 1DQ4A 2PHWA 1VAVA 2VUAA 3LSDA 2UURA 4UW4A 5EWSA 3M1HA 1A8DA 3NV4A 1JXNA 3USUA 1ULCA 4R9DA 2ZGPA 3NV2A 1LEMA 1WLDA 3AZWA 3AXDA 2ZZJA 5DUVA 4LBNA 1BJQA 2SBAA 1LECA 2JJ6A 5DZGA 2JE7A 3VKLA 2A3XA 4DFSA 1Q56A 1YYNA 2GN7A 3B9CA 4GALA 4LBKA 3POWA 3UK9A 1G86A 1W6OA 3MEPA 5T5JA 2NP0A 1G8WA 1BYHA 4K21A 1Q8SA 5H9SA 5DUUA 3C2UA 1GICA 3KQRA 5GLUA 1AXYA 2CYFA 3OBTA 3B69A 1WD3A 3WG1A 1FNYA 2EXJA 4XMIA 4ATEA 2A75A 4Q26A 5E8AA 4YM2A 4YZ3A 1VAMA 1Y7BA 1KITA 1IS5A 3USUB 2FMDA 2G4IA 3I8TA 3IM0A 3WDXA 1KJLA 4ZKTB 3N36A 4WVVA 1ENSA 1LGBA 4M01A 3WLUA 4C1XA 5T5PA 4U36A 4YG0A 2PHXA 5IK5A 2AR6A 4DRRA 1VLNA 1GZCA 2A7AA 3VKNA 3IMNA 4AGRA 3A4UA 4DS0A 1W6OB 4Q8KA 5DG2A 4XILA 5HCAA 2R1BA 2WT1A 3WG4A 4BLJA 1SBFA 1DLLA 2AREA 1V00A 1S0BA 3DGTA 3OYWB 4GWMA 1A3KA 4XTPA 2VW0A 2GALA 4XJWA 1G7YA 5F9TA 1AX2A 2W08A 3B00A 2GN3A 1ENRA 4AGGA 4BMBA 1FNZA 1DFQA 3WOGA 2DTYA 2LTNA 3D6EA 1LULA 1MS0A 1LHVA 1S0JA 2ZGOA 3SH5A 1G9AA 2ZMKA 3FUQA 4XBNA 1GNHA 1UL9A 3POYA 1ULEA 1VALA 2GNTA 4XJAA 4BLIA 5KXEA 5E89A 2GMMA 1O4ZA 1WW4A 1KQRA 3AP6A 3AP7A 1ULGA 5JVVA 4YM0A 1IKQA 1MS5A 5GLZA 2P3KA 5GM0A 3W59A 1N3OA 3AYDA 1IS4A 1ONAA 1SACA 4L8QA 3WUCA 2WLQA 3FUOA 1WW7A 1GNZA 3AP5A 1S0EA 2UWCA 1SBEA 1QDOA 2GNDA 1DBNA 4M00A 3ILNA 4LBQD 1QNYA 3A0KA 4YGEA 3WDUA 2NYYA 2I2SA 3AZYA 1OFSA 1WW5A 2XG3A 1FX5A 3GNEA 4CZSA 1FV2A 5GZGA 4GXLA 4NO4A 4ZXKA 1EPWA 3WUDA 3VUOA 2DYCA 3V0BB 4U2AA 4FP2A 4YGBA 4YW1A 2PHRA 4XZPA 4FPCA 1AX0A 1MVEA 3ILFA 3WNXA 2JDZA 4XJUA 4YGCA 4K1ZA 2HYKA 2JD4A 4CRQA 4ASMB 4IQPA 4UW3A 1WW6A 4FPOB 5GZEA 1HDKA 4HL0A 1MS8A 1SFYA 2D3RA 1CVNA 2WQZC 2WT0A 3ATGA 5DG1A 1LHNA 1Z78A 3JU9A 1JW6A 1W6MB 2CTVA 2PHTA
chains in the Genus database with same CATH superfamily
2D3PA 2VNVA 5KXDA 4CDQB 4JC1A 3UGHA 1XRUA 1SLLA 4XW3A 4CCNA 2XL7A 4A7KA 2GC3A 1BXHA 1N1YA 1QIQA 2WIIB 3JD72 4G3YC 4N7IA 4ES8A 4F3JA 4P9IA 5CFDB 1CPMA 1KDKA 5T52A 5CFCA 4FP3A 4HVQA 4TZDA 1LOAA 3H3UA 3PVOA 2VNRA 2LS6A 3SQOA 1V6JA 5BNOC 2MEV3 4NMIA 3H3ZA 4QKNA 4FTBA 2VZUA 2RS33 3POBA 3OTFA 2V72A 4NJ4A 4QDRA 4D7TA 3OPTA 3VKMA 2QZ3A 4UOJA 5F8PA 4AWDA 5BNQA 1Q43A 4Y1UA 5BNOA 4ZONA 2CNAA 5I8SA 1NE4A 1W8FA 2BTVC 2OXBA 3DEMA 2BYVE 1RJ8A 2PMWB 2RJLA 2RVAA 3ZYBA 1UN1A 3AVRA 3I7DA 2PQSA 1NZCA 3NL1A 1F5FA 5I0UA 3ZXKA 3R4DB 1UOGA 2XLFA 3AMPA 3DN7A 2VZ1A 2DCJA 2ZMNA 5FY5A 1CONA 3P3PA 3MV11 3RFRA 1L7LA 4AI3A 5EHDA 4AFCA 2FZ2A 5JOWA 4MUVA 2ES3A 1NLRA 1WCUA 4BISA 3CU7A 1GU3A 3KF3A 3TB0A 3SXWA 2YC2A 2C9AA 3Q8EA 2R1DA 5DDJ3 4YW6A 4R9CA 2HJIA 5A3PA 1BQPA 4JTNA 1W0OA 3FHIB 4RR3C 4AF9A 4BIFA 1R083 1J59A 4PCRA 2JE8A 2EIDA 1PVXA 4RGAA 4IESA 4CU7A 5EIYB 1PX3A 1DDLA 4W6WA 1V9U3 5IJRA 1W6PB 4JQRA 4Q4W2 2VQUA 2WFPA 2VZOA 5GZDA 2NPIA 1FI2A 3IKWA 4RR3A 2DUQA 5CZKA 2X29A 5IVFA 4Y22B 4YZ1A 1I5PA 5ANNA 2AZ5A 2D5FA 2DV9A 3HVDA 1IPSA 2ARXA 3RQ0A 4J1WA 1N1SA 3HOBA 4QKBA 3TN91 1REDA 3R05A 1RUE2 1YQ5A 4JAAA 4CA9A 2VPVA 3TAYA 2EIGA 1W9WA 2GP3A 2DTWA 1AL22 2W91A 3C7GA 1BEV2 1OI6A 1OLQA 4JQTA 4YGDA 3W5MA 4CVUA 4D7SA 2IFWA 2ZGNA 2KD7A 4IEZA 5CG8A 1Z0HA 4RD7A 3NNJA 4FOQA 4NPRA 4LK6A 3CNAA 2YZ4A 3AMNA 1UY1A 1W2NA 4COVA 4HN0A 3O1RA 1URXA 2ARAA 3T1LA 4K6BA 4CP9A 1C3HA 1VPHA 1WMFA 2ZBJA 4MSVA 4O65A 4NN0A 4BIOA 4FAGA 1SDDB 1GBGA 4R4XA 5AVPA 5A6XA 4LBJA 4BQWA 2Y26A 2YGLA 4Y20B 4OCTA 1T2XA 2IUWA 2NZ9A 5E16A 2YPJA 2DUOA 2XGXA 1CR7A 1GP5A 1R091 2WSUA 4TYSA 3VD9A 1X9TA 4M0NA 5BNNC 3AJZA 2AGSA 4R4ZA 4CDQC 4CCMA 2XWJB 2VZVA 3ZMNA 3K3OA 1FMD2 4Q0SA 5TSWA 3EO6A 1W6MA 4QB1A 5A80A 1QGLA 1NXMA 5AC91 5BNNA 1RHI3 2ILMA 3NW4A 4CDQA 1JYTA 1RL3A 3CJIB 1O8SA 2WJSA 3IN9A 4LBMA 3BTZA 3W58A 4K40A 3D0JA 4Q4X1 3PNAA 1JI6A 2H0BA 4F8AA 4OI4A 2XR4A 3MIGA 1J3RA 1UF2C 5BV6A 4AFMA 1XNAA 3IDCB 5A7WB 2X8KA 1XE8A 4UAPA 1WGPA 3PUAA 2QBXA 3C8XA 5JAXA 1ST8A 2YV8A 3VZMA 5C8CC 2BEOA 3NKGA 5C70A 1GZ9A 5J96B 2E7TA 3GBGA 1AUYA 2R0FA 4QB6A 3O12A 2HKXA 1YQ6A 2NMOA 4EE2A 1EV11 5C8CA 1CJPA 3D5OA 3LA7A 5T50A 4IERA 5C6CA 1OC1A 4UBHA 4FFIA 5A7QA 3K2OA 4Q1PA 1NXD1 4XCBA 5FCCA 5JOZA 5FKCA 4IW3A 1VRH2 1US3A 5ERLA 5FY7A 2FQPA 1ZZCA 2Z79A 2JWPA 2QQKA 4E2SA 2QTWB 4XHBA 3KCYA 4NOTA 3ZM8A 1D0GA 5I93A 1QJY1 4K8FA 1OHFA 5FK8A 1MS9A 1ULDA 4I0AA 1LTEA 1RUC2 3MIBA 3J8F2 4Y5Z0 1QY4A 5H9RA 4MHUA 3LFIA 4EJRA 4TTGA 3AK0A 1FPN1 4QXHA 3DCQA 2WZR2 2P2KA 4CCEA 4Y22A 4FOWA 4CP1A 2YU1A 3NV3A 1O5UA 1UAIA 3D0SA 2VVEA 3AL6A 1J58A 1QJU1 5FMOL 1JYIA 3U07A 2V09A 2NLRA 1J1TA 1UPSA 1F4AA 3QOPA 1W6NB 5FBZA 4P14A 2XLGA 4YWAA 3ME2A 3S57A 2Y6KA 1F31A 2ZX3A 4FFGA 1XYNA 4V2VA 4C1WA 2IXJA 2Z2SB 2WWSA 2W68A 1XSRA 1W04A 4RSUA 4E2GA 1H2MA 1VBB3 1IPKA 1ASJ3 4IEPA 4NAMA 4A6SA 2XPJA 3UT0A 1QH6A 3TEWA 3CLPA 4BU2A 4AGVA 1WBLA 1ZBE3 2CGOA 4UFLA 2ZGKA 1MEC1 4C91A 2KA3A 1COV1 1V6NA 3BTYA 1RIRA 4KWKA 2BOJA 3BKZA 4Y20A 4EN0A 3E97A 3PJQA 4LE4A 1WZXA 1TME2 1U5ZA 2N7GA 4FT8A 4ZS2A 3VD7A 2ZKNA 1W6QA 4XUPA 1JZ5A 1AYN2 3MUZ1 3I2GA 2D6LX 2FDGA 2D97A 2BU9A 2GZWA 4JGZC 4NROA 4ET7A 5LBEA 2QQJA 3ETQA 3VBSB 4CSWA 4ZXEA 3KVAA 3KF5A 5GJ6A 4YW5A 3N9QA 3RZKA 1BBT1 1M06G 4NR1A 5A7SA 1AR72 1FT9A 1DZRA 1CQ9A 1N3QA 3PHMA 4JGZA 4KU8A 3TN92 3ZYGA 3B9IA 4GMP0 4BQ1A 2P6CA 1RVF2 1LU2A 5FPLA 1VBE2 3S6PA 3WQ0A 1AVBA 4NWVA 1W3VA 2CHHA 4LKEA 5FZLA 4NHYA 3GF6A 1DQ1A 1NAEA 3SCFA 2P3IA 1DGRA 3WV6A 2C26A 2I45A 3KZ4C 4AFAA 1W28A 1ND2B 2D6OX 4BH9A 1PX4A 4OVEA 4QX5A 5F5AA 5J09A 4F7ZA 1SDWA 5FZ3A 4TN7A 3H7YA 3BOPA 3WR0A 1B35C 4JHZA 1QOSA 5DN2A 1CX4A 3I2JA 4YSFA 1DGRN 3FLRA 5GZFA 1LR5A 2A6YA 4RA0A 2BBAA 2XKPA 5JSPA 3LIHA 1NKGA 3BB6A 3PVEA 1RMU3 4FQZA 2VZTA 3BTXA 1B35A 5FZKA 1IS3A 4YG3A 3RZGA 2WYFA 1LB2A 3U78A 4GIQA 2WO3A 2EXHA 4FPFA 1ZNPA 1NY71 4I3PA 4LLFA 3ZXEA 4AEMA 1U5YA 1YHFA 3V65A 4DY3A 3I2OA 2PLV3 4I30A 4V2WA 5KR7A 3H8RA 2XWBB 3EMRA 1ZRIA 1NYWA 2DCKA 3DYOA 3GJAA 3M3CA 3PMSA 1E57A 4QX7A 1PIV2 3WW4A 4H7LA 1ZA4A 2IFRA 2VJXA 4OHWA 3LB9A 3V0AB 3N7KA 4RQPB 1E5HA 2NM1A 1Q8QA 5FY4A 5T5OA 4YARA 2QDNA 5FXXA 1WUVA 4Q4X2 4HK9A 2PN5A 3IDAA 2D43A 2I07B 4QX0A 2BPA2 1W90A 2ZAAA 2YMZA 3SH3A 1G9BA 1OT5A 2JDMA 3RSJA 4GMP3 4LORA 5IAVA 3WW2A 1HB1A 1TMF2 4EWDA 1D2SA 1TEIA 4GA9A 5KHIA 2OVUA 2WL1A 1EAH1 2Y34A 3ACGA 4PIXA 4CDWB 2VGDA 1LOGA 4HETA 4QB2A 1EV12 1V6OA 4L92A 4UW6A 4OYUA 5FXWA 5SV5A 4BQ2A 4FOVA 3SCHA 4BXSV 4D0QA 1S55A 2VZRA 3E5XA 4QQHA 1W99A 4XOGA 2VUJA 1LJ7A 4FQ4A 5GALA 1FYUA 4A7ZA 4A44A 4IEQA 5FZAA 3O1VA 1W8OA 1PZ8A 2O14A 5FMBA 2G1MA 1XBFA 3DECA 4MADA 1DIWA 3SLIA 4YPJA 3ZFEB 3ZO0B 4E27A 1CGPA 3VV1A 1VR3A 1QJY2 3LAGA 2XHNA 1DQ5A 1W0PA 1H9WA 3C7FA 4AVSA 1XU2A 2P3JA 3IIAA 5FOJB 4M0HA 5JOXA 2LM3A 3T2QA 3WCSA 5BUVA 3WT3A 1H2NA 3SMHA 1DQ4A 4BK4A 2ID4A 4CU6A 4Z1VA 4D6SA 4UW4A 3VBHC 5EWSA 1FPN2 2FDHA 3HBKA 2RS31 2WYSA 3NV4A 1JXNA 4LK7A 1EUTA 1ULCA 3VBSA 2Z5WA 3LOIA 1YQCA 2DCTA 2X5IC 1UXXX 3EJKA 3NNLA 3NV2A 4R9DA 4WBBA 4BQXA 5CKNA 1J83A 3HD8B 1QJU2 2ZEXA 4LBNA 1LECA 5DZGA 5L36A 5A33B 2JE7A 5FYBA 2A3XA 3GHMA 1ND2C 4Q0PA 1YYNA 4GALA 4DFSA 2X5IA 1AYN3 3POWA 1W03A 1AR63 1G86A 4RFRB 1XOYA 2F6BA 2VZPA 4YRDA 1Q8SA 3NKTA 4LA2A 4LO4B 3C2UA 3WNNA 3KCCA 2BRTA 4KWJA 5GLUA 1ND2A 1HXS3 1R1A2 1PK6C 1UO9A 1AR73 1UOFA 2CYFA 4HZFA 3P1IA 2Y0OA 2J1TA 2TNFA 2EXJA 2R061 1RUG3 4RN5A 2A75A 4XCAA 4XMIA 2HWB1 5DAWA 5E8AA 4Q4V2 5DDJ1 3VHNA 3WINE 3U14A 4CUGA 5IVBA 4OQ8A 4MXVA 4OHYA 1COV2 2FMDA 1PK6A 3B93A 3IM0A 1VRBA 3J7MA 3E5QA 1S2KA 3PL0A 5FZ0A 1POV1 4AE2A 5FR3A 1F2NA 3WP5A 1PO13 4NHMA 2XVGA 4OMCA 3WLUA 5A3NA 4U36A 5IK5A 1UY4A 1VLNA 4YVWB 2WS93 1GOHA 4AGRA 3A4UA 3KLSA 4RQPC 1W6OB 2WT1A 4BLJA 2VCCA 5C3QA 1DLLA 2AREA 3DGTA 3OYWB 4GWMA 1BBT2 3UV9A 1HJFA 2VW0A 2GALA 2X10A 5F9TA 4IEXA 2D93A 1H8VA 2W08A 4RQPA 1YUDA 2XBO3 4BMBA 1ENRA 4B4RA 4B8EA 1PGW1 2RR13 5FQ0B 1FOD3 2LTNA 1H8TC 3ZXGA 1LHVA 1S0JA 2ZGOA 3UKNA 2W87A 4HOOA 4NWWA 5FLJA 1X8EA 1XNBA 2JG9B 2FDKA 4N7UA 3WP6A 4QX2A 2VCAA 1VALA 4XDOA 3QH7A 5KXEA 2GMMA 4CDWC 1H8TA 1O4ZA 4CCDA 3EBRA 4YNIA 1H6XA 3AP7A 3DYMA 2HLEA 4Q4Y3 2K0GA 4BE3A 3M8LA 1IKQA 1W8ZA 1JU3A 3CZJA 4XUTA 5GLZA 4LT5A 3LPFA 1O3QA 4LUMA 2ATFA 4D3WA 1BVP1 4CDWA 4HKLA 1IS4A 3VDAA 2PTMA 4OLLA 5FPBA 1CIYA 2WLQA 2QQOA 4MO3M 4CDUC 3PURA 4QM8A 1OMIA 1ZRRA 3ZMOA 4ZU7A 1IHMA 2ARCA 2BDRA 3ZFEC 3VBFC 1W8TA 4OHVA 1QDOA 4M00A 1PVC2 2QFEA 3OUJA 3LA2A 5FZCA 4CDUA 2C9KA 4JZRA 1H0BA 1AR83 3C7EA 1OFSA 1RHI1 1WW5A 1UCXA 2J1AA 2XG3A 4LPLA 2XJPA 2VMFA 4GXLA 4UFJA 3RGBA 3ST7A 1SHWB 3VBFA 1NA1C 4KI5M 4CEYB 3V0BB 1MQTC 3OG2A 2J1SA 2VOWA 4MGQA 1RJ7A 4FPCA 4JVAA 4N9HA 2ZX0A 2IC1A 4OUSA 5FYVA 1NA1A 3EB7A 5FBJA 3WNXA 2BNMA 5FZHA 1RUD2 1TNFA 4EN9B 1MQTA 1OBNA 5JSRA 3HEIA 5GZEA 3JD71 1HDKA 1DYOA 3AFGA 1CVNA 5ACA3 3FN9A 3U4SA 2QQPA 3VBUC 3JU9A 1PGSA 1ND3B 4MGSA 2IXLA 2CTVA 1EAH2 5A1FA 1PZ9A 2A6ZA 3K48A 5JZGC 2FDJA 3JUUA 3ZXJA 1QQP3 3QCWA 1CAVB 2O1QA 4I02A 5KHKA 2A1XA 3VBUA 3M2MA 1MZ6A 1ZBA3 4HG6B 1WA6X 3SEPA 3WG3A 4IEUA 4F83A 4DNYA 4LHSA 2WNVC 4NAOA 3WHTA 4HSLA 5JZGA 5FY9A 1RUH2 2FCVA 1AJKA 4FPJA 3HNBM 3KV6A 5A6ZA 3VDDB 3R4UA 1OPOA 5F6KA 4ZY9A 2D7FA 5DZEA 2V73A 3ACFA 4YVWC 2A6XA 4WVWA 5F6LB 1K42A 2KXLA 3ZYPA 5FUIA 2DBNA 1GLHA 2OQ6A 3HWJA 1X50A 4GJYA 4XF3A 4YW4A 1X9PA 4XE9A 5LASA 4H55A 3MF9A 4YVWA 4XBLA 1Q8PA 2MEV2 3ZSLA 1WWYA 1JZ4A 5HCFA 3BODA 3KS7A 1SCRA 2RS32 1C1FA 3RZLA 3DUIA 2FDFA 2W46A 2CY6A 2QQVA 5FIXA 3OYWA 2FD8A 3NO8A 1OQ1A 4Q4W1 1OD3A 3NJXA 2LALA 3AZZA 1JOBA 5LA9A 2NQYA 2YXSA 4LBQB 1AJOA 4XABA 4CUBA 3T4HB 3E1F1 3NV1A 2A3WA 3KB5A 4GAZA 4GZ9A 1ASJ1 3Q8BA 2WNOA 5A70A 1LRHA 4IE6A 1RUE1 4YW3A 4FAHA 3OGJA 1ZBE1 3BN6A 4BOWA 2WAAA 1UU4A 3I49A 3BIEA 1BK1A 1GNYA 2ZABA 4NPLA 5FRAA 1AL21 4Q29A 4AI0A 4LHKA 4MX3A 5DDJ2 1ZZ8A 5FYZA 1R082 3Q8CA 1VE0A 3MIEA 4N53C 1RITA 1IG0A 3FLPA 3M4FA 3NNGA 4GKYA 2UWBA 3RYKA 1V9U2 2HWD3 3MW3A 4W8JA 3GGLA 4S2HA 4E2QA 1UX6A 1ZZ7A 1BZWA 2HWC3 4I09A 2VMCA 2VTFA 4HBNA 1O7FA 2J1UA 3MDPA 5AFEA 3VHOA 5IVCA 1CESA 4N53A 4KBBA 4PBPA 3ETPA 3I4IA 4XURA 2QJVA 4Y33A 3DKQA 4EZHA 1GWMA 2KR2A 4FPLA 3U4XA 1ZRCA 1G9CA 2BNOA 1O6UA 1VP6A 5LY2A 1JBCA 1DGLA 2VCBA 3J9SA 4ASLA 1XQNA 1S0IA 3LSEA 3V0BA 3ROUA 4UYBA 4OQ9A 2OUJA 5LB6A 3ZSEA 1PMIA 4LBOA 3CBNA 4LKFA 4OI2A 3WEZA 3LFMA 2PA7A 3PTRB 4FVVA 3WNMA 1LGNA 4QWNA 3U75A 3DXTA 5EP9A 1JZ8A 1ND3C 2PHLA 3J4UH 5FZGA 4FPHA 4BM8A 1NZIA 2LW8A 3H0OA 1W39A 2PHUA 4EYUA 4IEVA 3RRDA 2P34A 2Q5TA 1V0AA 1WA4A 3NJZA 1ACCA 5K0UC 3WQBA 1ND3A 4AFBA 5LBCA 1UOBA 3GM8A 2GC1A 1OFNA 2YDEA 4HMZA 4AQTA 3MYXA 1RUD3 3AP4A 3QD6A 2VZSA 3RMXA 1D4VB 1RUF3 1I3HA 2D6MA 4CP9B 3AKPA 5K0UA 5CB7A 1NQDA 2W5FA 4META 3P6BA 1Y3TA 1T6GC 1V6KA 2D6KA 2Q30A 2VNGA 4X8NA 2RHPA 1F4HA 2JDPA 1S2BA 2UY8A 3AKRA 4AYUA 4QGLA 3VDDA 3HQXA 1OQDA 1RHI2 1E5IA 1OA2A 3HQRA 5IATA 2H0VA 1S1AA 2I74A 4IXLA 5JR2A 5DPNA 1O5LA 1N3PA 3B7MA 3H1MA 4JHTA 3I3BA 4NPMA 3LF7A 4KNCA 3WHUA 2VY0A 2HEWF 5E1RA 5G05L 1UKRA 2ZEWA 4XAEA 3U0ZA 4COUA 3OD4A 4GWJA 1KFUL 1C5IA 3I3EA 1D0HA 3KVBA 1RUC1 3OGGA 3FBMA 3J8F1 1L7QA 4LO5B 5BNNB 5AVAA 1PO23 3MF6A 2P17A 1A8MA 1JYCA 5GLVA 3USSA 2E9QA 1IKPA 2Z42A 3N4MA 4PHZA 3ZFGB 1AYM3 5JDBA 1RUI3 3IBMA 3O7OA 2WZR1 1GKBA 4XXAA 1UMHA 4LBQA 1IPJA 3V64A 1QMJA 5ABJC 4LA3A 3UKVA 4DUXA 1MVQA 3HBZA 3O1PA 1OXCA 2E6VA 4XMAA 4ES9A 5SV8A 2CU5A 3MBWA 2BGPA 4XFBA 5EPAA 5L9RA 4PIZA 1APNA 1JTZX 1GP4A 2HH9A 4MV2A 1DQ2A 2DCYA 3ZYFA 1Y43B 1C8M3 2RMU3 5C8CB 5CG9A 3T30A 4J1XA 1OKOA 2CGPA 3VKFC 1YFWA 3OY8B 4JKMA 3IDEA 5GLWA 3URFA 1XNDA 5LK7B 4DOUA 4FTSA 3E6DA 3ZLIA 1PHMA 4AQ6A 1WLTA 2XJTA 2WN3A 3FWEA 3NMBA 2Z4FA 4DUVA 1UPIA 3I59A 4ITCA 1H2LA 2VQAA 5JXIA 1XNKA 1GYKA 2XHKA 1JYNA 1XE0A 1QOTA 4YFZA 2CSGA 3BTAA 1W9TA 2RM23 2WFF3 3NAPB 1ZZBA 5GLTA 2Y33A 3ZXDA 5HI0A 5JWPA 2VE1A 1TME1 2W52A 4B7KA 4XUNA 5C3PA 4N90A 1GQGA 5D8AC 4OI1A 2G19A 3TBDA 1AYN1 5B2GB 1WKYA 5J48A 3O0WA 3MFAA 4L2NA 5GZCA 4AOCA 2A6WA 3SEEA 4QXKA 4B3NA 2JDAA 2J1RA 3ECQA 1DG6A 5D8AA 2D6NA 1AR71 1UNBA 3HNYM 1VBB2 5CYYA 1ASJ2 2IXCA 1H4GA 2YYOA 3F2ZA 3P3NA 5A7PA 3WF0A 1YIFA 4FBFA 1RUG1 2A5ZA 5L73A 1UMIA 1XYPA 3KQ4B 3W21A 1RVF1 1ZBE2 2WO1A 3B02A 4IDZA 1VBE1 4LEJA 4O7XA 4TLFA 1LHOA 4CEWC 5FP9A 5IK8A 1MZ5A 2DDUA 1DYKA 4EROA 2ARBA 1QHDA 3K3NA 1VBA3 4FPKA 4PI2A 4PQQA 4EWAA 1PO11 3N7JA 3OSDA 4Q0QA 2UWAA 1VAKA 2XQRA 4CEWA 1ODMA 2D98A 4AHWA 1YXWA 1S0CA 1QJX3 2VAUA 4QX8A 5T5LA 2WO7A 3WDXA 1LCLA 1Q8VA 3SC7X 4UFIA 3N9LA 1JUIA 5HCBA 3RZZA 3U10A 1QJZA 2J42A 1DYPA 1K5MC 3KGZA 3OBRA 3PLQA 4XFHA 2UYAA 2J22A 1HQLA 4XUOA 2AUYA 1LAJA 1W9SA 1SBDA 3WF3A 1JHNA 1X82A 1XNCA 2GNMA 2WSVA 2RR11 1K5MA 1W6QB 2XBO1 5CBLA 1FOD1 5FJHA 1HRI3 1LGCA 3MW4A 3S0MA 3A23A 1RXFA 1S4CA 3AP9A 5C3OA 2BW8A 1G9DA 2BQPA 1JYWA 1CIWA 1PIV1 5DABA 3AC0A 3ZFGC 4RGKA 3ZIWA 1CZTA 2WWUA 2Y0IA 3D8CA 1LKNA 4JGZB 5FPAA 2SLIA 4Q4Y1 3WQ1A 2VUDA 5LRRA 3WSOA 4YLZA 1XB9A 2XJSA 4JTOA 4URAA 4LHLA 2BFUS 2GMPA 4LBLA 3UJOA 3ZFGA 1GMMA 1NLSA 4K20A 1RMU2 3NWKA 3K4ZA 3APBA 4GD4A 2ZXQA 4IGQA 3SCGA 3IZOA 2GDFA 4YW2A 2C1FA 1D7PM 1TMF1 1K5JA 1Z7S3 5KXBA 1PNGA 2PLV2 4R8HA 5D2AA 4Z07A 1VBC3 2BP6A 1QXRA 2W92A 1AR81 1SMVA 2R16A 3IPVA 4QPIC 4LOTA 2GP5A 4W6XA 4AVVA 3MLLA 2W1UA 1YEWA 4YZ2A 4DEQA 3RG0A 4A3ZA 1B35B 1J1LA 3OY8A 4URTA 3NJYA 1JOJA 3O0XA 4KMQA 3CEWA 2VMGA 4MYEA 3I2HA 1QOOA 4YVSB 4QPIA 4LO7A 1LESA 2XQXA 1B09A 5CA6A 3NAPC 5DAPA 5EFUA 1UWWA 1O91A 1UZ0A 3AKQA 5FXZA 2ORXA 2PHFA 4YZ5A 4Y1ZA 1R1ZA 4L11A 4HXCA 1W8WA 4EN8B 1MS4A 1OLRA 5I0SA 4QD2A 1PMHX 3THDA 1CZSA 1SLIA 1W2UA 1TG7A 2JX9A 1C57A 3NAPA 2WBKA 1YNAA 4PLMA 3WQ7A 3T1MA 4R9AA 1KRIA 1I9RA 1RGSA 5J3UA 4A41A 3WNKA 4XYXA 1ZX5A 2D44A 1QJEA 1H1AA 1AZDA 1OD5A 2VMEA 4OI0A 4BYYA 2BOIA 3H8UA 3P5BA 3DPRC 4V1PA 3AZVA 1EY2A 3ALQA 4M4RA 4RHV3 4A42A 4B1MA 1ZBA1 5C9AC 1PGL2 1OF3A 1OA4A 4S2DA 3KV4A 1ZREA 2JDYA 1RXGA 3LDKA 5FO7B 2J1VA 2C5DA 1S0GA 3OPWA 1WLWA 4GULA 3W5NA 2VMDA 3DPRA 3LSDA 4GH4C 3LD8A 4L9BA 3O1MA 1WCKA 4AEDC 1KS4A 1YFYA 5C4WC 4LTAA 3USUA 4G4FA 2ZGPA 3IMMA 4LITA 1LEMA 3L2HA 1R1A1 2ZZJA 3M3IA 4GH4A 5LRSA 1AL0G 1BJQA 5C4WA 4AEDA 2GC2A 4ARXA 1NE6A 1J84A 1I6XA 1Q56A 1NQJA 3B9CA 4Q4V1 2QZ2A 4BQ4A 1ALYA 3MEPA 2HYXA 2Y8KA 2NP0A 3DXUA 1YQ8A 2VD7A 1BYHA 4K21A 5H9SA 1RTVA 5DUUA 4Q5OA 3J7HA 4XF1A 1AXYA 2WLPA 3OD0A 3B69A 3ZR6A 1WD3A 1BK0A 1FNYA 2QQMA 4Q26A 3L9JT 4UXAA 3MIFA 2HWF3 4YZ3A 1AR62 1Y7BA 3BALA 4UBGA 1KITA 4M4PA 1WMEA 1KD7A 1IS5A 3F95A 3RDIA 3I8TA 4DXRA 2F4LA 1GFF2 3X29B 4QHBA 1HXS2 3UESA 4WVVA 1HJGA 4C1XA 1LGBA 4LOSA 3VBHB 4YG0A 4AAPA 2PHXA 1CAXB 5EJ3A 1RUG2 1F5JA 2A7AA 5FMDA 5FUNA 1RC6A 2X5IB 4DS0A 4Z2AA 4QKDA 4MGKE 1YFXA 1TVGA 2Q0AA 4XILA 3WG4A 3EYPA 2JD9A 3TEZA 1TZOA 1PO12 1A3KA 2E31A 4XTPA 3N9NA 2HWC1 4MVTA 4XJWA 5FLIA 5KHJA 3BU0A 2R073 4PIYA 2WS92 1DCSA 3D6EA 4FO9A 3AKSA 3I2IA 1MZEA 2FMYA 4NHLA 2ZMKA 3FUQA 4XBNA 4DZGA 4YVSC 1PK6B 3POYA 3ZOIA 1K12A 1ULEA 2GNTA 1V70A 1CJDA 1F15A 1VMJA 2CDOA 4XJAA 5FPZA 1VBD3 4AI8A 5LWBA 5E89A 3ZFFC 1H4HA 2VL4A 3O14A 1WCQA 2XBO2 2RR12 4YVSA 5JVVA 4YM0A 1FOD2 1PVC1 3IAQA 4J25A 5I0TA 2P3KA 2X09A 3RYPA 3TYJA 2ZTNA 1N3OA 3W59A 5J7MA 2ZPXA 4MXWA 2JB8A 3CL1A 4I3GA 5I8YA 3ZFFA 1ONAA 4IE5A 5JCTA 1EPZA 4SBVA 3WUCA 3VD5A 5FZBA 3K75B 3AMHA 5J1XA 3FX3A 1M4WA 2UWCA 4Q4Y2 4KWLA 1X33A 1DBNA 3JB8A 5LA1A 5FK7A 1QNYA 3MLJA 4IGPA 2G9ZA 1RUD1 4LQRA 3VHPA 5GZGA 4QQPA 4QMAA 3ZX7A 2DBIA 1O8PA 2K9ZA 5HCHA 3UETA 3WUDA 4XFGA 3VUOA 2DYCA 1H8TB 2D5HA 3IWZA 5K7PA 3AMQA 1CX1A 2PHRA 4KQ7A 1TQ5A 4LIVA 1JS9A 4XZPA 2E32A 3ILFA 1AR82 3ON7A 1YLLA 5F3EA 1DU3D 2YPDA 2C24A 3BPSA 4IQPA 2E7AA 5F3IA 4HL0A 1MS8A 1SFYA 3WNOA 3RJRA 2XDVA 3LOBA 2YB7A 4D6QA 4WM8C 3QH6A 2WT0A 3NRUA 3ATGA 5DG1A 1RUH1 3WNPA 5DQ0A 5FYTA 3H3LA 4CDUB 5F3CA 2PHTA 3IDBB 1OVSA 1UY2A 2B8MA 4P02B 2B39A 4Q2FA 5HV4A 1NCQB 4YW7A 4BWOA 5JIUA 3VBFB 5FZFA 4Y26A 4E4DX 1AYM1 3ORJA 5FZEA 5CAZA 3FLTA 5FAXA 5ACA2 1GQPA 1NX9A 4XDPA 1F9KA 4IUGA 1OSGA 4ATFA 5FV3A 4S2FA 1WLCA 1NA1B 2MEV1 4XAAA 1I5ZA 2CV6A 3KV9A 2DWRA 3LZZA 1MQTB 1Q8OA 1QQP2 3INAA 2JIJA 1QKQA 1W2TA 2VXJA 4UFHA 5A6QA 2WA4A 2XVLA 3GDBA 1ZBA2 5B4NA 3VLBB 3VZKA 4ZHNA 4NHKA 5EV7A 1SPPA 2RMU1 3VBHA 1CAXA 2HWE3 2RG4A 3TOJA 4QU1A 3POSA 4JDNA 3ZN6B 4FPYA 4CPBD 1GZTA 1SLTA 2DCZA 5JPNB 2VM9A 2ENRA 3ZYIB 3VBUB 4ORFA 2YBKA 5HV0A 3N7MA 2OKXA 1NOVA 1WCSA 3H1YA 3ZSJA 3HIFA 1F8VA 2OW4A 1ZYBA 2YC0A 3G6JB 4GWNA 5CNAA 3LGRA 5JZGB 5BPXA 2ZEZA 2PHDA 4AQ2A 1J3QA 5K8SA 1XE7A 2JDUA 4WM7B 3ZYRA 1R081 2BERA 2Y6GA 3CKHA 4CUCA 3KMHA 4WVMA 2WNVB 4DXSA 3VD3A 1V9U1 5ANQA 5EQUA 4PLNA 2E53A 4PBOA 3PUHA 1CD3G 3MZHA 1AX1A 1OPMA 4BXFA 2AEZA 2EAKA 5JR7B 3LCPA 3VZLA 1W9FA 3BGAA 4Q1RA 2JENA 4NIAA 2DU1A 4P5HA 2BV4A 3SHRA 1GZWB 3S5AA 1UZWA 3OBAA 2XXZA 2FBEA 3THCA 4AEKA 2DU0A 4A45A 4P9WA 1W9YA 3MGUA 4W65A 2W1WA 1JYVA 4MGIE 1W2AX 5I0RA 4YFWA 4LMFA 2BFUL 3GCXA 1KGYA 4MGZE 2CAVA 1WMDA 4CPBA 1QU0A 4OHZA 2DFBA 2VQ0A 2A70A 3KM5A 1ULFA 1QJX1 1U12A 3PVNA 2HWD2 2Q8EA 3SKJE 3PIGA 1DGWX 3RI8A 3WDTA 4QDQA 4NIGA 3ZDSA 2RS13 4GJZA 2ET7A 4AI2A 2HWC2 3MHZA 4AI1A 3NJVA 1Q5OA 4C8DA 3MPPG 3ZSKA 4KH9A 3Q8AA 2YROA 4LNVA 2DVFA 4UF0A 2QNKA 3LPGA 4WZCA 2XJQA 5M0TA 1H30A 5IK4A 5DAXA 4DQAA 4GB33 4LHNA 3RZJA 2EICA 4LIUA 1HRI1 1R093 3UKTA 1C5HA 1JN2P 3FMGA 3FFZA 3MICA 5KWRA 1UKGA 1NCQC 2BUKA 4K9SA 4BA6A 4HN1A 4D94A 3ASIA 1C4RA 3CIHA 4N53B 5L7OC 2ZHKA 1P8JA 4AVCA 3WVJA 5F5QA 3PU8A 2EVXA 4QAWA 5AC93 1NCQA 4JGYB 5KC6A 3DF0A 1RINA 3GJBA 1WD4A 5L7OA 2IZWA 1OH3A 1UU6A 4XEZA 3ES1A 4PF1A 2FCTA 4CUAA 1U5IA 2ZGMA 2YGMA 2JDNA 3O1OA 3ILRA 5FP8A 2YC4A 4QT6A 3FFQA 4C0HA 1RUJ3 1KJRA 1RUF2 2O8QA 2BZDA 2WZ8A 2WC2A 1EYBA 3T0AA 2ZACA 2IXHA 2A6VA 2OQ7A 5FZDA 4HLTA 3DL3A 4QQLA 2WT2A 3OCPA 2W47A 1UYZA 4NHXA 1V6LA 3ZN6A 1QF3A 2O0OA 4AVTA 1ZRDA 3I2KA 2RDNA 4FPEA 1FAYA 3POJA 5K0UB 2VVFA 2VMHA 4WM7C 1AF9A 1HV1A 3AFKA 5I8TA 3OPZA 2LRPA 4QPYA 1AR93 2R6QA 3HQUA 1HB3A 3LWCA 2AEYA 4ONUA 2HBTA 3GHNA 4WM7A 1JH5A 3WF2A 5KC5A 3AKTA 1PO22 5A1LA 3M70A 2RDRA 2WNVA 2XLAA 4NRQA 2WZPP 1AYM2 1WMXA 4RL7A 1ODNA 2VC9A 1ZRFA 1N1VA 1RUI2 4CCOA 4CXXA 5FREA 2LROA 5FFOC 5FO8B 4D7YA 3UYJA 4PI0A 4AG4A 4DRVA 1K45A 5BNPB 1VIWB 4MGTA 3T2OA 3U1XA 4XBQA 1GZWA 3HT1A 3WDWA 2ZEYA 3HN1A 5LY1A 3UGGA 1D2QA 5JOYA 3S5QA 1UYXA 3Q8FA 3BCWA 1SG3A 3WP3A 5JMCA 5A3OA 1C8M2 2RMU2 1HB4A 2EALA 3N9PA 3ZSMA 3LDRA 4NVPA 2B9VA 5FXVA 1QEXA 1ZZ6A 3OUIA 3PMEA 4XDQA 4AR2A 1VBB1 3WCRA 1LODA 3BOWA 2DF7A 2OA2A 4BMEA 4YZ4A 3GALA 1HQNA 3Q9OA 1SLAA 1IZ3A 2YG0A 5LEJA 5FKBA 3NNMA 5ABJB 2JG8C 3S30A 2UU8A 1MEC3 5F5IA 4XIKA 5F2WA 4NIIA 1UZVA 4XJ9A 2OIIA 3S7IA 3WXPA 4B1LA 1PMJX 3AYAA 2RM22 2DUPA 2WFF2 3WX5A 3JB4C 4LO8A 5E88A 2XB6C 1X8MA 5C33A 1K3IA 1W3XA 2JG8A 3PJYA 3K51A 4P9YA 5KHHA 3CHXA 1HX6A 2QUOA 3EXUA 4EQVA 1RUNA 1RUOA 1HB2A 2HBUA 4Y3OA 5EYXA 5LBFA 2VTXA 4WVZA 3KT4A 2J1EA 3I59B 4JGYC 4M3CE 2TUNA 5FMOS 3E6BA 2V5YA 1CN1A 1W05A 1FV3A 4YM1A 2E7QA 5E6HA 1H1MA 2ZGLA 1LOFC 4HK8A 4Z8BA 1UZZA 2YHJA 4JGYA 1XXNA 4PDWC 3SNMA 1OVPA 2P5BA 2B46X 2F17A 1IGOA 4FI9A 2VMIA 4H14A 3VBRC 2VG9A 5FY1A 2DVAA 2Y6FA 4XVHA 4C90A 1LOFA 2VOKA 3ZN5A 1LOEA 1VBA2 2Q8CA 3T2TA 5FZ4A 4H2AA 1ENXA 4PDWA 4MHRA 5D8AB 5G04L 4M3CA 5A6YA 5FWJA 4FOYA 3VBRA 1QJX2 3J7NA 3NQHA 4PLOA 4XJ8A 3R6SA 1JHJA 2RS53 4DPNA 1F35A 3EQEA 4CE8A 4AVAA 1DQ0A 2P3YA 3VBOB 2RDQA 1GQHA 4LUKA 4AEJA 1DP0A 1RMU1 3C3VA 2AYHA 4CEWB 2ZA9A 3FBYA 5A32A 3N7LA 2Q8OA 2PLV1 1HRI2 4XZUG 2GC0A 4ZPIA 4E4HA 4RS5C 3DV8A 1AXKA 3BYWA 2W1QA 3TNPB 2B7YA 3N3HA 3KT1A 2IVIB 3MIDA 2GH2A 4K3UA 5K9YA 1X36A 1HKDA 2VCMA 4EWEA 4RS5A 3WZ1A 1GUIA 4CTEA 2XOMA 3RWNA 1UIKA 3I2FA 1K5MB 2NN8A 4EN7B 4WV8A 2MPFA 1HLCA 4DIQA 5BNPC 2K46A 3B01A 3GBWA 4BCUA 3HNMA 4DXTA 5KHGA 4EV0A 2ZGTA 3RVHA 2QKDA 3GZAA 5T55A 4O9EA 4XPVA 3AZXA 4E4SA 5BNPA 4Z92B 1SFPA 3IB3A 4GMP1 4E8DA 1DLCA 3PIJA 1Z7S2 1CAWB 4GKXA 3H8XA 4JV4A 5EYYA 3DYPA 3PDQA 4IETA 5BY5A 3MO4A 4COYA 1VBC2 2AACA 3ZVXA 4B29A 1YO8A 2OYZA 4N8MA 4E8CA 4K1YA 4QXCA 5AFBA 3JXSA 1IQAA 2YFZA 1PGL1 4ISQA 5DZFA 5EZWA 4D69A 1POV0 3THPA 2E51A 4LLOA 4XQDA 4BQ5A 4N43B 1H9PA 2IXKA 5IT6A 3B5LB 5IUQA 2AH2A 1O3SA 2JECA 2QQNA 1O4YA 4PT6A 3IPVB 2VTXJ 3KWVA 5ABJA 2ERFA 5IFPA 4Y1VA 5FYMA 2CGNA 2OPKA 5FZIA 1SLCA 2XVKA 2OUHA 4DXZA 3SH4A 2GSYA 4N9IA 3VZNA 2ET1A 1GANA 3WDYA 3ACIA 3OJBA 4QPIB 3NNFA 4P9GA 1V6IA 4AZZA 1AHSA 2WUHA 4L97A 4M3CF 1IG3A 2PHWA 1VAVA 2VUCA 4OFGA 4COWA 5CADA 3M1HA 1BMV1 1A8DA 3RJ2X 2BWCA 2PAKA 2V4VA 3H9AA 4AFDA 4UFMA 4RHV2 4QQOA 1NCRB 3AZWA 1WLDA 3FHQA 2XH6A 4X6QB 5GKAC 1REFA 3AXDA 5JIAA 2SBAA 2ZX4A 3AL5A 2JJ6A 3T08A 2HWE1 2Y64A 5J98B 3OF1A 4NE9A 5FYIA 2ZOEB 1AR61 1ZVFA 2WAOA 2HEVF 5T5JA 2BNNA 5HBAA 1G8WA 4P9JA 2ADDA 2H6CA 3NSTA 4D6RA 4PJYA 1GICA 3KQRA 5LA0A 1HXS1 4JKKA 5CU1A 4AHZA 5LW9A 2W9XA 4QQ2A 3VBOC 4A3XA 4K7JA 2GAUA 4XF0A 5FY8A 3WG1A 4IV3C 4ATEA 2W3JA 2R063 3DPRB 3AMMA 2HWB3 3OBZA 3OOXA 1OLME 1VAMA 2V4AA 5C9AB 4P5YA 3USUB 2G4IA 3VBOA 4I2OA 1KJLA 3LEGA 1W06A 1POV3 4IV3A 2OX0A 2WO2A 3NVCA 3U11A 5L9BA 3I3QA 2BGCA 4ZKTB 4GH4B 1ENSA 2Q4SA 2BBVA 4AEDB 5C4WB 4JRLA 5T5PA 1PM7A 2AR6A 4OZOA 4DRRA 2WS91 4X6RB 4KU7A 3IMNA 2HWF2 3T3YA 5DG2A 1KEXA 5FPVA 1C8NA 2WNUC 4H7MA 5EJ1B 5HCAA 1OLMA 1UQXA 1SBFA 1V00A 1Q3EA 4FCAA 1S0BA 5FDBA 1JYXA 1HN0A 2ZKLA 1POQA 2BVVA 4LJHA 5JSOA 1W8NA 3B00A 2GN3A 4AGGA 2WNUA 4QDSA 4XC9A 4MG2A 2VOVA 1DFQA 2WQ8A 3GCWA 1YI9A 4R52A 5HXVA 3RI9A 1MS0A 3SH5A 3CZUA 1GNHA 1UL9A 5I91A 2E33A 4O9GA 1JZ2A 3MUY1 5FYCA 3PVBB 2G9FA 5FUPA 2RS11 4RGGA 1YCIA 5FP4A 3WW1A 5J36A 3I54A 2R072 4JX0A 1CAWA 1ULGA 1MS5A 1NT0A 1D4M3 2VZQA 5F37A 4LKDA 2RE9A 5GM0A 3JBG3 4N43C 5LEKA 1H6YA 2R30A 1YC61 3IAPA 4JDMA 5FMCA 4GB31 5FP3A 4L8QA 1VBD2 4ZU4A 3T2PA 1S0EA 5C3SA 1SBEA 3LIGA 4N43A 2Y6HA 3N9MA 4A4AA 2GNDA 2XJUA 5F2SA 5LA2A 5CFDC 2ZX1A 3ZIXA 3A0KA 4YGEA 1OQEA 3WD5A 2MHFA 3WDUA 1O3TA 1FX5A 3CJXA 4CZSA 4EZ4A 5ISLA 2HEYF 4NO4A 5CFDA 4FFFA 4O61A 5F5CA 4U2AA 1XU1A 2RJKA 1NCRC 1OOPB 2D40A 2VECA 1MVEA 3IIIA 5LATA 2R042 1G6NA 5FJKA 2AC1A 2JDZA 4MXWB 4YGCA 5A3WA 1UU5A 5DAQA 4A6OA 4W6YA 1RUJ1 1ZZ9A 2JD4A 1TE1B 3ZFFB 1MPXA 4BQYA 4CRQA 1IQDC 4CP0A 2PQQA 4FPOB 3JD73 2B42B 1NCRA 4L0PA 1HRV2 3WF4A 2D3RA 1UD1A 2EIEA 5ACA1 3EHKA 3PUSA 1OUXA 5IFTA 1LHNA 1Z78A 2JDKA 1L7RA 4HFSA 3THTA 4BB3A 4CXWA 5F3GA 4NIDA 3A22A 4ISRA 1QQP1 5LZ6A 2D3SA 2R49A 4P08A 1WCDJ 1AR91 1JOPA 5C3RA 3VB9A 3WF1A 2VU9A 3O0VA 4Z82A 4CYDA 1GP6A 4AI9A 4LR4A 1YWKA 4IGOA 3L2YA 2ZGRA 3JCIA 2R0HA 3GXUA 5C9AA 4DUWA 2QE3A 1W6PA 3CF6E 2Y6LA 1VB4A 1YI7A 3CDZB 3M3QA 4IE0A 2WABA 1XC6A 4KGGA 4DEVA 5HXMA 1RB8G 1QNWA 5IHRA 3RS6A 1S0DA 1TNRA 3QBQA 3VZOA 2EAAA 5J37A 2W94A 3MV01 1DGWA 1BMV2 5IVEA 1E5RA 2BWAA 2ZS6B 1VMFA 2OS2A 2ZZQA 3B94A 1O4TA 3PUQA 4WM8B 4AHYA 4W4ZA 2GU9A 1SLBA 4Q4W3 4Y4RA 2Q1ZB 4BK5A 3N35A 2FZ1A 1NG0A 2BGOA 4UW5A 2YFUA 2PAEA 4HSJA 5FLHA 2HWE2 4CCKA 2R32A 4CCCA 1LOBA 1US2A 4I0WB 4E9KA 3FL7A 2ZX2A 4K8RB 4XACA 5FTTC 4AAXA 4W50A 2CL2A 4INDA 1BLZA 3ZPOA 1RUE3 3ENRA 5LK5A 3TEXA 5C7GA 5APAA 2WA3A 2CWSA 4CU9A 1SPPB 1AL23 3MW2A 1BEV3 3CO2A 3W9AA 5A3LA 1SQ4A 3BI3A 1LHWA 4FPGA 4Q27A 3UL2A 2H6BA 3GZEA 4UWDA 2HWD1 3ACHA 1NLQA 5JMOA 5IK7A 3AYCA 1QJFA 4JKLA 2WKKA 3K77A 3CJIC 4S2GA 1A6CA 3ABZA 4ZS3A 3HJRA 2VOTA 3TNQA 4I0BA 5F7UA 4BDVB 5DAVA 3ZYHA 1U0AA 1KS5A 1DQ6A 1OOPC 1VB2A 4IE7A 4WVMB 3KT7A 1V6MA 2WZEA 1LEDA 3AX4A 3CJIA 4HONA 3AM2A 1LU1A 4MGYE 1CPNA 2ZMLA 2VQTA 4XXPA 4AK3A 1MACA 3M3EA 4HKOA 4QHZA 4BPZA 3VD4A 1FMD3 4C0BA 1JODA 1OOPA 5CISA 1YFUA 3GYDA 5F39A 5A7WA 4Q0UA 2ZGQA 2PFWA 5K4LA 2JE9A 4P9XA 5D21A 3RYRA 3BPZA 3OGVA 5C5UA 1SFNA 1W8UA 3R4SA 4KGQA 2RS51 4XJZA 2RS12 2TBVA 4IEWA 5BYNA 4Y1XA 3WG2A 3QLQA 3I2DA 5JLVA 2E63A 2XONA 5JI7A 3UNPA 2ETEA 2QCSB 3AB0A 4FFHA 1G9FA 3FC0A 4P9LA 3UGFA 1W0NA 1XSQA 4DMIA 2R043 3BUCA 3G7DA 3PU3A 4BQ3A 2DURA 3HAGA 1MS1A 1GR3A 3H1WA 1PZ7A 4UI9L 2VBDA 5FZOB 1RUF1 2EIBA 2EXKA 1GSLA 2IXIA 1R092 4GB32 4LULA 4RYDA 4DY5A 2UYBA 4QHOA 1HRV3 2CWMA 4PQ9A 4XQ4A 3AJYA 2WN2A 3H50A 1YIPA 3OUHA 1WBFA 3GZUC 4UT5A 1KDMA 4UF0B 3D4KA 3MI8A 4OMDA 2XUMA 2EF6A 2ZCWA 1IS6A 4Y24A 4HKWA 5AC92 4MOAA 4XF4A 1ULOA 4FTEA 1VRH3 4GWIA 2NMNA 3KCXA 4QPGB 4H3WA 3VHRA 4AQSA 3K4DA 2JICA 5JI9A 2YBPA 3T4VA 3CQOA 5C71A 1VMHA 4A2UA 2BVBA 3H8OA 2XL9A 1N1TA 1MR5A 4XUQA 2R7EB 2RJ2A 3MLKA 1RUC3 1YJKA 4JRAA 1RUJ2 3J8F3 4XF9A 3VDCA 1PO21 4I01A 1H2KA 4MH0E 4WM8A 4LO6B 2Y6JA 5FZ6A 3VGIA 2B4KA 5L7OB 2KM2A 1FXZA 1W6NA 1N47A 1RUI1 4Q8LA 4ARYA 1XPWA 2WZR3 4EN6B 3B3QE 1HW5A 2OPWA 4XFAA 1AXZA 1GWKA 4KG8A 5T54A 5L19A 4XFFA 4YM3A 3A7QA 2VH9A 1REEA 5IVVA 1OA3A 1JZ6A 2E26A 2X53S 3IT8A 1UY3A 2FHRA 3POIA 5F1RA 2QQWA 4XHXA 4Z2WA 1AR92 3KGLA 1OURA 1C8M1 1UIJA 3HPNA 3ELNA 1LNSA 2A73B 3RZMA 1YRZA 5L9VA 1ENQA 4CDXB 3LEMA 2PYTA 2ZGUA 2O8OA 2Q8DA 4XIOA 2IVJA 4CXYA 2VW1A 2VZ3A 3VBSC 2JKBA 5A3TA 1DZTA 3A0NA 3QACA 2ZGSA 3N9OA 5JPMB 2GMEA 3HN3A 2W1SA 5FPUA 5FWEA 3ZDVA 4KL1A 1I1EA 4ASKA 2Q1MA 5C8WA 5JXHA 3LA3A 2QDRA 3OB8A 2UY9A 1HN1A 2RM21 2WFF1 1BKZA 2XMLA 3BIWE 4PF5A 4QPWA 3S7EA 4OZXA 2VOXA 2ORZA 4IEOA 1TME3 3UJQA 5JXJA 1E5SA 5B4XA 2CDPA 5CIRA 2WNEA 2W0XA 3OGSA 4OUEA 5FYUA 3MFCA 4YYOA 3K4AA 1HV0A 4JCKA 3D3AA 2K2SA 4LXLA 4Q0VA 1UY0A 1O59A 3H42B 3ZKYA 4QX1A 1YQ2A 4TWTA 1Y9GA 4CCJA 2A71A 3VDBA 2P6HA 3TEYA 1LENA 2P1BA 4Y5SA 3SISA 1SEFA 5FYYA 3WP4A 3VKOA 3LKJA 1UX7A 2VXRA 3J26N 4YG6A 3TN93 1OH4A 3VN4A 4IEYA 3RNSA 1RVF3 1VBE3 1UZYA 1MEC2 3FE5A 5A3MA 5IAXA 1NUKA 1A78A 1JZ3A 1GOFA 3ZXFA 2D6PA 3WNLA 1VBA1 4NRPA 4KBZA 3PTYA 2Q1FA 1LOCA 1OKQA 4AXOA 5FZOA 4HVOA 1SZBA 2WINB 3T0BA 1DHKB 4RFT0 3ZXLA 3JQWA 2MNGA 5LCWL 3LEKA 4XETA 2XJVA 2XKOA 2ZHMA 2ZHLA 3O5SA 4HPKB 3M7AA 4QPGC 3VL8A 4FXKB 4B4QA 4CCLA 3T09A 3ITQA 3V0AA 3KHCA 1CAUB 2JG8B 3VZJA 1QH7A 3KHBA 3AXEA 1BCXA 4QPGA 1UYYA 1GWLA 4BJ0A 2TEPA 5IYYA 2EXIA 4QX3A 5IVJA 1PIV3 2DFCA 2VW2A 4DO0A 2ZAHA 2W95A 1OF4A 5A7NA 3SITA 4E4ZA 4HVRA 2WR9A 1UW8A 2LUWA 1XNTA 1KXGA 1XYOA 1S0FA 3CMGA 3WDVA 4Y1YA 5DXDA 3RMYA 1D4M1 3DKWA 4SLIA 2RS52 2QVSB 2YY1A 1S2EA 3JBG1 3K46A 4Q4X3 5FYHA 3M3OA 5A1AA 3HMYA 2QQIA 4LE3A 2WDBA 1QXPA 3JQXA 3ZFEA 1BHGA 4AW7A 2DVBA 2A3YA 4PDWB 1UYPA 4M3CB 5C5TA 2IWGB 5JXGA 4J6GA 4HANA 2XJRA 1Z7S1 3VBRB 1C28A 1NY72 1TMF3 1VJ2A 2PELA 2FCUA 4XTMA 2GNBA 4Y5TA 5FP7A 4CDXC 1PNFA 1QXJA 1VBC1 3ZYJB 4AL9A 3SKVA 1LHUA 3VL9A 3LQCA 5IVYA 1SCSA 1JUHA 1ZM1A 2G9GA 2JB4A 1EV13 4KWUA 2VBPA 3MIHA 4QM9A 4CDXA 3RZHA 1GV9A 1Y4WA 5IWFA 1MS3A 5DUWA 1UMZA 3ZPYA 4HT1T 4IV1B 3A21A 5A32B 4NUBA 4BHPA 4CP2A 1QWRA 1GOGA 2YU2A 2C0ZA 1DF0A 3BVCA 3RPQA 2V5DA 2RDSA 3LE0A 1IOAA 4B4PA 2J7MA 1HQWA 2OT7A 1H1IA 1C1LA 2BJSA 5DUXA 1QJY3 2C4XA 3E5UA 3ZKUA 5KXCA 2P37A 5A7OA 4RS5B 3AYEA 3ZN4A 5H9PA 4B7EA 5EXOA 4R9BA 4P00B 3KV5A 5I0DA 4ZU5A 4TXWA 5H9QA 2AENA 3R0RA 5A33A 2VBBA 1KFXL 2CAUA 4QXBA 5D1IA 1RYYA 2B45X 2JIGA 4WZFA 2PXJA 1FPN3 3V56A 2FDIA 3POEA 1CZVA 1UXZA 2JDHA 2ZHNA 1Y9QA 3I97A 3POGA 2DVDA 1A34A 3J7LA 2YBSA 4RHV1 1JU4A 2Z69A 2F4PA 3HR9A 4QU2A 1FATA 3RWKX 1DZQA 2W39A 3JZVA 1QJU3 1QDCA 1W8HA 2QQLA 3ES4A 4Y4YA 4CU8A 2DVGA 4KG0A 2X05A 1HIXA 2VUAA 3BU7A 2UURA 5FZ7A 3U37A 5FO9B 5CEHA 5A3UA 4FXGB 1Y9MA 4MZUA 3POFA 3WY6A 3H7JA 1R1A3 5DUVA 1XJAA 2Y38A 5FZMA 2EA7A 3VKLA 1J3PA 3I3DA 2GN7A 4G9SB 4LBKA 4Q4V3 3UK9A 1W6OA 3LEIA 1W2OA 5DMYA 2Y60A 1COV3 3O1TA 4MLOA 5CVRA 4HPKA 3KSCA 1EUUA 5CKMA 4TSVA 2JG9C 5CFCB 2QQUA 4X8PA 4FSJA 3OBTA 1CAUA 2C6SA 4ZZ5A 2B9UA 3C7HA 1CWPA 4OHXA 5FQ0A 2GH8A 4BZ4A 2HWF1 4YM2A 5T3NA 1MZFA 2JG9A 2JXAA 3TWIA 4NRMA 4OULA 4L99A 1BBT3 5BNOB 3N36A 4M01A 3TRSB 1U5XA 4AVBA 2W2IA 4XFIA 3LDBA 3O1UA 1ULPA 1BEV1 3GZTB 2R062 2ADEA 5FY0A 1GZCA 2HWB2 2B5HA 3VKNA 5FPXA 2XUEA 4TLGA 1JMUB 4Q8KA 1L3JA 2WQ4A 2R1BA 3GBFA 3C7OA 2YUEA 3WW3A 1YJLA 4OUMA 5IW0A 5FZ8A 1G7YA 5JUVA 2R071 1AX2A 1ZA7A 2JEMA 3AVSA 5BXXA 1PM4A 4XFCA 1FNZA 3FZ3A 3WOGA 4CEYC 2DTYA 3FHAA 4DINB 1LULA 3O1SA 1G9AA 4IV1C 2WWJA 2JKXA 4D8MA 4QKFA 4QGNA 4IV3B 1VBD1 1X7NA 4BLIA 4CEYA 1WW4A 4LKSA 1KQRA 3AP6A 4RR3B 4IV1A 3T0DA 1FMD1 1PGW2 3HT2A 4A7YA 1PVC3 3OEAA 5FZ1A 5FYSA 5HPOA 3AYDA 1O3RA 4JDOA 5LBBA 4COZA 3FJSA 1SACA 3ZXAC 3I3MA 3FUOA 1WW7A 1GNZA 5CKQA 5FZ9A 4ZZ8A 3AP5A 4QGMA 3PUIA 3MPBA 2WNUB 2VO5A 2ZJCA 4GQ7A 1D4M2 3ILNA 4LBQD 2R041 3JBG2 2OZJA 2NYYA 2RV9A 2I2SA 3AZYA 1T6BX 3GNEA 1FV2A 3OEBA 4IE4A 1CAVA 4ZXKA 1EPWA 3VDDC 3D82A 1HRV1 4NIHA 3W20A 4FP2A 4YGBA 4YW1A 2WRAA 5FOBB 4UFKA 3ZR5A 1AX0A 3KD4A 4DB5A 2VVDA 1EP0A 1OUSA 1EAH3 2PAMA 3ACLA 4XJUA 4IL7A 1BVVA 2VR4A 4K1ZA 2HYKA 1VRH1 2L9LA 4ASMB 4UW3A 1WW6A 4XQWA 2VULA 4AHXA 3E6CC 1UOJA 1STMA 5F32A 2OZ6A 1R64A 2VNOA 2WQZC 5EJZB 3OGRA 1JZ7A 1RUH3 2P4EA 1JW6A 5KBFA 1W6MB 5CFCC
chains in the Genus database with same CATH topology
2D3PA 5KXDA 4CDQB 4JC1A 1XRUA 1SLLA 4XW3A 2XL7A 4A7KA 2GC3A 1BXHA 1N1YA 2WIIB 3JD72 4G3YC 4N7IA 4ES8A 5CFDB 4F3JA 4P9IA 1CPMA 1KDKA 5T52A 5CFCA 4FP3A 4HVQA 4TZDA 1LOAA 3H3UA 3PVOA 2VNRA 1V6JA 5BNOC 2MEV3 4FTBA 3H3ZA 2RS33 3OTFA 4D7TA 3VKMA 2QZ3A 5BNQA 4AWDA 1Q43A 4Y1UA 5BNOA 2CNAA 5I8SA 1NE4A 2BTVC 2BYVE 1RJ8A 2RJLA 1UN1A 3I7DA 1NZCA 3NL1A 1F5FA 5I0UA 3ZXKA 3R4DB 2XLFA 3AMPA 3DN7A 2DCJA 2ZMNA 1CONA 3P3PA 2FZ2A 4AI3A 4AFCA 5JOWA 4MUVA 2ES3A 1NLRA 3CU7A 3TB0A 3SXWA 2C9AA 2R1DA 5DDJ3 4R9CA 2HJIA 1J59A 1BQPA 4JTNA 1W0OA 3FHIB 4RR3C 4AF9A 4BIFA 1R083 4PCRA 4RGAA 1PVXA 4IESA 1DDLA 4W6WA 1V9U3 1W6PB 4JQRA 4Q4W2 2WFPA 5GZDA 2NPIA 1FI2A 3IKWA 4RR3A 2DUQA 2X29A 4Y22B 4YZ1A 2AZ5A 2D5FA 2DV9A 2ARXA 3RQ0A 4J1WA 1N1SA 3TN91 1REDA 3R05A 1RUE2 4JAAA 2VPVA 3TAYA 2EIGA 2DTWA 1AL22 1BEV2 1OI6A 1OLQA 4YGDA 4D7SA 2IFWA 2ZGNA 4IEZA 1Z0HA 4RD7A 4NPRA 4FOQA 3CNAA 2YZ4A 3AMNA 4COVA 4HN0A 1URXA 3T1LA 4K6BA 1C3HA 2ZBJA 1WMFA 4MSVA 4NN0A 4BIOA 1GBGA 4R4XA 5AVPA 4LBJA 2Y26A 2YGLA 4Y20B 2NZ9A 5E16A 2YPJA 2DUOA 2XGXA 1CR7A 1R091 2WSUA 4TYSA 4M0NA 5BNNC 3AJZA 2AGSA 4R4ZA 4CDQC 2XWJB 3ZMNA 1FMD2 4Q0SA 5TSWA 3EO6A 1W6MA 1QGLA 1NXMA 5AC91 5BNNA 1RHI3 2ILMA 3NW4A 4CDQA 1RL3A 3CJIB 2WJSA 3IN9A 4LBMA 3W58A 4K40A 3D0JA 4Q4X1 3PNAA 2H0BA 4F8AA 4OI4A 5BV6A 3MIGA 1J3RA 1UF2C 4AFMA 3IDCB 2X8KA 1XE8A 5JAXA 1WGPA 2YV8A 3VZMA 5C8CC 2BEOA 3NKGA 1GZ9A 5J96B 2E7TA 3GBGA 1AUYA 2R0FA 3O12A 2HKXA 2NMOA 1EV11 5C8CA 1CJPA 3D5OA 3LA7A 5T50A 4IERA 5C6CA 4UBHA 4Q1PA 5FCCA 1NXD1 5JOZA 1VRH2 2FQPA 1ZZCA 2Z79A 4E2SA 4XHBA 3KCYA 4NOTA 1D0GA 5I93A 1QJY1 4K8FA 1OHFA 1MS9A 1ULDA 4I0AA 1LTEA 1RUC2 3MIBA 3J8F2 4Y5Z0 1QY4A 5H9RA 4EJRA 3AK0A 1FPN1 2WZR2 2P2KA 4Y22A 4FOWA 4CP1A 3NV3A 1O5UA 1UAIA 3D0SA 2VVEA 1J58A 1QJU1 5FMOL 1JYIA 3U07A 2V09A 2NLRA 1J1TA 1UPSA 5FBZA 3QOPA 1W6NB 4P14A 2XLGA 3ME2A 2ZX3A 1F31A 1XYNA 4C1WA 2IXJA 2Z2SB 2WWSA 2W68A 4RSUA 4E2GA 1H2MA 1VBB3 1IPKA 1ASJ3 4IEPA 2XPJA 1QH6A 3CLPA 4AGVA 1WBLA 1ZBE3 2CGOA 2ZGKA 1MEC1 4C91A 2KA3A 1COV1 1V6NA 1RIRA 4KWKA 4Y20A 4EN0A 3E97A 3PJQA 4LE4A 1TME2 1U5ZA 2N7GA 4FT8A 2ZKNA 1W6QA 1AYN2 2D6LX 2D97A 4JGZC 2GZWA 3ETQA 3VBSB 5GJ6A 4YW5A 1M06G 1BBT1 4NR1A 1AR72 1FT9A 1DZRA 1CQ9A 1N3QA 3PHMA 4JGZA 4KU8A 3TN92 3ZYGA 3B9IA 4GMP0 4BQ1A 1RVF2 1LU2A 1VBE2 3S6PA 3WQ0A 1AVBA 4NWVA 3GF6A 1DQ1A 3SCFA 2P3IA 1DGRA 3WV6A 2I45A 3KZ4C 4AFAA 1ND2B 2D6OX 4BH9A 4QX5A 4OVEA 5J09A 4F7ZA 1SDWA 3H7YA 3BOPA 3WR0A 1B35C 1QOSA 1CX4A 4YSFA 1DGRN 3FLRA 5GZFA 1LR5A 2A6YA 4RA0A 2XKPA 5JSPA 3BB6A 3PVEA 1RMU3 4FQZA 1B35A 1IS3A 4YG3A 1LB2A 4GIQA 4I3PA 2EXHA 4FPFA 1ZNPA 1NY71 4LLFA 4AEMA 3ZXEA 1U5YA 1YHFA 3V65A 4DY3A 2PLV3 4I30A 2XWBB 2DCKA 1NYWA 3M3CA 3PMSA 1E57A 1PIV2 3WW4A 4H7LA 1ZA4A 2IFRA 4OHWA 3LB9A 3V0AB 3N7KA 4RQPB 2NM1A 1Q8QA 5T5OA 4YARA 2QDNA 1WUVA 4Q4X2 4HK9A 2PN5A 2D43A 2I07B 2BPA2 2ZAAA 2YMZA 3SH3A 1G9BA 3RSJA 4GMP3 3WW2A 1TMF2 4EWDA 1D2SA 1TEIA 4GA9A 5KHIA 2OVUA 2WL1A 1EAH1 4PIXA 4CDWB 2VGDA 1LOGA 4HETA 1EV12 1V6OA 4L92A 4UW6A 5SV5A 4FOVA 3SCHA 1S55A 3E5XA 4QQHA 4XOGA 5GALA 2VUJA 1LJ7A 4FQ4A 4A7ZA 1FYUA 4IEQA 1PZ8A 5JPNB 3ZO0B 3SLIA 1DIWA 3ZFEB 4E27A 1CGPA 3VV1A 1VR3A 1QJY2 3LAGA 1DQ5A 1W0PA 1H9WA 4AVSA 1XU2A 2P3JA 3IIAA 5FOJB 4M0HA 5JOXA 2LM3A 3WCSA 5BUVA 3WT3A 1H2NA 3SMHA 1DQ4A 4Z1VA 4UW4A 3VBHC 5EWSA 1FPN2 2RS31 3NV4A 1JXNA 1ULCA 3VBSA 2Z5WA 3LOIA 4R9DA 2DCTA 2X5IC 3EJKA 4WBBA 3NV2A 3HD8B 1QJU2 4LBNA 1LECA 5DZGA 5L36A 5A33B 2JE7A 2A3XA 3GHMA 1ND2C 4Q0PA 1YYNA 4GALA 4DFSA 2X5IA 1AYN3 3POWA 1AR63 1G86A 2F6BA 4YRDA 1Q8SA 3NKTA 4LA2A 4LO4B 3C2UA 3KCCA 4KWJA 5GLUA 1ND2A 1HXS3 1R1A2 1PK6C 1AR73 2CYFA 4HZFA 2Y0OA 2TNFA 2EXJA 2R061 1RUG3 4XMIA 2A75A 3WINE 5E8AA 2HWB1 4ASLA 4FAGA 4Q4V2 5DDJ1 3VHNA 4MXVA 4OHYA 1COV2 2FMDA 1PK6A 3B93A 3IM0A 3WDXA 4AE2A 3E5QA 1S2KA 1POV1 1F2NA 3WP5A 1PO13 4NHMA 2XVGA 3WLUA 4U36A 5IK5A 1VLNA 4YVWB 2WS93 4AGRA 3A4UA 3KLSA 4RQPC 1W6OB 2WT1A 4BLJA 1DLLA 2AREA 3DGTA 3OYWB 4GWMA 1BBT2 3UV9A 2VW0A 2GALA 5F9TA 4IEXA 2D93A 1H8VA 2W08A 4RQPA 1YUDA 2XBO3 4BMBA 1ENRA 4B4RA 4B8EA 1PGW1 2RR13 5FQ0B 1FOD3 2LTNA 1H8TC 3ZXGA 1LHVA 1S0JA 2ZGOA 3UKNA 4NWWA 5FLJA 1X8EA 1XNBA 2JG9B 4N7UA 3WP6A 1VALA 3QH7A 5KXEA 2GMMA 4CDWC 1H8TA 1O4ZA 3EBRA 4YNIA 3AP7A 4Q4Y3 2K0GA 4BE3A 3M8LA 1IKQA 5GLZA 4LT5A 1O3QA 4LUMA 2ATFA 4D3WA 1BVP1 4CDWA 4HKLA 1IS4A 2PTMA 4OLLA 2WLQA 4CDUC 4QM8A 1OMIA 1ZRRA 3ZMOA 4ZU7A 1IHMA 3ZFEC 3VBFC 4OHVA 1QDOA 4M00A 1PVC2 2QFEA 3LA2A 4CDUA 1H0BA 1AR83 1OFSA 1RHI1 1WW5A 1UCXA 2XG3A 3ZFEA 2XJPA 4GXLA 3VBFA 3ST7A 1NA1C 4CEYB 3V0BB 1MQTC 2VOWA 1RJ7A 4FPCA 4JVAA 4N9HA 2ZX0A 2IC1A 4OUSA 1NA1A 3WNXA 2BNMA 1RUD2 1TNFA 4EN9B 1MQTA 5JSRA 5GZEA 3JD71 1HDKA 3AFGA 1CVNA 5ACA3 2QQPA 3VBUC 3JU9A 1PGSA 1ND3B 2IXLA 2CTVA 1EAH2 1PZ9A 2A6ZA 3K48A 5JZGC 3JUUA 3ZXJA 1QQP3 3QCWA 1CAVB 2O1QA 4I02A 5KHKA 3VBUA 3M2MA 1MZ6A 1ZBA3 3WG3A 4IEUA 4F83A 4DNYA 2WNVC 3WHTA 4HSLA 5JZGA 1RUH2 1AJKA 4FPJA 3VDDB 3R4UA 1OPOA 5F6KA 2D7FA 5DZEA 2V73A 4YVWC 2A6XA 4WVWA 5F6LB 2KXLA 3ZYPA 1GLHA 3HWJA 1X50A 4XF3A 4YW4A 4XE9A 4H55A 3MF9A 4YVWA 4XBLA 1Q8PA 2MEV2 3ZSLA 5HCFA 3BODA 3KS7A 1SCRA 2RS32 1C1FA 3DUIA 2CY6A 3OYWA 3NO8A 1OQ1A 4Q4W1 2LALA 3AZZA 2NQYA 2YXSA 4LBQB 1AJOA 3NV1A 2A3WA 3KB5A 1ASJ1 1LRHA 1RUE1 4YW3A 4FAHA 3OGJA 1ZBE1 4BOWA 1UU4A 1BK1A 2ZABA 5FRAA 1AL21 4Q29A 4LHKA 4MX3A 5DDJ2 1ZZ8A 1R082 3MIEA 4N53C 1RITA 3M4FA 3FLPA 3RYKA 4GKYA 2UWBA 1V9U2 2HWD3 3MW3A 4S2HA 4E2QA 1UX6A 1ZZ7A 1BZWA 2HWC3 4I09A 4HBNA 1O7FA 3MDPA 5AFEA 3VHOA 1CESA 4N53A 4KBBA 4PBPA 3I4IA 2QJVA 4FPLA 3U4XA 1ZRCA 1G9CA 2BNOA 1VP6A 1JBCA 1DGLA 3J9SA 3V0BA 1XQNA 1S0IA 3LSEA 3ROUA 2OUJA 3ZSEA 1PMIA 4LBOA 4OI2A 2PA7A 4FVVA 1LGNA 1ND3C 2PHLA 3J4UH 4FPHA 4BM8A 3H0OA 1W39A 2PHUA 4IEVA 3RRDA 2P34A 2Q5TA 3NJZA 1WA4A 5K0UC 1ND3A 4AFBA 2GC1A 1OFNA 2YDEA 4HMZA 4AQTA 3MYXA 1RUD3 3AP4A 3QD6A 3RMXA 1D4VB 1RUF3 1I3HA 2D6MA 3AKPA 5K0UA 5CB7A 1NQDA 4META 1Y3TA 1T6GC 1V6KA 2D6KA 2Q30A 2VNGA 4X8NA 2RHPA 2UY8A 1S2BA 3AKRA 4AYUA 4QGLA 3VDDA 3HQXA 1OQDA 1RHI2 1OA2A 2H0VA 1S1AA 2I74A 4IXLA 1O5LA 1N3PA 3B7MA 3H1MA 4KNCA 3WHUA 2VY0A 2HEWF 5E1RA 1UKRA 3U0ZA 4COUA 3OD4A 1KFUL 1C5IA 1D0HA 1RUC1 3OGGA 3FBMA 3J8F1 4LO5B 5BNNB 5AVAA 1PO23 3MF6A 2P17A 1A8MA 1JYCA 5GLVA 3USSA 2E9QA 1IKPA 2Z42A 3N4MA 3ZFGB 5JDBA 1AYM3 1RUI3 3IBMA 3O7OA 2WZR1 1GKBA 4XXAA 4LBQA 1IPJA 3V64A 1QMJA 5ABJC 4LA3A 3UKVA 1MVQA 3HBZA 4XMAA 2E6VA 4ES9A 5SV8A 4XFBA 4PIZA 1APNA 1JTZX 4MV2A 1DQ2A 2DCYA 1Y43B 1C8M3 2RMU3 5C8CB 5CG9A 4J1XA 2CGPA 3VKFC 1YFWA 3OY8B 5GLWA 3IDEA 3URFA 1XNDA 5LK7B 4DOUA 4FTSA 3E6DA 1PHMA 4AQ6A 1WLTA 2XJTA 3FWEA 1UPIA 3I59A 4ITCA 1H2LA 2VQAA 1XNKA 1GYKA 2XHKA 1QOTA 4YFZA 3BTAA 2RM23 2WFF3 3NAPB 1ZZBA 5GLTA 5HI0A 3ZXDA 5JWPA 1TME1 2W52A 4B7KA 4N90A 1GQGA 5D8AC 4OI1A 3TBDA 1AYN1 5B2GB 5J48A 3O0WA 3MFAA 4L2NA 5GZCA 2A6WA 4QXKA 4B3NA 3ECQA 1DG6A 5D8AA 2D6NA 1AR71 1VBB2 1ASJ2 2IXCA 1H4GA 2YYOA 3P3NA 4FBFA 1YIFA 1RUG1 2A5ZA 5L73A 1XYPA 1RVF1 1ZBE2 3B02A 4LEJA 4CEWC 1VBE1 4TLFA 1LHOA 5IK8A 1MZ5A 4EROA 1DYKA 2ARBA 1QHDA 4FPKA 1VBA3 4EWAA 1PO11 3N7JA 4Q0QA 2UWAA 1VAKA 4CEWA 2D98A 4AHWA 1YXWA 1S0CA 1QJX3 5T5LA 1LCLA 1Q8VA 3RZZA 1JUIA 5HCBA 3U10A 1QJZA 1DYPA 1K5MC 3KGZA 3OBRA 3PLQA 4XFHA 2UYAA 1HQLA 2AUYA 1SBDA 1JHNA 1X82A 1XNCA 2GNMA 2WSVA 2RR11 1K5MA 1W6QB 2XBO1 5CBLA 1FOD1 1HRI3 1LGCA 3MW4A 3S0MA 3AP9A 1G9DA 2BW8A 2BQPA 1CIWA 1PIV1 3ZFGC 3ZIWA 2Y0IA 3D8CA 1LKNA 4JGZB 2SLIA 4Q4Y1 3WQ1A 5LRRA 4YLZA 4JTOA 2XJSA 4LHLA 2BFUS 2GMPA 4LBLA 3UJOA 3ZFGA 1NLSA 4K20A 1RMU2 3NWKA 3APBA 3SCGA 2GDFA 4YW2A 2C1FA 1TMF1 1Z7S3 5KXBA 1PNGA 2PLV2 4R8HA 4Z07A 1VBC3 1QXRA 1AR81 1SMVA 2R16A 3IPVA 4QPIC 4W6XA 4AVVA 3MLLA 4YZ2A 3RG0A 1B35B 1J1LA 3OY8A 4URTA 3O0XA 1JOJA 3CEWA 2VMGA 4MYEA 4YVSB 1QOOA 4QPIA 4LO7A 1LESA 1B09A 5CA6A 3NAPC