4BH9A

A structural model of cap mutant (t127l and s128i) in the apo state
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
209
Chain Sequence
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVLIEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords cAMP-activated global transcriptional regulator CRP
publication title Allosteric inhibition through suppression of transient conformational states.
pubmed doi rcsb
source organism Escherichia coli
total genus 58
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2013-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bh9A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bh9A01
3I4PA 3K1NA 5JR3A 2V1XA 2D5FA 4I0BA 2WFPA 2VT2A 2R3SA 2YX4A 2OA4A 4N9HA 3QPHA 1FX7A 3ZQ7A 4F7ZA 5FB2A 1OKRA 1PMIA 3V7CA 3ST7A 3BJAA 1D8JA 3M1EA 4GO1A 3WTVC 3HQXA 2GQQA 1S3JA 4RGUA 4RGRA 4WXHA 2P17A 2AS5F 4M72A 3COAC 3RYKA 2D40A 1HQCA 1I27A 3EUHA 1IRFA 2XLAA 2B5HA 3FXRA 3JAMZ 4HF0A 1YUDA 2CO5A 1WWXA 2XIGA 1Y0UA 2OZ6A 5TRDA 3WU1B 1PDNC 1I1GA 2XAQA 1K78B 2CGPA 2KKOA 1USSA 4UXNA 2FMYA 4YRDA 4LLGF 2ZKLA 1JUHA 2JPCA 3BU7A 1QNTA 4LLOA 2E1NA 1SFNA 1FWZA 2UXXA 2Q0AA 1J3PA 2ET7A 4QLCU 3WTXC 4LLNA 3FXQA 2KIUA 1J7KA 4NB5A 1Y3TA 3CO6C 2C0ZA 3NW4A 4I02A 2IPQX 4G6DA 3QAHA 1ZN2A 4XLNF 2G7UA 2HZTA 4HVOA 1ZZ8A 4OIPF 1HW5A 4KU8A 4MHGA 1BIAA 1FNNA 5JFRA 5E16A 1YW9A 3WGHA 5JCTA 1R00A 1UIKA 2QLZA 1SAXA 4JBAA 3KLOA 2GXBA 1FOKA 4YYOA 3HT2A 3H1YA 3GUDA 1ZRCA 3GFJA 3JTGA 1P6RA 3HSRA 3REOA 3FMQA 3FJSA 4EWEA 4XBFA 2Q8KA 1UCRA 3C7JA 2MBFA 3H7YA 2M45A 1ZG5A 4EGYA 1CF7A 3V8JA 4FAGA 5I8SA 2EFPA 5BY5A 4L18B 5ED4A 2IXCA 3E97A 3UKTA 3KZZA 1GQGA 3S0MA 1O57A 2DBBA 1EY2A 1QGPA 3ZMVA 2K4JA 1ZLJA 4UV9A 4A2UA 2DI3A 2K02A 4LG0B 3LA3A 4WVZA 2Z3YA 1XN7A 5AIQA 3I7DA 4XF3A 5BQTA 1V4RA 5LGUA 3U10A 2OPKA 2HTJA 4WXCA 1QWRA 4RS8A 5JR7B 2GA1A 2DAOA 4HMZA 3SFZA 5BPIA 3H7JA 4R79A 4KDPA 1BOAA 1D3YA 3VODA 3MPBA 3NEUA 2W57A 3HT1A 2FBIA 1QY4A 2D93A 4I2OA 4MQ9F 1H9GA 3PNAA 3S7EA 2PJPA 1XMAA 2V1UA 3ECOA 4ONUA 3SHFA 3SHRA 2ZFWA 1Z6RA 3P9KA 5BPXA 1J5YA 4HSJA 2ELHA 4E2GA 1CAVA 3T1BA 3PLQA 4YIIA 2KIMA 1UB9A 1ODDA 2X4HA 2P5VA 3F72A 1EYBA 4TLFA 4GULA 3WW2A 4OIQF 3BZ6A 4FT8A 2H6CA 4YSFA 1H1MA 2F5DA 1ZG3A 2QQBA 2VOOA 1E2XA 3KP2A 3E5XA 4K2EA 5E18F 3OGJA 2XROA 5F6FA 4G8XA 2E9QA 5D6FA 1WSUA 3J81Z 4LULA 3CUOA 5F64A 4Q48A 2PAKA 4L9NA 2NNYA 4WZCA 2MC3A 2ZMEB 2LF8A 1SQ4A 2TDXA 2O03A 2NS0A 4MTEA 2GA2A 1KYZA 4WX9A 3L00A 1IZ1A 4QGLA 1XSVA 2MD5A 1U2WA 3LQQA 4EJUA 3KMHA 2FA5A 1P2FA 3ZP5A 1U5TA 1HW1A 4MTDA 3LZZA 5IT9Z 3KCCA 4O9GA 2VC1A 4MQVA 3WE2A 3H1WA 4ZU5A 1LDDA 3SCHA 1O4TA 3TNPB 3F23A 4IJAA 4Q0VA 3EBRA 2QUFA 1T39A 4HYEA 4P9UA 4I7HA 4KWJA 4LEJA 4I09A 5KVRA 3H50A 3KP4A 4LK0F 2ZNZA 2P8TA 3FMSA 1AOYA 3NQOA 1U12A 4NVPA 4XFFA 1O3TA 2ETEA 3ES4A 4JQFA 2QVOA 5I8YA 1WGPA 1BI2A 2QENA 3FZVA 2STWA 2HR3A 1HXDA 3NJZA 3BWGA 3U9GA 1F9NA 2HOEA 2CSOA 4U88A 2FOKA 4ENKA 5C6CA 5FD5A 5CVUA 2FQ3A 5LHHA 4ZH4F 2B9UA 3FHZA 2O0YA 4ORFA 2QJVA 2QVSB 3I59B 4RAYA 2Z9OA 4IXAA 2PA7A 2HYFA 2ZCWA 3SZTA 2D1HA 2ZBKA 1IN5A 1DP7P 3JTHA 3RIRA 1IN8A 4XF1A 5K8SA 3ZN1A 2L3DA 3T0YA 3ZPLA 4KT5C 5ILVA 4CHUA 1O3QA 1RUNA 5D6EA 3F6VA 1FP1D 3ISPA 1Q5OA 4QM9A 3J81K 5DCMA 1J9IA 2UYAA 4EWAA 4MEYF 1ZX5A 3MYXA 1HW2A 4RGSA 2OZUA 1XSDA 2QYOA 1V70A 1G6NA 1KU9A 3E6CC 1WKMA 2YU3A 4PZJA 5FLHA 2GC3A 5E8IA 5E1XA 5L3BA 3G73A 4Q0UA 4IHTA 2UYBA 2F2EA 3KEQA 2EVXA 5CVRA 4UNOA 2ZNYA 3I53A 5FDBA 2CW0F 3EDPA 4L5JA 2P6TA 3VFZA 3TOBA 2DCTA 4UHTA 2WTEA 2EAAA 3WW1A 2XHKA 1D5VA 1J3QA 3ULQB 1FI2A 2KXLA 4A6EA 5CVJA 4X6QB 3SCGA 3BOQA 4XRFA 1IPKA 1B59A 4P96A 1R1VA 1QO0D 2EJRA 4MZUA 2PAEA 2VBZA 5AONA 3N97A 1ZAOA 5I0SA 1YO5C 3LOIA 4XSXF 1R5GA 1YLLA 2N7GA 3ROUA 5D4RA 2DU9A 4KMUX 5H6QA 1LEAA 2L4MA 2D5HA 5FFXA 1BIBA 3FE5A 3GZ6A 1UHWA 4HX4A 5D5XB 2H27A 4XFBA 4AVCA 5DCFA 4BH9A 1S8NA 4FHTA 1XGNA 2O1QA 4OU0A 1LDJA 3I5UA 2GIVA 3NKTA 4PIXA 1LQ1A 1ZVFA 4MGIE 1YS6A 2MH2A 3IKVA 3KP5A 4A0ZA 3M3IA 3RDIA 5BXXA 3BPXA 4KFCA 3J80K 3RYRA 2VT3A 4Q0QA 1TTYA 3FHIB 4KN4X 5E1WA 5CJ9A 3EETA 2ADUA 4M9XA 5HOOA 4LUMA 2L4AA 5KHGA 1KQ9A 1FXZA 4QGMA 4MGRA 3R61A 1KA8A 3DEUA 3AAFA 3RKXA 4FX0A 3QU6A 5I0RA 4A0YA 4QXKA 1B9MA 2LF7A 1BBYA 3RPQA 5ICGA 1S6LA 1SD5A 4BQAA 4E70A 1QXRA 4WBBA 3O6BB 4Q47A 4LD5A 1I5ZA 3DP7A 2EFNA 3IDCB 1X8MA 3RPUA 4XFGA 4BXUA 3H8UA 1F1ZA 3D5LA 2VBXA 2O8QA 1TQPA 4S05A 1O7FA 1IAWA 2XAJA 2EWNA 1ONVA 2VOPA 4IEXA 2JPBA 5LRSA 3RJPA 3FXUA 4CDGA 1YIOA 3EYIA 1CAXB 2O61A 3V7SA 2FF4A 3E5QA 3W6JB 3J7AO 4HBLA 2M87A 1RIOH 1IXSB 2GC2A 3QP5A 4KICA 1IRGA 3L7WA 5HLHA 3QU3A 2OA2A 5CU1A 5BS6A 1GHCA 2PLYA 1X3UA 4Q5SF 2P5LC 2ZXJA 2CAUA 1Z91A 4WWCA 2VBWA 3JSOA 2YR2A 3OF1A 2O3FA 5KHIA 4YG2F 3C18A 1WI9A 1CAUB 1Y9QA 4Z82A 3R6SA 1BM9A 1SD6A 4M71A 5J7MA 1GVJA 2A6HF 1YLFA 4P55A 2JSCA 4M73A 3D0SA 2DQLA 4KN7X 1PM7A 3K2ZA 2B8MA 3BCWA 1IN4A 2PQQA 1BC8C 4UVAA 3Q9SA 3M70A 4IEVA 5L3DA 5D8LB 3ES1A 3NL1A 1O3SA 4M6XA 2FE3A 5I8TA 4JTOA 3WTZA 3EO6A 2EV0A 1CAWA 2E1CA 4YARA 4D7TA 2EK5A 4LGWA 3DN7A 2Z5UA 1XMKA 3WODF 5I0UA 4JK1X 2PI0A 2PMHA 4MGKE 3HTSB 1FP2A 4LUKA 1AWCA 1KGSA 1S29A 1ZRFA 1YYVA 4OMZA 3P7NA 4EJWA 1CX4A 1Q3EA 4JVAA 2KIFA 3H3ZA 1REPC 1FPQA 4AD9A 2A61A 3CDHA 4CICA 3I58A 4GCVA 4IEYA 5FQ0A 3FWEA 3TDZC 5LRRA 2CYYA 4L5IA 4IERA 4U0VA 3E6DA 2V1DA 4M74A 2O6GE 2IJLA 5E8GA 2Q30A 3IRRA 1IXRC 4I01A 4LFUA 4QMAA 2PHLA 1OR7A 3LA7A 3BP8A 5T3NA 1XB4A 1PP8F 4AVAA 4R1HA 1NE4A 4PDKA 4Y15A 1OYIA 2EB7A 1T6SA 2Y75A 4HX8A 2VE9A 4R8HA 5I0TA 2FNPA 2RQPA 1BN5A 2G7HA 2A07F 1RGSA 3CO2A 4N9IA 4OLLA 1WA4A 2DQRA 3M8FA 4TV7A 4UVCA 4Y13A 1DZRA 3D82A 3TKYA 1K78A 2XGXA 5ICFA 5DDGA 2DPDA 3L2HA 3CL1A 2XASA 1YFUA 1RZ4A 5ILUA 4KU7A 3C1DA 1KU2A 1SD7A 2F5FA 4I98B 3RZZA 2OAZA 2D2WA 2RGVA 1W7PD 3ECHA 4XF0A 2L01A 4IPAA 3WW4A 3CUQB 1UFMA 3TO9A 2V09A 2FQPA 3IIAA 5TJJA 2ET1A 1XRUA 3JAMK 1MDMB 5JI6A 1HSJA 3HOSA 3PQJA 4O5VA 2DLLA 5BOXA 1XGOA 4G7HF 3BY6A 2UWMA 3U11A 3WTUC 3WTTC 2QCSB 2I45A 2PAMA 1B4AA 1B6AA 1FLIA 5HDKA 5FPXA 4IEOA 1QBJA 3GXOA 4ZZLA 3GFIA 4ZYHA 1FY7A 5DV5A 4MGYE 2LKPA 1UD1A 3KLNA 4DINB 5LBQA 3SZPA 2WC2A 3S7IA 2XUBA 1EP0A 4XFCA 3EJKA 4E2SA 3DXJF 4WK8F 1OYWA 2NRAC 4CO8A 2MLKA 2Q1ZB 3RKYA 4EM0B 2M1BA 1QQIA 2PN6A 2VBYA 1S7OA 5AIPA 1WLTA 2BBYA 1GQHA 4L9VA 3CUQA 5LLQA 4KA4A 2QBYB 1U8RA 1LRHA 5HS8A 5JSOA 4LG0A 2HS5A 2ATFA 3GYHX 5ICCA 2GAUA 3T8TA 2VQAA 4MH0E 1WRJA 3VOEA 5LGNA 5KBFA 1W7PB 4MV2A 4LB5A 4CZZA 4AVPA 2C6YA 5ICEA 4OFGA 3TOAA 1ZREA 2CQKA 1FSHA 3LFKA 1IN6A 4A0XA 2A3SA 4PGGA 4I3PA 4HQEA 1J2XA 3HHHA 5H6RA 1TQMA 2V9VA 3HSEA 3O3KA 4WXDA 1MJAA 2NNNA 4NHJA 2W84A 4LK1F 3HRTA 4OIRF 2IXLA 1XE7A 2BNNA 1RTVA 5D1IA 4U0WA 2OZJA 2JTVA 1EH8A 2K27A 3BROA 3TQNA 1H0MA 2H6BA 3RI4A 3EQEA 3LWCA 1DGWA 3C3WA 2UY9A 4IEUA 3JZVA 4HQMA 1ZYRF 2NAZA 2PHDA 2M30A 2LSOA 4F8AA 2JZYA 2QBYA 5E1RA 1TQIA 2R7DA 4LJZF 4U0YA 3SMHA 5DUKA 1BI3A 4MNUA 1FYLA 1I6XA 3R0JA 1STZA 5BMZA 2ESHA 3NVCA 5L3FA 4XFIA 4O9EA 3LAGA 4ESBA 2Q0OA 4IRGA 1PP7U 2PTMA 2FEZA 5D5UB 3LSTA 5A2QZ 3TDUC 3KP6A 1JHHA 3GO5A 5CLSA 4MX3A 1XGSA 1BI1A 3SCFA 3WU0A 1ZG1A 4CXFA 5HS7A 4B29A 2ZMEA 5JVTA 3L9FA 5EZWA 3CTAA 3IC7A 3M7GA 4HV5A 5DUIA 3OD0A 1MGTA 3M9AA 1FZPB 5F1RA 1RL3A 3F22A 1JHFA 1W5TA 3P9IA 1EH6A 2CG4A 1VP6A 5CVIA 2D1VA 2LDUA 3LQRA 3QPTA 2JRTA 2PYTA 3LWFA 3FMRA 4J1XA 2Z2SB 3LA2A 2B0LA 3PFIA 2QZ8A 1I1SA 2VXZA 2PFWA 3KGLA 4MEXF 1LDKB 2ZJ2A 1LEBA 2GXGA 3HYIA 3V8LA 1B1BA 4AQ6A 1NZCA 2UY8A 3V4GA 3N4MA 2PFBA 4P5OA 2NYXA 2QWWA 2A69F 2E7WA 2UXNA 4MUVA 2Q2EA 2HKXA 3GBFA 1RNLA 5BUVA 1IUYA 3ERED 1ZGAA 1DPUA 4UV8A 4LA3A 5IT9K 2XL7A 4FBFA 1YFWA 2HTSA 3F6OA 1ZZBA 2YX7A 1H1IA 1FSEA 3SXWA 2IXKA 4AIKA 3IKTA 3ZMUA 3HUGA 1TW3A 4BHPA 5EEGA 1KU7A 6PAXA 3ZMZA 3I59A 3QP6A 4ENMA 2DTRA 4L0YB 3GWZA 1YFHA 2BV6A 1UPIA 4GXOA 2F5CA 1P4AA 2IRFG 3IL2A 4D0PA 4HBNA 1RUOA 4AXOA 1EV7A 5I93A 3WG9A 5E1ZB 1G4DA 1DPRA 3BPVA 3E3VA 3NRVA 3U0ZA 3G3ZA 1G3WA 4EM1A 1U5TC 3DV8A 1XCVA 5FPZA 3K69A 1QZYA 1K7AA 4KWLA 2DPUA 2P4WA 2Y0MA 3E5UA 1GXQA 2X0LA 1MZBA 2RC4A 1NHAA 3KZYA 3HHGA 4PCQA 3CO7C 1IW7F 2H0VA 2FXAA 3BB6A 3JW4A 1J58A 4UXAA 1LJ9A 3E6MA 2K7LA 5JSPA 1TW2A 2XV4S 1TQ5A 3WTYC 5K1YA 1YFYA 1ZZ9A 5HDNA 2KJBA 1ON1A 3CF6E 1F5TA 2STTA 2HYGD 2IA2A 3CJNA 1QZZA 3LAJA 1IF1A 4Z07A 4XLPF 4KMFA 4NQWA 5I91A 3ZN0A 3IWFA 4S04A 5L3EA 4KUMA 1O3RA 4ZYDA 3GX4X 5HVQC 1DUXC 3EHKA 1FBQA 5FCCA 1K79A 2F5EA 3B02A 3MDPA 1SEFA 2DK8A 4U7DA 1YHFA 3GW2A 2GZWA 3EYYA 3SQNA 3M8EA 3MQ0A 3DF8A 1ZZ7A 2OQGA 4RB0A 4XFHA 5E20A 1RC6A 3FFQA 4H7LA 2QQ9A 4Q0SA 1QPMA 2XAFA 3QOPA 3I54A 4GYIA 2Z33A 1Z1DA 1U6GA 5EEHA 2CV6A 3K9TA 4IVNA 2BYVE 2VODA 4AIJA 1ZLKA 4JTNA 1FBUA 3KFWX 2M5WA 1A04A 3ML6A 3HSFA 1Q1HA 1U3EM 4ZU4A 4ZYEA 1SFEA 2GC1A 4JV4A 1R36A 4WCGA 2FU4A 3ELNA 3ABTA 4GYGA 4Q0PA 1USTA 4IF4A 3P9CA 2EA4A 4L9TA 5LHIA 2FNAA 4GGGA 3MFKA 1R23A 2MLGA 1W5SA 3F3XA 1SMYF 2RN7A 1O7LA 4IEWA 3I71A 1R5HA 2P7CB 3UKNA 2FBKA 3CJXA 2EA2A 1YW7A 1O5LA 5EFUA 4HDUA 4HVQA 2CAVA 2ZKZA 4UBGA 2VN2A 4ESFA 4L2NA 4HSLA 1CAXA 2Z69A 2CWEA 2ZO4A 4AIHA 5E17F 2EFQA 1VTNC 3T5XA 4E2QA 3MWMA 2XLFA 2M8EA 3MZYA 4O3MA 2GH2A 1OPCA 1HBXG 3H92A 2G9WA 1R1UA 3MCZA 4KIBA 2H94A 3GVAA 1J1LA 2IA1A 4P9FA 2HJIA 1X8EA 5LHGA 1J3RA 3L2CA 1OFNA 1LB2A 2HKOA 4IEQA 2QQAA 1CAUA 2FMLA 2Y0OA 1P92A 2V6CA 4O6JA 3KP3A 1YG2A 1F4KA 4XSZF 4ETSA 1YWKA 1CF7B 3L09A 4IRHA 1R7JA 3PVBB 4XETA 3FF5A 5L3CA 1XE8A 1HKQA 3GFLA 4HV6A 4L9JA 1XSXA 1OI6A 5J6XA 3W6KB 2K0GA 1P4WA 1K6OA 5FLXZ 3HRSA 3VEPA 1B9NA 2IXIA 2ACJA 2VONA 4HLYA 2PMUA 1KYWA 4YFXF 1KU3A 3WTWC 2K86A 3ACLA 4KIFA 4QWQA 1FT9A 1FBSA 3WW3A 4M9ZA 2K9ZA 2OQRA 3KSCA 1DDNA 2IC1A 4HZFA 4OINF 3U2RA 3O14A 1SD4A 1ULYA 2YSRA 2BEOA 3USSA 4LB6B 1L3LA 3F8BA 2A68F 3MAJA 1CGPA 1YW8A 4OMYA 2O8XA 3IRQA 2W85A 2WWYA 3WTSC 2COMA 2EFWA 3B73A 4KIGA 3I64A 2P6SA 3TNQA 2P5KA 3K1PA 4RAZA 4LLLA 5FO5A 5AVPA 4J1WA 4YFNF 2D45A 4DNCA 5KHKA 3F8NA 4YNIA 2BNOA 3H1MA 1CAVB 1Z7UA 2Z99A 1BC7C 1QXJA 2ESNA 2EV6A 1R22A 4M6YA 2VPVA 2W25A 3OV8A 5FD6A 4QX5A 4HDVA 4G94A 2IW5A 3E6BA 3GF2A 3JSPA 4ENJA 3BPZA 2MH9A 2ETHA 4LA2A 2EFOA 3RTRA 3U1DA 2DW4A 3GYDA 2Y48A 3CEWA 3BJOA 1IXCA 2HQNA 5CYVA 2VE8A 4CYDA 4FX4A 1KQ0A 1UCXA 3DFGA 1IN7A 1LKNA 3GZ5A 2YPRA 1C0WA 5D8KB 4BHCA 4UVBA 5J48A 3MZHA 3ELKA 2A5YB 2PEXA 2VC0A 3HRMA 4ENNA 5FLXK 5CVVA 1MJ9A 3GFMA 3H3UA 2P7VB 3TO6A 1VR3A 1T0FA 2BE5F 3DKWA 1ZZ6A 2IXHA 1FYKA 5HLGA 4EJVA 3KGZA 4XFAA 3FM3A 1X82A 2RDPA 4HOBA 3HOTA 4ZU7A 4G7ZF 1U5TB 3O2PE 1MDMA 4KYWA 3F8FA 5DEQA 3T8RA 5FLJA 3BJ6A 2DFIA 1OD5A 1O5UA 1R58A 4WF2A 4ZZDA 1J0RA 1JE8A 3R4KA 5D4SA 5HDGA 2F4PA 1XDSA 3TO7A 3ABUA 4DQ2A 5K5QA 1ZARA 2KRFA 2ISYA 1SFXA 1XD7A 4XEZA 3QACA 5FGMA 4HF1A 4KNYA 4RB1A 1ZGJA 2EA7A 4HVRA 2H09A 2CFXA 4IESA 3CLOA 2BNMA 3FZ3A 5CADA 3I0TA 2MA3A 2MPFA 1UIJA 2XKOA 1EH7A 1UHMA 5IT3A 1ZRDA 4BYYA 2GC0A 5C8WA 3ETQA 2OD5A 5L3GA 2QM3A 4XF4A 3HTUA 2UZKA 2OYZA 3ZDSA 5K5OA 3RNSA 5LEJA 3OTFA 3KP7A 4EJTA 2Q4SA 4KL1A 2DO7A 3RYPA 1DGRA 4Q29A 3K1MA 4ZYGA 4L11A 5BPDA 1G3TA 1NYWA 3DPTA 2RV8A 3IBMA 3HRUA 4AWXB 4IEPA 2OU2A 1G3YA 3F21A 5DCMB 1W4MA 1HKTA 4AVBA 1W7PA 4Y17A 4IRIA 5JSRA 2FSWA 3S2WA 1LR5A 4ON0A 3H9AA 1Z9CA 5ERIA 1G3SA 3C3VA 1MKMA 1Q43A 2RKHA 3RKWA 5LGTA 1J75A 1SFUA 4EM2A 1TLHB 2HGCA 4EQQA 3WGIA 3ZMSA 2XAHA 4LMYA 4RB2C 3LAPA 4KWKA 1T98A 1TNTA 3G7DA 5JHUA 1LVAA 3Q9VA 4X6RB 2HQRA 4HX7A 3OOPA 2QNKA 3J80Z 3R60A 3DQVC 1RI7A 4RB3C 2LNBA 1PUEE 1H9TA 2HDCA 4HA8A 4Z2YA 1JXSA 2XRNA 1YFXA 1BI0A 2GU9A 1S7AA 4D7SA 2VECA 1ZZCA 2FRHA 3IWZA 2FBHA 2IA0A 4BHBA 2PQ8A 5HLIA 3CUQC 5DYMA 2IVMA 1TBXA 5D5VB 1VJ2A 3EQLF 3DPLC 4B8XA 1YS7A 4G6QA 2J5OA 3TGNA 4R52A 4ASNA 2QDRA 1EPZA 4OOIA 1UW8A 5FFZA 4IHSA 4P9GA 4A5NA 3KEOA 1P4XA 1ZHFA 1BJAA 2A6EF 4PIZA 5DD8A 3WE3A 1IPJA 3BDDA 3FX3A 5H20A 5BV6A 2PG4A 1ZRRA 1MD0A 4M9SA 1R1TA 1WQ2A 3V8KA 5KHHA 4EJOA 3CLPA 1Z05A 2L54A 1NXMA 1X7NA 4BAYA 1L0OC 5A2QK 1GXPA 3DL3A 3HIFA 1ZNPA 1L3JA 1HKSA 1YTYA 2MNGA 3IDBB 5J3UA 2PBIA 4I0AA 2J5PA 4G9YA 3SXYA 4A12A 2HEOA 5D5WB 1FC3A 4AQ2A 1TNSA 4XF9A 3R0AA 4META 1U78A 4YIFA 3K0LA 4IEZA 4OIOF 4PJYA 4N0BA 3QRFF 2KJCA 1MJBA 2OBPA 5FLIA 1XDUA 4FAHA 4K8FA 4YFKF 2XVCA 3IHUA 5LEKA 4UBHA 2RNJA 2IT0A 3NSTA 3VB2A 2IP2A 4RGXA 3WGGA 5KK1A 4HLTA 4HN1A 4RD7A 4EMSA 2AXLA 1SMTA 4HW0A 5KHJA 4HAMA 1XGMA 1HSTA 3V7RA 5JAXA 1D8KA 1T2KA 4QGNA 4IETA 4G7OF 3F8CA 3KE2A 4A5MA 4U7BA 4PGHA 4HN0A 4MGZE 1V3FA 4QM8A 1Z6TA 5J8FA 2HFHA 4EWDA 2ISZA 1ON2A 2L02A 2DK5A 2E7XA 4EV0A 3D0JA 3GEZA 1JGSA 4EGZA 4HF2A 4H0EA 2BGCA 1T38A 4EROA 4BNCA 3GLXA 2RVCA 4LTAA 3PQKA 5ILSA 1E17A 1ZH5A 2XAGA 1DZTA 2R7FA 3ZMDA 1CAWB 1LNWA 2XLGA 1KQ8A 4B09A 3VHRA 2JT1A 3KETA 2MHFA 5J8CA 4Q4ZF 1J59A 4UUVA 2DT5A 4CGZA 3OCPA 2V79A 2XL9A 3FM5A 3F8MA 1YQAA 1FYMA 4EVIA 4PIYA 5HI0A 3Q5FA 3UKVA 1OMIA 4HLXA 2XKPA 1XCBA 2GWRA 2K4BA 2W24A 2HWVA 3MEXA 4ESJA 3BALA 1NE6A 4L0ZB 5FQ0B 1OYYA 3ZMTA 4BIFA 2EV5A 4A6DA 5HS9A 2WV0A 5K5RA 2IXJA 5DD4A
chains in the Genus database with same CATH superfamily
5DQ0A 3CCLI 2IS2A 4AFBA 4I0BA 2WB1N 3O12A 1DQ1A 1W6OA 4N9HA 2KD7A 3O0VA 3QPHA 1FX7A 4AGVA 4F7ZA 5FB2A 2VBDA 4BXSV 1BZWA 5IWFA 1PMIA 3ST7A 2K40A 2ZX4A 3BJAA 2M9HA 5CISA 4GO1A 3HQXA 2VULA 1QQP2 1TVGA 4LBKA 3ZR5A 2WZEA 1RXFA 2P17A 1MH4A 1ZGWA 4QB6A 2ECCA 3RYKA 2D7FA 1HQCA 3AG2H 1DLCA 3BODA 3FXRA 1N77A 1WFXA 1MMNA 2CO5A 1WWXA 2XIGA 3BG6A 2ID4A 3HL2A 2DA7A 4HONA 1OCRH 2G4IA 2OZ6A 1VALA 1K78B 2W82A 5JR2A 1USSA 2DTZA 4ZPIA 4LLGF 2M0MA 2ZKLA 2D6OX 4V2WA 5FYCA 1QNTA 4BJ5C 1SFNA 1FWZA 2Q0AA 1PO13 2J1RA 5A7OA 1X50A 2C6SA 3OL4A 2VOXA 3FXQA 4JDNA 4BDVB 4CP2A 3VD7A 4I02A 3BLYA 3HJEA 3QAHA 3UL2A 2VJIA 2HZTA 1ZZ8A 5FIXA 3VBHA 3ZYFA 2H8RA 4ZDOA 3VLBB 1BIAA 3WGHA 3CHXA 1X1CA 4AQSA 1D5YA 1WBLA 1SAXA 3KLOA 2GXBA 5J1UA 2CU5A 4DZPA 4KGGA 3GM8A 4S2FA 1P6RA 3HSRA 3REOA 1UJ8A 3JQXA 4XBFA 3BZCA 3H0GJ 4IE5A 4B4RA 1UCRA 4GMP0 3C7JA 4XUTA 1VBC3 2MBFA 5JZGA 2M45A 4Y3OA 3S30A 2ICWG 1LECA 2ECBA 3RQ0A 3S0MA 4Q4Y3 3O8GA 1HXS3 1EY2A 1QGPA 4AEJA 2WZ8A 2K02A 3LKJA 1FMVA 3LA3A 1UELB 5AIQA 4AF9A 1Z7S3 2X10A 5IPAA 1K5MC 4NHMA 5T5JA 5LA2A 4WXCA 4QB2A 3K4MA 2L9RA 2A71A 4CPBA 3TL4X 1ZA7A 3AKRA 3BIWE 4R79A 3ZYRA 4AEDB 2ZGOA 3C2BA 2DU0A 5FZOA 2M4GA 5KR7A 3LFUA 1AJKA 3MPBA 1SFKA 3NEUA 2I2SA 2FBIA 3LOCA 4GFBA 4UW6A 3KF5A 1I6HJ 1GZCA 5FYSA 3S7EA 5GTHC 4P00B 2R5YA 2AZ5A 2LH9A 5F2SA 5AC92 3VL8A 2JDZA 3NJXA 4ZS3A 5BPXA 2ZJPF 4HSJA 3ZMNA 4M3CA 1RMU1 1A8MA 1CAVA 4H7MA 2KIMA 1O4YA 3OS0A 1UB9A 2YC4A 3MW2A 2R0HA 3DEEA 3G1LA 2X4HA 1G8WA 1EYBA 2M8GX 4X8PA 4FT8A 2W94A 5JPMB 4YSFA 2FD8A 5J37A 1PO22 1H1MA 4QWNA 3KP2A 2M4KA 2ZGTA 5E18F 3OGJA 5FUIA 2XROA 5DXDA 2XWBB 5F64A 3SDBA 2MC3A 3MIDA 3PNVA 3RMYA 2LF8A 5LCWL 4COYA 2RS33 1QJY1 4Q5OA 4MTEA 4NIGA 3VBSC 1V0AA 4WX9A 1YXWA 1JZ4A 4MVTA 4QGLA 1Q8PA 4K9SA 2CQNA 3LQQA 4EJUA 1DZQA 3O1RA 3SEEA 3KMHA 3KYCB 1P2FA 3U07A 3ZP5A 1U5TA 2ZGMA 5IK7A 3LZZA 2JG8A 1BBT3 1FTTA 1LDDA 3HDDA 1KD7A 4IJAA 5EQUA 3SH4A 2QUFA 5LBCA 3RZGA 4KWJA 2P1BA 4LEJA 1XC5A 5KVRA 1Y8QB 2JVGA 3H36A 4NMIA 1S0DA 1DBNA 4XFFA 4G12A 4E7JA 1IGOA 2O0OA 4JQFA 3PJYA 2QENA 3FZVA 2STWA 3VBOC 1BK1A 2HR3A 3BTJA 2HWF3 1GP5A 3WF1A 2YFUA 3AYEA 3NJZA 2R7QA 3NRUA 3KEYA 5CVUA 1UY4A 1YX5A 3FHZA 1CJDA 2XUEA 3MKZA 1D0YA 2OTJI 1UF2C 4B3AA 5A3WA 3I59B 4RAYA 2HYFA 2ZCWA 2HI3A 3PO3J 4OULA 4DS0A 1B72A 1I5PA 3PIGA 2CDOA 4XQWA 4WM7C 2YPDA 3HD8B 2WABA 5K8SA 5BNOB 4E7SA 4KT5C 2LOOA 5ILVA 4XRMA 2CHHA 3ZQIA 4CHUA 3FFZA 4XUNA 3J81K 3OG2A 1K4TA 1J9IA 3AZZA 4HG6B 1KU9A 1S2KA 2R5ZB 4PZJA 5FLHA 5E8IA 3G73A 2BERA 2VLAA 4D6RA 3S57A 2VZUA 4YVWA 3EDPA 3WP3A 4LBQA 2VCMA 2DCTA 5CBLA 1ZBA2 4O61A 2WTEA 1GZTA 3ULQB 1FI2A 2JDUA 4X6QB 3CCSI 5FP7A 4LLFA 1R1VA 3DTKA 3KLSA 5JMOA 3S5QA 2LC2A 3M7AA 4OCTA 3N97A 1VRH2 4QU1A 2D6LX 4CEYA 1MS5A 1KS5A 3ROUA 4AZZA 1HF0A 1BXHA 4LXLA 3LDBA 2E1MC 3ZYGA 4A3FJ 5FYMA 2WYFA 2RVAA 3GZTB 4Y1YA 4HX4A 3HNYM 4XABA 3I2GA 2VQGA 4EEFG 2WS91 3SQOA 5EG0A 4FP2A 3H9GA 3VBFA 1PGL2 2FDGA 4PIXA 5GZCA 5A7WA 1LQ1A 1JUPA 1W2UA 1YS6A 1MR5A 3IKVA 3KP5A 1FOD1 4WVMA 5C4XJ 5FXZA 1DGRN 3RDIA 4JQTA 4KFCA 2VZOA 3ABMH 4Q0QA 3WDWA 1TTYA 3JCUC 5C4WA 4KN4X 5CJ9A 1YC61 5HOOA 4LUMA 2XC7A 1WZ2A 3I2IA 5LK5A 3R61A 1W6NA 5F6LB 3T2PA 2WADA 4QPIC 5E3OA 4IW3A 1H4HA 2HQ5A 1BBYA 1V6OA 1S6LA 1SD5A 2XAUA 5FJKA 4LD5A 4RBOA 2HEYF 4ZONA 2EFNA 3OYAA 4NC8A 3IDCB 1L7RA 2BFUL 3CZJA 2HOSA 3ORJA 4V2GA 1SZBA 2R7VA 1IAWA 3IDAA 4B47A 1W8ZA 1ZBE3 4ISRA 4P9WA 5E79C 5E3NA 3BTZA 4Y20A 4HKLA 4JGYA 4MFEA 2VJ5A 5FFOC 3KCYA 3W6JB 1PZ9A 4X1EA 3I4MJ 4GH4C 4HBLA 2XWJB 2HWE1 4XLFA 4F55A 5EIYB 1IXSB 1U5XA 3UETA 3QP5A 4KICA 5DDJ3 5BS6A 1JZ3A 4B44A 4Q5SF 4W6XA 2LG4A 4COUA 1POQA 1V6IA 4AI3A 5CFDB 1G7YA 2QQVA 2OJED 3MKYB 2BQPA 1CAUB 3C7OA 4Z82A 4RR3B 5ABJB 3AG1H 5F1JA 1VBC1 2WIIB 3TAYA 1GVJA 3H42B 4FOYA 3L2QA 4DZJA 1YLFA 3NNGA 2HDDA 3K2ZA 3UJOA 3BCWA 1PIV3 2VB6A 1BC8C 5F5AA 5DZGA 4Q4Y1 3DXUA 1O3SA 4M6XA 1K6YA 4XQDA 4BQ1A 1DP3A 3GJBA 4Z6YA 2QQ8A 1LEDA 4YARA 3AZWA 4EN7B 3DN7A 1H8TA 1Z7S1 3IMNA 3WODF 3LD8A 2FCUA 4JK1X 4XQ4A 1US2A 2RS13 4MGKE 4LUKA 1K42A 5F0CA 4UFHA 5CAZA 1RUF3 2O14A 3KIOA 4JVAA 3I4NJ 1REPC 2A61A 5CQEA 3O5SA 3GTLJ 1AZDA 5LASA 5FQ0A 3FWEA 4CDXA 5LRRA 3HPNA 4U0VA 4LHNA 1RUE3 1WLWA 2J1VA 4PSXA 4Q4X1 3KQ4B 5E8GA 3K10A 4C1XA 3IRRA 1Z0HA 1Z77A 1IXRC 3WT3A 1OR7A 5DUWA 1POGA 3IZOA 3LA7A 1IJWC 1PP8F 3HC7A 1MZFA 1WKYA 3NNJA 4QPWA 4PDKA 4NIIA 3LIHA 2EB7A 4XORA 5FZ6A 1YQ5A 2Y75A 4R8HA 1YEWA 2RQPA 4E7ZA 2DVDA 2JA8J 2PJRB 2G7HA 1X2MA 2LM3A 2ZBJA 3HOYJ 3ZPOA 1PK6C 4FTSA 2DQRA 3D82A 1K78A 5ICFA 4UI9L 4UUSA 1HCRA 2YMZA 4X0GA 3AZYA 2R49A 2F5FA 4I98B 1ZRIA 5FYHA 3RZZA 3THPA 2OAZA 3KZIC 3JBG3 1ETWA 2D2WA 1GZWB 3ECHA 4XF0A 2L01A 4IPAA 3A0HC 1OCTC 3CUQB 3PNTA 1WCSA 1P7JA 3TO9A 9ANTA 1MDMB 1XRUA 4FOVA 3HOSA 3PQJA 2R7EB 2CV1A 5T5OA 1W0TA 4H55A 4BQWA 4FPGA 2HEVF 4AI2A 5HV0A 2I45A 5SV5A 2PHWA 4HKOA 1CX1A 1V9U2 5BNNC 4GDFA 5HDKA 1ERDA 5A1AA 5IK8A 3AVRA 4AGGA 2I10A 5DV5A 4OUSA 3E7LA 5LBQA 2XB5A 2WC2A 2HWF1 4OI0A 4DFSA 1UY3A 2MLKA 1S2EA 2HYKA 3ABKH 5FPLA 3DPRB 2DDUA 5FZ4A 1Y56A 1KGYA 1EF4A 3HBLA 2BBYA 1ZKGA 1VBA3 4KA4A 2CV0A 2QBYB 1W9YA 1LRHA 1DLLA 3V0BB 4ZC3A 3DKQA 3SYTA 1HOMA 2GAUA 1XS9A 4LR4A 1WRJA 3VOEA 1NOVA 1V54H 3GCWA 3GNEA 4AVPA 2C6YA 4OHYA 3TOAA 2CQKA 1FSHA 4A0XA 1AL21 4AEDA 4K1ZA 1RUD3 4LG3A 3ZFGB 5IFPA 4I3PA 4LOTA 4D5FA 1I39A 3OBRA 4WXDA 5FR3A 3IMMA 1MJAA 2NNNA 2B45X 3GTOJ 5JLXA 3HRTA 4OIRF 3SC7X 1MEC1 4EYUA 5D1IA 4BACA 2WZPP 4XL9A 3BROA 5H9PA 4DBQA 4Q4V1 5GZFA 2H6BA 3EQEA 3OYWB 1DGWA 3I2HA 2UY9A 3JZVA 3KT4A 1WD4A 3OUIA 3I2OA 2PHRA 2ME6A 2NAZA 2VC9A 3M3QA 2DJNA 3N05A 3J4UH 2WAOA 1YOVB 3MLJA 3SH3A 4ZTJA 3SMHA 1TT5B 2R1BA 2CY6A 2WYSA 5BMZA 5L3FA 1AR62 4O9EA 5L9VA 5L7OB 4L99A 3VD5A 5D5UB 3LSTA 5A2QZ 3WF2A 3KP6A 1QJX2 4MX3A 1K12A 1BI1A 4CXFA 2G0EA 1WBFA 5JVTA 3VYRB 5FO7B 1JU4A 4LE4A 4AYBA 5EZWA 3CCEI 3IC7A 4QHOA 1EUTA 1XPXA 4HV5A 2LROA 4Q2FA 4MYEA 3M9AA 4AHWA 2JSPA 1NCQC 4E9KA 1HDDC 3DYPA 2A1XA 2WNUC 4N7UA 1AYM2 2WA0A 2J22A 1W8TA 2VCAA 2KP6A 3OY8B 4JGZB 5LATA 2EIMH 2JRTA 4R9AA 4R4XA 4AFDA 2VJXA 4A3BJ 1DU3D 2D98A 3H8XA 4J1XA 2Z2SB 3LA2A 4XNFA 4LBJA 5FXXA 2YDEA 1LDKB 2ZJ2A 1GBGA 2PELA 2VG9A 3KVAA 1B1BA 5AC93 1VBE2 4NDLA 3WSOA 2PFBA 4N90A 3F95A 2QCOA 2E7WA 1PMJX 2UXNA 1MMSA 1D4VB 2FZ1A 1RNLA 3K4AA 5BUVA 1IUYA 3ERED 2PLV2 1DQ0A 4LA3A 5F0FA 2FDIA 1UMIA 2PN5A 5EYYA 2XL7A 1C8M2 1YFWA 3TOJA 3CJQB 2YX7A 1FSEA 2GMPA 3ZMUA 4GMP3 1TW3A 4BHPA 4DBRA 3BR2A 1K61A 6PAXA 3I59A 2WB1A 5DDJ1 4NNJA 4U36A 4DB5A 4PBOA 1REFA 2IRFG 2IUWA 4LBOA 4NROA 4D9JA 5IUQA 5BNOA 4OI4A 4CDUC 3BC8A 2XPVA 5KAIC 1UYZA 5B1BH 1G4DA 3E3VA 2E31A 3ZLIA 4G9SB 2VR4A 4AWDA 4ZKTB 1NA1C 2R5ZA 3LIGA 1CPNA 5HNHA 2LRPA 3D5SC 3NWSA 3NARA 1PIV1 3A23A 5ANNA 4IHXA 2Y0MA 5E3MA 5F08A 4RS5B 3KZYA 5F3CA 1EA3A 1RRJA 3HOUJ 1V6NA 3H5NA 5IT6A 1IV8A 1LJ9A 1UO9A 2EZHA 1RITA 5JHFA 1TQ5A 5K1YA 5HDNA 2KJBA 2PHFA 5B2GB 4GWMA 1ORKA 2LD5A 1K3IA 5LY2A 1RUG1 4BM8A 2K5CA 4A3XA 3LAJA 4M6VA 5GAHJ 4XLPF 4KMFA 1DYPA 1K5JA 5I91A 3CESA 3CD6I 5IW0A 3A01A 1MBEA 2HOTA 1A3KA 1RUE1 1K79A 3B02A 2R7TA 5FYIA 1Y8RB 2VMIA 4A3ZA 5FKOA 3FISA 2DK8A 1SEFA 4C3JJ 2BY1A 2Y30A 3JRGA 4RB0A 1AR91 2BVMA 4E6KG 1RC6A 3ZXJA 2QQ9A 4B1RA 3K4NA 2XPJA 4GWJA 3ACFA 3I54A 4D7YA 1Z1DA 5EEHA 2CV6A 3K9TA 1F15A 3X2QH 2BYVE 1AKHB 5J1RA 2D6PA 3F0CA 3SISA 1Q1HA 4JV4A 4LHKA 1WMEA 1T6GC 2FU4A 2C26A 4II3A 1FEXA 3M07A 1S0JA 2A6WA 4GYGA 4ZYAA 2EA4A 4L9TA 2VQCA 2E6VA 2QSHX 1OCOH 2CQXA 2RN7A 1UOBA 2XJUA 1O7LA 1GSLA 3I71A 3JBG1 2FBKA 2XF5A 3L2WA 3HVDA 3CJXA 3GCMA 2EA2A 3UNGC 4C1WA 1YW7A 1VRH3 1QJZA 2CAVA 2HYJA 3I3BA 1EV12 1E5IA 1JKRC 2VN2A 2VL4A 1ACCA 4OVEA 1W2TA 3I3EA 5JOWA 5SV8A 2CWEA 2ZO4A 5T50A 5E17F 3VUOA 2EFQA 1ASJ3 5FYVA 1REDA 2XLFA 2W39A 5EJCA 1L7LA 1T95A 4OQ9A 3ZQHA 2GH2A 1OPCA 2G9WA 3MCZA 3GVAA 2DOEA 2IA1A 4O7XA 5CFDA 1TP4A 1SDDB 1Z3YA 2DA4A 2QQAA 1CAUA 4ZXKA 1WLCA 1V5EA 1WLDA 4RR3A 2OW4A 1P92A 2V6CA 4O6JA 3KP3A 3KV9A 4EJRA 1F4KA 1YWKA 4ETSA 2A70A 3M1HA 3UR3C 1R7JA 3A7QA 3PVBB 2JKXA 1HKQA 5FKMA 4BOWA 3GFLA 1AR82 1RUH3 4Y26A 1K6OA 3ZXEA 2DA3A 5FRMA 3VBUB 1VBA1 1EAH1 2BXZA 5L9RA 3VBOB 4H4KC 1YJ9I 1XE0A 1YHQI 4JKKA 3ACLA 4Y1VA 1FT9A 3WW3A 4M9ZA 2K9ZA 4N7IA 2WFF2 3ON7A 3AKQA 2K2SA 4HZFA 4AVZA 3U2RA 2R93J 2A5ZA 2LRDA 4PJJA 2BEOA 3F2ZA 2ZMNA 4LB6B 3F8BA 1DU0A 2IGKA 1SG3A 4M3DA 4OMYA 2ZAHA 4YM0A 2O8XA 3I8TA 4ABZA 2COMA 3B73A 2HWD2 3FMGA 3BOWA 3PDQA 3FK7A 4FASD 1VPHA 4RAZA 4G6TB 2H8WA 4J1WA 4YFNF 2D45A 4DNCA 5KHKA 1ODMA 3LDRA 5JOXA 4RL7A 1ETKA 3WNPA 2Z99A 2HWC1 2OUHA 3VYUB 4M6YA 1OF3A 2ZJRF 2VPVA 2ID6A 2IW5A 3ZN4A 1LU1A 3IH4A 4ENJA 2DCZA 3RTRA 2PJRA 3GYDA 2Z1DA 3CEWA 2YU1A 2VE8A 4FX4A 2MFZA 1C0WA 3U75A 3NNFA 3TEWA 5K0UB 4CCKA 3MZHA 1MSEC 4HETA 2A5YB 2OC6A 4INDA 5CVVA 3MFAA 3GZAA 3H3UA 3GTMJ 2P7VB 3TO6A 2Y6JA 4PI0A 1JOBA 2IXHA 4YWAA 4BEHA 5HLGA 4UUTA 3FM3A 4I0WB 4XKCA 2RDPA 1APNA 1RIRA 4Y4YA 1MDMA 3F8FA 5DEQA 3T8RA 3HMYA 4A3LJ 4UOJA 3C2GA 1NY72 3CDZB 3KS7A 2LLKA 3ZM8A 4Q26A 2D44A 1R58A 1MMDA 5A80A 4ZZDA 2BOIA 2WWSA 3CJIC 3R4KA 3WQ7A 4HNUA 4CDQC 1VB2A 5DN2A 3LSEA 5HDGA 1XDSA 3ZSMA 2CS3A 2JD9A 2KRFA 1MVEA 1SFXA 1XD7A 4AIDA 4QPIB 3FXLA 1TME2 1ZGJA 4S2GA 3JRBA 1WCDJ 4KBBA 2VZ1A 3CLOA 3IAQA 1JBCA 3VZKA 2GNMA 3DPRA 2MPFA 1UIJA 2XKOA 1MS9A 2YG0A 4N43C 4GMP1 5C8WA 3WHBA 3ETQA 2OYZA 5LEJA 5BNPC 2MSYA 4RSUA 1MZEA 2Q4SA 4KL1A 5A7SA 2RS53 1DGRA 3V0BA 3VZOA 3DPTA 2RV8A 1D2QA 4AWXB 4IEPA 4IEJA 3LNQA 2DT6A 2EALA 2X09A 2O5RA 3T1LA 3F21A 5DCMB 3OSFA 2JDMA 4OUMA 5LD2C 3NKGA 4UFLA 3H0OA 4CP0A 3HKZN 3N36A 1JS9A 4AOCA 1O4ZA 1RUJ3 4XAAA 1SFUA 4IOAF 2QKDA 3T0DA 2VUAA 3AMNA 5E89A 3WGIA 1FNZA 1DGWX 4LBLA 2DYCA 4M3BA 5M5YJ 1V9U3 2PMWB 2I8DA 3LAPA 4QPGB 2DCKA 2GNDA 2D3SA 1CD3G 1O8SA 4I99C 4IGOA 1LVAA 2XB0X 4X6RB 3OYWA 2HQRA 2H1LA 3OOPA 2DA2A 3ZCOA 4E4ZA 5DTDA 2HDCA 3VKMA 4Z2YA 2XRNA 2M0CA 2Q1FA 2GU9A 5B4NA 3WG3A 1XYNA 2FRHA 3IWZA 1DU6A 2A6VA 2P2KA 4NE9A 1IUFA 4NPLA 5HLIA 1WGXA 2IVMA 3EQLF 3N7LA 5L7OA 3AYAA 4Q8KA 3JD71 1YS7A 2JB4A 5IVYA 2QKMB 3KCXA 4ASNA 2QDRA 1AXZA 3BR1A 1UW8A 3HXLA 4P5HA 3UESA 5IP9J 3K6GA 3A4UA 3KEOA 1P4XA 1HA8A 3GZEA 4PIZA 1XNCA 3WE3A 2AQEA 1OQEA 5H20A 3U14A 2DTYA 2D3PA 4XIKA 1OLTA 4M9SA 1R1TA 2YUEA 4V1PA 4CXWA 1Z05A 2CUZA 1MQTA 1LENA 3OY8A 4JGZA 4OZXA 2L54A 1NXMA 3RZHA 2F6CA 5C3RA 4BAYA 3IV5A 3GBGA 4AG4A 5A2QK 1GXPA 4I30A 2COBA 1A6IA 1MMGA 2P3YA 2JA7J 2WBMA 1ZNPA 1HKSA 2WO3A 1LODA 3LL7A 2UWBA 2KISA 1W6QA 4X6AJ 1CIWA 4G9YA 4ZJZA 4A12A 3B7MA 1H2KA 2E32A 4HT1T 2WLPA 4OHZA 1GV9A 2BVVA 4IEZA 4N0BA 2AACA 3THTA 4QXBA 4MG2A 3IPVB 4DUVA 1PGSA 1PK6B 1SVMA 3K3OA 4H14A 1XDUA 3OJBA 3GTKJ 3WF0A 4XR6A 4YFKF 5H9QA 4JX6A 3IHUA 5LEKA 2Q5TA 2BWAA 2RNJA 2WWJA 2ZHNA 2IT0A 1S0IA 3VB2A 3P3NA 1ASJ1 5AFBA 4YW6A 1AR63 2LFBA 1LHWA 2RJKA 3WGGA 2Q8CA 3SZGA 2XOMA 4AHYA 3BUCA 4RD7A 3ZSEA 2ZMEC 3BTIA 4BE1A 2QQPA 4K3UA 2AEYA 4HW0A 1XXNA 3IP4B 2KR2A 2P3JA 4L9BA 3ZFEB 2C5DA 2L9VA 1D8KA 4P02B 2VXDA 2R4GA 1GLNA 4QGNA 3VBRC 5FPUA 1ND2C 1PUFB 3KE2A 5CKMA 4A5MA 1V3FA 3LSGA 4EWDA 3LEKA 1I9RA 1QJEA 1WCQA 3B9CA 1JYTA 3GEZA 3VPRA 3MUY1 4MXVA 2W95A 2WKKA 1T38A 4CDWC 4EROA 4KG0A 3O1PA 4BNCA 4RS5A 3POIA 1C5HA 1S2BA 1CAWB 3DPUA 3FXJA 1R49A 4B09A 2MABA 3VHRA 3OBAA 4E8CA 5FLMJ 4UUVA 1JKPC 2QTWB 1YQAA 1VBE3 2BXYA 4EVIA 4QPYA 3LDKA 4PIYA 2G9GA 1XCBA 1SACA 2W24A 3W9AA 4C0HA 5K7ZA 3D5RC 1JXNA 1UNBA 4MHUA 5GZGA 1GOHA 2XONA 3OUJA 2ZHKA 2EV5A 2WT2A 4A6DA 5HS9A 2LS6A 2FUG2 3K70C 2IXJA 1QNYA 3I4PA 3K1NA 5JR3A 1R1ZA 2XG3A 2VVDA 1ULOA 2EZLA 1UXZA 2VT2A 2QEXI 2YX4A 5CEHA 2XB6C 2VMHA 3ZQ7A 1P7IA 1OKRA 4ZXEA 3PO2J 3M1EA 5IOZA 1ONAA 1N75A 4FVVA 4RGUA 1POV0 4GRIA 3COAC 3RGBA 4YW3A 2YU9J 1G9CA 3OWTA 1IRFA 1LFBA 4GKXA 3WEZA 3VSKA 1AKHA 4D1QA 3JAMZ 1GU3A 2MW8A 1FIPA 1SFYA 1Y0UA 4B4QA 4BIOA 2PMZN 1I1GA 5FP4A 1IG3A 3DBHB 4UXNA 4ZZ5A 3AFHA 1IQDC 4F3JA 1HX6A 2JPCA 1DG6A 3UYJA 1CZVA 3WDVA 1GV5A 1J3PA 2ET7A 3Q8BA 3LFIA 5KAFC 2KIUA 2W68A 5JI9A 4NUBA 1NT0A 4G6DA 1JYVA 2QBXA 2G7UA 4GALA 3WNMA 4OIPF 4P08A 1GWMA 4KU8A 4PLMA 2R043 2GSYA 4RGGA 1FNNA 5JFRA 5E16A 1YW9A 1NCQB 2QLZA 2VZSA 1GICA 1SPPB 4YYOA 3BTLA 1IS4A 2X5IC 5A3NA 2Q8KA 2EBIA 4Z2AA 5DM6F 2X6OA 1FOYA 1XQNA 2R061 3USUB 2IXCA 3RI9A 4XN3A 4M3FA 4B4PA 3ZMVA 3VBUA 4UV9A 4A2UA 4RAFA 4HEA2 2RS51 4JKLA 4GB31 2JDKA 4JRLA 1EPWA 1W03A 1XN7A 3ZOBA 4MGSA 4XCAA 3S1NJ 4XF3A 1V4RA 4B7EA 3H9QA 5LGUA 1JMUB 2BPA2 4L8QA 1MBHA 2XXZA 4ZZ8A 3D3AA 5LW9A 2DA6A 5JR7B 5C3QA 2GA1A 1D1CA 2DAOA 2IEKA 4HMZA 1T2XA 5BPIA 1YO8A 1RVF3 1QVTA 1ST8A 3VD9A 3N9PA 1RMU2 2WN3A 1RUJ1 2XVKA 1QOSA 5KXCA 3OS2A 1H9GA 1VZ0A 3PNAA 1LOGA 2PJPA 1XMAA 3AKSA 4MGQA 1GP4A 3SHFA 3LSHA 2LYCA 2XF7A 3P9KA 3NAPC 1E3HA 3QH6A 4AI9A 2YZ4A 4B8EA 1JZ2A 4KQ7A 5EJ3A 1ETYA 1ODDA 3J7YJ 4DRVA 3RKQA 5E6HA 2P5VA 2NP0A 3F72A 4URAA 3NWTA 3VHOA 1SBDA 3WW2A 2NLRA 2R30A 2F5DA 5M5WJ 5EDNA 2VW1A 2QQBA 2CL2A 3K51A 3H5RA 2VOOA 2HEWF 1E2XA 2DFHA 3PVEA 3C7FA 1F43A 1P9QC 3VDDB 2E9QA 4QKNA 4QDQA 4LULA 3K70D 3CUOA 2JG9B 5CYYA 2NNYA 2ZZJA 4AVTA 2YY1A 1JUMA 3PIOF 3NQHA 3CF5F 2EIKH 1DHKB 5K0UA 5EGOB 2A7AA 3A0BC 2ADEA 2QE3A 2ZEXA 4P9JA 3I3QA 5C9AB 2EZKA 1QGLA 1KS4A 2JEMA 1UZ0A 1BKZA 4HSTA 4KJZA 5JUVA 2V7FA 5IT9Z 1FIAA 1XB9A 3GLLA 1KJRA 1W90A 5JVGF 4O9GA 3AP4A 4WVWA 5F5IA 3TNPB 4P9UA 4I7HA 3FK6A 4I09A 1Q8OA 3T09A 3KP4A 1F2NA 4M0HA 3FMSA 2P8TA 2DN0A 3OYLA 1O3TA 2ETEA 3ES4A 2QVOA 5I8YA 3MLKA 5IHRA 1DGWY 5LZ6A 1HXDA 2V6EA 3PM1A 2EIJH 1M06G 4CUGA 1LGNA 2HOEA 1RKTA 2CSOA 3GTGJ 2TCTA 4ZH4F 1I3AA 2O0YA 1Z3XA 1GANA 4BY7J 3HUGB 4IKFA 4H2AA 1OISA 4IXAA 2CTVA 2PA7A 3I3DA 3ASNH 3O7OA 1IN8A 5GZEA 3KVBA 3THCA 2K9SA 3ZFFA 2DMUA 2L3DA 1HIXA 3ZPLA 5FBJA 3AM2A 3DU5A 1O3QA 5D6EA 4DYCA 1Q5OA 3T3YA 2QKLB 1ZA4A 3IIIA 3AYCA 5DCMA 2UYAA 1OA4A 2ZGRA 4CU8A 1QXPA 1FOWA 4RGSA 5C5UA 2QYOA 5JMCA 3E6CC 2YU3A 3MO4A 1HC8A 2GC3A 2XBO3 4Q0UA 3SEPA 3I53A 5FZ1A 2CW0F 4LNVA 3VFZA 5J96B 3K75B 3R4UA 3HQUA 4CCMA 3CQOA 4A6EA 4DEQA 1ETXA 1UU4A 3BOQA 4QPGA 1B59A 4AHXA 2GP3A 4FPFA 4TWTA 3W2AA 2JD4A 4CE8A 2PAEA 2WS92 5AONA 5M5XJ 2DV9A 3JQWA 2BBVA 1OCPA 3DEWA 1GNHA 1WW4A 2N7GA 3QPSA 3W5MA 1FOD2 5H6QA 4PDWC 2L4MA 4NR1A 5FFXA 1OQDA 1GDTA 2YB7A 3MFCA 2Y33A 3GZ6A 1UHWA 3O1MA 2H27A 4AI1A 2VZ3A 4AVCA 4BH9A 3GZUC 1XGNA 4OU0A 2YGMA 1LOBA 5FZGA 1VBD1 2GIVA 3VHPA 1ETOA 1G8XA 4YW4A 4RQPC 3WD5A 1XSRA 1QH6A 1E5HA 5AVAA 1PX4A 1R1A1 3BIEA 5CKNA 2ZHLA 1CPMA 5LBBA 2WO1A 4M9XA 1RR8C 1XU2A 2FQ4A 3H3VK 2ZXIA 4QGMA 5EWSA 3PUBA 2VZTA 1H4GA 1FPN3 4FX0A 2LTPA 3ERMA 3WNNA 2UU8A 5I0RA 4QXKA 4QDSA 4J19A 1QXRA 2GDFA 3D6EA 1MVQA 4Q47A 1U5YA 1U0AA 1O91A 2DFFA 4QHBA 2M2EA 4XE9A 1OVSA 1K45A 1X8MA 4BXUA 2GNBA 2HWE2 4LHLA 4JHZA 3JU9A 1YQ2A 1OOPC 2E63A 1UY2A 2JPBA 3FC0A 5LRSA 3IPVA 3U1KA 4CDGA 2RM23 2O61A 2VUDA 1LE8B 4YVSC 1S55A 2Y6HA 3E5QA 1QOTA 3L2RA 4WM8B 1DQ6A 3DTIA 1GZ9A 1RIOH 2OUMA 3OOUA 2BGPA 1VBC2 2R041 3MPPG 1IRGA 4EZ4A 2OA2A 5CIRA 1AHDP 4CEWC 3J7MA 5F3IA 1X3UA 2CAUA 3AMPA 2ZFUA 1Z91A 4XBQA 2YS9A 3JSOA 3OF1A 1TL8A 1NCRC 4Q4Y2 1X1PA 4YG2F 4JOMA 3OEAA 3ZFEA 3CCUI 1X4OA 5APAA 1Y9QA 1XNDA 1YI7A 4GIQA 2XVLA 1BM9A 4BQOA 1IRZA 2YFZA 1SD6A 1PUFA 1OSGA 5FPBA 4E4SA 4P55A 1Z7S2 4Q27A 1IN4A 3Q9SA 4OHXA 5FO8B 3M70A 5BYNA 5L3DA 2BVLA 4RM2A 2KL4A 3NL1A 5FBZA 3CF2A 4AI0A 1FATA 5C3OA 1CAWA 4HKWA 4Q4W1 2P34A 4D7TA 2OPTA 2EK5A 1LKXA 4LGWA 2Z5UA 3BTYA 5I0UA 2DYSH 1LFPA 4PF5A 4IHVA 4YFWA 1IGNA 1FP2A 1AWCA 4Q4X2 1F4AA 3O0WA 4RA0A 1T33A 1YYVA 3RJRA 1RVF1 1UQXA 4EJWA 4URTA 3MVPA 5BNPB 3DU6A 1VMJA 3H3ZA 3ASOH 5D8AC 3CDHA 4CICA 2KRCA 4GCVA 3AMMA 4IEYA 3BKZA 3WDUA 4XJWA 4HRIA 1PGW1 3AVSA 4DZGA 2WS93 3GXUA 3AMHA 1W36C 1JYNA 2ARBA 1WVRA 3JRFA 1CVNA 1UZYA 2X48A 4YG0A 3CCQI 5FUPA 3RSNA 3CQZJ 1Q8QA 3H35A 3BP8A 1WCMJ 1N1YA 2LR8A 3OR2C 5TGTA 1FMD3 5IAXA 2V26A 2KMUA 2VE9A 1QZEA 3T2QA 1YJKA 3AG4H 2NVXJ 3WHTA 3J26N 4AVVA 1G9DA 3LSDA 2WRAA 1NG7A 2VXJA 2CMPA 4AE2A 4Y13A 1N78A 1N1VA 1DZRA 3O0XA 3OMYA 1YI9A 4D5CA 2DPDA 4EN0A 4K1YA 3LPFA 2XASA 2IBDA 1YFUA 1RZ4A 5FZ9A 5LK7B 3C1DA 3AMQA 4I3GA 1WJ5A 3N9NA 1LHOA 2CJJA 3HKZA 4UFKA 2GM4A 3PIJA 1UFMA 1R4MB 1NKGA 2R16A 4C8DA 3IIAA 2ET1A 3JAMK 5H9SA 2WJSA 1RESA 2DLLA 1UAAA 4G7HF 2HWF2 2EIDA 4BXFA 2WLQA 3U11A 4M3EA 1B4AA 4DXSA 5F6KA 4W50A 4YEJA 5D2AA 4XIDA 2EIEA 1QBJA 3GFIA 2XVGA 4MGYE 2LKPA 1SPPA 3KLNA 1P8JA 3SZPA 3IAM2 4XHBA 2KM2A 3W21A 2XUBA 1EP0A 2YPJA 4XFCA 4YW2A 4CZCA 4HPQA 1PVC3 3EJKA 3DXJF 5JWPA 4WK8F 1OYWA 4BKXA 1IS3A 2W1UA 4EN6B 3CKHA 1U8BA 3USUA 4XJZA 2M1BA 3K4CA 1F35A 3J7NA 3OR1C 1VBB1 5FZ0A 1YIJI 4QQOA 2BHZA 2AR6A 1AL22 5LLQA 1H30A 2EICA 3KYDB 4LOCA 5JSOA 3PUQA 4GD4A 2IFRA 1QDOA 3GYHX 2ZGNA 5HBAA 2R1DA 2D3RA 4DW6A 5DUXA 4CU7A 2AHQA 2FCTA 3T8TA 1V5FA 2VQAA 5T5PA 5LGNA 1W7PB 1MEC2 3A2KA 5A1FA 2ZACA 3AC0A 2VNRA 3AJYA 4XLEA 4XDPA 3FBIB 2A3SA 4NHLA 2ZJQF 2XBO1 1AR73 4Q4V2 3VBHC 4HQEA 1J2XA 5H6RA 4K8RB 2B7YA 2V9VA 3O3KA 1T8IA 2AGSA 3LMMA 3ILFA 4NHJA 2JJ6A 3UGHA 3RWNA 2C9KA 1O8PA 3PMEA 2BNNA 3Q3SA 5FROA 2JTVA 3CNAA 1JUIA 4IQ4A 3MI8A 4RGAA 2K27A 4AK3A 3TQNA 5C71A 1H0MA 1IZ3A 5J3LA 2B63J 4PUSA 5EF6A 4IEUA 5JZGC 2BW3B 1D1BA 2PHDA 4F8AA 2QSGX 4XQFA 4LJZF 1NZIA 1BI3A 1XOYA 1I6XA 3TW6A 1YQ8A 4COZA 1POV3 3CMAI 4ESBA 4I76A 2Q0OA 1V6JA 2PTMA 1ULCA 1HV0A 3VDDA 4QKBA 5CLSA 3GO5A 2JG9A 2IGOA 3WU0A 2E1OA 5HS7A 3EUKL 4RFT0 3GALA 3L9FA 4Z1VA 3GTQJ 5EGOA 3CTAA 3HB9A 1IS6A 3PL0A 3TWIA 4XLHA 3M7GA 5DUIA 3OD0A 1T56A 1W8FA 1XYPA 5FPVA 3IH3A 4Z92B 4OHWA 1TWHJ 2B9SA 2R7ZJ 5C9AA 4EN9B 1GV2A 1RL3A 2WR9A 2JA5J 4QQ2A 4V2VA 1JHFA 1FPN1 3Q0VA 3VZLA 1AA7A 3S6PA 2E2IJ 2CG4A 3K7AJ 2D1VA 1RMU3 3LQRA 2PYTA 2DFEA 3KWVA 1IRXA 3PFIA 1I1SA 1DGLA 3HGGA 1RUI1 3FBNB 3MF9A 2WSVA 4L97A 2BZTA 3V8LA 5JLVA 1NZCA 3ZKYA 3S14J 2JWPA 4M00A 5DDJ2 2CWSA 3H1CA 4MUVA 4BMBA 2HPIA 1C1FA 2QQMA 3GBFA 3FIWA 1H2LA 2RM21 1ZGAA 4RFRB 1W8WA 1MW7A 1D2SA 4UV8A 4RM3A 1DQ5A 4XXPA 3AG3H 5IT9K 2Q8EA 3CMMA 1QJY3 4R9CA 4AIKA 3HUGA 3AZVA 1KU7A 4XLAA 3OGSA 3ZMZA 1UZCA 1TE1B 4ENMA 4L0YB 1H9WA 4KH9A 2BV6A 4CCCA 4GXOA 2F5CA 1P4AA 5FY0A 1HQWA 1PIV2 1W9SA 4HNTA 1IOAA 2C1FA 3MW4A 5C8CB 2R7WA 1Y4WA 3WG9A 3GTJJ 1DPRA 3JCIA 5IY5H 3B9IA 2IGNA 3G3ZA 4XJAA 4ZDLA 1G3WA 3ZRGA 4BUPA 4EM1A 2P3KA 4XURA 1U5TC 1XCVA 2JX9A 3HG9A 2JG8C 1JN2P 5KC6A 1CONA 2VXRA 4YG3A 5C3PA 4FCYA 3D1NI 2DPUA 1W9TA 2PMZA 3E5UA 1GXQA 1U0JA 4LOSA 1RUG2 4NAOA 4PCQA 3CO7C 2XGEA 3HBZA 3BB6A 4A93J 2X5IB 2JE8A 2WO2A 4OMDA 2TBVA 4FPCA 3ZOIA 1UU5A 4YM2A 1WW5A 1SFOJ 2JRMA 1PNGA 3WTYC 2JE9A 1YFYA 4PJ0C 1RUE2 3AL5A 2HNHA 2HXOA 3CJNA 2VH9A 4UF0B 1X9PA 3UKGA 3WZ1A 2RG4A 3POSA 2ZGUA 1OCZH 2Y34A 1BK0A 4S04A 5GAEJ 5L3EA 4KUMA 4D6SA 1DUXC 3WINE 3EHKA 2YUSA 5B1AH 1PNFA 1FBQA 5FCCA 3NNLA 4F92B 1VQ4I 1W39A 4ATEA 2YC0A 1QHGA 3OYEA 3WNKA 1Z21A 3M8EA 5IAVA 3FKJA 1VI0A 3DF8A 4BU2A 2BFUS 2EXHA 5FXWA 1GP6A 2XRLA 3TMOA 3W20A 2WAQN 4E7HA 1FMD1 2GMEA 3I4IA 2Z33A 1J84A 4YVWC 4MADA 4IVNA 1WWYA 4AIJA 1ZLKA 2P3IA 3VZJA 1CQ9A 2M5WA 1A04A 3ML6A 3JBG2 3WP4A 1F5JA 2GC1A 1PMHX 1R36A 3O1SA 3ELNA 2DWRA 1W6MA 1USTA 3P9CA 5LHIA 3MFKA 1Z67A 4CA0A 3F3XA 2WO7A 5C7GA 3AP5A 2P7CB 3S5AA 2AC1A 3KZ4C 4IGQA 4CEYC 5TISC 3OEBA 4CPBD 1O5LA 5IVJA 3WP6A 2WNVA 2WN2A 1SMVA 2J1TA 4ESFA 4HSLA 3PUIA 1FOD3 1AX1A 2Z69A 5A70A 3QQAA 4DXRA 3SEQA 3LSPA 2CGNA 4WM8A 2VQLA 2WSUA 2XQRA 3T5XA 3VBFC 1UOGA 4Y1ZA 5J98B 3RCOA 4O3MA 4W65A 3H92A 1R1UA 3A4CA 5FYBA 2H94A 5C4WC 3ZQFA 1RC9A 1PZ8A 4BZ4A 1DF0A 2VO5A 1OFNA 4IEQA 1FYUA 1VBA2 1XSQA 4RHV1 4NIAA 5FYYA 1IC8A 1PVC1 3FLRA 3PNYA 1QJU1 4XSZF 3L09A 4IRHA 3G1MA 4AFCA 5L3CA 3TYJA 1XE8A 2GH8A 3VKNA 4HV6A 2R92J 3ACHA 3W6KB 4Y22B 4B3NA 4J01A 1P4WA 1KQRA 3RFRA 3OPZA 1HN0A 1H2NA 1RUD2 2EXKA 2IXIA 4HLYA 1CZSA 3PJRA 4N8MA 1KYWA 3QD6A 1V6MA 1KU3A 3WTWC 2K86A 2Y9YA 3DWLE 1R4NB 4QWQA 3S1RJ 5CB7A 2HWE3 3X29B 4FCAA 4A4AA 1QHHD 3K4BA 4OINF 4NHKA 5B66C 4GA9A 2C9AA 4JGYC 5EPAA 4JKMA 5ACA3 4NWWA 1AR71 1K83J 1KDKA 1CGPA 2HWC2 4ATFA 3PU8A 3K2OA 1YW8A 1ZYBA 3VYSB 2W85A 2WWYA 4BJ6C 2P6SA 2P5KA 5GPCA 1BEV3 4QX7A 2LMDA 2KIQA 5FO5A 5AVPA 4A44A 5JIAA 2RR11 1BR4A 4UAPA 3VKOA 3FHAA 1QXJA 2MEV1 2ESNA 2EV6A 4M3CF 3KPHA 1ND3B 2DCJA 1I50J 4IV3B 1YI2I 1ZELA 3OV8A 5FD6A 1DQ4A 1IS5A 1D4M3 4XJ8A 2DDBA 5DAXA 3E6BA 4C90A 4BWOA 3DCQA 2DT7B 3UT0A 2W9XA 5K4LA 1ZQ3P 1POV1 4LA2A 4C2UA 2R7SA 3KHCA 5EYXA 4PSWA 2Y48A 1R093 1TC3C 3S17J 4CYDA 1RKWA 1VQLI 3WQ1A 4BHCA 1UWWA 1ZM1A 2AREA 3S2DJ 5J48A 1V5GA 4FETA 5D21A 2XJRA 4NOTA 2VC0A 1ODNA 3HRMA 2E33A 3NV4A 1Q56A 5FLXK 1MJ9A 2TRTA 2V9PA 1B8IA 1VR3A 4IHYA 5KXBA 1T0FA 3R05A 1VMFA 4MO3M 5A3PA 3WHUA 4A3KJ 3WQ0A 4Q4X3 1HRV1 1PX3A 4FI9A 4ZU7A 3ECQA 4KYWA 4CDXC 4LBQD 5FJ8J 3DXTA 3SDGA 1JE8A 4BLIA 4PI2A 2ZJCA 1RUC3 5D4SA 4IV1B 3RZMA 1OR7C 5CFCB 3TO7A 3ABUA 4DQ2A 3U4XA 1ZARA 4JCKA 2ISYA 1HJGA 3DYOA 4H3WA 4YZ5A 1W3VA 4KNYA 3I2DA 4YRVA 4RB1A 1W8OA 2EA7A 5IYCJ 4GAZA 4YGEA 2H09A 4QQPA 2VTXJ 3FZ3A 3U78A 1JTXA 2CNAA 2F4IA 4BCUA 4A3GJ 1ZRDA 2IGMA 5HPOA 5L3GA 2DMTA 2QM3A 3HTUA 2UZKA 2WNOA 3RNSA 4EJTA 5ERLA 4Q29A 1UYXA 5BPDA 2OCCH 2FZ2A 3HRUA 5IJRA 1LESA 2VKDA 1X2NA 2WQ4A 4JDMA 3WLUA 2AQFA 1W7PA 4Y17A 4IRIA 3A02A 1A34A 2CDPA 1VQ6I 4P9LA 1MNMC 3H9AA 1CQTA 2ELJA 1MKMA 1Q43A 2RKHA 5A7PA 5LGTA 1J75A 2HWB3 5GPAA 4YM3A 4MIMA 3BOPA 3M4OJ 1PYVA 4KWKA 2IS6A 4NHXA 2GXAA 1AL0G 3S3NA 4A3MJ 4HX7A 2VPLA 4XDQA 4FXKB 3J80Z 2ORXA 1MBKA 3JD72 1ZR2A 1MSFC 5JPNB 3R60A 4RB3C 3K4JA 3IM0A 4AEKA 3LEIA 3MHZA 1YFXA 1BI0A 3RQIA 2VECA 2IA0A 3PSIA 2PQ8A 5JDBA 3ZPYA 2GP5A 5D5VB 1QRYA 2JJ7A 2J5OA 4JX4A 1AL23 1VQNI 3MW3A 4A3JJ 3AKPA 1GQPA 5FFZA 4IHSA 4IL6C 1ZHFA 3Q8CA 1GYKA 5D8AB 2VGDA 5DD8A 1BL0A 4QD2A 4AEDC 4XBNA 1MEC3 5B4XA 3C2UA 3GTPJ 4KG8A 1RINA 1OUSA 1BVVA 1OVPA 3QYBA 3CLPA 4Q4V3 3BR3A 2CU7A 3O8HA 2Z4FA 3ITQA 1SLCA 3SLIA 1L0OC 3WU2C 1ULGA 3DL3A 1TZOA 3HN3A 1X58A 1LOFA 1L3JA 5CPRB 5J4VA 3JRIA 2ZTNA 2WY7Q 3IDBB 2VD7A 5J3UA 4UFMA 2KFDA 1TG7A 2WZR3 4I0AA 2C24A 2V72A 4XVHA 4DJAA 4PQQA 3N9OA 4N4NB 1OPMA 1YNAA 3FLTA 1ASJ2 4FOQA 1GT0C 3PUAA 4XMYA 4PJYA 4OIOF 1JW6A 3OSDA 2FBEA 5FLIA 4RLQA 2V4VA 4RDUA 1XPWA 2EIBA 4FAHA 1W1WE 4K8FA 5HXVA 4BY1J 3QPLA 4RGXA 1ZR4A 5FMBA 5DUUA 4EMSA 3AP9A 2YV8A 4CCJA 2AXLA 5GLTA 2F4MB 3OUHA 2F17A 5KHJA 2VASA 1RUH2 3OS1A 4HAMA 3SNMA 1SVLA 3V7RA 5C8CA 2EF6A 4A41A 4QTRA 1CESA 1YJWI 4AUXA 2OCEA 2E34A 5KC5A 2QQNA 4HN0A 4PGHA 2BGOA 1H8VA 4XK4A 4B48A 1Z6TA 5A3OA 5BNGA 3P5JA 2ISZA 3ZX7A 2DK5A 5F8PA 1H2MA 3H8RA 4EGZA 4L0PA 2BGCA 3P1IA 1LOAA 3CC4I 1KEXA 2G1MA 5ILSA 1E17A 3WDXA 1ZH5A 3R4DB 5F5CA 2R7FA 3ZMDA 2VOTA 4CUAA 4L5EA 3KETA 5J8CA 4BLJA 4Q4ZF 5IVFA 3W5NA 2J1AA 2V79A 2Y60A 3VYTB 1UYPA 2V4AA 5HI0A 3Q5FA 3UKVA 1OMIA 3B94A 2H0BA 2K4BA 2VW2A 5ACA1 2DU1A 2HWVA 1UX6A 2VBPA 3UV9A 1RYYA 3MEXA 3ENRA 5J1XA 3A0KA 4LT5A 3TEZA 4AL9A 1GKBA 3ZMTA 4N53A 4OI1A 3OYCA 4YGBA 2WV0A 2Y0IA 5FP8A 3UK9A 1C28A 2D5FA 1BEV1 1HDPA 4XKBA 2RDQA 3PURA 2X1EA 2WFPA 4QAWA 5BNOC 2OA4A 4M3CE 4A3DJ 3V7CA 4ANJA 3VBHB 4JAAA 3WTVC 2L7MP 4FFHA 4RGRA 2QQWA 2HVQA 3ALQA 2EINH 2D40A 1I27A 1D4M1 3EUHA 4MXWB 5CKTA 2XLAA 2B5HA 5C5TA 4HF0A 1W2NA 1YUDA 1HN1A 1KRIA 1R091 1RUG3 5TRDA 5A7NA 1JTYA 2R071 2CGPA 4YG6A 1HB3A 2FMYA 2Y6FA 4YRDA 3Q0UA 1JUHA 1OURA 2X51A 3BU7A 3FUOA 4LLOA 2E1NA 3W58A 2UXXA 4D7NA 4DGWB 3WTXC 2NQYA 4NB5A 1Y3TA 3BGAA 3CO6C 3O1OA 3NJVA 4ES9A 3BT9A 2IPQX 3BN6A 1WH5A 5I0DA 4MLOA 3VDBA 3FBYA 3U1XA 5FYZA 2RHPA 1EUUA 1AR93 1VAVA 5JXIA 1OKQA 4MHGA 4IDZA 3MIFA 2R6QA 2R062 1UIKA 1RUC1 4UB8C 1AU7A 4CUCA 3IDEA 1FOKA 3GUDA 1ZRCA 3GFJA 3JTGA 3ZR6A 3FMQA 5KHDA 5FP3A 3TEYA 2RS52 3H7YA 4GB32 1QF3A 4U87A 2CH0A 4EGYA 4PQ9A 1X1AA 2W5FA 1G9BA 2LBFB 3V8JA 4FAGA 1A35A 2EFPA 1Y1WJ 3E97A 3UKTA 2Q8DA 4UW4A 4M3CB 4XLCA 2VMDA 2DBBA 2LKSA 1R5ID 4IXLA 2K4JA 1S5LC 5JI7A 2EILH 1MPXA 1OA2A 4WVZA 2Z3YA 1RUJ2 3UGFA 1S0GA 2VZQA 1W0PA 2V4JC 5BQTA 1B35B 1OC1A 1MS3A 3U37A 3U10A 4JX5A 2OPKA 5JXHA 1LGBA 2HTJA 1GVDA 1QWRA 4RS8A 1XG1A 5CKQA 5FREA 4UFJA 1LU2A 1TT0A 3CCYA 1RB8G 3HT1A 4CYCB 2FDHA 2D93A 4I2OA 1XNAA 3VZNA 2HWB1 4BJTA 2V1UA 4DYQA 3ECOA 4ONUA 3SHRA 4XOGA 1NK2P 4D3WA 4DO0A 4CCNA 2ZFWA 1Z6RA 1WA6X 1XTAA 2ELHA 2C4XA 4RR3C 3QWLA 4XAEA 3T1BA 3PLQA 4YIIA 1W28A 1X9TA 1ND3A 4LMFA 1EAH3 4IV3A 3ZVXA 1OH4A 2RJLA 4GULA 1IKPA 3HJRA 2R7UA 3SKVA 2H6CA 1ZG3A 3IN9A 1NUKA 2GNTA 3K4DA 3E5XA 1MACA 4K2EA 3A0NA 2IVJA 2YBKA 4G8XA 5D6FA 1WSUA 3J81Z 5GM0A 2NOGA 3RZLA 1ETQA 3VDXA 4Q48A 4IHWA 1GWLA 4UB6C 5BNQA 4WZCA 4LHSA 3DEMA 1SQ4A 4F52A 2TDXA 2O03A 5CNAA 2NS0A 3FBMA 2NS8A 1COV3 1U5ZA 1XSVA 1B72B 1Q8SA 4Y4RA 2WL1A 2MD5A 1U2WA 5IK4A 1MBJA 2P6HA 1OBNA 5FZMA 1HW1A 4MTDA 3MIEA 3HZJA 3KCCA 1UKGA 4NRMA 4XTMA 4MQVA 3WE2A 2HWC3 1GOGA 4ZU5A 4XJ9A 2BOLA 3T08A 3F23A 5GALA 1A5JA 3H50A 2WZR1 3IKWA 1I3QJ 1VMHA 4IV1A 4LK0F 1BCXA 5CFCA 1AOYA 3NMBA 4FPJA 1RXGA 2LREA 1WGPA 1MIJA 2NOJB 2UV1A 2X6WA 3U9GA 3VD3A 2RE9A 1F9NA 2PXJA 4XMAA 3NV1A 1QEXA 3ZKUA 2FOKA 4ENKA 5FD5A 2XMLA 3OYHA 2FQ3A 5LHHA 2B9UA 1OLQA 3ESWB 1A6CA 2QJVA 4D6QA 4OZOA 3P6BA 3WXPA 4U2AA 3LSMA 2J1SA 3SZTA 2D1HA 3JB8A 3A1YA 1DP7P 3JTHA 2JKBA 3OBTA 1N1SA 4XF1A 4BS9A 1H6XA 2IWGB 4R4ZA 3ZN1A 3VN4A 4LIUA 1R9TJ 4G4FA 3ZSKA 1RUNA 3F6VA 1FP1D 3ISPA 2WAQA 3ZDVA 3RQ4A 4EWAA 4MEYF 3RSJA 5FKKA 1HW2A 1V70A 3VBFB 1X4PA 1W2OA 4LE3A 2VUJA 5E1XA 5L3BA 3E1F1 1U9NA 2I74A 2UYBA 3KEQA 1VQ7I 1RJ8A 2EVXA 2IVIB 4AQTA 3GCXA 1JGGA 4UNOA 5FDBA 2P6CA 4Y7NJ 4YGDA 2P6TA 4DUXA 3OGVA 4FE7A 3J7ZI 5HCFA 5LFAA 5IP6A 1IO2A 2RMU1 2XHKA 1IG7A 2KXLA 4DNYA 2FD5A 3ZXGA 4XRFA 3WP5A 1WZXA 4IL7A 3ZQGA 4M01A 5FY4A 2VBZA 1E5SA 1YO5C 1VBD2 3CDIA 3LOIA 4B43A 4XSXF 1R5GA 1NXD1 2XGCA 1YLLA 4YELA 3DPRC 2DU9A 2DCEA 2WQZC 4NQWB 1LEAA 3EMRA 2LTNA 1N25A 4COWA 1SC7A 5D5XB 4FQ4A 2LW8A 5DCFA 5IATA 4ITCA 1S8NA 4FHTA 2O1QA 1V55H 1LDJA 3I5UA 3NKTA 1SFPA 4MGIE 2MH2A 4QKFA 1W04A 4PCRA 1JZ7A 4KISA 3M3IA 2VNOA 5BXXA 1TWFJ 3BPXA 3J80K 3RYRA 1R081 1MS0A 1MMAA 4W6YA 2KPMA 5E1WA 1OQYA 3THDA 5AFEA 2V73A 3FXOA 5KHGA 1UL9A 3AKTA 2R7RA 3ABLH 3I2JA 2VTXA 1KA8A 4PHZA 3AAFA 3SKJE 2JICA 3RKXA 3QU6A 1IHMA 2Y2ZA 4A0YA 4A69C 2A6ZA 1B9MA 2LF7A 2L7KA 1W8HA 2BVBA 3ETPA 5ICGA 1KFUL 1S0FA 4BQAA 4E70A 3L2UA 4BQ5A 3BR6A 1F9KA 4LBNA 3O6BB 4WBBA 2NN8A 1I5ZA 3DP7A 3WUCA 2YROA 4NPRA 2HZDA 2K9QA 1TWCJ 4XFGA 3H8UA 1F1ZA 2VBXA 2O8QA 2R042 2VPRA 1K5MB 1BR1A 2XAJA 3JD73 3KF3A 5DAPA 1ONVA 3RJPA 3FXUA 1YIOA 3EYIA 1CAXB 1XMXA 2DOAA 3NV3A 2FF4A 2KDOA 5L7OC 3GDBA 3J7AO 4TN7A 2M87A 1C4RA 4FPEA 3QODA 2GN7A 4BK5A 4K20A 3L7WA 3G6EI 5HLHA 3QU3A 1GHCA 2PLYA 3DLLF 1UX7A 3BVCA 2P5LC 2RDSA 2VBWA 3MGUA 2YR2A 3OIOA 4BDZA 3BG7A 4HNVA 3C18A 1WI9A 2AYHA 3POYA 3G1OA 4V2FA 2X53S 4M71A 4NO4A 3ZMOA 5J7MA 2XHNA 5H9RA 4F83A 2XR4A 2A6HF 2BOJA 4Q4W2 2JSCA 3VSLA 1LJ7A 1MQTC 4JGZC 2DQLA 1AYN3 4KN7X 1PM7A 2B8MA 1AXKA 2D43A 1XNKA 3LSRA 1UU6A 5D8LB 2L2OA 3PVOA 2ZS6B 1RVF2 2FE3A 2L5QA 4JTOA 3WTZA 1E3OC 3EO6A 1R6RA 4P9YA 5CZKA 1XMKA 5GLZA 2VNVA 3CJTB 5FTTC 1PGW2 2PI0A 3TP0A 4XILA 4S2HA 3RRDA 1FAYA 3HTSB 2QQOA 3VBSB 2VOKA 1ZRFA 4Q8LA 4OMZA 3S32A 4UUSB 1Q3EA 3B6AA 2KIFA 2R0QC 3FHQA 1OA3A 1FPQA 4AD9A 1VQMI 4DYRA 1JYWA 2CUEA 1JU3A 1OH3A 2RNGA 3TDZC 4PJNA 2CYYA 4IERA 1SLIA 3E6DA 5ABJA 4M74A 2O6GE 2IJLA 3JXSA 2BJSA 2CYFA 2ENRA 5FK7A 4LFUA 4QMAA 4YW7A 2LKXA 4A3CJ 1JKQC 1XB4A 4AVAA 1W9FA 1NE4A 2VBBA 4Y15A 1MBFA 1OYIA 3DECA 2V1NA 3POGA 3OL3A 2UWAA 1HQLA 4AI8A 4MXWA 4HX8A 4M3GA 4RS5C 5I0TA 2ARCA 2FNPA 5LA1A 2WAEA 4OUEA 3HQRA 1BN5A 1QA6A 1RGSA 4N9IA 1Q1VA 1WA4A 1O4XA 4BQNA 3M8FA 4TV7A 1C8NA 1PZ7A 4UVCA 3PTRB 2X6XA 3RZJA 2XGXA 5DDGA 3L2HA 1NLSA 2DVBA 2VU9A 5K7PA 3CL1A 1TMF3 1N47A 4WM7B 4KBZA 3T2TA 5ILUA 3PHMA 1KU2A 1SD7A 4P9XA 1XNTA 2RGVA 1COV1 4HFSA 3HEIA 3WW4A 3M3EA 1ULDA 1S72I 1X19A 4SLIA 2V09A 2FQPA 5JI6A 1HSJA 4LPLA 4JP0A 3TN93 3J8F3 4O5VA 1XGOA 3BY6A 2UWMA 3P5BA 3WF4A 1I1EA 1VF9A 1PVXA 2L7FP 3CIHA 5EHDA 3K4LA 1B6AA 5A3MA 1FLIA 3NV2A 2FDKA 4DPNA 3GXOA 4ZZLA 4ZYHA 1FY7A 5K7FA 2GBYA 2JXAA 1H9PA 1NK3P 2XDVA 1VBB2 2GMMA 3S7IA 3ZQQA 1U9OA 4Z2WA 1JHJA 3S8PA 3CBNA 4PBPA 4E2SA 2X8KA 2NRAC 2LBFA 3APBA 4EM0B 4DXZA 4BE0A 3AB0A 2JN6A 2PN6A 2VBYA 5T55A 1ACIA 5C3SA 2E1MB 1S7OA 5AIPA 1GFF2 4AVSA 5F0HA 3D8CA 1GZWA 4GWIA 3CUQA 2XBO2 5FY7A 1U8RA 2PHTA 2HS5A 2ATFA 4FOWA 4XXAA 5ICCA 1WD3A 2WUHA 3B3QE 4DUWA 2XSJC 1B35A 4MH0E 2IXSA 3KT1A 4GWNA 2OKXA 1BW6A 2Z42A 4LB5A 4CZZA 3WHCA 2RJ2A 2JDYA 1IN6A 1YIFA 4ET7A 1KDMA 1D0HA 3FXKA 2M34A 5A3LA 1YCIA 4PGGA 2Z16A 1DYOA 3HHHA 3G6JB 4RLFA 3HSEA 4BBRJ 4CYCA 2Y31A 1SLLA 2W84A 5FRAA 1CJPA 5HCBA 5EZGA 4QPQA 1OCCH 5A6ZA 1XE7A 2PX9A 5F3GA 2XUMA 1RTVA 2E35A 4U0WA 2OZJA 2WDBA 4LKSA 2R063 1N1TA 4EE2A 2DVAA 4RYDA 3RI4A 2CV2A 5L73A