4D69A

Soybean agglutinin from glycine max in complex with the antigen tn
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
234
structure length
234
Chain Sequence
b'AETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENESGDQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title Detection of Tumor-Associated Glycopeptides by Lectins: The Peptide Context Modulates Carbohydrate Recognition.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 49
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d69A00
3WV6A 1WUVA 1JW6A 1QF3A 4BMEA 1AJOA 1DLLA 1JN2P 5JOZA 3ILNA 1V00A 2ZMKA 1YI7A 1LHUA 3SNMA 1WW4A 3MW3A 1IKPA 2W08A 1LOCA 1MACA 2C9AA 4FPFA 1LENA 4WVVA 2DYCA 4PQ9A 1V6OA 1DFQA 3O0VA 2FHRA 4FOVA 5IK7A 3PVNA 4CTEA 4ATFA 2D3PA 1SLAA 2ZACA 4FPGA 4K21A 3WG1A 3ZXEA 1GNZA 2ZHNA 4GKYA 3ILRA 5GM0A 4BLJA 1DGLA 2VU9A 2GN7A 4FPCA 2DU1A 1UN1A 3MEPA 5T5LA 1BJQA 4BMBA 5EYYA 3A0KA 2EXHA 1CQ9A 2D6KA 2ZMLA 4GA9A 4AWDA 1W0PA 4BM8A 2PHXA 4YG0A 2GN3A 2WSVA 3BTAA 1JYCA 1AX1A 5BYNA 1MS3A 1O4YA 4JCKA 1LCLA 3AJYA 2VUAA 3WDVA 4YZ1A 2SBAA 1G7YA 5GJ6A 1V6JA 5L73A 4AVTA 1V6MA 3WG3A 3WG2A 2WT2A 1Q8QA 3PJQA 4FOYA 4XJWA 4XMAA 4Y20A 2CY6A 1Q8PA 3A0NA 5H9SA 1HKDA 2A71A 5E88A 4YG6A 5IUQA 1GKBA 1UZZA 2PHRA 1CIWA 3N35A 4FPKA 4XJAA 4DRVA 1JBCA 1W6OB 3V65A 2YROA 4U36A 1KJRA 1HQLA 2WQZC 5H9RA 5IK4A 1MVQA 1Q8OA 3OBTA 4HANA 5DZGA 4BOWA 1QMJA 2OW4A 3ENRA 3QCWA 3JU9A 1YRZA 3B3QE 3SISA 1LESA 3O0WA 3SITA 4XBLA 3U4XA 2A3WA 3RMYA 4AGRA 2JDZA 2D6NA 1G86A 4YGBA 2A6VA 1YYNA 4I30A 3WCRA 1AF9A 3UL2A 3H0OA 2AENA 1Q56A 4YGDA 1RIRA 2DVFA 3D5OA 3ZSMA 2GNTA 2VXRA 3UJQA 1VAMA 2GNMA 2P34A 2BQPA 2V5YA 1PZ7A 1WW5A 3IPVA 3INAA 2PHWA 1LHOA 2D7FA 2Q5TA 1UMZA 2D44A 2CNAA 2DWRA 4FPYA 4M3CB 3SH4A 4D69A 2WT1A 3L2YA 4Y22A 4XTPA 2WKKA 2CWSA 1DQ6A 1QOSA 1JOJA 4YW3A 4YM3A 3AZXA 2ZGRA 4FOQA 2EALA 5LK5A 3VUOA 2DURA 2W39A 5JOYA 3AP4A 5DUWA 5FREA 1CONA 2HYKA 3VKNA 3W58A 1N1VA 4NOTA 2D6MA 4UW4A 4CRQA 1WBFA 3MW4A 4M01A 1C1FA 5CNAA 4BLIA 3ZXLA 1CN1A 4BQ1A 1G8WA 1GANA 1LTEA 2A7AA 2DVBA 4R9AA 1J1TA 3FLTA 4YM2A 3R05A 2P3JA 4AGVA 2E51A 2VW1A 1QDCA 5JMCA 5IK8A 2ZGOA 2LALA 4Y1YA 2XG3A 3UK9A 1F31A 4LBLA 4YW5A 5CAZA 1QNWA 1U0AA 4AVSA 2ARBA 4LBJA 5JDBA 1HQWA 1G9CA 2GALA 3V0BB 2DVAA 2JE7A 1LODA 1OKQA 3AYDA 1SACA 3MW2A 3IKWA 1GZ9A 3I4IA 1FV2A 4ASMB 2DU0A 1RINA 3RMXA 5GZGA 1WD4A 3AP7A 1MZ5A 4XIOA 3HR9A 3WDXA 1GZWB 2A3XA 4FPHA 3N7MA 1CR7A 1GYKA 5T55A 5JOWA 2OUJA 1Q8VA 1PZ9A 2DVDA 3AZYA 3ILFA 1RITA 2GNDA 3OPZA 3RG0A 2W68A 2ERFA 1KQRA 3AXDA 3D4KA 4M3CE 3WCSA 1G9AA 4XILA 3USUA 4RA0A 1IS3A 2DTWA 2A6ZA 2GMPA 1KDKA 1C1LA 2CTVA 2EXIA 5E8AA 1URXA 1VIWB 2GMEA 1V6LA 3ZSKA 3DUIA 4SLIA 3O5SA 5CB7A 2DUQA 1W6MA 1UX6A 3OY8A 2GNBA 4FP2A 1WLWA 2ZGLA 3M3QA 4UW3A 2ZAAA 4Y1UA 3ZSLA 3FUQA 3O0XA 4LBQB 3ZXJA 1DZQA 1WW7A 2ES3A 1W6NA 2ZABA 4YW4A 5DUVA 1Z78A 2PHFA 1DYKA 1S1AA 2ZGKA 3N7KA 3OYWB 5FRAA 1DQ2A 2D3RA 3WNXA 2CWMA 3M3EA 2VY0A 2DVGA 4M00A 3ZSJA 2JD4A 2R16A 1JHNA 2R0HA 4Y1ZA 3I8TA 1MVEA 5EYXA 1NLSA 1WW6A 3VV1A 3VKMA 1FAYA 2AYHA 3AYAA 1QU0A 1W6QA 4Q1PA 4RL7A 2A6XA 2E6VA 1AJKA 4R9BA 1S0DA 2AUYA 4WVWA 3BODA 4LBQD 4TYSA 4FPEA 2ZA9A 3TAYA 1S0CA 4XMIA 4FVVA 2D6PA 3AYEA 3GNEA 1V6NA 2YY1A 3JUUA 3AX4A 3APBA 4FPJA 4XOGA 3POWA 3WG4A 5F9TA 1AZDA 1TEIA 4JC1A 2D6LX 3FLPA 3POSA 4PF5A 3SLIA 3UJOA 1B09A 3FUOA 3OGGA 1VLNA 3WZ1A 4KBBA 2D43A 5CBLA 3WUCA 4Y20B 2NYYA 2KM2A 1ULDA 1DQ0A 4XJ8A 2R0FA 4Q27A 2DUPA 4XBNA 1UPSA 5T54A 1H9PA 1V6IA 1LHNA 4DRRA 1LGNA 2OVUA 4FPOB 4F83A 3V64A 4JRAA 4YG3A 4UW5A 3WHTA 1LHVA 3N36A 3WOGA 4XBQA 5EXOA 4YZ4A 2OUHA 4XJUA 3ZYPA 1MS5A 5DXDA 2UWAA 1AXYA 1QOOA 2EIGA 1IOAA 2A6WA 3WDTA 3RRDA 3ZXKA 1DYPA 1ULCA 3HN1A 3LCPA 1XQNA 4XJ9A 5GLWA 4FPLA 3PMEA 1DBNA 1A78A 4UW6A 3FLRA 1N1SA 2E53A 3ASIA 1A8DA 4GALA 4Y1XA 3WLUA 5DG1A 1S0BA 3AZWA 5T52A 1X50A 4L8QA 1SLLA 3WDUA 1MR5A 2UURA 1APNA 1YXWA 1MS8A 4LBOA 3T1MA 1Y7BA 3IPVB 4IQPA 1DHKB 4PCRA 1W6PA 4BPZA 5GZFA 1SCRA 4Q1RA 1N3OA 2JE9A 2R1BA 2UWCA 2WNEA 1H30A 3SH5A 4Q8KA 1GV9A 2P37A 4Y22B 1KRIA 3HMYA 5JOXA 4LBMA 1VALA 1ZM1A 2G4IA 4ISQA 3QLQA 2YZ4A 1R1ZA 2WT0A 4XXPA 2DUOA 5DZFA 1BXHA 4K20A 4YM1A 1G9DA 4YM0A 1LOBA 2ENRA 3AP5A 5KXCA 4XJZA 2A75A 1ENSA 5IK5A 5T5JA 3ZXFA 5IT6A 2EF6A 4ISRA 4YGCA 4AYUA 3NV3A 5GLTA 2ZMNA 3PVOA 1AVBA 1S0GA 1DQ4A 5SV8A 3T1LA 1FATA 3TB0A 1IS6A 3NV2A 3RQ0A 2WLQA 2R1DA 1YIFA 3IM0A 5GLZA 1BZWA 4C1XA 1DQ1A 1FX5A 1QOTA 2PHUA 4DQAA 4PBOA 3B00A 3LSEA 3V0BA 3V0AA 2CYFA 1S0EA 4Y26A 2E7TA 1IS5A 2XB6C 1ULFA 1BKZA 1UAIA 4WV8A 1ONAA 3C2UA 2DTYA 1UZYA 4XTMA 1MS9A 1D2SA 3LSDA 3M1HA 5CA6A 1UL9A 2ARXA 4NO4A 4P9YA 1LOGA 4AGGA 1I1EA 5EWSA 1MS4A 1SLTA 2YMZA 1AXZA 4M3CF 1PZ8A 4GWNA 1LGBA 3FFZA 1GZCA 4XZPA 1OFSA 4K1ZA 1LEMA 1WLCA 3OBRA 5HCAA 2P3IA 3USUB 1V6KA 4XIKA 1SLBA 4FOWA 5HCBA 2ZZJA 4AVVA 2NM1A 1CESA 1DIWA 1LOAA 2YXSA 2TEPA 2UU8A 5GLUA 1W6MB 3VKFC 4LBQA 1G9FA 3OY8B 5F5QA 4YLZA 1JUIA 1SBDA 2EXKA 2GMMA 1GNHA 1N1TA 1SBEA 2R49A 2UWBA 2ZGUA 2ZHKA 3B01A 3VKLA 3BIWE 3RS6A 2ZBJA 3OYWA 4FQZA 2C5DA 5AVAA 1D0HA 1W6NB 2ZKNA 2ZHLA 5HCFA 3AXEA 3IMNA 4YZ3A 2W52A 4GKXA 5H9QA 2JKBA 2ZGNA 4Y1VA 1VAVA 1FNYA 3DGTA 2WSUA 4FP3A 1N3PA 3NWKA 4YFWA 1O4ZA 2CL2A 2EXJA 2P3KA 3WVJA 1LULA 5H9PA 4R9CA 3W59A 4XE9A 5JLVA 2JECA 1JYIA 3A4UA 1SFYA 3MPPG 5DZEA 1WBLA 2AR6A 5JVVA 2ZGPA 1W6QB 3M3CA 1HLCA 3POYA 3Q9OA 2RHPA 2NN8A 1LGCA 1CPMA 4P9XA 2SLIA 1GICA 4DFSA 1C57A 3AZZA 4GWMA 1ULEA 3BOPA 5T5OA 4H55A 1GBGA 4W65A 1QGLA 1W6OA 1G9BA 5GALA 2PELA 1SLCA 3O12A 5KXBA 1LOFA 1W0OA 4R9DA 5DG2A 2D3SA 1H9WA 4LBKA 1HDKA 4ITCA 1WLDA 2ZGSA 4XDQA 3R4SA 1FV3A 1BYHA 1KDMA 4XYXA 4DPNA 3T2TA 2GDFA 3N7LA 4XXAA 5E89A 5GZCA 2AGSA 1ULGA 3AP9A 2AREA 3RSJA 1LHWA 3D6EA 3WDWA 3ZPYA 5T5PA 1Z0HA 3PVEA 5DUXA 5DUUA 1KJLA 4GXLA 1KITA 4FQ4A 1Q8SA 3KM5A 1MS1A 1BQPA 4OZXA 3N7JA 3M2MA 1CJPA 1F9KA 1OQ1A 2E7QA 1EPWA 3CNAA 4PBPA 4M3CA 4Y24A 2PHTA 2EAKA 4YW2A 1WD3A 2A5ZA 1CPNA 1N3QA 1A3KA 4XHXA 2NP0A 4C1WA 3NV1A 1S0FA 1S0JA 3ZVXA 4ZXKA 4LBNA 4Q26A 1N47A 1DQ5A 3NV4A 4HL0A 2DV9A 1JXNA 1IS4A 3IN9A 1ENRA 2ZHMA 1FNZA 1N1YA 1LECA 4MYEA 1QKQA 2JJ6A 1AXKA 1FYUA 1GLHA 1W6PB 5GZDA 4CZSA 4YW1A 1NXD1 1I3HA 2VH9A 2VW0A 3WUDA 3SH3A 3AZVA 4ZKTB 3ZYRA 3WDYA 1C4RA 1CVNA 2VW2A 2ZGTA 2FMDA 2NZ9A 2Z42A 4WZFA 1QNYA 3B9CA 1MZ6A 2A6YA 5T50A 4ATEA 3FBYA 3VKOA 1MS0A 3AFKA 4YGEA 3OJBA 3N3HA 3AYCA 3GALA 2ZGMA 4K1YA 2YV8A 5GLVA 2D6OX 1ENQA 2A70A 3AK0A 3R4UA 1SLIA 4Z8BA 1WCSA 2V73A 4YZ5A 1SCSA 4YFZA 2AH2A 4TZDA 1LOFC 3ATGA 4Q2FA 2WJSA 4YZ2A 1AX0A 2A3YA 1LJ7A 1SBFA 2B7YA 1IKQA 1UKGA 2I2SA 1AX2A 3M3OA 1LOEA 2LTNA 1GZWA 4DS0A 1LEDA 1LU1A 3B69A 5KXEA 2ZGQA 4P14A 5KXDA 2NMNA 1YO8A 1S0IA 4Q8LA 4P9WA 4XHBA 2H0BA 1GSLA 2NMOA 3KQRA 3V0AB 1LU2A 3AP6A 4U2AA 1ZA4A 3AJZA 2P2KA 5GZEA 3WHUA 1QDOA 1F5FA
chains in the Genus database with same CATH superfamily
1PGW1 5TSWA 1WUVA 1IG0A 2RS32 4OMCA 4X6QB 1JN2P 1X9TA 2XVLA 3O1OA 1HX6A 1RHI2 4HVQA 4XETA 2WFF1 3SNMA 1UQXA 1DLCA 1AYM2 2IXJA 4B4QA 5BY5A 2GP3A 4FT8A 4FPFA 4WVVA 1AR61 4M0HA 2RDRA 4LR4A 4LXLA 5FMBA 1W8UA 5APAA 4IESA 1R083 2Y0IA 3O0VA 1JZ5A 4Q4W3 5IK7A 1O3SA 3PVNA 4HPKA 4UFIA 2D3PA 3ZXEA 4K21A 1GNZA 4GKYA 4FTSA 2JD9A 1HB2A 4PI0A 3ALQA 4FFIA 3GJAA 3I2KA 4NHYA 2BOJA 3NNJA 1AR92 4MHRA 4TLFA 1S4CA 2VU9A 2KR2A 1PX3A 1COV1 1BBT1 3MEPA 3PURA 4CPBD 1RUD2 5C70A 5EYYA 1XPWA 2B9UA 2CSGA 2ZMLA 3GCWA 1NCRB 3T4HB 3ZIWA 4IEUA 1RUJ3 2LUWA 2JB8A 2XMLA 3ZMOA 5IVCA 4YG0A 4MGTA 3GDBA 4ZPIA 2DCJA 3ZFGC 4L97A 4IV1C 1W3VA 4NHXA 4FTBA 4LULA 4J1WA 1OF3A 5LY2A 2BVBA 5F32A 1QXJA 4CCKA 1AX1A 4CCLA 4RR3A 1JOBA 1MS3A 1O4YA 1UYPA 2X09A 3DPRC 4KG0A 4K7JA 2VUAA 4KWUA 5LBEA 4YZ1A 2KA3A 1G7YA 4HETA 5FYTA 2R061 3GCXA 4ZU5A 4AVTA 3WG3A 1WMFA 5HI0A 3I2GA 3IT8A 3VZOA 3ZXAC 3DECA 2JG8B 1Q8QA 3PJQA 4XMAA 4FCAA 1POQA 4E8CA 4NIIA 5CFDA 5FP9A 3M70A 4LKSA 5H9SA 4YW6A 1R092 1SQ4A 1SZBA 1K3IA 3N35A 5K0UB 2BNOA 2RMU3 2VECA 4FPKA 5LASA 3W5MA 4DRVA 5ABJB 1W6OB 3DV8A 2YROA 4CU6A 2HKXA 4BPZA 3HT1A 2JWPA 3UNPA 3RYPA 5IK4A 2HWC3 2QQVA 2DDUA 4Q4W2 4HANA 4HBNA 3BB6A 3X29B 3BYWA 2OW4A 4CEWA 1QQP2 4P9IA 4ZU4A 3EXUA 3JU9A 4QX3A 3LKJA 3B3QE 3SISA 3BTZA 4P02B 3OBAA 4XF1A 1DF0A 1OQEA 4GH4A 2A3WA 4AGRA 5C3PA 2JDZA 1O3TA 2A6VA 3NO8A 1KS5A 3ZIXA 2QQNA 1I5PA 5FZOA 3UL2A 2EIBA 2RS13 1VBB2 1HRV1 1ND2C 2VXRA 3UJQA 1VAMA 4I01A 4FFHA 2BQPA 1AR71 3CQOA 5L36A 2D7FA 4AEDC 1LKNA 1GP6A 2Q5TA 1PVC2 1UMZA 4FPYA 4OI2A 2W2IA 1RUC3 4D69A 4DXSA 3KF3A 4XTPA 3T08A 2WQ8A 4XFBA 2CWSA 1PVXA 4PI2A 2J1AA 5BUVA 1YQ6A 5LBBA 4CCEA 4DO0A 4D6QA 1UF2C 1XNAA 2QQUA 5LK5A 3OB8A 4QMAA 1MQTC 1YQ2A 3AKRA 5ANNA 4CDXA 3VUOA 2XGXA 4OHWA 2BGCA 3VDBA 1N1VA 4JKKA 4OYUA 3VBOB 5A33B 3M4FA 2W1SA 1WBFA 3MW4A 3ZOIA 1KS4A 4AI0A 1YUDA 4BLIA 1UD1A 2BWAA 2MNGA 3IDBB 2VVEA 1GANA 4H3WA 3VD4A 5C4WB 1QIQA 2DVBA 2BDRA 3KV6A 4R9AA 2LROA 2FDIA 1J1TA 1GR3A 4P9JA 1K5MB 4KH9A 2VW1A 2CHHA 1OH4A 5A7WA 3HIFA 3UK9A 4LBLA 5FZ8A 5CYYA 1EV13 1OOPC 1QNWA 4JTOA 4L11A 3VDCA 4CP1A 5BNQA 2W1WA 4Q4Y1 1REEA 1XB9A 2ARBA 4BQWA 1U5IA 4C0HA 4KU7A 3C7GA 5T3NA 1QJX3 3V0BB 3POFA 1UX7A 5FY8A 4BWOA 3AYDA 1KEXA 1SACA 3J8F2 2BVVA 4FAGA 3O1UA 4RSUA 1JH5A 2IXHA 4W6YA 3NSTA 1FV2A 4R52A 2DU0A 1RINA 4ASMB 1DZTA 3RYRA 1OT5A 4LHNA 3ZPOA 1MZ5A 3RWNA 3U07A 4MOAA 1GZWB 2A3XA 4FPHA 5JOWA 1GYKA 4N43B 4Y33A 5CZKA 5F5AA 5F5IA 2AACA 2OUJA 1OA3A 2DVDA 4G3YC 1RITA 2ZAHA 5LA9A 3OPZA 4AFCA 3PIJA 1KQRA 1H8TB 3NAPA 2EVXA 3KV4A 5A6ZA 3LEKA 2PXJA 4GQ7A 2P4EA 4M3CE 4W50A 1G9AA 3VDDC 2DTWA 1XU1A 4OQ9A 1C1LA 3ES4A 1D4M3 5ANQA 4AEMA 2VZ3A 3ITQA 4LK6A 1V6LA 3ZSKA 1JYVA 2RJKA 2OS2A 2XONA 2H6CA 1W9TA 4LA2A 2WNOA 3QACA 4SLIA 5CB7A 3ZYHA 1W6MA 4UFHA 2WZ8A 4FP2A 4Y1UA 2ZGLA 3M3QA 2Y6KA 4JGZB 1NA1A 1AUYA 4LHLA 3FUQA 3FHQA 1RVF1 1XOYA 3KGLA 4LBQB 2WFF3 1WW7A 4AVCA 1C8M3 1W6NA 1RMU1 4P9GA 2ZABA 2PHFA 1DYKA 1SPPA 2VZ1A 1S1AA 2XLGA 3CZUA 1AR63 1E5RA 5FRAA 4CUAA 4BE3A 1DQ2A 1EV12 5FJKA 3RFRA 2VBPA 1I5ZA 2CWMA 3WNXA 1ZBE1 3HN3A 1QJZA 1QEXA 3ZSJA 4AW7A 4LHSA 1MVEA 2VZQA 5EYXA 2IZWA 3A22A 1FAYA 3AYAA 1W6QA 1XYOA 4Q1PA 1CAVA 4R8HA 1AJKA 4R9BA 4R4ZA 1KXGA 4BHPA 1COV3 1BEV1 4UYBA 5A3NA 4FPJA 4N90A 3NW4A 2RDSA 4NAMA 2XH6A 1YQ5A 5L7OB 2OXBA 4PF5A 3POSA 5C71A 3SLIA 3H3LA 1MZFA 3ABZA 4KBBA 2DFBA 5FP7A 5CBLA 3WUCA 4Y20B 1WMEA 2BPA2 3N9LA 2CGOA 3ACLA 3E5XA 4F3JA 5I0RA 3OGSA 2WNVA 1UPSA 2R063 3RDIA 1LHNA 1F2NA 4F83A 4JRAA 4BK4A 1RUH3 4B4RA 3I3QA 3IAPA 4CYDA 2QBXA 3IWZA 4YZ4A 1WKYA 1EYBA 1MS5A 2QQMA 2W94A 1VR3A 1K5JA 3WSOA 1RUI2 2UWAA 2EIGA 4E2QA 4XJ9A 4E4ZA 1XQNA 5GLWA 1FPN3 2B42B 1JODA 5J7MA 1RUNA 1DBNA 3CKHA 4IEZA 3I3DA 1XSQA 2VTFA 2XHNA 4FXKB 4BA6A 4DXZA 3IAQA 3ZR6A 1O8SA 2E53A 3O14A 1A8DA 3J7LA 3ACHA 3NKTA 3OOXA 4GALA 1S0BA 4NRPA 4Y1XA 2VQUA 2PAEA 5FZFA 5BNOA 1ZZCA 2ILMA 2WA3A 2XJUA 4BDVB 5C5UA 1MR5A 2OPKA 3VDDB 1APNA 5A7QA 3KSCA 4X8NA 3T1MA 1XE7A 4IQPA 3HPNA 4QX1A 4WM8A 1N3OA 2ADDA 3RJRA 1H1IA 3M8LA 1YIPA 3S6PA 3U10A 4K8RB 1RUG1 3HMYA 4LBMA 1NCQB 2VQ0A 1F4HA 2D97A 3OD0A 4ISQA 1SDDB 1OLMA 4GIQA 2WT0A 4IV3B 2DUOA 4RFRB 1ZZ8A 4YM1A 4YM0A 4LQRA 1UYXA 3GYDA 5KXCA 3JD72 3KWVA 2J1EA 3MFCA 1GZTA 2K2SA 4NWWA 4CDWC 1ENSA 5LB6A 2VZRA 2IFRA 3HQXA 2ETEA 4YGCA 2X8KA 2V4AA 3QBQA 4OHVA 4CCNA 3URFA 2ZMNA 5SV8A 2C0ZA 1XE8A 2XR4A 3FX3A 5EFUA 1ZBA2 1B35B 4QDRA 4PIXA 4MXWA 3T0DA 3P1IA 1QH7A 1DQ1A 1FX5A 4GMP0 4IDZA 4QPGB 4CEWC 5DDJ2 3K4DA 2JDYA 2PHUA 4Z07A 4DQAA 4F7ZA 3HEIA 4GB32 2HWB2 4QXCA 3HOBA 2HH9A 1FPN2 1S0EA 4Y26A 4GH4C 3CHXA 3OTFA 5ERLA 3KVAA 4IE5A 3OGJA 3IDAA 3BVCA 5IAVA 4XTMA 2IXKA 2VNOA 4LO5B 1MS9A 1CAWA 5FY0A 5CA6A 1XRUA 2ARXA 2ET7A 5FPBA 4XFFA 2Y8KA 4P9YA 1LOGA 1TNRA 1UU6A 1MS4A 2BGPA 2R071 3WP5A 4M4RA 4M3CF 2IXIA 5BNNA 3I49A 4QB2A 1VRH1 5FZ1A 3WW2A 1GZCA 1VJ2A 3T3YA 1TME3 5KHGA 1RTVA 4K1ZA 2FQPA 4L0PA 4NROA 4ET7A 3OBRA 5JPMB 4MV2A 4HKWA 4XIKA 2QNKA 4LLOA 1ZA7A 4GD4A 4CDXC 4QB6A 3MI8A 5J98B 1HJGA 1UCXA 3LA3A 1D2QA 5GLUA 1NY71 5D21A 3OY8B 1PO13 3B94A 1X36A 1SBDA 2EXKA 2Q0AA 4LNVA 4NUBA 5C3OA 3BTYA 3BN6A 4OQ8A 1NE6A 2ZHKA 3VKLA 2VZUA 5F3GA 2ZBJA 1OQDA 3OYWA 5AVAA 3Q8BA 4PDWA 5HCFA 2ZHLA 4AFMA 5A32B 4WVMA 4UFLA 4GKXA 3VBSA 1DGWA 2VZOA 2JKBA 5FY1A 2EA7A 4A44A 1VAVA 3DGTA 4FP3A 4Z1VA 4E4DX 1N3PA 4YFWA 5HXVA 5J09A 1RUE3 1IZ3A 5H9PA 2OIIA 2VZPA 3KT1A 4R9CA 1HN0A 3W59A 1RMU3 3WQ0A 3WP6A 2JECA 1JYIA 2VOXA 2WS93 4Q0VA 2AR6A 2ZGPA 2ZX0A 5JI7A 2ZX3A 3K2OA 1HLCA 3POYA 4I09A 1ZBE3 2RHPA 4HG6B 4MGKE 2UYBA 4P9XA 1H2MA 5KHIA 2P5BA 4NIGA 1C57A 1HV0A 1ULEA 3BOWA 1CAXB 4XAEA 4N53B 1QGLA 2Y6JA 2YFZA 1SLCA 1LOFA 4R9DA 1DYOA 4COWA 4CDQB 4MLOA 1ASJ1 1H9WA 5A3LA 1WLDA 2ZEZA 4XDQA 4C8DA 3GHMA 5C3RA 2HJIA 1YQCA 4IW3A 2RDQA 5C9AC 2AGSA 3VBUA 2VMFA 2AREA 2XXZA 1LHWA 4IEOA 1MEC2 4RS5C 5FY9A 3ZPYA 4IEWA 3VB9A 2RM22 3PVEA 3KQ4B 1SG3A 1PO23 2HYXA 2JIJA 4E4SA 4AQ2A 5FQ0A 3WINE 1EAH2 4A41A 4HFSA 5CISA 5JMOA 1NG0A 5LCWL 1Q8SA 2K0GA 5LZ6A 1DGRN 1RC6A 4KQ7A 4WVZA 1RUF3 5LW9A 3N4MA 3MBWA 5LBCA 4OFGA 1F9KA 4IEPA 3ES1A 4XFAA 1EPWA 5A70A 4JHTA 3U14A 1RL3A 4YW2A 5C8CC 3FBMA 1RGSA 5A7PA 3HBKA 4GJZA 3W5NA 1PIV2 3C7OA 1S0FA 1S0JA 3DCQA 5A1AA 3AB0A 3L2HA 5I0SA 1DP0A 4HT1T 1W9SA 1GUIA 1ULOA 4ARYA 1JZ4A 1LECA 1J3PA 3LAGA 3O7OA 5F3IA 3U0ZA 4ZS2A 2GP5A 2XBO3 4CDUC 4CZSA 2VH9A 3B93A 5KHKA 1IPJA 3ZYIB 4JRLA 2YBSA 4QDQA 1CVNA 2Q8CA 2JDAA 2BW8A 2CU5A 2ZGTA 4I3PA 4O65A 5LA2A 2LS6A 1MZ6A 1QWRA 3SKVA 5FBJA 5KR7A 1MS0A 1ZREA 4YGEA 3GF6A 3RNSA 2HWE3 1FOD3 3Q8FA 4HN1A 5DAWA 3ZFGA 4K1YA 1DGWX 1VP6A 5K7PA 1ENQA 2UYAA 1SLIA 2LRPA 2V73A 2WAAA 3MO4A 3KHCA 4TSVA 4TZDA 4DINB 3EHKA 3ATGA 3TEWA 1R091 1OSGA 1LJ7A 1SBFA 2I2SA 1UKGA 1QJU3 5I91A 1UY1A 5DAQA 3LPFA 1RUF2 5BNPB 1UIKA 1LEDA 1LU1A 3B69A 4Q29A 1R081 1UO9A 2ZGQA 4P14A 5KXEA 4EN9B 5KXDA 5LA0A 1HW5A 1S0IA 4P9WA 4Q4W1 4C91A 2WO2A 2NMOA 2DCZA 1QQP1 1J3RA 1LU2A 2XUMA 5FUNA 3PDQA 3DXUA 1ZA4A 3VBRC 3FJSA 5GZEA 4CEYB 3EQEA 1DU3D 3VHNA 3WHUA 1IOAA 1F5FA 2WO7A 2VAUA 5IVBA 3C8XA 3WV6A 1W8WA 2JIGA 4AI3A 4PJYA 3P3PA 2ZCWA 2JG9B 2OPWA 2VUCA 1XBFA 3OCPA 5FYVA 3CMGA 1V00A 4INDA 4UT5A 1YI7A 1LHUA 1STMA 2XHKA 1SEFA 1VBB1 3MF6A 4LO6B 5DAPA 5AC93 1LOCA 4EWAA 1RUJ1 2DYCA 3MYXA 3I2HA 4PQ9A 1V6OA 4AEJA 4CP2A 3RVHA 4AI8A 4Y5SA 4I3GA 2YBPA 4FOVA 5I0DA 2F6BA 2R073 1ND2A 1SLAA 2ZACA 5J1XA 4HZFA 1BVVA 2HWE2 1WA6X 4O61A 3I2OA 5FY5A 2PAMA 1AR83 4LPLA 1GQHA 1OLME 3WF0A 4AEDA 3AC0A 1UZ0A 5C8WA 1QH6A 3AMNA 4FPCA 2DU1A 1VPHA 3HWJA 4PIZA 1HQNA 4RQPC 2WNUA 1BJQA 2FDKA 1RJ8A 3BCWA 2VMIA 3MLKA 1ZRFA 1CAUB 1H4GA 4LT5A 2QVSB 2RMU1 3PU8A 1VBC3 1MQTA 4BM8A 2I45A 4SBVA 1FMD2 1V9U2 3BTAA 1QJFA 3LE0A 2HWC1 2ZX1A 4QM8A 4ZXEA 4AF9A 4URAA 5A6XA 3WDVA 2FD8A 2OT7A 3RYKA 1V6JA 5L73A 3AMMA 2WYFA 4AK3A 4Z2WA 2WT2A 1SDWA 2ORZA 2PMWB 2Q1MA 3A0NA 3POJA 1HKDA 5JZGC 4I0WB 4L92A 1GKBA 1OOPA 1UZZA 1CIWA 2ZZQA 3CO2A 3E6CC 3MPBA 3NNFA 4HMZA 4XJAA 3DKQA 5AC92 1LR5A 1OLRA 3V65A 3IB3A 5BNNC 4ZZ8A 1HQLA 1RUOA 1MVQA 2WZR3 3DL3A 3OBTA 3HVDA 4MXVA 3T4VA 3QCWA 1YRZA 2WA4A 4N9IA 1LESA 3D8CA 3HNYM 2ZEXA 4W6WA 4TLGA 4LTAA 4YGBA 1NOVA 1TMF3 1AF9A 3PUHA 1XXNA 3I3MA 4Z92B 1EPZA 1GFF2 1Y9GA 2GNMA 2P34A 4WM7C 2RS33 3I59A 1W2AX 2VC9A 2Y26A 2PHWA 1R1A2 1KFUL 3INAA 1JU4A 1YNAA 1UYZA 4M3CB 2CNAA 1RHI3 5CKMA 4CU8A 5FYUA 4HKLA 1AYM3 3L2YA 2XDVA 3PTYA 4ARXA 1W2OA 2WKKA 4YM3A 3AFGA 4MGQA 2ZGRA 1EV11 4FTEA 1BHGA 3H8OA 5FYSA 5F3CA 3VL9A 2I74A 4DIQA 3KGZA 5FREA 2J1VA 2WYSA 3SMHA 2HYKA 1QJX1 2BGOA 2MPFA 4NE9A 3CJIC 3PMSA 2ZKLA 4UW4A 4CRQA 4O7XA 4TN7A 3FHIB 5K4LA 3PL0A 4UOJA 4C90A 5CFCB 1C1FA 1RXGA 5CNAA 1AR93 1AHSA 1CN1A 1G8WA 5F1RA 2WO3A 1WZXA 1VMHA 1OD3A 1RUD3 2P3JA 1QDCA 2JXAA 1BK0A 5EJ1B 4AQSA 4P00B 1F31A 5CAZA 3ZFEB 1TNFA 1U0AA 4Y4YA 2PLV2 2XJTA 1HB4A 1HQWA 1WCDJ 3FC0A 3H3ZA 5EJZB 2JE7A 1D4M1 1OKQA 4QPIC 3IKWA 2QDNA 4S2GA 3WNKA 1W9WA 3FHAA 3ZYGA 5IATA 3RMXA 5D1IA 2W47A 2GU9A 4AOCA 2YGLA 4XIOA 3WDXA 2XL7A 4Q0QA 3I2DA 5FZ0A 1CR7A 4AFBA 3RZZA 4IE7A 4XF0A 1R093 5LK7B 5LEJA 1Q8VA 1C8M1 3H8XA 3ON7A 4W4ZA 3RG0A 2W68A 1ZRCA 2ERFA 1BMV2 5C5TA 3AXDA 4E9KA 4AFAA 1A34A 3USUA 2OQ6A 3VGIA 1H6XA 1IS3A 3ACFA 3P3NA 4JZRA 3NJXA 3LDKA 3TNPB 5E8AA 1OPOA 1QQP3 4XDOA 1PGL1 1O5LA 4UFJA 4HXCA 4UBGA 3O5SA 4BH9A 1OHFA 3UKTA 2DUQA 1ODMA 1DDLA 4RHV2 4UW3A 2ZAAA 4QGMA 4AHXA 1VBE2 3O0XA 4XFIA 2XJPA 2W9XA 4C0BA 3O1RA 4YARA 1EUTA 5D2AA 4AZZA 2ES3A 5IAXA 1OLQA 4O9EA 3ZFFC 1SMVA 1VBB3 2B39A 1Z78A 4DNYA 3CIHA 3N7KA 1ST8A 2YG0A 4IL7A 2D5FA 2OYZA 4PLNA 5HXMA 1NLQA 4M00A 4IEQA 1EP0A 1UMHA 2WBKA 1PVC3 2WN2A 3OGVA 1NCRA 4LOTA 1VB2A 1NLSA 1UYYA 1WW6A 2RDNA 3VBFC 2AYHA 5IHRA 4Q4V3 2E6VA 2AUYA 4WVWA 2VNRA 5G04L 4OHZA 5BV6A 1RUH1 1TQ5A 2ZA9A 1J1LA 3TAYA 4XMIA 2VOWA 4LORA 2D6PA 3AKTA 3DYOA 3AYEA 3GNEA 1V6NA 2YY1A 3WG4A 3AX4A 2QZ2A 4KNCA 4N9HA 1H1AA 4CDWA 5F9TA 1EY2A 1PX4A 3BPSA 2D6LX 2JG8A 3JBG3 5DDJ1 5C33A 3UJOA 2HWB1 3IMMA 1FPN1 4D94A 2GH2A 2YGMA 1X8EA 5CFDB 1DQ0A 4NJ4A 4XABA 2J22A 2VMCA 2WDBA 2A1XA 3A7QA 5ABJA 1OVSA 3RZLA 1S55A 2Q4SA 3AKPA 3BTXA 4MVTA 1DZRA 2BZDA 2CGNA 4YG3A 1T2XA 3HBZA 3MF9A 4HK9A 3KT4A 2RJ2A 3PUIA 3N36A 3WOGA 4XBQA 2FDFA 3OD4A 3J8F3 2OUHA 4XJUA 5FZKA 3ZYPA 3W9AA 1W06A 1Z7S2 4RR3C 5D8AB 2HBTA 3E6BA 1YFWA 4QXBA 4XQDA 5DXDA 2MEV2 3VBHA 3LA7A 4N8MA 5FV3A 3WDTA 1JI6A 3ZXKA 1ULCA 3LCPA 2W5FA 5AFEA 5FY7A 2D93A 4IGOA 2HEWF 4FPLA 4P5HA 5JCTA 1JZ2A 3ZN4A 1OA4A 4RGKA 1AL0G 3E6DA 4J6GA 4WBBA 2O1QA 5FYHA 5FZOB 1UOGA 4YVSC 2WNUC 2B8MA 2QE3A 1M4WA 4Q4V2 5DAVA 3BU7A 4W8JA 2UURA 4XUQA 1YXWA 2MHFA 4DPNA 1Y7BA 1NZIA 1DHKB 4B29A 1W6PA 4EN6B 2JE9A 3WEZA 2UWCA 4Q8KA 1KGYA 3RGBA 1GV9A 3CDZB 2AEYA 3MV11 4NHMA 3SCFA 1KRIA 4UFMA 3JBG2 4IXLA 1ZM1A 2O14A 3RZJA 3PJYA 3ZN5A 1JYWA 3SHRA 4IERA 5FY4A 2KXLA 3DEMA 3E5QA 3GZEA 2HWD2 1ND3C 2NLRA 4AQ6A 2QTWB 5DZFA 4CU9A 1BXHA 4K20A 3LA2A 4PHZA 4XJZA 3OG2A 1CZTA 2C4XA 2A75A 2TNFA 4ZONA 3TNQA 4P5YA 4XZUG 5AVPA 2EF6A 5T5JA 5C6CA 4DB5A 3O1VA 1AVBA 3T1LA 1DQ4A 4Q4X2 3TB0A 3NV2A 2VZSA 1YIFA 2XOMA 2Z4FA 3J7HA 3WR0A 5A7WB 5FMDA 1TME1 4QX7A 3B00A 3V0BA 5CG9A 4IEXA 4JGYB 4A4AA 2PTMA 2C9KA 3QD6A 1IS5A 5FPXA 1VE0A 4LE3A 4WV8A 1OUXA 1REFA 3O1PA 3ZXDA 4EZHA 3O1TA 4ZY9A 1MEC1 1UZYA 1CZSA 1CX4A 5AFBA 2WQ4A 1UL9A 2X5IC 4NIHA 4NO4A 1PO11 5FYCA 5EZWA 1RB8G 5C9AA 3GXUA 3BGAA 3OUHA 1EAH1 5I0TA 4RS5A 4CP9A 4Y3OA 1SLTA 1R64A 1F8VA 1SHWB 4GWNA 2ZPXA 4GMP3 3VHOA 3FFZA 4ES9A 4QX2A 3NAPB 4COYA 1WLCA 5FZBA 2DCKA 3EO6A 1RXFA 1V6KA 2FBEA 2HLEA 3ZR5A 1RUE1 1US3A 2ZZJA 1PIV1 2GC0A 1X82A 3VHRA 4AVVA 4J25A 1RUI3 4UXAA 3POEA 3KD4A 2WS91 4CXXA 4DXTA 3I54A 5C8CA 3PU3A 1W6MB 2D40A 1ZZ7A 4L2NA 1G9FA 4LBQA 5F5QA 4HLTA 5JR2A 3RI9A 1NA1B 4LO7A 5JPNB 2GMMA 1GNHA 4JTNA 4EE2A 2XL9A 1OA2A 1NX9A 4LKFA 1L7QA 3Q8AA 3RS6A 1W6NB 2VZTA 2XKPA 2ZKNA 4LK7A 3AXEA 1K12A 3SEPA 1SPPB 4YZ3A 5KWRA 1UOFA 2PHDA 2ZOEB 3WX5A 5H9QA 2ZGNA 3IDEA 4DOUA 3NWKA 4XACA 4BZ4A 1O4ZA 3Q8CA 2EXJA 2H6BA 4MUVA 2PHLA 3WVJA 4QXHA 3A23A 2RS52 5JLVA 2F4PA 1POV3 3MPPG 3EYPA 3OF1A 5DZEA 2WLPA 3PLQA 5JVVA 1W6QB 3M3CA 1CAVB 2WINB 4BIFA 4FO9A 1LGCA 1PO21 3T0BA 4DFSA 3AZZA 1IQAA 5T5OA 2QQLA 4CSWA 1NQDA 3ZN6A 3AMPA 1OMIA 3JD73 5B4XA 1SFNA 2PELA 2VQAA 5IVJA 1RUF1 3J7NA 2BU9A 5KXBA 1YJKA 1UZVA 1P8JA 4E2SA 1HDKA 1C5HA 3SXWA 1J3QA 4IUGA 1UY3A 2ZGSA 1K42A 1BYHA 1KDMA 3GZTB 1YI9A 3NNMA 4KL1A 4XYXA 5F7UA 1TG7A 1ZBA3 3PUQA 2Q8DA 5DDJ3 2WNVB 2BOIA 3WDWA 1Z0HA 4GB33 2HWB3 3AL5A 4URTA 4O9GA 1F5JA 5DUXA 3VBRA 5FLIA 2QUOA 4CCCA 1KITA 4FQ4A 2XBO1 2K46A 4IGPA 1MS1A 4CUBA 2PFWA 1PGW2 1BQPA 4OZXA 1CJPA 3CNAA 4Y24A 3S0MA 1VB4A 1WD3A 3FL7A 4QQOA 4META 3OPTA 4XHXA 2PN5A 1O91A 1CZVA 3HJRA 2HWE1 4ZXKA 1FOD1 1PK6B 5FWJA 4Q26A 1N47A 5FK8A 4AEKA 1NCRC 2P17A 5BNOB 4HL0A 2DV9A 3ZLIA 5IYYA 1IS4A 3IN9A 1ENRA 2ZHMA 2R32A 3OGRA 4MYEA 3VD9A 4XF4A 4H7MA 3IIIA 1BK1A 4B1MA 1AXKA 3B5LB 4HONA 1NT0A 4WM8B 1H4HA 1QJU1 4EJRA 2P1BA 1I3HA 2VW0A 3KCYA 1W8HA 5EP9A 2G9ZA 2VM9A 4GZ9A 5DMYA 3RZGA 1V9U1 3ZYRA 4RQPA 3WDYA 1C4RA 1JHJA 2VW2A 2NZ9A 4WZFA 2JG8C 2VULA 3B9CA 4IE0A 1BBT2 4ATEA 2XLFA 3VKOA 4QPYA 3AFKA 5DN2A 1W90A 2K9ZA 2VQTA 3I3BA 2YV8A 4DY3A 5IFPA 5K0UC 1PGL2 3AK0A 5ABJC 3BPZA 5FPLA 1CJDA 2VUDA 4YZ5A 2RR12 4AR2A 3N9QA 1VBD3 1YCIA 4Q2FA 4Y5TA 4XC9A 1ZZ9A 1AX0A 3KB5A 5FPAA 2B7YA 1IKQA 5FZDA 5FYYA 1UOBA 3UKVA 2VTXA 2R7EB 5AC91 1AX2A 2XQRA 2HBUA 4DUXA 4XVHA 4DS0A 2YC4A 3ETPA 3VBHC 5JZGA 4Q8LA 4XHBA 4S2HA 2H0BA 4HSLA 5I0UA 3KQRA 4AVAA 3AP6A 2E63A 3R4DB 4QDSA 1WCUA 4A45A 4E27A 3WQ7A 5IVFA 2DCYA 3WF3A 5C3SA 1QDOA 2JENA 1AR81 2FMYA 1JW6A 1QF3A 1CAWB 4XDPA 5FZ6A 2B46X 3MIFA 4BMEA 1XU2A 1AJOA 1DLLA 3NJYA 4MGIE 3ILNA 4OLLA 3T30A 4RGAA 1WGPA 2ZMKA 1CD3G 4XF3A 3JCIA 3AVSA 3WF2A 2W08A 2ZJCA 1MEC3 1MACA 5BNNB 1LENA 1VBC1 1D0GA 4QHZA 1POV0 2QQKA 1DFQA 2RM23 2PA7A 5C7GA 2D5HA 1EAH3 4CTEA 3PHMA 4FPGA 4WM7A 2Y6LA 3VBOC 1V0AA 5FZ3A 2QQIA 4COUA 4BLJA 1DGLA 1AR72 1HRI3 3Q8EA 5A3TA 4CUCA 3CF6E 3PUSA 1JS9A 1UWWA 3VZMA 5C4WC 1VBD2 2G1MA 1H6YA 5T5LA 4BCUA 5LA1A 1YC61 4BMBA 1PIV3 3UYJA 2JDUA 1CQ9A 1K5MC 2C24A 3WNOA 4LKDA 3SEEA 4AWDA 2PHXA 1ZRRA 3TEZA 4PDWB 5FFOC 4B8EA 2GN3A 4WVMB 3WP4A 3VBSB 2Q1ZB 3CL1A 1JYCA 2WZR1 3CJIA 1DGRA 1HB1A 3H50A 2GZWA 2VCCA 3MIGA 3IIAA 4Q5OA 4JCKA 1LCLA 3AJYA 5CEHA 3J7MA 2SBAA 4JX0A 2QDRA 3FMGA 3I2JA 4GULA 2E26A 3RI8A 3W21A 1W03A 1GP4A 2WWSA 1RYYA 3WQBA 4FOYA 2XJRA 4XJWA 3C7HA 3LZZA 5FCCA 3WF4A 2BWCA 2Y6HA 2W92A 1PHMA 1TMF1 5EIYB 4N43C 2A71A 4YG6A 2PHRA 3BU0A 3BUCA 3LOBA 3HD8B 1S2EA 1JBCA 4U36A 1H8TC 1KJRA 2RS31 2VE1A 4Q4Y2 4QPIA 3BI3A 4YPJA 1Q8OA 1GOHA 4QQLA 1QMJA 1RHI1 3I2IA 4OUMA 5DZGA 3VZKA 5B4NA 3TN93 1AYM1 3THTA 1BMV1 5FO8B 1AYN2 3VBUB 3O0WA 3SITA 4XBLA 3MFAA 4D7YA 1W9FA 2BERA 4JDMA 2P6HA 1HRI2 2D6NA 4JGZC 1G86A 1Y9QA 1OC1A 1YYNA 3I2FA 3WCRA 2RV9A 2Y33A 5FQ0B 4MO3M 1Q56A 4OZOA 5LATA 2DVFA 3D5OA 3MZHA 2ZS6B 3ZMNA 5FPZA 3AKSA 5F2WA 5G05L 3HQUA 2V5YA 1J59A 1AR91 3LB9A 2OQ7A 1WW5A 3IPVA 1LHOA 3POGA 2KD7A 3SH4A 5KHHA 1RUD1 4TTGA 3S5QA 4Y22A 2VMHA 4NHLA 1QOSA 1JOJA 3AZXA 2IC1A 5CKNA 3WW1A 1W05A 1VAKA 4G4FA 1ZVFA 2DURA 5JOYA 1QXPA 3H42B 5DUWA 1RVF2 1AL23 5FZAA 3ZFFA 1CONA 5F6KA 1WLTA 2VOVA 5A1FA 5JXJA 2LM3A 3FZ3A 4LUMA 4NOTA 5A7OA 5HV4A 3SCHA 4H7LA 4M01A 2DBNA 5A80A 5L7OC 3RJ2X 1T6GC 4L99A 5ACA2 3FN9A 1LNSA 3MGUA 2C1FA 4JDNA 3D3AA 3GZAA 4YM2A 5FUIA 3VBFA 5FOJB 3U1XA 5FYMA 4AGVA 2E51A 1Q43A 2VBBA 3OUJA 3TN92 5IK8A 2YU1A 4NHKA 2LALA 1US2A 4Y1YA 5LRSA 4YW5A 3ZFGB 1FMD3 1V9U3 4DUVA 2BTVC 2WIIB 4IV1B 2ZXQA 3KT7A 4OUSA 1L7RA 5JDBA 3MDPA 1G9CA 2WFPA 3ZO0B 3KF5A 2GALA 1LODA 3DPRB 3MW2A 1E5HA 2WRAA 1GZ9A 1OH3A 3I4IA 5DAXA 3JXSA 5BNPA 4GWJA 5GZGA 3AP7A 4PLOA 1X7NA 2R042 2QJVA 3AM2A 1GOFA 3WW3A 4EWEA 1VBA2 2VCAA 2QQJA 4P9LA 4NPLA 5T55A 3P6BA 3LPGA 3CZJA 2BFUL 2YC2A 3AZYA 4D7SA 3ILFA 1W8NA 4XCBA 1E5IA 5FZ7A 2JDHA 3D4KA 3DYPA 3K3NA 4A6OA 2Y64A 2VMGA 3T2QA 2W91A 2GMPA 1KDKA 1O7FA 4LLFA 4QHOA 1PVC1 2EXIA 1Y4WA 2XJQA 3H1MA 3P5BA 1AL22 1URXA 1VIWB 2GMEA 3DUIA 3H8RA 1VRBA 4QKBA 1W8ZA 2WAOA 3LIHA 3ME2A 5I8SA 3T09A 1KFXL 3PUAA 1NAEA 2DBIA 4Q4V1 3B9IA 2GNBA 4YYOA 4BQ4A 4BXFA 1NCQC 3ZSLA 1QJEA 3GBFA 1IHMA 1O6UA 3ZXJA 3JB4C 3PVBB 4YVSA 2R6QA 2AC1A 2FCVA 3ZKUA 1DZQA 4AFDA 2PQQA 4IV3C 5JR7B 1A8MA 1ND2B 3NJZA 3OEAA 3ELNA 4YW4A 4A6SA 2ZGKA 3TYJA 1IPKA 2WWJA 3I7DA 3JBG1 2ATFA 2D3RA 4YWAA 4AAPA 1H8VA 1R1A3 4AEDB 4PF1A 1J84A 2JD4A 2R16A 2VZVA 4Y1ZA 1PM7A 2YC0A 3I8TA 1SFPA 5FZGA 3MIDA 4NPRA 1OXCA 5A6YA 5I8TA 2N7GA 3VV1A 4D0QA 1B35C 3LWCA 4RL7A 4BU2A 2A6XA 4QPGC 1S0DA 1MQTB 4TYSA 4ZHNA 5IVYA 1ND3A 4AHYA 2X29A 1W99A 4B7KA 3LFIA 4FVVA 5FLJA 4B3NA 3JUUA 4Q4X1 4XOGA 3APBA 3J8F1 1AZDA 1FI2A 4JC1A 4EROA 3QH6A 3J4UH 3FLPA 3NNGA 4MH0E 4PIYA 1REDA 2P6CA 4LIVA 1B09A 3FUOA 5J3UA 3OGGA 1VLNA 1H2LA 4EN7B 1XYPA 4K9SA 1QY4A 5A3MA 2KM2A 4MG2A 4XJ8A 2R0FA 5SV5A 4Q27A 1DG6A 2GH8A 3MLJA 3WW4A 5KC5A 1HIXA 1OOPB 2J1SA 4XFHA 5T54A 2GAUA 1LGNA 4DRRA 4LEJA 3V64A 1UPIA 3N9NA 1JUHA 2ARAA 2QQOA 5FZCA 3WHTA 3ZM8A 2PLV3 5FZHA 4D7TA 3IDCB 5C3QA 2VNGA 2RG4A 1L7LA 3K75B 2F4LA 1EUUA 1UU5A 2X5IA 5LRRA 2WABA 1U12A 3LFMA 5FXVA 1QOOA 1UOJA 2A6WA 1A6CA 1DYPA 4UF0A 4NIDA 4IETA 5J36A 5A3UA 4N7IA 1X33A 4GJYA 2WL1A 3PMEA 4UFKA 3RZKA 4UW6A 2VMEA 3FLRA 4HVOA 5IWFA 4BQ3A 1VRH2 1NLRA 1XNKA 3HT2A 4BYYA 1X50A 4L8QA 3WQ1A 2WN3A 3WDUA 3WF1A 2XQXA 3I59B 4ZU7A 3VD5A 2YFUA 1GOGA 4LBOA 4BQXA 4KMQA 1SCRA 4Q1RA 2R1BA 1H30A 1UNBA 2E31A 3UV9A 1J58A 5B2GB 5IW0A 4RHV3 3LDRA 3NL1A 5JOXA 1VALA 2G4IA 4QT6A 4AI9A 4EZ4A 1VBE3 4X8PA 4B7EA 4D8MA 1F35A 1M06G 2Z79A 3QLQA 2ZX4A 1R1ZA 2BNMA 4XXPA 2G9FA 4YVWA 3UKNA 1BCXA 2XVGA 4Q0SA 1VMFA 2NPIA 4BK5A 4QHBA 3I3EA 4ES8A 1LOBA 2ENRA 3AP5A 4N53C 5FDBA 3WNLA 4OULA 3UETA 3CEWA 4TXWA 4ISRA 3LF7A 4CDQC 3KS7A 3NV3A 4AYUA 2DFCA 1XE0A 1FATA 1GU3A 2Y38A 3RQ0A 3IM0A 3OUIA 1BZWA 4GMP1 4C1XA 4OUEA 4RD7A 2HWF2 4NWVA 4PBOA 3V0AA 1XNBA 1NYWA 2E7TA 2R30A 2CAVA 1ULFA 1UAIA 1UIJA 3HNBM 3C2UA 2DTYA 3D0SA 1RUI1 3AVRA 4NRMA 1D2SA 3KCCA 2XKOA 3NRUA 1ASJ2 4A7YA 5GKAC 4XQWA 1I1EA 2CDOA 3MUY1 4QGLA 5EWSA 2YMZA 4MSVA 1PZ8A 1X9PA 2DF7A 2IXLA 3U78A 3SCGA 3KZ4C 2YHJA 4HVRA 2GC1A 4NRQA 4XZPA 4I0AA 4AAXA 2Q1FA 2JDPA 3J26N 1BLZA 5HCAA 3KV5A 3USUB 3H3UA 3UGGA 5L19A 4FOWA 5HCBA 1IQDC 2DCTA 3LGRA 5FTTC 1NXMA 3MLLA 1Z7S3 2NM1A 4HPKB 1CESA 3U37A 1DIWA 1LOAA 2JB4A 1POV1 2MEV3 2TEPA 2YXSA 3BALA 4Q0PA 3WP3A 5F2SA 5FPUA 1U5ZA 2BEOA 5FP3A 2W87A 3GZUC 2TBVA 2YYOA 4YLZA 5BPXA 3M3IA 5HV0A 2I07B 5FWEA 5E16A 4LHKA 1N1TA 2UWBA 2R49A 3B01A 1UXXX 4A3XA 3ACIA 3BIWE 3D0JA 3G7DA 2B45X 4FQZA 4MHUA 5KBFA 1WWYA 3ST7A 1JZ8A 3JD71 4KG8A 3IMNA 4XEZA 4QU1A 1LB2A 3W20A 1FNYA 3SC7X 2WSUA 5FO7B 2CL2A 2P3KA 1JTZX 1LULA 4KU8A 4OVEA 1ZBA1 2Z2SB 5FJHA 4XE9A 1F4AA 3KHBA 4RGGA 3IZOA 2VJXA 4ZS3A 3U11A 1JYXA 1WBLA 4QX0A 2UY9A 3H8UA 3OPWA 4FBFA 1QHDA 4GB31 2RR11 4KWKA 4QWNA 3Q9OA 5BNPC 5JAXA 5LY1A 2NN8A 4UI9L 2VVDA 2WO1A 1GICA 4NN0A 2HWD3 1O8PA 1QJY2 1PNGA 4UWDA 3H9AA 1LRHA 3BOPA 5E1RA 5EJ3A 5K0UA 1GBGA 4W65A 1W6OA 5JXHA 4CDWB 3LQCA 4CEYC 5GALA 3O12A 3JQXA 1W0OA 4FXGB 4JV4A 5EQUA 1ULPA 4ITCA 4FSJA 3S7EA 2JG9C 1FV3A 2Q8OA 4JKLA 4Q4X3 2GDFA 1TZOA 5E89A 4CEWB 3PNAA 1ULGA 2Y6GA 3AP9A 4AI2A 3RSJA 3JB8A 4OCTA 1OKOA 5FZEA 5FZMA 4A7ZA 1R082 2ET1A 1NZCA 4GH4B 4JVAA 3OEBA 5DUUA 1UW8A 1ENXA 1KJLA 3VD7A 3LDBA 5D8AA 4ZZ5A 2HEVF 4WZCA 3KM5A 3UT0A 3AL6A 4BXSV 3N7JA 3VBHB 1XJAA 2Y60A 4LO4B 4HKOA 2V5DA 1W8OA 4PBPA 4BB3A 2PHTA 2EAKA 3F95A 3HQRA 3PIGA 1UMIA 1UY0A 1N3QA 1A3KA 1PMIA 2V4VA 2NP0A 5FO9B 3NV1A 3ZVXA 3QH7A 3H7YA 2JICA 4LBNA 4XFGA 1RUJ2 2ORXA 2W46A 1DQ5A 2QZ3A 3UGFA 1H1MA 4LIUA 4DMIA 3CBNA 1N1YA 1E57A 3PTRB 1VBD1 4A42A 3VBOA 1JZ6A 4CDXB 1WCKA 5A33A 2L9LA 2OKXA 5FYIA 4AG4A 5FXXA 1FYUA 1GLHA 1W6PB 5J96B 3S5AA 5HBAA 1WA4A 2ZX2A 1J83A 1NXD1 3DN7A 4YW1A 3WUDA 1O4TA 5FBZA 4ASLA 4ZKTB 1ZZ6A 5C4WA 3ZXGA 5KC6A 1HXS3 1ZRDA 2VL4A 2VCMA 1UKRA 2Z42A 2VBDA 3NJVA 5LBFA 4A2UA 2A6YA 1K5MA 2VR4A 1NKGA 1UXZA 4LJHA 1YFXA 2PQSA 3OJBA 5CVRA 3AYCA 3GALA 2ZGMA 2RMU2 5GLVA 1NE4A 4QKFA 5FLHA 1LAJA 3WNNA 3R4UA 4OI1A 4Y5Z0 3NNLA 3ZYBA 5BXXA 4YFZA 2AH2A 1RJ7A 2CDPA 4IGQA 4JQTA 1D7PM 2EIEA 2HWC2 1I6XA 2V09A 2WJSA 2A3YA 4YZ2A 5F37A 4I2OA 2VMDA 2AEZA 2RS53 4AE2A 2FDHA 1O3RA 2LTNA 1GZWA 4JGYA 2RM21 2J7MA 2C6SA 4N43A 4ORFA 3GJBA 3SKJE 5FR3A 1GSLA 1XSRA 4U2AA 5A3OA 4EQVA 1XYNA 4QQHA 2RS12 3AJZA 2P2KA 1H8TA 4QX8A 4OHXA 1AYN1 5FMCA 2FZ2A 5FZ4A 3LEIA 4HSJA 1X8MA 3WNPA 1HRI1 4K40A 3DYMA 3DF0A 1W9YA 3K48A 5JOZA 2J1UA 5EPAA 5C9AB 2E7AA 1RUC2 1WW4A 4RS5B 4CP9B 3MW3A 1IKPA 2C9AA 3FE5A 4K6BA 3J9SA 4JGZA 4H2AA 1W04A 3IBMA 4Z82A 4COZA 1HXS2 1GQGA 2G9GA 2FHRA 4DXRA 4ATFA 4JAAA 3G6JB 1YLLA 2A73B 3WG1A 1Q5OA 1OURA 2ZHNA 2IVIB 3N9PA 4YVWC 3ILRA 5GM0A 5J37A 3VLBB 5JIUA 2RVAA 4DZGA 5CFCC 5C8CB 4E4HA 2GN7A 4J1XA 1UN1A 3ZDSA 5J48A 2J1RA 2VNVA 1TE1B 1WMDA 3A0KA 2EXHA 3GGLA 4QGNA 2D6KA 2CV6A 4GA9A 1W0PA 2G19A 1W2NA 4V1PA 2WSVA 2ID4A 3NQHA 5ACA1 3ZFEC 1PM4A 4N7UA 3THPA 1QJX2 3USSA 4CDUB 5BYNA 4LITA 3TN91 5L7OA 5K8SA 2JX9A 2QFEA 1W2TA 5GJ6A 5JXGA 3C7EA 1V6MA 3WG2A 1UY2A 1C8NA 4L9BA 3CLPA 4Y20A 2FCTA 2CY6A 3U75A 1BBT3 1Q8PA 3H1WA 4LOSA 4F8AA 5E88A 4LUKA 5IUQA 2XJSA 4IEVA 5DPNA 2IVJA 3VZNA 1W3XA 5FXWA 3ZN6B 2R041 1VBA1 2RR13 5JSPA 2WQZC 5H9RA 3POIA 4BOWA 4GWIA 1ZZBA 1D4M2 2AZ5A 2VD7A 2VOTA 3ENRA 4MX3A 4XQ4A 2BBAA 2XJVA 1Y9MA 3DKWA 3U4XA 3CJXA 4KI5M 3RMYA 4XW3A 4Y4RA 2WR9A 1AL21 4I30A 1XNTA 4NAOA 3VBRB 3E5UA 2X05A 4M0NA 3KMHA 2WFF2 3H0OA 2AENA 5JSRA 1C8M2 4YGDA 1RIRA 3ZSMA 2GNTA 2IUWA 3WT3A 4ASKA 1AR62 3GBGA 3VDDA 2O8QA 1PZ7A 4RYDA 4PQQA 4DUWA 5FYBA 2YUEA 2D44A 2DWRA 4CA9A 1PK6A 2RE9A 2WT1A 1Q3EA 3R6SA 1DQ6A 2FDGA 4YW3A 1NCQA 3V56A 3L9JT 4FOQA 2X53S 5JI9A 1FMD1 1G6NA 4OHYA 2EALA 1OF4A 5JXIA 2W39A 4JHZA 3AP4A 4IV3A 5IVEA 4XFCA 1COV2 3VKNA 3W58A 5F3EA 4CP0A 5LEKA 2D6MA 1U5YA 2OZ6A 5JIAA 1HRV3 3K3OA 3VDAA 5F8PA 1AR73 3ZXLA 4BQ1A 1LTEA 2A7AA 5JSOA 4RQPB 4OI0A 4COVA 1CWPA 2E33A 2YU2A 3FLTA 5FMOS 3R05A 1B35A 2OZJA 2UY8A 3D82A 4QPGA 5JMCA 2Q8EA 3EMRA 2ZGOA 4BQ5A 5CFDC 1CX1A 1H2KA 1BVP1 2XG3A 3MUZ1 4D6RA 2EICA 2R062 1S2BA 4MXWB 1GWKA 4KGQA 2QCSB 4D6SA 1YEWA 4AVSA 1RUH2 2YBKA 1OD5A 4LBJA 1PMJX 4M4PA 5FIXA 2DVAA 4Z2AA 5EV7A 4HK8A 5CG8A 3MIBA 5KHJA 1Y43B 1O5UA 1WD4A 3MHZA 5D8AC 4QKNA 3RPQA 3HR9A 3N7MA 1JOPA 3TEYA 3B7MA 5JZGB 1IPSA 2GC3A 1PZ9A 1CGPA 5FKBA 2GNDA 4MGSA 4RN5A 4R4XA 2YPDA 3WCSA 4QB1A 4H14A 4XILA 4Q4Y3 4RA0A 4HOOA 1R1A1 2EIDA 1W39A 5FZIA 5L9BA 2A6ZA 2WZPP 2CTVA 4XAAA 2W1UA 4AXOA 2OA2A 2XWJB 3H1YA 3OSDA 4W6XA 4XUNA 4BQ2A 1AYN3 1HRV2 1QXRA 3ETQA 1UX6A 3HNMA 2XUEA 3OY8A 3VZLA 1WLWA 4BJ0A 2QKDA 3NMBA 1OPMA 5DQ0A 5A1LA 3EB7A 3UGHA 4LMFA 4K3UA 3VD3A 1E5SA 2BRTA 2W1QA 5CKQA 3JQWA 4CE8A 4A3ZA 3AMHA 4WM7B 5DUVA 4I02A 4B1LA 5A32A 2XWBB 3OYWB 1YJLA 2IFWA 2WWUA 2ZTNA 2VCBA 3M3EA 2VY0A 2DVGA 3KVBA 3VHPA 2ZEWA 4DEVA 1HB3A 5F5CA 1JHNA 1F15A 2R0HA 2BFUS 4QQ2A 3N9OA 2ZEYA 3VKMA 2WC2A 5LWBA 4I0BA 1QU0A 5I93A 4XURA 4FFFA 3BODA 4LBQD 2VPVA 2GC2A 4FPEA 1S0CA 2PLV1 4NPMA 1RVF3 1CAXA 3OBZA 4N53A 4JGYC 4E8DA 1TVGA 3CJIB 4LKEA 3POWA 3T2PA 2PYTA 2E9QA 1TEIA 5DABA 1JZ7A 4XPVA 1NUKA 4EN8B 2BYVE 2W3JA 4AHWA 4CDQA 1D4VB 2HWF1 2W0XA 3MV01 4MADA 1IG3A 3WZ1A 4B4PA 3LEMA 1CIYA 2D43A 5FZLA 1W8FA 2HEYF 5ACA3 1NQJA 2NYYA 1ULDA 2DUPA 4XBNA 1H0BA 3T0AA 4DEQA 1H9PA 1V6IA 3O1MA 3ZKYA 2OVUA 4FPOB 1TME2 4UW5A 1V70A 2QQWA 3NAPC 4CCMA 1LHVA 2O0OA 1BEV3 4QAWA 4QPIB 4MGYE 5EXOA 1YHFA 2WZEA 3TEXA 3TRSB 2ARCA 5FOBB 2CAUA 5FMOL 4CCDA 5A3PA 4XUOA 1AXYA 5HCHA 4RHV1 2R043 3RRDA 3HN1A 4Q0UA 1O3QA 1VBA3 1VBE1 3GM8A 1PO12 5FZ9A 1JU3A 1A78A 1NA1C 4NVPA 1GNYA 2ADEA 4OI4A 1OBNA 1N1SA 1ZRIA 3ASIA 1O59A 2EAAA 3THDA 3WD5A 3RWKX 5DG1A 3WLUA 3AZWA 4XCAA 5FPVA 4JDOA 1L3JA 2IWGB 3JZVA 5T52A 1S2KA 1SLLA 3POBA 5FK7A 2JDKA 4FFGA 3KLSA 4QX5A 2B5HA 4QXKA 1MS8A 3LOIA 3IPVB 3MICA 2GSYA 1WCQA 2Q30A 3I97A 4PCRA 1OVPA 4IE6A 5GZFA 5A7NA 1I9RA 1RUE2 2WNEA 3SH5A 3TOJA 4LA3A 1RMU2 2P37A 4Y22B 2BV4A 3BIEA 2WS92 4X6RB 2JDNA 5L9RA 4UAPA 1ZBE2 4CVUA 1GWMA 3C3VA 2YZ4A 3ZDVA 2Y6FA 4V2WA 1GP5A 3ZFFB 1KD7A 1G9DA 4DY5A 2BP6A 2JEMA 3GBWA 5IK5A 3ZXFA 5IT6A 4S2DA 5FP8A 3THCA 1ODNA 2VOKA 3N9MA 4G9SB 1QJY1 3PVOA 5GLTA 1S0GA 1BEV2 4NR1A 5K9YA 4LE4A 4E2GA 1IS6A 2WLQA 2R1DA 3EBRA 3VBFB 3B02A 4KGGA 1OI6A 5GLZA 3K77A 4IV1A 1RUG3 1QOTA 2WNVC 3RZHA 1C5IA 1YFYA 4P08A 3LSEA 5L9VA 2W95A 2VGDA 2VXJA 3DPRA 3FFQA 3QOPA 1PO22 4JQRA 2CYFA 5JWPA 3S30A 4NIAA 4AQTA 4CEYA 1UU4A 2XB6C 2Y34A 1U5XA 1BKZA 1ONAA 1Z7S1 4QKDA 2MEV1 3M1HA 2BJSA 3LSDA 4FI9A 4OMDA 2QQPA 2F17A 4BQYA 2JG9A 4AI1A 3TBDA 5IFTA 4AGGA 5IVVA 4CPBA 5FYZA 1AXZA 5CADA 1HV1A 4YNIA 2VVFA 3U4SA 1LGBA 3ECQA 3R0RA 2JDMA 5CU1A 1PK6C 3MIHA 3VN4A 2D98A 5A7SA 1OFSA 5BNOC 1LEMA 3RZMA 2NQYA 2RJLA 2P3IA 3ZYFA 2O8OA 2VTXJ 3LEGA 1SLBA 2JE8A 2VG9A 1T6BX 4RR3B 4MZUA 4YRDA 3ZYJB 2XBO2 3HAGA 1W0NA 1JZ3A 5ISLA 1GMMA 3F2ZA 4WM8C 2UU8A 2E32A 1MZEA 4QQPA 3VKFC 2P3YA 4EV0A 1YQ8A 5FP4A 1ZX5A 1JUIA 3S7IA 1DCSA 1CAUA 2HWD1 1SBEA 3C7FA 2ZGUA 2H0VA 1IGOA 3AMQA 2TUNA 4YVSB 1VRH3 2WNUB 1UZWA 2C5DA 1FOD2 2BBVA 3O1SA 1D0HA 3S57A 4ONUA 4V2VA 5F39A 5EHDA 3WY6A 1RUG2 2CGPA 1JYTA 2W52A 1PGSA 3AKQA 3ROUA 4AVBA 3CU7A 4Y1VA 3WNMA 1W8TA 5A3WA 3ORJA 4XF9A 4JKMA 2J42A 4IE4A 3T2OA 3SQOA 1GWLA 1QJU2 3KCXA 4XUPA 3A4UA 1SFYA 3VL8A 4CCJA 3K51A 1XC6A 2VUJA 1XNDA 4RFT0 3UESA 5JUVA 1CPMA 1ND3B 2SLIA 4GAZA 2C26A 4K8FA 1ZYBA 4GWMA 4KWLA 4BISA 4CCOA 4H55A 4CXWA 3MIEA 1YFUA 4TWTA 4A7KA 2YB7A 1G9BA 2XLAA 3NVCA 3NKGA 5DG2A 2D3SA 3H7JA 3LD8A 3TWIA 2WUHA 4LBKA 4BIOA 2YPJA 2JKXA 3ACGA 3E1F1 1JMUB 1HJFA 3R4SA 1PNFA 4QU2A 4XUTA 3DXTA 3T2TA 2RS11 3N7LA 4XXAA 5GZCA 4CXYA 3ZSEA 3D6EA 1PMHX 2B9VA 2HWF3 1ALYA 5T5PA 5M0TA 1MPXA 4HN0A 4KBZA 4D3WA 1C28A 1YWKA 1RUC1 2R072 4GXLA 1ZNPA 1K45A 5HPOA 2BNNA 4AHZA 3WXPA 5IJRA 2X5IB 3K4ZA 5FXZA 3M2MA 1AR82 1HXS1 1ASJ3 1OQ1A 2E7QA 4YW7A 4M3CA 4UF0B 4EN0A 2A5ZA 1CPNA 2B4KA 1H2NA 4C1WA 1C3HA 4KWJA 1VBC2 4LO8A 4QD2A 2Z69A 2YDEA 3NV4A 5I8YA 1JXNA 3VZJA 4PDWC 1NY72 2IXCA 4PT6A 1FNZA 4CUGA 1QKQA 1W28A 2JJ6A 3VBSC 1ACCA 3KV9A 4S2FA 1JYNA 5GZDA 2RS51 1FT9A 5CFCA 5CIRA 2XPJA 3E97A 3SH3A 1OUSA 2FZ1A 3AZVA 5FKCA 2J1TA 2OX0A 2FMDA 3EJKA 4EWDA 1QNYA 1XNCA 5T50A 1WMXA 2X10A 2Y0OA 3FBYA 2LW8A 3K46A 3LIGA 4CU7A 4YSFA 4EYUA 2VO5A 4YVWB 3ZX7A 3N3HA 5A6QA 2D6OX 2FCUA 4UBHA 2A70A 3ZFEA 4Z8BA 1WCSA 3K4AA 1SCSA 2PAKA 4FAHA 1LOFC 2WZR2 2FDJA 4CDUA 4AL9A 5FUPA 1Y3TA 1GQPA 1OFNA 3GHNA 4PLMA 5E6HA 3M3OA 1LOEA 2XVKA 4NMIA 3BKZA 3VBUC 1VMJA 2NMNA 2V72A 1YO8A 3M7AA 4MGZE 1W2UA 1HN1A 1QJY3 3V0AB 5F6LB 1TMF2 3FWEA 4IEYA 2Z5WA 1FXZA 4QM9A 4QPWA 3A21A 2BUKA 5FAXA 1UY4A
chains in the Genus database with same CATH topology
1PGW1 5TSWA 1WUVA 2RS32 4X6QB 1JN2P 2XVLA 1HX6A 1RHI2 4HVQA 4XETA 2WFF1 3SNMA 2IXJA 1AYM2 4B4QA 5BY5A 4FT8A 4FPFA 4WVVA 1AR61 4M0HA 4LR4A 4IESA 1R083 2Y0IA 3O0VA 4Q4W3 5IK7A 1O3SA 3PVNA 4HPKA 2D3PA 3ZXEA 4K21A 1GNZA 4GKYA 4FTSA 3ALQA 1AR92 4TLFA 2VU9A 1COV1 1BBT1 3MEPA 1RUD2 5EYYA 2B9UA 2ZMLA 3ZIWA 1NCRB 4IEUA 1RUJ3 2LUWA 3ZMOA 4YG0A 2DCJA 3ZFGC 4L97A 4IV1C 4FTBA 4LULA 4J1WA 2BVBA 1QXJA 1AX1A 1MS3A 1O4YA 3DPRC 4KG0A 4K7JA 2VUAA 4YZ1A 2KA3A 1G7YA 4HETA 2R061 4ZU5A 4AVTA 3WG3A 1WMFA 5HI0A 3ZXAC 3IT8A 3VZOA 2JG8B 1Q8QA 3PJQA 4XMAA 4FCAA 5CFDA 3M70A 5H9SA 1R092 1SQ4A 3N35A 5K0UB 2BNOA 2RMU3 2VECA 4FPKA 4DRVA 5ABJB 1W6OB 3DV8A 2YROA 2HKXA 3HT1A 3RYPA 5IK4A 2HWC3 4Q4W2 4HANA 4HBNA 3BB6A 3X29B 4CEWA 2OW4A 1QQP2 4P9IA 4ZU4A 3EXUA 3JU9A 3LKJA 3B3QE 3SISA 4XF1A 1DF0A 1OQEA 4GH4A 2A3WA 4AGRA 2JDZA 1O3TA 2A6VA 3NO8A 1KS5A 3ZIXA 3UL2A 2RS13 1VBB2 1HRV1 1ND2C 2VXRA 3UJQA 1VAMA 4I01A 2BQPA 1AR71 5L36A 2D7FA 4AEDC 1LKNA 2Q5TA 1PVC2 1UMZA 4FPYA 4OI2A 4D69A 1RUC3 4XTPA 4XFBA 2CWSA 1PVXA 5BUVA 1UF2C 5LK5A 4CDXA 3VUOA 4QMAA 1MQTC 3AKRA 2XGXA 4OHWA 2BGCA 1N1VA 3VBOB 5A33B 3M4FA 1WBFA 3MW4A 1KS4A 4AI0A 1YUDA 4BLIA 2MNGA 1UD1A 2BWAA 3IDBB 2VVEA 1GANA 4H3WA 5C4WB 2DVBA 4R9AA 1J1TA 1GR3A 4P9JA 1K5MB 4KH9A 2VW1A 3HIFA 3UK9A 4LBLA 1EV13 1OOPC 1QNWA 4JTOA 4L11A 4CP1A 5BNQA 4Q4Y1 1REEA 2ARBA 1U5IA 4C0HA 4KU7A 5T3NA 3V0BB 1QJX3 4BWOA 3AYDA 1SACA 3J8F2 4FAGA 2BVVA 4RSUA 1JH5A 2IXHA 4W6YA 3NSTA 1FV2A 4R52A 2DU0A 1RINA 4ASMB 1DZTA 3RYRA 4LHNA 1MZ5A 3RWNA 3U07A 1GZWB 2A3XA 4FPHA 5JOWA 1GYKA 4N43B 2OUJA 1OA3A 2DVDA 4G3YC 1RITA 2ZAHA 4AFCA 3OPZA 1KQRA 1H8TB 3NAPA 2EVXA 4M3CE 4GQ7A 1G9AA 2DTWA 1XU1A 1C1LA 3ES4A 1D4M3 4AEMA 1V6LA 3ZSKA 2RJKA 2H6CA 4LA2A 4SLIA 3QACA 5CB7A 1W6MA 4FP2A 4Y1UA 2ZGLA 3M3QA 4JGZB 1NA1A 1AUYA 4LHLA 3FUQA 1RVF1 4LBQB 3KGLA 2WFF3 1WW7A 4AVCA 1C8M3 1W6NA 1RMU1 4P9GA 2ZABA 2PHFA 1DYKA 2XLGA 1S1AA 1AR63 5FRAA 4BE3A 1DQ2A 1EV12 3WNXA 1I5ZA 2CWMA 1ZBE1 1QJZA 3ZSJA 4AW7A 1MVEA 5EYXA 2IZWA 1FAYA 3AYAA 1W6QA 1XYOA 4Q1PA 1CAVA 4R8HA 1AJKA 4R9BA 4R4ZA 1KXGA 4BHPA 1COV3 1BEV1 4FPJA 4N90A 3NW4A 2XH6A 5L7OB 4PF5A 3POSA 3SLIA 1MZFA 4KBBA 2DFBA 5CBLA 3WUCA 4Y20B 1WMEA 2BPA2 2CGOA 3ACLA 3E5XA 4F3JA 5I0RA 2WNVA 1UPSA 2R063 3RDIA 1LHNA 1F2NA 4F83A 4JRAA 1RUH3 4B4RA 4CYDA 3IWZA 4YZ4A 1EYBA 1MS5A 1VR3A 1RUI2 2UWAA 2EIGA 4E2QA 4XJ9A 4E4ZA 1XQNA 5GLWA 1FPN3 2B42B 5J7MA 1RUNA 1DBNA 4IEZA 4BA6A 4DXZA 4FXKB 1PGL2 2E53A 3O14A 1A8DA 4GALA 3NKTA 4Y1XA 5BNOA 1S0BA 2PAEA 1ZZCA 2ILMA 2WA3A 2XJUA 1MR5A 2OPKA 3VDDB 1APNA 3KSCA 4X8NA 3T1MA 1XE7A 4IQPA 4WM8A 1N3OA 3RJRA 1H1IA 3M8LA 1YIPA 3S6PA 3U10A 1RUG1 3HMYA 4LBMA 1NCQB 2VQ0A 2D97A 4ISQA 3OD0A 4GIQA 2WT0A 4IV3B 2DUOA 1ZZ8A 4YM1A 4YM0A 3GYDA 5KXCA 3JD72 3MFCA 2K2SA 4NWWA 4CDWC 1ENSA 2IFRA 3HQXA 2ETEA 4YGCA 2X8KA 3QBQA 4OHVA 3URFA 2ZMNA 5SV8A 2C0ZA 1XE8A 3FX3A 5EFUA 1ZBA2 1B35B 4PIXA 4MXWA 1QH7A 1DQ1A 1FX5A 4GMP0 4QPGB 4CEWC 5DDJ2 2PHUA 4Z07A 4DQAA 4F7ZA 4GB32 2HWB2 1FPN2 1S0EA 4Y26A 4GH4C 3OTFA 3OGJA 4XTMA 2IXKA 2VNOA 4LO5B 1MS9A 1CAWA 5CA6A 1XRUA 2ARXA 2ET7A 4XFFA 4P9YA 1LOGA 1TNRA 1UU6A 1MS4A 2R071 3WP5A 4M3CF 2IXIA 5BNNA 1VRH1 3WW2A 1GZCA 1VJ2A 1TME3 5KHGA 1RTVA 4K1ZA 2FQPA 3OBRA 5JPMB 4MV2A 4HKWA 4XIKA 2QNKA 4LLOA 4CDXC 3MI8A 5J98B 1UCXA 3LA3A 1D2QA 5GLUA 1NY71 3OY8B 1PO13 3B94A 1X36A 1SBDA 2EXKA 2Q0AA 4LNVA 1NE6A 2ZHKA 3VKLA 2ZBJA 1OQDA 3OYWA 5AVAA 4PDWA 5HCFA 2ZHLA 4AFMA 5A32B 4WVMA 4GKXA 3VBSA 1DGWA 2JKBA 2EA7A 4Z1VA 1VAVA 3DGTA 4FP3A 4E4DX 1N3PA 4YFWA 5HXVA 5J09A 1RUE3 1IZ3A 5H9PA 2OIIA 3KT1A 4R9CA 3W59A 1RMU3 3WQ0A 3WP6A 2JECA 1JYIA 2VOXA 2WS93 4Q0VA 2AR6A 2ZGPA 2ZX0A 5JI7A 2ZX3A 1HLCA 3POYA 4I09A 1ZBE3 2RHPA 4MGKE 2UYBA 4P9XA 1H2MA 5KHIA 1C57A 1HV0A 1ULEA 3BOWA 1CAXB 4N53B 1QGLA 1SLCA 1LOFA 4R9DA 4COWA 4CDQB 4MLOA 1ASJ1 1H9WA 5A3LA 1WLDA 4XDQA 3GHMA 2HJIA 5C9AC 2AGSA 3VBUA 2AREA 4IEOA 1LHWA 4RS5C 1MEC2 3ZPYA 4IEWA 2RM22 3PVEA 4E4SA 1PO23 4AQ2A 5FQ0A 3WINE 1EAH2 4HFSA 1NG0A 1Q8SA 2K0GA 1DGRN 1RC6A 4KQ7A 4WVZA 1RUF3 3N4MA 4OFGA 1F9KA 4IEPA 3ES1A 4XFAA 1EPWA 1RL3A 4YW2A 5C8CC 3FBMA 1RGSA 1PIV2 1S0FA 1S0JA 3AB0A 3L2HA 5I0SA 4HT1T 1LECA 1J3PA 3LAGA 3O7OA 3U0ZA 2XBO3 4CDUC 4CZSA 2VH9A 3B93A 5KHKA 1IPJA 3ZYIB 4JRLA 1CVNA 2ZGTA 2BW8A 4I3PA 1MZ6A 1QWRA 1MS0A 1ZREA 4YGEA 3GF6A 3RNSA 2HWE3 1FOD3 3ZFGA 4HN1A 4K1YA 1DGWX 1VP6A 5K7PA 1ENQA 2UYAA 1SLIA 2V73A 4TSVA 4TZDA 4DINB 3EHKA 3ATGA 1R091 1OSGA 1LJ7A 1SBFA 2I2SA 1UKGA 1QJU3 5I91A 1RUF2 5BNPB 1UIKA 1LEDA 1LU1A 3B69A 4Q29A 1R081 2ZGQA 4P14A 5KXEA 5KXDA 4EN9B 1HW5A 1S0IA 4P9WA 4Q4W1 4C91A 2NMOA 2DCZA 1QQP1 1J3RA 1LU2A 2XUMA 1ZA4A 3VBRC 3FJSA 5GZEA 4CEYB 3EQEA 1DU3D 3VHNA 3WHUA 1IOAA 1F5FA 3WV6A 4AI3A 4PJYA 3P3PA 2ZCWA 2JG9B 3OCPA 1V00A 4INDA 1YI7A 1LHUA 2XHKA 1SEFA 1VBB1 3MF6A 4LO6B 5AC93 1LOCA 4EWAA 1RUJ1 2DYCA 3MYXA 4PQ9A 1V6OA 4AEJA 4CP2A 4AI8A 4I3GA 4FOVA 2F6BA 2R073 1ND2A 1SLAA 2ZACA 4HZFA 1BVVA 2HWE2 2PAMA 1AR83 4AEDA 1GQHA 5C8WA 1QH6A 3AMNA 4FPCA 2DU1A 3HWJA 4PIZA 4RQPC 1HQNA 2WNUA 1BJQA 1RJ8A 3BCWA 2VMIA 3MLKA 1ZRFA 1CAUB 1H4GA 4LT5A 2QVSB 2RMU1 1VBC3 1MQTA 4BM8A 2I45A 4SBVA 1FMD2 1V9U2 3BTAA 2HWC1 2ZX1A 4QM8A 4AF9A 3WDVA 3RYKA 1V6JA 5L73A 3AMMA 4AK3A 4Z2WA 2WT2A 1SDWA 2Q1MA 3A0NA 1HKDA 5JZGC 4I0WB 4L92A 1GKBA 1OOPA 1UZZA 1CIWA 2ZZQA 3CO2A 3E6CC 3MPBA 4HMZA 4XJAA 5AC92 1LR5A 1OLRA 3V65A 5BNNC 1HQLA 1RUOA 1MVQA 2WZR3 3DL3A 3OBTA 4MXVA 3QCWA 1YRZA 2WA4A 4N9IA 1LESA 3D8CA 4W6WA 4LTAA 4YGBA 1NOVA 1TMF3 1AF9A 1XXNA 4Z92B 1EPZA 1GFF2 2GNMA 2P34A 4WM7C 2RS33 3I59A 2Y26A 2PHWA 1R1A2 1KFUL 3INAA 1YNAA 4M3CB 2CNAA 1RHI3 4HKLA 1AYM3 3L2YA 3PTYA 2WKKA 4YM3A 3AFGA 2ZGRA 1EV11 4FTEA 3VL9A 2I74A 3KGZA 5FREA 3SMHA 2HYKA 1QJX1 2MPFA 3CJIC 3PMSA 2ZKLA 4UW4A 4CRQA 4C90A 3FHIB 5CFCB 1C1FA 5CNAA 1AR93 1AHSA 1CN1A 1G8WA 5F1RA 1RUD3 2P3JA 1QDCA 2JXAA 4AQSA 1F31A 5CAZA 3ZFEB 1TNFA 1U0AA 4Y4YA 2PLV2 2XJTA 1HQWA 1WCDJ 3FC0A 3H3ZA 2JE7A 1D4M1 1OKQA 4QPIC 3IKWA 2QDNA 4S2GA 3ZYGA 3RMXA 5D1IA 2GU9A 2YGLA 4XIOA 3WDXA 2XL7A 4Q0QA 3I2DA 1CR7A 4AFBA 3RZZA 4XF0A 5LEJA 1R093 5LK7B 1Q8VA 1C8M1 1ZRCA 3RG0A 2W68A 1BMV2 2ERFA 3AXDA 4E9KA 4AFAA 3USUA 3VGIA 1IS3A 3P3NA 3TNPB 5E8AA 1OPOA 1QQP3 1PGL1 1O5LA 4UBGA 3O5SA 4BH9A 1OHFA 3UKTA 2DUQA 1DDLA 4RHV2 4UW3A 2ZAAA 4QGMA 4AHXA 1VBE2 3O0XA 4XFIA 2XJPA 4C0BA 4YARA 2ES3A 1OLQA 4O9EA 3ZFFC 1SMVA 1VBB3 2B39A 1Z78A 4DNYA 3N7KA 4IL7A 2D5FA 2OYZA 4PLNA 4M00A 4IEQA 1EP0A 1PVC3 1NCRA 1VB2A 1NLSA 1WW6A 3VBFC 2AYHA 4Q4V3 2E6VA 2AUYA 4WVWA 2VNRA 4OHZA 5BV6A 1RUH1 1TQ5A 2ZA9A 1J1LA 3TAYA 4XMIA 2VOWA 2D6PA 3AKTA 3AYEA 3GNEA 1V6NA 2YY1A 3WG4A 3AX4A 2QZ2A 4KNCA 4N9HA 1H1AA 4CDWA 5F9TA 1EY2A 2D6LX 2JG8A 3JBG3 5DDJ1 5C33A 3UJOA 2HWB1 1FPN1 4D94A 2GH2A 2YGMA 1X8EA 5CFDB 1DQ0A 5ABJA 1S55A 2Q4SA 3AKPA 4MVTA 1DZRA 2CGNA 4YG3A 3HBZA 3MF9A 4HK9A 3KT4A 3N36A 3WOGA 4XBQA 3OD4A 3J8F3 2OUHA 4XJUA 3ZYPA 3W9AA 1Z7S2 4RR3C 5D8AB 4XQDA 3E6BA 1YFWA 5DXDA 3VBHA 2MEV2 3WDTA 3LA7A 3ZXKA 1ULCA 3LCPA 5AFEA 2D93A 2HEWF 4FPLA 4P5HA 5JCTA 3ZN4A 1OA4A 1AL0G 3E6DA 4J6GA 4WBBA 2O1QA 4YVSC 2WNUC 2B8MA 2QE3A 1M4WA 4Q4V2 3BU7A 2UURA 1YXWA 2MHFA 4DPNA 1Y7BA 4B29A 1DHKB 1W6PA 4EN6B 2JE9A 4Q8KA 2UWCA 1GV9A 4NHMA 3SCFA 1KRIA 3JBG2 4IXLA 1ZM1A 3PJYA 3ZN5A 3SHRA 4IERA 2KXLA 3E5QA 2HWD2 1ND3C 2NLRA 4AQ6A 5DZFA 1BXHA 4K20A 3LA2A 4XJZA 2A75A 2TNFA 3TNQA 5T5JA 5AVPA 2EF6A 5C6CA 4DB5A 1AVBA 3T1LA 1DQ4A 4Q4X2 3TB0A 3NV2A 1YIFA 3WR0A 1TME1 3B00A 3V0BA 5CG9A 4IEXA 4JGYB 2PTMA 3QD6A 1IS5A 5FPXA 4LE3A 4WV8A 1REFA 3ZXDA 1MEC1 1UZYA 1CX4A 5AFBA 2WQ4A 1UL9A 2X5IC 4NO4A 1PO11 5EZWA 1RB8G 5C9AA 5I0TA 1EAH1 4RS5A 1SLTA 1F8VA 4GWNA 2ZPXA 4GMP3 3VHOA 3FFZA 4ES9A 3NAPB 4COYA 1WLCA 2DCKA 3EO6A 1V6KA 2FBEA 1RUE1 2ZZJA 1PIV1 2GC0A 1X82A 3VHRA 4AVVA 1RUI3 4UXAA 3KD4A 2WS91 3I54A 5C8CA <