4O65A

Crystal structure of the cupredoxin domain of amob from nitrosocaldus yellowstonii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
159
structure length
153
Chain Sequence
QLQSRFVKIEDETFSATRLITKAEFAKRTFGNSDLETLKQVDAMGCDPARRQDVLIVTGRLVSQVKQDLNAWISLFTNRWEFISRDPPGNVFTIPGGGEVPYKLCLSALEPGTYHAHTQLNIASVGPGLGPGMSIVVEGEPTEKPSAWSHPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative archaeal ammonia monooxygenase subunit B
publication title Structural conservation of the B subunit in the ammonia monooxygenase/particulate methane monooxygenase superfamily.
pubmed doi rcsb
source organism Candidatus nitrosocaldus yellowstonii
molecule tags Oxidoreductase
total genus 34
structure length 153
sequence length 159
ec nomenclature
pdb deposition date 2013-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4o65A00
4O65A 4PI2A 1YEWA 3RGBA 4PI0A 3CHXA 3RFRA 4PHZA
chains in the Genus database with same CATH superfamily
1YJLA 2QQJA 3LPFA 5D8AA 5FCCA 2GP3A 2XJPA 4LBLA 3WX5A 4CXWA 4D69A 2UU8A 3WQ7A 4NJ4A 3J9SA 1G6NA 2AREA 3W59A 4CDWC 5E1RA 2YC0A 2Q1ZB 4LBQD 1V6IA 3B00A 4JQRA 4LA3A 1YQ5A 1PO13 5JUVA 1W8NA 3VHNA 3K3OA 2Q8EA 3UESA 2FZ1A 1WMXA 3O0WA 4NE9A 5A1AA 5K7PA 1GFF2 3HQXA 4LMFA 3KVAA 2BVBA 3HT1A 1FMD2 3RS6A 2ARXA 4Q4X1 5C3RA 2YV8A 5FY5A 4AQ6A 4K1YA 2JG9B 3V65A 3UV9A 2JDMA 2V4AA 4D8MA 3O1VA 4PF5A 4XCAA 2XG3A 3OJBA 2LW8A 3Q8BA 5KXBA 2Z42A 3WVJA 5BNNA 3RI9A 4O7XA 4M3CB 3NL1A 3S57A 3WG3A 4L2NA 5HV0A 2DU1A 4YGBA 4OI1A 1QF3A 4N43B 5GLTA 4JDOA 3I54A 3RDIA 1O7FA 4H7LA 5JZGC 4FT8A 4XF0A 4XQWA 2UYAA 2SLIA 3MPPG 3OTFA 4XBQA 1YQ6A 4ZPIA 4K7JA 1LU1A 1ZBE3 3VDCA 4Q4W1 1LESA 5GLUA 4RS5C 3JCIA 4N9IA 3K2OA 4QM9A 4B8EA 1Q8OA 1DGRN 1VBB2 2QDNA 2WIIB 4DOUA 1LHUA 1OXCA 1R091 3AYEA 4AEMA 4AFMA 4QGLA 3QH7A 3RRDA 4EN0A 1AL22 2WNUB 1ASJ2 4FOYA 4YLZA 4CEWA 1YC61 3ACLA 2R49A 4BCUA 3CLPA 1G9FA 3PIJA 1Z7S3 4K8FA 3S7EA 1HW5A 1NE4A 2VR4A 3D3AA 1PVC2 3MIHA 4UWDA 2Y0IA 3T09A 1D4M1 2Y6FA 1OF4A 1ULPA 2J1UA 4QKNA 3SKJE 1PO12 3CMGA 4D6SA 3O1OA 3ZXKA 3WW4A 1RTVA 3MV11 1SBEA 4MG2A 2OT7A 3H7JA 1WW7A 1GZWB 2BNNA 5L7OA 4GB31 1LAJA 3IMNA 4QT6A 1OH3A 3I4IA 2B8MA 2R7EB 2CWSA 2WT1A 3P5BA 1AYM1 1S2EA 1K12A 1HQLA 1U5IA 2LRPA 4QXHA 4CZSA 2MEV1 4YVWA 1G9DA 1BBT2 1F2NA 3HIFA 2ZGMA 1QQP1 5HCBA 1F4HA 1Y7BA 4RYDA 1O3SA 4Q5OA 4TWTA 2CAVA 1WWYA 1YFWA 2CHHA 2VCAA 3ACIA 3OPZA 4HMZA 1Q5OA 1DYKA 1L7QA 1C3HA 4J1XA 4N9HA 2KXLA 4HPKB 1AR93 4P08A 4UF0A 5FPXA 4UOJA 1B09A 3MZHA 2JJ6A 3ZSJA 1E5HA 5A6QA 1LGNA 4YZ1A 1ZBE2 3U07A 1S0BA 5A7WB 5F2SA 2ZABA 3DPRA 2VZVA 4JTNA 3H42B 1JTZX 5FMOL 1C28A 1NLSA 3IAQA 3LSEA 4I09A 3BIEA 4AYUA 4E4DX 2D3RA 4YG6A 4D6RA 1RXGA 5A80A 1LOEA 1PZ8A 4UW3A 1UYYA 1US2A 2RS51 5FAXA 5GALA 4O9EA 5A33B 3LD8A 4OVEA 1Z7S2 1OI6A 5FMDA 1EV13 5B2GB 1S2BA 3E5XA 2AC1A 1L7RA 4GJZA 1D0HA 1HLCA 1PX4A 2ZKNA 2WFPA 2XJUA 5H9PA 1AR71 4FPYA 4GJYA 1VP6A 4B7EA 4CXXA 5FDBA 3MW4A 3HBKA 1SLBA 2PLV1 5JMCA 4XHXA 4NWWA 1ND2A 4ASKA 4IV3B 5EYXA 4GWIA 3U0ZA 1QKQA 4YM2A 3AK0A 5T5OA 4K21A 3WR0A 3R05A 1K42A 5BNOA 3P3PA 4XMIA 3CZJA 4XXAA 3IDEA 4GZ9A 3TYJA 4A4AA 4E27A 3UL2A 2IC1A 2TBVA 2EIDA 2ZEXA 5EZWA 2DFCA 5T3NA 3AJZA 1W6MA 4DEQA 3TN93 1DZQA 1M06G 1H9PA 4HKLA 4QPIB 3OB8A 2J1AA 1KEXA 1H8VA 2X5IC 3IN9A 3T0DA 3RSJA 5GM0A 2FDKA 3WNMA 1U5XA 3AP7A 3NNMA 5CZKA 1LHWA 3ETQA 3M8LA 2Q5TA 3QCWA 5T50A 5IVFA 5C6CA 3POFA 3AB0A 2W9XA 4YGCA 3CJXA 1VPHA 1UNBA 2P3IA 2XOMA 4A3ZA 1JXNA 4WM8A 1EAH3 1FMD1 1GOGA 2IVJA 5C4WA 4QX7A 4X6RB 2QCSB 3GZEA 3NWKA 2W1UA 4HK8A 4AG4A 2EF6A 2HKXA 2Y6KA 1W2OA 5DDJ2 1AX1A 4XF3A 5TSWA 2VXRA 4HVRA 1WLTA 2PAKA 4MHUA 5BNPB 2WBKA 2OKXA 3C3VA 4CCLA 4DUXA 5FJKA 4CDXC 1EV12 2NN8A 1JZ4A 3W5NA 2W1SA 3C7HA 2ZHNA 2XONA 4M4PA 4UFJA 5C8CC 5KXCA 3BTYA 3DXTA 5FZ1A 3PDQA 4CP0A 2XQXA 3AKPA 3AZXA 1W8WA 1Y9MA 3BVCA 3HN3A 3URFA 4NIGA 2N7GA 4R9AA 3ES4A 4GMP3 2EIEA 5K9YA 5JIAA 4P9YA 5LEKA 1PVXA 4A7YA 2PELA 5A6YA 3TOJA 4CDWA 4ZHNA 1NQDA 3LSDA 1H0BA 3IDBB 2YFUA 4W4ZA 4BQWA 1AL21 5LATA 3WQBA 5A7OA 1BVP1 2DBIA 3ALQA 1UPSA 5FY4A 3VBFC 3ZR6A 1F4AA 5JOZA 3OPWA 3IAPA 2QQOA 4CDQA 3WLUA 3Q8AA 3N9PA 3D5OA 3K3NA 5JVVA 4Q4V2 1KJLA 4AW7A 2ZAAA 1PO11 3MYXA 2WSUA 5IAXA 1BMV1 1TQ5A 3VD9A 4PBOA 1MVEA 5FZ3A 2GC0A 1OD3A 4GIQA 2RJLA 1GNZA 2C24A 2J1VA 3DKWA 1EAH2 4AEJA 5IATA 3IT8A 2D93A 4LBJA 3CIHA 4X8NA 3F95A 3OD0A 5JZGA 1VR3A 2W94A 1BBT1 1EPZA 2JDHA 3ZFEC 1GOHA 1QEXA 3R0RA 4FXGB 4PCRA 3TEZA 2SBAA 4RL7A 2WAAA 3NNJA 3VZLA 3ZFGB 3J7LA 4AR2A 3I59A 3AMNA 3GJAA 4NWVA 4RS5A 5J96B 5CFDC 3HEIA 1DQ5A 2P4EA 3PU8A 4RR3B 1WLWA 1OKQA 2D3SA 4Q2FA 4A2UA 2O8OA 3ZYRA 2NP0A 3VBHC 4IW3A 4C8DA 3I3DA 3M2MA 2B39A 3KLSA 1ZBE1 2E7QA 3WT3A 3WW2A 5BV6A 4XW3A 2CL2A 4JAAA 2V73A 2BEOA 5B4NA 4NHYA 3WF2A 3O0XA 3OUIA 5AVPA 3KV4A 4CE8A 2AEZA 3LDRA 5LWBA 2ARAA 2J1TA 1RMU3 2ZKLA 3A0NA 3CL1A 4FOQA 5DAWA 4ARYA 1HRI3 4EYUA 2B42B 4PT6A 2D6OX 1AL0G 5ERLA 4CU9A 5L73A 1Q43A 2QZ3A 3T08A 4ORFA 4FAHA 3TEWA 4URAA 1Z7S1 1D7PM 3E97A 4XFIA 1TME2 2VM9A 2ZHKA 3B3QE 1UXZA 3KV6A 4YZ4A 3ZN6B 1ALYA 1O59A 1GU3A 2B45X 3O1TA 4IGQA 1EP0A 3VD3A 2LROA 1NY72 5FMCA 4MXVA 5FYVA 3NQHA 4UW6A 4BE3A 1XC6A 3PUAA 5FP3A 4FPEA 4MGQA 4LULA 5JXIA 2Y0OA 1W05A 2WJSA 5FY1A 4S2FA 4MOAA 3V0AA 1CGPA 3OYWA 3EB7A 1HJGA 4ISRA 4Q0VA 4XUQA 4KBBA 3T0BA 3VKLA 3N4MA 5K0UC 3AMPA 2MHFA 1Q56A 1K45A 1BZWA 1RITA 3BPSA 3KM5A 4KU7A 2DCJA 2VUCA 1X50A 3A21A 3O1UA 3GZTB 1QNYA 2VZPA 4M3CE 4LKFA 2VOWA 2YGLA 4BJ0A 5FXWA 5HXVA 2YXSA 3U11A 1V6KA 4BISA 2OUJA 1PHMA 1W6PA 1OT5A 2CDPA 2P34A 3GALA 4PDWB 2QQIA 5FZGA 4DFSA 3VBOB 1NOVA 2V4VA 4FFGA 1RJ8A 5A7PA 1UIJA 1RUD2 2QQLA 2JG8C 3MPBA 2RVAA 1QY4A 2JE7A 2OPKA 1RMU2 2Q0AA 2YUEA 2C9KA 3I2FA 4JDMA 3PUIA 4XIOA 2WFF2 1W9FA 1C8NA 5DDJ1 1CESA 5T5PA 1LOBA 3S5AA 1W6OA 2YGMA 4P5YA 3LEIA 4QB2A 3WP6A 3OEBA 4LBKA 1CAVA 3B9CA 3NAPC 1KGYA 2W47A 4FPJA 2D5FA 1EV11 3SKVA 1VJ2A 4LO5B 4S2HA 1A8DA 2GH2A 2QQWA 2L9LA 4BZ4A 4W6YA 3FUOA 2LM3A 1OVPA 1WA6X 1N1YA 3RNSA 3VHOA 5KHGA 1O4TA 4RHV3 1W28A 1AR83 1NZCA 4N53C 2B9VA 4EN7B 1CD3G 3WF3A 1PGL1 3JQXA 1CWPA 2P6CA 2XHKA 1GLHA 1TE1B 1X33A 3AZYA 3VD7A 3I2OA 1J59A 1UY2A 1JBCA 1TG7A 4PIZA 5LA0A 1PIV3 3UT0A 1MQTB 5C9AA 2GALA 1WLDA 3ZKUA 3ZYGA 3N36A 2K9ZA 5LBBA 2EAKA 2WNVC 2VTXA 1KQRA 4Y22A 5FYYA 1APNA 3M3IA 4KBZA 1YQ8A 1NX9A 5I0TA 5FYBA 4AHWA 2WWJA 3ELNA 5EWSA 4CP2A 2BZDA 5F39A 1COV2 3UGFA 3WCSA 3WNOA 3WF4A 4CDXA 1EAH1 4BOWA 2JDYA 2QTWB 4BHPA 3W58A 5C8CA 2GNTA 2XQRA 5FKCA 2CWMA 4NIHA 1OFSA 4QX5A 4XAEA 1ODMA 4ZU7A 1TZOA 1P8JA 2TUNA 4AI2A 2YYOA 1VBA3 4HKOA 3RZGA 2W2IA 5BPXA 4RFRB 5FZ8A 2HWE2 1OQDA 5FXVA 2ADDA 2WKKA 4XBLA 5GLVA 1U5ZA 1W04A 3HNMA 3VBFA 1S0FA 4KGQA 4YWAA 5I91A 4NPLA 1ZRRA 2DUQA 1CAUA 1YI9A 5T54A 1REDA 3J8F3 3DN7A 1LEMA 4QDSA 4QHBA 4XHBA 3M3CA 1NG0A 1XNCA 1RGSA 3MHZA 4IL7A 3ZKYA 3MGUA 4UI9L 3LAGA 3E6DA 4OMDA 3MEPA 3U4XA 1STMA 5T5LA 4JGYB 4ES8A 4IETA 1CZTA 2Y26A 4M01A 4MGYE 1TME1 3MF9A 3CJIB 2VOKA 3T1MA 2BWAA 4XJ9A 3FHAA 3ST7A 4HONA 4Y5SA 4D7TA 1A3KA 2XVKA 3D0JA 5FLHA 2A6XA 2Q8DA 5FJHA 4LQRA 1NY71 4ZS2A 3SLIA 5LB6A 4G4FA 1YHFA 5F5CA 2RM22 2A3YA 4IE6A 4IXLA 3AP6A 2GMPA 2QQUA 5FYCA 1NAEA 2NMOA 4K3UA 1AJKA 2F4LA 5JI7A 5L9VA 3VDDA 3IZOA 2PHTA 2W68A 3H8RA 3CHXA 1JYCA 2OX0A 5F6KA 2PMWB 1KS4A 3HBZA 4ZZ8A 4CUGA 3V64A 4JGZC 2E51A 1DG6A 1VBA2 1EY2A 5E88A 5T52A 1RUOA 1QJZA 5AC92 2CYFA 2NZ9A 1GWKA 3NJVA 5FZOB 1JYTA 3RPQA 4AVAA 3E1F1 2A6YA 2ZGQA 3M3QA 4JHTA 4B1MA 2IXCA 2BPA2 4NHMA 5JOXA 4QQ2A 1W8FA 3NSTA 4JRAA 3ZXLA 3T2TA 1JI6A 3SCGA 5FO9B 4AVTA 1NA1A 4AXOA 4FOWA 1RUD1 5T5JA 2OQ7A 3J8F2 1LOCA 2AZ5A 2XMLA 4LORA 4EWEA 5FWEA 2RR13 1RMU1 1YNAA 3KS7A 4NRMA 4QKBA 5CFCB 1EUUA 1HRI1 2HJIA 2QFEA 3ME2A 3NJZA 4JQTA 4K6BA 5A7QA 2A75A 4MXWB 2QZ2A 4Q1PA 4QX0A 4YW1A 4FAGA 3GBFA 3A7QA 4JKKA 4R4ZA 3UKTA 1BK0A 4DNYA 4I2OA 2IZWA 4PLNA 4G3YC 2FHRA 1JUIA 3VZJA 5DAPA 2HWC2 1MS3A 2OUHA 3QLQA 5C70A 4BQYA 2JG9C 1RXFA 4YW5A 4CVUA 3RZHA 2Y33A 4F7ZA 3O1PA 2VMEA 5K0UA 4XF4A 1HV1A 1W0OA 2XWBB 3WP3A 5J09A 2D44A 5F5QA 5A3WA 1VIWB 4QXKA 4LK6A 2DYCA 4OZOA 4AF9A 4KWJA 3LPGA 5I93A 1QJX3 3BPZA 1OFNA 4A3XA 3ZXDA 1CN1A 5F1RA 2WT2A 3OGRA 5DG1A 1JU3A 1OA3A 2DTYA 4ET7A 5E6HA 3CNAA 4N7UA 3H8XA 4E8CA 4YVSB 5FZLA 1E5RA 3WG4A 2X09A 2JG8A 1RINA 2I45A 3VBUB 3UJOA 1U5YA 3PMEA 2K0GA 4K8RB 5FOBB 5JSOA 1DQ2A 3MLLA 3VHPA 1ZVFA 1XXNA 3FL7A 2WNUC 4EN8B 3DECA 1W6QB 3NAPA 1VB4A 2FMDA 3O1MA 2WSVA 1QWRA 4IEYA 4OI4A 5JAXA 3HNBM 2RR12 1QH7A 5DXDA 5FP7A 4NHXA 4HT1T 3I3QA 3TB0A 1S0DA 1CQ9A 2VO5A 4CP9B 5IK8A 2Z79A 4GH4B 4IEQA 3KMHA 1OOPA 2VMDA 1N1VA 2DVGA 3MI8A 4CUBA 5C71A 5IK7A 1SMVA 2OYZA 3ZSMA 3GF6A 4KG8A 3RWNA 2ENRA 4AQSA 2KA3A 3SCFA 1OURA 1N47A 3AKQA 4YW2A 4D7SA 1OUXA 4CCMA 3V56A 3ZPOA 5KC5A 5FLIA 2R073 4XVHA 5D2AA 3AC0A 2H6BA 2VZ1A 1VBC3 3MW3A 4BDVB 1GMMA 2D3PA 1AR81 2XVGA 4HANA 2XGXA 2WNVA 4FI9A 1OSGA 5F2WA 5B4XA 3JB4C 1GSLA 4OZXA 5ABJC 5KHIA 3OGJA 3VZOA 2D5HA 1D0GA 5F8PA 3ZDSA 1OVSA 1QJX2 4LOTA 4C1XA 4CUAA 2G1MA 3WUDA 1DU3D 4C90A 1PIV1 1OA4A 3E5UA 4RFT0 3MLKA 3MIGA 2NLRA 3THDA 3EQEA 1XE7A 4L99A 4CCNA 5FR3A 3U10A 2WO3A 2Q4SA 2BBAA 5LBCA 4COYA 1JHNA 4NVPA 1RUI3 1W3XA 4XJAA 2GDFA 2WLPA 3JUUA 2VQUA 1U12A 5CB7A 1KRIA 3ENRA 1W9WA 1XB9A 1PNGA 2WQZC 4S2GA 5JXGA 2ZEWA 2B5HA 2GN7A 2ZZQA 2JDKA 2HH9A 4W6XA 4D94A 2VOVA 5I0SA 1LULA 4Y20A 2C6SA 3GM8A 4Q8KA 5CEHA 3ATGA 2VZ3A 2E31A 1DGLA 2CY6A 2X8KA 3TBDA 1J3RA 4EV0A 4MGIE 2E7AA 1J3QA 1QJU2 2V72A 5I0DA 1VBA1 4UBGA 3QH6A 1QNWA 4AEDC 4YW3A 5FY7A 2DV9A 4U2AA 5J37A 3PVEA 4IV3C 2ZAHA 4CSWA 4JV4A 3K51A 3KWVA 5CAZA 4HN1A 3GCWA 2XLFA 3GBGA 4KQ7A 1HQWA 4Y1UA 4XPVA 3BGAA 4YSFA 1RL3A 1VBC2 1G7YA 2BGCA 2AR6A 2HEYF 2VOXA 2VE1A 3LA2A 4PHZA 4Z8BA 4QU2A 3APBA 4LBNA 1KS5A 4IEZA 1FNZA 2ORXA 3J8F1 4YARA 2VZOA 1ZRCA 4QPIC 1LODA 2ZGTA 3PL0A 3KGZA 3WINE 4IV1A 4NHLA 2PHXA 1V0AA 2OA2A 4LK7A 1QJFA 1HX6A 4CA9A 1FOD3 1JYWA 3KT1A 4GKYA 2G9GA 4XUOA 2I2SA 3B02A 1UY3A 1VBB3 4XACA 1YLLA 1RUI2 3BU7A 1Q3EA 1H8TB 4M4RA 4OHZA 3BTAA 1ASJ3 1H2MA 4NAOA 3POGA 4OYUA 4NHKA 4HLTA 4Q0PA 2Q8OA 3WV6A 5CISA 2JKXA 2JDAA 5FQ0A 4D7YA 4FCAA 4AAPA 1S0IA 2EIGA 5BNPC 1F5FA 2ZACA 3I3EA 1PVC3 2BUKA 4JGZA 5D8AB 2XPJA 3PJQA 2DCYA 3HPNA 3KVBA 2BOJA 2JEMA 3BTXA 1JODA 2E32A 2Z2SB 1UL9A 4AGVA 1KFUL 3WD5A 1N1SA 1PGSA 3N3HA 5BUVA 3GHMA 4L92A 1FI2A 3GZUC 4IGOA 2BOIA 1ENXA 1JHJA 3AKSA 4YG0A 2IXHA 1NZIA 3VBRA 5LRSA 2PHFA 4ZU5A 3SMHA 1MS4A 3WUCA 1G9CA 2FDIA 4A42A 1RUG3 5F5IA 1FXZA 1BBT3 1ENSA 2BBVA 3CZUA 3B01A 4JKLA 4XCBA 1AXZA 1ZZ7A 4OQ8A 4BB3A 2J7MA 2E26A 3CBNA 5FYTA 3ZOIA 3L2HA 3DCQA 5KR7A 3W9AA 4BLIA 2ARBA 2FCUA 2X29A 1ZX5A 2RR11 2A1XA 2XLGA 4AZZA 1POQA 3OBZA 3GBWA 3G7DA 2OW4A 2ZBJA 3O7OA 4LO4B 4L97A 1YEWA 1O3QA 1H9WA 2JG9A 3BB6A 4LUMA 3S6PA 1FOD2 1IKPA 3LFMA 3TNQA 4DEVA 4FPOB 4WM7B 1DGWA 4PJYA 4PIYA 3WNNA 3IWZA 4W8JA 3VUOA 2ERFA 5JOYA 1GV9A 2BRTA 4M3CA 1SFNA 2YDEA 1XE8A 4B1LA 2D98A 2Z4FA 4COWA 4QPWA 4GAZA 3USUB 1AR62 3AFGA 1FT9A 2FBEA 2VU9A 2X10A 1QH6A 4CEWB 1X7NA 3CEWA 1RUF2 4IUGA 1ENRA 1ZBA2 1CAXB 5FZCA 3ZFGC 1A8MA 3RJ2X 4UT5A 4DINB 2XJRA 3TNPB 3X29B 4AFCA 1ZRFA 4AGGA 1S55A 1LGBA 2BNMA 4CRQA 2VBPA 1QJX1 1CIYA 1LOAA 4AE2A 3EYPA 3KF3A 4XFGA 4E4SA 5J48A 3AMHA 5A1LA 2WNUA 5ANNA 1UYZA 1RUG2 1JS9A 5IVCA 5DAQA 1SPPA 3RZZA 3FWEA 2WUHA 1SDDB 2F6BA 4IGPA 2EA7A 1SG3A 4P9IA 3KZ4C 3QBQA 4M0NA 4ZXKA 4UAPA 4KG0A 4MVTA 2AACA 3UYJA 3G6JB 1Z0HA 5J98B 1CAWB 1V9U2 2WABA 1GZWA 2WAOA 1X8EA 2VZTA 3BOPA 4I3PA 4MX3A 4UF0B 4UFHA 5FZ7A 1FYUA 1FATA 4XZUG 5FY9A 3AZWA 3L2YA 3OCPA 2VMGA 3WEZA 5JOWA 4MGSA 1DFQA 2NQYA 3N9LA 4WZFA 2J22A 5DABA 3ZSKA 3W20A 5D21A 3FHQA 5FZAA 2XB6C 3FBMA 4P9LA 3WDWA 3GJBA 5DDJ3 4QXBA 2DTWA 5ABJA 3KQ4B 4HPKA 3VN4A 3B69A 2R071 4XE9A 3IB3A 1A6CA 4XABA 1VBC1 3UGHA 1X8MA 1EUTA 5IWFA 3NKGA 3ABZA 4X8PA 2A6ZA 4LBQB 1WMFA 4MV2A 4EQVA 4QKDA 4WV8A 4WVWA 2B46X 1VLNA 1SQ4A 2JXAA 4LITA 1E5SA 4EZHA 1GBGA 3WXPA 2QE3A 1CZSA 2AUYA 1OBNA 1XNKA 2DCTA 2GNDA 1ND3B 2CU5A 3EBRA 1O3TA 1VMJA 5EV7A 1SHWB 2UURA 3OGSA 4PDWC 3U78A 3HQUA 3VBOC 1JYNA 4Q0QA 3BOWA 5IAVA 1RUI1 5FZ6A 3WDXA 1UZ0A 2JDNA 4P5HA 3WQ1A 1W8TA 4XURA 5JLVA 4FPFA 2BFUL 3UK9A 3AZVA 3OBRA 1W6MB 2P3KA 4JDNA 1Y43B 3VZMA 2VTXJ 1G9AA 1MS5A 5FK7A 2OQ6A 5IVJA 4Q4V3 1MS1A 4BXSV 4IV3A 4YZ2A 3ZO0B 1VMFA 3I2HA 4P9XA 4BIFA 3AYAA 4BA6A 4UW5A 1CX4A 3IIAA 5DUUA 1HB3A 4QB1A 1O8SA 3K75B 4HSLA 2MNGA 1XNDA 2YBSA 4DY5A 1OLRA 1HIXA 5FYHA 4COUA 2YG0A 2W87A 1LCLA 4BMBA 3I2KA 4LO7A 5J1XA 1QXPA 4GQ7A 1K5MB 4AL9A 5IHRA 3K77A 2WO7A 3CDZB 3JBG3 3T30A 4LLOA 3TEXA 2P3JA 3K4AA 1H30A 5J3UA 4N90A 4HVOA 1S0CA 3THTA 5A3MA 1QXJA 1AJOA 3ES1A 4IE0A 2VZQA 4I0BA 4RA0A 1MQTC 3VHRA 3KGLA 3T0AA 2OS2A 1IGOA 1F5JA 4NIIA 1MVQA 3I2DA 3VDBA 3FJSA 2ZX2A 3I97A 1ACCA 1TNFA 3VKOA 4DZGA 5F3CA 2JX9A 2R32A 3U37A 4AEDA 2VMFA 3M70A 1FOD1 2DUOA 5LA1A 5FFOC 1WD4A 3HNYM 1O8PA 3WW3A 4AFBA 4AHZA 1MR5A 2V09A 1VBB1 3AYCA 4UFMA 1NUKA 1WCQA 4HSJA 3KQRA 2IXLA 5K4LA 4Z2WA 1RUH3 3RMXA 3LA3A 1ASJ1 5FBJA 4KI5M 1IG3A 1G86A 5FZMA 2NYYA 4WVVA 4YM3A 2D6NA 4XC9A 5FPAA 1TME3 3LDKA 1PVC1 3UJQA 2VW2A 1ENQA 2Y6JA 4CDQB 3BKZA 3RYKA 4UYBA 4MZUA 1D2SA 1UY1A 1ZZ9A 1H6YA 3HQRA 1RVF2 3VL9A 3AKTA 3WOGA 4FFFA 4GA9A 1RUG1 2D97A 1DIWA 3LE0A 4O61A 1NXD1 1NKGA 2G19A 3M3EA 1GR3A 1HJFA 2HWB2 5DMYA 4NIDA 5IK4A 3JBG2 4BQ2A 4DQAA 2J1RA 2RMU2 1WCSA 2OVUA 5A3UA 4FP3A 2KD7A 1W8HA 4YRDA 3MUY1 1G8WA 4JGYC 1V9U1 1LOFC 1W99A 1RUNA 4QX3A 3S7IA 1UW8A 1JW6A 3M3OA 3CJIC 3OEAA 1GANA 1PGW2 1N3OA 3P6BA 4FFIA 1JOBA 4Z82A 3FBYA 4ASLA 5CG9A 1NT0A 4QGNA 4XIKA 2C9AA 5FUPA 5LY1A 1VBD3 2IWGB 3EO6A 3N7JA 1RUD3 2RE9A 2W1QA 5A6XA 5EYYA 3ZFGA 1IZ3A 2BWCA 3BU0A 1UIKA 2XH6A 1V6LA 2WFF3 3ZMOA 1RUH2 4QB6A 2VC9A 4WBBA 5LA2A 1OLQA 5CKNA 4HK9A 5IT6A 4KMQA 5KHKA 5EHDA 1ZZBA 4OUSA 3ZXJA 1QXRA 1WMEA 1X9TA 1O5UA 5F3GA 5DG2A 5FYUA 2C5DA 1UQXA 1ZZCA 3KCXA 4LO8A 4HZFA 1PMJX 5E89A 4QX8A 2RS13 1KDMA 1PK6B 3RI8A 4B4QA 3LOIA 4Q29A 2YC2A 2ZXQA 2FDFA 5FY0A 3D6EA 4BXFA 5DUXA 4B4PA 5FZEA 2IXKA 2VTFA 3MIBA 5FYSA 3W5MA 3BALA 2JENA 4AI1A 5F32A 2BU9A 3ZIWA 5HPOA 4D3WA 4NOTA 4ISQA 4LHNA 5CFCC 3V0AB 1Y3TA 3J7MA 4H7MA 2PTMA 1LGCA 1XNAA 3U75A 2VUAA 4AFDA 3LEGA 1HB2A 4ZKTB 1WCKA 2QQKA 2VCMA 4GWNA 2CV6A 4Z1VA 5FZIA 4TTGA 4L11A 1DYOA 1XOYA 5KXDA 2ZGUA 2RV9A 1IS4A 1VBD2 3A0KA 1COV3 3H0OA 2GP5A 1UCXA 1HRV3 1PZ9A 2UYBA 3L9JT 4IESA 4PIXA 5ANQA 1QJY3 3RZLA 5IVEA 2A73B 4RGKA 2LS6A 4Y26A 4A7KA 3H1YA 3HN1A 5HXMA 4MH0E 4LKSA 3ZSLA 3ZXEA 2DF7A 3EJKA 4AWDA 1PNFA 4XAAA 1SEFA 4ZU4A 2ZJCA 3ZR5A 4NPRA 1CAVB 1NLRA 2QQMA 1LR5A 2DFBA 1SLCA 2XWJB 3NNGA 4PDWA 2WZPP 4CP1A 5CADA 3VBOA 2PHDA 2HWE3 1ONAA 3ETPA 4YVSC 4IEOA 3LOBA 2RS12 4XFFA 1REEA 4XTPA 1JYIA 3VBUC 4M00A 4DUVA 1Q8PA 4FPHA 1QU0A 3FFZA 4XUTA 1LRHA 1JN2P 1OMIA 5JR2A 3C7GA 1WGPA 4I01A 2PAEA 1POV0 4DRVA 2FDGA 1IPKA 2A6VA 1X82A 4IQPA 5DZGA 4I0AA 2X5IA 3UKNA 1GQHA 3ZYFA 2QQPA 1DZTA 4BM8A 3H8OA 4D0QA 1GICA 4RQPB 4ITCA 2FDHA 3C2UA 4KL1A 3LKJA 2WRAA 1MZ6A 1RUJ2 5A3OA 5C9AB 1BKZA 2J1EA 5A3PA 4GH4C 4ASMB 1L7LA 2WA4A 2V5DA 1A34A 4Q4V1 1ULFA 1Z78A 4QXCA 3JZVA 4Y5Z0 5C5UA 3IPVA 2K46A 3PHMA 4EN6B 5IK5A 3OUHA 1KXGA 4CU8A 1RVF1 1BQPA 1OLMA 5LRRA 2RM23 1HRV2 3ZYIB 2OZJA 2VBBA 1QJY2 4V1PA 1MQTA 3PURA 1RUC2 3NV1A 2W52A 4I30A 1GZTA 4ATEA 1LHOA 3WDTA 5JSPA 3JBG1 2RDQA 3VZKA 1JMUB 3U14A 1CR7A 1I9RA 3AP5A 1DLLA 4TLFA 5AC93 4COZA 4ES9A 4I02A 1WZXA 3SH3A 4NUBA 2IFWA 2VW0A 2EXKA 4G9SB 2RS32 2VNRA 5JWPA 1UZZA 1IS3A 2PQQA 3J7HA 3RQ0A 3AYDA 1ULDA 1PGW1 4COVA 1CZVA 2GNMA 3POEA 1H2NA 4OQ9A 1BVVA 2BJSA 3KF5A 2VQTA 3DV8A 4PQQA 1VRH3 5KXEA 5I0UA 1IQAA 2PFWA 4KWKA 4RSUA 5GZDA 3UNPA 2ZMLA 4V2WA 2Y64A 2B9UA 4MGZE 5F3EA 1R1ZA 1KDKA 5CKQA 2HWF2 3ZFFB 1SDWA 4AFAA 1I5ZA 1RUH1 4K9SA 5FUIA 3I7DA 2D43A 2JWPA 4AOCA 2ZS6B 4M3CF 1TVGA 2ZGSA 4CXYA 2CGNA 4B7KA 1V6OA 4XZPA 3N35A 5FPUA 1HKDA 1V6NA 2EALA 1I3HA 1OC1A 4AI8A 3T2OA 1M4WA 5G05L 2W08A 2O14A 1UKRA 4WZCA 3ZYJB 2DVBA 3KV9A 1JOPA 4MHRA 1YFYA 2JDUA 5KHJA 4OHWA 2HWC3 5EJZB 2PYTA 1W9SA 2Q30A 1NCQB 2UWCA 2UY8A 3IKWA 3MFCA 3GGLA 3ZFEA 1B35B 1JH5A 2P2KA 3VBSB 4XJ8A 4QQOA 1J3PA 3RFRA 1ZRDA 3WSOA 2ZOEB 5G04L 5CFDA 4DMIA 4QDRA 1NCRB 3EMRA 4EWAA 1LOFA 3FX3A 1RUE3 1J83A 1C57A 3SQOA 3ACHA 3SXWA 2BTVC 1UOJA 1V6MA 3VDDB 3VBHA 1MS0A 1KJRA 3USSA 4PLOA 3ZN5A 5CIRA 4FFHA 1AX0A 2WWUA 5FXXA 3QACA 3T1LA 5FBZA 2HBTA 4GALA 3VKNA 4BQ5A 1GQPA 4MUVA 4E9KA 3C7EA 3S5QA 4QX1A 1H8TC 5FP9A 3ZSEA 5JPNB 3ECQA 3RGBA 4CDUB 1VBD1 3NJYA 5BYNA 3T4HB 5AFEA 1VRH2 2RJKA 2ZGKA 1XPWA 4OMCA 5JMOA 1QJEA 3RYPA 1NA1B 3O0VA 3KV5A 5D1IA 2WFF1 4DXTA 1WBLA 3DYOA 3VB9A 4FPCA 4FO9A 4HL0A 5SV8A 5FZOA 4W65A 1K5JA 1J1LA 2R0HA 3NV2A 4YZ3A 3DXUA 1UMZA 3U1XA 3ILFA 4HFSA 4BQXA 4XOGA 1FNYA 4O65A 1SACA 4PI2A 5LASA 4QQPA 1REFA 4Y1YA 1US3A 3CF6E 4CCCA 4IEXA 5I0RA 4BK5A 2RS11 1AF9A 4N7IA 3JD72 3AXEA 1YUDA 4Y4RA 4RN5A 4DS0A 5CFCA 2XKOA 4V2VA 3JB8A 4XILA 2R30A 4ZY9A 4AHYA 4ARXA 2WLQA 3J26N 4TYSA 3V0BB 1T6BX 3POIA 2P37A 4W6WA 4N43C 1RUE2 1C8M2 4QQLA 4BQ1A 1S0GA 2JIJA 1J58A 3FMGA 4XUPA 5GZEA 2O1QA 1GZ9A 2G4IA 2H0VA 3I2GA 4NAMA 3RVHA 2VUDA 3AL6A 3HOBA 3SEEA 1T6GC 2R063 4I3GA 4LEJA 4KH9A 1RUJ1 4E4HA 5KWRA 3KT4A 3ACFA 3QOPA 1BYHA 1HQNA 2D6MA 4WM7C 1LKNA 4QPGB 2WQ4A 2ZGOA 5FZ0A 4OI0A 1V6JA 4OLLA 4LKDA 2GZWA 5EIYB 2P1BA 5DQ0A 2XBO2 3NV4A 4JHZA 5JI9A 4CPBD 1QDCA 1SFPA 2QKDA 1COV1 2R043 5EJ3A 3EHKA 1ZA7A 1IPSA 1HRV1 3OY8B 4CEWC 4H14A 1UY4A 2VZUA 3NNFA 4NRQA 1QJY1 5FIXA 5I8SA 5LK5A 4CCEA 4J1WA 1RUC1 2AYHA 1OHFA 4DY3A 1UX7A 4HXCA 4YVSA 3JQWA 3IMMA 2PAMA 4Q4X2 1UY0A 3OG2A 4CUCA 2JE8A 3VBUA 1QJU3 3WW1A 1EPWA 3OPTA 1OOPB 2AH2A 4N53A 3TAYA 3K48A 1XU1A 1DP0A 3A23A 2HWE1 5BNQA 1AYN3 1W6QA 2RS31 5IUQA 1WUVA 1NXMA 4PI0A 3BYWA 3AVSA 1DQ1A 1MS8A 1BK1A 1NYWA 2BNOA 4XEZA 3E5QA 2DWRA 5JSRA 1QMJA 3SHRA 4CP9A 2Y60A 5FWJA 1PZ7A 5ISLA 5F7UA 4GH4A 1FV2A 4Q4W2 3ZXGA 2HWF1 1QOSA 5IW0A 2G9ZA 4KWUA 2VY0A 1UO9A 5M0TA 2Y6HA 5L9RA 1L3JA 2BGOA 2PN5A 2WZ8A 4SLIA 2ZGNA 5FZ9A 1W8ZA 1DGWX 2R062 2ET7A 2D40A 1RIRA 1IKQA 3ROUA 1UKGA 2W39A 3M7AA 1LECA 4Q1RA 2B7YA 3T2PA 1Q8QA 1VBE3 3NRUA 5A32A 2WZEA 3MIFA 3HR9A 3PU3A 4XJWA 3WF0A 4MYEA 5IFTA 4A6SA 3A22A 3WG2A 1D4M2 2DUPA 3SISA 2R042 4SBVA 2RM21 4XQDA 5APAA 2C4XA 2A6WA 2CGPA 5KBFA 4GB32 4XF1A 5KC6A 2DCKA 3O14A 3WNKA 1YFXA 3VDAA 1K3IA 1SFYA 3LWCA 3UKVA 1ND3C 1W9YA 2I74A 4YM1A 2MEV2 4XDPA 3BN6A 4P00B 5AC91 1JZ2A 4IE4A 3SCHA 2VCBA 1QQP2 2FCVA 2ZGRA 4LOSA 4WVMA 3ZXFA 4BH9A 4E8DA 4Z2AA 5FKBA 1AYN2 1C1LA 1OA2A 2QUOA 2XJVA 4QHOA 2ZX0A 4CEYB 4CYDA 2BDRA 3EXUA 1W6NB 2VMHA 4Q0SA 1VRH1 1XE0A 2NPIA 4JZRA 4QKFA 1UWWA 2RJ2A 2RHPA 3C8XA 5JR7B 4NROA 3OBAA 1HB4A 3LA7A 2GC1A 3N7KA 2AEYA 1PMHX 5L9BA 2ADEA 4MO3M 1OPMA 1UOFA 5IFPA 2IXJA 1HV0A 1OLME 4GWJA 4IV1B 5GJ6A 4EE2A 3AP4A 4TZDA 4XFAA 2PHLA 2OIIA 5FLJA 1VBE2 2RS52 3A4UA 2B4KA 3H1WA 2HWC1 2VBDA 1AR63 2YU1A 1UX6A 1K5MC 3PUSA 1AR72 1DLCA 1W2AX 1RUF3 1YIFA 2E7TA 2OPWA 3AMMA 1ZBA3 5FQ0B 4BYYA 5JCTA 3ZMNA 2HWD3 3N9NA 2VH9A 2HYKA 4R52A 2ID4A 2WWSA 2YB7A 3LCPA 3PLQA 4HOOA 4AVSA 1RUE1 3MICA 2ZX3A 5FRAA 5L19A 1O4ZA 3N9QA 2XJQA 4X6QB 5H9QA 4YM0A 3N9MA 4K20A 2P3YA 1IOAA 1GYKA 1WW6A 2JKBA 2XKPA 3SEPA 4EZ4A 1XQNA 2XL9A 2YPDA 3VBRB 4P9GA 1ZYBA 3ORJA 4ZONA 1UZVA 1WKYA 1HN1A 4N8MA 1XYNA 2XHNA 3VD4A 1FAYA 1W8UA 5AFBA 2ES3A 2OZ6A 3POJA 5GLZA 1WW4A 2PXJA 2XBO1 3ZVXA 5BNNB 2A3XA 3HD8B 3JXSA 4OCTA 4AK3A 4XXPA 1V9U3 2ZEYA 3NKTA 2JB4A 2RDSA 5F37A 2XXZA 4ZXEA 4Y1VA 2JE9A 3R4SA 2X05A 3AFKA 3D82A 2UWBA 4CCOA 4J6GA 4CDQC 4QQHA 2RDNA 4GWMA 5E16A 3ZPYA 1EYBA 3POSA 5A3TA 4QHZA 2Z69A 3IDCB 3H9AA 4INDA 1GWLA 1OH4A 3AM2A 1YO8A 4N43A 5F9TA 1GP5A 3LQCA 4Z07A 2F17A 1GNYA 1E5IA 2YFZA 1LHVA 3ITQA 4U36A 5GLWA 1XNBA 1POV3 2EAAA 2HWD2 3OD4A 1W90A 4Q8LA 4XFHA 4AQ2A 2YBPA 5JXHA 1ULCA 5EQUA 4RR3C 4WM7A 4XYXA 1W06A 4WVZA 5CNAA 2WO1A 2H0BA 3PTYA 1MEC3 2XUMA 5FREA 1ULOA 2YHJA 4H3WA 1S0JA 2FQPA 3MUZ1 2R061 1JOJA 3USUA 5L7OB 4Q0UA 2WT0A 1C5HA 4FQ4A 1QOOA 5GZCA 4R4XA 3ILNA 2ZPXA 3NVCA 1CAXA 1SPPB 2OXBA 4HG6B 4JX0A 4LBOA 4YVWB 4B29A 1W0PA 4D6QA 4QM8A 1GQGA 4K40A 4JVAA 1XU2A 2YZ4A 2JD4A 2AENA 2R041 3O12A 4R9DA 4TN7A 4RD7A 3MF6A 4BQ3A 1BMV2 1MZFA 4XMAA 2D6PA 3MIDA 4FXKB 3D4KA 3H7YA 5GKAC 2VNGA 2WNOA 3SH5A 1F9KA 3ZLIA 1UF2C 2HLEA 3BODA 4H55A 4YW4A 1PK6C 1QJU1 3DPRB 4UFLA 5FPVA 1CONA 1IS5A 4TLGA 4IE7A 4DRRA 3OGVA 2ZHLA 2ZX1A 1W39A 3LB9A 1AYN1 4TSVA 1CAWA 4YZ5A 1R64A 4FOVA 3WF1A 4CU7A 5ABJB 1A78A 4FVVA 1W2TA 4LO6B 4URTA 5A7WA 1QHDA 4XJZA 4AVVA 2A71A 2IFRA 3DYPA 4Y1XA 4Y3OA 3WP5A 2QJVA 3BUCA 1I1EA 5CYYA 1AVBA 2WS93 4LKEA 1MEC2 2FD8A 1YRZA 3WY6A 5IYYA 2R0FA 3SC7X 5DN2A 4FSJA 3DUIA 1SLLA 1ND2B 1T2XA 4M0HA 5A33A 4S2DA 2ZX4A 1XSRA 5FPLA 5C7GA 1VBE1 2VVFA 5C3QA 3O1SA 5DUVA 1U0AA 5BNOB 4UXAA 4LBQA 1LHNA 2VXJA 5CVRA 3ZN4A 3MFAA 3P3NA 5A1FA 1VRBA 3WDYA 4FQZA 3RWKX 1ND3A 2W95A 4IEUA 4F83A 1VAMA 3NV3A 3FUQA 4LPLA 1MPXA 4XDOA 4YYOA 3ZXAC 4P02B 4HN0A 2VULA 4CU6A 4FPLA 2HEVF 3WHUA 1BLZA 2ATFA 1RVF3 1O91A 1ZM1A 3WNLA 1JYVA 5F3IA 2EXIA 4WM8B 3I49A 4FTSA 5L36A 4NMIA 5C4WB 2HWB3 4QPIA 3H3UA 1SBFA 2XJTA 2RMU3 2WYFA 4LE3A 5EJ1B 1AR92 3NMBA 3TRSB 3FFQA 4I0WB 1W9TA 4A44A 4RQPC 5GZGA 1W0NA 3N7MA 2IUWA 3OF1A 2QQNA 2CDOA 3Q8FA 3R4DB 5C9AC 2Y34A 3OGGA 2WS92 5IVYA 5IJRA 5FZBA 5JDBA 1D2QA 4YGEA 4UFIA 1ZRIA 2JDZA 4UBHA 1AHSA 3PTRB 2VUJA 5LW9A 1K5MA 4AEDB 5BNPA 4Q4Y3 1GWMA 1Y9GA 1AUYA 1HN0A 1URXA 2QNKA 3FN9A 4Z92B 4PF1A 4CDWB 3WG1A 3BTZA 2NM1A 4MGKE 2WN3A 4QDQA 5FTTC 1AR61 1LNSA 1WD3A 1DDLA 4YW6A 1UU6A 5FY8A 5FYZA 1RUF1 3GXUA 1ZBA1 3GNEA 4XETA 2W5FA 5FO7B 1LU2A 2HWD1 3LGRA 2V5YA 2FCTA 2GSYA 3AJYA 1S0EA 4KWLA 5IVVA 4TXWA 1PGL2 1O3RA 4LE4A 1OPOA 1O5LA 3AZZA 3TWIA 1TNRA 5HI0A 4PBPA 4Y33A 4OI2A 3HT2A 4QX2A 3FLTA 1RYYA 1XNTA 3O5SA 2Q1FA 5FK8A 1WMDA 2EXHA 5FMBA 1PX3A 5HCAA 3WDUA 3ZFFC 2D6KA 3NNLA 2P5BA 4IDZA 5JZGB 4BPZA 1JZ5A 2HBUA 1OKOA 4XJUA 1DQ0A 2A3WA 3B9IA 3I59B 4RS5B 2WINB 3R4UA 4QAWA 4RGAA 2DBNA 1VB2A 2CAUA 2BYVE 5LBFA 5J36A 2AGSA 4GULA 4LHSA 2W1WA 1NCQC 3FHIB 4QMAA 1XBFA 4UFKA 2GMMA 5F6LB 3RZMA 1B35C 4Q4Y2 3VBSC 3DYMA 3MDPA 2WDBA 2XDVA 1JZ7A 3ZYHA 1BEV3 2CTVA 2ZCWA 4HBNA 4RR3A 1DZRA 1LOGA 1NCRC 2PQSA 2C1FA 2IVIB 3MBWA 4EJRA 2F4PA 2YU2A 3LFIA 3HMYA 5DAVA 3KCYA 2ARCA 3HVDA 4FPKA 3VDDC 1CJPA 3LIGA 3WNXA 3INAA 3WP4A 1POV1 4YFWA 2DVAA 4LXLA 1C1FA 3H50A 3Q8CA 4YNIA 3T4VA 1H1AA 4OFGA 1MEC1 1SCSA 2YPJA 2J1SA 2Y6GA 1JYXA 3VV1A 2VMIA 4L8QA 3T3YA 2E63A 2J42A 1PM7A 4LLFA 5EFUA 3UGGA 4AI9A 4CDUC 1ULGA 3B7MA 5C3OA 1IS6A 1NA1C 5HCFA 2YMZA 1H1IA 2YY1A 1ZA4A 3RYRA 2WA3A 2JDPA 5C3PA 2CSGA 3OYWB 1Y9QA 1YQCA 2ZZJA 3SNMA 2C26A 3GYDA 3ZN6A 3UETA 3ZYPA 3KSCA 1RUJ3 3WZ1A 1PK6A 2D7FA 2UWAA 3BIWE 3N9OA 3W21A 1WCUA 2DDUA 4BIOA 4BK4A 4EROA 1YWKA 3VGIA 3J7NA 3S30A 2ORZA 1X36A 4LHKA 4CCDA 4BQ4A 3OUJA 1W6PB 1LJ7A 2WL1A 2WQ8A 5C5TA 3AX4A 1I5PA 1PO23 1R083 2WO2A 4OHVA 5CA6A 3GCXA 3OBTA 5K8SA 5JXJA 2E9QA 1RUC3 2WZR3 1W8OA 3DKQA 3KB5A 1BEV2 4O9GA 3T2QA 4C0BA 3J4UH 2YROA 5HCHA 5JIUA 1X9PA 2YBKA 4MLOA 1W6OB 3D8CA 5FO8B 3MLJA 1AR91 4CTEA 4E2SA 1HDKA 1VAKA 3CQOA 3M4FA 4ZZ5A 4KGGA 4JTOA 3RG0A 1UU5A 2VD7A 1RC6A 5FZHA 5LK7B 2XUEA 1W2NA 1CIWA 2RS33 3VL8A 4BLJA 1J84A 1QOTA 2WS91 5FV3A 4QPGC 4AEKA 5A7NA 4XFBA 4LA2A 4FTBA 3MW2A 1W2UA 4K1ZA 1HRI2 5DAXA 2HYXA 3ASIA 4IEWA 4UW4A 1N3QA 4L0PA 5LA9A 1D4VB 5C3SA 2HWF3 2GN3A 2WNEA 2EVXA 4LR4A 4XUNA 1HXS3 3POWA 1V70A 1UOBA 2VNVA 2ZGPA 1F31A 2X5IB 3LF7A 3TEYA 4A45A 3PIGA 2P6HA 5E8AA 3E6BA 4DPNA 1JZ8A 4Y22B 5A3NA 3Q8EA 5I8YA 4AVBA 1OOPC 1UU4A 1PM4A 1FPN3 1Y4WA 3GDBA 4Q26A 4LT5A 3F2ZA 3IPVB 5FZFA 4LNVA 5ACA3 3D0SA 3PJYA 3FLPA 4DXSA 1FX5A 1O6UA 1GNHA 3DL3A 4Y24A 1PO22 1R082 4RQPA 5FPZA 2VGDA 4CDXB 1GP6A 4HVQA 3DEMA 3H8UA 4BWOA 2WZR2 2RG4A 5HV4A 3GZAA 2HWB1 1O4YA 5C8CB 1OF3A 1NQJA 3DF0A 1KITA 2RMU1 1OQEA 1UD1A 2P17A 1WCDJ 4H2AA 1Q8SA 2ET1A 5FUNA 3POYA 3B5LB 4DXRA 3H3LA 2E53A 2VAUA 2VPVA 4CCJA 4EN9B 1UOGA 1TMF3 1AXYA 3PVBB 3I2IA 2O8QA 2DCZA 1KD7A 2WR9A 3PUHA 5EPAA 1QIQA 3TN92 5A6ZA 3O1RA 3C7OA 1SBDA 2Y6LA 3VBFB 2XVLA 4Q4Y1 4R8HA 1TEIA 3H3ZA 4B3NA 3ZX7A 1CAUB 2NMNA 4CCKA 4LJHA 5IVBA 1HXS2 1UMHA 3Q9OA 2R1DA 1YCIA 4AGRA 4YW7A 1NLQA 4F8AA 4Y5TA 2JICA 2VOTA 3ILRA 1KFXL 2PHRA 2XLAA 3RZJA 1Q8VA 2PA7A 4BU2A 5EXOA 3RZKA 3LEKA 1GZCA 4AAXA 2ZHMA 4NRPA 1XSQA 2GU9A 1CJDA 4RHV2 2VZSA 3P1IA 1WA4A 4A41A 1AR82 1AXKA 1FPN2 2XL7A 3AP9A 1S4CA 2JECA 4GKXA 4GMP1 3ZFFA 3ACGA 3JD73 4E2GA 1DQ6A 4CEYC 4KU8A 3LZZA 4PQ9A 3ZFEB 5ACA2 3THCA 3K4ZA 4LIVA 1N3PA 2XR4A 1YFUA 2DU0A 4LTAA 1RHI3 3NO8A 1LTEA 1ULEA 4ATFA 4JGYA 4XBNA 4RGGA 4META 5CFDB 1PIV2 1C8M3 1YI7A 2ETEA 3AKRA 1ST8A 4LIUA 5T55A 4YFZA 1IHMA 3QD6A 3CJIA 1BJQA 2EIBA 1JZ3A 5I8TA 2DVFA 1CPNA 2ZA9A 1VMHA 1UYPA 3VBHB 3I3BA 4B4RA 3NJXA 2D6LX 3AVRA 3FC0A 4Y1ZA 1AX2A 1NCQA 2BERA 1RJ7A 4P9WA 4FP2A 1VALA 1R1A3 3DGTA 4IV1C 4FBFA 1B35A 1ZZ8A 3OOXA 1TMF2 3PVOA 3CKHA 5EP9A 3VBSA 3WDVA 1CVNA 3VZNA 3ZDVA 3HAGA 4A7ZA 2BVVA 2DURA 1WBFA 4OULA 2FZ2A 3AMQA 2LTNA 4R9CA 3I3MA 4DUWA 1NCRA 4YPJA 3WCRA 1S1AA 2XBO3 4AHXA 4MGTA 4BMEA 5LY2A 5JPMB 2VMCA 1SCRA 1IPJA 4E2QA 5D8AC 2CNAA 3FZ3A 2WN2A 1GKBA 5FZKA 4P14A 2FDJA 2C0ZA 2R16A 3THPA 1BEV1 3KD4A 2YC4A 4KNCA 2VVEA 3VKFC 1GP4A 4Q4X3 5KHHA 1DYPA 3RJRA 5CU1A 2JB8A 2W0XA 3CO2A 1H6XA 1YQ2A 4MSVA 5J7MA 3ZIXA 4DXZA 2K2SA 3MIEA 3ZYBA 4PLMA 1YXWA 2A5ZA 4JCKA 4CDUA 4W50A 1YJKA 3VBRC 3VKMA 3WHTA 3KCCA 5FOJB 1BHGA 1DCSA 5AVAA 3I2JA 5F5AA 2Z5WA 1MZEA 2ZGLA 1MACA 1VE0A 1UAIA 1E57A 4OUMA 5CG8A 1DQ4A 3RMYA 4NO4A 3AL5A 4MXWA 4IERA 4FPGA 4R9BA 5K0UB 1RHI2 3S0MA 5BNNC 2O0OA 2BGPA 1ODNA 2GH8A 4Q4W3 2WC2A 5BXXA 3SITA 4AVCA 4IEPA 3PNAA 4DO0A 4QWNA 2I07B 1DHKB 4GMP0 5FPBA 1UZWA 1R093 2RDRA 1V00A 2BQPA 3U4SA 2H6CA 2A70A 1R1A2 1OD5A 2Q1MA 3C7FA 1JU4A 2JG8B 3V0BA 2XJSA 4ONUA 4HETA 1D4M3 1FV3A 1I6XA 2E6VA 2VW1A 2MPFA 4DB5A 2LUWA 4Q27A 1WW5A 1IQDC 1IG0A 3OSDA 4OHYA 1PO21 1R081 3NAPB 5H9SA 2ZEZA 4NIAA 1JZ6A 1DF0A 1UZYA 2BP6A 4JC1A 2WZR1 2DVDA 4GB33 5DZEA 3IIIA 3ZM8A 2BW8A 1W3VA 1SLIA 3VD5A 1AYM3 4QPGA 2Y38A 3M1HA 1WLCA 4AI0A 2VL4A 2MEV3 3K4DA 2W91A 1MS9A 1QQP3 3WNPA 2GAUA 5L7OC 1GOFA 4N53B 4NPMA 3BI3A 1XYOA 1H4GA 1QGLA 4FTEA 3OY8A 1C4RA 4C1WA 3LDBA 2X53S 1DGRA 4YVWC 3TN91 2VNOA 4XTMA 5DPNA 3NW4A 5DUWA 4NN0A 5FP8A 4ZS3A 1C5IA 1F15A 1VAVA 3H1MA 2WNVB 4L9BA 4LUKA 2EXJA 3LIHA 4XF9A 2ZMKA 1HXS1 1SLTA 5FYIA 1XYPA 3N7LA 5HBAA 2VVDA 1ZNPA 5DZFA 1S2KA 5CKMA 1ZZ6A 2A7AA 1CPMA 5FZ4A 2CGOA 1R092 1MZ5A 3PUQA 3B94A 3KHBA 5FXZA 2VZRA 3KHCA 5FMOS 5H9RA 2JIGA 2RS53 3HJRA 3GHNA 3CU7A 3AXDA 3DPRC 4RHV1 2WYSA 5LEJA 1F8VA 5LCWL 3IBMA 2W46A 4HKWA 2EICA 2G9FA 1DBNA 1HB1A 5A32B 1FPN1 4QU1A 2VQAA 1AR73 1RB8G 5ACA1 5BY5A 1H2KA 4GXLA 2KM2A 2PLV3 2BV4A 2QVSB 5A3LA 4QPYA 1H1MA 3VLBB 4EWDA 1UYXA 1PMIA 4C91A 4Y20B 5CBLA 1UXXX 3MV01 4E4ZA 1AYM2 2VG9A 4C0HA 3FE5A 1XRUA 3PMSA 4YGDA 1UPIA 4OUEA 5LZ6A 2R6QA 4AI3A 4XDQA 3K46A 4XQ4A 3BCWA 3FLRA 1GUIA 1ND2C 1TMF1 3MO4A 3ON7A 2GMEA 4MADA 4WVMB 2Q8CA 3POBA 3IDAA 1AZDA 2VECA 4YG3A 1OQ1A 2W92A 5C33A 2GC3A 5BNOC 4J25A 3E6CC 2LALA 2BFUS 5A7SA 1CX1A 1F35A 5GZFA 4JKMA 5SV5A 1LENA 2TEPA 4QD2A 4OHXA 4LBMA 1N1TA 4DIQA 2Y8KA 2ILMA 5LBEA 1NE6A 1SZBA 2HEWF 4A6OA 1JUHA 2ZMNA 1ZREA 2PHUA 2R1BA 2ZTNA 1W03A 1FMD3 1SLAA 1OUSA 4P9JA 1G9BA 2PHWA 3KT7A 2VQ0A 2W3JA 4IE5A 2JD9A 4F3JA 3B93A 4CEYA 2GNBA 5C8WA 4NR1A 2QQVA 4IEVA 3HWJA 3IM0A 1YIPA 2KR2A 2R072 1UMIA 1W6NA 4WM8C 3R6SA 5C4WC 2VJXA 1YYNA 3I8TA 4LHLA 1UN1A 3SH4A 5FP4A 3JD71 3LEMA 4XFCA 1LEDA 4QGMA 1BXHA 3WQ0A 1H2LA 4GD4A 2E33A 4Y4YA 5FYMA 1BCXA 2IXIA 1LB2A 1RHI1 1QDOA 1J1TA 2PLV2 2TNFA 3JU9A 4JGZB 5A70A 1C8M1 2QBXA 2GC2A 2VCCA 4JRLA 2FMYA 1H4HA 1H8TA 2QDRA 1XJAA 5FZDA 3PVNA 1AL23 1R1A1 4CPBA 2UY9A 4AQTA
chains in the Genus database with same CATH topology
4O65A 4PI2A 1YEWA 3RGBA 4PI0A 3CHXA 3RFRA 4PHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O65 A;  4PI2 A;  1YEW A;  3RGB A;  4PI0 A;  3CHX A;  3RFR A;  4PHZ A; 
#chains in the Genus database with same CATH topology
 1YJL A;  2QQJ A;  3LPF A;  5D8A A;  5FCC A;  2GP3 A;  2XJP A;  4LBL A;  3WX5 A;  4CXW A;  4D69 A;  2UU8 A;  3WQ7 A;  4NJ4 A;  3J9S A;  1G6N A;  2ARE A;  3W59 A;  4CDW C;  5E1R A;  2YC0 A;  2Q1Z B;  4LBQ D;  1V6I A;  3B00 A;  4JQR A;  4LA3 A;  1YQ5 A;  1PO1 3;  5JUV A;  1W8N A;  3VHN A;  3K3O A;  2Q8E A;  3UES A;  2FZ1 A;  1WMX A;  3O0W A;  4NE9 A;  5A1A A;  5K7P A;  1GFF 2;  3HQX A;  4LMF A;  3KVA A;  2BVB A;  3HT1 A;  1FMD 2;  3RS6 A;  2ARX A;  4Q4X 1;  5C3R A;  2YV8 A;  5FY5 A;  4AQ6 A;  4K1Y A;  2JG9 B;  3V65 A;  3UV9 A;  2JDM A;  2V4A A;  4D8M A;  3O1V A;  4PF5 A;  4XCA A;  2XG3 A;  3OJB A;  2LW8 A;  3Q8B A;  5KXB A;  2Z42 A;  3WVJ A;  5BNN A;  3RI9 A;  4O7X A;  4M3C B;  3NL1 A;  3S57 A;  3WG3 A;  4L2N A;  5HV0 A;  2DU1 A;  4YGB A;  4OI1 A;  1QF3 A;  4N43 B;  5GLT A;  4JDO A;  3I54 A;  3RDI A;  1O7F A;  4H7L A;  5JZG C;  4FT8 A;  4XF0 A;  4XQW A;  2UYA A;  2SLI A;  3MPP G;  3OTF A;  4XBQ A;  1YQ6 A;  4ZPI A;  4K7J A;  1LU1 A;  1ZBE 3;  3VDC A;  4Q4W 1;  1LES A;  5GLU A;  4RS5 C;  3JCI A;  4N9I A;  3K2O A;  4QM9 A;  4B8E A;  1Q8O A;  1DGR N;  1VBB 2;  2QDN A;  2WII B;  4DOU A;  1LHU A;  1OXC A;  1R09 1;  3AYE A;  4AEM A;  4AFM A;  4QGL A;  3QH7 A;  3RRD A;  4EN0 A;  1AL2 2;  2WNU B;  1ASJ 2;  4FOY A;  4YLZ A;  4CEW A;  1YC6 1;  3ACL A;  2R49 A;  4BCU A;  3CLP A;  1G9F A;  3PIJ A;  1Z7S 3;  4K8F A;  3S7E A;  1HW5 A;  1NE4 A;  2VR4 A;  3D3A A;  1PVC 2;  3MIH A;  4UWD A;  2Y0I A;  3T09 A;  1D4M 1;  2Y6F A;  1OF4 A;  1ULP A;  2J1U A;  4QKN A;  3SKJ E;  1PO1 2;  3CMG A;  4D6S A;  3O1O A;  3ZXK A;  3WW4 A;  1RTV A;  3MV1 1;  1SBE A;  4MG2 A;  2OT7 A;  3H7J A;  1WW7 A;  1GZW B;  2BNN A;  5L7O A;  4GB3 1;  1LAJ A;  3IMN A;  4QT6 A;  1OH3 A;  3I4I A;  2B8M A;  2R7E B;  2CWS A;  2WT1 A;  3P5B A;  1AYM 1;  1S2E A;  1K12 A;  1HQL A;  1U5I A;  2LRP A;  4QXH A;  4CZS A;  2MEV 1;  4YVW A;  1G9D A;  1BBT 2;  1F2N A;  3HIF A;  2ZGM A;  1QQP 1;  5HCB A;  1F4H A;  1Y7B A;  4RYD A;  1O3S A;  4Q5O A;  4TWT A;  2CAV A;  1WWY A;  1YFW A;  2CHH A;  2VCA A;  3ACI A;  3OPZ A;  4HMZ A;  1Q5O A;  1DYK A;  1L7Q A;  1C3H A;  4J1X A;  4N9H A;  2KXL A;  4HPK B;  1AR9 3;  4P08 A;  4UF0 A;  5FPX A;  4UOJ A;  1B09 A;  3MZH A;  2JJ6 A;  3ZSJ A;  1E5H A;  5A6Q A;  1LGN A;  4YZ1 A;  1ZBE 2;  3U07 A;  1S0B A;  5A7W B;  5F2S A;  2ZAB A;  3DPR A;  2VZV A;  4JTN A;  3H42 B;  1JTZ X;  5FMO L;  1C28 A;  1NLS A;  3IAQ A;  3LSE A;  4I09 A;  3BIE A;  4AYU A;  4E4D X;  2D3R A;  4YG6 A;  4D6R A;  1RXG A;  5A80 A;  1LOE A;  1PZ8 A;  4UW3 A;  1UYY A;  1US2 A;  2RS5 1;  5FAX A;  5GAL A;  4O9E A;  5A33 B;  3LD8 A;  4OVE A;  1Z7S 2;  1OI6 A;  5FMD A;  1EV1 3;  5B2G B;  1S2B A;  3E5X A;  2AC1 A;  1L7R A;  4GJZ A;  1D0H A;  1HLC A;  1PX4 A;  2ZKN A;  2WFP A;  2XJU A;  5H9P A;  1AR7 1;  4FPY A;  4GJY A;  1VP6 A;  4B7E A;  4CXX A;  5FDB A;  3MW4 A;  3HBK A;  1SLB A;  2PLV 1;  5JMC A;  4XHX A;  4NWW A;  1ND2 A;  4ASK A;  4IV3 B;  5EYX A;  4GWI A;  3U0Z A;  1QKQ A;  4YM2 A;  3AK0 A;  5T5O A;  4K21 A;  3WR0 A;  3R05 A;  1K42 A;  5BNO A;  3P3P A;  4XMI A;  3CZJ A;  4XXA A;  3IDE A;  4GZ9 A;  3TYJ A;  4A4A A;  4E27 A;  3UL2 A;  2IC1 A;  2TBV A;  2EID A;  2ZEX A;  5EZW A;  2DFC A;  5T3N A;  3AJZ A;  1W6M A;  4DEQ A;  3TN9 3;  1DZQ A;  1M06 G;  1H9P A;  4HKL A;  4QPI B;  3OB8 A;  2J1A A;  1KEX A;  1H8V A;  2X5I C;  3IN9 A;  3T0D A;  3RSJ A;  5GM0 A;  2FDK A;  3WNM A;  1U5X A;  3AP7 A;  3NNM A;  5CZK A;  1LHW A;  3ETQ A;  3M8L A;  2Q5T A;  3QCW A;  5T50 A;  5IVF A;  5C6C A;  3POF A;  3AB0 A;  2W9X A;  4YGC A;  3CJX A;  1VPH A;  1UNB A;  2P3I A;  2XOM A;  4A3Z A;  1JXN A;  4WM8 A;  1EAH 3;  1FMD 1;  1GOG A;  2IVJ A;  5C4W A;  4QX7 A;  4X6R B;  2QCS B;  3GZE A;  3NWK A;  2W1U A;  4HK8 A;  4AG4 A;  2EF6 A;  2HKX A;  2Y6K A;  1W2O A;  5DDJ 2;  1AX1 A;  4XF3 A;  5TSW A;  2VXR A;  4HVR A;  1WLT A;  2PAK A;  4MHU A;  5BNP B;  2WBK A;  2OKX A;  3C3V A;  4CCL A;  4DUX A;  5FJK A;  4CDX C;  1EV1 2;  2NN8 A;  1JZ4 A;  3W5N A;  2W1S A;  3C7H A;  2ZHN A;  2XON A;  4M4P A;  4UFJ A;  5C8C C;  5KXC A;  3BTY A;  3DXT A;  5FZ1 A;  3PDQ A;  4CP0 A;  2XQX A;  3AKP A;  3AZX A;  1W8W A;  1Y9M A;  3BVC A;  3HN3 A;  3URF A;  4NIG A;  2N7G A;  4R9A A;  3ES4 A;  4GMP 3;  2EIE A;  5K9Y A;  5JIA A;  4P9Y A;  5LEK A;  1PVX A;  4A7Y A;  2PEL A;  5A6Y A;  3TOJ A;  4CDW A;  4ZHN A;  1NQD A;  3LSD A;  1H0B A;  3IDB B;  2YFU A;  4W4Z A;  4BQW A;  1AL2 1;  5LAT A;  3WQB A;  5A7O A;  1BVP 1;  2DBI A;  3ALQ A;  1UPS A;  5FY4 A;  3VBF C;  3ZR6 A;  1F4A A;  5JOZ A;  3OPW A;  3IAP A;  2QQO A;  4CDQ A;  3WLU A;  3Q8A A;  3N9P A;  3D5O A;  3K3N A;  5JVV A;  4Q4V 2;  1KJL A;  4AW7 A;  2ZAA A;  1PO1 1;  3MYX A;  2WSU A;  5IAX A;  1BMV 1;  1TQ5 A;  3VD9 A;  4PBO A;  1MVE A;  5FZ3 A;  2GC0 A;  1OD3 A;  4GIQ A;  2RJL A;  1GNZ A;  2C24 A;  2J1V A;  3DKW A;  1EAH 2;  4AEJ A;  5IAT A;  3IT8 A;  2D93 A;  4LBJ A;  3CIH A;  4X8N A;  3F95 A;  3OD0 A;  5JZG A;  1VR3 A;  2W94 A;  1BBT 1;  1EPZ A;  2JDH A;  3ZFE C;  1GOH A;  1QEX A;  3R0R A;  4FXG B;  4PCR A;  3TEZ A;  2SBA A;  4RL7 A;  2WAA A;  3NNJ A;  3VZL A;  3ZFG B;  3J7L A;  4AR2 A;  3I59 A;  3AMN A;  3GJA A;  4NWV A;  4RS5 A;  5J96 B;  5CFD C;  3HEI A;  1DQ5 A;  2P4E A;  3PU8 A;  4RR3 B;  1WLW A;  1OKQ A;  2D3S A;  4Q2F A;  4A2U A;  2O8O A;  3ZYR A;  2NP0 A;  3VBH C;  4IW3 A;  4C8D A;  3I3D A;  3M2M A;  2B39 A;  3KLS A;  1ZBE 1;  2E7Q A;  3WT3 A;  3WW2 A;  5BV6 A;  4XW3 A;  2CL2 A;  4JAA A;  2V73 A;  2BEO A;  5B4N A;  4NHY A;  3WF2 A;  3O0X A;  3OUI A;  5AVP A;  3KV4 A;  4CE8 A;  2AEZ A;  3LDR A;  5LWB A;  2ARA A;  2J1T A;  1RMU 3;  2ZKL A;  3A0N A;  3CL1 A;  4FOQ A;  5DAW A;  4ARY A;  1HRI 3;  4EYU A;  2B42 B;  4PT6 A;  2D6O X;  1AL0 G;  5ERL A;  4CU9 A;  5L73 A;  1Q43 A;  2QZ3 A;  3T08 A;  4ORF A;  4FAH A;  3TEW A;  4URA A;  1Z7S 1;  1D7P M;  3E97 A;  4XFI A;  1TME 2;  2VM9 A;  2ZHK A;  3B3Q E;  1UXZ A;  3KV6 A;  4YZ4 A;  3ZN6 B;  1ALY A;  1O59 A;  1GU3 A;  2B45 X;  3O1T A;  4IGQ A;  1EP0 A;  3VD3 A;  2LRO A;  1NY7 2;  5FMC A;  4MXV A;  5FYV A;  3NQH A;  4UW6 A;  4BE3 A;  1XC6 A;  3PUA A;  5FP3 A;  4FPE A;  4MGQ A;  4LUL A;  5JXI A;  2Y0O A;  1W05 A;  2WJS A;  5FY1 A;  4S2F A;  4MOA A;  3V0A A;  1CGP A;  3OYW A;  3EB7 A;  1HJG A;  4ISR A;  4Q0V A;  4XUQ A;  4KBB A;  3T0B A;  3VKL A;  3N4M A;  5K0U C;  3AMP A;  2MHF A;  1Q56 A;  1K45 A;  1BZW A;  1RIT A;  3BPS A;  3KM5 A;  4KU7 A;  2DCJ A;  2VUC A;  1X50 A;  3A21 A;  3O1U A;  3GZT B;  1QNY A;  2VZP A;  4M3C E;  4LKF A;  2VOW A;  2YGL A;  4BJ0 A;  5FXW A;  5HXV A;  2YXS A;  3U11 A;  1V6K A;  4BIS A;  2OUJ A;  1PHM A;  1W6P A;  1OT5 A;  2CDP A;  2P34 A;  3GAL A;  4PDW B;  2QQI A;  5FZG A;  4DFS A;  3VBO B;  1NOV A;  2V4V A;  4FFG A;  1RJ8 A;  5A7P A;  1UIJ A;  1RUD 2;  2QQL A;  2JG8 C;  3MPB A;  2RVA A;  1QY4 A;  2JE7 A;  2OPK A;  1RMU 2;  2Q0A A;  2YUE A;  2C9K A;  3I2F A;  4JDM A;  3PUI A;  4XIO A;  2WFF 2;  1W9F A;  1C8N A;  5DDJ 1;  1CES A;  5T5P A;  1LOB A;  3S5A A;  1W6O A;  2YGM A;  4P5Y A;  3LEI A;  4QB2 A;  3WP6 A;  3OEB A;  4LBK A;  1CAV A;  3B9C A;  3NAP C;  1KGY A;  2W47 A;  4FPJ A;  2D5F A;  1EV1 1;  3SKV A;  1VJ2 A;  4LO5 B;  4S2H A;  1A8D A;  2GH2 A;  2QQW A;  2L9L A;  4BZ4 A;  4W6Y A;  3FUO A;  2LM3 A;  1OVP A;  1WA6 X;  1N1Y A;  3RNS A;  3VHO A;  5KHG A;  1O4T A;  4RHV 3;  1W28 A;  1AR8 3;  1NZC A;  4N53 C;  2B9V A;  4EN7 B;  1CD3 G;  3WF3 A;  1PGL 1;  3JQX A;  1CWP A;  2P6C A;  2XHK A;  1GLH A;  1TE1 B;  1X33 A;  3AZY A;  3VD7 A;  3I2O A;  1J59 A;  1UY2 A;  1JBC A;  1TG7 A;  4PIZ A;  5LA0 A;  1PIV 3;  3UT0 A;  1MQT B;  5C9A A;  2GAL A;  1WLD A;  3ZKU A;  3ZYG A;  3N36 A;  2K9Z A;  5LBB A;  2EAK A;  2WNV C;  2VTX A;  1KQR A;  4Y22 A;  5FYY A;  1APN A;  3M3I A;  4KBZ A;  1YQ8 A;  1NX9 A;  5I0T A;  5FYB A;  4AHW A;  2WWJ A;  3ELN A;  5EWS A;  4CP2 A;  2BZD A;  5F39 A;  1COV 2;  3UGF A;  3WCS A;  3WNO A;  3WF4 A;  4CDX A;  1EAH 1;  4BOW A;  2JDY A;  2QTW B;  4BHP A;  3W58 A;  5C8C A;  2GNT A;  2XQR A;  5FKC A;  2CWM A;  4NIH A;  1OFS A;  4QX5 A;  4XAE A;  1ODM A;  4ZU7 A;  1TZO A;  1P8J A;  2TUN A;  4AI2 A;  2YYO A;  1VBA 3;  4HKO A;  3RZG A;  2W2I A;  5BPX A;  4RFR B;  5FZ8 A;  2HWE 2;  1OQD A;  5FXV A;  2ADD A;  2WKK A;  4XBL A;  5GLV A;  1U5Z A;  1W04 A;  3HNM A;  3VBF A;  1S0F A;  4KGQ A;  4YWA A;  5I91 A;  4NPL A;  1ZRR A;  2DUQ A;  1CAU A;  1YI9 A;  5T54 A;  1RED A;  3J8F 3;  3DN7 A;  1LEM A;  4QDS A;  4QHB A;  4XHB A;  3M3C A;  1NG0 A;  1XNC A;  1RGS A;  3MHZ A;  4IL7 A;  3ZKY A;  3MGU A;  4UI9 L;  3LAG A;  3E6D A;  4OMD A;  3MEP A;  3U4X A;  1STM A;  5T5L A;  4JGY B;  4ES8 A;  4IET A;  1CZT A;  2Y26 A;  4M01 A;  4MGY E;  1TME 1;  3MF9 A;  3CJI B;  2VOK A;  3T1M A;  2BWA A;  4XJ9 A;  3FHA A;  3ST7 A;  4HON A;  4Y5S A;  4D7T A;  1A3K A;  2XVK A;  3D0J A;  5FLH A;  2A6X A;  2Q8D A;  5FJH A;  4LQR A;  1NY7 1;  4ZS2 A;  3SLI A;  5LB6 A;  4G4F A;  1YHF A;  5F5C A;  2RM2 2;  2A3Y A;  4IE6 A;  4IXL A;  3AP6 A;  2GMP A;  2QQU A;  5FYC A;  1NAE A;  2NMO A;  4K3U A;  1AJK A;  2F4L A;  5JI7 A;  5L9V A;  3VDD A;  3IZO A;  2PHT A;  2W68 A;  3H8R A;  3CHX A;  1JYC A;  2OX0 A;  5F6K A;  2PMW B;  1KS4 A;  3HBZ A;  4ZZ8 A;  4CUG A;  3V64 A;  4JGZ C;  2E51 A;  1DG6 A;  1VBA 2;  1EY2 A;  5E88 A;  5T52 A;  1RUO A;  1QJZ A;  5AC9 2;  2CYF A;  2NZ9 A;  1GWK A;  3NJV A;  5FZO B;  1JYT A;  3RPQ A;  4AVA A;  3E1F 1;  2A6Y A;  2ZGQ A;  3M3Q A;  4JHT A;  4B1M A;  2IXC A;  2BPA 2;  4NHM A;  5JOX A;  4QQ2 A;  1W8F A;  3NST A;  4JRA A;  3ZXL A;  3T2T A;  1JI6 A;  3SCG A;  5FO9 B;  4AVT A;  1NA1 A;  4AXO A;  4FOW A;  1RUD 1;  5T5J A;  2OQ7 A;  3J8F 2;  1LOC A;  2AZ5 A;  2XML A;  4LOR A;  4EWE A;  5FWE A;  2RR1 3;  1RMU 1;  1YNA A;  3KS7 A;  4NRM A;  4QKB A;  5CFC B;  1EUU A;  1HRI 1;  2HJI A;  2QFE A;  3ME2 A;  3NJZ A;  4JQT A;  4K6B A;  5A7Q A;  2A75 A;  4MXW B;  2QZ2 A;  4Q1P A;  4QX0 A;  4YW1 A;  4FAG A;  3GBF A;  3A7Q A;  4JKK A;  4R4Z A;  3UKT A;  1BK0 A;  4DNY A;  4I2O A;  2IZW A;  4PLN A;  4G3Y C;  2FHR A;  1JUI A;  3VZJ A;  5DAP A;  2HWC 2;  1MS3 A;  2OUH A;  3QLQ A;  5C70 A;  4BQY A;  2JG9 C;  1RXF A;  4YW5 A;  4CVU A;  3RZH A;  2Y33 A;  4F7Z A;  3O1P A;  2VME A;  5K0U A;  4XF4 A;  1HV1 A;  1W0O A;  2XWB B;  3WP3 A;  5J09 A;  2D44 A;  5F5Q A;  5A3W A;  1VIW B;  4QXK A;  4LK6 A;  2DYC A;  4OZO A;  4AF9 A;  4KWJ A;  3LPG A;  5I93 A;  1QJX 3;  3BPZ A;  1OFN A;  4A3X A;  3ZXD A;  1CN1 A;  5F1R A;  2WT2 A;  3OGR A;  5DG1 A;  1JU3 A;  1OA3 A;  2DTY A;  4ET7 A;  5E6H A;  3CNA A;  4N7U A;  3H8X A;  4E8C A;  4YVS B;  5FZL A;  1E5R A;  3WG4 A;  2X09 A;  2JG8 A;  1RIN A;  2I45 A;  3VBU B;  3UJO A;  1U5Y A;  3PME A;  2K0G A;  4K8R B;  5FOB B;  5JSO A;  1DQ2 A;  3MLL A;  3VHP A;  1ZVF A;  1XXN A;  3FL7 A;  2WNU C;  4EN8 B;  3DEC A;  1W6Q B;  3NAP A;  1VB4 A;  2FMD A;  3O1M A;  2WSV A;  1QWR A;  4IEY A;  4OI4 A;  5JAX A;  3HNB M;  2RR1 2;  1QH7 A;  5DXD A;  5FP7 A;  4NHX A;  4HT1 T;  3I3Q A;  3TB0 A;  1S0D A;  1CQ9 A;  2VO5 A;  4CP9 B;  5IK8 A;  2Z79 A;  4GH4 B;  4IEQ A;  3KMH A;  1OOP A;  2VMD A;  1N1V A;  2DVG A;  3MI8 A;  4CUB A;  5C71 A;  5IK7 A;  1SMV A;  2OYZ A;  3ZSM A;  3GF6 A;  4KG8 A;  3RWN A;  2ENR A;  4AQS A;  2KA3 A;  3SCF A;  1OUR A;  1N47 A;  3AKQ A;  4YW2 A;  4D7S A;  1OUX A;  4CCM A;  3V56 A;  3ZPO A;  5KC5 A;  5FLI A;  2R07 3;  4XVH A;  5D2A A;  3AC0 A;  2H6B A;  2VZ1 A;  1VBC 3;  3MW3 A;  4BDV B;  1GMM A;  2D3P A;  1AR8 1;  2XVG A;  4HAN A;  2XGX A;  2WNV A;  4FI9 A;  1OSG A;  5F2W A;  5B4X A;  3JB4 C;  1GSL A;  4OZX A;  5ABJ C;  5KHI A;  3OGJ A;  3VZO A;  2D5H A;  1D0G A;  5F8P A;  3ZDS A;  1OVS A;  1QJX 2;  4LOT A;  4C1X A;  4CUA A;  2G1M A;  3WUD A;  1DU3 D;  4C90 A;  1PIV 1;  1OA4 A;  3E5U A;  4RFT 0;  3MLK A;  3MIG A;  2NLR A;  3THD A;  3EQE A;  1XE7 A;  4L99 A;  4CCN A;  5FR3 A;  3U10 A;  2WO3 A;  2Q4S A;  2BBA A;  5LBC A;  4COY A;  1JHN A;  4NVP A;  1RUI 3;  1W3X A;  4XJA A;  2GDF A;  2WLP A;  3JUU A;  2VQU A;  1U12 A;  5CB7 A;  1KRI A;  3ENR A;  1W9W A;  1XB9 A;  1PNG A;  2WQZ C;  4S2G A;  5JXG A;  2ZEW A;  2B5H A;  2GN7 A;  2ZZQ A;  2JDK A;  2HH9 A;  4W6X A;  4D94 A;  2VOV A;  5I0S A;  1LUL A;  4Y20 A;  2C6S A;  3GM8 A;  4Q8K A;  5CEH A;  3ATG A;  2VZ3 A;  2E31 A;  1DGL A;  2CY6 A;  2X8K A;  3TBD A;  1J3R A;  4EV0 A;  4MGI E;  2E7A A;  1J3Q A;  1QJU 2;  2V72 A;  5I0D A;  1VBA 1;  4UBG A;  3QH6 A;  1QNW A;  4AED C;  4YW3 A;  5FY7 A;  2DV9 A;  4U2A A;  5J37 A;  3PVE A;  4IV3 C;  2ZAH A;  4CSW A;  4JV4 A;  3K51 A;  3KWV A;  5CAZ A;  4HN1 A;  3GCW A;  2XLF A;  3GBG A;  4KQ7 A;  1HQW A;  4Y1U A;  4XPV A;  3BGA A;  4YSF A;  1RL3 A;  1VBC 2;  1G7Y A;  2BGC A;  2AR6 A;  2HEY F;  2VOX A;  2VE1 A;  3LA2 A;  4PHZ A;  4Z8B A;  4QU2 A;  3APB A;  4LBN A;  1KS5 A;  4IEZ A;  1FNZ A;  2ORX A;  3J8F 1;  4YAR A;  2VZO A;  1ZRC A;  4QPI C;  1LOD A;  2ZGT A;  3PL0 A;  3KGZ A;  3WIN E;  4IV1 A;  4NHL A;  2PHX A;  1V0A A;  2OA2 A;  4LK7 A;  1QJF A;  1HX6 A;  4CA9 A;  1FOD 3;  1JYW A;  3KT1 A;  4GKY A;  2G9G A;  4XUO A;  2I2S A;  3B02 A;  1UY3 A;  1VBB 3;  4XAC A;  1YLL A;  1RUI 2;  3BU7 A;  1Q3E A;  1H8T B;  4M4R A;  4OHZ A;  3BTA A;  1ASJ 3;  1H2M A;  4NAO A;  3POG A;  4OYU A;  4NHK A;  4HLT A;  4Q0P A;  2Q8O A;  3WV6 A;  5CIS A;  2JKX A;  2JDA A;  5FQ0 A;  4D7Y A;  4FCA A;  4AAP A;  1S0I A;  2EIG A;  5BNP C;  1F5F A;  2ZAC A;  3I3E A;  1PVC 3;  2BUK A;  4JGZ A;  5D8A B;  2XPJ A;  3PJQ A;  2DCY A;  3HPN A;  3KVB A;  2BOJ A;  2JEM A;  3BTX A;  1JOD A;  2E32 A;  2Z2S B;  1UL9 A;  4AGV A;  1KFU L;  3WD5 A;  1N1S A;  1PGS A;  3N3H A;  5BUV A;  3GHM A;  4L92 A;  1FI2 A;  3GZU C;  4IGO A;  2BOI A;  1ENX A;  1JHJ A;  3AKS A;  4YG0 A;  2IXH A;  1NZI A;  3VBR A;  5LRS A;  2PHF A;  4ZU5 A;  3SMH A;  1MS4 A;  3WUC A;  1G9C A;  2FDI A;  4A42 A;  1RUG 3;  5F5I A;  1FXZ A;  1BBT 3;  1ENS A;  2BBV A;  3CZU A;  3B01 A;  4JKL A;  4XCB A;  1AXZ A;  1ZZ7 A;  4OQ8 A;  4BB3 A;  2J7M A;  2E26 A;  3CBN A;  5FYT A;  3ZOI A;  3L2H A;  3DCQ A;  5KR7 A;  3W9A A;  4BLI A;  2ARB A;  2FCU A;  2X29 A;  1ZX5 A;  2RR1 1;  2A1X A;  2XLG A;  4AZZ A;  1POQ A;  3OBZ A;  3GBW A;  3G7D A;  2OW4 A;  2ZBJ A;  3O7O A;  4LO4 B;  4L97 A;  1YEW A;  1O3Q A;  1H9W A;  2JG9 A;  3BB6 A;  4LUM A;  3S6P A;  1FOD 2;  1IKP A;  3LFM A;  3TNQ A;  4DEV A;  4FPO B;  4WM7 B;  1DGW A;  4PJY A;  4PIY A;  3WNN A;  3IWZ A;  4W8J A;  3VUO A;  2ERF A;  5JOY A;  1GV9 A;  2BRT A;  4M3C A;  1SFN A;  2YDE A;  1XE8 A;  4B1L A;  2D98 A;  2Z4F A;  4COW A;  4QPW A;  4GAZ A;  3USU B;  1AR6 2;  3AFG A;  1FT9 A;  2FBE A;  2VU9 A;  2X10 A;  1QH6 A;  4CEW B;  1X7N A;  3CEW A;  1RUF 2;  4IUG A;  1ENR A;  1ZBA 2;  1CAX B;  5FZC A;  3ZFG C;  1A8M A;  3RJ2 X;  4UT5 A;  4DIN B;  2XJR A;  3TNP B;  3X29 B;  4AFC A;  1ZRF A;  4AGG A;  1S55 A;  1LGB A;  2BNM A;  4CRQ A;  2VBP A;  1QJX 1;  1CIY A;  1LOA A;  4AE2 A;  3EYP A;  3KF3 A;  4XFG A;  4E4S A;  5J48 A;  3AMH A;  5A1L A;  2WNU A;  5ANN A;  1UYZ A;  1RUG 2;  1JS9 A;  5IVC A;  5DAQ A;  1SPP A;  3RZZ A;  3FWE A;  2WUH A;  1SDD B;  2F6B A;  4IGP A;  2EA7 A;  1SG3 A;  4P9I A;  3KZ4 C;  3QBQ A;  4M0N A;  4ZXK A;  4UAP A;  4KG0 A;  4MVT A;  2AAC A;  3UYJ A;  3G6J B;  1Z0H A;  5J98 B;  1CAW B;  1V9U 2;  2WAB A;  1GZW A;  2WAO A;  1X8E A;  2VZT A;  3BOP A;  4I3P A;  4MX3 A;  4UF0 B;  4UFH A;  5FZ7 A;  1FYU A;  1FAT A;  4XZU G;  5FY9 A;  3AZW A;  3L2Y A;  3OCP A;  2VMG A;  3WEZ A;  5JOW A;  4MGS A;  1DFQ A;  2NQY A;  3N9L A;  4WZF A;  2J22 A;  5DAB A;  3ZSK A;  3W20 A;  5D21 A;  3FHQ A;  5FZA A;  2XB6 C;  3FBM A;  4P9L A;  3WDW A;  3GJB A;  5DDJ 3;  4QXB A;  2DTW A;  5ABJ A;  3KQ4 B;  4HPK A;  3VN4 A;  3B69 A;  2R07 1;  4XE9 A;  3IB3 A;  1A6C A;  4XAB A;  1VBC 1;  3UGH A;  1X8M A;  1EUT A;  5IWF A;  3NKG A;  3ABZ A;  4X8P A;  2A6Z A;  4LBQ B;  1WMF A;  4MV2 A;  4EQV A;  4QKD A;  4WV8 A;  4WVW A;  2B46 X;  1VLN A;  1SQ4 A;  2JXA A;  4LIT A;  1E5S A;  4EZH A;  1GBG A;  3WXP A;  2QE3 A;  1CZS A;  2AUY A;  1OBN A;  1XNK A;  2DCT A;  2GND A;  1ND3 B;  2CU5 A;  3EBR A;  1O3T A;  1VMJ A;  5EV7 A;  1SHW B;  2UUR A;  3OGS A;  4PDW C;  3U78 A;  3HQU A;  3VBO C;  1JYN A;  4Q0Q A;  3BOW A;  5IAV A;  1RUI 1;  5FZ6 A;  3WDX A;  1UZ0 A;  2JDN A;  4P5H A;  3WQ1 A;  1W8T A;  4XUR A;  5JLV A;  4FPF A;  2BFU L;  3UK9 A;  3AZV A;  3OBR A;  1W6M B;  2P3K A;  4JDN A;  1Y43 B;  3VZM A;  2VTX J;  1G9A A;  1MS5 A;  5FK7 A;  2OQ6 A;  5IVJ A;  4Q4V 3;  1MS1 A;  4BXS V;  4IV3 A;  4YZ2 A;  3ZO0 B;  1VMF A;  3I2H A;  4P9X A;  4BIF A;  3AYA A;  4BA6 A;  4UW5 A;  1CX4 A;  3IIA A;  5DUU A;  1HB3 A;  4QB1 A;  1O8S A;  3K75 B;  4HSL A;  2MNG A;  1XND A;  2YBS A;  4DY5 A;  1OLR A;  1HIX A;  5FYH A;  4COU A;  2YG0 A;  2W87 A;  1LCL A;  4BMB A;  3I2K A;  4LO7 A;  5J1X A;  1QXP A;  4GQ7 A;  1K5M B;  4AL9 A;  5IHR A;  3K77 A;  2WO7 A;  3CDZ B;  3JBG 3;  3T30 A;  4LLO A;  3TEX A;  2P3J A;  3K4A A;  1H30 A;  5J3U A;  4N90 A;  4HVO A;  1S0C A;  3THT A;  5A3M A;  1QXJ A;  1AJO A;  3ES1 A;  4IE0 A;  2VZQ A;  4I0B A;  4RA0 A;  1MQT C;  3VHR A;  3KGL A;  3T0A A;  2OS2 A;  1IGO A;  1F5J A;  4NII A;  1MVQ A;  3I2D A;  3VDB A;  3FJS A;  2ZX2 A;  3I97 A;  1ACC A;  1TNF A;  3VKO A;  4DZG A;  5F3C A;  2JX9 A;  2R32 A;  3U37 A;  4AED A;  2VMF A;  3M70 A;  1FOD 1;  2DUO A;  5LA1 A;  5FFO C;  1WD4 A;  3HNY M;  1O8P A;  3WW3 A;  4AFB A;  4AHZ A;  1MR5 A;  2V09 A;  1VBB 1;  3AYC A;  4UFM A;  1NUK A;  1WCQ A;  4HSJ A;  3KQR A;  2IXL A;  5K4L A;  4Z2W A;  1RUH 3;  3RMX A;  3LA3 A;  1ASJ 1;  5FBJ A;  4KI5 M;  1IG3 A;  1G86 A;  5FZM A;  2NYY A;  4WVV A;  4YM3 A;  2D6N A;  4XC9 A;  5FPA A;  1TME 3;  3LDK A;  1PVC 1;  3UJQ A;  2VW2 A;  1ENQ A;  2Y6J A;  4CDQ B;  3BKZ A;  3RYK A;  4UYB A;  4MZU A;  1D2S A;  1UY1 A;  1ZZ9 A;  1H6Y A;  3HQR A;  1RVF 2;  3VL9 A;  3AKT A;  3WOG A;  4FFF A;  4GA9 A;  1RUG 1;  2D97 A;  1DIW A;  3LE0 A;  4O61 A;  1NXD 1;  1NKG A;  2G19 A;  3M3E A;  1GR3 A;  1HJF A;  2HWB 2;  5DMY A;  4NID A;  5IK4 A;  3JBG 2;  4BQ2 A;  4DQA A;  2J1R A;  2RMU 2;  1WCS A;  2OVU A;  5A3U A;  4FP3 A;  2KD7 A;  1W8H A;  4YRD A;  3MUY 1;  1G8W A;  4JGY C;  1V9U 1;  1LOF C;  1W99 A;  1RUN A;  4QX3 A;  3S7I A;  1UW8 A;  1JW6 A;  3M3O A;  3CJI C;  3OEA A;  1GAN A;  1PGW 2;  1N3O A;  3P6B A;  4FFI A;  1JOB A;  4Z82 A;  3FBY A;  4ASL A;  5CG9 A;  1NT0 A;  4QGN A;  4XIK A;  2C9A A;  5FUP A;  5LY1 A;  1VBD 3;  2IWG B;  3EO6 A;  3N7J A;  1RUD 3;  2RE9 A;  2W1Q A;  5A6X A;  5EYY A;  3ZFG A;  1IZ3 A;  2BWC A;  3BU0 A;  1UIK A;  2XH6 A;  1V6L A;  2WFF 3;  3ZMO A;  1RUH 2;  4QB6 A;  2VC9 A;  4WBB A;  5LA2 A;  1OLQ A;  5CKN A;  4HK9 A;  5IT6 A;  4KMQ A;  5KHK A;  5EHD A;  1ZZB A;  4OUS A;  3ZXJ A;  1QXR A;  1WME A;  1X9T A;  1O5U A;  5F3G A;  5DG2 A;  5FYU A;  2C5D A;  1UQX A;  1ZZC A;  3KCX A;  4LO8 A;  4HZF A;  1PMJ X;  5E89 A;  4QX8 A;  2RS1 3;  1KDM A;  1PK6 B;  3RI8 A;  4B4Q A;  3LOI A;  4Q29 A;  2YC2 A;  2ZXQ A;  2FDF A;  5FY0 A;  3D6E A;  4BXF A;  5DUX A;  4B4P A;  5FZE A;  2IXK A;  2VTF A;  3MIB A;  5FYS A;  3W5M A;  3BAL A;  2JEN A;  4AI1 A;  5F32 A;  2BU9 A;  3ZIW A;  5HPO A;  4D3W A;  4NOT A;  4ISQ A;  4LHN A;  5CFC C;  3V0A B;  1Y3T A;  3J7M A;  4H7M A;  2PTM A;  1LGC A;  1XNA A;  3U75 A;  2VUA A;  4AFD A;  3LEG A;  1HB2 A;  4ZKT B;  1WCK A;  2QQK A;  2VCM A;  4GWN A;  2CV6 A;  4Z1V A;  5FZI A;  4TTG A;  4L11 A;  1DYO A;  1XOY A;  5KXD A;  2ZGU A;  2RV9 A;  1IS4 A;  1VBD 2;  3A0K A;  1COV 3;  3H0O A;  2GP5 A;  1UCX A;  1HRV 3;  1PZ9 A;  2UYB A;  3L9J T;  4IES A;  4PIX A;  5ANQ A;  1QJY 3;  3RZL A;  5IVE A;  2A73 B;  4RGK A;  2LS6 A;  4Y26 A;  4A7K A;  3H1Y A;  3HN1 A;  5HXM A;  4MH0 E;  4LKS A;  3ZSL A;  3ZXE A;  2DF7 A;  3EJK A;  4AWD A;  1PNF A;  4XAA A;  1SEF A;  4ZU4 A;  2ZJC A;  3ZR5 A;  4NPR A;  1CAV B;  1NLR A;  2QQM A;  1LR5 A;  2DFB A;  1SLC A;  2XWJ B;  3NNG A;  4PDW A;  2WZP P;  4CP1 A;  5CAD A;  3VBO A;  2PHD A;  2HWE 3;  1ONA A;  3ETP A;  4YVS C;  4IEO A;  3LOB A;  2RS1 2;  4XFF A;  1REE A;  4XTP A;  1JYI A;  3VBU C;  4M00 A;  4DUV A;  1Q8P A;  4FPH A;  1QU0 A;  3FFZ A;  4XUT A;  1LRH A;  1JN2 P;  1OMI A;  5JR2 A;  3C7G A;  1WGP A;  4I01 A;  2PAE A;  1POV 0;  4DRV A;  2FDG A;  1IPK A;  2A6V A;  1X82 A;  4IQP A;  5DZG A;  4I0A A;  2X5I A;  3UKN A;  1GQH A;  3ZYF A;  2QQP A;  1DZT A;  4BM8 A;  3H8O A;  4D0Q A;  1GIC A;  4RQP B;  4ITC A;  2FDH A;  3C2U A;  4KL1 A;  3LKJ A;  2WRA A;  1MZ6 A;  1RUJ 2;  5A3O A;  5C9A B;  1BKZ A;  2J1E A;  5A3P A;  4GH4 C;  4ASM B;  1L7L A;  2WA4 A;  2V5D A;  1A34 A;  4Q4V 1;  1ULF A;  1Z78 A;  4QXC A;  3JZV A;  4Y5Z 0;  5C5U A;  3IPV A;  2K46 A;  3PHM A;  4EN6 B;  5IK5 A;  3OUH A;  1KXG A;  4CU8 A;  1RVF 1;  1BQP A;  1OLM A;  5LRR A;  2RM2 3;  1HRV 2;  3ZYI B;  2OZJ A;  2VBB A;  1QJY 2;  4V1P A;  1MQT A;  3PUR A;  1RUC 2;  3NV1 A;  2W52 A;  4I30 A;  1GZT A;  4ATE A;  1LHO A;  3WDT A;  5JSP A;  3JBG 1;  2RDQ A;  3VZK A;  1JMU B;  3U14 A;  1CR7 A;  1I9R A;  3AP5 A;  1DLL A;  4TLF A;  5AC9 3;  4COZ A;  4ES9 A;  4I02 A;  1WZX A;  3SH3 A;  4NUB A;  2IFW A;  2VW0 A;  2EXK A;  4G9S B;  2RS3 2;  2VNR A;  5JWP A;  1UZZ A;  1IS3 A;  2PQQ A;  3J7H A;  3RQ0 A;  3AYD A;  1ULD A;  1PGW 1;  4COV A;  1CZV A;  2GNM A;  3POE A;  1H2N A;  4OQ9 A;  1BVV A;  2BJS A;  3KF5 A;  2VQT A;  3DV8 A;  4PQQ A;  1VRH 3;  5KXE A;  5I0U A;  1IQA A;  2PFW A;  4KWK A;  4RSU A;  5GZD A;  3UNP A;  2ZML A;  4V2W A;  2Y64 A;  2B9U A;  4MGZ E;  5F3E A;  1R1Z A;  1KDK A;  5CKQ A;  2HWF 2;  3ZFF B;  1SDW A;  4AFA A;  1I5Z A;  1RUH 1;  4K9S A;  5FUI A;  3I7D A;  2D43 A;  2JWP A;  4AOC A;  2ZS6 B;  4M3C F;  1TVG A;  2ZGS A;  4CXY A;  2CGN A;  4B7K A;  1V6O A;  4XZP A;  3N35 A;  5FPU A;  1HKD A;  1V6N A;  2EAL A;  1I3H A;  1OC1 A;  4AI8 A;  3T2O A;  1M4W A;  5G05 L;  2W08 A;  2O14 A;  1UKR A;  4WZC A;  3ZYJ B;  2DVB A;  3KV9 A;  1JOP A;  4MHR A;  1YFY A;  2JDU A;  5KHJ A;  4OHW A;  2HWC 3;  5EJZ B;  2PYT A;  1W9S A;  2Q30 A;  1NCQ B;  2UWC A;  2UY8 A;  3IKW A;  3MFC A;  3GGL A;  3ZFE A;  1B35 B;  1JH5 A;  2P2K A;  3VBS B;  4XJ8 A;  4QQO A;  1J3P A;  3RFR A;  1ZRD A;  3WSO A;  2ZOE B;  5G04 L;  5CFD A;  4DMI A;  4QDR A;  1NCR B;  3EMR A;  4EWA A;  1LOF A;  3FX3 A;  1RUE 3;  1J83 A;  1C57 A;  3SQO A;  3ACH A;  3SXW A;  2BTV C;  1UOJ A;  1V6M A;  3VDD B;  3VBH A;  1MS0 A;  1KJR A;  3USS A;  4PLO A;  3ZN5 A;  5CIR A;  4FFH A;  1AX0 A;  2WWU A;  5FXX A;  3QAC A;  3T1L A;  5FBZ A;  2HBT A;  4GAL A;  3VKN A;  4BQ5 A;  1GQP A;  4MUV A;  4E9K A;  3C7E A;  3S5Q A;  4QX1 A;  1H8T C;  5FP9 A;  3ZSE A;  5JPN B;  3ECQ A;  3RGB A;  4CDU B;  1VBD 1;  3NJY A;  5BYN A;  3T4H B;  5AFE A;  1VRH 2;  2RJK A;  2ZGK A;  1XPW A;  4OMC A;  5JMO A;  1QJE A;  3RYP A;  1NA1 B;  3O0V A;  3KV5 A;  5D1I A;  2WFF 1;  4DXT A;  1WBL A;  3DYO A;  3VB9 A;  4FPC A;  4FO9 A;  4HL0 A;  5SV8 A;  5FZO A;  4W65 A;  1K5J A;  1J1L A;  2R0H A;  3NV2 A;  4YZ3 A;  3DXU A;  1UMZ A;  3U1X A;  3ILF A;  4HFS A;  4BQX A;  4XOG A;  1FNY A;  4O65 A;  1SAC A;  4PI2 A;  5LAS A;  4QQP A;  1REF A;  4Y1Y A;  1US3 A;  3CF6 E;  4CCC A;  4IEX A;  5I0R A;  4BK5 A;  2RS1 1;  1AF9 A;  4N7I A;  3JD7 2;  3AXE A;  1YUD A;  4Y4R A;  4RN5 A;  4DS0 A;  5CFC A;  2XKO A;  4V2V A;  3JB8 A;  4XIL A;  2R30 A;  4ZY9 A;  4AHY A;  4ARX A;  2WLQ A;  3J26 N;  4TYS A;  3V0B B;  1T6B X;  3POI A;  2P37 A;  4W6W A;  4N43 C;  1RUE 2;  1C8M 2;  4QQL A;  4BQ1 A;  1S0G A;  2JIJ A;  1J58 A;  3FMG A;  4XUP A;  5GZE A;  2O1Q A;  1GZ9 A;  2G4I A;  2H0V A;  3I2G A;  4NAM A;  3RVH A;  2VUD A;  3AL6 A;  3HOB A;  3SEE A;  1T6G C;  2R06 3;  4I3G A;  4LEJ A;  4KH9 A;  1RUJ 1;  4E4H A;  5KWR A;  3KT4 A;  3ACF A;  3QOP A;  1BYH A;  1HQN A;  2D6M A;  4WM7 C;  1LKN A;  4QPG B;  2WQ4 A;  2ZGO A;  5FZ0 A;  4OI0 A;  1V6J A;  4OLL A;  4LKD A;  2GZW A;  5EIY B;  2P1B A;  5DQ0 A;  2XBO 2;  3NV4 A;  4JHZ A;  5JI9 A;  4CPB D;  1QDC A;  1SFP A;  2QKD A;  1COV 1;  2R04 3;  5EJ3 A;  3EHK A;  1ZA7 A;  1IPS A;  1HRV 1;  3OY8 B;  4CEW C;  4H14 A;  1UY4 A;  2VZU A;  3NNF A;  4NRQ A;  1QJY 1;  5FIX A;  5I8S A;  5LK5 A;  4CCE A;  4J1W A;  1RUC 1;  2AYH A;  1OHF A;  4DY3 A;  1UX7 A;  4HXC A;  4YVS A;  3JQW A;  3IMM A;  2PAM A;  4Q4X 2;  1UY0 A;  3OG2 A;  4CUC A;  2JE8 A;  3VBU A;  1QJU 3;  3WW1 A;  1EPW A;  3OPT A;  1OOP B;  2AH2 A;  4N53 A;  3TAY A;  3K48 A;  1XU1 A;  1DP0 A;  3A23 A;  2HWE 1;  5BNQ A;  1AYN 3;  1W6Q A;  2RS3 1;  5IUQ A;  1WUV A;  1NXM A;  4PI0 A;  3BYW A;  3AVS A;  1DQ1 A;  1MS8 A;  1BK1 A;  1NYW A;  2BNO A;  4XEZ A;  3E5Q A;  2DWR A;  5JSR A;  1QMJ A;  3SHR A;  4CP9 A;  2Y60 A;  5FWJ A;  1PZ7 A;  5ISL A;  5F7U A;  4GH4 A;  1FV2 A;  4Q4W 2;  3ZXG A;  2HWF 1;  1QOS A;  5IW0 A;  2G9Z A;  4KWU A;  2VY0 A;  1UO9 A;  5M0T A;  2Y6H A;  5L9R A;  1L3J A;  2BGO A;  2PN5 A;  2WZ8 A;  4SLI A;  2ZGN A;  5FZ9 A;  1W8Z A;  1DGW X;  2R06 2;  2ET7 A;  2D40 A;  1RIR A;  1IKQ A;  3ROU A;  1UKG A;  2W39 A;  3M7A A;  1LEC A;  4Q1R A;  2B7Y A;  3T2P A;  1Q8Q A;  1VBE 3;  3NRU A;  5A32 A;  2WZE A;  3MIF A;  3HR9 A;  3PU3 A;  4XJW A;  3WF0 A;  4MYE A;  5IFT A;  4A6S A;  3A22 A;  3WG2 A;  1D4M 2;  2DUP A;  3SIS A;  2R04 2;  4SBV A;  2RM2 1;  4XQD A;  5APA A;  2C4X A;  2A6W A;  2CGP A;  5KBF A;  4GB3 2;  4XF1 A;  5KC6 A;  2DCK A;  3O14 A;  3WNK A;  1YFX A;  3VDA A;  1K3I A;  1SFY A;  3LWC A;  3UKV A;  1ND3 C;  1W9Y A;  2I74 A;  4YM1 A;  2MEV 2;  4XDP A;  3BN6 A;  4P00 B;  5AC9 1;  1JZ2 A;  4IE4 A;  3SCH A;  2VCB A;  1QQP 2;  2FCV A;  2ZGR A;  4LOS A;  4WVM A;  3ZXF A;  4BH9 A;  4E8D A;  4Z2A A;  5FKB A;  1AYN 2;  1C1L A;  1OA2 A;  2QUO A;  2XJV A;  4QHO A;  2ZX0 A;  4CEY B;  4CYD A;  2BDR A;  3EXU A;  1W6N B;  2VMH A;  4Q0S A;  1VRH 1;  1XE0 A;  2NPI A;  4JZR A;  4QKF A;  1UWW A;  2RJ2 A;  2RHP A;  3C8X A;  5JR7 B;  4NRO A;  3OBA A;  1HB4 A;  3LA7 A;  2GC1 A;  3N7K A;  2AEY A;  1PMH X;  5L9B A;  2ADE A;  4MO3 M;  1OPM A;  1UOF A;  5IFP A;  2IXJ A;  1HV0 A;  1OLM E;  4GWJ A;  4IV1 B;  5GJ6 A;  4EE2 A;  3AP4 A;  4TZD A;  4XFA A;  2PHL A;  2OII A;  5FLJ A;  1VBE 2;  2RS5 2;  3A4U A;  2B4K A;  3H1W A;  2HWC 1;  2VBD A;  1AR6 3;  2YU1 A;  1UX6 A;  1K5M C;  3PUS A;  1AR7 2;  1DLC A;  1W2A X;  1RUF 3;  1YIF A;  2E7T A;  2OPW A;  3AMM A;  1ZBA 3;  5FQ0 B;  4BYY A;  5JCT A;  3ZMN A;  2HWD 3;  3N9N A;  2VH9 A;  2HYK A;  4R52 A;  2ID4 A;  2WWS A;  2YB7 A;  3LCP A;  3PLQ A;  4HOO A;  4AVS A;  1RUE 1;  3MIC A;  2ZX3 A;  5FRA A;  5L19 A;  1O4Z A;  3N9Q A;  2XJQ A;  4X6Q B;  5H9Q A;  4YM0 A;  3N9M A;  4K20 A;  2P3Y A;  1IOA A;  1GYK A;  1WW6 A;  2JKB A;  2XKP A;  3SEP A;  4EZ4 A;  1XQN A;  2XL9 A;  2YPD A;  3VBR B;  4P9G A;  1ZYB A;  3ORJ A;  4ZON A;  1UZV A;  1WKY A;  1HN1 A;  4N8M A;  1XYN A;  2XHN A;  3VD4 A;  1FAY A;  1W8U A;  5AFB A;  2ES3 A;  2OZ6 A;  3POJ A;  5GLZ A;  1WW4 A;  2PXJ A;  2XBO 1;  3ZVX A;  5BNN B;  2A3X A;  3HD8 B;  3JXS A;  4OCT A;  4AK3 A;  4XXP A;  1V9U 3;  2ZEY A;  3NKT A;  2JB4 A;  2RDS A;  5F37 A;  2XXZ A;  4ZXE A;  4Y1V A;  2JE9 A;  3R4S A;  2X05 A;  3AFK A;  3D82 A;  2UWB A;  4CCO A;  4J6G A;  4CDQ C;  4QQH A;  2RDN A;  4GWM A;  5E16 A;  3ZPY A;  1EYB A;  3POS A;  5A3T A;  4QHZ A;  2Z69 A;  3IDC B;  3H9A A;  4IND A;  1GWL A;  1OH4 A;  3AM2 A;  1YO8 A;  4N43 A;  5F9T A;  1GP5 A;  3LQC A;  4Z07 A;  2F17 A;  1GNY A;  1E5I A;  2YFZ A;  1LHV A;  3ITQ A;  4U36 A;  5GLW A;  1XNB A;  1POV 3;  2EAA A;  2HWD 2;  3OD4 A;  1W90 A;  4Q8L A;  4XFH A;  4AQ2 A;  2YBP A;  5JXH A;  1ULC A;  5EQU A;  4RR3 C;  4WM7 A;  4XYX A;  1W06 A;  4WVZ A;  5CNA A;  2WO1 A;  2H0B A;  3PTY A;  1MEC 3;  2XUM A;  5FRE A;  1ULO A;  2YHJ A;  4H3W A;  1S0J A;  2FQP A;  3MUZ 1;  2R06 1;  1JOJ A;  3USU A;  5L7O B;  4Q0U A;  2WT0 A;  1C5H A;  4FQ4 A;  1QOO A;  5GZC A;  4R4X A;  3ILN A;  2ZPX A;  3NVC A;  1CAX A;  1SPP B;  2OXB A;  4HG6 B;  4JX0 A;  4LBO A;  4YVW B;  4B29 A;  1W0P A;  4D6Q A;  4QM8 A;  1GQG A;  4K40 A;  4JVA A;  1XU2 A;  2YZ4 A;  2JD4 A;  2AEN A;  2R04 1;  3O12 A;  4R9D A;  4TN7 A;  4RD7 A;  3MF6 A;  4BQ3 A;  1BMV 2;  1MZF A;  4XMA A;  2D6P A;  3MID A;  4FXK B;  3D4K A;  3H7Y A;  5GKA C;  2VNG A;  2WNO A;  3SH5 A;  1F9K A;  3ZLI A;  1UF2 C;  2HLE A;  3BOD A;  4H55 A;  4YW4 A;  1PK6 C;  1QJU 1;  3DPR B;  4UFL A;  5FPV A;  1CON A;  1IS5 A;  4TLG A;  4IE7 A;  4DRR A;  3OGV A;  2ZHL A;  2ZX1 A;  1W39 A;  3LB9 A;  1AYN 1;  4TSV A;  1CAW A;  4YZ5 A;  1R64 A;  4FOV A;  3WF1 A;  4CU7 A;  5ABJ B;  1A78 A;  4FVV A;  1W2T A;  4LO6 B;  4URT A;  5A7W A;  1QHD A;  4XJZ A;  4AVV A;  2A71 A;  2IFR A;  3DYP A;  4Y1X A;  4Y3O A;  3WP5 A;  2QJV A;  3BUC A;  1I1E A;  5CYY A;  1AVB A;  2WS9 3;  4LKE A;  1MEC 2;  2FD8 A;  1YRZ A;  3WY6 A;  5IYY A;  2R0F A;  3SC7 X;  5DN2 A;  4FSJ A;  3DUI A;  1SLL A;  1ND2 B;  1T2X A;  4M0H A;  5A33 A;  4S2D A;  2ZX4 A;  1XSR A;  5FPL A;  5C7G A;  1VBE 1;  2VVF A;  5C3Q A;  3O1S A;  5DUV A;  1U0A A;  5BNO B;  4UXA A;  4LBQ A;  1LHN A;  2VXJ A;  5CVR A;  3ZN4 A;  3MFA A;  3P3N A;  5A1F A;  1VRB A;  3WDY A;  4FQZ A;  3RWK X;  1ND3 A;  2W95 A;  4IEU A;  4F83 A;  1VAM A;  3NV3 A;  3FUQ A;  4LPL A;  1MPX A;  4XDO A;  4YYO A;  3ZXA C;  4P02 B;  4HN0 A;  2VUL A;  4CU6 A;  4FPL A;  2HEV F;  3WHU A;  1BLZ A;  2ATF A;  1RVF 3;  1O91 A;  1ZM1 A;  3WNL A;  1JYV A;  5F3I A;  2EXI A;  4WM8 B;  3I49 A;  4FTS A;  5L36 A;  4NMI A;  5C4W B;  2HWB 3;  4QPI A;  3H3U A;  1SBF A;  2XJT A;  2RMU 3;  2WYF A;  4LE3 A;  5EJ1 B;  1AR9 2;  3NMB A;  3TRS B;  3FFQ A;  4I0W B;  1W9T A;  4A44 A;  4RQP C;  5GZG A;  1W0N A;  3N7M A;  2IUW A;  3OF1 A;  2QQN A;  2CDO A;  3Q8F A;  3R4D B;  5C9A C;  2Y34 A;  3OGG A;  2WS9 2;  5IVY A;  5IJR A;  5FZB A;  5JDB A;  1D2Q A;  4YGE A;  4UFI A;  1ZRI A;  2JDZ A;  4UBH A;  1AHS A;  3PTR B;  2VUJ A;  5LW9 A;  1K5M A;  4AED B;  5BNP A;  4Q4Y 3;  1GWM A;  1Y9G A;  1AUY A;  1HN0 A;  1URX A;  2QNK A;  3FN9 A;  4Z92 B;  4PF1 A;  4CDW B;  3WG1 A;  3BTZ A;  2NM1 A;  4MGK E;  2WN3 A;  4QDQ A;  5FTT C;  1AR6 1;  1LNS A;  1WD3 A;  1DDL A;  4YW6 A;  1UU6 A;  5FY8 A;  5FYZ A;  1RUF 1;  3GXU A;  1ZBA 1;  3GNE A;  4XET A;  2W5F A;  5FO7 B;  1LU2 A;  2HWD 1;  3LGR A;  2V5Y A;  2FCT A;  2GSY A;  3AJY A;  1S0E A;  4KWL A;  5IVV A;  4TXW A;  1PGL 2;  1O3R A;  4LE4 A;  1OPO A;  1O5L A;  3AZZ A;  3TWI A;  1TNR A;  5HI0 A;  4PBP A;  4Y33 A;  4OI2 A;  3HT2 A;  4QX2 A;  3FLT A;  1RYY A;  1XNT A;  3O5S A;  2Q1F A;  5FK8 A;  1WMD A;  2EXH A;  5FMB A;  1PX3 A;  5HCA A;  3WDU A;  3ZFF C;  2D6K A;  3NNL A;  2P5B A;  4IDZ A;  5JZG B;  4BPZ A;  1JZ5 A;  2HBU A;  1OKO A;  4XJU A;  1DQ0 A;  2A3W A;  3B9I A;  3I59 B;  4RS5 B;  2WIN B;  3R4U A;  4QAW A;  4RGA A;  2DBN A;  1VB2 A;  2CAU A;  2BYV E;  5LBF A;  5J36 A;  2AGS A;  4GUL A;  4LHS A;  2W1W A;  1NCQ C;  3FHI B;  4QMA A;  1XBF A;  4UFK A;  2GMM A;  5F6L B;  3RZM A;  1B35 C;  4Q4Y 2;  3VBS C;  3DYM A;  3MDP A;  2WDB A;  2XDV A;  1JZ7 A;  3ZYH A;  1BEV 3;  2CTV A;  2ZCW A;  4HBN A;  4RR3 A;  1DZR A;  1LOG A;  1NCR C;  2PQS A;  2C1F A;  2IVI B;  3MBW A;  4EJR A;  2F4P A;  2YU2 A;  3LFI A;  3HMY A;  5DAV A;  3KCY A;  2ARC A;  3HVD A;  4FPK A;  3VDD C;  1CJP A;  3LIG A;  3WNX A;  3INA A;  3WP4 A;  1POV 1;  4YFW A;  2DVA A;  4LXL A;  1C1F A;  3H50 A;  3Q8C A;  4YNI A;  3T4V A;  1H1A A;  4OFG A;  1MEC 1;  1SCS A;  2YPJ A;  2J1S A;  2Y6G A;  1JYX A;  3VV1 A;  2VMI A;  4L8Q A;  3T3Y A;  2E63 A;  2J42 A;  1PM7 A;  4LLF A;  5EFU A;  3UGG A;  4AI9 A;  4CDU C;  1ULG A;  3B7M A;  5C3O A;  1IS6 A;  1NA1 C;  5HCF A;  2YMZ A;  1H1I A;  2YY1 A;  1ZA4 A;  3RYR A;  2WA3 A;  2JDP A;  5C3P A;  2CSG A;  3OYW B;  1Y9Q A;  1YQC A;  2ZZJ A;  3SNM A;  2C26 A;  3GYD A;  3ZN6 A;  3UET A;  3ZYP A;  3KSC A;  1RUJ 3;  3WZ1 A;  1PK6 A;  2D7F A;  2UWA A;  3BIW E;  3N9O A;  3W21 A;  1WCU A;  2DDU A;  4BIO A;  4BK4 A;  4ERO A;  1YWK A;  3VGI A;  3J7N A;  3S30 A;  2ORZ A;  1X36 A;  4LHK A;  4CCD A;  4BQ4 A;  3OUJ A;  1W6P B;  1LJ7 A;  2WL1 A;  2WQ8 A;  5C5T A;  3AX4 A;  1I5P A;  1PO2 3;  1R08 3;  2WO2 A;  4OHV A;  5CA6 A;  3GCX A;  3OBT A;  5K8S A;  5JXJ A;  2E9Q A;  1RUC 3;  2WZR 3;  1W8O A;  3DKQ A;  3KB5 A;  1BEV 2;  4O9G A;  3T2Q A;  4C0B A;  3J4U H;  2YRO A;  5HCH A;  5JIU A;  1X9P A;  2YBK A;  4MLO A;  1W6O B;  3D8C A;  5FO8 B;  3MLJ A;  1AR9 1;  4CTE A;  4E2S A;  1HDK A;  1VAK A;  3CQO A;  3M4F A;  4ZZ5 A;  4KGG A;  4JTO A;  3RG0 A;  1UU5 A;  2VD7 A;  1RC6 A;  5FZH A;  5LK7 B;  2XUE A;  1W2N A;  1CIW A;  2RS3 3;  3VL8 A;  4BLJ A;  1J84 A;  1QOT A;  2WS9 1;  5FV3 A;  4QPG C;  4AEK A;  5A7N A;  4XFB A;  4LA2 A;  4FTB A;  3MW2 A;  1W2U A;  4K1Z A;  1HRI 2;  5DAX A;  2HYX A;  3ASI A;  4IEW A;  4UW4 A;  1N3Q A;  4L0P A;  5LA9 A;  1D4V B;  5C3S A;  2HWF 3;  2GN3 A;  2WNE A;  2EVX A;  4LR4 A;  4XUN A;  1HXS 3;  3POW A;  1V70 A;  1UOB A;  2VNV A;  2ZGP A;  1F31 A;  2X5I B;  3LF7 A;  3TEY A;  4A45 A;  3PIG A;  2P6H A;  5E8A A;  3E6B A;  4DPN A;  1JZ8 A;  4Y22 B;  5A3N A;  3Q8E A;  5I8Y A;  4AVB A;  1OOP C;  1UU4 A;  1PM4 A;  1FPN 3;  1Y4W A;  3GDB A;  4Q26 A;  4LT5 A;  3F2Z A;  3IPV B;  5FZF A;  4LNV A;  5ACA 3;  3D0S A;  3PJY A;  3FLP A;  4DXS A;  1FX5 A;  1O6U A;  1GNH A;  3DL3 A;  4Y24 A;  1PO2 2;  1R08 2;  4RQP A;  5FPZ A;  2VGD A;  4CDX B;  1GP6 A;  4HVQ A;  3DEM A;  3H8U A;  4BWO A;  2WZR 2;  2RG4 A;  5HV4 A;  3GZA A;  2HWB 1;  1O4Y A;  5C8C B;  1OF3 A;  1NQJ A;  3DF0 A;  1KIT A;  2RMU 1;  1OQE A;  1UD1 A;  2P17 A;  1WCD J;  4H2A A;  1Q8S A;  2ET1 A;  5FUN A;  3POY A;  3B5L B;  4DXR A;  3H3L A;  2E53 A;  2VAU A;  2VPV A;  4CCJ A;  4EN9 B;  1UOG A;  1TMF 3;  1AXY A;  3PVB B;  3I2I A;  2O8Q A;  2DCZ A;  1KD7 A;  2WR9 A;  3PUH A;  5EPA A;  1QIQ A;  3TN9 2;  5A6Z A;  3O1R A;  3C7O A;  1SBD A;  2Y6L A;  3VBF B;  2XVL A;  4Q4Y 1;  4R8H A;  1TEI A;  3H3Z A;  4B3N A;  3ZX7 A;  1CAU B;  2NMN A;  4CCK A;  4LJH A;  5IVB A;  1HXS 2;  1UMH A;  3Q9O A;  2R1D A;  1YCI A;  4AGR A;  4YW7 A;  1NLQ A;  4F8A A;  4Y5T A;  2JIC A;  2VOT A;  3ILR A;  1KFX L;  2PHR A;  2XLA A;  3RZJ A;  1Q8V A;  2PA7 A;  4BU2 A;  5EXO A;  3RZK A;  3LEK A;  1GZC A;  4AAX A;  2ZHM A;  4NRP A;  1XSQ A;  2GU9 A;  1CJD A;  4RHV 2;  2VZS A;  3P1I A;  1WA4 A;  4A41 A;  1AR8 2;  1AXK A;  1FPN 2;  2XL7 A;  3AP9 A;  1S4C A;  2JEC A;  4GKX A;  4GMP 1;  3ZFF A;  3ACG A;  3JD7 3;  4E2G A;  1DQ6 A;  4CEY C;  4KU8 A;  3LZZ A;  4PQ9 A;  3ZFE B;  5ACA 2;  3THC A;  3K4Z A;  4LIV A;  1N3P A;  2XR4 A;  1YFU A;  2DU0 A;  4LTA A;  1RHI 3;  3NO8 A;  1LTE A;  1ULE A;  4ATF A;  4JGY A;  4XBN A;  4RGG A;  4MET A;  5CFD B;  1PIV 2;  1C8M 3;  1YI7 A;  2ETE A;  3AKR A;  1ST8 A;  4LIU A;  5T55 A;  4YFZ A;  1IHM A;  3QD6 A;  3CJI A;  1BJQ A;  2EIB A;  1JZ3 A;  5I8T A;  2DVF A;  1CPN A;  2ZA9 A;  1VMH A;  1UYP A;  3VBH B;  3I3B A;  4B4R A;  3NJX A;  2D6L X;  3AVR A;  3FC0 A;  4Y1Z A;  1AX2 A;  1NCQ A;  2BER A;  1RJ7 A;  4P9W A;  4FP2 A;  1VAL A;  1R1A 3;  3DGT A;  4IV1 C;  4FBF A;  1B35 A;  1ZZ8 A;  3OOX A;  1TMF 2;  3PVO A;  3CKH A;  5EP9 A;  3VBS A;  3WDV A;  1CVN A;  3VZN A;  3ZDV A;  3HAG A;  4A7Z A;  2BVV A;  2DUR A;  1WBF A;  4OUL A;  2FZ2 A;  3AMQ A;  2LTN A;  4R9C A;  3I3M A;  4DUW A;  1NCR A;  4YPJ A;  3WCR A;  1S1A A;  2XBO 3;  4AHX A;  4MGT A;  4BME A;  5LY2 A;  5JPM B;  2VMC A;  1SCR A;  1IPJ A;  4E2Q A;  5D8A C;  2CNA A;  3FZ3 A;  2WN2 A;  1GKB A;  5FZK A;  4P14 A;  2FDJ A;  2C0Z A;  2R16 A;  3THP A;  1BEV 1;  3KD4 A;  2YC4 A;  4KNC A;  2VVE A;  3VKF C;  1GP4 A;  4Q4X 3;  5KHH A;  1DYP A;  3RJR A;  5CU1 A;  2JB8 A;  2W0X A;  3CO2 A;  1H6X A;  1YQ2 A;  4MSV A;  5J7M A;  3ZIX A;  4DXZ A;  2K2S A;  3MIE A;  3ZYB A;  4PLM A;  1YXW A;  2A5Z A;  4JCK A;  4CDU A;  4W50 A;  1YJK A;  3VBR C;  3VKM A;  3WHT A;  3KCC A;  5FOJ B;  1BHG A;  1DCS A;  5AVA A;  3I2J A;  5F5A A;  2Z5W A;  1MZE A;  2ZGL A;  1MAC A;  1VE0 A;  1UAI A;  1E57 A;  4OUM A;  5CG8 A;  1DQ4 A;  3RMY A;  4NO4 A;  3AL5 A;  4MXW A;  4IER A;  4FPG A;  4R9B A;  5K0U B;  1RHI 2;  3S0M A;  5BNN C;  2O0O A;  2BGP A;  1ODN A;  2GH8 A;  4Q4W 3;  2WC2 A;  5BXX A;  3SIT A;  4AVC A;  4IEP A;  3PNA A;  4DO0 A;  4QWN A;  2I07 B;  1DHK B;  4GMP 0;  5FPB A;  1UZW A;  1R09 3;  2RDR A;  1V00 A;  2BQP A;  3U4S A;  2H6C A;  2A70 A;  1R1A 2;  1OD5 A;  2Q1M A;  3C7F A;  1JU4 A;  2JG8 B;  3V0B A;  2XJS A;  4ONU A;  4HET A;  1D4M 3;  1FV3 A;  1I6X A;  2E6V A;  2VW1 A;  2MPF A;  4DB5 A;  2LUW A;  4Q27 A;  1WW5 A;  1IQD C;  1IG0 A;  3OSD A;  4OHY A;  1PO2 1;  1R08 1;  3NAP B;  5H9S A;  2ZEZ A;  4NIA A;  1JZ6 A;  1DF0 A;  1UZY A;  2BP6 A;  4JC1 A;  2WZR 1;  2DVD A;  4GB3 3;  5DZE A;  3III A;  3ZM8 A;  2BW8 A;  1W3V A;  1SLI A;  3VD5 A;  1AYM 3;  4QPG A;  2Y38 A;  3M1H A;  1WLC A;  4AI0 A;  2VL4 A;  2MEV 3;  3K4D A;  2W91 A;  1MS9 A;  1QQP 3;  3WNP A;  2GAU A;  5L7O C;  1GOF A;  4N53 B;  4NPM A;  3BI3 A;  1XYO A;  1H4G A;  1QGL A;  4FTE A;  3OY8 A;  1C4R A;  4C1W A;  3LDB A;  2X53 S;  1DGR A;  4YVW C;  3TN9 1;  2VNO A;  4XTM A;  5DPN A;  3NW4 A;  5DUW A;  4NN0 A;  5FP8 A;  4ZS3 A;  1C5I A;  1F15 A;  1VAV A;  3H1M A;  2WNV B;  4L9B A;  4LUK A;  2EXJ A;  3LIH A;  4XF9 A;  2ZMK A;  1HXS 1;  1SLT A;  5FYI A;  1XYP A;  3N7L A;  5HBA A;  2VVD A;  1ZNP A;  5DZF A;  1S2K A;  5CKM A;  1ZZ6 A;  2A7A A;  1CPM A;  5FZ4 A;  2CGO A;  1R09 2;  1MZ5 A;  3PUQ A;  3B94 A;  3KHB A;  5FXZ A;  2VZR A;  3KHC A;  5FMO S;  5H9R A;  2JIG A;  2RS5 3;  3HJR A;  3GHN A;  3CU7 A;  3AXD A;  3DPR C;  4RHV 1;  2WYS A;  5LEJ A;  1F8V A;  5LCW L;  3IBM A;  2W46 A;  4HKW A;  2EIC A;  2G9F A;  1DBN A;  1HB1 A;  5A32 B;  1FPN 1;  4QU1 A;  2VQA A;  1AR7 3;  1RB8 G;  5ACA 1;  5BY5 A;  1H2K A;  4GXL A;  2KM2 A;  2PLV 3;  2BV4 A;  2QVS B;  5A3L A;  4QPY A;  1H1M A;  3VLB B;  4EWD A;  1UYX A;  1PMI A;  4C91 A;  4Y20 B;  5CBL A;  1UXX X;  3MV0 1;  4E4Z A;  1AYM 2;  2VG9 A;  4C0H A;  3FE5 A;  1XRU A;  3PMS A;  4YGD A;  1UPI A;  4OUE A;  5LZ6 A;  2R6Q A;  4AI3 A;  4XDQ A;  3K46 A;  4XQ4 A;  3BCW A;  3FLR A;  1GUI A;  1ND2 C;  1TMF 1;  3MO4 A;  3ON7 A;  2GME A;  4MAD A;  4WVM B;  2Q8C A;  3POB A;  3IDA A;  1AZD A;  2VEC A;  4YG3 A;  1OQ1 A;  2W92 A;  5C33 A;  2GC3 A;  5BNO C;  4J25 A;  3E6C C;  2LAL A;  2BFU S;  5A7S A;  1CX1 A;  1F35 A;  5GZF A;  4JKM A;  5SV5 A;  1LEN A;  2TEP A;  4QD2 A;  4OHX A;  4LBM A;  1N1T A;  4DIQ A;  2Y8K A;  2ILM A;  5LBE A;  1NE6 A;  1SZB A;  2HEW F;  4A6O A;  1JUH A;  2ZMN A;  1ZRE A;  2PHU A;  2R1B A;  2ZTN A;  1W03 A;  1FMD 3;  1SLA A;  1OUS A;  4P9J A;  1G9B A;  2PHW A;  3KT7 A;  2VQ0 A;  2W3J A;  4IE5 A;  2JD9 A;  4F3J A;  3B93 A;  4CEY A;  2GNB A;  5C8W A;  4NR1 A;  2QQV A;  4IEV A;  3HWJ A;  3IM0 A;  1YIP A;  2KR2 A;  2R07 2;  1UMI A;  1W6N A;  4WM8 C;  3R6S A;  5C4W C;  2VJX A;  1YYN A;  3I8T A;  4LHL A;  1UN1 A;  3SH4 A;  5FP4 A;  3JD7 1;  3LEM A;  4XFC A;  1LED A;  4QGM A;  1BXH A;  3WQ0 A;  1H2L A;  4GD4 A;  2E33 A;  4Y4Y A;  5FYM A;  1BCX A;  2IXI A;  1LB2 A;  1RHI 1;  1QDO A;  1J1T A;  2PLV 2;  2TNF A;  3JU9 A;  4JGZ B;  5A70 A;  1C8M 1;  2QBX A;  2GC2 A;  2VCC A;  4JRL A;  2FMY A;  1H4H A;  1H8T A;  2QDR A;  1XJA A;  5FZD A;  3PVN A;  1AL2 3;  1R1A 1;  4CPB A;  2UY9 A;  4AQT A; 
#chains in the Genus database with same CATH homology
 4O65 A;  4PI2 A;  1YEW A;  3RGB A;  4PI0 A;  3CHX A;  3RFR A;  4PHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...