2RM21

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
273
structure length
273
Chain Sequence
b'TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 43
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rm2100
4IV1A 4YVWC 1V9U3 3ZFEA 1VRH2 4QPGB 2HWD2 1VBE1 3IDEA 1VBC3 1AYN3 2RS13 1AL23 1QJX2 1RUF2 5ACA3 5LK7B 4RFT0 1F8VA 3ZFFC 1RMU3 1RHI2 1TME1 4CDUC 1Z7S1 2RS31 1NA1A 5AC91 1TME2 3VBHA 2XPJA 1QJY1 4N53A 1QJU1 3JD73 2R071 1Z7S3 4QPIA 1D4M3 1NCQA 1RUJ2 5AC93 1VB4A 1QJY3 1PIV3 3ZFGA 1QJU3 3VBFA 1ND2C 4Q4X1 1BMV1 1NY72 4GMP1 2R073 2WFF1 4AEDC 2R062 1BBT2 1RUD1 5C9AB 2XBO3 3DPRC 1AR81 5D8AC 5ABJC 1H8TA 4CDWC 1RUC2 4IV3B 2FZ1A 2HWB1 1VBD2 2RR11 1AR83 4Q4W3 1RUG2 1NOVA 5C4WB 2HWB3 4QPGC 2RMU1 1HRI2 2RR13 2HWE1 2RMU2 5L7OB 1EV12 1B35A 4Q4V1 1VB2A 5CFCA 5BNNB 4WM8C 3VBRA 1TMF2 2RM22 4Q4Y3 5CFDA 3VBSA 1MQTA 4WM7C 1AR73 2ZZQA 4RR3A 3TN92 4Y4YA 1R093 5BNOA 1RUI1 1HX6A 3LOBA 1PVC2 2HWC1 4YVSC 1R082 1PO11 1ASJ2 3VDDB 2HWC2 4CEWC 1R1A3 3J8F2 1QQP1 2RS53 4JGYC 3CJIC 1PGW1 1PGL2 1FOD2 4RQPA 1PGW2 4GB33 1K5MC 4IV1B 4RHV1 3ZFEB 1C8M1 1QQP3 2WZR1 1FPN1 2MEV3 4YVWA 1OHFA 2BFUS 1MEC2 1AR62 2PLV2 4RHV3 1ZBE2 4CEYC 5K0UC 1C8M3 1RUH3 1V9U2 1FPN3 4RS5C 1AYN1 3ZFFA 1NA1B 1BEV3 1AYM3 1VBC2 2RS12 4N53B 1AL22 1RMU1 1FMD2 1HXS3 2R041 5ACA2 4CDXC 1SMVA 4QPIB 1NCQB 2WS91 4JGZC 1VBE2 1HRV1 1VBA3 4GH4C 5C8CB 3JD71 4NWVA 3ZFGB 3VBFB 2R043 3NAPC 1OOPC 1D4M1 1EAH3 1ND2A 5BNPC 1CJDA 1Z7S2 1PIV1 2WS93 2RS32 4PDWB 4AEDA 3VDDC 1HRV3 5AC92 2X5IC 1H8TB 1QJY2 1ND3C 1QJU2 3DPRA 5D8AA 5ABJA 2XBO1 3FBMA 2R072 1VRH3 4CDWA 2FZ2A 2HWD3 3VBUB 1QJX3 1RUF3 4Q4X2 3JB4C 3VBOB 1BMV2 1OPOA 2WFF2 1AL0G 2ZAHA 4Q4W1 1RUD2 2WLPA 1AR82 1NCRB 1B35B 1RVF1 4Y5Z0 5JZGC 5CFCB 1QJZA 2HWB2 3VBSB 5CFDB 1MQTB 1RUJ3 4WM8A 2RR12 4RR3B 4N53C 5DDJ1 4WM7A 1RVF3 4Q4Y1 1POV0 1AR71 4CDQA 3M8LA 1BBT3 5C8CC 5DDJ3 2HWE2 1R091 4SBVA 2HWF3 1RUE1 1E57A 4Q4V2 4YVSA 1R092 5FOJB 4PDWC 1ZBA1 4CEWA 4RQPB 4JGYA 1R1A1 1RUE3 3CJIA 1RUG3 4LLFA 2RS51 1RUI2 1HRI3 1ZBA3 1K5MA 4YVWB 3VBUC 1EV13 4GB31 3VBOC 5C9AC 5A32A 4N43B 1PO12 2MEV1 2RM23 1QQP2 1W39A 4CEYA 4IV3C 3ZFFB 5K0UA 2BUKA 1COV1 1NCRC 1X33A 4RS5A 1RUH1 1VBB3 2DF7A 4RHV2 4GMP0 1C8M2 1BEV1 2WZR2 1FPN2 1AYM1 4CDXA 5C4WC 1COV3 1PVC3 1VAKA 1HXS1 5FMOL 1R083 1ASJ3 3JB8A 4JGZA 5L7OC 4GH4A 1HXS2 2BBVA 1RB8G 1ND2B 3J8F3 3JBG1 3NAPA 4CDUA 1WCDJ 1OOPA 3VBHB 1VBA1 4BCUA 1AYN2 1PO21 2IZWA 1M06G 5BNNC 5BNPA 1X36A 1EAH1 1RMU2 3DPRB 5D8AB 5A33A 5ABJB 2R042 2X5IA 4Z92B 1AR91 3JBG3 1ND3A 1PO23 4CDWB 1MEC3 1AR63 4RQPC 2WS92 1HRV2 1F2NA 2PLV3 3JD72 1ZBE3 1POV3 1VRH1 1AR93 1D4M2 2HWD1 1QJX1 1PIV2 1RUF1 4N43C 1CD3G 1FMD3 1RHI1 1C8NA 2ZTNA 2XBO2 5JZGA 4IV1C 4WM8B 1VBE3 3ZFEC 4WM7B 1RHI3 1AUYA 3ZXAC 4QPGA 1RUJ1 4CDQB 1TME3 2VQ0A 4Q4W2 4FTSA 2RS33 4NWWA 4EJRA 1NY71 5C8CA 3VBRB 1NA1C 5FMOS 1RVF2 4YVSB 1A6CA 2R061 1BBT1 3VBHC 4CEWB 4FTBA 2HWF1 4PDWA 5BNOB 5DDJ2 1RUC1 4QPIC 5J96B 4JGYB 1NCQC 3CJIB 1GFF2 2HWF2 4Q4X3 2R063 3HAGA 4GMP3 1VBD1 4Q4Y2 3ZFGC 3VBFC 1AR72 2WFF3 2BFUL 1K5MB 1RUD3 1IHMA 1RUG1 1RUC3 5A32B 3VBUA 1HRI1 1RUE2 1VBD3 3VBOA 2WWSA 5C9AA 1H8TC 1EV11 1ZBA2 4CEYB 5K0UB 4RS5B 4IV3A 3S6PA 1R1A2 1NCRA 4FSJA 1TMF1 2RM21 2RS52 2RMU3 3TN91 4CDXB 2HWE3 1VBB1 2BPA2 4GB32 5C4WA 4JGZB 1TMF3 4Q4V3 1VBB2 4CDQC 4GH4B 2MEV2 1PVC1 3TN93 3NAPB 1B35C 4CDUB 5L7OA 1OOPB 5CFCC 1R081 1ASJ1 1COV2 3VBRC 5BNPB 3VBSC 5BNNA 1MQTC 5J98B 5CFDC 1RUH2 3J8F1 4RR3C 5A33B 2X5IB 1RUI3 1PGL1 1ND3B 1BEV2 1FOD1 5BNOC 1AYM2 2HWC3 2TBVA 1PO13 1MEC1 1AR61 4AEDB 2QQPA 1HQNA 1FOD3 3JBG2 5GKAC 1VBA2 1PO22 2PLV1 3VDDA 1NG0A 1ZBE1 1POV1 1V9U1 1EAH2 4FTEA 4N43A 2Y26A 1AR92 2WZR3 5JZGB 1VBC1 2RS11 1DDLA 2GSYA 2GH8A 1AL21 1FMD1 5ACA1
chains in the Genus database with same CATH superfamily
4HN0A 1SCRA 2EF6A 4IV1A 2AGSA 4Q2FA 5CG8A 3A22A 4J1WA 4Y3OA 3ZFEA 3BYWA 1G7YA 2XVGA 4LE4A 1OVPA 3NJZA 4QPGB 1Y7BA 3MIBA 2YGLA 4HVOA 1VBC3 1KJRA 4UI9L 3OGRA 5IVBA 3UETA 1EY2A 1RUF2 5ACA3 1CAVB 3H8OA 2E33A 3OJBA 4RFT0 4R9DA 1F8VA 3PUHA 2D3RA 4X6RB 2BWAA 4XJ8A 4CDUC 2X09A 3BALA 4O9EA 5FLHA 3WLUA 3ZYPA 2RS31 3LOIA 3B00A 5AC91 3H0OA 4XPVA 2VUJA 4HMZA 1QJY1 2XHKA 1OPMA 3ALQA 4XOGA 5T3NA 3BN6A 3RDIA 1NAEA 3WDXA 2Z42A 4MH0E 1W2OA 2IXJA 4OUEA 2EIDA 3BTAA 5EQUA 3B9IA 3ZYFA 5LA9A 3ZMOA 4QPIA 1GNZA 2ZX0A 4FPEA 1RUJ2 4C90A 2VECA 3KS7A 2VZOA 5IVYA 3RFRA 4LITA 5FYSA 4D7TA 4Z8BA 1PIV3 1QJU3 1MS3A 3VBFA 5KBFA 2JDPA 3Q8AA 2JDKA 5F37A 4GMP1 3LZZA 2R073 2P17A 3IAQA 2JG8C 3PU8A 1N1YA 2XBO3 4HT1T 4DZGA 1OUXA 3A4UA 2VZVA 4YZ3A 1H8TA 3IWZA 3H8UA 1WD3A 3POWA 4ZXEA 2FZ1A 3SKJE 4IW3A 5IFTA 1JH5A 1MZ5A 1STMA 2EIBA 2LM3A 2X8KA 4FPGA 5A7WA 2Q8EA 4CP2A 1V6OA 3VKLA 1UY1A 2VZTA 2A6ZA 2J1EA 2ZMLA 3I4IA 1OF3A 2JIGA 3AL5A 4LK7A 2E7AA 5C4WB 4FP2A 4CU6A 4M3CA 4YW4A 1J59A 3SEPA 2VMFA 1UYXA 4AVTA 3OD4A 1AF9A 2LRPA 4YSFA 1NE6A 1UKRA 4L92A 3O1SA 3QCWA 2ZS6B 5A3PA 5FY5A 2ZACA 2WN3A 3OPWA 5FZ6A 4NHKA 4AHZA 2NP0A 4B1LA 4QB6A 3NNGA 4LA2A 1ULDA 5EXOA 3ZXGA 2RE9A 3VZNA 1SLTA 3GZEA 2NMOA 1QXPA 3T3YA 3VBSA 3EJKA 1MQTA 5HBAA 1GWMA 5FKCA 3TNPB 5FV3A 2PA7A 1C28A 5A1LA 1Q56A 4LHLA 2WNVA 4FPKA 2Z69A 5BNOA 1QDOA 2WNUB 2VCBA 2D97A 2XLFA 1RUI1 4HFSA 4OI0A 4LTAA 2JWPA 3ME2A 4FFGA 4QB1A 3WF2A 3EHKA 5E6HA 3P5BA 4M00A 3LOBA 3LQCA 4U2AA 4LKEA 2HWC1 1L7QA 3DYMA 2CAUA 4HANA 3I2KA 1DBNA 1GKBA 4KI5M 5HXVA 1PO11 3N9PA 3RMYA 4DY3A 1B09A 4KU8A 5IYYA 1O3RA 2R0HA 4CEWC 3UJOA 2ZGQA 2JG9A 2Q8DA 3LEGA 4JGYC 3AP7A 3MLJA 1HN0A 1ZREA 4HVQA 2DTWA 2WFPA 1BLZA 4AVBA 1GQPA 1DU3D 5FO9B 1JZ3A 2WR9A 3AJYA 4XCBA 5FXWA 5A3UA 1WMXA 1K5MC 4RHV1 2O1QA 2PAKA 1ST8A 1C8M1 2D6PA 3AKRA 4QKBA 4BPZA 1OHFA 1V6KA 1XYNA 1X50A 4O65A 2ZGNA 3TEXA 2DFCA 2ZZJA 2JD9A 1JXNA 4N9IA 1F4HA 1GZWB 3AYEA 3WUDA 4CXWA 5LA1A 2OPKA 2VM9A 3NV2A 4IETA 1FPN3 1JZ4A 4Q1PA 1AYN1 1S0EA 2GNTA 5FIXA 4BQYA 3ZFFA 1RIRA 3BVCA 1SG3A 3S0MA 4P9IA 5T52A 1VBC2 4RFRB 3GF6A 1GSLA 3HQUA 4N53B 5JOZA 3VD5A 1HXS3 1PGSA 2R041 3SKVA 4BJ0A 2VZQA 5ACA2 2ZHLA 4IGOA 4EROA 2ZXQA 5J3UA 4B3NA 3I2OA 4OUMA 5CKNA 1LODA 1RC6A 2PQQA 1NCQB 1NLRA 5T5JA 4GJYA 1NXMA 1VBE2 4A2UA 2JDHA 4DEVA 4Y24A 4AHWA 3L2HA 4LBKA 5C8CB 4ZPIA 1XNCA 4B1MA 5B4XA 1LOFA 2WNEA 3U14A 5TSWA 4ATEA 4IDZA 4UFKA 1YLLA 4FOWA 4EZ4A 1SPPB 2D44A 2D6LX 2W95A 5EV7A 4AEDA 3OGVA 4MGYE 2QZ3A 4ONUA 1TE1B 4QX5A 1DQ5A 4CU9A 2X5IC 3RI8A 3WHUA 2R16A 5FR3A 1DHKB 1QJU2 3DPRA 3O1RA 5F9TA 4QX1A 1C57A 2W91A 3O1MA 2HJIA 4CPBA 2R072 4XUPA 3IKWA 1VRH3 4CDWA 4E4HA 1FI2A 2FDKA 3KF3A 4QM9A 1QDCA 2J42A 3H42B 4FPOB 1QJX3 4PIYA 1SZBA 4KBZA 2D98A 3VBOB 3PIJA 2ZCWA 5T5PA 1BMV2 2VNGA 1OPOA 5JI7A 4BWOA 5T54A 2JJ6A 1GOGA 1GBGA 1LHWA 3ELNA 4EWDA 2WLPA 5DZGA 3KT4A 3ENRA 1UU6A 4ITCA 1NCRB 1GYKA 2GNDA 2VOTA 4I09A 1GZTA 4QGNA 1QJZA 3O1VA 2OQ6A 1K5JA 3AL6A 3K46A 4UBGA 1GU3A 5IHRA 3K4AA 3WF0A 2DCYA 3POEA 3H3ZA 4WM8A 4RR3B 4LO5B 5DDJ1 3DXUA 4R9CA 2QQKA 1OD3A 4FT8A 1S2BA 5FLIA 1DYPA 4AI2A 3KB5A 1W05A 1POV0 2JD4A 4KNCA 4AF9A 3RZHA 3MBWA 5LEJA 2A6VA 3C7EA 1G9FA 2PQSA 3KWVA 4KBBA 4MXWB 4DO0A 1VMJA 3N9QA 1NXD1 1IS4A 1ENQA 2HWF3 2OQ7A 2RDNA 3O0WA 3B02A 1Y9MA 3OY8A 1DQ0A 1G6NA 4O61A 4Q4V2 2X05A 3AP5A 4AEMA 4GD4A 2HEYF 4P5HA 4PDWC 3VDBA 3ZYJB 2Z4FA 2XQXA 3K51A 4UYBA 5KXCA 2YUEA 1R1A1 2AENA 3CJIA 4NVPA 2DVBA 1L7RA 3Q8FA 4LLFA 5LW9A 2VUDA 4CUCA 3KT7A 5F2WA 1Y3TA 4A41A 4INDA 3POBA 3UJQA 5KXDA 1H4HA 2QQWA 3H50A 3I3EA 3VBUC 4XFIA 4XTPA 3WW3A 4E9KA 4UFLA 5JR2A 3KD4A 4LMFA 4WV8A 5KHIA 1E5RA 2FDFA 2YG0A 4F7ZA 5JSOA 2GMMA 3WQ0A 4QQLA 1XNBA 2VD7A 4MV2A 4H14A 2Z2SB 2RDSA 4PT6A 5CU1A 4DY5A 1SLLA 2J1RA 1UMHA 4LIVA 5K0UA 1ZZ9A 4RS5A 5FUPA 2B9UA 4WZCA 2GN3A 2CY6A 4N8MA 2WA4A 4QDQA 2EXIA 1JYIA 2XL7A 3VHOA 3KT1A 3MLLA 2DF7A 4XXAA 4GMP0 2LW8A 4RA0A 5FWJA 1FAYA 3URFA 4XFAA 5GLVA 4Z07A 1BEV1 1FPN2 3H9AA 4CDXA 4DUXA 2VW1A 1COV3 2KXLA 1ZM1A 2PFWA 4AFCA 1KD7A 1VAKA 4MYEA 4AE2A 4AK3A 4DFSA 2VL4A 1S0IA 3S57A 1R083 1H8VA 1OT5A 2GDFA 1D0HA 4GH4A 5A7PA 1HXS2 1W2NA 1REEA 2GH2A 3LB9A 4K8RB 3TAYA 3FWEA 1ND2B 4WZFA 4EN7B 3JBG1 3AZWA 4EQVA 2VOKA 5CKQA 1VBA1 3WXPA 2IZWA 1M06G 1LULA 2LS6A 1Z0HA 4LXLA 1O4TA 4G4FA 4WVMA 3UK9A 5HCHA 1I5PA 4UFMA 1J1TA 1RMU2 1OQEA 3KQ4B 4HKOA 1JI6A 5G05L 4AFMA 4BK5A 5ABJB 2XVLA 4LKSA 1H9WA 1LNSA 1YI7A 1W8WA 2K2SA 2YU2A 3O14A 1UY3A 1W03A 5FP3A 3UGFA 4S2DA 1BK0A 3HNBM 1OVSA 4NN0A 4M0NA 1AR63 4LLOA 1VE0A 5GM0A 3MO4A 2PLV3 4QU2A 2O0OA 2WINB 3PJQA 1POV3 4QX0A 4XQWA 3SH3A 2HWD1 4NRMA 5FZDA 3BKZA 3TEYA 1HB3A 1UZ0A 4BIOA 2VTXA 2XLAA 2Y6HA 1Q8VA 2VCMA 2XH6A 3AZZA 2VULA 4LUKA 5F1RA 3VUOA 3SMHA 1RHI1 1BJQA 2A5ZA 1ODMA 3D3AA 4IEUA 3WNMA 2AUYA 4N90A 3BU0A 2CV6A 4BM8A 2NN8A 1D4VB 1UZWA 1YIPA 3MIFA 5LY2A 1O91A 5FZ3A 1J3PA 2Y8KA 4PQQA 2WYFA 4LKDA 4HSLA 1VAMA 4WM7B 1W8FA 3B7MA 4QXBA 1V6JA 3RZKA 1CZTA 1XXNA 3LA7A 3VZOA 4BMBA 1GZ9A 1W8OA 2X53S 4GQ7A 3QD6A 4QPGA 3PTYA 3M4FA 1V6IA 4CDQB 4EN0A 2PAEA 1OLRA 3MFCA 2RS33 1GICA 2PMWB 4NWWA 5BUVA 1CAVA 3F2ZA 4EJRA 4H7MA 1JBCA 1SBEA 2XKOA 3WNKA 4BIFA 5FMOS 4LORA 1VRBA 3D6EA 3WHTA 2YDEA 1BBT1 3VBHC 2WT0A 4E2QA 2G9GA 2YC0A 5CAZA 3AZXA 4BXSV 1Q8QA 2PYTA 1WMDA 4A3ZA 1PM4A 1HV1A 2OXBA 3AFKA 1ZZ7A 2Y6GA 5BNOB 2EICA 3N4MA 4P9GA 2FD8A 5B4NA 4BLJA 1H1MA 2BOIA 2HWF2 1W9SA 1FX5A 1ODNA 1H4GA 2O8QA 1ONAA 2R063 3D5OA 3KSCA 3DYPA 3HAGA 1VBD1 2LALA 4GMP3 3DECA 2VUCA 4Q4Y2 2CNAA 5AVAA 1AR72 3ZFGC 4NPMA 2P5BA 1QF3A 2ARXA 1X8EA 4BDVB 3HT1A 4FO9A 1RUG1 4P5YA 1EPZA 3LSEA 1WMEA 1WCKA 3BOWA 3LEMA 1W2TA 3MFAA 4MGQA 2F4PA 3SXWA 4CP1A 2BVBA 2LUWA 2YFUA 1IPKA 1W8ZA 1G9BA 1UOGA 1X7NA 3POGA 3HJRA 5LBEA 3QLQA 2A6YA 4JAAA 4LA3A 1EYBA 2L9LA 3B9CA 2PHDA 3ZXKA 2RM21 1YQ6A 2I45A 2RS52 3OGJA 1J3QA 4K9SA 4YM2A 3ZYIB 1Q43A 4YFWA 5DG1A 1OXCA 2QVSB 1RYYA 4UBHA 2B7YA 1AHSA 1EP0A 1U5IA 5C4WA 3TB0A 1CGPA 4R9AA 4MHUA 4JGZB 4HK8A 4I02A 5ERLA 2ZKNA 2MEV2 5GJ6A 3NAPB 1ULCA 4BE3A 2Y6JA 2Q30A 5CFCC 2VH9A 4KH9A 3V64A 4A7ZA 4AI0A 2QQJA 4JQTA 1COV2 4BISA 5BNPB 4X6QB 5JXIA 3ZXFA 1UZZA 4D0QA 4FQZA 3ZXEA 5CBLA 2XR4A 1RUH2 2R1BA 3EBRA 3POJA 1YWKA 2IXIA 2FMDA 4AQTA 1RUI3 2W52A 2Q1FA 4OQ9A 4CU8A 1PGL1 3ACLA 3MUY1 4ZXKA 2ET1A 2OT7A 1BKZA 1YQCA 3AMQA 4M0HA 4M4PA 2HWC3 5ANQA 1RUNA 3GJBA 1JZ7A 2C9AA 2WNUA 4CPBD 5J37A 4IGPA 1PO13 5KHGA 2DUQA 1LOGA 2ZMKA 3H7JA 3VKOA 2JE8A 1SLIA 4W6XA 1QXRA 4AEDB 5GZCA 2YROA 3CZJA 3CZUA 4XFBA 4P9XA 4ATFA 4I2OA 2LROA 2Y38A 3NWKA 3S5QA 4COWA 3NNLA 1WCUA 1HN1A 1UPSA 1ULEA 1ZBE1 2W0XA 4YG0A 5JMCA 1IQAA 1V9U1 1EAH2 4FTEA 4N43A 2W2IA 2ARCA 3AK0A 4TLFA 3KF5A 5JOYA 1UOFA 4OI2A 5JZGB 1W8UA 5LA2A 2RS11 4QHZA 2GH8A 5IK7A 1BCXA 2BYVE 4TWTA 3SCFA 2BDRA 4JKMA 4YVWC 5FMBA 4NIAA 1H2KA 1OFSA 5ISLA 4NE9A 1QMJA 5DN2A 5FXXA 4CCDA 4QX2A 5CNAA 2PHFA 1DF0A 2JEMA 3IDEA 1AYN3 1WLWA 3ABZA 3V0AB 1AL23 3NJYA 1CIWA 4IERA 5FY0A 4B29A 2W1QA 3IDBB 5EHDA 5FYHA 1VPHA 1UIKA 1S0CA 3ON7A 4ZU4A 1TME1 1L3JA 4S2FA 2P6CA 1QWRA 1YQ5A 5EFUA 3ZSMA 4DRVA 4GULA 4O9GA 5FZ0A 4G3YC 3FE5A 5AFEA 4N53A 1WLCA 4IE6A 2D6KA 2Q1MA 3ITQA 3THDA 1U5XA 2UYAA 3O7OA 5KHKA 2Y0OA 3KM5A 1XPWA 1Z7S3 2DVAA 2OIIA 3KGLA 4QT6A 1NCQA 2JDZA 4GAZA 3T08A 3MDPA 5IT6A 3THPA 3VHNA 4IE7A 5I0SA 3WEZA 1H2MA 3BB6A 5HI0A 2WO7A 2WIIB 4XACA 5F32A 1SPPA 3ACFA 1TVGA 2ZGPA 2R062 3NVCA 4YW6A 1YUDA 2Q1ZB 5C9AB 1H1AA 5D8AC 4DXTA 1ZX5A 2TNFA 3SH4A 2BVVA 2DDUA 3D82A 3WVJA 2DUPA 2UU8A 1YQ8A 4W50A 3TOJA 1NQDA 4IV3B 3LPFA 4ZS3A 3LA2A 2HWB1 4XUQA 1W6PB 2Z5WA 4MGZE 1O5LA 4C1WA 4XJZA 1QGLA 2Y34A 3BU7A 4XE9A 2J1AA 2RR11 5A7QA 1AR83 3JXSA 4PHZA 1GP5A 3AYDA 2VW0A 3OEAA 5DUXA 4E8DA 4CYDA 4KL1A 1E5SA 5LASA 5LEKA 1QOTA 1AXKA 1VLNA 4QPGC 2RMU1 5DAXA 2XL9A 1HRI2 2QKDA 4LOSA 1XB9A 5C3OA 4AGVA 5GLTA 3MW4A 4R4XA 3POSA 1LU2A 4DUWA 2HWE1 3B93A 3N9NA 5FLJA 4LO7A 3FLRA 1YRZA 5L7OB 1EV12 1A78A 1CAUB 4D7SA 4QMAA 1PNGA 4GKYA 3N9OA 1GR3A 1I9RA 5BNNB 3POYA 4QKNA 2OKXA 3VBRA 4A42A 4NIDA 3IDAA 1RUOA 4UF0B 2HH9A 4AVCA 1W8HA 3KCYA 2GAUA 4RR3A 4YGEA 1HQWA 4Y4YA 1C1LA 3VV1A 2VMIA 1PZ8A 2JKBA 1A3KA 2VQTA 4MLOA 5FK7A 1NQJA 5FQ0B 1JZ2A 3IDCB 4AI9A 3MUZ1 1PVC2 4MXWA 3VZJA 3I3MA 4L99A 3KHCA 1F35A 4YVSC 1IOAA 3GJAA 3VDDB 1ASJ2 2E31A 3OOXA 1WWYA 2ET7A 2HWC2 4LO8A 4DEQA 1KRIA 1R1A3 4Y1VA 5FOBB 5DUWA 3BODA 4NHXA 1DGRA 3J8F2 1QQP1 3I3DA 2B46X 2DV9A 2P6HA 1SDDB 3P6BA 4P02B 4NIGA 3N9LA 4Q0PA 2RDRA 1IG0A 4C0HA 2ZGKA 4QQ2A 3ZYHA 1W2AX 5FZGA 2XONA 4Y33A 4J25A 4MUVA 1UOJA 5I8TA 3LF7A 4FPYA 2BGCA 2QQVA 2VOXA 4CSWA 4K20A 2IVIB 3OUIA 2JDAA 3SCHA 1MEC2 4LHNA 3IMMA 1O3TA 3T2TA 1V00A 2WO1A 3I49A 2WYSA 4PI2A 4GA9A 3NMBA 3SNMA 5C7GA 3PTRB 2EALA 4CEYC 1BQPA 1X82A 1OUSA 4IUGA 3DYOA 1UWWA 4XETA 2OZJA 2B39A 1XYPA 2VXJA 4LOTA 2CYFA 5E8AA 1NA1B 5FYZA 1WBFA 4XDQA 1BHGA 5CADA 1BEV3 3THTA 3WF1A 3DKWA 3ST7A 2IVJA 4GWMA 1AL22 1FMD2 3FHAA 2ZOEB 4Y1UA 1Y4WA 2ZX3A 1SMVA 1Q8OA 4NAOA 1OLME 3AVRA 5FPZA 1HB4A 4CUBA 3CJXA 3LIHA 5DG2A 5LA0A 3WP4A 3WDYA 1HRV1 1VBA3 5F7UA 5HPOA 2AR6A 2Y6FA 3JD71 4NWVA 4XFHA 3WINE 3MLKA 2QJVA 5FCCA 3J7LA 3H8XA 1OOPC 2R30A 3WZ1A 4B4PA 1D4M1 3WP3A 5IFPA 2D5HA 1ND2A 4ISRA 4JQRA 1WBLA 2VZPA 2QDRA 4CCCA 1Z7S2 4IGQA 2WS93 1QXJA 2DWRA 1U5ZA 3P1IA 3LSDA 3NJXA 3UKVA 3WOGA 2P1BA 4COYA 2DTYA 1ND3C 2J1VA 2OPWA 1LCLA 5ABJA 1CR7A 1S2KA 4ET7A 4FAGA 5GZDA 3FFQA 1OQ1A 2G9ZA 2PHRA 3OBAA 5FY4A 5L73A 1LGBA 1JYTA 3WUCA 2HWD3 1NLQA 2W1SA 3RRDA 4XYXA 2DU0A 2XOMA 2VZ3A 2ZEZA 1HB1A 4YG6A 3SEEA 4YARA 3VD9A 2JDUA 3AZVA 2A6XA 2BNMA 2R32A 3G7DA 3HQRA 5F2SA 4Q4X2 4YW2A 2C24A 4RGGA 4BQXA 2RJ2A 2PHUA 4AW7A 3VHPA 2VU9A 1W3VA 4AI8A 2C5DA 2WFF2 3USUB 4Q4W1 5KR7A 2Y6KA 1RUD2 2PELA 4BB3A 2WO2A 1AR82 3WQ7A 2MHFA 3J4UH 1SLCA 3GZAA 5FZMA 3EYPA 2DURA 1B35B 4YGCA 3V56A 1SDWA 2EIEA 2WUHA 1YXWA 3EQEA 4NPLA 3ZSJA 1WGPA 5LZ6A 1ZA7A 5CFDB 3KLSA 1LB2A 4LE3A 4N53C 4YGDA 4IQPA 2YMZA 1LENA 3UL2A 5GZEA 4WM7A 3MPPG 4MXVA 4A7KA 1RVF3 2H6CA 1G8WA 2GC3A 5FZ4A 4L11A 3VDAA 3LPGA 4CDQA 1WCSA 2HYXA 2IWGB 4BU2A 1BBT3 4EE2A 4LK6A 5C8CC 1VALA 3ZPOA 3VKFC 1KITA 2XG3A 4AZZA 1R091 3GHNA 4SBVA 1VMHA 2ZGOA 3ZSLA 4XW3A 5JXHA 1RUE1 4JTOA 3WP6A 1E57A 1GWLA 1UMZA 3RZJA 2V4AA 2WJSA 1W2UA 4XXPA 4YFZA 3AMMA 1ZBA1 2OX0A 5LB6A 1RJ8A 3AXDA 3NNMA 1D2SA 4NOTA 4QU1A 5H9QA 3SC7X 2RV9A 2QQLA 2XB6C 1RUG3 2D93A 3VKMA 2HBUA 1ACCA 4IE5A 4QPYA 3FL7A 5C8WA 4XJUA 2UY8A 4M4RA 3RYPA 3RJ2X 3JCIA 2GNBA 4FP3A 4OHZA 3T1LA 4QXCA 4GB31 1PNFA 5CEHA 3VBOC 4AHXA 4AQSA 5AFBA 4N43B 4D69A 4NR1A 1N3QA 1URXA 4R8HA 3APBA 3WNXA 1J3RA 2CSGA 2ADEA 1CZSA 4ORFA 2RM23 1AX2A 5FRAA 4CP0A 4XCAA 3B5LB 2X29A 5A7NA 3WG3A 1NCRC 1NUKA 1I3HA 1CPNA 3N3HA 4IEXA 5CVRA 1YI9A 4ZZ8A 1UY2A 1R64A 2X10A 1FV2A 3T30A 5IK8A 5H9RA 1W9WA 4AAXA 1H0BA 4HG6B 2WZR2 3PVBB 1AYM1 2D3PA 1DQ4A 3T0DA 2H0VA 3V0BB 3V65A 1UCXA 4QQHA 5FMOL 5GZFA 1JU4A 1AX0A 2P2KA 4JHZA 3I3BA 4JGZA 4IL7A 1FNYA 2YBPA 5FMDA 2JB8A 2WAOA 3OYWB 5C6CA 1NKGA 3J7MA 1F15A 3NAPA 1WCDJ 3OSDA 1PO21 1UNBA 3HR9A 1YHFA 3Q9OA 5BNPA 1C5IA 2JG8B 5FPBA 5FREA 2WWJA 5DAVA 4PIXA 5FWEA 5CA6A 2V5DA 1WMFA 1LOBA 2ZGMA 2BU9A 2R7EB 3FHIB 5ANNA 3ZN5A 2DCTA 2V73A 2VBDA 3O12A 4JDOA 2WS92 4UT5A 4Y1XA 1DLCA 4NHMA 1AZDA 3E6BA 2XJQA 2E51A 1ZBE3 5C5UA 1WUVA 3PVOA 1AR93 5EYXA 5FY7A 3CHXA 5LATA 4DXSA 2IC1A 1AXZA 2VJXA 3LIGA 5I0UA 3GHMA 3M1HA 4K40A 3TEWA 1PIV2 1RUF1 5IUQA 1JHJA 1XE7A 3VB9A 4KGQA 3VKNA 5BNQA 2YBSA 2A7AA 3SHRA 4RGKA 2UURA 5IWFA 3MW3A 5IK5A 3RYRA 1GQGA 1I6XA 2I74A 2OW4A 2VAUA 2XBO2 3NNJA 5JZGA 2I07B 4IV1C 1OC1A 4C1XA 1UU5A 1PK6B 2AZ5A 2DBIA 4RSUA 4OZOA 3ZFEC 3U1XA 3S7EA 3LA3A 5KC5A 4XF3A 1AUYA 2XKPA 3K75B 4K1YA 5FPLA 4YW3A 1QH7A 3E5XA 4HONA 3W9AA 1FXZA 2FDIA 1RUJ1 1TME3 1FT9A 4ES9A 3V0AA 1A34A 1KDKA 4GXLA 1A8MA 1F9KA 3ACGA 3PMEA 4CP9B 3E5UA 3VBRB 1BZWA 3GYDA 1RVF2 1F5FA 1A6CA 4D7YA 3NNFA 1UL9A 5F3IA 4OQ8A 3FFZA 2HKXA 3HD8B 3I2DA 4NIHA 1OKQA 3NL1A 3P3NA 4LJHA 4CEWB 3GBFA 4ZY9A 3MIDA 5H9SA 3B3QE 5JR7B 5APAA 5FYTA 1XU2A 1JOJA 3UGHA 2JE7A 4CCNA 2E6VA 4PCRA 2WAAA 4JDNA 2OS2A 4QPIC 4RD7A 4JGYB 4RL7A 4BQWA 2FMYA 2XWJB 3ZKUA 1UXXX 5DMYA 5J96B 1S4CA 3ACIA 2CGOA 4QQPA 1SLAA 1APNA 3VBFC 4AFAA 5FAXA 1K5MB 2CWMA 3M3OA 3ZIWA 4C8DA 5GLUA 4E8CA 1RUC3 4UOJA 3O1PA 3VD4A 5A32B 2WC2A 4UFIA 5FK8A 4FOVA 2VO5A 1S2EA 2DU1A 5C9AA 1H8TC 4DB5A 2VNRA 1DYOA 2KM2A 3GBGA 5LY1A 2ZEWA 1MR5A 2YV8A 2BOJA 1OI6A 1WD4A 4XZPA 5F6LB 3UESA 2JECA 3O0VA 2IXLA 4XC9A 3U10A 1YCIA 4IV3A 5EPAA 5JI9A 3D8CA 4FSJA 1W6PA 2PHWA 3ZSKA 1GOHA 1NLSA 1IKQA 2BERA 2QE3A 4K21A 2EAAA 2RMU3 3FX3A 2VBPA 5FJHA 1F5JA 1ENRA 1PVXA 1PX4A 2HWE3 5FP4A 2Q8OA 4L8QA 5JLVA 3HNMA 2VUAA 2P3YA 2VR4A 1FV3A 4XURA 2RDQA 3KCXA 1TMF3 3RG0A 4CCMA 3PVEA 4CDQC 4EN8B 1GP6A 1J84A 5D21A 5FYMA 4R9BA 1I1EA 3A21A 2OUJA 3GM8A 2N7GA 3TN93 3WQBA 5L7OA 2QQNA 5EZWA 2YFZA 4COUA 3WR0A 2R0FA 3T0BA 3ZIXA 1CAUA 1DP0A 1DGLA 2D6OX 2VBBA 5J36A 4Y26A 1W8TA 4YZ2A 4EWEA 2QFEA 5T55A 3VBSC 1MQTC 5BNNA 3K77A 2VOWA 3CDZB 2V5YA 3HBKA 3KV5A 1X9TA 2AYHA 4UF0A 2X5IB 4LBLA 2WNVC 4LHSA 3RQ0A 4TLGA 5EJ3A 5BNOC 3ECQA 3WNNA 1KFXL 3GXUA 5F5CA 2DVFA 2OVUA 3DCQA 5A6QA 2TBVA 3W59A 3OF1A 3LGRA 5FXZA 2YY1A 5FQ0A 1UY0A 2VVFA 3OBRA 3U0ZA 2NZ9A 3I97A 1DGRN 4XDPA 4DQAA 4Q27A 2QQPA 1FOD3 3U4XA 4AL9A 2C4XA 3OUJA 5F3CA 1YFWA 3MV01 4BMEA 3VDDA 2PN5A 1S1AA 2JG9C 2F17A 3KV4A 2K46A 2WABA 4DXZA 4FVVA 5C5TA 1C4RA 3PJYA 4Y22B 2FDHA 1UX6A 4H3WA 4ZU5A 3WQ1A 5I0TA 1AR92 3Q8EA 1ZZCA 1VBC1 1DGWA 2WZ8A 1VMFA 2WRAA 1SLBA 5ACA1 2XDVA 3LCPA 4HOOA 1OA3A 3SH5A 1XNAA 2YXSA 1IZ3A 3RGBA 2VPVA 3ORJA 1RTVA 1VRH2 2VZSA 1U0AA 3K48A 1VBE1 2EAKA 4IEPA 3J7NA 1ULOA 4OZXA 2GP5A 3HNYM 1QJX2 4HKWA 4QKFA 2DUOA 1ALYA 3WD5A 4UAPA 3ZFFC 3OGGA 4M01A 1BYHA 3Q8BA 5BV6A 2F4LA 5JWPA 2C9KA 4SLIA 3B69A 2ZX4A 3ZYBA 1YJKA 1NA1A 1QIQA 2JX9A 3ATGA 3MICA 4JC1A 4QHBA 1NZCA 1TME2 4MADA 2C26A 5F3GA 4Q29A 5I8YA 4L0PA 1QJU1 1AX1A 2D6NA 5F5QA 3K4DA 4PF5A 1VP6A 3JD73 4XJAA 3ZN6B 5K8SA 3O1TA 2SLIA 2BGPA 4XF0A 2R071 4CU7A 1YFXA 4KQ7A 4KU7A 1D4M3 2A71A 3I2GA 1PZ7A 4CXYA 1NZIA 5AC93 5FZHA 3LWCA 1LOFC 3K3OA 4Z82A 2W92A 1RJ7A 4D8MA 1QJY3 2E63A 3GCWA 1BMV1 4XFFA 1NY72 5EWSA 4AVVA 3L2YA 4AEDC 3BIEA 1KQRA 1REDA 1V6LA 4MO3M 3I3QA 1SHWB 3LDKA 4META 4EWAA 3DPRC 4WVWA 1HKDA 2VTFA 2FBEA 1W6MB 1UZYA 4YG3A 4FXKB 1KS4A 4CDWC 1RUC2 1Q3EA 2VXRA 3QH6A 3OUHA 3ILNA 5LBBA 1UD1A 4LULA 2PHLA 3IZOA 1O4YA 3GNEA 1MVQA 1UYPA 2KD7A 3VDCA 5LBFA 4FAHA 4LT5A 5FZOB 3HPNA 1UOBA 4JTNA 4Q4W3 1AJKA 4MHRA 5I91A 3LFIA 1QNWA 4OYUA 1WA6X 4AI3A 1EPWA 3USUA 5FZIA 1XRUA 3ILFA 3FZ3A 3SQOA 2RMU2 3T2QA 3E6CC 1Y43B 3U4SA 1LOAA 2IFRA 1B35A 4Q4V1 4BHPA 1VB2A 2XQRA 4ZHNA 5FPXA 3MYXA 2XWBB 1SCSA 4WM8C 3CKHA 3ACHA 1R1ZA 1TMF2 2RVAA 3R4UA 4Y4RA 5CFDA 1GQHA 4YM0A 1RL3A 3TN92 2XXZA 1JTZX 2Q8CA 1US3A 4H7LA 3WDVA 1U12A 2P3IA 2A3YA 4AR2A 4YLZA 1R093 5FPVA 4JDMA 4K1ZA 3WCSA 1HX6A 1NE4A 2BTVC 4EN9B 1JZ8A 2YC4A 1JYNA 4AVSA 5FY9A 3Q8CA 2FCVA 4AXOA 4XHXA 1R082 1H6YA 2QQUA 3FJSA 3PUQA 2YPJA 2RHPA 3ZYRA 3C2UA 5L9BA 2JXAA 2YPDA 2ZEXA 1LGNA 2ID4A 1V6NA 3CJIC 1PGW1 2A73B 2FCUA 1Y9QA 1ZRIA 4JRLA 5BXXA 1FOD2 4URTA 1DQ2A 3CEWA 4ASMB 4B4QA 3R4SA 5A80A 3P3PA 4LKFA 4GB33 3TRSB 1POQA 5EJZB 2QTWB 3AMNA 1FPN1 5GLZA 4JV4A 2JENA 1XOYA 3NW4A 4WVZA 1AR62 3H1MA 1PX3A 2EXJA 2B45X 4YM3A 1YO8A 2VQUA 4K3UA 2PAMA 2PLV2 3MIHA 1XBFA 2A3XA 2NMNA 1IPJA 4RHV3 5DXDA 3X29B 5A6XA 2B4KA 1RITA 1QOSA 1C8M3 2ZGRA 3J7HA 4XQDA 3T2PA 5K0UC 4RS5C 4UW3A 3MZHA 4PBOA 5E16A 4FPJA 4QXHA 3S5AA 2IUWA 3PVNA 5G04L 1Z78A 4ES8A 1AYM3 1RMU1 1UAIA 3HIFA 1PMJX 4Q5OA 4QWNA 4CDXC 1D0GA 1W99A 4JZRA 3VGIA 4CZSA 4M3CF 3AYCA 3NV1A 4MVTA 1HJGA 3V0BA 5KXBA 4GH4C 1S0BA 2XUMA 3RZZA 3VZMA 1PM7A 3ZFGB 5JSPA 1SBFA 2R043 5A3TA 3KV6A 1W6NB 5FYYA 4MSVA 3OYWA 1ZZBA 1CJDA 2KA3A 3RZMA 2Y64A 1VAVA 4LR4A 2RS32 4JRAA 3VDDC 5AC92 2JG8A 3UYJA 2ZPXA 3R4DB 1ENSA 4KWUA 1QJY2 5EP9A 1ZZ8A 1H1IA 3R6SA 1DGWX 2ARAA 3HT2A 2YYOA 3CQOA 4XFGA 2GMPA 3RPQA 3HMYA 3IMNA 4AAPA 4CCJA 3GCXA 1SEFA 3ETPA 2UYBA 4OMCA 4HXCA 4P00B 5FZ8A 2HBTA 2P37A 1UF2C 4E4SA 1N3PA 1RUF3 1XE8A 3J26N 1PMHX 2A3WA 2HYKA 3JB4C 4XQ4A 3USSA 5A6YA 1WCQA 1LHVA 2OYZA 4NPRA 4FPHA 3AC0A 4FFHA 3UT0A 4JHTA 4QXKA 2E53A 2WQ8A 2DCKA 2IXHA 1KFUL 4HBNA 5BPXA 4AFBA 4CUGA 3THCA 5CFCB 3ZXLA 5FZ1A 1ZRDA 1GMMA 3K4ZA 4QDRA 2EVXA 4IEYA 3W5MA 3HVDA 3TEZA 3CO2A 5F39A 1RUJ3 3SISA 1PK6A 4MGSA 1ZRRA 4CTEA 2J7MA 1NX9A 1GV9A 1W06A 2W68A 2VZRA 2DVDA 3KMHA 1OQDA 4Q4Y1 2FQPA 2JE9A 3VLBB 5IVFA 4OVEA 3AFGA 1AR71 3E5QA 3C7GA 1LHUA 5JVVA 1OF4A 1W9TA 1JUHA 2GN7A 5DDJ3 3W21A 5IAVA 1J1LA 1CZVA 4CP9A 3VL8A 3VN4A 1O3SA 3FUOA 1R092 5HXMA 2D43A 1TG7A 5T5LA 4LBNA 5FOJB 1SFPA 5LRRA 4CEWA 2JDYA 3ZXJA 4L97A 3NV4A 1Q8PA 2XJSA 3C7HA 2D7FA 2JKXA 4YW5A 3FN9A 3RI9A 3PUIA 3T0AA 4RQPB 4JGYA 1UN1A 2BV4A 1OD5A 4HSJA 2RS51 1RUI2 1AVBA 2GZWA 1K5MA 4YVWB 3WDUA 5D1IA 4PQ9A 2WSVA 1MVEA 3AZYA 3B01A 3FMGA 3K3NA 2F6BA 4W4ZA 5L19A 2WNOA 1JODA 1EUTA 2GC0A 4M3CE 5A32A 5FO7B 4GALA 1L7LA 1PO12 5GZGA 1DCSA 4WVVA 2MEV1 5JXJA 4JX0A 4KGGA 4ARYA 2NM1A 2FCTA 2AEZA 2BJSA 2VGDA 1UIJA 4COZA 3WCRA 2Y6LA 4JCKA 1COV1 1IKPA 1X9PA 3NQHA 4TN7A 4V2VA 4AHYA 3EB7A 2EA7A 1ULPA 4ASKA 1GNYA 1GOFA 3U11A 3WF3A 4B7KA 1RUH1 4PLOA 4JVAA 4Y5TA 4XTMA 4IXLA 4PI0A 5A7OA 4BQ2A 4FBFA 3IT8A 3PUAA 4GWJA 4QDSA 4RHV2 1K12A 4YZ5A 4OHYA 2ZBJA 1C8M2 5FZLA 4Q0SA 4NIIA 5DAPA 4XF9A 5C4WC 1UKGA 3CL1A 2ZA9A 4K6BA 5DAWA 2A1XA 2P4EA 3NRUA 1LR5A 2E32A 3JB8A 3RWNA 4MG2A 2VE1A 3H1WA 2BBVA 1W3XA 1KXGA 3ES1A 1IS5A 1OH3A 2ERFA 2YC2A 2C1FA 1AYN2 1H2LA 3OGSA 1O6UA 3T4VA 5CISA 4LIUA 2ZMNA 1X36A 3DXTA 2ZHMA 3NKTA 4HKLA 1EAH1 2GALA 2QQIA 4MGIE 5GALA 5FY8A 5SV5A 3MPBA 5D8AB 3KVBA 4YW7A 1CWPA 2R042 2BP6A 2X5IA 4X8PA 4R52A 4Z92B 3JBG3 1YEWA 1G86A 2VMHA 2UY9A 2VCCA 1CX4A 2BGOA 2WNUC 5FMCA 1MZEA 3AKQA 4LBQB 2ZEYA 2RJKA 1F2NA 1JZ5A 1FATA 3LFMA 1LRHA 4HK9A 4OHVA 1WW5A 4AEKA 1W90A 2QCSB 5K4LA 2VZUA 3WSOA 4XJ9A 1C1FA 2J1UA 4QM8A 4HZFA 3S30A 5A1AA 1XNDA 4AQ6A 4N43C 2R1DA 3GBWA 4XMAA 5FZ7A 4PLMA 1JOPA 4QX8A 4E4DX 3JU9A 4H55A 3ZLIA 4BH9A 2ZTNA 3IPVB 4Y22A 4DS0A 1XC6A 2O8OA 1LESA 2WT2A 3GALA 5C3SA 1M4WA 2Q5TA 2G19A 1LGCA 1CAXB 1NYWA 1GUIA 1S55A 1VBE3 4D94A 3MF6A 3M3QA 5C33A 5IVCA 4MGKE 3ZR5A 1XE0A 1CPMA 1RHI3 2WKKA 3I2IA 3RS6A 2DYCA 3A7QA 2WT1A 3PMSA 5FUIA 4CCOA 5JMOA 1UW8A 1K45A 1JOBA 3A23A 3I8TA 1YIFA 1S0JA 2VQ0A 4UW6A 1D7PM 5DZFA 5FP7A 1TNRA 1NT0A 5CZKA 4YWAA 2GNMA 3LAGA 2HLEA 1YNAA 1W9YA 3N7LA 4FCAA 4X8NA 4XUNA 4ARXA 5JCTA 5SV8A 1HB2A 4Z2AA 1D2QA 4YVSB 2R061 4BQ4A 1H6XA 4CE8A 4E27A 5B2GB 3A0NA 3ILRA 2XJPA 5FUNA 4FTBA 3DEMA 1PMIA 3BI3A 4PDWA 5DDJ2 5J7MA 4NROA 4AQ2A 3U75A 1QEXA 3WP5A 3ZN6A 1NCQC 2IFWA 4DPNA 2QBXA 3HN1A 4YGBA 4A4AA 2W5FA 3C7OA 2BFUL 2ORXA 4FPCA 3QBQA 3VD7A 1W0OA 4P9YA 1F31A 1MS9A 5FYVA 3BPSA 3VBUA 5FYIA 2W47A 1HRI1 1ULFA 2XVKA 3H7YA 4L9BA 5A3WA 4TTGA 4QGLA 2EXKA 1VBD3 2V09A 2WWSA 2J1TA 5I0DA 3WT3A 4A44A 2H6BA 2PHTA 1MS0A 5JPNB 1EV11 4GJZA 3UKNA 1GANA 3WG2A 3OEBA 4CEYB 1W6MA 2A75A 3QH7A 2EXHA 1S0FA 1W6QB 4A45A 4L2NA 1YC61 4P9LA 5J09A 3S6PA 1R1A2 3CBNA 4AOCA 2J1SA 1H2NA 1QJEA 1QOOA 1W6OB 3BIWE 4QQOA 2XJUA 1SQ4A 4ZONA 3KCCA 5KC6A 1H9PA 1PK6C 4DIQA 1KDMA 2ATFA 4HVRA 1WW4A 2Q4SA 3NV3A 4FPFA 5FZOA 4A3XA 4Z1VA 4XUOA 3A0KA 4LHKA 4D6RA 1VBB1 4AG4A 5CG9A 4EN6B 1OA2A 3WDWA 4GIQA 4OULA 4UXAA 2W1UA 4V1PA 3ZVXA 4Q4V3 4A7YA 4N9HA 5BY5A 1O3QA 4XDOA 1PVC1 2AREA 4V2WA 4CDUB 1OOPB 3RWKX 5FJKA 5FYCA 4UFHA 1ASJ1 1Q8SA 4J6GA 2BZDA 5FP8A 3G6JB 3VBRC 5C71A 2CGNA 4COVA 3H1YA 2ZGTA 3PUSA 4RR3C 3J8F1 4XAEA 2ILMA 2ZX1A 4YM1A 5A33B 4IEOA 4NMIA 1LTEA 1ND3B 1DQ1A 1BEV2 1OLMA 4BOWA 5JUVA 4W65A 4I0AA 4PBPA 4YZ4A 5FFOC 4EV0A 3D0SA 3WF4A 1OA4A 5GLWA 1UYZA 4Y20B 1UO9A 2NPIA 3PDQA 5C70A 4D6SA 1LOEA 5FP9A 3WG1A 3C8XA 5FBZA 1MEC1 2D40A 1XSQA 4WBBA 3E97A 1EUUA 3I2HA 3JBG2 5IATA 1VBA2 1IS6A 2VMDA 4BA6A 1NG0A 4GWIA 1RXFA 2NYYA 3CLPA 3PLQA 3LEKA 2GMEA 4LQRA 3VD3A 1CQ9A 4XILA 3HN3A 5DAQA 2ZHNA 3FLPA 1JYXA 1QKQA 1ZNPA 5I0RA 5F6KA 1XJAA 1DDLA 2GSYA 5FZFA 1AL21 1FMD1 1G9AA 5EIYB 3E6DA 5IK4A 1DQ6A 1T6GC 1GZCA 4W8JA 1V9U3 4QAWA 5H9PA 2K9ZA 1RGSA 2CU5A 4NUBA 3VL9A 4NRPA 4BXFA 4CCLA 2ORZA 1T2XA 1W0NA 1RB8G 4I30A 2HWD2 2E9QA 4Z2WA 2RS13 3ZOIA 3FHQA 4I01A 5LK7B 2OUHA 3NKGA 4FFFA 1KJLA 2MNGA 4F83A 3W5NA 3IIIA 3O1UA 2ARBA 1RMU3 1RHI2 3VHRA 1T6BX 1Z7S1 5JPMB 4LBMA 4S2HA 4B4RA 4YYOA 4CUAA 3IAPA 3VBHA 3WNLA 4GWNA 4IE4A 5IVVA 2XPJA 4QX3A 3ZR6A 4KG8A 3AP4A 4JKKA 1CIYA 3M2MA 4QGMA 1WW6A 3T2OA 1DYKA 2LTNA 3DUIA 1SACA 1BVVA 3HBZA 2UWBA 3AYAA 4HPKB 5IJRA 3WW4A 1OBNA 1XSRA 3JQWA 1BVP1 1VB4A 3ZFGA 2WZEA 2W1WA 5IAXA 1ND2C 4BQ5A 4GZ9A 4Q4X1 4I3GA 1C3HA 4FOQA 1W6NA 3MI8A 1H30A 2WFF1 1W9FA 2CHHA 2I2SA 1BBT2 1RUD1 4ISQA 2TEPA 3RMXA 4E4ZA 1AR81 4KG0A 3ZDVA 2XJRA 4KWLA 5ABJC 1LHNA 3UGGA 1O8PA 3MHZA 3PU3A 4A6SA 4AVAA 5A70A 3WY6A 1QU0A 5FBJA 4UWDA 3KGZA 3DKQA 3DL3A 3CU7A 4F8AA 5CYYA 3OCPA 2ZHKA 3K2OA 4QD2A 4BQ1A 1VBD2 1WKYA 1RINA 1CAWB 3RSJA 4FI9A 3SLIA 1DZTA 3UKTA 1UQXA 2WSUA 5L9VA 3BUCA 1F4AA 2W46A 4DUVA 4Q1RA 1RUG2 1UU4A 2YU1A 2G1MA 1NOVA 3MV11 3AP9A 4LUMA 1YQ2A 2UWCA 2HWB3 5KXEA 3I2JA 1XYOA 4IEWA 5KWRA 3I59B 5FZ9A 3KZ4C 1J83A 4AI1A 2RR13 4CVUA 2AH2A 5F3EA 4XF4A 2CTVA 3PIGA 1BK1A 2ENRA 3IIAA 1O4ZA 3HOBA 3SCGA 4MGTA 1VJ2A 5CFCA 2FDGA 4Q0VA 1JU3A 1V6MA 2DCJA 3FBYA 3AKSA 2RM22 4Q4Y3 3BTZA 4WM7C 1AR73 2YGMA 2ZZQA 5FZEA 1FYUA 3E1F1 4YPJA 4ASLA 3O0XA 3ROUA 2BNNA 2DVGA 3DN7A 2WQZC 5E89A 4F3JA 1CX1A 2TUNA 3ZM8A 2W9XA 4NO4A 3ZMNA 1MS4A 4LBOA 1LECA 1VR3A 2WBKA 5EJ1B 2CL2A 5A3NA 5FDBA 3N7JA 1J58A 2IXKA 2CDOA 4XBLA 1IS3A 1TZOA 2JIJA 2W39A 2EIGA 1OH4A 4P08A 2BQPA 3CNAA 3QOPA 1CONA 2VG9A 1CESA 5C3RA 1JYVA 4MX3A 4CCEA 1MS1A 1MACA 1IGOA 2OZ6A 3AB0A 5DUVA 3DV8A 3POFA 1HJFA 1JW6A 2G4IA 2G9FA 2RS53 2ZGSA 5F8PA 1PGL2 2E7TA 3KHBA 1VIWB 3WNOA 2BW8A 3SITA 4RQPA 4OMDA 1PGW2 1XNTA 1ZA4A 4IV1B 2J22A 1JYCA 1OSGA 4QB2A 3BTYA 3ZFEB 1KGYA 1QQP3 1S0GA 2MEV3 2WZR1 4BZ4A 1WA4A 4YVWA 2BFUS 2VTXJ 3JUUA 3R05A 2QZ2A 1KS5A 1WLDA 4U36A 3IBMA 3KV9A 2XUEA 1LEDA 1LJ7A 3PNAA 4NAMA 2Z79A 4P9JA 4Q26A 3LDRA 1ZBE2 5F5IA 5KHHA 1N1SA 5CKMA 1LAJA 1V9U2 1RUH3 5FY1A 4Q0QA 3U07A 2XJTA 4A6OA 2XGXA 3IN9A 3GZUC 3KVAA 2WL1A 4OCTA 5JIUA 1ZRFA 1LKNA 3WX5A 1UXZA 3H3UA 4IEZA 4FQ4A 3ETQA 2RS12 1GWKA 3H8RA 1UYYA 1PHMA 2YB7A 3AJZA 2ZX2A 3MF9A 1ENXA 1O5UA 1PZ9A 2QQMA 2Q0AA 4FOYA 3CMGA 4XFCA 5T50A 2DBNA 4QPIB 2VCAA 4IEVA 3C7FA 5L9RA 4CCKA 2WS91 4JGZC 2XMLA 3ES4A 5C3QA 4W6YA 3N9MA 3ZSEA 5DABA 4LEJA 3OG2A 2GC2A 3VBFB 3NAPC 2ES3A 1MZ6A 4OHWA 3ZN4A 1EAH3 2XLGA 5BNPC 1SFNA 4KWKA 4UFJA 4XZUG 3D0JA 3O5SA 2P34A 3WNPA 3WDTA 4URAA 4FTSA 4ZZ5A 4LO6B 1PIV1 5HCBA 1U5YA 4CA9A 4PDWB 4RGAA 1HRV3 4XAAA 3U78A 3MIGA 1H8TB 2WN2A 3AMPA 3T4HB 1V70A 2K0GA 4EZHA 4DXRA 5D8AA 3RZLA 1K42A 3OBZA 4O7XA 2XBO1 3FBMA 4XBNA 3I54A 4IEQA 3ZYGA 3AM2A 2FZ2A 5A7WB 5FYUA 2KR2A 3POIA 1O8SA 4LBQA 3PURA 4W6WA 4AGRA 2SBAA 4N7IA 1W8NA 3VBUB 4ZU7A 2P3KA 3RNSA 1WZXA 2VC9A 3WG4A 4AEJA 2ZGUA 4M3CB 3OB8A 4Q8LA 5HCAA 5FZCA 5HCFA 2UWAA 1CN1A 4LBJA 5A6ZA 1AL0G 1OLQA 2C0ZA 2D3SA 2XHNA 2ZAHA 4BK4A 1YJLA 4C0BA 5E1RA 3TYJA 1ZYBA 4KWJA 1N1TA 3HWJA 4XJWA 4G9SB 5DZEA 5E88A 1RVF1 3IPVA 3N35A 1HLCA 1XNKA 4Y5Z0 5JZGC 4YRDA 1E5HA 3R0RA 1LHOA 2VOVA 5KHJA 1G9DA 2HWB2 3ZXDA 3FC0A 3T1MA 1JS9A 1TQ5A 4R4ZA 3M3IA 3MEPA 1CAXA 1MQTB 1P8JA 3VBSB 2RR12 3UV9A 3PL0A 4DINB 2IXCA 5JSRA 2WNVB 3MW2A 2B42B 5EYYA 3LEIA 3AKTA 2CDPA 2R49A 1N1VA 3M8LA 4XEZA 4XMIA 1DLLA 5LCWL 3IM0A 1W0PA 1LEMA 2HWE2 1W28A 3F95A 2R6QA 2AEYA 2PHXA 3M3CA 5A3OA 5K7PA 1ZRCA 4I0BA 5IVJA 3WV6A 2VY0A 4YVSA 2PXJA 2H0BA 4LNVA 1JUIA 2JG9B 3MIEA 5FYBA 2B9VA 2YHJA 1N3OA 2JDMA 2VNOA 4IESA 4HL0A 4DRRA 5FPAA 3ZKYA 4FXGB 1RUE3 2E26A 1DG6A 4OFGA 3LKJA 1O59A 4BYYA 3VZLA 3QACA 5FTTC 5I93A 1HRI3 1MZFA 2FHRA 1ZBA3 3HQXA 2ZABA 5CB7A 5J48A 2VNVA 2NLRA 4OUSA 3S7IA 2PTMA 3TBDA 1EV13 4RN5A 4RYDA 5IW0A 1K3IA 5C9AC 4E2SA 1I5ZA 5J1XA 5JOXA 2WO3A 2WZPP 4YNIA 4XF1A 5F5AA 3ASIA 2B5HA 4XHBA 1QQP2 1TNFA 1W39A 3EMRA 4UW4A 5D2AA 1IQDC 4IV3C 3ZFFB 2BUKA 4CEYA 1UX7A 1X33A 1W6QA 3W58A 3INAA 4K7JA 4OI1A 3TWIA 1RXGA 1Y9GA 1VBB3 3ZDSA 2A6WA 5FPUA 1QJFA 1W6OA 3N7KA 2E7QA 2W94A 1GNHA 5FZBA 5FZAA 1PVC3 4TXWA 2WLQA 3O1OA 5JDBA 1HXS1 2ZKLA 2ZJCA 3PHMA 1HQLA 2C6SA 3AKPA 4ZS2A 3B94A 4B7EA 4YZ1A 1ASJ3 5A7SA 1XU1A 3H3LA 5L7OC 1JN2P 4QPWA 4XUTA 4FPLA 3RYKA 3GGLA 3J8F3 2WWUA 5DPNA 1C5HA 4BCUA 1OOPA 3VBHB 4CDUA 2HEVF 4OI4A 5JAXA 1HV0A 1G9CA 2A70A 2ZGLA 4J1XA 4Y1YA 4MZUA 5BNNC 2BBAA 2YZ4A 1W04A 3DPRB 5A33A 3TNQA 1OMIA 1JMUB 3HEIA 1AR91 1ND3A 3BOPA 3BTXA 4HETA 1PO23 4CDWB 4XBQA 4CRQA 5A1FA 2DFBA 4P14A 1MEC3 1TEIA 1CVNA 4RQPC 5IVEA 2D5FA 3OPZA 2D6MA 1HRV2 3MGUA 4HN1A 4HLTA 3JD72 4Y20A 2O14A 2QUOA 4NRQA 3CF6E 1VRH1 1OFNA 1D4M2 1UMIA 1ZZ6A 2W87A 2WQ4A 4B8EA 1UZVA 2P3JA 1IG3A 2B8MA 4EYUA 1QJX1 1O7FA 3EO6A 1JZ6A 3JQXA 1JYWA 1X8MA 1CD3G 1UY4A 5DUUA 5LRSA 1OURA 1FMD3 5LK5A 1C8NA 2CGPA 1GZWA 1Q5OA 4QHOA 4TSVA 4PJYA 4Q8KA 5L36A 4DMIA 3BGAA 2MPFA 4AYUA 2XJVA 2W08A 4WM8B 2OA2A 3WW2A 1SBDA 1OKOA 4KMQA 3LD8A 5FKBA 5HV4A 2V4VA 4XIOA 2DCZA 4XVHA 1UPIA 3ZXAC 1YFYA 3ZX7A 3OBTA 1S0DA 2JB4A 1LU1A 2ADDA 4Y1ZA 3U37A 4E2GA 1DZRA 2Y60A 4Q4W2 4BLIA 5FO8B 1BXHA 1GP4A 2JDNA 3T09A 3NJVA 5DQ0A 4BQ3A 1NY71 2Y33A 5BYNA 5C8CA 1NA1C 1HW5A 4K8FA 1V0AA 3DGTA 3M70A 1DIWA 3OPTA 3OY8B 4I3PA 1LOCA 4N7UA 1QY4A 2VZ1A 3M3EA 2ETEA 1HIXA 4NJ4A 4H2AA 3ZPYA 2HWF1 4PIZA 1E5IA 2AC1A 3RJRA 1RUC1 5HV0A 2WDBA 3CJIB 1GFF2 4C91A 4Q4X3 1MPXA 5JOWA 4AGGA 4HPKA 4Y5SA 2WFF3 3GZTB 2BWCA 3NSTA 2VMGA 1WW7A 1RUD3 5T5OA 5JXGA 5K9YA 1IHMA 1KEXA 5AVPA 2QQOA 4JKLA 4ZKTB 5LWBA 3C3VA 4Q0UA 1RUE2 3VBOA 3AX4A 2ZAAA 5A3MA 2FDJA 1CJPA 1MS8A 2CWSA 3EXUA 4PF1A 1ZBA2 2W3JA 4LPLA 5K0UB 2WA3A 1FNZA 4RS5B 5M0TA 1QNYA 1NCRA 2Y0IA 1TMF1 2AACA 5FZKA 2GP3A 5I8SA 3VZKA 1CAWA 3TN91 4QX7A 4DOUA 5CIRA 4CDXB 4GKXA 1N47A 3NO8A 1US2A 3LDBA 1A8DA 2BPA2 4GB32 2CAVA 3IB3A 1HDKA 3CIHA 4IE0A 2VW2A 5A3LA 4P9WA 1XQNA 2VVDA 3I59A 1VBB2 2QNKA 3LE0A 1WLTA 2GU9A 4GH4B 3AVSA 3WW1A 3I7DA 4AFDA 3I2FA 1B35C 3RVHA 4D3WA 4OLLA 1R081 3J9SA 3L9JT 1DZQA 4MOAA 2QDNA 3RZGA 1MS5A 2JICA 4NHLA 5JIAA 4WVMB 5CFDC 4TZDA 5J98B 4DNYA 2VQAA 3FLTA 3JZVA 2V72A 3N7MA 4YW1A 3OD0A 1AXYA 2BEOA 4S2GA 1IPSA 1QHDA 1FOD1 1YYNA 1AYM2 2RJLA 5FXVA 3D4KA 4TYSA 3AP6A 1ZVFA 4PLNA 2HEWF 4AWDA 4XABA 4LBQD 3OTFA 4FFIA 3AMHA 2YBKA 1AR61 4D6QA 2GC1A 4OHXA 1HQNA 2BNOA 2VMEA 5GKAC 5C3PA 1REFA 4LO4B 4QKDA 3GDBA 4I0WB 2VVEA 1PO22 2PLV1 3BCWA 2VMCA 3N36A 2BRTA 4UW5A 3UNPA 1POV1 5LBCA 4NHYA 1DFQA 2Y26A 4XIKA 1YFUA 1QH6A 1JHNA 1ULGA 3W20A 3AXEA 4CXXA 1SFYA 2WZR3 3FUQA 3ZO0B 3BPZA 2RG4A 3DF0A 3M7AA 1AJOA 2NQYA 3KQRA 1GLHA
chains in the Genus database with same CATH topology
4HN0A 1SCRA 2EF6A 4IV1A 2AGSA 4Q2FA 5CG8A 4J1WA 3ZFEA 1G7YA 2XVGA 4LE4A 3NJZA 4QPGB 1Y7BA 3MIBA 2YGLA 4HVOA 1VBC3 1KJRA 1EY2A 1RUF2 5ACA3 1CAVB 3OJBA 4RFT0 4R9DA 1F8VA 2D3RA 4X6RB 2BWAA 4XJ8A 4CDUC 3BALA 4O9EA 5FLHA 3WLUA 3ZYPA 2RS31 3LOIA 3B00A 5AC91 3H0OA 4XPVA 2VUJA 4HMZA 1QJY1 2XHKA 1OPMA 3ALQA 4XOGA 5T3NA 3RDIA 3WDXA 2Z42A 4MH0E 2IXJA 3BTAA 3B9IA 3ZMOA 4QPIA 1GNZA 2ZX0A 4FPEA 1RUJ2 4C90A 2VECA 3KS7A 4D7TA 4Z8BA 1PIV3 1QJU3 1MS3A 3VBFA 5KBFA 4GMP1 3LZZA 2R073 2P17A 2JG8C 1N1YA 2XBO3 4HT1T 4DZGA 3A4UA 4YZ3A 1H8TA 3IWZA 3H8UA 1WD3A 3POWA 2FZ1A 1JH5A 1MZ5A 2X8KA 4CP2A 2LM3A 4FPGA 1V6OA 3VKLA 2A6ZA 2ZMLA 3I4IA 5C4WB 2E7AA 4FP2A 4M3CA 4YW4A 1J59A 4AVTA 3OD4A 1AF9A 4YSFA 1NE6A 1UKRA 4L92A 3QCWA 2ZS6B 2ZACA 4NHKA 4AHZA 2NP0A 4LA2A 5EXOA 1ULDA 3ZXGA 2RE9A 3VZNA 1SLTA 3U0ZA 2NMOA 1QXPA 5HBAA 3VBSA 3EJKA 1MQTA 3TNPB 2PA7A 1C28A 1Q56A 4LHLA 2WNVA 4FPKA 2Z69A 5BNOA 1QDOA 2WNUB 4HFSA 2D97A 2XLFA 1RUI1 4OI0A 4LTAA 3ME2A 3EHKA 4M00A 3LOBA 4U2AA 2HWC1 4HANA 2CAUA 1DBNA 1GKBA 5HXVA 3RMYA 1PO11 4DY3A 1O3RA 1B09A 4KU8A 2R0HA 4CEWC 3UJOA 2ZGQA 2JG9A 4JGYC 3AP7A 3MLJA 1ZREA 4HVQA 2DTWA 2WFPA 4AVBA 1DU3D 5FO9B 3AJYA 1K5MC 4RHV1 2O1QA 2PAKA 2D6PA 1C8M1 3AKRA 4BPZA 1OHFA 1V6KA 1XYNA 1X50A 2ZGNA 2DFCA 2ZZJA 1JXNA 4N9IA 1GZWB 3AYEA 3WUDA 2OPKA 3NV2A 4IETA 1FPN3 4Q1PA 1AYN1 1S0EA 2GNTA 3ZFFA 1RIRA 3S0MA 4P9IA 5T52A 1VBC2 3GF6A 1GSLA 4N53B 5JOZA 1HXS3 1PGSA 2R041 5ACA2 2ZHLA 4EROA 5J3UA 4B3NA 4OUMA 1LODA 1RC6A 2PQQA 1NCQB 1NLRA 5T5JA 1NXMA 1VBE2 4A2UA 4Y24A 4AHWA 3L2HA 4LBKA 5C8CB 1XNCA 1LOFA 2WNEA 4ATEA 5TSWA 1YLLA 4FOWA 2D44A 2D6LX 5EV7A 4AEDA 4MGYE 2QZ3A 4ONUA 1TE1B 4QX5A 1DQ5A 2X5IC 3RI8A 3WHUA 2R16A 1DHKB 1QJU2 3DPRA 5F9TA 1C57A 2HJIA 2R072 3IKWA 1VRH3 4CDWA 1FI2A 4QM9A 1QDCA 4FPOB 1QJX3 4PIYA 2D98A 3VBOB 5T5PA 2ZCWA 1BMV2 2VNGA 1OPOA 5JI7A 4BWOA 5T54A 2JJ6A 1GBGA 1LHWA 3ELNA 4EWDA 2WLPA 5DZGA 3KT4A 3ENRA 1UU6A 4ITCA 1NCRB 1GYKA 2GNDA 4I09A 4QGNA 1QJZA 4UBGA 2DCYA 3H3ZA 4WM8A 4RR3B 4LO5B 5DDJ1 4R9CA 4FT8A 1S2BA 5FLIA 1DYPA 4AI2A 3KB5A 1POV0 2JD4A 4KNCA 4AF9A 5LEJA 2A6VA 1G9FA 4MXWB 4KBBA 1NXD1 1IS4A 1ENQA 2HWF3 3O0WA 3B02A 4Q4V2 3OY8A 1DQ0A 1G6NA 3AP5A 4AEMA 2HEYF 4P5HA 4PDWC 3ZYJB 3K51A 5KXCA 2YUEA 1R1A1 2AENA 3CJIA 4NVPA 2DVBA 4LLFA 3KT7A 1Y3TA 4INDA 3UJQA 5KXDA 1H4HA 3H50A 3VBUC 4XFIA 4XTPA 3WW3A 4E9KA 3KD4A 5KHIA 5JSOA 4F7ZA 2GMMA 3WQ0A 4QQLA 1XNBA 4MV2A 4H14A 2Z2SB 5CU1A 4DY5A 1SLLA 5K0UA 1ZZ9A 4RS5A 2B9UA 4WZCA 2GN3A 2CY6A 2WA4A 1JYIA 2EXIA 2XL7A 3VHOA 3KT1A 3MLLA 2DF7A 4XXAA 4GMP0 4RA0A 1FAYA 3URFA 4XFAA 5GLVA 4Z07A 1BEV1 1FPN2 3H9AA 4CDXA 2VW1A 1COV3 2KXLA 1ZM1A 2PFWA 4AFCA 1KD7A 1VAKA 4MYEA 4AE2A 4AK3A 4DFSA 1S0IA 1R083 1H8VA 2GDFA 1D0HA 4GH4A 1HXS2 2GH2A 1REEA 3LB9A 3TAYA 3FWEA 1ND2B 4WZFA 4EN7B 3JBG1 3AZWA 2VOKA 1VBA1 3WXPA 2IZWA 1M06G 1LULA 1Z0HA 1O4TA 4G4FA 4WVMA 3UK9A 4AFMA 1J1TA 1RMU2 1OQEA 4HKOA 5ABJB 2XVLA 1H9WA 1YI7A 2K2SA 3O14A 4S2DA 4NN0A 4M0NA 1AR63 4LLOA 5GM0A 2PLV3 4QU2A 2O0OA 2WINB 3PJQA 1POV3 4XQWA 3SH3A 2HWD1 4BIOA 2XLAA 1Q8VA 2XH6A 3AZZA 2VULA 4LUKA 5F1RA 3VUOA 3SMHA 1RHI1 1BJQA 2A5ZA 4IEUA 2AUYA 4N90A 2CV6A 4BM8A 2NN8A 1D4VB 1YIPA 3MIFA 1O91A 1J3PA 4HSLA 1VAMA 4WM7B 3B7MA 1V6JA 1XXNA 3LA7A 3VZOA 4BMBA 1GZ9A 2X53S 4GQ7A 3QD6A 4QPGA 3PTYA 3M4FA 1V6IA 4CDQB 4EN0A 2PAEA 1OLRA 3MFCA 2RS33 1GICA 4NWWA 5BUVA 1CAVA 4EJRA 4H7MA 1JBCA 1SBEA 2XKOA 4BIFA 5FMOS 3D6EA 3WHTA 4E2QA 2YDEA 1BBT1 3VBHC 2WT0A 2G9GA 2YC0A 5CAZA 3AZXA 1Q8QA 2PYTA 1WMDA 1HV1A 3AFKA 1ZZ7A 5BNOB 3N4MA 4P9GA 4BLJA 1H1MA 2HWF2 1FX5A 4BZ4A 1H4GA 2O8QA 1ONAA 2R063 3D5OA 3KSCA 3HAGA 4GMP3 1VBD1 2LALA 4Q4Y2 3T2TA 3ZFGC 2CNAA 5AVAA 1AR72 1QF3A 2ARXA 1X8EA 3HT1A 4FO9A 1RUG1 1EPZA 3LSEA 1WMEA 1WCKA 3BOWA 3MFAA 3SXWA 2F4PA 4CP1A 2BVBA 2LUWA 1IPKA 1G9BA 1X7NA 3QLQA 2A6YA 4JAAA 4LA3A 1EYBA 3B9CA 2PHDA 3ZXKA 2RM21 2I45A 2RS52 3OGJA 1J3QA 4K9SA 4YM2A 3ZYIB 1Q43A 4YFWA 5DG1A 2QVSB 4UBHA 2B7YA 1AHSA 1EP0A 1U5IA 5C4WA 3TB0A 1CGPA 4R9AA 4JGZB 4HK8A 4I02A 2ZKNA 2MEV2 5GJ6A 3NAPB 1ULCA 4BE3A 2Q30A 5CFCC 2VH9A 4KH9A 3V64A 4A7ZA 4AI0A 5BNPB 1COV2 4X6QB 3ZXFA 1UZZA 5CBLA 4FQZA 3ZXEA 1RUH2 2R1BA 3EBRA 1YWKA 2IXIA 2FMDA 4AQTA 1RUI3 2W52A 1PGL1 3ACLA 4ZXKA 2ET1A 1BKZA 3AMQA 4M0HA 2HWC3 1RUNA 2C9AA 2WNUA 5J37A 1PO13 5KHGA 2DUQA 1LOGA 2ZMKA 3H7JA 3VKOA 1SLIA 4W6XA 1QXRA 4AEDB 5GZCA 2YROA 4XFBA 4P9XA 4ATFA 4I2OA 2Y38A 3NWKA 4COWA 1UPSA 1ULEA 1ZBE1 2W0XA 4YG0A 5JMCA 1IQAA 1V9U1 1EAH2 4FTEA 4N43A 4TLFA 3AK0A 5JOYA 4OI2A 5JZGB 2RS11 2GH8A 5IK7A 1BCXA 2BYVE 4TWTA 3SCFA 4YVWC 1H2KA 1OFSA 1QMJA 5CNAA 2PHFA 1DF0A 2JEMA 3IDEA 1AYN3 1WLWA 3V0AB 1AL23 4B29A 1CIWA 4IERA 3IDBB 1UIKA 1S0CA 4ZU4A 1TME1 1L3JA 4S2FA 1QWRA 5EFUA 3ZSMA 4DRVA 4GULA 4O9GA 4G3YC 3FE5A 5AFEA 4N53A 1WLCA 2D6KA 2Q1MA 1U5XA 2UYAA 3O7OA 5KHKA 2Y0OA 3KM5A 1Z7S3 2DVAA 2OIIA 3KGLA 4QT6A 1NCQA 2JDZA 3MDPA 5IT6A 3THPA 3VHNA 5I0SA 1H2MA 3BB6A 5HI0A 2WIIB 2ZGPA 2R062 3NVCA 1YUDA 2Q1ZB 5C9AB 1H1AA 5D8AC 1ZX5A 2TNFA 3SH4A 2BVVA 3D82A 3WVJA 2DUPA 2UU8A 3TOJA 1NQDA 4IV3B 3LA2A 2HWB1 1W6PB 2Z5WA 4MGZE 1O5LA 4C1WA 4XJZA 1QGLA 3BU7A 4XE9A 2RR11 1AR83 5DUXA 3AYDA 2VW0A 4CYDA 4KL1A 5LEKA 1QOTA 1AXKA 1VLNA 4QPGC 2RMU1 2XL9A 1HRI2 2QKDA 4AGVA 5GLTA 3MW4A 4R4XA 3POSA 1LU2A 2HWE1 3B93A 5FLJA 4LO7A 3FLRA 1YRZA 5L7OB 1EV12 1A78A 1CAUB 4D7SA 4QMAA 1PNGA 4GKYA 1GR3A 1I9RA 5BNNB 3POYA 3VBRA 1RUOA 4AVCA 3KCYA 2GAUA 4RR3A 4YGEA 1HQWA 4Y4YA 1C1LA 3VV1A 2VMIA 1PZ8A 2JKBA 1A3KA 4MLOA 1NQJA 5FQ0B 3IDCB 1PVC2 4MXWA 3VZJA 4L99A 4YVSC 1IOAA 3VDDB 1ASJ2 2ET7A 2HWC2 4LO8A 1KRIA 1R1A3 4Y1VA 5FOBB 5DUWA 3BODA 1DGRA 3J8F2 1QQP1 4Q1RA 2B46X 2DV9A 4Q0PA 4C0HA 2ZGKA 4QQ2A 4MUVA 5I8TA 4FPYA 2BGCA 2VOXA 4K20A 3SCHA 1MEC2 4LHNA 1O3TA 1V00A 4GA9A 3SNMA 2EALA 4CEYC 1BQPA 1X82A 4XETA 2OZJA 2B39A 1XYPA 5CADA 2CYFA 5E8AA 1NA1B 1WBFA 4XDQA 1BEV3 3THTA 3DKWA 3ST7A 4GWMA 1AL22 1FMD2 2ZOEB 4Y1UA 2ZX3A 1SMVA 1Q8OA 5FPZA 3CJXA 5DG2A 3WP4A 3WDYA 1HRV1 1VBA3 2AR6A 3JD71 4NWVA 4XFHA 3WINE 3MLKA 2QJVA 5FCCA 1OOPC 2R30A 3WZ1A 4B4PA 1D4M1 3WP3A 2D5HA 1ND2A 4ISRA 4JQRA 1WBLA 2QDRA 1Z7S2 2WS93 1QXJA 2DWRA 1U5ZA 3LSDA 3UKVA 3WOGA 4COYA 2DTYA 1ND3C 1LCLA 5ABJA 1CR7A 1S2KA 4FAGA 5GZDA 3FFQA 1OQ1A 2PHRA 5L73A 1LGBA 3WUCA 2HWD3 3RRDA 4YARA 4XYXA 2DU0A 4YG6A 3AZVA 2A6XA 2BNMA 2R32A 3G7DA 4Q4X2 4YW2A 4RGGA 4AW7A 2PHUA 3VHPA 2VU9A 4AI8A 2C5DA 2WFF2 3USUB 4Q4W1 1RUD2 2PELA 1AR82 3WQ7A 2MHFA 3J4UH 1SLCA 3GZAA 2DURA 1B35B 4YGCA 3V56A 1SDWA 1YXWA 3EQEA 3ZSJA 1WGPA 5CFDB 3KLSA 1LB2A 4LE3A 4N53C 4YGDA 4IQPA 2YMZA 1LENA 3UL2A 5GZEA 4WM7A 3MPPG 4MXVA 4A7KA 1RVF3 2H6CA 1G8WA 2GC3A 4L11A 4CDQA 1WCSA 2IWGB 1BBT3 5C8CC 1VALA 3VKFC 1KITA 2XG3A 1R091 3GHNA 4SBVA 2ZGOA 3ZSLA 4XW3A 1RUE1 4JTOA 3WP6A 1E57A 1UMZA 2WJSA 1W2UA 4XXPA 4YFZA 3AMMA 1ZBA1 1RJ8A 3AXDA 1D2SA 4NOTA 5H9QA 2XB6C 1RUG3 2D93A 3VKMA 4QPYA 5C8WA 4XJUA 2UY8A 3RYPA 3RJ2X 3JCIA 2GNBA 4FP3A 4OHZA 3T1LA 4GB31 1PNFA 3VBOC 4AHXA 4AQSA 5AFBA 4N43B 4D69A 4NR1A 1N3QA 1URXA 4R8HA 3APBA 3WNXA 1J3RA 4ORFA 2RM23 1AX2A 5FRAA 4CP0A 3B5LB 2X29A 3WG3A 1NCRC 1I3HA 1CPNA 3N3HA 4IEXA 5CVRA 1YI9A 1FV2A 5IK8A 5H9RA 1H0BA 2WZR2 3PVBB 1AYM1 2D3PA 1DQ4A 2H0VA 3V0BB 3V65A 1UCXA 4QQHA 5FMOL 5GZFA 1AX0A 2P2KA 4JGZA 4IL7A 1FNYA 3OYWB 5C6CA 3NAPA 1WCDJ 1PO21 3HR9A 1YHFA 3Q9OA 5BNPA 1C5IA 2JG8B 5FREA 4PIXA 5CA6A 1WMFA 1LOBA 2ZGMA 3FHIB 3ZN5A 2DCTA 2V73A 4JDOA 3O12A 4Y1XA 2WS92 4NHMA 1AZDA 3E6BA 2XJQA 2E51A 1ZBE3 1WUVA 3PVOA 1AR93 5EYXA 2IC1A 1AXZA 5I0UA 3GHMA 3M1HA 4K40A 1PIV2 1RUF1 5IUQA 1XE7A 3VKNA 4KGQA 5BNQA 2A7AA 3SHRA 2UURA 3MW3A 5IK5A 3RYRA 1GQGA 1I6XA 2XBO2 2I74A 2OW4A 5JZGA 2I07B 4IV1C 4C1XA 1UU5A 1PK6B 2AZ5A 4RSUA 3ZFEC 3S7EA 3LA3A 5KC5A 4XF3A 1AUYA 2XKPA 4K1YA 4YW3A 1QH7A 3E5XA 3W9AA 1FXZA 1RUJ1 1TME3 1FT9A 4ES9A 3V0AA 1KDKA 4GXLA 1A8MA 1F9KA 3PMEA 3E5UA 3VBRB 1BZWA 3GYDA 1RVF2 1F5FA 1A6CA 4D7YA 1UL9A 3FFZA 2HKXA 3HD8B 3I2DA 1OKQA 3NL1A 3P3NA 4CEWB 3GBFA 3MIDA 5H9SA 3B3QE 5JR7B 1XU2A 1JOJA 2JE7A 2E6VA 4PCRA 4JDNA 4RL7A 4QPIC 4RD7A 4JGYB 5J96B 2FMYA 2XWJB 2CGOA 4QQPA 1SLAA 1APNA 3VBFC 4AFAA 5FAXA 1K5MB 2CWMA 3M3OA 3ZIWA 5GLUA 1RUC3 5A32B 2WC2A 4FOVA 2DU1A 5C9AA 1H8TC 4DB5A 2VNRA 2KM2A 3GBGA 1MR5A 2YV8A 1OI6A 1WD4A 4XZPA 5F6LB 2JECA 3O0VA 2IXLA 3U10A 1YCIA 4IV3A 5JI9A 3D8CA 4FSJA 1W6PA 2PHWA 3ZSKA 1NLSA 1IKQA 4K21A 2QE3A 2EAAA 2RMU3 3FX3A 1F5JA 1ENRA 1PVXA 2HWE3 2Q8OA 4L8QA 5JLVA 2VUAA 1FV3A 3KCXA 1TMF3 3RG0A 3PVEA 4CDQC 4EN8B 4R9BA 1I1EA 3TN93 2OUJA 2N7GA 5L7OA 5EZWA 4COUA 3WR0A 2R0FA 3ZIXA 1CAUA 5J36A 1DGLA 2D6OX 4Y26A 4YZ2A 4EWEA 2QFEA 5T55A 3VBSC 1MQTC 5BNNA 2VOWA 2V5YA 2AYHA 2X5IB 4LBLA 2WNVC 3RQ0A 5EJ3A 5BNOC 3ECQA 1KFXL 2DVFA 2OVUA 2TBVA 3W59A 3OF1A 3LGRA 2YY1A 5FQ0A 2VVFA 3OBRA 2NZ9A 2QQPA 1DGRN 4DQAA 4Q27A 1FOD3 3U4XA 1YFWA 3VDDA 2PN5A 1S1AA 2JG9C 4DXZA 4FVVA 1C4RA 3PJYA 4Y22B 1UX6A 4H3WA 4ZU5A 3WQ1A 5I0TA 1AR92 1ZZCA 1VBC1 1DGWA 1SLBA 5ACA1 3LCPA 1OA3A 3SH5A 2YXSA 1IZ3A 2VPVA 1RTVA 1VRH2 1U0AA 3K48A 1VBE1 2EAKA 4IEPA 4OZXA 1QJX2 4HKWA 3WD5A 2DUOA 1ALYA 3ZFFC 3OGGA 4M01A 1BYHA 5BV6A 5JWPA 4SLIA 3B69A 2ZX4A 1YJKA 1NA1A 3ATGA 2JX9A 3MICA 4JC1A 4QHBA 1NZCA 1TME2 5I8YA 4Q29A 1QJU1 1AX1A 2D6NA 5F5QA 4PF5A 1VP6A 3JD73 4XJAA 3ZN6B 5K8SA 2SLIA 4XF0A 2R071 1YFXA 4KQ7A 4KU7A 1D4M3 2A71A 1PZ7A 5AC93 3LWCA 1LOFC 4Z82A 1RJ7A 1QJY3 2E63A 1BMV1 4XFFA 1NY72 5EWSA 4AVVA 3L2YA 4AEDC 1KQRA 1REDA 1V6LA 4META 4EWAA 3DPRC 4WVWA 1HKDA 2FBEA 1W6MB 1UZYA 4YG3A 4FXKB 1KS4A 4CDWC 1RUC2 1Q3EA 2VXRA 3QH6A 3ILNA 1UD1A 4LULA 2PHLA 1O4YA 3GNEA 1MVQA 4FAHA 4Q4W3 4JTNA 1AJKA 5I91A 1QNWA 4AI3A 1EPWA 3USUA 1XRUA 3ILFA 3FZ3A 2RMU2 3E6CC 1Y43B 1LOAA 2IFRA 1B35A 4Q4V1 4BHPA 1VB2A 5FPXA 3MYXA 2XWBB 1SCSA 4WM8C 1R1ZA 1TMF2 3R4UA 5CFDA 1GQHA 4YM0A 1RL3A 3TN92 1JTZX 4H7LA 3WDVA 1U12A 2P3IA 2A3YA 4YLZA 1R093 4JDMA 4K1ZA 3WCSA 1HX6A 1NE4A 2BTVC 4EN9B 4AVSA 4AXOA 4XHXA 1R082 3FJSA 2YPJA 2RHPA 3C2UA 2JXAA 1LGNA 1V6NA 3CJIC 1PGW1 2A73B 1Y9QA 4JRLA 5BXXA 1FOD2 4URTA 1DQ2A 3CEWA 4ASMB 4B4QA 3R4SA 3P3PA 4GB33 3TRSB 3AMNA 1FPN1 5GLZA 4JV4A 2JENA 3NW4A 4WVZA 1AR62 3H1MA 2EXJA 2B45X 4YM3A 1YO8A 4K3UA 2PAMA 2PLV2 3MIHA 2A3XA 2NMNA 1IPJA 4RHV3 5DXDA 3X29B 1RITA 1QOSA 1C8M3 2ZGRA 4XQDA 5K0UC 4RS5C 4UW3A 3MZHA 4PBOA 5E16A 4FPJA 3PVNA 4ES8A 1Z78A 1AYM3 1RMU1 1UAIA 3HIFA 4CDXC 1D0GA 3VGIA 4CZSA 4M3CF 3AYCA 3NV1A 4MVTA 3V0BA 5KXBA 4GH4C 1S0BA 2XUMA 3RZZA 3VZMA 1PM7A 3ZFGB 5JSPA 1SBFA 2R043 1W6NB 4MSVA 3OYWA 1ZZBA 1CJDA 2KA3A 1VAVA 4LR4A 2RS32 4JRAA <