1YUDA

X-ray crystal structure of protein so0799 from shewanella oneidensis. northeast structural genomics consortium target sor12.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
158
structure length
158
Chain Sequence
MQNADDFIKFLELEQHVEGGFYRSSYRSETAFDPSRQLWSSIYFLLRTGEVSHFHRLTADEMWYFHAGQSLTIYMISPEGELTTAQLGLDLAAGERPQFLVPKGCIFGSAMNQDGFSLVGCMVSPGFTFDDFELFSQEALLAMYPQHKAVVQKLSRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein SO0799
publication title Crystal structure of hypothetical protein SO0799 from Shewanella oneidensis
rcsb
source organism Shewanella oneidensis
total genus 26
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yudA01
2Z2SB 2PHDA 1EPZA 1J3QA 2XHKA 4I0AA 2D5FA 4ZU5A 1I6XA 2Y0OA 2QNKA 2XLFA 2GC0A 2BNOA 1SEFA 1Q5OA 3SXWA 2GH2A 4QGLA 2PYTA 3RNSA 1YFYA 3MDPA 3NVCA 1OD5A 4F7ZA 1CAWA 5I8SA 5JSOA 4J1WA 4IEQA 5KHIA 2UY8A 5EZWA 1J58A 2IXCA 2MNGA 1UIJA 1YUDA 5I93A 1O3SA 3USSA 4AXOA 4FAGA 3G7DA 2Q4SA 4P9GA 3I59B 4H7LA 4OLLA 5LEJA 3SMHA 1H1IA 2HJIA 4B29A 1V70A 1XE7A 2HKXA 2UY9A 2ZKLA 4I2OA 3U0ZA 3E97A 1ZZ9A 4QX5A 3UKTA 3H8UA 4E2QA 3OTFA 2PAEA 2XKPA 4Q0SA 3S0MA 1IPJA 5JCTA 4HVRA 3GBFA 3R6SA 2ETEA 4IEYA 1QY4A 1CAUB 2H0VA 3PNAA 4R52A 1DGRA 1J59A 1ZVFA 4LA3A 5FQ0A 3DV8A 3NL1A 2K9ZA 5FDBA 3TNPB 2N7GA 1UCXA 4EROA 2P17A 3CL1A 2UYAA 4N9IA 4L11A 3LA2A 5KHJA 2IXKA 1GQGA 2B8MA 1Q43A 5JSPA 2ET1A 2BNMA 5J3UA 3I54A 3OD0A 2CAVA 4I3PA 3E5QA 3JZVA 5BV6A 4XF1A 3FE5A 4XF0A 5J7MA 1QXJA 2MPFA 3ELNA 2H6BA 4N9HA 1O5UA 4AQ6A 4XFHA 1NYWA 2XL9A 5EFUA 3ES1A 4IEPA 3I7DA 3PLQA 1NXMA 4UXAA 4LULA 4Q0QA 1RUOA 1ZZ8A 2QDRA 3D0SA 1O4TA 3H50A 2FQPA 3RZZA 3RYKA 4MGKE 1X82A 4MX3A 5E16A 5KHGA 4IESA 2PA7A 3CEWA 4AQ2A 5I0TA 3KCCA 2WFPA 2Z69A 3N4MA 1XRUA 3IIAA 1Q3EA 3VHRA 4Q29A 5I0RA 3H3UA 1QXRA 4ONUA 3GYDA 1J3PA 5D1IA 4HSLA 1ZRCA 5HI0A 4J1XA 2OYZA 2UYBA 4GULA 1CX4A 4FT8A 1PMIA 1ZRDA 5FPZA 2OZJA 3RPQA 2D40A 2GAUA 4KU7A 2IC1A 2GC1A 4MV2A 3E5UA 2BGCA 5BUVA 4Z82A 3WW4A 3LZZA 4MGYE 3NKTA 2B9UA 4EV0A 3LAGA 5FLJA 1ZNPA 2XKOA 5BXXA 1WLTA 5BY5A 1H1MA 3ACLA 1FI2A 1PM7A 3FX3A 4JTNA 5J48A 4LTAA 2I45A 1GQHA 3S7IA 4QXKA 4YSFA 5C8WA 1X7NA 4X6RB 3MZHA 5JAXA 2ZCWA 3EHKA 3NSTA 1J3RA 1EY2A 3DL3A 3L2HA 1O5LA 5LRRA 3ETQA 1LRHA 2Q0AA 4HN0A 3OF1A 1RTVA 1YFWA 3FFQA 3BPZA 3HQXA 5BPXA 1NE6A 4JV4A 4UBGA 2Q1ZB 4TLFA 3OGJA 4I02A 3MYXA 5E1RA 5JR7B 3TNQA 3HT1A 1UPIA 1XE8A 3H3ZA 2ET7A 4YNIA 2EAAA 1ZX5A 2H6CA 4HZFA 2XLGA 5KHKA 1JUHA 1OMIA 3CLPA 1YHFA 4PJYA 1WA4A 2OA2A 3H1YA 4MH0E 3CF6E 4MZUA 3ROUA 5I0SA 3IDCB 1VP6A 4A2UA 5T3NA 4FBFA 1X8EA 3CO2A 3IDBB 1O3TA 1ZZ6A 5I0UA 4AVBA 3KMHA 3IBMA 2CGPA 3MPBA 4O9GA 2GZWA 5FCCA 4O9EA 4IETA 2EA7A 2V09A 1ZZCA 1TQ5A 2O1QA 4QM8A 1LR5A 5K8SA 1YWKA 1RL3A 1SFNA 4Q0UA 2WC2A 3O14A 4BH9A 5FLIA 5LEKA 2VQAA 2OPKA 4KWKA 1CAVB 4IEVA 2GU9A 1YFUA 2C0ZA 1RGSA 2ATFA 1X8MA 4XEZA 5JSRA 4I0BA 4PIZA 3SHRA 3PVBB 3E5XA 3UKNA 3LA3A 3UKVA 1O3QA 2PTMA 4BHPA 3EQEA 3SCHA 2GC2A 5CADA 2QCSB 2Q30A 2QVSB 4LUMA 4ORFA 2K0GA 3H1WA 4LLOA 1VJ2A 3BCWA 5FLHA 3ZDSA 4E2SA 3HIFA 5I8YA 4QGMA 2PAKA 5AVPA 4ZU4A 2XGXA 4YYOA 1ZRRA 4XFGA 2EVXA 2IXJA 3BU7A 4IEUA 3NJZA 1UW8A 1NE4A 4I09A 4XETA 3NW4A 3E6DA 2B5HA 3M3IA 3WW1A 3RYRA 4PIYA 1OI6A 2D5HA 1QWRA 1L3JA 3EO6A 4WZCA 2CV6A 4EWEA 1NZCA 3KGZA 3ST7A 3H1MA 4QMAA 3KSCA 2CAUA 2KXLA 2MHFA 4MGZE 5KBFA 4XFBA 3SCGA 3LOIA 3M70A 2D93A 4UBHA 4Z07A 4BYYA 4META 3FWEA 1DGWA 3WW3A 3B02A 4IEXA 3U10A 1CAVA 2O8QA 2BYVE 1O3RA 1LKNA 4IERA 4F8AA 3E6CC 3H7YA 3H7JA 1ZRFA 1Y3TA 2PHLA 2BEOA 3BB6A 2PAMA 4YRDA 3EBRA 2VECA 3CJXA 4HSJA 3RYPA 4JVAA 4HVQA 1Y9QA 3KGLA 4AVAA 4DINB 3RDIA 2PFWA 4AVCA 4PIXA 4RD7A 3QACA 3OCPA 4IEWA 1UIKA 2XLAA 1RUNA 3FZ3A 1EP0A 1ZZBA 3FJSA 2IXHA 2FMYA 1CAXB 4FAHA 3DKWA 4WVZA 1OFNA 1WGPA 4QM9A 4EWAA 2BNNA 3H9AA 4KL1A 2GC3A 4KU8A 3C3VA 5FPXA 1I5ZA 4XFAA 4XFFA 3IWZA 3D0JA 3U11A 1DZRA 2QJVA 1O7FA 4LA2A 4XF4A 5CVRA 3D82A 4X6QB 1FT9A 3LWCA 5KHHA 2VPVA 4XFCA 2OZ6A 4HBNA 4D7SA 3HT2A 4ZU7A 1RC6A 4KWJA 1FXZA 5I91A 4Q0PA 1CAWB 5I8TA 4IEOA 3E6BA 4OFGA 1UD1A 2IXIA 4XFIA 3FHIB 4HMZA 3QOPA 4EWDA 4XF9A 5LRSA 1HW5A 3EJKA 4I01A 1J1LA 2XL7A 4LUKA 4R8HA 1EYBA 4JTOA 5F1RA 4Q0VA 1U12A 4MUVA 4MGIE 5CU1A 4KWLA 3I59A 4QGNA 2PQQA 1IPKA 1ZREA 3S7EA 4D7TA 4E2GA 1G6NA 3BALA 4BIFA 4HVOA 3WW2A 4LEJA 1VR3A 4WBBA 1CGPA 4IEZA 1SQ4A 3SCFA 4HLTA 2E9QA 1YLLA 1ZZ7A 4HN1A 1CAXA 4NVPA 4K8FA 2IXLA 1DZTA 2DCTA 2F4PA 3ES4A 4YARA 5C6CA 4L2NA 5FQ0B 3DN7A 3LA7A 1CAUA 4XF3A 1YFXA 1LB2A 4CYDA
chains in the Genus database with same CATH superfamily
2JECA 4AK3A 2W08A 2Z2SB 2PHDA 1YO8A 4B4RA 1LAJA 1J3QA 2XHKA 3MUZ1 3VKNA 3I4IA 1OQEA 1COV3 2RS52 1SLBA 2W39A 1RUH2 4FXKB 1FYUA 3VBFC 5A3PA 1OLMA 4CCMA 2LW8A 2VE1A 5FPVA 5BNPB 4YM0A 2XLFA 2GNDA 4XXPA 1S0DA 3WXPA 4LLFA 4DEQA 1AR72 1XNTA 2GH2A 4OZOA 1CZVA 1BHGA 4MVTA 4INDA 1RIRA 2ADEA 1RJ8A 2HWF1 1W3VA 2RJKA 1AF9A 4CEYB 4E9KA 1XB9A 1ZA4A 2VMIA 5A7SA 3GJAA 4IEQA 1DP0A 3I8TA 5EZWA 2GN3A 1J58A 1GOGA 2DCKA 2IXCA 3MIFA 5CFCC 2R1BA 1D7PM 4LKDA 1G9BA 1YUDA 2PQSA 4XMIA 3ZMOA 3W59A 2PHTA 3D4KA 1VBB3 4FAGA 3I2HA 2EICA 1DQ4A 1GUIA 3I59B 2FDIA 4CEWA 1UF2C 1CPMA 3VD4A 2VG9A 1XNKA 1UX6A 3PU3A 4HOOA 4WM7B 4MYEA 2NLRA 1VMHA 1XE7A 4HPKA 3AZWA 3MF6A 2UY9A 4EN6B 1RUC2 3U0ZA 1LOCA 1ASJ3 2C6SA 3GHMA 3E97A 4IUGA 2UURA 2WT2A 2EIEA 4GA9A 3N7JA 3THDA 2VR4A 2RM23 3IPVB 1Z78A 4CCJA 2D44A 2DVBA 3BIEA 2YGLA 2WQ4A 2Q5TA 2PAEA 3ORJA 4Q0SA 2Z42A 3J26N 3LEIA 4AYUA 3USUA 4HANA 5DZFA 4IEYA 3AXDA 2H0VA 3PNAA 4Z2WA 1NQJA 3OBRA 4R52A 3B9CA 4TXWA 1ZRFA 2RS31 3WG4A 1ZVFA 1J59A 1AYN2 1E5SA 3DV8A 3IDEA 4JQTA 5FQ0A 2WO2A 3O1SA 1BKZA 1NCRA 4JGYB 4LKEA 1OBNA 3JBG2 4Q4Y1 2DU1A 5GZCA 3POFA 1N1SA 2N7GA 4CSWA 3CL1A 1RUD2 2UYAA 3VHOA 4LXLA 4N9IA 1Y9MA 3OUHA 3PURA 2IXKA 2BRTA 5K9YA 1GWKA 3QD6A 3WUDA 3N9MA 5JSPA 2XBO1 5FZOA 1H8TB 3AYCA 1KXGA 1UMIA 1EV12 3RWKX 1H9WA 4I3PA 1QU0A 1REEA 1VIWB 5IK7A 1UOFA 2UU8A 5J7MA 1VBB1 3VBHC 1Y7BA 5C70A 2O14A 4KBZA 5ABJB 1MQTA 3WF3A 2R0FA 2YC0A 5KR7A 2B7YA 3O1MA 5DUXA 2NN8A 4IEPA 5FY9A 2W1QA 5A1LA 3PLQA 1QJX2 5H9SA 4KGGA 2RDRA 2LS6A 1ODNA 3F95A 4RHV3 2XG3A 2X10A 4XJAA 1ASJ1 3D0SA 3MV11 3MIDA 2EF6A 5F2SA 2DFCA 3HPNA 4COYA 3WUCA 4MGKE 1DCSA 4I30A 4MX3A 2AH2A 2GN7A 4H55A 1D2SA 1LOBA 2QQLA 3VBFA 1WW5A 4IESA 4YZ4A 2R30A 2IFWA 1CZTA 2JDKA 3AMMA 4XUOA 2JIJA 2RS12 2ZAAA 1W99A 2WFPA 1AJKA 3LEMA 5FZFA 3VBOC 4AF9A 3N4MA 4Q29A 5I0RA 1R082 3H3UA 1SDDB 1WUVA 4TWTA 1LTEA 1JN2P 3LB9A 3N3HA 5EJ1B 1OA2A 3IMMA 2CSGA 3NQHA 4B7KA 1W0OA 1KFUL 5IYYA 1G86A 5T5JA 5KXEA 4G3YC 3FFZA 1ZRCA 5CFCA 2PELA 4J1XA 4CVUA 1OD3A 3PTYA 1SCRA 1YJLA 3ZX7A 1AXYA 1PVC2 3LD8A 1CX4A 5IW0A 1WLDA 4NPMA 1NA1B 4Y1YA 3Q8FA 3RPQA 4AI2A 4BDVB 2QE3A 3RJ2X 3SH3A 5A3TA 3WP3A 1UN1A 4LO8A 1US3A 1N3QA 4MV2A 2XJVA 4BQXA 4XQ4A 2A75A 2VVFA 3TN91 1R1A3 4AI1A 3CJIC 5DAQA 5HPOA 3OUJA 1ULCA 4MXWA 1W9TA 2W46A 2ZGPA 3J8F3 3WW4A 4W50A 4NIIA 1XU1A 5GLWA 4R4XA 4BQ3A 2XJUA 2VW2A 3P6BA 5FYVA 1RB8G 4IE7A 4AEJA 5JZGB 1RUJ3 3AKPA 4COVA 2A6XA 1NLQA 3C7EA 1GQHA 2XR4A 2I2SA 1H2NA 1UMZA 1X7NA 2W0XA 3AP9A 4X6RB 2BBVA 2TUNA 4W6XA 4AOCA 1BVP1 3OBZA 2OX0A 2W9XA 4ISQA 4ARXA 1EY2A 1MR5A 2HWD1 1OC1A 3THTA 3ZSEA 2ZACA 4OHVA 1UU4A 1PO11 2WZR1 2V72A 4IXLA 4S2DA 3B7MA 4Y5TA 1AYM1 3AMHA 3GBGA 4Z8BA 1JZ2A 1LRHA 4IE5A 4D69A 3GDBA 1H2LA 4HN0A 5DUVA 1RTVA 2P4EA 1UO9A 1N1VA 4KI5M 2XJQA 5F3GA 3UV9A 3OG2A 1FV2A 1X50A 4E8CA 1I5PA 4FPCA 4BK4A 1NE6A 5HV4A 4QPGC 1W8OA 1SLIA 4XUQA 4I02A 4R9BA 3MYXA 5JR7B 3VBHA 3N9PA 1DDLA 1OKQA 4BXSV 1US2A 3RZHA 1UPIA 4FFHA 5FTTC 1PGSA 4CU7A 4UW4A 1OFSA 1F35A 1NCQB 4GZ9A 4RA0A 3ZR5A 3AYAA 2KA3A 1FOD1 2C24A 4HETA 1C3HA 3TBDA 2WUHA 4JGZC 1T6BX 2RR11 1BZWA 3MW4A 4N53C 2R063 2EIDA 3A0NA 2BQPA 2WA3A 1JUHA 1VRH2 1HJGA 4PT6A 1YHFA 1S2BA 5FYSA 3OBTA 5SV8A 4CP9B 4ASLA 4QQPA 1WCDJ 5FYHA 3H1YA 3K2OA 4MH0E 2VL4A 4JKKA 1PO23 1H6XA 4NO4A 3P3PA 3MEPA 1X8EA 1GICA 2D6OX 5T3NA 3VBOA 4FBFA 5FMOL 1FMD3 3IDBB 1HV0A 5FMOS 4AVBA 4K40A 3IM0A 4OQ9A 3IBMA 1QIQA 3MPBA 2IVIB 2C5DA 4AEDC 1YC61 1M06G 3ZSLA 5LA1A 5FZ7A 5JOXA 2V09A 1PZ8A 5B4NA 4RR3C 5FOBB 1VBD2 2QDNA 4CXXA 3ILNA 3UL2A 1AR63 1JXNA 1VMJA 1W9SA 2E53A 1YWKA 2J1RA 2VGDA 2RS51 1SFNA 2VOVA 1RUH1 3RFRA 3LFMA 2HWC1 5AFBA 4JRAA 3VHPA 5IVCA 5E88A 4BMEA 2DV9A 1AR71 4Q8KA 4PQ9A 4FXGB 4Z92B 2GU9A 1YFUA 2C0ZA 1W6NB 1UYXA 1NUKA 2P3JA 3EYPA 4I0BA 5FPAA 3PVBB 5IVVA 2WNUC 3CJIA 4CDUC 2FDJA 5T5PA 4FFGA 4CXYA 1XBFA 4UW3A 1JOBA 1W39A 1VBC1 4QPWA 4H2AA 2KR2A 4P9LA 2WQ8A 4A4AA 1O3QA 4TYSA 2EXKA 3ZYBA 2QQPA 5KC6A 1MVEA 2GC2A 1CIWA 4YFWA 2HWE2 1Y4WA 2R043 3MV01 4YLZA 4LUMA 2BW8A 4IQPA 1ZA7A 2QBXA 2HYKA 1TMF2 3BTYA 4P9JA 3C8XA 1F15A 3OPZA 2ZHNA 1AL0G 3VZJA 3PL0A 4GB33 4AAPA 1W6QB 1QNYA 1ZRRA 4AI3A 1URXA 3GZAA 3MIBA 1RUC1 1K5MB 4AFCA 2VMHA 3VD7A 2CNAA 2WWUA 1KFXL 3BU7A 4I0WB 3NJZA 4XDOA 4QHZA 3ZFEB 5KXDA 5L7OB 1K45A 5FWEA 3UJQA 2YC4A 3LQCA 1HN1A 3HQUA 3T08A 4YPJA 4JHTA 1JZ5A 1OA3A 4OZXA 4LJHA 1AR61 5DAVA 2YMZA 5LK5A 4CDQB 5FK8A 2WJSA 1PIV3 2VZPA 2ZZJA 3DXUA 1L3JA 4IV3B 4QPGA 5DAPA 4XHXA 3ZXLA 2BBAA 4N43C 2XOMA 4FTEA 4YVWB 2W95A 3JBG1 3ST7A 3PIGA 3EMRA 3KSCA 2CAUA 1AVBA 4QMAA 2MHFA 1LOAA 3JD72 3VD3A 2X5IB 3LOIA 3M70A 4WM7C 1F5FA 2D93A 5D8AB 5ANQA 5F9TA 4JGZA 1Z7S1 5CYYA 1CPNA 4C1XA 4TTGA 5IVEA 3FWEA 3M4FA 4WZFA 3OOXA 1CIYA 1W9YA 4N53A 3WW3A 5A7QA 1EV11 5A7OA 2A3XA 5A33B 4QPYA 3LEKA 3WDYA 1CAVA 2O8QA 3ABZA 4GQ7A 4QXBA 4WVMB 1RHI3 3OGRA 2VULA 2X53S 3OYWA 4P02B 1U0AA 1JYVA 3CU7A 3BOWA 1IG0A 4XBNA 4F8AA 1V6JA 3E6CC 2DURA 1QJX1 4K8RB 1UY2A 1Y3TA 2PHLA 2BEOA 1SZBA 3BB6A 3A0KA 3POEA 4YRDA 4RYDA 3RZJA 4XAAA 1SMVA 5JIUA 3HQRA 4AEDA 2VECA 1LEMA 1VRBA 2W87A 3CJXA 3MHZA 5C3SA 2PLV3 1ZBA3 3H0OA 3GF6A 4RR3A 3KGLA 2OXBA 1FATA 1S0EA 2VUAA 2D43A 1GANA 4CUBA 1UAIA 3V0BA 1ULPA 1QF3A 3QACA 2JICA 5FZHA 3AZZA 3K4DA 3QH6A 3FBMA 2XLAA 3CZUA 1H8TC 3IKWA 1AX2A 2P6CA 2QQWA 1DYKA 4FO9A 4NIDA 3FJSA 3BOPA 3O12A 1R081 3POIA 4QX3A 3KZ4C 3POSA 4LO5B 4WVWA 1HRI1 4WVZA 3ZYFA 2WNVB 1BVVA 2BTVC 4DB5A 1CJPA 2VBPA 2WNUA 4CDUA 4V2VA 4QX8A 3JCIA 3NJYA 1O4YA 4Q4X2 1AUYA 2BWAA 1HB1A 2VOWA 1R092 4QX7A 4XUPA 4A6OA 3VBUB 1SBFA 4UFLA 4P9XA 4IL7A 4BJ0A 4TZDA 4LA2A 1PVC1 1SACA 4XF4A 1UOJA 3KCYA 3LWCA 3AL5A 1GSLA 1GOFA 1UKGA 4Y4RA 1QJFA 4Q27A 2R7EB 2EXIA 4SBVA 4ZZ8A 3L2YA 5DDJ3 4ZU7A 1JHJA 2E33A 2VUJA 4XUNA 4YVSC 2AC1A 4DUWA 2C9AA 2GNTA 4UI9L 1AL22 5CBLA 3SEPA 2VOKA 1UNBA 3U37A 1D2QA 5C9AC 5CKMA 2IXIA 4QAWA 5FPUA 3FHIB 5LZ6A 1VBE1 3QOPA 3MUY1 3T4VA 3T2PA 4EWDA 4XF9A 1V00A 3VL8A 4LOSA 4AGRA 1U5ZA 3N7LA 2VMEA 5LATA 2E7TA 2WO7A 1QQP3 1N47A 1XSRA 3UETA 2ZEZA 1XNCA 5GM0A 1ULEA 1D4M2 3WNXA 1KQRA 1POV3 3C7OA 1VLNA 4LUKA 1T2XA 4JTOA 4N43A 5GJ6A 5FO9B 1OKOA 1ZBE2 4OI1A 2AEYA 1G8WA 3POYA 5CU1A 1QH6A 3I59A 4M00A 1CN1A 1V0AA 3OUIA 2PQQA 1VAMA 3P3NA 3HNMA 5FZ3A 4D7TA 5BNOB 1G6NA 2JDPA 4IDZA 4WM7A 1NKGA 5FP4A 1TZOA 4BIFA 2A71A 4L8QA 3WW2A 2VMGA 3FUQA 4KNCA 4GKXA 4JC1A 1WW7A 3RMYA 1BEV2 4IEZA 1UY3A 5TSWA 3WDVA 4ES8A 1IS4A 5DAXA 3IPVA 1YLLA 2OS2A 2Y33A 3LE0A 3KQRA 2PHUA 4NVPA 4K8FA 2DCTA 2ZABA 3ES4A 3Q8AA 5FXZA 1JYCA 2J1SA 5FBJA 1U5YA 2MEV2 4FVVA 5LBBA 1LB2A 1S0BA 3ZSKA 1S0IA 4UT5A 1PGL2 5IFTA 3GZUC 1Q8VA 5FRAA 4F83A 3VD5A 1VRH1 5CB7A 1TG7A 4K1ZA 2QNKA 5C3RA 5JPMB 3MIGA 3ZOIA 1WD3A 3B94A 3SXWA 3AKRA 4QGLA 1H8TA 3MLJA 1YFYA 3I2KA 3GNEA 4P9WA 5IVBA 2Q8EA 1RVF1 4JCKA 1R64A 4AFAA 5I8SA 1MEC2 2VBDA 1JZ6A 1Z0HA 4J1WA 1EPWA 4A41A 1PHMA 2MNGA 3GZEA 3B5LB 5FZGA 2W47A 4HT1T 4XABA 3HOBA 4A7KA 2CGOA 4B3NA 1AXKA 4C0BA 4CU9A 4CUGA 4AEKA 2ERFA 5DN2A 2Q4SA 1N1YA 3J7HA 3MO4A 4P9GA 1CZSA 3O1TA 5IK5A 5LEJA 2HJIA 4AGGA 3CHXA 3IDAA 3SC7X 1JU3A 4QT6A 1ENXA 1OQ1A 4UAPA 2Y6LA 2Y34A 3J4UH 3KWVA 3NWKA 3U4SA 4RL7A 1W8FA 4YVSA 3N9OA 4IV1C 4AFMA 1BBT3 1HV1A 1QJY3 4GJYA 3U78A 4DNYA 3D3AA 3U14A 4XBLA 4CP2A 2WZ8A 1KS4A 3A23A 2JE7A 3H8UA 1YCIA 5C9AA 3DXTA 1GYKA 1RUF2 4YGDA 4FFIA 4J25A 5T54A 1AR82 1ND3B 2DCZA 2HWE1 2A6WA 4B1MA 3GBFA 3R6SA 2ETEA 1QY4A 1J84A 1CAUB 1W6OB 4LQRA 3JUUA 2W5FA 5LBFA 4CCKA 5T55A 2JEMA 1OLRA 5DZEA 1RUE2 3ACGA 3NL1A 5F6KA 1PZ7A 3J7NA 2K9ZA 2VZVA 4Q2FA 1TE1B 2A1XA 1UMHA 5FYCA 4DRVA 5J98B 1UCXA 1HN0A 4Y22B 2P17A 3R4DB 3ZFFB 1IKPA 4MHUA 2PHRA 3LA2A 1TME3 1W6MB 3LIHA 1L7LA 2YUEA 2FZ1A 3B69A 4OHXA 2B8MA 5C3OA 1Q43A 1HJFA 5L9RA 2B45X 2BNMA 4E4HA 2ZMNA 3OGVA 5J3UA 3OD0A 2CAVA 3ITQA 4E4DX 2K2SA 3KV6A 4DS0A 2DBNA 1MZ5A 4XF1A 4MGSA 2JE8A 2RMU1 3NJVA 1WMDA 2MPFA 4NWWA 5SV5A 4UF0B 2VCCA 4XZUG 3UGHA 2NM1A 3ZIXA 1H8VA 4XFHA 4AQ6A 4COWA 2IFRA 5A7WB 3WNLA 1FAYA 3TAYA 1WWYA 3I7DA 4D7YA 2GNBA 2W1SA 4KBBA 4PLNA 3KV4A 3THCA 4DOUA 3VUOA 3C2UA 4LIVA 3MPPG 2WLPA 3DKQA 3JD71 4FPOB 4LULA 2G9GA 1ZZ8A 2JG9B 1OLME 4RGAA 5AVAA 4XTPA 2JD9A 3H50A 1XQNA 2FQPA 4NIHA 1CQ9A 3BI3A 1H4GA 4NE9A 3RYKA 4XIOA 1K5MC 1JOJA 3HMYA 3VBRC 5F3EA 4CUAA 5C5UA 5LWBA 1SBDA 3N9QA 5KHGA 1HXS1 2PA7A 4AQ2A 1DQ0A 5L7OC 5A3NA 2ZGLA 2VZOA 3KCCA 2Z69A 1XRUA 2IUWA 2RJ2A 2OT7A 3AJZA 4ONUA 3ME2A 1NY72 1IG3A 2VW0A 3GXUA 4CDQC 1J3PA 5D1IA 4IV3C 1B35C 1QNWA 2QQKA 2WZEA 4HSLA 3PUIA 2WABA 4YW5A 4DXTA 4MG2A 1LU2A 4MGQA 3BKZA 4YVWC 4LK6A 4BE3A 5DUUA 2XJRA 3PTRB 1R1A2 4TSVA 3M3QA 2OYZA 2UYBA 5DMYA 4LK7A 1BCXA 2PHXA 3RZGA 2DUOA 4FT8A 1HX6A 5FPZA 5C4WC 2FHRA 1RUG1 4PLOA 4EN8B 4AE2A 2GAUA 2IC1A 4DFSA 2ZBJA 1WZXA 1JW6A 2AR6A 3POGA 3N9LA 2R072 3BTZA 4M0HA 2RS33 4FPLA 4Z82A 1QJEA 3GCWA 3ZN5A 4BPZA 4CP9A 3T2TA 2ARAA 3GGLA 4Q4Y3 2B9UA 4EV0A 3LAGA 1CONA 3UNPA 1W2NA 1EAH3 1ZNPA 4IV1A 4Q4X1 5FMDA 3WT3A 1WLTA 2LALA 5FZAA 5BY5A 1DQ1A 1R091 1E57A 1W2AX 2VY0A 5K0UB 1PM7A 4JTNA 1LU1A 1YI9A 4BXFA 5J48A 3TEXA 4LTAA 3S7IA 5F5QA 4EYUA 2R49A 2XBO3 2G19A 4QXHA 1JZ4A 1VALA 3J7MA 3M3CA 2JDHA 4M3CB 3RJRA 2WSVA 3JQWA 3BUCA 5DXDA 2V5DA 1J3RA 1TVGA 3DL3A 3PJYA 2JDUA 2XQXA 2VNGA 1FX5A 3WNKA 1DFQA 3OEBA 2ORZA 1S2EA 3ECQA 1EUTA 1V6KA 4HFSA 3TOJA 3WSOA 1LNSA 1HB3A 4YG6A 2WDBA 1LECA 2IZWA 4QX0A 4DY5A 5J1XA 1AL21 5JOYA 5JVVA 3IB3A 3UYJA 2Q0AA 4OUEA 3WX5A 4RGKA 3RZKA 3OF1A 1RITA 1NZIA 2NZ9A 3CIHA 3OY8A 1F8VA 1W6NA 1YFWA 3D6EA 3FFQA 4ISRA 3ZO0B 1S0GA 4AVVA 3HQXA 3V0AA 2ZX3A 1GNHA 3NRUA 2FCUA 2WWJA 1UZ0A 4UBGA 4XJ9A 4D8MA 2AUYA 3RRDA 1D4M1 4CPBD 3VBUC 3ACHA 2D98A 2LTNA 1QEXA 1GOHA 2A3WA 1V9U2 4YW6A 2EAKA 2BGOA 3OGSA 2JIGA 1UXZA 3H3ZA 4Y1VA 3OB8A 1J83A 2ET7A 1PO22 4FSJA 2EAAA 4E4ZA 1ZX5A 1LOEA 1H2KA 2VZ3A 3BN6A 4NRMA 1FMD2 2E7QA 1YNAA 1AR92 4IE0A 1EAH1 1ND2B 5D21A 5CZKA 4NHYA 2Q8OA 1BEV1 5FZ4A 1K5MA 2FBEA 1W8HA 3VBRA 3ACIA 5CKNA 5IAXA 5FKBA 1QHDA 5L7OA 1VAVA 2YBKA 3IDCB 4A2UA 2R0HA 5FMCA 5FUNA 1N3OA 4LBQA 5ANNA 2A6VA 3KMHA 4CDQA 4O9EA 4IETA 5BYNA 4IV3A 4ET7A 1B35A 1WBLA 3TN93 1UKRA 3OSDA 1DG6A 3V65A 4K20A 1DZQA 1OVPA 1POV0 1S0CA 2ZGKA 3APBA 4O61A 4QKDA 4N7UA 4QM8A 4YVWA 3O1VA 4FTSA 5AC92 3DCQA 1MVQA 1BMV2 4ITCA 1QJU2 4P9YA 5JI7A 4QPIA 2WC2A 5FYBA 3O14A 4BH9A 4P08A 5C4WA 1CESA 2ZPXA 1DU3D 3H42B 4KWKA 4NHLA 4JRLA 3RS6A 2FDFA 4AHWA 1CJDA 1XE0A 2R042 1HB2A 2WN3A 4L9BA 1RGSA 1X8MA 2ADDA 4AVTA 2VD7A 5A32B 2QQOA 2HWD3 1MEC1 2PMWB 3NAPB 2WZR3 1PO13 2WFF2 3LA3A 2UWAA 1AHSA 2NMOA 4AG4A 2QQUA 1GP6A 3I97A 2Q8CA 1Y9GA 1AYM3 4OMDA 1DF0A 4IE6A 4QKFA 3WV6A 4ES9A 5A3LA 1REFA 2KD7A 2QCSB 2QVSB 3C7FA 5EQUA 3V64A 5GLTA 5T50A 3H1WA 2A7AA 1ENQA 3SEEA 4OHZA 1VJ2A 3PUHA 5ACA1 4CDXB 4D6QA 2L9LA 4NWVA 5LY2A 5I8YA 3SISA 4QGMA 3RG0A 4PBPA 3H8XA 2VMFA 2XGXA 5FZ1A 4F3JA 2WNEA 2CU5A 4XFGA 5DUWA 3KB5A 1D4VB 1PIV2 1GKBA 2JDNA 1KITA 4A42A 1W8UA 4BU2A 1O91A 1BXHA 4Y24A 1DQ6A 5FO7B 1FOD3 4Q1RA 3T2OA 1NE4A 1OT5A 2E32A 2XJSA 1JYNA 2J7MA 2ES3A 4Q4V2 3E6DA 1LHWA 2RR13 4QB6A 5IVJA 3WW1A 2JKXA 5A3MA 4ASKA 1K12A 3TWIA 4FP3A 5LBCA 2D5HA 1X9PA 3PMEA 1H4HA 4ZY9A 3KVBA 3VBUA 3AP7A 2RG4A 2IWGB 4EWEA 1MS0A 5IT6A 4XXAA 4A3XA 1WW6A 4KH9A 3O0VA 1RYYA 3VKLA 3W58A 4UYBA 5JWPA 2KXLA 1RHI2 2DCJA 2WIIB 1KGYA 1DGRN 3LSDA 4AEMA 2ZS6B 1GZWA 4Q4W2 4XCBA 3AP4A 4AQSA 4BYYA 4BQ2A 2DF7A 2YPDA 3WINE 4AR2A 2B9VA 1MS1A 4DO0A 1W6PB 5ERLA 1DHKB 1UXXX 3T1MA 1N3PA 3U10A 3T0BA 3AK0A 3IAQA 2RDQA 2WT1A 2PLV2 3MW2A 5L9VA 1RMU1 2RS53 1RUH3 2JG8B 3WF1A 3HBZA 4GH4B 2OW4A 2UWCA 2HWB1 4OHYA 2HWC3 1NG0A 2QFEA 3H7YA 4N90A 3RI8A 1F9KA 4P5HA 1AR73 1O8PA 2FCTA 1OPOA 3EBRA 1HRV2 2NYYA 5J96B 3N7KA 1QGLA 5C8CB 5CKQA 5HCHA 3ASIA 4L92A 1VB2A 3FHAA 4IGQA 4JVAA 2Y38A 4HVQA 1Y9QA 2VZRA 4LBLA 4BLJA 4MSVA 1V6OA 3ZFFC 1VBC3 1SCSA 1UU6A 2P37A 2CGNA 4XCAA 4RD7A 2F17A 3OCPA 1W90A 2BU9A 5CFDC 1UIKA 2DWRA 1SPPB 4AGVA 3Q8EA 1OURA 4FQZA 3B93A 2IXHA 4LBMA 4UW6A 4ZPIA 5FXXA 1NY71 1CAXB 4FAHA 2VXRA 3DKWA 3DPRB 2VQUA 4FCAA 1OFNA 1WGPA 1O8SA 3AZYA 3LSEA 5FAXA 4EWAA 2BNNA 3H9AA 4C0HA 1W0NA 1VE0A 2SBAA 2VZSA 3C3VA 4XJUA 5FZKA 2ZX4A 4NRPA 3IWZA 1RUC3 5JMOA 1HKDA 3TB0A 5JXGA 1LGCA 4RFRB 3MW3A 1O7FA 4Q8LA 4YW1A 5J09A 2ARXA 3D82A 1UZVA 1UZYA 2WS92 3OEAA 4LO7A 3VBSC 5CISA 1R1ZA 1JYWA 4LR4A 1GV9A 1CD3G 1UY0A 2ZHKA 5EYXA 1W2OA 1XSQA 3DYOA 4EN0A 4D6SA 3NV4A 3LPFA 2OZ6A 1C8M2 4XQDA 3VB9A 1JZ8A 4XUTA 2R071 1S0FA 3HT2A 1Q8PA 4DRRA 5CA6A 1E5RA 1RC6A 2DCYA 4BOWA 1VBA2 3HJRA 5A1FA 1FXZA 1F4AA 5I91A 3JBG3 5LBEA 1UY1A 5FZIA 2GP5A 2C9KA 4YM3A 4A3ZA 4PQQA 3KV5A 2LROA 2V5YA 4HMZA 5M0TA 3QLQA 1Z7S3 3EJKA 2G9FA 4WV8A 5CEHA 3ILRA 1YQ2A 2A3YA 2JDMA 4I01A 4OI4A 5JUVA 1J1LA 1EV13 1S2KA 1GMMA 4NPLA 3O1RA 5G04L 4CEWB 5JLVA 5F1RA 2D6KA 4FQ4A 4Q0VA 2QTWB 5GZGA 4MADA 1WKYA 4AZZA 4TLGA 3O1UA 1XYPA 4LKSA 3ACFA 1QJX3 2QQIA 2DTYA 2WQZC 1PMJX 3WP6A 3S5AA 3BALA 4QB2A 4JKLA 1JOPA 3GHNA 3B01A 4XDQA 5LA2A 5A80A 5BNPC 3FC0A 3PU8A 2VCAA 4LEJA 1VR3A 4WBBA 4EZ4A 5H9QA 4KG8A 1YEWA 1GLHA 4A44A 1SQ4A 3U75A 3SCFA 1OSGA 5A3UA 4AW7A 4CEYC 2ZGOA 1ZZ7A 1FNYA 1C8NA 4HN1A 3USUB 3AL6A 5F37A 5FO8B 1DZTA 5C6CA 4ZXEA 4AHXA 1LHUA 1OVSA 5FQ0B 3DN7A 4DEVA 1NCRB 1CAUA 1WLCA 2LRPA 1YXWA 1YFXA 1R083 2WR9A 3IZOA 1MZ6A 2C1FA 1AYN1 1JHNA 3LEGA 4CYDA 4CE8A 4N8MA 1HRI3 2DU0A 4JKMA 1EPZA 1JS9A 1H0BA 5E8AA 3FHQA 4QU1A 4U36A 4PI0A 3WP4A 4QKBA 1RUD1 4Z2AA 4Y22A 3QH7A 3ZFFA 2D5FA 1WCKA 4ZU5A 1I6XA 1N1TA 3MFAA 5JR2A 3MICA 4N7IA 5F3IA 2GC0A 2BNOA 1SEFA 1PVC3 1Q5OA 5GZFA 5CFDA 3VL9A 1YI7A 5IUQA 2FDKA 3RNSA 4ASMB 1G9DA 3MDPA 1MQTB 3NVCA 1OD5A 2ZXQA 3BTAA 4PF5A 1CAWA 4JDNA 4PDWB 1CX1A 1FPN2 3FN9A 3CKHA 2UY8A 4IGPA 3RI9A 3TYJA 2QQVA 3WF4A 1UIJA 1C5IA 2O0OA 2FZ2A 2OUHA 5AC91 1VMFA 1O3SA 2VOTA 2YBPA 3WNNA 4COZA 3IAPA 2B42B 3HNYM 1QOSA 4UFKA 5F7UA 1WCSA 1VBE3 4ZONA 4JGYC 4H7LA 3VBSA 4NAOA 5FZEA 3SMHA 4I3GA 1ND2C 3GCXA 3ILFA 3B3QE 3VBFB 1RUI2 4J6GA 1V70A 3T30A 4E4SA 3MIHA 3URFA 4JZRA 4I2OA 4HKWA 2PN5A 2RS11 1ZZ9A 3NKGA 4QX5A 2WFF1 4LBJA 2BDRA 2VUCA 1UYZA 2VJXA 3OTFA 3W9AA 3ZN6A 1PZ9A 2Y6GA 4AFDA 5I0DA 5ABJC 2CDOA 2QZ2A 2FDGA 2GALA 4P00B 4YFZA 1SLLA 2G9ZA 5JCTA 2HH9A 2W1UA 1SBEA 3PHMA 4LKFA 3POBA 5FZLA 1DGRA 3BYWA 1LCLA 1XNDA 2VZTA 2E63A 2Q1MA 4LA3A 1UWWA 1GZTA 1B09A 5FZ8A 1ST8A 4M01A 4RFT0 1ENSA 5FDBA 1UZZA 3ZYRA 4L11A 4U2AA 2ZTNA 4HONA 3AMNA 5FP9A 4CDWB 3O5SA 4MXWB 1F2NA 3D8CA 2ET1A 4OMCA 2JB8A 5BNPA 3I54A 2HWF2 3CMGA 1H2MA 3EB7A 4LO6B 3ZXAC 5BV6A 1FV3A 3VDBA 3W5MA 3CNAA 3FE5A 4MHRA 4DIQA 1WMEA 4A7YA 1QXJA 4Y5Z0 3ELNA 3VGIA 3VKMA 1VRH3 4N9HA 1O5UA 1JZ7A 4QWNA 1X36A 2YPJA 4CEYA 4P5YA 3AVSA 4WM8B 2YZ4A 3NV3A 2RDNA 3WG3A 3C7GA 2BJSA 1E5HA 4HKLA 4W8JA 1OA4A 1NXMA 2XONA 4M4PA 4UFIA 1NAEA 2Q1FA 4YZ5A 3DYMA 1RVF3 2HEWF 3H3LA 4M3CA 1IQAA 2RVAA 4Q0QA 5GLVA 2QDRA 2WKKA 3KHBA 1LGNA 3VZOA 4XILA 1NA1C 3C7HA 4A6SA 5A6XA 5FR3A 4GMP3 1OF3A 3WEZA 2W3JA 4XMAA 2A5ZA 4JDOA 1VBD3 5FY5A 4G4FA 3DUIA 5CG8A 4K3UA 3CEWA 3BU0A 5I0TA 4EE2A 3AYDA 2OPWA 2OVUA 1V6IA 3S6PA 2GMEA 3VHRA 5FJHA 3WNOA 2YV8A 3VBHB 5JOZA 3GYDA 4B8EA 3B00A 1KDKA 3ZKUA 1L7QA 4ZXKA 5JZGC 4OI0A 3AYEA 4FPFA 1COV2 1UX7A 1VAKA 1QOOA 2W68A 1UZWA 3N36A 5HI0A 3I2IA 1HIXA 2RS32 1CR7A 2OUJA 4HG6B 4NR1A 1W2UA 2LM3A 2ZX1A 4GULA 4PBOA 4Q4Y2 4QX2A 5FYUA 1PMIA 4RQPB 3I3MA 3O1OA 1ZRDA 2OZJA 2D40A 4W65A 4Y1XA 2XUEA 4JGYA 4KU7A 5FBZA 1ZRIA 2HWE3 1S1AA 2GC1A 1ND2A 2YROA 1LENA 4QHOA 4B4QA 3KS7A 1YQ6A 1TMF3 5A70A 1C4RA 2VBBA 3TEWA 2XBO2 4FPJA 3VBOB 2NP0A 1CWPA 4MGYE 2WL1A 1AX1A 3WY6A 4A45A 3ENRA 2FCVA 4FPYA 3ZKYA 1C28A 2VNOA 3Q8CA 2E31A 5FLJA 1VBB2 2XB6C 1HQWA 1REDA 2BWCA 5H9RA 1X33A 3PVEA 5BXXA 3KD4A 1H1MA 3ACLA 4XQWA 3ZDVA 1W28A 4GXLA 2I74A 4GMP1 4GWNA 4YG3A 2I45A 5GKAC 5ABJA 3OPWA 3WP5A 1GP5A 2BOIA 3FLTA 1VBD1 2ZCWA 1NCQC 2ZGNA 2DDUA 3EHKA 1PVXA 3NSTA 4L99A 4OI2A 3T1LA 1ASJ2 1V6LA 2RMU3 1C8M1 5C33A 1IS5A 4AI0A 2RM22 3L2HA 1O5LA 1WBFA 2QQNA 2XH6A 3ETQA 3KCXA 5LRRA 5FZ6A 3P5BA 2YBSA 1VBA1 4FOYA 5E89A 4DMIA 4H3WA 4EN7B 3T09A 2V73A 1U5XA 1DLCA 1DGWX 2VNRA 2GNMA 1JTZX 4LIUA 4YW7A 3PJQA 4GJZA 4XPVA 3JD73 2D6PA 2YU2A 4Y20B 4AHZA 5A32A 5BPXA 3MF9A 3W20A 2Y6HA 4JV4A 2VW1A 4BCUA 2Z79A 3K46A 3HD8B 4OVEA 4Y3OA 4SLIA 3WVJA 1C57A 3N35A 4PLMA 4TLFA 5E1RA 3TNQA 4S2GA 1HXS3 4XE9A 3HT1A 2ARCA 3I2GA 4YGCA 2DUPA 1XE8A 1OHFA 1W3XA 1TMF1 2Y6FA 3ETPA 5HCBA 1QH7A 3KT1A 1PGW2 2NMNA 1PM4A 5A7NA 2G4IA 4YNIA 2JWPA 5C3QA 4CU8A 2C26A 4RGGA 4GWJA 4NOTA 2VU9A 1UYYA 2H6CA 4LE4A 1NA1A 2XLGA 1RXFA 2EXJA 1UPSA 5KHKA 1GBGA 3AVRA 1OMIA 2CL2A 3CLPA 2AZ5A 2YHJA 4PJYA 1ONAA 4R4ZA 3TN92 2GH8A 1WA4A 4XYXA 5FY4A 4XTMA 1TNRA 3AMQA 2D3RA 1YRZA 3U1XA 3ROUA 1VP6A 3ZPOA 1STMA 3HAGA 4QPGB 2VXJA 1RUG3 4RHV2 1G9FA 2OIIA 2WYFA 2JD4A 3BIWE 3K77A 3VDDB 1F4HA 2Y0IA 4AQTA 3LDBA 4XJZA 1SLTA 4BQ1A 3A4UA 3M2MA 2R1DA 1V6NA 2A6ZA 4W6WA 3NV1A 5JZGA 1ZZCA 3WG2A 2Y64A 2BOJA 1LODA 3RZMA 1HQLA 2XHNA 2CWMA 2I07B 2K46A 2VVDA 1RL3A 3ZYGA 1W2TA 1W8ZA 3SH4A 2HWD2 4Q4X3 4EN9B 5F6LB 2WZR2 4QQ2A 1R093 1W8WA 2P34A 4FOWA 3A22A 4GWIA 5FLIA 2VQAA 4Y1UA 2OPKA 1GP4A 5LEKA 1AYM2 2VCBA 1CAVB 5G05L 1ZM1A 4KQ7A 5CAZA 3NNJA 3T0DA 5JSRA 5FZ0A 3ZFEC 2ZJCA 3I3BA 3LGRA 3UK9A 3S57A 4PIZA 3LF7A 4NMIA 5FUIA 4CCOA 3UKNA 1XNAA 2GSYA 2XQRA 4XAEA 4M4RA 4BQ5A 3AMPA 4B4PA 2PTMA 1SDWA 5FZCA 2RE9A 3PUQA 3SCHA 1AL23 4CU6A 2PXJA 3OD4A 5CADA 1E5IA 4ATFA 4G9SB 1W9WA 2XVKA 2VCMA 4RR3B 5F8PA 3UT0A 1UOBA 3ZFGB 3BCWA 5FLHA 1FOD2 4E2SA 1GWMA 4IGOA 3V0BB 5HCAA 3HIFA 2ZGTA 1NCQA 1RUI1 2PAKA 4Y5SA 4RS5B 4TN7A 2RR12 2X5IC 3J8F2 2TBVA 1D4M3 5IJRA 1A8DA 5D8AC 4W4ZA 2XVLA 3MI8A 4YYOA 1XYOA 1G9CA 4FFFA 4AL9A 1LHOA 2WNOA 1W06A 1RUJ2 5FY8A 1ZBE3 1BQPA 5HXVA 4DQAA 3INAA 3WLUA 2E7AA 1UW8A 1JBCA 1OOPB 5EPAA 2WNUB 1A8MA 4BM8A 4I09A 4PDWC 4CDUB 3IN9A 4L97A 2X09A 1MS9A 1UL9A 4URAA 2B5HA 3M3IA 4PIYA 4NUBA 1OI6A 4LITA 4JHZA 1BEV3 2DVGA 2CV6A 2Y60A 2HYXA 3ZXEA 1WW4A 2WSUA 1QOTA 1WD4A 1QJZA 3P1IA 4FOVA 3WD5A 4C91A 3KGZA 3VN4A 2V4AA 3H1MA 1QDCA 3FLRA 2ENRA 3KF5A 4MGZE 5HV0A 5KBFA 4R9DA 3TEZA 3K4AA 3SCGA 1XNBA 2XVGA 3T3YA 2TEPA 2HWC2 3MGUA 4UBHA 3SKJE 2XPJA 1MZEA 3SLIA 2MEV3 1EUUA 1LULA 4IEXA 3DF0A 2QQMA 1XPWA 3S5QA 3WOGA 5FPBA 2TNFA 3L9JT 4C90A 4IERA 4YGBA 3RQ0A 2ZAHA 2WNVC 2ZEWA 2R6QA 4LE3A 1VBC2 1JUIA 5DPNA 5APAA 4UFHA 3PUSA 1DGLA 3RWNA 4DUVA 2P3IA 5DABA 2YU1A 4KMQA 2PAMA 3POJA 1U5IA 4N43B 3CBNA 2R062 4ZHNA 1S55A 3RYPA 1XJAA 3ZYJB 1GR3A 4MO3M 3ZYPA 1MEC3 1ZBE1 4EQVA 4YM2A 5FV3A 1RINA 3WZ1A 4DINB 3RDIA 4A7ZA 4PIXA 4CDWC 5F3CA 4IEWA 4NIGA 2D6MA 2DTWA 5L19A 1W6QA 4BQ4A 3AB0A 5A3OA 4BQYA 1RUNA 1AXZA 1TNFA 5JPNB 5ACA3 3WQ0A 2ID4A 4QQOA 3I3DA 1GU3A 3ZFEA 2B46X 5JXHA 1AR62 3GBWA 4KL1A 1COV1 3AXEA 1JODA 1Q56A 4HKOA 4KU8A 4S2FA 4WM8C 2A6YA 2PHWA 2F6BA 2J1EA 4QDSA 5FPXA 1I5ZA 4XFAA 4XFFA 3K75B 2IVJA 3D0JA 1OQDA 3RMXA 4UW5A 4K21A 3WDUA 2AENA 1D0GA 1DZRA 2JDZA 2MEV1 2QJVA 3OPTA 5EP9A 4QHBA 2P5BA 4X6QB 1FT9A 1ALYA 1QMJA 1RUF3 3BODA 3FLPA 4HXCA 2WINB 1AR83 1A34A 1PGL1 5A6QA 5KHHA 3J9SA 4XFCA 4GMP0 1Z7S2 4O7XA 3ZXDA 5FY1A 1GZ9A 3NO8A 3WNMA 2AYHA 5BNOC 2X5IA 2WO3A 4BK5A 1JU4A 3POWA 4XC9A 5EYYA 4MLOA 5D8AA 4YZ3A 2ZMKA 1RUE3 4LBOA 1QDOA 5D2AA 5IK4A 2CHHA 4Q0PA 3UGGA 5I8TA 4IEOA 3E6BA 5A33A 3GZTB 5GALA 3MLLA 5L73A 2BV4A 4MOAA 1G9AA 4PDWA 4WVMA 1GZCA 3HNBM 1YJKA 5LRSA 4GB32 1XYNA 4BISA 2YGMA 3LPGA 3RGBA 3QCWA 4KWUA 2GMPA 3VZKA 2XL7A 3LDKA 1ZYBA 5DZGA 2W52A 1YIPA 4XJWA 4R8HA 1EYBA 3K4ZA 4XZPA 3WDWA 3AZXA 1RMU3 4RQPC 2RM21 2HWB3 1LHNA 4OULA 3W21A 4KWLA 5FYYA 4IW3A 2DVDA 3S7EA 4YGEA 1Q8QA 5FKCA 3K51A 4NPRA 5LA9A 4YVSB 5H9PA 1SFYA 2ZGRA 4LHKA 1HLCA 4OYUA 4YW2A 5C9AB 5FZ9A 4GIQA 3KF3A 4HLTA 4DY3A 1HRI2 2P6HA 4BQWA 1OH3A 3Q8BA 2J22A 4KG0A 5IVYA 1RUF1 3DEMA 3BTXA 4AVSA 1AR81 3AM2A 4R9CA 4CZSA 2JB4A 2WNVA 4D6RA 4YARA 1MS3A 4RSUA 4EZHA 1MS4A 5A7PA 4H7MA 3VLBB 2JJ6A 1UU5A 1YQCA 2JDAA 5FPLA 2DVAA 1PK6B 5AFEA 1PGW1 1NXD1 1RUE1 1KJRA 5GLZA 4XVHA 2QUOA 4UOJA 3GJBA 4DXRA 2NPIA 4I0AA 3ZR6A 4CA9A 2Y0OA 1X9TA 3M8LA 2QQJA 2JE9A 4OCTA 5FYIA 2DBIA 5B4XA 4CDWA 4NIAA 1VB4A 2W94A 2EALA 4FOQA 5IWFA 3KT4A 2DUQA 1RXGA 5DG2A 2PYTA 3A7QA 4RHV1 4HL0A 1VBE2 1W0PA 1DYOA 2D97A 2VMDA 3IMNA 4F7ZA 4DPNA 5JSOA 5LCWL 1ZBA2 1JYTA 1NQDA 1AX0A 4V2WA 2RV9A 4XDPA 2R073 5KHIA 1ND3C 2GMMA 4UWDA 4WM8A 4CXWA 4CCEA 2EIBA 1NLSA 3I3QA 3T0AA 4FP2A 4ZZ5A 5I93A 1XU2A 1O4ZA 3USSA 5GZEA 4AXOA 2DVFA 2EXHA 3G7DA 4CTEA 2R32A 3I49A 1BK0A 4OLLA 1AJOA 3PDQA 1H6YA 5FOJB 4CUCA 1P8JA 1H1IA 4LMFA 5L36A 3THPA 4B29A 3SNMA 4QD2A 5BNNB 1SLAA 4BMBA 4BLIA 2A70A 4K1YA 1JYIA 2HKXA 5FY7A 1DIWA 1FNZA 4AI8A 2ZKLA 4URTA 5BNOA 1UQXA 1F5JA 5CNAA 2ZGSA 5CG9A 3VDDC 1WCUA 1CVNA 3UKTA 2XUMA 4E2QA 3NNMA 5FJKA 5FZDA 2XKPA 4OHWA 2WN2A 3S0MA 1IPJA 4QXCA 1DQ2A 3CZJA 4ZS3A 4HVRA 4MGTA 2GDFA 4FTBA 2Y8KA 4XACA 2VC9A 4AI9A 5FZBA 2AEZA 1R1A1 1G7YA 5DDJ2 5K7PA 3ZSMA 2WLQA 2FDHA 3J8F1 3RVHA 2JG9C 4DZGA 3TNPB 4RQPA 4EROA 3TEYA 4LHNA 3SITA 2EIGA 1V9U3 3HVDA 5FFOC 5KHJA 1RUJ1 3AP5A 5LB6A 1GQGA 3AC0A 1APNA 4LNVA 1K42A 1YQ8A 5LA0A 2VTXA 1QKQA 1QQP2 4V1PA 2V4VA 3ZXFA 1AYN3 2CWSA 4H14A 4IV1B 3R4SA 5KC5A 2C4XA 1YQ5A 3E5QA 1RVF2 3JZVA 5DQ0A 5HBAA 1AR93 1OPMA 2OKXA 1BYHA 1W04A 4XF0A 3WNPA 1RUD3 2H6BA 2JKBA 1MACA 1NYWA 2XL9A 3K3OA 1ULDA 5EFUA 3NNGA 3WR0A 3ZXKA 4E27A 3ES1A 1C5HA 2X29A 5FYMA 1OUXA 2D6NA 4O65A 3ZFGC 1LEDA 3J7LA 4UXAA 2ZGQA 3K48A 5FMBA 3PUAA 1RUOA 5B2GB 4RS5C 3V56A 5BNQA 1TEIA 2UWBA 2VO5A 4GALA 1O4TA 5FWJA 2Q8DA 3KQ4B 3RZZA 2YDEA 1WA6X 4C8DA 1X82A 4LT5A 4HPKB 1YYNA 3OY8B 5E16A 2DYCA 2O8OA 3AZVA 5AC93 1PX3A 1SFPA 5A3WA 3HR9A 3VV1A 1OOPC 5JIAA 3V0AB 1QJU3 3M3EA 4CCCA 5IAVA 4CRQA 4GAZA 4YW3A 3JU9A 3IIAA 4Y20A 1Q3EA 1LJ7A 2F4LA 1QXRA 4JQRA 4OQ8A 5JMCA 4JDMA 4D0QA 3CDZB 4C1WA 1XOYA 5GLUA 3FL7A 5K0UC 2R061 4QKNA 3WHTA 3KV9A 1GNYA 3M7AA 1IOAA 1ND3A 1V9U1 4LOTA 3VHNA 2BP6A 3WF0A 3AFGA 2B39A 3ON7A 4QB1A 4Y33A 1NT0A 5F5IA 3NMBA 1IZ3A 2RS13 4CP0A 2WFF3 3UJOA 4NN0A 3N9NA 1PO21 2H0BA 1W6OA 2JDYA 3F2ZA 1KJLA 1NX9A 1K5JA 5FP8A 2ZZQA 4LORA 1FMD1 1BJQA 3O7OA 4AAXA 1AR91 3VBRB 5E6HA 2OQ6A 2WT0A 3E5UA 3I3EA 1OUSA 4XHBA 2BGCA 3LOBA 4CPBA 4NHKA 5FZOB 4DXSA 5BUVA 5IATA 4YWAA 2XJTA 1W6MA 2VQTA 3LZZA 4LBQB 3NKTA 2ZHLA 3VKOA 1JI6A 1YIFA 3OJBA 4M3CF 3U4XA 2RMU2 2XKOA 4ARYA 3VDDA 1B35B 1WLWA 4MXVA 1BK1A 3AFKA 3O0WA 1FI2A 3FX3A 2CYFA 5KWRA 4UF0A 3WQ1A 1S4CA 4FPEA 4QXKA 5A7WA 2D6LX 3HWJA 4AFBA 4YSFA 5C8WA 3PMSA 5LASA 1JMUB 4Q4V3 3PVOA 4QPIB 5JAXA 3MZHA 1ULFA 4S2HA 4Y1ZA 2WRAA 2YC2A 1BMV1 2ZGMA 3KVAA 1QJU1 4CP1A 5C4WB 2XMLA 4NRQA 1BBT2 1QJY2 2YXSA 2ZOEB 1SHWB 2JG9A 2P1BA 3ZYHA 2A73B 1IS6A 2VTFA 1JZ3A 2DFBA 4XW3A 4EJRA 1PNFA 1HXS2 2R041 2CTVA 5J37A 4RN5A 4XF3A 3KHCA 1ULOA 2J1UA 4YZ1A 1IGOA 1LOFC 3Q9OA 1L7RA 3BPZA 4Q4W3 2WWSA 3LIGA 4GB31 5FYTA 3MIEA 5T52A 3VZMA 2FMDA 3IT8A 3WQBA 1PNGA 2Q1ZB 1NLRA 3ZMNA 3OGJA 4PCRA 2HLEA 1T6GC 1AZDA 5FIXA 3I2DA 2LUWA 4CCNA 3NNLA 2RDSA 5IFPA 4M3CE 3ZXGA 3H8OA 5CFCB 3JQXA 2VM9A 3QBQA 4X8NA 2RJLA 1TME2 3M1HA 5EJZB 1LHVA 5FXVA 1KEXA 4QX1A 3ZVXA 2YG0A 3ZFGA 2AGSA 1F31A 2VVEA 5JXIA 5DAWA 5FP3A 4B7EA 1RUG2 1IKQA 5A1AA 4RS5A 1HRV3 2J42A 3WG1A 5F2WA 1GQPA 2QZ3A 2WYSA 3OBAA 4HZFA 1PIV1 3MBWA 2HBUA 4UFJA 4BZ4A 5FK7A 2OA2A 2BERA 3CF6E 4MZUA 5I0SA 1OOPA 4XURA 5CIRA 4Q4V1 3VD9A 3NAPC 3KT7A 2VZUA 3CO2A 4PF1A 1ZZ6A 5I0UA 3ZSJA 4AWDA 5IK8A 2ILMA 1O3TA 4YW4A 2CGPA 3RSJA 5LY1A 4O9GA 2GZWA 2AREA 2VH9A 5FCCA 3T4HB 5EHDA 3VKFC 1J1TA 2EA7A 1Q8SA 3DGTA 2E51A 5IHRA 1HQNA 4W6YA 5K0UA 4BWOA 2XJPA 1TQ5A 2SLIA 2O1QA 3HBKA 4Z1VA 1WMFA 1KDMA 1LR5A 4K6BA 5K8SA 1GZWB 4R9AA 1RHI1 4CDXC 1W05A 1W8NA 5A6YA 4PHZA 3I2FA 4Q0UA 5L9BA 1WMXA 3WCSA 4UFMA 4Q4W1 2Z4FA 1H9PA 2ARBA 2JX9A 2J1TA 1IQDC 4DUXA 4QQLA 4LPLA 3WCRA 4QDRA 2WS93 4ZS2A 5T5LA 1IHMA 4IEVA 3U07A 4QQHA 4P9IA 4JAAA 1NOVA 3BVCA 3JXSA 2ATFA 2VNVA 4XEZA 3SKVA 2PLV1 3ZXJA 3LCPA 2YFZA 3A21A 3O0XA 3SHRA 1ZBA1 2ORXA 5FP7A 3E5XA 2P3KA 3ZM8A 1C8M3 2Z5WA 1PMHX 3UKVA 1UY4A 2BZDA 3NNFA 4GWMA 4NJ4A 1HDKA 1MS5A 4BHPA 1VBA3 1IPSA 1A3KA 3EQEA 2D7FA 2YFUA 2ZX2A 3R4UA 1HRV1 1OXCA 1BLZA 3DECA 1PK6C 3GALA 1UYPA 2Q30A 4ORFA 4NAMA 3IIIA 1O6UA 4OUMA 4CCDA 5KXBA 2K0GA 4D3WA 2E6VA 4LLOA 1MPXA 1V6MA 3ZDSA 4LBQD 2D3PA 2BGPA 5AVPA 4LHSA 1Y43B 4ZU4A 1GNZA 5EV7A 5DG1A 5GZDA 3PVNA 2PHFA 1EAH2 3SQOA 3UESA 1M4WA 1O59A 2EVXA 2IXJA 2ZHMA 4AHYA 4B1LA 4IEUA 4WVVA 3WDTA 1OF4A 1POQA 5F39A 1I9RA 5JDBA 4YZ2A 5LK7B 4XETA 1C1LA 3AKSA 3FMGA 4LBNA 2JG8C 3NW4A 4GH4C 1LOFA 3SH5A 5FUPA 1W9FA 1Q8OA 1XXNA 2WO1A 3RYRA 3R0RA 2WAOA 4ATEA 1QWRA 2VOXA 3GM8A 3EO6A 4WZCA 2HEVF 5DDJ1 5JOWA 1GFF2 2VZQA 2WZPP 5C71A 3ZIWA 2W91A 4FPGA 2XDVA 3ZLIA 4NHMA 5C8CC 1NZCA 2FD8A 3RZLA 2WS91 2BUKA 2QKDA 4COUA 4KGQA 3VZNA 4LHLA 5F32A 4JX0A 4XFBA 4DXZA 1DBNA 5J36A 1UOGA 3E1F1 2W2IA 4Z07A 5BNNC 4META 5F5AA 1ULGA 3B9IA 4L0PA 2J1VA 4Q1PA 2OQ7A 1QQP1 1DGWA 3I2JA 3B02A 3EXUA 5FY0A 1POV1 1DQ5A 3MLKA 1ENRA 5EXOA 4LO4B 4YM1A 2J1AA 1DLLA 2BYVE 3CJIB 4D94A 2ZGUA 1O3RA 1LKNA 3DPRC 1A6CA 3R05A 1I1EA 2CY6A 3PIJA 2E26A 2ZA9A 2ZEYA 3H7JA 4XJ8A 3NAPA 5EIYB 4XOGA 3FUOA 4Y26A 4E8DA 5HCFA 1S0JA 4QU2A 4FI9A 5A6ZA 3G6JB 1XC6A 4HSJA 1LGBA 2CDPA 3NJXA 5ACA2 4Q5OA 5FZMA 3H8RA 2VUDA 1FPN3 3HN3A 3W5NA 1MS8A 2WA4A 4AVAA 5C5TA 1KD7A 3I2OA 2YY1A 2P2KA 2ZEXA 3K3NA 4K7JA 5F5CA 1ODMA 4CDXA 5FXWA 2PFWA 4AVCA 1GWLA 5EJ3A 1LOGA 2JENA 1W8TA 2AACA 3FZ3A 1EP0A 5FYZA 3D5OA 1ZZBA 2VMCA 1KS5A 3MFCA 2W92A 4PI2A 1WCQA 1ACCA 2FMYA 4XBQA 3AKTA 1PX4A 2YB7A 3WHUA 3JB8A 1D0HA 1RUI3 4Q26A 4QM9A 5LW9A 2BPA2 3TRSB 2BVBA 2GC3A 3HN1A 5T5OA 1SG3A 2Y26A 2BFUL 1OLQA 2BFUS 5HXMA 3OGGA 2Y6KA 4QDQA 5IVFA 1OH4A 3X29B 2W1WA 3U11A 4NROA 5ISLA 3O1PA 1RJ7A 1QXPA 3AX4A 5CVRA 1PK6A 5JI9A 4CEWC 2B4KA 3LKJA 2VTXJ 3VDAA 4YG0A 2VPVA 4JGZB 1W03A 2XWJB 3ATGA 4HBNA 1PO12 4XIKA 4D7SA 2VAUA 5CFDB 4N53B 3T2QA 1C1FA 5C3PA 4BIOA 4KWJA 3AJYA 3KM5A 4NHXA 4IE4A 4LBKA 1VPHA 1CAWB 4X8PA 3VDCA 4ZKTB 1W6PA 3JB4C 4BB3A 2BVVA 3OYWB 4OFGA 1RMU2 1UD1A 2XWBB 4XFIA 2HBTA 3BPSA 1JYXA 2JXAA 2HWB2 3AKQA 2HEYF 3LFIA 3KLSA 3HEIA 1FPN1 2Y6JA 2JG8A 1HW5A 3ZN4A 2WBKA 4GH4A 2GP3A 5JXJA 4AEDB 2NQYA 2D3SA 1IS3A 2HWF3 1KRIA 2ZMLA 1NCRC 2RHPA 3VBSB 3WQ7A 2G1MA 3VZLA 1H30A 5EWSA 4HK9A 1U12A 3LDRA 4P14A 5C8CA 4MUVA 1BBT1 3FBYA 1QJY1 3AP6A 3DYPA 4MGIE 3NV2A 4BA6A 2YYOA 1SLCA 4GKYA 4CCLA 4QGNA 1IPKA 1JH5A 1H1AA 1HB4A 1LESA 2VQ0A 1ZREA 4E2GA 5C7GA 5KXCA 2VZ1A 2X05A 4HVOA 3S30A 5BNNA 1CGPA 3N7MA 4FPKA 2WAAA 2ZX0A 4M0NA 5FREA 3CQOA 3ALQA 2XXZA 3ZN6B 1MZFA 1SPPA 3WF2A 2KM2A 1MQTC 1K3IA 2E9QA 4FPHA 2P3YA 1I3HA 2X8KA 4OUSA 1CAXA 2ZKNA 4K9SA 3DPRA 1A78A 1DYPA 2IXLA 3BGAA 2F4PA 3WDXA 4L2NA 1TME1 4HK8A 4GD4A 2R16A 3ZYIB 5K4LA 3UGFA 4QPIC 3ZPYA 3LA7A 3M3OA 4Y4YA
chains in the Genus database with same CATH topology
2JECA 4AK3A 2W08A 2Z2SB 2PHDA 1YO8A 4B4RA 1J3QA 2XHKA 3VKNA 3I4IA 1OQEA 1COV3 2RS52 1SLBA 2W39A 1RUH2 4FXKB 1FYUA 3VBFC 5BNPB 4YM0A 2XLFA 2GNDA 4XXPA 1S0DA 3WXPA 4LLFA 1AR72 2GH2A 4MVTA 4INDA 1RIRA 1RJ8A 2HWF1 2RJKA 1AF9A 4CEYB 4E9KA 1ZA4A 2VMIA 4IEQA 3I8TA 5EZWA 2GN3A 1J58A 2DCKA 2IXCA 5CFCC 3MIFA 2R1BA 1G9BA 1YUDA 4XMIA 3ZMOA 3W59A 2PHTA 3D4KA 1VBB3 4FAGA 1DQ4A 3I59B 4CEWA 1UF2C 1CPMA 2VG9A 1XNKA 1UX6A 4WM7B 4MYEA 2NLRA 1XE7A 4HPKA 3AZWA 3MF6A 2UY9A 4EN6B 1RUC2 3U0ZA 1LOCA 1ASJ3 3GHMA 3E97A 2UURA 2WT2A 4GA9A 3N7JA 2RM23 3IPVB 1Z78A 2D44A 2DVBA 2YGLA 2WQ4A 2Q5TA 2PAEA 4Q0SA 2Z42A 3J26N 4AYUA 3USUA 4HANA 5DZFA 4IEYA 3AXDA 2H0VA 3PNAA 4Z2WA 1NQJA 3OBRA 4R52A 3B9CA 2RS31 3WG4A 1ZVFA 1J59A 1AYN2 3IDEA 3DV8A 5FQ0A 1BKZA 1NCRA 4JGYB 4Q4Y1 3JBG2 2DU1A 5GZCA 1N1SA 2N7GA 3CL1A 1RUD2 2UYAA 3VHOA 4N9IA 2IXKA 5K9YA 3QD6A 3WUDA 5JSPA 2XBO1 1H8TB 3AYCA 1KXGA 1EV12 1H9WA 4I3PA 1QU0A 1REEA 1VIWB 5IK7A 2UU8A 5J7MA 1VBB1 3VBHC 1Y7BA 5ABJB 1MQTA 2R0FA 2YC0A 2B7YA 5DUXA 2NN8A 4IEPA 3PLQA 1QJX2 5H9SA 4KGGA 4RHV3 2XG3A 4XJAA 1ASJ1 3D0SA 3MIDA 2EF6A 2DFCA 4COYA 3WUCA 4MGKE 4I30A 4MX3A 2AH2A 2GN7A 4H55A 1D2SA 1LOBA 3VBFA 1WW5A 4IESA 4YZ4A 2R30A 2IFWA 3AMMA 3VBOC 2RS12 2ZAAA 2WFPA 1AJKA 3N4MA 4AF9A 4Q29A 5I0RA 1R082 3H3UA 1WUVA 4TWTA 1LTEA 1JN2P 3LB9A 3N3HA 1OA2A 4B7KA 1W0OA 1KFUL 1G86A 5T5JA 5KXEA 4G3YC 3FFZA 1ZRCA 5CFCA 2PELA 4J1XA 3PTYA 1SCRA 1YJLA 3ZX7A 1AXYA 1PVC2 1CX4A 1WLDA 1NA1B 4Y1YA 3RPQA 4AI2A 2QE3A 3RJ2X 3SH3A 3WP3A 1UN1A 4LO8A 4MV2A 1N3QA 2XJVA 4XQ4A 2A75A 2VVFA 3TN91 1R1A3 4AI1A 3CJIC 3WW4A 1ULCA 4MXWA 2ZGPA 3J8F3 1XU1A 5GLWA 4R4XA 2XJUA 2VW2A 1RB8G 4AEJA 5JZGB 1RUJ3 3AKPA 4COVA 2A6XA 1GQHA 2I2SA 1H2NA 1UMZA 1X7NA 2W0XA 3AP9A 4X6RB 2BBVA 2TUNA 4W6XA 1BVP1 4ISQA 1EY2A 1MR5A 2HWD1 3THTA 3ZSEA 2ZACA 4OHVA 1UU4A 1PO11 2WZR1 4IXLA 4S2DA 3B7MA 1AYM1 3AMHA 3GBGA 4Z8BA 1LRHA 4D69A 1H2LA 4HN0A 5DUVA 1RTVA 1N1VA 2XJQA 3UV9A 1FV2A 1X50A 4FPCA 1NE6A 4QPGC 1SLIA 4I02A 4R9BA 3MYXA 5JR7B 3VBHA 1DDLA 1OKQA 1UPIA 5FTTC 1PGSA 4UW4A 1OFSA 4RA0A 1NCQB 3AYAA 2KA3A 1FOD1 4HETA 1C3HA 3TBDA 4JGZC 2RR11 1BZWA 3MW4A 4N53C 2R063 3A0NA 2BQPA 2WA3A 1JUHA 1VRH2 1YHFA 1S2BA 3OBTA 5SV8A 4ASLA 4QQPA 1WCDJ 3H1YA 4MH0E 1PO23 4NO4A 3P3PA 3MEPA 1X8EA 1GICA 2D6OX 5T3NA 3VBOA 4FBFA 5FMOL 1FMD3 3IDBB 1HV0A 5FMOS 4AVBA 4K40A 3IM0A 3IBMA 4AEDC 3MPBA 2C5DA 1M06G 5JOXA 2V09A 1PZ8A 4RR3C 5FOBB 1VBD2 2QDNA 3ILNA 3UL2A 1AR63 1JXNA 2E53A 1YWKA 2VOVA 2VGDA 2RS51 1SFNA 1RUH1 2HWC1 4JRAA 3VHPA 5E88A 4BMEA 2DV9A 1AR71 4Q8KA 4PQ9A 4FXGB 4Z92B 2GU9A 1YFUA 2C0ZA 1W6NB 4I0BA 2P3JA 3PVBB 2WNUC 3CJIA 4CDUC 5T5PA 4UW3A 1W39A 1VBC1 4P9LA 1O3QA 4TYSA 2EXKA 5KC6A 1MVEA 2GC2A 1CIWA 4YFWA 2HWE2 2R043 4YLZA 4LUMA 2BW8A 4IQPA 2HYKA 1TMF2 4P9JA 3OPZA 2ZHNA 1AL0G 4GB33 1W6QB 1QNYA 1ZRRA 4AI3A 1URXA 3GZAA 3MIBA 1RUC1 1K5MB 4AFCA 2VMHA 2CNAA 1KFXL 3BU7A 4I0WB 3NJZA 3ZFEB 5KXDA 5L7OB 3UJQA 1OA3A 4OZXA 1AR61 2YMZA 5LK5A 4CDQB 2WJSA 1PIV3 4QPGA 2ZZJA 4IV3B 1L3JA 4XHXA 3ZXLA 4N43C 4FTEA 4YVWB 3JBG1 3ST7A 4QMAA 3KSCA 2CAUA 1AVBA 2MHFA 1LOAA 3JD72 2X5IB 3LOIA 3M70A 4WM7C 1F5FA 2D93A 5D8AB 5F9TA 4JGZA 1Z7S1 1CPNA 4C1XA 3FWEA 3M4FA 4WZFA 3WW3A 4N53A 1EV11 5A33B 2A3XA 4QPYA 3WDYA 1CAVA 2O8QA 4GQ7A 4WVMB 1RHI3 2VULA 2X53S 3OYWA 1U0AA 3CU7A 3BOWA 4XBNA 4F8AA 1V6JA 3E6CC 2DURA 1QJX1 3ZSLA 1ZRFA 1Y3TA 2PHLA 2BEOA 3BB6A 4YRDA 3A0KA 1SMVA 5JIUA 4AEDA 2VECA 1LEMA 3CJXA 2PLV3 1ZBA3 3H0OA 3GF6A 4RR3A 3KGLA 1FATA 1S0EA 2VUAA 2D43A 1GANA 1UAIA 3V0BA 1QF3A 3QACA 2JICA 3AZZA 3QH6A 3FBMA 2XLAA 3IKWA 1H8TC 1AX2A 1DYKA 4FO9A 3FJSA 3BOPA 3O12A 1R081 3KZ4C 3POSA 4LO5B 4WVWA 1HRI1 4WVZA 2WNVB 1BVVA 2BTVC 4DB5A 1CJPA 2WNUA 4CDUA 3JCIA 1O4YA 4Q4X2 1AUYA 2BWAA 2VOWA 1R092 3VBUB 1SBFA 4P9XA 4IL7A 4TZDA 4LA2A 1PVC1 1SACA 4XF4A 3KCYA 3LWCA 1GSLA 1UKGA 4Q27A 2EXIA 4SBVA 3L2YA 5DDJ3 4ZU7A 2VUJA 4YVSC 2C9AA 2GNTA 1AL22 5CBLA 2VOKA 1D2QA 5C9AC 2IXIA 3FHIB 1VBE1 3QOPA 4EWDA 4XF9A 1V00A 3VL8A 4AGRA 1U5ZA 3N7LA 2E7TA 1QQP3 1N47A 3WNXA 5GM0A 1XNCA 1ULEA 1D4M2 1KQRA 1POV3 4LUKA 1VLNA 4JTOA 4N43A 5GJ6A 5FO9B 1ZBE2 4OI1A 1G8WA 3POYA 5CU1A 1QH6A 3I59A 4M00A 1CN1A 2PQQA 1VAMA 3P3NA 4D7TA 5BNOB 1G6NA 4WM7A 4BIFA 2A71A 4L8QA 3WW2A 2VMGA 3FUQA 4KNCA 4GKXA 4JC1A 1WW7A 3RMYA 1BEV2 4IEZA 5TSWA 3WDVA 4ES8A 1IS4A 3IPVA 1YLLA 3KQRA 2PHUA 4NVPA 4K8FA 2DCTA 2ZABA 3ES4A 1JYCA 1U5YA 2MEV2 4FVVA 1LB2A 1S0BA 3ZSKA 1S0IA 1PGL2 3GZUC 1Q8VA 5FRAA 4F83A 1VRH1 5CB7A 4K1ZA 2QNKA 5JPMB 3MIGA 1WD3A 3B94A 3SXWA 3AKRA 4QGLA 1H8TA 3MLJA 1YFYA 3GNEA 4P9WA 1RVF1 4JCKA 4AFAA 5I8SA 1MEC2 1Z0HA 4J1WA 1EPWA 1PHMA 2MNGA 3B5LB 4HT1T 4B3NA 4A7KA 2CGOA 1AXKA 4C0BA 4AEKA 2ERFA 2Q4SA 1N1YA 4P9GA 5IK5A 5LEJA 2HJIA 4AGGA 4QT6A 1ENXA 1OQ1A 3J4UH 3NWKA 4RL7A 4YVSA 4IV1C 4AFMA 1BBT3 1HV1A 1QJY3 4DNYA 4CP2A 4XBLA 3H8UA 1KS4A 2JE7A 5C9AA 1YCIA 1GYKA 1RUF2 4YGDA 5T54A 1AR82 1ND3B 2DCZA 2HWE1 2A6WA 3GBFA 3R6SA 2ETEA 1QY4A 1CAUB 1W6OB 3JUUA 5T55A 2JEMA 1OLRA 5DZEA 1RUE2 3NL1A 5F6KA 1PZ7A 2K9ZA 4Q2FA 1TE1B 4DRVA 5J98B 1UCXA 4Y22B 2P17A 3R4DB 3ZFFB 1IKPA 2PHRA 3LA2A 1TME3 1W6MB 2YUEA 4OHXA 2FZ1A 3B69A 2B8MA 1Q43A 2B45X 2BNMA 2ZMNA 5J3UA 3OD0A 2CAVA 4E4DX 2K2SA 4DS0A 1MZ5A 4XF1A 2RMU1 1WMDA 2MPFA 4NWWA 5SV5A 2NM1A 3ZIXA 1H8VA 4XFHA 4AQ6A 4COWA 2IFRA 1FAYA 3TAYA 3I7DA 4D7YA 2GNBA 4KBBA 4DOUA 4PLNA 3VUOA 3C2UA 3MPPG 2WLPA 3JD71 4FPOB 4LULA 2G9GA 1ZZ8A 2JG9B 4RGAA 5AVAA 4XTPA 3H50A 1XQNA 2FQPA 1CQ9A 1H4GA 3RYKA 4XIOA 1K5MC 1JOJA 3HMYA 3VBRC 1SBDA 5KHGA 1HXS1 2PA7A 4AQ2A 1DQ0A 5L7OC 2ZGLA 3KCCA 2Z69A 1XRUA 3AJZA 4ONUA 3ME2A 1NY72 4CDQC 2VW0A 1J3PA 5D1IA 4IV3C 1B35C 1QNWA 4HSLA 4YW5A 1LU2A 4YVWC 4BE3A 5DUUA 2XJRA 1R1A2 4TSVA 3M3QA 2OYZA 2UYBA 1BCXA 2PHXA 2DUOA 4FT8A 1HX6A 5FPZA 5C4WC 2FHRA 1RUG1 4PLOA 4EN8B 4AE2A 2GAUA 2IC1A 4DFSA 2ZBJA 1JW6A 2AR6A 2R072 4M0HA 2RS33 4FPLA 4Z82A 3ZN5A 4BPZA 3T2TA 4Q4Y3 2B9UA 4EV0A 3LAGA 1CONA 1EAH3 1ZNPA 4IV1A 4Q4X1 3WT3A 1WLTA 2LALA 5BY5A 1DQ1A 1R091 1E57A 2VY0A 5K0UB 1PM7A 4JTNA 1LU1A 1YI9A 5J48A 4LTAA 3S7IA 5F5QA 2R49A 2XBO3 1VALA 3M3CA 4M3CB 3RJRA 2WSVA 3JQWA 5DXDA 1J3RA 3DL3A 3PJYA 2VNGA 1FX5A 1DFQA 3ECQA 3TOJA 1V6KA 4HFSA 4YG6A 1LECA 2IZWA 4DY5A 5JOYA 1AL21 5JVVA 2Q0AA 3WX5A 3OF1A 1RITA 2NZ9A 3OY8A 1F8VA 1W6NA 1YFWA 3D6EA 3FFQA 4ISRA 3ZO0B 1S0GA 4AVVA 3HQXA 3V0AA 2ZX3A 1GNHA 4UBGA 4XJ9A 2AUYA 3RRDA 1D4M1 3VBUC 2D98A 2LTNA 2A3WA 1V9U2 2EAKA 3H3ZA 4Y1VA 2ET7A 1PO22 4FSJA 2EAAA 4E4ZA 1ZX5A 1LOEA 1H2KA 1FMD2 2E7QA 1YNAA 1AR92 1EAH1 1ND2B 2Q8OA 1BEV1 1K5MA 2FBEA 3VBRA 1QHDA 5L7OA 1VAVA 3IDCB 4A2UA 2R0HA 1N3OA 4LBQA 2A6VA 3KMHA 4CDQA 4O9EA 4IETA 5BYNA 4IV3A 1B35A 1WBLA 3TN93 1UKRA 1DG6A 3V65A 4K20A 1DZQA 1POV0 1S0CA 2ZGKA 3APBA 4QM8A 4FTSA 4N7UA 4YVWA 5AC92 1MVQA 1BMV2 4ITCA 1QJU2 4P9YA 5JI7A 4QPIA 2WC2A 3O14A 4BH9A 5C4WA 1CESA 2ZPXA 1DU3D 4KWKA 4NHLA 4JRLA 3RS6A 4AHWA 1CJDA 2R042 4L9BA 1RGSA 1X8MA 4AVTA 5A32B 2HWD3 1MEC1 3NAPB 2WZR3 1PO13 2WFF2 3LA3A 2UWAA 1AHSA 2NMOA 4AG4A 1AYM3 1DF0A 3WV6A 4ES9A 5A3LA 1REFA 2QCSB 2QVSB 3V64A 5GLTA 5T50A 3H1WA 2A7AA 1ENQA 5ACA1 4OHZA 1VJ2A 4CDXB 4NWVA 5I8YA 3SISA 4QGMA 3RG0A 4PBPA 2XGXA 4F3JA 2WNEA 4XFGA 5DUWA 3KB5A 1D4VB 1PIV2 1GKBA 1KITA 1O91A 1BXHA 4Y24A 1DQ6A 5FO7B 1FOD3 4Q1RA 1NE4A 2XJSA 4Q4V2 2ES3A 3E6DA 1LHWA 2RR13 3WW1A 5A3MA 3TWIA 4FP3A 2D5HA 3PMEA 1H4HA 3VBUA 3AP7A 2IWGB 4EWEA 1MS0A 5IT6A 4XXAA 4A3XA 1WW6A 4KH9A 3O0VA 3VKLA 3W58A 5JWPA 2KXLA 1RHI2 2DCJA 2WIIB 3LSDA 1DGRN 4AEMA 2ZS6B 1GZWA 4Q4W2 3AP4A 4AQSA 4BYYA 2DF7A 3WINE 1MS1A 1W6PB 1DHKB 3T1MA 1N3PA 3U10A 3AK0A 2WT1A 2PLV2 3MW2A 1RMU1 2RS53 1RUH3 2JG8B 3HBZA 4GH4B 2OW4A 2UWCA 2HWB1 4OHYA 2HWC3 1NG0A 2QFEA 3H7YA 4N90A 3RI8A 1F9KA 4P5HA 1AR73 1OPOA 3EBRA 1HRV2 2NYYA 5J96B 3N7KA 1QGLA 5C8CB 3ASIA 4L92A 1VB2A 4JVAA 2Y38A 4HVQA 1Y9QA 4BLJA 4LBLA 4MSVA 1V6OA 3ZFFC 1VBC3 1SCSA 1UU6A 2P37A 2CGNA 4RD7A 3OCPA 5CFDC 1UIKA 2DWRA 4AGVA 4FQZA 3B93A 2IXHA 4LBMA 4UW6A 1NY71 1CAXB 4FAHA 2VXRA 3DKWA 3DPRB 4FCAA 1OFNA 1WGPA 3AZYA 3LSEA 5FAXA 4EWAA 2BNNA 3H9AA 4C0HA 2SBAA 4XJUA 3C3VA 2ZX4A 3IWZA 1RUC3 1HKDA 3TB0A 1LGCA 3MW3A 1O7FA 4Q8LA 4YW1A 5J09A 2ARXA 3D82A 1UZYA 4LO7A 2WS92 3VBSC 1R1ZA 4LR4A 1GV9A 1CD3G 2ZHKA 5EYXA 4EN0A 3NV4A 2OZ6A 1C8M2 4XQDA 2R071 1S0FA 3HT2A 1Q8PA 5CA6A 1RC6A 2DCYA 4BOWA 1VBA2 1FXZA 5I91A 3JBG3 4YM3A 2V5YA 4HMZA 3QLQA 1Z7S3 3EJKA 2G9FA 4WV8A 3ILRA 2A3YA 4I01A 4OI4A 1J1LA 1EV13 1S2KA 4CEWB 5JLVA 5F1RA 2D6KA 4FQ4A 4Q0VA 5GZGA 1XYPA 1QJX3 2DTYA 2WQZC 3WP6A 3BALA 3GHNA 3B01A 4XDQA 5BNPC 3FC0A 4LEJA 1VR3A 4WBBA 5H9QA 4KG8A 1GLHA 1SQ4A 3SCFA 1OSGA 4AW7A 4CEYC 2ZGOA 1ZZ7A 1FNYA 1C8NA 4HN1A 3USUB 5FO8B 1DZTA 5C6CA 4AHXA 1LHUA 5FQ0B 3DN7A 1NCRB 1CAUA 1WLCA 1YXWA 1YFXA 1R083 4XF3A 1MZ6A 2C1FA 1AYN1 1JHNA 4CYDA 1HRI3 2DU0A 1EPZA 1H0BA 5E8AA 4U36A 3WP4A 1RUD1 4Y22A 3QH7A 3ZFFA 2D5FA 1WCKA 4ZU5A 1I6XA 1N1TA 3MFAA 3MICA 4N7IA 2GC0A 2BNOA 1SEFA 1PVC3 1Q5OA 5GZFA 5CFDA 3VL9A 1YI7A 5IUQA 3RNSA 4ASMB 1G9DA 3MDPA 1MQTB 3NVCA 1OD5A 3BTAA 4PF5A 1CAWA 4JDNA 4PDWB 1FPN2 2UY8A 3RI9A 3TYJA 1UIJA 1C5IA 2O0OA 2FZ2A 2OUHA 5AC91 1O3SA 4COZA 2B42B 1QOSA 1WCSA 1VBE3 4JGYC 4H7LA 3VBSA 3SMHA 4I3GA 1ND2C 3ILFA 3B3QE 3VBFB 1RUI2 4J6GA 1V70A 4E4SA 3MIHA 3URFA 4I2OA 4HKWA 2PN5A 2RS11 1ZZ9A 3NKGA 4QX5A 2WFF1 4LBJA 3OTFA 3W9AA 3ZN6A 1PZ9A 4AFDA 5ABJC 2QZ2A 2GALA 4YFZA 5JCTA 1SLLA 3PHMA 1SBEA 1DGRA 1LCLA 1XNDA 2E63A 2Q1MA 4LA3A 1B09A 4M01A 4RFT0 1ENSA 5FDBA 1UZZA 3ZYRA 4L11A 4U2AA 2ZTNA 3AMNA 4CDWB 3O5SA 4MXWB 1F2NA 3D8CA 2ET1A 5BNPA 3I54A 2HWF2 3ZXAC 1H2MA 5BV6A 4LO6B 1FV3A 3CNAA 3FE5A 1WMEA 4A7YA 1QXJA 4Y5Z0 3ELNA 3VGIA 3VKMA 1VRH3 4N9HA 1O5UA 1X36A 2YPJA 4CEYA 4WM8B 2YZ4A 3NV3A 3WG3A 4HKLA 1OA4A 1NXMA 4YZ5A 4M3CA 1RVF3 2HEWF 4Q0QA 1IQAA 5GLVA 2QDRA 2WKKA 1LGNA 3VZOA 4XILA 1NA1C 4GMP3 4XMAA 2A5ZA 4JDOA 1VBD3 4G4FA 3DUIA 5CG8A 4K3UA 3CEWA 5I0TA 3AYDA 2OVUA 1V6IA 3S6PA 2GMEA 3VHRA 2YV8A 3VBHB 5JOZA 3GYDA 4B8EA 3B00A 1KDKA 4ZXKA 5JZGC 4OI0A 3AYEA 4FPFA 1COV2 1VAKA 1QOOA 2W68A 3N36A 5HI0A 1HIXA 2RS32 1CR7A 2OUJA 4NR1A 4PBOA 1W2UA 2LM3A 2ZX1A 4GULA 4Q4Y2 3VZJA 4DRRA 1PMIA 4RQPB 1ZRDA 2OZJA 2D40A 4W65A 4Y1XA 4KU7A 4JGYA 5FBZA 2HWE3 1S1AA 2GC1A 1ND2A 2YROA 1LENA 4B4QA 3KS7A 1TMF3 1C4RA 2XBO2 4FPJA