4BH9A

A structural model of cap mutant (t127l and s128i) in the apo state
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
209
Chain Sequence
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVLIEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric inhibition through suppression of transient conformational states.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords cAMP-activated global transcriptional regulator CRP
total genus 58
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2013-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bh9A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bh9A01
3W6KB 2D1HA 4J1XA 2ESHA 2BNMA 3O6BB 2PBIA 4LLNA 1G6NA 5JR7B 4QM8A 3HQXA 1KA8A 2A68F 4G6DA 4LK0F 3CO2A 1T2KA 2A69F 3SMHA 2KRFA 3RZZA 1UHWA 4Y15A 3M8EA 3KP4A 2IXJA 3DPLC 4KU7A 1BIBA 2H27A 3J80K 2HOEA 3WTYC 3EQLF 2FA5A 1XB4A 4O5VA 1IPKA 1XD7A 4RB0A 4XFGA 4HV6A 5T3NA 3I54A 2KKOA 3RJPA 4NQWA 5HI0A 2L54A 3CLPA 5H20A 3FJSA 1ON2A 2W57A 4LA2A 2Y48A 3E6DA 2MA3A 1ZZ8A 2FMLA 3MFKA 1W5SA 1VTNC 1LR5A 2EFOA 4HQEA 5LGTA 5ICFA 4DQ2A 4D7SA 3BJOA 2GWRA 3FM5A 4HDVA 3QRFF 4QM9A 5HLIA 1Q3EA 2V79A 4HX4A 1H9TA 1KU2A 1ULYA 4ASNA 4XEZA 4L9NA 2OZ6A 3HIFA 5C8WA 1KGSA 2JPCA 3V7CA 5FO5A 2RQPA 3L2HA 3TOAA 3HUGA 1WRJA 1J5YA 3PFIA 4LTAA 3SCFA 3JTHA 3G73A 2HKXA 4BHBA 2IPQX 3EQEA 4RGSA 2XAFA 3HRSA 2DBBA 4UVBA 2H0VA 3KP3A 4U0VA 5E20A 1HKTA 1LNWA 4NVPA 2ATFA 3F21A 2YX4A 4EROA 4FAHA 4P9FA 1IXRC 3HSFA 5FB2A 1CGPA 2F5DA 4TV7A 3K0LA 3FZVA 1BOAA 4EQQA 4YNIA 2CWEA 3F6VA 4D0PA 4XLPF 5BUVA 1LDJA 1SD6A 4A5NA 4HZFA 2DI3A 1IXCA 2LNBA 1CAUA 1KU3A 1YFXA 5CVIA 3CUQB 2IC1A 3IBMA 4YFXF 4BNCA 2PG4A 4Q29A 3VEPA 1T39A 5HDKA 4P96A 2ACJA 5DDGA 2CG4A 1MKMA 3EUHA 3J80Z 3FF5A 4ESFA 4OFGA 4Z82A 3WTUC 3FWEA 1ZAOA 2FRHA 1S7OA 4AWXB 1TQIA 4UXNA 2OA2A 1DPUA 1UW8A 3BALA 3J7AO 1BC8C 1C0WA 4ENNA 2UYBA 4G6QA 3NQOA 2HZTA 4Q0SA 2X0LA 4A5MA 2IVMA 2E7XA 6PAXA 1NE4A 3HOSA 3IIAA 3WTZA 1YG2A 2O8QA 4L9TA 2QBYA 2P7CB 2QUFA 2QZ8A 1CAXA 4RGRA 4KFCA 1J3RA 4IXAA 5IT9K 4AVCA 3MPBA 5L3DA 3IWFA 4A2UA 3KGZA 5F64A 4KIFA 2B0LA 1R7JA 3J81K 4META 1O5LA 4YFNF 4P9UA 3FE5A 2MD5A 3TO9A 2EB7A 1HKSA 3ZN1A 5E1XA 3ABUA 1J75A 3LOIA 4KYWA 4Q4ZF 2AXLA 3HHGA 4N9IA 1YS6A 3I53A 3NRVA 4PJYA 1QXRA 3KSCA 1YW7A 3WU0A 2PMUA 3MZYA 2EV0A 5LEKA 3E5QA 2COMA 3TDUC 4JTNA 2OAZA 3K1PA 4L11A 3BCWA 1J9IA 1XGMA 4HF0A 2XAQA 3TNQA 2WTEA 1XGNA 4IRHA 2QDRA 3HYIA 1X8EA 1BBYA 1UHMA 1U3EM 1Q1HA 1U5TA 3GFMA 4L5IA 5HOOA 4HAMA 4JBAA 2CQKA 1J7KA 1Z05A 3FHZA 3Q9VA 1O5UA 2GC2A 4CICA 5JI6A 1FBQA 3H50A 4ESJA 5L3FA 3GZ5A 1DDNA 1G3SA 4HX7A 5BQTA 4HLTA 3WW3A 2CGPA 4ZYDA 3C3WA 2F4PA 2J5OA 4O6JA 4WWCA 3I4PA 5D5WB 5H6QA 1G3TA 4JK1X 2NNNA 3C18A 5FQ0A 1AWCA 1OR7A 4EGYA 4IPAA 5K5QA 5ED4A 4HLXA 1P4AA 2MH9A 4TLFA 3IRRA 2PQQA 2Y75A 3RKXA 4M9ZA 4XLNF 4AQ6A 3CJNA 3CTAA 4ZU5A 4CDGA 4F7ZA 1Z6RA 1YFWA 1J58A 3B73A 3SHRA 2XL9A 4PDKA 4YRDA 1IN8A 3ZMUA 4EV0A 4L0ZB 4S04A 4MH0E 4OOIA 2KIUA 4XFIA 3HRUA 1ZLKA 1RL3A 4UBHA 3QP6A 2DCTA 4QMAA 3F6OA 4QGNA 3RYKA 3CUOA 1ZLJA 2MBFA 1K78B 3TO7A 4OIQF 3P9CA 2H6BA 1HSTA 4FAGA 1VR3A 1TLHB 3ABTA 1DZTA 3F8BA 4IETA 1KYZA 4HBNA 5D4RA 2XUBA 5K1YA 1X3UA 5EEGA 3HSRA 4L0YB 2Z9OA 3I59A 1I5ZA 3P7NA 2XVCA 3KLOA 4I0AA 5KHIA 3TGNA 2G7HA 2GXGA 5I8SA 4CXFA 4AVPA 4G94A 1R23A 2XASA 4EGZA 4GULA 3E6BA 3OD0A 3H1YA 2OA4A 1XCVA 5HDNA 3VFZA 5KHKA 1RTVA 5JR3A 1H1MA 4EJOA 2P17A 1NXMA 3KP5A 4NHJA 4EM0B 4BYYA 3SCHA 2XLGA 1BI2A 5BMZA 5BPDA 3GFLA 3QU6A 2ZBKA 4Q47A 4GO1A 1MJAA 4M6YA 4OIRF 2QENA 1R36A 1YFYA 3ZMTA 1YTYA 2VOPA 3ZDSA 4A6DA 5E1RA 4MGZE 1FPQA 1TQPA 4BQAA 1Z1DA 3I71A 1MDMA 2NAZA 2P6TA 3FXQA 2NRAC 2XKOA 3O14A 3BROA 2I45A 3TDZC 3U0ZA 3UKTA 1U2WA 2DK8A 3OOPA 1FY7A 2KIFA 2F5CA 5BOXA 2HQRA 4JV4A 3O2PE 3MAJA 2Z69A 4KL1A 4DNCA 5HS8A 3WW4A 2EA7A 2GU9A 4A0ZA 1P4XA 3F72A 5DD4A 4ZU4A 1QBJA 4YIFA 3AAFA 4BIFA 2QVOA 1IN4A 2P5VA 5F6FA 4MEYF 1ZZBA 3H9AA 3GWZA 4HOBA 2EK5A 1XMAA 3V8KA 1S6LA 5AIPA 2UY9A 2KXLA 1B6AA 2ESNA 1SMTA 1BI1A 1B1BA 4WX9A 3RI4A 1VJ2A 2RKHA 2K7LA 3NW4A 5HDGA 2ZJ2A 5FD6A 2PQ8A 2FBIA 1T98A 2IA1A 2VC1A 1FYKA 1Y0UA 2YU3A 4D7TA 2ZCWA 5EZWA 1UB9A 3O3KA 4KA4A 2Z2SB 5E16A 1IN7A 4EWDA 3HHHA 1UPIA 2VONA 1KQ0A 1B9NA 3Q5FA 2B9UA 1U5TC 2V1XA 2Q8KA 2BNNA 1H9GA 2EFPA 1KYWA 2GC3A 4O9EA 1TW2A 1Z6TA 4I02A 2RDPA 1KQ9A 5FLXK 2QM3A 2PLYA 5I91A 4MV2A 1KU9A 3GFIA 1YW8A 4ZYEA 3KFWX 2Q0AA 2K4JA 4MTDA 3VODA 1R5GA 4RB1A 3RYRA 3USSA 1U78A 4JTOA 2OZUA 1SAXA 5AIQA 4EM2A 1ZREA 4JVAA 3W6JB 2PI0A 4LULA 4RGUA 3R61A 1B4AA 3H3ZA 2QCSB 3FXUA 1QZYA 1R00A 1TW3A 4ZYHA 3D0JA 5D4SA 2C6YA 4I7HA 4LLGF 2B8MA 1XSDA 2LKPA 2NNYA 4AIJA 3OCPA 3KP2A 3JTGA 3KGLA 3OV8A 3GXOA 5LGNA 2YSRA 4YG2F 5CADA 3E6MA 3QACA 1JXSA 4FX0A 1YLLA 4I98B 5HVQC 1SEFA 2XAGA 2F5EA 4U0WA 4M74A 4RB3C 1G3YA 4Z07A 3DP7A 4HV5A 5FPXA 2EV6A 4ZH4F 5JCTA 1D8JA 5EFUA 3U2RA 2ZNYA 2K4BA 3F3XA 2DT5A 4LD5A 5DCMA 4ESBA 1P6RA 3RKWA 5D1IA 4LUMA 4N9HA 2OBPA 4PCQA 5EEHA 3K9TA 4AXOA 5FLXZ 2G9WA 1SD5A 5A2QK 3QPTA 1DP7P 2EFWA 3VHRA 1F1ZA 4WVZA 2L4MA 1FZPB 1ZVFA 3IRQA 3GBFA 3MWMA 3BPXA 5DD8A 5DUKA 1DPRA 1JHHA 3NKTA 1OPCA 3L09A 4F8AA 3JW4A 1YWKA 5KHHA 1PUEE 1DUXC 3JSOA 4M9XA 4M71A 5HS7A 1HW5A 3KZZA 1GXQA 4U7BA 4NB5A 3GEZA 3KEQA 4MNUA 3V7RA 2A5YB 1YLFA 2Y0OA 1XSXA 3EYIA 1PP7U 1OYWA 1RGSA 4CHUA 1BM9A 4HBLA 2XLFA 4ENJA 1DZRA 1YUDA 1OYYA 2M30A 3BJ6A 1W7PD 3NJZA 4QWQA 5FFXA 2Z99A 3BPVA 4G7HF 4XFAA 1RNLA 3L2CA 4IRIA 3H3UA 3EHKA 1ZRFA 2YPRA 3J81Z 4L9JA 3MEXA 4OU0A 3EBRA 2EVXA 5I0SA 1VP6A 2EA2A 3FM3A 1HW1A 2M45A 4RAZA 4IEVA 3FFQA 5BV6A 1UCXA 5I8TA 2H09A 1MJ9A 3T8TA 2JRTA 2UXNA 1GQHA 1XDSA 1S8NA 2XIGA 2FBKA 1P2FA 1CAUB 3RNSA 3FX3A 1WSUA 3KZYA 3KMHA 3BOQA 1B9MA 5AONA 2AS5F 1PP8F 1XCBA 3E6CC 3TOBA 1Q5OA 4MQ9F 2XRNA 5ICCA 1L0OC 4M9SA 4BXUA 4UXAA 4KN7X 1LDKB 2Z33A 3P9IA 5H6RA 5LGUA 4BH9A 3BDDA 2IXLA 1TNSA 5I93A 3DXJF 3ZQ7A 2O8XA 1JE8A 1LEBA 3RDIA 3BPZA 4QGMA 1LJ9A 5FCCA 4LMYA 3SZPA 3ZMVA 2VT3A 3F8NA 1HXDA 1YFUA 1JGSA 4WXDA 2CYYA 3DF8A 2QVSB 3LA3A 4KWLA 1FSHA 3CEWA 1J3QA 5JFRA 1MGTA 3JSPA 4YFKF 3DN7A 2LF8A 2Q30A 2HTSA 2MPFA 1NYWA 4KWJA 4A0XA 1USSA 2V6CA 1OFNA 3LQQA 5E17F 4WXHA 3KLNA 3HSEA 4G7OF 5KK1A 5CVUA 3MYXA 2D5HA 2PA7A 1ZARA 2HYGD 1O57A 4MGRA 3I0TA 3SXYA 5IT9Z 4HQMA 2ETEA 2XGXA 3M70A 2MH2A 4XSZF 3TNPB 1E2XA 3U1DA 2FU4A 1W4MA 3HT1A 4YSFA 5FLJA 3MZHA 5BPIA 1H0MA 1U5TB 4O3MA 5DV5A 4G9YA 4KDPA 2D2WA 4ONUA 2IXCA 3SCGA 3KCCA 3R6SA 2VBZA 3ECHA 2XROA 4KICA 5JSRA 2JSCA 1T6SA 2P6SA 2PN6A 1IW7F 5KHJA 4HMZA 1LDDA 1R1UA 2GXBA 1ZZ7A 1QXJA 2VBWA 1ZH5A 1WGPA 2QWWA 1XMKA 2ZO4A 3HTSB 3L9FA 2F2EA 3SFZA 3RTRA 2GA2A 1ZRDA 2KJCA 4KN4X 3WGGA 2EA4A 5CVVA 3KETA 3HOTA 3IL2A 4HF1A 2EV5A 4LGWA 1GQGA 2LF7A 4UV9A 1XGSA 1ZG1A 4PIYA 2P8TA 4Q0PA 5FDBA 5BPXA 4LG0A 1X8MA 1LQ1A 3U10A 2UWMA 4IERA 4G7ZF 1MJBA 1Y9QA 3H1MA 1O3TA 3QAHA 1IPJA 2PAKA 5ILSA 2PTMA 2C0ZA 1UFMA 4B29A 4ZYGA 3N4MA 4I3PA 4Q0UA 1FYLA 1XN7A 2ET7A 1E17A 2H6CA 4IVNA 1JUHA 3LA2A 5LHIA 2EJRA 2ZNZA 1OMIA 2ET1A 2DLLA 1REPC 3F8CA 5D5UB 2K86A 3BWGA 4OIPF 1OD5A 2XLAA 1ZHFA 3T1BA 1SMYF 1HBXG 2PEXA 4MGKE 4R79A 5J6XA 2P4WA 2ZKLA 4KMUX 1WKMA 4BHCA 3TKYA 1FLIA 2D1VA 2OYZA 2M1BA 2XHKA 1B59A 3ROUA 3SQNA 1FOKA 1BC7C 3EJKA 1R1TA 2HS5A 2HYFA 1QZZA 1L3LA 2TDXA 2ADUA 3PNAA 2E9QA 4RS8A 5LRRA 4LB5A 2VBYA 4OMZA 4L9VA 4Q5SF 2L01A 1EV7A 4H7LA 1LKNA 2DQLA 4ZZLA 1FBUA 2H94A 3EYYA 2VBXA 3R60A 3ETQA 2P7VB 2O03A 4WBBA 5E8GA 1EPZA 1DGWA 2BNOA 2O6GE 2DU9A 2L4AA 1RI7A 3COAC 2ZMEA 4G8XA 5IT3A 1MZBA 2JZYA 2ZXJA 3ULQB 3FMQA 1EH6A 2PFWA 2PYTA 2A61A 5L3EA 2STTA 1FNNA 3R0AA 1ZGJA 2IP2A 5JSPA 1I27A 1QWRA 2J5PA 1ZX5A 2GQQA 2K0GA 2BEOA 1SFNA 1CAVB 1IUYA 1G3WA 4KWKA 3WTTC 5TJJA 5LRSA 3LWCA 2PHLA 2MNGA 1ZYRF 5DCMB 4IEXA 2HGCA 2VC0A 3EETA 4XF4A 4CYDA 2STWA 4UVCA 5D5XB 2GA1A 3LAJA 3CLOA 3PLQA 1WWXA 2BBYA 1G4DA 4IESA 4IJAA 1LVAA 2DK5A 4HN0A 1J1LA 1IF1A 5JSOA 4KMFA 5D6FA 3CDHA 1WA4A 1IXSB 2VODA 3OF1A 1RZ4A 1D5VA 2RGVA 3R0JA 3WGHA 4UHTA 3NL1A 2MLGA 2IXKA 4UBGA 4XFHA 1RUOA 3CF6E 2DPUA 2PMHA 4MZUA 4AIHA 2P5KA 2Q2EA 2UY8A 4MGIE 3P9KA 1R22A 4A12A 4EJVA 3KP6A 4IEYA 1IRFA 3NSTA 5ICGA 3I64A 4QGLA 3K1MA 3PQJA 2FMYA 1QNTA 5BS6A 3ACLA 1D3YA 3VB2A 2FXAA 5J8CA 4LJZF 1Z9CA 2A6HF 2E7WA 3L00A 4XF3A 4QLCU 2RV8A 1USTA 4P9GA 2DTRA 3KEOA 3D5LA 4HF2A 2K9ZA 4EJTA 2EAAA 4U7DA 1GXPA 4MX3A 4WXCA 1SFEA 2QQBA 3WTSC 3JAMK 1FSEA 2OD5A 4ZZDA 2NYXA 3C3VA 1S29A 4PGHA 4HYEA 4M73A 2F5FA 3C7JA 4BAYA 4E2QA 1ZZ6A 2PAEA 4HSJA 2DO7A 2ZFWA 3GUDA 4HDUA 5FQ0B 3GVAA 1U12A 4O9GA 1S3JA 1S7AA 2Y0MA 1SD7A 1H1IA 1HQCA 3F22A 4ETSA 1T0FA 2EFNA 1NHAA 4Z2YA 5TRDA 4FX4A 2L02A 3H1WA 1I6XA 4K2EA 2GIVA 2R7DA 5E8IA 3MDPA 4Y13A 2E1CA 1TQ5A 3GO5A 2ELHA 4M72A 4KIBA 4GXOA 1O3SA 1XDUA 2IRFG 3BJAA 2CV6A 3ELKA 3D0SA 4BHPA 2HTJA 1RUNA 2D5FA 1CF7B 2M87A 2A07F 4QX5A 3FMSA 5E1WA 2KIMA 3GZ6A 2A6EF 2HDCA 3WU1B 1W7PA 4YIIA 4GGGA 1J59A 1ONVA 4LFUA 1XE8A 3M8FA 3IWZA 5L3CA 1J0RA 3K1NA 5DEQA 5I8YA 3LAPA 4H0EA 5I0TA 3ML6A 2VN2A 1MDMB 5DYMA 5D8LB 4FHTA 4U0YA 4DINB 1R5HA 4RAYA 3HRMA 2Z3YA 5FGMA 4MUVA 1L3JA 2W24A 4P5OA 2IA2A 3SHFA 1LRHA 4FBFA 3IKVA 2XKPA 1UD1A 4EJUA 2R7FA 5KHGA 1FYMA 2EFQA 3MQ0A 4PGGA 2K27A 4EJWA 2GZWA 2QQ9A 3ISPA 4L2NA 1ZNPA 4AD9A 4UUVA 3GLXA 3S0MA 4N0BA 3QOPA 3REOA 1XRUA 3ZP5A 1XSVA 1TQMA 3RIRA 4HLYA 3U9GA 3ES4A 2PHDA 1ZRCA 4I01A 3WE2A 1STZA 4ZU7A 4E2GA 3IHUA 3WW1A 4R1HA 3M3IA 5JAXA 1CX4A 4OMYA 2JT1A 1BI0A 1GHCA 4ENMA 4JQFA 1KU7A 1PM7A 1YYVA 1P92A 3WW2A 1YW9A 3RYPA 4WF2A 3ES1A 3RPQA 4LA3A 4XF0A 4Y17A 2ZKZA 1LB2A 4XETA 1FP1D 2BE5F 2G7UA 2D40A 2PAMA 3GW2A 3DPTA 2D93A 2GC0A 2JPBA 3V8JA 1CF7A 2VOOA 2WV0A 1SD4A 2IXIA 4Q0QA 2DQRA 2LSOA 4LB6B 1FBSA 4U88A 5CLSA 4PIZA 3V7SA 3CL1A 1BJAA 2Q0OA 4EM1A 3IKTA 2B5HA 2HR3A 3NVCA 2QJVA 3U11A 4WZCA 4GYIA 3DEUA 1NZCA 2WWYA 4XFCA 2RN7A 2PJPA 2HWVA 3DL3A 4P55A 4MGYE 2FQPA 2ISZA 3GFJA 1ZZCA 4HN1A 4IEUA 1I1GA 3WGIA 4L5JA 5ERIA 4MTEA 5LBQA 2QQAA 3F8FA 1P4WA 1YHFA 1U6GA 1IRGA 1YIOA 1EP0A 2VT2A 2HEOA 5J8FA 3KP7A 2M8EA 3BP8A 5KBFA 3JAMZ 1A04A 2CSOA 4OLLA 1UCRA 1XGOA 1FT9A 2QBYB 4MEXF 5E18F 4LLLA 4PIXA 2RC4A 3Q9SA 4CGZA 1ZZ9A 4XRFA 4LUKA 4KNYA 4ORFA 5K8SA 1TNTA 4UNOA 3V4GA 4AVBA 3I59B 5K5RA 2EWNA 2KJBA 1HSJA 4Q0VA 1T38A 5LHGA 4XFBA 2CAUA 2GC1A 1IZ1A 3VOEA 3TQNA 3FMRA 2HKOA 1V3FA 5J48A 2BV6A 2MC3A 4XSXF 1FC3A 4AQ2A 2FOKA 5D8KB 2E1NA 4I2OA 1UIJA 1FWZA 2IW5A 3QPHA 3BZ6A 3KE2A 1SFXA 1DGRA 2OPKA 3K2ZA 3CUQA 2NS0A 1WLTA 3QU3A 4RGXA 1K78A 3GF2A 3PVBB 3EO6A 2W85A 4WK8F 3M1EA 1QO0D 3R4KA 1W5TA 2FEZA 4CO8A 1J3PA 1O4TA 4XFFA 5HLHA 1CAWA 4EWEA 5FLHA 4IRGA 1ZG3A 3G7DA 3C1DA 2CW0F 5D5VB 3S7EA 4EWAA 1CAXB 1HW2A 5HLGA 1XE7A 3WODF 4XF9A 2V1DA 4LLOA 3HRTA 3G3ZA 4KU8A 4X6QB 4FT8A 3BB6A 3EDPA 3H7JA 2VQAA 4K8FA 3WE3A 2XAHA 3I5UA 3GYDA 2DFIA 5HS9A 4LK1F 1X7NA 5J7MA 4HX8A 4B09A 3F23A 2VXZA 3MCZA 2XL7A 3ERED 4QXKA 1HKQA 4WCGA 4KIGA 2HQNA 4A6EA 3ST7A 3H7YA 1GVJA 2UXXA 5CJ9A 3LZZA 1KQ8A 1WI9A 4IEOA 5AVPA 3N97A 1ZG5A 3UKVA 3FXRA 1TTYA 1WQ2A 1PMIA 5L3BA 1IN6A 2UYAA 3RKYA 5ILVA 2JTVA 2DAOA 3WTWC 3B02A 2WC2A 1I1SA 2ETHA 5ICEA 2VPVA 1K6OA 2QNKA 2OZJA 5LHHA 4IEWA 1ZGAA 2BYVE 5I0UA 1EY2A 3UKNA 2PFBA 5J3UA 2FSWA 1SQ4A 4Q48A 1F9NA 4XBFA 3ZMSA 5I0RA 4RB2C 4IF4A 4ENKA 2QLZA 4IEZA 4PZJA 3TO6A 3S7IA 2FBHA 1CAVA 2CAVA 1R58A 5BXXA 1CAWB 4MHGA 4ON0A 3D82A 5LLQA 4X6RB 1QPMA 4AVAA 2R3SA 2FQ3A 2FNAA 4B8XA 3WTXC 3DQVC 1MD0A 5FFZA 5A2QZ 2QYOA 3NEUA 1OKRA 2Q1ZB 1F4KA 3BU7A 3H8UA 1OYIA 2L3DA 5ILUA 2XAJA 4HW0A 2WFPA 4UVAA 3GYHX 1W7PB 3M7GA 1ODDA 2XV4S 2FE3A 3WTVC 3H92A 5DCFA 4IHTA 3RPUA 1AOYA 2D45A 3OGJA 2OU2A 2W25A 2ISYA 2Z5UA 3T8RA 3DFGA 3CJXA 3LSTA 5CVRA 4E70A 2IJLA 4HA8A 1JHFA 1V70A 4I09A 3SZTA 3HTUA 5D6EA 3ELNA 5DUIA 1O7LA 2W84A 1TBXA 3E5XA 3IDBB 3FZ3A 2FNPA 2V1UA 2O1QA 3BY6A 2UZKA 2K02A 4IHSA 3K69A 4KT5C 1O3QA 2OQRA 3LAGA 2A3SA 1BIAA 3M9AA 5E1ZB 5FD5A 2MHFA 3GX4X 1O3RA 2Q4SA 1UIKA 1ZN2A 1QGPA 1EYBA 3WG9A 2LDUA 1ZRRA 2GAUA 2DW4A 3L7WA 3V8LA 1FXZA 5KVRA 4YYOA 1SFUA 1IN5A 3DKWA 4HVOA 2IA0A 2M5WA 3E97A 3JZVA 4HVRA 5FPZA 1IAWA 1FX7A 4OINF 3ZMDA 2O61A 3I58A 3OTFA 4R8HA 1F5TA 4A0YA 3FHIB 1RC6A 4EMSA 2OQGA 2P5LC 1RIOH 3IC7A 4J1WA 1QQIA 1J2XA 3CO6C 5L3GA 3I7DA 4AIKA 3LWFA 1O7FA 1FI2A 4GYGA 1QY4A 1YO5C 2HJIA 3CUQC 1K79A 5LEJA 1ON1A 3IDCB 1X82A 1Y3TA 1EH8A 3DV8A 4UV8A 5K5OA 3ZN0A 2IXHA 2VECA 2IT0A 3E3VA 5F1RA 2CO5A 2YX7A 1EH7A 2CFXA 3S2WA 2ZMEB 4IEQA 5JVTA 4OIOF 2V9VA 4HVQA 4LEJA 4MQVA 2RVCA 1U8RA 3LQRA 3LA7A 1YFHA 1OI6A 5BY5A 4IEPA 1Z7UA 5FLIA 2O3FA 1Q43A 2X4HA 4EVIA 3QP5A 2RNJA 2YR2A 5CU1A 2DPDA 4L18B 4S05A 4I0BA 2V09A 3E5UA 1K7AA 3F8MA 1R1VA 5CYVA 3T0YA 2N7GA 4LG0B 4YARA 4HSLA 1V4RA 3ZMZA 2O0YA 1Z91A 4RD7A 1BN5A 3PQKA 2HFHA 1D8KA 4XF1A 3T5XA 4CZZA 1PDNC 3ECOA 3ZPLA 4E2SA 4KUMA 2VE9A 2MLKA 2VE8A 1BI3A 1YS7A 2BGCA 3CO7C 1YQAA 2FF4A 3HT2A 5C6CA 1LEAA 2GH2A 1FP2A 4R52A 4GCVA 5CVJA 5JHUA 4M6XA 3SXWA 3LFKA 1NE6A
chains in the Genus database with same CATH superfamily
3ABMH 3OPTA 4HPKA 3TAYA 3MFAA 3X2QH 2J1SA 1OLTA 2A68F 3CO2A 4OWRB 1T2KA 1ETWA 2PHXA 1UHWA 4IE6A 3M8EA 2IXJA 1JYTA 4KU7A 2PHRA 1EPWA 3EQLF 3DCFA 3AZVA 3ZDVA 1XB4A 1IZ3A 4YVSC 2R062 3L2VA 1ZBA1 4XFGA 4CDUA 4HV6A 3UR3C 3I54A 4JQRA 2F4MB 5ACA3 2A75A 4NQWA 3I4MJ 2L54A 2OJED 1W3XA 4HT1T 3E6DA 1SG3A 4W4ZA 5DQ0A 1YI2I 4JKMA 2OCCH 3VSKA 1JZ5A 2GWRA 2DTWA 3FM5A 4COYA 5HLIA 1Q3EA 2DA5A 1F5JA 4HOOA 4XEZA 4L9NA 4A7YA 5C8WA 1HQLA 2BY1A 2WV1A 2EIBA 4DQAA 1S0DA 5FO5A 3L2HA 1U5IA 3VKOA 1WRJA 4LTAA 2JE9A 2E6VA 4BQXA 3LEKA 4A3IJ 2TEPA 2IPQX 4RGSA 4HNTA 1VQ8I 3I3QA 2CV1A 1WJ5A 4UVBA 5L9RA 4NVPA 2YX4A 4OULA 4EROA 4UFIA 4P9FA 5FB2A 3H5RA 1V00A 5A70A 2F5DA 4XOPA 1MZ6A 3KVAA 2BW3A 2HEVF 2XPUA 2KPMA 1RUH2 4LHLA 5C33A 2MSYA 1V6NA 3BOPA 5JXIA 1QHGA 4UFMA 1JOBA 5FBZA 1DP0A 1YFXA 3LMMA 4IV3A 2XGCA 2IC1A 5DG1A 2ORZA 1C5IA 2DJIA 3ASIA 2G9GA 5FZEA 5IVBA 3K4NA 5FXWA 5DDGA 5K7FA 1YQ2A 3FK6A 4KGQA 1WH5A 2RG4A 1VRBA 5DM7F 4BDYA 2ZHKA 1Y56A 1S7OA 4AWXB 1AR91 4A4AA 3GXUA 3VDBA 4ENNA 1RUE2 2QQMA 2ELJA 1CR7A 2DUOA 1SACA 5FYVA 4A5MA 1FTZA 3WG1A 6PAXA 3HOSA 3IIAA 3MF9A 3WTZA 1BCXA 1LGCA 4L9TA 1QHHD 1SPPB 2WA4A 2QZ8A 1CAXA 5HBAA 2Y69H 3ZVXA 1J3RA 1IRZA 2CRGA 5IT9K 5FZFA 4AOCA 4EN8B 4RQPA 1IPSA 3MPBA 3IWFA 4A2UA 2ZGNA 1R7JA 4QQPA 1O5LA 4P9UA 3ZYGA 4C30A 3ZN1A 4SLIA 1NAEA 3AMPA 3AP5A 3K4CA 2WZR2 1YS6A 4IDZA 5LWBA 4DUXA 3NNGA 3NRVA 5A32A 2RS51 1F5FA 4FE4A 1DGLA 4JTNA 2JUGA 3BTXA 3BCWA 2DV9A 4XDPA 1WMFA 2ZAHA 2WTEA 5FRAA 1PK6C 5C4XJ 5EPAA 4XQFA 3HYIA 3ZN5A 3HEIA 3WG7H 2X8KA 2K40A 3AP4A 4YVWC 1Z05A 3ILNA 1RUD2 3H50A 4ESJA 1PNFA 2AUYA 1VBC1 1LKXA 4IGOA 2BP6A 3V42A 1H8VA 1OHFA 2UWBA 3RZHA 4GWMA 4ZYDA 1TZOA 1U5YA 2MFZA 3NO8A 4XRMA 2KFDA 2F4PA 2J5OA 1XNAA 1O4YA 4YGBA 3ONQA 3WNLA 3BIEA 2ZC2A 3GBGA 2P5BA 3DXTA 4EGYA 3K48A 1H89C 3HKZA 4AAPA 3RQIA 5K5QA 4HLXA 1P4AA 3WDTA 1LOFA 2RM21 4KMQA 4YGDA 4AQ6A 4ZU5A 4CDGA 4FCYA 2R0FA 1FOXA 1W6NA 2WINB 1J58A 2WRAA 4IHXA 4RS5A 3OD4A 5FREA 1JZ8A 4HK8A 4EV0A 4C0BA 2O14A 4XURA 3B6CA 4OOIA 4LK7A 2E35A 5A32B 2OVUA 2DCTA 4QMAA 1OOPA 1URXA 2MBFA 3P9CA 2MC4A 4W97A 1E3PA 4NHMA 2ZJQF 5E3OA 3O7OA 4XNFA 1W8FA 4COWA 1RRJA 3JRBA 1CJPA 1NQDA 4XXPA 2JA5J 3LEGA 4OI2A 1XJAA 2QQVA 5FJHA 3B3QE 4L0YB 1I5ZA 1DGWY 4IL6C 5KHIA 1J09A 4XONA 3JD71 1H2LA 4EGZA 2EXJA 4ZONA 4XCAA 5K4LA 2WAAA 2X6WA 1UY2A 2AEZA 1TP4A 2J1UA 4HKLA 3WF3A 2W1QA 5KHKA 1RTVA 2VM9A 1SC7A 1EV13 3A21A 2ZACA 4ZS2A 4L99A 1FNZA 1C1LA 4PLOA 2DA7A 2XLGA 2VOWA 5BMZA 1W6QA 3ASNH 5BPDA 3IM0A 3ZXKA 3GFLA 3I2GA 4Q47A 4GO1A 3HPNA 3I3DA 2BXZA 2VZTA 2CL2A 3ZXJA 5FZCA 2VOPA 1JTXA 4A6DA 1VBC3 3GTQJ 3RZGA 1FPQA 4QWNA 2R7QA 2E53A 2J1TA 3FXQA 4FASD 3O14A 4FOQA 3TDZC 1WJBA 3U0ZA 3S16J 3UKTA 3H9JA 2VZOA 3HZJA 3S15J 3IMNA 4K21A 2F5CA 3VN4A 2HQRA 1VQKI 3S1QJ 3MAJA 3JREA 1IV6A 1VBE2 5HS8A 1X3WB 2JWTA 2QQNA 1P4XA 3ERMA 4NPRA 1VQ9I 3WNKA 2NS8A 4UUSB 3PUBA 3PUQA 1QBJA 3VKMA 3AAFA 4BL0B 5FYCA 4BIFA 1IN4A 3NJXA 1Y4WA 4MEYF 1RMU1 1ZZBA 4A3XA 1AR81 1WW4A 2WO3A 2KXLA 1SMTA 4LBMA 1B1BA 2X5IB 1ZM1A 4J00A 2V4AA 1T98A 2WNEA 2VC1A 1Y0UA 3I2OA 4RGGA 2RS52 3TP0A 4A3JJ 5EZWA 1UB9A 3O3KA 4OHWA 3Q5FA 2B9UA 1U5TC 2V1XA 2Q8KA 2VQUA 2A6YA 3B7MA 2GC3A 4AHWA 2X10A 2RDPA 5FLXK 2IXSA 2PLYA 5I91A 4MV2A 4CCCA 5CQEA 4ZYEA 4N90A 5JPMB 3B9IA 2DJNA 2WAQN 4CSWA 1R5GA 2VULA 3N35A 3USSA 3BTLA 2JICA 1U78A 4PSXA 1N3PA 3DBHB 3TYJA 1LCLA 2C9AA 2HNHA 4EM2A 1ZREA 4QX7A 3R05A 4JVAA 2PI0A 4QQHA 3R61A 2XBO1 3WP6A 3FXUA 1RC9A 3U37A 4OHYA 2F6CA 2C6YA 2CDPA 2B8MA 2W08A 1XSDA 4FP3A 5CB7A 3KP2A 2GM4A 1Q1VA 3FHAA 4NROA 5FY1A 1NOVA 1W8UA 2P2KA 3E6MA 4A7KA 5M3FJ 4I98B 1ETQA 1SEFA 2F5EA 1IQAA 4M74A 2DVGA 4Q4V2 4HV5A 1QQP2 2EV6A 3U2RA 2R7VA 2K4BA 4C2MJ 2WNUA 3F3XA 4CCMA 2VLAA 1QDOA 3UYJA 4PCQA 3NQHA 1MMNA 1SD5A 1ZTRA 3QPTA 4HFSA 4GA9A 1F1ZA 2L4MA 3PNTA 2FCVA 3GBFA 4CYCA 5DD8A 3POWA 2HLEA 1OPCA 3L09A 1LENA 5CYYA 3X29B 1DUXC 3RI9A 3JSOA 1ND2B 1OCTC 4WM8A 2RNGA 1ENRA 1GXQA 5KWRA 3H9QA 3VZJA 4NB5A 4FISA 2A5YB 1YLFA 4C1WA 5FYYA 2R6QA 1OYWA 1RGSA 5FZBA 3PU8A 2XLFA 1A36A 3WDXA 2YUSA 1UMHA 4QXHA 4GJYA 3P1IA 4DBQA 2H8RA 2R1DA 3BJ6A 1W7PD 4Q2FA 4C90A 3S3NA 2R043 3UGGA 4NNJA 3AFKA 3EPZA 1AXKA 2EA2A 4XMIA 4IEVA 1WA6X 2HXIA 2D5VA 3POBA 1MJ9A 1HF0A 2UXNA 4V19K 2KZVA 1S8NA 1JJ8C 3K2OA 5B1AH 3RNSA 1FMVA 3FX3A 1WSUA 1UXXX 4XHXA 1XCBA 3L1PA 1Q5OA 4GKXA 4MQ9F 1VQ5I 4DJAA 4X8NA 4E8DA 3VZLA 3S1RJ 4UXAA 1W36C 1WLCA 2ERFA 2R063 4DYQA 5F3IA 4B1LA 4LR4A 3P9IA 2ZGTA 4G3YC 4BH9A 3DXJF 1RUG3 2K46A 5C3QA 3A0KA 3RDIA 1BBT2 1DFQA 4XMYA 2VZPA 2WNVC 3F8NA 3BZKA 1GZTA 4E7JA 2W00A 1JGSA 4CXXA 3DF8A 3CEWA 2Y34A 1NA1A 4NC8A 1WWYA 2Q30A 2J1EA 3UGFA 1UO9A 2R5ZA 1HC8A 1M4WA 4AFAA 5IK4A 1USSA 2EF6A 2M4GA 4CE8A 3WNXA 4CEWC 4QHZA 3TRSB 2WY7Q 3LQQA 5A3LA 3HSEA 1G9FA 3MYXA 2ZXQA 4B3AA 2DVFA 2VGDA 2L9VA 1W6MA 5EYXA 3SXYA 1REEA 5IT9Z 2DMQA 3M70A 2MH2A 1RYYA 4P9JA 4XN0A 1E2XA 1W4MA 4IV1B 5FXVA 1H0MA 4QPGA 1U5TB 4O3MA 4G9YA 1XS9A 4Q4X2 4RGKA 5J1RA 5JXJA 2BBAA 5JSRA 2BJSA 1T6SA 2JG9B 1FNYA 4HMZA 3ZQQA 3I3LA 1LESA 1ZZ7A 1QXJA 3LQCA 1ZH5A 2VMHA 5DAXA 3QODA 2F2EA 3SFZA 2BTVC 4KN4X 4B1MA 2EA4A 3KETA 4QPQA 2FDGA 4UV9A 2DMTA 1XGSA 4NO4A 1X8MA 2G9FA 4XRSG 1LQ1A 1ND3A 2VNRA 4G7ZF 3WF2A 3HOZJ 3W6VA 3QAHA 1AL23 5ILSA 5APAA 2PTMA 1UFMA 4ZYGA 4I3PA 5FO9B 1AL0G 3BTYA 1XN7A 2ET7A 1E17A 3CP8A 1LULA 2WFF3 3KIOA 2ZGUA 3LA2A 1GANA 2ET1A 1S72I 2JIJA 5F8PA 5D5UB 3V0AB 1WHUA 4NHKA 1JYCA 1ZHFA 4F93B 1HA8A 3TN92 4MGKE 5J6XA 5HLTA 4D6QA 1WKMA 2PMWB 1V9U2 4D69A 4YELA 1BYHA 3TKYA 1QKQA 2OYZA 2HYXA 3M4FA 3ZFGB 2A6VA 1B59A 3ROUA 2Y31A 3ORJA 5FZOB 3EJKA 1OA4A 1ND3C 5LASA 4N4NB 4QKNA 2R5ZB 2ADUA 2JDUA 5DUVA 2WT0A 4Q5SF 3PURA 1FPN3 2C4XA 1F8VA 4XJ8A 2WR9A 3Q8CA 1V55H 3SH4A 3ETQA 1JZ2A 4WBBA 3JRFA 1EPZA 2BNOA 4DBRA 2DU9A 2O6GE 5JVVA 2L4AA 4M01A 4DB5A 5IT3A 1E5SA 1NG6A 2JZYA 2ZXJA 3ULQB 3SZGA 2FDIA 1LNSA 3PNVA 2LM3A 5AVAA 4DRVA 4RHV1 5C8CB 4JGYA 3Q8FA 3ZR8X 2B46X 4FPEA 4IXLA 2RR13 2WBMA 1I27A 1QH7A 3V0BA 2QCOA 3S32A 1ZX5A 2GQQA 2HEYF 2K0GA 1SFNA 1CAVB 2B39A 3I2JA 4KWKA 4PJLA 1OKOA 4FPCA 4XBQA 5LRSA 3A02A 2W1WA 1UZZA 4A3ZA 1QHDA 2MNGA 5A1FA 3BG5A 3T30A 2WNUB 3NNLA 1IS6A 4CYDA 5D5XB 3LAJA 3CLOA 2NN8A 4Y22A 2RJ2A 2BBYA 5CQGA 3OYWA 5C44J 3HPGA 1J1LA 3IAPA 4KMFA 1PZ8A 3PIPF 3CDHA 1N78A 1Z78A 3UK9A 2X5IA 2FZ1A 2BOLA 4UHTA 2K5CA 3WDVA 2ECCA 5A3OA 1AYN2 2WQZC 4XZPA 4OVEA 3QYEA 2X51A 2V4VA 2PMHA 2XHNA 4AIHA 4DXRA 1IDYA 2VD7A 2M4KA 2M8GX 3KP6A 3NSTA 2GALA 5ICGA 2RQQA 3MUY1 3I64A 3OYJA 1OC1A 3K1MA 1TWCJ 3ACLA 1D3YA 4I30A 4OQ9A 1HRV1 4AGVA 2FXAA 5J8CA 1Z9CA 4XF3A 1USTA 3ZFFC 3KEOA 3GLLA 3ZM8A 1KFXL 1SVLA 4EJTA 1C57A 5GAEJ 2EAAA 4MX3A 5IK7A 4NBQA 4WXCA 1YQ8A 4YW6A 1SFEA 1PK6B 3WTSC 4YFWA 5FUPA 2GN7A 4CDQC 2F5FA 2GN3A 3C7JA 4IGPA 1ZZ6A 1RR7A 2PAEA 2RDRA 4IZZA 1U12A 4O9GA 5E79C 4BE2A 4CCOA 1S7AA 2Y0MA 1EA3A 2YC2A 5CFCB 2VUJA 3AKTA 3W58A 2KM2A 1T0FA 1UL9A 5ABJC 1OR7C 3H1WA 5IY5H 3MDPA 1H8AC 2E1CA 1TQ5A 4HONA 3G6EI 1VRH2 3WLUA 5K7ZA 3M4OJ 2CV6A 3WOGA 2TRTA 3W2WA 3ELKA 5FYMA 2WB1N 4FCAA 5JLVA 5FYIA 3Q9OA 3DCQA 1QOOA 2A07F 3FMSA 5E1WA 2R7XA 3GZ6A 1JI8A 1GP6A 3M7AA 1A78A 2WA0A 3R4UA 3DU6A 1LOCA 1XE8A 3M8FA 3IWZA 3C7HA 4XJ9A 3WNOA 3ML6A 4JHZA 3DECA 3HRMA 1QVUA 2RM23 3O1UA 3AXDA 4EN0A 3KYLA 4MUVA 1TNFA 3DEEA 1TME3 2IA2A 3IKVA 5JZGA 2HXOA 4AUXA 2ZGKA 3OOXA 5F6KA 4NAMA 4EJUA 1GNYA 4DPNA 1AX1A 4ARXA 4YVSA 4AD9A 1HRI3 1NXD1 4UUVA 3JD72 3QOPA 2LOOA 3REOA 1XRUA 2MGQA 4P9XA 2LH9A 4CDWB 3H0GJ 5KXEA 3ILFA 1GZWA 3CZJA 4D7NA 2FZ2A 4HLYA 3VBHA 4I01A 1STZA 4KH9A 1RVF2 2ZMEC 4A3BJ 1MW7A 1POV0 3WW1A 5A33B 2HWF1 4FPHA 1KGYA 1GHCA 2ZEWA 1KU7A 1PM7A 1EAH1 1P92A 1AYN1 2VJXA 3JD73 4WF2A 1HQNA 4BU2A 4XF0A 3AFGA 3WP3A 2QFEA 5FKNA 4MXWB 1FP1D 4M3EA 2QSFX 1GWLA 1DP3A 4CXWA 2GC0A 2VJ4A 4YG0A 1Q56A 2VOOA 1VLNA 2GLOA 3H8OA 2M7BA 1POV3 4PJMA 2DQRA 3AYCA 1EUTA 4U88A 3BI3A 1ETVA 4KGGA 2NVXJ 4MSVA 4XAAA 1F4HA 1BJAA 2XR4A 2Y6HA 3QOEA 2Q8OA 4XIDA 2XRLA 4DZJA 3NVCA 5LA1A 3DEUA 1NZCA 4XFCA 4U36A 3ABKH 2HOSA 1ULOA 1RKWA 2FQPA 4IEUA 2WAQA 2ADDA 1H8TA 3FBNB 2JQ7A 3RSNA 5ERIA 1POV1 2CDOA 2E63A 4LJHA 5JOXA 4OUMA 1D0GA 3F8FA 1U6GA 4SBVA 2WB1A 1IRGA 5C8CA 1JODA 3PTYA 4LOSA 1ETKA 5KBFA 3JAMZ 3P6BA 4OLLA 4XW3A 3HMYA 4PIXA 1ITYA 3Q9SA 2FD8A 4UFJA 1ZZ9A 2J1VA 1UG2A 2NOGA 2WZR3 4GJZA 5LBCA 5DTDA 4BXSV 3UT0A 1TNTA 5A3NA 3QYFA 2R0HA 5JI7A 1HSJA 1RUG2 4XFBA 2XUEA 2WNUC 1W1WE 1IZ1A 3FMRA 1V3FA 5G05L 1GQPA 4CA9A 2VXRA 4I76A 5GADJ 4COZA 2QSGX 3FKJA 4UWDA 3JQXA 3MW4A 1SBEA 3KE2A 3JRAA 5FZLA 5C7GA 3PTRB 5BNPC 4JGZC 1PO11 1KS4A 1MZFA 2R041 2WKKA 5C8CC 3CDIA 3WT3A 2QUOA 3GF2A 3OUHA 2LRDA 3A4CA 4WK8F 1MSFC 3IT8A 4QT6A 1W5TA 4ZZ5A 1O4TA 4YZ1A 5FMOS 4RQPB 5D5VB 1L7QA 3L9JT 4D6SA 2C5DA 2Z1DA 1CZSA 4IE5A 1SLLA 3WODF 2DUQA 3IIIA 4XF9A 4B44A 3CU7A 3WP4A 1J83A 3M8LA 4BBRJ 3O1TA 5FZ8A 2WZPP 3OEBA 4LK1F 2JE7A 4B09A 4OI4A 4BGDA 3AL0C 4W6XA 1S2BA 4QQLA 3RVHA 5BNNA 3ST7A 5FV3A 1RUG1 1GVJA 1NG0A 2UXXA 5CJ9A 1KQ8A 3MKLA 1HV0A 2DFBA 1V6KA 4CP0A 5FY7A 5FPAA 1L7RA 1PMIA 1IN6A 1BMV1 2WS92 5ILVA 3B5LB 2DMNA 3FUOA 5IK5A 1LHNA 2ECBA 2WA3A 3NAUA 1YI7A 2OZJA 5LHHA 2VZVA 5FZ9A 3H5AA 2K9SA 4C2UA 1MMGA 2HWE2 3T2OA 1F9NA 1SVMA 3WHCA 4B47A 1H9WA 5JMOA 4RB2C 1GVDA 1W8OA 1SFPA 1HB4A 3SEEA 3WCRA 5GLTA 2X05A 2CAVA 1R58A 3K4DA 4ON0A 4YZ2A 4AVAA 4OHZA 2FNAA 3WTXC 1MD0A 4CPBD 2QYOA 4QPWA 5ERLA 4LO5B 3DLLF 3DTIA 1HQWA 4JGYB 1K5JA 1F4KA 5FY4A 3BU7A 4JCKA 5H9QA 5ILUA 1GOHA 3GYHX 4WM7A 2DFCA 4LE4A 2JRMA 3EYPA 2RS11 3NAPC 1BMV2 2FE3A 5F3CA 4UUSA 5EG0B 4AFMA 4AK3A 2Z5UA 3HBKA 2G19A 3T4HB 3DFGA 3CJXA 3LSTA 3KF5A 1G7YA 2R5YA 1RJ8A 3RJRA 3SZTA 2CV0A 4PDWB 5IYDJ 2L7ZA 3RWKX 1O7LA 2W84A 1VBE1 2JENA 2K9NA 1MQTA 3FZ3A 3MKZA 2FNPA 1BLZA 2K02A 4IHSA 1KONA 4CPBA 2W46A 3LAGA 3M9AA 1UZCA 1WCQA 4KITB 1UIKA 1QGPA 1EYBA 5FYBA 4QXCA 3K4MA 1QZEA 1WJCA 2GAUA 2ZMKA 2P37A 4W8JA 2VVFA 4HVOA 3OY9A 1Q8PA 9ANTA 1NLSA 3E97A 4PT6A 3JZVA 4YGEA 3OGRA 4HVRA 4N53B 3TWIA 1W8NA 2KR2A 4KBBA 2YU9J 5FWEA 5M3MJ 3OBAA 5FZ6A 2OQGA 4O65A 1RIOH 2ZSHB 1ZBA3 2BW8A 1W99A 5L3GA 1RUI2 1Z21A 1VMHA 1ENSA 1U5ZA 3ZKYA 2Q8EA 4JGZA 4G12A 1C3HA 3MKYB 3OS1A 3IDCB 2HI3A 4UV8A 5FZ3A 2VTXJ 3DUIA 2Z79A 3L2QA 2VECA 4S2GA 1Y9GA 2VQGA 5D8AC 5F1RA 2LG4A 1CIYA 3HNMA 4II2A 3S2WA 5CPRB 3N7JA 1B8IA 4KISA 4OMCA 3O8HA 4WZFA 4GMP0 1U8RA 1A5JA 1UWWA 1SLBA 4PQQA 3LOCA 4IEPA 5BY5A 1QQP1 1Z7UA 4FTBA 1Q43A 3SFIA 1IGNA 3NWSA 2VIXA 1F2NA 4L18B 4S05A 4I0BA 3E5UA 3F8MA 3R0RA 1VIWB 2WO7A 4N8MA 2K3PA 2O0YA 2OTJI 3MIDA 4GB33 2HWC3 4A3LJ 4BISA 5B4NA 2QQWA 4MFDA 3PQKA 4RHV2 4PSWA 4YGCA 1IHMA 3ZPLA 4E2SA 1YS7A 1SLAA 2Y6LA 3PJQA 3CO7C 1XNKA 1OCOH 1AR92 4FXGB 3WV6A 5C6CA 4OHVA 1LEAA 1FP2A 4AVVA 4HNUA 2D7FA 3BR6A 1BVVA 1JOJA 2XQRA 5CVJA 3ACFA 3LFKA 3W6KB 2D1HA 4TLGA 2WNVA 4J1XA 2ESHA 2BNMA 2PBIA 4C8DA 1BXHA 2EPFA 5JR7B 4AEDA 4NHYA 4AFDA 5J98B 3T1LA 2ICWG 4LK0F 4FPKA 2AZ5A 5C9AC 2R7SA 4HL0A 2LD5A 5IVYA 2KRFA 3RZZA 3VD3A 4Y15A 4Q8LA 1VBB3 3LL7A 1BIBA 1V54H 3VBSA 2H27A 2YZ4A 2GMEA 4FO9A 4XXAA 5E89A 2HOEA 3K10A 1XD7A 3VZNA 3WY6A 1TEIA 2ZSIB 5F5CA 2EBIA 3PJYA 4V2FA 3RJPA 4QDQA 2VB6A 5HI0A 3CLPA 4A44A 5H20A 1X9TA 2AEYA 3FJSA 4LA2A 3F0CA 2Y48A 3NAPA 1W6MB 2MA3A 1W5SA 2JJ6A 1G9DA 1AZDA 4AEDB 3PIGA 5LA2A 2YC0A 5FRNA 5LGTA 2L2OA 3BJOA 4HDVA 4GAZA 2WNOA 1H9TA 4ASNA 4B43A 2B9VA 2OZ6A 3HIFA 5D2AA 2JPCA 5HCBA 3TOAA 3HUGA 1RHI2 1ERDA 3CQZJ 4YZ5A 3ATGA 1J5YA 3PFIA 3SCFA 3JTHA 3G73A 1HOMA 3S14J 5CNAA 3EQEA 3CF2A 2DBBA 3VDXA 2FDJA 5ISLA 2M2EA 4GWJA 5E20A 1LNWA 3K4LA 2ATFA 4ET7A 3F21A 4PCRA 1ZGWA 1XXNA 1AKHB 1D1BA 1CGPA 1WW6A 4TV7A 1RUE1 3FZVA 4EQQA 4N53C 4U87A 2KMUA 3KPHA 5GZGA 1BQPA 2NXNB 2HPIA 3F6VA 3THTA 5BUVA 5A7OA 1SD6A 3HOXJ 4A5NA 1A6CA 3DKYA 5HCFA 2LR8A 1HRI2 1GR3A 1MBFA 3CUQB 3IBMA 1LHVA 3PFYA 4BNCA 2PG4A 3MIBA 2JB8A 4JX0A 1T39A 3SEQA 4XKVA 5HDKA 1CPNA 1UMZA 4C3HJ 2XOMA 3CQOA 3J80Z 3OGSA 3GZTB 4ESFA 3UETA 5EJ1B 2W1UA 2D6KA 3VD4A 1JHJA 1UAAA 3ZR5A 2FRHA 1XX5A 1UW8A 2KDOA 1XMXA 1OISA 3J7AO 2ZTNA 4AR2A 3OR2C 4G6QA 3NQOA 1G9AA 1LE8B 2X0LA 4XLFA 1OA2A 2IVMA 4RS5B 4GKYA 1NE4A 5E6HA 1P7JA 1H2MA 2P7CB 1W8ZA 2EALA 2A6TA 4GWIA 1R082 5FUIA 2ZEZA 3ZQFA 5CIRA 4AVCA 3A0NA 1LECA 3CCLI 1OA3A 2DYCA 3W59A 2M0CA 3J81K 1Y0NA 3FE5A 2MD5A 3FBMA 1LEMA 2EXIA 5E1XA 2NMOA 1V6MA 3LOIA 3KZIC 1HRV3 2DTZA 2UWCA 3I4IA 1GNHA 3I53A 3VYRB 4PJYA 5M5WJ 1YW7A 3CCEI 2PMUA 1QA6A 2VW1A 2EV0A 2AXTC 1A8MA 1GV9A 1EAH2 2COMA 4MFEA 4L11A 3OS2A 1J9IA 1AU7A 3R4DB 1UPSA 4I99C 1A6IA 4AHZA 4HEA2 2XB0X 1IG3A 4MADA 3O5SA 3G1LA 3D5SC 1Q1HA 3GFMA 2W48A 4L5IA 2OUMA 1BBT3 2DUPA 4JBAA 5A33A 1L7LA 1ZQ3P 4XOGA 2R0QC 4Q4X1 3Q9VA 4KT6A 3POIA 1FBQA 2DOFA 5CKMA 1BW5A 2E60A 4Y1YA 4AEDC 1DDNA 2BFUL 3HN1A 4A3EJ 2QTWB 3WW3A 2CGPA 1QJX2 1RR8C 3S2DJ 5KNLA 2BGPA 1XNTA 1RMU2 5D5WB 4LOTA 1G3TA 5A7PA 3ZYFA 5BYNA 2BOIA 4MXVA 5EF6A 1LFBA 1DQ6A 1R081 3C18A 2IWGB 1OR7A 4LMFA 3HB9A 1Z67A 1NCRB 1AX0A 2MH9A 2P6CA 4TLFA 2PQQA 4AZZA 5A6XA 3RKXA 4M9ZA 1JKRC 4P02B 1H2NA 4XLNF 4G9SB 4Y5Z0 4NN0A 4E27A 1JUPA 4XJAA 2W1SA 1Z6RA 3OYLA 4P9WA 3CJIA 1N1SA 1LU1A 4YZ4A 4OQ8A 3B73A 3IUOA 1OH4A 1IN8A 1UY3A 4L0ZB 5HV0A 4PLMA 4CDQA 3O1PA 4S04A 4IV1A 2KIUA 2GDFA 5CFDC 1ZLKA 4UBHA 1DYPA 1OBNA 3RYKA 3TN91 4BE1A 1ZLJA 1I5PA 4MGQA 4N7UA 1W2OA 3OL3A 2H6BA 3ZR6A 3NV3A 2OIIA 1W9FA 3ABTA 3F8BA 4LHKA 4ZJZA 1VFCA 1DQ4A 3VUOA 3WHBA 2WZ8A 5GTIC 5LATA 3I59A 3P7NA 3KLOA 2DURA 2WAOA 3C2UA 2G7HA 1S0GA 5I8SA 2PN5A 3ZGKA 4CXFA 2DA1A 4L0PA 4G94A 1I1EA 1R23A 4FPOB 3H8XA 1XCVA 5T5LA 1XYNA 1XSRA 5HDNA 4QIWN 2VMIA 5JR3A 1H1MA 3CC4I 4NHJA 1RETA 2ORXA 3PUHA 3OBRA 1FMWA 4D5FA 1BI2A 4YW4A 3DLAA 1JYIA 2ZBKA 2VC9A 1MJAA 4M6YA 4OIRF 4NRQA 3RWNA 4IOAF 2JG9C 1R36A 4W65A 1W0UA 5E3NA 5G04L 1YFYA 3WP5A 1V9U3 1YHQI 4M4PA 1REFA 4FPJA 3ZDSA 1Y8QB 2RREA 4AGGA 5DABA 5CKNA 1W2NA 2NAZA 4PFPA 4XRSA 4FFIA 1F43A 1U2WA 2NLRA 1FY7A 1MS0A 1HKDA 3UJOA 2MABA 3ABZA 3LPFA 3KV5A 5BOXA 3HJEA 3OIPA 3VDDB 2ZX3A 2Z69A 2W52A 4DNCA 3WW4A 4NAOA 4A0ZA 4YW3A 1SHWB 4OYUA 3BVCA 2SBAA 2YBSA 1V5GA 4AHXA 4YG3A 4Q4W2 5FFOC 4YIFA 3GCMA 4N43B 2QVOA 5IP7J 3FHNA 3GWZA 4GD4A 2VNGA 1UMQA 3IKWA 4W50A 4O7XA 1TWFJ 2VXDA 1B6AA 2ESNA 1BI1A 2QKMB 2RKHA 2K7LA 1KS5A 2PQ8A 1VZ0A 1K5MB 3F2ZA 2R49A 1I9RA 2L9RA 1FOD2 1S0EA 1XU1A 4D7TA 2HWE3 1WD3A 2ZGRA 4AWDA 1IN7A 4Y4RA 1W36D 4EWDA 1VBB1 3PUIA 2BNNA 2XH6A 5KC6A 3UV9A 1H9GA 5T5PA 2ZGOA 2H0BA 4O9EA 1TW2A 1E5HA 1Z6TA 3TP3A 1KQ9A 3KT1A 2QM3A 1D5YA 3GFIA 4RSUA 1A3KA 3L2WA 3CMEI 2Q0AA 2K4JA 2GMPA 4MTDA 1DYOA 3VODA 4RB1A 3RYRA 2QSHX 2WT1A 1GICA 1MZ5A 2MEV3 4D3WA 1SAXA 2Y0IA 5AIQA 1APLC 3LDBA 1MS4A 4GXLA 2WLQA 3HNYM 2YYOA 3OOUA 2QCSB 3H3ZA 1HB3A 5DUWA 4Y5TA 1QZYA 3SISA 1TW3A 1S0FA 2W3JA 3TW6A 3HOVJ 5D4SA 5IATA 4QHBA 4I7HA 1ZBE2 2RMU1 4XC9A 5DAVA 3N36A 5KXDA 3PL8A 1VQ4I 2NNYA 2Y0SA 3JTGA 3KGLA 3OV8A 1PZ7A 4XLEA 2XPJA 4RR3C 2P6HA 1OQDA 4M3CE 1UYZA 1B8IB 2BZTA 3SDGA 2GMMA 1NH3A 4FX0A 2XAGA 4A3GJ 3B9CA 1AJKA 3LEMA 4XVHA 5FPXA 2AENA 4UF0B 5EFUA 2ZNYA 2DT5A 4LD5A 4LBOA 5D1IA 4LUMA 2XJSA 5FLVA 5DDJ3 1JYVA 2HQ5A 1XBFA 5FLXZ 3Q0UA 1W05A 1N77A 2EFWA 2PQSA 5FY0A 1YEWA 2HBTA 3DF0A 1ZVFA 1O4ZA 1UAIA 1VB2A 2HVQA 4JDNA 1M1EB 5DUKA 4JX5A 1JHHA 1MQTC 1OSGA 1PVEA 3MV11 2CJJA 1JHNA 1PUEE 4LNVA 4D8MA 4NIDA 4M71A 5HS7A 4K8RB 1HW5A 2DU1A 3KEQA 3V7RA 3MPPG 1RUI1 3EYIA 4DGWB 3HOBA 4HBLA 2E34A 3VLBB 5IOYA 4ENJA 3PM1A 4CCJA 2C24A 1F36A 3ZSLA 3HDDA 4FI9A 4XFAA 4IRIA 1KITA 2QA4I 1OQ1A 1ZRFA 5B3SH 1OCCH 4OU0A 4L9JA 3EBRA 5KHDA 2EVXA 1YIFA 5I0SA 4CU7A 4MGTA 3CCUI 1UJ8A 1PGL2 4RAZA 3FFQA 2W91A 5BV6A 1UCXA 1HRI1 1HRV2 2JRTA 1XDSA 3FIWA 5BNOA 3KMHA 4BPZA 1B9MA 4A3KJ 5AONA 1PP8F 5A1LA 3TOBA 4UB8C 2YPDA 4NE9A 4F92B 3V0AA 3G1OA 1FTTA 2XRNA 4FFGA 3T2TA 3K2AA 4C9YA 3ZN4A 1TNRA 3SLIA 3LSGA 5H6RA 5EIYB 3LOBA 1T56A 1TNSA 5I93A 1FATA 3K77A 3PO2J 1O59A 3ZQ7A 4XYXA 5GLWA 1AYM1 1LJ9A 5FCCA 4LMYA 3SZPA 4HG6B 1FOYA 3M3CA 4BJ6C 4QPIA 2HU9A 1HXDA 4NC6A 2WZEA 3P5JA 1YJ9I 3QCWA 1VQNI 4WXDA 4QX8A 3NAPB 1OH3A 3QD6A 3USUB 3DN7A 3QWLA 2MPFA 1BL0A 4KWJA 2DCEA 5EV7A 1WJFA 2NVTJ 1WLDA 3T3YA 2VUMJ 3INAA 3JBG3 3PUFA 4DYRA 2GXAA 3LFIA 2E1OA 1Y39A 4AGRA 2XJVA 4FPYA 4M6VA 1AA7A 5KK1A 5A6ZA 2D5HA 2JIGA 4IKFA 4X8PA 2C9KA 1ZARA 4YM0A 1QJU2 3PHMA 4MGRA 3OYKA 4NDLA 1AL22 4HQMA 3JQWA 2C26A 5C70A 3RRDA 2J42A 4XSZF 1OQYA 3TNPB 4F83A 2FU4A 4XN3A 4YSFA 5FLJA 4FOWA 1OD3A 2OS2A 2BXYA 4A93J 4Q5OA 4PJNA 1JKQC 4GALA 3SCGA 3KCCA 3CC2I 3R6SA 3RKQA 1PUFB 1TMF3 4KICA 4YVWB 1IW7F 2WAFA 1YX5A 4FPGA 5FP4A 1NCRA 2CV2A 3L9FA 5J96B 4HPKB 1VQOI 3RTRA 1ZRDA 2KJCA 3WGGA 3HOTA 3KYCB 1W2UA 1IJWC 4BOWA 3VYTB 4PIYA 3HN3A 5FDBA 4LG0A 3KS7A 5FJKA 5TSWA 4ZY9A 1AHSA 3K4JA 3SITA 3WDWA 1MEC1 1LHWA 1O3TA 4QPGC 4AE2A 2C0ZA 4B4RA 5IVFA 1SLCA 4Q0UA 2I74A 1FYLA 3ZSEA 4CTEA 3AZYA 2RMU3 2A71A 1RESA 2DFEA 5F0FA 4IVNA 1R49A 2K9MA 2EJRA 5C3SA 2SLIA 2CS3A 1BHGA 1K45A 2QBXA 2Q8DA 4NRMA 3BQYA 1GFF2 1JTYA 4R79A 2P4WA 2ZKLA 4HETA 4FTSA 4BY1J 2JG8B 5A80A 3JCIA 1FLIA 3FLRA 5FJ8J 3BTAA 3SQNA 1APNA 1CQ9A 4RBOA 5LFAA 5FYHA 3N7LA 1Z7LA 2VKDA 4E6KG 2TDXA 2OKXA 2OQ6A 3B94A 3DYMA 4LB5A 2VBYA 4OMZA 5FPBA 2Y2ZA 1C8NA 1EV7A 1OPMA 2J7MA 5GZFA 3VBHB 4H7LA 4LK6A 1LKNA 3R60A 1PYVA 4CP9A 5E8GA 2CU7A 3FMGA 5FK8A 1RI7A 3IH3A 4DS0A 1E3OC 5A7SA 3FMQA 1FPN1 3UL2A 2PFWA 2VBBA 2PYTA 4QB6A 2STTA 3FHQA 2XF7A 1Z7S3 1QWRA 3A0BC 2J5PA 1PIV1 4CCEA 2LTNA 3WF0A 2BEOA 2MD0A 1IUYA 1R092 2JWPA 1FEXA 1ONAA 5TJJA 4JX4A 5C9AB 2PHLA 4TN7A 1VBA3 3W9AA 5F7UA 4XF4A 4BIOA 1T95A 4UVCA 1VNDA 1OURA 2W87A 1WWXA 1G4DA 3LSDA 1LVAA 4EYUA 1ACIA 5DAWA 1IF1A 1H9PA 5D6FA 3JBG2 1ETOA 1YI9A 1WA4A 2BV4A 3O1RA 1IXSB 2VODA 1RZ4A 2ZKNA 4ANJA 2RGVA 3NL1A 1IRXA 1TT5B 2HYKA 4NWWA 4AW7A 5GAGJ 2AACA 2DPUA 1UELB 3AM2A 2HWF2 1ULFA 2Y6GA 1AL21 5L19A 2UY8A 4MGIE 2RV9A 5L9BA 3P9KA 4EJVA 4CH7A 4K9SA 3SH3A 2UV1A 5GLUA 4IEYA 2XJQA 1OQEA 3S17J 3VBSC 4A45A 5JDBA 4QGLA 4Y22B 3CDZB 1UU5A 1AR71 1R1A2 5FROA 2E7WA 3L00A 4AC0A 4GFBA 2TUNA 2RV8A 3ZXEA 3ZRGA 4P9GA 2DTRA 3PSFA 3D5LA 4Y3OA 1OLQA 3Q8BA 5FO8B 4NUBA 4IQ4A 1TWHJ 4EEFG 2IGNA 3A01B 1ETXA 2RS12 1FSEA 4ZPIA 2KT0A 4BQ5A 1K12A 4M73A 2I8DA 3WUCA 1GUIA 4QQ2A 3V0BB 4M3FA 5ABJB 2ZFWA 3SH5A 1VALA 4XQWA 3RG0A 4QU1A 4DXSA 1HX6A 4ETSA 4XUOA 1NHAA 1IC8A 4GH4B 4K2EA 1S0BA 2ELHA 3CP2A 1US3A 4GXOA 1O3SA 1XDUA 2IGMA 1UYPA 2VZQA 3BJAA 1PNGA 3KV6A 2JA7J 4GIQA 2QQKA 1A34A 2A70A 2HOAA 4XJWA 3HD8B 2O8OA 3BR0A 2D5FA 1PVXA 4QX5A 5FZOA 2E2HJ 1R71A 2HDCA 1W7PA 4BE0A 4BA6A 2EIKH 1W6OB 3KD4A 3EB7A 3CCSI 3OIQA 5FPUA 1ONVA 3NNJA 5L3CA 1JGGA 1W0PA 3K1NA 3AXEA 5DEQA 5IYCJ 3RMXA 5I8YA 3AB0A 5I0TA 4H0EA 5D8LB 2KIQA 4FHTA 4DINB 3AVSA 2ARCA 3WR0A 3AMMA 5FGMA 1YJWI 2KQRA 3O12A 3WZ1A 1L3JA 3TW7A 4FBFA 1UD1A 2RS32 3ZX7A 1MBGA 5KAFC 1ZELA 2R7FA 1FYMA 2P4EA 4PGGA 5CFCC 2K27A 3IDEA 4L2NA 1G2HA 1RUJ2 3GLXA 4N0BA 3J7ZI 2K3FA 3O0VA 2EIMH 1ZR2A 3C7GA 3MFCA 4QHOA 3U9GA 2EINH 5IVJA 3WINE 2PHDA 3SJMA 1UF2C 3NV1A 2HWD1 2NVUB 2BQPA 1Z3XA 1CX4A 3WUDA 2G1MA 2LBFB 2JT1A 4UW4A 4B1RA 2D98A 1YYVA 3WW2A 3ZYBA 4B4QA 4DZGA 4JGYC 1AX2A 1YW9A 1EKEA 2K9QA 4ZC3A 3RYPA 4CU8A 4KG8A 2LW8A 1K83J 2CU5A 3KT4A 1TWAJ 4XOTA 2WABA 4Y17A 2JXAA 1VQMI 1UYYA 2BE5F 2G7UA 2D40A 2WDBA 4WVVA 4DMIA 5F3GA 3VPRA 3GW2A 3DPTA 5DM6F 2JPBA 3V8JA 4QPGB 1UY0A 3J7YJ 2WN2A 2DCKA 4AI3A 1C8M3 2IXIA 1VPHA 4LB6B 1FBSA 2WWSA 3KCXA 5CLSA 1N1YA 2JVHA 2VMFA 2QQPA 2EIDA 3AG1H 3IKTA 2XBO3 4DIQA 3J7AY 1S1AA 2LYCA 3U11A 1NCQA 3DPRA 3HJRA 4GYIA 3RPUD 1MPXA 2RN7A 2PJPA 3DL3A 1BVP1 3K70D 3KQRA 1D0HA 4H2AA 4IGQA 2LUWA 5DN2A 2ISZA 1ZZCA 4BCUA 2JJ7A 4ZDLA 2K85A 1G8XA 1NY71 4OZXA 1JYNA 1W0NA 4V2WA 2VT2A 5J8FA 2M8EA 1IKPA 2CSOA 1FT9A 1PIV3 3MI8A 2QBYB 1D1CA 5IPAA 4LLLA 4CGZA 3ZFFA 5FPVA 2HZDA 5K8SA 1X1DA 2RMU2 2Y33A 3V4GA 2CW8A 4AVBA 3I59B 1CPMA 2EWNA 2CAUA 2A5ZA 2ES3A 2QQOA 3NARA 2GC1A 3OMYA 4MO3M 3K4ZA 4JQTA 5J48A 1UXZA 1IQDC 4GRIA 1PO23 1PVC1 4NRPA 3FBYA 2FOKA 1UZWA 3O1VA 2X1EA 5FP8A 1O4XA 3WG4A 3U14A 3K2ZA 4K3UA 5IT6A 5ABJA 4YEJA 3PVBB 3EO6A 5EZGA 3ZPOA 1OOPB 1QO0D 1SCSA 5IVEA 4FVVA 1YQ6A 4PHZA 4LORA 5FY9A 1VAMA 5K0UB 3HR9A 1BEV3 1YCIA 1ZG3A 4V2VA 5CAZA 2CW0F 4LITA 1HW2A 2LS6A 1NCQB 1LGNA 3HRTA 4KU8A 4X6QB 3BB6A 2OQ7A 3WF4A 3HWJA 4K8FA 3ZXFA 2AYHA 3OGVA 1CX1A 3GYDA 2XWJB 3OSFA 1BZWA 5HS9A 4F91B 5SV5A 2V6EA 4PFOA 5T5JA 1QPIA 4C3JJ 1YQ5A 3KV9A 1OXCA 4FP2A 1IDZA 3IMMA 4RAGA 4QXKA 5DZFA 3VSLA 1HKQA 3RI8A 4ZDPA 3ACGA 3H7YA 4RHV3 3DTEA 4CDXA 3LZZA 1WI9A 5CFCA 5CKQA 3GHMA 1Z7S1 5JPNB 3J7NA 1TTYA 2NVYJ 1ZA7A 2MG4A 1CZVA 1LHOA 2JTVA 2X1DA 2O8KA 4M0NA 2Y60A 1I1SA 3BIWE 1K6OA 2A3XA 5FZMA 1BR1A 2BYVE 4A69C 3MZ8A 5A6QA 1EY2A 3UKNA 2FSWA 4Q48A 3ZMSA 4XBFA 1XNDA 4IF4A 2HWD2 1VRH1 4ENKA 4OI1A 4PZJA 2CUJA 4ZKTB 1DQ0A 2L0KA 3AJYA 1CAVA 4CP1A 5BXXA 1ENQA 4MHGA 3ACIA 4X6RB 5JOZA 4B8XA 4DNYA 1GOGA 3DQVC 5FFZA 1QJEA 1XYOA 3WEZA 1DGWX 1OKRA 1IUFA 5C3EJ 2Q1ZB 3HPHA 2ZZJA 1Y1WJ 1NQJA 2XAJA 4HW0A 3A03A 4XUQA 2M34A 3M7GA 1UY4A 1ODDA 2WADA 2X1CA 4RR3B 3BU0A 5FZKA 4YVWA 4RM2A 2ME6A 2VR4A 1QJU1 1Z3YA 2HWC1 4XQ4A 3JRCA 3RPUA 1AOYA 3U21A 1Y7BA 3OGJA 2OU2A 2W25A 4NHXA 2ISYA 3MMYB 1FV2A 4MO7A 4E70A 1ND2C 4HA8A 3PMSA 3D3AA 5IJRA 3VYUB 2WUHA 3VB9A 4I09A 1H8TC 3HTUA 1PMJX 2YB7A 4BQ4A 5D6EA 3ELNA 2JG9A 5DUIA 1UU4A 3E5XA 4XJZA 3I55I 3ZQIA 2V1UA 1TE1B 3AYEA 1ORKA 2BFUS 1AR62 4D0QA 2A1XA 1BIAA 1NLQA 2ELKA 2YS9A 3WG9A 1RUF1 3WQBA 4M3GA 1ZRRA 3Q0VA 2DW4A 3L7WA 3V8LA 1WGXA 3PU3A 1FXZA 5KVRA 2KA3A 4W6YA 3A1YA 1IAWA 3RGBA 4OINF 3A01A 3I58A 5IP6A 4R8HA 3N9MA 1F5TA 1W06A 4EMSA 1PM4A 2OCEA 2P5LC 3IC7A 3LFUA 4J1WA 1T33A 1QQIA 4YFZA 2G0EA 3AMHA 3HM5A 1X19A 1VQLI 1NA1B 3LWFA 1O7FA 5A3TA 2MW8A 1UN1A 1QY4A 4LE3A 3BG9A 1K79A 3WDYA 2VCBA 2X53S 3AP9A 5LA0A 5JZGC 3J8F3 3VDDC 4NWVA 2Y9YA 2V5DA 4P14A 4BK5A 2YX7A 1S2EA 1EH7A 3KHBA 1X1PA 2CFXA 4A6SA 4N7IA 1CONA 3LNQA 2WIIB 1RB8G 1MMDA 2D6MA 4XIOA 3IAM2 1YC61 2ZJPF 3LQRA 4LBLA 2X6XA 1AKHA 4AM3A 1OF4A 1HLCA 3MLLA 1MBEA 2O3FA 4IOCF 1QXPA 5CU1A 4NIIA 1W2AX 1EJ9A 4LG0B 4YARA 4HSLA 3ZMZA 2G9ZA 5BNOC 1Z91A 1U0AA 2EZHA 2LMDA 2WO1A 1BN5A 2HFHA 4J01A 3H0OA 1GLHA 2W0XA 1QJZA 2VE8A 2OUJA 2BGCA 4GZ9A 3FXMA 1XNBA 1Y6IA 2PHWA 3D6EA 1HV1A 1AUYA 5GZEA 3BLYA 2HWC2 1IGOA 1WJEA 3GALA 2DN0A 1MVEA 1IOAA 1SCRA 4DEQA 3W2AA 4LLNA 3ZPYA 1G6NA 2W47A 1V6JA 2M3AA 4E7ZA 1GSLA 1NKGA 1RUF3 3HQXA 1KA8A 1TG7A 4G6DA 3WQ7A 4I6ZA 2CQXA 2CQNA 2FQ4A 2VMCA 2JSPA 3SMHA 4Q4V3 4ATFA 2YXSA 3ENRA 5B5EC 2VAUA 2M9HA 3KP4A 5JOYA 4U2AA 3BKZA 1ZYBA 2PMZN 3J80K 2EH3A 3WTYC 1C28A 3QH7A 1CQTA 3LFMA 4YZ3A 3VBFC 1IPKA 4RB0A 4M3CA 3PL0A 1LVKA 4BQQA 5T3NA 5T52A 4PJ0C 2P1BA 4XTPA 2KKOA 2IBDA 5CG8A 2V73A 2E2IJ 1V6IA 4RGAA 3U4SA 1B35C 5FR3A 1ZZ8A 3MFKA 2EFOA 4HQEA 3OYEA 2L7KA 5ICFA 1RUC1 4DQ2A 4D7SA 2YDEA 4RS5C 3K6GA 4XLHA 2HPMA 4BXFA 3QRFF 4QM9A 4CVUA 2V79A 1S4CA 1ULYA 1QOTA 5C9AA 3IDAA 3OL4A 2ADEA 5IK8A 4AVZA 2PJRB 3ZQGA 2L7FP 2ZOEB 3CC7I 2D43A 1QQP3 4W6WA 5FKKA 3ZXDA 2HKXA 4BHBA 4R9CA 2FUG2 3HRSA 5T54A 3L2YA 3KP3A 4C1XA 4GMP1 1E5IA 5F32A 2CWMA 5A7WB 1QNYA 4FAHA 3HSFA 4BM8A 3OPWA 4EN7B 3NWTA 3HC7A 2NVQJ 1BOAA 1R083 4AEMA 4YNIA 4D0PA 4OMDA 1D0YA 1CIWA 1PUFA 1LDJA 1X36A 3CD6I 3MICA 2DDBA 2DI3A 4HZFA 5FXZA 2ZJRF 1VQPI 4Q4Y3 5A7NA 4HNVA 4Q1RA 1CAUA 5CVIA 2XPWA 1VBD3 3ZQHA 4YFXF 2E7AA 2R7TA 2VW0A 3ZFEC 2YC4A 4Q29A 3VEPA 5M5XJ 3AJZA 3LSEA 2ACJA 2CG4A 4FTEA 1MKMA 3EUHA 2DT7B 1KJRA 2BBVA 3VBRC 2LY9A 3ZFEB 3POFA 3POSA 4Z82A 4CXYA 5EQUA 3PNYA 1ZAOA 1TQIA 3H3VK 4MGSA 1I3AA 3H35A 3CF5F 2NQYA 1C0WA 2UYBA 1YRNA 3OY8B 1V5FA 2HZTA 4Q0SA 3VHOA 4CRQA 4BXXJ 3WHTA 2E7XA 4LG3A 5GP9A 1AYM2 1YG2A 2O8QA 2ZMLA 2QBYA 2QUFA 1VE0A 4KFCA 3OPZA 2A7AA 3KGZA 4KIFA 2B0LA 4O61A 4META 4YFNF 2FBEA 2EB7A 1AYM3 3ZKUA 5DDJ2 5ACA1 5A6YA 2VTFA 1J75A 1X1CA 3POGA 4KYWA 4UOJA 4V2GA 2GBYA 4N9IA 1BBT1 5L7OA 5FMDA 4LO7A 4ZTFA 1HB1A 3MZYA 1FMD1 2I10A 3E5QA 4QTRA 3TDUC 4M3CF 1XGMA 3H1CA 4HF0A 1O8SA 3JXSA 3DBLB 1VAVA 5BNOB 2EIJH 1XGNA 1JS9A 4R4ZA 5T55A 4JKKA 2KRHA 2L9LA 2LALA 2VOKA 1UHMA 1U5TA 5LD2C 5HOOA 2BY0A 4E7KA 2CQKA 1JTZX 3ZSMA 1J7KA 3FHZA 1O5UA 2GC2A 5JI6A 3ZN6B 5LK5A 4D94A 1PGL1 1FOD1 4Z2AA 3UNGC 4OI0A 3VHNA 3T09A 5FYUA 5L3FA 3GZ5A 1SBDA 2B7EA 2GNTA 1QRYA 2CWSA 3HBZA 3TEZA 4X1EA 4HLTA 1W9TA 2WZR1 2JK3A 1W90A 1TZLA 2VKHA 3W2VA 4WWCA 1TT0A 3I4PA 5H6QA 3GTLJ 2ZX0A 4UI9L 1JJ6C 2NNNA 2GSYA 4RLQA 2JA2A 1SAUA 1R091 3I97A 4I0WB 5ED4A 3M1HA 2Y75A 1GP5A 2RR12 3HL2A 1OPOA 5FWJA 3CTAA 2YG0A 5FY8A 3K75B 1CJDA 3VBUC 3SHRA 1DLCA 3ZMUA 3KX2A 1X9PA 4P08A 1UOJA 2OPWA 3AP6A 1RL3A 4QB1A 4QGNA 4QQOA 2JMWA 3CUOA 4Q1PA 5IOZA 2IS2A 1DU0A 4OIQF 2GNMA 2XPVA 3A0HC 3J4UH 2GH8A 1RVF1 3WQ1A 2EICA 1VR3A 2LVSA 3AC0A 1DZTA 1KYZA 4JX6A 2W82A 2VZSA 4HBNA 1X3UA 5B2GB 3HSRA 2F17A 3QH6A 1A35A 1V0AA 4I0AA 1G86A 3ZQCA 3TGNA 1H0BA 2A3YA 4IUGA 5HODA 2KHMA 5IW0A 4PQ9A 1AYN3 1FAYA 2XASA 3JU9A 3PIJA 4GULA 4IE7A 3SQOA 2Z42A 1XNCA 1W9WA 1ULPA 3H1YA 2LP0A 1VBD2 3LF7A 2OA4A 2P3IA 2Y0SN 4XHBA 5FOBB 4LBJA 2LK2A 5FRMA 4Q4Y2 1NZIA 2XB5A 3J26N 2EZKA 2P17A 1X1BA 3KP5A 1UX7A 4EM0B 3LB9A 3SCHA 4LLFA 1NY72 5CFDA 4AQTA 2X9DA 3BTJA 2PMZA 3BTCA 3AVRA 4PK4A 3VBOA 2BVBA 4E7SA 4J6GA 5D21A 4LPLA 1YTYA 4DY5A 5FKMA 4Z1VA 1O8PA 4MGZE 5IUQA 4ASLA 3I71A 1MDMA 4HSRA 2P6TA 2XKOA 2DODA 2AQEA 2I45A 1LHUA 1VRH3 1GWMA 3OOPA 2L9SA 2WS93 3OYDA 3THPA 1F35A 3FXKA 4JV4A 1I3QJ 2RM22 5EYYA 3A23A 3OYMA 2LROA 1BKZA 4KL1A 2XJUA 3MW3A 1LOAA 2GU9A 2A6ZA 2FX0A 4A3FJ 1X2MA 5AC91 4P00B 3F72A 2W95A 3ECQA 2WAEA 4QB2A 1R6RA 2ZZQA 1YJKA 2VJJA 5F6FA 1IS5A 3WNNA 5CA6A 2R7ZJ 3H9AA 4HOBA 4QX2A 3VDCA 2DFHA 2EK5A 3KHCA 1KXGA 1XMAA 1S6LA 2V9KA 5GZCA 4Z2WA 2NPIA 4WX9A 3RZMA 3RI4A 1VJ2A 2HVSA 3AG4H 5FD6A 1GUUA 3NW4A 3FLTA 2FBIA 1O6UA 2IA1A 2OV7A 5LBBA 4JRLA 3BTIA 1FYKA 4YM3A 2EQRA 2YU3A 4CUCA 1OKQA 2XJPA 4PF1A 2R7WA 4B7EA 2D6NA 4KA4A 2IUWA 5E16A 4LT5A 3CCYA 4ZTJA 5IVVA 2LC2A 2D3RA 2R071 3CCQI 1QNWA 2R042 4YG6A 1JKPC 4BB3A 3Q8AA 2EFPA 2YU1A 3H9GA 3AP7A 2Q5TA 3S3MA 3N9OA 1GZWB 2R061 1KU9A 2BOJA 4UY8I 4A6OA 5C4WB 3KFWX 1E57A 4RFT0 4CUBA 4INDA 1PVC2 3OBZA 1G9CA 2JD9A 3ETPA 2V5YA 5AFEA 1X58A 2EIEA 4BQWA 2KL4A 4LULA 4RGUA 5F2WA 1B4AA 4EJRA 1R5ID 1R00A 5JLXA 4ZYHA 3OUIA 4QPYA 4LLGF 2VH9A 4OZOA 1VMFA 4AIJA 1N75A 2LKSA 3Q0WA 4H4KC 1QJY3 4E4ZA 2YSRA 1JUIA 4QD2A 1H4GA 2V26A 3ZO0B 5CADA 3WCSA 3QACA 1JXSA 1MBKA 1YLLA 4U0WA 1W8TA 4D1QA 2HH9A 3CJIC 2O7OA 3O8GA 3DP7A 4GMP3 1CZTA 2V7FA 4AI0A 4ESBA 4FFHA 4WM7B 2X5IC 1ALYA 3RKWA 2Y26A 3HQUA 4Z6YA 4TTGA 5EEHA 3LSPA 4AXOA 2G9WA 1QJY2 2R30A 1DP7P 2VUDA 1FPN2 3GBWA 4WVZA 2JDMA 5GLVA 1W0OA 3P3NA 1DPRA 1JZ4A 3ZCOA 2ZEYA 1YWKA 5KHHA 3CESA 2D3PA 2J1AA 1RUD3 2ENRA 2VL8A 1W3VA 3KZZA 3GEZA 2OXBA 4C2TA 4KBZA 1Z0HA 1PVC3 5EJ3A 5J37A 3ZYRA 1KEXA 2YU2A 1YUDA 3LGRA 4G4FA 4XZUG 3JRDA 2NMNA 1V6OA 4QAWA 3NJZA 4QWQA 5FFXA 2XC7A 1RNLA 2DFFA 3L2CA 2YBPA 2DDAA 3CZ6A 1R093 3EHKA 1P9QC 2YPRA 3J81Z 2KP6A 2R4GA 3I3BA 1VP6A 4HPQA 3T2PA 4ASKA 2XVGA 3FM3A 2R7EB 2R7UA 2M45A 1COV3 4DOUA 3A22A 2HVRA 3E1F1 5B1BH 4IE4A 4ES9A 1ASJ1 1NG7A 2VCCA 3T8TA 1F15A 1WZXA 4BQ2A 1UZYA 1GQHA 3WNMA 1PGW1 4H55A 1P2FA 1CD3G 3KZYA 3BOQA 5JHFA 4B4PA 5LW9A 2AS5F 1A8DA 5JXGA 3U1XA 2C6SA 5IWFA 1NK3P 3F9KA 5ICCA 4DFSA 1L0OC 5F3EA 3VYSB 4GWNA 4KN7X 3HUGB 1LDKB 3SEZA 1B35B 5LGUA 4NHLA 2WNVB 3BDDA 5J40A 2IXLA 1YXWA 1GKBA 1WVRA 2O8XA 2XVKA 1OVPA 3DPRB 1LEBA 4L5EA 3TN93 3MD2A 4A3CJ 1JT0A 5J36A 3VZOA 1ODMA 3OJBA 4CCKA 1YFUA 4GDFA 4CUGA 1WMDA 2IS4A 2QVSB 3LA3A 3NJYA 4AEKA 1MGTA 3C2BA 4LKEA 3JSPA 3I4NJ 2JDAA 1NYWA 1ND2A 3T0DA 3JCUC 1SBFA 3I2FA 1Z0XA 4UB6C 1OFNA 4JHTA 5E17F 1ETYA 4K1YA 4WXHA 1W0TA 1D2QA 2A5WA 1YQCA 3CMMA 4G7OF 5BNQA 4LKSA 1Q8VA 5DG2A 2VJIA 1STMA 4MG2A 2LY2A 2PA7A 1X1AA 3KWVA 1O57A 1R9TJ 1QDCA 1VB4A 1NK2P 1QVTA 3I0TA 3OUJA 2ETEA 5C4WC 4AL9A 3M3EA 2A6WA 2RAEA 1OCZH 3MZHA 5BPIA 4WVWA 2RDNA 2YMZA 5DV5A 2DU0A 4BQNA 5F1JA 4KDPA 2D2WA 4ONUA 2IXCA 2CUFA 4CEYB 2VBZA 3BCAA 5FYSA 4UT5A 4FQGA 4HK9A 2BVLA 2P6SA 2PN6A 1GDTA 5KHJA 2GXBA 3RQ0A 5BNPB 4XABA 1WGPA 5C3RA 1XMKA 2ZO4A 3VBSB 4MYEA 1WCMJ 1JT6A 1G8WA 1Y43B 2VQ0A 1QU3A 2BWCA 3AKQA 5CVVA 3LDKA 3IL2A 2EV5A 4LGWA 1ZG1A 2P8TA 4Q4W3 5BPXA 2DDUA 3U10A 4CU9A 2UWMA 4IERA 4B48A 1OLME 4CCNA 3IPVB 1YE9A 3H1MA 3I2KA 1BR4A 4QPIB 2XWBB 1IPJA 2COBA 5FUNA 5A3MA 4XTMA 5I0DA 2X09A 3GF6A 4YW7A 1JUMA 1JUHA 1LE8A 2E71A 5JIAA 1U5XA 1OMIA 2W2IA 2DLLA 1REPC 1MBHA 2K86A 4CDXB 3BWGA 2P34A 5F0CA 2BY3A 4OIPF 1OD5A 4Y1VA 4P5YA 3T1BA 1SMYF 4LIUA 1HBXG 4UFKA 5J1XA 4C91A 1K5MC 4BDZA 4IHVA 4BHCA 2ZS6B 3UJQA 2D1VA 2M1BA 2XHKA 4B3NA 1YJLA 1BC7C 3Q8EA 5F0HA 4W1UA 2ZA9A 4CDWC 2DOAA