2RM21

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 43
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rm2100
1RUE2 1M06G 4YVSC 1H8TC 2HWB1 3NAPC 1EAH1 2WWSA 1OOPA 2WS91 3CJIC 1Z7S2 2PLV3 2X5IA 2HWD2 3VBRB 1FPN2 1VBB3 4Q4V2 1VBC1 3VBOB 5AC91 4N53B 2RMU3 3VBHA 3JD73 1AYM2 2WFF3 5ACA2 4NWWA 2RS13 2R071 5CFCC 3HAGA 4RR3B 2R063 1VBA3 1ND2B 1A6CA 2HWB2 1RHI3 4YVWA 1EAH2 1EV12 5FOJB 2MEV1 1HRI3 3JB4C 4YVSA 1H8TA 5C4WC 1RVF3 1F8VA 5DDJ2 3J8F3 3NAPA 3M8LA 2XPJA 5BNNC 1AR93 2RMU1 1AR71 1PVC3 2IZWA 1NA1A 2WZR1 5A33B 3CJIA 1VBC2 3JD71 5BNOB 2WFF1 1AYN3 1RUC2 5AC92 1AR63 2ZAHA 5C8CB 1RMU2 1RUD3 1VBE3 5L7OC 4IV3B 4CEYB 1RHI1 1RUE3 2R072 5JZGC 5D8AC 1K5MC 4RFT0 3DPRC 4CDQB 4Q4W1 1RVF1 1FOD1 3J8F1 4BCUA 5CFCA 3VBSC 2BUKA 1AR91 5K0UC 4AEDB 2GH8A 4Z92B 1PVC1 2MEV2 1Z7S3 1R091 4WM7C 2ZTNA 2HWD3 4NWVA 4RS5C 1FPN3 4Q4V3 4N43A 4RQPB 1AR72 2WZR2 5C4WA 4JGZB 5C9AC 1RUD1 5BNNA 2Y26A 1C8M2 2WFF2 1F2NA 1AYM3 3S6PA 5ACA3 1ND3B 3VBOC 1HX6A 4FTSA 3VDDB 1C8NA 1RUH1 4IV1C 4WM8B 2HWB3 4CDWB 1EAH3 4Q4W2 1EV13 1FOD2 5JZGA 1FPN1 4RR3C 5D8AA 3ZFFC 4CEWB 1K5MA 1POV3 3DPRA 5DDJ3 1HRV1 1ND2C 1COV1 1BBT1 1R092 1QJU2 2HWC1 3VBSA 2TBVA 5K0UA 3VBFB 1VBC3 1AYM1 5BNPB 1RUC3 4WM7A 5AC93 4RS5A 4CDUC 1RMU3 1X33A 2FZ1A 5C9AA 2WLPA 4FSJA 2R073 2VQ0A 5J98B 1EV11 5ABJB 1MQTB 2BFUL 1RUH2 1POV1 4QPIC 5DDJ1 1AUYA 3ZFEC 4IV3C 1ZBA1 3ZFGB 3JBG2 2MEV3 1NCRC 1PIV2 4IV1A 1VBD2 4CDQC 3VBUC 1HRV2 1COV2 4RHV1 1BBT2 2RS32 1RUC1 2WZR3 1AR73 2HWC2 3ZFFA 1AL21 1RMU1 1BEV2 1AR81 1NCQB 1C8M3 4RQPC 1V9U2 1FMD1 1OOPB 4CDXC 4CDUA 4Q4W3 1PGW1 4JGYC 1FOD3 2X5IB 4FTBA 1QQP1 1ZBA2 1TMF2 2HWE2 1R093 4QPIA 3VBHB 3ZFEA 1QJU3 4GH4C 4IV3A 4RHV2 1R1A1 1C8M1 1NCRA 1AL22 3VBUA 1PO21 1QJY2 1WCDJ 1AR82 1BMV1 3VBFC 4GMP0 4PDWC 4YVWB 1B35B 2DF7A 1FMD2 1DDLA 1R082 1H8TB 1RUH3 2R042 1AL0G 3NAPB 1PGW2 3JBG3 1QJU1 5A32A 1NA1B 4Y4YA 1HXS1 1PIV3 1MQTC 1QQP2 1VBD3 4CDXA 3CJIB 1OHFA 1HRV3 1COV3 1BBT3 2RS33 4JGYA 5CFDB 2HWC3 1R1A2 3VBRC 1BEV3 4GH4A 1PO22 2RS51 2HWF1 4N53C 1ASJ1 1NG0A 1BMV2 1V9U3 1TME1 4FTEA 2QQPA 5CFCB 5L7OA 3JBG1 1VB2A 1PIV1 3JB8A 1VBD1 3VBFA 3TN92 3IDEA 4PDWA 1GFF2 5LK7B 1ZBA3 2RS31 4GB31 1TMF3 1VAKA 4N43B 2HWE3 1RUF1 1HXS2 4Q4Y1 1BEV1 5BNNB 4RHV3 1W39A 1AL23 1QJX1 1MEC1 1QJY3 1AR83 1V9U1 1PO11 5BNOC 1RUG2 2RS52 2HWF2 2RM22 3VBRA 1ASJ2 4Q4X2 1RUI1 5C8CC 1FMD3 1TME2 1RUJ1 3VBOA 5JZGB 1R083 4N53A 5D8AB 2ZZQA 4CEYC 2R043 1K5MB 1TMF1 3DPRB 2HWE1 2RR12 1B35C 2XBO1 4QPGB 3VBSB 2FZ2A 5K0UB 1QQP3 4GB32 4AEDC 1RUF2 4RR3A 1CD3G 1IHMA 4Q4Y2 3LOBA 4WM7B 1ND2A 4RS5B 1QJY1 4EJRA 1ZBE2 1R1A3 1NA1C 5FMOS 1VRH2 1QJX2 1MEC2 5C9AB 1PO23 4JGZC 5CFDC 1D4M1 1PO12 1R081 2BFUS 2R041 5A33A 1VB4A 1ND3C 1RUI2 1NOVA 1RUJ2 1CJDA 4SBVA 5BNOA 4IV1B 1E57A 3VDDC 3TN93 4WM8C 4CDWC 5C8CA 2XBO2 4Y5Z0 3ZFFB 4CEYA 3FBMA 1HXS3 4CEWC 1RB8G 4CDQA 1B35A 2PLV1 4N43C 5J96B 1VBB1 2WS92 4AEDA 5BNPC 1RUG3 2RS53 2HWF3 4CDUB 2RM23 1D4M2 1ASJ3 4Q4X3 4YVSB 3TN91 4RQPA 2BBVA 1TME3 4JGZA 5CFDA 2RS11 1POV0 5ABJC 2R061 1VBA1 4QPIB 3ZFEB 2RR13 1PGL1 1ND3A 4GB33 1NCRB 1QJZA 3ZFGC 1RUF3 3VDDA 1HRI1 3VBUB 4Q4Y3 4WM8A 4CDWA 1ZBE3 4QPGC 3ZXAC 2PLV2 1RUG1 1VRH3 2RM21 1QJX3 1NY71 1MEC3 1VBB2 4Q4X1 4CEWA 1PO13 1AYN1 1NCQC 2RMU2 1AR61 1X36A 1RUI3 1VBE1 2RR11 3JD72 4LLFA 5A32B 1RUJ3 5BNPA 2RS12 1OPOA 1RUE1 4CDXB 1OOPC 2R062 1VBA2 5C4WB 4JGYB 2GSYA 2XBO3 1ZBE1 1PGL2 2BPA2 4GMP3 2X5IC 1RHI2 1VRH1 5ABJA 1MQTA 1HRI2 1Z7S1 4GH4B 1HQNA 1RVF2 3VBHC 2HWD1 3J8F2 4Q4V1 1AR92 2WS93 3ZFGA 1PVC2 1SMVA 1NY72 5L7OB 4QPGA 1D4M3 1AYN2 5GKAC 4PDWB 1AR62 5ACA1 1RUD2 1VBE2 4YVWC 5FMOL 1NCQA 4GMP1
chains in the Genus database with same CATH superfamily
3NKTA 2X05A 1R1ZA 1ENRA 3N35A 4YVSC 1W8OA 4AW7A 2WLQA 1JU3A 2JDAA 1ZZ9A 1AX1A 4UOJA 5FPVA 1JTZX 3ZKYA 4XETA 2R0FA 2IWGB 1LB2A 4HXCA 1DGWX 1IGOA 3QD6A 4YZ3A 1UX7A 3UGHA 1CPNA 2RDRA 1GLHA 5AVAA 1ONAA 4MGYE 1KRIA 1Z7S2 3M2MA 3U14A 2AH2A 3MW3A 2UY9A 1GOGA 4MHUA 4UFHA 4XJZA 2D3RA 2HWD2 4KU8A 2C9KA 5GLZA 4GULA 2BP6A 1SFPA 1VBC1 1WKYA 4PF5A 2OUJA 4B4RA 2EIDA 4BH9A 1JU4A 4YARA 2P2KA 1XB9A 1SDWA 1GANA 2VZRA 4QB2A 2YDEA 5DAWA 5JPNB 5HBAA 2EXKA 4AHXA 5A3UA 1AYM2 5ACA2 4NWWA 2R071 5CFCC 2W5FA 2VOTA 2XLFA 5G04L 4KU7A 5ERLA 3RDIA 2XG3A 1KFUL 1XPWA 2A6VA 1A6CA 3KF5A 4A45A 3PUAA 2VAUA 1WMEA 1ALYA 1EAH2 2YXSA 4XIKA 4YW4A 1EV12 3I3MA 3MFAA 2WNVB 5JXHA 4CXYA 3QCWA 2VW0A 3ILFA 3BPSA 1SLAA 3J7HA 2W91A 1NAEA 3VKFC 3M8LA 3U78A 1XNTA 2Y0IA 3UGGA 2XPJA 1AR93 4RD7A 2B46X 2Q0AA 3URFA 2RMU1 1JZ6A 5DABA 3R4UA 1AR71 5CKQA 2GAUA 1NA1A 3WDVA 1O3SA 2IXHA 1O5UA 1XE0A 3MPPG 3CJIA 3L2HA 2J1VA 2VMIA 1OVSA 1P8JA 2VOKA 2GP3A 3JD71 4NHLA 1WA6X 4IE7A 4Y20A 4ZONA 3I7DA 2WFF1 3RJRA 4ORFA 3NNMA 4FQZA 3UYJA 4E4DX 3OGJA 4AFBA 4KNCA 1OUSA 4XF1A 4ZXEA 5JXIA 1N1VA 4LO8A 5C8CB 1RMU2 3DXTA 5J09A 2VNVA 2ZS6B 5L7OC 4OI4A 1RUE3 2B8MA 1UD1A 1QDCA 3VHOA 5GJ6A 4ARYA 2Y6KA 4AAPA 4CVUA 2JIJA 4MYEA 4N7IA 4Q4W1 1XXNA 4GD4A 1FOD1 1W6OB 4W50A 1H1AA 1YQ6A 3J8F1 4C0BA 1IPSA 2JKXA 1GOFA 5FYIA 2GH8A 1QU0A 3ACLA 1PVC1 2MEV2 2WYFA 1FAYA 4L11A 3UJOA 1R091 1F5JA 2XKOA 3HT1A 1SEFA 2ZKNA 4OUMA 4Q4V3 1AJOA 3R0RA 3NJZA 4FOVA 4N43A 1WLWA 4S2FA 4RQPB 2C4XA 5FIXA 5FQ0B 3S7IA 2WN3A 4JGZB 2XVLA 3NMBA 1J3QA 5BNNA 2Y26A 4WVWA 4CPBD 2A6XA 2WQ8A 4Y22A 1A8DA 4ZU5A 1BK0A 2OZJA 5C7GA 5L36A 1UZ0A 1F2NA 3MW4A 4IESA 2J42A 3S6PA 3VL9A 1OH3A 5FDBA 3BIEA 4YGEA 4XHBA 1HX6A 1N3PA 3IAPA 4P14A 5FY8A 3O1SA 5IVCA 2DVAA 3AKTA 4IV1C 4WM8B 1QOOA 5F5CA 2DWRA 1J59A 4CDWB 3ZN6B 4UW5A 2QQWA 3NNFA 3U11A 1AXKA 5G05L 3UJQA 1OF3A 1LOAA 1V70A 5JZGA 5FTTC 3WP4A 1JHJA 1HRV1 4IEPA 4EWEA 1BBT1 3I2KA 3LIHA 4R9AA 2JG9C 3K46A 3OBAA 1HB2A 4TWTA 4DUWA 2HWC1 4IXLA 4MO3M 4LBQD 2ZOEB 4NAOA 5FP4A 1D0GA 1RTVA 1H2KA 5TSWA 5IVYA 3KV4A 1RJ8A 1AYM1 3WV6A 5BNPB 4FFGA 5AC93 2CWSA 1WGPA 2ZGQA 4P5YA 4RS5A 3MF6A 4YNIA 3I3QA 3ZXJA 3RI8A 1VAMA 3J9SA 3VKLA 3WP6A 2TUNA 5FK7A 4GWMA 4Q0QA 1UKRA 3RYPA 1ULGA 4O9GA 1W6PB 3FFQA 5C71A 1H2LA 3K77A 3VD4A 3ACFA 1HN1A 2WLPA 5FZ3A 1W0PA 1CR7A 3KGZA 1EV11 4LHSA 3LA7A 1DZQA 4JQTA 3S57A 3WNNA 1SBEA 3IT8A 1AX0A 5B4XA 2R30A 1CX1A 5A1LA 3HEIA 1NZIA 3JBG2 3T1MA 5F2WA 4AK3A 5A3NA 4Y3OA 1NCRC 3I3DA 4RA0A 1VBD2 2RE9A 4QKDA 3FE5A 5FY9A 1MS3A 2VNOA 4N7UA 4FFHA 3NJYA 3POBA 5KHJA 4UW6A 2Q30A 5L9BA 1N1SA 3RQ0A 1JYNA 1L7QA 1LHVA 3NJVA 1RMU1 3NKGA 1GNYA 1NCQB 1W2UA 3Q9OA 4FOWA 2EICA 2ZEZA 1WD4A 3KM5A 5KR7A 1UY2A 1OD5A 2HLEA 3PDQA 3NV2A 1I6XA 4PLOA 4Y33A 1G7YA 3W59A 2GC3A 2ZA9A 4K1YA 4CDUA 5F3EA 1XNAA 3H42B 4L8QA 2ID4A 4GAZA 4XFBA 2D7FA 5GALA 3PVNA 1YLLA 3B94A 2ATFA 2VXRA 4Q1PA 4DQAA 1SFYA 1OMIA 5FMCA 1KITA 1LODA 3ORJA 2C0ZA 3EBRA 1UAIA 2EIEA 4J1WA 3LPGA 4JTNA 1O4TA 3MIFA 5C70A 4Z1VA 4QHZA 3GM8A 3VDAA 2VOXA 1CIYA 3JU9A 1AR82 3RRDA 1UXXX 2HH9A 5FY5A 1BMV1 3AVRA 1H9PA 4UXAA 1CX4A 2R49A 2ZGKA 5FZDA 4BIOA 5A7QA 4W8JA 3AXDA 4PDWC 1YRZA 4YVWB 3WF2A 4AOCA 4FBFA 3O14A 1NX9A 1FMD2 4OZXA 5BUVA 4Q0SA 2G9ZA 4I09A 1R082 1OFNA 5FUIA 4URAA 1RUH3 3WR0A 2WNUA 1SFNA 1K5JA 3PNAA 4LHKA 4KI5M 2R0HA 2RV9A 1Q8QA 2C9AA 2JDPA 4GQ7A 2R1DA 3UV9A 1J1TA 2LTNA 1HXS1 1PIV3 1HDKA 1PMIA 1QQP2 1XU2A 4NPMA 4NR1A 4F8AA 4YM3A 3TEWA 1OHFA 1PX4A 3AZVA 2ZGSA 4KWKA 1BK1A 3H3UA 5F2SA 4JGYA 3U10A 4PBOA 4OQ8A 3GZUC 5I0RA 2GMPA 3H1YA 3O1PA 4PHZA 3TWIA 5GZFA 1MS5A 1WLCA 2YGMA 1DGLA 3AX4A 3ECQA 2WUHA 4FPLA 4GH4A 3C7EA 4AI3A 1RIRA 4MXWA 4OQ9A 4YZ4A 3POJA 2JG8B 3PU8A 4NMIA 4IE5A 1NE4A 1LCLA 1SLTA 2Q4SA 2WBKA 4FTEA 2YPJA 2QQPA 4NRPA 1TNFA 3ZXDA 5HV0A 5L9VA 3JBG1 1UU4A 2DBIA 3K3NA 1GR3A 2CGPA 4J25A 2VNGA 1V6MA 1VBD1 5T54A 2FCVA 2VC9A 1VPHA 4MUVA 4UWDA 3IDEA 2QQLA 3O12A 4GJZA 4AHZA 4BK5A 1ZBA3 5D2AA 3WY6A 4DPNA 1TMF3 1SDDB 3D8CA 5A1FA 2OT7A 2HWE3 1YUDA 2VZOA 2YHJA 2WNVC 1QKQA 4IERA 4Q4Y1 4QXKA 4Z07A 2XJRA 5FZ8A 2XOMA 1G8WA 4QAWA 3I3BA 4XAEA 3HOBA 5IVJA 3MPBA 5DZGA 4AR2A 1W39A 3VD9A 2ZCWA 3V0AA 4RFRB 1DHKB 1U5XA 3OGRA 4QQPA 3P5BA 1QJX1 1MEC1 2A71A 2OPKA 2Y0OA 3KVAA 4WVZA 4FQ4A 4NIAA 1PO11 1UOBA 3OBTA 3WNLA 1C3HA 1NXD1 1SCRA 4MH0E 2RS52 2Z2SB 4XJAA 2YY1A 5FXWA 3RG0A 5BNOC 2RM22 3VBRA 4FFFA 2JD4A 1O4YA 4Q4X2 4E2GA 3PIJA 1UCXA 2RJLA 3GGLA 3MHZA 4M0NA 4CUGA 1RUI1 5C8CC 4XUTA 3U4XA 2DFBA 3VBOA 1O6UA 5C3RA 3PTRB 3RZLA 4N53A 2ZX2A 3OEAA 1K5MB 1V6JA 2ZHNA 3AYCA 2BGPA 2ZGNA 1KS5A 4K6BA 5L9RA 1JI6A 2DV9A 4OHZA 2RR12 2XBO1 1WUVA 1YYNA 3ETPA 4XE9A 2XVKA 1RYYA 5K0UB 3MUY1 1E5HA 5LBFA 1JZ2A 1QNYA 4RR3A 4XUNA 1JYVA 2JEMA 4KGQA 4KL1A 4NROA 1ND2A 1Q8OA 4WM7B 3OGGA 1PMHX 2DCJA 3ZXGA 1JYWA 1R1A3 2Q8DA 5FFOC 5F1RA 1NA1C 5IAXA 1GNHA 1ZZCA 3OOXA 1UOGA 1W6QA 4P5HA 3K2OA 2WA4A 3OJBA 3OPWA 5F39A 5HPOA 2J1SA 3DYPA 4JGZC 4TLGA 5CFDC 2QVSB 2VGDA 1R081 3AC0A 5FY4A 5A33A 1RC6A 1JZ5A 3LOIA 4LULA 1CAWA 1XNKA 2ENRA 4HL0A 2BYVE 3A4UA 1Y7BA 1NUKA 2PELA 3AYEA 1EUTA 1ULCA 1DGRN 3PUHA 2GNTA 3A23A 2VD7A 1QH7A 2CY6A 2VCCA 4QKNA 4WM8C 5FZLA 3ZXKA 4CDWC 4CXXA 1Q8PA 4LUKA 4DS0A 4Q8KA 5JI9A 2DDUA 3ELNA 3ZFFB 1US3A 4CEYA 3JQXA 3K4DA 4LO5B 3W58A 2AACA 3A22A 2Y6HA 1H4HA 4W4ZA 5CVRA 2W9XA 4K40A 4PCRA 1B35A 2OIIA 2XR4A 2WRAA 4XILA 2Q1FA 3KV6A 2YBKA 4N43C 4DFSA 5IHRA 2YC4A 3EJKA 4UFJA 4Y1UA 1RITA 2DCTA 1QXPA 3WW3A 4AYUA 2OPWA 2O8QA 5IVVA 2D5HA 3CHXA 4R8HA 5BNPC 1MS0A 1D4M2 1WCUA 1ASJ3 5F3IA 5FZKA 4CXWA 3DL3A 3LE0A 1YNAA 3O7OA 4YVSB 3WF1A 2ZPXA 3KQRA 3SNMA 4TTGA 2UY8A 2RS11 1LULA 3BTYA 4AI9A 2YU2A 4BPZA 2W08A 1VBA1 4QPIB 5FYUA 1LTEA 5KBFA 4HG6B 1ND3A 5FYTA 3I8TA 4GB33 3HMYA 1RUF3 3VBUB 5CAZA 3KT4A 4PIYA 2J1RA 1YEWA 1ZBE3 4OZOA 4UYBA 5I0TA 4CCCA 2IXKA 3KCCA 4YSFA 2QUOA 2D98A 2ZMLA 2PLV2 3MYXA 2WC2A 4KWUA 4XBNA 5E89A 3VD3A 3ABZA 4HVQA 2RM21 3IPVA 5DXDA 4Q4X1 5ANNA 3ILRA 4JRLA 2VQUA 1VRBA 1NCQC 2G4IA 2VECA 4IEOA 3ZMNA 3A0NA 1UY4A 1OT5A 3WNMA 2W1QA 2UU8A 2D6KA 5J7MA 1X82A 1CVNA 1GWMA 1S0GA 2RR11 3HN1A 4FCAA 4LLFA 3B5LB 1RUJ3 4Q0UA 4BYYA 1OPOA 4B8EA 4CPBA 2B45X 3VKNA 3BU7A 2Q8OA 1Y9MA 1GNZA 2R062 1OC1A 4J6GA 1JOBA 4XFCA 5A3WA 1DZTA 1CAVA 1RGSA 4LPLA 2BPA2 3N36A 2O0OA 2NLRA 4FOQA 2OA2A 3CQOA 4BDVB 2XL7A 2FDKA 4WVMA 2C5DA 1LOCA 1MQTA 2EA7A 1HRI2 2LUWA 5C3OA 1KFXL 3NVCA 1RVF2 4WBBA 2P6CA 3UKVA 5GZCA 2D97A 3LFMA 2IXLA 3OUJA 5T3NA 4EE2A 3K75B 3ZFGA 2E7QA 3S30A 1W04A 3ME2A 2NYYA 1NY72 5L7OB 3PLQA 1GUIA 3PTYA 2ZBJA 3J26N 3O0VA 4NVPA 4PT6A 2YBSA 3AZYA 5C6CA 5FV3A 2FDIA 4CCLA 1JHNA 1ULEA 1QMJA 1AR62 1O4ZA 2W94A 3O1RA 3EYPA 1C5IA 1RUD2 3ZDSA 1VIWB 4YVWC 1J84A 2WQ4A 2IXIA 2QNKA 1ZA4A 5FXZA 5IVFA 5DN2A 1AVBA 3AMQA 5CISA 2HWB1 2BGCA 3F95A 4FP2A 1FX5A 4YW6A 1O3TA 4IE6A 5F32A 5GZEA 4QDQA 4AHYA 1PMJX 2VUCA 5A3PA 4HOOA 2WWSA 3I59B 4RL7A 1R64A 4UFLA 5E16A 3SEEA 4AQ2A 4DXZA 1OI6A 1OOPA 4EN9B 5CKMA 5F5AA 5FZCA 2FMYA 1T2XA 3FHIB 2VTFA 4I0WB 2X5IA 3ZXFA 4BQXA 1FPN2 1VBB3 2JB4A 4E27A 1YO8A 2OS2A 3S5QA 5JXGA 4AI2A 5JMCA 3T4VA 1VMJA 2RMU3 4LBQB 4CCMA 1KQRA 5FPXA 3DF0A 4D7SA 1AHSA 2LALA 5FZ6A 2JG8C 2IUWA 3JD73 4QDSA 2H6BA 1S4CA 5K7PA 2WFF3 4WZFA 4XBQA 4UBGA 2PMWB 3THTA 4CYDA 1K45A 1GU3A 1V6OA 3D82A 3KMHA 5DZEA 5FCCA 5F37A 1A8MA 1IKPA 5H9SA 4DUXA 4QU1A 2VO5A 3I2GA 2SLIA 2DVDA 4X6RB 5FOJB 3CKHA 3JB4C 4XUOA 1H8TA 4QMAA 4O9EA 5C4WC 4BIFA 1GWLA 5B2GB 3J8F3 3NAPA 2PHLA 2F17A 4HFSA 3GJBA 5EQUA 1G9AA 1XBFA 3RZGA 3T0DA 2E9QA 2WZR1 1PVC3 3TAYA 3UKTA 4AI8A 4H3WA 4AI1A 1DQ0A 2WYSA 1N3OA 5FP9A 1VBC2 4N8MA 4QX3A 1D4VB 1WBFA 1MR5A 4QX7A 1AYN3 1RUC2 1YFUA 3DKQA 2VG9A 4MGSA 4E4HA 1G9BA 3LAGA 2FHRA 4ISQA 5C3SA 4IE0A 2A6WA 3ZN4A 3VN4A 1UO9A 1VBE3 1WCSA 2GC2A 3B69A 4OULA 4X6QB 3M3CA 4W6XA 3OG2A 1X8MA 4BQ1A 4NUBA 4BE3A 4LOSA 2R072 1E5IA 1FYUA 3D0JA 4MVTA 5FZOB 1K5MC 4J1XA 4RFT0 5DUUA 3T0AA 1Q56A 3LPFA 4LBMA 4ZY9A 2RJ2A 1RVF1 1IG3A 3SMHA 1QIQA 5A3OA 4AEMA 5K0UC 3FZ3A 2BNMA 3RS6A 5KHKA 3W5NA 4Z92B 1SPPB 1Z7S3 2P3JA 4A7ZA 3B7MA 3SH5A 1XE7A 4WM7C 2ZTNA 2HWD3 2X09A 3IZOA 3M4FA 1WCKA 2VNRA 3B3QE 1U5IA 4NJ4A 1YFXA 2GZWA 3EMRA 1AR72 2A73B 2DVBA 2X29A 4QB6A 4UFIA 5CADA 3DYOA 2GN3A 4YW5A 1RUD1 2AR6A 2W47A 1T6BX 4LQRA 3O1VA 2FDJA 1PZ8A 1C8M2 5F9TA 2WFF2 2VBDA 3MW2A 4IEUA 4DB5A 4DXSA 3N4MA 1OXCA 4YGDA 1IG0A 4NIDA 4NIIA 1AYM3 5FY7A 5ACA3 2JDYA 4QQ2A 3VBOC 1STMA 1G9CA 5T5PA 1QGLA 2QJVA 4FTSA 3LCPA 2QKDA 3VDDB 1QJEA 3I2JA 4BQ3A 1JN2P 2VW2A 2VMFA 2EAKA 1YWKA 5I0UA 5LEKA 3THPA 5GZGA 4XW3A 2WT2A 2VMDA 1EAH3 3PMSA 4Q4W2 5EXOA 1EV13 1J3PA 1J83A 1FOD2 3ST7A 3ZR6A 3HQRA 2X53S 1FPN1 4RR3C 3NV4A 5D8AA 3ZFFC 3DPRA 1ND2C 2W2IA 1COV1 4XCBA 2ZHMA 1XC6A 1R092 1NXMA 3LEIA 3ZXEA 1QJU2 3AK0A 3D0SA 2VM9A 3VBSA 1JODA 3S0MA 2TBVA 1SLLA 5F6KA 4FAGA 1DQ2A 3MO4A 4UF0B 5KC6A 4GJYA 2Y6JA 2JE9A 5EYYA 2NZ9A 1OVPA 1OLRA 1FATA 3BALA 1H8VA 3AM2A 4D69A 4ITCA 4MXVA 1RMU3 3JQWA 4LLOA 1X33A 3GZTB 2VUDA 2I74A 5C3PA 2FZ1A 5C9AA 1VP6A 2BW8A 4FSJA 2CV6A 2VQ0A 2WIIB 2YPDA 1ZYBA 2XUEA 4I02A 5J98B 4E4SA 1QH6A 2JECA 2QQUA 3POSA 4HLTA 5A6XA 4JKMA 5LA1A 3WD5A 3WX5A 3LB9A 4GIQA 4QPIC 1UIKA 3WQ1A 4A2UA 4Z2AA 3HPNA 4EZHA 4IV3C 1BVVA 4GWJA 4IEWA 4KWJA 1V0AA 1ULPA 3AMPA 2WWUA 4LKSA 3E6DA 5FZ1A 4DXTA 2MEV3 2GNBA 4XHXA 2KA3A 3MV11 2NM1A 5L73A 3VBUC 1HRV2 4CU6A 1NLRA 5FYSA 1UY0A 3NNLA 4RHV1 4P9WA 4IGQA 1BBT2 2RS32 2Z79A 3MUZ1 1RUC1 3OPZA 4YG3A 4A7KA 4BLJA 1GOHA 2HWC2 1LHNA 1AL21 4R4ZA 1N47A 5EYXA 1YQCA 1SQ4A 3ACHA 1BEV2 1HN0A 2BVBA 2VOWA 2RG4A 3GCWA 1H9WA 5LB6A 3BKZA 4XACA 1M4WA 3W20A 1D7PM 5DG2A 1C5HA 3EB7A 1EUUA 1X8EA 2DCZA 2BGOA 4HK8A 3X29B 5DMYA 1OA3A 1V9U2 4JZRA 1RL3A 2G1MA 1PM7A 3MICA 3PURA 1CAXA 3WXPA 3E97A 4YG0A 5A6ZA 1DFQA 1UIJA 1YQ2A 3WNKA 1PGW1 2DCYA 5FZGA 1O8PA 1O3QA 4FTBA 1UYZA 1E5RA 1JS9A 2ARCA 3BIWE 5LA2A 4QKBA 2EIGA 3W9AA 2BVVA 2C1FA 1WWYA 1VE0A 2W46A 2P3IA 5GM0A 3ZFEA 4AG4A 4E8CA 1G6NA 2VXJA 1C8M1 2BRTA 1WMDA 1GZWA 2XMLA 3NQHA 2BTVC 1FXZA 1US2A 4AE2A 1PO21 3AZWA 1QJY2 2BQPA 4NHXA 4AXOA 3JXSA 3PL0A 3T1LA 1JZ8A 2NN8A 3VBFC 3HBKA 4P9GA 1X9TA 2YFZA 1S2BA 2E6VA 3IMNA 3CL1A 2DF7A 4SLIA 2P37A 1DCSA 1YJLA 4XXAA 1DDLA 5A7NA 4XFIA 1XNDA 4HKOA 4LKDA 3T2TA 2K0GA 2PTMA 5JOZA 1H6YA 2LS6A 3RZZA 3VZKA 3JBG3 1QJU1 5FUNA 4FPHA 4Z2WA 1NA1B 2DUPA 4Y4YA 5A32A 1MQTC 1VBD3 1Z0HA 3LIGA 3CJIB 1ZZ8A 5I8SA 4B1MA 3VZNA 4CDXA 2W87A 4DOUA 5KC5A 5IATA 3EXUA 3CZJA 2W95A 4AVVA 5CFDB 3ZYHA 1ULFA 3ZYIB 4XMAA 3DKWA 4B29A 4NAMA 3T0BA 2NMOA 3FL7A 3R6SA 3T2PA 4A7YA 1W99A 2JB8A 2ZEWA 4MX3A 1VR3A 3ZN6A 1ZZ7A 2QE3A 1GSLA 1OF4A 1OLMA 4AEKA 4I01A 2HWF1 3H8RA 4D6SA 2EIBA 4XJUA 3ZSKA 5JDBA 4AF9A 1PZ9A 4B7KA 4RSUA 2GNMA 3V64A 1BMV2 4BQYA 1MS1A 4BMEA 1TME1 4LBLA 3AJZA 4Q0PA 4HETA 3ZX7A 1RINA 4BISA 5I93A 1VB2A 2ZEXA 1IQDC 2ZGOA 3FFZA 3H8OA 3JB8A 1L7RA 2N7GA 3H3ZA 3MIEA 4U2AA 2RS31 1SG3A 1KDMA 4N43B 4XZPA 3DXUA 1HXS2 4GWIA 3B9IA 1IS3A 4S2GA 1BEV1 1F4AA 1HQLA 3J7MA 2OXBA 5BNNB 5EWSA 5IUQA 1GKBA 5LY1A 1YC61 3CMGA 2ZMKA 4L2NA 3SC7X 3AP7A 4XFHA 4CP9A 4DRVA 3OBZA 1QOSA 2QQIA 4DY5A 1AR83 1V9U1 4RGGA 4A3XA 2RDNA 3KHBA 4HSLA 4S2DA 2VOVA 3FUQA 4OHVA 3V0BA 4MOAA 2ZHLA 1OLME 2F6BA 3U37A 3OYWA 2DVGA 3QOPA 2WSUA 1FMD3 5B4NA 5JZGB 1R083 1W3XA 4PI0A 2ZZQA 3LEMA 3V65A 3WZ1A 4LIVA 2P6HA 1OKOA 3Q8EA 3NNGA 1S0FA 4XFGA 3OF1A 4YW7A 1UMHA 4LR4A 4QXHA 5A3MA 1Y4WA 4EV0A 2IC1A 1QQP3 1SBFA 3LQCA 3SH3A 2ZGRA 1LNSA 4OLLA 1WMFA 3AP4A 2OW4A 4CSWA 1PK6C 1CD3G 1UOJA 1AXYA 2WO2A 4Q4Y2 3LDRA 1UMZA 4RS5B 1QJY1 4QT6A 3OEBA 4EJRA 5A6QA 1H0BA 5JSOA 1EP0A 1O3RA 5LZ6A 5E6HA 2JDMA 1VRH2 2KD7A 4UW4A 3USSA 5AFEA 4ZPIA 4GXLA 1QJX2 4HK9A 1MEC2 3WUDA 4I0BA 5FUPA 2PHFA 4LMFA 4K8RB 4NHYA 3AMNA 4QQHA 5LA0A 4IE4A 2XQRA 2BERA 2B39A 3EQEA 1PO12 4Y26A 5T55A 2ERFA 4L0PA 4AI0A 1CGPA 2PHDA 3CU7A 1WZXA 4ZU4A 2HKXA 1RUI2 2D6MA 1NOVA 2X10A 1CJDA 1Q5OA 4QXCA 1LHOA 4SBVA 5FK8A 2WL1A 5EPAA 5HCBA 4NN0A 1EPZA 3LKJA 5FYBA 3VDDC 3ZIWA 5JLVA 3NV1A 3ON7A 4IEQA 3S7EA 1ENSA 1XJAA 2P5BA 3J7LA 4XTMA 2B7YA 1LHWA 4E8DA 2MPFA 2XBO2 1S55A 3PJQA 3SXWA 4CU8A 1H1IA 2Z5WA 5LA9A 4XEZA 3M7AA 3N7LA 5GLWA 2W1SA 4AQTA 2D6LX 3IAQA 3T30A 4CDQA 2WN2A 1ZRFA 2YZ4A 4JAAA 4BM8A 4E9KA 1OPMA 5BY5A 1U12A 2DUOA 2XHNA 4H55A 1LR5A 3BODA 1H2NA 3AP6A 4BOWA 2WS92 3V56A 4AEDA 1OH4A 1SHWB 2VUJA 2XJVA 4PI2A 5LEJA 2WNOA 2J1AA 2RS53 4HN0A 4AAXA 4CDUB 1ZZ6A 2RM23 5E1RA 4Q4X3 1J1LA 2UURA 4F7ZA 1CN1A 1EYBA 1XNBA 5FKCA 5A3LA 2HYKA 1LOFA 2ORXA 3TEZA 3OY8A 1G9FA 5JR2A 1BYHA 3ZSMA 4MGTA 1ZRIA 4K3UA 4LBKA 5ABJC 1JH5A 4ATEA 2PXJA 2AC1A 2RR13 2HJIA 4BXFA 5T5OA 3GZEA 4YGCA 2I07B 2JJ6A 1QJZA 3DV8A 5A7WA 1CAUA 2A6YA 3PUSA 5I8YA 5CB7A 3ZR5A 4P00B 1TE1B 4QPGC 1W6MA 1G9DA 3RZHA 2VZVA 1XSRA 5FYHA 4XJWA 5FYZA 5CNAA 3VZMA 4UFKA 4CEWA 3ZN5A 4URTA 1PNFA 4QGNA 1SLCA 3APBA 1OQ1A 2CAVA 2WNUB 3ACGA 2JX9A 5JOXA 2PHUA 3VZOA 3MIDA 3TBDA 2ARAA 2JKBA 2I2SA 1S2EA 2RS12 1RUE1 2VBPA 4LO7A 1JW6A 3HNYM 1QWRA 2GH2A 1A78A 1VBA2 1QEXA 2R6QA 4JGYB 5C4WB 4X8NA 2GSYA 1L7LA 2VL4A 2FCTA 5F8PA 3HN3A 3UESA 1HB4A 1LESA 3ZVXA 1RHI2 3D6EA 3B93A 1VRH1 4QX2A 2UWBA 4CP0A 3NL1A 2XJTA 5JPMB 4GH4B 5K4LA 3IDBB 1IPJA 3KV9A 4MXWB 3USUA 3QACA 5ISLA 1JBCA 5CG9A 4Q4V1 2AUYA 1ZX5A 1NLQA 1UU5A 3ATGA 3H1WA 4R4XA 1SMVA 5A7OA 1MZEA 2DU0A 4HMZA 4QGLA 1D4M3 4LHNA 4I3GA 5HV4A 5GKAC 1UWWA 4CTEA 2E32A 3DYMA 3FHQA 4XYXA 1DQ4A 2ZHKA 3IDAA 3VKMA 4MG2A 1V6IA 2VQAA 3TOJA 2WWJA 5FMOL 5FR3A 4I2OA 2VMCA 4GMP1 5FYYA 1M06G 4AWDA 1O7FA 3N9QA 4COWA 4ISRA 4OI1A 4DINB 2E33A 2F4PA 4CZSA 5I0SA 1GQPA 5KXDA 3AKRA 2WS91 4XXPA 3WDTA 3CJIC 3RZMA 3Q8BA 4JRAA 2I45A 5JSPA 1A3KA 4CU7A 4WV8A 1NQJA 2PLV3 3NV3A 3PVOA 4DY3A 3VBRB 1GICA 4UW3A 5JIAA 4TXWA 2UYAA 3AMMA 4Q29A 4Q0VA 3VBOB 3HNMA 4I3PA 4O7XA 1UNBA 4ZKTB 5JSRA 5AC91 4N53B 3VBHA 2BDRA 4COZA 1MZFA 5J37A 2BZDA 4TN7A 3E5UA 5CZKA 2XUMA 4HONA 4NPLA 4LBJA 1DYOA 3WCSA 3B00A 4NOTA 2BNNA 1Q8VA 4ZS2A 4LOTA 3GXUA 3P3NA 5BNOB 1H2MA 3BUCA 3QH7A 3B01A 2W1UA 5FWEA 2VH9A 3HAGA 5EP9A 4RR3B 2VVFA 2PAMA 2R063 3OTFA 4S2HA 1ND2B 2UWAA 5FLIA 2HWB2 3MI8A 2DCKA 3LF7A 5C5TA 3VUOA 1UKGA 1W8TA 3RZJA 1W6QB 5JUVA 1HRI3 3K48A 4DO0A 2IXCA 4YVSA 4CU9A 3ENRA 2D6PA 1RVF3 3N7MA 5DDJ2 5FO8B 1JUHA 2YBPA 1V6KA 1OA4A 1HV1A 5CU1A 5BNNC 1AXZA 4P08A 5JAXA 3ZYPA 4XJ9A 4AVCA 3H7YA 3HBZA 2VZSA 2YUEA 2IZWA 5A33B 1IS4A 1WCQA 2OUHA 3GBGA 1CAWB 4LTAA 1BZWA 2VVDA 3SCHA 5IT6A 3WG1A 2CDPA 3M3EA 4G3YC 1F35A 3I49A 1OA2A 4C8DA 1AR63 4B3NA 4XDQA 4D8MA 1XYPA 1RUD3 1HV0A 2BNOA 2KXLA 2VUAA 3J7NA 4EROA 2QDRA 2XH6A 4IV3B 1C4RA 4CEYB 2PQQA 1ULOA 1RHI1 2P1BA 4PLNA 5JZGC 5AVPA 4YRDA 3SKVA 4BQ5A 4EYUA 1W8FA 1GP6A 5KWRA 1F4HA 3ZPOA 4KBZA 3C7HA 5CFCA 1PX3A 2CTVA 1YI7A 5FPZA 4XC9A 1U5YA 4AL9A 1X9PA 4Y4RA 4NWVA 4RS5C 2JDUA 3T08A 4BQ4A 1UN1A 1FPN3 3G6JB 3RVHA 1TEIA 4QQOA 5CBLA 2NQYA 2ZZJA 1C1LA 3VD7A 2WZR2 2ZX1A 3P1IA 2YB7A 2WDBA 4M3CA 3BI3A 4GWNA 1LOGA 4PJYA 1RXFA 3AFGA 2ZGTA 1REDA 3GZAA 1C57A 2Z4FA 5FZHA 1MVEA 3FHAA 1ND3B 4JQRA 1Q43A 4LUMA 4XAAA 1SZBA 4XF0A 1WLTA 3RWNA 1V6LA 3K3OA 3WP3A 4CCNA 4COVA 4PQ9A 3S5AA 1RUH1 2E63A 3GJAA 5IVBA 2J1UA 4AEJA 1H1MA 4C1WA 5JXJA 4HVRA 1YI9A 1OBNA 4AFAA 2P4EA 1CZVA 2RJKA 3H9AA 5FYCA 1W3VA 3I54A 4AGGA 2FQPA 4CRQA 5JVVA 4E4ZA 2ZX0A 5BNQA 1ZREA 1FNZA 1YIFA 1K3IA 2Y60A 3HT2A 4QM8A 5DG1A 2JD9A 4COUA 4FPEA 1LHUA 5FXXA 3UNPA 1JZ7A 3VHPA 3BOPA 1LEMA 1W0OA 3FBYA 5E88A 5A7PA 2BOJA 3WG2A 1HLCA 4FXGB 3VBFB 3AB0A 1YFWA 3POIA 1VBC3 5EJ3A 1DQ1A 3WW4A 5LK5A 1KS4A 4OI2A 1RUC3 4YWAA 2W1WA 1CQ9A 4BHPA 1SBDA 4M3CE 2ARBA 4CDUC 1WLDA 3GCXA 1W2TA 2B4KA 3HWJA 4TLFA 1UU6A 3WQBA 1CAVB 3AZZA 1FV3A 2QQMA 4QPYA 3VLBB 1NT0A 3OCPA 2YGLA 2J22A 2R073 1F15A 4WVMB 1MQTB 2ET7A 1Y9QA 2WO3A 2HEWF 1ACCA 5IK4A 1POV1 4AFMA 5DDJ1 1AUYA 2WO1A 3TB0A 2JIGA 1ZBA1 5FPAA 2A5ZA 2XHKA 5FPLA 3ZFGB 2J7MA 4IV1A 4BQ2A 1JYIA 4CDQC 1DGWA 4AVTA 3KT1A 3ACIA 1W2NA 1YXWA 3KF3A 5JCTA 1COV2 5EV7A 1NQDA 1WD3A 3LWCA 2P17A 1AR73 4OFGA 4FPFA 4CA9A 3NW4A 2DTWA 3BB6A 3N9OA 1DYPA 3WT3A 2Y6LA 1C8M3 2ES3A 2JG9A 2PA7A 3HIFA 1B09A 3TEXA 2UYBA 1QXJA 3ILNA 2WJSA 3G7DA 4XZUG 3GDBA 4ASKA 2WNUC 3ES1A 3THDA 4ES8A 5JOYA 1ENQA 3PHMA 2XXZA 4OCTA 3P6BA 3IBMA 1ZRDA 2YG0A 1MS9A 1OOPB 4FO9A 2VMHA 4L9BA 1IKQA 4LBNA 4EQVA 4ZHNA 4YG6A 4Q4W3 2EAAA 2ZABA 5DPNA 4HKWA 3R4DB 4JGYC 1FOD3 2GALA 2X5IB 2GDFA 2H6CA 1XSQA 2D40A 5FLJA 3KD4A 1KEXA 1UYXA 1OUXA 1AF9A 1IS5A 1X7NA 3GHNA 1R093 2WAOA 5FJHA 4BWOA 1OQEA 1QJU3 2VW1A 4GH4C 4WZCA 4LT5A 1N3QA 1YCIA 4RHV2 1R1A1 3WDUA 2PHXA 5LCWL 4NHKA 5A3TA 4TZDA 1S0IA 4QX0A 2VTXJ 3KGLA 1BJQA 1NCRA 1DP0A 1UOFA 3FC0A 4CP2A 3DN7A 4A3ZA 1AL22 2P3YA 2W39A 3N9NA 2C6SA 1PM4A 1U5ZA 2VCBA 2XWJB 3HQUA 5FZ4A 4NE9A 5BPXA 4LE3A 2QZ3A 2E7TA 3KHCA 4DXRA 4ATFA 2D43A 3N7KA 2PHWA 5FP3A 2QFEA 3O1OA 2IVIB 1OURA 4EN8B 2PAEA 3EO6A 3OUIA 1IQAA 4JDMA 1H8TB 5J48A 2R042 1I1EA 1AL0G 2JDHA 3CZUA 2ETEA 3MZHA 1PK6B 2LW8A 2XL9A 3NAPB 4YPJA 3RPQA 3SISA 3H3LA 5HI0A 1KJLA 2AGSA 1PGW2 2VMEA 2VZUA 3LSDA 4GKXA 3SHRA 2CGOA 2WABA 2HEYF 2FCUA 4H14A 1L3JA 4AGRA 1HRV3 1LGNA 2A6ZA 1XOYA 1BBT3 2RS33 3KS7A 3U07A 1W6NB 4JHZA 4XVHA 3WW2A 4FVVA 4LA2A 3ZYBA 2HWC3 4IGOA 1N1TA 1I5PA 1UZYA 3AL6A 3NO8A 3VBRC 1BEV3 3ES4A 2R1BA 2JDKA 3I2OA 2VZ3A 2JENA 1PO22 5FAXA 3AJYA 4HPKA 4K7JA 4N53C 4L92A 4PF1A 1QOTA 1ASJ1 5C8WA 2WNEA 3CF6E 2DFCA 3BTAA 3FLPA 1NG0A 1HKDA 3GALA 3FLRA 4TSVA 3T2QA 1V9U3 4HN1A 4O65A 3OD4A 1JYCA 2CWMA 4LHLA 2WINB 3ZIXA 1S0CA 2O8OA 5FKBA 2YMZA 3TN92 2ZKLA 3IM0A 4PDWA 5LK7B 3FJSA 4LJHA 4CUAA 1ODNA 4GB31 3WSOA 3B9CA 4YM1A 1RUF1 5KXEA 1LGBA 1EPWA 1W8HA 4A6SA 2VE1A 4OHWA 3KV5A 1JOPA 3O5SA 3WVJA 1YQ5A 1DLLA 2SBAA 2HBTA 3LZZA 4INDA 4LKEA 2O14A 3DEMA 4QPWA 2LROA 2WZEA 3UETA 3OPTA 1QJY3 1HB1A 5KHGA 3CNAA 3M70A 3VHNA 5J36A 1UY3A 4AQSA 4CCJA 1GV9A 1RUG2 1SACA 4CE8A 1W2OA 2HWF2 4QWNA 3I3EA 1VMHA 1D2SA 2BWCA 2WA3A 3AVSA 3VDCA 2R7EB 1TG7A 1TME2 1HQWA 1RUJ1 3NWKA 4AFCA 4CP1A 2ZMNA 5D8AB 4CEYC 3WG3A 2YU1A 1W9WA 3DPRB 2Y34A 4NO4A 3MFCA 3VHRA 4ES9A 1KD7A 1B35C 5BYNA 5GLUA 4QPGB 3VBSB 1S2KA 3D3AA 2FZ2A 5JR7B 2GC0A 4P02B 2DUQA 2ZJCA 1BKZA 2XJSA 4MADA 4ZS3A 5LW9A 2XKPA 3KQ4B 3Q8AA 4FP3A 4AQ6A 1IHMA 2D44A 3BGAA 4W6YA 5JIUA 4ZZ5A 3AFKA 2QQNA 5FBZA 4C90A 5FMOS 2WQZC 4R52A 4K21A 2WNVA 4N9HA 1UPIA 1PHMA 3E1F1 5C9AB 2JDZA 2G9FA 4CUCA 2XJQA 5H9PA 3VL8A 4LBOA 5FP8A 5IK5A 1T6GC 3M3QA 4X8PA 2BFUS 3LDKA 2R041 1JYXA 5T5JA 3AP5A 5KXCA 1ND3C 4PIXA 2JWPA 4EN6B 5BNOA 5HXVA 2AYHA 1PVXA 1ZNPA 2ADDA 2ZGMA 3IIIA 3QLQA 4YM0A 1BCXA 3WW1A 5E8AA 4D6QA 5KHHA 1UZVA 1CIWA 5C8CA 2CSGA 4MHRA 1GWKA 3KB5A 4Y5Z0 3FBMA 1HXS3 1DQ5A 1URXA 2BOIA 4HBNA 5FZBA 3ZSJA 1H6XA 2Y8KA 5FREA 1W6OA 3VGIA 3WDYA 4KG0A 1DZRA 2HYXA 2ZGUA 3ROUA 1VBB1 1KXGA 3IB3A 4UFMA 1CPMA 4EWAA 5CKNA 2AREA 4NPRA 1OSGA 5LRRA 2Z69A 4JDOA 3WDWA 1CAXB 1PGSA 3C7FA 3HJRA 4QKFA 3TN91 5M0TA 4RQPA 5FQ0A 2BBVA 4UT5A 4JGZA 4N90A 4LO6B 5CFDA 2RDQA 4COYA 1W06A 2A3WA 3CLPA 4IEZA 4LA3A 4TYSA 3ZFEB 3FUOA 1ZM1A 2PFWA 1PGL1 2X8KA 3POGA 4Y20B 2ZGPA 3UL2A 5DZFA 4ZZ8A 5I91A 1GZWB 3M3IA 3FMGA 5F7UA 2B42B 4F83A 3ZFGC 1YQ8A 4QD2A 3RYKA 4Q4Y3 1Y43B 2RVAA 3GBFA 4W6WA 4NHMA 1YFYA 4WM8A 3LA2A 4QQLA 4CDWA 1JZ3A 4UAPA 1WA4A 4MGIE 3I4IA 4Q27A 4M4PA 2W3JA 2AEYA 1H4GA 1RUG1 1VRH3 2IVJA 2XWBB 1AX2A 3IDCB 5K9YA 4XIOA 3ZXAC 1QJX3 1YIPA 1MEC3 4JDNA 4GKYA 4Y1YA 4ARXA 1LJ7A 4YFWA 3I2IA 4ASMB 1PO13 4FPKA 1AYN1 4MV2A 2WSVA 5FZ0A 3B02A 1ODMA 3BVCA 2FMDA 4Q26A 2G19A 1APNA 5FPBA 1RUI3 1KJRA 1VBE1 1QDOA 3E5XA 5A32B 4YYOA 4AZZA 4D7TA 5BNPA 4CDXB 4A42A 4D6RA 3LSEA 1OOPC 1Y3TA 2BWAA 4OVEA 5FWJA 4BMBA 3T3YA 5HCHA 3RZKA 2XLGA 4YW3A 3MBWA 1S1AA 1W6PA 2XBO3 3VB9A 1DG6A 5A70A 3JUUA 1UQXA 4D7YA 4GMP3 2X5IC 5L19A 4H7MA 3KZ4C 5FXVA 3E6CC 4Y22B 4V1PA 4QHOA 1Z7S1 5IFTA 2QCSB 3ZYJB 2TEPA 3ASIA 4ET7A 4G4FA 4BK4A 2HWD1 3WHTA 2EVXA 5DUVA 1AR92 3ZO0B 2WS93 2HBUA 2XJUA 2Z42A 1TNRA 2XJPA 3TRSB 1DLCA 3QH6A 2VTXA 4YLZA 5GZDA 1GZCA 5HCAA 5APAA 4NIGA 4LNVA 4HT1T 1JYTA 3DCQA 3D4KA 3AZXA 5ACA1 5FMBA 3NSTA 4META 3IIAA 1DYKA 2NP0A 1XU1A 4FOYA 1NCQA 1U0AA 4QX5A 1UZZA 1RUE2 5FZ9A 4JKLA 1H8TC 5FOBB 1KGYA 5D1IA 4A6OA 2GNDA 1EAH1 1DF0A 3AKSA 3NAPC 5J1XA 2GMEA 4PBPA 2B9VA 5FO9B 2RDSA 2W0XA 3E6BA 4CP9B 1CZSA 4JC1A 4R9CA 1S0EA 2XVGA 2OKXA 4D0QA 3T09A 2A3YA 4RN5A 3SCFA 3WNXA 1LOBA 2EF6A 3I2FA 3V0BB 3LA3A 4IW3A 5CYYA 5IK8A 3EHKA 3MEPA 1ENXA 4Q4V2 4GA9A 4V2WA 3OYWB 5FZAA 1REEA 1ST8A 4IEYA 1VMFA 4KQ7A 2BBAA 3C7OA 2JDNA 4EZ4A 1QHDA 2AEZA 3N9MA 1S0DA 1V00A 3N9PA 2V5DA 4FT8A 1WW7A 1LENA 1LKNA 1NKGA 4EN7B 1GZ9A 2DBNA 2OZ6A 1MS8A 4LIUA 4V2VA 4ZXKA 3WF4A 1W8WA 5LY2A 4R9DA 5FP7A 5FYMA 2QZ2A 2ZACA 2RS13 3ZYFA 3OD0A 2E7AA 3AKPA 4P9JA 1VBA3 1W8ZA 3MGUA 4FXKB 4P9LA 4HZFA 1WW5A 4YM2A 1JUIA 2VQTA 1POQA 1RHI3 1Q8SA 1UXZA 2YC2A 3LGRA 3N9LA 4YVWA 3W21A 1ZA7A 3F2ZA 3HQXA 4QB1A 2MEV1 2MNGA 5LWBA 2CAUA 3CDZB 2VY0A 1WBLA 2FDHA 1E5SA 1BXHA 2ZAAA 2WAAA 3WQ0A 1F8VA 1IS6A 5FRAA 4BU2A 2V4AA 4PLMA 3MLLA 2Y6FA 1IPKA 4XUPA 2PHRA 2YFUA 4M4RA 5C33A 1W28A 2CU5A 1TZOA 1JMUB 5AC92 4Y1XA 5A80A 3PUQA 3WDXA 5DAPA 4E2QA 5HXMA 2ZAHA 2NPIA 1YHFA 2XQXA 4IL7A 2MHFA 3U0ZA 4DMIA 4D94A 2W52A 3LDBA 4OHXA 3WHUA 3SCGA 1VJ2A 2ZGLA 2R32A 1NLSA 1SLBA 5IAVA 3RSJA 4F3JA 3FLTA 5D8AC 3VZLA 5J3UA 3POWA 3DPRC 3H50A 2JG8A 5GLTA 3ZLIA 4CDQB 3GBWA 3U1XA 1OLQA 2WZ8A 5EHDA 1BQPA 3BN6A 3PMEA 3CEWA 4KG8A 4LK7A 4M01A 4XURA 5D21A 3PVBB 5SV8A 3VBSC 2BUKA 4BCUA 1AR91 1O5LA 4IGPA 3ZM8A 1LU1A 1BHGA 2GC1A 4QDRA 4AEDB 2VZQA 2PHTA 3J4UH 1CONA 2BU9A 2K2SA 4XCAA 3BTXA 2D3SA 4BQWA 2KM2A 4L97A 4WVVA 3O0WA 4AHWA 5KXBA 1KDKA 4K8FA 4XJ8A 3M1HA 4XBLA 4U36A 5C4WA 1LRHA 2JXAA 3KCXA 3OY8B 5DUXA 2V5YA 3WP5A 4CCEA 5C9AC 2W68A 1W9TA 5EIYB 4H7LA 5LBBA 1Q3EA 2BJSA 1TQ5A 3BTZA 3I97A 2GP5A 5EJZB 4HSJA 3VD5A 3ZOIA 2K9ZA 4NRMA 5A7WB 3POYA 1CAUB 1C8NA 2ILMA 4M0HA 4DUVA 2HWB3 2VPVA 3ZSEA 3CO2A 5CG8A 1GP4A 1W6MB 3RMYA 2GN7A 1WW4A 3GYDA 1XQNA 4I0AA 4CEWB 2DU1A 1K5MA 1POV3 3PU3A 1DU3D 5DDJ3 3SITA 4BZ4A 2VZTA 3CJXA 1H30A 4FPOB 2TNFA 5K0UA 1PZ7A 5IVEA 1X50A 5IYYA 3C8XA 4FPYA 2WZPP 1DGRA 2DURA 2ZX4A 1GQHA 1UMIA 3MIHA 5DAXA 4WM7A 3WNOA 1PNGA 3BPZA 3N7JA 4CUBA 2D5FA 1F5FA 3IMMA 2OYZA 3LFIA 4JVAA 2QDNA 3OSDA 4H2AA 3GHMA 5DAQA 4GALA 3P3PA 5F5QA 1V6NA 3SKJE 3VKOA 4XDPA 5ABJB 3KLSA 1QY4A 3DECA 4QXBA 1W0NA 3WINE 1F31A 4QU2A 3UGFA 3V0AB 2JE7A 1RUOA 2BFUL 4XF3A 4C91A 5T5LA 1RJ7A 1RUH2 2PYTA 5EZWA 4AFDA 3A0KA 3ZDVA 5FJKA 3ZFEC 2Y33A 3USUB 2E26A 5KHIA 2FD8A 1XNCA 4R9BA 4JKKA 1PIV2 3INAA 1RUNA 4LE4A 1VAVA 3RWKX 2B9UA 3IWZA 2XB6C 3THCA 4JTOA 1G86A 2WZR3 3Q8FA 4IEXA 4JCKA 3ZFFA 4DEVA 4HKLA 3FX3A 5BV6A 3KCYA 4YW2A 3U4SA 1GZTA 4FPJA 4Y24A 1AR81 3AXEA 4PQQA 2FBEA 4A44A 4MGQA 5A6YA 3H0OA 2VZ1A 4MSVA 1JXNA 2QQKA 2VR4A 3A21A 3IKWA 4AVSA 4RQPC 2D3PA 3PIGA 4XABA 5JOWA 2OQ7A 4RGAA 5F6LB 1FMD1 5A7SA 3FWEA 1VALA 3KWVA 4B4QA 4CDXC 3WUCA 4UBHA 3ZSLA 4OMDA 2CHHA 3H8UA 3PUIA 3UT0A 4JHTA 2IFWA 2VCMA 3RFRA 3M3OA 2LRPA 1QQP1 1ZBA2 4OUSA 2DVFA 2ET1A 1TMF2 4AVAA 2HWE2 3OGVA 2YV8A 2VZPA 4PIZA 4QPIA 4XOGA 4MLOA 4LORA 3VBHB 4IV3A 4K9SA 3K51A 3K4AA 1CJPA 2A7AA 3LEGA 3Q8CA 2A75A 3WG4A 1NYWA 3GF6A 2Q5TA 1NE6A 4QHBA 3VBUA 1HJGA 1A34A 2RHPA 5FZFA 1WCDJ 5LASA 1CWPA 2E31A 3NNJA 4XUQA 2Q8CA 3AYAA 2WFPA 4O61A 3TNQA 1W05A 2NMNA 2VU9A 3R05A 4GMP0 4JX0A 4LKFA 3C2UA 1B35B 1W03A 2ZXQA 4LXLA 2KR2A 2E51A 2LM3A 4M00A 1GP5A 3DUIA 4MGKE 2YC0A 4XFFA 3O1TA 4LITA 3T4HB 3HVDA 2DTYA 5SV5A 1LEDA 3E5QA 4CCOA 1O8SA 2HEVF 3A7QA 2OX0A 4RGKA 4LO4B 1XYNA 3RGBA 1J3RA 2JICA 3O0XA 1MZ6A 5FLHA 3AP9A 1COV3 1MPXA 3JCIA 5EJ1B 2QBXA 2WT1A 3SLIA 5EFUA 3ZMOA 3MLKA 4QX8A 1R1A2 2E53A 3H1MA 1UW8A 2VULA 1FI2A 1S0JA 2EALA 2D93A 2OQ6A 5H9QA 1REFA 1SCSA 2BEOA 1D2QA 4DEQA 2RS51 3I2DA 1FNYA 3FN9A 2P3KA 3OB8A 4ONUA 5AFBA 3QBQA 2WO7A 5CFCB 5LATA 5L7OA 5LBEA 1W9YA 4A41A 5HCFA 1PIV1 3IPVB 3MIGA 1D0HA 2YROA 1HB3A 5BXXA 3VBFA 4D3WA 4DIQA 4EN0A 1GFF2 4XTPA 3RYRA 2Y64A 4ASLA 1VAKA 2D6NA 3HD8B 1ULDA 5FY0A 4LEJA 4YZ1A 1UF2C 2V73A 1MZ5A 3KSCA 4KH9A 4M3CB 1UYPA 4XFAA 2EXHA 5GLVA 4RHV3 1OFSA 3R4SA 2ARXA 4FPCA 4MGZE 2CL2A 4UI9L 2DYCA 3VZJA 1W9SA 4OHYA 3POEA 5JMOA 1LU2A 3I59A 4W65A 2V4VA 1AL23 5IK7A 1IOAA 5I8TA 2BV4A 5ANQA 3WLUA 4DZGA 2VMGA 2WT0A 3POFA 4XQWA 2A1XA 5DQ0A 3L9JT 2PN5A 4Q2FA 2C26A 5T50A 1JZ4A 4IETA 1DIWA 1W8UA 4P9YA 4FPGA 4XPVA 4Z8BA 1GBGA 3PVEA 1ASJ2 1K12A 4G9SB 4B4PA 3ETQA 1SLIA 4BJ0A 2VCAA 3WQ7A 1LOEA 4QX1A 2IXJA 4XQ4A 4C1XA 2W92A 3BOWA 3NJXA 2R043 1TMF1 3MV01 1VLNA 3BCWA 4LBQA 4Y1ZA 4IQPA 1GQGA 2HWE1 3ZKUA 1YJKA 3H8XA 3AYDA 5FZEA 5FPUA 1W9FA 3WF0A 1ZRCA 5CA6A 3BYWA 4GB32 4Y5SA 4NIHA 1S0BA 2D6OX 2GMMA 2PQSA 1HJFA 1RUF2 5LBCA 3ZPYA 4AEDC 3WNPA 1F9KA 3L2YA 3HNBM 4P9XA 3SH4A 4C0HA 1AJKA 3LOBA 3ZXLA 1WMXA 1ZBE2 4FFIA 4RYDA 5FO7B 5FYVA 4YZ2A 2OVUA 5IFPA 3JZVA 2R16A 2V09A 5FZ7A 3WOGA 3ITQA 5F3CA 1PO23 3O1UA 1LOFC 3TNPB 3SEPA 1D4M1 3AMHA 4A4AA 4L99A 3LD8A 1W8NA 4OMCA 2F4LA 4OYUA 3C7GA 3WF3A 4YZ5A 3I2HA 5CIRA 4KWLA 4I30A 1VB4A 1MS4A 1ZVFA 3OBRA 3DGTA 2CGNA 4OI0A 1C28A 1RUJ2 2A70A 4BLIA 1LAJA 4IV1B 1E57A 2Q1MA 4MZUA 1LECA 4N9IA 4JV4A 3TN93 3TEYA 5DAVA 4IUGA 2FDGA 2H0VA 3UK9A 1NZCA 2ADEA 2QQOA 2YYOA 4IEVA 1UY1A 4XF4A 2ORZA 4E2SA 4CEWC 4Q1RA 5FZOA 4BXSV 1FV2A 4YFZA 1RB8G 1XRUA 1TVGA 2JG9B 3H7JA 3IN9A 4FI9A 2V72A 2PLV1 1HIXA 2J1TA 1ZZBA 3K4ZA 4M3CF 4AVBA 5C5UA 1XYOA 1WW6A 2VJXA 3T2OA 5J96B 3LEKA 2ZEYA 4FAHA 5T52A 4KMQA 3WCRA 1PK6A 4QGMA 1GMMA 1SPPA 5F3GA 1QJFA 3RMXA 1FT9A 2EXIA 2FDFA 3NRUA 1RUG3 2XLAA 3KT7A 2HWF3 3W5MA 2CYFA 4BA6A 1DBNA 1IZ3A 1QXRA 1ZRRA 3BU0A 4HANA 1TME3 2QTWB 4B7EA 1W6NA 4Y5TA 1POV0 2J1EA 2JE8A 1I5ZA 5FZMA 3RNSA 2R061 3U75A 5LRSA 2AZ5A 2XDVA 5FZIA 4CCDA 2QQJA 1K42A 1CESA 1LGCA 2Q8EA 3ZYGA 4ZU7A 3PJYA 2EXJA 3N3HA 4NRQA 3UKNA 1NCRB 4GZ9A 1CZTA 2XGXA 3VDDA 1HRI1 1XE8A 2UWCA 1QNWA 4BB3A 1OQDA 2IFRA 1UZWA 2WR9A 4OUEA 5I0DA 2B5HA 3KVBA 2O1QA 1O59A 4DRRA 4XF9A 2P34A 1QF3A 1BLZA 1JOJA 1VBB2 1NY71 3HR9A 5DUWA 1OD3A 5F5IA 2CNAA 5FY1A 3CIHA 2VVEA 5IW0A 1BVP1 4XQDA 3SQOA 4DNYA 4YGBA 1Y9GA 3WEZA 5CEHA 5JI7A 2CDOA 4KBBA 4Q5OA 3MLJA 1MACA 2RMU2 2L9LA 1AR61 2Y38A 1X36A 4IDZA 4UF0A 2G9GA 1GYKA 1O91A 3JD72 2PAKA 2GU9A 4Q8LA 3AL5A 4YW1A 3CBNA 5C3QA 1MVQA 1N1YA 4KGGA 4XDOA 1OKQA 4B1LA 5K8SA 1UL9A 1UYYA 3TYJA 3O1MA 1ZBE1 1PGL2 2VBBA 1W90A 3RJ2X 3MDPA 1Z78A 1DQ6A 3OUHA 2Y6GA 2K46A 4QM9A 3GNEA 4P9IA 5ABJA 5JWPA 3MF9A 3RI9A 5A1AA 1RXGA 3ZYRA 4CCKA 2AENA 3C3VA 4K1ZA 1HQNA 1I9RA 4HPKB 3VBHC 1UX6A 3J8F2 3MIBA 3OGSA 2WKKA 5FMDA 2Q1ZB 1C1FA 3AKQA 3VV1A 1PVC2 1EY2A 1AZDA 2A3XA 1UPSA 3VDBA 1I3HA 5H9RA 3D5OA 4QPGA 4EWDA 4Y1VA 1W2AX 5FBJA 4AGVA 1AYN2 4HVOA 3ALQA 4XMIA 1J58A 5IWFA 2XONA 2C24A 2ZX3A 4LK6A 4PDWB 2H0BA 2QQVA 4Z82A 1HW5A 4K20A 1VBE2 5IJRA
chains in the Genus database with same CATH topology
3NKTA 1R1ZA 1ENRA 3N35A 4YVSC 4AW7A 2WLQA 1ZZ9A 1AX1A 1JTZX 4XETA 2R0FA 2IWGB 1LB2A 1DGWX 1IGOA 3QD6A 4YZ3A 1CPNA 5AVAA 1GLHA 1ONAA 4MGYE 1KRIA 1Z7S2 3M2MA 2AH2A 3MW3A 2UY9A 4XJZA 2D3RA 2HWD2 4KU8A 5GLZA 4GULA 1VBC1 4PF5A 2OUJA 4B4RA 4BH9A 4YARA 2P2KA 1SDWA 1GANA 2YDEA 5JPNB 5HBAA 2EXKA 4AHXA 1AYM2 5ACA2 4NWWA 2R071 5CFCC 2XLFA 4KU7A 3RDIA 2XG3A 1KFUL 2A6VA 1A6CA 1WMEA 1ALYA 1EAH2 2YXSA 4XIKA 4YW4A 1EV12 3MFAA 2WNVB 3QCWA 2VW0A 3ILFA 1SLAA 3VKFC 3M8LA 2XPJA 2Y0IA 1AR93 4RD7A 2B46X 2Q0AA 3URFA 2RMU1 3R4UA 1AR71 1O3SA 2GAUA 1NA1A 3WDVA 2IXHA 1O5UA 3MPPG 3CJIA 3L2HA 2VMIA 2VOKA 3JD71 4NHLA 4Y20A 3RJRA 5BNOB 3I7DA 2WFF1 4ORFA 4FQZA 4E4DX 3OGJA 4AFBA 4KNCA 4XF1A 1N1VA 4LO8A 5C8CB 1RMU2 5J09A 2ZS6B 5L7OC 4OI4A 1RUE3 2B8MA 1UD1A 1QDCA 3VHOA 5GJ6A 4MYEA 4N7IA 4Q4W1 1XXNA 1FOD1 1W6OB 1H1AA 3J8F1 4C0BA 2GH8A 1QU0A 3ACLA 1PVC1 2MEV2 1FAYA 4L11A 3UJOA 1R091 1F5JA 2XKOA 3HT1A 1SEFA 2ZKNA 4OUMA 4Q4V3 1AJOA 3R0RA 3NJZA 4FOVA 4N43A 1WLWA 4S2FA 4RQPB 5FQ0B 3S7IA 4JGZB 2XVLA 1J3QA 5BNNA 2Y26A 4WVWA 2A6XA 4Y22A 1A8DA 4ZU5A 2OZJA 5L36A 1F2NA 3MW4A 4IESA 3S6PA 3VL9A 5FDBA 4YGEA 4XHBA 1HX6A 1N3PA 4P14A 2DVAA 3AKTA 4IV1C 4WM8B 1QOOA 1J59A 2DWRA 4CDWB 3ZN6B 4UW5A 3U11A 1AXKA 3UJQA 1LOAA 1V70A 5JZGA 5FTTC 3WP4A 1HRV1 4IEPA 4EWEA 1BBT1 4R9AA 2JG9C 4TWTA 2HWC1 4IXLA 4LBQD 2ZOEB 1D0GA 1RTVA 1H2KA 5TSWA 1RJ8A 1AYM1 3WV6A 5BNPB 5AC93 2CWSA 1WGPA 2ZGQA 4RS5A 3ZXJA 3MF6A 4YNIA 4CP1A 3RI8A 1VAMA 3J9SA 3VKLA 3WP6A 2TUNA 4GWMA 4Q0QA 1UKRA 3RYPA 1ULGA 4O9GA 1W6PB 3FFQA 1H2LA 2WLPA 1W0PA 1CR7A 3KGZA 1EV11 3LA7A 1DZQA 1SBEA 3IT8A 1AX0A 2R30A 3JBG2 3T1MA 4AK3A 1NCRC 4RA0A 1VBD2 2RE9A 3FE5A 1MS3A 2VNOA 4N7UA 5KHJA 4UW6A 2Q30A 1N1SA 3RQ0A 1LHVA 1RMU1 3NKGA 1NCQB 1W2UA 3Q9OA 4FOWA 1WD4A 3KM5A 1OD5A 3NV2A 1I6XA 4PLOA 1G7YA 3W59A 2GC3A 2ZA9A 4K1YA 4CDUA 4L8QA 4XFBA 2D7FA 5GALA 3PVNA 1YLLA 3B94A 2ATFA 2VXRA 4Q1PA 4DQAA 1SFYA 1OMIA 1KITA 1LODA 2C0ZA 3EBRA 1UAIA 4J1WA 4JTNA 1O4TA 3MIFA 4Z1VA 2VOXA 3JU9A 1AR82 3RRDA 1BMV1 1H9PA 4UXAA 1CX4A 2R49A 2ZGKA 4BIOA 3AXDA 4PDWC 1YRZA 4YVWB 4FBFA 3O14A 1FMD2 4OZXA 5BUVA 4Q0SA 4I09A 1R082 1OFNA 1RUH3 3WR0A 2WNUA 1SFNA 3PNAA 4LHKA 2R0HA 1Q8QA 2C9AA 4GQ7A 3UV9A 2R1DA 1J1TA 2LTNA 1HXS1 1PIV3 1HDKA 1PMIA 1QQP2 1XU2A 4NR1A 4F8AA 4YM3A 1OHFA 3AZVA 4KWKA 2ZGSA 1BK1A 3H3UA 4JGYA 3U10A 4PBOA 3GZUC 5I0RA 2GMPA 3H1YA 3TWIA 5GZFA 1MS5A 1WLCA 2YGMA 1DGLA 3AX4A 3ECQA 4FPLA 4GH4A 4AI3A 1RIRA 4MXWA 4YZ4A 2JG8B 1NE4A 1LCLA 1SLTA 2Q4SA 4FTEA 2YPJA 2QQPA 1TNFA 3ZXDA 3JBG1 1UU4A 2CGPA 1GR3A 2VNGA 1V6MA 1VBD1 5T54A 4MUVA 3IDEA 3O12A 4DPNA 4AHZA 1ZBA3 3WY6A 1TMF3 3D8CA 2HWE3 1YUDA 4Z07A 2YHJA 2WNVC 1QKQA 4IERA 4Q4Y1 4QXKA 2XJRA 1G8WA 3MPBA 5DZGA 1W39A 2ZCWA 3V0AA 1DHKB 1U5XA 4QQPA 1QJX1 1MEC1 2A71A 2OPKA 2Y0OA 4WVZA 4FQ4A 1PO11 3OBTA 1C3HA 1NXD1 1SCRA 4MH0E 2RS52 2Z2SB 4XJAA 2YY1A 5BNOC 3RG0A 2RM22 3VBRA 2JD4A 1O4YA 4Q4X2 4E2GA 1UCXA 2RJLA 4M0NA 1RUI1 5C8CC 3U4XA 2DFBA 3VBOA 4N53A 2ZX2A 1K5MB 1V6JA 2ZHNA 3AYCA 2ZGNA 1KS5A 4K6BA 2DV9A 4OHZA 2RR12 2XBO1 1WUVA 1YYNA 4XE9A 2XVKA 5K0UB 1QNYA 4RR3A 2JEMA 4KGQA 4KL1A 4WM7B 1ND2A 1Q8OA 3OGGA 2DCJA 3ZXGA 1R1A3 5F1RA 5FFOC 1NA1C 1GNHA 1ZZCA 1W6QA 4P5HA 3OJBA 2WA4A 4JGZC 5CFDC 2QVSB 2VGDA 1R081 5A33A 1RC6A 3LOIA 4LULA 1CAWA 1XNKA 2ENRA 4HL0A 2BYVE 3A4UA 1Y7BA 2PELA 3AYEA 1ULCA 1DGRN 2GNTA 4WM8C 1QH7A 2CY6A 3ZXKA 4CDWC 4DS0A 1Q8PA 4LUKA 4Q8KA 5JI9A 3ELNA 3ZFFB 4CEYA 3JQXA 4LO5B 3W58A 1H4HA 5CVRA 4K40A 4PCRA 1B35A 2OIIA 4XILA 4N43C 4DFSA 3EJKA 4Y1UA 1RITA 2DCTA 1QXPA 3WW3A 4AYUA 2O8QA 2D5HA 4R8HA 5BNPC 1MS0A 1D4M2 1ASJ3 3DL3A 3O7OA 1YNAA 4YVSB 2ZPXA 3KQRA 3SNMA 2UY8A 2RS11 1LULA 4BPZA 2W08A 1VBA1 4QPIB 1LTEA 5KBFA 1ND3A 3I8TA 4GB33 3HMYA 1RUF3 3VBUB 5CAZA 3KT4A 4PIYA 1ZBE3 5I0TA 2IXKA 3KCCA 4YSFA 2QUOA 2D98A 2ZMLA 2PLV2 3MYXA 2WC2A 4XBNA 5E89A 3ZXAC 4HVQA 2RM21 3IPVA 5DXDA 4Q4X1 3ILRA 4JRLA 2G4IA 1NCQC 2VECA 4IEOA 3ZMNA 3A0NA 2UU8A 2D6KA 5J7MA 1CVNA 1S0GA 2RR11 1X82A 3HN1A 4FCAA 4LLFA 4Q0UA 3B5LB 1RUJ3 4BYYA 1OPOA 4B8EA 2B45X 3VKNA 3BU7A 2Q8OA 1GNZA 2R062 4J6GA 4XFCA 1DZTA 1CAVA 1RGSA 2BPA2 3N36A 2O0OA 2NLRA 4FOQA 2OA2A 2XL7A 4WVMA 2C5DA 1LOCA 1MQTA 2EA7A 1HRI2 2LUWA 1KFXL 3NVCA 1RVF2 4WBBA 3UKVA 5GZCA 2D97A 2IXLA 5T3NA 3ZFGA 2E7QA 3S30A 3ME2A 2NYYA 1NY72 5L7OB 3PLQA 3PTYA 2ZBJA 3J26N 3O0VA 4NVPA 3AZYA 5C6CA 1JHNA 1ULEA 1QMJA 1AR62 1O4ZA 1C5IA 1RUD2 3ZDSA 1VIWB 4YVWC 2WQ4A 2QNKA 2IXIA 1ZA4A 1AVBA 3AMQA 2HWB1 2BGCA 4FP2A 1FX5A 1O3TA 5GZEA 4AHYA 4RL7A 2WWSA 3I59B 5E16A 4AQ2A 4DXZA 1OI6A 1OOPA 4EN9B 2FMYA 3FHIB 4I0WB 2X5IA 3ZXFA 1FPN2 1VBB3 4E27A 1YO8A 4AI2A 5JMCA 2RMU3 4LBQB 5FPXA 1KQRA 3DF0A 4D7SA 1AHSA 2LALA 2JG8C 3JD73 2H6BA 5K7PA 2WFF3 4WZFA 4XBQA 4UBGA 3THTA 4CYDA 5FCCA 1V6OA 3D82A 3KMHA 5DZEA 1A8MA 1IKPA 5H9SA 2SLIA 2DVDA 4X6RB 5FOJB 3JB4C 1H8TA 4QMAA 4O9EA 5C4WC 4BIFA 5B2GB 3J8F3 3NAPA 2PHLA 4HFSA 1G9AA 2E9QA 2WZR1 1PVC3 3TAYA 3UKTA 4AI8A 4H3WA 4AI1A 1DQ0A 1N3OA 1VBC2 1D4VB 1WBFA 1MR5A 1AYN3 1RUC2 1YFUA 2VG9A 1G9BA 3LAGA 2FHRA 4ISQA 2A6WA 3ZN4A 3VN4A 1WCSA 1VBE3 2GC2A 3B69A 4OULA 4X6QB 3M3CA 4W6XA 4BQ1A 1X8MA 4BE3A 2R072 1FYUA 4MVTA 3D0JA 1K5MC 4J1XA 4RFT0 5DUUA 1Q56A 4LBMA 1RVF1 3SMHA 4AEMA 5K0UC 3FZ3A 2BNMA 3RS6A 5KHKA 4Z92B 1Z7S3 2P3JA 4A7ZA 3B7MA 3SH5A 1XE7A 4WM7C 2ZTNA 2HWD3 3M4FA 1WCKA 2VNRA 3B3QE 1U5IA 1YFXA 2GZWA 1AR72 2A73B 2DVBA 2X29A 5CADA 2GN3A 4YW5A 1RUD1 2AR6A 1PZ8A 1C8M2 5F9TA 2WFF2 3MW2A 4IEUA 4DB5A 3N4MA 4YGDA 1AYM3 5ACA3 4QQ2A 3VBOC 1G9CA 5T5PA 1QGLA 2QJVA 4FTSA 3LCPA 2QKDA 3VDDB 1JN2P 2VW2A 2EAKA 1YWKA 5I0UA 5LEKA 3THPA 5GZGA 4XW3A 2WT2A 1EAH3 3PMSA 4Q4W2 5EXOA 1EV13 1J3PA 1FOD2 3ST7A 2X53S 1FPN1 4RR3C 3NV4A 5D8AA 3ZFFC 3DPRA 1ND2C 1COV1 2ZHMA 1R092 1NXMA 3ZXEA 1QJU2 3AK0A 3D0SA 3VBSA 3S0MA 2TBVA 1SLLA 5F6KA 4FAGA 1DQ2A 5KC6A 2JE9A 5EYYA 2NZ9A 1OLRA 1FATA 3BALA 1H8VA 3AM2A 4D69A 4ITCA 4MXVA 1RMU3 3JQWA 4LLOA 1X33A 3GZTB 2I74A 2FZ1A 5C9AA 1VP6A 2BW8A 4FSJA 2CV6A 2VQ0A 2WIIB 4I02A 1ZYBA 5J98B 5ABJB 4E4SA 1QH6A 2JECA 4HLTA 3POSA 3WD5A 3WX5A 3LB9A 4GIQA 4QPIC 1UIKA 3WQ1A 4A2UA 4IV3C 1BVVA 4IEWA 4KWJA 3AMPA 3E6DA 2MEV3 2GNBA 4XHXA 2KA3A 2NM1A 5L73A 3VBUC 1HRV2 1NLRA 4RHV1 4P9WA 1BBT2 2RS32 2Z79A 3OPZA 1RUC1 4YG3A 4A7KA 4BLJA 2HWC2 1LHNA 1AL21 4R4ZA 1N47A 5EYXA 1SQ4A 1BEV2 2BVBA 2VOWA 1H9WA 1M4WA 5DG2A 1C5HA 1X8EA 2DCZA 4HK8A 3X29B 1OA3A 1V9U2 1RL3A 1PM7A 3MICA 1CAXA 3WXPA 3E97A 4YG0A 1DFQA 1UIJA 1PGW1 2DCYA 1O3QA 4FTBA 3BIWE 2EIGA 3W9AA 2BVVA 2C1FA 5GM0A 2P3IA 3ZFEA 4AG4A 1G6NA 1C8M1 1WMDA 1GZWA 2BTVC 1FXZA 4AE2A 1PO21 3AZWA 1QJY2 2BQPA 4AXOA 3T1LA 2NN8A 3VBFC 4P9GA 1S2BA 2E6VA 3IMNA 3CL1A 2DF7A 4SLIA 2P37A 1YJLA 4XXAA 1DDLA 4XFIA 1XNDA 4HKOA 3T2TA 2K0GA 2PTMA 5JOZA 3RZZA 3VZKA 3JBG3 1QJU1 4Z2WA 4FPHA 5A32A 1NA1B 2DUPA 4Y4YA 1MQTC 1VBD3 1Z0HA 5I8SA 3CJIB 1ZZ8A 4CDXA 4DOUA 3VZNA 5KC5A 3EXUA 4AVVA 5CFDB 3ZYIB 1ULFA 4XMAA 3DKWA 4B29A 2NMOA 3R6SA 4A7YA 4MX3A 3ZN6A 1VR3A 1ZZ7A 2QE3A 1GSLA 4AEKA 4I01A 2HWF1 4XJUA 3ZSKA 5JDBA 4AF9A 1PZ9A 4B7KA 4RSUA 2GNMA 3V64A 1BMV2 1MS1A 4BMEA 1TME1 4LBLA 3AJZA 4Q0PA 4HETA 3ZX7A 1RINA 5I93A 1VB2A 2ZGOA 3FFZA 3JB8A 2N7GA 3H3ZA 3MIEA 4U2AA 2RS31 1KDMA 4N43B 4XZPA 1HXS2 3B9IA 1IS3A 4S2GA 1BEV1 1HQLA 5BNNB 5EWSA 5IUQA 1GKBA 2ZMKA 4L2NA 3AP7A 4XFHA 4DRVA 1QOSA 4DY5A 1AR83 1V9U1 4RGGA 4A3XA 4HSLA 4S2DA 2VOVA 3FUQA 4OHVA 3V0BA 2ZHLA 2F6BA 3OYWA 2DVGA 3QOPA 2WSUA 1FMD3 5JZGB 1R083 3V65A 2ZZQA 3WZ1A 1S0FA 4XFGA 3OF1A 4LR4A 5A3MA 4EV0A 2IC1A 1QQP3 1SBFA 3SH3A 2ZGRA 4OLLA 1WMFA 3AP4A 2OW4A 1PK6C 1CD3G 4Q4Y2 1AXYA 1UMZA 4RS5B 1QJY1 4QT6A 4EJRA 1H0BA 5JSOA 1EP0A 1O3RA 1VRH2 5AFEA 4UW4A 3USSA 4GXLA 1QJX2 4HK9A 1MEC2 3WUDA 4I0BA 2PHFA 4QQHA 3AMNA 2B39A 3EQEA 5T55A 1PO12 4Y26A 2ERFA 4AI0A 1CGPA 2PHDA 3CU7A 4ZU4A 2HKXA 1RUI2 2D6MA 1NOVA 1CJDA 1Q5OA 4SBVA 1LHOA 2WL1A 5HCBA 3VDDC 4NN0A 1EPZA 3LKJA 3ZIWA 5JLVA 3NV1A 4IEQA 3S7EA 1ENSA 4XTMA 2B7YA 1LHWA 2MPFA 2XBO2 1S55A 3PJQA 3SXWA 1H1IA 2Z5WA 4XEZA 3M7AA 3N7LA 5GLWA 4AQTA 2D6LX 4CDQA 1ZRFA 2YZ4A 4JAAA 4BM8A 4E9KA 1OPMA 5BY5A 1U12A 2DUOA 4H55A 1LR5A 3BODA 1H2NA 3AP6A 4BOWA 2WS92 3V56A 4AEDA 2VUJA 2XJVA 5LEJA 2RS53 4HN0A 4CDUB 1ZZ6A 2RM23 5E1RA 4Q4X3 1J1LA 2UURA 4F7ZA 1CN1A 1EYBA 1XNBA 5A3LA 2HYKA 1LOFA 3OY8A 1G9FA 1BYHA 3ZSMA 4K3UA 4LBKA 5ABJC 1JH5A 4ATEA 2RR13 2HJIA 5T5OA 4YGCA 2I07B 2JJ6A 1QJZA 3DV8A 1CAUA 2A6YA 5I8YA 5CB7A 1TE1B 4QPGC 1W6MA 1G9DA 4XJWA 5CNAA 3VZMA 4CEWA 3ZN5A 4URTA 1PNFA 4QGNA 1SLCA 3APBA 1OQ1A 2CAVA 2WNUB 2JX9A 5JOXA 2PHUA 3VZOA 3MIDA 3TBDA 2JKBA 2I2SA 2RS12 1RUE1 4LO7A 1JW6A 1QWRA 2GH2A 1A78A 1VBA2 2R6QA 5C4WB 4JGYB 4X8NA 2GSYA 1LESA 3ZVXA 1RHI2 3D6EA 3B93A 1VRH1 2UWBA 4CP0A 3NL1A 2XJTA 5JPMB 4GH4B 3IDBB 1IPJA 4MXWB 3USUA 3QACA 1JBCA 5CG9A 4Q4V1 2AUYA 1ZX5A 1UU5A 3ATGA 3H1WA 4R4XA 1SMVA 1MZEA 2DU0A 4HMZA 4QGLA 1D4M3 4LHNA 4I3GA 5GKAC 4CTEA 4XYXA 1DQ4A 2ZHKA 3VKMA 1V6IA 2VQAA 3TOJA 5FMOL 4I2OA 4GMP1 1M06G 4AWDA 1O7FA 4COWA 4ISRA 4OI1A 4DINB 2F4PA 4CZSA 5I0SA 5KXDA 3AKRA 2WS91 4XXPA 3WDTA 3CJIC 5JSPA 4JRAA 2I45A 1A3KA 4WV8A 1NQJA 2PLV3 3NV3A 3PVOA 4DY3A 3VBRB 1GICA 4UW3A 5JIAA 2UYAA 3AMMA 4Q29A 4Q0VA 3VBOB 4I3PA 4ZKTB 5JSRA 5AC91 4N53B 3VBHA 5J37A 4COZA 1MZFA 3E5UA 2XUMA 4LBJA 3WCSA 3B00A 4NOTA 2BNNA 1Q8VA 3P3NA 1H2MA 3QH7A 3B01A 2VH9A 3HAGA 4RR3B 2VVFA 2PAMA 2R063 3OTFA 4S2HA 1ND2B 2UWAA 5FLIA 2HWB2 3MI8A 2DCKA 3VUOA 1UKGA 1W6QB 1HRI3 3K48A 2IXCA 4YVSA 3ENRA 2D6PA 1RVF3 3N7MA 5DDJ2 5FO8B 1JUHA 1V6KA 1OA4A 1HV1A 5CU1A 5BNNC 1AXZA 5JAXA 3ZYPA 4XJ9A 4AVCA 3H7YA 3HBZA 2YUEA 2IZWA 5A33B 1IS4A 2OUHA 3GBGA 1CAWB 4LTAA 1BZWA 2VVDA 3SCHA 5IT6A 3WG1A 3M3EA 4G3YC 1OA2A 1AR63 4B3NA 4XDQA 1XYPA 1RUD3 1HV0A 2BNOA 2KXLA 2VUAA 4EROA 5IK4A 2QDRA 2XH6A 4IV3B 1C4RA 4CEYB 2PQQA 1RHI1 4PLNA 5JZGC 5AVPA 4YRDA 5KWRA 5CFCA 2CTVA 1YI7A 5FPZA 1U5YA 4NWVA 4RS5C 1UN1A 1FPN3 3G6JB 1TEIA 4QQOA 5CBLA 2NQYA 2ZZJA 1C1LA 2WZR2 2ZX1A 4M3CA 4GWNA 1LOGA 4PJYA 3AFGA 2ZGTA 1REDA 3GZAA 1C57A 1MVEA 1ND3B 4JQRA 1Q43A 4LUMA 4XF0A 1WLTA 3RWNA 1V6LA 3WP3A 4COVA 4PQ9A 1RUH1 2E63A 4AEJA 4C1WA 1H1MA 4HVRA 1YI9A 4AFAA 2RJKA 3H9AA 3I54A 4AGGA 2FQPA 4CRQA 5JVVA 4E4ZA 2ZX0A 5BNQA 1ZREA 1FNZA 1YIFA 4COUA 3HT2A 4QM8A 5DG1A 4FPEA 1LHUA 3VHPA 3BOPA 1LEMA 1W0OA 3FBYA 5E88A 3WG2A 1HLCA 4FXGB 3VBFB 3AB0A 1YFWA 1VBC3 5EJ3A 1DQ1A 3WW4A 5LK5A 1KS4A 4OI2A 1RUC3 1CQ9A 4BHPA 1SBDA 4M3CE 2ARBA 4CDUC 1WLDA 3HWJA 4TLFA 1UU6A 1CAVB 3AZZA 1FV3A 4QPYA 3VLBB 3OCPA 2YGLA 2R073 4WVMB 1MQTB 2ET7A 1Y9QA 2HEWF 1POV1 4AFMA