4BH9A

A structural model of cap mutant (t127l and s128i) in the apo state
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
209
Chain Sequence
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVLIEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric inhibition through suppression of transient conformational states.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords cAMP-activated global transcriptional regulator CRP
total genus 58
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2013-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bh9A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bh9A01
3G3ZA 5D4RA 4KT5C 4EJVA 3NJZA 3SMHA 5ICFA 1EYBA 2DPUA 3GLXA 4RB3C 1Z9CA 3CDHA 3GFMA 4MQVA 1W5TA 5DCMA 2E7WA 3KLNA 2K0GA 3O3KA 5KVRA 1HXDA 3HSRA 4WBBA 2X4HA 1ZZ6A 3KSCA 5J8FA 5L3DA 4MGIE 3BWGA 2DK5A 5F6FA 1DGWA 1SFUA 5JAXA 2BNOA 2M30A 1QZYA 1J5YA 2F5EA 3Q9SA 4EROA 5L3EA 5BQTA 2YX7A 1UD1A 4Q0SA 5LLQA 5J8CA 1WLTA 3UKNA 4WX9A 4U0WA 4OFGA 1Q43A 2LKPA 1ZRRA 3F8FA 2IP2A 2ESHA 3GZ6A 3HSEA 3E6MA 2M45A 1XCVA 1FZPB 4N9IA 1KYWA 4HSLA 2KJCA 1FPQA 4HLYA 3WW4A 4MGRA 4U7DA 2EJRA 3BY6A 3K69A 2DW4A 5AVPA 3I53A 2B0LA 1TQMA 3RIRA 4P9FA 3B73A 3FMSA 1O3RA 2L3DA 2XHKA 4EQQA 1CAVB 3F8NA 3J80Z 1G3SA 1HBXG 3HT2A 2Z69A 1SD4A 2ET1A 5IT3A 1U5TC 4BXUA 4BAYA 2D1VA 4QLCU 2QJVA 4QXKA 4MHGA 3HOTA 3NQOA 3V4GA 3R61A 3RZZA 2DAOA 5JSOA 2LSOA 5FQ0B 3ZMUA 3H50A 5J7MA 2W84A 1TW2A 2FSWA 4ZYGA 2L4AA 4ESBA 1O57A 5KHIA 3HRUA 1T98A 2B8MA 4XEZA 5JSRA 4OIQF 3BB6A 1FP2A 4EM1A 5DUKA 3R4KA 1DGRA 2OZJA 3HRMA 3RKWA 4XSXF 1E2XA 2O6GE 2BGCA 5E1WA 3FMQA 4QGLA 3PQKA 1LKNA 2MHFA 3KGLA 3ETQA 4ENKA 5ED4A 3MWMA 1ZVFA 4HVRA 4OLLA 4D7TA 6PAXA 5D6FA 4H0EA 3EYIA 3REOA 3GFLA 2IXKA 2PHLA 4D7SA 3ZMSA 3VB2A 3QPHA 1SMTA 2MC3A 3CTAA 1U5TB 1USTA 5EFUA 2OU2A 1R36A 3GYDA 4CYDA 2K27A 3MZHA 1WA4A 5FLJA 1ZAOA 5KHKA 1MKMA 4RGXA 3BJOA 4JQFA 3GBFA 4P9GA 4L9NA 4WF2A 2FMYA 4KFCA 2KIFA 1DUXC 2QBYA 3PNAA 3VOEA 5FB2A 3RNSA 3BZ6A 1SD5A 2G7UA 1O3TA 2FXAA 3OD0A 2Z33A 5E8GA 4I7HA 2HS5A 1V4RA 5HS7A 1J59A 1SD7A 5JFRA 4KMUX 3R0AA 3FF5A 1GXPA 3IKTA 4NHJA 2Z9OA 4YRDA 5BMZA 4G94A 3MZYA 2UXNA 2XLFA 1IXCA 1ZZ9A 2QZ8A 2P8TA 4ZH4F 5IT9K 3IKVA 2O0YA 1IPKA 5K1YA 3T8TA 3TKYA 1QXJA 5D5VB 4IEVA 2RC4A 2CSOA 1IZ1A 2DK8A 1ZG5A 2EA2A 2Q8KA 3MEXA 3JSPA 4P55A 4A0XA 4B29A 2GC2A 1OD5A 3WE3A 1ZN2A 4M9ZA 5EEHA 2Q0OA 2UYAA 1G3WA 4XBFA 4KWLA 1LJ9A 1E17A 2J5OA 1QO0D 3RKYA 1LQ1A 4AD9A 4KIBA 2AS5F 3C7JA 4TV7A 4RB0A 4RGUA 4ESFA 1XD7A 1YQAA 5FGMA 4EGYA 3BPZA 1G3YA 4LLOA 5EZWA 4Q0UA 2MD5A 3M8EA 2GXGA 4E2GA 4F8AA 3VEPA 3ZQ7A 4ZU7A 4QGNA 2DLLA 3OV8A 1IW7F 3LQRA 4I01A 2PTMA 5DDGA 2GH2A 1NZCA 1LDDA 5BXXA 2A68F 2EFOA 4WXDA 3F6OA 4WWCA 2JT1A 3H8UA 1HW5A 2VOPA 2CG4A 2DQRA 3ABTA 4P5OA 5HS8A 5FD6A 1EH6A 2QWWA 3F8MA 1XE7A 4HDUA 4GCVA 3DXJF 1UHMA 3BDDA 1X7NA 1XMKA 2CFXA 1ZYRF 1KU7A 2NNYA 4BHCA 4O6JA 2UXXA 1BJAA 2CAVA 3HRSA 1YW7A 1DDNA 4EJOA 1XMAA 2D2WA 2ZNYA 3RI4A 3USSA 4EM2A 2VC0A 4AIJA 3WODF 1A04A 5ERIA 2EFNA 4FX4A 5BPDA 4LA3A 1K78B 1PP7U 3PFIA 2C0ZA 1R5HA 2W85A 2FBKA 2F5FA 3H9AA 3SCGA 1J1LA 3OGJA 4IF4A 3ZMZA 4AVPA 1S29A 1MZBA 2DO7A 2PFBA 5CVIA 2HFHA 3S7EA 3I71A 3ZMDA 3EHKA 3I59B 5E17F 2YX4A 4IJAA 2P6SA 1XDUA 4UVCA 2IXHA 1K6OA 1MDMB 4RB1A 3I7DA 2R3SA 2CWEA 2MBFA 2A6HF 1YFWA 3EQLF 2NRAC 1Y3TA 4OIOF 5L3BA 3GEZA 4O5VA 2EV6A 3PVBB 2FU4A 4A0ZA 1PP8F 4WXHA 4LULA 3U9GA 4HMZA 2D5FA 1DPRA 4PGGA 1HKTA 2RVCA 4R52A 3LWCA 1SFEA 2PLYA 1CX4A 4ENMA 3BJ6A 2P6TA 3S2WA 5BPXA 1MD0A 1XN7A 1UIJA 3EJKA 1UCRA 3JW4A 4M71A 1U6GA 2MA3A 1BBYA 4DNCA 2W57A 3V7RA 4X6QB 2H6CA 4FT8A 1CAUB 5JI6A 1G6NA 2HJIA 3BPVA 2GC1A 4HAMA 3ZPLA 2IT0A 2OQGA 4O3MA 1ZARA 2Z99A 3W6KB 1TQIA 3B02A 2GAUA 4HW0A 5I91A 5H6RA 2UZKA 2QNKA 2A6EF 3FJSA 5E1XA 3L2CA 3V8KA 3BPXA 3AAFA 2P5LC 4HN1A 3BU7A 4P96A 3V8JA 4BHBA 3IDCB 3HYIA 3S0MA 3LA7A 4LK0F 2FF4A 3KLOA 4AIHA 4CDGA 1J9IA 2F4PA 2PA7A 2XUBA 3TO6A 3WTWC 5LGTA 2OD5A 1Q5OA 1JE8A 1G4DA 4YFKF 2L01A 4EJUA 4R79A 1HW1A 2ZCWA 5J3UA 2CGPA 3KEOA 4PIZA 4G8XA 4ETSA 4IESA 3CF6E 1S7OA 5HDKA 1CAXB 4LB5A 2WWYA 5LRSA 5KHGA 2OZ6A 3CUQC 2K02A 1NE6A 3G73A 4NVPA 3K9TA 3M70A 2R7DA 1MGTA 2JPCA 4ZYHA 3ACLA 1RGSA 1KU2A 2Q0AA 4L9VA 2L02A 1KYZA 5JSPA 2NAZA 3WGHA 3WTSC 2OAZA 5BY5A 4HA8A 3TDUC 2FBHA 5DUIA 4KNYA 5DEQA 3LWFA 5ILSA 1FSEA 1O5LA 1QGPA 2A3SA 3IL2A 3C3WA 1TTYA 4UV9A 4G6DA 4CO8A 3FE5A 4CXFA 3TOBA 2O8XA 2HDCA 3ZN1A 4KYWA 1CAXA 4HX7A 2Z3YA 4GYIA 4RGRA 5JHUA 3CO7C 3E5UA 4L0ZB 4M9SA 2HR3A 1RI7A 4XETA 4UUVA 4QMAA 2H09A 3KFWX 4HF2A 4Q0VA 5ICGA 5BV6A 2P5VA 4RD7A 1T0FA 5CYVA 2D5HA 4MGYE 5HOOA 3J7AO 3WU0A 3UKVA 1KA8A 3ULQB 1YFYA 4NQWA 4L5JA 2D1HA 4IRGA 2HYFA 1I1SA 4O9GA 1PUEE 5FLHA 1BM9A 4LB6B 5E16A 1YHFA 2EV5A 4M6XA 1XCBA 2PMHA 1KQ0A 3CUQB 4LK1F 1QBJA 1J3QA 1H9GA 3BROA 1R58A 5LHIA 3KP2A 2V79A 4KN7X 1WI9A 5L3CA 3GFIA 1EH8A 3F72A 1R1VA 2NNNA 3RDIA 2PMUA 3EDPA 4HDVA 2FRHA 1H0MA 2ATFA 4KWJA 5BS6A 3K0LA 1BN5A 3KE2A 1HSJA 4XFFA 4LLLA 4K2EA 3FXRA 5H20A 2FNPA 3IWFA 3QAHA 4LGWA 1CAWB 2HZTA 4IEPA 3RPUA 4RS8A 5BUVA 1P4XA 1W7PD 1TQPA 1Z05A 4EV0A 1UCXA 3Q9VA 2J5PA 1VP6A 1YW9A 1CAVA 2M1BA 4YARA 3QRFF 2JPBA 3HHGA 3N4MA 3V7CA 3M1EA 1ZREA 1T6SA 5CU1A 3H1WA 4HQMA 4KUMA 1QZZA 3KP6A 2ETEA 4LFUA 5I93A 2IRFG 2QUFA 2EV0A 1K78A 2MH2A 3CUOA 2IPQX 4OINF 4HBNA 5BOXA 2BNMA 2D93A 3LA2A 3U0ZA 3GVAA 1OKRA 4L0YB 5FFXA 2LF8A 2FQPA 3RJPA 2KRFA 1OYWA 1Z6TA 2Y48A 3BCWA 1KQ9A 4JVAA 2O61A 4IERA 2R7FA 1ZH5A 3T5XA 2X0LA 4HV6A 1GQGA 5BPIA 3WGGA 2XKOA 4PCQA 3LAJA 2OPKA 3MFKA 2ISZA 2DI3A 2PN6A 2QYOA 1NXMA 3HTSB 1W7PB 3W6JB 5K5OA 1ZRCA 2VECA 5EEGA 3K1NA 5ICEA 1YUDA 4GULA 4IEQA 4I09A 2UY9A 4I0BA 4R8HA 2PG4A 2ZKLA 2O1QA 2HTJA 3GXOA 3D0SA 3R0JA 1UPIA 1OYYA 1U8RA 3TGNA 4Q5SF 2VBZA 2GXBA 4UBHA 2VXZA 4YYOA 2RNJA 5FLIA 3H3UA 4WXCA 2LDUA 1IN8A 4HF1A 2K7LA 2V09A 2C6YA 2GZWA 2IVMA 2QM3A 4MGZE 4LJZF 1Z91A 2VQAA 2V9VA 1LR5A 4XF0A 3MAJA 4GO1A 3LQQA 4META 4HX4A 3GF2A 2Y0OA 1VJ2A 3ROUA 3NL1A 5DD4A 5JCTA 1QPMA 2XIGA 3LFKA 3OCPA 2HTSA 4E2SA 2P5KA 4KA4A 3G7DA 1LEBA 5TRDA 4M74A 4MTEA 2K9ZA 1YIOA 1O3QA 1MJBA 4LLGF 2AXLA 4UVBA 2I45A 2Y75A 2EFQA 2MLKA 3HSFA 1XGMA 5HS9A 2A5YB 3GO5A 2DPDA 2Y0MA 4A2UA 3L9FA 4I3PA 1LVAA 2XVCA 2H27A 1ON1A 2QENA 1FY7A 2VODA 3JTHA 2G7HA 1Z1DA 2Q4SA 1XRUA 2ET7A 3H3ZA 4IHTA 2BE5F 1HW2A 2XAQA 1SAXA 3DFGA 5FFZA 4LG0B 2PAEA 4OMYA 4HZFA 1BI0A 4D0PA 3O2PE 3ZP5A 4ZU5A 2DT5A 1YFUA 4MX3A 1CAUA 5KHJA 2OA2A 1YLLA 1L3LA 3KEQA 1WSUA 2FOKA 4HV5A 5AIPA 3I58A 4I2OA 4CICA 3WW3A 1SD6A 3L2HA 5KK1A 3J81Z 2HGCA 2IA2A 4JTOA 2PEXA 1Q3EA 3LAPA 1S8NA 2EB7A 2FQ3A 3T0YA 1J7KA 1J3PA 2IC1A 3IBMA 3C1DA 1YFHA 1EPZA 3WTXC 4HX8A 4HQEA 4E2QA 5K8SA 3T1BA 1B1BA 1AWCA 3OF1A 2XROA 3VODA 4M73A 5H6QA 5I0SA 1YLFA 1XGSA 2QCSB 2E1NA 4FHTA 2K86A 3GWZA 4UXNA 3O14A 1J2XA 2XAHA 2Q1ZB 1C0WA 5J48A 2GQQA 1MDMA 1RIOH 1H9TA 5LBQA 2KIUA 2VT3A 3ZN0A 1L0OC 3CJNA 1B9MA 1XSVA 5HLHA 2CQKA 2K4BA 1AOYA 3TO9A 1X8MA 3FX3A 1ZX5A 1HKSA 4MV2A 3HRTA 1BC7C 3IHUA 4EM0B 2VN2A 3VFZA 1WGPA 3NEUA 2FA5A 5L3GA 4G7OF 1BC8C 3SHFA 4Q0QA 1FYMA 1IXSB 2M8EA 3RPQA 4FBFA 2ELHA 1O7FA 1D8JA 1CF7B 2P7VB 4IHSA 1QXRA 1GHCA 3KP4A 3F23A 1TNSA 2GU9A 1JHFA 4G7ZF 5CVRA 3U2RA 1IUYA 3FXUA 1LRHA 4M9XA 3ECOA 1FP1D 1OPCA 5FLXZ 3K1PA 4MEXF 1P92A 5HLGA 4Q4ZF 2HEOA 3KETA 2MH9A 2LNBA 1FSHA 3F8BA 4PDKA 5D5UB 4IEZA 4EJWA 3FHZA 2OQRA 5F1RA 3ZDSA 2CW0F 4EMSA 4B8XA 2KJBA 2CV6A 3EETA 3WGIA 3Q5FA 1JHHA 5F64A 1BIAA 2A69F 1GXQA 4XF9A 1G3TA 2MPFA 3IC7A 2PJPA 4XFIA 3MYXA 5FCCA 3SXWA 1F5TA 1HKQA 1GQHA 5CLSA 3E5QA 3TO7A 1JGSA 1B59A 4ONUA 2G9WA 1IN4A 2IA0A 3CO2A 2XGXA 3ELKA 1KGSA 2RKHA 4QGMA 3JSOA 1J0RA 3SCFA 1ULYA 5LRRA 4U0YA 3HQXA 4ESJA 1J75A 4KICA 2VBXA 2OYZA 2O8QA 4G6QA 1ZZ7A 1YG2A 1Y0UA 3R6SA 4IEOA 3I59A 2HKXA 3J81K 3FZVA 3MCZA 3KMHA 3WW1A 4LG0A 1XDSA 4YG2F 2FNAA 4IVNA 3KGZA 4MNUA 1VR3A 4Q29A 2RDPA 3QPTA 4ZYDA 1K79A 4LEJA 1FBSA 3F3XA 2E9QA 1FBQA 4BNCA 3F21A 3OOPA 4Y15A 2MNGA 4LUMA 2XAJA 1H1MA 4J1XA 3TDZC 3ES4A 4A5NA 5HDNA 2L4MA 3CLPA 2H6BA 3U11A 4TLFA 2PHDA 5A2QK 5ILVA 3I5UA 1U78A 1T2KA 3QU6A 5K5QA 2QQ9A 3HOSA 2FBIA 4JK1X 3TNPB 1EH7A 3DQVC 2DQLA 4Z2YA 5JVTA 1EP0A 3H1YA 1F9NA 3LOIA 1R7JA 1B4AA 2Q2EA 1LNWA 1YWKA 1Z7UA 1ZHFA 3HIFA 3P9IA 2LF7A 3QP5A 4JV4A 2DFIA 1ZGAA 3LSTA 4MTDA 1ZZ8A 3NSTA 1T38A 3M3IA 1WWXA 3ECHA 4OU0A 5E8IA 2P7CB 3CJXA 3HUGA 2CO5A 5T3NA 2PAMA 4IEUA 1DP7P 2YU3A 1YO5C 1YFXA 2GIVA 2XASA 1FT9A 3EUHA 3WTTC 2EA4A 4I0AA 4PGHA 2IXIA 4F7ZA 2D40A 3GUDA 4MGKE 4BIFA 5KBFA 2DCTA 1O7LA 2CAUA 2Z2SB 4LMYA 3SFZA 2OBPA 5IT9Z 3RYRA 1IPJA 4GXOA 1KU9A 1ZZBA 2EVXA 3I0TA 4XLPF 2GA1A 3DN7A 1IXRC 4ZZDA 3DL3A 4IXAA 3L00A 4GYGA 4HOBA 1FOKA 1NE4A 4X6RB 1UFMA 5TJJA 1KQ8A 4IETA 5HVQC 1ZRDA 3CO6C 3O6BB 1S6LA 2IXCA 2XL9A 4QM9A 4M72A 3V8LA 1RUOA 1SQ4A 2V6CA 3IRRA 4ENNA 4HVOA 2XL7A 5HI0A 3EO6A 2COMA 4OIRF 3SCHA 1SEFA 2QVOA 1YS7A 3KZZA 4HBLA 3RTRA 3NKTA 4KU8A 5DCMB 2WC2A 2UWMA 4XRFA 4B09A 2RV8A 2NYXA 1RL3A 5I8TA 2A07F 4QWQA 3TOAA 3FHIB 1W4MA 2W25A 2B9UA 4AVBA 2EA7A 4LUKA 2XAGA 4NB5A 1SFXA 3DPTA 1JUHA 2VONA 4U0VA 1OMIA 4UVAA 4WCGA 2ZXJA 1R23A 3KCCA 4L9TA 4AQ6A 2F5CA 4RAYA 3K1MA 2STWA 4FAHA 4XF3A 1BI3A 1DPUA 1V3FA 2XAFA 1FC3A 2VE9A 1X82A 1J3RA 3CUQA 4A5MA 2YR2A 1L3JA 1SFNA 1XE8A 3KZYA 4R1HA 2WTEA 3JAMK 2H0VA 3SQNA 3WU1B 1Y9QA 5FPZA 4L5IA 3UKTA 1ZG1A 1TBXA 2ZNZA 2VE8A 1NYWA 2ZKZA 3PLQA 3TNQA 3GZ5A 1LB2A 1CF7A 1U2WA 3SZPA 3LZZA 4RGSA 2FMLA 1RTVA 4UBGA 3IIAA 2GA2A 2ZJ2A 2QQAA 2YPRA 2XLGA 3HHHA 4JTNA 3QU3A 5I8SA 1NHAA 4MQ9F 5LHGA 3GYHX 5CADA 2BYVE 3GX4X 3U10A 2XV4S 4P9UA 2ADUA 2ZO4A 3IRQA 2XLAA 3CEWA 1BIBA 5E18F 3COAC 4A0YA 1STZA 4J1WA 1UW8A 1IF1A 1OFNA 4L2NA 1FI2A 5I8YA 1X3UA 2KXLA 4N0BA 4G7HF 2HQRA 2GC0A 2PFWA 4UV8A 4UNOA 4Y13A 5LEKA 3WTUC 3NVCA 3LAGA 2RGVA 4WZCA 1PMIA 3DP7A 1F4KA 2F5DA 4H7LA 1O5UA 2P17A 2QBYB 2VBYA 5CVVA 4A6DA 2ZFWA 3C18A 2WV0A 1R1UA 4LA2A 3S7IA 1YS6A 1TNTA 2M5WA 1RC6A 1CAWA 1WRJA 4LTAA 5FQ0A 4AIKA 2UY8A 1YW8A 1D5VA 5CVUA 3BP8A 3FFQA 1UIKA 3WTVC 1R5GA 3RYKA 1ZLJA 5AONA 4M6YA 4Q0PA 1ZZCA 5D8KB 3H7YA 5KHHA 4XLNF 3CL1A 3KP5A 2OZUA 1VTNC 1J58A 4MUVA 2DTRA 1CGPA 2HWVA 3PQJA 4OMZA 4PIYA 4XF1A 4U7BA 1W5SA 2IW5A 5DD8A 3JZVA 2EFWA 3H1MA 3J80K 1OYIA 2RQPA 1S7AA 4WVZA 4A12A 1QQIA 3T8RA 4ORFA 2BNNA 2D45A 5HDGA 3FWEA 4ZZLA 3F8CA 4HN0A 3QACA 5DCFA 3NW4A 2QLZA 4KU7A 1OI6A 2VC1A 2JTVA 2FE3A 2W24A 3ISPA 5A2QZ 4HF0A 4AVAA 3N97A 5E1ZB 1FXZA 2VBWA 4L9JA 1ZGJA 1EV7A 1O3SA 4XFHA 1USSA 1IRFA 1ON2A 5D1IA 1UB9A 4I02A 2JRTA 3P7NA 2HOEA 2ETHA 2GWRA 1P4AA 2KIMA 3MPBA 2MLGA 4UXAA 2P4WA 1PM7A 2E7XA 2M87A 4QM8A 2BBYA 1FX7A 3SZTA 2FEZA 4YIFA 4G9YA 3FZ3A 2YSRA 2F2EA 5E1RA 2GC3A 3E3VA 4EGZA 4KMFA 4KIGA 4E70A 2E1CA 5ICCA 5D5WB 1DZTA 3E6DA 4JBAA 2V1XA 4LLNA 4EJTA 2QVSB 4BYYA 2DBBA 5FO5A 3M8FA 3TQNA 4PIXA 3EBRA 3FMRA 1TQ5A 5FPXA 4ASNA 2N7GA 2TDXA 5C8WA 4MEYF 4HSJA 2JSCA 4Y17A 3LA3A 3DPLC 1V70A 4YFNF 2KKOA 4Z82A 1T39A 3ML6A 1LDJA 3DEUA 2STTA 5J6XA 3ZMTA 4BH9A 1FNNA 4KL1A 1YTYA 4PJYA 2IXJA 3DV8A 1IN6A 4IPAA 3ST7A 4HYEA 4IRHA 4OIPF 5FDBA 3EQEA 2O3FA 2HYGD 1LEAA 3K2ZA 3ES1A 4EWEA 1HSTA 3MQ0A 3CLOA 4U88A 1ZNPA 1YYVA 1P2FA 4MZUA 4I98B 1K7AA 1WQ2A 4EWAA 2PYTA 3NRVA 4XFBA 4BQAA 4HLXA 4EVIA 2PAKA 3I54A 3QP6A 2UYBA 1X8EA 4IEXA 4N9HA 1I5ZA 3E6CC 2ESNA 1B6AA 2VT2A 2ACJA 3GW2A 1IAWA 3I4PA 3KP3A 1D3YA 1O4TA 3JTGA 1MJ9A 2O03A 2ZMEB 1I27A 1ZG3A 3P9KA 4YSFA 2NS0A 3WW2A 4AVCA 1MJAA 2K4JA 2JZYA 3VHRA 1GVJA 4K8FA 4UHTA 3KP7A 1IRGA 3D0JA 1SMYF 3E6BA 3M9AA 4CZZA 1I6XA 4AWXB 4LD5A 1ZRFA 4MH0E 3BJAA 3L7WA 4AQ2A 3E97A 1XSDA 2HKOA 1TW3A 4IRIA 4IEYA 5D5XB 4XFAA 5ILUA 1U5TA 4OOIA 3WTZA 4AXOA 3ABUA 2QQBA 1FYLA 4ZU4A 5LGUA 4XF4A 1OR7A 1XGOA 5LHHA 3WG9A 2A61A 2DU9A 3U1DA 1QNTA 2IJLA 3SXYA 4QX5A 1W7PA 5I0TA 1REPC 5I0UA 3I64A 2WFPA 3F6VA 2ISYA 5C6CA 4S05A 2BEOA 4EWDA 5LGNA 4KDPA 3H92A 4CGZA 4KIFA 3BALA 3ZMVA 1ODDA 2QDRA 3L09A 5E20A 4XFGA 4YFXF 3RYPA 1Z6RA 3WE2A 4L18B 4HVQA 1ONVA 3H7JA 1RUNA 2PQQA 5DYMA 4FAGA 2EFPA 1R22A 5CVJA 3F22A 5FLXK 5I0RA 1FBUA 4ON0A 3IDBB 5LEJA 3D82A 1U12A 5L3FA 4HLTA 1BOAA 2OA4A 2PQ8A 3DF8A 1UHWA 4A6EA 3QOPA 2V1DA 2H94A 4YIIA 2HQNA 4DQ2A 3MDPA 1IN7A 1RNLA 3IWZA 4RAZA 1S3JA 1LDKB 4ZYEA 2CYYA 1RZ4A 5FD5A 3D5LA 2PBIA 4CHUA 1P6RA 4Q47A 1FYKA 3E5XA 1EY2A 2V1UA 1JXSA 3EYYA 3HT1A 4BHPA 1D8KA 3WTYC 1XSXA 1U3EM 3R60A 4FX0A 3ELNA 1XGNA 1H1IA 5AIQA 1P4WA 4XSZF 2VPVA 1BI2A 2XKPA 4L11A 1F1ZA 2VOOA 3GFJA 4O9EA 4GGGA 1BI1A 5D6EA 1KU3A 2ZMEA 2PI0A 1FLIA 4KWKA 3DKWA 1HQCA 1QY4A 4Q48A 2L54A 3V7SA 5CJ9A 4S04A 2EWNA 3RKXA 5DV5A 2ZBKA 2RN7A 2B5HA 3HTUA 2EAAA 4DINB 2XRNA 5D8LB 2EK5A 1R1TA 1IN5A 4Z07A 1I1GA 4IEWA 5JR7B 1FWZA 1R00A 3FXQA 1Q1HA 1TLHB 2Z5UA 1QWRA 4YNIA 2IA1A 1B9NA 4PZJA 1DZRA 2IXLA 3OTFA 3C3VA 3BOQA 2Q30A 3M7GA 3FM3A 3ERED 5K5RA 3FM5A 4KN4X 3JAMZ 5JR3A 4ENJA 4RB2C 5D4SA 1XB4A 4XFCA 1ZLKA 4WK8F 1PDNC 3P9CA 5HLIA 2BV6A 1WKMA 3SHRA
chains in the Genus database with same CATH superfamily
2CDOA 4EJVA 5H9PA 3TN92 5C9AC 1BBT3 1GWMA 2ZZQA 4QX7A 5CA6A 2BTVC 3GLXA 1W04A 3L2UA 4YGCA 1S0JA 4GB33 2VNVA 3CMEI 2O5RA 1W8OA 2K0GA 1W2UA 1IG7A 5KVRA 3KV9A 1ENQA 2CY6A 2W87A 3CBNA 3HSRA 1ND2C 4Q26A 2X4HA 1RXGA 4JKMA 5J8FA 4IL6C 4ZZ8A 2HWF1 1QOSA 5F6FA 1DGWA 1JZ5A 3L2YA 3CESA 3BCAA 3M4FA 4TZDA 3KM5A 2F5EA 4EN7B 3W2WA 4EROA 5C3RA 2NLRA 5J4VA 1RUG1 1WLTA 2WWSA 1JOJA 1I3AA 1L7LA 4WX9A 1Q43A 3OPTA 4YWAA 2LKPA 1LHVA 1JUIA 1K12A 1ZRRA 1ZR4A 3WSOA 3HSEA 3E6MA 3MKYB 4A4AA 4CVUA 4N9IA 3L2QA 3U4XA 1FOD2 1KYWA 2WSUA 2KJCA 4CDUA 4HLYA 4JHTA 3UK9A 4DPNA 3HOXJ 3K6GA 4BS9A 1PO22 3OSGA 5CFDA 3LOCA 5EDNA 4P9FA 3THPA 1F36A 3DU6A 2G19A 1O3RA 2ZTNA 5F7UA 2L3DA 1GP4A 1TT5B 2W1OA 4YG6A 2ET1A 3NARA 5F3CA 4L99A 3VZKA 3QWLA 2EIDA 5CYYA 5EF6A 5FZOB 2OTJI 4CPBD 4ATEA 4FFFA 3NQOA 3RZZA 2DAOA 1OH3A 3LIHA 4F3QA 4IHXA 3UJOA 3I56I 3H50A 2W84A 1TW2A 2E71A 4A3EJ 4ITCA 3A03A 2EXJA 2FSWA 1O57A 5KHIA 3HRUA 1ASJ2 3H3LA 3GDBA 3BB6A 4ZTJA 4SLIA 5DUKA 3WNMA 3R4KA 1GU3A 2OZJA 2HU9A 4DIQA 2BGCA 2H0BA 2DCYA 3MWMA 4HVRA 3WNLA 4OLLA 2WO7A 2ZC2A 4D7TA 3RWNA 3LOBA 4LOCA 2VUMJ 4H0EA 1YYNA 3GFLA 1AX2A 1BYHA 2PHLA 1FPN2 5EYRA 2VBPA 2MC3A 3CTAA 1SBEA 2AYHA 4XUPA 5EFUA 3J26N 4FI9A 4MADA 2OJED 4ES8A 3QQAA 3GYDA 1ZAOA 4CZCA 3N05A 3KT1A 4E4ZA 4RGXA 5BNNC 3JBG3 3BJOA 3GBFA 2PHFA 4P9GA 4FFGA 1X1CA 3A0NA 5IYYA 1VRH3 3QYFA 2KZVA 3WINE 1MH3A 3RZKA 2XG3A 3WG7H 1SVMA 3S30A 2KP6A 1IKPA 1TNFA 3OD0A 5L7OC 2ZMKA 4Y4RA 2R7QA 5E8GA 2OTLI 2DMUA 2X6XA 1RB8G 2GN7A 3B93A 3DBHB 4LK6A 1OJLA 4KMUX 3FF5A 1XTAA 1MQTC 5IVBA 4AHZA 1TC3C 2BVBA 2WFF2 1DYOA 4QPIC 3VBOC 2DA4A 4LO4B 5LATA 2VZUA 2JA5J 3BODA 1C8M2 5AC93 5HLTA 4AYUA 2CMPA 3OEAA 1IPKA 4DUWA 3CIHA 3M7AA 3Q3SA 4IEVA 4FTBA 2ZGLA 2OCCH 4XKWA 1T95A 4MHUA 3USUA 5FPUA 4PF5A 1SLCA 1QOTA 2WBMA 4NIGA 2JDYA 4A0XA 2W1QA 4BJ0A 3WE3A 1HRI1 1A35A 3KYCB 1OA2A 4PF1A 3TEYA 4UFIA 2CUEA 5CFCB 4XBFA 1E17A 4GQ7A 4XHBA 1QO0D 2JG9B 1YQ8A 4AD9A 2QGUA 3OYGA 2VJJA 5GM0A 4P9YA 5A6QA 1XD7A 5T5JA 4XK4A 5FGMA 4JRLA 2MD5A 2GXGA 3VBUB 3AP7A 5FZOA 3VEPA 2W1UA 1B72B 2R1BA 4IX7A 4HPKB 1IW7F 1PHMA 4UW3A 2A6VA 3CKHA 2W7NA 3H0GJ 3OL4A 5DDGA 2D97A 2GH2A 1LDDA 3VKMA 2QQLA 2XJRA 4C1XA 4WWCA 3H8UA 1HW5A 3PUIA 5HS8A 4RQPB 2R042 5GLTA 1XE7A 3FLTA 4HDUA 2VBBA 3DXJF 2ARXA 5IVCA 3AZZA 4SBVA 5GJ6A 3S3OA 1KFXL 4KMQA 1XMKA 1RKTA 5C4WC 2WNUA 2D6OX 3KCXA 1BJAA 3GMEA 5CISA 2A1XA 2CAVA 5FZ3A 1NAEA 1S0DA 4IZZA 4EJOA 1VQPI 2MEV3 3RI4A 3JB8A 4JGYA 4J25A 1V54H 1OKOA 1A04A 5ERIA 4AI9A 2AHQA 1ZBA3 1K78B 1TWGJ 4QQPA 1K5MA 2JWTA 4KJZA 5KXBA 1TWAJ 2AO9A 3ERMA 2CGNA 5A7OA 2J7MA 3DPRB 2DO7A 3WHBA 3ECQA 2HFHA 3KYLA 2VOXA 4QPIB 3OIOA 3J4UH 5E17F 3R4SA 3VB9A 5IVFA 2NMNA 1HOMA 3K46A 3GCWA 3IT8A 4BDYA 4BLIA 1KDKA 3POJA 4BDVB 3EQLF 2NRAC 3DKQA 3ZXDA 4BKXA 3M3YJ 2PLV2 2EV6A 5C4WB 2X5IB 4FSJA 4EJRA 4WXHA 4EATA 1E3PA 2CUFA 4AL9A 2E32A 4PGGA 1HJGA 1HKTA 4AVTA 3UNPA 4IE4A 1PMJX 2P6CA 2CSGA 2ZHKA 3I2HA 1TP4A 4ENMA 4PCRA 3BJ6A 2HWE3 2P6TA 4X0GA 1KGYA 4OHWA 1R093 5BPXA 2YGMA 1MD0A 1UIJA 2E34A 3EJKA 3JW4A 2J1TA 1U6GA 4N7UA 2W95A 5IW0A 4QU2A 3S5QA 1CAUB 5JI6A 5JOXA 1DGWX 3BPVA 1JTZX 2OQGA 1LGCA 1ZARA 2Z99A 3WP4A 1U0JA 2M0MA 3C7OA 5I91A 1D0XA 4ARXA 4QT6A 1RUI2 4F83A 2QNKA 2COBA 1S0BA 2A6EF 3IMMA 3AAFA 2FUG2 5BNOA 3FXJA 3V8JA 1X2NA 3TN93 3LA7A 1V00A 5F3IA 5A7NA 4LIUA 1AU7A 4YFKF 2K40A 2XBO1 4XLCA 4PIZA 4G8XA 1S7OA 2RS11 5HDKA 1XBFA 1AL0G 1FMD1 2V1NA 3OIQA 2LP0A 5IATA 5KHGA 1OLRA 2VI6A 1PK6A 1OLME 4TTGA 4J00A 2VW2A 1TMF1 1UYPA 4ZYHA 1VBB2 1UOGA 1RGSA 1ZRIA 2Q0AA 3BTJA 4ZS3A 2L02A 2W4SA 3RI9A 4G6TB 4JX4A 3WF2A 5BY5A 3PUAA 4HXCA 3WF1A 4KNYA 2WA4A 5GADJ 5ILSA 5LBFA 1QGPA 4CO8A 4UV9A 4G6DA 1OT5A 4B4RA 4E8CA 4MXWB 1EV11 3U37A 2HEVF 1CAXA 2ZPXA 4XRMA 4GYIA 4RGRA 5JHUA 3CO7C 2V26A 3PJQA 4M9SA 3LIGA 4QMAA 3KFWX 1AXKA 4BU2A 1S5LC 3K70D 5BV6A 2VVFA 2P5VA 3OS2A 1WJDA 1FAYA 2DVFA 2D5HA 2WS92 1TWFJ 2JA8J 3WQ7A 2YBPA 2HZDA 3ULQB 2ZAHA 3H9QA 3HR9A 3HD8B 2ARAA 4L5JA 5IP7J 4IRGA 4BJ6C 1VQKI 1US2A 2XRLA 2YS9A 1PUEE 1W6NA 5FLHA 4LB6B 2P5BA 3DEEA 2Q8EA 1RUF1 1A36A 1XCBA 2A3WA 4LK1F 1K83J 1H9GA 1SVOA 2W48A 2OUHA 3BROA 2VB6A 1HIXA 5LHIA 3AKZA 3ZR6A 4KN7X 5L3CA 3GFIA 3ZVXA 4YZ5A 3F72A 3O5SA 4HDVA 2FRHA 1H0MA 3I4NJ 3MUY1 2RS32 4I6ZA 1LENA 4AI0A 4B3AA 1TVGA 3CDIA 4K2EA 3NKGA 3AG4H 3IWFA 3V64A 4LGWA 1DBNA 1CAWB 4IEPA 4O61A 4LIVA 5APAA 1WJFA 3FHNA 3A0KA 1TQPA 1Z05A 4EV0A 2VQGA 1CN1A 1DP0A 1E5IA 2HLEA 3MIFA 1W39A 4JGZA 2X85A 4M0HA 3S15J 1V9U2 2BFUL 3WCRA 3DECA 3B9CA 3HHGA 3N4MA 1JH5A 3V7CA 1D4M3 2F5VA 2AEZA 2LM3A 1T6SA 1V6NA 2E60A 2BY1A 4KUMA 3KP6A 3LSIA 2KFDA 1S9HA 1W3XA 4BMBA 5J3LA 3U1KA 3WOGA 2GMMA 2E5NA 2DUQA 2KLOA 1VBB3 2VW0A 2WB1A 2JD4A 3LA2A 2XHNA 2VJIA 3RSJA 1V6LA 5FFXA 4IHVA 2LF8A 1Z6TA 1RJ8A 3AL5A 4YVWC 2R7FA 1OURA 2EZIA 3NRUA 4JGYB 1Y1VJ 5G05L 1OD3A 3KZ4C 4PCQA 3LAJA 2QYOA 2G9FA 2WUHA 1YRNB 4ZDOA 1ZRCA 3AK0A 3K1NA 4IEQA 4II2A 1AF9A 2DYRH 2PG4A 2YC0A 2ZX0A 2WZR3 2HTJA 3GXOA 3RFRA 3ON7A 2WT2A 3DXUA 3D0SA 4Z2WA 3R0JA 1HRI3 1OYYA 4XR6A 3TGNA 3ZRGA 2GXBA 2UWCA 5FLIA 3H3UA 4P9IA 3K3NA 4LBQA 3CJRB 1AYN3 2HVSA 2F4LA 4JKLA 1N75A 4D9JA 1LR5A 4XF0A 4E9KA 2XBO3 1H8TA 2JE7A 3OYAA 5EZGA 2DF7A 3LQQA 4XBLA 4CE8A 4HX4A 3ROUA 3NL1A 1BR4A 4CCNA 4IDZA 2WNEA 1QPMA 2XIGA 1W36D 4XACA 1GMMA 2HTSA 1W6PB 2A70A 2VL8A 3G7DA 3ZFFA 3CDZB 4D6RA 1YIOA 2JG8A 5C4XJ 4XZPA 2X1EA 5FUIA 2AXLA 4UVBA 2I45A 4G3YC 1G9CA 1UU4A 3HSFA 5IFPA 3BLYA 5HS9A 1VQMI 5FKOA 4H7MA 2A5YB 3L9FA 1LVAA 2ZXHA 1ON1A 4BISA 4GIQA 1AR72 3JUUA 1Z1DA 2Q4SA 4CP9A 1JYNA 1BI0A 4D0PA 1RJ7A 4P14A 3SQOA 3PTYA 3K4AA 2DT5A 3HWJA 2OA2A 4GXLA 4UF0A 4HV5A 5AIPA 1W8NA 4PDWB 5FMOL 1X3ZB 5JDBA 1D4M2 2IA2A 4JTOA 5ERLA 4EZ4A 5IJRA 2FQ3A 3T0YA 5JHFA 3DU5A 3BVCA 1J3PA 5A7SA 3C1DA 2EXHA 3FBNB 4E2QA 2CQ7A 3WV6A 4M73A 4NC6A 4JX0A 1VQ5I 1W6MA 2LD5A 4XTPA 2FD8A 3FHQA 4GH4C 3ZQIA 1A8DA 2XUMA 4EN0A 1BW6A 1C0WA 4QSHA 1VAKA 3WNKA 3GZNB 2WINB 3ZN0A 1C3HA 2R30A 4FE7A 3CJNA 2WO3A 2F17A 5HLHA 1OH4A 5D8AB 1JTXA 4XZUG 3FX3A 3NJXA 1RMU2 4RBOA 3PL0A 2WAQN 3HRTA 1BC7C 2LTPA 3ABZA 1UY1A 1ZTRA 1GNYA 1I5PA 1MNMC 2WT0A 3VFZA 2R16A 3UYJA 5L3GA 4G7OF 3FBMA 2L2OA 4D5FA 1CD3G 1D0ZA 3SHFA 1ETVA 5C44J 3K7AJ 2M8EA 3HOYJ 1VRBA 1WJCA 1O7FA 1QXRA 1XB9A 1GHCA 4LOSA 3BTZA 2GBYA 2GU9A 3PIPF 3VBSA 1AYN1 4E8DA 1FMWA 4XJ8A 3FXUA 1LRHA 3ECOA 1DLCA 3NMBA 5BNPC 1TL8A 2GNTA 3WNXA 1P92A 5HLGA 1EAH3 4B7EA 3PO2J 5HODA 3F8BA 4BQYA 4YGDA 1HRV2 2E53A 2EAKA 4XILA 3VD7A 3FHZA 2HWE2 3BTLA 5F1RA 3ZDSA 4EMSA 4FPJA 5K0UB 1MZFA 4XQWA 3Q5FA 4MSVA 1BIAA 2A69F 1AR82 3IC7A 2PJPA 4P00B 4XFIA 4XURA 4Y5Z0 1MS4A 1HKQA 1AJOA 5DQ0A 4AAXA 3E5QA 3HN3A 4COZA 1RHI3 3CHXA 2G9WA 2IA0A 2CH0A 1MEC3 3IH3A 3O0WA 1VB4A 3ELKA 5B1AH 3JSOA 2R7UA 1RUI3 2YBSA 4KICA 4XQFA 4PDWA 1JU4A 4G6QA 3HC7A 4EYUA 2K9QA 3TRSB 3I59A 3THDA 4AVSA 2KD7A 1NG0A 2E1MC 3ZXKA 1PGW2 3FZVA 1D1AA 3KMHA 1C8M1 4HONA 4UW6A 2FNAA 3OYEA 2YU9J 4MNUA 5HXVA 4OI2A 3QPTA 4ZYDA 1X1DA 2D44A 2G9GA 3F3XA 4YELA 2E9QA 3VBOA 1A78A 1IS5A 3OOPA 2MNGA 1GOFA 1H1MA 4IGPA 4PBPA 4A5NA 4NROA 2L4MA 3ZYRA 5JXGA 1W8FA 2D3SA 2V9PA 2Y31A 1V55H 3TNPB 1EH7A 5JVTA 1AYN2 2ZFUA 1EP0A 3D3AA 1YWKA 2DMQA 1Z7UA 1ZHFA 1UKRA 1SC7A 1JT6A 3HIFA 3P9IA 1H8AC 3QP5A 1Z77A 3RS6A 2LC2A 4X6AJ 4QWNA 2DFIA 4NOTA 5C4JJ 2JXAA 1OPOA 1LOFA 5A3LA 3CF2A 5CG8A 4YVSC 3NSTA 1AYM2 1T38A 2VUDA 2ZJQF 5JMCA 3ZGKA 4A6SA 5T3NA 1BHGA 4BE1A 3PIGA 3H0DA 1EF4A 2GIVA 1FT9A 2WJSA 2VKVA 2DURA 2IXIA 4DEQA 2D40A 3K4KA 2ID4A 3MFCA 4MGKE 4RM2A 3GTPJ 1O7LA 2Z2SB 3HDDA 2NMOA 1SLAA 3LB9A 1ODNA 5ISLA 4NHKA 5HBAA 1AX0A 1IPJA 1PGSA 4GXOA 1KU9A 3I0TA 2VZ3A 4BQNA 2OUMA 5F27A 3DN7A 5CAZA 1IXRC 5JLVA 4IXAA 3L00A 2SBAA 1UJ8A 1NE4A 1KQ8A 4Q4Y1 3JR9A 3LFIA 1BEV3 1J83A 1JI8A 1W9YA 3VD3A 5L19A 1GT0C 4ISRA 4YZ1A 2E63A 1SPPB 3EO6A 2A5ZA 4OIRF 1CQ9A 4Q4V3 1JZ2A 2FDIA 2QQPA 3AP6A 4CUAA 4HBLA 3RTRA 1XPXA 3P3NA 4XRFA 3C2GA 3I2DA 3HAGA 1SEUA 3EUKL 4QWQA 4FTHA 4JOMA 2M7AA 1LOGA 5JXJA 3VBUC 5C70A 1C8NA 3HBZA 3DYOA 1LU2A 1TME1 3J8F1 3HNBM 4A42A 2H8RA 3MKLA 3BC8A 2F5CA 4QQLA 3LL7A 1HLCA 4XF3A 2GNBA 5JVVA 1POV3 2ZMNA 3BZCA 4QX2A 1ERDA 3WT3A 4XDQA 2JG8C 3RWKX 2V72A 3ZSKA 2L7FP 1LHOA 1W6OA 2R1DA 1L3JA 4D7MA 3WF3A 1SFNA 1YI2I 2VQLA 1UYZA 4R1HA 4E7KA 4Y33A 3M3OA 5FPZA 2NS7A 1CESA 5IK4A 2C4XA 2EICA 2ZNZA 4COUA 3DLAA 4IV3B 2DOFA 1FOD1 3RG0A 4JRAA 2YPRA 3DCFA 4CA9A 3BQZA 5D8AA 3TOJA 1WJBA 2VASA 1NHAA 5LHGA 5FO8B 1UU5A 2BYVE 4BBSJ 3U10A 4OHZA 4AQTA 3AVRA 1NKGA 1VBD2 3IRQA 4INDA 1BIBA 4QDRA 5GLVA 4X8NA 1FI2A 2ZB9A 3T3YA 4Y13A 3WTUC 4NUBA 1XQNA 1SG3A 4LBQB 2RGVA 4WZCA 1PMIA 3K51A 3WU2C 2P17A 2VBYA 3C18A 1R1UA 1YS6A 4AWDA 5FQ0A 4AIKA 5FZCA 3OEBA 1WBLA 3J7YJ 3WTVC 1R5GA 4DZGA 5FYVA 1VQ7I 4Z2AA 1ZLJA 2EZKA 4M3FA 3ZN4A 1ZZCA 2RS13 4DJAA 3Q0WA 5KHHA 2QZ2A 3K4NA 3CL1A 4DBRA 1Z21A 2OZUA 2BGOA 3OS1A 1J58A 3AFGA 4U7BA 5DD8A 5EJ3A 4RS5B 2D6LX 3J80K 1H1AA 2ZXQA 1S7AA 3BG7A 4WVZA 4ISQA 3VDDC 4ORFA 3FWEA 5JIUA 4KI5M 5J1YA 1LU1A 4XJZA 3NW4A 3ACIA 2QLZA 1K6YA 4FVVA 3NV4A 2IFRA 2JTVA 3ISPA 5A2QZ 1F2NA 1MSEC 4AVAA 5E1ZB 1BJQA 1BR1A 4XFHA 1IRFA 1ON2A 1DZQA 1NH3A 5D1IA 4I02A 1JN2P 2BUKA 4EN8B 3WXPA 3TMOA 3O1PA 3LF7A 2MLGA 1GUIA 3I3LA 3ETPA 3SZTA 2FEZA 3IH4A 2RR12 2AC1A 4A69C 2X10A 3POFA 2E1CA 4ATFA 4PQQA 2L7ZA 2C1FA 3E6DA 3T4VA 5C4WA 2B9SA 4EJTA 4CXWA 3MD2A 4DO0A 1CZSA 4WM7B 5FO5A 1W5CC 3PUHA 3FMRA 4CU6A 4BGDA 5FPXA 4V19K 5GP9A 4JDMA 4MEYF 3LA3A 1JGGA 1SVLA 1I1EA 2H1KA 4YFNF 5GTIC 2HWF2 1T39A 3OY8A 3UL2A 2WZR2 5JMOA 4DRVA 1UY4A 4KL1A 1YTYA 5FBJA 5A7QA 2A6XA 2CGOA 2UWAA 5F3EA 3W2AA 2BV4A 2ZHMA 3S57A 3D4KA 4IRHA 2XVKA 4OUSA 4W1UA 5T5PA 2PXJA 4U88A 5FXZA 4AU7A 1P2FA 2LFBA 1GZWA 2ME0A 1PK6C 3T08A 3TEZA 4BB3A 4L8QA 4BPZA 3SISA 4MG2A 4EVIA 2PAKA 1SLTA 2LBFA 1X8EA 1VBE3 4IEXA 3RZGA 2Q1FA 1GP5A 3E6CC 1B6AA 1D2SA 4S0HB 1HLVA 1IAWA 5A3OA 4GB31 5IOZA 1O4TA 3C7FA 1I27A 5FV3A 4C91A 3EYPA 4B44A 5FP9A 1VZ0A 1WW5A 4DB5A 2R063 4WV8A 2XUEA 1IRGA 4QPYA 3KHBA 1FTTA 3WDWA 4AWXB 3ZYBA 3T09A 3BJAA 3RZDJ 1ENRA 2K9SA 2CNAA 1T56A 1X4OA 4IEYA 1NCRC 4XFAA 1TE1B 4AXOA 2FZ1A 2DVBA 3GLLA 4HRIA 2ZHNA 1OR7A 3WG9A 3MW4A 2DU9A 1PVC1 4Z92B 2I5UA 2W5FA 3QYEA 2VAUA 3ILFA 5I0TA 4GWNA 3OYCA 3OS0A 1AJKA 2K85A 2FCTA 1WHUA 5LGNA 1WH7A 2QSFX 5DZEA 4Y52J 3L09A 1UG0A 3SEQA 2R7EB 1SCRA 3LSEA 2VNGA 3RYPA 4A3DJ 2MEV1 3LSDA 2NM1A 2QA4I 4L18B 2GP3A 1XG1A 1C4RA 1ONVA 3UESA 4D1QA 3J9SA 4OHXA 2DDBA 5CVJA 1PUFB 4PFOA 3MI8A 2R7SA 2OA4A 1OVSA 1V0AA 2JUCA 2JDKA 4XICA 1UHWA 3QOPA 2V1DA 4DQ2A 3HPGA 2VG9A 1LDKB 1XU1A 2CYYA 4LQRA 3RCOA 3WP6A 3JRCA 2XJTA 3EYYA 3EUHC 1GDTA 3GTMJ 1RYYA 1K61A 4B47A 1XSXA 4WM7A 1QJU2 4UW5A 4Q4X3 1BZWA 2HWD3 3ELNA 1MPXA 4BWOA 3D8CA 2JMWA 1X19A 5F2WA 1M1EB 4A3BJ 2XKPA 3GFJA 4GGGA 2JB8A 1BI1A 2P34A 1JODA 2KISA 4KWKA 1UY0A 3KVBA 1HQCA 4AEKA 1QY4A 4ET7A 3CP8A 4B3NA 2W1WA 4TXWA 3FLRA 5L9RA 3V7SA 2P2KA 3C7HA 2VQUA 4A44A 4J19A 2ZBKA 3B3QE 2LVSA 1RETA 4Z07A 5D21A 1I1GA 5DN2A 1ZBA2 4IO9F 3S93A 3FXQA 2A5WA 5DDJ1 5M3MJ 1RUC3 5AVAA 1Q1HA 1TLHB 1NA1C 3ASNH 4OWRB 1PO23 4JX6A 1UL9A 5ABJC 2IXLA 3OTFA 3ZQLA 2Q30A 3ZFEB 3FM3A 5GLUA 1VRH1 2E51A 5K5RA 1SACA 3PJRA 3FM5A 1VPHA 2OKXA 4O65A 5D4SA 1XB4A 5F5QA 4WK8F 3MZ8A 1D0GA 1PDNC 5T52A 2CV2A 4YEJA 4FE4A 1UKGA 4CCKA 1Y7BA 4E7LA 3MIDA 4A3GJ 4A7KA 3ZIXA 4JQTA 1R6RA 1GOHA 1OFSA 3MFAA 2DFCA 2E7WA 5GZGA 2ILMA 3KLNA 3O3KA 4NRMA 1R092 1W05A 1ZZ6A 1FEXA 2LKSA 3AFHA 5K7PA 2NOGA 3FMGA 2VQCA 2DK5A 5LK7B 1AR62 4GH4B 4CXXA 3VD4A 5H9QA 1Z3YA 4MLOA 1W2NA 1ETYA 1J5YA 4Y22B 3Q9SA 1WMXA 2NOJB 1SANA 4FO9A 4YLZA 1K3IA 4XOTA 3P5JA 4OFGA 1LTEA 3GTQJ 4XABA 2ESHA 1Z7S1 2DA1A 1QJZA 1OLMA 1H2MA 5F2SA 1FV3A 4RS5C 1O8SA 4BQ2A 4A93J 1QJY2 3HB9A 5FP4A 4DUVA 5FJHA 4CP0A 2WAEA 4W97A 3I53A 3CJQB 4E4SA 1TQMA 3RIRA 3B73A 1RUH1 2NVYJ 5FZMA 1JHJA 3A0HC 3J7LA 4EQQA 3A1YA 2KQRA 1A5JA 4NN0A 4RS5A 2VJ5A 3L9JT 1G3SA 3ZN6A 1HDPA 2F6BA 4MGQA 3WNOA 4RAFA 5IT3A 4WM8A 4BXUA 1XXNA 1J1TA 4OAYA 4BAYA 1PO21 1G2HA 5EWSA 4XLAA 3KB5A 2X6OA 2QJVA 2V9KA 4MHGA 2JB4A 1ZK8A 3R61A 3AG2H 1ETXA 5EPAA 1UZCA 3ZMUA 1NCQC 5J7MA 1BBT1 1IKQA 1UOFA 3WQ1A 4R4XA 2L4AA 4ESBA 4LT5A 4CH7A 1FP2A 3DKXA 5ANQA 1IJWC 1PGL1 3HRMA 2O6GE 4XSXF 1E2XA 1NK2P 4N90A 3OYIA 3PQKA 1LKNA 4DOUA 4P9LA 3WCSA 3ETQA 4ENKA 5ED4A 1WLCA 4AI8A 1G8WA 1J09A 2HWD1 5D6FA 4XKBA 2R4GA 2IXKA 5BNNB 3ZMSA 3OYFA 3C7GA 4IKFA 1QU3A 4Y26A 2RS53 2OCEA 3W2VA 2VTXJ 1N77A 3SJMA 1WA4A 5FLJA 1MKMA 2GMEA 4HKLA 1BK0A 5T54A 3FC0A 4LBNA 1ITYA 4WF2A 4KFCA 3NNFA 1DUXC 2QBYA 3A7QA 1UZWA 3A01A 2ZJPF 5FB2A 3RNSA 2ZX1A 3MF6A 1W9FA 2RS12 1KDMA 3BZ6A 1H2KA 1DU6A 3S1MJ 4D0QA 5FR3A 1L7RA 2L7MP 1O3TA 4QPWA 1PVXA 4HNTA 2UV1A 4V2VA 2ZGTA 3PJYA 1MS9A 3UV9A 4DFSA 3VD5A 5JFRA 2IS4A 4J01A 4YRVA 3MICA 4EEFG 5JI9A 1JZ6A 2XB0X 1ZA7A 2C26A 3MZYA 2UXNA 1A31A 2QKLB 1IXCA 4IE6A 3VYRB 3N9QA 1GP6A 4FOWA 3OBAA 2P8TA 4QPOA 5K1YA 3T8TA 3TKYA 1QXJA 3S1RJ 3T0BA 5M0TA 5D5VB 4QXBA 4YGEA 2RC4A 5FZ1A 1HKDA 3GTKJ 2V6EA 5C7GA 3MO4A 2ZS6B 1XJAA 4OCTA 3MIBA 5IP6A 4XKVA 3MBWA 3PU3A 1WZXA 3SH5A 5HV4A 5FTTC 5J37A 4PI0A 3WZ1A 3DWLE 2Q0OA 2QQKA 1G3WA 4NNJA 3ME2A 1Q8SA 3TP3A 5IFTA 5JXIA 1LQ1A 4Y3OA 3JU9A 3K4LA 1LODA 3C7JA 4RB0A 3I2GA 1RUF2 2DBIA 4XC9A 1T0FC 4YM0A 4EGYA 5EZWA 4Q0UA 4E2GA 1P7IA 3FKIJ 5M3FJ 4F8AA 4OQ8A 4QGNA 4TWTA 2VZQA 3LQRA 1RIRA 2EINH 4I01A 1AR63 2PTMA 5IHRA 3NQHA 1NZCA 3MIGA 5GTHC 2JD9A 3F6OA 4O7XA 1ZM1A 2JG9A 4RDUA 1GUUA 2QQIA 2DQRA 1RMU3 3VV1A 2A71A 4P5OA 3M2MA 1F8VA 5F5AA 1W06A 2QWWA 3F8MA 3CDLA 1F31A 3B69A 3VBRB 2DA3A 1OQ1A 1VMFA 4CP1A 3C8XA 1Y39A 5FPBA 1HCRA 3FK6A 2NNYA 1ND2B 1KRIA 4O6JA 1EUTA 3H9GA 1VBA3 1ND3A 3H0OA 3PUSA 1ODMA 3ACGA 5A1FA 5A3MA 1NQJA 1WJEA 2BERA 3MLJA 3WODF 5IT6A 3LMMA 1ZQ3P 4QHBA 5FP3A 1PP7U 4DXZA 3PFIA 1YJKA 3BTXA 2ECCA 3TL4X 3H9AA 2Y30A 1J1LA 1ENSA 4IF4A 3ZMZA 2LRPA 2W39A 4AVPA 3AXEA 1FMD3 1MIJA 2PFBA 3A23A 2XGEA 2GH8A 2JDNA 1AR83 1QJU3 1W8TA 5I0DA 1OKQA 3FDYA 4AI1A 3ZMOA 1FOD3 3D6EA 4MHRA 3I7DA 4RB1A 3GNEA 2CWEA 2IGOA 5C3SA 5FPVA 3HBLA 5DZGA 2VXRA 4DBQA 4HMZA 3D5SC 1DQ0A 1IG3A 1DPRA 2DA2A 1AL21 5A6XA 5A1LA 3LWCA 3IB3A 1JYXA 2MD0A 4CEYA 2XPVA 1SLBA 2VZSA 2E2IJ 1B35B 2W9XA 4IOAF 2AQEA 5F9TA 1XN7A 2R32A 4MOAA 1UCRA 4M71A 5ACA1 1Y4WA 1FJLA 1BBYA 5C3OA 5EGOA 1H9WA 2BPA2 2W57A 2BJSA 2Y8KA 3DPRC 1G6NA 4FFHA 5KXEA 2GC1A 2WSVA 5CPRB 1YIJI 3E1F1 1AHDP 1TQIA 3B02A 4PHZA 4XPVA 3WDXA 1CIWA 1XOYA 4HW0A 2OW4A 3VBSB 1NLQA 4HKWA 3JB4C 2DJNA 2DTYA 3BU0A 2XJPA 4JP0A 2IAIA 3FBIB 3L2CA 2DDUA 1NY71 3RRDA 2R7ZJ 1MR5A 4IGOA 4CZSA 2JA7J 1REEA 3OGSA 3BR5A 2VKDA 2FF4A 3N7JA 4RQPC 4BUPA 2F4PA 3WG2A 2L01A 4R79A 1HW1A 3JRAA 2HOAA 5J3UA 1X4PA 2CGPA 3KEOA 3FXMA 4IESA 2D3RA 2ZGQA 3CUQC 2YFUA 2CQQA 2VQHA 3BKZA 1CVNA 2R7DA 3INAA 3ZFGB 1KU2A 1OQYA 2DYSH 1U8BA 1YCIA 1M4WA 3WTSC 3WGHA 4W6YA 4COVA 4HA8A 1RHI2 5M5XJ 1VBE1 5DEQA 1MEC2 3LWFA 3OYWB 3J7AY 3IL2A 3C3WA 4YW3A 2JJ6A 1LJ7A 3TOBA 2ZOEB 3GJBA 1X2MA 2HDCA 1RUE3 3POWA 4BEHB 2J42A 1PO11 2PHXA 1O59A 2Z5WA 2X9DA 4L0ZB 5FY1A 5HPOA 2ELJA 5FPLA 4HF2A 1FNZA 2PHWA 2X1DA 5FZEA 1JYWA 2Z42A 3I3EA 1HB4A 5L73A 3OBZA 5BNOB 1OPMA 1LOEA 2X6WA 2VR4A 3BIEA 3A02A 5CYVA 5HOOA 3J7AO 1X3WB 4HK9A 5DG1A 4NPRA 4DZPA 5IYBJ 4HG2A 3JCIA 3C2HA 1S0IA 5CFCC 1IPSA 1WCDJ 4XN0A 1YHFA 1XNCA 1KQ0A 2JG9C 2EXKA 2XQRA 1Q56A 2RMU1 3KP2A 3HOVJ 4B43A 3JRGA 1W0TA 3ZSJA 2XJSA 3EDPA 2G4IA 2WS91 5M5YJ 1W90A 4KWJA 4BJ5C 2R5YA 2R0HA 5ANNA 3K0LA 3A0BC 1HSJA 4XFFA 2HWE1 2FDFA 4LLLA 1TT0A 3LCPA 3HNMA 1VBA2 4QPGB 5DABA 4GRIA 1P4XA 2HWC1 3HOWJ 1UCXA 3Q9VA 2M1BA 1DFQA 3OBTA 3L2VA 5DM6F 5DAQA 1WD3A 4ZYAA 3H1WA 4IV1C 3Q8AA 1QZZA 4IXLA 1QZEA 4LFUA 1RUD1 1MS5A 4C90A 1OBNA 5I93A 5A32B 1JUMA 2HBTA 2R043 2MH2A 4OINF 4JX5A 4HBNA 5A33B 2BNMA 3KWVA 5FWJA 3O1MA 3U0ZA 3ZLIA 1OKRA 2V7FA 1MZEA 3RJRA 2FQPA 2Y48A 1KQ9A 4IERA 5FYUA 1ZH5A 4A3XA 1MS0A 2YG0A 2X0LA 5FYBA 3IN9A 3EPZA 5KC6A 2WNUB 5J1XA 3HUGB 2PJRA 2DI3A 1EJ9A 1NXMA 3HTSB 4QKNA 5K5OA 2VECA 4HNUA 5B5EC 1SMVA 4I09A 1WKYA 2KDZA 2EF6A 2ZGOA 2Y60A 1CJPA 1P9QC 1PIV1 1C5HA 5FY5A 1RUE1 2O1QA 1WCKA 5FAXA 4BXXJ 3G6JB 3QYBA 2RS33 1SBFA 4Q5SF 2VBZA 1RVF2 2ZGUA 3BI3A 1BCXA 1IN8A 2K7LA 2C6YA 5A6ZA 2RDSA 1BVVA 2VJXA 1Z91A 3POYA 2E5ZA 4HSRA 4NMIA 4META 5C9AA 3GF2A 2Y0OA 1I3QJ 1T2XA 5JZGC 4X1EA 2ZGPA 4E2SA 2Y6FA 3VDCA 1LEBA 5EJCA 5C8CC 5L36A 1JZ3A 4PJNA 2BZDA 4P1WA 2Z4FA 4BCUA 2H1LA 2LRDA 4L5EA 5KAIC 1W6QA 4B1MA 2CQNA 4OVEA 4I3PA 1RUD2 2H27A 2QENA 4JDOA 3JTHA 4Z1VA 4XOPA 1K5JA 2ET7A 4GKXA 3MPPG 5FFZA 4XIKA 4HZFA 4BBRJ 3IIIA 2HQ5A 4PQ9A 4ZU5A 5FBZA 3V0AA 1U5YA 2VQTA 1ETWA 4MX3A 1CAUA 4D94A 2FOKA 1E5RA 2WDBA 2DTZA 2C9AA 3WW3A 3L2HA 1R1A3 2XOMA 3PMEA 2W47A 1Q3EA 4UUTA 3LAPA 1S8NA 4GD4A 2W82A 4DRRA 1Y56A 2RDQA 3CQOA 3O12A 1J7KA 1YFHA 3WTXC 4XIOA 4HQEA 5K8SA 1RUE2 2VE1A 3VL8A 4AFBA 1B1BA 4CUGA 5ABJA 2Y26A 3VODA 4AGGA 4FPEA 1U5ZA 5LBEA 2XB6C 3JCUC 4XXPA 2EXIA 3Q8BA 2VZOA 2QCSB 2E1NA 5CKTA 4MYEA 3O14A 1J2XA 2Q1ZB 1BBT2 2Y0IA 4I99C 2E7AA 1O91A 1H9TA 1GZTA 5LBQA 5L7OA 1L0OC 3U07A 1V6OA 4N43C 1B9MA 1XSVA 4KNCA 2CW7A 3TO9A 1X8MA 4MV2A 3CMAI 1QH6A 4ZTFA 1NLSA 1WGPA 4BY7J 3DCQA 3O8HA 2FA5A 1W3VA 2JKBA 2Y34A 1EAH2 1VI0A 1FYMA 1BW5A 3MHZA 4RLFA 9ANTA 1Q8QA 2B45X 1U9OA 4RFT0 5B4XA 1CF7B 1MNDA 1KJLA 4RGKA 4E7SA 4CU7A 1RXFA 2K2SA 2B7YA 2BVMA 1IUYA 1VMHA 2VNRA 1S72I 4N53B 3W6VA 4MEXF 4C9YA 3N35A 4PSXA 4Q4ZF 2HEOA 3KETA 1N3OA 1DQ5A 1MH4A 1WZ2A 5D5UB 1BJZA 5FUNA 1HQNA 1QHGA 2JDZA 4JCKA 4IE5A 4B8XA 2KJBA 3LE0A 4CEYC 2QBXA 3K4DA 3EETA 2IS2A 1JHHA 3WF0A 1QEXA 3VBRC 4LE3A 4XDPA 3PURA 2ZABA 2FX0A 5F39A 1F5TA 3VPRA 3TO7A 1JGSA 2VL4A 1B59A 2BWAA 3OYKA 1JXNA 2OQ7A 2EBIA 3A4CA 4AE2A 3B7MA 1VQ4I 1KGSA 2WFF1 3M1CA 1J0RA 3SCFA 1ULYA 4ESJA 1J75A 2VC9A 2OYZA 3ZFEA 2BWCA 5IAXA 3R6SA 4IEOA 2GOXB 3MKZA 3GZEA 4ZS2A 2R7XA 3VDDB 5FYYA 3MCZA 4YG2F 5H2FC 1W0PA 3KGZA 1VR3A 5LCWL 4LEJA 4R9BA 1FBQA 3V0BB 3POBA 1OF4A 1EAH1 4CUCA 4R9DA 2VTXA 2XAJA 4EN9B 2DUPA 2DT6A 1QVTA 5HCAA 1DYPA 1H4GA 1AXYA 3OGRA 2ZGNA 2PHDA 1TG7A 1I50J 5C71A 3I5UA 2VKEA 5K5QA 2QQ9A 2FBIA 2HH9A 4Z2YA 1TMF3 2IVIB 2L9SA 3H1YA 3LOIA 1R7JA 1LNWA 5A3WA 2LF7A 1HRV3 5JOWA 1QA6A 3JRHA 2IFWA 3DLLF 3RMYA 5LWBA 1HQWA 2CHHA 1F35A 3OSFA 4UFMA 2HBUA 4MTDA 2R0QC 2VD7A 3LQCA 1ZZ8A 2IZWA 4Y20A 3M3IA 4OU0A 2Y69H 2CO5A 2VMFA 2R041 2YB7A 2PAMA 3CCSI 1XPWA 2YU3A 1YFXA 1BVP1 3EUHA 2FJ1A 2P37A 5F6KA 4Z6YA 4F7ZA 3CCUI 3BTAA 5KBFA 2ADEA 4NIDA 4KBZA 4WZFA 2OBPA 3ZXSA 4I3GA 3T2OA 2BVVA 3RYRA 4MVTA 2DV9A 5FZLA 4U2AA 1HA8A 1S1AA 3DL3A 2W00A 1AX1A 4X6RB 5TJJA 2ARCA 4N7IA 2BXYA 4IETA 4YGBA 1ZRDA 2WFF3 1S6LA 4QM9A 5F5CA 4M72A 4GWMA 2EILH 2XJQA 1RUOA 2JDAA 3IRRA 2XL7A 2COMA 1Y0NA 5T5LA 1MVQA 4KGGA 1SEFA 1LAJA 3JRIA 5J4YA 5CKMA 3KZZA 2GSYA 3NKTA 5IP9J 2UWMA 2KA3A 2NYXA 1RL3A 2D7FA 2A07F 5FXWA 1ZGWA 1W4MA 2W25A 2B9UA 3HNYM 5K7HA 4YVWB 2XAGA 1HX6A 3ZPOA 2LG4A 1T6BX 2VONA 4BK4A 1OMIA 4HPKA 3J7HA 4UVAA 4ANJA 3UGFA 4LBQD 2JENA 3SH3A 1R23A 5K9YA 3DEWA 3OR1C 5FY9A 3IAS2 2XAFA 4NHYA 1D4VB 3S1NJ 4E6KG 3QLQA 3WDVA 4S2DA 2YR2A 4MFDA 1P8JA 1X33A 3AMQA 4LKEA 3JAMK 1IOAA 3SQNA 3IMNA 2K46A 2ZXIA 1TBXA 3HG9A 4L9BA 2VE8A 1NYWA 5GZDA 1QMJA 4Q4Y2 2YBKA 2N8GA 1U2WA 4RFRB 3LZZA 1RTVA 4XXAA 1NXD1 1FIAA 3IV5A 3N9PA 2ZJ2A 4AI2A 3LD8A 5FKBA 2XLGA 2L7KA 3HHHA 1KXGA 4JTNA 5FXXA 3GYHX 3GX4X 3AG3H 4P9UA 2WO2A 4EZHA 4A0YA 3B00A 3GZTB 4L2NA 4W6XA 5I8YA 4XNFA 4BQ4A 4UFLA 4N0BA 2EZHA 2W52A 3U1XA 3LAGA 1REFA 3LFMA 1O5UA 2QBYB 1DQ2A 5CVVA 3UGHA 2OC6A 1S4CA 2ZFWA 2ERFA 1ETQA 1TNTA 1WRJA 1PIV3 4FCAA 4K1YA 1YW8A 2IVJA 1N3QA 3GTLJ 3RJ2X 2VZPA 3BP8A 3FFQA 3RYKA 4KT6A 2PMWB 2LLKA 2OT7A 2WIIB 1TEIA 4Q0PA 1R083 3H7YA 1OOPB 3MIEA 3MLLA 4IV3C 5FJKA 2KZGA 2A6WA 4AFDA 4MUVA 2VGDA 4PIYA 3CZJA 3RKQA 3JZVA 1AKHA 3AMHA 2RS52 1OYIA 1SBDA 5DAPA 3PM1A 3JRDA 1ZBE3 1TZLA 4OYUA 2D45A 4YW7A 3F8CA 1IDZA 4HN0A 4NQWB 3V65A 3CMMA 3VBFA 1D5YA 1OI6A 5JOYA 2VC1A 2WA0A 3F2ZA 4AFCA 2W24A 2YUEA 4HF0A 5FKLA 3N97A 1FXZA 2VZ1A 4M0NA 3VZJA 5KXDA 2JRTA 4RA0A 3J7ZI 1P4AA 4HG6B 2LH9A 1OCPA 4Y7NJ 4JYKA 1Q8OA 5BNQA 2BBYA 4CSWA 3FZ3A 1FV2A 4C1WA 2YSRA 2XVLA 5C3EJ 3E3VA 4EGZA 4QAWA 1PYVA 2F4OB 4KIGA 4E70A 2ZEZA 5D5WB 2RE9A 4CDQC 3ATGA 4JBAA 1RINA 2V1XA 4QDQA 5K7FA 1ETOA 3I8TA 2HDDA 2PHTA 4QU1A 3M8FA 2E19A 3WQBA 5BYNA 2JUGA 2TDXA 3FBYA 2WAAA 1XMXA 4HSJA 4BDZA 3GJAA 2GN3A 1V70A 4IHWA 3BR2A 2XR4A 1OA3A 1LDJA 2STTA 1XYNA 3ZMTA 3CC2I 3HEIA 4BH9A 3W20A 2FZ2A 4FQZA 2X1CA 2R072 5LA2A 1IN6A 1WLDA 2VCBA 2PLV3 4HYEA 1LFUP 4OIPF 3EQEA 4FP2A 2RJLA 3K2ZA 1UXXX 3ES1A 4LO8A 1FMVA 2XGCA 3QD6A 4I98B 1PO13 4BEHA 1K7AA 1GWKA 3BTYA 2PYTA 3T2PA 1KFUL 4AF9A 4BQAA 5FFOC 3I54A 4OUEA 2K9LA 3UNGC 2FDJA 2ESNA 1JJ8C 3GW2A 1PNFA 3I4PA 4Y5TA 3KP3A 2VZTA 3CCQI 3WHTA 4LBJA 3ZDVA 2Z16A 1ZG3A 4LKFA 1OCCH 4YSFA 1RR8C 1QJEA 2NS0A 2WR9A 3OPZA 2K4JA 5IPAA 2JZYA 4QPGA 2CUZA 4W65A 3AZXA 3OJBA 1SMYF 3E6BA 3M9AA 3J8F2 5KHDA 4BOWA 2PLV1 5E79C 3L7WA 4AQ2A 3E97A 4COWA 1F5FA 1TW3A 1F43A 5D5XB 3WTZA 3FUOA 1CR7A 3ABUA 1Y43B 4ZU4A 4XF4A 1DCSA 3ZQFA 2A61A 3U1DA 1QNTA 2NN8A 1AA7A 4IW3A 1Z7LA 1W7PA 2JA2A 2PMZA 2WLPA 2Y38A 5I0UA 4CEWB 3KCYA 2WFPA 3ZIWA 5C6CA 3DEMA 1UYXA 1X1AA 2CQXA 2QDRA 2R071 4XCAA 4E7ZA 5E20A 3CQZJ 1D2QA 4HPQA 4MO7A 3ZXGA 2XDVA 3JRBA 5DYMA 1QQP1 2EFPA 1Z0XA 3F22A 4AUXA 5AC91 5A7WA 5LEJA 1UU6A 1W8WA 4BY1J 4FFIA 2PQ8A 2WQZC 2VMEA 2RDRA 2EIJH 1G86A 4A6EA 3I2KA 4B4CA 4YVSA 4JDNA 3K3OA 4YIIA 5DM7F 2LREA 5DAWA 1HB3A 1RNLA 3IWZA 4RAZA 3T4HB 4D7NA 3OYMA 4ZYEA 5FD5A 1FYKA 3E5XA 5FZHA 1EY2A 5C8CA 4RR3A 3ZQCA 3HT1A 4HETA 4DOZA 2WADA 4X8PA 3A01B 1I39A 5JPNB 1U3EM 3FHAA 5F1JA 2EZLA 4FX0A 4QB1A 3IKWA 1XGNA 5AIQA 2VPVA 4L11A 2XAUA 2DA5A 4PJMA 3MN2A 4Q4W3 1QH7A 5LA1A 2OPWA 1NUKA 5JI7A 4ABZA 4XW3A 4L0PA 1RMU1 5A7PA 1RUJ3 4S04A 3B6CA 3RKXA 3GHNA 1GQPA 3J7MA 3HTUA 2EAAA 5D8LB 1RHI1 1MVEA 3WDTA 2ELKA 4K6BA 5JR7B 1UZZA 1FWZA 1BKZA 2R92J 4YNIA 2Z5UA 1QWRA 1B9NA 4PZJA 1IUFA 2RM21 1IS6A 3AYEA 4B7KA 2WLQA 4DGWB 2XVGA 3BOQA 4JGYC 3M7GA 5T5OA 4NJ4A 1KS5A 2ICWG 3VYTB 4BK5A 2K9NA 2HPIA 2K9MA 4PFPA 2XXZA 4IOCF 1WMEA 2AZ5A 5JR3A 4IQPA 1PGW1 4AGRA 4ENJA 4HSTA 4H2AA 1MZ5A 4FOVA 4XFCA 4BE2A 4NPLA 2A05A 3T0DA 3KV6A 4OI4A 5EJZB 4NRQA 1FOYA 2BV6A 2FDKA 1WKMA 3SHRA 3RPUD 4KT5C 4LBKA 1AR81 3H5RA 3SMHA 5ICFA 3AMNA 3VBHB 5EG0A 2O8KA 4FQ4A 2DPUA 3ZN6B 1OCZH 2ZGRA 3U14A 2TEPA 3CDHA 3GFMA 4MQVA 2ENRA 1W5TA 2E7TA 2GOMA 5LZ6A 1C1LA 3LSPA 2RMU2 1HXDA 5HNFA 4WBBA 3VYUB 5HV0A 3KSCA 3GTGJ 4HKOA 1H30A 4MGIE 1XE0A 3BWGA 5F08A 1G9BA 1VAVA 2DVAA 1ZR2A 1OFCX 4NHLA 1QZYA 1MMAA 2R7OA 1GZ9A 5L3EA 5FRNA 5BQTA 1UD1A 2VY0A 4Q0SA 3VYSB 5J8CA 5ACA3 3UKNA 4FOYA 4AYBA 2LALA 4U0WA 2E31A 3F8FA 3OUIA 2M45A 1JYTA 2BHYA 3VDAA 1FPQA 4C3HJ 3WW4A 4MGRA 1YOVB 4U7DA 4GH4A 3K69A 5AVPA 3MGUA 3I4IA 4LO6B 2QSGX 4XJUA 3AP9A 3H35A 2BRTA 2XHKA 1CAVB 2ZX2A 1F15A 4FISA 2W91A 3J80Z 4LPLA 1VQNI 1QJX1 1DGLA 1SD4A 2Z79A 4RQPA 2D43A 1NCRA 3S32A 1LECA 3WQ0A 2I74A 1GOGA 2CWMA 5KCMA 2QFEA 5JR2A 5B4NA 2A3XA 3OYLA 4QLCU 1PX3A 1GNZA 3VZMA 4CPBA 3CMYA 2DCEA 5JSOA 4N43A 2R7TA 3KX2A 5FKCA 5FQ0B 1BQPA 2V4AA 3I97A 2F6CA 3NNLA 4ZYGA 3JBG1 2LROA 2PMZN 2YGLA 4LLFA 1AR61 4YFZA 1T98A 4XEZA 1X1BA 4OIQF 1RR7A 4YPJA 4EM1A 3V0AB 1NK3P 5DZFA 1DGRA 1NZIA 3RKWA 1BMV2 5E1WA 2DUOA 2IGNA 5JLWA 3KGLA 3KV5A 1G9AA 4A41A 4J6GA 1ULEA 1K42A 1COV2 1O4ZA 1Z7S2 3VKLA 1A6QA 3EYIA 3AKPA 1GZWB 4D7SA 2XJVA 5T55A 3DBRB 3ONQA 3QPHA 2VCMA 1SMTA 4Q4W1 3PDQA 3ZSLA 1U5TB 1USTA 2AACA 1REDA 4EE2A 4BXSV 4GFBA 5DUVA 1POQA 1AHSA 2K27A 2M2EA 4LR4A 1RPWA 2A75A 1BL0A 1D4M1 3OY8B 1KJRA 1RUC1 2GALA 3WNNA 3WLUA 3AYCA 4A3CJ 4YM2A 4L9NA 1S0FA 2DVDA 4A7ZA 1Z78A 2NZ9A 3PNAA 1K4TA 1PZ9A 3VOEA 4OZOA 5EEAA 1UHSA 2JDPA 2Q5TA 5FZ0A 2Y6KA 1SD5A 1WD4A 2G7UA 2FXAA 1WCQA 3A21A 3M8JA 4I7HA 1ULFA 3W5NA 2FQ4A 1DU3D 2HS5A 4YVSB 2DWRA 5HS7A 2OIIA 3AKRA 1SD7A 5JVGF 4LK7A 5JZGA 3R0AA 1LKXA 1GXPA 3VKOA 3IKTA 3AKTA 2Z9OA 1AR92 4BQ3A 2ZZJA 2C5DA 2BY2A 3BR1A 4XLEA 2PHUA 5JIAA 2XLFA 2EALA 4WVMB 2JWPA 3H36A 3PMSA 4TLGA 3SNMA 4QD2A 5A70A 2E2HJ 1ZZ9A 2QZ8A 4ZH4F 5IT9K 3IKVA 2QKMB 3THTA 5EXOA 1HRI2 2DK8A 1ZG5A 3JSPA 2L0KA 2GC2A 4GA9A 1QGLA 2V73A 2QQMA 1VBC3 2TNFA 3WG1A 3FIWA 4M9ZA 2E35A 1SFPA 5EEHA 2UYAA 2ZGMA 1LJ9A 4B4PA 3KQRA 1PVEA 3J7NA 3RKYA 1JOPA 5IVYA 4RGUA 5E89A 4ESFA 1H88C 2F4MB 1RUC2 1NCQB 2GMPA 2JK3A 1XSRA 2LR8A 2V4JC 4IL7A 3K75B 4NWWA 1JHNA 5C9AB 4QKDA 2DLLA 2RNGA 2P3YA 2GNMA 1T08B 2BU9A 1HDDC 3VN4A 5J36A 5A3PA 3W59A 3DTIA 2BY0A 4WXDA 1UZYA 2R0FA 4RHV3 2JT1A 4BLJA 4AHXA 1MBHA 2VOPA 2CG4A 5FZAA 4LHKA 4Q4Y3 4DW6A 3OBRA 3WP3A 4CCOA 3KT7A 5K0UA 1EH6A 4LBLA 4FPCA 5J40A 4GCVA 1UHMA 4CDUC 1W9SA 4GAZA 3ZFGC 2BGPA 2Q2EB 3G2BA 2XQXA 4MGSA 3AYAA 1AR91 2CFXA 3LSRA 5DUUA 1ZYRF 3ZYHA 2UXXA 4AR2A 2KT0A 2E26A 3H3VK 4HNVA 3HRSA 5A3TA 1DGRN 1XMAA 1D0HA 1T8IA 4K21A 2Y9YA 3USSA 2VC0A 4AIJA 4FX4A 3ZQQA 2DDAA 1DG6A 1R5HA 4UI9L 1MBEA 4XBNA 3OGJA 3BTCA 2VCCA 4ZONA 5J96B 1MZBA 3TEDA 3WD5A 4Y22A 4CDWC 4A3KJ 3H1CA 3H5NA 3S7EA 4W4ZA 2VUJA 1IG0A 2J1AA 4QQHA 3W58A 3ASOH 3FXKA 3P5BA 2YX4A 2RG4A 4IJAA 2RDNA 1RUH2 2W46A 3CCJI 2P6SA 1XDUA 1LEMA 3X29B 1MDMB 1TWCJ 2R3SA 3AL0C 1QXPA 5A1AA 2A6HF 1Y1WJ 1UX6A 2AENA 2M34A 5E3OA 3H42B 1Y3TA 1UO9A 4QKBA 2W2IA 1PZ8A 3WHUA 2XF6A 4CDQB 2FU4A 4LULA 3U9GA 4XJAA 1UF2C 4R52A 1SFEA 2CJJA 3IDEA 4ZHNA 3POGA 1XS9A 1WFXA 2MA3A 4GJYA 4GKYA 3VKFC 4D6SA 4HANA 3K4MA 4AHYA 1IO2A 3V7RA 4X6QB 1XC5A 4FT8A 3ZYIB 1DQUA 4N8MA 4HAMA 3ZPLA 2IT0A 3T30A 2G1MA 4CCLA 2GAUA 1MMSA 3BG6A 4AI3A 4Q1PA 5CZKA 2UZKA 1YE9A 2D6MA 2YYOA 4F3JA 2W68A 3TW7A 3FJSA 5E1XA 3V8KA 1MMGA 2FOWA 3BU7A 4P96A 2X05A 3LSMA 3SDGA 4PLNA 2AH2A 4XONA 3IDCB 3HYIA 1F4AA 2XWBB 3ZCOA 1DLLA 2X8KA 3OSDA 1FMD2 2PA7A 2XUBA 1Q5OA 1LESA 1G4DA 4EJUA 2ZCWA 3M07A 5CBLA 1W0OA 1ZBE1 4MGTA 4ETSA 4YM1A 4LB5A 5IK5A 5FP8A 4IV1B 1AXZA 2K02A 3G73A 4NVPA 4FTEA 4IHYA 1KD7A 3K9TA 3M70A 3HL2A 1QPIA 3CJIB 3ACLA 3OOXA 4P9JA 5CKNA 2D6NA 4K40A 2VLAA 2E2JJ 2XSJC 1KYZA 1RUF3 3NAPA 4HL0A 1W0UA 5JSPA 2HEWF 2OAZA 4W8JA 2FBHA 5DUIA 1VBB1 3T1MA 4M6VA 2VMIA 4FXKB 1FSEA 4ZJZA 1O5LA 2A3SA 5LBBA 1ETKA 1QHHD 1OUXA 3FE5A 4IE0A 4CXFA 3GBWA 1YI9A 1AL23 5LY1A 1S2KA 4KYWA 1MW7A 4HX7A 3JXSA 5GLWA 2VTFA 2ZSIB 1JS9A 3E5UA 1VIWB 3LEKA 2DA6A 1RI7A 1UNBA 2H09A 1MZ6A 4Q0VA 3ZFEC 3I49A 5FIXA 4RD7A 1VLNA 1GSLA 4MGYE 3UKVA 5IY5H 4RM3A 2R7VA 2I10A 1RITA 3NV1A 4L97A 3DF0A 3I3BA 2D1HA 3C2BA 1WUVA 1I1SA 4O9GA 1BM9A 3TAYA 4A3MJ 2HXOA 1V6JA 4M6XA 2Y0SA 2PMHA 4LO7A 2RS31 1QVUA 1J3QA 3S2DJ 1CJDA 1R58A 4Y20B 3J8F3 3HQUA 5IK7A 1WI9A 4FPLA 1EH8A 1UOJA 1MS1A 2ZHLA 1R081 2K3PA 1R1VA 3VDXA 3AKQA 3OL3A 4CRQA 1X36A 1OISA 5FY0A 1LE8A 1XNKA 5GPCA 5BS6A 3MMYB 5IOYA 1BN5A 3KE2A 2NVTJ 4K1ZA 3D5RC 1R5ID 1ULDA 2WBKA 2FNPA 4QB6A 3QAHA 2CV0A 1PM4A 3RPUA 4RS8A 3VHNA 4AEDC 4HEA2 2V5YA 5HCBA 1GZCA 2DA7A 5EZHA 3ITQA 2J1VA 4LHLA 1BEV1 4NWVA 2X09A 2XC7A 2J5PA 1VP6A 3IZOA 3K48A 1YW9A 4XBQA 2ZXWH 4YARA 2QE3A 3RZJA 3QRFF 2BHZA 5H9RA 2WNVA 3M1EA 2I8DA 4OUMA 1AYM1 2ETEA 2RR13 3AB0A 5KWRA 4PJJA 1DYKA 2Y6LA 2QUFA 3AC0A 3CUOA 2IPQX 3I4MJ 2PHRA 5BOXA 4CA0A 4C30A 3GVAA 1AYM3 3RJPA 1OYWA 1RUG3 3T5XA 3CCVI 4HV6A 3UT0A 1GQGA 1ND3B 3JQXA 5BPIA 4AK3A 1Y6IA 3MFKA 2PN6A 3BQYA 4RSUA 1W7PB 2OPTA 5SV5A 2LY1A 1TZOA 1LNSA 5EEGA 4GULA 5ICEA 1YUDA 2X5IA 3W9AA 4M3DA 2ZKLA 1R71A 4GDFA 1N1SA 1UPIA 1W1WE 3BG3A 4YYOA 2RNJA 1QJX3 2AXTC 2VH9A 4HF1A 5FZ7A 2V09A 5F8PA 4ASKA 2WS93 1OQDA 3HXLA 3SC7X 2QM3A 2WQ8A 3VD9A 3H5AA 5F3GA 3LSGA 2VQAA 1ENHA 2JVHA 2V9VA 3MAJA 1XX5A 3OUHA 4PI2A 1WCUA 4GO1A 2DCZA 1PK6B 2TUNA 4AQSA 1N78A 5JCTA 3LFKA 1A6IA 2P5KA 1MS8A 4KA4A 1SHWB 1XNTA 4M74A 1MJBA 1W99A 2Y75A 4IV3A 3NJYA 1XGMA 3T1LA 4UFJA 2X48A 4Y1UA 2Y0MA 4A2UA 1E5SA 1XNBA 3S1QJ 2WZR1 1FY7A 1R1A2 2VODA 1RUI1 4CCCA 3AXDA 1H9PA 4IHTA 1JKQC 2BE5F 1HW2A 2XAQA 1SAXA 1W03A 2D6KA 4OMYA 2ZBJA 4WVWA 1E5HA 1G59A 1VAMA 2A3YA 5FY7A 3PSIA 4QX3A 5KHJA 2VU9A 1L3LA 3KEQA 3G4SI 4WVMA 4OZXA 4DQAA 3I58A 4CICA 4XMYA 1SD6A 2VQ0A 2HGCA 1IQDC 2XONA 4AYBN 4XAEA 3ZR5A 1RVF1 2EB7A 3N7MA 4UYBA 2BY3A 2IC1A 1EPZA 3S16J 4HX8A 2YHJA 3U4SA 4DXRA 5FYTA 2QDNA 3KQ4B 1QNYA 2XROA 2BZTA 4RL7A 2L9LA 4Q27A 1GNHA 4AIDA 5SV8A 5B66C 4ZY9A 1XGSA 1OLQA 2K86A 3GWZA 5JOZA 4UXNA 4WM8C 3RI8A 1ND3C 1DP3A 2ME6A 1YQ5A 5CB7A 3OYNA 5J48A 1DGRM 2GQQA 3CMGA 3U78A 4LHSA 5EHDA 5E3NA 1US3A 2Z1DA 2VT3A 2HWB1 4BL0B 3NV3A 2FCUA 1A8MA 2K4BA 2G9ZA 2WZEA 1ZX5A 1HKSA 4EM0B 1DQ1A 2VN2A 4DYRA 2PJRB 1CZTA 1G7YA 1BC8C 1RUJ1 2FDGA 4Q0QA 1UOBA 5BNPA 2JSPA 5LD2C 3LDRA 2P7VB 4IHSA 2JX9A 3F23A 3VZOA 1TNSA 4I76A 1JHFA 4G7ZF 3SEZA 1JZ4A 2J1UA 4G12A 2GP5A