4O65A

Crystal structure of the cupredoxin domain of amob from nitrosocaldus yellowstonii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
159
structure length
153
Chain Sequence
QLQSRFVKIEDETFSATRLITKAEFAKRTFGNSDLETLKQVDAMGCDPARRQDVLIVTGRLVSQVKQDLNAWISLFTNRWEFISRDPPGNVFTIPGGGEVPYKLCLSALEPGTYHAHTQLNIASVGPGLGPGMSIVVEGEPTEKPSAWSHPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative archaeal ammonia monooxygenase subunit B
publication title Structural conservation of the B subunit in the ammonia monooxygenase/particulate methane monooxygenase superfamily.
pubmed doi rcsb
source organism Candidatus nitrosocaldus yellowstonii
total genus 34
structure length 153
sequence length 159
ec nomenclature
pdb deposition date 2013-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4o65A00
4PHZA 3RFRA 3RGBA 4O65A 4PI2A 4PI0A 3CHXA 1YEWA
chains in the Genus database with same CATH superfamily
3N3HA 2XPJA 1F9KA 1UX7A 1W0PA 2BERA 4PBPA 5FJKA 4MOAA 2JE8A 3I2GA 3KCCA 3KWVA 5LBFA 3ETQA 1G9DA 1GQGA 1LOFC 2VZ1A 3M3IA 2ZPXA 1UU5A 3LFMA 3PVOA 1GZTA 1CJDA 2DU0A 1VBB1 1IQDC 1PK6C 2XJPA 4QHBA 4QX5A 4R8HA 3MV01 3SKJE 5FMCA 1X33A 1R083 4B1LA 1F4HA 3P5BA 4FPCA 4HKLA 5FO8B 2VBDA 3A0NA 1IPKA 1HN0A 4YGBA 1FV3A 1DYPA 1EY2A 4DUXA 1SDWA 4XXPA 3TAYA 2P3YA 3RJ2X 4XJZA 2J1SA 2G9GA 5FZAA 5FMBA 2JD9A 2NP0A 4OYUA 1RUD1 1RUJ2 5BNOB 1VBA3 4IE0A 1AYM2 2A3XA 4BZ4A 2RS52 1GOGA 2I74A 5FUIA 3UJQA 4A2UA 3IDEA 4BQWA 5JSPA 2HWE2 1Q8QA 1UMIA 5F32A 2AC1A 2B8MA 5FUNA 3TN91 3BN6A 5C4WC 1JU4A 2X5IB 1HJGA 3MLJA 2LS6A 2VULA 1F15A 1NCRB 5F2WA 3SISA 5L7OA 1ASJ3 2WNEA 5FLJA 1GP4A 1O8PA 2ZAAA 1HV0A 4Y22A 5FXZA 4Y20A 1BVP1 4OI0A 2HWF2 1W6QA 3AP5A 2PAMA 1RXFA 4LUMA 3ZYJB 2R063 1DQ0A 2YU1A 1N3QA 3AXDA 5B4NA 1HB2A 1KS4A 1BBT2 3BOWA 2JEMA 3U75A 1NCQB 2LRPA 5A7NA 2IXKA 5CFDB 1JZ7A 2R49A 4C1XA 3ZX7A 2D6LX 1VRH2 4IGOA 1G9AA 3JD73 3NJVA 4OHZA 5I0DA 4AVSA 1YC61 2Z5WA 2WT0A 4JGZB 2QNKA 5LW9A 2BNMA 4BU2A 1AJOA 1OMIA 3WNPA 4P9LA 5FMOL 4OLLA 1DU3D 1GMMA 1WMDA 3NW4A 1BKZA 1UU6A 3I7DA 2E6VA 4PBOA 3K77A 4UFHA 3W9AA 3WG1A 2ADDA 4FPLA 4CEYC 2PMWB 4B1MA 1JYVA 1BK1A 1DQ5A 2JG8C 5EYXA 4Z2AA 5FY4A 1XPWA 2FMYA 4UFKA 2MNGA 1XJAA 1N3PA 1PO12 1U5IA 3HT1A 4DOUA 2J7MA 1MR5A 2AEZA 1AYM1 5FOBB 1UKRA 1W2UA 4JDNA 4CCLA 4D7SA 4AE2A 1GWLA 1DGWA 1UX6A 5FYIA 1BEV3 1OD5A 3ENRA 2D5HA 4NMIA 3SEEA 4KG8A 4UFLA 5JOXA 3N4MA 4OI2A 1UZYA 5A32B 1RUOA 3WG3A 2TUNA 3OEAA 5A6YA 4EZHA 1BMV2 3I2IA 3SEPA 3VDDB 4CCEA 1J3QA 1LOAA 2WWUA 4IE5A 2VQUA 3DCQA 4JDOA 4X6QB 1REFA 2VCCA 4HK8A 4UW4A 2JECA 1UF2C 1X50A 1WLDA 4IEQA 5ABJB 4NIDA 1V9U2 1L7QA 5F5QA 5J3UA 4JKLA 1MS9A 4RR3C 4MZUA 2HWF1 1H9WA 1LU2A 1RHI3 1Z0HA 4AEJA 4O7XA 2E9QA 4LA3A 3VHOA 4CU6A 1BBT1 1LU1A 1UOBA 1C8NA 1NKGA 4NRQA 1CQ9A 3I2FA 4DINB 1Q8PA 2OUHA 2ET1A 4P08A 4E4HA 1VRH1 3WOGA 1LHNA 4PF5A 4EZ4A 3LPFA 3D0SA 4XTMA 5FXXA 5FTTC 2IZWA 5EPAA 3OOXA 5JOWA 2W39A 3RZHA 4MGYE 3HIFA 4PI0A 3SC7X 1VBC2 5LRSA 3VZMA 4UBHA 2DFCA 4GWMA 4QT6A 1YYNA 2Y6KA 3PDQA 4COUA 1E5SA 2VM9A 5GZGA 3KF5A 4IEXA 4AQ6A 3UJOA 3HMYA 4LBMA 2VZRA 1R092 5KXEA 4BIOA 2XHKA 2K9ZA 3RMYA 3RGBA 1BXHA 4FTEA 1OOPB 1F8VA 2K46A 1POV3 4LMFA 1W2OA 1ZRDA 3GDBA 2FBEA 4FOQA 1WUVA 3GALA 4CA9A 4OVEA 1R082 1ZA7A 3PUIA 3HQRA 3EO6A 3QLQA 3ZFGB 3WR0A 3ACFA 3UT0A 4W65A 4BQXA 1BMV1 1COV3 1AF9A 2Z2SB 1NXMA 2ZEXA 4MXVA 4IV1C 4M0HA 4WVMB 5F3GA 5HV0A 3WF4A 4GKXA 3TNPB 2X09A 3AP7A 3HPNA 3ECQA 3RQ0A 3AVSA 1X8MA 1WW5A 1NLQA 2RJLA 1HJFA 1NY72 3POIA 4P9JA 1UPIA 2WNOA 4QGNA 2WAAA 1VBA2 4YM2A 1SZBA 3OUIA 2UYBA 5GLVA 5SV5A 5C9AC 4IUGA 4MV2A 1A8MA 1EP0A 1FI2A 2ZJCA 4FOVA 4Z07A 4LLFA 3LEKA 2R0FA 4Q1PA 1W6MA 3NAPB 3B93A 1Q8SA 3ZKUA 4BB3A 2WZR2 4XUOA 1QJY1 3SCFA 3WUCA 4GWNA 4OMDA 4EE2A 2EICA 1AR81 5A1LA 3ACGA 1DQ2A 3AJZA 4QX3A 4TWTA 5EJZB 1F35A 1VP6A 2KR2A 2FHRA 3H42B 3VBRC 1ASJ2 1X9PA 4DEVA 5LATA 1O91A 1E5IA 2XLAA 5EZWA 1MEC1 3FBYA 4HKWA 5IW0A 5FPAA 4CVUA 1FMD2 4JTOA 1XSQA 1R091 2O1QA 2WN3A 1W9YA 5F9TA 4AVVA 2SLIA 2VVEA 4UYBA 3AKRA 3C7OA 3AKSA 4CCOA 1BHGA 1RINA 3BU7A 2YFUA 3B94A 5GALA 1CD3G 4KGGA 5FWEA 2P3JA 3KVAA 4NHKA 3M2MA 3SCHA 4QKFA 5FBJA 3B9CA 1UOFA 2V72A 1O3QA 5A3UA 5JOYA 5HCHA 2QQKA 3FJSA 4J25A 1KGYA 3DPRB 4JAAA 4R9BA 2E7TA 2GH8A 3IDBB 2VOTA 1D4VB 4QQLA 1NY71 3VBSC 4BQ5A 1C5HA 5AC91 5BNPC 1KJLA 4BIFA 2ZGUA 4H55A 3OJBA 4Z8BA 3O0VA 2WYSA 5IVEA 2GNMA 4ARXA 3OY8B 4JTNA 4GAZA 2PHLA 3A21A 4NO4A 4Q29A 4D6SA 4MSVA 3WT3A 2WZR1 4KL1A 3TEWA 4BLIA 5IVJA 3B02A 5T55A 1RUH2 1SLLA 3MIHA 1W8TA 4QPGA 4XBLA 1OH3A 5E16A 3JZVA 2Q8OA 4W6XA 1F4AA 2LALA 3KQ4B 1XU1A 2UWAA 2KD7A 4JC1A 1UY1A 1OQEA 2JXAA 2A6YA 4K9SA 5FYTA 3W5NA 5I8SA 2V09A 2BGOA 2ZX1A 5FDBA 2I2SA 4V2VA 1RHI2 4YG3A 1SCRA 1FMD1 4Y1XA 4ASKA 2ES3A 2WO7A 1CAXB 2PLV1 2Q1ZB 3POFA 1ND2A 5DN2A 4U36A 4LKEA 1KD7A 1ENRA 3O1UA 1S0FA 5C6CA 5KC6A 2CWSA 4XMAA 2WZPP 2RJKA 4LO8A 1E57A 2ZEZA 2I07B 4IEZA 1LHUA 3RFRA 1LKNA 2C0ZA 2ZX3A 2JWPA 4KMQA 1ZZ8A 1IQAA 1J58A 1NYWA 5FZOB 1YQ8A 2Y26A 1VMFA 5A1AA 4PDWC 2MHFA 5FY0A 4FOYA 2A6WA 1NUKA 5EV7A 4Q0QA 5FKCA 5HXVA 1OA4A 2Q8DA 1J59A 1ZRIA 3KGLA 5FBZA 5F5CA 3ITQA 4BQ1A 1UY2A 5BNOA 4IETA 2H6CA 1J84A 2EXIA 3DUIA 5FYCA 4H3WA 1JTZX 3POBA 1PZ8A 3PVNA 2E51A 3WW3A 4LT5A 1UOGA 4JDMA 1W2NA 1GZWB 2VOXA 3I2JA 3OBZA 4QPIC 5JI9A 1RUH1 3HJRA 2R32A 1W2AX 3EMRA 4WV8A 3IMNA 4JKKA 2YB7A 1IS4A 3MIFA 4GD4A 4AEKA 5FLHA 4W8JA 1JYNA 1IPSA 5A7OA 1LGCA 2A5ZA 2VY0A 2GMMA 2GP5A 1NCRA 4LHNA 5D8AB 1LHVA 3VKNA 1ENXA 4CU9A 3VD4A 1H4HA 2IUWA 4Q27A 3DL3A 1B35C 4SLIA 4D3WA 3WNKA 5B2GB 2QQWA 3W21A 3LPGA 3AMNA 2BWCA 3H9AA 4LR4A 4DZGA 2WFF3 3IM0A 3ILRA 1JOJA 5LWBA 4MVTA 1PX4A 1W05A 4GMP0 4IGPA 4KH9A 1NCQA 2OVUA 2ZGPA 2DDUA 2E32A 3RSJA 5CFDA 2LUWA 2JDPA 2FCVA 5LRRA 3FLPA 3I3BA 4KWLA 5J96B 5FK8A 2JDAA 1M06G 4JGZA 3JBG3 1AYN2 1CAUB 2VUCA 3O12A 4IW3A 1PO21 4LBLA 1Q3EA 3MIDA 4Q4W2 5CYYA 4AHYA 5FY7A 4XCBA 4CEWC 3Q8BA 2ZAHA 4FXGB 4Y1UA 3N9LA 2AZ5A 3E5XA 5J36A 3V0BA 4FTBA 3WSOA 3AKPA 3BODA 5I0UA 2W2IA 4HLTA 2K2SA 2EAKA 1ND3B 4H2AA 1REDA 3FHIB 4QM8A 5EWSA 1CPNA 1RUI1 1G9CA 1GSLA 5IATA 4L92A 4IEPA 2D98A 2DWRA 3LF7A 3N7MA 3PJYA 4HT1T 4HZFA 2ET7A 4C1WA 5I0RA 3WINE 5C5UA 5GKAC 2BGPA 2VAUA 5A32A 1ULFA 2BOJA 1OD3A 2ZKLA 1ZBE2 1SBFA 3ZDVA 2Y6HA 3USUB 4NN0A 2YFZA 5ACA3 5DDJ1 2BWAA 3VDDA 4QB2A 3MO4A 4LHKA 4B4PA 3O1RA 3C3VA 4RGKA 1EAH1 2RS11 2PAEA 1J83A 2XGXA 1G8WA 1DZQA 3MLKA 4XFGA 3RYKA 5J37A 1FXZA 1W8UA 3BI3A 5ABJA 4OUSA 2E31A 3PUAA 2QBXA 4NUBA 2DBNA 2RJ2A 1AHSA 5DZFA 4A7KA 5FFOC 1QOOA 5JXHA 1RITA 3LDKA 5CKMA 1IGOA 1W06A 4FFFA 5BNNC 1DLCA 4S2FA 1HRI2 2B45X 1HKDA 4YGCA 2XVKA 3O1MA 1FPN1 5DUXA 2Z42A 4FPHA 4O9GA 4FPKA 3DYPA 3KQRA 4DPNA 1AYN1 2C9AA 3C7EA 4DUVA 1POQA 2EXKA 2YGLA 4Q4W1 4XJUA 3SMHA 4KBZA 5FZMA 1CVNA 5I8YA 5T3NA 4IV3C 1H4GA 3FUOA 4QQOA 1CX4A 2Z69A 4OFGA 4QAWA 1VBE1 2WO1A 5J09A 2ZBJA 3ACIA 5F3IA 4UW6A 1H1IA 5A3OA 4ATFA 1FX5A 1H2MA 3JXSA 4XJAA 4CU8A 1DP0A 1HXS2 2XH6A 4IE6A 3VZNA 1AZDA 1OOPA 2DVDA 2ZGSA 1F31A 3HR9A 2RDNA 1UQXA 2QKDA 2WNUB 4YVWC 2RDRA 5JXGA 4A44A 1AX1A 3GHMA 4DRVA 1RUC2 1ZRCA 1QY4A 4K6BA 1CZTA 1W90A 3ZFGA 4S2GA 4RD7A 5G05L 1ZBE1 4XPVA 4XUQA 2RS31 5GLTA 3HNMA 4H7LA 4WM8B 1HIXA 1Y9QA 4LXLA 3ZSLA 2WO2A 4WVMA 3TEYA 2PQSA 3R05A 4ZXEA 3S57A 1PGL1 2CAUA 2QQOA 4YVSB 1O5LA 4LE3A 2DUOA 2PHDA 1XRUA 4A6OA 1WW4A 2WSVA 3UV9A 2DYCA 4QMAA 5DABA 4NHLA 2ID4A 1AR91 1T2XA 2HWC3 5CB7A 3MF6A 3MPBA 4BK5A 4Z1VA 2VMEA 5I0SA 3NAPA 4L0PA 4N90A 1OVPA 3VDAA 1WCUA 4Q4V1 3BU0A 2XWBB 4BWOA 1V6KA 1OHFA 4DEQA 4FQ4A 1HRI1 5C8CC 3VV1A 1PVC1 2D97A 2P6HA 2JDHA 5F6KA 2CYFA 1K5JA 3WP4A 1OQ1A 2B5HA 3J7NA 5FZ7A 4AQ2A 1VPHA 4LE4A 2IXHA 3KV9A 1RVF3 4GQ7A 2ZA9A 5J1XA 1BLZA 1L7LA 2VJXA 4XHBA 4RQPC 4ZHNA 1UAIA 4QPWA 4CP0A 1Y4WA 1OQDA 4TTGA 1AL23 4B7EA 1JODA 2DCJA 4QB6A 1UYYA 1A78A 1HXS1 2GC2A 3BCWA 3I4IA 5LA2A 5F3EA 1QDOA 4ONUA 1U5XA 3T2PA 3E5UA 4UF0B 1CPMA 1HB3A 4QXHA 4Y5SA 1RUC1 4MXWB 4JQTA 4QHZA 2GP3A 5FZHA 3AP6A 5EP9A 5FWJA 4NPRA 2A71A 2VTFA 4MGSA 3HEIA 4KQ7A 1AR63 1OUSA 3NWKA 3DPRA 1G9BA 1JYCA 2XKPA 4JRLA 4AFBA 4X8PA 1D7PM 1GQPA 2YROA 5FP4A 4TSVA 3ZPYA 2ZEYA 1LB2A 5K8SA 2NYYA 3CL1A 4MGIE 5IWFA 4N53B 3H50A 2VVDA 4CYDA 3FHAA 3ZFEB 3OY8A 1VRBA 1ULEA 2G1MA 4N7IA 1Z7S3 2FDGA 4E2SA 3WW4A 2Y0IA 4YG6A 2QQJA 3UL2A 1NAEA 1UKGA 2VZ3A 3DXTA 1H2LA 3AKQA 3K3NA 4UT5A 3WP6A 5C7GA 4E8DA 5ACA2 2C4XA 5KHJA 1PMJX 3MW3A 3S7IA 3W20A 2MEV1 1ZZ6A 3AZXA 4GWJA 4N43C 5F7UA 3UNPA 4ZS3A 3JCIA 1W99A 1O8SA 1W6PB 3OBRA 5FPXA 4D7YA 1V6LA 1CZSA 5FIXA 1HW5A 4CSWA 1H8VA 2A6ZA 2YHJA 3G7DA 3K75B 5C3SA 3P6BA 3RI9A 1SEFA 3B69A 5FXWA 1G6NA 5DZEA 1WA4A 3CO2A 1CAXA 1QJX1 3CHXA 2GH2A 4QDRA 3VKOA 2AREA 2DVFA 4DY3A 2FQPA 3NRUA 4QX7A 1PMHX 2HEVF 1JZ6A 2IC1A 2YU2A 5FZBA 1JYWA 4AF9A 3WCRA 4R4ZA 4C0BA 3TRSB 3MZHA 2R16A 4F83A 1I5ZA 3CJIB 5FYUA 5JVVA 3T0DA 1AX2A 2OQ6A 1JMUB 3H3UA 4URAA 3M70A 4LULA 2UY9A 4GIQA 1OSGA 1GP6A 1OLQA 1KRIA 5A6ZA 2GMEA 3HNBM 1SMVA 5FYZA 4BXSV 4QPGC 2GU9A 1EPZA 1K5MB 4CDWB 5FRAA 1ZBA2 1MS8A 2JDMA 2PAKA 5CA6A 2CU5A 3R0RA 4LK7A 3WQBA 4GKYA 3GBWA 2BEOA 4I02A 1RUF3 3MYXA 5IHRA 3ES1A 3VBFB 3IKWA 4OQ9A 1MZ5A 3FMGA 5T5PA 1D0GA 2VBPA 4AW7A 1UZZA 2VOKA 1XE0A 1GZWA 3NSTA 1YRZA 4CP1A 4IEVA 1ND2C 2D40A 2D7FA 1SLAA 2PHTA 5IAXA 5LBEA 2GC1A 4XVHA 2VQ0A 3KM5A 4QKNA 1X9TA 1Q43A 4D6QA 4DY5A 1DF0A 4IEYA 5HPOA 1XSRA 2BDRA 1QH6A 2OX0A 4HSLA 1PZ9A 2HWB3 5D8AA 4B7KA 2QJVA 2ORZA 3N7LA 2RM22 3FBMA 4FAGA 2YC2A 2Q8CA 3KHBA 4QU2A 2GSYA 2Q5TA 4IE7A 2QE3A 4CTEA 4FT8A 1AR71 1JXNA 3KSCA 1QOSA 2JIGA 2Q1MA 1OUXA 4HN1A 2VECA 4R9DA 4WZCA 4PHZA 4RL7A 2VTXA 4TLFA 3VBUB 4RA0A 5BNOC 2B4KA 3ZSEA 3U4SA 3AP9A 1W6NA 1QJU2 4SBVA 3T1LA 1M4WA 5C8WA 1CAUA 3D3AA 4FFGA 1RUE3 5E88A 4CXYA 3WDVA 4NHMA 4BPZA 2P4EA 3UYJA 3WXPA 2PYTA 3QH6A 4OZXA 3ZYBA 1HRV2 4LBNA 1PHMA 1S0IA 1WCSA 5FUPA 4Y3OA 1DGWX 5A7QA 5KXBA 1ZBA1 4Q4Y2 4RS5C 5JPMB 3O1PA 2X5IC 1UW8A 1RUG3 1ND3A 4Y24A 2WQ8A 1UYZA 4LTAA 5IVCA 1LGBA 2XKOA 1NCRC 3OPTA 4MYEA 5CVRA 2ZXQA 3LEMA 5FP3A 3EBRA 3GXUA 4FPYA 4LK6A 1FNYA 3I2OA 4PLNA 1OT5A 4FPJA 1CJPA 4Q0PA 5JZGA 3ZYFA 4Q8LA 1PIV2 4JHZA 3J8F1 5FV3A 3VZJA 4X6RB 3ZVXA 5HCBA 1NCQC 3USUA 1C8M3 3BOPA 3WDUA 1VBD2 1DBNA 3O1OA 2W3JA 3L9JT 3VBHB 2WDBA 2D5FA 1H8TB 3HWJA 3PU8A 3H1YA 3O7OA 4RN5A 3OEBA 4DB5A 4XBNA 4JGZC 2IFWA 1QNYA 2W46A 5LEKA 4MADA 2QTWB 2RM21 2Y6JA 2Q30A 4RHV3 3N35A 3WF3A 2YBSA 1E5RA 1Z7S2 4PIXA 1V6NA 3FE5A 5T5JA 1G7YA 3UESA 1YFXA 4CDQB 1UZ0A 3MFCA 1AXZA 5F5IA 3RWKX 1JZ5A 1GUIA 4YW2A 1JW6A 1FOD1 3WNNA 3M1HA 5FJHA 1XE8A 2QQIA 1QF3A 2WQ4A 1QJU1 3BIWE 1YQCA 5KWRA 2Y6FA 2JDKA 1JN2P 2ARCA 2VQTA 3C2UA 5FY8A 4J1WA 3C7HA 4Q4X3 1FNZA 2JENA 4R52A 1HRV1 2EIGA 2FDFA 1ENSA 2ARBA 3DXUA 1KDMA 3TWIA 5FZ4A 2VCAA 4Q4Y1 5HXMA 5BUVA 4QX2A 2WL1A 3IMMA 3THTA 5IYYA 3U78A 2QQLA 2TNFA 3WF0A 2JJ6A 4FI9A 5EJ3A 2Y64A 5FZFA 4DNYA 4BH9A 2WN2A 3FFZA 3GYDA 4JCKA 3KCYA 5ABJC 2WNUA 4A42A 1PNGA 5JSRA 5GZEA 3V0BB 1CESA 2QQMA 4J6GA 4DXTA 4YW4A 4NROA 1L7RA 3N9PA 1VAVA 1H1AA 3H8XA 3OYWB 4D7TA 2XJSA 4AK3A 3NVCA 5F6LB 1PIV1 3CNAA 2AEYA 5AVAA 2BNOA 1RUJ1 4XIOA 4WM8A 2O14A 2ZGTA 1VBD1 3P3PA 4AGVA 1S2BA 2VZSA 2B9UA 1ZZ9A 2RS51 2W1SA 4IEUA 4HG6B 4YVSA 3EYPA 1I5PA 3POYA 5J48A 1QJZA 2HWE1 2OUJA 5K7PA 4BYYA 1RUF2 1UOJA 1GNZA 5C4WB 3TEZA 3LE0A 4I0BA 2OXBA 3AKTA 4COZA 3ROUA 5JR2A 4HSJA 2CV6A 2YDEA 4K20A 2VE1A 1TNRA 2V73A 2R073 3LA3A 4L99A 4WM7B 4YGDA 2J1EA 3GNEA 3S0MA 5LK7B 5BV6A 3BUCA 3ACLA 2XG3A 4IE4A 3T2OA 3KVBA 4QDQA 3AJYA 3VD9A 1GFF2 2GN3A 3LB9A 1ENQA 2P34A 3DV8A 2HLEA 5F1RA 4XUTA 2BOIA 3VBOC 4QKBA 3ZXDA 1HB1A 1G9FA 5FYHA 5FYYA 4PT6A 4Z92B 3K4DA 3RS6A 4EWEA 4XJ8A 4ZU7A 4HL0A 2ZMNA 2YMZA 5I8TA 2JDYA 4N8MA 3S6PA 5FK7A 1W8WA 1UO9A 1QQP3 1V6OA 2PFWA 3MBWA 4LOSA 1RTVA 4XIKA 3VD3A 4A3XA 4UF0A 4CEYB 3O1TA 1ZA4A 2PHXA 2UY8A 5IVYA 5JIUA 3OGJA 4MXWA 4Q0VA 4S2HA 5DAPA 1J3RA 1P8JA 3ETPA 4M3CF 3K48A 1GQHA 1IPJA 1RUE2 1SG3A 2D6KA 3U0ZA 1PO11 3NAPC 4YARA 5T54A 1DGRA 4YGEA 2DURA 2FDJA 2W47A 3I2KA 3PTYA 4NWWA 1LODA 1YI9A 2OPKA 5FPVA 4UW5A 4XQWA 4YWAA 2P5BA 3EQEA 1RUG2 3MF9A 4JGYC 2YGMA 1LULA 4N53A 4BM8A 2XMLA 1NXD1 1TME3 3IZOA 2A6XA 1W04A 2XL9A 3PUSA 5FP7A 2X05A 3SH3A 3ZFEA 1LR5A 4IESA 4JZRA 4LKFA 1ZM1A 2H6BA 4OUMA 3LKJA 1TG7A 2QQNA 1QDCA 1TMF3 4MGQA 2IVIB 2DVAA 4OHXA 5FZ3A 2YC0A 1V9U1 1C8M2 4ES9A 3W59A 4RR3B 5DZGA 3AFKA 1I3HA 1T6BX 3R4SA 1DYOA 4KU7A 1XU2A 1QWRA 2R6QA 5LEJA 1W6PA 2DUQA 4EWDA 2XBO3 3MW2A 5FYSA 3PMEA 2VZVA 1OBNA 4D94A 4QD2A 4PJYA 4A4AA 3OUJA 4RHV2 4IQPA 3N36A 3B01A 3PNAA 2AGSA 4AVTA 4RGAA 5IFPA 1RB8G 5DUUA 2RR13 1V0AA 5FZ1A 3K46A 2B7YA 4Y33A 1VBC1 4HVQA 1LHOA 1PNFA 5IK8A 2J1VA 3D0JA 3E6DA 5EIYB 1O3RA 4HETA 2CWMA 3CJIA 4NIHA 3DYOA 2LROA 5FCCA 3IPVB 3FX3A 1ZVFA 3P1IA 1H0BA 2R062 2VUAA 2XUMA 5FY9A 3ZXAC 2FDHA 3MGUA 3WG2A 3B7MA 3OUHA 1Z78A 3JD72 5AVPA 4AHZA 2IWGB 1K5MA 4CDWA 1R081 3AMQA 2WZ8A 2OZJA 3OF1A 3U1XA 4Z82A 3M3EA 3VZKA 3ZYGA 3VDBA 2VO5A 3HD8B 2NZ9A 3POJA 5GZCA 4EN7B 3OGGA 3I59B 1GU3A 1JH5A 3AYAA 2Y38A 1A6CA 4IV1B 3BTZA 1D4M3 3VBFA 4BCUA 3RZJA 2DVBA 3T1MA 5C3RA 1OKOA 3G6JB 3R6SA 4CUBA 1S0DA 2A1XA 5C9AB 2BW8A 1VBA1 3MUZ1 4RFRB 4YFWA 1GNYA 5F39A 3B00A 5H9QA 1RUNA 2JDZA 4M4PA 1RXGA 4GULA 2D3PA 4K1ZA 4P14A 4Y4YA 1QH7A 1XNTA 1LNSA 1BEV2 1ZRRA 3I3DA 2SBAA 1QIQA 2A70A 3OG2A 2HEWF 2IXCA 5C33A 2IXJA 4PLMA 1NE4A 4MG2A 2ZACA 4QGLA 4G4FA 4XFFA 4YW5A 2W94A 5AFBA 5JXJA 1GKBA 2OZ6A 2YPJA 5JOZA 1W0NA 2EIDA 4C8DA 4BMBA 2ZZQA 3NV1A 5FZIA 3VBRB 1RJ7A 2EALA 1ASJ1 2HEYF 4FP3A 3ZXJA 5CBLA 4Y5TA 1WWYA 1OC1A 3MI8A 5DAWA 2B9VA 1YJLA 3AL6A 3SH5A 3VBUA 2GMPA 1CIYA 2D6PA 2W1UA 3NV2A 4CPBA 5KHKA 1W6OB 2R061 5CFCC 1MQTC 3MIEA 3D82A 1DZTA 3LGRA 4AEDA 2XR4A 3CZJA 4A6SA 4CPBD 4YZ2A 5HI0A 3V0AB 3J4UH 1RL3A 3LDBA 2YY1A 3WEZA 3JD71 2VZTA 1ULGA 4LO5B 1ZNPA 5FYMA 4GMP3 3MUY1 2VOVA 2D93A 1U5ZA 5GLUA 4CP2A 5AFEA 4YZ3A 5A7SA 5A3PA 2O0OA 2R7EB 2NQYA 2P1BA 2ZHKA 3WNOA 2VMDA 2O8QA 3IAQA 1Q8OA 4I01A 5BYNA 1O3TA 4B4QA 4CDXC 5L73A 2VXRA 2BYVE 2ORXA 3O0WA 3VBSB 5BNPB 1C57A 2A75A 4K8RB 3U11A 5IVFA 2ZHNA 4NE9A 2B46X 2VMFA 2FZ2A 2JB8A 3AK0A 4I0WB 4XFAA 4YYOA 3N7JA 1BEV1 3VBHA 1DQ1A 1FAYA 3LSEA 3AP4A 4X8NA 3U37A 1H8TA 3O0XA 1US2A 3J7HA 5A3TA 3OD0A 5C5TA 3JB4C 5E89A 1PGSA 3OGRA 3WDTA 5FR3A 2VMIA 1NZIA 1COV2 2W68A 2A3WA 4XAEA 3KCXA 1GV9A 2JB4A 3AMPA 4BLJA 5LY1A 3FWEA 1XNAA 1HLCA 1H9PA 4Q8KA 3D6EA 2Q8EA 2GDFA 1HDKA 2QVSB 1ZZCA 4XJWA 5CIRA 2Q4SA 4KWUA 5AC92 4CDQA 1RHI1 2ENRA 4XQDA 3IIAA 2W1QA 2YG0A 3OCPA 1Y9GA 3M3OA 2J42A 3FZ3A 1OVSA 2LM3A 4V1PA 3BPSA 4WVZA 3TEXA 4XURA 5K0UB 2XBO2 4QU1A 4QDSA 2CGPA 2XWJB 4LQRA 1MPXA 4PF1A 1S0JA 3A7QA 2JD4A 4XUPA 2VXJA 3AL5A 3I2DA 4Y5Z0 3RZZA 4L2NA 1PZ7A 4QQPA 3H8RA 4NAMA 1LEDA 1F5FA 1PK6A 1UN1A 2RR12 2VD7A 3DKQA 4XQ4A 5H9PA 2JKXA 1GLHA 1W6NB 3DEMA 4HBNA 4ASMB 4E27A 3WDYA 3RG0A 4NPMA 3ZOIA 3T30A 5I0TA 3N9MA 1H6XA 5FAXA 5GLWA 3NNMA 4P9GA 5IK7A 3H8OA 3LA2A 4GB33 1UY4A 1CAWB 5FPZA 3T2QA 3S30A 4NWVA 4FFIA 3RZMA 1W8OA 1VB4A 2BJSA 2R043 3OYWA 3ZN4A 1W9WA 1WBLA 4YLZA 4TZDA 1POV1 4AVBA 3IDCB 4NHXA 4EN6B 1OKQA 5L7OC 3AYDA 3VLBB 1YFWA 4HK9A 3U10A 2VQAA 3KB5A 2W91A 2W08A 4W50A 3E97A 3KLSA 2ZOEB 3DF0A 5SV8A 2IXLA 4BQ2A 4LBQA 3FUQA 5JZGB 2PTMA 4BOWA 1COV1 1W28A 3N9QA 1ULCA 5C4WA 4Y1YA 3ZM8A 2HWD3 4YZ1A 1I9RA 3ELNA 1RMU3 1MS1A 5FZCA 1MS4A 4CDUB 1LHWA 1D0HA 3H1MA 1URXA 2QDRA 5JMCA 2P3IA 4WM7A 5CG9A 2C26A 4MH0E 1B35B 1NX9A 3HN1A 1S0BA 2AR6A 5FZLA 4MX3A 2NN8A 4UFIA 1LENA 4OHVA 4AXOA 3SHRA 3DN7A 5A6QA 3O14A 5JUVA 2EXHA 1VMHA 3JU9A 2H0VA 5G04L 3BALA 1XYPA 4LBOA 2R1DA 2F4LA 4K40A 3H3ZA 2GAUA 1Y7BA 2VVFA 2WS93 2MPFA 1EV13 5T5OA 3EXUA 2NLRA 4FXKB 3DECA 1DQ6A 4PQ9A 1IG3A 5IVBA 2VNOA 3U07A 2ERFA 3LDRA 3OPWA 5GM0A 3N9NA 3QACA 4LORA 3AFGA 4YNIA 4CEWB 2XL7A 4CEYA 4DO0A 1X82A 3AZVA 1YWKA 3A23A 4QPYA 1R1A3 4W6WA 1K3IA 3UGHA 2PHRA 2YZ4A 1J1LA 1JUHA 3JQWA 1V6JA 2F6BA 2RMU3 3MHZA 4UFMA 3M3QA 4QGMA 3AZZA 4EV0A 4YRDA 1O6UA 1LESA 3M7AA 2F4PA 2JG9B 3KT7A 4FFHA 5CISA 1ZX5A 5K9YA 1B09A 4D0QA 5KR7A 2VC9A 1OI6A 1QXJA 2WNVB 5FQ0B 4CCKA 1NA1B 5J7MA 3NL1A 2ZGLA 4AWDA 2WJSA 1ACCA 4ZY9A 5H9RA 1WLWA 3WX5A 1WD3A 3ZN6B 1YHFA 4XF0A 1I6XA 1C4RA 2GC3A 3RYRA 2Y33A 3TB0A 5L9RA 5FZDA 2WWJA 4J1XA 3UGGA 4XZUG 3M4FA 1XB9A 3OTFA 2WSUA 4GH4B 3DKWA 5ERLA 1VBB3 5H9SA 1ZREA 5CKQA 4LKDA 2OQ7A 4RR3A 4P00B 3UKNA 4AVAA 2A3YA 2VNVA 2ZX4A 4XFIA 2VZPA 3GZAA 1Q5OA 4HXCA 3ZXKA 3L2YA 4BE3A 2R30A 1DZRA 2RDQA 2ZS6B 2XHNA 4XFCA 3VKLA 4YPJA 4RGGA 1SLBA 2DCYA 5BNNB 3LA7A 2WIIB 4NRMA 4DXSA 4QX8A 1RGSA 1YQ5A 2KA3A 1N1YA 1NZCA 4DRRA 3FHQA 1RUD3 5KXDA 2WWSA 1HQLA 1J1TA 1LAJA 5FPUA 4AI1A 4HKOA 3WNXA 3QD6A 4BMEA 4E4ZA 3CDZB 1YIFA 1OFNA 2QFEA 3KGZA 5DMYA 1ALYA 3POEA 2NMNA 2JDUA 3IPVA 4LHSA 2WFF2 3ZFEC 3TN93 5BPXA 1TVGA 4HPKB 4UBGA 5JI7A 4D69A 3MFAA 4AGRA 2QZ2A 4ORFA 2OIIA 5KHGA 2KM2A 1QNWA 3RZGA 2QQPA 4CXXA 5I91A 1QKQA 4UI9L 3T0BA 1SDDB 2E63A 2JX9A 4HANA 1FOD3 3JBG2 5C3QA 4COVA 3RDIA 4PI2A 2Z79A 3TNQA 1CONA 4R4XA 4JV4A 2R0HA 3I59A 2J1AA 4IV1A 5IUQA 1OLME 5BNQA 5FZ8A 1AX0A 1Y3TA 3T09A 1NT0A 5IT6A 3KF3A 4DQAA 3CLPA 3USSA 4AFMA 1L3JA 5C9AA 4AAPA 1K12A 2H0BA 3SH4A 3ZXGA 4PIZA 4AYUA 2QDNA 3KV4A 1WLCA 3ZR5A 4I3PA 4YG0A 2ADEA 2WRAA 4N7UA 1Q56A 2VW0A 1PMIA 5FP8A 2QZ3A 1IKPA 4A41A 3NNJA 5C8CB 4URTA 1T6GC 1IS6A 1U5YA 3WF2A 1PVXA 2TBVA 1UMZA 3MDPA 3CZUA 1AYM3 3VBRA 1JZ8A 4Q26A 1K5MC 4XE9A 5FO9B 4CDWC 3J9SA 1BVVA 3L2HA 1WCQA 3ME2A 1OURA 2G4IA 4RQPB 4AQSA 5LY2A 2D6MA 4CP9B 3K3OA 2WO3A 3KZ4C 4TN7A 3WY6A 4ES8A 2WFF1 5LB6A 1JI6A 1W6OA 2ARXA 2X8KA 3AZYA 4AFDA 1EPWA 5A80A 4CUAA 3V0AA 3QCWA 2YXSA 2C1FA 1XOYA 4MGZE 3OGVA 3LZZA 1IS5A 1EV12 4UAPA 4W4ZA 3N9OA 1N1VA 1OF4A 3PLQA 1NE6A 5D1IA 3JBG1 4BK4A 2J1TA 5CKNA 1OPMA 5KHHA 2D6OX 2F17A 1PM4A 2HWF3 2TEPA 1UCXA 4RSUA 1JYIA 5JLVA 2XVGA 4MGKE 1LOEA 2J1UA 4GJYA 1BBT3 2N7GA 2ZGKA 3LOBA 1R1A2 4R9AA 1IOAA 2Y0OA 2JE9A 1SFNA 2EXJA 1VRH3 2PHUA 3VBSA 2RMU2 4XEZA 3ASIA 4AFCA 1OLMA 2P17A 4QXBA 3GF6A 5BNPA 4FSJA 1GICA 4PQQA 1A3KA 3QOPA 3BTYA 1CWPA 2XJVA 3ZFFB 1UIKA 5J98B 1J3PA 4HMZA 3WD5A 3WW2A 5FYVA 1C1FA 2C5DA 2DCZA 1LOGA 4CUGA 1FT9A 5IFTA 3J7LA 4B8EA 4GJZA 2QQVA 4FVVA 1WMFA 3FLTA 5ACA1 3Q9OA 2WUHA 3NV4A 4NRPA 1JS9A 4TLGA 2VZOA 4N43B 1BCXA 5FY1A 1S2EA 5EFUA 2WLPA 5EJ1B 3T4HB 1NOVA 4XJ9A 3NJXA 1VBB2 2ZGMA 4LJHA 3UKVA 3KD4A 3U4XA 5E1RA 3H1WA 2HWC2 3B9IA 3PJQA 3O1VA 3HVDA 3MV11 4CUCA 5K0UA 1WLTA 2WLQA 4P9YA 4G9SB 3LWCA 1DYKA 4HONA 4LPLA 4XDOA 3PUHA 4CCJA 1DCSA 2ZMKA 1KDKA 3ATGA 2DV9A 5GLZA 1W03A 4FO9A 3UETA 3RZKA 2GN7A 3M3CA 4P9WA 2UU8A 3THCA 2ILMA 5FZ9A 1YXWA 2P3KA 3RMXA 3VBHC 1CR7A 3PVEA 2YBPA 2ZHMA 1RVF2 1XNKA 5LK5A 4AEDB 1UXZA 2RG4A 4QM9A 4WZFA 2D6NA 1US3A 1HX6A 3KV6A 4DUWA 1YNAA 4FAHA 3JQXA 1QJY3 2DVGA 1AL22 1CAWA 2OKXA 1WW7A 1AR83 4DXRA 2A6VA 2WR9A 3I8TA 1SHWB 4XUNA 3SITA 1PM7A 1ULOA 1RYYA 2XVLA 5FMDA 1SPPB 2VZQA 5FP9A 1U12A 4P02B 1CZVA 4Q0SA 2I45A 3WNLA 3QH7A 5F5AA 5L36A 5LA9A 1W9FA 1MEC3 1MS3A 1S2KA 4XOGA 2VNRA 5KC5A 3WDWA 5C3PA 1AR62 4Y4RA 3ZMNA 3IDAA 1R093 5L19A 1WZXA 4Q5OA 1YCIA 2CGNA 3POSA 4I30A 2XJRA 1H6YA 3KT1A 5CFDC 3S7EA 4CDUA 4P9IA 1S4CA 2VUDA 4P5YA 1AVBA 4M4RA 2WQZC 4FCAA 5FREA 1B35A 1SCSA 4YZ5A 1YIPA 2BUKA 2HWC1 4DIQA 3AMMA 4BISA 2FD8A 5FLIA 2P37A 3FL7A 1CAVB 1GR3A 1MVEA 5DAVA 3AC0A 3ZXEA 1UD1A 3E6CC 3MIBA 1YJKA 4XTPA 2Y34A 3RI8A 5AC93 4NIIA 4FPEA 1WCDJ 3VL8A 1JZ3A 1SBEA 1JZ2A 3GBFA 1RVF1 2XJQA 1AUYA 4N9HA 3IB3A 2WYFA 4AAXA 3WF1A 4OCTA 2BQPA 4CEWA 2WBKA 2WZR3 1A34A 1F5JA 1XYOA 2XLFA 1AL21 3TOJA 4O61A 1PK6B 4RS5B 4F7ZA 5FPLA 3OB8A 2Y6GA 3VDDC 4P9XA 2FDKA 5FY5A 4L8QA 2PXJA 4WM7C 2BNNA 4ISQA 4CCMA 5HBAA 2ARAA 4M00A 2BTVC 2JG9A 1GZ9A 1TQ5A 2Q0AA 4MO3M 2B42B 4XDPA 3BTXA 3E5QA 1AR61 1FMD3 2WNVA 5CNAA 1QXPA 5FQ0A 1D2SA 1NA1A 4XDQA 2GNBA 2XUEA 1SACA 2PLV3 2RVAA 3OD4A 3T3YA 3AX4A 2PQQA 1JZ4A 2E33A 1VR3A 3ZN6A 3POGA 4AI9A 1R1ZA 4XACA 4QX0A 2XXZA 5A1FA 3NJZA 2RV9A 4ATEA 2AENA 4WVWA 4GH4A 3H0OA 4BHPA 4LBQB 1TZOA 1STMA 3FN9A 3WNMA 3RZLA 1CN1A 3VB9A 4P5HA 5HCAA 1Z7S1 4XYXA 2ZABA 3I97A 3E6BA 1OH4A 2EVXA 4D6RA 1S0CA 3POWA 1Y43B 5BNNA 4OQ8A 5T50A 1QJEA 1DGRN 2X29A 1ZZ7A 1XE7A 2ZGOA 4ZZ5A 1YFYA 3RYPA 1OOPC 4CRQA 1QJFA 1IKQA 3GZTB 5IJRA 3H7YA 4IGQA 4EWAA 1GOHA 2HWB2 4CCNA 4E9KA 1SLIA 1V6MA 1XQNA 3ON7A 4COWA 2X10A 3ZFGC 3LQCA 4IV3A 3CU7A 1Y9MA 2YPDA 1O7FA 1RUH3 4G3YC 4RYDA 1S0GA 1XYNA 4WVVA 1S55A 1C5IA 2EIEA 2VTXJ 3LEIA 4FPOB 4KG0A 2VMCA 4ZPIA 5DAQA 3WHUA 4EROA 4ARYA 4HPKA 1OA2A 3P3NA 3VD7A 4YVWA 2BPA2 3WDXA 2WT2A 4NAOA 4AFAA 2BP6A 3CIHA 2W5FA 3CEWA 2JG8B 5CG8A 3K51A 1JUIA 3SNMA 1VB2A 4DFSA 1W8NA 5A7WB 4Y1ZA 4KNCA 2XJTA 1W3XA 1QJY2 2VW2A 2BVVA 3RVHA 3UKTA 2PA7A 3IWZA 4EN0A 1AR82 3RPQA 1ONAA 1RIRA 5A3MA 1KJRA 4QHOA 5A3LA 2VUJA 3URFA 1XBFA 1RUF1 5CEHA 1VJ2A 5JCTA 3RNSA 2FCTA 1VIWB 2XONA 3IT8A 3LAGA 3ZYPA 4K21A 4XXAA 1PO23 3M8LA 1HQNA 1MEC2 3NKGA 5D2AA 5FO7B 4AR2A 1H1MA 1GBGA 3I3QA 2NMOA 2BGCA 3VL9A 3CBNA 3VHPA 1UNBA 4QX1A 4N9IA 4QKDA 4YW3A 5C8CA 1UZVA 3CQOA 1KITA 1JYXA 2HYXA 1RUI3 2GNDA 3NNGA 1UY0A 2HWB1 3VKMA 3VBOB 1APNA 2P6CA 2AYHA 3N7KA 2V5DA 4RQPA 5FZKA 4E8CA 2BV4A 4CP9A 3CJXA 3ZYHA 3LEGA 4K1YA 3DPRC 3PTRB 5DG2A 4XILA 5DDJ3 2QQUA 1GZCA 3VHRA 2V4AA 2Y60A 3FC0A 4LITA 2ZMLA 1EAH3 2RS13 4AI3A 5M0TA 4OHYA 3LFIA 1UMHA 3Q8AA 3ZSMA 3ACHA 3BB6A 4MGTA 1PX3A 3VZOA 1FV2A 1RUE1 2HH9A 4NR1A 4F8AA 2DBIA 1N47A 5HV4A 1X36A 3S5AA 4Q4X2 4FPFA 4ZU5A 3SCGA 1RC6A 2Z4FA 3GM8A 3NO8A 3SLIA 3PIGA 5FOJB 3I54A 4ZONA 3HBKA 4TYSA 1RUG1 4JGYB 1QXRA 3K2OA 1FPN3 4XFBA 3OBAA 1AYN3 1EUTA 2D44A 5DAXA 5GZFA 3ZDSA 4XETA 3ZFFA 2LTNA 4Q4W3 4EYUA 1O5UA 3D5OA 2E7AA 1POV0 3FLRA 5EXOA 1KXGA 3A0KA 4M3CB 4HN0A 3O5SA 1PGW2 1VBE3 1ZZBA 4ZS2A 2PLV2 2HJIA 4H14A 3VN4A 1C8M1 2PN5A 4XABA 4NIAA 2ZKNA 4D8MA 3NNLA 4N43A 3GJAA 4ET7A 2W87A 3B3QE 3BTAA 4KI5M 3THDA 4HOOA 5D21A 2IVJA 5ISLA 4YM3A 1ULDA 2ETEA 1REEA 1SLTA 2ZGNA 3J26N 2DUPA 1UPSA 2EF6A 2Q1FA 3D8CA 4RHV1 3TBDA 1NLRA 1W8FA 4KGQA 3PU3A 1ZBE3 4FBFA 3ZYRA 4OMCA 2RS33 3ORJA 2R072 4M0NA 2HBUA 4YW1A 2OPWA 2ZX0A 4YW6A 4L11A 2DF7A 1WCKA 4I09A 4Q2FA 3WP3A 4KWKA 2CL2A 4FOWA 4YW7A 3W5MA 1VMJA 5A3NA 1AXYA 2K0GA 4AHWA 3OBTA 1C28A 2HBTA 2FCUA 2QUOA 5KHIA 5LA1A 5IAVA 3CF6E 3CMGA 5IK4A 1R64A 1AR93 3EJKA 1UWWA 1DG6A 5FPBA 3VD5A 4LO7A 2DU1A 4Q4X1 2D43A 1KFXL 3V65A 3MW4A 3ZLIA 4Q4V3 4LNVA 2IXIA 5A33B 5CAZA 1KQRA 1HRI3 1VE0A 4GA9A 3HQXA 1PVC3 3PIJA 3E1F1 1HQWA 2VMHA 3HQUA 5LCWL 4JVAA 1QQP2 5EYYA 5APAA 4JQRA 3DGTA 5D8AC 1SPPA 2OT7A 4XMIA 4AI8A 5KXCA 3AMHA 4K8FA 4U2AA 3ILFA 1H2NA 3AVRA 5JAXA 3NMBA 2LW8A 2HYKA 3VKFC 1PGW1 4QB1A 5K0UC 2EIBA 4LLOA 5LBBA 3W58A 1JOBA 4A45A 1S1AA 1NLSA 2JDNA 1HXS3 2IFRA 3BPZA 3KS7A 5C3OA 3AYCA 4QXKA 1CGPA 3WG4A 2VU9A 4C0HA 2DCKA 4F3JA 1DDLA 4A3ZA 4ZXKA 2VW1A 3C7GA 2W92A 1RUC3 4B3NA 2C9KA 2P2KA 3HBZA 1QMJA 1TME2 4K7JA 5LA0A 1F2NA 2E7QA 5CU1A 5DUWA 3VDCA 3WZ1A 1W8HA 3SKVA 1PO22 2VPVA 3T4VA 2OYZA 2KXLA 1LTEA 1EYBA 2R071 4XF9A 1V70A 4BXFA 3H3LA 1CAVA 4Y1VA 2OW4A 5JR7B 1TMF2 2ZGQA 4B4RA 1K42A 5BXXA 2XQRA 4L9BA 2C6SA 4NOTA 1ND3C 1OF3A 5ANNA 3ZIXA 1JOPA 1SFPA 3OSDA 1RUI2 5CFCB 1MQTB 4CZSA 1H2KA 2RE9A 3NQHA 4EN8B 3S5QA 4Q0UA 3GZEA 1MS0A 1W0OA 1QHDA 4BQYA 4OZOA 4Z2WA 5JZGC 4B29A 1LOFA 2O8OA 3JB8A 5B4XA 1CIWA 4QQ2A 3LIGA 1DGLA 1WMEA 5DQ0A 3CKHA 4RS5A 1KS5A 5DDJ2 2X5IA 3UK9A 1AJKA 1BK0A 3AYEA 2MEV3 4NJ4A 4ASLA 1O59A 1QQP1 3B5LB 1EAH2 2RS12 2D3RA 2ZTNA 4CDUC 2BBVA 4OUEA 3WW1A 3GZUC 3LD8A 4V2WA 4BDVB 1KFUL 3WQ7A 4PDWB 4CDXB 3ZSJA 4JRAA 2VH9A 3VZLA 4GXLA 4AI0A 3LIHA 1WD4A 5CADA 1XC6A 2UURA 4GALA 4JHTA 2RHPA 2ZGRA 1TNFA 5E8AA 1JHJA 1QJX3 3WVJA 4BJ0A 1DFQA 2CDOA 1BYHA 3EB7A 3I2HA 4GWIA 4EQVA 4YSFA 5C71A 1DIWA 1LOBA 3GJBA 4BA6A 2WABA 5DPNA 1FPN2 5F3CA 1H30A 5F37A 1X8EA 1TME1 4QPIB 5LASA 3KT4A 1DLLA 5IVVA 4LOTA 1WGPA 1ODNA 1D4M2 4O65A 2DCTA 3BYWA 3AZWA 1QU0A 1SQ4A 1MZEA 5FZGA 4LBQD 3MIGA 3ZXFA 5DG1A 1TMF1 1VBE2 2UWBA 2WKKA 1WBFA 5FZ0A 3A22A 4K3UA 4E4DX 2VOWA 2YBKA 3H8UA 2BVBA 2ZX2A 3C7FA 1AXKA 4ZKTB 4H7MA 4AQTA 4LUKA 1FYUA 3NNFA 4AG4A 2OA2A 1ODMA 2XBO1 5T52A 2WNUC 1LJ7A 2JG9C 1YQ6A 2XLGA 2GNTA 3R4UA 2BRTA 5I93A 1N1TA 3WQ1A 2WNVC 3GHNA 3ZMOA 4OI1A 1NA1C 2B39A 4DXZA 3WHTA 2RS32 3HN3A 4HVOA 2RR11 2EAAA 2VR4A 4WM8C 3BIEA 3ST7A 1ST8A 1S0EA 1IG0A 4LBKA 4YZ4A 1PGL2 2G19A 2VL4A 2XDVA 1I1EA 1UYPA 4ITCA 5A6XA 1XNDA 1IZ3A 4YVSC 3K4AA 3H7JA 4GH4C 1XNBA 4FQZA 3HOBA 1JU3A 4AI2A 5JIAA 4NIGA 1O4YA 4DS0A 4C91A 2GZWA 2JG8A 2CGOA 1AR92 3ZIWA 4I0AA 1W3VA 1GNHA 5A7WA 2UWCA 3VHNA 5JSOA 1HB4A 3LOIA 4AOCA 1LRHA 5GJ6A 1MZFA 4E2QA 2CHHA 2PHWA 2X53S 4Q4V2 5L7OB 1U0AA 2WZEA 1AR73 3HNYM 1LGNA 3OPZA 4Y22B 3IAPA 1TEIA 1PVC2 1ZYBA 1VALA 5E6HA 5FKBA 4FPGA 2BU9A 3AM2A 4Y20B 2DTYA 4CE8A 1W6QB 3ZKYA 3NKTA 3I49A 1MS5A 2L9LA 4RFT0 1ZRFA 4NVPA 1D4M1 4M3CE 4KBBA 2VMGA 1KEXA 1V00A 4Y26A 4AHXA 1W9SA 1O4ZA 2BBAA 2NM1A 1V6IA 2W95A 2Y8KA 4ISRA 5EQUA 5A7PA 4COYA 2FZ1A 5KBFA 1X7NA 1ZBA3 1SFYA 5JMOA 2J22A 1LOCA 3T0AA 3KV5A 3MICA 3Q8FA 4FP2A 1W2TA 1N1SA 2CY6A 4LIUA 2QCSB 3IN9A 1YQ2A 2ZCWA 2BFUS 4TXWA 2W9XA 3VBOA 4IXLA 2JE7A 2RDSA 4AEMA 3O1SA 2CAVA 4NPLA 5LZ6A 1GOFA 3GBGA 4HFSA 2ATFA 3F2ZA 2V5YA 2XQXA 5A3WA 3J8F3 3WUDA 4UXAA 3WV6A 1NQDA 2WC2A 3ZXLA 3R4DB 1YEWA 4O9EA 3RJRA 4AZZA 3IIIA 4META 3RRDA 1BQPA 1MZ6A 3ALQA 3EHKA 3U14A 1WMXA 4C90A 3T2TA 3VUOA 4JKMA 4IV3B 1TE1B 4LO4B 4N53C 4IDZA 4E4SA 3HAGA 1EUUA 2W52A 3GCWA 4AGGA 4E2GA 2RM23 2W0XA 1YI7A 1LECA 1QEXA 4JX0A 4MHUA 4WBBA 1XNCA 3X29B 5L9BA 1UYXA 1NG0A 3DYMA 4YVWB 2AUYA 3F95A 4GMP1 1UL9A 4IEWA 2MEV2 3NV3A 1WA6X 2E26A 4JGYA 4NHYA 3TYJA 2WT1A 3ZPOA 3VGIA 1W9TA 3PVBB 4LO6B 1QJU3 4PLOA 4UWDA 4MUVA 1VAKA 3WCSA 1UZWA 4GB32 5DUVA 5K4LA 2DFBA 2XOMA 3QBQA 3D4KA 4LA2A 5FXVA 1HRV3 2CDPA 2HKXA 3BGAA 2R042 4M3CA 3I3MA 5CZKA 1QJX2 4Q4Y3 3LSDA 3PHMA 1O4TA 2AH2A 2VZUA 3A4UA 3ES4A 1MVQA 4ZU4A 4CCCA 4CXWA 2CTVA 2VCBA 5L9VA 1OPOA 4Q1RA 1C3HA 1JHNA 4ZZ8A 3CJIC 2Y6LA 3PMSA 4XZPA 5FYBA 5ANQA 4LHLA 1MACA 1VAMA 2HWD2 1LCLA 1PIV3 3ZR6A 1HN1A 1W39A 1OLRA 1RMU2 1RJ8A 1RUJ3 1VBD3 1JBCA 3PURA 3NJYA 4M01A 3WP5A 2YUEA 2RS53 4BQ4A 2WA3A 5JPNB 5DXDA 2VBBA 3SXWA 2A73B 1OFSA 3PUQA 2HWE3 3ZYIB 1DHKB 1BJQA 3ZFFC 2ZHLA 3VBFC 1AL0G 2JKBA 3HT2A 3BKZA 4HVRA 3Q8CA 4QQHA 2WS92 3C8XA 4IERA 2PELA 2VG9A 3PL0A 2XJUA 4A7ZA 1SBDA 1XXNA 2G9ZA 5A33A 1NQJA 2D3SA 2J1RA 2UYAA 1A8DA 2VCMA 2VGDA 3LCPA 4EJRA 5EHDA 4W6YA 2NPIA 2A7AA 1CX1A 3ILNA 1W6MB 1UY3A 1DQ4A 4IEOA 4L97A 4GB31 2WAOA 4LKSA 4A7YA 2GALA 2W1WA 5FZEA 4EN9B 3GCXA 2OS2A 4DMIA 4LEJA 3THPA 1GWMA 2R041 1WKYA 3MEPA 3ABZA 3KMHA 4LBJA 5TSWA 4XF1A 5GZDA 1JYTA 2BFUL 1AR72 1OA3A 2CNAA 1K45A 3K4ZA 3OGSA 1HV1A 4R9CA 4BQ3A 1O3SA 2C24A 4MLOA 3I3EA 1OXCA 4OI4A 2E53A 4XBQA 4CU7A 2ZZJA 3VBUC 4FTSA 1WW6A 1E5HA 3JUUA 1YFUA 1VLNA 3IBMA 3FFQA 2DTWA 4QXCA 1GP5A 1UIJA 2JIJA 2WA4A 3AB0A 4XC9A 4AEDC 2HWD1 1YUDA 2FDIA 2BZDA 5FZOA 4XW3A 1G86A 1PO13 1GYKA 1RMU1 5F2SA 4UW3A 1N3OA 5A70A 4KU8A 4KWJA 3APBA 1IS3A 4XFHA 1YLLA 4CCDA 2GC0A 5BY5A 4YM1A 1IHMA 5JXIA 2WINB 1QGLA 3UGFA 4IL7A 4PCRA 4UOJA 5CFCA 1MQTA 1D2QA 2AACA 4PIYA 3ZO0B 1UU4A 3INAA 5FMOS 1BZWA 1C1LA 2FMDA 3AXEA 2WS91 2YC4A 1FATA 2XB6C 2V4VA 4UFJA 4I2OA 1EV11 3Q8EA 3KHCA 5JWPA 1LEMA 2EA7A 3J8F2 1RUD2 1V9U3 2VNGA 2ZEWA 4XHXA 3ZN5A 1GWKA 1ULPA 2YV8A 5T5LA 5IK5A 1H8TC 1W8ZA 4AVCA 5C70A 2JICA 3WQ0A 3MLLA 3V64A 4OHWA 1Q8VA 3BVCA 3GGLA 4LIVA 1R1A1 4XAAA 3V56A 4PDWA 4QPGB 5FZ6A 2WFPA 4CDXA 4QWNA 4XCAA 2R1BA 3TN92 1GANA 4INDA 4S2DA 4GZ9A 4YFZA 2RMU1 5HCFA 4XF4A 4OULA 3ZSKA 5JDBA 4AL9A 1UXXX 4XF3A 5F8PA 4YM0A 1VBC3 3RWNA 1QOTA 4CDQC 5LBCA 3SQOA 4MHRA 3WLUA 1FOD2 3J7MA 2CSGA 3MPPG 1YO8A 3T08A 1SLCA 2PHFA 2YYOA 2G9FA 4QPIA 1ND2B 4I3GA
chains in the Genus database with same CATH topology
4PHZA 3RFRA 3RGBA 4O65A 4PI2A 4PI0A 3CHXA 1YEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHZ A;  3RFR A;  3RGB A;  4O65 A;  4PI2 A;  4PI0 A;  3CHX A;  1YEW A; 
#chains in the Genus database with same CATH topology
 3N3H A;  2XPJ A;  1F9K A;  1UX7 A;  1W0P A;  2BER A;  4PBP A;  5FJK A;  4MOA A;  2JE8 A;  3I2G A;  3KCC A;  3KWV A;  5LBF A;  3ETQ A;  1G9D A;  1GQG A;  1LOF C;  2VZ1 A;  3M3I A;  2ZPX A;  1UU5 A;  3LFM A;  3PVO A;  1GZT A;  1CJD A;  2DU0 A;  1VBB 1;  1IQD C;  1PK6 C;  2XJP A;  4QHB A;  4QX5 A;  4R8H A;  3MV0 1;  3SKJ E;  5FMC A;  1X33 A;  1R08 3;  4B1L A;  1F4H A;  3P5B A;  4FPC A;  4HKL A;  5FO8 B;  2VBD A;  3A0N A;  1IPK A;  1HN0 A;  4YGB A;  1FV3 A;  1DYP A;  1EY2 A;  4DUX A;  1SDW A;  4XXP A;  3TAY A;  2P3Y A;  3RJ2 X;  4XJZ A;  2J1S A;  2G9G A;  5FZA A;  5FMB A;  2JD9 A;  2NP0 A;  4OYU A;  1RUD 1;  1RUJ 2;  5BNO B;  1VBA 3;  4IE0 A;  1AYM 2;  2A3X A;  4BZ4 A;  2RS5 2;  1GOG A;  2I74 A;  5FUI A;  3UJQ A;  4A2U A;  3IDE A;  4BQW A;  5JSP A;  2HWE 2;  1Q8Q A;  1UMI A;  5F32 A;  2AC1 A;  2B8M A;  5FUN A;  3TN9 1;  3BN6 A;  5C4W C;  1JU4 A;  2X5I B;  1HJG A;  3MLJ A;  2LS6 A;  2VUL A;  1F15 A;  1NCR B;  5F2W A;  3SIS A;  5L7O A;  1ASJ 3;  2WNE A;  5FLJ A;  1GP4 A;  1O8P A;  2ZAA A;  1HV0 A;  4Y22 A;  5FXZ A;  4Y20 A;  1BVP 1;  4OI0 A;  2HWF 2;  1W6Q A;  3AP5 A;  2PAM A;  1RXF A;  4LUM A;  3ZYJ B;  2R06 3;  1DQ0 A;  2YU1 A;  1N3Q A;  3AXD A;  5B4N A;  1HB2 A;  1KS4 A;  1BBT 2;  3BOW A;  2JEM A;  3U75 A;  1NCQ B;  2LRP A;  5A7N A;  2IXK A;  5CFD B;  1JZ7 A;  2R49 A;  4C1X A;  3ZX7 A;  2D6L X;  1VRH 2;  4IGO A;  1G9A A;  3JD7 3;  3NJV A;  4OHZ A;  5I0D A;  4AVS A;  1YC6 1;  2Z5W A;  2WT0 A;  4JGZ B;  2QNK A;  5LW9 A;  2BNM A;  4BU2 A;  1AJO A;  1OMI A;  3WNP A;  4P9L A;  5FMO L;  4OLL A;  1DU3 D;  1GMM A;  1WMD A;  3NW4 A;  1BKZ A;  1UU6 A;  3I7D A;  2E6V A;  4PBO A;  3K77 A;  4UFH A;  3W9A A;  3WG1 A;  2ADD A;  4FPL A;  4CEY C;  2PMW B;  4B1M A;  1JYV A;  1BK1 A;  1DQ5 A;  2JG8 C;  5EYX A;  4Z2A A;  5FY4 A;  1XPW A;  2FMY A;  4UFK A;  2MNG A;  1XJA A;  1N3P A;  1PO1 2;  1U5I A;  3HT1 A;  4DOU A;  2J7M A;  1MR5 A;  2AEZ A;  1AYM 1;  5FOB B;  1UKR A;  1W2U A;  4JDN A;  4CCL A;  4D7S A;  4AE2 A;  1GWL A;  1DGW A;  1UX6 A;  5FYI A;  1BEV 3;  1OD5 A;  3ENR A;  2D5H A;  4NMI A;  3SEE A;  4KG8 A;  4UFL A;  5JOX A;  3N4M A;  4OI2 A;  1UZY A;  5A32 B;  1RUO A;  3WG3 A;  2TUN A;  3OEA A;  5A6Y A;  4EZH A;  1BMV 2;  3I2I A;  3SEP A;  3VDD B;  4CCE A;  1J3Q A;  1LOA A;  2WWU A;  4IE5 A;  2VQU A;  3DCQ A;  4JDO A;  4X6Q B;  1REF A;  2VCC A;  4HK8 A;  4UW4 A;  2JEC A;  1UF2 C;  1X50 A;  1WLD A;  4IEQ A;  5ABJ B;  4NID A;  1V9U 2;  1L7Q A;  5F5Q A;  5J3U A;  4JKL A;  1MS9 A;  4RR3 C;  4MZU A;  2HWF 1;  1H9W A;  1LU2 A;  1RHI 3;  1Z0H A;  4AEJ A;  4O7X A;  2E9Q A;  4LA3 A;  3VHO A;  4CU6 A;  1BBT 1;  1LU1 A;  1UOB A;  1C8N A;  1NKG A;  4NRQ A;  1CQ9 A;  3I2F A;  4DIN B;  1Q8P A;  2OUH A;  2ET1 A;  4P08 A;  4E4H A;  1VRH 1;  3WOG A;  1LHN A;  4PF5 A;  4EZ4 A;  3LPF A;  3D0S A;  4XTM A;  5FXX A;  5FTT C;  2IZW A;  5EPA A;  3OOX A;  5JOW A;  2W39 A;  3RZH A;  4MGY E;  3HIF A;  4PI0 A;  3SC7 X;  1VBC 2;  5LRS A;  3VZM A;  4UBH A;  2DFC A;  4GWM A;  4QT6 A;  1YYN A;  2Y6K A;  3PDQ A;  4COU A;  1E5S A;  2VM9 A;  5GZG A;  3KF5 A;  4IEX A;  4AQ6 A;  3UJO A;  3HMY A;  4LBM A;  2VZR A;  1R09 2;  5KXE A;  4BIO A;  2XHK A;  2K9Z A;  3RMY A;  3RGB A;  1BXH A;  4FTE A;  1OOP B;  1F8V A;  2K46 A;  1POV 3;  4LMF A;  1W2O A;  1ZRD A;  3GDB A;  2FBE A;  4FOQ A;  1WUV A;  3GAL A;  4CA9 A;  4OVE A;  1R08 2;  1ZA7 A;  3PUI A;  3HQR A;  3EO6 A;  3QLQ A;  3ZFG B;  3WR0 A;  3ACF A;  3UT0 A;  4W65 A;  4BQX A;  1BMV 1;  1COV 3;  1AF9 A;  2Z2S B;  1NXM A;  2ZEX A;  4MXV A;  4IV1 C;  4M0H A;  4WVM B;  5F3G A;  5HV0 A;  3WF4 A;  4GKX A;  3TNP B;  2X09 A;  3AP7 A;  3HPN A;  3ECQ A;  3RQ0 A;  3AVS A;  1X8M A;  1WW5 A;  1NLQ A;  2RJL A;  1HJF A;  1NY7 2;  3POI A;  4P9J A;  1UPI A;  2WNO A;  4QGN A;  2WAA A;  1VBA 2;  4YM2 A;  1SZB A;  3OUI A;  2UYB A;  5GLV A;  5SV5 A;  5C9A C;  4IUG A;  4MV2 A;  1A8M A;  1EP0 A;  1FI2 A;  2ZJC A;  4FOV A;  4Z07 A;  4LLF A;  3LEK A;  2R0F A;  4Q1P A;  1W6M A;  3NAP B;  3B93 A;  1Q8S A;  3ZKU A;  4BB3 A;  2WZR 2;  4XUO A;  1QJY 1;  3SCF A;  3WUC A;  4GWN A;  4OMD A;  4EE2 A;  2EIC A;  1AR8 1;  5A1L A;  3ACG A;  1DQ2 A;  3AJZ A;  4QX3 A;  4TWT A;  5EJZ B;  1F35 A;  1VP6 A;  2KR2 A;  2FHR A;  3H42 B;  3VBR C;  1ASJ 2;  1X9P A;  4DEV A;  5LAT A;  1O91 A;  1E5I A;  2XLA A;  5EZW A;  1MEC 1;  3FBY A;  4HKW A;  5IW0 A;  5FPA A;  4CVU A;  1FMD 2;  4JTO A;  1XSQ A;  1R09 1;  2O1Q A;  2WN3 A;  1W9Y A;  5F9T A;  4AVV A;  2SLI A;  2VVE A;  4UYB A;  3AKR A;  3C7O A;  3AKS A;  4CCO A;  1BHG A;  1RIN A;  3BU7 A;  2YFU A;  3B94 A;  5GAL A;  1CD3 G;  4KGG A;  5FWE A;  2P3J A;  3KVA A;  4NHK A;  3M2M A;  3SCH A;  4QKF A;  5FBJ A;  3B9C A;  1UOF A;  2V72 A;  1O3Q A;  5A3U A;  5JOY A;  5HCH A;  2QQK A;  3FJS A;  4J25 A;  1KGY A;  3DPR B;  4JAA A;  4R9B A;  2E7T A;  2GH8 A;  3IDB B;  2VOT A;  1D4V B;  4QQL A;  1NY7 1;  3VBS C;  4BQ5 A;  1C5H A;  5AC9 1;  5BNP C;  1KJL A;  4BIF A;  2ZGU A;  4H55 A;  3OJB A;  4Z8B A;  3O0V A;  2WYS A;  5IVE A;  2GNM A;  4ARX A;  3OY8 B;  4JTN A;  4GAZ A;  2PHL A;  3A21 A;  4NO4 A;  4Q29 A;  4D6S A;  4MSV A;  3WT3 A;  2WZR 1;  4KL1 A;  3TEW A;  4BLI A;  5IVJ A;  3B02 A;  5T55 A;  1RUH 2;  1SLL A;  3MIH A;  1W8T A;  4QPG A;  4XBL A;  1OH3 A;  5E16 A;  3JZV A;  2Q8O A;  4W6X A;  1F4A A;  2LAL A;  3KQ4 B;  1XU1 A;  2UWA A;  2KD7 A;  4JC1 A;  1UY1 A;  1OQE A;  2JXA A;  2A6Y A;  4K9S A;  5FYT A;  3W5N A;  5I8S A;  2V09 A;  2BGO A;  2ZX1 A;  5FDB A;  2I2S A;  4V2V A;  1RHI 2;  4YG3 A;  1SCR A;  1FMD 1;  4Y1X A;  4ASK A;  2ES3 A;  2WO7 A;  1CAX B;  2PLV 1;  2Q1Z B;  3POF A;  1ND2 A;  5DN2 A;  4U36 A;  4LKE A;  1KD7 A;  1ENR A;  3O1U A;  1S0F A;  5C6C A;  5KC6 A;  2CWS A;  4XMA A;  2WZP P;  2RJK A;  4LO8 A;  1E57 A;  2ZEZ A;  2I07 B;  4IEZ A;  1LHU A;  3RFR A;  1LKN A;  2C0Z A;  2ZX3 A;  2JWP A;  4KMQ A;  1ZZ8 A;  1IQA A;  1J58 A;  1NYW A;  5FZO B;  1YQ8 A;  2Y26 A;  1VMF A;  5A1A A;  4PDW C;  2MHF A;  5FY0 A;  4FOY A;  2A6W A;  1NUK A;  5EV7 A;  4Q0Q A;  5FKC A;  5HXV A;  1OA4 A;  2Q8D A;  1J59 A;  1ZRI A;  3KGL A;  5FBZ A;  5F5C A;  3ITQ A;  4BQ1 A;  1UY2 A;  5BNO A;  4IET A;  2H6C A;  1J84 A;  2EXI A;  3DUI A;  5FYC A;  4H3W A;  1JTZ X;  3POB A;  1PZ8 A;  3PVN A;  2E51 A;  3WW3 A;  4LT5 A;  1UOG A;  4JDM A;  1W2N A;  1GZW B;  2VOX A;  3I2J A;  3OBZ A;  4QPI C;  5JI9 A;  1RUH 1;  3HJR A;  2R32 A;  1W2A X;  3EMR A;  4WV8 A;  3IMN A;  4JKK A;  2YB7 A;  1IS4 A;  3MIF A;  4GD4 A;  4AEK A;  5FLH A;  4W8J A;  1JYN A;  1IPS A;  5A7O A;  1LGC A;  2A5Z A;  2VY0 A;  2GMM A;  2GP5 A;  1NCR A;  4LHN A;  5D8A B;  1LHV A;  3VKN A;  1ENX A;  4CU9 A;  3VD4 A;  1H4H A;  2IUW A;  4Q27 A;  3DL3 A;  1B35 C;  4SLI A;  4D3W A;  3WNK A;  5B2G B;  2QQW A;  3W21 A;  3LPG A;  3AMN A;  2BWC A;  3H9A A;  4LR4 A;  4DZG A;  2WFF 3;  3IM0 A;  3ILR A;  1JOJ A;  5LWB A;  4MVT A;  1PX4 A;  1W05 A;  4GMP 0;  4IGP A;  4KH9 A;  1NCQ A;  2OVU A;  2ZGP A;  2DDU A;  2E32 A;  3RSJ A;  5CFD A;  2LUW A;  2JDP A;  2FCV A;  5LRR A;  3FLP A;  3I3B A;  4KWL A;  5J96 B;  5FK8 A;  2JDA A;  1M06 G;  4JGZ A;  3JBG 3;  1AYN 2;  1CAU B;  2VUC A;  3O12 A;  4IW3 A;  1PO2 1;  4LBL A;  1Q3E A;  3MID A;  4Q4W 2;  5CYY A;  4AHY A;  5FY7 A;  4XCB A;  4CEW C;  3Q8B A;  2ZAH A;  4FXG B;  4Y1U A;  3N9L A;  2AZ5 A;  3E5X A;  5J36 A;  3V0B A;  4FTB A;  3WSO A;  3AKP A;  3BOD A;  5I0U A;  2W2I A;  4HLT A;  2K2S A;  2EAK A;  1ND3 B;  4H2A A;  1RED A;  3FHI B;  4QM8 A;  5EWS A;  1CPN A;  1RUI 1;  1G9C A;  1GSL A;  5IAT A;  4L92 A;  4IEP A;  2D98 A;  2DWR A;  3LF7 A;  3N7M A;  3PJY A;  4HT1 T;  4HZF A;  2ET7 A;  4C1W A;  5I0R A;  3WIN E;  5C5U A;  5GKA C;  2BGP A;  2VAU A;  5A32 A;  1ULF A;  2BOJ A;  1OD3 A;  2ZKL A;  1ZBE 2;  1SBF A;  3ZDV A;  2Y6H A;  3USU B;  4NN0 A;  2YFZ A;  5ACA 3;  5DDJ 1;  2BWA A;  3VDD A;  4QB2 A;  3MO4 A;  4LHK A;  4B4P A;  3O1R A;  3C3V A;  4RGK A;  1EAH 1;  2RS1 1;  2PAE A;  1J83 A;  2XGX A;  1G8W A;  1DZQ A;  3MLK A;  4XFG A;  3RYK A;  5J37 A;  1FXZ A;  1W8U A;  3BI3 A;  5ABJ A;  4OUS A;  2E31 A;  3PUA A;  2QBX A;  4NUB A;  2DBN A;  2RJ2 A;  1AHS A;  5DZF A;  4A7K A;  5FFO C;  1QOO A;  5JXH A;  1RIT A;  3LDK A;  5CKM A;  1IGO A;  1W06 A;  4FFF A;  5BNN C;  1DLC A;  4S2F A;  1HRI 2;  2B45 X;  1HKD A;  4YGC A;  2XVK A;  3O1M A;  1FPN 1;  5DUX A;  2Z42 A;  4FPH A;  4O9G A;  4FPK A;  3DYP A;  3KQR A;  4DPN A;  1AYN 1;  2C9A A;  3C7E A;  4DUV A;  1POQ A;  2EXK A;  2YGL A;  4Q4W 1;  4XJU A;  3SMH A;  4KBZ A;  5FZM A;  1CVN A;  5I8Y A;  5T3N A;  4IV3 C;  1H4G A;  3FUO A;  4QQO A;  1CX4 A;  2Z69 A;  4OFG A;  4QAW A;  1VBE 1;  2WO1 A;  5J09 A;  2ZBJ A;  3ACI A;  5F3I A;  4UW6 A;  1H1I A;  5A3O A;  4ATF A;  1FX5 A;  1H2M A;  3JXS A;  4XJA A;  4CU8 A;  1DP0 A;  1HXS 2;  2XH6 A;  4IE6 A;  3VZN A;  1AZD A;  1OOP A;  2DVD A;  2ZGS A;  1F31 A;  3HR9 A;  2RDN A;  1UQX A;  2QKD A;  2WNU B;  4YVW C;  2RDR A;  5JXG A;  4A44 A;  1AX1 A;  3GHM A;  4DRV A;  1RUC 2;  1ZRC A;  1QY4 A;  4K6B A;  1CZT A;  1W90 A;  3ZFG A;  4S2G A;  4RD7 A;  5G05 L;  1ZBE 1;  4XPV A;  4XUQ A;  2RS3 1;  5GLT A;  3HNM A;  4H7L A;  4WM8 B;  1HIX A;  1Y9Q A;  4LXL A;  3ZSL A;  2WO2 A;  4WVM A;  3TEY A;  2PQS A;  3R05 A;  4ZXE A;  3S57 A;  1PGL 1;  2CAU A;  2QQO A;  4YVS B;  1O5L A;  4LE3 A;  2DUO A;  2PHD A;  1XRU A;  4A6O A;  1WW4 A;  2WSV A;  3UV9 A;  2DYC A;  4QMA A;  5DAB A;  4NHL A;  2ID4 A;  1AR9 1;  1T2X A;  2HWC 3;  5CB7 A;  3MF6 A;  3MPB A;  4BK5 A;  4Z1V A;  2VME A;  5I0S A;  3NAP A;  4L0P A;  4N90 A;  1OVP A;  3VDA A;  1WCU A;  4Q4V 1;  3BU0 A;  2XWB B;  4BWO A;  1V6K A;  1OHF A;  4DEQ A;  4FQ4 A;  1HRI 1;  5C8C C;  3VV1 A;  1PVC 1;  2D97 A;  2P6H A;  2JDH A;  5F6K A;  2CYF A;  1K5J A;  3WP4 A;  1OQ1 A;  2B5H A;  3J7N A;  5FZ7 A;  4AQ2 A;  1VPH A;  4LE4 A;  2IXH A;  3KV9 A;  1RVF 3;  4GQ7 A;  2ZA9 A;  5J1X A;  1BLZ A;  1L7L A;  2VJX A;  4XHB A;  4RQP C;  4ZHN A;  1UAI A;  4QPW A;  4CP0 A;  1Y4W A;  1OQD A;  4TTG A;  1AL2 3;  4B7E A;  1JOD A;  2DCJ A;  4QB6 A;  1UYY A;  1A78 A;  1HXS 1;  2GC2 A;  3BCW A;  3I4I A;  5LA2 A;  5F3E A;  1QDO A;  4ONU A;  1U5X A;  3T2P A;  3E5U A;  4UF0 B;  1CPM A;  1HB3 A;  4QXH A;  4Y5S A;  1RUC 1;  4MXW B;  4JQT A;  4QHZ A;  2GP3 A;  5FZH A;  3AP6 A;  5EP9 A;  5FWJ A;  4NPR A;  2A71 A;  2VTF A;  4MGS A;  3HEI A;  4KQ7 A;  1AR6 3;  1OUS A;  3NWK A;  3DPR A;  1G9B A;  1JYC A;  2XKP A;  4JRL A;  4AFB A;  4X8P A;  1D7P M;  1GQP A;  2YRO A;  5FP4 A;  4TSV A;  3ZPY A;  2ZEY A;  1LB2 A;  5K8S A;  2NYY A;  3CL1 A;  4MGI E;  5IWF A;  4N53 B;  3H50 A;  2VVD A;  4CYD A;  3FHA A;  3ZFE B;  3OY8 A;  1VRB A;  1ULE A;  2G1M A;  4N7I A;  1Z7S 3;  2FDG A;  4E2S A;  3WW4 A;  2Y0I A;  4YG6 A;  2QQJ A;  3UL2 A;  1NAE A;  1UKG A;  2VZ3 A;  3DXT A;  1H2L A;  3AKQ A;  3K3N A;  4UT5 A;  3WP6 A;  5C7G A;  4E8D A;  5ACA 2;  2C4X A;  5KHJ A;  1PMJ X;  3MW3 A;  3S7I A;  3W20 A;  2MEV 1;  1ZZ6 A;  3AZX A;  4GWJ A;  4N43 C;  5F7U A;  3UNP A;  4ZS3 A;  3JCI A;  1W99 A;  1O8S A;  1W6P B;  3OBR A;  5FPX A;  4D7Y A;  1V6L A;  1CZS A;  5FIX A;  1HW5 A;  4CSW A;  1H8V A;  2A6Z A;  2YHJ A;  3G7D A;  3K75 B;  5C3S A;  3P6B A;  3RI9 A;  1SEF A;  3B69 A;  5FXW A;  1G6N A;  5DZE A;  1WA4 A;  3CO2 A;  1CAX A;  1QJX 1;  3CHX A;  2GH2 A;  4QDR A;  3VKO A;  2ARE A;  2DVF A;  4DY3 A;  2FQP A;  3NRU A;  4QX7 A;  1PMH X;  2HEV F;  1JZ6 A;  2IC1 A;  2YU2 A;  5FZB A;  1JYW A;  4AF9 A;  3WCR A;  4R4Z A;  4C0B A;  3TRS B;  3MZH A;  2R16 A;  4F83 A;  1I5Z A;  3CJI B;  5FYU A;  5JVV A;  3T0D A;  1AX2 A;  2OQ6 A;  1JMU B;  3H3U A;  4URA A;  3M70 A;  4LUL A;  2UY9 A;  4GIQ A;  1OSG A;  1GP6 A;  1OLQ A;  1KRI A;  5A6Z A;  2GME A;  3HNB M;  1SMV A;  5FYZ A;  4BXS V;  4QPG C;  2GU9 A;  1EPZ A;  1K5M B;  4CDW B;  5FRA A;  1ZBA 2;  1MS8 A;  2JDM A;  2PAK A;  5CA6 A;  2CU5 A;  3R0R A;  4LK7 A;  3WQB A;  4GKY A;  3GBW A;  2BEO A;  4I02 A;  1RUF 3;  3MYX A;  5IHR A;  3ES1 A;  3VBF B;  3IKW A;  4OQ9 A;  1MZ5 A;  3FMG A;  5T5P A;  1D0G A;  2VBP A;  4AW7 A;  1UZZ A;  2VOK A;  1XE0 A;  1GZW A;  3NST A;  1YRZ A;  4CP1 A;  4IEV A;  1ND2 C;  2D40 A;  2D7F A;  1SLA A;  2PHT A;  5IAX A;  5LBE A;  2GC1 A;  4XVH A;  2VQ0 A;  3KM5 A;  4QKN A;  1X9T A;  1Q43 A;  4D6Q A;  4DY5 A;  1DF0 A;  4IEY A;  5HPO A;  1XSR A;  2BDR A;  1QH6 A;  2OX0 A;  4HSL A;  1PZ9 A;  2HWB 3;  5D8A A;  4B7K A;  2QJV A;  2ORZ A;  3N7L A;  2RM2 2;  3FBM A;  4FAG A;  2YC2 A;  2Q8C A;  3KHB A;  4QU2 A;  2GSY A;  2Q5T A;  4IE7 A;  2QE3 A;  4CTE A;  4FT8 A;  1AR7 1;  1JXN A;  3KSC A;  1QOS A;  2JIG A;  2Q1M A;  1OUX A;  4HN1 A;  2VEC A;  4R9D A;  4WZC A;  4PHZ A;  4RL7 A;  2VTX A;  4TLF A;  3VBU B;  4RA0 A;  5BNO C;  2B4K A;  3ZSE A;  3U4S A;  3AP9 A;  1W6N A;  1QJU 2;  4SBV A;  3T1L A;  1M4W A;  5C8W A;  1CAU A;  3D3A A;  4FFG A;  1RUE 3;  5E88 A;  4CXY A;  3WDV A;  4NHM A;  4BPZ A;  2P4E A;  3UYJ A;  3WXP A;  2PYT A;  3QH6 A;  4OZX A;  3ZYB A;  1HRV 2;  4LBN A;  1PHM A;  1S0I A;  1WCS A;  5FUP A;  4Y3O A;  1DGW X;  5A7Q A;  5KXB A;  1ZBA 1;  4Q4Y 2;  4RS5 C;  5JPM B;  3O1P A;  2X5I C;  1UW8 A;  1RUG 3;  1ND3 A;  4Y24 A;  2WQ8 A;  1UYZ A;  4LTA A;  5IVC A;  1LGB A;  2XKO A;  1NCR C;  3OPT A;  4MYE A;  5CVR A;  2ZXQ A;  3LEM A;  5FP3 A;  3EBR A;  3GXU A;  4FPY A;  4LK6 A;  1FNY A;  3I2O A;  4PLN A;  1OT5 A;  4FPJ A;  1CJP A;  4Q0P A;  5JZG A;  3ZYF A;  4Q8L A;  1PIV 2;  4JHZ A;  3J8F 1;  5FV3 A;  3VZJ A;  4X6R B;  3ZVX A;  5HCB A;  1NCQ C;  3USU A;  1C8M 3;  3BOP A;  3WDU A;  1VBD 2;  1DBN A;  3O1O A;  2W3J A;  3L9J T;  3VBH B;  2WDB A;  2D5F A;  1H8T B;  3HWJ A;  3PU8 A;  3H1Y A;  3O7O A;  4RN5 A;  3OEB A;  4DB5 A;  4XBN A;  4JGZ C;  2IFW A;  1QNY A;  2W46 A;  5LEK A;  4MAD A;  2QTW B;  2RM2 1;  2Y6J A;  2Q30 A;  4RHV 3;  3N35 A;  3WF3 A;  2YBS A;  1E5R A;  1Z7S 2;  4PIX A;  1V6N A;  3FE5 A;  5T5J A;  1G7Y A;  3UES A;  1YFX A;  4CDQ B;  1UZ0 A;  3MFC A;  1AXZ A;  5F5I A;  3RWK X;  1JZ5 A;  1GUI A;  4YW2 A;  1JW6 A;  1FOD 1;  3WNN A;  3M1H A;  5FJH A;  1XE8 A;  2QQI A;  1QF3 A;  2WQ4 A;  1QJU 1;  3BIW E;  1YQC A;  5KWR A;  2Y6F A;  2JDK A;  1JN2 P;  2ARC A;  2VQT A;  3C2U A;  5FY8 A;  4J1W A;  3C7H A;  4Q4X 3;  1FNZ A;  2JEN A;  4R52 A;  1HRV 1;  2EIG A;  2FDF A;  1ENS A;  2ARB A;  3DXU A;  1KDM A;  3TWI A;  5FZ4 A;  2VCA A;  4Q4Y 1;  5HXM A;  5BUV A;  4QX2 A;  2WL1 A;  3IMM A;  3THT A;  5IYY A;  3U78 A;  2QQL A;  2TNF A;  3WF0 A;  2JJ6 A;  4FI9 A;  5EJ3 A;  2Y64 A;  5FZF A;  4DNY A;  4BH9 A;  2WN2 A;  3FFZ A;  3GYD A;  4JCK A;  3KCY A;  5ABJ C;  2WNU A;  4A42 A;  1PNG A;  5JSR A;  5GZE A;  3V0B B;  1CES A;  2QQM A;  4J6G A;  4DXT A;  4YW4 A;  4NRO A;  1L7R A;  3N9P A;  1VAV A;  1H1A A;  3H8X A;  3OYW B;  4D7T A;  2XJS A;  4AK3 A;  3NVC A;  5F6L B;  1PIV 1;  3CNA A;  2AEY A;  5AVA A;  2BNO A;  1RUJ 1;  4XIO A;  4WM8 A;  2O14 A;  2ZGT A;  1VBD 1;  3P3P A;  4AGV A;  1S2B A;  2VZS A;  2B9U A;  1ZZ9 A;  2RS5 1;  2W1S A;  4IEU A;  4HG6 B;  4YVS A;  3EYP A;  1I5P A;  3POY A;  5J48 A;  1QJZ A;  2HWE 1;  2OUJ A;  5K7P A;  4BYY A;  1RUF 2;  1UOJ A;  1GNZ A;  5C4W B;  3TEZ A;  3LE0 A;  4I0B A;  2OXB A;  3AKT A;  4COZ A;  3ROU A;  5JR2 A;  4HSJ A;  2CV6 A;  2YDE A;  4K20 A;  2VE1 A;  1TNR A;  2V73 A;  2R07 3;  3LA3 A;  4L99 A;  4WM7 B;  4YGD A;  2J1E A;  3GNE A;  3S0M A;  5LK7 B;  5BV6 A;  3BUC A;  3ACL A;  2XG3 A;  4IE4 A;  3T2O A;  3KVB A;  4QDQ A;  3AJY A;  3VD9 A;  1GFF 2;  2GN3 A;  3LB9 A;  1ENQ A;  2P34 A;  3DV8 A;  2HLE A;  5F1R A;  4XUT A;  2BOI A;  3VBO C;  4QKB A;  3ZXD A;  1HB1 A;  1G9F A;  5FYH A;  5FYY A;  4PT6 A;  4Z92 B;  3K4D A;  3RS6 A;  4EWE A;  4XJ8 A;  4ZU7 A;  4HL0 A;  2ZMN A;  2YMZ A;  5I8T A;  2JDY A;  4N8M A;  3S6P A;  5FK7 A;  1W8W A;  1UO9 A;  1QQP 3;  1V6O A;  2PFW A;  3MBW A;  4LOS A;  1RTV A;  4XIK A;  3VD3 A;  4A3X A;  4UF0 A;  4CEY B;  3O1T A;  1ZA4 A;  2PHX A;  2UY8 A;  5IVY A;  5JIU A;  3OGJ A;  4MXW A;  4Q0V A;  4S2H A;  5DAP A;  1J3R A;  1P8J A;  3ETP A;  4M3C F;  3K48 A;  1GQH A;  1IPJ A;  1RUE 2;  1SG3 A;  2D6K A;  3U0Z A;  1PO1 1;  3NAP C;  4YAR A;  5T54 A;  1DGR A;  4YGE A;  2DUR A;  2FDJ A;  2W47 A;  3I2K A;  3PTY A;  4NWW A;  1LOD A;  1YI9 A;  2OPK A;  5FPV A;  4UW5 A;  4XQW A;  4YWA A;  2P5B A;  3EQE A;  1RUG 2;  3MF9 A;  4JGY C;  2YGM A;  1LUL A;  4N53 A;  4BM8 A;  2XML A;  1NXD 1;  1TME 3;  3IZO A;  2A6X A;  1W04 A;  2XL9 A;  3PUS A;  5FP7 A;  2X05 A;  3SH3 A;  3ZFE A;  1LR5 A;  4IES A;  4JZR A;  4LKF A;  1ZM1 A;  2H6B A;  4OUM A;  3LKJ A;  1TG7 A;  2QQN A;  1QDC A;  1TMF 3;  4MGQ A;  2IVI B;  2DVA A;  4OHX A;  5FZ3 A;  2YC0 A;  1V9U 1;  1C8M 2;  4ES9 A;  3W59 A;  4RR3 B;  5DZG A;  3AFK A;  1I3H A;  1T6B X;  3R4S A;  1DYO A;  4KU7 A;  1XU2 A;  1QWR A;  2R6Q A;  5LEJ A;  1W6P A;  2DUQ A;  4EWD A;  2XBO 3;  3MW2 A;  5FYS A;  3PME A;  2VZV A;  1OBN A;  4D94 A;  4QD2 A;  4PJY A;  4A4A A;  3OUJ A;  4RHV 2;  4IQP A;  3N36 A;  3B01 A;  3PNA A;  2AGS A;  4AVT A;  4RGA A;  5IFP A;  1RB8 G;  5DUU A;  2RR1 3;  1V0A A;  5FZ1 A;  3K46 A;  2B7Y A;  4Y33 A;  1VBC 1;  4HVQ A;  1LHO A;  1PNF A;  5IK8 A;  2J1V A;  3D0J A;  3E6D A;  5EIY B;  1O3R A;  4HET A;  2CWM A;  3CJI A;  4NIH A;  3DYO A;  2LRO A;  5FCC A;  3IPV B;  3FX3 A;  1ZVF A;  3P1I A;  1H0B A;  2R06 2;  2VUA A;  2XUM A;  5FY9 A;  3ZXA C;  2FDH A;  3MGU A;  3WG2 A;  3B7M A;  3OUH A;  1Z78 A;  3JD7 2;  5AVP A;  4AHZ A;  2IWG B;  1K5M A;  4CDW A;  1R08 1;  3AMQ A;  2WZ8 A;  2OZJ A;  3OF1 A;  3U1X A;  4Z82 A;  3M3E A;  3VZK A;  3ZYG A;  3VDB A;  2VO5 A;  3HD8 B;  2NZ9 A;  3POJ A;  5GZC A;  4EN7 B;  3OGG A;  3I59 B;  1GU3 A;  1JH5 A;  3AYA A;  2Y38 A;  1A6C A;  4IV1 B;  3BTZ A;  1D4M 3;  3VBF A;  4BCU A;  3RZJ A;  2DVB A;  3T1M A;  5C3R A;  1OKO A;  3G6J B;  3R6S A;  4CUB A;  1S0D A;  2A1X A;  5C9A B;  2BW8 A;  1VBA 1;  3MUZ 1;  4RFR B;  4YFW A;  1GNY A;  5F39 A;  3B00 A;  5H9Q A;  1RUN A;  2JDZ A;  4M4P A;  1RXG A;  4GUL A;  2D3P A;  4K1Z A;  4P14 A;  4Y4Y A;  1QH7 A;  1XNT A;  1LNS A;  1BEV 2;  1ZRR A;  3I3D A;  2SBA A;  1QIQ A;  2A70 A;  3OG2 A;  2HEW F;  2IXC A;  5C33 A;  2IXJ A;  4PLM A;  1NE4 A;  4MG2 A;  2ZAC A;  4QGL A;  4G4F A;  4XFF A;  4YW5 A;  2W94 A;  5AFB A;  5JXJ A;  1GKB A;  2OZ6 A;  2YPJ A;  5JOZ A;  1W0N A;  2EID A;  4C8D A;  4BMB A;  2ZZQ A;  3NV1 A;  5FZI A;  3VBR B;  1RJ7 A;  2EAL A;  1ASJ 1;  2HEY F;  4FP3 A;  3ZXJ A;  5CBL A;  4Y5T A;  1WWY A;  1OC1 A;  3MI8 A;  5DAW A;  2B9V A;  1YJL A;  3AL6 A;  3SH5 A;  3VBU A;  2GMP A;  1CIY A;  2D6P A;  2W1U A;  3NV2 A;  4CPB A;  5KHK A;  1W6O B;  2R06 1;  5CFC C;  1MQT C;  3MIE A;  3D82 A;  1DZT A;  3LGR A;  4AED A;  2XR4 A;  3CZJ A;  4A6S A;  4CPB D;  4YZ2 A;  5HI0 A;  3V0A B;  3J4U H;  1RL3 A;  3LDB A;  2YY1 A;  3WEZ A;  3JD7 1;  2VZT A;  1ULG A;  4LO5 B;  1ZNP A;  5FYM A;  4GMP 3;  3MUY 1;  2VOV A;  2D93 A;  1U5Z A;  5GLU A;  4CP2 A;  5AFE A;  4YZ3 A;  5A7S A;  5A3P A;  2O0O A;  2R7E B;  2NQY A;  2P1B A;  2ZHK A;  3WNO A;  2VMD A;  2O8Q A;  3IAQ A;  1Q8O A;  4I01 A;  5BYN A;  1O3T A;  4B4Q A;  4CDX C;  5L73 A;  2VXR A;  2BYV E;  2ORX A;  3O0W A;  3VBS B;  5BNP B;  1C57 A;  2A75 A;  4K8R B;  3U11 A;  5IVF A;  2ZHN A;  4NE9 A;  2B46 X;  2VMF A;  2FZ2 A;  2JB8 A;  3AK0 A;  4I0W B;  4XFA A;  4YYO A;  3N7J A;  1BEV 1;  3VBH A;  1DQ1 A;  1FAY A;  3LSE A;  3AP4 A;  4X8N A;  3U37 A;  1H8T A;  3O0X A;  1US2 A;  3J7H A;  5A3T A;  3OD0 A;  5C5T A;  3JB4 C;  5E89 A;  1PGS A;  3OGR A;  3WDT A;  5FR3 A;  2VMI A;  1NZI A;  1COV 2;  2W68 A;  2A3W A;  4XAE A;  3KCX A;  1GV9 A;  2JB4 A;  3AMP A;  4BLJ A;  5LY1 A;  3FWE A;  1XNA A;  1HLC A;  1H9P A;  4Q8K A;  3D6E A;  2Q8E A;  2GDF A;  1HDK A;  2QVS B;  1ZZC A;  4XJW A;  5CIR A;  2Q4S A;  4KWU A;  5AC9 2;  4CDQ A;  1RHI 1;  2ENR A;  4XQD A;  3IIA A;  2W1Q A;  2YG0 A;  3OCP A;  1Y9G A;  3M3O A;  2J42 A;  3FZ3 A;  1OVS A;  2LM3 A;  4V1P A;  3BPS A;  4WVZ A;  3TEX A;  4XUR A;  5K0U B;  2XBO 2;  4QU1 A;  4QDS A;  2CGP A;  2XWJ B;  4LQR A;  1MPX A;  4PF1 A;  1S0J A;  3A7Q A;  2JD4 A;  4XUP A;  2VXJ A;  3AL5 A;  3I2D A;  4Y5Z 0;  3RZZ A;  4L2N A;  1PZ7 A;  4QQP A;  3H8R A;  4NAM A;  1LED A;  1F5F A;  1PK6 A;  1UN1 A;  2RR1 2;  2VD7 A;  3DKQ A;  4XQ4 A;  5H9P A;  2JKX A;  1GLH A;  1W6N B;  3DEM A;  4HBN A;  4ASM B;  4E27 A;  3WDY A;  3RG0 A;  4NPM A;  3ZOI A;  3T30 A;  5I0T A;  3N9M A;  1H6X A;  5FAX A;  5GLW A;  3NNM A;  4P9G A;  5IK7 A;  3H8O A;  3LA2 A;  4GB3 3;  1UY4 A;  1CAW B;  5FPZ A;  3T2Q A;  3S30 A;  4NWV A;  4FFI A;  3RZM A;  1W8O A;  1VB4 A;  2BJS A;  2R04 3;  3OYW A;  3ZN4 A;  1W9W A;  1WBL A;  4YLZ A;  4TZD A;  1POV 1;  4AVB A;  3IDC B;  4NHX A;  4EN6 B;  1OKQ A;  5L7O C;  3AYD A;  3VLB B;  1YFW A;  4HK9 A;  3U10 A;  2VQA A;  3KB5 A;  2W91 A;  2W08 A;  4W50 A;  3E97 A;  3KLS A;  2ZOE B;  3DF0 A;  5SV8 A;  2IXL A;  4BQ2 A;  4LBQ A;  3FUQ A;  5JZG B;  2PTM A;  4BOW A;  1COV 1;  1W28 A;  3N9Q A;  1ULC A;  5C4W A;  4Y1Y A;  3ZM8 A;  2HWD 3;  4YZ1 A;  1I9R A;  3ELN A;  1RMU 3;  1MS1 A;  5FZC A;  1MS4 A;  4CDU B;  1LHW A;  1D0H A;  3H1M A;  1URX A;  2QDR A;  5JMC A;  2P3I A;  4WM7 A;  5CG9 A;  2C26 A;  4MH0 E;  1B35 B;  1NX9 A;  3HN1 A;  1S0B A;  2AR6 A;  5FZL A;  4MX3 A;  2NN8 A;  4UFI A;  1LEN A;  4OHV A;  4AXO A;  3SHR A;  3DN7 A;  5A6Q A;  3O14 A;  5JUV A;  2EXH A;  1VMH A;  3JU9 A;  2H0V A;  5G04 L;  3BAL A;  1XYP A;  4LBO A;  2R1D A;  2F4L A;  4K40 A;  3H3Z A;  2GAU A;  1Y7B A;  2VVF A;  2WS9 3;  2MPF A;  1EV1 3;  5T5O A;  3EXU A;  2NLR A;  4FXK B;  3DEC A;  1DQ6 A;  4PQ9 A;  1IG3 A;  5IVB A;  2VNO A;  3U07 A;  2ERF A;  3LDR A;  3OPW A;  5GM0 A;  3N9N A;  3QAC A;  4LOR A;  3AFG A;  4YNI A;  4CEW B;  2XL7 A;  4CEY A;  4DO0 A;  1X82 A;  3AZV A;  1YWK A;  3A23 A;  4QPY A;  1R1A 3;  4W6W A;  1K3I A;  3UGH A;  2PHR A;  2YZ4 A;  1J1L A;  1JUH A;  3JQW A;  1V6J A;  2F6B A;  2RMU 3;  3MHZ A;  4UFM A;  3M3Q A;  4QGM A;  3AZZ A;  4EV0 A;  4YRD A;  1O6U A;  1LES A;  3M7A A;  2F4P A;  2JG9 B;  3KT7 A;  4FFH A;  5CIS A;  1ZX5 A;  5K9Y A;  1B09 A;  4D0Q A;  5KR7 A;  2VC9 A;  1OI6 A;  1QXJ A;  2WNV B;  5FQ0 B;  4CCK A;  1NA1 B;  5J7M A;  3NL1 A;  2ZGL A;  4AWD A;  2WJS A;  1ACC A;  4ZY9 A;  5H9R A;  1WLW A;  3WX5 A;  1WD3 A;  3ZN6 B;  1YHF A;  4XF0 A;  1I6X A;  1C4R A;  2GC3 A;  3RYR A;  2Y33 A;  3TB0 A;  5L9R A;  5FZD A;  2WWJ A;  4J1X A;  3UGG A;  4XZU G;  3M4F A;  1XB9 A;  3OTF A;  2WSU A;  4GH4 B;  3DKW A;  5ERL A;  1VBB 3;  5H9S A;  1ZRE A;  5CKQ A;  4LKD A;  2OQ7 A;  4RR3 A;  4P00 B;  3UKN A;  4AVA A;  2A3Y A;  2VNV A;  2ZX4 A;  4XFI A;  2VZP A;  3GZA A;  1Q5O A;  4HXC A;  3ZXK A;  3L2Y A;  4BE3 A;  2R30 A;  1DZR A;  2RDQ A;  2ZS6 B;  2XHN A;  4XFC A;  3VKL A;  4YPJ A;  4RGG A;  1SLB A;  2DCY A;  5BNN B;  3LA7 A;  2WII B;  4NRM A;  4DXS A;  4QX8 A;  1RGS A;  1YQ5 A;  2KA3 A;  1N1Y A;  1NZC A;  4DRR A;  3FHQ A;  1RUD 3;  5KXD A;  2WWS A;  1HQL A;  1J1T A;  1LAJ A;  5FPU A;  4AI1 A;  4HKO A;  3WNX A;  3QD6 A;  4BME A;  4E4Z A;  3CDZ B;  1YIF A;  1OFN A;  2QFE A;  3KGZ A;  5DMY A;  1ALY A;  3POE A;  2NMN A;  2JDU A;  3IPV A;  4LHS A;  2WFF 2;  3ZFE C;  3TN9 3;  5BPX A;  1TVG A;  4HPK B;  4UBG A;  5JI7 A;  4D69 A;  3MFA A;  4AGR A;  2QZ2 A;  4ORF A;  2OII A;  5KHG A;  2KM2 A;  1QNW A;  3RZG A;  2QQP A;  4CXX A;  5I91 A;  1QKQ A;  4UI9 L;  3T0B A;  1SDD B;  2E63 A;  2JX9 A;  4HAN A;  1FOD 3;  3JBG 2;  5C3Q A;  4COV A;  3RDI A;  4PI2 A;  2Z79 A;  3TNQ A;  1CON A;  4R4X A;  4JV4 A;  2R0H A;  3I59 A;  2J1A A;  4IV1 A;  5IUQ A;  1OLM E;  5BNQ A;  5FZ8 A;  1AX0 A;  1Y3T A;  3T09 A;  1NT0 A;  5IT6 A;  3KF3 A;  4DQA A;  3CLP A;  3USS A;  4AFM A;  1L3J A;  5C9A A;  4AAP A;  1K12 A;  2H0B A;  3SH4 A;  3ZXG A;  4PIZ A;  4AYU A;  2QDN A;  3KV4 A;  1WLC A;  3ZR5 A;  4I3P A;  4YG0 A;  2ADE A;  2WRA A;  4N7U A;  1Q56 A;  2VW0 A;  1PMI A;  5FP8 A;  2QZ3 A;  1IKP A;  4A41 A;  3NNJ A;  5C8C B;  4URT A;  1T6G C;  1IS6 A;  1U5Y A;  3WF2 A;  1PVX A;  2TBV A;  1UMZ A;  3MDP A;  3CZU A;  1AYM 3;  3VBR A;  1JZ8 A;  4Q26 A;  1K5M C;  4XE9 A;  5FO9 B;  4CDW C;  3J9S A;  1BVV A;  3L2H A;  1WCQ A;  3ME2 A;  1OUR A;  2G4I A;  4RQP B;  4AQS A;  5LY2 A;  2D6M A;  4CP9 B;  3K3O A;  2WO3 A;  3KZ4 C;  4TN7 A;  3WY6 A;  4ES8 A;  2WFF 1;  5LB6 A;  1JI6 A;  1W6O A;  2ARX A;  2X8K A;  3AZY A;  4AFD A;  1EPW A;  5A80 A;  4CUA A;  3V0A A;  3QCW A;  2YXS A;  2C1F A;  1XOY A;  4MGZ E;  3OGV A;  3LZZ A;  1IS5 A;  1EV1 2;  4UAP A;  4W4Z A;  3N9O A;  1N1V A;  1OF4 A;  3PLQ A;  1NE6 A;  5D1I A;  3JBG 1;  4BK4 A;  2J1T A;  5CKN A;  1OPM A;  5KHH A;  2D6O X;  2F17 A;  1PM4 A;  2HWF 3;  2TEP A;  1UCX A;  4RSU A;  1JYI A;  5JLV A;  2XVG A;  4MGK E;  1LOE A;  2J1U A;  4GJY A;  1BBT 3;  2N7G A;  2ZGK A;  3LOB A;  1R1A 2;  4R9A A;  1IOA A;  2Y0O A;  2JE9 A;  1SFN A;  2EXJ A;  1VRH 3;  2PHU A;  3VBS A;  2RMU 2;  4XEZ A;  3ASI A;  4AFC A;  1OLM A;  2P17 A;  4QXB A;  3GF6 A;  5BNP A;  4FSJ A;  1GIC A;  4PQQ A;  1A3K A;  3QOP A;  3BTY A;  1CWP A;  2XJV A;  3ZFF B;  1UIK A;  5J98 B;  1J3P A;  4HMZ A;  3WD5 A;  3WW2 A;  5FYV A;  1C1F A;  2C5D A;  2DCZ A;  1LOG A;  4CUG A;  1FT9 A;  5IFT A;  3J7L A;  4B8E A;  4GJZ A;  2QQV A;  4FVV A;  1WMF A;  3FLT A;  5ACA 1;  3Q9O A;  2WUH A;  3NV4 A;  4NRP A;  1JS9 A;  4TLG A;  2VZO A;  4N43 B;  1BCX A;  5FY1 A;  1S2E A;  5EFU A;  2WLP A;  5EJ1 B;  3T4H B;  1NOV A;  4XJ9 A;  3NJX A;  1VBB 2;  2ZGM A;  4LJH A;  3UKV A;  3KD4 A;  3U4X A;  5E1R A;  3H1W A;  2HWC 2;  3B9I A;  3PJQ A;  3O1V A;  3HVD A;  3MV1 1;  4CUC A;  5K0U A;  1WLT A;  2WLQ A;  4P9Y A;  4G9S B;  3LWC A;  1DYK A;  4HON A;  4LPL A;  4XDO A;  3PUH A;  4CCJ A;  1DCS A;  2ZMK A;  1KDK A;  3ATG A;  2DV9 A;  5GLZ A;  1W03 A;  4FO9 A;  3UET A;  3RZK A;  2GN7 A;  3M3C A;  4P9W A;  2UU8 A;  3THC A;  2ILM A;  5FZ9 A;  1YXW A;  2P3K A;  3RMX A;  3VBH C;  1CR7 A;  3PVE A;  2YBP A;  2ZHM A;  1RVF 2;  1XNK A;  5LK5 A;  4AED B;  1UXZ A;  2RG4 A;  4QM9 A;  4WZF A;  2D6N A;  1US3 A;  1HX6 A;  3KV6 A;  4DUW A;  1YNA A;  4FAH A;  3JQX A;  1QJY 3;  2DVG A;  1AL2 2;  1CAW A;  2OKX A;  1WW7 A;  1AR8 3;  4DXR A;  2A6V A;  2WR9 A;  3I8T A;  1SHW B;  4XUN A;  3SIT A;  1PM7 A;  1ULO A;  1RYY A;  2XVL A;  5FMD A;  1SPP B;  2VZQ A;  5FP9 A;  1U12 A;  4P02 B;  1CZV A;  4Q0S A;  2I45 A;  3WNL A;  3QH7 A;  5F5A A;  5L36 A;  5LA9 A;  1W9F A;  1MEC 3;  1MS3 A;  1S2K A;  4XOG A;  2VNR A;  5KC5 A;  3WDW A;  5C3P A;  1AR6 2;  4Y4R A;  3ZMN A;  3IDA A;  1R09 3;  5L19 A;  1WZX A;  4Q5O A;  1YCI A;  2CGN A;  3POS A;  4I30 A;  2XJR A;  1H6Y A;  3KT1 A;  5CFD C;  3S7E A;  4CDU A;  4P9I A;  1S4C A;  2VUD A;  4P5Y A;  1AVB A;  4M4R A;  2WQZ C;  4FCA A;  5FRE A;  1B35 A;  1SCS A;  4YZ5 A;  1YIP A;  2BUK A;  2HWC 1;  4DIQ A;  3AMM A;  4BIS A;  2FD8 A;  5FLI A;  2P37 A;  3FL7 A;  1CAV B;  1GR3 A;  1MVE A;  5DAV A;  3AC0 A;  3ZXE A;  1UD1 A;  3E6C C;  3MIB A;  1YJK A;  4XTP A;  2Y34 A;  3RI8 A;  5AC9 3;  4NII A;  4FPE A;  1WCD J;  3VL8 A;  1JZ3 A;  1SBE A;  1JZ2 A;  3GBF A;  1RVF 1;  2XJQ A;  1AUY A;  4N9H A;  3IB3 A;  2WYF A;  4AAX A;  3WF1 A;  4OCT A;  2BQP A;  4CEW A;  2WBK A;  2WZR 3;  1A34 A;  1F5J A;  1XYO A;  2XLF A;  1AL2 1;  3TOJ A;  4O61 A;  1PK6 B;  4RS5 B;  4F7Z A;  5FPL A;  3OB8 A;  2Y6G A;  3VDD C;  4P9X A;  2FDK A;  5FY5 A;  4L8Q A;  2PXJ A;  4WM7 C;  2BNN A;  4ISQ A;  4CCM A;  5HBA A;  2ARA A;  4M00 A;  2BTV C;  2JG9 A;  1GZ9 A;  1TQ5 A;  2Q0A A;  4MO3 M;  2B42 B;  4XDP A;  3BTX A;  3E5Q A;  1AR6 1;  1FMD 3;  2WNV A;  5CNA A;  1QXP A;  5FQ0 A;  1D2S A;  1NA1 A;  4XDQ A;  2GNB A;  2XUE A;  1SAC A;  2PLV 3;  2RVA A;  3OD4 A;  3T3Y A;  3AX4 A;  2PQQ A;  1JZ4 A;  2E33 A;  1VR3 A;  3ZN6 A;  3POG A;  4AI9 A;  1R1Z A;  4XAC A;  4QX0 A;  2XXZ A;  5A1F A;  3NJZ A;  2RV9 A;  4ATE A;  2AEN A;  4WVW A;  4GH4 A;  3H0O A;  4BHP A;  4LBQ B;  1TZO A;  1STM A;  3FN9 A;  3WNM A;  3RZL A;  1CN1 A;  3VB9 A;  4P5H A;  5HCA A;  1Z7S 1;  4XYX A;  2ZAB A;  3I97 A;  3E6B A;  1OH4 A;  2EVX A;  4D6R A;  1S0C A;  3POW A;  1Y43 B;  5BNN A;  4OQ8 A;  5T50 A;  1QJE A;  1DGR N;  2X29 A;  1ZZ7 A;  1XE7 A;  2ZGO A;  4ZZ5 A;  1YFY A;  3RYP A;  1OOP C;  4CRQ A;  1QJF A;  1IKQ A;  3GZT B;  5IJR A;  3H7Y A;  4IGQ A;  4EWA A;  1GOH A;  2HWB 2;  4CCN A;  4E9K A;  1SLI A;  1V6M A;  1XQN A;  3ON7 A;  4COW A;  2X10 A;  3ZFG C;  3LQC A;  4IV3 A;  3CU7 A;  1Y9M A;  2YPD A;  1O7F A;  1RUH 3;  4G3Y C;  4RYD A;  1S0G A;  1XYN A;  4WVV A;  1S55 A;  1C5I A;  2EIE A;  2VTX J;  3LEI A;  4FPO B;  4KG0 A;  2VMC A;  4ZPI A;  5DAQ A;  3WHU A;  4ERO A;  4ARY A;  4HPK A;  1OA2 A;  3P3N A;  3VD7 A;  4YVW A;  2BPA 2;  3WDX A;  2WT2 A;  4NAO A;  4AFA A;  2BP6 A;  3CIH A;  2W5F A;  3CEW A;  2JG8 B;  5CG8 A;  3K51 A;  1JUI A;  3SNM A;  1VB2 A;  4DFS A;  1W8N A;  5A7W B;  4Y1Z A;  4KNC A;  2XJT A;  1W3X A;  1QJY 2;  2VW2 A;  2BVV A;  3RVH A;  3UKT A;  2PA7 A;  3IWZ A;  4EN0 A;  1AR8 2;  3RPQ A;  1ONA A;  1RIR A;  5A3M A;  1KJR A;  4QHO A;  5A3L A;  2VUJ A;  3URF A;  1XBF A;  1RUF 1;  5CEH A;  1VJ2 A;  5JCT A;  3RNS A;  2FCT A;  1VIW B;  2XON A;  3IT8 A;  3LAG A;  3ZYP A;  4K21 A;  4XXA A;  1PO2 3;  3M8L A;  1HQN A;  1MEC 2;  3NKG A;  5D2A A;  5FO7 B;  4AR2 A;  1H1M A;  1GBG A;  3I3Q A;  2NMO A;  2BGC A;  3VL9 A;  3CBN A;  3VHP A;  1UNB A;  4QX1 A;  4N9I A;  4QKD A;  4YW3 A;  5C8C A;  1UZV A;  3CQO A;  1KIT A;  1JYX A;  2HYX A;  1RUI 3;  2GND A;  3NNG A;  1UY0 A;  2HWB 1;  3VKM A;  3VBO B;  1APN A;  2P6C A;  2AYH A;  3N7K A;  2V5D A;  4RQP A;  5FZK A;  4E8C A;  2BV4 A;  4CP9 A;  3CJX A;  3ZYH A;  3LEG A;  4K1Y A;  3DPR C;  3PTR B;  5DG2 A;  4XIL A;  5DDJ 3;  2QQU A;  1GZC A;  3VHR A;  2V4A A;  2Y60 A;  3FC0 A;  4LIT A;  2ZML A;  1EAH 3;  2RS1 3;  4AI3 A;  5M0T A;  4OHY A;  3LFI A;  1UMH A;  3Q8A A;  3ZSM A;  3ACH A;  3BB6 A;  4MGT A;  1PX3 A;  3VZO A;  1FV2 A;  1RUE 1;  2HH9 A;  4NR1 A;  4F8A A;  2DBI A;  1N47 A;  5HV4 A;  1X36 A;  3S5A A;  4Q4X 2;  4FPF A;  4ZU5 A;  3SCG A;  1RC6 A;  2Z4F A;  3GM8 A;  3NO8 A;  3SLI A;  3PIG A;  5FOJ B;  3I54 A;  4ZON A;  3HBK A;  4TYS A;  1RUG 1;  4JGY B;  1QXR A;  3K2O A;  1FPN 3;  4XFB A;  3OBA A;  1AYN 3;  1EUT A;  2D44 A;  5DAX A;  5GZF A;  3ZDS A;  4XET A;  3ZFF A;  2LTN A;  4Q4W 3;  4EYU A;  1O5U A;  3D5O A;  2E7A A;  1POV 0;  3FLR A;  5EXO A;  1KXG A;  3A0K A;  4M3C B;  4HN0 A;  3O5S A;  1PGW 2;  1VBE 3;  1ZZB A;  4ZS2 A;  2PLV 2;  2HJI A;  4H14 A;  3VN4 A;  1C8M 1;  2PN5 A;  4XAB A;  4NIA A;  2ZKN A;  4D8M A;  3NNL A;  4N43 A;  3GJA A;  4ET7 A;  2W87 A;  3B3Q E;  3BTA A;  4KI5 M;  3THD A;  4HOO A;  5D21 A;  2IVJ A;  5ISL A;  4YM3 A;  1ULD A;  2ETE A;  1REE A;  1SLT A;  2ZGN A;  3J26 N;  2DUP A;  1UPS A;  2EF6 A;  2Q1F A;  3D8C A;  4RHV 1;  3TBD A;  1NLR A;  1W8F A;  4KGQ A;  3PU3 A;  1ZBE 3;  4FBF A;  3ZYR A;  4OMC A;  2RS3 3;  3ORJ A;  2R07 2;  4M0N A;  2HBU A;  4YW1 A;  2OPW A;  2ZX0 A;  4YW6 A;  4L11 A;  2DF7 A;  1WCK A;  4I09 A;  4Q2F A;  3WP3 A;  4KWK A;  2CL2 A;  4FOW A;  4YW7 A;  3W5M A;  1VMJ A;  5A3N A;  1AXY A;  2K0G A;  4AHW A;  3OBT A;  1C28 A;  2HBT A;  2FCU A;  2QUO A;  5KHI A;  5LA1 A;  5IAV A;  3CF6 E;  3CMG A;  5IK4 A;  1R64 A;  1AR9 3;  3EJK A;  1UWW A;  1DG6 A;  5FPB A;  3VD5 A;  4LO7 A;  2DU1 A;  4Q4X 1;  2D43 A;  1KFX L;  3V65 A;  3MW4 A;  3ZLI A;  4Q4V 3;  4LNV A;  2IXI A;  5A33 B;  5CAZ A;  1KQR A;  1HRI 3;  1VE0 A;  4GA9 A;  3HQX A;  1PVC 3;  3PIJ A;  3E1F 1;  1HQW A;  2VMH A;  3HQU A;  5LCW L;  4JVA A;  1QQP 2;  5EYY A;  5APA A;  4JQR A;  3DGT A;  5D8A C;  1SPP A;  2OT7 A;  4XMI A;  4AI8 A;  5KXC A;  3AMH A;  4K8F A;  4U2A A;  3ILF A;  1H2N A;  3AVR A;  5JAX A;  3NMB A;  2LW8 A;  2HYK A;  3VKF C;  1PGW 1;  4QB1 A;  5K0U C;  2EIB A;  4LLO A;  5LBB A;  3W58 A;  1JOB A;  4A45 A;  1S1A A;  1NLS A;  2JDN A;  1HXS 3;  2IFR A;  3BPZ A;  3KS7 A;  5C3O A;  3AYC A;  4QXK A;  1CGP A;  3WG4 A;  2VU9 A;  4C0H A;  2DCK A;  4F3J A;  1DDL A;  4A3Z A;  4ZXK A;  2VW1 A;  3C7G A;  2W92 A;  1RUC 3;  4B3N A;  2C9K A;  2P2K A;  3HBZ A;  1QMJ A;  1TME 2;  4K7J A;  5LA0 A;  1F2N A;  2E7Q A;  5CU1 A;  5DUW A;  3VDC A;  3WZ1 A;  1W8H A;  3SKV A;  1PO2 2;  2VPV A;  3T4V A;  2OYZ A;  2KXL A;  1LTE A;  1EYB A;  2R07 1;  4XF9 A;  1V70 A;  4BXF A;  3H3L A;  1CAV A;  4Y1V A;  2OW4 A;  5JR7 B;  1TMF 2;  2ZGQ A;  4B4R A;  1K42 A;  5BXX A;  2XQR A;  4L9B A;  2C6S A;  4NOT A;  1ND3 C;  1OF3 A;  5ANN A;  3ZIX A;  1JOP A;  1SFP A;  3OSD A;  1RUI 2;  5CFC B;  1MQT B;  4CZS A;  1H2K A;  2RE9 A;  3NQH A;  4EN8 B;  3S5Q A;  4Q0U A;  3GZE A;  1MS0 A;  1W0O A;  1QHD A;  4BQY A;  4OZO A;  4Z2W A;  5JZG C;  4B29 A;  1LOF A;  2O8O A;  3JB8 A;  5B4X A;  1CIW A;  4QQ2 A;  3LIG A;  1DGL A;  1WME A;  5DQ0 A;  3CKH A;  4RS5 A;  1KS5 A;  5DDJ 2;  2X5I A;  3UK9 A;  1AJK A;  1BK0 A;  3AYE A;  2MEV 3;  4NJ4 A;  4ASL A;  1O59 A;  1QQP 1;  3B5L B;  1EAH 2;  2RS1 2;  2D3R A;  2ZTN A;  4CDU C;  2BBV A;  4OUE A;  3WW1 A;  3GZU C;  3LD8 A;  4V2W A;  4BDV B;  1KFU L;  3WQ7 A;  4PDW B;  4CDX B;  3ZSJ A;  4JRA A;  2VH9 A;  3VZL A;  4GXL A;  4AI0 A;  3LIH A;  1WD4 A;  5CAD A;  1XC6 A;  2UUR A;  4GAL A;  4JHT A;  2RHP A;  2ZGR A;  1TNF A;  5E8A A;  1JHJ A;  1QJX 3;  3WVJ A;  4BJ0 A;  1DFQ A;  2CDO A;  1BYH A;  3EB7 A;  3I2H A;  4GWI A;  4EQV A;  4YSF A;  5C71 A;  1DIW A;  1LOB A;  3GJB A;  4BA6 A;  2WAB A;  5DPN A;  1FPN 2;  5F3C A;  1H30 A;  5F37 A;  1X8E A;  1TME 1;  4QPI B;  5LAS A;  3KT4 A;  1DLL A;  5IVV A;  4LOT A;  1WGP A;  1ODN A;  1D4M 2;  4O65 A;  2DCT A;  3BYW A;  3AZW A;  1QU0 A;  1SQ4 A;  1MZE A;  5FZG A;  4LBQ D;  3MIG A;  3ZXF A;  5DG1 A;  1TMF 1;  1VBE 2;  2UWB A;  2WKK A;  1WBF A;  5FZ0 A;  3A22 A;  4K3U A;  4E4D X;  2VOW A;  2YBK A;  3H8U A;  2BVB A;  2ZX2 A;  3C7F A;  1AXK A;  4ZKT B;  4H7M A;  4AQT A;  4LUK A;  1FYU A;  3NNF A;  4AG4 A;  2OA2 A;  1ODM A;  2XBO 1;  5T52 A;  2WNU C;  1LJ7 A;  2JG9 C;  1YQ6 A;  2XLG A;  2GNT A;  3R4U A;  2BRT A;  5I93 A;  1N1T A;  3WQ1 A;  2WNV C;  3GHN A;  3ZMO A;  4OI1 A;  1NA1 C;  2B39 A;  4DXZ A;  3WHT A;  2RS3 2;  3HN3 A;  4HVO A;  2RR1 1;  2EAA A;  2VR4 A;  4WM8 C;  3BIE A;  3ST7 A;  1ST8 A;  1S0E A;  1IG0 A;  4LBK A;  4YZ4 A;  1PGL 2;  2G19 A;  2VL4 A;  2XDV A;  1I1E A;  1UYP A;  4ITC A;  5A6X A;  1XND A;  1IZ3 A;  4YVS C;  3K4A A;  3H7J A;  4GH4 C;  1XNB A;  4FQZ A;  3HOB A;  1JU3 A;  4AI2 A;  5JIA A;  4NIG A;  1O4Y A;  4DS0 A;  4C91 A;  2GZW A;  2JG8 A;  2CGO A;  1AR9 2;  3ZIW A;  4I0A A;  1W3V A;  1GNH A;  5A7W A;  2UWC A;  3VHN A;  5JSO A;  1HB4 A;  3LOI A;  4AOC A;  1LRH A;  5GJ6 A;  1MZF A;  4E2Q A;  2CHH A;  2PHW A;  2X53 S;  4Q4V 2;  5L7O B;  1U0A A;  2WZE A;  1AR7 3;  3HNY M;  1LGN A;  3OPZ A;  4Y22 B;  3IAP A;  1TEI A;  1PVC 2;  1ZYB A;  1VAL A;  5E6H A;  5FKB A;  4FPG A;  2BU9 A;  3AM2 A;  4Y20 B;  2DTY A;  4CE8 A;  1W6Q B;  3ZKY A;  3NKT A;  3I49 A;  1MS5 A;  2L9L A;  4RFT 0;  1ZRF A;  4NVP A;  1D4M 1;  4M3C E;  4KBB A;  2VMG A;  1KEX A;  1V00 A;  4Y26 A;  4AHX A;  1W9S A;  1O4Z A;  2BBA A;  2NM1 A;  1V6I A;  2W95 A;  2Y8K A;  4ISR A;  5EQU A;  5A7P A;  4COY A;  2FZ1 A;  5KBF A;  1X7N A;  1ZBA 3;  1SFY A;  5JMO A;  2J22 A;  1LOC A;  3T0A A;  3KV5 A;  3MIC A;  3Q8F A;  4FP2 A;  1W2T A;  1N1S A;  2CY6 A;  4LIU A;  2QCS B;  3IN9 A;  1YQ2 A;  2ZCW A;  2BFU S;  4TXW A;  2W9X A;  3VBO A;  4IXL A;  2JE7 A;  2RDS A;  4AEM A;  3O1S A;  2CAV A;  4NPL A;  5LZ6 A;  1GOF A;  3GBG A;  4HFS A;  2ATF A;  3F2Z A;  2V5Y A;  2XQX A;  5A3W A;  3J8F 3;  3WUD A;  4UXA A;  3WV6 A;  1NQD A;  2WC2 A;  3ZXL A;  3R4D B;  1YEW A;  4O9E A;  3RJR A;  4AZZ A;  3III A;  4MET A;  3RRD A;  1BQP A;  1MZ6 A;  3ALQ A;  3EHK A;  3U14 A;  1WMX A;  4C90 A;  3T2T A;  3VUO A;  4JKM A;  4IV3 B;  1TE1 B;  4LO4 B;  4N53 C;  4IDZ A;  4E4S A;  3HAG A;  1EUU A;  2W52 A;  3GCW A;  4AGG A;  4E2G A;  2RM2 3;  2W0X A;  1YI7 A;  1LEC A;  1QEX A;  4JX0 A;  4MHU A;  4WBB A;  1XNC A;  3X29 B;  5L9B A;  1UYX A;  1NG0 A;  3DYM A;  4YVW B;  2AUY A;  3F95 A;  4GMP 1;  1UL9 A;  4IEW A;  2MEV 2;  3NV3 A;  1WA6 X;  2E26 A;  4JGY A;  4NHY A;  3TYJ A;  2WT1 A;  3ZPO A;  3VGI A;  1W9T A;  3PVB B;  4LO6 B;  1QJU 3;  4PLO A;  4UWD A;  4MUV A;  1VAK A;  3WCS A;  1UZW A;  4GB3 2;  5DUV A;  5K4L A;  2DFB A;  2XOM A;  3QBQ A;  3D4K A;  4LA2 A;  5FXV A;  1HRV 3;  2CDP A;  2HKX A;  3BGA A;  2R04 2;  4M3C A;  3I3M A;  5CZK A;  1QJX 2;  4Q4Y 3;  3LSD A;  3PHM A;  1O4T A;  2AH2 A;  2VZU A;  3A4U A;  3ES4 A;  1MVQ A;  4ZU4 A;  4CCC A;  4CXW A;  2CTV A;  2VCB A;  5L9V A;  1OPO A;  4Q1R A;  1C3H A;  1JHN A;  4ZZ8 A;  3CJI C;  2Y6L A;  3PMS A;  4XZP A;  5FYB A;  5ANQ A;  4LHL A;  1MAC A;  1VAM A;  2HWD 2;  1LCL A;  1PIV 3;  3ZR6 A;  1HN1 A;  1W39 A;  1OLR A;  1RMU 2;  1RJ8 A;  1RUJ 3;  1VBD 3;  1JBC A;  3PUR A;  3NJY A;  4M01 A;  3WP5 A;  2YUE A;  2RS5 3;  4BQ4 A;  2WA3 A;  5JPN B;  5DXD A;  2VBB A;  3SXW A;  2A73 B;  1OFS A;  3PUQ A;  2HWE 3;  3ZYI B;  1DHK B;  1BJQ A;  3ZFF C;  2ZHL A;  3VBF C;  1AL0 G;  2JKB A;  3HT2 A;  3BKZ A;  4HVR A;  3Q8C A;  4QQH A;  2WS9 2;  3C8X A;  4IER A;  2PEL A;  2VG9 A;  3PL0 A;  2XJU A;  4A7Z A;  1SBD A;  1XXN A;  2G9Z A;  5A33 A;  1NQJ A;  2D3S A;  2J1R A;  2UYA A;  1A8D A;  2VCM A;  2VGD A;  3LCP A;  4EJR A;  5EHD A;  4W6Y A;  2NPI A;  2A7A A;  1CX1 A;  3ILN A;  1W6M B;  1UY3 A;  1DQ4 A;  4IEO A;  4L97 A;  4GB3 1;  2WAO A;  4LKS A;  4A7Y A;  2GAL A;  2W1W A;  5FZE A;  4EN9 B;  3GCX A;  2OS2 A;  4DMI A;  4LEJ A;  3THP A;  1GWM A;  2R04 1;  1WKY A;  3MEP A;  3ABZ A;  3KMH A;  4LBJ A;  5TSW A;  4XF1 A;  5GZD A;  1JYT A;  2BFU L;  1AR7 2;  1OA3 A;  2CNA A;  1K45 A;  3K4Z A;  3OGS A;  1HV1 A;  4R9C A;  4BQ3 A;  1O3S A;  2C24 A;  4MLO A;  3I3E A;  1OXC A;  4OI4 A;  2E53 A;  4XBQ A;  4CU7 A;  2ZZJ A;  3VBU C;  4FTS A;  1WW6 A;  1E5H A;  3JUU A;  1YFU A;  1VLN A;  3IBM A;  3FFQ A;  2DTW A;  4QXC A;  1GP5 A;  1UIJ A;  2JIJ A;  2WA4 A;  3AB0 A;  4XC9 A;  4AED C;  2HWD 1;  1YUD A;  2FDI A;  2BZD A;  5FZO A;  4XW3 A;  1G86 A;  1PO1 3;  1GYK A;  1RMU 1;  5F2S A;  4UW3 A;  1N3O A;  5A70 A;  4KU8 A;  4KWJ A;  3APB A;  1IS3 A;  4XFH A;  1YLL A;  4CCD A;  2GC0 A;  5BY5 A;  4YM1 A;  1IHM A;  5JXI A;  2WIN B;  1QGL A;  3UGF A;  4IL7 A;  4PCR A;  4UOJ A;  5CFC A;  1MQT A;  1D2Q A;  2AAC A;  4PIY A;  3ZO0 B;  1UU4 A;  3INA A;  5FMO S;  1BZW A;  1C1L A;  2FMD A;  3AXE A;  2WS9 1;  2YC4 A;  1FAT A;  2XB6 C;  2V4V A;  4UFJ A;  4I2O A;  1EV1 1;  3Q8E A;  3KHC A;  5JWP A;  1LEM A;  2EA7 A;  3J8F 2;  1RUD 2;  1V9U 3;  2VNG A;  2ZEW A;  4XHX A;  3ZN5 A;  1GWK A;  1ULP A;  2YV8 A;  5T5L A;  5IK5 A;  1H8T C;  1W8Z A;  4AVC A;  5C70 A;  2JIC A;  3WQ0 A;  3MLL A;  3V64 A;  4OHW A;  1Q8V A;  3BVC A;  3GGL A;  4LIV A;  1R1A 1;  4XAA A;  3V56 A;  4PDW A;  4QPG B;  5FZ6 A;  2WFP A;  4CDX A;  4QWN A;  4XCA A;  2R1B A;  3TN9 2;  1GAN A;  4IND A;  4S2D A;  4GZ9 A;  4YFZ A;  2RMU 1;  5HCF A;  4XF4 A;  4OUL A;  3ZSK A;  5JDB A;  4AL9 A;  1UXX X;  4XF3 A;  5F8P A;  4YM0 A;  1VBC 3;  3RWN A;  1QOT A;  4CDQ C;  5LBC A;  3SQO A;  4MHR A;  3WLU A;  1FOD 2;  3J7M A;  2CSG A;  3MPP G;  1YO8 A;  3T08 A;  1SLC A;  2PHF A;  2YYO A;  2G9F A;  4QPI A;  1ND2 B;  4I3G A; 
#chains in the Genus database with same CATH homology
 4PHZ A;  3RFR A;  3RGB A;  4O65 A;  4PI2 A;  4PI0 A;  3CHX A;  1YEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...