4BH9A

A structural model of cap mutant (t127l and s128i) in the apo state
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
209
Chain Sequence
b'VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVLIEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-activated global transcriptional regulator CRP
publication title Allosteric inhibition through suppression of transient conformational states.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 58
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2013-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bh9A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bh9A01
4L2NA 2O0YA 2GC2A 3MZHA 2IXLA 1TW2A 1I6XA 4Q0PA 5FPZA 3K1NA 3HQXA 3K1MA 3SXYA 5FLXK 4LD5A 4OMYA 2DU9A 1PM7A 5J8FA 4N9HA 2Q30A 4ENNA 2FU4A 1ZG3A 3FMQA 1L3LA 1FX7A 1YIOA 1UCRA 2VONA 2NNYA 3T5XA 2PFWA 1CF7A 1K79A 5AONA 2IA0A 2F4PA 1ZHFA 4KN4X 4ON0A 3CDHA 3KETA 3BOQA 1TQMA 4MZUA 5E1RA 2HYGD 1RGSA 3WODF 1S6LA 3SZPA 3F6VA 3KE2A 5DCFA 2GA2A 4LJZF 1FWZA 3IIAA 2XLAA 1J7KA 4HVQA 5BMZA 1DZTA 2STTA 2MPFA 4Q48A 2QZ8A 1P6RA 4M9ZA 5BUVA 2ZMEA 1ZNPA 3DPLC 2ZKLA 1UCXA 2EV6A 1ODDA 5A2QK 3KGZA 4AVAA 5LEJA 2DPUA 4BNCA 2H94A 1RL3A 3M8EA 3ZDSA 3BPXA 5JFRA 3WGHA 1F4KA 3GFJA 1DGRA 4PIXA 4QXKA 1FYKA 2VODA 4IEWA 5ICGA 4PIZA 2Q1ZB 2HDCA 4AWXB 3V4GA 3BY6A 3CUQB 3RKYA 3COAC 3RNSA 3H9AA 2MH2A 1LVAA 2GIVA 3EQLF 4BXUA 3IWZA 2Y48A 3T8RA 2Q2EA 5LRRA 4M6XA 3GFMA 4R1HA 1QBJA 1LNWA 2A3SA 5I93A 2E1NA 4HBNA 2F2EA 5DD8A 2DT5A 2IP2A 5CVJA 3RTRA 4JTOA 1JGSA 4NVPA 2DLLA 2DTRA 4LGWA 1O4TA 3MPBA 4EWDA 4JTNA 4MUVA 3DKWA 1MJBA 4HQMA 1LB2A 2Z9OA 2MC3A 3U2RA 3HHHA 3CJXA 3REOA 5FLHA 1SFUA 2NNNA 3U1DA 1KU3A 2EWNA 5E8IA 5F1RA 2WWYA 1EPZA 3O2PE 1ZLKA 4RD7A 4HDUA 3OF1A 1U5TC 3MFKA 3K2ZA 4IRGA 2YR2A 3KEQA 4F8AA 3H3UA 1T39A 1OI6A 3GVAA 4E2GA 1JE8A 2V09A 2F5EA 1Z05A 3TOBA 2QBYB 3KGLA 3WTWC 4UXAA 2K4BA 4CGZA 3CO6C 1IXCA 4WK8F 2FQPA 1G3TA 1S7AA 1J5YA 2OA4A 4QGNA 1YFWA 4HF2A 4ZU5A 3RKXA 2FEZA 1MGTA 2FBHA 3L2CA 4EVIA 2RQPA 3CUQA 2VBZA 2RC4A 3ZMDA 4KYWA 2LF7A 3TNQA 3OOPA 4RS8A 2E1CA 4RGXA 3IRQA 1RUNA 2D5HA 4TV7A 5DUKA 2V1XA 5TJJA 3L9FA 3KP4A 3H92A 4D7SA 1YO5C 2LF8A 3UKNA 3LOIA 4BIFA 1OKRA 4KMFA 2IPQX 5FFXA 4HSLA 2ISZA 2XRNA 3PVBB 4YSFA 1G6NA 2E9QA 1XGNA 4HMZA 1U8RA 4EM1A 4IESA 4BYYA 2EFWA 1IXRC 3E5UA 1DPRA 4XFCA 4OU0A 4HV5A 1J2XA 2X0LA 1J3PA 2BNNA 2O8XA 1R36A 3OD0A 1FBQA 4CZZA 4ZYDA 2BNOA 1YYVA 4KIBA 2XROA 4E2QA 4GGGA 1ZLJA 3R60A 4UNOA 1U5TB 4IEUA 4IERA 4UUVA 3H50A 2XIGA 1XRUA 4I02A 4LB6B 5D4SA 4IEPA 2QYOA 2W57A 5CYVA 2FBIA 3M3IA 5ICEA 3RI4A 3J80Z 3KLNA 3BDDA 4WXCA 2GZWA 2YX7A 2QBYA 4XSZF 3GLXA 1R5GA 5FD5A 3RYRA 4S05A 1KQ0A 4FBFA 1QPMA 4FT8A 2UYAA 4GXOA 2JT1A 1U12A 4KL1A 2KIFA 4WCGA 4WVZA 1IW7F 1WA4A 3V8KA 2HQRA 1ZYRF 2E7WA 2YPRA 5CVVA 4Q0SA 1ULYA 4LUKA 5FO5A 2GA1A 2DO7A 3QU3A 1XSVA 2CAVA 2ELHA 4EM0B 4IJAA 3CL1A 3FMSA 4EJUA 2OU2A 3H1WA 4I7HA 1YS6A 4OOIA 1ZG5A 5T3NA 2EV5A 1MD0A 5D5VB 4CDGA 5E1XA 3H7JA 2MNGA 1ZRCA 5CJ9A 4EQQA 2VXZA 1IN6A 3JW4A 2B9UA 1Q43A 3MZYA 4HX8A 4L5JA 1BI2A 4IVNA 3NKTA 4RAZA 4OINF 1X7NA 1UB9A 3HT2A 1MJ9A 3TDZC 2BGCA 3R0JA 1O3QA 1BBYA 5FDBA 2QVSB 5JVTA 2J5PA 4E70A 2F5FA 1XSXA 1NE4A 4DINB 2GC1A 1U5TA 4RGUA 5L3BA 2WC2A 2QDRA 1W7PB 3LQRA 2K9ZA 3NQOA 3GYDA 5JAXA 2VT2A 3CLOA 3N4MA 2DQRA 4XLPF 2FF4A 5HDGA 4WXDA 1FYLA 5HS7A 4L0YB 2IXHA 2ZNYA 2KIUA 2Q4SA 1YW7A 3QOPA 3TDUC 2V79A 4HW0A 5H6QA 1G3YA 1P4XA 4H0EA 2RGVA 1O5UA 1K7AA 3HSEA 2W24A 4KWJA 3C18A 4A0ZA 3GZ5A 2FNAA 2CG4A 4ZH4F 3Q5FA 1QZZA 1B9NA 3ZP5A 1EYBA 4IEVA 2O3FA 4I09A 2V6CA 4I0BA 4G8XA 2EFPA 1MZBA 4D0PA 4KIGA 2DK5A 1BI3A 1Z1DA 2CWEA 1MDMB 5LEKA 4KNYA 4JV4A 3F3XA 1VJ2A 3ZMUA 5HLGA 3S7IA 1WLTA 5BPIA 4EGZA 3KEOA 1WKMA 1FP2A 1PMIA 4EM2A 3EJKA 1IN7A 2XLGA 4Z2YA 4I98B 4X6QB 2P5VA 4L11A 2K0GA 1FOKA 2P8TA 3TKYA 2H0VA 5E8GA 1SAXA 3EQEA 3CJNA 1SD4A 2DI3A 2RKHA 3NEUA 3IDCB 3I5UA 4LTAA 1Q3EA 1SMTA 1IPKA 1IF1A 2ATFA 1W7PA 2X4HA 4LLLA 2FMYA 2EFNA 5KVRA 2HGCA 2PTMA 4MHGA 2HS5A 3HSFA 3H7YA 3BJOA 2IJLA 1J9IA 3I7DA 5DV5A 2K7LA 3S2WA 2DQLA 3FF5A 4MH0E 1S3JA 1E17A 1VTNC 2KKOA 5CVRA 3FXUA 4MTDA 5A2QZ 3BP8A 3L7WA 5ILVA 1QZYA 4IRIA 4IEYA 3FFQA 4A0XA 4ZZLA 4G7OF 1USSA 1S8NA 3T8TA 2HTSA 5FLJA 4MV2A 3BPZA 1XE7A 3R6SA 3ZQ7A 2RVCA 4M74A 4Z82A 4EMSA 5BOXA 5I8TA 4AIKA 2L3DA 2OQGA 1ZARA 2A61A 2GH2A 1ZN2A 2V1DA 4XF1A 1EH8A 4YIIA 1SFEA 4IEOA 4LULA 1LDDA 1W7PD 1QQIA 3D82A 4EJTA 2PHLA 5J3UA 3IC7A 5HLHA 2I45A 4UBGA 1R23A 3DP7A 1X8EA 4XBFA 3F23A 2O61A 2ET7A 1G3WA 2DBBA 4KN7X 2UY9A 2P4WA 4XETA 3CUQC 1TW3A 3FM5A 4AQ2A 1FNNA 4UVBA 1LJ9A 5KHKA 2JPCA 2A69F 1P92A 2JTVA 3WTSC 5I0UA 4HX4A 3RJPA 4ZYGA 4HLTA 2PYTA 3E97A 1V3FA 5KBFA 1AWCA 4HYEA 1U6GA 2HYFA 3DQVC 1RNLA 3KFWX 3SQNA 1KU9A 5LHIA 3WGIA 2OZ6A 1ZZ7A 5JR3A 1GQGA 4AVBA 1S29A 3ZMTA 5JCTA 4J1WA 1SD5A 2ACJA 1ZRDA 2Y0OA 1A04A 1VR3A 2FA5A 2GXBA 5JSPA 3ECOA 1KU2A 4XSXF 1OR7A 5LHGA 1CAXB 1TNTA 4X6RB 1XGOA 2EFQA 2PQ8A 3FXRA 2GU9A 2ZFWA 4MGKE 2NS0A 3OCPA 4IEXA 3JSOA 4K2EA 3SCHA 1D8KA 4YFXF 4PJYA 5ICFA 1XCBA 4U7DA 2XAFA 2PLYA 2COMA 3GEZA 5F6FA 1BOAA 4HN0A 4ENMA 1E2XA 3E6MA 4WBBA 4R79A 3Q9VA 2UXNA 1J75A 4WZCA 5E20A 1R1VA 1H1MA 4KDPA 2P6TA 1O57A 5C6CA 1IN4A 1J3QA 3CLPA 4XF9A 2VQAA 2XL7A 1YFXA 3FHIB 1D3YA 2EA4A 2CFXA 5DCMB 3QP6A 5FFZA 2ESHA 3GZ6A 5L3EA 4EJVA 1IAWA 1GVJA 3N97A 4LA2A 1LKNA 5FLIA 4YARA 5HS9A 2FBKA 2IXJA 1ZAOA 4KICA 3G7DA 3G3ZA 4LB5A 3EUHA 3DN7A 3MAJA 3CUOA 3TO6A 4WX9A 5DDGA 4YIFA 4YG2F 5E16A 4ENJA 4LLNA 2PAKA 1CAXA 1JHHA 4CHUA 2P17A 3ACLA 1XN7A 1LDKB 5HLIA 1BI0A 2MLGA 3R61A 4IHSA 1CAUB 3C3WA 3CO2A 2YU3A 1EP0A 4EWEA 2GXGA 1IXSB 2V1UA 3MDPA 2HFHA 5TRDA 2D5FA 2HQNA 1T38A 3LWCA 4HX7A 2Z2SB 4WXHA 3E6CC 4XFAA 3EO6A 3R4KA 2JZYA 4XFGA 3SCGA 2ETEA 1B6AA 1YFHA 2DCTA 4IETA 2K86A 3LA3A 1B9MA 2KRFA 4CYDA 2O6GE 3I4PA 4U88A 1SFNA 3MCZA 3SHFA 3R0AA 1AOYA 4A6DA 2D45A 4EGYA 5AIQA 3M1EA 3EBRA 1U2WA 2HEOA 2VC0A 3MQ0A 4HF0A 4LLGF 2BV6A 4EWAA 4ESJA 4MQVA 4M9SA 5I8SA 1LEAA 1FZPB 1HKSA 3CO7C 2K4JA 3WW2A 1O7FA 2VE8A 5DCMA 6PAXA 2HKXA 2HKOA 1YW9A 4L9TA 3KP6A 3WW4A 2P5LC 1FBSA 4UV9A 1PP7U 3BPVA 2ISYA 1P4WA 2G9WA 1HXDA 2UXXA 2OZJA 3IBMA 3PQJA 3GBFA 3ISPA 4M72A 1NYWA 3LZZA 1Q5OA 1B59A 4QLCU 2HR3A 3NW4A 2PA7A 2TDXA 1HQCA 4AVCA 2XKPA 4Q0UA 2H6BA 2AS5F 1UD1A 1XB4A 3L09A 2ET1A 3BZ6A 4UBHA 2H6CA 2FNPA 2Y75A 4S04A 2QQAA 3V7RA 4ESBA 1ZZCA 3WGGA 4QM8A 4WF2A 1WWXA 5FGMA 5LLQA 3RZZA 1MKMA 3RKWA 1IN5A 3FX3A 1ZZ6A 3NL1A 4KWKA 3JTHA 1Z9CA 3NSTA 1B4AA 3EYYA 4B09A 1KQ9A 3DFGA 5HI0A 1D8JA 3F8CA 1QO0D 2O03A 2GC3A 4KU8A 5K5OA 5F64A 2XHKA 2PHDA 3HRUA 5D5XB 3FM3A 4CICA 3WTTC 3PNAA 3L2HA 3VFZA 2EA7A 1YHFA 2C0ZA 3M8FA 3ZMSA 2OQRA 2Z69A 4WWCA 2MD5A 1K78B 5I0RA 1C0WA 3BCWA 3GW2A 2P7VB 3USSA 1TQ5A 1ZX5A 2MBFA 4DQ2A 2A5YB 2EFOA 3EYIA 3JAMK 4GYIA 3PQKA 1HW2A 4G6DA 2M1BA 5CVUA 3ABUA 4MGYE 1H9GA 2BNMA 2KJCA 4MX3A 1FI2A 2A68F 1H0MA 1NHAA 3UKTA 1ZZ8A 3ST7A 4ESFA 4OFGA 1HSJA 2HJIA 3UKVA 2VPVA 1QXJA 1YWKA 2VBWA 3ZN1A 3IWFA 2WTEA 4U0WA 2IA2A 1KGSA 1Z6RA 1UW8A 5K1YA 4A5NA 3LA2A 3CTAA 3D0JA 2B8MA 2PJPA 3HRSA 3F21A 1QNTA 4R8HA 4JBAA 4ZYEA 2EAAA 1U78A 4Y15A 1FY7A 4ORFA 4QX5A 2B5HA 4L0ZB 3PFIA 3GFLA 1IN8A 2B0LA 3BB6A 3H8UA 4Y13A 3GYHX 5HDNA 1R5HA 2RV8A 2XL9A 3M7GA 1LDJA 4I3PA 1R1TA 5I0SA 2ZXJA 1KYZA 4P9FA 4O5VA 4KT5C 1T6SA 1BJAA 3LQQA 2FE3A 2QCSB 3HUGA 2WFPA 5D8KB 1W5SA 4G7HF 3V8LA 2JSCA 4AVPA 1HW1A 1KQ8A 4OMZA 4MGIE 1HW5A 1Q1HA 1K78A 1TQPA 1SMYF 3HT1A 5AIPA 3RPQA 1SFXA 1FT9A 4A0YA 5IT9Z 2BBYA 4QGMA 1HSTA 3BALA 5J6XA 2M30A 2Z33A 5C8WA 4N0BA 4A12A 3F22A 4NHJA 4A6EA 2C6YA 3ELKA 3G73A 2L01A 2PFBA 1X3UA 3DEUA 4PCQA 3K0LA 1P2FA 2VT3A 4HAMA 1H1IA 4BAYA 1XMKA 4ASNA 2ZBKA 4K8FA 3JZVA 1Y3TA 4M73A 1XGSA 3E5QA 2OZUA 3KP5A 4QWQA 3I58A 5LRSA 5KHJA 1Y0UA 5L3GA 4LMYA 4JVAA 2R7DA 3OV8A 1BC7C 3W6KB 1FC3A 2GC0A 3RIRA 4L18B 2P6SA 2L4MA 3WTXC 1PP8F 2FOKA 5BS6A 2L54A 3QP5A 4O9EA 5E1WA 3ERED 1OYIA 1TBXA 3KCCA 5CVIA 5DUIA 1QGPA 2PBIA 1UHMA 5CADA 3WE3A 4HZFA 2LDUA 1IZ1A 3F72A 1DZRA 2D1VA 1GXPA 2OBPA 1QY4A 5LGUA 3CF6E 3K1PA 1OMIA 1DDNA 2IRFG 4UVAA 1IRGA 1X82A 4PZJA 3T1BA 2QUFA 3U11A 2CSOA 3I64A 5I91A 4BQAA 5JSOA 4RB2C 1JXSA 1JUHA 5KK1A 3C1DA 3EHKA 3RYPA 4P96A 1F5TA 3FXQA 5BPDA 5LGNA 4L9VA 5LHHA 2VBXA 4MGZE 1YUDA 4MEYF 1SD6A 2XUBA 2ZJ2A 2JRTA 4M6YA 3IKVA 3E6DA 2A07F 1V70A 3NRVA 1MDMA 2Q0OA 5EEGA 3J7AO 2W84A 2IA1A 3NJZA 5DYMA 3RPUA 2XAHA 1Z7UA 4XFIA 1G3SA 4FAGA 5IT9K 3W6JB 3DPTA 5BQTA 3Q9SA 2XGXA 3IHUA 3BJ6A 1USTA 2IXKA 5H6RA 1OPCA 2FSWA 1FPQA 3HYIA 2PN6A 5EEHA 3WTUC 4L9NA 4LEJA 4LK0F 1YS7A 4EROA 2CQKA 4E2SA 1SQ4A 1EY2A 3H1YA 2H27A 3HHGA 1PUEE 1VP6A 3L00A 5FQ0B 3WW1A 4PGGA 5ILSA 5LBQA 1HKQA 1J59A 2ZNZA 4QM9A 5IT3A 5LGTA 3GFIA 2XASA 3ULQB 1Z91A 3FWEA 2L4AA 1MJAA 2XKOA 2R3SA 1XE8A 1UHWA 4ZU4A 5ED4A 4IPAA 2A6EF 4HDVA 1EV7A 3OGJA 2HTJA 5J8CA 1R58A 2D93A 1I27A 2ESNA 1ZH5A 2BYVE 2QJVA 3SMHA 3HOSA 2M45A 2VBYA 3SXWA 2EVXA 1F1ZA 2P5KA 1ZGJA 3LAGA 1TLHB 4UVCA 3P7NA 2NAZA 3E5XA 4YFKF 4ZU7A 1ZZBA 3VOEA 2J5OA 1G4DA 4HQEA 3KMHA 2LNBA 1T98A 2R7FA 2UWMA 4HN1A 4O9GA 3P9KA 3ECHA 4KFCA 2O1QA 1EH6A 2EA2A 5FB2A 3KZYA 3ZMVA 1O3TA 1FP1D 5ERIA 3D5LA 3JTGA 4I01A 3K9TA 4BHCA 2OAZA 1LEBA 5AVPA 2MA3A 3QU6A 2Z3YA 1OYWA 2Z5UA 4FAHA 1O7LA 4AQ6A 3LAPA 2ZO4A 1CX4A 1EH7A 1J0RA 2KIMA 1W4MA 3BU7A 1PDNC 4OLLA 4UV8A 2XLFA 4LUMA 3KSCA 3MEXA 4RGRA 4EV0A 2A6HF 3B73A 5E1ZB 5FQ0A 2GWRA 4G7ZF 5ILUA 1JHFA 1RI7A 4XFBA 1B1BA 2KJBA 5E18F 2IT0A 2PAEA 3F8FA 3TOAA 3KLOA 3IL2A 1YTYA 1OD5A 3WW3A 2MH9A 1OYYA 3GF2A 3V7CA 4JQFA 2WV0A 3SZTA 2VECA 4AIJA 3HRMA 4Z07A 2D1HA 1KU7A 4J1XA 3TGNA 1WI9A 2STWA 4HA8A 3HTSB 3FE5A 3OTFA 1YLFA 4XFHA 3F6OA 2QNKA 4EJOA 2HOEA 4Q47A 4PIYA 2ZKZA 4OIQF 5L3FA 1FBUA 4HV6A 1DUXC 1R1UA 2VN2A 4HLXA 4ETSA 4GCVA 3WU0A 1GHCA 2XAJA 5L3DA 2UYBA 2G7UA 4KWLA 1GXQA 1KA8A 5KHGA 1TNSA 4HOBA 3LSTA 4FX4A 2MLKA 4MEXF 4BHPA 4LG0B 1RTVA 3HRTA 3JAMZ 4HBLA 4KMUX 1V4RA 5J7MA 1S7OA 2OYZA 2JPBA 2ADUA 4LLOA 2LKPA 3SCFA 1ZVFA 1P4AA 1IUYA 3EETA 1DP7P 2N7GA 4O3MA 3WG9A 1X8MA 3LA7A 3SHRA 3QAHA 3E3VA 4Q0VA 3ES1A 4P9UA 5KHIA 1O3RA 2ETHA 4GULA 4BHBA 2CGPA 3ES4A 3WTZA 3M9AA 1YW8A 4ZZDA 1XDSA 2HWVA 2P7CB 2UY8A 2OA2A 4R52A 1UIJA 2FRHA 1DPUA 5FCCA 4MNUA 4IHTA 4CXFA 2RN7A 1RIOH 3PLQA 4TLFA 3J81Z 1ZRFA 2ZCWA 3LFKA 3D0SA 5K5RA 3BROA 3HTUA 2XVCA 2DK8A 1KYWA 1I5ZA 3H3ZA 3WTYC 1BC8C 5I8YA 3F8BA 4XEZA 1TQIA 1D5VA 2LSOA 1REPC 1CAUA 2PQQA 2Q0AA 1BN5A 5D6EA 4META 1UPIA 4XF4A 4BH9A 3GUDA 3I54A 4IEZA 2EV0A 1UFMA 5D5WB 3QPHA 4RB0A 5D4RA 3DL3A 2PMUA 3LAJA 1ONVA 4U7BA 2O8QA 4XF0A 2QQBA 1NE6A 4YYOA 4F7ZA 2UZKA 4P5OA 3RDIA 3FJSA 3GXOA 3T0YA 3VB2A 2VE9A 4HVRA 1TTYA 3QPTA 2FMLA 4LG0A 4GO1A 5FD6A 2W85A 2HZTA 1XD7A 1HKTA 1HBXG 3HSRA 1I1SA 4UHTA 3ML6A 1LRHA 4HSJA 2Z99A 4LA3A 1WSUA 3DXJF 1UIKA 5BXXA 1CAWB 4IXAA 4MQ9F 1NXMA 2PAMA 1ZRRA 3NVCA 2QWWA 3VHRA 5L3CA 2IXIA 2EB7A 4OIRF 4YNIA 4ZYHA 3E6BA 4QMAA 1U3EM 4U0YA 3ETQA 3I59B 2H09A 3B02A 4MTEA 2YSRA 2OD5A 3ABTA 3V7SA 1ZG1A 4PGHA 4KA4A 1SEFA 2GAUA 3WE2A 4AD9A 2F5DA 2QM3A 1L0OC 2IVMA 2EK5A 3V8JA 4I0AA 1ZZ9A 3KZZA 4XFFA 4FHTA 1XSDA 2CV6A 3F8NA 2EJRA 2D2WA 2BEOA 1XCVA 2YX4A 4L5IA 4RB3C 3J81K 3DF8A 5ICCA 1T2KA 2BE5F 4PDKA 1LR5A 1XDUA 3P9IA 3AAFA 3WTVC 1XMAA 2QLZA 5HVQC 3S7EA 4OIPF 3S0MA 3GWZA 4KU7A 4M9XA 1YFYA 2Y0MA 4I2OA 4P55A 4MGRA 1K6OA 3BJAA 5BY5A 4M71A 3U9GA 3IRRA 2Q8KA 4P9GA 4IRHA 5JI6A 1J3RA 2KXLA 3KP7A 2QVOA 4G94A 4A5MA 4EJWA 2NRAC 3P9CA 2RDPA 4RAYA 1FSHA 4LK1F 3SFZA 4N9IA 3EDPA 3I71A 1Y9QA 2CW0F 3MYXA 2E7XA 3ZMZA 1CAVB 5D8LB 2K02A 5FPXA 3FZVA 3TNPB 3ZN0A 3FMRA 2MHFA 3ELNA 3GX4X 1WQ2A 1CAWA 3U10A 5HS8A 4FX0A 3TQNA 4NQWA 4KIFA 1Z6TA 3ROUA 4IF4A 5DEQA 2XV4S 1BIBA 3J80K 2DFIA 3F8MA 1STZA 4OIOF 1WRJA 4LFUA 3O3KA 4G9YA 1ON2A 1O3SA 2RNJA 3O6BB 4GYGA 5EFUA 2FXAA 4XLNF 4Q29A 4UXNA 3GO5A 3QRFF 3I59A 4QGLA 4HVOA 4B8XA 3VEPA 5KHHA 1IRFA 5HOOA 4NB5A 1YQAA 2IW5A 4KUMA 4XRFA 3DV8A 1QWRA 2XAGA 1RZ4A 2CAUA 4ENKA 2CO5A 4YFNF 2VOPA 1J1LA 1YFUA 5D1IA 1J58A 2IC1A 2FQ3A 2PMHA 3H1MA 3ZPLA 1IPJA 2QQ9A 3VODA 3I53A 1LQ1A 5FLXZ 1FSEA 2PI0A 4ONUA 2L02A 3FZ3A 2PG4A 1BI1A 2D40A 1DGWA 2VC1A 4YRDA 4HF1A 2M8EA 1FXZA 1R7JA 1WGPA 2V9VA 4AXOA 2AXLA 2K27A 5BPXA 1FLIA 4RB1A 1F9NA 4JK1X 2DPDA 4B29A 1O5LA 2M5WA 3TO7A 4Q5SF 1GQHA 3I0TA 2F5CA 1CAVA 3QACA 1CF7B 3IKTA 4O6JA 1BIAA 5EZWA 1YG2A 3M70A 2XAQA 5JR7B 2DW4A 3IDBB 1RC6A 1RUOA 3MWMA 4D7TA 5JSRA 4Q0QA 4U0VA 3C7JA 1W5TA 4G6QA 4A2UA 5H20A 5CLSA 1I1GA 1SD7A 1H9TA 1NZCA 4DNCA 3K69A 3TO9A 2ZMEB 3WU1B 2OPKA 5E17F 1R22A 2W25A 5D5UB 3LWFA 4H7LA 1R00A 4Y17A 4IEQA 1FYMA 5K8SA 1ZREA 3O14A 1BM9A 3U0ZA 3JSPA 5HDKA 2NYXA 1QXRA 5CU1A 3CEWA 5J48A 3HIFA 5K5QA 2GQQA 4HLYA 4RGSA 2CYYA 1CGPA 1XGMA 5JHUA 3RYKA 1OFNA 1ZGAA 4L9JA 5BV6A 4Q4ZF 3FHZA 1L3JA 1T0FA 2G7HA 4CO8A 3KP3A 1ON1A 2VOOA 2QENA 5DD4A 2DAOA 3C3VA 2M87A 4XF3A 5I0TA 2PEXA 4AIHA 2IXCA 3KP2A 3HOTA 1YLLA 3BWGA 5D6FA
chains in the Genus database with same CATH superfamily
2JUCA 1VBA2 1TW2A 3K2AA 2ZTNA 4AU7A 5LFAA 3VWBA 5C9AA 4OMYA 2DU9A 3GTJJ 1RUI3 2ZJRF 4ENNA 2FU4A 3FMQA 1YIOA 2NVTJ 2ME6A 1Y7BA 4YW2A 1UZ0A 4LBMA 2IA0A 2F4PA 4ON0A 4PFOA 4JGZB 3GALA 1RGSA 4XUTA 4CDQB 3GTQJ 1MMGA 4FPCA 3WZ1A 2ZACA 1QHHD 3IIAA 2XLAA 1J7KA 1K42A 1OXCA 1X36A 1DZTA 4OI1A 1P6RA 4M9ZA 3S15J 2WLPA 5C3EJ 4RS5C 1TG7A 2ZMEA 4XOGA 5CYYA 2ZKLA 2FDFA 2RDSA 1LECA 1QJFA 2IEKA 3KGZA 2JVHA 1UPSA 4XR6A 1OLME 3BPXA 2Z42A 2YC4A 5BNOC 1OSGA 3C7HA 3ENRA 1VRH3 4Q4X3 3JBG3 2X53S 5L7OB 2R061 3PIGA 2WAOA 3V4GA 3CJIA 4WM8A 3TAYA 3RKYA 3COAC 2PLV2 1G9BA 2GH8A 4E4HA 4BXUA 4RQPB 2Q2EA 5LRRA 2ENRA 3PIPF 5CIRA 4CZCA 4MADA 1MR5A 2A3SA 1G86A 4N4NB 4IV3C 5F8PA 1R64A 2WYFA 5CVJA 4MYEA 2DFBA 5M5XJ 4NVPA 2PN5A 2DTRA 4LGWA 5KXCA 4GWMA 2R043 2HYKA 3DKWA 4MUVA 3A0HC 1OOPA 2Z9OA 3OSDA 1FX5A 3S16J 2XHNA 3N35A 3U2RA 3HHHA 3WQBA 3OY9A 2RDQA 3RRDA 1KU3A 2DU1A 2EWNA 2WWYA 2D6NA 4D6QA 2MEV2 1S55A 2CJJA 2PXJA 1ZLKA 4CDQA 2CV1A 2LLKA 2YBSA 4GH4C 3OF1A 1U5TC 1XSQA 3KEQA 4YM2A 1T39A 3GVAA 1Z05A 1Y0NA 3CO6C 4CEYB 2VE1A 2CFOA 4WK8F 2KL4A 1D7PM 5FRNA 1S7AA 2OA4A 5FZKA 1CX1A 1KS5A 2FEZA 5L7OA 4FTBA 4BCUA 5CFCB 2RQPA 2XPVA 1QPIA 4PDWC 5GZFA 3S3NA 3RG0A 2ZJPF 4RGXA 4M3CF 1RUNA 4TV7A 5FZ3A 4RQPA 2K40A 1Z7S2 4QPYA 1C4RA 4KT6A 3MFCA 2B9VA 3CCQI 1Y4WA 4CRQA 1YO5C 2LF8A 3UKNA 1OKRA 2A6XA 1VQMI 2EIJH 3M4OJ 5FZ1A 4DPNA 3PVBB 4YSFA 1M4WA 1U8RA 2LR8A 3N7KA 2EFWA 3S6PA 4CU6A 2P0WA 4OU0A 3D4KA 2X0LA 1J3PA 2LYCA 5HNHA 2MSYA 2Y34A 5F6LB 3SJMA 1QDCA 2DTYA 5FYBA 2CUFA 2X6YA 2XVGA 3EUAA 1H8TB 2E1MB 1ONAA 1RMU3 4AQTA 4GGGA 2QFEA 4FFHA 4UNOA 3P5JA 3AFKA 4UUVA 1WMXA 4IERA 2R7QA 1W6OB 1BEV2 2C26A 3M3IA 4RA2A 2E7AA 3BDDA 2G19A 4WXCA 3KCXA 2GZWA 1HB1A 3GLXA 1ASJ2 5IYYA 1AR62 5FD5A 3ZVXA 2EIMH 1TEIA 2ZGMA 5FMBA 4YFZA 2JT1A 2WO1A 3CCVI 1IW7F 5CFCA 1VRBA 1Z7LA 3SDGA 3LSDA 2WAFA 1XOYA 2YS9A 2E7WA 1I9RA 4ET7A 1I5PA 5AC92 4OHXA 1AR82 3BPSA 2RS53 1FOD3 5DTDA 1WH7A 1SCRA 2XB6C 2CAVA 4EM0B 3TBDA 2ECBA 2WNUB 3FBYA 2B9SA 3GNEA 3H1WA 5IK5A 4I7HA 1YS6A 4QPOA 2EV5A 1AL21 3VBHC 3RQIA 2MNGA 5F2WA 1WI3A 3VZKA 5JDBA 4EQQA 3PL0A 5BNPB 2HQ5A 1UMHA 1Q43A 1PYVA 4HX8A 2A5WA 5GZCA 4RAZA 1MJ9A 1RC9A 2W52A 3R0JA 2R32A 5JVTA 1F9KA 1H8TA 5F5IA 2FMDA 1NTCA 3J7HA 3WUDA 2XUMA 2F5FA 1XSXA 4DINB 2GC1A 5DUWA 2QDRA 4YG6A 1J84A 3B7MA 2RJKA 3MMYB 2VXJA 5EPAA 4XLPF 3B94A 1W6OA 1UOBA 2K9LA 1RHI1 5HNFA 3PTRB 2KIUA 2Q4SA 1B8IB 4XNFA 2GIZA 1PM4A 5EYXA 4BQYA 2V79A 5H6QA 1G3YA 3FUOA 4H0EA 2RGVA 2AO9A 3HSEA 3S1QJ 4KWJA 2C5DA 3BR0A 3G4SI 1A6CA 1B9NA 3VDAA 3LSGA 1G9FA 2DV9A 1WW6A 4PUSA 3NMBA 2EFPA 2ZHKA 4Z8BA 3WXPA 3ZKUA 1A36A 4D0PA 4WVVA 1Z1DA 1IC8A 3PL8A 3ZOBA 4XQ4A 5LEKA 1WJAA 2YGMA 4GJZA 2P3KA 1R4MB 2WNUA 1BLZA 2ZX1A 1OKOA 1COV3 4ZTFA 1BVVA 5BPIA 1WKMA 4MVTA 5FZEA 3VDDB 3EJKA 4I98B 5BNPA 5H9RA 4L11A 2QQIA 1GWLA 4CDUC 5I0DA 3DEWA 2CNAA 4AEDB 4XRSG 1ACIA 1DLLA 5L36A 2RKHA 1OLQA 3IDCB 3GJBA 5E3LA 2YROA 1HA8A 4XZPA 5IP7J 1U5IA 3T1LA 1MS0A 1QOSA 3JQWA 2XJUA 1MBFA 2PLV1 2KHMA 4IOCF 2QQ8A 5F3IA 4LOSA 2HS5A 1B8IA 1J9IA 3L9JT 1PO23 4AFDA 3FF5A 1S3JA 1C5HA 5CVRA 1YOVB 3JQXA 1VMJA 4MTDA 4XVHA 5A2QZ 4LKDA 3L7WA 4IRIA 1QZYA 3ZQGA 3FFQA 3IPVB 2HTSA 5FLJA 4MV2A 1FMWA 1XE7A 4JCKA 5M0TA 4K9SA 1WVRA 2L3DA 4AYUA 2OQGA 1ZARA 2AEYA 1LOGA 4XF1A 2V5DA 1LDDA 1W7PD 3OYAA 4A3IJ 4LO6B 3OPZA 4HKLA 5J3UA 3IC7A 1IJWC 3WY6A 4UBGA 3BU0A 3MV11 3U78A 2ET7A 2BDRA 4ZJZA 1VQ5I 2UY9A 2P4WA 4JAAA 5L19A 3FM5A 4AQ2A 3VDDA 3WF3A 1RMU2 2A69F 1JODA 1P92A 3PNYA 1GQPA 5I0UA 4HX4A 3THPA 2XQRA 2MFZA 4AEDA 4C1XA 1NCQC 3LIGA 3ZFEB 4PQQA 1K83J 1W3VA 3DQVC 1RNLA 2NPIA 4AVSA 5FUIA 1KU9A 5FAXA 5M5YJ 2LK2A 1MS9A 1CQ9A 1ZZ7A 4NHXA 1GQGA 3V42A 3URFA 4ZXEA 2Y0OA 4BBSJ 3ZN6B 1G9CA 1VR3A 5FROA 1Z7S1 2FA5A 3BI3A 2KQRA 3W2WA 3ECOA 1WJFA 5A33B 1V5FA 2VUMJ 4X6RB 1V00A 1LHUA 4BJ0A 4RM3A 4G9SB 3IPVA 3M4FA 1FOD2 2XPUA 1K6YA 1QJY2 3I2FA 4FPGA 4BJ5C 4G3YC 1MZ6A 3JSOA 4K2EA 3PJRA 3TYJA 1UF2C 5FZBA 2ECCA 3CF2A 2BVVA 5C5TA 3CJRB 2Q5TA 2K46A 4LBQD 4L97A 1LHOA 4AZZA 2JG9C 2BY3A 1W06A 3L1PA 2ZGOA 4B8EA 1E5HA 1WLWA 1JBCA 3WP6A 1BEV1 1H1MA 4KDPA 4Q4Y3 1S2KA 3I4NJ 4BQNA 3ABMH 1CD3G 5FZMA 3K46A 1ASJ1 1BW5A 1AR61 1T56A 1D3YA 2E1OA 2XOMA 1D4M3 3MIEA 3TWIA 5FFZA 2ESHA 3MKLA 4O61A 3D5RC 2VBDA 5L3EA 3ZFEA 1LU1A 2YPJA 3AP6A 4C2MJ 4AK3A 2B42B 4EYUA 1PVXA 2FBKA 1YJLA 5FLVA 2W94A 3G6EI 3MW3A 1DYOA 4LB5A 3DN7A 3AB0A 1AF9A 3CUOA 5AC91 1L7QA 5DQ0A 4YG2F 1XNBA 3WX5A 1RUI1 2JSPA 2RE9A 1D0YA 3T0DA 3UGFA 1JUSA 1R4NB 3HD8B 2Y0SN 3WINE 3I56I 1LDKB 5HLIA 5CKQA 4QXBA 3C3WA 1L7LA 3AKQA 2YU3A 4HSRA 2DOFA 3KWVA 5FP9A 3UR3C 2V1UA 3OS0A 5EZGA 4BDYA 2KZGA 2HQNA 1NH3A 4DBRA 4LBKA 3WNXA 2UWAA 3E6CC 5FTTC 4CEWB 2R7UA 1ETKA 4XFGA 3IAM2 2DCTA 2K86A 4PFPA 1QJX2 1QEXA 1B9MA 2KRFA 1REDA 2E2JJ 2GNMA 3MCZA 3SHFA 3R0AA 1AOYA 2XR4A 3MKZA 1A35A 5AIQA 3CC4I 2BV6A 4DZPA 4HXCA 2JJ6A 4MQVA 1VRH1 3IMMA 2R1BA 1LEAA 2Y6KA 4Q4X1 3CO7C 3WW2A 4DS0A 2UUZA 5IYCJ 4XXAA 1RR8C 1RUF3 6PAXA 1DGRM 1GANA 1C8NA 1GZCA 4L9TA 3KP6A 2R0HA 4IUGA 2OPTA 3BPVA 3EYPA 3ZIWA 2QKDA 1W8ZA 1HXDA 2UXXA 3IBMA 2Y38A 3F9KA 3N7MA 3ISPA 1NYWA 4IGPA 2KFDA 5IYDJ 2XSJC 1LE8B 2LG4A 2PA7A 3NARA 3HOUJ 3VHNA 3VZJA 2W1QA 2AS5F 3IP4B 2R7ZJ 2GNBA 3QQAA 3S1MJ 2DN0A 3GCXA 1ND2C 4S04A 3OB8A 1UMZA 4M3CB 1LAJA 2JDNA 4FI9A 4QM8A 1WWXA 4Y33A 3W20A 3FX3A 5A3WA 5LBCA 3EYYA 1UAAA 3ZFFB 4KG8A 4CEWA 5KC5A 1LGCA 2O03A 4PJNA 2GC3A 4RA0A 1W8NA 2R1DA 5AVAA 1X1AA 3WSOA 1U9NA 3MIGA 3VFZA 3M8FA 3BT9A 1YRZA 1O8PA 1K4TA 2EIBA 1K78B 2QQMA 5LCWL 1C0WA 2M2EA 3KZIC 3SLIA 3NV1A 1WCQA 1JOPA 3WDYA 5JUVA 3EYIA 2DMPA 1HDPA 2KA3A 2WNVB 5CVUA 3ZYRA 3W2AA 2D98A 4TWTA 4M3FA 4FTEA 4FPOB 2YXSA 2NVXJ 3OYLA 1FV3A 1SFKA 1NHAA 3Q3SA 3UKTA 3FLPA 1YCIA 2FZ1A 1LE8A 1R092 3KT7A 1X1PA 1WUVA 4XYXA 2HWB2 2VPVA 1H6XA 3BTXA 1YWKA 1Z0HA 3ZN1A 3IWFA 1KGSA 1A78A 3RKQA 3DBHB 2MW8A 4M3CA 3CTAA 2B8MA 4KMQA 4AFBA 3F21A 4JBAA 4NWWA 5FKNA 1RMU1 2A3WA 2FDHA 1FY7A 4ORFA 2B5HA 1VBD3 3JRDA 3H0OA 5C8CC 2B0LA 3ZFFA 5C3PA 2VNRA 2DURA 5KXDA 2UWCA 1R5HA 2RV8A 1W9YA 4D7YA 3I2IA 1IKQA 4I3PA 3ZXAC 2RVAA 4OHZA 3OGGA 4XCBA 4PBPA 1X1CA 4TN7A 3H3VK 4KT5C 4Z6YA 1HB4A 1BJAA 3LQQA 1E5SA 4CPBD 3BR2A 3HNYM 1OA2A 4F83A 2VBPA 4JX0A 4U2AA 1JTZX 2EAKA 2VOTA 1W5SA 3V8LA 2JSCA 3SEZA 2P34A 1HW5A 4ASKA 1K78A 1TQPA 5AIPA 3DKQA 3GTKJ 2BFUL 5FKOA 2YUEA 4M0NA 3PSFA 2A1XA 5H9QA 2CYFA 2WNVA 3BQZA 1X3UA 3ABLH 3M2MA 1FOD1 5C33A 1P2FA 5EGOB 4Y5Z0 4HEA2 2RMU2 4HAMA 1H1IA 4BAYA 1OQYA 4K8FA 1VAMA 1ZR2A 1WD4A 3GCWA 2OZUA 5KHJA 2IGKA 1ZELA 1K61A 3HKZA 2X1EA 1BBT2 2L4MA 5LBBA 3NAPC 1YX3A 5E1WA 1QZEA 2R7XA 5DAWA 1TBXA 2CRGA 3KCCA 3JD73 3ACFA 3FL7A 4Y1VA 4Q4V3 4U87A 2DDBA 3K4DA 5F3EA 3N9OA 2LDUA 1XBFA 2ID4A 4GKXA 3G1MA 1W6PB 3I8TA 1A6QA 1DZRA 4F91B 3LDKA 4YM0A 2D1VA 3SKVA 3KHBA 3CF6E 3HL2A 3T4VA 1GVDA 3DXUA 3WLUA 2IRFG 4UVAA 1NAEA 2NQYA 3T1BA 3ZQCA 4HL0A 5I91A 5KCMA 4AVZA 4XJAA 3C1DA 1RJ8A 4GMP1 4LQRA 4P96A 1CJDA 3FXQA 3S3OA 3AMMA 1YHQI 2ZHLA 1LUJB 2CQQA 4II2A 4J19A 2G9GA 4MGZE 5IATA 4HRIA 1US2A 4BISA 4MEYF 4HG6B 4LE4A 2JG8C 2ZJ2A 3L2WA 3E6DA 1HX6A 4NO4A 2ZBJA 1MDMA 3HM5A 1AX0A 2BOLA 1W0OA 4K6BA 4UFKA 2XAHA 5EGOA 1AYN3 4P08A 3W6JB 3BOWA 3GGLA 3DPTA 3Q9SA 2DCEA 5LA9A 3H35A 1COV1 4DOUA 2VZVA 1FPQA 4MXWB 1SMVA 2PN6A 4KITB 2B46X 3MIBA 2X5IB 1SQ4A 2YG0A 2W00A 4K1ZA 3OYWB 5FQ0B 4E7HA 3WW1A 1UKRA 3IDAA 1TT0A 4UUTA 5LGTA 2VPRA 3GFIA 2ZMNA 1Z91A 1NA1B 2E7QA 4TLGA 2L4AA 1W6PA 4AIDA 3DEEA 3K4JA 2W48A 1XE8A 2XWBB 4K40A 5ED4A 4AGRA 3B69A 1RUC2 1XYPA 2XJPA 1DDLA 2HVSA 2Y33A 2QJVA 3BVCA 3NNGA 4PI0A 2OS2A 2DXIA 1PO21 2EVXA 4BK5A 1F1ZA 1ZGJA 4AYBA 3P7NA 2R6QA 5D21A 4CUAA 3VOEA 2JWTA 3MKYB 2BY0A 2UWMA 3D8CA 1AVBA 3SNMA 3P9KA 4B43A 3S14J 4KFCA 5DUVA 3J8F2 3AVSA 1QH7A 4Y24A 3MIDA 5ERIA 4E8CA 3JTGA 2Y60A 4DZGA 3RWKX 1HV0A 3K9TA 2OAZA 2VZSA 2CU7A 1LEBA 5A3NA 2DFCA 2HEWF 3ORJA 1OJLA 2Z5UA 1O7LA 1UXZA 4OI4A 4XJUA 3N9NA 2HOSA 4MXWA 1W4MA 1SVMA 4RL7A 3BU7A 1PDNC 2RNGA 3G1LA 1H30A 2VOXA 2XAUA 2X5IA 4N53B 4LXLA 3OYCA 3BG3A 3SFIA 3B73A 2X6WA 2P4EA 3OYWA 5FQ0A 1WBFA 3RVHA 3USUB 3AZZA 2PAEA 1NA1A 1OH4A 4X8PA 1D1CA 4H3WA 2MH9A 1YRNB 1PMHX 2VECA 5B2GB 3HRMA 4Z07A 1N3PA 5JPMB 2AZ5A 1KU7A 4I76A 4FO9A 5F3GA 4HA8A 4CUCA 3FBNB 3OTFA 4XFHA 5J47A 2QNKA 1C1FA 1M06G 4V1PA 5K0UA 4EJOA 3KIOA 5L3FA 1FBUA 4HV6A 1DUXC 4BQOA 3ZPOA 3OL4A 2HWB1 2CW8A 3EUKL 2W68A 4ASLA 2ELJA 4EN6B 4HT1T 2ELKA 3POBA 3S93A 4RS5B 3LSTA 4A7ZA 4DMIA 3CLQA 4BGDA 5GPAA 4A7YA 1D0XA 1RTVA 4AUXA 1V4RA 3ZQLA 2OYZA 2M9HA 2OQ7A 2JPBA 1EKEA 4LLOA 2LKPA 1E57A 2FDGA 1LFBA 2J22A 4A3GJ 1RJ7A 2FDJA 2HWE2 3BYWA 4D3WA 3SHRA 5BNOB 3E3VA 2TRTA 4Q0VA 1UG2A 4P9UA 4Q4Y1 5KHIA 3VKMA 4GULA 4N53A 4LHLA 4QX0A 1YW8A 2E63A 5FFOC 3O0XA 2ZGNA 2FRHA 1DPUA 4IHTA 2RJLA 4CXFA 3USUA 4TLFA 1Y56A 1ZRFA 4R9BA 1OLRA 3I2OA 5JPNB 3BROA 1Z67A 4UW3A 1RKTA 2VJJA 1T6BX 2CHHA 1V6NA 4IV3B 3RI9A 1YRNA 1DIWA 1BC8C 1PVC2 3OSGA 4A3XA 1JYXA 1QVUA 4K21A 1REPC 1CAUA 2R7TA 2RMU1 4XF4A 4GQ7A 5C4WC 5A7PA 3R05A 4IEZA 5D5WB 2JRMA 4RB0A 4RR3B 1UY1A 1HRV3 2Y6LA 4DW6A 2BPA2 2Z1DA 3GHNA 4Z92B 4RSUA 4GH4B 1BBT1 2ZB9A 1NE6A 2UZKA 4IXLA 4P5OA 3AG4H 2K9MA 2IVIB 4LBJA 1LCLA 2WLQA 1TTYA 3W5MA 2FMLA 5BNGA 5FD6A 4DRRA 2L2OA 4CE8A 2IS1A 2X85A 4LKFA 4GALA 1HBXG 3HSRA 3FK6A 3VBOA 3D1NI 2W47A 3ML6A 1LRHA 1F8VA 3POSA 2VB6A 2D6LX 2E36A 4RGGA 5BNOA 5BXXA 3BG9A 1NXMA 4E7SA 3ZN4A 5GTIC 2AGSA 1S0EA 2L5QA 3OGVA 2AH2A 2WZR3 2W4SA 1OCRH 2EB7A 3DTEA 1AXKA 4OIRF 2JUGA 5A32B 2OV7A 3ATGA 4NE9A 1RUF1 3E6BA 4QMAA 1OKQA 2PHTA 1UMIA 3AZYA 3I49A 2ARCA 5EIYB 1POV1 4IV3A 2F5DA 1YI9A 3WG1A 1L0OC 1CZVA 3LOBA 1HJGA 3KZZA 4FHTA 1W1WE 3W3CA 4XOTA 1X4OA 3E0JB 3DF8A 5ICCA 4PDKA 3C7EA 3P3PA 4FP2A 1N75A 4FISA 3WTVC 3AJYA 5HVQC 2NOJB 4FQ4A 3WVJA 1PHMA 2AEZA 4RR3A 5IOYA 3B93A 3AZXA 1YFYA 2PMZN 2Y0MA 3WT3A 3S5AA 4Y22B 4M3GA 4MGRA 4EE2A 4URAA 3H5AA 4GH4A 2WO7A 2R7RA 2GMEA 2WN3A 2Y0IA 3KP7A 2DODA 2D97A 4EJWA 1SG3A 4MGTA 2RDPA 4N9IA 3WF1A 1Y9QA 2P6HA 3ZMZA 1OLMA 2Y6FA 2QCOA 5FPXA 3FZVA 4QKNA 5FZ0A 1TWCJ 3PURA 4QX1A 2ZEZA 4AL9A 2MHFA 2I07B 4C90A 2VU9A 3GCMA 1C57A 5LBEA 1XU2A 3TQNA 3ROUA 3J7MA 1RUC1 3C2HA 2XV4S 1WPKA 2R5ZA 2W1WA 2DFIA 5JIAA 3O3KA 4G9YA 1ON2A 1O3SA 3O6BB 3BTAA 5A32A 4GYGA 5EFUA 1JUPA 3GO5A 3QRFF 3IAS2 4HVOA 3A01B 3CCMI 2JJ7A 2VL4A 4NB5A 1W8WA 2W08A 4XRFA 2VD7A 4QX8A 4CDWA 2HEYF 2CO5A 3J8F1 3QH7A 3OSFA 3DKYA 4BY1J 3CJIC 4WM8C 5CFDB 1IPJA 2ZMLA 1WW5A 2PI0A 1ULOA 1JZ4A 3E7LA 3JR9A 4Q26A 4CCKA 1E5RA 1K45A 4FE7A 2F17A 1WGPA 4Y22A 4LITA 3M3OA 3NWSA 1VBD1 2D7FA 3SEPA 3PIJA 4A3BJ 1GQHA 1OOPC 1MQTB 1HQWA 1UX6A 3MEPA 3BR3A 5FV3A 5EZWA 4F3JA 2CTVA 1TME3 2XAQA 5JR7B 3IDBB 1UY2A 2L9RA 1W90A 4FFGA 4U0VA 4CDQC 5B1BH 3SH5A 5H20A 3H42B 1I1GA 5FLMJ 4HETA 1GLHA 4BQ3A 2IGOA 4V2VA 5EEAA 2RDRA 3OWTA 3WU1B 2XJQA 4PJ0C 3CQZJ 5GP9A 1MEC3 2AENA 2W3JA 2F5VA 2YZ4A 5D5UB 4PLMA 3A01A 5B3SH 1D0GA 3O14A 4XW3A 3ZFGB 4NRMA 3U0ZA 5HDKA 3CEWA 5J48A 5K5QA 2FUG2 4HLYA 2M8GX 1CGPA 3A0BC 1AR72 3OJBA 4XURA 3U1XA 5KNLA 5M3FJ 5L7OC 2DDAA 5BV6A 4IX7A 1L3JA 2E5NA 4XQDA 5CFDA 4CO8A 1TMF3 4JP0A 2FOWA 2I10A 2QENA 2EZKA 2LM3A 3VZLA 3VUOA 3IT8A 2X48A 3C3VA 2HWE1 3AX4A 1YLLA 3WQ7A 3BWGA 2O0YA 5K7FA 3JD71 2HVQA 2IXLA 1I6XA 4Q4V1 3I9V2 3HQXA 4Y5SA 4YZ5A 4LD5A 3KV4A 1PM7A 5J8FA 1MQTA 1WH5A 1L3LA 2VONA 4OAYA 2F4MB 5EJCA 1D1AA 4KN4X 3BOQA 2VAUA 4CCJA 4C8DA 3WODF 1S6LA 3F6VA 2ICWG 4BK4A 3KE2A 2LVSA 2NS7A 3TMOA 1UZYA 2STTA 1GYKA 4Q48A 1DCSA 1VBE2 4ISQA 3WP4A 1ZNPA 3A03A 5DAVA 4ASMB 2LKSA 1LULA 1ODDA 3H36A 5A2QK 2RS12 5KR7A 4XKBA 3AMHA 3M8EA 3ZFGA 4L0PA 5JFRA 1AYN1 3O5SA 4PIXA 3GBGA 2VODA 4IEWA 5ICGA 4DQAA 2HDCA 4WV8A 3JRBA 2Y69H 1W2UA 2VG9A 4PJMA 5IW0A 4QD2A 1FMD2 1HIXA 5IK8A 1MNEA 3RZJA 2MH2A 3S57A 1WKYA 1N47A 3ZSMA 3EQLF 3IWZA 3AZVA 3KQ4B 1U5XA 3OYHA 2WYSA 4M3DA 4M6XA 1NCQB 1PGW1 3AJZA 3A0KA 4YGEA 2E1NA 3UNPA 1TZLA 4NMIA 2HOAA 2ZGLA 1UY0A 2F2EA 1VQ4I 1HCRA 2B7EA 3W6VA 3SISA 3RTRA 2K9NA 4QTRA 3ITQA 4ES9A 3KQRA 1O4TA 4EWDA 2EXHA 1MJBA 5HLTA 3I2KA 1T2XA 1PZ7A 3VBSC 1YJ9I 1ZBE3 1DU0A 3CJXA 5FLHA 3U1DA 5EJ1B 1EPZA 4E4DX 4PCRA 1GFF2 1DG6A 1H8TC 3OG2A 1UZWA 2E1MC 2ZJCA 5T54A 2XRLA 1HKDA 3MFKA 2YR2A 1U5ZA 4FPYA 4AGGA 4F8AA 4XLCA 1PK6C 4FOYA 3H3UA 2VJ5A 1OI6A 5GADJ 4IQPA 1AA7A 2WNEA 2VZTA 2BW8A 3WTWC 2OQ6A 2K4BA 4CGZA 1ACCA 2JG9B 3BTIA 2WS93 2BFUS 5J37A 5F2SA 4DEQA 3O1UA 4HF2A 4OMDA 1MGTA 1LEDA 2FBHA 3L2CA 4EVIA 1FNYA 4QU1A 2LF7A 1OA4A 2VXRA 3N9PA 2E1CA 4CU7A 3U07A 1JYNA 2D5HA 1UYXA 1SAUA 1VBB2 2KD7A 2V1XA 3HGGA 5TJJA 2X9DA 3PUFA 1NCQA 3H92A 2JA5J 4YW3A 3IKWA 3DPRC 1ZGWA 2JXAA 2H8RA 5FFXA 4HSLA 4AGVA 2XRNA 2IFRA 2K85A 3T2OA 1G6NA 1TME2 1XGNA 3OYIA 4HMZA 2WAAA 5IUQA 3G2BA 1NQJA 4IESA 3AP4A 5DUXA 1J2XA 1JW6A 1XU1A 2J1SA 2O8XA 3W21A 3OD0A 5T5PA 4CP0A 3DGTA 3SZGA 4KIBA 2R0QC 3T3YA 4LO7A 2G9ZA 3VL9A 5C3SA 3IMNA 5JXHA 1W6QB 1X3ZB 2L7ZA 4IEUA 1IS5A 2HPIA 1ZA4A 1ZM1A 1A6IA 3H50A 2XIGA 3K70D 1XRUA 5DZGA 1RUG2 1G8XA 2W57A 3WD5A 1YI2I 2XWJB 5CYVA 3SKJE 1AUYA 2AC1A 1SEUA 1MW7A 5CAZA 1BJZA 3J7NA 2YX7A 5FPUA 4D69A 3BR1A 4BQWA 3RYRA 2JG9A 3LEGA 1QPMA 4GXOA 5A6YA 1O4ZA 4EJRA 4DY3A 2WAQN 4RGKA 4LBOA 4LBNA 2DYCA 3H1CA 5EXOA 4DNYA 2GA1A 2QE3A 1VFCA 1Y43B 2DO7A 4GIQA 4LBLA 2ELHA 4IJAA 3LEKA 3IH2A 4JGYB 4EJUA 3X2QH 4OOIA 1MBHA 5T3NA 3C8XA 3HAGA 1XQNA 3DYMA 3OEAA 3O0WA 5CJ9A 2VZQA 1UQXA 5GPCA 2E32A 2B9UA 3CNAA 2GALA 1J83A 1BI2A 3BCBA 4IVNA 4OINF 1UB9A 3S8PA 2BGCA 4AEDC 1IG7A 1BBYA 5FDBA 2J5PA 3NJVA 3PUIA 4E7LA 4IE6A 5A7SA 1RUD3 1NE4A 1AR71 1WCKA 2K9ZA 1HRV1 3GYDA 5JAXA 1ND3B 4C91A 2DQRA 3QLQA 2FF4A 5JR2A 3FLTA 4WXDA 4GFBA 5DS9A 4L0YB 3S1NJ 3CCUI 1OF4A 3A21A 1I1EA 1JUMA 4MGQA 2A3YA 2D6PA 3OBTA 1P4XA 1AHDP 5JMOA 2C24A 1QQP2 3ZSLA 3WOGA 2HWC3 4A0ZA 1BR4A 2FNAA 3GTGJ 3ZSEA 1SACA 5FY4A 4ZH4F 1HXS2 3ZP5A 1EYBA 4IEVA 1FIAA 4I09A 1X4PA 2V6CA 3V64A 2RS32 1OFSA 2OF7A 2JX9A 4YIRX 1X58A 2VZPA 3E1SA 3AM2A 2WZR1 1MZBA 4KIGA 3THDA 3MZ8A 4JGYA 3MGUA 1WLTA 4EGZA 3KEOA 1B35C 2VKVA 1VBE1 1FP2A 5DDJ3 4EM2A 1E5IA 3BKZA 4Z2YA 5ANNA 3D3AA 3K3OA 2K0GA 1FOKA 4S2GA 5EF6A 3RMXA 1VQ6I 4NUBA 2RS11 3Q0UA 2DA7A 2H0VA 3RCOA 3CJNA 1TC3C 3TBIA 3CCYA 5ABJB 5ACA2 1VZ0A 1IPKA 3ZFEC 4XLFA 3VD4A 3TP3A 2RV9A 2LBFB 4A3KJ 2X4HA 1ND3A 4QAWA 4X1EA 3KT1A 2HGCA 5C8CB 3WR0A 1GZWB 5F37A 3HSFA 4NHYA 3H7YA 3W58A 3BODA 4NC8A 2PELA 1GOFA 2K7LA 3BG5A 3NNLA 1HB3A 2KKOA 3FXUA 2Y64A 2J1RA 4XONA 1RUH2 4YFWA 4A0XA 1WFXA 4G7OF 4W6XA 2HNHA 4EMSA 2DTWA 5BOXA 2WSUA 3M07A 5I8TA 2NP0A 5GAGJ 1C8M3 4B47A 1YQ6A 4YIIA 2E26A 1FYUA 1R1A3 2I45A 5FYYA 3ILFA 3DP7A 1GZTA 1PIV2 1X8EA 3F23A 2O61A 5JVGF 1G3WA 4YGDA 2DBBA 2FCVA 5FZIA 5F7UA 4E6KG 5E89A 3CUQC 1FNNA 2JPCA 3G1OA 4KG0A 3OR2C 5FZCA 1F4AA 1QHDA 1VAVA 1HB2A 4ZYGA 1V3FA 3OY8B 3K2OA 4HSTA 2QF7A 4IDZA 4C1WA 1A31A 1QJEA 2JE8A 3FXMA 3NAPB 2HEVF 5ABJA 1A8DA 3J7ZI 1VBC2 3ALQA 2H8WA 1MMSA 2FD8A 1H2NA 4QQ2A 2KDOA 2LBFA 3ZMTA 5JCTA 4BDZA 1NZIA 3HXLA 1JYVA 1JKRC 2W0XA 5C8CA 1GZWA 1VBB1 1XG1A 3VZOA 1SANA 3CCSI 1GICA 2DWRA 4RBOA 1KU2A 4OI0A 4XSXF 1CAXB 2LRPA 2VXDA 2VH9A 2VUCA 2F6BA 2R93J 2E53A 3FXRA 2WSVA 5D2AA 2ZFWA 1TME1 3OS2A 5J1UA 2RM22 3HR9A 5GALA 2HWD3 4YFXF 4CEWC 1KQRA 2XDVA 2PLYA 2QQOA 2COMA 4UUSB 1IO2A 1BOAA 4ENMA 3HNMA 1WW7A 1YJKA 2D44A 2UXNA 1RUG1 1BKZA 1W36C 5F0CA 3BR5A 1IN4A 2L9VA 1J3QA 2IBDA 3CLPA 4XF9A 4IGQA 4XLEA 1YFXA 2EA4A 3OY8A 2CFXA 4A4AA 5F27A 3A2KA 5FYSA 3T1MA 2ZKNA 2WQ8A 3QP6A 3NAPA 3B9IA 1GV2A 3K4ZA 4QB1A 4EJVA 1UELB 1PVEA 4C2UA 3HOBA 5FLIA 3WDUA 3VPRA 5JZGC 4UFIA 1FTTA 1ERDA 2IXJA 4JRAA 4CYCB 3G3ZA 1X50A 2DUOA 3M8LA 2WFF3 3EUHA 4ZXKA 3ZCOA 1DU3D 1GWKA 5FMCA 1LKXA 1S0DA 1UAIA 4WX9A 2LTPA 2BWCA 5E16A 1YX5A 2CQNA 1CAXA 1AYM2 3HOXJ 4C3JJ 3LB9A 1NK3P 3A22A 2MLGA 2VUJA 2IS2A 2A3XA 4HG2A 2WA3A 3LL7A 1T38A 1GWMA 5A3MA 1FOWA 3LWCA 4YG3A 1YIJI 1RVF3 2Z2SB 4WXHA 3ZFFC 3ERMA 3R4KA 1UG0A 4COVA 1R71A 4UUSA 4XORA 4QQLA 3LA3A 4A3EJ 1VE0A 3PIOF 4A6DA 1GNZA 4QDSA 3AG1H 2XMLA 1SDDB 1U2WA 2LFBA 4LE3A 4W4ZA 4ESJA 4D7NA 2J42A 4BE0A 1X1DA 3KYCB 2HKXA 1CR7A 3T2PA 3KHCA 3T0AA 1YW9A 2WNVC 1AZDA 3OS1A 4UV9A 2DOAA 1HXS1 2WZ8A 4KH9A 2G9WA 2Q1MA 2OZJA 3QD6A 3GBFA 2BHZA 1IZ3A 3M3QA 3O1RA 5IVCA 5TSWA 5CZKA 3ZM8A 1XYNA 3NW4A 2TDXA 2EBIA 2KIQA 1TWAJ 4DIQA 1VQPI 2CGNA 4BXFA 2XKPA 1UD1A 1XB4A 3L09A 2ET1A 2EALA 3BZ6A 4B4CA 2EF6A 2FNPA 4NHLA 1W04A 2Y75A 1OQ1A 4BJTA 5FPAA 2F48A 4GMP0 4OHWA 3RZZA 2WINB 3RKWA 1IN5A 4AQSA 2JDMA 3NL1A 4KWKA 3NSTA 4QU2A 1B4AA 1KQ9A 5CNAA 5HI0A 3I97A 4QB2A 5K5OA 2DVDA 3KYDB 5ACA1 1AXYA 3HRUA 4P9XA 2R062 4CICA 1MS5A 4FCAA 4G12A 1HDDC 3L2HA 5A3TA 2EA7A 4D0QA 1YHFA 2R7OA 2C0ZA 3ZQHA 1ULFA 5L9BA 1US3A 2OQRA 2XPWA 2NZ9A 2MD5A 2BBAA 5I0RA 1ZK8A 4IW3A 3GW2A 2P7VB 4EATA 5JVVA 3USSA 1SFPA 3VN4A 1HC8A 2EFOA 3BOPA 1G2HA 1WA6X 1R9TJ 1HW2A 4P9IA 5T55A 2BP6A 1H9GA 1W05A 1W0PA 3U75A 2A68F 4FASD 3CCEI 1MBJA 3A1YA 1MS8A 4JOMA 2ZX4A 1HSJA 3UKVA 4N8MA 1HV1A 4EN7B 2VOKA 4JX5A 4U0WA 3P6BA 5K1YA 1PIV1 4TZDA 2ZSHB 3OMYA 1NKGA 3HRSA 1QNTA 5K9YA 4LPLA 5FZ4A 1T6GC 1U78A 4Y15A 3CESA 1AR93 2QTWB 3HC7A 2GXAA 5FY5A 3GFLA 1IN8A 4UYBA 3H8UA 2CQ7A 5HDNA 3VBUA 4OQ8A 2XL9A 5F08A 5I0SA 2ZXJA 5G05L 1KYZA 2WO3A 1EV13 4Z2WA 3PDQA 1VBC1 4OAZA 1ETQA 2QCSB 2WFPA 1CONA 4MGIE 2HZDA 3BLYA 2QKMB 2BBYA 4QGMA 3K7AJ 4CXXA 1KS4A 3LSJA 1WCUA 5J6XA 1CPMA 3PMSA 2IVJA 4RGAA 1X33A 1W9FA 4BACA 1T8IA 1NOVA 3F22A 2C6YA 2OJED 2PFBA 5LATA 3DEUA 3OIOA 4RHV3 3NWKA 4NN0A 3OYJA 3DTIA 1ENXA 5A3UA 3FFZA 4BU2A 4AE2A 5EG0B 4HKWA 4M73A 5DZFA 1XGSA 5A7OA 3E5QA 3HBZA 3KP5A 2V26A 5LRSA 4B3AA 4LMYA 3W6KB 2GC0A 3RIRA 4L18B 4XJWA 5F39A 2P6SA 4FXGB 1AU7A 1Z78A 5CPRB 5GLVA 2N8GA 1RVF2 1W9TA 5CVIA 1UYYA 5F04A 5DUIA 2PBIA 1W8OA 1E3HA 1NA1C 3M7AA 2OBPA 1GZ9A 3S3MA 3ZRGA 4FXKB 4XUNA 4Y7NJ 2GMPA 3IAQA 3SEQA 5FXWA 1DDNA 4JHZA 1A8MA 5T52A 1X82A 4LKSA 4M00A 4MO3M 1MSEC 2WB1N 2DCZA 1F5FA 4RDUA 3N05A 4BQAA 5J3LA 5JSOA 4RB2C 1JUHA 1JZ7A 5KK1A 3RZKA 3BCAA 1V6MA 2HWC1 4N7IA 5K0UC 4L9VA 4D5CA 4A41A 1R1ZA 3ZR5A 4NPMA 2VMIA 2CW7A 4XPVA 4AHXA 2BGPA 4COUA 3RZDJ 4FQGA 2WBMA 1SD6A 1DU6A 2JRTA 2R4GA 3IKVA 2A07F 4QPQA 4A69C 2AUYA 1WWYA 1AL22 2Q0OA 2R073 3MLLA 5EEGA 3J7AO 3N7LA 5DYMA 3M8JA 3RPUA 1XPXA 3PU3A 1T08B 2DOEA 2Q8OA 5IT9K 2LKXA 2WZEA 5LY2A 2OKXA 4ITCA 1W2OA 1F43A 2FSWA 4AHZA 3HYIA 4G6TB 4L9NA 1AX1A 4IEJA 5BNNC 4EROA 1H2LA 4WM8B 4E2SA 1DBNA 3H1YA 4N53C 1MBEA 3L00A 3BTYA 1QKQA 1ULDA 2XASA 3O12A 5FPBA 2XKOA 1VQOI 3H0DA 4ZU4A 2A6ZA 1RUE3 1EV7A 4XRMA 2HTJA 5JLVA 2LH9A 1I27A 2ESNA 1ZH5A 1OOPB 1SHWB 3SMHA 2AREA 4B1MA 3ZYJB 2EIGA 4JYKA 3DLLF 2VBYA 3L2YA 3SXWA 2PX9A 5HCFA 2WRAA 2Y30A 2JN6A 2NAZA 2DCKA 4ZU7A 4YZ2A 2ZOEB 2GMMA 5KHDA 2BTVC 2LNBA 5FOJB 1T98A 4HN1A 4O9GA 2WL1A 4UAPA 2O1QA 2VCCA 2GP5A 4W50A 1O3TA 4XC9A 1FP1D 1IDZA 1C8M1 4Q4W3 4BHCA 1C5IA 1BMV1 1SLCA 1JGGA 3QU6A 5C5UA 3VBOC 2Z3YA 5TGTA 4YWAA 2Z79A 5E3MA 1R1A1 2ZO4A 3MPPG 4ES8A 1POV0 2M7AA 2KIMA 2IZWA 3R4SA 3RFRA 3GZAA 4OLLA 4CSWA 2WJSA 4A3DJ 1ETXA 4RGRA 1VQ9I 4UT5A 5E1ZB 4CH7A 3HOYJ 2V9KA 2ME0A 5ILUA 4ISRA 2HWF3 3H5NA 4XFBA 2IT0A 5E18F 2W95A 4DXRA 3F8FA 3TOAA 4WZFA 2O5RA 5DG2A 3CJTB 5LY1A 3IL2A 1W9SA 4R9DA 5EV7A 3ON7A 1BYHA 3CD6I 3NRUA 4TSVA 4FPEA 4J1XA 1TE1B 1WI9A 2STWA 1OPOA 3VBFC 4QPIB 4LK6A 3AL5A 4LT5A 2HOEA 4Q47A 4RR3C 4OQ9A 4ETSA 3ABZA 4X6AJ 5FYCA 2EH3A 2L9SA 2XAJA 5L3DA 2GOMA 1TNSA 1L7RA 2CU5A 4FX4A 3TN93 4N43C 3PFYA 4MEXF 4BHPA 3SYTA 3VKNA 3GMEA 3JAMZ 4HBLA 4KMUX 4DYCA 5J7MA 4MHRA 1VLNA 3CMYA 4Q27A 1P4AA 3X29B 1TP4A 3EETA 3WUCA 4UOJA 4QKBA 5FYIA 3LSHA 4F3QA 3I55I 1UWWA 4AFAA 4RYDA 1UY4A 2LTNA 1XDSA 4XDQA 3NV3A 4XHXA 2P7CB 2ADDA 2UY8A 1UIJA 1MH4A 2H1LA 3CIHA 4MNUA 1KGYA 2ZGKA 4HNUA 1OCPA 2ZCWA 3GZUC 4B1LA 3I3EA 3OL3A 3LFKA 4CP1A 1G59A 1ZQ3P 2DK8A 2KPMA 4PF5A 4OMCA 5IVVA 1PX3A 2ERFA 4BE1A 4CDWC 5FO7B 2EILH 1PO13 3F8BA 1TQIA 4XN3A 5A80A 2VZ3A 3I3BA 1D5VA 4P9WA 3VBSB 1ZA7A 2PQQA 4MOAA 5D6EA 1HRI2 1UPIA 2JWPA 4QPIA 3GUDA 4MLOA 2XGCA 5D4RA 1RYYA 2PMUA 2HBTA 3RWNA 3K51A 1AX2A 3DUIA 2DBNA 4ATFA 1LOEA 2R30A 4KNCA 4YYOA 3G71I 3WNKA 3RDIA 3FJSA 3LEMA 3T0YA 1E3PA 2O8KA 3VB2A 4COWA 1REFA 1RVF1 4E7IA 1XNCA 1PK6B 3LDBA 1N3QA 1QXPA 1XNAA 3BG6A 4XUQA 3PO2J 1DGLA 1G9AA 1XD7A 5HCAA 1I1SA 1ENRA 4TTGA 1JYWA 4PLOA 3HOZJ 1WSUA 1GMMA 3PJYA 3WG7H 4IXAA 4Y1YA 4MQ9F 1ZBA2 4NQWB 1DYKA 5F0HA 2JDYA 3CC7I 2V73A 2PAMA 4QXCA 3M3YJ 2OW4A 4XJZA 1K4SA 4JDNA 3T2TA 5CQGA 4NOTA 3TEXA 3S32A 1U3EM 4U0YA 3ETQA 2H09A 2Z4FA 4K20A 3B02A 4CPBA 4MTEA 3LOCA 2OD5A 1RUI2 4PGHA 4KA4A 3WE2A 3DPRB 2ZAAA 2QM3A 2Y6JA 2EK5A 2A71A 4GWJA 4PSWA 5FZ7A 2CV6A 3ASNH 2EJRA 2BEOA 2YX4A 1LJ7A 1T2KA 3VBSA 3C7FA 2VZ1A 5CFDC 2IS4A 2QLZA 5A7WA 3S7EA 4F93B 4RLFA 4FOVA 4MO7A 4F52A 3GWZA 3BZCA 4M9XA 1BXHA 3HN3A 5FO8B 4I2OA 2VKDA 2OX0A 4P55A 4Q1PA 2DMNA 1K6OA 4M71A 4ZZ8A 3OOUA 3U9GA 4P9GA 4XKWA 5JI6A 4A5MA 4FPFA 1EPWA 4AWDA 3BUCA 1PK6A 2A6VA 5IP9J 1SVOA 1CIYA 4XQFA 3MYXA 2E7XA 1MQTC 1VRH2 4FPHA 4NBQA 4Q4X2 4FETA 3JBG2 2VCAA 1V9U3 5FKMA 1ENHA 1WBLA 1WQ2A 2UURA 1JZ5A 4CA9A 2WQ4A 4OUMA 4FX0A 4NQWA 4KIFA 2V1NA 3DECA 4XQWA 3N9QA 4IF4A 5DEQA 4Y20B 4LO8A 2ARXA 1DQ5A 3FBIB 3I3DA 1YQ8A 4XLNF 4QGLA 5JXIA 3F0CA 1SLTA 2R042 4F55A 3TP0A 1RITA 4FCYA 2HH9A 1YQAA 3DPRA 1Q8PA 1WLDA 5EWSA 4CCCA 3DV8A 4LJHA 1RZ4A 3ZFGC 4ENKA 3ETPA 4AHYA 2VOPA 1T33A 1YFUA 5T50A 1PUFB 1PNGA 5D1IA 1UX7A 5J36A 2QEXI 3ZPLA 1LQ1A 4ONUA 3FZ3A 2F4OB 1BI1A 2D40A 2E34A 3I3LA 4S0HB 1DGWA 3ZR8X 4YRDA 2M8EA 1DGWY 2M0MA 1U0AA 3HMYA 2V9VA 4AXOA 5BPXA 1FLIA 2VKHA 1DQ0A 4B4PA 1V5EA 1AR91 1J1TA 1JYTA 1F9NA 2ZGPA 2DPDA 4B29A 1BCXA 4BJ6C 2J7MA 1SC7A 2CQXA 2D6OX 4CU9A 3IH4A 2F5CA 3IKTA 2A6WA 3ZGKA 3M70A 2DA5A 2HXIA 2DW4A 4DBQA 1RUOA 4D7TA 5JSRA 5F3CA 2WT2A 1W5TA 4G6QA 3LSKA 4A2UA 1SZBA 1PNFA 4Y20A 3KF5A 3KLSA 3FLRA 2EIDA 2R16A 3TO9A 2UV1A 2PQSA 1NG0A 4PHZA 3K48A 3RI8A 4HPKB 1R22A 3FBMA 3WP5A 3VD7A 5KC6A 1ZREA 3FMGA 1BM9A 1KONA 3JSPA 2JK3A 2ZGUA 5CU1A 4XIDA 3HIFA 1ZKGA 4RGSA 2YMZA 2CYYA 3TB0A 1B35B 1PUFA 3FHZA 2FZ2A 3THTA 4FVVA 1JOBA 1UJ8A 4EN8B 4V2FA 4H55A 2CMPA 3INAA 2BZDA 2M87A 1YEWA 3T2QA 2IXCA 4I0WB 2I74A 1R083 2ZFUA 4L2NA 3KV5A 3MZHA 1QOOA 4XDPA 4Q0PA 4YG0A 5FPZA 5FOBB 4DUWA 3P5BA 3K1MA 2L9NA 3SXYA 2M4KA 3MKWB 1JUIA 1HQLA 1GNYA 4J01A 4HK9A 2OTLI 1UCRA 2NNYA 4AHWA 1QIQA 1K79A 5AONA 1ZHFA 3CDHA 3KETA 2XB5A 3MUZ1 2VO5A 4JC1A 2HYGD 4BDVB 3WF4A 1XXNA 1H2MA 2AQEA 4LJZF 2RS52 5BUVA 2D6KA 4AI3A 1HRI1 5FY0A 1KITA 4HPKA 2EV6A 1I3AA 3PM1A 4QDQA 1YXWA 2KZVA 3J7YJ 4H2AA 1K12A 5LEJA 3DKXA 4BNCA 4CDXB 4Y3OA 1B72B 3ZDSA 3AL6A 1Q8QA 3WHCA 3WGHA 1F4KA 3GFJA 2VJIA 1DGRA 4QXKA 1QJU3 4PIZA 2Q1ZB 1JYCA 1B35A 3CUQB 5FJHA 3RNSA 4BA6A 4NHKA 4A93J 1LVAA 1KZHA 2GIVA 3UKGA 2NLRA 3T8RA 2Y48A 3ZIXA 2RR13 5JLWA 5FKLA 2DA2A 4R1HA 2JKXA 1QBJA 1LNWA 5I93A 2E33A 3KZ4C 1ZBA1 4HBNA 5GZGA 5CKTA 2DT5A 3Q8CA 2BXYA 2ZXIA 4JTOA 5JOXA 3Q9OA 4UWDA 1JGSA 5J98B 1NLSA 3MPBA 3TOJA 4IQ4A 4JTNA 4HQMA 2PMWB 3CJQB 2DVFA 2MC3A 2OXBA 1IPSA 1LEMA 4BE3A 1RUE1 2VNGA 5FREA 3REOA 3GTMJ 2NNNA 2CSGA 2BW3B 3CCJI 5IY5H 4RAGA 5E8IA 5F1RA 1GP4A 1MZFA 4JZRA 1W99A 2JMWA 3KX2A 2C9KA 4M0HA 1OF3A 1YIFA 4XCAA 4HDUA 3AKTA 5FY8A 5IK7A 4J00A 5EYYA 4NIGA 4A3FJ 5DN2A 3BTCA 2Q1FA 4EQVA 4E2GA 1X19A 5LK7B 1COV2 5DAXA 3KGLA 4CDXA 4D8MA 2V7FA 1OHFA 4Q4W1 1B72A 2JA8J 5IOZA 3DU5A 2FQPA 4Y1UA 1G3TA 1J5YA 2CV0A 3EXUA 1IKPA 2XXZA 2A75A 3PSIA 3CUQA 2E31A 2RC4A 4KYWA 3OOPA 3D6EA 4RS8A 3PVOA 2A05A 2VZRA 4LOCA 5DUKA 3JBG1 2JDPA 3L9FA 1H8VA 2H1KA 2OIIA 3GJAA 3RZGA 5EDNA 1Y8QB 3A0NA 3HQUA 3LOIA 2XVLA 3PTYA 5FYZA 2HWF1 3V56A 3HJRA 2IPQX 2LUWA 4JGYC 4QSHA 1PO22 5JZGB 2E9QA 2WY7Q 4GB33 4SLIA 4EM1A 4BYYA 1IXRC 3E5UA 1DPRA 2NYYA 3H5RA 4IHWA 2R041 2BW3A 1JJ8C 3BN6A 1Q1VA 1LOAA 4CZZA 5A6QA 2XROA 4E2QA 3AP5A 2WZPP 3TEWA 1RHI3 2AQFA 1F15A 5FZ6A 4I02A 4LB6B 5D4SA 1ND3C 2QYOA 1XMXA 5IVBA 4QT6A 1VBA3 4W97A 2TUNA 5ICEA 3OIQA 3RI4A 3J80Z 3O8HA 4XKVA 2OCCH 1CESA 3GTOJ 3ZXLA 4XSZF 4A7KA 1K5MB 4S05A 1KQ0A 2VULA 3LPFA 3TEZA 4XMAA 4J6GA 1U12A 3HEFA 5FJ8J 1JZ3A 3AKRA 3JRIA 3AYEA 4AEKA 2CH0A 2LS6A 3WEZA 3V8KA 3I2DA 2YPRA 2E7TA 2YDEA 4KJZA 4NWVA 1T95A 4W65A 5CVVA 4Q0SA 1ULYA 3KVAA 4XE9A 5A7NA 4XXPA 2HI3A 4GRIA 3QU3A 2VR4A 1D0ZA 2VMCA 1W6NB 3CL1A 4AI9A 1RETA 1LTEA 2R0FA 2ZJQF 2AXTC 1NX9A 1WJDA 5JZGA 4K7JA 4CDGA 4XRSA 1ZRCA 2VXZA 3U37A 1IN6A 2I8DA 3MZYA 3RQ4A 1PO11 3HT2A 1X7NA 4D5FA 2Q8DA 3TDZC 2KMUA 3E1F1 2PLV3 3U4SA 2NVYJ 4E70A 2X51A 5ABJC 4I6ZA 2KISA 1JJ6C 4CTEA 2V4JC 1OPMA 4OCTA 1ENSA 3C2BA 3NQOA 3CLOA 3RZMA 1UYPA 2WA4A 2IXHA 3THCA 2ZNYA 1QJU2 4XMYA 1YW7A 3QOPA 4IL6C 2P5BA 4FOQA 5GZEA 1GV9A 3S2HJ 2WKKA 4Q4Y2 1VQKI 1K5MA 2DTZA 1O5UA 1K7AA 2W24A 1ULEA 1WLCA 3C18A 4DRVA 1V6LA 5IP6A 1LODA 5E8AA 1D4M2 5TISC 2OUHA 3WNLA 2O3FA 3IUOA 2UWBA 2DMQA 4GWIA 4I0BA 2DUQA 3AG2H 2MEV3 2BJSA 4Q2FA 1YIPA 3MN2A 1KFUL 3U4XA 4E7ZA 3H3LA 2BZTA 1W39A 1RKWA 2M34A 1W2TA 3OUJA 3FHAA 3BG7A 2FDIA 4QKFA 1BI3A 2CWEA 2A6TA 4Y5TA 1MDMB 1W6NA 3KPHA 4KNYA 3F3XA 1STMA 3GZTB 3NAUA 3POYA 4BMBA 3OYFA 1VJ2A 3ZMUA 2RS51 3S7IA 1PJRA 3HBLA 3BZKA 1SLIA 1PMIA 1YQ2A 4LHKA 4X6QB 2FQ4A 1NY72 4GKYA 1SFOJ 1U5YA 4QIWN 4PBOA 5E8GA 1SAXA 3EQEA 4LR4A 1SD4A 3NEUA 5FZGA 2VASA 2LC2A 4B4RA 2W7NA 3KB5A 4LTAA 1Q3EA 4XOPA 4AAXA 4FTHA 1SMTA 3WNOA 3BTLA 2XJVA 3DTKA 3LKJA 3V65A 1Z7S3 1RXFA 1LENA 1LNSA 2WWUA 4F92B 4XTPA 3ZKYA 2FMYA 1TNFA 3AP7A 3ZYGA 2PTMA 4MHGA 3EUHC 3GHMA 2VCMA 3BJOA 3AMPA 2IJLA 3I7DA 2GN3A 1NUKA 4COYA 2DQLA 3B3QE 2SLIA 3HOWJ 4MH0E 1E17A 1VTNC 1DYPA 1F31A 2KM2A 4KGGA 3BP8A 3JB4C 5ILVA 4IEYA 2OUJA 3L2RA 1USSA 1S8NA 1RUF2 3ZQ7A 2RVCA 4Z82A 4XTMA 1W2AX 4AIKA 2VTXA 2EIEA 1GBGA 2XF6A 4QQOA 2A61A 1DQ1A 1ZN2A 4FFIA 4GB32 1R5ID 2R7EB 4IEOA 3SDBA 4OI2A 4EJTA 2PHLA 1WGXA 5B4NA 5J40A 2UU8A 1W0UA 4OHVA 4XBFA 4W8JA 2GNDA 3IDEA 3FHQA 1ASJ3 1W0TA 2QSHX 1IGNA 1MSFC 4UFLA 1AR63 4IE0A 1TW3A 4UVBA 1LJ9A 4NHMA 2EXIA 4EEFG 4QHZA 1XS9A 2JTVA 1RPWA 3RJPA 4HLTA 3E97A 3D5OA 1AWCA 5LA1A 1YJNI 1U6GA 5HBAA 2GOXB 4YW7A 2WT1A 4SBVA 2HYFA 3SQNA 3PUAA 5AC93 5GLWA 3OUIA 4AVBA 4AAPA 3HKZN 1AR83 5FXZA 2ZX0A 1SD5A 2ACJA 4JQRA 4IGOA 4AI0A 5JSPA 2DA1A 5LHGA 3C7GA 5FP8A 4P14A 2EFQA 2PQ8A 1H9PA 4R4XA 5IVYA 1Y39A 1CZSA 2KR2A 2NS0A 5GLZA 5FBJA 2ORXA 4IEXA 5K0UB 4I3GA 4LORA 4JDMA 1D8KA 1NCRB 3LFUA 3LSPA 4CCLA 1C28A 2NN8A 2XAFA 2D5VA 3GEZA 5F6FA 3C2UA 3O0VA 4HN0A 2RAEA 2K5CA 1W9WA 3OYKA 1ORKA 3CMEI 3Q9VA 1TL8A 2P6TA 3HJEA 1O57A 5DABA 2TCTA 2VQAA 4CP9B 5FP7A 3FHIB 3TW7A 1C1LA 5BNNB 5A1FA 1UOJA 1VBD2 2D43A 1JZ2A 1UU6A 3MF6A 3POGA 1GVJA 3DEMA 4LA2A 3GLLA 2R7SA 5GJ6A 4V2WA 3ZQQA 5T5OA 5FYMA 1R081 3O1VA 5HS9A 1LESA 1ZAOA 3G7DA 1MIJA 3MAJA 1GT0C 5GLUA 1IV8A 1CQTA 4BXSV 4P9LA 2VTXJ 4YIFA 1HJFA 1O4YA 4E7KA 1KD7A 4LLNA 4CHUA 5E88A 4GDFA 4JGZA 2NVQJ 1GR3A 4W6WA 1MNMC 3R61A 3CO2A 4IHSA 1CAUB 4EWEA 2GXGA 3GZNB 2D3PA 1F2NA 2WR9A 2CV2A 1WJEA 3MDPA 1N1SA 1JZ8A 2D5FA 2G4IA 3MICA 4CU8A 1O59A 1NCRA 3WV6A 3PO3J 2JZYA 4AYBN 1KRIA 3VBUC 2ETEA 1B6AA 1YFHA 1D5YA 4IETA 3NQHA 4UW6A 2WDBA 4CYDA 2O6GE 3I4PA 2JIGA 1SFNA 3MD2A 4LOTA 2X10A 2D45A 2ZX2A 3VBOB 1VF9A 2VC0A 3MQ0A 2TBVA 2CDPA 1QJU1 4Q1RA 4EWAA 4BQ5A 5I8SA 1HKSA 5CEHA 2K4JA 3LMMA 4QXHA 1O7FA 3JD72 4CP9A 4WM7C 4UI9L 4Q4V2 3WF0A 5BNNA 2E2HJ 1IQDC 3ONQA 1X2MA 2VVEA 4P5YA 2VMEA 3WW4A 2RR11 2P5LC 1FBSA 1POQA 3OGRA 2ISYA 1WJCA 5DXDA 1D4M1 5F0FA 4C3IJ 3JRGA 2NXNB 1TZOA 2XGEA 2HR3A 1Z0XA 3CF5F 3KVBA 3VYRB 4AVCA 4NJ4A 3AL0B 2XQXA 4Q0UA 3AG3H 3W5NA 2LREA 5A7QA 3PMEA 4FTSA 4UBHA 2QQAA 3VBFB 1RUJ3 3WGGA 4WF2A 4G4FA 1HQNA 3OBAA 4KGQA 3N9LA 1NY71 3JTHA 4YELA 1Z9CA 4B09A 3DFGA 1D8JA 3F8CA 2L7MP 1QO0D 3WDWA 1AYN2 2DA6A 4KU8A 2EZLA 5F64A 2XHKA 2PHDA 5D5XB 4N43B 4CEYA 3FM3A 3WTTC 4C0HA 3PNAA 3JRAA 5EQUA 1S0GA 1WZXA 4QKDA 2ORZA 2OVUA 4FQZA 1UN1A 4E9KA 2Z69A 4WWCA 1W2NA 1FIPA 2AACA 1PGW2 5FYHA 3BCWA 3O1MA 4ZZ5A 3WQ1A 4AI1A 1ZX5A 2MBFA 3LQCA 3DCFA 1XC5A 3MIFA 2FDKA 1O4XA 3JAMK 2FX0A 1QJY3 2XF7A 2R5ZB 5C71A 2PHRA 2R7WA 5JOZA 1W8TA 2BQPA 2ZAHA 1MBKA 2BNMA 5F32A 5G04L 3J26N 3CMMA 3CC2I 4YW1A 1FI2A 5T5JA 2VQHA 5M3MJ 2AHQA 3ZXSA 2V72A 3ST7A 2GSYA 4YM3A 4ESFA 1ODMA 4CDWB 3GXUA 5DAQA 2FJ1A 4GB31 5LW9A 4YPJA 2HJIA 1QXJA 4QQPA 2VBWA 3AKPA 3P1IA 2WTEA 2VMHA 3PHMA 1UW8A 3QCWA 4WVWA 3LA2A 2CL2A 3PJQA 3VBFA 1BHGA 4X8NA 1XTAA 4R8HA 2PHXA 4BEHB 3ZLIA 1OH3A 4BOWA 2EQRA 4QX5A 5FZ9A 4L0ZB 4AFMA 4EZ4A 3BB6A 5J4YA 1QVTA 4M01A 3GYHX 1VALA 3AZWA 1Q56A 2EXKA 1UZVA 3FISA 1R1TA 3K4NA 1OR7C 1VBA1 4N43A 4B48A 1GOGA 1ZRIA 4GMP3 2BERA 1BW6A 1T6SA 3ASOH 4GZ9A 3A4UA 4A3LJ 4CCMA 5D8KB 3K4CA 2XH6A 3CHXA 4G7HF 4AVPA 1HW1A 4RN5A 4OMZA 1SMYF 3Q0VA 3HT1A