4D69A

Soybean agglutinin from glycine max in complex with the antigen tn
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
234
structure length
234
Chain Sequence
AETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENESGDQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title Detection of Tumor-Associated Glycopeptides by Lectins: The Peptide Context Modulates Carbohydrate Recognition.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 49
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d69A00
4Y24A 1CPNA 4YW1A 1BYHA 1Q56A 2ZABA 2SLIA 3V64A 5GZGA 2D44A 2ZA9A 3V65A 1LOFA 2EIGA 2VU9A 2ZZJA 2GNBA 3FUOA 3ZSJA 5JLVA 1TEIA 1FNZA 1IS6A 1UMZA 1Z78A 5JDBA 2E6VA 5T5LA 2OW4A 1GV9A 3O12A 4Q8LA 4NO4A 4XTPA 1QDOA 3JU9A 1IKQA 1D0HA 1GSLA 1V6NA 1ZA4A 3PMEA 4FPFA 3IM0A 1N3QA 5H9RA 2E7QA 1GZWB 4UW6A 2E7TA 4OZXA 1LHVA 2D6NA 3MPPG 1JN2P 1LTEA 2ZACA 2EALA 1F5FA 2LALA 4P14A 2D6KA 1QF3A 3AZYA 3OY8B 4XHXA 2V73A 2D6LX 1G9DA 4YW3A 2P3KA 3I4IA 1F31A 2ZHNA 4JC1A 5AVAA 2A6YA 2JDZA 2ZMKA 1MS5A 2A3YA 2EXIA 3OYWB 2ZAAA 4AWDA 3ZXJA 3R4SA 5GLUA 1MS4A 3HR9A 1LEDA 1NXD1 3L2YA 3WHUA 3ASIA 2PHWA 2I2SA 2C5DA 4C1WA 3OPZA 1W0OA 3A0NA 1JBCA 4FQ4A 3WDUA 3OBTA 3OJBA 1H9WA 1LGCA 1HQLA 2LTNA 2UWBA 3RSJA 2TEPA 5EWSA 3UJOA 3FLRA 4R9DA 3AYEA 4PQ9A 4FPOB 1MZ6A 2ZGPA 3WG1A 1N1SA 1C1LA 2OUJA 1ZM1A 3NV3A 1FATA 3AFKA 4K1YA 1V6MA 2NMNA 2PHUA 1AJKA 1YO8A 1G7YA 4CTEA 1UAIA 3N35A 4MYEA 4YM0A 4F83A 1G9AA 1G9CA 1BQPA 1QU0A 1WBFA 1G86A 1Q8VA 2ZGUA 3ZSKA 4ZKTB 4YG3A 3N36A 4XMIA 3WCRA 5F5QA 4AGGA 1VIWB 2V5YA 4TZDA 2JE7A 2WNEA 4ITCA 1JYIA 5DZFA 4GKXA 1DQ2A 5GLWA 3VUOA 2A71A 1HDKA 4FOQA 5IT6A 4Q1PA 1LECA 2WKKA 3UL2A 5T54A 2ES3A 1H30A 1LOGA 2GMPA 3AYAA 3AZXA 1AX1A 1SCRA 1VALA 2VW1A 4FOYA 1Z0HA 4LBMA 1FAYA 5JOZA 3QCWA 4U2AA 1LENA 4AVSA 2D6OX 5GJ6A 3TB0A 3AXEA 1LU1A 4U36A 5JVVA 4P9XA 3UJQA 2DVBA 4M3CF 4HANA 1LJ7A 1OKQA 4JCKA 2NN8A 4AYUA 2VW2A 2ZGMA 1DBNA 5CA6A 4W65A 1VLNA 1AJOA 1LCLA 2Q5TA 1FX5A 3POYA 1N1TA 4XOGA 4ATFA 4Y20A 3ZXLA 1RINA 4DQAA 1AX0A 1UN1A 3SH4A 4BMBA 5HCAA 1NLSA 3TAYA 3U4XA 1XQNA 1WD3A 3R4UA 3DUIA 4NOTA 2W39A 2C9AA 1UKGA 4FPEA 1W6PB 1JXNA 1APNA 1YRZA 1EPWA 1LHUA 2DTYA 5GZEA 1IS5A 3VKMA 1S1AA 1AZDA 1SLTA 3AP9A 4Y1XA 1DQ1A 3INAA 5JOYA 4YG6A 3RS6A 1QOTA 1X50A 4FPGA 4XJZA 1GLHA 3POSA 1MVEA 1Q8QA 1WUVA 1MS3A 3W58A 2A6XA 3AP7A 1ULCA 5H9PA 5EXOA 4XHBA 4YZ1A 2ZHMA 4YZ2A 5JOWA 3N7MA 4DRVA 4BQ1A 2CL2A 1WD4A 3LSDA 1DLLA 3RRDA 4XJWA 2AGSA 4WVVA 5E8AA 3ZSMA 1LOEA 5GLVA 4BOWA 4YGEA 3UK9A 2WT0A 1VAVA 2PELA 4GWMA 4DS0A 2ZMLA 5DG2A 3NV4A 3VV1A 4AVTA 1MS9A 3FBYA 1MZ5A 4DPNA 4XZPA 3WLUA 1QOSA 1GANA 2EXHA 2EF6A 2P3IA 1C4RA 3MW2A 2JE9A 3VKOA 1DGLA 3KQRA 3JUUA 3POWA 4YGDA 2YROA 1IKPA 2D3RA 5T52A 3WOGA 4M3CB 1SBFA 3CNAA 4WVWA 4XBQA 2EAKA 3SNMA 5IK8A 4YM2A 1CONA 1KRIA 1N1VA 4Y20B 1SBEA 1S0EA 2CTVA 3C2UA 4L8QA 4FP2A 3SISA 1WLDA 2D43A 4HL0A 1JW6A 4Y1YA 5DG1A 1BXHA 2GNMA 2E51A 3D4KA 1IS4A 1N1YA 4XTMA 4ISQA 1N3OA 2ZBJA 1CVNA 2YZ4A 3MW4A 1JUIA 4UW3A 4LBKA 1N47A 5JMCA 4SLIA 3V0BA 2WQZC 2H0BA 2P37A 2WT2A 3FLPA 3B9CA 4YZ5A 1V6OA 4YG0A 1HKDA 5GZDA 4M01A 1GZCA 2GDFA 1G9BA 2GNDA 1LULA 2DURA 1CPMA 3N7KA 4BPZA 1GICA 2CNAA 1A3KA 2ZMNA 2A70A 4ASMB 1A78A 1W6PA 1URXA 1KJLA 1V6JA 3SITA 3BIWE 1DZQA 4Z8BA 1SLAA 4R9CA 2WLQA 3FFZA 4LBLA 1ENSA 1N3PA 5CNAA 4AVVA 1LHNA 1MS0A 3WG4A 1SBDA 3AP6A 3OGGA 1DIWA 4Y22B 3WUCA 4BMEA 2NP0A 1ONAA 3B00A 4BM8A 1I3HA 4ISRA 1LOFC 3RQ0A 4XILA 1BKZA 2DVGA 4FPHA 2ZGNA 4Y1ZA 3ZYRA 4LBQD 1UZYA 3RG0A 2NMOA 3IPVB 4K20A 3ILRA 2AR6A 4UW4A 4C1XA 1B09A 2YY1A 1SFYA 4Q27A 3ZPYA 1UX6A 1W6QA 2R16A 2AREA 4P9YA 2YXSA 2JJ6A 4DFSA 5KXBA 1YI7A 3NV2A 3H0OA 4FPYA 3WDYA 2YMZA 2PHTA 4K21A 2VY0A 2XB6C 1KDKA 4GKYA 2PHRA 3M2MA 3APBA 1ENQA 2W52A 4GA9A 2D6PA 5T5JA 3WCSA 4R9BA 3ENRA 4M3CA 1QKQA 4IQPA 4XXAA 3WV6A 3V0BB 1MACA 2NZ9A 5CB7A 1LGBA 3RMXA 1MVQA 3B69A 1LOBA 4Y1VA 3ZYPA 1VAMA 2A5ZA 1SLIA 2DU0A 2SBAA 1LU2A 3AP5A 2VH9A 2A3XA 5KXDA 3ZSLA 3WUDA 4AGVA 1S0BA 2ZGSA 4YGBA 5CBLA 2DWRA 4FPJA 1ULEA 3ILFA 3V0AA 2ZGRA 2ZGTA 4LBQA 2R49A 4FPCA 5IK5A 4M00A 1AVBA 4FQZA 3AZVA 1DQ5A 3DGTA 2JD4A 1GNZA 2AH2A 2CY6A 2P3JA 3AK0A 4Q8KA 3T1LA 1OFSA 1LOCA 4UW5A 1W6MA 3D5OA 3Q9OA 1RIRA 3M1HA 2R1BA 2RHPA 3ZVXA 2UWAA 1D2SA 5HCFA 4D69A 2A75A 3BTAA 3O0XA 4ZXKA 2FHRA 3MEPA 4XIOA 5H9QA 4YZ3A 3D6EA 3WDXA 3BOPA 1V6LA 1LESA 4H55A 1RITA 4CZSA 2ZHKA 1FV3A 1W6QB 4YGCA 3WDVA 1CR7A 2YV8A 2UU8A 4Y22A 1S0CA 1MR5A 1GBGA 3SH3A 5IK4A 1LODA 2DVAA 2ZKNA 1AF9A 3OBRA 2VUAA 4XMAA 5DUVA 5GZFA 3SH5A 2ENRA 4YLZA 2DUOA 3AX4A 5HCBA 3ATGA 4FPKA 4Q26A 2GMMA 3IPVA 1S0IA 4XJ8A 5IK7A 3HMYA 4LBJA 1QDCA 5T55A 1Y7BA 5SV8A 1C57A 1QNYA 3AYCA 1AXZA 1CIWA 2DUQA 3O0WA 1SLBA 4Q2FA 3VKLA 2PHXA 1HLCA 1V6IA 2CYFA 4YW5A 5DUWA 1ENRA 1KITA 3A0KA 5DXDA 4YW4A 1WBLA 2VW0A 5L73A 3WNXA 1G9FA 4Y26A 5GLZA 1W0PA 4GWNA 4KBBA 1KQRA 3O0VA 3AJYA 1IOAA 1O4ZA 3N7JA 1QOOA 4BLJA 1QMJA 1JOJA 2UURA 3M3CA 1DHKB 3V0AB 4ATEA 3AXDA 4LBQB 1ULGA 3A4UA 1KJRA 1AX2A 4Q1RA 1H9PA 4RL7A 2XG3A 5GM0A 1WCSA 1J1TA 2EXKA 4Y1UA 1WW6A 2W08A 2WSVA 3B3QE 1MS1A 2CWSA 1WW5A 1W6MB 2ARXA 4PBOA 4YFZA 3MW3A 1PZ7A 2A6ZA 1UPSA 4PBPA 1CN1A 1R1ZA 1WW7A 4YM1A 3T1MA 2WJSA 2DVDA 1LOAA 2D7FA 4P9WA 1CESA 1ULFA 1G8WA 1W6NA 5GLTA 3ZXFA 5KXCA 2D6MA 3PJQA 2CWMA 4I30A 2WSUA 3BODA 3AP4A 1U0AA 4YM3A 1OQ1A 4XXPA 4FOVA 4GALA 2GNTA 3M3OA 5T5PA 1ULDA 2BQPA 1S0FA 2KM2A 1Q8PA 5H9SA 5JOXA 2ARBA 3PVEA 4XBLA 1GKBA 3I8TA 2D3SA 3KM5A 4CRQA 2AUYA 1AXKA 2R1DA 3IN9A 3AJZA 3WHTA 3WDWA 1WLCA 3WVJA 4LBNA 1DYKA 1Q8OA 5FRAA 3WG3A 2A6WA 2OUHA 2DUPA 5CAZA 3IMNA 4K1ZA 2DYCA 4XJUA 1DQ0A 3PVOA 4GXLA 3ILNA 5KXEA 1FNYA 1KDMA 3USUB 4AGRA 1JYCA 1GZ9A 3LCPA 5DZGA 4TYSA 2ZHLA 2GALA 3W59A 1JHNA 1CJPA 5LK5A 4FOWA 1Q8SA 2A7AA 3QLQA 1WLWA 4BLIA 1S0GA 1IS3A 2R0HA 1W6OA 2GN7A 3HN1A 4FP3A 3VKFC 4DRRA 1WW4A 2DU1A 4XJAA 1QGLA 5T50A 4YW2A 3AYDA 3WDTA 1SACA 1LEMA 2ZGLA 1DFQA 1I1EA 3AZWA 3RMYA 1BJQA 3T2TA 4RA0A 2JKBA 1V6KA 4YZ4A 4M3CE 3LSEA 2ERFA 1GNHA 2AENA 4PCRA 2B7YA 2W68A 2A3WA 1SLLA 5DUXA 1LGNA 2E53A 1FV2A 3M3EA 1V00A 2DTWA 4PF5A 1W6NB 3AZZA 3R05A 2EXJA 4LBOA 1GZWA 1SLCA 2GMEA 1S0JA 2NYYA 1SCSA 3WG2A 2AYHA 2FMDA 2ZGQA 1FYUA 1S0DA 2G4IA 3GNEA 4XJ9A 2P34A 5T5OA 1LHOA 5GALA 3SLIA 1GYKA 2D3PA 3ZXKA 4XBNA 5E89A 1UL9A 3OY8A 4XYXA 1CQ9A 2A6VA 2VXRA 4WZFA 5GZCA 4R9AA 5F9TA 3B01A 4XE9A 5DZEA 3NWKA 1YIFA 2HYKA 1DYPA 4XIKA 2GN3A 2ZGOA 3OYWA 4XDQA 1LHWA 4FVVA 3IKWA 2UWCA 2DVFA 3WZ1A 1F9KA 2WT1A 4YFWA 1HQWA 2DV9A 5IUQA 4WV8A 1PZ9A 2OVUA 2Z42A 5EYXA 1DQ4A 1O4YA 3PVNA 3M3QA 5BYNA 3VKNA 3ZXEA 3N7LA 3N3HA 2ZGKA 2JECA 5E88A 5DUUA 1AXYA 1C1FA 3FLTA 3GALA 1BZWA 1YYNA 1W6OB 1PZ8A 5FREA 3NV1A 1UZZA 2PHFA 1MS8A 2NM1A 1YXWA 3O5SA 1QNWA 1DQ6A 1A8DA 4JRAA 4FPLA 5EYYA 2R0FA 2P2KA 3USUA 3FUQA
chains in the Genus database with same CATH superfamily
4Q4Y2 4Y24A 1DGWX 1Q56A 1YQ6A 2ZABA 3MF9A 4Q4X1 4Y33A 4YW1A 3FJSA 3V65A 2HEYF 2VMDA 5CFCA 2XKPA 5FAXA 2C24A 2XDVA 4LA2A 1RUNA 1RUD2 3IIIA 3M3IA 3WNLA 4AFAA 2P5BA 2HH9A 1CAVA 1TNFA 1GV9A 2OW4A 3O12A 4NO4A 2JENA 1XU1A 4WVMA 3PMEA 5ERLA 4MOAA 3O1OA 3ZR6A 1ODNA 4F3JA 4OI0A 2HWE2 1NE4A 3WQ7A 2W2IA 3H3UA 4QQPA 1VE0A 4OZXA 4QXBA 4UW6A 2DDUA 2GH2A 5CZKA 4DUXA 1JU4A 5CADA 5FDBA 2IXKA 1F5FA 2WWJA 1R083 1W9YA 2BRTA 3VD7A 4XHXA 2D6LX 3LD8A 3I4IA 2ZHNA 5J7MA 2O0OA 3HEIA 1ZRDA 5C3OA 2JDZA 2VGDA 4UBGA 3VBUA 3GCXA 3OYWB 2Q30A 3H8UA 1MS4A 3TEWA 1H2MA 2RR12 3PUQA 4HETA 5LRSA 2WR9A 2BGOA 1W9SA 3OUJA 4C1WA 4CPBA 4XDOA 1W0OA 3THPA 1VAKA 2EICA 1JBCA 1JS9A 1E5HA 1UMIA 2IC1A 3OBTA 1XRUA 5FY1A 2CGPA 3OJBA 4Q4X3 1H9WA 1FMD2 1OQEA 4CUAA 3OBAA 5A6XA 2XVLA 5FPXA 4JGZC 1POV0 4R9DA 3MBWA 2WNUC 4FPOB 5CG8A 3WG1A 2XXZA 3N9QA 4COZA 1KS5A 1MEC2 1XE8A 2OUJA 1QXPA 1UOBA 3B5LB 1JUHA 3OGRA 1V6MA 2NMNA 4JTOA 4CTEA 4YM0A 2G19A 3N35A 4F83A 1G9CA 1O3RA 1BQPA 4BK4A 4YW7A 5FYHA 2VJXA 2ZGUA 4ZKTB 5F5CA 3N36A 3BPZA 2JG9B 3IIAA 5FZCA 3I3QA 5FZ0A 1C28A 3L9JT 5A7OA 4ITCA 3TYJA 5C70A 1RTVA 3BGAA 1DQ2A 5I8TA 2WNVA 4NHXA 5GLWA 3ZFGB 3IMMA 4N43C 1YCIA 5IT6A 2WKKA 1CZVA 5LEJA 4E8DA 1PGL1 1RXGA 1GOHA 3PJYA 2XLFA 3AYAA 3F95A 1SCRA 2VW1A 5FXVA 5JOZA 3VN4A 5IAVA 1ZBA3 5I0DA 3QCWA 4HVRA 4AVSA 2HEWF 3TB0A 4U36A 2VVDA 4B29A 4AFMA 4JDOA 5G05L 5FPBA 4IE0A 2LW8A 2KA3A 3CHXA 4XC9A 5K0UC 4N7UA 3T30A 3ABZA 1AYN2 1VLNA 5G04L 4MG2A 1AJOA 1OSGA 1OBNA 2Q5TA 2RG4A 1PVXA 5C6CA 3LDBA 4BMBA 4XUOA 5I91A 4DMIA 5HCAA 3TAYA 3T2PA 3ZYHA 2CU5A 4QKNA 1UYZA 1XQNA 2YC0A 3A7QA 3JB4C 5I8SA 4OYUA 4QU1A 3Q8BA 1XSQA 1QJY2 2X8KA 1UKGA 1JXNA 4FAGA 1APNA 1XNDA 4CEYC 2DTYA 4MGIE 3SXWA 1PNGA 4TN7A 3AP9A 5JOYA 2Q8DA 3RS6A 4FFFA 1K42A 2OXBA 4MGTA 1GWKA 2VZSA 4J1WA 4CVUA 1E57A 4RQPA 5ACA2 3ETQA 3AP7A 1ULCA 1LRHA 3J7LA 3AB0A 4YZ1A 3O1TA 4YVSC 1VP6A 2WS91 2W92A 3N7MA 2WZR2 1BHGA 4LT5A 4I0AA 1TZOA 3JB8A 2RS33 2CL2A 4AK3A 2KXLA 3N9OA 4K9SA 1H1MA 2CGOA 4COUA 1DLLA 4Q4W2 4RS5A 3RRDA 3ZSMA 4JV4A 1FI2A 4NIAA 2WT0A 3WT3A 2BOIA 3PUIA 2ZMLA 1UO9A 3NV4A 4WM8C 2OYZA 1MS9A 3VV1A 4DOUA 1JU3A 2VZUA 2XJPA 3I2IA 3LGRA 4CXWA 1QOSA 2VZQA 2X09A 4OMDA 5CKQA 4RHV2 1JZ3A 1QJU2 3TRSB 2VMEA 2Q0AA 5JWPA 1IKPA 5T52A 2JDNA 3SQOA 1SBFA 3TN92 3VBFA 4HKOA 1W3VA 3GJBA 4FCAA 2EAKA 3SNMA 1DU3D 2R041 5IK8A 3WP3A 1CONA 4IV3B 5FLIA 4D8MA 3TEYA 2XH6A 3MGUA 1YLLA 3SISA 5C9AA 5FKBA 4Y1YA 3ZM8A 3WQBA 2I74A 2GNMA 1IPSA 2O14A 2VZ1A 3EMRA 4ISQA 2ZBJA 1JYNA 3FX3A 3HVDA 4UWDA 3VBOC 4JTNA 2WO7A 3VD5A 3C7HA 2WS93 1VB2A 4SLIA 3B9CA 4JGYA 4YG0A 4TSVA 1NQDA 2R063 5I93A 3POBA 4COVA 3GHMA 4JHTA 1NE6A 1UOJA 4IE6A 2GH8A 2CNAA 1CIYA 1O59A 4NWWA 4X6QB 2IXCA 2NQYA 3LF7A 4IE4A 4AQ2A 1HV1A 5BNOB 3SITA 1JZ2A 1IQDC 3BIWE 3WW2A 1DZQA 4O9GA 5IVFA 1CX4A 1DGWA 4K40A 2C6SA 1W9WA 2WWSA 4UT5A 1VJ2A 5FLHA 3EO6A 1MS0A 3KVAA 3DYOA 4NR1A 4XVHA 1BBT3 2EA7A 3OGGA 2IZWA 4OI1A 1OOPC 3WG4A 5HXMA 2NP0A 1W03A 2R043 1PM7A 4V2VA 3RQ0A 1LOFC 3ACIA 2D40A 4XILA 1QXJA 3TEZA 3RZGA 5KHHA 3DPRB 1UCXA 2EAAA 4LBQD 1COV2 4CDUB 1IPKA 2PXJA 3IPVB 2HLEA 3IDAA 4OUMA 3F2ZA 1ND3C 3I54A 1PX4A 1ND2A 4UW4A 4ZS2A 5FXXA 5C8WA 5CFDA 1SFYA 1UQXA 1NG0A 1KS4A 1PX3A 2AREA 2R16A 3CQOA 2HWF3 4BQ4A 1YI7A 1R093 3NV2A 4LHLA 2H6CA 4ZZ5A 1WWYA 1W8FA 2PHTA 1RUG3 3HQUA 2XB6C 2XOMA 1S2EA 4GKYA 3M2MA 4CP9A 5FQ0A 2D6PA 1QQP1 5DAXA 5FYSA 3RWNA 3OPWA 3JD71 1VBC1 5FBJA 4IQPA 4A7KA 3V0BB 5LEKA 1S55A 1ZBE2 1WMEA 3MHZA 1NLRA 5ANNA 1PVC1 2Z5WA 3W5MA 3RMXA 1NY72 3JCIA 1BVVA 3B69A 3AMHA 3MIHA 4LLFA 2PN5A 4FXGB 5FZ3A 3EJKA 5FZ7A 3AP5A 4LO6B 4AEDA 1QJX1 2HWC1 1EPZA 3ZSLA 3ZR5A 4FPJA 4A3XA 2QQVA 4QWNA 3KMHA 2ZGTA 4HBNA 4HN0A 2G9FA 2WRAA 2A1XA 1TG7A 3VZLA 5FWEA 2XJQA 1AVBA 3I2DA 3OG2A 4HVQA 3AZVA 1RUE2 3KWVA 2JD4A 1GNZA 2AH2A 2WAOA 4Q8KA 2OPWA 2V4VA 1NA1C 3MLLA 4I01A 3Q9OA 5FIXA 4GJYA 5KHGA 1ZRFA 2Y6LA 2J1VA 5FP4A 1J59A 1D2SA 4D69A 4EZ4A 2BUKA 3O0XA 4ZXKA 1K5JA 5A7WB 1H8TC 5H9QA 4NN0A 1RB8G 5FZ1A 3D6EA 1PM4A 4TTGA 2K0GA 1NCRA 2AC1A 4EN6B 1QQP3 4H55A 4C0BA 2JDKA 1AL21 4CDQC 3WDVA 1CR7A 1ULPA 4AHZA 1YFYA 1OF3A 3DL3A 1B35A 2CDPA 3SH3A 5F39A 5IK4A 1PVC3 4QXKA 2BEOA 1TMF2 2ENRA 2ZX2A 4YLZA 5A3OA 4BHPA 3NJZA 5HCBA 5I0RA 4Q26A 4MO3M 5A6YA 4XJ8A 3OGJA 1U5XA 4LBJA 2HWC3 1QH7A 3I2JA 1CIWA 2ZX3A 4GJZA 2JDMA 1HLCA 2F4LA 4EJRA 2XHKA 3MPBA 3VLBB 1YFUA 4OHWA 3A0KA 4NPLA 4Q4V1 2VTFA 5DXDA 5DAWA 3WNXA 1POV3 3GZAA 4NHYA 5JI9A 1LNSA 1KQRA 3O0VA 5J98B 5HPOA 5KHJA 1FOD2 5IVBA 4AFBA 3V56A 1JOJA 2UURA 3M3CA 2VUDA 5D8AC 3RDIA 1PGW1 3EXUA 4JAAA 3VZOA 2FDHA 3CKHA 1UX7A 4HKLA 4Q5OA 2WLPA 2BNMA 3Q8CA 4KH9A 4QM8A 1GQHA 4HPKB 2KR2A 1OC1A 5A7QA 1YI9A 2X29A 4QPGB 1AL23 2P6HA 4WM7A 1W6MB 1Y9MA 3B94A 1QH6A 3FHAA 4L97A 1UPSA 4PBPA 4CXYA 4IE5A 1WW7A 1RXFA 4UI9L 1YQCA 2DCYA 4FO9A 1CX1A 2DVDA 1CAXB 1NUKA 2XJSA 4QU2A 2IXLA 5J3UA 1CESA 3GCWA 5FZAA 5KXCA 3PJQA 5LWBA 4CP0A 1AR93 3CJIA 1OT5A 4P9LA 4I0BA 2GNTA 5T5PA 1ULDA 4UOJA 2KM2A 3U0ZA 4N8MA 5H9SA 1WLTA 2JG9C 4Q4V3 5L9RA 3KM5A 4CRQA 2AUYA 1YHFA 4JGZB 5BNNB 4CCKA 2PAMA 3ZFGC 1WLCA 1YIPA 4CDXA 4I0WB 1DYKA 4R4XA 1D4M3 2VBPA 2VQTA 3IMNA 3OTFA 4K1ZA 4MV2A 2ZX0A 4XJUA 3CF6E 1CAUB 3VD3A 3WNOA 5B2GB 3AKPA 3USUB 5LATA 1GZ9A 1JHJA 2Y0OA 4XABA 1VRH1 2MEV2 1SHWB 2VUCA 4ES9A 4FOWA 4WVMB 1CAVB 1C8M1 1X9TA 4PDWA 5E1RA 3K4AA 1VBC2 4LULA 4XDPA 5A1AA 4PJYA 4XJAA 2BV4A 2BTVC 4I3GA 5FP7A 2AEZA 3AYDA 3WDTA 1DFQA 4WVZA 3BI3A 3RMYA 1T6BX 4IEQA 2VCBA 4M3CE 1GNHA 2IWGB 4AQ6A 1GR3A 2B7YA 2QZ2A 2I07B 2VECA 5FYVA 1HXS2 4QPWA 3SCFA 4HLTA 1RC6A 4W4ZA 3VHOA 4AI1A 3TWIA 1W6NB 1VBD1 3MO4A 3POGA 3KV5A 4KL1A 5CVRA 2GMEA 2YPDA 4META 3ZN4A 3UNPA 5I0TA 2B39A 2Y26A 2G4IA 3GNEA 5T5OA 2P34A 1LHOA 2XJUA 3KV9A 4GD4A 1GYKA 2D3PA 3AMNA 4OQ9A 3FE5A 3ZXKA 3ES1A 1WMFA 5F9TA 2JEMA 1Y43B 2F17A 5DZEA 1CZSA 3ZXGA 1M06G 2MHFA 4CEYB 2VBDA 2QCSB 3LB9A 5I0UA 3C7EA 5ABJA 3ZFFA 5FY5A 2VCMA 4KWLA 1C8M3 3AL6A 2QE3A 4KWKA 4LIUA 4AEKA 2Y60A 3J8F2 4ARYA 3ZPOA 1NZCA 5IW0A 1SFNA 2J42A 4WV8A 5DPNA 1PZ9A 1Y4WA 4UF0A 2Z42A 3WSOA 3HAGA 1DYOA 3NNGA 4LHNA 2FDIA 4DY5A 3KCCA 4YVSB 3N3HA 4YYOA 2Y34A 1RHI1 1SZBA 1C1FA 2RS12 1OUSA 3GALA 4XFIA 3U4SA 3CDZB 1W9FA 4QQHA 5FV3A 4FTEA 3PL0A 5JCTA 1MS8A 2NM1A 2LM3A 1W28A 3O5SA 1QNWA 3I3EA 3POEA 4CPBD 1JOPA 5EYYA 2VULA 2R0FA 3HQRA 1VBD3 4IV3C 3FUQA 2ZEXA 5J96B 2OA2A 4Q4Y1 3HIFA 4OZOA 3I7DA 5LASA 4QQLA 3V64A 2D44A 3BU0A 1VR3A 1RUC3 2B46X 2VU9A 3FUOA 5A33A 4ARXA 1YUDA 5JLVA 1PO21 1TEIA 5FYBA 1RUD1 1Z78A 5LY2A 5JDBA 4LKEA 4XTPA 1XJAA 2RS52 5C4WA 3LA3A 2E63A 1PGW2 1AR82 4KU7A 4DXTA 3DN7A 2JXAA 4XUQA 2B42B 4AL9A 4E2QA 2E7QA 2FCTA 3DF0A 1CGPA 2E7TA 1RVF2 1XYPA 3MPPG 4LXLA 4PLMA 2ZACA 1F4AA 1ZZ8A 2C1FA 4QPIA 2LALA 4O65A 1NZIA 2W46A 3AZYA 5FZFA 1ULOA 1PIV2 3M8LA 2P3KA 4K7JA 4C91A 2VCAA 1SPPA 2FCVA 3KHBA 4KI5M 3U11A 3MUY1 5BNOC 3I59A 1MS5A 3MFCA 1RHI3 2HWD3 5T3NA 1O3QA 3ZXJA 3R4SA 1MZEA 3HR9A 3T4VA 1NXD1 4JKLA 4ZU4A 2I2SA 2RR11 4CCNA 4A42A 1JZ7A 2C5DA 5IVVA 3OPZA 2RM23 3E97A 4OFGA 4RQPB 2Y6FA 3SEPA 2XPJA 2Q8OA 4AAPA 1W8ZA 4Q4Y3 1NAEA 4AQSA 3DPRC 4CDQB 3K4ZA 1FMD1 4CDUC 1PK6A 1RUD3 4PQ9A 5A7PA 3LA2A 4RS5B 1QJFA 2O8OA 5K4LA 1T2XA 3NV3A 4BIOA 1NCQA 2J1SA 2Z2SB 4ZS3A 2PHUA 3NNLA 1AUYA 2BZDA 2HWE3 3EQEA 4HSLA 5BPXA 1G9AA 2IVJA 4QQOA 1QU0A 1WBFA 4H7MA 4JQRA 3ZSKA 3ZX7A 4YG3A 4PIYA 3WCRA 4QX0A 4JKMA 4AGGA 5FY0A 3S0MA 1GMMA 2XJRA 2JE7A 1RJ7A 2IUWA 1GP6A 2QKDA 2WNEA 4EV0A 4URAA 1O7FA 4ZHNA 1ND3B 3VUOA 2A71A 3VBFB 3ZFEA 3VDDB 4BWOA 2ZEZA 2CSGA 3OB8A 4LQRA 3VDBA 1L3JA 4OUEA 3VZKA 2WN3A 2GMPA 1US2A 4FOYA 4NUBA 5F8PA 5C3QA 2AACA 3H50A 2YGLA 4LBMA 1FAYA 2RR13 5FZOA 4XAAA 4LPLA 5C9AB 4LO4B 4XFBA 3UJQA 5FYTA 3O1PA 3KCXA 1J84A 4KMQA 4HANA 2D5HA 2RMU3 1TQ5A 2JE8A 1FMD3 4JCKA 4C8DA 2ZGMA 4S2FA 1PNFA 2HKXA 2Y6JA 4L2NA 4XURA 3E5XA 4Z82A 4EN8B 5C8CA 5CA6A 4W65A 1AYN1 2Z79A 3NQHA 4JGYB 3H8RA 1LCLA 1PMHX 3NVCA 1HJFA 3P5BA 1MEC3 3HT2A 3ZXLA 3A22A 4DQAA 2WC2A 2E33A 1UN1A 3SH4A 3CJXA 4OCTA 4N53C 3ZYGA 4QDQA 3U4XA 1OLME 2W3JA 3H7JA 3ALQA 2OX0A 4S2DA 1QJY1 2C9AA 4BDVB 4N90A 1LHUA 4LKSA 3VKMA 1AYM3 2LS6A 2JDYA 2D98A 1S1AA 1NOVA 3HQXA 3INAA 3VL8A 4TWTA 2BBAA 4N9IA 1YJKA 4CP9B 2PLV2 3POSA 2B45X 5F3IA 1JZ5A 1Q8QA 3WF1A 4XACA 5ACA1 4UYBA 3KT4A 5EXOA 1C3HA 4XHBA 2YFUA 2ZHMA 2PMWB 4D6RA 2QQJA 5A6QA 4DRVA 5FOBB 3LEMA 2WZR1 3FBMA 4MX3A 1EAH2 2OQ7A 1WD4A 3UKVA 5L36A 1NKGA 4OHVA 4LEJA 4CCOA 4Q4W1 4XJWA 2EIBA 3GHNA 5DDJ1 1VMJA 5GLVA 3T0DA 1WCDJ 1VAVA 3FFQA 4GWMA 1LKNA 3R0RA 1K5MC 3C7GA 3K51A 5DG2A 4DO0A 4DS0A 1KXGA 3DEMA 4DEQA 2YGMA 1W8HA 1MZ5A 2DCZA 3FBYA 4HG6B 4XZPA 4D7SA 1PO22 1UNBA 2CAVA 2EXHA 2ZAHA 5CU1A 2ZXQA 2P3IA 4RHV1 1OVSA 2XQRA 3KQRA 1QJU1 1JI6A 3POWA 5FQ0B 4LKDA 4YGDA 3G7DA 2YB7A 1DG6A 5LA0A 3IAQA 3TN91 5A7NA 4DY3A 1QJY3 1UU5A 2VNOA 4IXLA 4UAPA 1SMVA 1JZ8A 5FO7B 1UF2C 1AHSA 1KRIA 3VBSA 1N1VA 2Y6KA 4GIQA 1SBEA 4LTAA 2CTVA 3GBFA 4L8QA 4QPGC 4Y20B 2BYVE 2D43A 2Q1ZB 2Y33A 1ASJ2 4L11A 4NAOA 5DG1A 2GSYA 4ASKA 1LR5A 2C9KA 1BXHA 2OQ6A 3JQWA 5ACA3 3D4KA 1IS4A 1L7RA 1N1YA 1VMFA 4JVAA 4XTMA 5JSOA 1N3OA 1UXZA 2RV9A 4H2AA 3WX5A 5D8AB 4AAXA 5C5UA 1XNTA 5JAXA 5FK7A 3MF6A 4SBVA 3KF5A 3JBG2 4LKFA 2WQZC 1H6XA 4LITA 2H0BA 2P37A 2VAUA 2QTWB 4MHUA 4PHZA 1H1IA 4YZ5A 1V6OA 3NJYA 1O3TA 1U5YA 1OKOA 2HJIA 1X9PA 3WEZA 1OF4A 2IFWA 4G9SB 1CPMA 3N7KA 4XQDA 5JXIA 2G9GA 4IV1A 1GICA 5HV4A 3UETA 2R32A 1RL3A 3GF6A 5BNNC 4QX3A 1W6PA 1URXA 4YVWA 5HCHA 1HN0A 2BOJA 2VNVA 4RHV3 3LDKA 3FFZA 4L0PA 1N3PA 4AVVA 2YC4A 4MGZE 3TN93 5AC91 3AKTA 3AP6A 1DIWA 1XE7A 1ONAA 3B00A 3H3LA 4WZCA 4BM8A 5CFCC 5JXGA 1I3HA 4LJHA 3U14A 2PAEA 3J26N 2VMGA 4QX1A 2HBUA 3RYRA 1COV1 3DXUA 4BISA 1H2LA 2NMOA 4HKWA 3T0BA 1IHMA 2BWCA 2AR6A 1PGSA 3E5UA 3JZVA 2FQPA 2YY1A 4KQ7A 3VBHA 4ASLA 1UX6A 1W6QA 4I09A 3RJRA 5BNPB 5CEHA 2YXSA 2JJ6A 5KXBA 5F3GA 4M4RA 4N7IA 3AL5A 3WDYA 4BJ0A 2YMZA 5FPZA 4AI3A 5KBFA 1KDKA 3AMQA 3U07A 5IAXA 2W52A 4IUGA 3VZNA 3WCSA 5FOJB 1IPJA 1I5ZA 3ENRA 3VBUC 5FXWA 4Z2WA 1XYOA 2PQQA 2XMLA 1ZBE1 3K75B 4AG4A 4JX0A 3AVSA 2NZ9A 1J3RA 5CB7A 3T2OA 1WKYA 2WNOA 1NY71 1MVQA 3BOWA 4WM8A 4Y1VA 2UYBA 3H1WA 4Y3OA 1VAMA 2A5ZA 3CO2A 4WM7B 5AC93 5FLJA 3QH6A 4NIHA 1SEFA 2QVSB 2HWB1 2X05A 1MQTA 4OVEA 2Y6HA 2ZGSA 4YGBA 5CBLA 4W6YA 3RZLA 2VO5A 3V0AA 3ZXDA 1CD3G 5JR7B 4AXOA 5J1XA 3PUSA 1VRBA 1COV3 2C26A 2W1UA 3WW3A 2AZ5A 2OS2A 1DQ5A 3DGTA 1RUE1 2ET1A 3NJXA 4QQ2A 3ZOIA 2P3JA 3HNYM 2CAUA 4AVAA 4BQ3A 1H4HA 3ACGA 4BB3A 3T1LA 1MPXA 1LOCA 2JWPA 3POFA 2YG0A 5EZWA 3RZKA 2RHPA 4IEPA 5A6ZA 2A75A 3PURA 5C3SA 1VBB2 1UOFA 4HMZA 4RSUA 3VBOA 2WNVC 4YZ3A 5DDJ2 4CDXB 4Y4YA 1OLQA 3BOPA 1D4VB 1LESA 3O1UA 3ACHA 5FWJA 2VZPA 4YGCA 1XSRA 4QHBA 4Y22A 4NRPA 4MXWA 2G9ZA 2GC1A 1R082 4MGYE 3H42B 5F7UA 3ZIXA 3HWJA 4BQXA 2DVAA 5DUVA 3W9AA 5GZFA 3SH5A 2VOVA 1WCUA 1TMF1 3IDEA 2DUOA 1F2NA 2JIGA 3ATGA 1IZ3A 4RGAA 1HRV2 2GMMA 1S0IA 2R7EB 1KD7A 2HYXA 2WO1A 1QDCA 2VL4A 3HMYA 4M4PA 5T55A 1GU3A 3AYCA 3NKGA 3O0WA 4Q2FA 2PHXA 2ZKLA 3I2OA 4BU2A 2G1MA 1V6IA 2YBPA 5FK8A 1PO12 2XL7A 4OHXA 3MDPA 3ACLA 2WYFA 4BA6A 2WINB 1HX6A 1KITA 5A32A 2XBO2 5L73A 1RUE3 3BB6A 4OULA 1G9FA 4X6RB 4AI9A 4CA9A 2UYAA 1W0PA 4KBBA 4IETA 1O4ZA 4CCEA 1FOD1 1UZWA 1DHKB 4ATEA 4AR2A 4LBQB 3A4UA 1AX2A 4KG8A 4RL7A 1HN1A 2QBXA 3WF4A 2BFUS 4INDA 2XG3A 2XGXA 1WCSA 1KEXA 1XPWA 1F35A 1WW6A 4P9IA 1OFNA 3ECQA 4RQPC 1W2TA 3HOBA 4EWEA 4B4QA 2A6ZA 3LOIA 1CN1A 1OPOA 4YM1A 3PVBB 3T1MA 2WJSA 3ZDVA 4AEJA 4L99A 1HB3A 2X5IA 2IXIA 1TMF3 2RE9A 1W05A 1K45A 1W99A 4A44A 1G8WA 4RS5C 2D6MA 5A3WA 4I30A 3LOBA 3GYDA 1HB1A 4XXPA 1AR62 1ZBA2 3UGFA 4FOVA 2BFUL 5AC92 4DUWA 4ZXEA 3M3OA 4UF0B 1POQA 2BQPA 4JDNA 1QHDA 2ARBA 3UKNA 1VBA2 3WQ1A 3OD0A 4BIFA 4CYDA 1D0GA 2W1SA 4XBLA 1GKBA 1ODMA 1I5PA 2ADEA 2D3SA 2XWBB 4P5YA 3SEEA 4CU7A 2R1DA 3WHTA 5KHIA 4H3WA 1OA3A 3WVJA 3VBFC 4CUGA 1Q8OA 1FOD3 3VDDC 1XU2A 2VM9A 2DUPA 2YU1A 4C90A 4GXLA 2ZPXA 3ILNA 1KDMA 3O1RA 2QFEA 3HJRA 4XPVA 3LCPA 2JICA 3S5AA 5DZGA 5L9BA 5FO8B 2GALA 1NA1A 2MEV1 1ZYBA 2GP3A 3W59A 5C9AC 4O7XA 5LK5A 1Q8SA 4QKBA 1S0GA 1IS3A 2R0HA 1W6OA 4LORA 4D94A 5C4WB 3HN1A 2WL1A 1JZ6A 2WA4A 1EP0A 1TME2 2YFZA 5CYYA 2QDRA 4P5HA 4JGYC 4UFIA 4H14A 4XFHA 4PQQA 3AZWA 4AOCA 1GWMA 3LAGA 4QDRA 4RD7A 3SCGA 2ERFA 2HWB2 3KVBA 2ZTNA 2Z4FA 3KT7A 1SG3A 2LUWA 3T2QA 2VQ0A 3NW4A 1HXS1 1SPPB 2E53A 3OUIA 4DNYA 1DZRA 2DTWA 4PF5A 5D1IA 5F3CA 3AZZA 1SDDB 2R30A 3K77A 4IEZA 4LBOA 1W2OA 5EV7A 1F5JA 1S0JA 2NYYA 2VZRA 5FKCA 5I0SA 2VOKA 1RUH2 1CZTA 1W8NA 4K8RB 4UFMA 3WG2A 4RFRB 3KHCA 1UY2A 1UY3A 3NAPA 4P00B 4XJ9A 4BQWA 4YSFA 3SLIA 3UGGA 4Y4RA 4N53B 1UL9A 5EJ1B 1Q3EA 4WZFA 4AHYA 5GZCA 1SQ4A 1PK6B 3NWKA 1CAWA 1REFA 2HYKA 1DYPA 4XIKA 3OYWA 1LHWA 1ND2C 4FVVA 4LHSA 4ET7A 2PFWA 3WP5A 3JD73 1VBC3 3J8F1 5CFDC 1HQWA 2ATFA 2DV9A 3AKQA 1A6CA 5FYYA 1EUUA 5FY4A 5JI7A 2OVUA 3OGSA 3QH7A 1DQ4A 1O4YA 4IGOA 3KB5A 5B4XA 2VMCA 5EPAA 3VHNA 2ZGKA 1BK0A 2BJSA 4AHXA 1BEV2 2JECA 4CCCA 4HZFA 3FLTA 2RS11 1PZ8A 1QJX3 2YYOA 5FREA 1ACCA 2R062 1YXWA 4QX8A 1DQ6A 4FPLA 1OA4A 2P2KA 3IT8A 1K5MB 1XNBA 4UFHA 1CPNA 5GZGA 3IWZA 2ZA9A 3LIGA 3D0JA 1VB4A 2VCCA 2ZZJA 5EHDA 5FZOB 3RZJA 2JG9A 1H1AA 1PHMA 4AEDC 3WF0A 1UMZA 4AI8A 4LA3A 2E6VA 5GKAC 5JSRA 1JTZX 3ZYIB 4Q8LA 2RS51 4RN5A 2GZWA 3JU9A 1GSLA 1V6NA 5F5IA 1AR81 5FP8A 1W8OA 1HRI2 3ZKUA 2XKOA 2JB4A 5EJZB 1GZWB 1H2NA 4XUPA 5C8CB 1RVF1 3PNAA 4IE7A 3HT1A 3S6PA 1JN2P 1LTEA 2W87A 4RFT0 2OZJA 2EALA 3VB9A 4V2WA 3OY8B 3KV6A 2V73A 2XVGA 1G9DA 1YQ8A 1PIV1 3LE0A 1F31A 4JC1A 5AVAA 2H0VA 1G6NA 3H7YA 2A3YA 2EXIA 3LKJA 4PIZA 4AWDA 1HB4A 2HWF2 2RS13 3FL7A 5FO9B 1NCRC 1R092 3CMGA 2GC0A 3L2YA 4PLNA 5FUPA 1XNCA 3ASIA 4R52A 3WHUA 1UU6A 4X8NA 5FMBA 3RZMA 4LO7A 5FP3A 1P8JA 2P1BA 1RUG2 1B35C 2I45A 4GH4A 1ENXA 4OI4A 3PTRB 2CDOA 4P08A 2QQUA 3VZMA 1LGCA 4W8JA 2LTNA 5DMYA 2UWBA 4UBHA 5FFOC 2QJVA 2VR4A 2QQOA 4XQWA 3FLRA 3W21A 4Y5Z0 2ZGPA 5FZGA 4FFIA 5FZDA 2RS53 4CXXA 1FATA 5BNPC 1UXXX 1YO8A 2DCKA 3OBZA 1UAIA 5CFCB 3LFMA 1G86A 5M0TA 2BPA2 2A73B 4RYDA 3PIJA 3VBRA 1VIWB 2XHNA 4AFDA 2DFCA 5D2AA 1UMHA 4TZDA 4J6GA 2EVXA 2FMYA 2VZOA 1JYIA 5DZFA 4Q0PA 4GKXA 1WMDA 2ZEWA 2BWAA 4Z2AA 2YBKA 1HDKA 4FOQA 5DAPA 4Q1PA 1NLQA 5T54A 5DABA 5EP9A 1GP5A 2QQIA 2ES3A 5FY7A 2QQPA 1LOGA 1I6XA 2BVVA 4MGSA 3UT0A 3AZXA 1YNAA 1AX1A 1VALA 3VBSB 4FBFA 4PI0A 5HV0A 1W90A 4WM7C 1REEA 1LENA 1Z7S2 2JKXA 3M70A 5GJ6A 3AXEA 5JIUA 1VBE2 3DYPA 4XF0A 2K9ZA 5FZEA 4P9XA 2IVIB 2DVBA 4M3CF 5JSPA 1LJ7A 1OKQA 2VQAA 2VVFA 2QQMA 3ZLIA 1Y9QA 3ITQA 4NPRA 3VBUB 3VGIA 1ZZ7A 2D93A 2NN8A 2VW2A 2YU2A 1YQ2A 3OF1A 3RI8A 3SCHA 5AVPA 3RJ2X 3U37A 2E26A 4P9JA 5FZKA 5JZGA 3BTZA 4XOGA 3CJIC 3MI8A 1N1TA 4XF4A 3USSA 4AFCA 1RINA 1S2BA 3B7MA 4AQTA 4JQTA 4W50A 1NLSA 2J1TA 3H3ZA 1VRH3 1UIJA 2VNRA 2Y0IA 3DUIA 3H9AA 3R4UA 4B4RA 5FYMA 5EFUA 1W6PB 2DBNA 2FDJA 1YRZA 4YVWB 3T3YA 1EPWA 1AR71 5GZEA 4CDXC 4QGNA 4QGLA 4CDWA 1NX9A 3S7EA 1AZDA 1SLTA 1RUI2 4Y1XA 2O8QA 3OCPA 4YG6A 4NIIA 1X50A 2PLV1 1MVEA 4PIXA 3ON7A 1MS3A 4GMP0 3W58A 2A6XA 3VHPA 4LK6A 1U5IA 5JOWA 4BQ1A 2TBVA 3BTYA 3K3OA 2W47A 5CG9A 1EAH1 4PDWC 2Y38A 3WP6A 2WNVB 5BNOA 3POJA 3E6CC 3GZTB 5E8AA 4J25A 4YGEA 3U1XA 5FYIA 3U78A 1UY0A 1WCKA 2D5FA 2E31A 2KD7A 4QT6A 4XQ4A 4W6XA 3H8OA 3CZJA 1XYNA 4DPNA 1XNKA 5FY9A 1OLRA 1GANA 1OQDA 2J1UA 3N9MA 3VKOA 4F8AA 1C4RA 2WZPP 2JE9A 4LLOA 1DGLA 3WW4A 3JUUA 3VL9A 5FZBA 2YROA 3SKJE 4RR3A 3KLSA 2EIEA 3X29B 3WF2A 3C8XA 1RUOA 3OEBA 3KF3A 1W2AX 4XFFA 4G4FA 2WA3A 4GB32 4QB1A 2E7AA 4YM2A 4YW6A 5F6KA 1H0BA 1ZX5A 4YWAA 4A6OA 1RUJ2 3C2UA 5DN2A 1W8TA 4FP2A 2BP6A 3LEIA 4KWJA 4EE2A 1ASJ1 2WAAA 2PLV3 4FSJA 1J3QA 4LR4A 1DLCA 2E51A 1A8MA 2VD7A 1YC61 3LQCA 3NSTA 1MQTB 2PAKA 3R6SA 1J1LA 1D4M2 4I2OA 2P4EA 1PMIA 2WDBA 4LNVA 5JUVA 4DIQA 1E5RA 1W06A 3ZFFC 3V0BA 3JBG1 5KWRA 4MADA 2ZX4A 3CL1A 1GP4A 5GZDA 1ZRIA 2F6BA 2GDFA 1G9BA 1XOYA 2GNDA 2RDSA 4NVPA 4QX7A 1LULA 2DURA 2FDKA 4BPZA 3W5NA 4XEZA 5F2WA 5LA1A 5A3MA 2V4AA 2ZMNA 2A70A 5FJKA 4ASMB 1PO23 5LCWL 4KGGA 5TSWA 1KJLA 2MPFA 2VUJA 2VPVA 5KC6A 4CCLA 1SLAA 4R9CA 2WLQA 4LBLA 5FTTC 3MICA 1ENSA 1V70A 5HI0A 4OQ8A 3ME2A 2L9LA 2RJKA 1I9RA 1SBDA 4XUTA 4Y22B 4BMEA 2BGCA 4E4DX 1EV12 3KGZA 4IGPA 5LB6A 5FZLA 1RMU2 2X53S 1BKZA 4FPHA 3LPGA 4Y1ZA 3OSDA 4HN1A 3SHRA 2XQXA 2WUHA 5B4NA 1ASJ3 4EN0A 4K20A 2E9QA 5C4WC 4JZRA 2ZJCA 4NIDA 3ILRA 4CEWA 3A23A 1JYVA 3PU3A 3OEAA 4GZ9A 4LE3A 4C0HA 1ZRRA 1B09A 4AF9A 1YJLA 4LK7A 1R1A1 4JRLA 2Y64A 4P9YA 3P3NA 4PF1A 1T6GC 3JBG3 3AVRA 3KSCA 3UYJA 5A32B 1GNYA 5EIYB 3MIEA 5FZHA 1WA6X 3URFA 2FDFA 1NQJA 3N9PA 5L7OA 1OVPA 4IL7A 5CKMA 1HQNA 4LMFA 1BVP1 4GA9A 1BLZA 4G3YC 3O7OA 2VG9A 4M3CA 4JHZA 3WR0A 1QKQA 2X10A 3BPSA 5ANQA 4AZZA 1QXRA 2JG8A 2WIIB 4MZUA 4EYUA 2Q1FA 1W8UA 4LHKA 2YHJA 5IATA 3B02A 1REDA 1UOGA 2DU0A 2SBAA 4HONA 2WQ4A 2VH9A 5KXDA 3OD4A 4AGVA 3WUDA 1S0BA 4HK9A 1PK6C 2DWRA 2VXJA 5JXJA 1ULEA 1AR72 2BERA 2ZGRA 2B4KA 2R49A 2LRPA 2ZZQA 4M00A 4ZU5A 3T0AA 2WABA 2DCJA 4EZHA 4BK5A 3O1MA 4FQZA 1NCQC 1S4CA 3ACFA 1DP0A 2J1RA 1RUC2 5FZ4A 3AK0A 5C5TA 4EWAA 3DKWA 5FZIA 4O61A 4DB5A 1OD5A 1W6MA 3D5OA 5LA9A 1ZREA 4P9GA 3M1HA 3MLJA 5K9YA 1BMV2 5E6HA 1J83A 5HCFA 3R4DB 1M4WA 4ORFA 3K4DA 3UV9A 1VBB1 4XIOA 3RZZA 3MV11 3WDXA 1ND2B 4LO5B 3ZFEC 1V6LA 3FHIB 2ARCA 1IG0A 3THDA 5CFDB 1RITA 4CZSA 1GOGA 2RDRA 2MNGA 2YV8A 2UU8A 3HNBM 5A80A 1S0CA 1MR5A 1R081 5AFEA 4QXHA 1GBGA 1AYN3 1W2NA 4EN7B 1YWKA 3PDQA 3OBRA 4XMAA 1AF9A 3KD4A 3ROUA 4BZ4A 5A3NA 2JDAA 4Y5TA 2QQKA 3AX4A 1NT0A 3D0SA 4OLLA 2ZOEB 4JGZA 2HWD2 1HRV1 5IK7A 3CZUA 2WNUA 3ZN5A 4A7ZA 1Y7BA 4CU8A 1C57A 2R072 3VKLA 3E6BA 4J1XA 3ZN6A 1OH4A 3AM2A 3J4UH 3CU7A 3J7MA 2RM22 3MLKA 5C8CC 3PU8A 1CAUA 1PO11 2CYFA 4YW5A 1UKRA 1RJ8A 4IEXA 4NRQA 4XETA 1ZZBA 3FWEA 3MYXA 2XBO1 4OUSA 4UFKA 1WBLA 4YW4A 1ZZ9A 5FMOL 5JMOA 1XBFA 5FJHA 5BXXA 4HVOA 1W3XA 4Y26A 4AEDB 5GLZA 3W20A 3AKRA 5IFPA 5LBFA 1OMIA 3GXUA 1IOAA 1FT9A 3N7JA 1QMJA 3RFRA 2XUMA 4H7LA 4N43A 4QX2A 1ULGA 2VZVA 2WZR3 1KJRA 4OI2A 3MUZ1 1H9PA 1QY4A 1VBB3 5LZ6A 3SKVA 1O91A 1UZVA 2VC9A 4Q4W3 5DDJ3 2EXKA 3BN6A 4Y1UA 5HXVA 2W08A 5JIAA 3VDAA 3MV01 2B9UA 1MS1A 3NAPB 4TLFA 4GULA 2W1WA 1D7PM 3MIGA 1OA2A 3WD5A 3GM8A 3T09A 5BUVA 4QB6A 4PBOA 3RGBA 3MW3A 1PZ7A 1Q5OA 3PUHA 1VPHA 1JYTA 1XNAA 1R1ZA 3QACA 5A3LA 3IBMA 1SFPA 4P9WA 4WBBA 3WQ0A 4GMP1 3H1MA 3WNMA 1CAWB 1JOBA 1U12A 3EYPA 1QJZA 1W6NA 1QJU3 3HPNA 1F8VA 5K0UA 4CP1A 5FXZA 1HRV3 1NCRB 2CWMA 2GC3A 1C5IA 4O9EA 3DYMA 3WW1A 4E2GA 1OQ1A 3I3MA 1AR61 1K12A 2WBKA 1ZBA1 5FR3A 3CLPA 4GALA 3H1YA 1D2QA 3VD9A 4FTBA 1B35B 1CWPA 3BIEA 1S0FA 1Q8PA 5L19A 2W94A 2WFF2 1DF0A 1PO13 2YPJA 3RYKA 5JOXA 1VBA1 4K8FA 4A7YA 4DINB 1S2KA 4E4SA 2XBO3 3N4MA 2RMU2 2ARAA 3ES4A 1OPMA 1V9U2 3I8TA 4IEYA 5A3UA 4R4ZA 4A4AA 2CGNA 3IN9A 3AJZA 2WZ8A 4Q0SA 4CEYA 4CP2A 1ZZ6A 2RDNA 3PIGA 4QXCA 5FRAA 3TOJA 3WG3A 1O5LA 1QJEA 1R1A2 4ZY9A 2DYCA 2V72A 3CEWA 4IGQA 1DQ0A 3PVOA 3C7FA 3CBNA 5KXEA 1FNYA 3VBSC 1J58A 2PQSA 4AGRA 2TNFA 4LUKA 4TYSA 2VZ3A 3BTXA 1FPN2 1W0NA 4YVSA 1ALYA 1X36A 3UKTA 2A7AA 3QLQA 4JKKA 1AYM2 1WLWA 4AI0A 1XC6A 4BLIA 4EN9B 2FD8A 1NYWA 2GN7A 4RGGA 4BXFA 4FP3A 3VKFC 2DU1A 1YFWA 2R6QA 5FYZA 1TME1 1WZXA 4CU9A 4CCJA 3IDBB 2QDNA 4GMP3 4XZUG 4XFGA 1RUF2 1LEMA 2ZGLA 4CU6A 1I1EA 1UW8A 3P1IA 4B1LA 4CSWA 2J7MA 1AR63 3KS7A 2RS31 3RI9A 2A3WA 2OZ6A 4IV1C 5LK7B 1DGRN 5DUXA 2VMHA 1FXZA 1VBA3 3M3EA 2B8MA 4YVWC 1V00A 5DAVA 5DQ0A 5LBCA 5C3RA 3R05A 3NKTA 1OLMA 2EXJA 2W0XA 1SLCA 1KFUL 4D7TA 1SCSA 4PT6A 4D6QA 5A1FA 2RJ2A 1RUH1 1W8WA 3CJIB 5J09A 4NE9A 1FYUA 1S0DA 3PTYA 3VD4A 3BALA 3KV4A 1TNRA 1YQ5A 4GH4B 5GALA 4A6SA 4YNIA 4XBNA 5E89A 4XYXA 4MGKE 2A6VA 2VXRA 5IVCA 1UU4A 4R9AA 3B01A 1TE1B 2DFBA 2ET7A 4XDQA 1UIKA 2WZEA 2VTXJ 1V0AA 3WZ1A 3SC7X 3VBHC 4YFWA 3U75A 3VDCA 3PUAA 1TME3 2Q8CA 1ZBE3 3KQ4B 4NJ4A 2WQ8A 5EYXA 4E8CA 3PVNA 4AW7A 2J22A 5A3PA 5BYNA 3VKNA 4OMCA 2Q8EA 3WY6A 4LE4A 3I2FA 3VBRB 1OURA 4HT1T 5HBAA 5IFTA 4BYYA 1BEV1 1MZFA 2BDRA 5DUUA 1AXYA 1C8NA 4E27A 4PDWB 1BZWA 2HWB3 3NNFA 1H4GA 3BYWA 4Z07A 1W9TA 1HJGA 2PHFA 3FHQA 3ZXAC 2R061 4AVBA 5FPUA 1A8DA 2OKXA 4CCDA 3M3QA 1OOPA 4Q4X2 1BYHA 1X33A 2SLIA 4QPYA 1LOFA 2EIGA 4CE8A 5IVYA 1RUH3 2GNBA 3ZSJA 1L7LA 2WN2A 5I8YA 1FNZA 1IS6A 3IB3A 2Y8KA 5FYUA 1MQTC 5FCCA 5T5LA 4YARA 5A1LA 1QDOA 1IKQA 1D0HA 1ZA4A 1ND3A 1YEWA 4FPFA 3HD8B 3IM0A 1N3QA 1ZVFA 1HRI1 4XCAA 3E1F1 3VDDA 4D0QA 5H9RA 1BBT1 5KHKA 4DXRA 2QZ3A 3LDRA 1LHVA 2D6NA 2IXJA 1H8VA 5JZGB 3UESA 4XF9A 3TEXA 1QEXA 4P14A 2QQNA 2D6KA 3MFAA 1QF3A 2B5HA 1O5UA 4YW3A 3RPQA 2A6YA 2ZMKA 4Q0UA 2ZS6B 1BEV3 5FYCA 5ABJB 3ZFFB 2ZAAA 2XJVA 3NRUA 1JMUB 5GLUA 2HWF1 4NAMA 4CDWB 5K7PA 3I2GA 1LEDA 1R091 4NPMA 4OHYA 2PHWA 3GBGA 5IYYA 1WGPA 4XFCA 1GQGA 2ZCWA 5IJRA 1RUG1 3QD6A 3A0NA 5KC5A 3B93A 4FQ4A 3WDUA 4B8EA 1IG3A 1ZZCA 5FPAA 2FBEA 1HQLA 5EJ3A 2NLRA 3KGLA 3RSJA 2TEPA 4HSJA 2LROA 5EWSA 2C0ZA 3UJOA 3AYEA 1MZ6A 2WO3A 2EIDA 1N1SA 1U5ZA 2JDHA 1C1LA 2XVKA 2F4PA 1ZM1A 5F32A 1OXCA 3AFKA 4K1YA 3GBWA 4IESA 1RGSA 1EUTA 4KG0A 3WF3A 1GUIA 1HRI3 1AJKA 3MZHA 1G7YA 4MYEA 1CJDA 5FMDA 1Q8VA 3RVHA 1UZ0A 5A33B 5C33A 4XMIA 4GWJA 5FP9A 1ZA7A 1UYPA 5F5QA 4Z1VA 2V5YA 3WNKA 1XB9A 4B4PA 4HK8A 4KNCA 4MLOA 2W95A 2BNOA 2XLAA 1H8TA 3D3AA 3LPFA 5F3EA 3S7IA 2HEVF 3UGHA 4MXVA 1IQAA 2ORZA 2VOXA 4RR3B 4EQVA 3VZJA 5A70A 1LECA 3UL2A 2JD9A 2Y6GA 2C4XA 4CDQA 1PGL2 3K48A 1H30A 1OUXA 1UY1A 3AKSA 4QPIB 1Z0HA 2UY9A 4U2AA 2YBSA 2RS32 2D6OX 1Z7S1 3LIHA 2FCUA 1LU1A 2YC2A 4BQ2A 1VBE1 5J37A 3BUCA 5JVVA 1W2UA 4F7ZA 1H2KA 2X5IC 3J7HA 3LZZA 2BBVA 3I59B 4IERA 2H6BA 4L92A 5CIRA 3ZYFA 2YDEA 1XXNA 2Z69A 3T08A 4AYUA 1DBNA 2HBTA 5LY1A 3RZHA 2WWUA 4ONUA 2VQUA 4AEMA 2FDGA 2FZ2A 1KGYA 4K6BA 1FX5A 3POYA 2NPIA 4ATFA 4Y20A 4CCMA 1W04A 1AX0A 2CV6A 2DF7A 3C3VA 1E5IA 4MHRA 4QAWA 5C3PA 1WD3A 3BU7A 2MEV3 4A41A 2OT7A 2K46A 4W6WA 4NOTA 3FN9A 1GQPA 2W39A 4FPEA 5D8AA 1F15A 1IS5A 3S5QA 1NCQB 4MGQA 1DQ1A 1RUI1 2XONA 1QOTA 3M4FA 4FPGA 2XL9A 1GLHA 4XJZA 1POV1 4BCUA 5F37A 1WUVA 5C71A 4LOTA 5H9PA 4JDMA 1BK1A 5JXHA 1C5HA 1JYWA 4YZ2A 3BCWA 1RYYA 2WS92 4KWUA 4X8PA 4A2UA 3K2OA 1XE0A 1Z7S3 1VBE3 2DBIA 3LSDA 1Y9GA 4QKFA 5CISA 4CEWB 3DCQA 1HXS3 2AGSA 4WVVA 3ZFEB 1LOEA 3QOPA 4N9HA 4BOWA 3UK9A 3THCA 5LW9A 4PI2A 2PELA 3I2KA 4AVTA 4GQ7A 4E2SA 2BGPA 4QDSA 1K3IA 3WLUA 2ADDA 2EF6A 3MW2A 3ELNA 5L7OB 2PA7A 1DZTA 2E32A 4DEVA 3H8XA 5FZ9A 3ZFGA 2D3RA 3WOGA 1O6UA 4M3CB 1AR91 1BBT2 3TNPB 1UY4A 3WXPA 4XAEA 3CNAA 4WVWA 3HN3A 3EB7A 2BNNA 4XBQA 2R042 4D6SA 4GB31 1SDWA 1WA4A 2BW8A 2J1AA 4IEVA 5BNPA 2JG8B 3DKQA 4FT8A 3J8F3 3NAPC 1RUI3 1RUJ1 1S0EA 3ZYJB 4A3ZA 1WLDA 2VZTA 4HL0A 3WNNA 1JW6A 2VTXA 4LUMA 4UFLA 3CIHA 4NMIA 1CVNA 1D4M1 2XUEA 2W9XA 2YZ4A 5J36A 3MW4A 1O4TA 1JUIA 4NRMA 4LBKA 4UW3A 1N47A 4A45A 5JMCA 1J3PA 4NROA 1H6YA 2WT2A 3FLPA 3JXSA 2O1QA 3S30A 2GC2A 2VMFA 4QGMA 1HKDA 4M01A 2GU9A 3PLQA 1GZCA 3PHMA 3O1VA 1DDLA 4BQYA 1OD3A 5FPLA 3RNSA 3KCYA 2N7GA 2GP5A 3O14A 5LBEA 5CKNA 1A3KA 3POIA 2ETEA 4LOSA 1A78A 1GWLA 5APAA 1Q43A 1V6JA 4V1PA 1X8MA 5E16A 4FTSA 4Z8BA 3J7NA 4AI2A 1AR83 4DUVA 1L7QA 3QBQA 5CNAA 1LHNA 3WUCA 4DZGA 1GFF2 4E4ZA 2QUOA 3K3NA 5ISLA 1RVF3 2XJTA 4GB33 1EV11 4XF3A 4ISRA 1RMU1 4NHKA 2DVGA 3DXTA 2ZGNA 1RUJ3 3ZYRA 4YPJA 1UZYA 3I3BA 1UWWA 4NWVA 4UFJA 3RG0A 3P3PA 2VOWA 2ZX1A 3BKZA 1PIV3 2WNUB 3FC0A 3C7OA 2W5FA 4COYA 3BVCA 3B9IA 3OGVA 2VNGA 5FZMA 4C1XA 3A21A 3HNMA 3ZN6B 4Q27A 4FFGA 3ZPYA 3E6DA 1JODA 4KBZA 4HFSA 4DFSA 4R8HA 3WINE 3H0OA 4FPYA 5IHRA 3OPTA 4K21A 2VY0A 2P6CA 3ZKYA 5KR7A 2PHRA 3S57A 3APBA 1ENQA 5AFBA 3ZYBA 1QQP2 5T5JA 4R9BA 4AHWA 4NIGA 3JD72 3NO8A 4N43B 2DCTA 5JR2A 2JDUA 3MIBA 1WCQA 4XXAA 3WV6A 3AC0A 4MUVA 4MH0E 1MACA 4D7YA 1PVC2 4QMAA 4IV3A 3SMHA 3ST7A 1LGBA 2JDPA 1O8SA 1LOBA 2RVAA 5A7SA 2BVBA 3ETPA 3GJAA 4GH4C 3ZYPA 4D3WA 1SLIA 2Q4SA 4KGQA 5K8SA 1LU2A 3DV8A 3N9NA 2TUNA 4IV1B 1QJX2 2A3XA 2HWC2 1EV13 2VMIA 1RMU3 4K3UA 3NL1A 5C7GA 4ES8A 1ZRCA 3ILFA 3PMSA 4M0HA 1HV0A 4QM9A 4LBQA 2XLGA 4FPCA 5SV5A 3N9LA 5IK5A 4BE3A 5K0UB 1QIQA 2Q1MA 3ZMNA 2CY6A 1RUC1 5DAQA 5BNQA 3IZOA 1UYYA 1OFSA 5IVEA 4UW5A 1OHFA 2K2SA 3M7AA 1NXMA 4IEOA 5FUIA 1JZ4A 1RIRA 2R1BA 3VBRC 1BMV1 4B3NA 3ZVXA 3AMPA 2UWAA 1O3SA 3BTAA 2FHRA 3MEPA 4XF1A 5A3TA 4ZPIA 3I3DA 3RWKX 2CHHA 3VBHB 1TVGA 1VMHA 1AL22 3Q8AA 2ZHKA 1FV3A 1W39A 1W6QB 4QHZA 4DXSA 4YRDA 4MSVA 3J9SA 3P6BA 1UD1A 4PLOA 5FPVA 1LAJA 1LODA 2ZKNA 3Q8EA 4LO8A 2VUAA 3GDBA 1HIXA 3DPRA 4FXKB 4AVCA 2D97A 4CDUA 2V5DA 4FPKA 3ZDSA 4FI9A 3IPVA 2HWD1 4QX5A 4DXZA 2VE1A 4BH9A 1ST8A 3WNPA 1AR92 5SV8A 1QNYA 4HOOA 1AXZA 4TXWA 2DUQA 2R071 1SLBA 4IEUA 4Y5SA 3MIFA 3NNJA 3OUHA 1AR73 2JB8A 5F6LB 5FZ6A 1A34A 2RM21 5LBBA 1OH3A 2AEYA 4ZU7A 5JZGC 1ZNPA 5DUWA 1ENRA 2PYTA 3L2HA 3LFIA 2PHDA 2IXHA 3LEKA 4Q4V2 2W91A 4GWIA 2VW0A 4WM8B 3TBDA 3D82A 2RDQA 4AE2A 4GWNA 4BXSV 1PMJX 2XR4A 2ILMA 4ZZ8A 3AJYA 2IFRA 3NJVA 3THTA 5BY5A 1QOOA 1OI6A 4BLJA 2VVEA 1EYBA 3V0AB 2ZEYA 3AXDA 5ABJC 4Q1RA 1IGOA 1EAH3 3HBZA 4CDWC 4HXCA 3VHRA 2HWE1 3HBKA 5GM0A 4QKDA 1J1TA 3ZMOA 3T4HB 1DCSA 4B1MA 3GGLA 2WSVA 3B3QE 4CUBA 3NMBA 2CWSA 1WW5A 1KFXL 2ARXA 4XUNA 4YFZA 3KZ4C 2QQWA 4MVTA 4IEWA 4I02A 4EWDA 1LOAA 2D7FA 3IAPA 3VBOB 4UXAA 1X8EA 3FZ3A 3ZIWA 1ULFA 5GLTA 3ZXFA 2RJLA 2V09A 3TNQA 2WSUA 5JPMB 1HB2A 3BODA 3AP4A 1U0AA 4YM3A 2GAUA 2R073 2PHLA 4MXWB 2JIJA 4EROA 4FFHA 3AMMA 4XCBA 2WFF1 4N53A 1JH5A 3PVEA 2RMU1 4NHLA 4IW3A 1V9U1 1AXKA 2YUEA 4QHOA 5A7WA 1R64A 3WDWA 4RR3C 4NHMA 2J1EA 4LBNA 3GZUC 5L9VA 1STMA 1AL0G 2A6WA 2OUHA 3DECA 4RGKA 5CAZA 4M0NA 1MEC1 5FZ8A 3Q8FA 1E5SA 1UPIA 4L9BA 1JYCA 1OOPB 5FY8A 4B7EA 1VRH2 4QPIC 2ZHLA 1FPN1 1JHNA 1CJPA 2QQLA 5LRRA 1C8M2 3ORJA 1AYM1 2XWJB 3D8CA 3MIDA 3JQXA 3GZEA 4S2HA 4Q0VA 4DRRA 1WW4A 5T50A 1QGLA 1X82A 4S2GA 4YW2A 1DGRA 4QD2A 1SACA 1JYXA 4E9KA 1RUF1 5LA2A 4CUCA 1K5MA 4GAZA 1HW5A 3U10A 1BJQA 5F5AA 3T2TA 5J48A 2JKBA 1V6KA 4Q29A 4YZ4A 3LSEA 5FBZA 2WO2A 2AENA 4PCRA 2W68A 4I3PA 3ZSEA 3O1SA 4LIVA 1SLLA 2WFF3 2X5IB 3EBRA 1LGNA 1FV2A 2WYSA 1UYXA 4FAHA 2OPKA 1VBD2 5JPNB 1V9U3 1X7NA 3I2HA 1GZWA 2PTMA 3E5QA 4QB2A 5EQUA 3ZO0B 3K46A 4HPKA 2AYHA 2FMDA 2ZGQA 3OOXA 4ZONA 3KT1A 2FZ1A 5IWFA 3G6JB 3LEGA 4QPGA 2VOTA 1R1A3 4TLGA 1YFXA 3EHKA 2VBBA 4XFAA 3OY8A 3I49A 2OIIA 1CQ9A 4XW3A 3LWCA 3LA7A 3NNMA 1LB2A 1CAXA 4XE9A 1FPN3 4OHZA 4COWA 1YIFA 1BCXA 1Y3TA 3FMGA 2GN3A 2ZGOA 4CEWC 2JX9A 3I97A 3IKWA 2UWCA 1GZTA 2DVFA 2P3YA 1F9KA 2W1QA 2WT1A 4IDZA 5FUNA 5BV6A 1F4HA 2ID4A 5FMOS 5FMCA 5IUQA 1GOFA 5IVJA 4E4HA 1O8PA 2B9VA 1RUF3 4Q0QA 1NA1B 1WMXA 2BU9A 3WP4A 2ORXA 1EY2A 3ZXEA 3N7LA 5D21A 2UY8A 3IDCB 4KU8A 4Z92B 1RHI2 5E88A 5F1RA 4P02B 5BNNA 5L7OC 5F2SA 1QWRA 2QNKA 1YYNA 1W6OB 1H8TB 4B7KA 3RYPA 3NV1A 1UZZA 1US3A 2P17A 2WFPA 4JRAA 2JG8C 3AFGA 4BQ5A 3USUA 4RA0A 4URTA
chains in the Genus database with same CATH topology
4Q4Y2 4Y24A 1DGWX 1Q56A 2ZABA 3MF9A 4Q4X1 4YW1A 5CFCA 3V65A 3FJSA 2HEYF 2XKPA 5FAXA 4LA2A 1RUNA 1RUD2 3M3IA 4AFAA 4WVMA 1CAVA 1TNFA 1GV9A 2OW4A 3O12A 4NO4A 2JENA 1XU1A 3PMEA 4F3JA 4OI0A 2HWE2 1NE4A 3WQ7A 3H3UA 4QQPA 4UW6A 4OZXA 2GH2A 5CADA 5FDBA 2IXKA 1F5FA 1R083 4XHXA 2D6LX 3I4IA 2ZHNA 5J7MA 2O0OA 1ZRDA 2JDZA 2VGDA 4UBGA 3VBUA 3OYWB 2Q30A 3H8UA 1MS4A 1H2MA 2RR12 4HETA 5LRSA 4C1WA 1W0OA 3THPA 1VAKA 1JBCA 2IC1A 3OBTA 1XRUA 2CGPA 3OJBA 4Q4X3 1H9WA 1FMD2 1OQEA 2XVLA 5FPXA 4JGZC 1POV0 4R9DA 2WNUC 4FPOB 5CG8A 3WG1A 4COZA 1KS5A 1MEC2 1XE8A 2OUJA 1QXPA 3B5LB 1JUHA 1V6MA 2NMNA 4JTOA 4CTEA 4YM0A 3N35A 4F83A 1O3RA 1G9CA 1BQPA 2ZGUA 4ZKTB 3N36A 3BPZA 2JG9B 3IIAA 1C28A 3L9JT 3TYJA 4ITCA 1RTVA 1DQ2A 5I8TA 2WNVA 5GLWA 3ZFGB 4N43C 1YCIA 5IT6A 2WKKA 5LEJA 1PGL1 3PJYA 2XLFA 3AYAA 1SCRA 2VW1A 5JOZA 3VN4A 1ZBA3 3QCWA 4HVRA 4AVSA 2HEWF 3TB0A 4U36A 2VVDA 4B29A 4AFMA 4JDOA 2KA3A 5K0UC 4N7UA 1AYN2 1VLNA 1AJOA 1OSGA 2Q5TA 1PVXA 5C6CA 4BMBA 5I91A 4DMIA 5HCAA 3TAYA 1XQNA 2YC0A 3JB4C 5I8SA 1QJY2 2X8KA 1UKGA 1JXNA 4FAGA 1APNA 1XNDA 4CEYC 2DTYA 4MGIE 3SXWA 1PNGA 3AP9A 5JOYA 3RS6A 4J1WA 1E57A 4RQPA 5ACA2 3ETQA 3AP7A 1ULCA 1LRHA 3AB0A 4YZ1A 4YVSC 1VP6A 2WS91 3N7MA 2WZR2 4LT5A 4I0AA 3JB8A 2RS33 2CL2A 4AK3A 2KXLA 4K9SA 1H1MA 2CGOA 4COUA 1DLLA 4Q4W2 4RS5A 3RRDA 3ZSMA 4JV4A 1FI2A 2WT0A 3WT3A 2ZMLA 3NV4A 4WM8C 2OYZA 1MS9A 3VV1A 4DOUA 2XJPA 3LGRA 1QOSA 4RHV2 1QJU2 3TRSB 5JWPA 2Q0AA 1IKPA 5T52A 3TN92 3VBFA 1SBFA 4HKOA 4FCAA 2EAKA 3SNMA 1DU3D 2R041 5IK8A 3WP3A 1CONA 4IV3B 5FLIA 2XH6A 3MGUA 1YLLA 3SISA 5C9AA 4Y1YA 2I74A 2GNMA 4ISQA 2ZBJA 3FX3A 3VBOC 4JTNA 2WS93 1VB2A 4SLIA 3B9CA 4JGYA 4YG0A 4TSVA 1NQDA 2R063 5I93A 4COVA 3GHMA 1NE6A 2GH8A 2CNAA 4NWWA 4X6QB 2IXCA 2NQYA 4AQ2A 1HV1A 5BNOB 3SITA 3BIWE 3WW2A 1DZQA 4O9GA 1CX4A 1DGWA 4K40A 2WWSA 1VJ2A 5FLHA 3EO6A 1MS0A 5AC92 4NR1A 3WG4A 1BBT3 2EA7A 3OGGA 2IZWA 4OI1A 1OOPC 2NP0A 2R043 1PM7A 3RQ0A 1LOFC 4XILA 2D40A 1QXJA 5KHHA 3DPRB 1UCXA 2EAAA 4LBQD 1COV2 4CDUB 1IPKA 3IPVB 4OUMA 1ND3C 3I54A 1ND2A 4UW4A 5C8WA 5CFDA 1SFYA 1NG0A 1KS4A 2AREA 2R16A 2HWF3 1YI7A 1R093 3NV2A 4LHLA 2H6CA 2PHTA 1RUG3 2XB6C 4GKYA 3M2MA 5FQ0A 2D6PA 1QQP1 3RWNA 3JD71 1VBC1 4IQPA 4A7KA 3V0BB 5LEKA 1S55A 1ZBE2 1WMEA 1NLRA 1PVC1 2Z5WA 3RMXA 1NY72 3JCIA 1BVVA 3B69A 3AMHA 3MIHA 4LLFA 2PN5A 4FXGB 3EJKA 4AEDA 3AP5A 4LO6B 1QJX1 2HWC1 1EPZA 3ZSLA 4FPJA 4A3XA 3KMHA 2ZGTA 4HBNA 4HN0A 2G9FA 3VZLA 2XJQA 1AVBA 3I2DA 4HVQA 3AZVA 1RUE2 2JD4A 1GNZA 2AH2A 4Q8KA 1NA1C 3MLLA 4I01A 3Q9OA 5KHGA 1ZRFA 1J59A 1D2SA 4D69A 2BUKA 3O0XA 4ZXKA 1H8TC 5H9QA 4NN0A 3D6EA 2K0GA 1NCRA 4EN6B 1QQP3 4H55A 4C0BA 1AL21 4CDQC 3WDVA 1CR7A 4AHZA 1YFYA 3DL3A 1B35A 3SH3A 5IK4A 1PVC3 4QXKA 2BEOA 1TMF2 2ENRA 2ZX2A 4YLZA 4BHPA 3NJZA 5HCBA 5I0RA 4Q26A 4XJ8A 3OGJA 1U5XA 4LBJA 2HWC3 1QH7A 1CIWA 2ZX3A 1HLCA 4EJRA 2XHKA 3MPBA 3VLBB 1YFUA 4OHWA 3A0KA 4Q4V1 5DXDA 3WNXA 1POV3 3GZAA 5JI9A 1KQRA 3O0VA 5J98B 5KHJA 1FOD2 4AFBA 3V56A 1JOJA 2UURA 3M3CA 5D8AC 3RDIA 1PGW1 3EXUA 4JAAA 3VZOA 4HKLA 2WLPA 2BNMA 4KH9A 4QM8A 1GQHA 4HPKB 1YI9A 2X29A 4QPGB 1AL23 4WM7A 1W6MB 3B94A 1QH6A 4L97A 1UPSA 4PBPA 1WW7A 2DCYA 4FO9A 2DVDA 1CAXB 2XJSA 4QU2A 2IXLA 5J3UA 1CESA 5KXCA 3PJQA 4CP0A 1AR93 3CJIA 4P9LA 4I0BA 2GNTA 5T5PA 1ULDA 2KM2A 3U0ZA 5H9SA 1WLTA 2JG9C 4Q4V3 3KM5A 4CRQA 2AUYA 1YHFA 4JGZB 5BNNB 2PAMA 3ZFGC 1WLCA 1YIPA 4CDXA 4I0WB 1DYKA 4R4XA 1D4M3 3IMNA 3OTFA 4K1ZA 4MV2A 2ZX0A 4XJUA 3CF6E 1CAUB 5B2GB 3AKPA 3USUB 1GZ9A 2Y0OA 1VRH1 2MEV2 4ES9A 4FOWA 4WVMB 1CAVB 1C8M1 4PDWA 5E1RA 1VBC2 4LULA 4PJYA 4XJAA 4I3GA 2BTVC 3AYDA 3WDTA 1DFQA 4WVZA 3RMYA 4IEQA 4M3CE 1GNHA 2IWGB 4AQ6A 1GR3A 2B7YA 2QZ2A 2I07B 2VECA 1HXS2 3SCFA 4HLTA 1RC6A 3VHOA 4AI1A 3TWIA 1W6NB 1VBD1 4KL1A 5CVRA 2GMEA 4META 3ZN4A 5I0TA 2B39A 2Y26A 2G4IA 3GNEA 5T5OA 2P34A 1LHOA 2XJUA 1GYKA 2D3PA 3AMNA 3ZXKA 3FE5A 3ES1A 1WMFA 5F9TA 2JEMA 1Y43B 5DZEA 3ZXGA 1M06G 2MHFA 4CEYB 3LB9A 2QCSB 5ABJA 5I0UA 3ZFFA 4KWLA 1C8M3 4KWKA 2QE3A 4AEKA 3J8F2 1NZCA 1SFNA 4WV8A 1PZ9A 2Z42A 3HAGA 4LHNA 4DY5A 3KCCA 4YVSB 3N3HA 4YYOA 1RHI1 1C1FA 2RS12 4XFIA 3GALA 4QQHA 4FTEA 5JCTA 1MS8A 2NM1A 2LM3A 3O5SA 1QNWA 5EYYA 2VULA 2R0FA 1VBD3 4IV3C 3FUQA 5J96B 2OA2A 4Q4Y1 3HIFA 3V64A 3I7DA 4QQLA 2D44A 1VR3A 1RUC3 2B46X 2VU9A 3FUOA 5A33A 5JLVA 1YUDA 1PO21 1TEIA 1RUD1 1Z78A 5JDBA 4XTPA 2RS52 5C4WA 3LA3A 2E63A 1PGW2 1AR82 4KU7A 3DN7A 2JXAA 2B42B 4E2QA 2E7QA 3DF0A 1CGPA 2E7TA 1RVF2 1XYPA 3MPPG 4PLMA 2ZACA 1ZZ8A 2C1FA 4QPIA 2LALA 3AZYA 1PIV2 3M8LA 2P3KA 4K7JA 4C91A 3U11A 5BNOC 3I59A 1MS5A 3MFCA 1RHI3 2HWD3 5T3NA 1O3QA 3ZXJA 3R4SA 1MZEA 3HR9A 1NXD1 4ZU4A 2I2SA 2RR11 2C5DA 3OPZA 2RM23 3E97A 4OFGA 4RQPB 2XPJA 2Q8OA 4AQSA 4Q4Y3 3DPRC 4CDQB 1FMD1 4CDUC 1PK6A 1RUD3 4PQ9A 3LA2A 4RS5B 2O8OA 3NV3A 4BIOA 1NCQA 2Z2SB 2PHUA 1AUYA 2HWE3 4HSLA 3EQEA 5BPXA 1G9AA 4QQOA 1QU0A 1WBFA 4H7MA 4JQRA 3ZSKA 3ZX7A 4YG3A 4PIYA 3WCRA 4AGGA 3S0MA 2XJRA 2JE7A 1RJ7A 2QKDA 2WNEA 4EV0A 1O7FA 1ND3B 3VUOA 2A71A 3VBFB 3ZFEA 3VDDB 4BWOA 1L3JA 3VZKA 2GMPA 4FOYA 3H50A 2YGLA 4LBMA 1FAYA 2RR13 5C9AB 4LO4B 4XFBA 3UJQA 3KCXA 4HANA 2D5HA 2RMU3 1TQ5A 4JCKA 1FMD3 2ZGMA 4S2FA 1PNFA 2HKXA 4Z82A 4L2NA 4EN8B 3E5XA 5C8CA 5CA6A 1RB8G 4W65A 1AYN1 2Z79A 4JGYB 1LCLA 3NVCA 1MEC3 3HT2A 3ZXLA 4DQAA 2WC2A 1UN1A 3SH4A 3CJXA 3ZYGA 4N53C 3U4XA 3H7JA 3ALQA 4S2DA 1QJY1 2C9AA 4N90A 1LHUA 3VKMA 1AYM3 2D98A 1S1AA 1NOVA 3HQXA 3INAA 3VL8A 4TWTA 4N9IA 1YJKA 2PLV2 3POSA 2B45X 1Q8QA 5ACA1 3KT4A 5EXOA 1C3HA 4XHBA 5FOBB 2ZHMA 4DRVA 2WZR1 3FBMA 4MX3A 1EAH2 1WD4A 3UKVA 5L36A 4OHVA 4LEJA 4Q4W1 4XJWA 3GHNA 5DDJ1 5GLVA 1WCDJ 1VAVA 3FFQA 4GWMA 1LKNA 3R0RA 1K5MC 3K51A 5DG2A 4DS0A 1KXGA 2YGMA 3FBYA 1MZ5A 2DCZA 4XZPA 4D7SA 1PO22 2CAVA 2EXHA 2ZAHA 5CU1A 2P3IA 4RHV1 3KQRA 1QJU1 3POWA 5FQ0B 4YGDA 3G7DA 1DG6A 3TN91 4DY3A 1QJY3 1UU5A 2VNOA 4IXLA 1SMVA 5FO7B 1UF2C 1AHSA 1KRIA 3VBSA 1N1VA 4Y20B 4GIQA 1SBEA 4LTAA 2CTVA 3GBFA 4L8QA 4QPGC 2BYVE 2D43A 2Q1ZB 4L11A 1ASJ2 5DG1A 2GSYA 1LR5A 1BXHA 3JQWA 5ACA3 5JSOA 3D4KA 1IS4A 1N1YA 4JVAA 4XTMA 1N3OA 3WX5A 5D8AB 5JAXA 3MF6A 4SBVA 3JBG2 2WQZC 2H0BA 2P37A 4YZ5A 1H1IA 1O3TA 1V6OA 1U5YA 2HJIA 2IFWA 4G9SB 1CPMA 3N7KA 4XQDA 2G9GA 4IV1A 1GICA 2R32A 1RL3A 3GF6A 5BNNC 1W6PA 1URXA 4YVWA 4RHV3 3FFZA 1N3PA 4AVVA 4MGZE 3TN93 5AC91 3AKTA 3AP6A 1DIWA 1XE7A 1ONAA 3B00A 4WZCA 4BM8A 5CFCC 1I3HA 2PAEA 3J26N 2VMGA 3RYRA 1COV1 1H2LA 2NMOA 4HKWA 1IHMA 2BWCA 2AR6A 1PGSA 3E5UA 3JZVA 2FQPA 2YY1A 4KQ7A 3VBHA 4ASLA 1UX6A 1W6QA 4I09A 3RJRA 5BNPB 2YXSA 2JJ6A 5KXBA 4N7IA 3WDYA 2YMZA 5FPZA 4AI3A 5KBFA 1KDKA 3AMQA 3U07A 2W52A 3VZNA 3WCSA 5FOJB 1IPJA 1I5ZA 3ENRA 3VBUC 4Z2WA 1XYOA 2PQQA 4AG4A 1ZBE1 2NZ9A 1J3RA 5CB7A 1NY71 1MVQA 3BOWA 4WM8A 4Y1VA 2UYBA 3H1WA 1VAMA 2A5ZA 3CO2A 4WM7B 5AC93 5FLJA 3QH6A 1SEFA 2QVSB 2HWB1 1MQTA 4OVEA 2ZGSA 4YGBA 5CBLA 4W6YA 3V0AA 3ZXDA 1CD3G 5JR7B 4AXOA 1COV3 3WW3A 2AZ5A 1DQ5A 3DGTA 1RUE1 2ET1A 4QQ2A 2P3JA 2CAUA 4AVAA 1H4HA 3T1LA 1LOCA 5EZWA 2RHPA 4IEPA 2A75A 1VBB2 4RSUA 4HMZA 3VBOA 2WNVC 4YZ3A 5DDJ2 4CDXB 4Y4YA 1OLQA 3BOPA 1D4VB 1LESA 4YGCA 4QHBA 4Y22A 4MXWA 2GC1A 1R082 4MGYE 3ZIXA 3HWJA 2DVAA 5DUVA 3W9AA 5GZFA 3SH5A 2VOVA 1TMF1 3IDEA 2DUOA 1F2NA 3ATGA 1IZ3A 4RGAA 1HRV2 2GMMA 1S0IA 1KD7A 3HMYA 1QDCA 5T55A 3AYCA 3NKGA 3O0WA 4Q2FA 2PHXA 2ZKLA 1V6IA 1PO12 2XL7A 4OHXA 3MDPA 3ACLA 4BA6A 2WINB 1HX6A 1KITA 5A32A 2XBO2 5L73A 1RUE3 3BB6A 4OULA 1G9FA 4X6RB 2UYAA 1W0PA 4KBBA 4IETA 1O4ZA 1FOD1 1DHKB 4ATEA 4LBQB 3A4UA 1AX2A 4KG8A 4RL7A 2BFUS 4INDA 2XG3A 2XGXA 1WCSA 1WW6A 4P9IA 1OFNA 3ECQA 4RQPC 4EWEA 4B4QA 2A6ZA 3LOIA 1CN1A 1OPOA 4YM1A 3PVBB 3T1MA 2WJSA 4AEJA 4L99A 2X5IA 2IXIA 1TMF3 2RE9A 1G8WA 4RS5C 2D6MA 4I30A 3LOBA 3GYDA 4XXPA 1AR62 1ZBA2 4FOVA 2BFUL 3M3OA 2BQPA 4JDNA 1QHDA 2ARBA 3UKNA 1VBA2 3WQ1A 3OD0A 4BIFA 4CYDA 1D0GA 4XBLA