4BH9A

A structural model of cap mutant (t127l and s128i) in the apo state
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
209
Chain Sequence
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVLIEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-activated global transcriptional regulator CRP
publication title Allosteric inhibition through suppression of transient conformational states.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 58
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2013-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bh9A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bh9A01
2MNGA 2MLGA 3QU3A 3TDZC 3HRMA 4G94A 2L3DA 3HT2A 3S7EA 3T5XA 4YIIA 1KQ0A 1OI6A 4KFCA 5D5XB 1ZRFA 4WVZA 4RB1A 4I09A 3BU7A 4FBFA 5HDKA 3KGLA 5F1RA 2NAZA 2QJVA 5JSRA 3ST7A 5HS8A 3TNQA 4KU7A 2DQLA 2GXGA 2YU3A 3D82A 1E2XA 2L02A 5H6RA 2JTVA 3B02A 1J0RA 5F64A 4LUKA 3LAPA 2VBZA 4HSLA 2OPKA 3T8RA 2A3SA 4MUVA 5K8SA 4UXAA 2CGPA 4WXDA 4HOBA 3KLNA 3LQQA 3WTYC 3C3VA 1LDJA 1J3PA 1J7KA 3FE5A 3CO2A 1FLIA 2X0LA 5BY5A 1CAUB 3HHHA 1DPUA 5JI6A 4WZCA 1SFUA 4CXFA 4HW0A 3WE3A 1F5TA 3KP5A 4E2GA 2XKPA 4ASNA 3GVAA 1ZZ7A 1YO5C 4I3PA 3FF5A 3OGJA 2B8MA 3SHRA 2BNMA 3FJSA 2XL9A 1RC6A 5ILSA 2P17A 5JSOA 2P6SA 2H09A 2OA2A 3EQLF 3CDHA 2VC1A 1FI2A 2KKOA 3CTAA 4LB6B 1LKNA 5D8KB 4BYYA 5HOOA 2H6BA 1SD5A 1P4XA 1FBQA 1BI3A 1F4KA 3KSCA 2FOKA 3E5XA 4LA3A 3I4PA 2MC3A 4IHSA 4OFGA 4BHPA 3GFJA 2QDRA 3QPTA 1B59A 3V4GA 5I8YA 1FBUA 1B4AA 1DUXC 4BIFA 1HSJA 3CUQC 2Q1ZB 2HR3A 3C18A 3FXUA 2JZYA 2M87A 5I8SA 2EJRA 4I98B 3CF6E 4EWEA 2F5CA 5LBQA 3I54A 2VT2A 2B0LA 3F8MA 3H1MA 1DGRA 4UBGA 4ZYDA 1IRFA 5I0TA 3F72A 1K6OA 2GH2A 5EFUA 2C6YA 4HV6A 1G3SA 2IPQX 2L4MA 2PN6A 4IEOA 4JBAA 2V1DA 2V6CA 3P9CA 4X6RB 1O57A 1ZZCA 3E3VA 1ZLKA 1W7PB 2M1BA 2KXLA 1U5TB 5LHGA 4RS8A 2D2WA 3SQNA 2PFWA 1S29A 4M71A 2PFBA 2P5VA 2M8EA 5KK1A 3G3ZA 2COMA 4K2EA 2O0YA 3F22A 1FT9A 2IT0A 3LWCA 4J1XA 3RYKA 1TQPA 3QRFF 4UXNA 3RDIA 2H6CA 1YFWA 2VQAA 4YFKF 2Z99A 3MEXA 1B6AA 3HSFA 3JAMZ 5HLGA 2DAOA 3V7SA 1FC3A 1R1VA 4N9HA 4RB3C 4MGIE 3L9FA 5DCFA 1WRJA 3BJ6A 4ONUA 4G7OF 2XLAA 4B09A 1LQ1A 4PZJA 3ULQB 3EDPA 3BOQA 3H7JA 4L11A 3R61A 1NYWA 5JAXA 4PCQA 4LG0A 3CJXA 1UB9A 4M74A 3PVBB 4LTAA 4GYGA 1ZRRA 2HKOA 2ELHA 3FZVA 1U2WA 3GUDA 3CJNA 3I58A 5J8FA 1QQIA 3KMHA 1ZZBA 2EV6A 1RNLA 2PQ8A 2Q0OA 1YHFA 2M30A 3KP6A 3I59A 3KP7A 3ZDSA 4I02A 1YWKA 4XFAA 5T3NA 1MDMA 1Q5OA 4XSZF 1XMAA 2A61A 3K1MA 1O3RA 2JRTA 3D0JA 3MDPA 3IKVA 4G7ZF 1BJAA 1RIOH 2D5HA 2RVCA 3P9IA 5E17F 3H3ZA 2FMLA 5ERIA 1S7AA 4JQFA 3WW1A 3JAMK 4EJOA 4LULA 5LGNA 5FD5A 1JXSA 5KHJA 1SMYF 3C3WA 2X4HA 2HGCA 2Y48A 5D5VB 1NZCA 4AQ2A 4WXHA 4WX9A 1D8JA 2PEXA 1J59A 2EFWA 5J6XA 2GA1A 2VONA 2MD5A 2KRFA 1V70A 3OCPA 4E2SA 3GFLA 4OIPF 4CGZA 1O3SA 2A5YB 1ZRCA 5LEJA 4ENKA 2DI3A 1G3TA 1IPKA 1O7LA 4A5MA 1FBSA 2QYOA 5LGTA 1DP7P 2D45A 1I6XA 4M6YA 3ABUA 1YIOA 2G7UA 2ESNA 2XLFA 4HMZA 1TTYA 2XAQA 1ZG1A 4ENNA 3UKVA 1J75A 3F8BA 4UHTA 4HZFA 3IC7A 4ESJA 3HTUA 4BXUA 3SCGA 3SXYA 1KYWA 1S7OA 1XSXA 1C0WA 3H1WA 5J7MA 5BQTA 5JVTA 2PJPA 2GAUA 1QY4A 2NNNA 4WBBA 4A5NA 1LB2A 2QWWA 3V8KA 1BI0A 3BROA 1FSEA 2YX4A 3WW2A 2AS5F 4U0YA 2IRFG 3FMSA 2GC1A 4MHGA 4KU8A 1QXRA 1LEBA 2UY8A 1U3EM 3TNPB 2FNPA 1ODDA 1OD5A 3W6JB 2VN2A 4P9FA 1JE8A 1D8KA 4Q47A 3FM5A 1S6LA 4OOIA 4WCGA 4P5OA 4HDUA 1IN4A 2Q4SA 2NNYA 1MGTA 4PIYA 1IXCA 1R1UA 2ZNYA 4IF4A 1CAVA 2H0VA 1YLFA 2FQPA 5LEKA 3SXWA 2RNJA 4RGXA 5K5QA 1EH7A 1ULYA 2PYTA 2CO5A 3E6BA 3JSOA 4PGHA 5KVRA 3ISPA 4RB2C 3H7YA 3MPBA 1J3QA 2IXCA 2EK5A 1QZZA 1J2XA 2MA3A 3TQNA 2W25A 2K7LA 1IW7F 2DBBA 4HAMA 5FPXA 4OMZA 4Y13A 3OV8A 3MZHA 3K9TA 1RUOA 3H1YA 4R1HA 3LA3A 3L7WA 1RUNA 1BM9A 4U0WA 1XE7A 3I7DA 2KIMA 3COAC 2FU4A 4UVAA 1F1ZA 4KA4A 3SZTA 4ENMA 1H0MA 1QO0D 1D3YA 1XD7A 1PP7U 1XCVA 2GXBA 4DQ2A 2KIUA 2K4JA 5HLHA 5JR7B 2HFHA 2OU2A 3LFKA 1HW5A 4WF2A 4XLNF 3E5UA 1SMTA 4K8FA 2LNBA 5L3BA 4FX4A 1YFUA 1V4RA 4DNCA 5EZWA 4AXOA 1U5TC 2K86A 2A6EF 4G8XA 5FFZA 4QLCU 3HRUA 4F7ZA 1TQ5A 5K5OA 2IJLA 1G4DA 3ES4A 2DFIA 3O6BB 3L2HA 4HLXA 4M9XA 1ZARA 2Z9OA 3WTZA 4MGZE 5DDGA 5L3FA 4BHCA 1OR7A 3GZ5A 4HF2A 3JW4A 1OYYA 3ES1A 4MEXF 1KU3A 4RAZA 1DGWA 2EFOA 1QPMA 4OIOF 4UV8A 3ZPLA 1IN7A 1SD4A 4AVCA 3HIFA 3VODA 1RI7A 4H0EA 1YQAA 3U0ZA 4G9YA 2QUFA 2VXZA 4YARA 1WSUA 1EYBA 2DQRA 3PFIA 4ZU5A 2EA2A 1YS6A 1GXQA 3ZMDA 4FT8A 5CVUA 3O3KA 1T0FA 3I53A 4KIGA 2FNAA 2XGXA 5FO5A 4KICA 5DD8A 1MKMA 4MGKE 1X7NA 4AIJA 2EFQA 3F3XA 5KHIA 5CU1A 1Y3TA 1R5HA 4U7BA 4MH0E 1Z7UA 1R1TA 3F21A 4IEXA 3M70A 1MD0A 2ADUA 3N4MA 1X8EA 3BWGA 3JSPA 2EV0A 3HSEA 2HWVA 3VEPA 1STZA 2RN7A 2W57A 4YIFA 3FZ3A 4FAHA 1BI2A 3HTSB 4KIBA 2GIVA 4ZU7A 2JSCA 4LG0B 3ECOA 3SHFA 4GGGA 1Z05A 2HZTA 2ATFA 2ISZA 2EWNA 4M73A 2QBYB 3JZVA 2HYGD 4WK8F 2PHLA 4XEZA 1ZZ6A 2IA0A 5E1WA 2A07F 5DUKA 2DCTA 4AIHA 3L09A 2E7WA 3IKTA 2Z3YA 3I59B 4JVAA 2Y0MA 5IT9K 3E6DA 3S7IA 1MDMB 2HTJA 3FXQA 4P9UA 2E7XA 3WU1B 4EWAA 4I2OA 2P8TA 5HDNA 3FMRA 5CVJA 2BE5F 1ZGAA 3R6SA 2PMUA 3HRTA 1KU7A 4Q48A 4I0AA 1RTVA 1IN6A 2BNOA 4YYOA 4EJUA 4HA8A 4TV7A 2E9QA 1DZTA 3EQEA 4PJYA 3IWZA 4KDPA 2ET7A 1ZLJA 1W7PD 2ZMEA 5L3GA 2LF8A 3LOIA 1OPCA 2XKOA 4ON0A 1SQ4A 1T38A 1Z1DA 1REPC 4MEYF 1O3TA 1MJ9A 1P92A 1EY2A 4KUMA 3UKNA 4O6JA 1FP1D 4XFHA 1QBJA 4A0YA 2IA1A 3V7RA 4ZH4F 4GULA 1GHCA 1MJBA 3S0MA 4KWJA 3CLOA 1O4TA 4TLFA 1TLHB 1TNTA 4Q5SF 1KU2A 3ELKA 5BOXA 5KHKA 1EPZA 2VOOA 3MCZA 4EWDA 3PNAA 4KN7X 2XROA 3U11A 5BV6A 1KU9A 3TKYA 4P9GA 4JK1X 2HYFA 3M7GA 2UZKA 3KLOA 1YS7A 2I45A 1E17A 3M9AA 2UYBA 1Y0UA 2MBFA 3KE2A 5BPDA 1U78A 4RD7A 3K2ZA 1ZN2A 1J1LA 1IAWA 1T2KA 1CAWA 3EYIA 4I7HA 4RGRA 3KP2A 4DINB 2DK8A 3F8NA 4M9SA 2IP2A 5HS9A 2K0GA 1H9GA 2V79A 3U10A 2OZUA 2DPUA 1ZYRF 2STWA 3WTWC 5DUIA 3NSTA 5H6QA 5ILUA 5IT3A 2YX7A 1GVJA 1UD1A 2L54A 3T8TA 2KJBA 5LRSA 1T98A 1USTA 2WC2A 2FE3A 3F8CA 4XFIA 4MGRA 1XSDA 1QNTA 4XF9A 3DPTA 2MH2A 4EJVA 3IRRA 5A2QZ 4IERA 3B73A 1DDNA 2RV8A 1JGSA 3L2CA 4R8HA 5CVVA 4G6DA 1WA4A 1BN5A 4FAGA 1KA8A 4QGMA 2Z2SB 2Y75A 4NVPA 3FHIB 5I0UA 3WTXC 3GO5A 4M72A 2PQQA 3Q9VA 4XF4A 2QVSB 2D5FA 1AWCA 3I71A 1WGPA 2H27A 4OINF 1R23A 4LD5A 1CF7B 3U2RA 4ZZLA 3BPXA 2K02A 1YG2A 3TO9A 2LKPA 1FX7A 2R3SA 4EJWA 3J7AO 4KWLA 4G7HF 2JPBA 3CO6C 4L5JA 1H1IA 2HS5A 4L0ZB 2CW0F 3WTTC 5LHIA 1UIJA 1QGPA 1ZG5A 1XGMA 4BHBA 3DXJF 3J80Z 4UUVA 4QXKA 3K0LA 2PMHA 2DU9A 1S3JA 4L2NA 1WWXA 4A0XA 2HEOA 4L9TA 3BJAA 4EV0A 2GC2A 3R0AA 1GXPA 3U1DA 1LEAA 2FMYA 5E8GA 1TW3A 4A6DA 4HQEA 4XF3A 3KCCA 5A2QK 4EMSA 4LEJA 2ISYA 1UHWA 5BPIA 5FCCA 4O9GA 4PIXA 1AOYA 4IVNA 4KMUX 4D7TA 4EM0B 2CWEA 1ZH5A 1U12A 1UW8A 4CHUA 3K1NA 4ZYEA 2RDPA 4LLGF 3NKTA 4A6EA 1NXMA 3ETQA 1ZAOA 3N97A 5DCMB 1HKTA 4BQAA 2Y0OA 1IN8A 4Z2YA 1O7FA 5J8CA 4P96A 1LNWA 2GC0A 4EM2A 1HBXG 2D1VA 2QNKA 3R0JA 3R60A 2AXLA 3TO6A 3S2WA 1FYKA 4HYEA 5FLHA 6PAXA 4HBLA 1BIAA 1I5ZA 3RIRA 1FPQA 4HDVA 2UXNA 4QMAA 1XDSA 2QM3A 2DK5A 4XRFA 4MQVA 4KYWA 3J80K 5I8TA 3IIAA 4I0BA 3KEQA 3FMQA 2CAVA 2OD5A 1K79A 4HLYA 3MWMA 1PP8F 3GWZA 3DV8A 5JCTA 4H7LA 1BI1A 2TDXA 3FXRA 2FA5A 2DW4A 1TBXA 2FEZA 4HX4A 1WKMA 1FP2A 1DZRA 1IXSB 4WWCA 1L3JA 4MV2A 1X82A 4XFCA 1UIKA 3L00A 3BPVA 1Q3EA 3H92A 5EEGA 5HDGA 1ON2A 2H94A 4P55A 1Z6TA 1BC7C 2CQKA 5C6CA 5FLXZ 5JHUA 2HKXA 5BUVA 4XFBA 4M6XA 5ILVA 1YW7A 4U0VA 5JR3A 3BY6A 4HQMA 4Q0VA 2OAZA 4A0ZA 2XRNA 2IXIA 4RB0A 3HSRA 3GYHX 3FM3A 3KP3A 1R7JA 3HOTA 2R7DA 1R00A 3LSTA 2ZJ2A 1W7PA 2HJIA 4XFGA 2P5KA 3HQXA 3C1DA 3LA2A 1YW8A 3RZZA 3NVCA 2KJCA 3EUHA 1XN7A 3NL1A 1F9NA 2GZWA 3RYRA 1GQHA 2D93A 1O5UA 2HDCA 3MFKA 1ZNPA 2MH9A 5J3UA 1SFNA 5CYVA 3MZYA 1CAXA 1A04A 2FBKA 2XAFA 4F8AA 2V1XA 5L3DA 1RZ4A 3GLXA 1HW2A 2P4WA 4IEWA 4KL1A 3V8JA 2M45A 4L5IA 1FXZA 4CZZA 3LAGA 2DTRA 3FFQA 2FQ3A 2W84A 3EJKA 2O8QA 4KIFA 3BDDA 2ZMEB 3Q9SA 2ZKZA 2BGCA 3F6VA 3BALA 1LRHA 1EH6A 3G7DA 5ICGA 2ZFWA 2LSOA 2IC1A 5FQ0A 4KWKA 3KZZA 2QVOA 2JT1A 3VFZA 4KT5C 3FHZA 2F5EA 3GF2A 2Z69A 2PLYA 4OIQF 2O8XA 1K78A 1LVAA 3CLPA 1XGNA 4LK0F 4RAYA 3R4KA 4BAYA 1B9MA 1VR3A 2XVCA 3IDCB 3QAHA 3FX3A 2PG4A 3OOPA 4CICA 3V7CA 3P7NA 2A68F 4Z07A 4S04A 4JTNA 3ZN0A 4D0PA 3RJPA 3M1EA 5HVQC 3IHUA 4ESBA 1HQCA 4EROA 3QOPA 2ACJA 5FDBA 2YPRA 2P6TA 5LHHA 2F4PA 4CO8A 3G73A 2LF7A 2WFPA 3WE2A 2Q0AA 3O14A 4Z82A 4GCVA 3U9GA 1B1BA 2QQBA 2ET1A 1L3LA 4IRGA 3IDBB 3V8LA 1HW1A 1OKRA 4Q0PA 3GFIA 1FZPB 5HI0A 4E2QA 3ROUA 2A69F 5I0RA 3EO6A 1R36A 4LGWA 2M5WA 5E1ZB 1O3QA 4EQQA 2PAEA 3I5UA 3QP5A 3TO7A 2G7HA 5FD6A 3F6OA 4PGGA 1W4MA 4XF0A 2XAHA 3TGNA 3I64A 4EM1A 4YFNF 4HF1A 3F23A 4M9ZA 2V09A 1U8RA 3BZ6A 3H9AA 1TQIA 3MAJA 5CVIA 2O6GE 1SAXA 4L9VA 4ZU4A 1S8NA 2IXJA 4LUMA 4HN1A 2ETHA 4MTDA 2OA4A 1HSTA 3DKWA 2V9VA 3DP7A 1R5GA 1OFNA 2KIFA 4HN0A 4OLLA 1LJ9A 1XMKA 1I1GA 3QU6A 2BV6A 3SCHA 4N0BA 5AIQA 2OZJA 3GXOA 2UYAA 4IPAA 2EAAA 2FF4A 4GYIA 5ICEA 1ZX5A 4ENJA 1OYIA 3CUQA 3LA7A 1QWRA 3RTRA 3NRVA 2RQPA 3ABTA 2NRAC 1WQ2A 4LLOA 4XLPF 3ZMTA 1QZYA 5E16A 4U7DA 1EH8A 3WGGA 3PLQA 2L01A 2XL7A 2OBPA 3T1BA 2VBXA 2NS0A 1GQGA 2BBYA 1SD6A 2Q8KA 1L0OC 3ZMUA 2VC0A 3WW3A 4E70A 4PIZA 4HVQA 1NE6A 2EB7A 1ZHFA 2QLZA 2VT3A 1J5YA 1QXJA 4L0YB 3ZN1A 2DPDA 3ERED 3SCFA 4AVAA 2PA7A 2VBWA 3KGZA 1WLTA 2XV4S 2GC3A 4XETA 2DO7A 4UVBA 1H9TA 2VE8A 2OYZA 4KMFA 5LGUA 2GQQA 1G3YA 4AVBA 2ZO4A 4O5VA 5AVPA 2CFXA 4EGZA 4X6QB 3GX4X 2CV6A 1USSA 4IEZA 1O5LA 4NHJA 4QX5A 2ZBKA 3UKTA 1KQ9A 4UBHA 3H3UA 2RC4A 1J58A 4MNUA 3WTSC 2V1UA 3VHRA 3WW4A 4OMYA 1WI9A 1SD7A 4S05A 1YLLA 1Y9QA 4Q0QA 2EFPA 2P7VB 3M8FA 1ON1A 1U6GA 1IN5A 1PM7A 3LWFA 2FBHA 2GA2A 1FWZA 3J81Z 2XHKA 5D8LB 4I01A 2F2EA 5D6FA 1VTNC 2FSWA 3QPHA 2K27A 2VODA 5HLIA 5D4SA 5E20A 4BH9A 5I93A 3LAJA 1HKQA 4FX0A 4Q4ZF 1PDNC 3RKWA 4FHTA 3H8UA 4KNYA 2XAGA 3O2PE 4HVOA 2ESHA 4B8XA 4KN4X 3TOAA 1CGPA 1I1SA 4XF1A 3WGHA 1UFMA 2IXLA 2O03A 3BCWA 3RI4A 4YRDA 3KZYA 2FBIA 3IL2A 3SZPA 2N7GA 4XBFA 3ML6A 4ETSA 1XGSA 1VP6A 4LB5A 3IRQA 2YSRA 5FGMA 4AQ6A 2Q2EA 3WGIA 4O3MA 1CAVB 3WODF 4Q0UA 1ZREA 5D5WB 1SFXA 1Q1HA 3EYYA 3RKXA 2R7FA 2C0ZA 1YFXA 1BOAA 4MTEA 4AIKA 5CLSA 5E1RA 3OTFA 4Q29A 1KGSA 3D0SA 4HV5A 1CAXB 3HYIA 1K7AA 3J81K 1CX4A 4QGLA 4BNCA 3ELNA 1BIBA 5DD4A 2Z5UA 2DT5A 1P4WA 4R52A 1P2FA 2E1NA 2XUBA 4O9EA 1ZGJA 2CYYA 3E6CC 1HXDA 2QQ9A 3CEWA 3DQVC 1EP0A 1MZBA 5ICCA 2QQAA 3ZQ7A 3F8FA 1YUDA 2XIGA 4HSJA 4OIRF 2EV5A 3K1PA 4MX3A 2IXKA 3ACLA 1FOKA 4MZUA 1FYLA 4Q0SA 4QM8A 3ECHA 5AIPA 3REOA 4LA2A 5JFRA 3QP6A 4LJZF 1H1MA 4A2UA 2A6HF 3JTHA 5FQ0B 4IEQA 4L9NA 1LR5A 4IJAA 2MPFA 5J48A 1EV7A 4AWXB 3BPZA 5KHHA 3OD0A 2FRHA 5FLJA 5BS6A 1K78B 1JHHA 5JSPA 3ZP5A 4IEYA 1X8MA 3KETA 2QBYA 2WV0A 1FSHA 3PQJA 3TDUC 2WWYA 1D5VA 3NW4A 1UHMA 2BEOA 5E8IA 5BMZA 5F6FA 4EJTA 3RKYA 1TW2A 4EGYA 3QACA 4RGUA 1OMIA 2PI0A 2ZNZA 3K69A 5K5RA 2D1HA 3DN7A 2HQRA 3NQOA 3FWEA 3ZMVA 4GO1A 2J5PA 5DYMA 4HVRA 1G6NA 1CAUA 2ZCWA 2CAUA 3IBMA 3GYDA 2ZXJA 2B9UA 5ICFA 1YW9A 3ZMSA 4UV9A 1T39A 4LFUA 5I0SA 2OQGA 1ONVA 5FPZA 1W5SA 4QGNA 1KYZA 2RGVA 2XLGA 2EA7A 1Q43A 5I91A 5LLQA 2P5LC 3H50A 1UCXA 3EETA 2LDUA 3DF8A 5DV5A 3WG9A 4AD9A 5DEQA 4YNIA 4YSFA 5HS7A 1FY7A 2MLKA 3EHKA 2EVXA 3MQ0A 4WXCA 3T0YA 2G9WA 3HT1A 1IUYA 1YYVA 1BC8C 1XB4A 3JTGA 4META 1NE4A 1ZZ8A 2XASA 5TRDA 5BPXA 2IXHA 4ZZDA 1ZRDA 4IESA 5E18F 3OF1A 1JUHA 2CG4A 1TNSA 1FYMA 4HF0A 5KBFA 4IRIA 3WU0A 4QM9A 2W24A 1XRUA 3P9KA 3GEZA 5K1YA 2HTSA 5L3CA 1YFYA 3GW2A 2JPCA 4IRHA 3NJZA 4Y17A 5CVRA 3GZ6A 4RGSA 1R58A 1Z6RA 4AVPA 3I0TA 3RPQA 5ED4A 3CUQB 2EA4A 1P4AA 4N9IA 2K9ZA 3IWFA 1ZZ9A 3WTUC 2K4BA 5KHGA 3HHGA 1U5TA 4LLNA 1RGSA 3WTVC 4HX8A 1UPIA 4NB5A 4OU0A 1XGOA 2VPVA 2L4AA 2UXXA 3SMHA 1YFHA 4A12A 2PBIA 5AONA 2F5FA 5H20A 3GBFA 4EVIA 3USSA 5D4RA 2D40A 1PUEE 5D5UB 4HBNA 1IZ1A 2O3FA 5D1IA 1OYWA 3SFZA 4UVCA 1P6RA 1XE8A 3BP8A 4QWQA 4J1WA 2UY9A 5E1XA 1J3RA 2ZKLA 4GXOA 3HRSA 4XFFA 2GWRA 4L9JA 2Q30A 1YTYA 2IVMA 4XSXF 3LZZA 2HOEA 1SFEA 3TOBA 3RYPA 5D6EA 1IRGA 1CF7A 4ZYHA 4ORFA 3DL3A 2BYVE 2PHDA 2FXAA 3HOSA 5FLXK 2PTMA 2MHFA 3DPLC 1B9NA 2PAMA 3NEUA 1I27A 4NQWA 2IW5A 2E1CA 1R22A 3W6KB 3E6MA 5TJJA 4MGYE 5C8WA 1XSVA 1VJ2A 3BJOA 1SEFA 2VE9A 1X3UA 1JHFA 4L18B 1FNNA 2VBYA 1IPJA 2EFNA 2GU9A 4HX7A 3RNSA 2QENA 2HQNA 5LRRA 4LK1F 2OQRA 3DFGA 2P7CB 3C7JA 5FLIA 1ZG3A 4JTOA 1LDDA 4YFXF 1RL3A 1IXRC 4IEVA 4IHTA 1BBYA 2J5OA 4PDKA 4CDGA 4LMYA 2OZ6A 5EEHA 3CO7C 3MYXA 4IXAA 1XCBA 3DEUA 3KEOA 3PQKA 4ESFA 1CAWB 2PAKA 4HLTA 3CL1A 3M8EA 2ETEA 2DLLA 4G6QA 1DPRA 2B5HA 4R79A 5CADA 3KP4A 3ZMZA 2XAJA 2NYXA 4U88A 4B29A 4LLLA 3AAFA 5DCMA 2O1QA 2W85A 2YR2A 2BNNA 1Z91A 2VOPA 3M3IA 3E97A 1LDKB 4JV4A 3VOEA 5FB2A 1J9IA 3VB2A 3BB6A 1UCRA 2CSOA 1T6SA 2STTA 4IEUA 3LQRA 1Z9CA 3D5LA 5BXXA 3CUOA 1NHAA 2O61A 4YG2F 2Z33A 4Y15A 4UNOA 5IT9Z 4MQ9F 3KFWX 1PMIA 3GFMA 4D7SA 1IF1A 5CJ9A 2QCSB 3EBRA 4IEPA 2VECA 1TQMA 1XDUA 2WTEA 2UWMA 1V3FA 3Q5FA 1G3WA 3E5QA 4CYDA 1W5TA 2F5DA 2RKHA 1ZVFA 5FFXA 2QZ8A 2IA2A 1MJAA 3HUGA 1KQ8A 4IETA 3RPUA 1HKSA 5L3EA 4ZYGA
chains in the Genus database with same CATH superfamily
2ZEYA 4LXLA 3TDZC 3NV1A 5IVBA 1PUFA 2L3DA 2JDAA 3T5XA 3VYUB 1OI6A 5FOBB 4KFCA 2B4KA 3KHBA 1ZRFA 4LLFA 5AFBA 4B4CA 2L5QA 3GTQJ 3TP3A 5F1RA 5JSRA 5FJKA 4BQ4A 1H6YA 4U87A 1IS6A 2RG4A 2HWC3 5C3RA 1E2XA 5H6RA 3WQBA 1W04A 2ZZJA 2HLEA 4E9KA 5KXDA 2CGOA 2JA6J 2VNRA 3CP8A 1H2LA 2KT0A 1FIAA 1NCQB 1Q8PA 3I4IA 4PBPA 2Y0SA 4MOAA 3ZYJB 2VG9A 1LDJA 2K9NA 1HB4A 4HEA2 5IVVA 3CO2A 2WFF2 1AR91 1SFUA 4HW0A 3WE3A 3CCJI 2BV4A 1A78A 4N90A 4CYCA 2W39A 4B4PA 4E4DX 3GDBA 1YO5C 2BNMA 2IGMA 2H09A 4MIMA 1D1AA 4YPJA 2VC1A 2KKOA 4LB6B 2CRGA 3BQYA 2VB6A 2ZJPF 1AA7A 4BYYA 2W92A 5HOOA 1NQJA 2ZHNA 4HETA 1SLBA 2H6BA 1P4XA 4XZPA 2OC6A 3GM8A 1DZQA 1DGWX 3OY8B 4OFGA 2VQCA 3QPTA 1SFYA 1DUXC 4BIFA 3CUQC 3I3LA 3HQRA 2AH2A 2X5IC 1LODA 1YJ9I 2ERFA 2O14A 5I8SA 3AKQA 2CYFA 3CF6E 3ZSLA 3I54A 4CA0A 2VT2A 4K21A 1OF3A 3H1MA 2W9XA 4BE1A 3WG7H 2VQTA 3PTRB 2GH2A 5GKAC 3AYDA 1AXZA 2OCEA 2C6YA 2IPQX 3AVSA 3WNOA 4IGOA 1OHFA 3CKHA 4IEOA 3ZRGA 3BZCA 1WCDJ 1ZZCA 1ZLKA 4IHWA 2M1BA 3T0DA 2WNVC 2JIGA 4DMIA 4M71A 3FFZA 1AKHA 3MW3A 1W8HA 1K12A 5CFCB 1OLTA 4GMP1 1VBA1 2COMA 4XVHA 2O0YA 3F22A 2PHWA 2QUOA 4UW4A 1FT9A 4CU9A 3GTPJ 5F08A 4IHXA 2CQNA 2H6CA 2VJJA 1TE1B 4JHTA 4PI0A 3K77A 2TUNA 2ORZA 1MBKA 2LRPA 3WP3A 3HSFA 4HPQA 5HLGA 5SV5A 2DAOA 4K9SA 1MBHA 2CHHA 4CEYB 1CR7A 4P9XA 5A3TA 1KEXA 1WRJA 4TSVA 4G7OF 1LQ1A 2CUZA 4PZJA 2M8GX 3EDPA 3ULQB 4BK5A 4PJNA 3BTIA 2P6HA 3WNXA 1IZ3A 1YRNB 3RMXA 4NQWB 1EV11 3K7AJ 4M3DA 3PVBB 3ZSKA 4GYGA 2HKOA 2ELHA 3GUDA 3CJNA 2XVGA 3I58A 2N8GA 5J8FA 1QQIA 3KMHA 2NN8A 2BW3B 2QBXA 2EIJH 2D6OX 4MXWB 3I59A 5KAFC 3IH2A 1UQXA 4I02A 1YWKA 3EYPA 1MDMA 3M3CA 4CE8A 2WO1A 3D0JA 3MDPA 2ARXA 3IKVA 1BJAA 1RIOH 4MLOA 2D5HA 2FHRA 4FOWA 3VUOA 3JAMK 4KT6A 3BLYA 4EJOA 3QBQA 4D8MA 3AZXA 2ID3A 5A1AA 1AL23 4DNYA 5A7NA 4RL7A 2K3PA 3DPRC 1HRI2 1D8JA 1BBT3 2WS93 1BEV2 5J6XA 1U0AA 3K4DA 3PSFA 3FIWA 2VMHA 2VZVA 1RUC2 1DYPA 4CGZA 1O3SA 5LEJA 3OSDA 1PM4A 1OCPA 1L7QA 1O7LA 5A33A 2W1SA 4Q4W3 1DP7P 2E51A 2DU1A 2DTYA 4LNVA 4LK7A 2DYSH 2R49A 1IS4A 5FUPA 3K3OA 2XAQA 4QX8A 3UKVA 2WAOA 5FP4A 3THCA 2JVGA 3JCIA 1PK6B 3IC7A 4BXUA 3SCGA 3LDBA 1NG0A 4Q8LA 5F5QA 3KLSA 3GNEA 4QX1A 1C0WA 5EDNA 2JG9B 2NP0A 1MBJA 5J7MA 2PJPA 2FD5A 1BR4A 1LB2A 1RUG3 2E26A 3BROA 3HUGB 2YX4A 2VH9A 2XPWA 4AW7A 2B7YA 2YB7A 5FIXA 2OT7A 4MHGA 2X5IB 1LEBA 2L9VA 2D98A 3TNPB 2OTJI 3VDDB 4PDWC 3W6JB 1Y4WA 1JE8A 1D8KA 4Q47A 3FM5A 4CCDA 1PVEA 2OIIA 5ACA2 2QQLA 4Q27A 3VBSA 1NQDA 1MGTA 3N05A 1IXCA 3LNQA 2FQPA 1MZ5A 3WG2A 5K5QA 2JEMA 2PYTA 1IRZA 2F4OB 3E6BA 3OL3A 4PGHA 4AI9A 1MPXA 3ISPA 3MPBA 4XLCA 1OA3A 2IXCA 1NCRA 4AFMA 1UMZA 1J2XA 2GALA 2W25A 2K7LA 5FPLA 3ZQHA 3JRFA 4HAMA 5FPXA 5E3NA 5CYYA 2WL1A 1POQA 1NKGA 1U9OA 2YMZA 4IX7A 4AFAA 4CPBD 1S0IA 2XB0X 1RUNA 4U0WA 1FTZA 1NG7A 4UVAA 3K4LA 3SEEA 1F1ZA 3W21A 1JGGA 4BQYA 3MW2A 1D3YA 3BU0A 2KIUA 2K4JA 4L9BA 1N1VA 5C4WC 2HFHA 2WA0A 2OU2A 4BJTA 1SMTA 2R7RA 4NPLA 1VQKI 3I2GA 1W9SA 1OH3A 4AEDC 1JT6A 4QLCU 1MZFA 1XSRA 3DLAA 4NUBA 2DFIA 2Z4FA 3VZOA 4TTGA 4E7LA 3ZOIA 5FREA 1VAVA 2D3PA 2RR11 1K4SA 2ZPXA 3HD8B 4DEVA 4M9XA 2Z9OA 3VDXA 4ASLA 3JREA 5DS9A 3WTZA 4K8RB 3HN3A 2GBYA 1OR7A 3WZ1A 3ABKH 3ILFA 4E7IA 5FZMA 1OYYA 3K4NA 5A3NA 1MMAA 3PVNA 1XNKA 3H3LA 3MVPA 4FFGA 2EFOA 3ZN6A 1IN7A 1UZVA 3GJBA 1SD4A 3PUHA 1QZEA 3PMEA 4RR3C 1AYN1 1V9U1 2A6TA 4YARA 5ISLA 4QKFA 4OI2A 1GXQA 5BYNA 4FT8A 3JCUC 1UOJA 4OAZA 3O3KA 3AMPA 1MNEA 2VCCA 2CTVA 2HOAA 4IQ4A 4ATEA 2FNAA 2Q8DA 4UW3A 4KICA 2NS7A 4RN5A 3ZGKA 4N7IA 5KHIA 1AR93 1R71A 4UFJA 2X1CA 4MH0E 1Z7UA 2OF7A 5B5EC 2VBBA 1IPSA 1X8EA 3FLRA 4TN7A 2WBMA 5FY5A 2COBA 2BHYA 4R9AA 4FPGA 4EQVA 2GOXB 4PCRA 2RN7A 4YIFA 2GIVA 5FKCA 3TB0A 1T6GC 3G71I 1ZGWA 2ZGUA 1Z05A 2HZTA 1J83A 4CZSA 1TWGJ 3HVDA 4JX0A 4M73A 1VBB2 2DOFA 1QQP1 3CCUI 1REEA 5FBJA 2HYGD 3Q0UA 2PHLA 1ZZ6A 4IV1C 1V0AA 2F48A 3IKTA 1AJKA 3LGRA 3POBA 1F4HA 5GAGJ 4C9YA 3MIGA 1ETXA 3E6DA 3OYDA 1WVRA 4P9UA 3KS7A 2CH0A 4FE7A 4CUCA 4I2OA 4UUTA 4BQ2A 2P8TA 5JMCA 5J4YA 2E71A 4FPHA 4CXXA 1TZLA 4XPVA 1IN6A 4YYOA 3IB3A 4FTSA 2E9QA 2R071 3IWZA 4KDPA 1RR8C 1W7PD 4C2MJ 2WNEA 2DA4A 2VOKA 3OGRA 1H9PA 5L3GA 3ZN4A 2NOGA 4W8JA 1X4PA 5CKQA 2K9QA 2Y64A 1P92A 2X48A 5C33A 3C2UA 2CV0A 3NNMA 3S0MA 4GMP3 4AAPA 3CLOA 3A03A 1VBA3 2QFEA 2ZABA 1O4TA 4TLFA 4AHYA 5C4JJ 1KU2A 5BOXA 1EPZA 1YE9A 2VOOA 3MCZA 5JWPA 1QVTA 3PNAA 4KN7X 3FHQA 1R49A 2IXSA 2VZOA 3B94A 1KU9A 2B46X 1WH5A 2I45A 1E17A 3R4SA 3D3AA 1T95A 1WCSA 3WF0A 2XPUA 3KE2A 2ZFUA 5BPDA 1YX5A 2DUQA 2FDIA 4EEFG 1J1LA 5JOZA 5G05L 1E3HA 1IAWA 3ZIWA 5DPNA 4I7HA 3OYLA 4B8EA 3OYNA 4RGRA 3KP2A 2LY9A 1W0OA 5M3MJ 3KQ4B 1XMXA 4P02B 4UFIA 1DQ4A 2VTXJ 2K0GA 1LUJB 1EV13 4AUXA 2V79A 5A7PA 1ZYRF 1RUJ2 5IT3A 4CUBA 1MZEA 2KJBA 4OHZA 2WC2A 1USTA 3F8CA 4XFIA 3ILNA 1XSDA 1G2HA 3WOGA 2DT6A 5A2QZ 3KV9A 4CCMA 4F55A 3L2CA 1RC9A 5CVVA 1RMU1 3FHIB 1F35A 4AG4A 3DPRA 3Q9VA 1LEMA 3ZSJA 2ZTNA 1Z7LA 3A1YA 2D5FA 3B69A 4YFWA 1AWCA 4B1MA 2W94A 1SC7A 4ZY9A 4LD5A 4QU1A 4XN3A 1ZQ3P 1PMHX 3QLQA 4FPFA 3U14A 4YM1A 3FKJA 3WUDA 2W00A 3QYFA 4BDZA 2JPBA 3CO6C 4BE0A 3HN1A 3CCVI 3QPSA 4WVMA 1PGL2 1QGPA 1ZG5A 1LOCA 1WWYA 3HOUJ 4ASKA 1HC8A 1E5HA 2IS4A 2X09A 5FPAA 1UKRA 5GJ6A 2HEOA 2QQUA 2JG8A 3BJAA 1RUI2 3H42B 1JT0A 3POGA 2B7EA 2GC2A 1GXPA 1LEAA 1RINA 5E8GA 2G4IA 4Y4YA 3APBA 4TZDA 1IV6A 1UHWA 4O65A 4O9GA 4XOTA 1ZH5A 5LBBA 3HJEA 3K1NA 4AU7A 4XLEA 4LLGF 3NKTA 4A6EA 3K51A 4NO4A 4M00A 1D0HA 4Z2YA 1O7FA 2B9SA 4RGGA 4W50A 2R5YA 3BOWA 4EM2A 1HBXG 2QNKA 4LITA 2R5ZB 4HYEA 1AR71 2ZXQA 3UL2A 5FP8A 1LOFC 2EICA 2VZSA 1I5ZA 4GZ9A 4MXVA 4QMAA 5F39A 2M3AA 4AYBA 3NO8A 4XRFA 1OKOA 4CDWB 4MQVA 5I8TA 3IIAA 3SNMA 4NAMA 3WD5A 3KM5A 4XBLA 1PP8F 1YI7A 2TBVA 3HKZA 4BA6A 3LSMA 1QJEA 1BI1A 4HX4A 1WKMA 1FP2A 2EIBA 3H0DA 1L3JA 4MV2A 4M3FA 4XICA 1X82A 1E0EA 2QQWA 5DZFA 3AJZA 3WINE 1W8FA 1Q3EA 4IV3C 2VIXA 1BC7C 4Y1ZA 1W28A 1HLVA 5C6CA 1XPXA 3N7KA 5FYTA 5JR3A 2HBTA 2B63J 4HQMA 2XRNA 3HSRA 3GYHX 1WJAA 3KP3A 3NNLA 5E8AA 3J8F1 5CFDA 1W7PA 3AYEA 2HQAA 2B9VA 3LA2A 4GXLA 3LSGA 4WM7C 5L7OC 1XYOA 1CZTA 5FXVA 3NL1A 3Q8FA 1O8PA 2LKSA 3O1PA 3ZCOA 2D93A 3A4CA 2HDCA 2EAKA 1WW6A 3POSA 4YG3A 2OPWA 2MH9A 5J3UA 5ANQA 4PSWA 3R4DB 2FBKA 1RZ4A 1HW2A 3JRAA 4W4ZA 4KL1A 2IWGB 3LAGA 3P3NA 3MIDA 3JQWA 2W84A 3EJKA 4LORA 3ZFFC 1M06G 2YC0A 1YOVB 3BDDA 1WCQA 2RR13 3OR1C 2VGDA 5C9AC 2VXJA 1SZBA 1X9TA 2ZKZA 3T3YA 1JYXA 1VQ7I 2XDVA 5FTTC 2PXJA 1MS9A 2L7KA 2ZFWA 3MHZA 1C3HA 1ULCA 3I2FA 4LBQD 2HWE1 3OYKA 3AVRA 4IHVA 4KT5C 2XJSA 3GF2A 2PLYA 3MF6A 2O8XA 3AXDA 1JUMA 1PHMA 1XGNA 4LK0F 3CLPA 4UT5A 1AYN3 1V9U3 2FUG2 1IG0A 4CP0A 3QAHA 1R092 2EXKA 2Q5TA 2PG4A 3OOPA 4CICA 3P7NA 1B35C 3MLLA 4Z07A 5A3WA 4WVVA 5IYYA 4A42A 3ZN0A 1AL22 2KM2A 5HVQC 3ZDVA 4C8DA 4ESBA 1HQCA 1BBT2 4EROA 2AQFA 2YPRA 2R30A 4C91A 2JK3A 2WFPA 4ANJA 2VUMJ 2LD5A 3U9GA 4FCAA 5GZFA 4W97A 5HI0A 4E4HA 4Q4W2 1A35A 3GTKJ 4ZS3A 1R36A 1O91A 4CXWA 4LGWA 5JDBA 5E1ZB 1O3QA 3I5UA 3BTAA 5GAHJ 1QQP3 2XAHA 1G9FA 3NNFA 4EM1A 2GDFA 4BQWA 2YFUA 4M9ZA 2V09A 1U8RA 3H9AA 2IUWA 1TQIA 1VQ5I 5FY9A 4N43A 2OTLI 1UYXA 2E35A 4LUMA 2IXJA 4RS5B 2ETHA 2VE1A 1Y39A 1RUG2 3BR6A 1MW7A 2L7MP 1HSTA 2V9PA 3VBRB 5IP7J 2DA1A 2CY6A 3TEWA 3WQ7A 4CU8A 3T0BA 1OFNA 2EALA 4CP9B 1LJ9A 4B1LA 2XPJA 1I1GA 1H88C 3THPA 3WHBA 5DZGA 3SCHA 2P81A 3NAUA 2R073 4YM2A 2OZJA 4A6OA 4YW2A 4XKVA 1JMUB 2FF4A 1K61A 4GYIA 2KHMA 1GV5A 3LA7A 2ARAA 4IL7A 1S55A 2RQPA 5EJ3A 3VKLA 4LLOA 3LCPA 2VKHA 3IP4B 4PFOA 5FJHA 3WGGA 1EJ9A 5LD2C 4WM8C 2VBXA 1LESA 1JYWA 1GQGA 2Q8KA 3OY9A 2OQ6A 3ZMUA 2CUEA 2VC0A 4PIZA 1SFKA 1Q56A 1NE6A 3RGBA 3B5LB 3C7FA 1GYKA 4JRLA 4CA9A 1QJZA 1GNYA 2VPLA 1APNA 1W0UA 3ERED 4UFLA 1R4MB 3Q0WA 5A32B 3KGZA 2ZGNA 2BTVC 4XETA 2DO7A 5FMCA 1D2SA 1X36A 4D6SA 2CV2A 2OYZA 1G3YA 4ITVA 1YXWA 3TWIA 3UYJA 3RWNA 5ABJA 2CFXA 2ZX1A 5IK4A 4D1QA 1EAH1 3DU6A 2WAQA 3S3OA 1UG2A 4Y1UA 2UWBA 1SD7A 2VZQA 5TISC 3FLPA 2BY2A 3HKZN 3S57A 2JE7A 1YLLA 3WDUA 4Q0QA 1F5FA 2EFPA 3M8FA 1ON1A 4QXCA 2RDSA 3C7OA 5FKKA 2ZX2A 1KRIA 4QQPA 3LWFA 4ISQA 1AHDP 4B3NA 1LOGA 2YUEA 2F2EA 3FHNA 1RMU3 2VOXA 2VODA 2WUHA 1NT0A 5JVVA 5E20A 4ABZA 3WR0A 4PLMA 4EE2A 4FX0A 4Q4ZF 3RKWA 2OUJA 5FLVA 1MIJA 3OYIA 5C3QA 2KD7A 1IKQA 3TOAA 1CGPA 2HBUA 4ZHNA 3M3OA 2O03A 3RI4A 3KZYA 3CJIA 2XQXA 1TWFJ 2CGNA 3ACIA 2BPA2 4XBFA 2R7XA 2FCVA 2ZX3A 3A2KA 3LDKA 3N9MA 1BK1A 5JR2A 1VP6A 2W47A 4OZXA 1WKYA 1UY2A 3V65A 1GZTA 5F37A 4YM3A 1W9WA 5D5WB 2R7FA 1VQOI 1BOAA 2ZMEC 2ZEWA 1TNRA 4LIVA 4MTEA 1N3PA 5CLSA 4CUAA 1AR92 2WRAA 4LBQA 3G6JB 1RB8G 4Q29A 2Y26A 5FZFA 1VRH1 3D0SA 4HV5A 1CAXB 4BLIA 3J81K 4QGLA 5C8CA 1LHVA 4P14A 4U36A 3BTZA 4E27A 3I2OA 3B01A 2DT5A 1P4WA 3CJTB 4R52A 2WABA 2CYYA 1LOFA 3VBHB 3WNKA 5A1FA 3CCRI 1EP0A 2E1MC 2WJSA 5FFOC 2XIGA 4OIRF 4IE5A 4MZUA 1UU4A 3KV4A 3H5RA 4Q0SA 3VBFC 5DUVA 2JQ7A 2GN3A 3I3DA 1AF9A 3A7QA 2E2HJ 2DOAA 5T50A 1AR73 3JTHA 5FQ0B 3BKZA 1GMMA 1LR5A 3K6GA 2MPFA 1FEXA 3JBG1 4AWXB 2VBPA 4FXGB 5FZLA 5FLJA 5JSPA 4IEYA 2GNDA 1VBC1 2QBYA 2A6ZA 3JB8A 1G9BA 1FSHA 2GNBA 3TDUC 3IT8A 3AMNA 1TVGA 3MLJA 4QPGA 2MEV1 1UHMA 5E8IA 3O1RA 5BMZA 2UV1A 1NCQA 3QACA 4RGUA 5M5XJ 1OMIA 1DHKB 1XE0A 2PI0A 2ZKNA 5K5RA 3TYJA 4F52A 1A31A 1N1YA 1COV1 1LU1A 3G6EI 1TT5B 4URAA 2MD0A 1A6CA 2J5PA 5DYMA 2IGNA 3X2QH 1WJDA 4PQ9A 2BUKA 4QPIB 2CAUA 2EF6A 2LTPA 3P5BA 1YW9A 2VJ4A 1ODNA 3ZFEC 3L1PA 4LFUA 3HPNA 1RRJA 3U4XA 2OQGA 2VJXA 4NRPA 4XMAA 3ZFGB 4LO5B 2RGVA 3THTA 1Q43A 1MBEA 1VBA2 5J1YA 1UCXA 2WO3A 4RHV1 5CNAA 3J8F3 4YNIA 1A8MA 2GP5A 4QPQA 3EHKA 4XR6A 3OY8A 3IZOA 3H8OA 1SANA 1SPPB 2GLOA 2EZLA 5KWRA 2G9WA 3IPVB 1Z67A 4ZYAA 1KZHA 2YDEA 5BPXA 4A93J 3KYDB 4X1EA 3AZZA 4LR4A 3OSFA 2DUPA 5EIYB 4OVEA 1OFCX 1W90A 4CDQC 4A3JJ 2ECCA 4A3BJ 5T5OA 3GEZA 3RZDJ 2LROA 5L36A 5L3CA 3NMBA 4D7MA 3C7HA 2PLV3 5CVRA 3GZ6A 3BN6A 5JLWA 1PMJX 2WZR1 4ZJZA 1VBE1 3RPQA 2QTWB 2E5NA 3BYWA 2VOWA 4C2TA 1N75A 3IMNA 3IWFA 3SH3A 3WTUC 2K4BA 3WUCA 3HHGA 1B35A 2Y6KA 3CCYA 2XB6C 4HX8A 1UPIA 1ZYBA 2HWE3 3PL8A 3R05A 3SMHA 3TBIA 5CFCA 4A12A 2OVUA 3CCMI 3VL8A 3Q8CA 4EVIA 3ASNH 2XGCA 1JOPA 5D4RA 4NE9A 2D40A 4G12A 4HG6B 5D5UB 4JC1A 2O3FA 4UVCA 1P6RA 5F3GA 3LSDA 1WLWA 5E1XA 3E7LA 4CEYA 2GWRA 5T55A 4L9JA 1IGOA 5CEHA 4RLQA 1YTYA 2IVMA 1RR7A 4KBBA 2EXJA 4LOCA 2C4XA 1GT0C 2DWRA 4SBVA 3TOBA 3E1SA 4JGYC 3PO3J 1SDDB 2PHDA 3BTYA 5FLXK 2LFBA 1OOPB 1YRNA 1B9NA 1BVVA 2PAMA 4NQWA 1I27A 4A7KA 4KH9A 2AHQA 3W6KB 1BR2A 4RFT0 2JDHA 1W06A 1MH3A 3DWLE 1HRV1 3BJOA 4IHYA 1X3UA 1JHFA 1RXGA 2VBYA 4FQGA 4A41A 5CKMA 1UNBA 2BW3A 3A23A 1CJDA 2EFNA 4MXWA 3K75B 2QSGX 4HX7A 2MGQA 2AUYA 4A44A 3DFGA 1R1ZA 5FLIA 5K0UB 1LENA 4YFXF 2RJ2A 5B1AH 1DGRN 4CDGA 5G04L 3NWTA 1CJPA 2OZ6A 5EEHA 4CEWA 3MLKA 3EUHC 3DEUA 3DEWA 1QJY1 3KEOA 2R041 3TW7A 1O4YA 2C1FA 3ZQGA 2NVQJ 1ODMA 3ZM8A 2RS32 1ND2B 3OIPA 2WNUC 4GFBA 3BTXA 4WM8A 1H8TC 3CMMA 4H4KC 4K1YA 4AEKA 1GUUA 2BNNA 1X3ZB 5JXIA 2GNTA 4N7UA 3M3IA 2RMU1 3FBNB 3HNMA 1HXS1 4NDLA 3CLQA 4NIIA 2AQEA 4MFDA 3WDWA 4HONA 5FB2A 3M8JA 2JIJA 4QSHA 3AKPA 4BEHB 1UELB 2Q2EB 1YQ5A 4O7XA 2HWB2 3WDYA 1UCRA 2CSOA 1OBNA 4NPMA 4IEUA 3ZQLA 3LQRA 2A7AA 2RAEA 1Z9CA 2XGDA 3D5LA 3ZXDA 1NHAA 4QPWA 5FXZA 1OCTC 1P7IA 1LFUP 1PMIA 4CCLA 1AX1A 5IVEA 2VECA 1US3A 5BNNA 2XAUA 1J84A 3Q5FA 4FQ4A 2JG9A 3E5QA 2F5DA 5FXWA 3K4MA 3CMYA 3ETPA 1OLME 1ZVFA 4K3UA 2JA2A 2QZ8A 3HUGA 2DA5A 2LUWA 3I55I 3POEA 1HKSA 3DBLB 2UUZA 3FC0A 1WA6X 1D5YA 1TMF1 5CKNA 3VDDA 1JOJA 1ULPA 1EAH3 3HRMA 3IDAA 3OBRA 4ZC3A 3HT2A 2AZ5A 4YIIA 3S14J 2W08A 5D5XB 1KQRA 2VNVA 4RB1A 5FP9A 4IQPA 4FBFA 3JRGA 4I3GA 1PVC1 2VNOA 5J1RA 5FZ6A 2DQLA 2DYRH 2GXGA 1RUD1 3U07A 2JTVA 4XUTA 1J0RA 1YHQI 2QA4I 5F64A 2OPKA 1ND3C 1FOXA 3H9JA 1RKWA 4M3CF 1NLRA 4UXAA 4WXDA 1G9AA 3MD2A 3KLNA 3LQQA 3DTEA 1RETA 5EYYA 2J1UA 1J3PA 1J7KA 5EJCA 2LMDA 2BVMA 2RR12 5F7UA 5BY5A 3HHHA 4JP0A 4AYUA 4XUOA 4CXFA 2QQ8A 2JDKA 3G4SI 1PNGA 3J7ZI 3H1CA 1XNBA 1ZZ7A 3DTKA 1RUE1 3CZ6A 3FF5A 3SHRA 2QKLB 2A3WA 2IEKA 3UV9A 1JI6A 1RC6A 2P17A 5T5JA 3EQLF 1FI2A 5LA0A 4A3DJ 1AYN2 4BDYA 4Q4Y2 4H55A 4XQDA 3GTMJ 2PN5A 1SD5A 1FBQA 5A1LA 3KSCA 3MO4A 2FOKA 5IP6A 3A21A 2FJ1A 4BHPA 2AEZA 3GFJA 1JTXA 4QKBA 1FBUA 2CS3A 1B4AA 3MUZ1 1RIRA 3H5AA 2ZGOA 4LHNA 2XJRA 2KRHA 4FTHA 2YBKA 4EJRA 1I3AA 5HNHA 2XR4A 5FZ4A 4XONA 3C18A 5FY8A 2JZYA 4D9JA 2EJRA 3CC2I 3J7AY 4YFZA 4I98B 3VBUB 3AKZA 2W1OA 4AOCA 5FZIA 1U5XA 2DFHA 4M01A 1VIWB 1XNDA 4IO9F 4NIDA 1K6OA 5K7HA 3B6AA 3VBOB 3MUY1 3AK0A 4F83A 1G3SA 5FLMJ 3SZGA 3RI9A 3BODA 1QQP2 2GP3A 1VNDA 4PLOA 2V6CA 1O57A 4DO0A 2D2WA 2R16A 4KMQA 3ZYPA 5IFTA 4FFIA 4G9SB 1BA5A 3JBG3 5EZGA 2MW8A 1YITI 1VBC3 1UZZA 2L2OA 3LWCA 3JRHA 3RYKA 3T4HB 4UXNA 4Z6YA 1YFWA 2MEV3 2VQAA 1MSEC 3UJOA 1OLMA 1UU5A 5LW9A 1BLZA 2R072 3E1F1 3SEQA 1COV3 4N9HA 4RB3C 4MGIE 1R6RA 1GZCA 4MO7A 2XLAA 5C3OA 1HJGA 4COVA 4OHXA 5J1UA 3BOQA 4HSRA 3ZOBA 4PCQA 4OI4A 1QHHD 1NAEA 1NX9A 1NOVA 4LKEA 5FYZA 4M74A 4NAOA 2B42B 4LTAA 4NIGA 1ZRRA 3Q8EA 4I0WB 4RHV3 1W03A 1NY72 1HB3A 2RS11 2E1OA 3SITA 1BW6A 3A0BC 1ZZBA 2BJSA 2EV6A 2VL4A 1RNLA 2YFZA 1FMD2 2YY1A 2PQ8A 5DM7F 2YBPA 1W6MB 2M30A 1R64A 3IAM2 1YHFA 2JB4A 4QXBA 3OPTA 1GWLA 3HEFA 1PJRA 5T3NA 1Q5OA 3K1MA 1IV8A 1QIQA 1O3RA 4G7ZF 4YZ4A 4YGDA 2RVCA 3P9IA 5E17F 4LQRA 5JUVA 2FMLA 1IJWC 4JQFA 3WW1A 4MG2A 1HLCA 4DQAA 5GZEA 3MV01 2AEYA 5JIAA 3C3WA 2X4HA 2EXIA 3OSGA 2WZR3 1NZCA 4AQ2A 4XUPA 3AFGA 1VBE3 2PEXA 1J59A 4XE9A 2VZ3A 2KLOA 2MD5A 3DPUA 3A0KA 3QH7A 3OCPA 3LL7A 3GFLA 4OIPF 4KG0A 4QD2A 1B09A 1IPKA 2M34A 4YG6A 4N53C 1RMU2 2XF5A 4AAXA 2OPTA 3KT1A 4M6YA 2G7UA 1UPSA 2LW8A 1X58A 4XXAA 2Y6JA 1IHMA 2ESNA 1YIFA 4A3XA 1TWAJ 1X50A 1E5SA 3F8BA 4UHTA 2JKXA 5T5PA 4ESJA 3HTUA 4NC6A 1KYWA 1QPIA 1S7OA 1OF4A 1XSXA 2BRTA 3H1WA 2VC9A 5JVTA 5BNPA 4BS9A 1ZKGA 3FXLA 4A5NA 1ULEA 4YVWB 3VDCA 2XJUA 2VMFA 4CU6A 4HRIA 2H0BA 2VL8A 4N4OB 5HLTA 4KU8A 3ZYBA 2UY8A 4HSTA 3FK6A 4P9FA 4DFSA 4NOTA 3WV6A 2KIQA 1HQLA 4WCGA 2VQ0A 4P5OA 3EMRA 1IN4A 2QF7A 4XTMA 3GZUC 1Y1WJ 2G19A 4RMNA 2YU1A 1HRV3 2ZNYA 4Y1XA 1VQ9I 1YO8A 2KP6A 1CAVA 4YELA 2K40A 3HR9A 3PUAA 4FQZA 3BR0A 1CQTA 1IDYA 3SXWA 4HK9A 4EN6B 2RNJA 4M3GA 1AR81 4NIHA 3NWSA 5M5YJ 2CO5A 3JSOA 2DDAA 3MN2A 3IAS2 1LFBA 3UJQA 4LO7A 1QZZA 4CH7A 1V6NA 2MA3A 3OUJA 3WNLA 1JZ2A 1TWHJ 2R1DA 2EINH 1QJY3 1Z3XA 2R043 4OMZA 2C24A 3HWJA 3OV8A 3G1LA 1AR72 1SCSA 3ILRA 2CSGA 3KVAA 1LGNA 3NAPC 1XE7A 2RS52 3VZMA 2KIMA 1JZ5A 2RMU3 1TME1 2FU4A 1HXS3 5HPOA 4JDMA 4DUWA 3SZTA 4ENMA 1H0MA 2JUCA 3HQUA 1DCSA 3VB9A 3SQOA 1PP7U 2GXBA 4DQ2A 4DS0A 4M6VA 4XKBA 1OJLA 3T2TA 4WF2A 3E5UA 4K8FA 4DXRA 4ZKTB 5LFAA 2LNBA 3WCSA 5L3BA 1AX2A 2W7NA 4DNCA 4LKSA 4AXOA 1U5TC 2K86A 3SKJE 3CU7A 4FPYA 2SBAA 5FFZA 2W82A 4F7ZA 1TQ5A 5K5OA 5EG0B 5C3PA 3S1MJ 2IJLA 2NXNB 3VKOA 4WV8A 4HLXA 2Y6FA 5F6KA 1C8M2 3IDEA 3J8F2 1TMF3 4B7EA 1I9RA 1DQUA 3GZ5A 5FMOS 2R5ZA 5LY1A 4YGCA 3OJBA 2BVVA 4MEXF 1XQNA 4RAZA 3O1VA 1DGWA 2ZJQF 3D8CA 4OIOF 1NA1C 2LH9A 4UV8A 3ZPLA 2WBKA 4AVCA 3VODA 4XQFA 1RI7A 4H0EA 4U2AA 4GQ7A 1YYNA 5B4NA 4G9YA 1PVC3 2XVLA 1RUD3 4CDWA 2QQOA 3PFIA 1ONAA 2YC2A 3ZMDA 4AVTA 2V4VA 5CVUA 4PHZA 3DKQA 4BXXJ 1T0FA 2V72A 3X29B 2FZ2A 2CW8A 1US2A 2XGXA 1MKMA 1X7NA 4AIJA 2EFQA 2JDZA 3IIIA 3AG2H 1ETKA 4A3FJ 3W9AA 3HPHA 3WHCA 4FE4A 1A5JA 4Z2AA 4LT5A 1Y3TA 1K3IA 3W2VA 2YU2A 4U7BA 1PVXA 5FYIA 3LSJA 3M70A 4XORA 1MD0A 3BWGA 3JSPA 1RUE3 4UFHA 4XLHA 2EV0A 5HODA 4C0HA 3VEPA 2HWE2 3MIBA 2W57A 2O8KA 1BI2A 2XH6A 1JN2P 4ZU7A 4WVWA 1OLRA 2JSCA 2VKEA 4LG0B 2LG4A 2NVUB 2XBO1 3OMYA 4XIOA 2ZHKA 3M1CA 2VM9A 2KR2A 3JZVA 4XEZA 4V19K 3OEAA 4C90A 1W0TA 2A07F 3F9KA 4AIHA 1W2NA 2B45X 4RQPB 2OJED 1VQ6I 2NVYJ 1WGXA 1LAJA 1WD3A 2QSHX 4DUVA 2IBDA 3KB5A 1F4AA 4QTRA 1CPMA 3WU1B 4Z1VA 5HDNA 3FMRA 5CVJA 4JGZC 2VPRA 1KU7A 4Q48A 4I0AA 2BNOA 4EJUA 1S0CA 2MFZA 1DZTA 1OLQA 4GJZA 3LSPA 2ET7A 4GJYA 1YC61 1ASJ2 4YLZA 5FY1A 3LOIA 1DQ2A 3WSOA 4BGDA 4EZHA 5JI7A 2DFEA 2XKOA 2DA2A 4ON0A 1ENQA 1SQ4A 2E33A 2Y30A 1MJ9A 4FVVA 1EY2A 5DAPA 4O6JA 2QDNA 1QBJA 4OI1A 5H9SA 3N36A 4A0YA 4ZH4F 1H8AC 4GULA 2KQRA 4OQ9A 4AI3A 1MJBA 2M7AA 4Y4RA 2HH9A 1PIV2 1VZ0A 4V2GA 1XBFA 2HWC1 2NMOA 4Q5SF 4OCTA 3FXKA 2J1VA 3NAPB 2OX0A 1Y0NA 1X1AA 4EWDA 1IS5A 3VZNA 3U11A 3T4VA 1MMGA 1UXZA 3TKYA 2KFDA 2HYFA 3M7GA 4Y22B 2UYBA 1Y0UA 2BOJA 4ARYA 3DKYA 2AACA 1ZBA1 3A02A 5AC91 1ZN2A 1GDTA 3O1TA 2R0HA 1BCXA 1HF0A 5JVGF 2C9KA 4Z92B 5J96B 2DK8A 4BMEA 4XYXA 2IP2A 5HS9A 1QJX1 4XOGA 1Q8SA 2STWA 3WTWC 2ELKA 3ERMA 2Y6GA 3KX2A 3T8TA 2EZIA 2RS13 2VJ5A 4RA0A 1AXYA 4MGRA 2VZUA 4EJVA 1QEXA 4IERA 1YX3A 2RV8A 1JGSA 1M4WA 2R061 4R8HA 2IGKA 3AMHA 1BN5A 4RS5A 2CL2A 4NVPA 3AG3H 3WTXC 3GO5A 2PQQA 3HOZJ 2D6KA 4XUNA 3I2IA 2QVSB 3VBRA 2VJIA 4L5EA 5IVYA 3I71A 2CW7A 1N77A 4IUGA 4AGGA 3ZMNA 3RJRA 3DCQA 5JZGB 2K02A 1X19A 2W3JA 5F6LB 1HQWA 3BPSA 4AHZA 4L5JA 3FISA 3Q8AA 2HS5A 4L0ZB 3WTTC 5LHIA 1DGRM 2HWD1 3DXJF 3J80Z 4UUVA 4QXKA 3RFRA 5IHRA 1HN1A 5LZ6A 2PMHA 5BNGA 1U5IA 3WQ0A 1OVSA 5FPVA 1XYNA 1CVNA 2XJQA 2ZGTA 2KPMA 2WB1A 5F27A 4EV0A 3VHNA 3BC8A 1HV1A 2P1BA 3KD4A 3U1DA 4PT6A 1Z7S1 4E7JA 2YS9A 3OEBA 4FASD 3L2QA 2YC4A 4AVSA 4A6DA 2JE9A 4XF3A 5A2QK 2ISYA 1MACA 4CCCA 4OUEA 5FCCA 3N7LA 1AOYA 2LYCA 4EM0B 1UW8A 2EIMH 2WDBA 4ZYEA 1JW6A 4V2VA 3HGYA 1NXMA 3FN9A 2WNOA 1RUH2 3N97A 5DCMB 4GH4B 4XNFA 5EJ1B 3OG2A 1UMIA 4XL9A 2JDYA 1O4ZA 2ZXHA 3R60A 1V54H 2E2IJ 1FYKA 1ETWA 6PAXA 4PQQA 3ZXLA 4HT1T 1BIAA 1HCRA 4HDVA 2VMGA 3U78A 4MFEA 3L2YA 3PVEA 2DK5A 1MS1A 3CDIA 3ZXKA 2PJRB 1VRH2 5FUNA 3JRCA 3KEQA 4HLYA 4LO8A 3DBHB 4QDQA 1AR83 4D94A 4H7LA 2ORXA 1ZA4A 2DW4A 2BVBA 1TBXA 2FEZA 1DZRA 2XJVA 3ME2A 1MZ6A 2ARBA 1PZ9A 5FY4A 2JSPA 2RM21 5FPBA 1FNZA 4XQ4A 3VHOA 1QJFA 5IVFA 5JOXA 2H94A 4QPOA 1RKTA 3ZVXA 5FLXZ 1GP4A 1W9TA 4XK4A 1JU3A 2HKXA 2VLAA 4XFBA 3WNNA 4ZTFA 3JBG2 2R7VA 3MFCA 4S2DA 5LK5A 4R9BA 2O8OA 4RB0A 1VBC2 1R7JA 1TME3 3I4NJ 1X3WB 1ULGA 1FMWA 1S0BA 2BDRA 1I5PA 3NJVA 4XFGA 3HQXA 4FPOB 3SKVA 4GDFA 3RZZA 1XN7A 3PUIA 4COUA 2FQ4A 4ZS2A 2GZWA 4B4RA 1GQHA 4JCKA 4AFBA 1W2TA 1O5UA 4I30A 3WF3A 5CYVA 4QWNA 1CAXA 1X1BA 2XAFA 1D4M1 2V1XA 1OSGA 2OCCH 2VQLA 2P4WA 2X53S 1GWMA 4IEWA 3V8JA 2M45A 2IVIB 2GNMA 4S2GA 1AUYA 3FKIJ 3FFQA 2FQ3A 2WADA 4KIFA 3OD4A 2WN3A 2E2JJ 4RHV2 3OGVA 3SH4A 1EH6A 1GLNA 2XSDC 1G59A 2LSOA 5IJRA 5HV4A 5FQ0A 2Y9ZA 3S17J 3MKYB 2JT1A 2X51A 2KISA 1GNHA 4L0PA 1LVAA 3U1XA 3BG7A 3R4KA 3RKQA 2M4GA 1B9MA 1O4XA 1H4HA 4CCOA 2A3XA 2Y60A 3V7CA 1DP3A 3JQXA 1ZBE1 4JTNA 3VBSC 3RJPA 5GAEJ 1LJ7A 2WZR2 1XOYA 3FLTA 5T54A 1K83J 4QPIA 2F4PA 1DU0A 4CO8A 1W05A 3O14A 4Z82A 1B1BA 1L3LA 3NKGA 4IRGA 2BY0A 1OKRA 4Q0PA 3GFIA 1X1DA 3ZFGA 1O6UA 1FIPA 2A69F 4CVUA 4XQWA 2K3FA 1Y6IA 1AKHB 1QA6A 2XBO3 2M5WA 4EQQA 3QP5A 3TO7A 4BDVB 2XONA 4QQHA 5D8AB 3M07A 1AVBA 1W4MA 2JVHA 3I64A 4PK4A 4R4ZA 4HXCA 3F23A 1FV3A 4JGZA 3BZ6A 1SPPA 1Y56A 3S1RJ 2DJNA 4BMBA 3AL6A 3MAJA 2Q8CA 1MQTB 3IPVA 4BUPA 4NRMA 1S8NA 3GJAA 3ORJA 4NRQA 2J1RA 4MTDA 3CNAA 1ETVA 1ZK8A 4K7JA 4QHOA 3GTGJ 2OA4A 3RZGA 4JDNA 4HKLA 2FX0A 2HXIA 2YYOA 3O8HA 5DM6F 1R5GA 1VMFA 1I39A 3HOVJ 2TEPA 1AYM1 4HN0A 1SACA 3BUCA 4OLLA 4XJAA 3ZXEA 1XMKA 4YM0A 2V9KA 3BG6A 2DCKA 1QGLA 4UUSA 5AIQA 5FKBA 2UYAA 4AC0A 2O0OA 2EBIA 4IE4A 2VTXA 2IGOA 1OPOA 2R93J 1WQ2A 4XLFA 4MGTA 2VXDA 3C2HA 3ZMTA 2W1WA 4OUMA 3GZEA 3ZXJA 2BBYA 5FRMA 3MZ8A 1NK2P 5K4LA 1VQNI 1I50J 3JB4C 4HVQA 2EB7A 3FHAA 1QU0A 2YZ4A 3AL0C 1J5YA 1OR7C 4BJ0A 4L0YB 1QNWA 3J9SA 3ZN1A 2ZMLA 2R042 4LE4A 2GC3A 3NJXA 4L99A 4NHYA 1XB9A 5BNOC 3KQRA 1H9TA 4Y5TA 1H9WA 4D5CA 5IYBJ 2RMU2 1ZBA3 1HXS2 5AC93 4CDUB 2CV6A 4BQNA 3VD3A 1BKZA 1O5LA 2XOMA 4GAZA 1KQ9A 3SC7X 2BFUS 3H3UA 1LOBA 1QJX3 1J58A 1QJU1 5A33B 4RAGA 3JD73 4MNUA 2V1UA 3VHRA 4OMYA 3S15J 1WI9A 5FZHA 3TW6A 1UF2C 4Y3OA 3H8RA 3TOJA 3WDXA 3N9PA 4S05A 3WP5A 2BXZA 2P7VB 4DY3A 1IN5A 4FXKB 4D69A 2GA2A 4FSJA 2XHKA 1ULFA 2R063 1VTNC 5K0UA 1GV2A 5DG2A 4KITB 4XBNA 4BH9A 3VDAA 5I93A 4QU2A 2P37A 5DZEA 3QH6A 1PDNC 2PHXA 2CQXA 1RYYA 4LBKA 2XAGA 4KN4X 1ND2A 3WGHA 4HK8A 5AVAA 2BZTA 3VZJA 3O0VA 3LEKA 5CZKA 3GHNA 4NROA 3IL2A 4E7ZA 2TCTA 1PVC2 2R7WA 1U5ZA 4YZ5A 1XGSA 1M1EB 4INDA 4NIAA 1W2UA 1XNTA 4A7YA 4BZ4A 2HWD3 4BEHA 2Q2EA 1H1AA 4AQ6A 3O0XA 3ZSEA 2M2EA 4UAPA 1V6MA 4FISA 3OYHA 1MS8A 1SFXA 1Q1HA 3RKXA 1FAYA 1YQ8A 5GLTA 1D2QA 4AIKA 5IOYA 5IP9J 1WUVA 1Z7S3 5L9BA 3OTFA 1NCRB 4MYEA 4Q8KA 5LBEA 3B3QE 5JOWA 1KGSA 4LBNA 2WV1A 3HYIA 1CX4A 4BNCA 4CXYA 3B9IA 1OCCH 3CP2A 2Z5UA 1P2FA 2E1NA 2XUBA 1HXDA 2QQ9A 4XM3A 3CEWA 4DY5A 2D6NA 1D0GA 1MZBA 4R9CA 2QQAA 1ENRA 3ZQIA 3ZQ7A 2J1AA 3LEIA 2TRTA 3K1PA 4MX3A 1I3HA 2IXKA 1SBFA 2PHRA 5FZ0A 3ECHA 3VPRA 4LA2A 1TWCJ 2R92J 1H1MA 1ENSA 1CX1A 5FWEA 1XC5A 5E3MA 3S3NA 4YZ2A 5ACA1 5KHHA 1K5MB 2W68A 2FRHA 5FMOL 3TN91 2W2IA 2DURA 2WV0A 1JUIA 1JKQC 1WMEA 1D5VA 3NW4A 1K42A 1LOEA 4EJTA 4CTEA 1TW2A 1OURA 5FYYA 1IDZA 1RXFA 1Y8QB 3K69A 4ITCA 3USUB 3NQOA 1Q8QA 3BTLA 4W1UA 4HVRA 1YQCA 3SISA 2RM23 4M3CE 2J1EA 3AZVA 2ZXJA 4FCYA 2B9UA 4DXSA 3ZMSA 1AXKA 4UV9A 4D0QA 5DXDA 3T30A 1T08B 2V26A 5FPZA 4MGSA 1W5SA 1F31A 2XLGA 3BZKA 5I91A 3S1QJ 3RQ4A 3EETA 2JN6A 5DV5A 4S0HB 1G8WA 2EQRA 5DEQA 1QRYA 1WLDA 2VY0A 4ARXA 1F9KA 4WXCA 4QHBA 2W52A 3T0YA 2YBSA 2YV8A 1IUYA 2RNGA 1ZZ8A 1XPWA 1QF3A 1ALYA 5TRDA 4ZZDA 1ZRDA 2ZX0A 4TLGA 2EIEA 5K7PA 1E57A 2LKXA 1TNSA 4HF0A 5KBFA 2JJ6A 4QM9A 3VBUA 1D4M3 3VYSB 1VAKA 2A6VA 4C3HJ 3OGSA 2JG8C 3PVOA 3GW2A 4IRHA 1LE8B 1Z0HA 3OPZA 3C2GA 2DV9A 3VBOA 2VVFA 4RGSA 1R58A 5J09A 1WHUA 3I0TA 1PX3A 4GMP0 3CC7I 1H8VA 1MVEA 3CUQB 4K1ZA 1GLHA 1KFUL 3N9OA 2CUFA 2RS12 3OS0A 1W3XA 2VUCA 4RAFA 3WG3A 5KHGA 3DEMA 1RGSA 5DN2A 2DUOA 4NB5A 4OU0A 2L4AA 4C1WA 2X8KA 1UZWA 4GKXA 4NN0A 4XW3A 2M4KA 5EYRA 3KIOA 2Y0SN 4UI9L 5D1IA 1WMFA 2SLIA 5F9TA 3QD6A 3BP8A 4QWQA 1ZBE3 2BVLA 3VD7A 4XFFA 3LEMA 3PJRA 2WNVB 2JXAA 4Q26A 5AFEA 2H1LA 2WIIB 4H2AA 2D3RA 4XSXF 2JA8J 2Q8OA 1SFEA 4IW3A 3EXUA 1CF7A 4HKOA 2V1NA 3MMYB 2BYVE 3HOSA 3HDDA 1QOSA 2MHFA 1YJWI 1PX4A 4B4QA 1N25A 2E1CA 1Q8OA 4AHWA 3PIPF 1R1A2 3WY6A 4MGYE 4YVSC 1VJ2A 3N7JA 2HDWA 2ZBJA 3KCXA 4P08A 3NV3A 2RV9A 3L9JT 5C7GA 2W4SA 2VU9A 2YGMA 4LK6A 2VAUA 1IPJA 4FOYA 4BL0B 2GU9A 2WT2A 1W6MA 2O5RA 2QENA 3OWTA 2FZ1A 2P7CB 3C7JA 1LU2A 3M3QA 1LDDA 3OYJA 2MSYA 1V00A 4M3CA 1MNMC 1IXRC 2VNGA 2DDUA 5CFDC 2AREA 4IEVA 1ACIA 4IHTA 1BBYA 5FMBA 5FUIA 5A3UA 5FK8A 3PM1A 1XCBA 4LKFA 1AYM3 1OUSA 1GP6A 3POYA 4IGPA 5EV7A 1XU2A 3CL1A 2IS1A 2DLLA 2FDFA 1DPRA 2B5HA 3PNTA 4OMCA 2GN7A 3ZMZA 5A7WA 2NYXA 4U88A 2QCOA 3AAFA 2O1QA 2W85A 1FOWA 1Z91A 2X6XA 2F17A 2Z16A 3LQCA 1LDKB 4JV4A 2G1MA 1J9IA 3VB2A 3ESWB 2C6SA 3L2WA 4AR2A 1AR82 5L19A 2STTA 5IW0A 4R9DA 4CCJA 2ZHLA 3PUFA 5BXXA 5BNOA 1YRZA 2O61A 1G9DA 4DPNA 1G9CA 4Y15A 4UNOA 2CWMA 4MQ9F 3LIHA 4KWUA 4X6AJ 3HG9A 4FI9A 3DPRB 1BYHA 5ERLA 3VN4A 1J09A 5LY2A 1LHOA 1KFXL 2WTEA 4AI0A 1V3FA 5L9VA 5IAVA 3WF4A 1JZ4A 2R6QA 2RKHA 4KISA 3DCFA 4RYDA 2NZ9A 2WYSA 3GBGA 3KHCA 4YVWA 3MKLA 2VCBA 1KQ8A 1J1TA 3RPUA 5L9RA 2MNGA 1TME2 2MLGA 1ERDA 3QU3A 3WCRA 4G94A 3S7EA 2K5CA 5FROA 3RSNA 3BU7A 4Q2FA 2ZGSA 1QJU3 2HEVF 5HDKA 4LOTA 2JG8B 2NAZA 2QJVA 5IY5H 1OCZH 5HS8A 3ST7A 3TNQA 4RBOA 3ZXGA 3CCLI 4FP3A 3ACFA 5A6ZA 4CCEA 2L02A 3B02A 2E53A 4LUKA 2R0FA 3LAPA 4Q5OA 1W6NB 4HSLA 4Y52J 4PJ0C 1JHNA 4KG8A 1B72B 2XJPA 1H30A 2ELJA 5IK5A 3PNVA 4PDWB 4MUVA 5K8SA 4C1XA 3DLLF 2ENRA 3C3VA 3FE5A 3F0CA 1YIJI 1FLIA 1YI2I 1DPUA 3N9LA 4FFFA 3VYRB 1XNCA 1F5TA 1HJFA 3LFIA 4CDXA 3KF3A 4Y20B 4J25A 4N43C 3OGJA 5L73A 5ILSA 5JSOA 3PNYA 3CTAA 5IYDJ 2NQYA 3D5SC 3LSHA 4XBQA 2P5BA 2E60A 1PGL1 2TNFA 1A36A 3I4PA 1CD3G 2MC3A 2RQQA 1FYUA 4IHSA 1FPN1 2QDRA 3V4GA 1OXCA 5C5TA 1QOTA 1HSJA 2Q1FA 2HR3A 2L9NA 1RPWA 1NH3A 3BQZA 2Y38A 3U75A 3M3EA 3FXUA 4I76A 3ABMH 4EWEA 2F5CA 3DF0A 5EG0A 4BPZA 3J7MA 3A0HC 3F8MA 1GBGA 4ZYDA 1YJLA 1IRFA 3LE0A 5I0TA 1VB4A 2XBO2 3BG5A 1XS9A 1LECA 5C4WB 4WZFA 3MBWA 2PN6A 1CQ9A 3UKGA 2V1DA 4HNUA 4X6RB 4J19A 3E3VA 2C26A 1NTCA 1W7PB 2KXLA 3OIOA 4RS8A 3SQNA 3ZYRA 1WPKA 3ZPOA 3GTLJ 5IWFA 4AEDB 1W39A 1HB1A 3AP9A 5ACA3 4DGWB 2M8EA 5KK1A 5ABJC 3EUKL 3LKJA 3G3ZA 3TN93 4RDUA 2L9RA 1OQDA 2DCYA 1ZR2A 4J1XA 2WAEA 3QRFF 5B66C 1XU1A 1B6AA 3NV4A 4FPKA 4JX4A 2GIZA 4DRVA 3V7SA 3CQZJ 1FC3A 2DVAA 3L9FA 5DCFA 4TYSA 3RVHA 3BJ6A 4XDQA 4LMFA 4RR3B 4Q4X1 2WSVA 1PYVA 2DA3A 1NYWA 4LHKA 4X0GA 5JAXA 3K4KA 4ES8A 3VL9A 3C7GA 4XLAA 4LG0A 1ZRIA 3H0GJ 3FZVA 4F3JA 2HWC2 4YW7A 2GMPA 2ZC2A 4BQ1A 3I2KA 2D5VA 1GV9A 4DW6A 4RQPA 5CIRA 3CJIC 4CCNA 3KP7A 3JU9A 1WJEA 1LEDA 1S2EA 4XFAA 2XMLA 4XSZF 1XMAA 4HG2A 2A61A 3KZIC 3AMMA 2JRTA 2I10A 3S5AA 2EH3A 1ZBA2 5AC92 3PDQA 3C7EA 3I9V2 1S7AA 5LGNA 1OQEA 1WW7A 2ZS6B 4IV1B 1SMYF 1GFF2 1QJX2 2Y48A 4PF1A 3CC4I 3IH3A 5D5VB 3OOXA 3PUSA 1H2NA 3I3QA 4WX9A 2VW1A 1QHGA 3MI8A 2EFWA 4GRIA 2CQ7A 2GA1A 3DYMA 1TT0A 2KRFA 1V70A 1K45A 5H9RA 4QAWA 5C8CC 4JQRA 1QHDA 1G3TA 5FKOA 4A5MA 1FBSA 2R062 2KZGA 4BBSJ 4QB1A 5LGTA 4RM3A 4AIDA 5DTDA 3MIFA 1PO11 2V7FA 2D45A 1I6XA 2M0MA 1YIOA 2VUDA 3FK7A 4XN0A 4HMZA 1TTYA 1ZG1A 4ENNA 1UWWA 1R091 4Q1RA 5LB6A 5EPAA 2GM4A 1CWPA 4P5HA 5F5IA 3FBYA 2GAUA 2BOIA 1W6OB 4Y22A 4F3QA 4WBBA 3V8KA 1BI0A 2LLKA 3WW2A 3JRBA 2W48A 2IRFG 4QPGC 4YVSA 3FMSA 4ZDLA 2WAAA 2OS2A 1QXRA 1U3EM 1ODDA 1NCQC 1OD5A 2HWD2 2AENA 1T33A 1CIYA 1W8UA 1SFPA 3O1OA 1S6LA 5J3LA 3ZXAC 2R7EB 2Q4SA 3L2VA 1E3OC 1R4NB 3K70C 4V2FA 1Z7S2 3W2WA 2ZX4A 4IF4A 1V55H 3LPGA 4NBQA 1MS0A 2BFUL 5FZ9A 1PGW1 1P7JA 1K5JA 2EXHA 2H0VA 1YLFA 3WQ1A 3BTJA 1EH7A 4A7ZA 2WQ4A 3T1LA 3W2AA 3S93A 5KVRA 4MHRA 4AEMA 4G3YC 4D7NA 3H35A 5ABJB 1SHWB 1S4CA 3CZUA 2K2SA 1IS3A 3WHTA 2L9SA 5KC6A 5EGOA 4YIRX 3MZHA 5JZGA 1BZWA 2WT1A 3K9TA 3A01B 4B3AA 1RUOA 2PLV1 3H1YA 4R1HA 3CESA 3LA3A 3GBWA 4N8MA 3KPHA 5GTHC 2NM1A 1BM9A 3QWLA 1ZM1A 2VXRA 3AL5A 4UB8C 3CMGA 3M1HA 3K4BA 2YU9J 1XCVA 1W0PA 2C9AA 2QZ3A 1UYPA 2Y33A 1AU7A 5HLHA 5JR7B 3PMSA 3OPWA 1HW5A 2ARCA 4XLNF 4FX4A 3K2OA 4BXSV 1VQ8I 2A6YA 2RM22 5EZWA 2AYHA 5EXOA 1JI8A 2Y9YA 3MKZA 3HRUA 5J36A 2OW4A 4CCKA 5CFCC 3I3EA 1G4DA 3F95A 3FUOA 4YGEA 3ES4A 2EIDA 2ZGLA 2W95A 4LBLA 2M7BA 1D7PM 2WS92 1QDOA 4GH4A 2ZAAA 1ZARA 2Y6LA 2J7MA 3WF2A 4BQOA 4I99C 4CEYC 3WU2C 3RQIA 4DOZA 2RJKA 4LBOA 2DTWA 2E63A 3HIFA 2EIGA 4Z8BA 2XWJB 2VXZA 3POIA 1WSUA 2DQRA 2EA2A 1JKRC 2PJRA 1YS6A 2CDOA 4LBQB 2VCAA 1D4M2 3WDVA 2LBFB 5F0HA 3M2MA 3M7AA 3I53A 3K70D 5JPNB 4KIGA 3WNPA 5DD8A 4MGKE 2AGSA 2YPJA 2HOSA 2MYSA 4GIQA 2DVGA 5CU1A 2JDPA 3B6CA 1R5HA 1A6QA 3AG4H 4LOSA 4GA9A 5DAXA 3ZPYA 4IE7A 3U37A 3WT3A 2HWVA 5CAZA 3ATGA 3FZ3A 2OKXA 2HZDA 4XJ8A 4KIBA 2X05A 2RHPA 4FO9A 3CHXA 5FKNA 2ISZA 1Y9GA 3B00A 2QQVA 3J7NA 4UF0B 5FYMA 4CEWC 3M4FA 2KZVA 1IKPA 4PI2A 2QBYB 2ICWG 4QPGB 4J6GA 2DCTA 4IV3B 3L09A 2E7WA 1ZBE2 1FPN3 2Y0MA 2HTJA 1RUI3 1KD7A 4LKDA 1D0XA 2E7XA 4EWAA 5DDJ1 4JKKA 4IQJA 2FBEA 4AI2A 4FOVA 5FYVA 3POWA 3SDGA 3JR9A 3R6SA 2K9SA 2P3YA 3HRTA 2LP0A 2CMPA 1IGNA 1VBD1 1TEIA 3EQEA 3V0BB 1I6HJ 1ZLJA 1MEC1 2P2KA 5F04A 3IUOA 4FTEA 4WM7B 5L7OB 4OHVA 2LF8A 1PK6C 5HCHA 2J1TA 5BNNC 2BHZA 1T38A 1Z1DA 1W9YA 2JG9C 4MEYF 1QNYA 1WBFA 1JZ3A 4AYBN 5E89A 2R7SA 1FP1D 2R4GA 4XFHA 2LVSA 2BGPA 3K4CA 1W3VA 1GHCA 2GMMA 2RDQA 5FZKA 3CCSI 1TLHB 1F36A 2W91A 3HMYA 3VDDC 1POV0 3ZFFB 1TNTA 3O1UA 5H2FC 4AHXA 2K85A 5KHKA 5C9AB 2X85A 1HA8A 2V5YA 1AYM2 5CPRB 2XROA 5BV6A 4L8QA 1JHJA 4JK1X 1VQPI 3CDZB 1YS7A 3M9AA 4EN7B 2E5ZA 5A6QA 1SVLA 3V56A 4BE2A 4RD7A 1C5IA 3K2ZA 1DFQA 3RZHA 4AEJA 1BQPA 1CAWA 4Q4X3 2X9DA 2KMUA 4K20A 4IL6C 4DINB 3OYBA 3I2HA 4M9SA 1B35B 4JHZA 3VV1A 3D6EA 3NSTA 5D8AA 5H6QA 5ILUA 2YX7A 1GVJA 1VE0A 1SLLA 2FE3A 3RCOA 2K9MA 3FBMA 3ZXFA 1QNTA 4XF9A 3DPTA 5FPUA 4A3EJ 1OQYA 2MH2A 1MSFC 3MGUA 3B73A 1L7RA 2DCZA 1A34A 3H9QA 1MQTA 2DA6A 1GICA 1N3OA 4FAGA 2ZXWH 1KA8A 4QGMA 2Z2SB 3P6BA 5IK7A 1XTAA 1X2NA 2ZZQA 4QDSA 2ADDA 1LFPA 4LPLA 1BMV1 1LNSA 5A6YA 1RVF1 3U2RA 5A7QA 5C3SA 3VKMA 3TO9A 2LKPA 2Y34A 1FX7A 2R3SA 1QJU2 2HNHA 1JH5A 3K46A 4EJWA 1QU3A 1H1IA 3DYOA 1DLLA 1RJ7A 2ZAHA 2D43A 1XGMA 4BHBA 1EA3A 1W6PB 4ZZ5A 3D5RC 1CN1A 4PJJA 1WWXA 1SFOJ 2BP6A 3I4MJ 4L9TA 4OULA 1PO13 3J4UH 1LULA 1WCMJ 2FMYA 3KWVA 1TW3A 3UNGC 1W8TA 4AVVA 4HQEA 1GKBA 3OS2A 3KCCA 2EPFA 4EMSA 1R093 4LEJA 5F2WA 2PX9A 4LIUA 3O5SA 5BPIA 4CEWB 4PIXA 2WZ8A 1JS9A 4IVNA 4KMUX 4D7TA 4COWA 1ETOA 1U12A 1GR3A 1OVPA 4ZDPA 4FOQA 4CHUA 4WM8B 4C3JJ 2RDPA 1UXXX 4P1WA 4AWDA 1ZAOA 3WP4A 4BQAA 2Y0OA 1IN8A 4CDUA 2WY7Q 3EUAA 1LNWA 4W6WA 2LR8A 2D1VA 1A3KA 3CCQI 4PSXA 1PZ8A 3CIHA 4HBLA 1GZWB 4BQ5A 4JDOA 1UY4A 3AFKA 3LSEA 1BVP1 2QM3A 4FETA 4X8PA 1AX0A 1LHUA 3URFA 4KBZA 4KYWA 3J80K 1GSLA 3LIGA 4I0BA 2I5UA 4AGRA 2OD5A 5KXCA 3MWMA 5BNNB 2ZHMA 2ME6A 2TDXA 3DECA 2FA5A 2P3KA 3AZWA 2L0KA 4Y1VA 1KDMA 1U5YA 4AFDA