2RM21

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 43
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rm2100
1RUJ3 1AR71 1PO22 1RUE1 4Q4V3 4WM7C 1Z7S3 4QPIC 3S6PA 1BMV1 2ZAHA 4AEDC 1AR92 1C8M2 1Z7S2 4YVWC 4IV3B 4FTEA 1VBE3 1R1A3 1FOD3 4FSJA 1FMD3 5ACA3 4N53A 5C9AB 1RVF3 1RMU2 1R1A2 1FOD2 5FMOL 4CDWB 5K0UC 5ACA2 1AYM1 1TME1 5BNNB 1RVF2 3VBUB 1HQNA 1V9U2 5L7OC 4JGZC 3ZFFC 1H8TC 1ND2A 1PIV3 2WS93 2RS52 5CFCC 1ZBE3 1TMF2 1NCRA 1RUI3 4Q4V1 1ZBE2 4JGYB 1C8M1 1Z7S1 1BEV3 1NCQA 4N53B 3VBSC 1AUYA 2HWD3 3JD73 5C8CA 5D8AA 1RMU1 1R1A1 1FOD1 2HWD2 1B35B 2Y26A 5ACA1 4RS5A 1VB4A 2FZ1A 3JBG3 3JD72 1RVF1 5J96B 1X33A 3JB4C 3VDDB 1QQP2 4FTBA 3ZFEA 2HWE2 2RR12 1HX6A 2XPJA 3DPRC 4PDWC 4CEWA 5DDJ3 3JB8A 5CFDA 5LK7B 1PIV1 2WS91 1ZBE1 2RM22 4WM8C 5D8AB 2X5IC 1OOPC 5BNPC 4RS5B 1NA1A 1EAH3 4YVSA 2HWD1 1MQTA 1RUC2 3JD71 4CDQB 3J8F3 2WFF2 1HXS3 4NWWA 4CEWB 1AL0G 4WM7A 5A32B 1HXS2 4QPGC 1OPOA 1RUG3 1RB8G 1RUE2 1K5MB 2R063 2RM21 5GKAC 1NA1B 1BBT3 4YVSB 5FOJB 3VBHC 2WLPA 5K0UA 1ND3B 1ASJ3 2XBO3 1EAH1 4RQPC 1CD3G 5L7OA 3ZFFA 4Q4W3 1ASJ2 1RUH2 1H8TA 4GB33 3VBRA 4Q4W2 1QJU3 1HXS1 1HRV3 4GB32 4N43C 4RR3B 1QJU2 4LLFA 2PLV3 1VBA3 1RUJ2 5K0UB 4Q4V2 5ABJB 1VBD3 1BBT1 4CEYC 4EJRA 1VBD2 2DF7A 1VB2A 1VBE2 4GH4C 3VBFA 5A33B 1FMD2 3VBRB 1SMVA 1ASJ1 1RUH1 2RS13 2XBO1 2MEV3 3ZFGC 3CJIC 2HWC3 3DPRA 4PDWA 4Q4W1 2RS12 1VRH3 4GB31 2HWC2 1ZBA3 5BNOA 1QJU1 1HRV1 1VRH2 1RUJ1 2X5IA 1PIV2 2WS92 1OOPA 2R043 5BNPA 1QJZA 1NOVA 4CDUA 2PLV1 1POV3 1RUI2 3VBFB 3M8LA 2R042 1BEV2 1VBD1 4IV1A 4IV3C 1AL23 3FBMA 1VBE1 4NWVA 1FMD1 5C9AC 2WZR3 1ND2B 4CDWC 5BNNC 5JZGA 1QJX3 5BNOB 2RS11 3JBG2 2WZR2 3VBUC 2MEV1 1NCRB 1MEC3 2HWC1 1R083 1QJX2 1NCQB 1AYN3 4CDUB 1VRH1 3LOBA 2RS33 4GMP3 1EV13 3NAPA 1ZBA1 4IV1B 2IZWA 5DDJ2 1DDLA 5C8CB 2RS32 4JGYC 1EV12 2HWF3 1RUI1 2GSYA 2R041 1COV3 3IDEA 1D4M3 1BEV1 1IHMA 4RQPA 2R073 2RMU3 1POV1 1RUF3 1VBC3 1COV2 5JZGB 1D4M2 2R072 1EAH2 5C4WA 4Q4Y3 1RUF2 3ZFEB 1B35C 1PGL1 1FPN3 4CDXA 1NY72 3JBG1 2WZR1 5CFDB 3J8F2 3VBOC 4QPIA 3VDDC 3NAPB 1RUD3 1QJX1 4AEDA 4YVWA 2BBVA 1RUD2 1AYN1 1RUG2 5DDJ1 1A6CA 3TN93 4CEYA 2RS31 4GMP1 1EV11 1MQTB 2R062 4RHV3 1QJY3 5D8AC 1BBT2 5C4WB 1RHI3 4CDXB 2HWF1 4RS5C 4RHV2 1COV1 1D4M1 3CJIA 3ZFGA 2R071 4WM7B 2RMU1 1RHI2 1RUF1 1VAKA 1X36A 4QPIB 4JGZA 2XBO2 4AEDB 2FZ2A 1POV0 4CDQC 1NY71 1VBB3 5CFCA 4Q4Y1 3J8F1 4YVWB 4Z92B 2GH8A 4CEWC 1VBB2 4CEYB 5AC93 1F8VA 1HRV2 3VBSA 1RUD1 1AYM3 1PGW2 4Q4X3 1RUG1 4Y5Z0 1K5MC 4IV3A 2R061 1NA1C 2PLV2 1VBA2 4YVSC 3TN91 5C9AA 5L7OB 4JGZB 3ZFFB 5J98B 1H8TB 4RHV1 1QJY1 1PO23 4CDWA 4GMP0 5CFCB 1ND3C 1RHI1 3VBUA 1AR93 1C8M3 2WWSA 1C8NA 2BPA2 3VBSB 2MEV2 2HWB3 1VBB1 4WM8A 1RMU3 4JGYA 1PO13 1PGW1 2HWB2 5AC91 1AR63 4RR3C 1ZBA2 1V9U3 1PO12 4Q4X1 1VBA1 5ABJC 1AR62 2ZTNA 2RS53 1HRI3 1B35A 3DPRB 4PDWB 1TMF3 1AL22 1HRI2 1PO21 3VBOA 3VDDA 4QPGA 1PGL2 3VBRC 4WM8B 1M06G 1AR91 1OHFA 4FTSA 2X5IB 1OOPB 5BNPB 1AR83 1W39A 2HWB1 1MEC2 1R082 1NG0A 3VBHA 2BFUL 1AYN2 1AR82 1PO11 1QQP3 1AR61 4N53C 4RFT0 2HWE3 2RR13 1F2NA 4Y4YA 3VBOB 1GFF2 1V9U1 3VBFC 4QPGB 2HWF2 4CDQA 1AL21 2RS51 1HRI1 2RM23 2RMU2 2QQPA 1VBC2 1TMF1 5A32A 4N43A 1ND2C 4Q4Y2 4SBVA 1FPN2 5BNOC 3VBHB 1R093 1K5MA 1NCRC 5FMOS 1RUC3 1MEC1 1NCQC 1R081 4CDUC 1R092 2WFF3 2ZZQA 4RQPB 1AR81 2TBVA 4IV1C 5C8CC 4GH4A 1ND3A 1PVC3 3TN92 1QQP1 2VQ0A 1AR73 1QJY2 1RUE3 3ZXAC 2HWE1 2RR11 4N43B 1PVC2 1VBC1 1CJDA 5JZGC 1AR72 3ZFEC 1BMV2 4BCUA 1FPN1 5CFDC 4RR3A 2BFUS 3NAPC 1R091 5ABJA 4GH4B 5AC92 1RUH3 1TME3 2BUKA 3HAGA 1RUC1 1WCDJ 3ZFGB 3CJIB 2WFF1 1AYM2 4Q4X2 1E57A 1TME2 1MQTC 5C4WC 5A33A 1PVC1 4CDXC 5BNNA
chains in the Genus database with same CATH superfamily
3SNMA 4AI9A 5CBLA 2D3SA 1UWWA 2O1QA 1PO22 3USSA 1V6OA 2JWPA 3OG2A 4IE0A 4QPIC 1NQJA 5I0RA 3S6PA 4W4ZA 2D93A 5F5QA 3WDVA 3ZKUA 2Q4SA 3M3IA 1DQ2A 4CU9A 2GNMA 1AR92 1Z7S2 4YVWC 5AVPA 4QGMA 1JYCA 2JENA 4FTEA 4H55A 1LULA 4Z2AA 2Y0OA 3RNSA 2YGMA 1OQEA 2YBSA 3U11A 3T2OA 1ALYA 1L7RA 3M4FA 2WINB 3HNYM 4DQAA 4BE3A 3IPVA 3LIHA 2ZMNA 3K2OA 1H30A 1X9PA 3NJYA 3FE5A 4HFSA 2OA2A 5IUQA 3I8TA 5CNAA 1HQNA 3A0KA 2FCTA 1V9U2 5DUVA 4NUBA 4CCMA 1UOBA 2ZMKA 5JPNB 2YFUA 3CDZB 2EIBA 2VTFA 5H9PA 3K4AA 4XE9A 4KU7A 4ZU7A 4AFDA 3GF6A 4AFAA 3FC0A 5FO8B 3NO8A 2P34A 1VP6A 1LGBA 1UOFA 2ZAAA 5FTTC 4EV0A 5EJ1B 1BK1A 3TEZA 4ZONA 1RUI3 4I02A 1Z7S1 5JOXA 1NCQA 3WDXA 1B09A 2B7YA 2WDBA 3VBSC 2ES3A 3AK0A 3DKQA 3J26N 3NKTA 1J83A 1YQ8A 3OBZA 3SMHA 4G3YC 2B8MA 5GZCA 5C8CA 5D8AA 3GBWA 3WUCA 1HKDA 2JX9A 4DUXA 4W6XA 1JHNA 4HKOA 3SCHA 4AQTA 4D6SA 5JSPA 1HQLA 1FX5A 4LIVA 2VQTA 3I2JA 3MW2A 4MXVA 1C57A 4B4PA 3UGGA 4BQWA 2A73B 3EB7A 2DVDA 3PU3A 3S0MA 1EYBA 2YHJA 2ZABA 3PUQA 4XUOA 5JLVA 1DQ6A 3ZFEA 2HWE2 2JG8B 1IPSA 3VV1A 2YFZA 5LA9A 5C3RA 3RDIA 5DDJ3 2UURA 3Q8AA 1UZWA 4XFAA 2VQUA 1OF4A 4C91A 4LO4B 1X82A 3POBA 4UYBA 4Y3OA 3FHIB 1CIYA 3B9CA 5KC5A 5DAPA 2ZGPA 5A80A 5JUVA 1W90A 2Q1FA 1DQ5A 1H0BA 1MS5A 2OUHA 2UY8A 2P37A 2P1BA 2Z69A 5FREA 2CYFA 4C0BA 1XNTA 2RV9A 4R52A 1P8JA 1RUC2 2PELA 4XHXA 3NQHA 4Y24A 3VHNA 2VBBA 3ZXEA 1BZWA 2WNUC 4HT1T 3N3HA 1DZTA 3W5NA 2W95A 3LDKA 4S2HA 1QOOA 5CIRA 1NXMA 4C90A 3UV9A 2VJXA 3H0OA 2ZMLA 2I07B 3VZKA 4LO6B 2BZDA 2VE1A 2RE9A 1HXS2 3WP6A 4COUA 3KVAA 4ATEA 2E63A 1RUG3 5J36A 1KQRA 2VQAA 4BM8A 1K5MB 2XQRA 4L99A 1V6KA 2Z5WA 1JBCA 3FLTA 4JTNA 3WP3A 1J3RA 5IVCA 2B46X 1O3TA 4QKNA 1OURA 5F32A 3SHRA 1SDDB 2A3YA 3NNFA 3BB6A 2C24A 1F5FA 5FOJB 4Z1VA 2IXKA 1CAWA 3JCIA 4BOWA 3O1UA 1G86A 1AX2A 1H4HA 3WW4A 1ND3B 3IB3A 1O4TA 2XBO3 1QXPA 5FPVA 4HZFA 3OGRA 3ENRA 1I5ZA 4CU8A 3IDCB 1CD3G 2QQOA 4FAHA 1OUSA 1L7LA 3WOGA 3OTFA 4E4HA 4QKDA 1NX9A 2IVJA 1BQPA 2W2IA 3VB9A 3N7KA 4XIOA 3WF3A 1F5JA 3I2HA 3PDQA 1PX3A 1HXS1 1YI9A 2DU0A 3E6BA 3KLSA 3ZXFA 3S30A 2DCTA 3EBRA 4GB32 4ZZ8A 5FYVA 2W1WA 3WLUA 1XXNA 4XETA 1K12A 4KH9A 2BOJA 4LO7A 1WD4A 3RZJA 4LKFA 5A7SA 4UW5A 2BVBA 3PTRB 4KNCA 5ABJB 3LGRA 4LR4A 4Y1VA 3I2DA 5F6KA 3DKWA 2XJUA 5CG9A 5FYSA 4EJRA 1VBD2 4GWMA 4IE7A 4XFCA 4A7YA 4CA9A 1W6NA 4JQTA 5TSWA 3IDBB 1QXJA 1GZCA 3H9AA 4GH4C 3UL2A 3VBRB 1UU6A 3USUA 2NM1A 5A3NA 3BPSA 3ZFGC 2W87A 1IPKA 3DPRA 2JDKA 2GZWA 3WVJA 4LMFA 1VRH3 3AKPA 1PNFA 3GDBA 1BHGA 1ACCA 1LECA 2C1FA 4GB31 5GLUA 2VZUA 1R64A 1ZBA3 2CNAA 1HB4A 2W1SA 3DYMA 3W20A 4HLTA 1NLRA 3PVBB 4FPJA 2R043 4YGCA 3KWVA 1W6OA 4CCOA 2XGXA 2JDUA 1JOPA 4UFLA 5FYZA 2HEWF 2PLV1 3AYEA 3LPGA 1POV3 3ROUA 4Q0PA 3LB9A 1SG3A 2VZPA 1RUI2 4NAMA 3NV3A 1DP0A 3IPVB 3M8LA 3VBFB 4B3NA 4DY5A 3A0NA 1VBD1 1MR5A 2GDFA 3CIHA 4M01A 3FFQA 4I0WB 4IL7A 3TAYA 3WP4A 2J1UA 1A8MA 2CU5A 4JHZA 1GUIA 1QWRA 1TG7A 2E9QA 3HD8B 4CDWC 4D3WA 2OKXA 1OBNA 4UAPA 1LU1A 1NXD1 3VN4A 5BNNC 1QJX3 5BNOB 3V0BB 4BH9A 2G9FA 3VBUC 2A6YA 5C8WA 4CXYA 4XTPA 1EPZA 4IESA 4XILA 3WG2A 4AG4A 5ERLA 1NCQB 3BALA 3I3QA 2XOMA 4CDUB 5FLJA 1PK6A 3ZSMA 2DVGA 2HYKA 3KVBA 4GMP3 5LY2A 3VKMA 3GZAA 2BNMA 4IV1B 3H1MA 5DDJ2 3W59A 1JW6A 5C8CB 2RJLA 4AOCA 1RUI1 2VNOA 4PIXA 2W94A 2EA7A 2YC2A 1D4M3 3C7FA 2YY1A 2ET1A 1WMFA 1DGLA 2Y6GA 1LJ7A 4TLFA 2RMU3 2Y33A 4LBOA 3UETA 2B45X 5EYYA 2W5FA 1W6MB 5JZGB 3K77A 4OVEA 1J58A 4WVMB 3MICA 3O7OA 1Q43A 4Q4Y3 3ZFEB 1B35C 1PGL1 1FPN3 2YC0A 4PIZA 1OD3A 2OVUA 3I3BA 1D2QA 4XXAA 1JHJA 1UPIA 2WJSA 4QX2A 5FZ4A 1Y7BA 1S0GA 4CZSA 4K20A 1KXGA 3NAPB 4OLLA 4E27A 1RUD3 3EJKA 2O14A 4Y26A 5FYUA 4AEDA 3O1RA 1VAVA 5F5CA 3ZMNA 2P17A 2TUNA 1S2KA 2BBVA 2QQKA 2QTWB 1W04A 3PVEA 1BK0A 1UKGA 1RUG2 5DDJ1 2XJRA 3U78A 4CEYA 4QGNA 4QB2A 3TNQA 2Z2SB 4QX5A 4D6QA 2B4KA 3PVOA 2XVLA 1LOFA 5D8AC 3O1OA 5FKCA 3WZ1A 4LIUA 1WBLA 4FFGA 4FOYA 4CUBA 4FPYA 4UBGA 4RHV2 1UW8A 2VOXA 4XCAA 2XH6A 2QQWA 4TLGA 2DVAA 1RHI2 1X36A 3WQ0A 4CCJA 5D21A 2FDKA 2XBO2 3BCWA 1OFNA 5HCFA 4BHPA 4CRQA 1VBB3 3A21A 2VCCA 4IW3A 1VJ2A 2D43A 3OD0A 3QACA 4H3WA 5F9TA 1BLZA 5D2AA 4AEMA 2VCBA 5F3EA 1WW4A 5KR7A 1UZ0A 4FOQA 3KT7A 3T2PA 4GWNA 3NNJA 3WDTA 1BCXA 2AREA 1GWLA 1W3XA 1S0EA 1PGW2 1F35A 1RUG1 2EALA 3HMYA 3I97A 1CAWB 4NO4A 3DYPA 4UW4A 4NHMA 1PVXA 4UFHA 2EF6A 3P6BA 4K21A 4XF3A 2AH2A 3J9SA 3TN91 4DOUA 1A8DA 5C9AA 1V0AA 2VOTA 1DLLA 4IUGA 4RHV1 3H7JA 4FXGB 2XJPA 2B9UA 2VZOA 5H9RA 1RHI1 4CCKA 2ADEA 1JYNA 1Q8SA 1C8M3 2GC2A 1A34A 3AKSA 4BJ0A 4FPHA 5CG8A 4NHKA 1V6LA 2VZRA 4CCEA 4ISQA 1K42A 3IBMA 2R30A 4M3CF 5KHHA 3IMMA 5CKMA 2BNNA 1AXKA 5T52A 1XE7A 4IE5A 2R1DA 4LHSA 3WEZA 4FBFA 4JGYA 2WKKA 3AFKA 3IDAA 1PGW1 5H9SA 5KBFA 3I59B 1ZBA2 5FAXA 1JTZX 1OLMA 1LHVA 1PO12 3OGSA 3BGAA 3OD4A 1AR62 5JMCA 1CESA 1BVVA 2UYAA 2ZGRA 3URFA 4E4SA 2ZTNA 1G9BA 1DZRA 2X8KA 2JB8A 3DPRB 4AVCA 3KSCA 4J25A 4XJZA 3RFRA 1DZQA 4MHRA 4TYSA 4EN9B 4RD7A 1RUNA 4KWKA 3E5XA 1GP5A 4CVUA 5AFBA 3VBOA 2WL1A 3SISA 1VLNA 2FMYA 1FXZA 4EZHA 2XLAA 1SEFA 3GHNA 5FOBB 3OJBA 5JCTA 5T3NA 1UAIA 5IK4A 1M06G 4UT5A 4NAOA 3WX5A 1I5PA 1SLIA 2J42A 5FZDA 4ZU4A 4XFFA 5L9VA 4XURA 2XB6C 5KXCA 2HBTA 4Q26A 2DCKA 4JRAA 3P5BA 3WP5A 1NG0A 2E7TA 3VBHA 3RZLA 4MG2A 2BFUL 3I3MA 5FPAA 1V6JA 2OYZA 1AR82 1PO11 2LS6A 1QQP3 1AR61 3T4VA 4PBOA 5LW9A 5LBEA 1HV1A 3WNXA 5JXJA 1F2NA 1GFF2 1H2KA 4MGQA 2EAKA 4MSVA 4QPGB 3F95A 1DU3D 4GIQA 2HBUA 2N7GA 2FMDA 2RS51 2QVSB 3LE0A 2RM23 4MO3M 5J3UA 2RMU2 1WLDA 2W08A 2QQPA 3BPZA 5GLTA 4AQ6A 4A3ZA 1KFUL 4E2SA 1ZRDA 4N43A 1ND2C 1YXWA 2J1AA 1IS4A 1PK6B 2VD7A 4Q4Y2 4S2DA 1FPN2 3KM5A 1YUDA 4AI0A 2WLQA 1IGOA 3LEKA 3LA2A 3PURA 5EXOA 4EROA 4AI8A 4ARYA 2XMLA 4AR2A 2CV6A 4FPOB 5H9QA 3VZOA 1KS5A 1MS4A 1R092 2WFF3 2DURA 4MGYE 5DPNA 5CB7A 5FZKA 1AR81 3WSOA 1SACA 1D0HA 4OI0A 1CAUA 4C8DA 3E97A 2XL9A 4FPGA 5C7GA 2C5DA 5HCBA 1VR3A 3W21A 3TYJA 2DUQA 3WNOA 4EYUA 3JZVA 3SCFA 4ASMB 5FUPA 1G9DA 3H3ZA 4GJZA 3PMEA 2PHFA 2WZPP 2RR11 4B7EA 4C1XA 3CZUA 4DXZA 2LUWA 3RG0A 5J1XA 4LEJA 5LBCA 1OA4A 4JX0A 4Q1PA 5LRSA 3M70A 1AR72 3H3LA 3PIJA 1ULDA 2CGOA 3N9MA 5ISLA 4FPLA 3PIGA 1W0PA 4J1XA 2Q8OA 5LA1A 4Q8KA 1XSRA 1FPN1 3RJ2X 4GJYA 2X29A 4L8QA 1HB1A 2QE3A 3K75B 4RR3A 2BFUS 4D8MA 3BU0A 4LOSA 5JXHA 3H8RA 5A6YA 1TNRA 2AC1A 5BNQA 2D6OX 2NYYA 3T3YA 3W9AA 4IQPA 1R091 2RJ2A 2FBEA 3MEPA 4JHTA 1W9YA 3OBRA 2A6WA 5JSOA 2NZ9A 1F4HA 1W6QB 4YM2A 4R9BA 3MLLA 5I91A 1J59A 3BUCA 5CAZA 1WKYA 2W0XA 1KJLA 4FVVA 2YROA 1D0GA 3HN1A 4FAGA 1LU2A 1MS8A 4KGQA 2GH2A 3PMSA 5A33A 4A4AA 3FFZA 2VXJA 2VU9A 3LCPA 2W1UA 3LDBA 4NIGA 4LOTA 5E6HA 1UL9A 3WNNA 3BIEA 2NP0A 1RUJ3 2WQ4A 1AR71 3AP4A 1MZFA 1Z7S3 3WT3A 2P6CA 2ZX1A 4G9SB 2FCVA 3RVHA 2YPJA 2JE8A 4AEDC 1ZRCA 1C8M2 1OUXA 2LTNA 4FFHA 1JN2P 4HANA 2J1EA 2QJVA 2G1MA 1E5IA 2VO5A 2HJIA 3C7HA 4IEXA 4R8HA 1FMD3 2PFWA 1VALA 5C9AB 2DYCA 2QQIA 2W92A 4KWJA 1T2XA 3SLIA 1FOD2 5FMOL 1UX6A 2PAKA 5FYHA 3THTA 3ECQA 1CPNA 4IEPA 4OZOA 3WW2A 5K0UC 3SKVA 3ZR6A 3GZUC 3OPWA 2YU2A 2D7FA 1YYNA 1WMDA 2V72A 1UYXA 3AKQA 3H1WA 1CZVA 1WLTA 1ZX5A 2LW8A 3GALA 3LA7A 3CQOA 3MIHA 1HIXA 2VCAA 1H8TC 3AJYA 4OHWA 4NIAA 4AHWA 5F1RA 1JZ4A 2PHWA 2QDRA 2A75A 2XDVA 3NWKA 1Q3EA 4BK5A 1FV2A 4R9CA 2JKBA 5FYIA 3O1PA 3UGFA 1NCRA 5FUNA 4Q0VA 4XMAA 2JG8A 3VHPA 3HQRA 4JGYB 1C8M1 1W03A 1GLHA 3RZMA 4OFGA 5LBFA 4AGRA 4N53B 4XQWA 3OBTA 1I6XA 5CKNA 3ASIA 1W6PB 1UY0A 2PHLA 4CP2A 3KQ4B 4AHZA 4AAPA 2WC2A 3RZZA 2DFCA 2VUJA 1W8UA 5A7WB 2BYVE 1FOD1 1WW6A 1ULFA 2HWD2 2GMMA 2R7EB 5IT6A 2P3JA 5A3MA 2FZ1A 3JBG3 1UO9A 2QQJA 3JQWA 5J96B 3I2FA 3PJYA 1CIWA 1X33A 2VG9A 5IVFA 5IYYA 5GM0A 1QOTA 4NMIA 1QQP2 2PAMA 4XC9A 3N9OA 1HX6A 2BGOA 4JAAA 4K9SA 1SDWA 4UFMA 1DGRA 2C9AA 2HH9A 4PDWC 4P5YA 2WN3A 4UF0A 2AYHA 2E33A 3JB8A 3VD3A 1YCIA 2C6SA 4PJYA 1LHUA 1PM7A 2LM3A 3VZLA 1PIV1 2WS91 5LA2A 2YDEA 1AJKA 1J84A 1YHFA 2RM22 2WNVC 3RYRA 3ZYFA 2A6VA 5I0SA 4DEQA 5HPOA 3RZHA 1NUKA 5APAA 4TZDA 5K8SA 5JOYA 1LRHA 2VECA 3BN6A 1OOPC 3HBKA 1OSGA 3I3DA 4RS5B 3WG1A 1I1EA 4CU6A 3MIBA 3AP6A 2EICA 3DYOA 1W9TA 1GNHA 2EXHA 1UIJA 2HWD1 4QX7A 4ES8A 3V65A 1RITA 3VZNA 2BJSA 4FPCA 2V73A 4Y33A 2WFF2 2JDMA 1ZA7A 1HXS3 5DG2A 2GNTA 1CONA 3KT1A 5HV0A 3AC0A 4WM7A 5GZGA 3ZR5A 5G05L 5IK5A 4FQ4A 3H50A 3O1SA 3WW3A 4Q27A 1S1AA 4YW6A 2ETEA 5FPBA 4NIHA 3IN9A 1LHNA 4MLOA 3MIEA 5DAWA 4QHBA 1RB8G 4DPNA 3NNGA 4DY3A 1YJKA 3PVNA 4Y5TA 5FMDA 3H1YA 3Q8CA 2FCUA 2RM21 5FYYA 2VZSA 1UY2A 5GKAC 1IKPA 2VXRA 4XJUA 2B9VA 4E8CA 5HV4A 1G6NA 5KXBA 1JI6A 3O0WA 1CAUB 2D5HA 4X6QB 2E7AA 2WLPA 5DAQA 4ZU5A 3VBHC 3D8CA 4UW3A 1IQDC 1VRBA 2P4EA 3MF6A 5IVVA 1O3SA 1XYOA 4LE4A 3KCYA 5DAXA 4W65A 3WHTA 4RQPC 5J09A 5L7OA 1SLBA 1UY1A 1O4YA 4LXLA 1UU5A 2ID4A 3WINE 5EIYB 4GB33 4K1ZA 3E5UA 4FPKA 1N3PA 3WG3A 3VBRA 1O59A 4RGGA 1ENXA 4I01A 1QOSA 1ZRRA 4N43C 3ETPA 2DFBA 3NJVA 1UMHA 4LA3A 1QJU2 4RR3B 5FY4A 5IFPA 1IKQA 2PLV3 2JKXA 1VBA3 1RUJ2 4HN0A 4PIYA 4Z82A 3KV5A 4AEKA 3D0JA 4XFBA 1VBD3 3ILFA 1QNWA 5KHKA 2W46A 1G8WA 4JRLA 4PHZA 1LENA 2ZX0A 2D6MA 1LOCA 2B5HA 4DUWA 1JU3A 3WNMA 2DF7A 1XRUA 1VB2A 1EUTA 1BXHA 1AHSA 3BIWE 1URXA 2NMOA 3BYWA 3CBNA 4HOOA 4QD2A 4Q2FA 5GJ6A 2F4LA 3VBFA 2VTXA 3B7MA 1IG0A 1HN0A 1FMD2 5FXWA 4D7YA 1DGRN 5A33B 1FATA 1QJFA 2GN3A 1JS9A 4C0HA 3ZSLA 4YGDA 4XBLA 1XBFA 5GALA 2RDSA 4F3JA 4XF1A 1JU4A 2RS12 5FK8A 4QMAA 2A1XA 1TEIA 5DAVA 1ZZ6A 5FLIA 4EN7B 3IMNA 1QJU1 1HRV1 5A3LA 5BNOA 2HYXA 1FT9A 4MGKE 3V0BA 3AB0A 1QH7A 3BODA 1RUJ1 2X5IA 1YQ6A 4BMBA 5BNPA 3Q8FA 5HXMA 1IQAA 2KA3A 2RVAA 4QPYA 2WFPA 2ZEYA 1U12A 4CDUA 2CL2A 3C7GA 5T50A 2LROA 1NYWA 1LOBA 4RGKA 3CKHA 2WUHA 3GCXA 4IV1A 3ZN4A 2YUEA 4NIDA 3BTAA 5CADA 5I93A 4NWVA 1FMD1 4CCLA 1XQNA 1LOGA 5F5AA 2YG0A 3MO4A 5FPLA 1W6MA 5JZGA 3AM2A 3MBWA 2RS11 3JBG2 3KF3A 2MEV1 3MV01 2ORXA 1AJOA 4I3GA 4WVMA 1NCRB 3RWKX 4F83A 5C3QA 1MEC3 2GMEA 1AXYA 4RSUA 2WN2A 3BTXA 1JUIA 3LA3A 1OVPA 5I8TA 4FT8A 1K3IA 3POIA 1UKRA 4KL1A 2Q1ZB 3NAPA 1S0IA 2J22A 2Z42A 5T5JA 1D4VB 4DXRA 2YC4A 4PLMA 1ZZ8A 1EV12 3A22A 3S5AA 1H6XA 3LD8A 3NJXA 4K40A 1H6YA 4BQ4A 1IHMA 1LEDA 3AMPA 4FXKB 4AHYA 3MW3A 5EZWA 5FFOC 4RA0A 3AKRA 3KMHA 4HSLA 2WWUA 2AZ5A 1COV2 3RYKA 3FBYA 4AFMA 4EWDA 1D7PM 1ZA4A 1ZZ9A 1QNYA 2R072 4KG8A 4L2NA 3BI3A 3JQXA 4OHXA 4UFIA 4BMEA 1GNZA 4UF0B 3JBG1 4UFJA 2D3PA 3MGUA 3B01A 2BV4A 3AMHA 4ZPIA 1I9RA 1SCRA 1YJLA 2XJQA 2Y0IA 1ZYBA 2VUDA 4LPLA 4QQPA 2JG8C 3VDBA 5JR2A 4DZGA 2EXJA 2VC9A 4OMDA 3EMRA 3MFCA 4LQRA 2B42B 2VOVA 3WV6A 3WD5A 4D69A 3QH6A 1QJEA 1HN1A 4JC1A 3ME2A 3TN93 5I0UA 2ATFA 4XF9A 1F4AA 4XW3A 4AI2A 2WO2A 1EV11 3AZYA 3VKOA 4RHV3 2CAVA 2NMNA 5C4WB 1NE4A 2XJSA 2JDYA 1RHI3 4JV4A 3CHXA 2HWF1 1DIWA 1COV1 5F3GA 2D97A 3CJIA 3QH7A 4DMIA 4YLZA 2R071 4WM7B 2CAUA 4YM1A 3JU9A 2RHPA 3ZIXA 3UT0A 2QUOA 4QXHA 2B39A 3WDYA 2XJTA 1MS3A 2ZOEB 2OIIA 4I3PA 1NT0A 2GH8A 1PZ9A 1WZXA 2JDPA 4MGIE 3RPQA 5EJ3A 1D2SA 4CP1A 4XOGA 1S55A 1NLQA 1REDA 3IWZA 5FYMA 2XKPA 5C70A 5CVRA 2Y6FA 4JVAA 3OPZA 4M00A 4INDA 1W2UA 1T6BX 1GOGA 1CZTA 3LFIA 3QOPA 1K5MC 4TSVA 2WO7A 2MHFA 3ELNA 2QZ3A 3KCCA 2IFRA 3NVCA 4FP2A 4IV3A 5DG1A 4A42A 5F37A 1RTVA 3OSDA 2PLV2 4LHLA 1UD1A 4QU1A 2WQZC 3N7JA 1VBA2 4A6OA 3IAQA 2FDHA 1Y9QA 5IAVA 3HWJA 4DIQA 3I59A 5L7OB 4JGZB 5L9BA 1QJY1 1UIKA 2JECA 4BK4A 5CFCB 5JXGA 2BGPA 3O12A 5FLHA 1DCSA 1ND3C 2WZEA 2G9GA 4FFFA 2P3IA 3LDRA 5F39A 4XEZA 3V64A 4PF5A 1JYXA 4HK8A 5FBJA 2GC1A 3S57A 1AF9A 3QLQA 4A45A 4AVBA 3ABZA 3F2ZA 1QH6A 3I54A 5EJZB 3WR0A 1PO13 2HWB2 2AENA 4H2AA 4S2GA 3T08A 1AR63 2WO3A 5AC91 2VULA 1BKZA 2A70A 3N9QA 3OUHA 4K8FA 4LKDA 4DB5A 4GKXA 3EQEA 5DMYA 2XLFA 2W91A 4OI4A 4AVTA 1JYTA 2X53S 1VBA1 4LBJA 5ABJC 4HN1A 3K51A 3K4ZA 4YW2A 1LHWA 4Y4RA 1JUHA 1OD5A 2RS53 3WQ7A 1J1TA 3FX3A 3GXUA 3R05A 5FP4A 2ZA9A 2XONA 3AYDA 4MUVA 4OUSA 3I3EA 5DQ0A 1EP0A 2CWMA 3JXSA 2XG3A 3HPNA 4QDRA 4CSWA 4YGBA 1HRI2 3AMQA 3LOIA 5FJKA 3LSEA 2DV9A 4MOAA 3VDDA 4QPGA 4A41A 3VBRC 1PGL2 3KZ4C 1QIQA 1SQ4A 2XVGA 3PJQA 5GZFA 4WM8B 4A44A 3IT8A 4CPBA 1VMHA 5FY1A 1OH3A 1OHFA 4HETA 3FZ3A 4LBQA 4KMQA 4RFRB 4D94A 2H6BA 2X5IB 4LT5A 5BNPB 5JOWA 5ANQA 3HR9A 4XBQA 4A3XA 1KFXL 2FQPA 4E4DX 3AKTA 1AR83 1W39A 2HWB1 5KC6A 1MEC2 1S0JA 3RMYA 2AEYA 5FDBA 1HLCA 2JG9B 3LKJA 5FZ6A 5FZLA 4V2WA 4Q0SA 1S0DA 4V2VA 2KR2A 4ARXA 4LKSA 3ORJA 4GULA 1IG3A 2RR13 4RFT0 4D6RA 5ANNA 2D6PA 4Q8LA 5FZOA 1A3KA 3VBFC 4YW1A 4EQVA 4PBPA 4CDQA 2WT2A 3OUJA 1LOEA 1HRI1 1ENQA 2WSVA 5KHIA 3POFA 4L92A 3VD4A 5I8SA 3DEMA 2XVKA 4RL7A 1QF3A 1TMF1 2VM9A 1W9SA 5A32A 1XC6A 4PQQA 4P14A 4K8RB 1C3HA 4LJHA 4PQ9A 5B2GB 4IEZA 4YW4A 4WVVA 3U07A 3GZTB 5BNOC 1HB3A 3TB0A 2OT7A 4YSFA 1MZ5A 1EPWA 1R093 1YIPA 2PYTA 2V4AA 5IW0A 1DYOA 4X6RB 1MEC1 4BWOA 1NCQC 2ILMA 3VKFC 4BIOA 1S0CA 2E6VA 2VBDA 4YZ4A 3ZDVA 4CDUC 2H0BA 1TZOA 1UQXA 2TBVA 4IV1C 4XTMA 5FQ0A 2VZQA 3RMXA 5C8CC 3TN92 1MACA 3RI8A 3TNPB 4DS0A 3RZKA 2WQ8A 1W05A 1W6QA 1QU0A 2VQ0A 1AR73 5EPAA 4JCKA 1U5YA 3J7NA 3N9PA 1PVC2 3ZXGA 1STMA 5JZGC 5C71A 2R16A 3HT1A 1Q8VA 4PT6A 3ZFEC 2L9LA 2WIIB 5T5PA 2ZXQA 3T09A 5IVBA 2ZEWA 4OULA 4BCUA 1OI6A 4IEYA 5A7QA 1GU3A 5FYTA 3KV4A 1HW5A 2IXCA 5AVAA 5BY5A 4IEQA 1GQGA 3HEIA 4DEVA 4YFZA 3NAPC 3POEA 3D82A 2YB7A 3AZWA 4HVQA 1PX4A 3WF1A 3HJRA 1LNSA 4G4FA 1RUH3 4LBNA 1W8NA 2BWCA 3SC7X 3KGLA 3RSJA 2W9XA 3T30A 4COWA 1GOHA 2UY9A 3CJIB 5C6CA 4YZ1A 5EHDA 1SBFA 2Y6KA 1E57A 2QCSB 4BDVB 5JWPA 4R4ZA 5LCWL 1GBGA 2E53A 3POSA 1PVC1 3CU7A 3THCA 1UZZA 5IWFA 1V6IA 2ZX3A 1NKGA 2P6HA 3EYPA 3MLKA 4Z8BA 1RJ7A 1RUE1 4IGPA 4DO0A 2A6XA 3I49A 4YG0A 3VHRA 3GHMA 3WCSA 1G9AA 1O3QA 2VMCA 4HG6B 1DFQA 3AL5A 3OEAA 1UXZA 2Q8EA 3AX4A 5I8YA 3A4UA 4IV3B 1H9WA 1VBE3 2CDOA 3OCPA 2W3JA 1FOD3 2VMEA 2WT0A 3LZZA 5FWEA 3PUAA 2YU1A 1KITA 5LBBA 2QQLA 5L36A 2ZZJA 3POWA 4GZ9A 4N53A 1L7QA 3AZXA 1OQ1A 4Y1XA 3AP7A 1R1A2 1W6PA 2E32A 1JZ5A 5ACA2 1KJRA 4FI9A 4LBKA 1RVF2 2XJVA 3NV2A 4XJAA 2IWGB 4QHOA 5A7WA 5A6QA 4HKLA 4MV2A 2OPKA 1JXNA 2PQSA 1VIWB 2Y64A 2O8OA 5EQUA 4MGSA 1SBDA 5FY7A 3ZVXA 1KDMA 2ZGKA 1PIV3 1HJGA 2RS52 2WS93 4PCRA 1ONAA 4BQXA 1J3PA 5K4LA 3ZYHA 3L2HA 4XZUG 1UOJA 5F3CA 3OPTA 3OGJA 1ZBE2 4Q4V1 3UJOA 2BEOA 1BEV3 3LAGA 4UXAA 4CUGA 1Q8OA 1TE1B 2WT1A 4U36A 2XQXA 1N1TA 2HWD3 3LPFA 5LASA 1XE0A 2WYSA 4YRDA 2IXIA 4YM3A 3ZN6B 3AP9A 1R1A1 1W8WA 1YFWA 2VNVA 5ACA1 3NV1A 2VAUA 4RS5A 3PU8A 1VB4A 4KGGA 5JXIA 3JD72 1RVF1 3SH5A 1OXCA 2JDAA 3ES1A 4OZXA 3CLPA 3T4HB 3JB4C 3WXPA 3FJSA 4OMCA 3KF5A 3VDDB 1LB2A 1NAEA 2R32A 2DCJA 1Y9MA 2RR12 2OX0A 4IE4A 3ALQA 3O1VA 3DPRC 4LBQB 4XDQA 1LOAA 5J7MA 2VW1A 4QXCA 3WF0A 3R6SA 2GMPA 2Q5TA 2EXKA 3B5LB 5CFDA 4OI1A 1C1FA 1MS0A 1LODA 5FZ3A 1WMXA 2IUWA 1ZBE1 2GAUA 3SQOA 1F9KA 4UFKA 5A7PA 3VL9A 2ZHKA 5JIUA 4YPJA 5FZGA 5FCCA 4QXBA 3FN9A 2BVVA 1YLLA 2D44A 1NLSA 2DUOA 4H7LA 3U4SA 4XCBA 1MQTA 5FZOB 3OB8A 2WAOA 3ZSKA 5D1IA 1U5ZA 2KD7A 3N9LA 3JD71 4CDQB 1CGPA 3VDAA 4Y1UA 4QXKA 2XUMA 3MHZA 4YW3A 4CEWB 1AL0G 1CN1A 2Q8CA 3EHKA 5A32B 3W58A 4QPGC 4MH0E 1XE8A 3ZO0B 1LESA 5A6ZA 3UKNA 1JZ8A 2WA3A 1FNYA 5FZFA 1JH5A 1FAYA 2R063 1NZCA 3WDUA 5IAXA 4NHYA 1NA1B 5DZFA 4PI2A 3NNLA 3DECA 3J4UH 4FFIA 4YVSB 1PK6C 2VTXJ 4E2GA 4JTOA 1OLRA 3RWNA 4F8AA 5DUWA 4OYUA 5FQ0B 2CTVA 5LATA 4E8DA 4XACA 4XF4A 2CGPA 3KD4A 1DQ1A 1EAH1 2UWCA 4P9JA 4CE8A 4IERA 4CP9B 1W0OA 2DWRA 1ASJ2 1QXRA 1RUH2 2ARCA 4IEVA 5CZKA 2X05A 3LEGA 1RXFA 3OBAA 4YGEA 3P3NA 4IDZA 3VUOA 4D7TA 4Q4W2 1QJU3 1HRV3 4XYXA 2GC0A 3AXDA 4LUKA 4OQ8A 3C3VA 5JI7A 3L9JT 1HQWA 3BTZA 2VPVA 3G6JB 4MX3A 3B9IA 3J7HA 3M3QA 3RGBA 3VHOA 4LLFA 5FY9A 1QHDA 3HNBM 4CXXA 3AYAA 1JYVA 2XWJB 2W52A 3T2TA 5FO9B 3Q8EA 5K0UB 2DCZA 5I0TA 4YZ5A 3D5OA 5KHGA 2FDJA 3CO2A 1BBT1 1TNFA 1RJ8A 1GSLA 3INAA 3WQBA 4CEYC 1JZ7A 5BYNA 1YQCA 3SKJE 1JZ3A 4I09A 4AQ2A 4LTAA 4K6BA 1PMIA 5J37A 1VBE2 1LOFC 4O61A 4Y22B 1LHOA 3GM8A 2W47A 4XJWA 4XFHA 1ASJ1 1RUH1 2RS13 4M3CB 2MEV3 2JD9A 4EZ4A 1UZVA 1YFXA 5JI9A 3ZXLA 4CXWA 3N9NA 1W9FA 3TBDA 4MZUA 4Q4W1 1NZIA 1HJFA 4HMZA 4AYUA 5IVYA 4QDSA 2OQ7A 4QU2A 3AL6A 1AXZA 2HWC2 2D6KA 2ORZA 2YV8A 5CEHA 5C5TA 5FZBA 4NROA 3H8XA 2DVBA 1PIV2 2WS92 2JE9A 4AI1A 1DYPA 5GLZA 3U1XA 4NRQA 5F8PA 3GJBA 1ST8A 4P9GA 1RC6A 1YI7A 2ZGSA 4FO9A 1FNZA 1XU1A 4MHUA 4RGAA 1QKQA 4XVHA 5FUIA 5T54A 1POQA 2EAAA 2WBKA 5C3PA 1BEV2 1AL23 5B4XA 1K5JA 1TVGA 5JOZA 2WNUA 3BOWA 2BGCA 1VBE1 3UKTA 5FZ9A 2O8QA 2OW4A 5IK7A 1RINA 4M3CE 5C9AC 5DUXA 3HT2A 4IGOA 1V00A 1UZYA 1XYPA 4BQYA 4EWAA 1V70A 2AUYA 2ZS6B 3ST7A 2WZR2 1G7YA 3PUIA 2P3YA 4CU7A 4I2OA 2HWC1 1R083 1JMUB 2X10A 2ZPXA 3K3OA 3ZN5A 1N3OA 1MS9A 2C4XA 2NLRA 2YMZA 3ACIA 1EV13 1W8ZA 3ZYRA 1GZ9A 5HCAA 5BPXA 3QD6A 3MI8A 5FYBA 5LWBA 2IZWA 5C33A 1UYZA 1SPPA 5A3OA 2RS32 1DDLA 1C5IA 2QFEA 3FUQA 4JGYC 2HWF3 2BNOA 4A7ZA 2GSYA 4P9LA 4BISA 1O4ZA 1COV3 3IDEA 1BYHA 1ULCA 1BEV1 4MVTA 4QM9A 1J1LA 4O9GA 1WA6X 2VUAA 4BU2A 2R073 5JMOA 1VBC3 1UU4A 1W2OA 5IATA 4IEWA 1SZBA 5C4WA 3LEMA 4HBNA 1RUF2 1OKQA 2ARBA 1AZDA 1WLWA 3ZYGA 4NPMA 3FLPA 4B8EA 1Z78A 3J7LA 5FP3A 1NY72 2WZR1 5CFDB 3VKLA 2A6ZA 2PHTA 4W50A 1DYKA 1VMJA 3VBOC 1KRIA 3X29B 1WWYA 1GZWB 2D98A 4B7KA 4FQZA 1WCUA 4QQHA 1OA2A 1GV9A 2H6CA 4AL9A 5T55A 2RDRA 4ASLA 3TWIA 3AXEA 1SLLA 3O1TA 4HL0A 2PA7A 2WR9A 5LRRA 1AYN1 2RS31 5C3OA 3ILNA 1C1LA 1MQTB 1XNAA 2R062 4Q5OA 1M4WA 1QJY3 4NE9A 5FZIA 5A70A 5LEKA 2JEMA 2C0ZA 2NQYA 3ZLIA 4CDXB 5DUUA 1W0NA 1H1AA 1E5HA 2VH9A 2DCYA 4RS5C 4LK6A 5FMBA 3VZJA 2GC3A 3ZFGA 5K9YA 3CNAA 3WW1A 5FR3A 2IXJA 2VCMA 1DQ0A 1RUF1 4QPIB 4XQDA 4JGZA 3TRSB 3O0VA 1MVQA 1O6UA 4LE3A 1WCKA 2FZ2A 1NY71 1W06A 4CPBD 5CFCA 4OHYA 3IKWA 4J1WA 4TTGA 1DGWA 1WUVA 4YVWB 5FRAA 3P3PA 5GLWA 4F7ZA 4Z92B 2FD8A 4LBQD 1OMIA 4UWDA 5AC93 1UY4A 2VMHA 4LUMA 4MGTA 1US3A 4QM8A 1HRV2 2ZGTA 1N1SA 1X8EA 2ZHLA 2ZGMA 1F8VA 4YM0A 2WO1A 1AYM3 3LF7A 4HPKB 4D0QA 5DZGA 5E89A 4ZY9A 2AR6A 3WCRA 2R061 2R6QA 3MPPG 3GCWA 1GQPA 1GP4A 2D40A 3MLJA 4JKLA 1JOJA 4EE2A 5J98B 2D5FA 2JB4A 4CDWA 4N7IA 5JSRA 1CQ9A 1W8OA 1XYNA 1BVP1 4AEJA 3VBUA 3WF2A 2X09A 3WG4A 3H8OA 3I7DA 4FPEA 4ONUA 1W2NA 1QDCA 4XF0A 1GNYA 2WWSA 3O14A 2BPA2 4EN8B 5FPZA 1AVBA 4PI0A 3VBSB 4E2QA 5FY0A 2MEV2 5L73A 2JJ6A 2ZBJA 4KBZA 2HWB3 4CCDA 3OGGA 4L9BA 1UNBA 4GQ7A 5LA0A 3ILRA 1DLCA 4WM8A 3ON7A 1RMU3 2R1BA 2ZGOA 1AX0A 4NIIA 4GALA 3M3OA 4RR3C 3E6DA 3M3EA 3PL0A 1CZSA 3VDCA 1GWMA 2HEVF 1CVNA 1W3VA 4Q4X1 1ULPA 3OOXA 1GZTA 4COVA 4O9EA 4JQRA 3POYA 2JG9A 5FXVA 1HRI3 3I4IA 1B35A 3WUDA 2ZGLA 5FY5A 5KXDA 1XNCA 3ZXDA 1GR3A 1OKOA 1TMF3 2BTVC 5A7OA 2QBXA 5BV6A 4XUPA 3AVRA 1AL22 1I3HA 1PO21 1JOBA 2A3XA 4J6GA 4M0HA 1KD7A 3PLQA 1AR91 2VOWA 4GXLA 4FTSA 2F4PA 2A7AA 2PTMA 4QGLA 3ZPYA 3OF1A 2ET7A 3U4XA 2CDPA 3KS7A 4DUVA 2VOKA 3KGZA 1MS1A 4PLNA 2E26A 3ETQA 4NJ4A 4QHZA 5FZCA 1MPXA 1XNBA 1FV3A 1R082 3IAPA 3OYWB 3PUSA 4NN0A 2BW8A 4LORA 3ZOIA 3SEPA 2R0FA 2V5DA 3WNLA 2WNUB 4I30A 4IXLA 3IIIA 1APNA 4LLOA 2TEPA 1PM4A 3I2GA 2VW2A 2JDHA 1MZEA 4Y4YA 1WGPA 1V9U1 2IXHA 2A5ZA 4YW5A 4IE6A 3B94A 4DRVA 2HWF2 5DZEA 4DINB 4P00B 1OQDA 2J1RA 1YQ5A 1KGYA 1AL21 1U5XA 1ZZ7A 3E1F1 1VBC2 5KHJA 3LQCA 1IS3A 1DGWX 2FHRA 1OT5A 1ZRIA 4QKFA 1SFPA 3KHCA 3N35A 2XWBB 2OZ6A 4C1WA 1SHWB 4AWDA 4SBVA 4B4RA 5CA6A 4BXSV 1NCRC 2ZHMA 5FMCA 1SPPB 4I0AA 1V6MA 2Y8KA 5FKBA 1R081 3KB5A 4P5HA 1QGLA 4QQ2A 1ODMA 2K2SA 5CYYA 1OF3A 2Q30A 2YGLA 2VY0A 4P08A 4EN6B 3R0RA 4QB1A 4COYA 1O3RA 2TNFA 3NSTA 3ZYPA 5C5UA 3MIDA 1V6NA 4WVZA 2CGNA 4X8NA 4YG3A 4W6WA 3UYJA 1QEXA 1PVC3 5CKQA 3APBA 2IXLA 1ENSA 4TN7A 3DXTA 3Q9OA 1C4RA 1JODA 2GP3A 2VR4A 4IGQA 1SLAA 2Z4FA 3ZSEA 2JIJA 1QJY2 1RUE3 2HWE1 3POJA 3D6EA 4L11A 4LK7A 4Y20B 2Y6LA 4Z2WA 1VBC1 2O0OA 2OZJA 1U0AA 3T0DA 4AW7A 1SLTA 1Y43B 4K7JA 4JKMA 3RS6A 1BMV2 5BUVA 3VKNA 1UF2C 2FDIA 2Y60A 1LGNA 1UXXX 2RDNA 5FYCA 5BXXA 5SV5A 3V56A 2G4IA 1DQ4A 2Y38A 3CZJA 5LEJA 4LBMA 1WA4A 3D3AA 2VZVA 1H2LA 1W2AX 3EXUA 3KV9A 5E16A 1LAJA 1ZM1A 2VVDA 3AZVA 4N9HA 1XSQA 4GH4B 4QX3A 3U75A 3GYDA 5AC92 2F6BA 5HBAA 4AFBA 1YWKA 1CAVB 2JDNA 3HAGA 5E88A 4DFSA 4XFIA 1RUC1 4P9WA 5LZ6A 2SBAA 4ZS2A 1LEMA 2GNBA 2WA4A 1AYM2 5HXVA 3ZFGB 1TME2 1PGSA 4UI9L 3HQUA 1IOAA 2Y6HA 1REEA 1Y4WA 2AGSA 3I2OA 5L19A 5IVJA 5C4WC 5J48A 5FXXA 3K4DA 2QZ2A 2ZGNA 2Q0AA 2V09A 5FZ8A 4LA2A 1X9TA 2LRPA 2PAEA 4XBNA 1S2BA 2HEYF 4Q4V3 4X8PA 4WM7C 3DUIA 5FZ1A 2Q1MA 2V5YA 2BQPA 3IZOA 4YNIA 3C7OA 4P02B 2PHUA 2YZ4A 1BMV1 2VBPA 2ZAHA 1CPMA 5M0TA 2BRTA 4TXWA 4AF9A 4BLJA 1HB2A 4YW7A 3S7EA 4QX0A 2CHHA 2Y34A 4HVOA 4XUQA 3AMNA 4URAA 2DTYA 3LFMA 1R1A3 4FSJA 4Y1ZA 5L9RA 4NRMA 2C9KA 1GQHA 4BZ4A 3V0AB 2YXSA 5ACA3 1EY2A 2VMFA 4K1YA 5JVVA 1RVF3 2EIDA 1RMU2 3MFAA 3PNAA 4QKBA 4AVSA 4CDWB 1AYM1 1W99A 2RJKA 4LO5B 1TME1 3WF4A 4CCNA 5BNNB 1L3JA 3VGIA 3ZN6A 3VBUB 1YRZA 2XLGA 2XUEA 3B93A 4XZPA 5L7OC 4JGZC 2I45A 1UY3A 5JDBA 4CCCA 4XAEA 1ND2A 2W39A 4D7SA 3BTYA 3T1LA 1CR7A 4NHXA 2JE7A 1ZBE3 1E5SA 2BOIA 2IC1A 4L97A 1XNDA 2RG4A 3WY6A 2JDZA 2AEZA 1TMF2 2W68A 4WVWA 5GLVA 2UU8A 3ZKYA 3A23A 2J7MA 4YWAA 3NV4A 1SLCA 1XJAA 4B4QA 2GNDA 2J1VA 1H8VA 3HIFA 1X8MA 1AUYA 3ZXKA 4BPZA 5IFTA 1OPMA 3GGLA 5FPUA 1WLCA 5A3PA 1OVSA 4P9IA 3VD5A 5IHRA 3CL1A 3JD73 1A78A 4P9YA 1RMU1 1H2NA 4GKYA 1B35B 4XFGA 1OH4A 2P3KA 4AK3A 2Y26A 3MIGA 2A71A 4BQ3A 3TOJA 4M4PA 4XUTA 1IPJA 3AJZA 4URTA 3JUUA 1KEXA 2D6LX 5FP7A 5A1FA 1Z0HA 3M2MA 3MUZ1 1S2EA 3ZFFC 4EWEA 4OI2A 4FTBA 4B1MA 3SCGA 3TEYA 4ZXEA 4HKWA 1N3QA 5KXEA 4YFWA 2ZGQA 2XPJA 5DABA 4CEWA 4MYEA 2ZACA 5T5OA 1Q56A 5LK7B 1ZRFA 3B02A 3SXWA 2WAAA 3FUOA 2SLIA 2W1QA 4WM8C 2R0HA 3NL1A 4CP0A 5D8AB 5LB6A 1PHMA 4AE2A 5A6XA 1NE6A 1SCSA 2X5IC 3MV11 3PHMA 5BNPC 3LSDA 3N4MA 1NA1A 1EAH3 3K48A 5EV7A 5A3TA 1OC1A 2IFWA 3OY8A 4YVSA 4O7XA 3VZMA 2DUPA 3KT4A 4XHBA 3M3CA 2ZKLA 1UX7A 2XXZA 2JG9C 4L0PA 3THDA 3ZMOA 3FWEA 3J8F3 4M4RA 4WZCA 4BLIA 2WYFA 3GBGA 3FLRA 5EWSA 3R4DB 1IS5A 4S2FA 1ULOA 4NWWA 4KWUA 2VVEA 2FDGA 5A7NA 1JYWA 4ORFA 2WNEA 1W8TA 4CP9A 2Z79A 3C2UA 3POGA 2VZTA 4FOVA 3WQ1A 1OPOA 3E5QA 2R49A 3P1IA 3GNEA 4FCAA 2K0GA 2E51A 4N90A 4Q0QA 1RUE2 4PLOA 2ARXA 5FJHA 4HK9A 4YYOA 4ET7A 4XUNA 3L2YA 3CEWA 3TEXA 3O1MA 1BBT3 5A1LA 5FWJA 2VMDA 1H1MA 2CWSA 4XABA 3VLBB 4MGZE 5CISA 4XIKA 4XQ4A 5K0UA 2VZ1A 4Y1YA 1ASJ3 5A3WA 3WNPA 5F5IA 2VGDA 4ZS3A 3CMGA 1W8HA 1ZZCA 4LBLA 2WNOA 3ZFFA 4Q4W3 2ENRA 1H8TA 3ZPOA 3GBFA 4AXOA 4YG6A 3NW4A 4Y22A 2KXLA 5DXDA 5F7UA 4UW6A 3NRUA 4M3CA 2Q8DA 3D0SA 2VL4A 2JIGA 3ITQA 1O8PA 2PHRA 4OHZA 2WWJA 3ZYBA 4QT6A 3HOBA 5FIXA 2AACA 4R4XA 2WRAA 3NJZA 4Q4V2 2OXBA 1GANA 4ZXKA 2ZHNA 3N36A 4LO8A 1ODNA 2KM2A 4OUEA 2EXIA 2JXAA 1Y3TA 4Q0UA 5A3UA 1RIRA 3LIGA 4ISRA 5K7PA 1Q8QA 4OQ9A 3MUY1 1X50A 3H7YA 1O91A 3T0AA 1O5LA 2QDNA 2I74A 3GJAA 3G7DA 2BERA 1SMVA 1IS6A 2DU1A 2XBO1 3H42B 4HSJA 4NVPA 4Z07A 2HKXA 3CJIC 2HWC3 4PDWA 1AX1A 3K3NA 3T2QA 1WCSA 1Q5OA 1ZREA 4R9DA 4JZRA 2H0VA 1IZ3A 1GICA 4IEUA 4GWIA 2DVFA 4ASKA 1LTEA 2G9ZA 4QWNA 4BQ2A 2WNVA 2K46A 4NHLA 1G9FA 1N47A 1K45A 1HDKA 3ZX7A 4CYDA 4A6SA 2BU9A 1VRH2 4M0NA 4KG0A 5FBZA 2IVIB 5T5LA 1PMJX 5A1AA 3UK9A 1OOPA 1QJZA 4LULA 1NOVA 2PQQA 3RQ0A 1W6NB 1YO8A 1F31A 1YIFA 1CAXA 4XPVA 3IIAA 3ACGA 2D3RA 3HBZA 2OS2A 5FY8A 2R042 1SFYA 3HNMA 3ZYJB 1W8FA 1KDKA 2XHKA 4O65A 2VUCA 4IV3C 5JAXA 3USUB 1PMHX 4OHVA 3C8XA 3NKGA 2YYOA 3FBMA 1C5HA 4P9XA 3QCWA 3CJXA 4QB6A 1Q8PA 4ZZ5A 1REFA 2WZR3 1UMZA 3ZDSA 1ND2B 1VPHA 4HONA 1MVEA 2RDQA 3H8UA 1XNKA 4W8JA 1CX4A 1W6OB 2YBKA 1QJX2 3ACLA 4QPWA 1AYN3 4BXFA 2ARAA 1VRH1 3LOBA 2RS33 4W6YA 2CSGA 1GZWA 1ZBA1 2PHXA 1GWKA 4AFCA 3N7LA 4YZ2A 1VAMA 5CFCC 1G9CA 4DXSA 2PMWB 2VNRA 1S4CA 2R041 1DF0A 1WCQA 3TEWA 3MDPA 3EO6A 4AI3A 4RQPA 1POV1 1RUF3 2FDFA 1XB9A 4NOTA 1D4M2 3MF9A 1EAH2 4DNYA 2WZ8A 3FL7A 5G04L 4AQSA 2XKOA 4CDXA 1YEWA 3OUIA 1GYKA 1XU2A 5DN2A 5KWRA 4WV8A 3AYCA 4H7MA 1O8SA 4MADA 1YQ2A 2GALA 3J8F2 5FZEA 3RJRA 4QPIA 4GWJA 5FK7A 2ZGUA 1QDOA 3VDDC 1WW7A 3WNKA 1Y9GA 4OCTA 1QJX1 1UN1A 1H1IA 3BOPA 3T1MA 4XXPA 1KS4A 4KQ7A 4HXCA 2V4VA 2PN5A 1RYYA 4Y5SA 4YVWA 4CTEA 1CX1A 1DHKB 1RUD2 3MPBA 1H9PA 5FZHA 3LWCA 3PTYA 3SH3A 1A6CA 1OLQA 2VW0A 2XL7A 3MIFA 3OY8B 1ULGA 5FZ7A 4GMP1 2F17A 2J1TA 5FZAA 4MXWA 1VMFA 3FMGA 2EVXA 1BBT2 4HPKA 4KI5M 4QX8A 1TQ5A 1LR5A 3AFGA 5FPXA 3DL3A 2QQUA 1JYIA 1FYUA 4GD4A 1D4M1 4ITCA 5FV3A 1NQDA 2DDUA 3SH4A 4CUCA 1YFUA 2JD4A 2RMU1 1VAKA 4K3UA 2OPWA 2PXJA 2DBNA 4AEDB 1POV0 4JDNA 4CDQC 2JICA 3ZYIB 5FZ0A 4Q4Y1 3J8F1 1RUOA 1LGCA 1SFNA 1W2TA 4A7KA 3RYPA 2VZ3A 1OFSA 3VL8A 4CEWC 3BVCA 5GZEA 3U0ZA 4IEOA 1VBB2 4CEYB 1N1VA 1DG6A 3D4KA 2HLEA 5EFUA 1UYPA 4Q29A 2ZEZA 4AGGA 3AZZA 2C26A 3VBSA 4SLIA 1RUD1 3UESA 5SV8A 2UWAA 4Q4X3 4BB3A 4Y5Z0 1W28A 3WDWA 4OUMA 5FP8A 1CJPA 4FOWA 1NA1C 2G19A 3VD9A 3E6CC 3KV6A 3UGHA 1EUUA 4YVSC 1UOGA 2ZX4A 4AGVA 3OEBA 3ZFFB 4B29A 1H8TB 3I2IA 2OUJA 1PO23 2QNKA 4DXTA 3MW4A 4GMP0 4LHNA 5FXZA 1F15A 1MZ6A 3M7AA 3DXUA 2UWBA 4XDOA 4BQ1A 1OA3A 4RN5A 3B69A 4I0BA 1AR93 3ACHA 1T6GC 4E4ZA 1H2MA 4LHKA 1O7FA 1WMEA 5JIAA 3ZXJA 1C8NA 1QMJA 2I2SA 3R4UA 4NR1A 2P5BA 2NPIA 5F3IA 3SEEA 1YC61 1VBB1 4GAZA 3SITA 4AHXA 1R1ZA 1DBNA 1LCLA 1GMMA 2QQVA 3HN3A 1GOFA 3LEIA 4UOJA 5HI0A 3AMMA 4GA9A 4QDQA 2XHNA 2GU9A 4CUAA 1E5RA 1US2A 3U10A 1H4GA 4KU8A 5IJRA 2BDRA 5F2SA 1UYYA 2DBIA 3RI9A 5C3SA 1ENRA 3S5QA 2DTWA 1V9U3 3Q8BA 3THPA 2WABA 2VVFA 5E1RA 1J3QA 3AP5A 3OYWA 1PZ7A 3ES4A 4H14A 5IK8A 3CF6E 2BWAA 1WBFA 2PHDA 4PDWB 2LALA 1PNGA 1ZNPA 3O5SA 5JR7B 4KWLA 3RRDA 3DGTA 1YNAA 4AVVA 1O5UA 2WNVB 2XR4A 3UJQA 3ZM8A 5HCHA 4KBBA 4WZFA 1U5IA 1UMIA 4ATFA 1YFYA 5IVEA 4FP3A 2E7QA 2NN8A 4LKEA 1X7NA 1OOPB 4NPRA 1QY4A 2BP6A 3KQRA 4BA6A 2EIEA 2CY6A 1CAXB 4UBHA 2WSUA 1LKNA 3RZGA 3T0BA 4QX1A 1AYN2 3NNMA 4AZZA 3BKZA 5FO7B 2ZX2A 1GP6A 2ZKNA 5EP9A 4Q1RA 3A7QA 4N8MA 3FHAA 4N53C 5AFEA 3W5MA 2HWE3 4B1LA 3ZIWA 4N7UA 3VBOB 3MZHA 4XJ8A 5E8AA 3O0XA 2OQ6A 3ZSJA 2ZJCA 3HVDA 5LY1A 1XPWA 2E31A 2ERFA 3UNPA 5EYXA 1ULEA 3I2KA 5CU1A 4EN0A 1W9WA 2ADDA 1S0BA 4META 3U37A 4COZA 3ACFA 3BU7A 1UCXA 2GN7A 2EIGA 3VD7A 4ZKTB 2UYBA 1CWPA 2GP5A 4Y20A 1S0FA 3DN7A 4XMIA 4TWTA 2VMGA 1SBEA 2ZCWA 2VMIA 1OLME 3DCQA 3VBHB 3U14A 1K5MA 1WD3A 5FMOS 4NPLA 5F2WA 1JZ2A 4E9KA 5B4NA 1RUC3 4IETA 3B3QE 3IM0A 2ZZQA 4BIFA 4XAAA 3FHQA 4RQPB 3B00A 4A2UA 4ES9A 4U2AA 2P2KA 4LNVA 3MYXA 1PZ8A 4GH4A 1ND3A 4FPFA 4NRPA 2QQMA 3J7MA 3QBQA 4HVRA 1RXGA 1CAVA 3DF0A 4LITA 4R9AA 1FI2A 1QQP1 1N1YA 3S7IA 4ZHNA 4YARA 2YBPA 3AVSA 3ZXAC 2YPDA 4N43B 5GZDA 4YZ3A 3M1HA 1CJDA 3KHBA 3HQXA 3C7EA 4PF1A 3PUHA 4QAWA 4RYDA 1ZVFA 2MPFA 1RL3A 2Y6JA 3OGVA 4XJ9A 5FZMA 2K9ZA 4AVAA 1XOYA 2D6NA 2J1SA 5CFDC 2MNGA 1ZZBA 4JDOA 5JPMB 3NMBA 1VE0A 5I0DA 4BQ5A 1BJQA 4MXWB 2QKDA 4QQOA 4XDPA 1GKBA 5ABJA 4WBBA 3K46A 3N7MA 1TME3 2BBAA 2BUKA 4BYYA 1UPSA 2VNGA 1WCDJ 4AAXA 3DV8A 1C28A 3WHUA 4DRRA 3UKVA 4N9IA 2A3WA 1RGSA 2WFF1 4JDMA 5FP9A 4Q4X2 2QQNA 3V0AA 5F6LB 3KCXA 1MQTC 3ATGA 3H3UA 4JKKA 1HV0A 3R4SA 1JZ6A 3GZEA 4QQLA 1WW5A 2ZEXA 4V1PA 5LK5A 4CDXC 5BNNA
chains in the Genus database with same CATH topology
3SNMA 5CBLA 2D3SA 2O1QA 1PO22 3USSA 1V6OA 4QPIC 1NQJA 5I0RA 3S6PA 2D93A 5F5QA 3WDVA 2Q4SA 3M3IA 1DQ2A 2GNMA 1AR92 1Z7S2 4YVWC 5AVPA 4QGMA 1JYCA 2JENA 4FTEA 4H55A 1LULA 2Y0OA 3RNSA 2YGMA 1OQEA 3U11A 1ALYA 3M4FA 2WINB 4DQAA 4BE3A 3IPVA 2ZMNA 1H30A 3FE5A 4HFSA 2OA2A 5IUQA 3I8TA 5CNAA 1HQNA 3A0KA 1V9U2 5DUVA 5JPNB 2ZMKA 5H9PA 4XE9A 4ZU7A 4KU7A 4AFDA 3GF6A 4AFAA 3FC0A 5FO8B 3NO8A 2P34A 1VP6A 1LGBA 2ZAAA 5FTTC 1BK1A 1RUI3 4I02A 1Z7S1 5JOXA 1NCQA 3WDXA 1B09A 2B7YA 3VBSC 2ES3A 3AK0A 3J26N 3NKTA 3SMHA 4G3YC 2B8MA 5GZCA 5C8CA 5D8AA 3GBWA 3WUCA 1HKDA 2JX9A 4W6XA 1JHNA 4HKOA 3SCHA 4AQTA 5JSPA 1HQLA 1FX5A 3MW2A 4B4PA 4MXVA 1C57A 3S0MA 2A73B 2DVDA 1EYBA 2YHJA 2ZABA 5JLVA 1DQ6A 3ZFEA 2HWE2 2JG8B 3VV1A 3RDIA 5DDJ3 2UURA 4XFAA 4C91A 4LO4B 1X82A 3FHIB 3B9CA 5KC5A 2ZGPA 1DQ5A 1H0BA 1MS5A 2OUHA 2UY8A 2P37A 2Z69A 5FREA 2CYFA 4C0BA 4R52A 1RUC2 2PELA 4XHXA 3VHNA 4Y24A 3ZXEA 1BZWA 2WNUC 4HT1T 3N3HA 1DZTA 4S2HA 1QOOA 5CIRA 1NXMA 4C90A 3UV9A 3H0OA 2ZMLA 2I07B 3VZKA 4LO6B 3WP6A 2RE9A 1HXS2 4COUA 4ATEA 2E63A 1RUG3 5J36A 1KQRA 2VQAA 4BM8A 1K5MB 4L99A 1V6KA 2Z5WA 1JBCA 3FLTA 4JTNA 3WP3A 1J3RA 2B46X 1O3TA 3SHRA 2A3YA 3BB6A 1F5FA 5FOJB 4Z1VA 2IXKA 1CAWA 3JCIA 4BOWA 1G86A 1AX2A 1H4HA 3WW4A 1ND3B 1O4TA 2XBO3 1QXPA 4HZFA 3ENRA 1I5ZA 3IDCB 1CD3G 4FAHA 3WOGA 3OTFA 1BQPA 3N7KA 4XIOA 1F5JA 1HXS1 1YI9A 2DU0A 3E6BA 3KLSA 3ZXFA 3S30A 2DCTA 3EBRA 4GB32 3WLUA 1XXNA 4XETA 4KH9A 4LO7A 1WD4A 4UW5A 2BVBA 4KNCA 5ABJB 3LGRA 4LR4A 4Y1VA 3I2DA 5F6KA 3DKWA 2XJUA 5CG9A 4EJRA 1VBD2 4GWMA 4A7YA 4XFCA 1W6NA 5TSWA 3IDBB 1QXJA 1GZCA 3H9AA 4GH4C 3UL2A 3VBRB 1UU6A 3USUA 2NM1A 3ZFGC 3DPRA 1IPKA 2GZWA 3WVJA 1VRH3 3AKPA 1PNFA 5GLUA 2C1FA 1LECA 4GB31 1ZBA3 2CNAA 4HLTA 1NLRA 3PVBB 4FPJA 2R043 4YGCA 1W6OA 2XGXA 2HEWF 2PLV1 3AYEA 3ROUA 1POV3 4Q0PA 3LB9A 1RUI2 3VBFB 3NV3A 3M8LA 3IPVB 4B3NA 4DY5A 3A0NA 1VBD1 1MR5A 2GDFA 4M01A 3FFQA 4I0WB 4IL7A 3TAYA 3WP4A 1A8MA 1QWRA 2E9QA 3HD8B 4CDWC 4D3WA 1LU1A 1NXD1 3VN4A 5BNNC 1QJX3 5BNOB 3V0BB 4BH9A 2G9FA 3VBUC 2A6YA 5C8WA 4XTPA 1EPZA 4IESA 4XILA 3WG2A 4AG4A 1NCQB 3BALA 4CDUB 5FLJA 1PK6A 3ZSMA 2DVGA 2HYKA 4GMP3 3VKMA 3GZAA 2BNMA 4IV1B 3H1MA 5DDJ2 3W59A 1JW6A 5C8CB 2RJLA 1RUI1 2VNOA 4PIXA 2EA7A 1D4M3 2YY1A 2ET1A 1WMFA 1DGLA 1LJ7A 4TLFA 2RMU3 4LBOA 2B45X 5EYYA 1W6MB 5JZGB 4OVEA 1J58A 4WVMB 3MICA 3O7OA 1Q43A 4Q4Y3 3ZFEB 1B35C 1PGL1 1FPN3 2YC0A 4PIZA 2OVUA 1D2QA 4XXAA 2WJSA 1UPIA 4CZSA 1Y7BA 1S0GA 4K20A 1KXGA 3NAPB 4OLLA 4E27A 1RUD3 3EJKA 4Y26A 4AEDA 1VAVA 3ZMNA 2P17A 2TUNA 1S2KA 2BBVA 3PVEA 1UKGA 1RUG2 5DDJ1 2XJRA 4CEYA 4QGNA 3TNQA 2Z2SB 4QX5A 3PVOA 2XVLA 1LOFA 5D8AC 3WZ1A 1WBLA 4FOYA 4FPYA 4UBGA 4RHV2 1UW8A 2VOXA 2XH6A 2DVAA 1RHI2 1X36A 3WQ0A 2XBO2 3BCWA 1OFNA 5HCFA 4BHPA 4CRQA 1VBB3 1VJ2A 2D43A 3OD0A 3QACA 4H3WA 5F9TA 4AEMA 1WW4A 4FOQA 3KT7A 4GWNA 3WDTA 1BCXA 2AREA 1S0EA 1PGW2 1RUG1 2EALA 3HMYA 4NO4A 1CAWB 4UW4A 4NHMA 1PVXA 2EF6A 4K21A 4XF3A 2AH2A 3J9SA 3TN91 4DOUA 1A8DA 5C9AA 1DLLA 4RHV1 3H7JA 4FXGB 2XJPA 2B9UA 5H9RA 1RHI1 1Q8SA 1C8M3 2GC2A 3AKSA 4FPHA 5CG8A 4NHKA 1V6LA 4ISQA 3IBMA 2R30A 4M3CF 5KHHA 2BNNA 1AXKA 5T52A 1XE7A 2R1DA 4FBFA 4JGYA 2WKKA 3AFKA 1PGW1 5H9SA 5KBFA 3I59B 1ZBA2 5FAXA 1JTZX 1LHVA 1PO12 3OD4A 1AR62 5JMCA 1CESA 1BVVA 2UYAA 2ZGRA 3URFA 4E4SA 2ZTNA 1G9BA 1DZRA 2X8KA 3DPRB 4AVCA 3KSCA 4XJZA 1DZQA 4EN9B 4TYSA 1RUNA 4RD7A 4KWKA 3E5XA 5AFBA 3VBOA 2WL1A 3SISA 1VLNA 2FMYA 1FXZA 2XLAA 1SEFA 3GHNA 5FOBB 3OJBA 5JCTA 5T3NA 1UAIA 5IK4A 1M06G 3WX5A 1SLIA 4ZU4A 4XFFA 2XB6C 5KXCA 4Q26A 2DCKA 4JRAA 3WP5A 1NG0A 2E7TA 3VBHA 2BFUL 1V6JA 2OYZA 1AR82 1PO11 1QQP3 1AR61 4PBOA 1HV1A 3WNXA 1F2NA 1GFF2 1H2KA 4QPGB 2EAKA 4MSVA 1DU3D 4GIQA 2N7GA 2FMDA 2RS51 2QVSB 5J3UA 2RM23 2RMU2 1WLDA 2W08A 2QQPA 3BPZA 5GLTA 4AQ6A 4E2SA 1KFUL 1ZRDA 4N43A 1ND2C 1YXWA 1IS4A 1PK6B 4Q4Y2 4S2DA 1FPN2 3KM5A 1YUDA 4AI0A 2WLQA 1IGOA 3LA2A 4EROA 5EXOA 4AI8A 2CV6A 4FPOB 5H9QA 3VZOA 1KS5A 1MS4A 1R092 2WFF3 2DURA 4MGYE 5CB7A 1AR81 1SACA 1D0HA 4OI0A 1CAUA 3E97A 2XL9A 4FPGA 2C5DA 5HCBA 1VR3A 3TYJA 2DUQA 3JZVA 3SCFA 4ASMB 1G9DA 3H3ZA 3PMEA 2PHFA 2WZPP 2RR11 4B7EA 4C1XA 2LUWA 3RG0A 4LEJA 1OA4A 4Q1PA 5LRSA 3M70A 1AR72 1ULDA 2CGOA 4FPLA 4J1XA 1W0PA 2Q8OA 4Q8KA 1FPN1 3RJ2X 2X29A 4L8QA 2QE3A 4RR3A 2BFUS 1TNRA 5BNQA 2D6OX 2NYYA 3W9AA 4IQPA 1R091 3MEPA 2FBEA 3OBRA 2A6WA 5JSOA 2NZ9A 1W6QB 4YM2A 4R9BA 3MLLA 5I91A 1J59A 5CAZA 2W0XA 1KJLA 4FVVA 2YROA 1D0GA 3HN1A 4FAGA 1LU2A 1MS8A 4KGQA 2GH2A 3PMSA 5A33A 3FFZA 3LCPA 2VU9A 1UL9A 2NP0A 1RUJ3 2WQ4A 1AR71 3AP4A 1MZFA 1Z7S3 3WT3A 2ZX1A 4G9SB 4AEDC 2YPJA 1ZRCA 1C8M2 2LTNA 1JN2P 4HANA 2QJVA 4IEXA 2HJIA 4R8HA 1FMD3 2PFWA 1VALA 5C9AB 2DYCA 3SLIA 4KWJA 1FOD2 5FMOL 1UX6A 2PAKA 3THTA 3WW2A 3ECQA 1CPNA 4IEPA 5K0UC 3GZUC 2D7FA 1YYNA 1WMDA 3AKQA 3H1WA 1ZX5A 1WLTA 3LA7A 3MIHA 3GALA 3ZFFC 4AFMA 4OHWA 1HIXA 3AJYA 1H8TC 4AHWA 5F1RA 2PHWA 2QDRA 2A75A 3NWKA 1Q3EA 1FV2A 4R9CA 2JKBA 1NCRA 4Q0VA 4XMAA 2JG8A 3VHPA 4JGYB 1C8M1 1GLHA 4OFGA 4AGRA 4N53B 4XQWA 3OBTA 1I6XA 3ASIA 1W6PB 2PHLA 4CP2A 4AHZA 2WC2A 3RZZA 2DFCA 2VUJA 2BYVE 1FOD1 1WW6A 1ULFA 2HWD2 2GMMA 5IT6A 2P3JA 5A3MA 2FZ1A 3JBG3 3JQWA 5J96B 3PJYA 1CIWA 1X33A 2VG9A 5GM0A 1QOTA 1QQP2 2PAMA 1HX6A 4JAAA 4K9SA 1SDWA 1DGRA 2C9AA 4PDWC 2AYHA 3JB8A 1YCIA 4PJYA 1LHUA 1PM7A 2LM3A 3VZLA 1PIV1 2WS91 3RYRA 2YDEA 1AJKA 2RM22 1YHFA 2WNVC 3UJQA 5I0SA 2A6VA 4TZDA 5K8SA 5JOYA 1LRHA 2VECA 1OOPC 1OSGA 4RS5B 3WG1A 1I1EA 3MIBA 3AP6A 1GNHA 2EXHA 1UIJA 2HWD1 4ES8A 3V65A 1RITA 3VZNA 4FPCA 2V73A 2WFF2 1HXS3 5DG2A 2GNTA 1CONA 3KT1A 4WM7A 5GZGA 5IK5A 4FQ4A 3H50A 3WW3A 4Q27A 1S1AA 2ETEA 3IN9A 1LHNA 4MLOA 3MIEA 1RB8G 4QHBA 4DPNA 4DY3A 1YJKA 3PVNA 3H1YA 2RM21 5GKAC 1IKPA 2VXRA 4XJUA 1G6NA 5KXBA 3O0WA 4ZU5A 1CAUB 2D5HA 4X6QB 2E7AA 2WLPA 3VBHC 3D8CA 4UW3A 3MF6A 1O3SA 1XYOA 4LE4A 3KCYA 3WHTA 4W65A 4RQPC 5J09A 5L7OA 1SLBA 1O4YA 1UU5A 3WINE 4GB33 4K1ZA 3E5UA 4FPKA 1N3PA 3WG3A 3VBRA 4RGGA 1ENXA 4I01A 1QOSA 1ZRRA 4N43C 2DFBA 4RR3B 4LA3A 1QJU2 1IKQA 2PLV3 1VBA3 1RUJ2 4HN0A 4PIYA 4Z82A 4AEKA 3D0JA 4XFBA 1VBD3 3ILFA 1QNWA 5KHKA 1G8WA 4JRLA 1LENA 2ZX0A 2D6MA 1LOCA 2B5HA 2DF7A 1XRUA 1VB2A 1BXHA 1AHSA 3BIWE 1URXA 2NMOA 5GJ6A 4QD2A 4Q2FA 3VBFA 3B7MA 4D7YA 1FMD2 5A33B 1DGRN 1FATA 2GN3A 4C0HA 3ZSLA 4YGDA 4XBLA 5GALA 4F3JA 4XF1A 2RS12 4QMAA 1TEIA 1ZZ6A 5FLIA 4EN7B 3IMNA 1QJU1 1HRV1 5A3LA 5BNOA 4MGKE 1FT9A 3V0BA 3AB0A 1QH7A 3BODA 1RUJ1 2X5IA 4BMBA 5BNPA 1IQAA 2KA3A 4QPYA 2WFPA 4CDUA 1U12A 2CL2A 5T50A 1NYWA 1LOBA 4IV1A 3ZN4A 2YUEA 3BTAA 5CADA 5I93A 4NWVA 1FMD1 1XQNA 1LOGA 1W6MA 5JZGA 3AM2A 2RS11 3JBG2 4I3GA 2MEV1 4WVMA 1AJOA 1NCRB 4F83A 1MEC3 2GMEA 1AXYA 4RSUA 1JUIA 3LA3A 5I8TA 4FT8A 1UKRA 4KL1A 2Q1ZB 3NAPA 1S0IA 2Z42A 5T5JA 1D4VB 4PLMA 1ZZ8A 1EV12 4K40A 1IHMA 1LEDA 3AMPA 4FXKB 4AHYA 3MW3A 5EZWA 5FFOC 4RA0A 3AKRA 3KMHA 4HSLA 3RYKA 2AZ5A 1COV2 3FBYA 4EWDA 1ZA4A 1ZZ9A 2R072 1QNYA 4KG8A 4L2NA 3JQXA 4OHXA 4BMEA 1GNZA 3JBG1 2D3PA 3MGUA 3B01A 3AMHA 1I9RA 1SCRA 1YJLA 2XJQA 2Y0IA 1ZYBA 4QQPA 2JG8C 4DZGA 2EXJA 3MFCA 2B42B 2VOVA 3WV6A 3WD5A 4D69A 3QH6A 3TN93 4JC1A 3ME2A 5I0UA 2ATFA 4XF9A 4XW3A 4AI2A 1EV11 3AZYA 3VKOA 4RHV3 2CAVA 2NMNA 5C4WB 1NE4A 2XJSA 4JV4A 1RHI3 2HWF1 1DIWA 1COV1 2D97A 3CJIA 3QH7A 4DMIA 4YLZA 2R071 4WM7B 2CAUA 4YM1A 3JU9A 2RHPA 3ZIXA 2QUOA 3WDYA 2B39A 2XJTA 1MS3A 2ZOEB 2OIIA 4I3PA 2GH8A 4MGIE 1PZ9A 3RPQA 3SXWA 4DXZA 5EJ3A 1D2SA 4CP1A 4XOGA 1S55A 1REDA 3IWZA 2XKPA 5CVRA 4JVAA 3OPZA 4M00A 4INDA 1W2UA 3QOPA 1K5MC 4TSVA 3NVCA 2MHFA 3ELNA 2QZ3A 3KCCA 2IFRA 4FP2A 4IV3A 5DG1A 1RTVA 2PLV2 4LHLA 1UD1A 2WQZC 3N7JA 1VBA2 1Y9QA 3HWJA 5L7OB 3I59A 4JGZB 1QJY1 1UIKA 2JECA 5CFCB 3O12A 5FLHA 1ND3C 2G9GA 2P3IA 4XEZA 3V64A 4PF5A 4HK8A 2GC1A 1AF9A 3QLQA 4AVBA 1QH6A 3I54A 3WR0A 1PO13 2HWB2 2AENA 4S2GA 5AC91 1AR63 2VULA 1BKZA 2A70A 4K8FA 4DB5A 4GKXA 3EQEA 2XLFA 4OI4A 4AVTA 2X53S 1VBA1 4LBJA 5ABJC 4HN1A 3K51A 4YW2A 1LHWA 1JUHA 1OD5A 2RS53 3WQ7A 1J1TA 3FX3A 3R05A 2ZA9A 3AYDA 4MUVA 4OUSA 1EP0A 2CWMA 2XG3A 4YGBA 1HRI2 3AMQA 3LOIA 3LSEA 2DV9A 3VDDA 4QPGA 1PGL2 3VBRC 3KZ4C 1SQ4A 2XVGA 3PJQA 5GZFA 4WM8B 3IT8A 1OHFA 4HETA 3FZ3A 4LBQA 4D94A 2H6BA 2X5IB 4LT5A 5BNPB 5JOWA 3HR9A 4XBQA 4A3XA 1KFXL 2FQPA 4E4DX 3AKTA 1AR83 1W39A 2HWB1 5KC6A 1MEC2 1S0JA 3RMYA 5FDBA 1HLCA 2JG9B 3LKJA 4Q0SA 1S0DA 4GULA 4RFT0 2RR13 2D6PA 4Q8LA 1A3KA 3VBFC 4YW1A 4PBPA 4CDQA 2WT2A 1LOEA 1HRI1 2WSVA 1ENQA 5KHIA 4L92A 5I8SA 2XVKA 4RL7A 1QF3A 1TMF1 5A32A 5B2GB 4P14A 4PQ9A 1C3HA 4IEZA 4YW4A 4WVVA 3U07A 3GZTB 5BNOC 3TB0A 4YSFA 1MZ5A 1EPWA 1R093 1YIPA 2PYTA 4X6RB 1MEC1 4BWOA 1NCQC 2ILMA 3VKFC 4BIOA 1S0CA 2E6VA 4YZ4A 4CDUC 2H0BA 2TBVA 4IV1C 4XTMA 5FQ0A 3RMXA 5C8CC 3TN92 1MACA 3RI8A 3TNPB 4DS0A 1W6QA 1QU0A 2VQ0A 1AR73 4JCKA 1U5YA 1PVC2 3ZXGA 5JZGC 2R16A 3HT1A 1Q8VA 3ZFEC 2WIIB 5T5PA 4OULA 4BCUA 1OI6A 4IEYA 1HW5A 2IXCA 5AVAA 5BY5A 4IEQA 1GQGA 4YFZA 3NAPC 3D82A 3AZWA 4HVQA 4G4FA 1RUH3 4LBNA 2BWCA 3KGLA 3RSJA 4COWA 2UY9A 3CJIB 5C6CA 4YZ1A 5JWPA 1SBFA 1E57A 2QCSB 4R4ZA 1GBGA 2E53A 3POSA 1PVC1 3CU7A 1UZZA 1V6IA 2ZX3A 4Z8BA 3MLKA 1RJ7A 1RUE1 2A6XA 4YG0A 3VHRA 3GHMA 3WCSA 1G9AA 1O3QA 1DFQA 3AX4A 5I8YA 3A4UA 4IV3B 1H9WA 1VBE3 3OCPA 1FOD3 2WT0A 3LZZA 1KITA 5L36A 2ZZJA 3POWA 4N53A 3AZXA 4Y1XA 1OQ1A 3AP7A 1R1A2 1W6PA 5ACA2 1KJRA 4LBKA 1RVF2 2XJVA 3NV2A 4XJAA 2IWGB 4HKLA 4MV2A 2OPKA 1JXNA 1VIWB 2O8OA 1SBDA 3ZVXA 1KDMA 2ZGKA 1PIV3 2WS93 2RS52 4PCRA 4EV0A 1ONAA 1J3PA 3L2HA 3OGJA 1ZBE2 4Q4V1 3UJOA 2BEOA 1BEV3 3LAGA 4UXAA 1Q8OA 1TE1B 2WT1A 4U36A 1N1TA 2HWD3 4YRDA 2IXIA 4YM3A 3ZN6B 3AP9A 1R1A1 1YFWA 5ACA1 3NV1A 4RS5A 1VB4A 4KGGA 3JD72 1RVF1 3SH5A 3ES1A 4OZXA 3CLPA 3WXPA 3JB4C 3FJSA 1LB2A 3VDDB 2R32A 2DCJA 2RR12 3ALQA 3DPRC 4LBQB 4XDQA 1LOAA 5J7MA 2VW1A 3R6SA 2GMPA 2Q5TA 2EXKA 3B5LB 5CFDA 4OI1A 1C1FA 1MS0A 1LODA 1ZBE1 2GAUA 1F9KA 3VL9A 2ZHKA 5JIUA 5FCCA 2BVVA 1YLLA 2D44A 1NLSA 2DUOA 4H7LA 1MQTA 3ZSKA 5D1IA 1U5ZA 3JD71 4CDQB 1CGPA 4Y1UA 4QXKA 2XUMA 4YW3A 4CEWB 1AL0G 1CN1A 3EHKA 5A32B 3W58A 4QPGC 4MH0E 1XE8A 3ZO0B 1LESA 3UKNA 2WA3A 1FNYA 1JH5A 1FAYA 2R063 1NZCA 3WDUA 1NA1B 5DZFA 3J4UH 4YVSB 1PK6C 4E2GA 4JTOA 1OLRA 3RWNA 4F8AA 5DUWA 5FQ0B 2CTVA 4XF4A 2CGPA 3KD4A 1DQ1A 1EAH1 2UWCA 4P9JA 4IERA 1W0OA 2DWRA 1ASJ2 1QXRA 1RUH2 4IEVA 4YGEA 3P3NA 3VUOA 4D7TA 4Q4W2 1QJU3 1HRV3 4XYXA 2GC0A 3AXDA 4LUKA 3C3VA 5JI7A 3L9JT 1HQWA 2VPVA 3G6JB 4MX3A 3B9IA 3M3QA 3VHOA 4LLFA 1QHDA 3AYAA 2XWJB 2W52A 3T2TA 5FO9B 5K0UB 2DCZA 5I0TA 4YZ5A 3D5OA 5KHGA 3CO2A 1BBT1 1TNFA 1RJ8A 1GSLA 3INAA 4CEYC 4I09A 4AQ2A