1YUDA

X-ray crystal structure of protein so0799 from shewanella oneidensis. northeast structural genomics consortium target sor12.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
158
structure length
158
Chain Sequence
MQNADDFIKFLELEQHVEGGFYRSSYRSETAFDPSRQLWSSIYFLLRTGEVSHFHRLTADEMWYFHAGQSLTIYMISPEGELTTAQLGLDLAAGERPQFLVPKGCIFGSAMNQDGFSLVGCMVSPGFTFDDFELFSQEALLAMYPQHKAVVQKLSRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SO0799
publication title Crystal structure of hypothetical protein SO0799 from Shewanella oneidensis
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
total genus 26
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yudA01
4N9HA 1DGWA 3LAGA 1YHFA 5T3NA 1DZRA 4P9GA 4MGZE 4O9GA 2XLAA 4I0AA 4Q29A 3PVBB 5KHKA 1UD1A 2V09A 4JTNA 1YFYA 3EQEA 5FLHA 4IEWA 2IC1A 2GZWA 4O9EA 4KU7A 5I0UA 3NKTA 2PYTA 1Q5OA 4META 5JSRA 3ELNA 3ES4A 1YLLA 2GC1A 5J7MA 3E97A 4E2SA 3B02A 1Q3EA 4HLTA 5BV6A 1ZZ6A 3CF6E 3MDPA 3IWZA 3LZZA 3H1MA 3I59A 3OCPA 2OZJA 5LRRA 4JV4A 2BNNA 4EWAA 2IXIA 1CAVA 3D0JA 1CGPA 4PIXA 3MYXA 4IEUA 5LRSA 2BNMA 1UCXA 4MX3A 5FLJA 3HT1A 4LULA 4MUVA 4UBHA 1WA4A 2Y0OA 1Y3TA 4QM9A 4AVAA 1RUOA 3FFQA 4QMAA 3TNQA 4QGLA 5F1RA 1Q43A 4LA3A 3OTFA 1U12A 5I0SA 3EO6A 2PFWA 1PM7A 3CEWA 2Q0AA 3IDBB 2D40A 5LEJA 3OF1A 2B5HA 2QVSB 4I3PA 3NSTA 2IXKA 2H0VA 3G7DA 1IPKA 4J1WA 3FHIB 3H3ZA 1WLTA 4HBNA 5J48A 3IDCB 1J59A 1QXRA 5E16A 4UXAA 3LOIA 4FBFA 1H1IA 4PIYA 1ZZ7A 2BGCA 4WBBA 4HVQA 2OPKA 3USSA 2VQAA 2PAKA 1NZCA 2CV6A 4RD7A 1ZRFA 2VPVA 5FQ0B 4A2UA 1ZZ8A 3SCFA 4YSFA 4EROA 4MGKE 2PAMA 4Q0VA 1CAUB 5I8YA 5K8SA 1YFXA 4XF4A 2CGPA 3HT2A 4IEYA 3N4MA 4IEZA 4PJYA 4LTAA 4E2QA 1ZX5A 1WGPA 3E5UA 3S7IA 4H7LA 2XKOA 2IXLA 1UW8A 3BU7A 3D82A 2DCTA 3O14A 4YRDA 3WW4A 1OMIA 5CADA 4XFAA 5KHGA 3GYDA 4AVBA 4IEOA 3KGLA 1VP6A 4Z82A 3ROUA 2PQQA 1YFWA 1YFUA 4KWLA 3QOPA 4HZFA 5FPZA 4XFIA 4KWKA 5I0RA 2WFPA 4QGNA 3WW1A 4Q0UA 3L2HA 4I02A 3PNAA 3UKNA 1YWKA 4HSJA 2H6CA 1RC6A 2ZKLA 4LEJA 3ETQA 2QJVA 2XLGA 4IETA 4Q0QA 4EWEA 5KHJA 5I8TA 4LA2A 1CAXB 1O3TA 5KBFA 3CO2A 3GBFA 1EY2A 4R8HA 1ZRDA 2O8QA 4YNIA 1LB2A 4Q0SA 1I6XA 3OD0A 2UYBA 1O4TA 2XKPA 3RZZA 1NYWA 4ONUA 3NW4A 4MGYE 5KHHA 4ZU5A 4E2GA 2E9QA 2PTMA 1O5LA 5AVPA 3KMHA 2Q30A 2IXJA 3S7EA 4XFFA 1ZRRA 4NVPA 4XETA 1RUNA 1EP0A 3ST7A 4L11A 2H6BA 1UIJA 4BH9A 4OLLA 1J3RA 4XF3A 3WW2A 4XFBA 5JAXA 2OYZA 3ES1A 3BALA 5HI0A 1XE8A 5JSOA 3H1WA 1CAWB 4I09A 4UBGA 4FAHA 2D5HA 1EYBA 4CYDA 2ZCWA 3QACA 5BPXA 1LRHA 2HJIA 3E5XA 2K9ZA 5D1IA 1NXMA 4MV2A 4XFGA 1J58A 4JVAA 1J1LA 3LWCA 5J3UA 4XEZA 3FE5A 3H7YA 5CU1A 5FCCA 1VR3A 4R52A 3SMHA 3KGZA 1DZTA 2IXCA 5JR7B 4KL1A 1O3QA 1IPJA 1V70A 3ZDSA 4B29A 4QGMA 5C6CA 4LLOA 4D7TA 2VECA 3I59B 1LR5A 4I0BA 4WVZA 4HN1A 4AXOA 1SQ4A 1CAVB 3DKWA 1CAXA 4XFCA 4MGIE 4HVRA 3SCGA 4GULA 2BEOA 1NE4A 4IESA 3E6DA 1FI2A 3EBRA 1O5UA 1X82A 5JCTA 3R6SA 2PHLA 4N9IA 3CLPA 3U10A 4L2NA 4IEVA 4K8FA 1LKNA 5I93A 2B8MA 4KU8A 4QXKA 3NJZA 2ETEA 3NVCA 4I2OA 2XHKA 3RYKA 4DINB 1DGRA 2Q1ZB 2GH2A 3FJSA 1UIKA 4TLFA 3NL1A 1EPZA 4AQ2A 5KHIA 3LA2A 4QM8A 5BY5A 4XF0A 1QWRA 1XRUA 3H9AA 3TNPB 2GU9A 4ZU4A 2XGXA 3SXWA 3DV8A 4IEQA 5C8WA 1X8MA 3EHKA 4F8AA 2QNKA 4IERA 3HIFA 1G6NA 1ZNPA 3KSCA 1UPIA 2D93A 4XF9A 4EWDA 5FPXA 1ZZ9A 2UY8A 3E6BA 2FMYA 4FAGA 3RPQA 2PA7A 3ACLA 3M70A 5EFUA 2EVXA 3UKVA 2QCSB 1O7FA 2CAUA 2PHDA 4JTOA 1J3PA 3JZVA 2UY9A 1OD5A 3OGJA 1CX4A 2XL7A 3M3IA 5I91A 1X8EA 4MZUA 3RNSA 1QY4A 5FQ0A 1Y9QA 1ZZCA 3U0ZA 1SEFA 1OI6A 3IIAA 1NE6A 2HKXA 2MNGA 4HSLA 4YYOA 2N7GA 3FWEA 1CAUA 2OA2A 1VJ2A 4HN0A 1O3RA 4X6QB 3RYRA 4ORFA 3H7JA 2UYAA 3H3UA 4HVOA 1ZZBA 4BYYA 2P17A 2CAVA 3KCCA 4Z07A 4IEPA 3I7DA 2BYVE 3I54A 2XLFA 3H50A 2ET1A 5JSPA 3VHRA 4ZU7A 4WZCA 5BXXA 4KWJA 4X6RB 1ZREA 2Z69A 3D0SA 1FT9A 3IBMA 1RL3A 3CL1A 2EA7A 3MZHA 1XE7A 1OFNA 3EJKA 1ZRCA 4D7SA 1YUDA 2QDRA 3SHRA 3RYPA 2I45A 2ET7A 2FQPA 4F7ZA 3BB6A 1I5ZA 4MH0E 2MPFA 1RGSA 4AVCA 3UKTA 3FZ3A 1PMIA 3BCWA 3BPZA 3C3VA 4XFHA 4EV0A 1GQHA 3H8UA 4LUMA 4IEXA 4XF1A 1H1MA 2EAAA 4BIFA 3H1YA 5BUVA 3E6CC 3FX3A 4YARA 2O1QA 1GQGA 1L3JA 4J1XA 2Z2SB 4AQ6A 2GC2A 5E1RA 2Q4SA 3WW3A 3DN7A 3SCHA 5EZWA 2WC2A 4FT8A 1JUHA 2B9UA 2C0ZA 3MPBA 2K0GA 3DL3A 4Q0PA 3RDIA 1QXJA 2PAEA 3PLQA 1TQ5A 3LA3A 1SFNA 5I0TA 3CJXA 4OFGA 5LEKA 1HW5A 3HQXA 4LUKA 2GC0A 5CVRA 2IXHA 4I01A 2OZ6A 1X7NA 3E5QA 2BNOA 4PIZA 4QX5A 1FXZA 2ATFA 2F4PA 5FLIA 2KXLA 5I8SA 4HMZA 5FDBA 1RTVA 3S0MA 1ZVFA 1O3SA 1J3QA 2XL9A 3U11A 4BHPA 2D5FA 2MHFA 3LA7A 2GAUA 2GC3A 1CAWA
chains in the Genus database with same CATH superfamily
3OUHA 4QHBA 1LOFA 1ZBE3 4Q4V2 5CZKA 2WWSA 3I2GA 3L2YA 1DZRA 2FCVA 2KD7A 2P6CA 4P9GA 1C1LA 3ENRA 4RYDA 3WUDA 4BM8A 4O9GA 2YPDA 5IK7A 2VZ1A 4BIOA 3IMNA 2XLAA 2VNGA 3O0XA 3H0OA 2HH9A 4Q29A 1RUH3 5KHKA 3O5SA 4OZXA 3GBGA 2FCUA 2JX9A 2LUWA 1ZBA3 3POIA 3LIHA 3UK9A 4QDSA 1UU4A 2VBPA 4RFRB 2PLV1 4J25A 2V4VA 2IC1A 3KV6A 5G05L 2XQXA 1LECA 1S0GA 3NKTA 4MLOA 4DIQA 2A73B 5LY1A 4AEDA 1VMFA 2BERA 4MYEA 3BU0A 1AJKA 2X29A 3MLKA 4HL0A 1U5XA 5FYYA 5DG1A 3ES4A 1MVEA 2GC1A 1BKZA 3E1F1 5FZCA 1XBFA 2RS32 2ZGSA 2CGNA 3QBQA 2OXBA 3WQ7A 3BODA 1KQRA 1UYYA 3EYPA 1HJFA 1UYXA 1X36A 3HNYM 4HLTA 3CF6E 3VHPA 4C1WA 4Q8KA 3IWZA 2LM3A 4FOVA 3KM5A 1QJEA 5EWSA 2WT0A 5K0UA 2FDHA 4XUNA 1NCQB 4DXRA 1VRH2 4EWAA 1LENA 2QKDA 2Q1MA 5A3PA 1W9FA 4FPCA 2DYCA 1W9WA 3C7EA 5BNNB 1OLME 1MVQA 2CDPA 4LOTA 1LULA 4YVWB 3MEPA 3WNMA 4BDVB 5C5TA 1PIV1 2Z4FA 4MO3M 2I74A 3DCQA 5FLJA 1ENQA 4XIKA 2WQ4A 4FCAA 4NPRA 4UBHA 4BWOA 3WF3A 1Y3TA 4WVMB 3WLUA 4AVAA 4LBNA 5CBLA 5IATA 5K9YA 5CISA 1R1A1 1W8UA 4FTSA 5AFBA 1W3XA 2E33A 3GBWA 3PUAA 3VKMA 1Y43B 3J8F2 1PVXA 2HWD3 3EO6A 1VBC2 2VVDA 1ST8A 4LK6A 3AB0A 2Q0AA 1F5JA 3KV9A 3M1HA 2VBDA 2D40A 1FATA 1TMF3 1G9FA 3KV4A 4Q4Y3 3MIEA 4UT5A 5ANQA 2B5HA 1OFSA 2FDGA 1CN1A 2IXKA 1UPSA 2PMWB 4Q27A 5L9VA 2H0VA 1KFXL 2VOVA 1ZA4A 1NCQC 4ASKA 3DXUA 3OEAA 3OBRA 3IDCB 1Y9GA 4HKLA 4HKWA 5CKMA 5J48A 1QXRA 4YZ4A 4FBFA 3CZJA 5BNNC 2VW0A 4WBBA 3RVHA 4Y22A 3TEYA 1BMV2 2OPKA 3USSA 1L7QA 3R4DB 2JDZA 4YVWC 4CCLA 1NZCA 2CV6A 1JN2P 3IZOA 1W6PB 2WFF3 4A6SA 5BNOB 2EXHA 1ENRA 1UZ0A 1ZZ8A 3DPRA 3SCFA 5KXCA 4IV1B 3OD4A 5SV5A 5FZLA 4A3ZA 1NG0A 5AFEA 5GZCA 4GAZA 4MGKE 3H8RA 1TZOA 3ZMOA 1SLTA 3UT0A 1O4ZA 3J7NA 2VZUA 5I8YA 1ASJ3 1ZM1A 3POGA 1JHJA 2BGPA 2ZX3A 4TWTA 3N7KA 3BPSA 5EJZB 2QQLA 2CGPA 2XWJB 4PI0A 4YW1A 4E2QA 4XBNA 1UY3A 5FP9A 4JGZA 2HWC2 2ZGPA 1S0FA 3POWA 4JDOA 2BBAA 5GM0A 3OOXA 2TEPA 3RJRA 2RVAA 4NOTA 2IXLA 1PGL1 5FXWA 3MHZA 4P9LA 1UW8A 1QKQA 2DCTA 3O14A 2DUOA 2ZHNA 1UX7A 1PM4A 1W05A 1WMXA 2BZDA 2G9GA 1OMIA 2WAOA 5J37A 2EXKA 4DEQA 3X29B 1QJFA 1SMVA 3U4SA 4C90A 1GKBA 1HJGA 4G4FA 5FUPA 5BNOC 4IEOA 1XNTA 2JE7A 2X5IB 3N9PA 1G9CA 4AF9A 2XOMA 1VP6A 1SDWA 1W8TA 4JX0A 4IV1C 1YFUA 4W50A 1PMHX 1LTEA 3WDTA 4JZRA 2VQUA 3VZOA 5A80A 4FPFA 3JBG3 3L2HA 3N7JA 4A42A 2ZKLA 1GYKA 1PX4A 4XURA 3O0WA 1BJQA 4IETA 4EWEA 2R16A 5KHJA 4NN0A 5I8TA 1Q8VA 2VZQA 4XABA 4LA2A 1CAXB 5DN2A 2R071 1Q8SA 2JB4A 4N53A 3SH4A 3WHTA 5KBFA 1UMHA 1UOBA 3GBFA 5FZ0A 1CWPA 4EZHA 2RM23 1GNYA 2RMU1 1RUC2 4DUWA 2O8QA 5IWFA 5CEHA 4GIQA 3VHNA 5DUVA 3RWKX 4Y1XA 3O1UA 1UU5A 3V0BA 1W90A 1AYM2 2CSGA 3PU3A 5FYMA 1I6XA 1CPNA 2BWCA 3OD0A 2JDUA 1XPWA 3WP6A 1O4TA 2J1UA 2J42A 2XXZA 2YY1A 2ZGNA 1NYWA 3RZZA 5FRAA 2OIIA 2RR11 5D8AA 3VL9A 2WNOA 5HV4A 2QQKA 2X5IC 2B4KA 3ZKUA 4L9BA 3WG1A 2WT2A 1JUIA 3OGVA 3S7EA 1ZRRA 3NJVA 3WF1A 2ZMLA 3JUUA 1EP0A 1EUTA 1ENSA 4D8MA 3ST7A 5FREA 2RE9A 1BCXA 3POFA 1UIJA 1OURA 2HYKA 2L9LA 5DG2A 1J3RA 5FWEA 2D43A 3ZR5A 1BBT1 4QKNA 3T09A 1RVF1 3W20A 3WNKA 1QIQA 4GD4A 1NA1B 3EMRA 3BALA 5FZGA 5BNPC 2F6BA 1NQJA 4KGQA 5C3PA 2Q8CA 4HOOA 2WO2A 1XXNA 2SBAA 4AYUA 1J83A 2B7YA 1PNGA 2D5HA 2RDRA 3HPNA 4QKBA 1JZ8A 4E4HA 2P3YA 3RG0A 3QACA 4R4XA 3AL5A 4YW4A 5BPXA 5HCAA 5CAZA 4CVUA 4FQZA 4QD2A 4UI9L 1DLLA 1G9BA 1AR81 1N3OA 4K20A 2ZMKA 5JIUA 2VG9A 1GNHA 1NXMA 4AI8A 1W6QA 2DVAA 1GZCA 3J7LA 4CXXA 4JAAA 5FXXA 4JVAA 2Y6HA 1J1LA 1RHI2 4LNVA 3NWKA 3VDDA 1YIPA 2VBBA 5CU1A 4COZA 2VXJA 5T5LA 4FTEA 4YZ3A 4LBJA 5F6KA 3SMHA 3WVJA 5JOXA 2R043 2R0FA 3KV5A 4UAPA 3S57A 2PHWA 3B7MA 3DUIA 3FHQA 1X33A 4AEDB 2JICA 3GALA 5ABJA 5JI9A 1XSQA 3VD3A 3GZTB 3NNFA 1UKGA 1RJ8A 3M3OA 1NA1C 3TYJA 1AR61 1C28A 3WHUA 1MEC3 2AZ5A 2OUJA 1IPJA 4JGYA 1V70A 5IVFA 1Q8OA 2ADEA 2FZ1A 1VE0A 4ASMB 4S2FA 5C6CA 1LOFC 3A4UA 4D7TA 2QQOA 3HD8B 1AXZA 1Q56A 1C5IA 3PL0A 4LO8A 4YLZA 4Q4V3 4ZONA 3VD5A 5AC92 5JMCA 5DZFA 1LR5A 3RQ0A 1ND3A 5IVVA 3C7FA 1LNSA 4Z2AA 1E57A 4ISRA 1ULGA 4AI2A 3RZJA 4QHOA 4BJ0A 1PK6A 2HWF2 3BN6A 1UZYA 2VD7A 4KGGA 1MS9A 1V9U2 1C3HA 1GNZA 3VBSA 1OF4A 4IE0A 5DZEA 1HLCA 2UWBA 3DYMA 4FFFA 4CUAA 4CU7A 5JCTA 1PGW2 2D7FA 3R6SA 4AEDC 2PHLA 3WDVA 3T1MA 2JDMA 4L2NA 2DCJA 2W2IA 2C1FA 4K8FA 2AACA 1QU0A 4URAA 5DDJ2 3NVCA 1CVNA 1LODA 5FZ1A 2RS33 2XHKA 4XJUA 1DGRA 2Q1ZB 1R092 4A7KA 2JEMA 1W2AX 1UIKA 3FJSA 1HRV3 2JG9A 4TTGA 1S0JA 5K0UC 1IKPA 4N8MA 1OPOA 3JQWA 3OPWA 5KHIA 2J22A 2VU9A 3MW4A 1NUKA 2LTNA 1US3A 1VRH3 4AZZA 4DUVA 4XF0A 2R32A 1CD3G 3LCPA 3PIJA 1E5SA 4DO0A 4K1YA 4JKLA 2JDAA 1H4HA 5A3MA 4ZU4A 2XGXA 2GDFA 4IEQA 1VBA1 5FMCA 5C8WA 4XUOA 2D6OX 3VDAA 4A41A 2D3PA 5FMOS 1W2NA 1VBD2 2OPWA 2ZMNA 3DPRB 1OC1A 5IVEA 3IN9A 2ZHKA 4IERA 4BXSV 4X8PA 5F5IA 2WLPA 2DV9A 3HIFA 3JB8A 1G6NA 2ZAAA 2MEV3 4FP2A 1UPIA 2DF7A 3CU7A 4AAXA 3J8F3 1OSGA 1HRI1 3SC7X 4BQ2A 1ZZ9A 5FPXA 1VBC3 3FMGA 2FMYA 4M4PA 2B42B 2BQPA 5C3RA 3RPQA 2GP3A 5FPAA 4LO5B 4K3UA 2ZEYA 3M70A 1H1AA 2EVXA 2DCZA 3AMPA 2HWE2 5F5CA 3URFA 3K4DA 3HMYA 2CAUA 2UU8A 2PHDA 2VQTA 3LSEA 4JGZB 4JTOA 4TYSA 2D6LX 2XDVA 2JE8A 3FHAA 3QH6A 1VAKA 2WZEA 5I91A 1X8EA 4CDQB 2JENA 4CP9B 4XAEA 2A6WA 4DB5A 4MZUA 2VH9A 1UYZA 1Y9QA 4F83A 1QNWA 3T0AA 5FY4A 2ZABA 1ZZCA 3JU9A 4HXCA 1SEFA 3U0ZA 1QJU2 2VO5A 2JIGA 4H3WA 5IK5A 1JTZX 4XYXA 4IGPA 2HKXA 1QJX1 1QQP2 4HSLA 3T2QA 5F5QA 4MG2A 3JD72 5C7GA 3DPRC 4XE9A 1W6NB 3N9OA 1HQLA 3MFCA 3HQUA 3R05A 1IPSA 5FZIA 2ZKNA 5T5PA 4BQWA 4HVOA 3RZHA 4QDRA 1ULOA 2J1RA 2Q8OA 1ALYA 1HXS1 2P17A 2CAVA 3BOWA 4Z07A 3GCXA 3WP3A 1ENXA 1WCSA 3FLTA 1JODA 2WO7A 4IGOA 3VB9A 3I54A 1YQCA 4MADA 3ZLIA 3MIHA 2CY6A 5BYNA 1GZWA 2GN3A 4JGZC 4FPYA 4CU8A 5BXXA 3O1RA 5FP4A 3OGRA 2HWC3 3HVDA 4LOSA 4X6RB 1ZREA 2XVLA 1WBFA 3OBZA 2ZGKA 5DAWA 3HR9A 1W0OA 4WM8A 5ANNA 4CDQC 3V0BB 2UWCA 1OVPA 4DY3A 1D4M1 2W3JA 5GLUA 3EJKA 5HXVA 4IQPA 3KQ4B 1JYXA 1N3QA 2QDRA 1WCDJ 4XHBA 4CDWA 3AM2A 1DYPA 2JG8A 3RYPA 3W58A 4BQ4A 2FQPA 3T2OA 5I0DA 5D8AB 1SACA 4Q4X1 1M06G 1HIXA 3UKTA 5FYUA 5JR2A 3BPZA 4B7KA 1YI7A 1WW5A 3I3BA 4XVHA 1GQHA 3H8UA 4LUMA 4K6BA 5SV8A 3EXUA 1LAJA 4AI9A 3T2PA 4IGQA 1VBB2 2VUJA 1Q8PA 1F35A 3B94A 5A33A 4ARYA 1G8WA 1OQ1A 5JMOA 3FN9A 1BK0A 1SLIA 1GQGA 1VRBA 2WSVA 3B9CA 2D98A 3FC0A 4AQ6A 5JXGA 1DQ5A 2ZEWA 1WD4A 4Q4W1 4A7YA 1FPN3 4FT8A 1JUHA 1FAYA 1NOVA 2NPIA 2K0GA 2X53S 1RUC3 5F3EA 1QXJA 1RUJ1 3J4UH 4PQQA 3PLQA 4NIIA 5FZBA 1W39A 3LA3A 4IV3A 2JKBA 4DZGA 3CHXA 1JOBA 1AYM3 2PLV2 3BVCA 4LUKA 5CKQA 4P9WA 1QXPA 1U0AA 5JPNB 4QDQA 4LO4B 2VW1A 1CJPA 4QX5A 5D8AC 3AXDA 3ZFEA 2BW8A 4YW5A 4HANA 4HMZA 3VDDB 1J1TA 3DF0A 4I0WB 5GLVA 2AUYA 2XVGA 1BVP1 4AQSA 4CCMA 5A7PA 3AX4A 1WMDA 3RFRA 3MF9A 5FY8A 3O1SA 3KD4A 4RHV1 2YYOA 3A7QA 5ABJB 3ZIXA 3LA7A 3WEZA 3S30A 5DMYA 3ETPA 2WJSA 3AKTA 3KT4A 4JGYB 5FOBB 4MGZE 1D2SA 1IOAA 1BZWA 1UF2C 2P37A 4DMIA 1WW7A 5LK5A 3TRSB 4EN6B 4AVSA 3ASIA 4PI2A 3PVBB 3N9MA 4XJAA 1H2NA 1RB8G 2VMDA 4N7UA 1ND3B 1NCRA 2Y6LA 4GH4A 1PIV2 2GP5A 1Z7S2 3EQEA 4IEWA 2Q1FA 2Y0IA 4NMIA 1PK6B 4O9EA 4HETA 1POV3 1V6OA 4MHUA 3ZXGA 2A70A 5IUQA 1A78A 1RUG1 2FDFA 2PYTA 3O1MA 3VDDC 1RHI3 5EV7A 3ZOIA 4META 3VBSB 3WNOA 1YLLA 4IL7A 3WG2A 2WBKA 3I2OA 3GDBA 4CCNA 1PZ8A 2CHHA 1D4VB 1FOD2 1U5YA 2OVUA 5JUVA 4E9KA 3K48A 1EV11 5ABJC 1P8JA 3IAPA 3K4ZA 4FPJA 3MDPA 4H55A 5CB7A 3NV1A 4Y20A 5J96B 3LZZA 3T4HB 2ENRA 2VTFA 2WYFA 4JGYC 4GWIA 1QF3A 2BNNA 2AENA 3T0DA 1CAVA 3GF6A 3POJA 2WIIB 4CA9A 3MYXA 4IEUA 5FK7A 1SDDB 2OS2A 5FY0A 4WVVA 1ND3C 3LKJA 2QE3A 3GHNA 4A45A 3PVNA 5E89A 1UCXA 2XWBB 4MX3A 2W46A 5EP9A 1IS3A 4XUQA 1PK6C 2VZTA 3HT1A 4LULA 1BVVA 2PXJA 1RUF2 2HWF3 1KD7A 2XJRA 2R0HA 3VGIA 5FP7A 1AR71 3AP4A 4QGLA 1Q43A 1LOEA 3OTFA 1U12A 1RXGA 1LEDA 3ILNA 3VBSC 4BMBA 5I0SA 1EAH1 4FPEA 1MZFA 2VVFA 3OGGA 3IM0A 2VE1A 2B46X 4QXBA 1RIRA 4Q2FA 4CP2A 3O1VA 2E31A 3OY8A 5FTTC 5LEJA 1ZRIA 3OF1A 5FZMA 2GNMA 1COV1 2BUKA 3OYWA 4AAPA 1NLQA 3KVBA 3NSTA 5IFTA 5DDJ3 4PF5A 2BFUS 2QDNA 2BPA2 5DZGA 1IPKA 4OUMA 5A7OA 3AL6A 3M8LA 3TB0A 1RUD2 4P5YA 4AFMA 1QNYA 3H3ZA 4UFIA 2A6YA 4JRAA 1VIWB 2VZ3A 4WM7A 1J59A 1PGL2 1HB1A 1R093 1YO8A 5C9AA 4ASLA 1PO12 1H1IA 2DVBA 1APNA 3AJZA 4Y1UA 1JI6A 5A7QA 5FZFA 5C4WA 4O65A 5JDBA 1LHOA 5A1AA 3HWJA 2FDIA 5A70A 1CIWA 5DAXA 1ZBE1 1OQDA 2VPVA 2ID4A 4A2UA 4DPNA 2E6VA 1K42A 4E4SA 1XNCA 4YW2A 3IMMA 4OZOA 2BU9A 1RUH1 2A3WA 2R1DA 3KT7A 1BK1A 1S55A 2JKXA 4XILA 3GJAA 3ZXKA 4Z92B 1HV1A 1R083 2BRTA 3WX5A 4DOUA 5LK7B 1W3VA 1OUSA 3TBDA 1AX1A 2W1UA 4CXYA 2RS13 1CPMA 4IEYA 2OQ7A 3WR0A 4PJYA 2R072 3ILFA 1JYVA 1QEXA 5HCHA 3THDA 3S5AA 4G9SB 4C0BA 2WL1A 4FOWA 3VZJA 3TWIA 3S7IA 2FCTA 4EN7B 4Y3OA 2IWGB 4Y1VA 1SBEA 5K7PA 2HWE3 4XZUG 3B3QE 1F4HA 2E53A 3KVAA 4QX7A 3WW4A 2CWSA 4UFLA 3J26N 4WM8B 2RR12 3RRDA 5KHGA 2Y64A 1GP6A 1LOAA 4CPBA 3CMGA 4QPYA 4AVBA 5JAXA 1S2KA 4LBQA 2V72A 3KGLA 1F31A 3ROUA 4DFSA 2PQQA 1GMMA 1AL22 3POEA 2R063 4KWLA 4BK5A 4CDWB 1QJU3 3AFGA 2JECA 2JG8B 3QOPA 4XFIA 3MBWA 1QJZA 3AYEA 4GZ9A 3RS6A 2WFPA 3V56A 3ZFFA 4XW3A 3A21A 4BQ1A 4EJRA 2XQRA 3LOBA 3NV4A 3JD73 2W52A 1CQ9A 4I02A 3I3EA 4RGKA 1BBT2 3UKNA 4IUGA 4LEJA 4YPJA 2Q8DA 3ETQA 2NP0A 1GWLA 1SG3A 1LGBA 3RWNA 4U2AA 1NX9A 1NKGA 3LDBA 2JDPA 3N7MA 4QKFA 1CX1A 3KLSA 3SEEA 3ZXDA 1FYUA 3B00A 5IFPA 4F3JA 1C1FA 2HWD1 2P2KA 2VUCA 4GB33 1JZ4A 4YVSA 1A3KA 2FD8A 4ISQA 3VZLA 3H42B 2AH2A 5EPAA 5FJKA 4Q4Y1 4BU2A 1UOGA 1TMF1 4QQOA 1JZ6A 2Z79A 2E63A 2XKPA 1IG3A 2W39A 1TVGA 1QOSA 4WM8C 1F8VA 4IV3B 3WUCA 5KHHA 4AGGA 1AR93 3TEZA 2WNEA 1HB2A 5AVPA 3KMHA 2IXJA 4WVWA 2VUDA 4D6QA 4XFFA 2ARXA 2PHFA 3GM8A 4AK3A 3NAPA 4XETA 4CDWC 5CA6A 4GWJA 2JG8C 3HQRA 1I5PA 1W8ZA 2VCMA 4L0PA 2H6BA 3ZFEB 1W99A 4LE3A 1C8M3 1VB4A 3BTZA 4L8QA 2YGLA 3VBRA 3SKJE 4FPLA 4EN8B 2WFF1 2BJSA 1NXD1 4FOQA 5FPLA 2ZACA 2JXAA 1AR62 1LOBA 4N90A 1VBB3 3I2IA 3H1WA 4X8NA 1MPXA 4B4RA 4GMP3 3O12A 2J1SA 4RQPA 4I30A 2ES3A 3JCIA 1SFPA 1RUE3 4CYDA 3JQXA 5A6QA 1ASJ1 4UW4A 3D4KA 1MS4A 4OYUA 1YJKA 4IXLA 3F2ZA 4IV3C 2J1VA 4SBVA 4XFGA 3VKNA 4GH4B 1NCRB 1BXHA 5K4LA 2Y6JA 3UGHA 2G9ZA 2EF6A 3LWCA 1OOPA 2RV9A 5IW0A 5A1LA 2I07B 2WSUA 3OPTA 1GOFA 2QTWB 1TEIA 3ZFEC 1DZTA 2D44A 1NY72 1RJ7A 4PBOA 4AI3A 4XHXA 5FBJA 1OH3A 4V2VA 3PVEA 3KWVA 2WR9A 3ZR6A 1O3QA 2NZ9A 1WCQA 3AYDA 3VBFA 1DU3D 3GJBA 5FMBA 3ZDSA 2VZRA 3ZSMA 4BOWA 4QGMA 3I49A 3BTXA 3ZSKA 1CR7A 3AMHA 1O6UA 4LHLA 4LLOA 4XIOA 3ZN4A 5FOJB 5KC5A 3JBG1 4BPZA 4BLJA 3CQOA 4FFGA 2RS52 2VOTA 4WVZA 5C8CA 1QJY2 1SQ4A 1CAVB 1KEXA 3CKHA 3VBUA 5A1FA 3UETA 2QQNA 1OPMA 4XFCA 1VBA2 4FXGB 4O61A 3C8XA 4OMCA 4GH4C 1NCRC 2RM21 4PDWA 4CDXA 3PDQA 1SLBA 4RR3A 1Z7S3 5HCBA 3VBHA 2VQ0A 4NPMA 4YW7A 5L7OB 4BZ4A 1D2QA 2DWRA 4ES9A 1W6OB 2J1EA 1UX6A 3F95A 3QD6A 2XJPA 3N9QA 5FXVA 1X82A 3NJXA 2GNTA 4MGTA 3MIDA 3CLPA 3U78A 1LKNA 1HRI2 2B8MA 3I3DA 3NNJA 4QKDA 3NJZA 3SKVA 3VKFC 3KCXA 1FOD3 3OY8B 4ZHNA 4Q8LA 4XAAA 4DINB 1DDLA 4LHKA 3LPGA 5H9QA 4HKOA 1CZSA 3OYWB 2IVIB 3A22A 5CIRA 4LKEA 1OXCA 4TLFA 5FMDA 3ZSLA 2ARCA 5J36A 3AMQA 3NL1A 1JYTA 2AGSA 2A3XA 3Q8EA 1WD3A 4QM8A 4WM7B 2HLEA 4R9DA 4QXCA 5LA2A 3VZKA 5C9AB 1RXFA 3WQ0A 1QWRA 3A0NA 1V00A 1XRUA 4Y5Z0 5FIXA 5IJRA 3ZYIB 3BIEA 1XYOA 1AYN2 1H4GA 1YQ8A 3RMXA 1GU3A 3WP5A 3AKSA 1S0CA 1YRZA 4HK8A 5FKCA 4QB1A 2DURA 1QJX2 4PHZA 4QB2A 4GKYA 4F8AA 5LY2A 5L7OC 3V0AB 3DGTA 2QNKA 4XQDA 3IIIA 1RUF3 2R7EB 3Q8AA 3WF2A 4BXFA 2VUAA 2JIJA 1ZNPA 3KSCA 1MS1A 2Y6FA 4QU2A 1JYWA 4IE4A 4XF9A 1H2MA 1UU6A 3ACIA 3E6BA 2PA7A 2A3YA 2XBO2 1QDCA 2NQYA 2R041 2XONA 3H8XA 1O7FA 2VNRA 5DUWA 3SNMA 3JZVA 3PVOA 4PBPA 2WNVA 5IVYA 4QX3A 4B4QA 1CX4A 4FTBA 2V4AA 1JYNA 5IVBA 3M3IA 4AW7A 4WM7C 2UWAA 1RUD3 5FP8A 5C70A 4XPVA 5C9AC 1MEC1 2BVBA 4Z8BA 3MI8A 4ZY9A 1D4M2 1TG7A 5FQ0A 1PO13 3D5OA 1RMU2 4XTPA 4XC9A 2HWB3 5CG9A 3AP5A 4H7MA 2VCAA 4LT5A 2D6PA 1HKDA 1JZ3A 2W91A 1DQ4A 1UZWA 2A6VA 4ARXA 4GALA 1WLDA 4LBQB 1LGNA 4LR4A 5B4NA 3BKZA 2QZ3A 1DQ6A 5FUNA 3S5QA 1DIWA 1CAUA 4M4RA 4ATFA 2YU1A 2OA2A 4OI2A 4XCAA 3ZXEA 4HN0A 1YQ5A 3P3NA 4X6QB 1OQEA 3ZFFB 1OD3A 2UYAA 1DBNA 1JZ7A 4JDNA 4AVVA 1ZZBA 4H2AA 2GMEA 3USUA 4YZ1A 3LE0A 2YFUA 1W9YA 4P5HA 3ZFGA 1OT5A 1TME2 5E88A 5FFOC 1UL9A 2KR2A 4ZS2A 2XLFA 2W1QA 2YMZA 4Q4W2 1H8VA 4UYBA 4D69A 1DQ2A 4E4ZA 5FY1A 1AHSA 4WZCA 3MIGA 4KWJA 3ZN6A 2QZ2A 4ZKTB 4LBKA 1T2XA 1AXKA 1W8FA 3D0SA 3IBMA 4BA6A 4EE2A 4QPWA 1RL3A 4YVSB 2BGOA 3CL1A 5A3NA 4NRMA 4AEJA 3RI8A 2RS31 2OQ6A 3MZHA 1PVC2 4HG6B 1S1AA 4AGRA 4QPIA 4D7SA 2A5ZA 4MXVA 3MV11 3SHRA 1MZ5A 4EN9B 1DCSA 1HRV1 1QH7A 2BOIA 2RR13 1IHMA 1STMA 2O8OA 3LF7A 3OJBA 3K4AA 4NHXA 1I5ZA 2EIBA 4AVCA 4W65A 5FY5A 4YG6A 1N3PA 2XH6A 1PMIA 5K0UB 4Y4RA 1XC6A 1VRH1 3ZYJB 3GZUC 4CP0A 1AL23 3NAPB 3RMYA 4LK7A 1N1YA 2P3KA 3ZSEA 3CNAA 5EJ1B 3H3LA 3ZFFC 4D3WA 2FMDA 4EV0A 3HN1A 1N47A 1RITA 2R30A 1MQTA 2VMIA 2DU0A 4IEXA 4JKMA 4XF1A 4YGCA 3WCSA 5LA0A 3VBRB 2EAAA 3H1YA 1BBT3 3ECQA 3E6CC 3LFIA 3FX3A 3Q8FA 5CYYA 3KHBA 3T4VA 4QQ2A 1WCUA 2Z2SB 4ATEA 1GZ9A 1GSLA 2GC2A 4LO6B 2E7QA 3MPPG 4AFDA 2WN2A 1UMIA 1FV2A 2MEV1 4LQRA 3SLIA 3TN92 3I2FA 3DL3A 3J8F1 4AI0A 4RQPB 2WWUA 4AG4A 2EXJA 4YVSC 2OT7A 1VBC1 3IAQA 1HW5A 2YB7A 4Q1RA 2XHNA 5F3GA 2WZR2 2SLIA 3N3HA 2DBIA 3INAA 4I01A 2RJKA 3ALQA 2WINB 5T52A 1X7NA 5JWPA 4LPLA 2DBNA 4COYA 2ATFA 4GQ7A 4NWWA 5FZOA 1ULCA 1JOJA 1WZXA 3K51A 5FLIA 1OOPB 5I8SA 1MR5A 2RHPA 4TSVA 2PHTA 3NAPC 3UJQA 1J3QA 4QX0A 3ACGA 2VZSA 4LIUA 4K40A 4LE4A 1JOPA 1MZ6A 1JYIA 3NV3A 2XL9A 3U11A 1EV12 3UNPA 3VBRC 4Y22B 5EIYB 1REDA 1KXGA 2QQIA 2ZOEB 1CAWA 4IEPA 2EIGA 4N9HA 5FZKA 1DGWA 1WKYA 3LAGA 4A6OA 4AEMA 1PO22 1AR63 3VDBA 1YHFA 3CBNA 4QPGA 2J1TA 4HONA 1GZTA 2CYFA 2HYXA 2OUHA 3W9AA 1FMD1 1BQPA 2DFCA 4RQPC 2Y34A 4YGDA 2V09A 5HBAA 5ACA2 4JTNA 3G6JB 3AFKA 1LJ7A 2QQMA 4RN5A 5FLHA 4FPKA 3VBUB 3VD9A 2B45X 2GZWA 4XMIA 4UF0A 4CDXB 5I0UA 2WS92 2HWC1 4FOYA 4RR3B 3WG4A 1Z78A 1OOPC 3T0BA 1DHKB 1Q5OA 3FUOA 3N9NA 4DNYA 1EAH2 5JSRA 1W9TA 1A6CA 3ELNA 3WQ1A 4B3NA 4NE9A 3UV9A 3LSDA 3OUIA 4FI9A 3E97A 3AVRA 3VL8A 5J7MA 5JOWA 4V2WA 4LBLA 4E2SA 3B02A 3VZNA 2Y60A 2R1BA 1Q3EA 4QX8A 3ZPOA 5A3LA 3ON7A 1W6MA 5L9RA 3HN3A 3ME2A 2I2SA 3C7GA 3H1MA 3I59A 3OCPA 3I2HA 5LRRA 1RUI2 2JD9A 3ITQA 4ZPIA 5B4XA 1UY2A 2IXIA 3GGLA 3AC0A 1OA3A 4Q1PA 3D0JA 2ZGQA 4R9BA 1CGPA 3ILRA 5FMOL 4LKFA 1VMHA 2AEZA 1SCSA 3ZVXA 4EN0A 2JWPA 4E8CA 3WNLA 4B8EA 1BLZA 1YC61 2BNMA 2RS53 1PMJX 1UOFA 1QJY3 4WZFA 4LJHA 3VBUC 2DU1A 3WCRA 4G3YC 1BHGA 4Y24A 5A32A 3MGUA 5JOYA 4PLMA 1FPN1 2YU2A 4CDXC 4N53B 4P9YA 4QMAA 4RR3C 3TNQA 1RUC1 1E5HA 3DECA 5LBCA 3RZKA 4LA3A 1URXA 1VBE2 4TXWA 1ND2A 1EUUA 5GKAC 4W6YA 2P3JA 2AEYA 1REFA 2ZHLA 1DG6A 1XJAA 2QVSB 3OBTA 3D8CA 1S0EA 1HRI3 4FPHA 4CZSA 1WA6X 3T2TA 2CU5A 2B9VA 4L99A 3G7DA 5KR7A 4J1WA 4Y33A 3AVSA 5FZAA 2UURA 3T3YA 1UXZA 4D6SA 1HX6A 3AKQA 3AXEA 2TBVA 3OB8A 3LOIA 4W6WA 1ZZ7A 2BGCA 2FHRA 2WNVB 3NQHA 2VCCA 1F9KA 1V6JA 5IYYA 4NO4A 2VQAA 4UFMA 2GNDA 3PUIA 2PAKA 1GBGA 4FFHA 4XCBA 5C3OA 1ZRFA 4LORA 5FQ0B 4AWDA 4LO7A 3K77A 1AYN3 2VM9A 3LQCA 4N53C 5EQUA 2YC0A 4NUBA 4UOJA 4PT6A 3UYJA 1C57A 5J09A 3GZEA 1SZBA 4A3XA 1QGLA 4NHKA 4Q0VA 1CAUB 4QQLA 5F7UA 1X9PA 2G1MA 2KA3A 2W1WA 3MV01 4LHNA 5K8SA 1YFXA 1WBLA 4LBOA 4P00B 1POV1 4QHZA 4XF4A 4YW3A 5H9SA 1LGCA 3HT2A 5LCWL 2JDNA 3USUB 1W6QB 4IEZA 1ZX5A 1WGPA 3ZFGB 2G19A 1RHI1 2ORXA 2Y33A 1AL0G 1D7PM 4DEVA 2XBO3 3BOPA 1XE0A 1W0NA 2VZOA 3BU7A 3LD8A 1R64A 3K75B 4NR1A 4QXHA 2GNBA 3SQOA 2WNVC 2VMFA 5CADA 4XFAA 5EYYA 3A0KA 4IE7A 2C9AA 3GYDA 2Z5WA 4MVTA 3ZKYA 2VVEA 4RFT0 4UW3A 1NCQA 3NJYA 1RMU3 4QPIB 3LEIA 2BP6A 1XNAA 2DVDA 5JOZA 4HZFA 1ACCA 2LRPA 5I0RA 3WW1A 4QGNA 5ERLA 1LHUA 4Q0UA 2ZA9A 1WMFA 2IVJA 2LALA 3R0RA 3PNAA 1W2UA 4HSJA 2ZZQA 1OF3A 1O4YA 1H2LA 2W1SA 2QJVA 2EIDA 4OCTA 2B39A 4JKKA 1H6XA 4UW5A 2HWF1 1MQTB 2D3RA 1ULFA 5GLZA 4JCKA 2X05A 1O3TA 4HK9A 2YDEA 3CO2A 1EY2A 3ZFGC 1R1A2 1IQDC 3RI9A 5DABA 1TME3 3D6EA 3HAGA 3ZYFA 4GXLA 2D97A 2QFEA 1LB2A 2YZ4A 4OHYA 1UO9A 5T54A 4P08A 4Q0SA 4CPBD 3AJYA 1S2EA 4LBQD 2UYBA 3IT8A 2BTVC 3V65A 5A6YA 4ONUA 3O7OA 5AVAA 4MGYE 5DDJ1 4E2GA 2RDQA 2LW8A 2E9QA 1UWWA 2PTMA 3HBKA 4COWA 2YBKA 4RGAA 1PVC3 4BISA 2JDHA 2R49A 4YM0A 4QPIC 1K5JA 2WNUA 4D94A 5CFCA 4NVPA 1R091 5FYHA 1W2TA 4OQ8A 4NIGA 1L7LA 3SH5A 2WLQA 5FZOB 1BEV1 2JG9B 4KI5M 4BH9A 2JD4A 4OLLA 1FX5A 5KWRA 3M3EA 5AC93 2YGMA 1V6IA 3N7LA 3NV2A 4UFKA 1AX0A 1MQTC 3J9SA 1YNAA 2ERFA 4EQVA 4HT1T 4IV1A 2FDKA 5CKNA 1XE8A 3CJIA 5JSOA 3BTYA 2WUHA 1CAWB 4AFBA 1GP5A 2YG0A 2KM2A 4E8DA 3JBG2 3C7HA 2ZX0A 2JDKA 1V9U3 1R081 2DCYA 3V64A 4QPGB 2WT1A 2Y26A 4PLNA 1LRHA 1WW4A 3TN93 2HJIA 3DEMA 4KBZA 1ODMA 5FYVA 2RS11 4NIAA 4M00A 3VDCA 2XJSA 5D1IA 3N9LA 2J1AA 2DUQA 3MW2A 4KG8A 1AXYA 3GCWA 3WNNA 5J3UA 5FZEA 3UGFA 4CRQA 2WZR3 1UZVA 5EHDA 1US2A 2NLRA 2HWE1 4R52A 1YYNA 1W06A 2HEWF 3LEKA 3KGZA 3WDUA 4CEWA 1GQPA 1MZEA 3PMEA 1FNZA 1S0BA 2JG9C 4AHZA 2WDBA 3DXTA 2NM1A 5A6ZA 2PHRA 4F7ZA 1YQ6A 5JR7B 4CU9A 4L97A 3NNLA 5CFDA 3BI3A 1ONAA 2PHUA 1KJRA 3D3AA 2R061 3HBZA 3B9IA 1N1SA 5TSWA 1QJU1 1EV13 4B29A 1GV9A 1XQNA 4DUXA 1OKQA 4NPLA 1UZZA 5GZDA 2VC9A 1W6MB 3I97A 1WCKA 4RSUA 3JD71 5FYTA 2VECA 3I59B 1PO23 4AVTA 1ZBA1 3IB3A 1VBD3 3AZYA 1XU2A 1OVSA 4MOAA 1LCLA 4QPGC 1X9TA 3TAYA 4BMEA 4XJWA 5DAQA 3OSDA 3DKWA 1DQ0A 3I2KA 1VAVA 2P3IA 4MSVA 2XUEA 1CAXA 4MGIE 1SFYA 4FXKB 4AEKA 3I2JA 5ACA3 2BEOA 1NE4A 2YPJA 5FO7B 2D6NA 2RDSA 2RMU2 4XQ4A 4GB31 5D21A 5JXHA 4N7IA 1LEMA 4IESA 2IUWA 5J98B 3WOGA 1V6MA 5A32B 4LKSA 3WF0A 1TNFA 1GZWB 2AR6A 3EBRA 3VZMA 3FL7A 5DAVA 2WS93 1G9AA 5C71A 2BFUL 4ZZ8A 2YBSA 2XJTA 3ATGA 1AR91 4S2GA 1ND2B 4PQ9A 4XDOA 1UN1A 3ZO0B 5C3QA 3M7AA 4J6GA 4NIHA 5A3WA 4I2OA 3LIGA 2VNOA 4IE6A 5LB6A 4OQ9A 2A71A 4FSJA 3WNXA 4COVA 2R042 1KS5A 4RA0A 5KXEA 1UQXA 4K9SA 5IVCA 2GH2A 2E26A 2XJQA 5JI7A 4AR2A 1C8M1 3KHCA 2IFWA 3BTAA 1SLCA 5F9TA 1QQP3 5A7WA 4W6XA 4AQ2A 1CONA 2C4XA 4Z1VA 1PX3A 1RUI3 5BNQA 3FLPA 5BY5A 5LWBA 1RVF2 1NA1A 2VCBA 2GU9A 1GUIA 3A23A 3SXWA 3DV8A 1NQDA 1B35A 1VBB1 5CNAA 3ORJA 1JHNA 4GMP1 2ZTNA 3U37A 1KDMA 4M3CF 5A33B 5T50A 1RUE1 2V5DA 1UNBA 4DXTA 4DXZA 1SLLA 3MUY1 3Q8BA 4IDZA 3B69A 2WZPP 3RJ2X 2VOXA 2C9KA 2W5FA 1AR82 1UOJA 3VKOA 2D93A 3WY6A 2JB8A 5FZ8A 4BE3A 1TNRA 1VBE3 2P6HA 4EWDA 1ND2C 2VJXA 2ILMA 1WMEA 2FBEA 2YC4A 3I2DA 3Q8CA 4AE2A 3WDYA 1SBDA 2O0OA 4PCRA 2QQWA 5FZ7A 2W08A 2YFZA 1IS6A 2W0XA 1AUYA 1CJDA 5DUUA 4YWAA 1J3PA 4JC1A 2UY9A 3KQRA 4B1MA 3ZYGA 2WO1A 3OGJA 2GSYA 2XL7A 4OHZA 5IHRA 2X8KA 4LXLA 5FUIA 1UY4A 4U36A 3NNMA 1OI6A 2BV4A 4UW6A 4C8DA 3RZLA 3NRUA 1HRV2 1WLWA 4LBMA 2N7GA 3FWEA 4OHXA 3ABZA 3PUSA 1XYNA 1IGOA 1OLQA 1VJ2A 4JQRA 5FR3A 4CDUA 4ORFA 1UMZA 2BWAA 1GP4A 1H6YA 1HN0A 2C26A 1ODNA 3C2UA 5LBFA 3TOJA 5GZGA 3KCCA 4YFZA 4UFHA 2ZEXA 1ULPA 1Z7S1 4D7YA 2FDJA 1DGWX 3KS7A 2BYVE 2PLV3 2PQSA 3UL2A 1UXXX 3VBOA 2A7AA 3ACFA 3H50A 5JSPA 5E8AA 4AFAA 2VW2A 2MEV2 2QQVA 1DZQA 3J7MA 3N35A 1V0AA 5KXBA 4CCDA 2Z69A 1FT9A 3S6PA 3ZX7A 3AKPA 4A7ZA 3ACHA 1D0HA 3B93A 3R4SA 3PURA 2WKKA 1Y7BA 5APAA 2W47A 1FOD1 1LOCA 3WF4A 5A3TA 1XE7A 4NRQA 2ARBA 4GA9A 1YXWA 2YC2A 1ZA7A 2I45A 3U1XA 1K3IA 4Y1YA 2W92A 5B2GB 4KG0A 5IVJA 1U5ZA 3BB6A 4GWMA 4CUBA 4Y20B 3W5MA 2WNUB 2K2SA 4D6RA 3BCWA 5CFCB 1H9PA 1QHDA 1OBNA 3PU8A 4FPGA 3LPFA 1QOTA 4I3GA 3KCYA 5LZ6A 1F2NA 4P14A 3AZXA 4RS5A 4XQWA 4KNCA 3ZIWA 1PIV3 4CSWA 4YARA 1KFUL 4Y5TA 1RUF1 1IZ3A 2Q4SA 2WA4A 3DN7A 4H14A 5F39A 3SCHA 4ITCA 4XZPA 1UKRA 2WC2A 3CJIB 5EZWA 2B9UA 3MPBA 1JBCA 4JRLA 1R1A3 1FMD2 4Q0PA 2VZPA 5T55A 1FNYA 4Q5OA 2P1BA 3MIFA 3WNPA 5HV0A 1TQ5A 3POYA 4BB3A 1SFNA 5FY7A 5I0TA 4KBBA 5DUXA 4OFGA 3HQXA 2GC0A 5CVRA 1Y4WA 5FO9B 3I3MA 2VTXJ 1W8HA 1JW6A 2OZ6A 4W8JA 3ZM8A 1N1VA 2EAKA 5LBEA 1CZVA 2X10A 2BNOA 4PIZA 1FXZA 3O1TA 4JHZA 2F4PA 5JZGA 5HCFA 5FDBA 1RUD1 1RTVA 1W8NA 2WNUC 2ZZJA 4CDQA 1W8OA 5CFCC 4YM1A 4CP9A 1O3SA 3OBAA 2Q8EA 1PO11 4CEWB 3K3OA 5EYXA 2VMHA 4HPKA 4IE5A 4ZZ5A 2HWB1 1GLHA 1GOGA 1DP0A 2D5FA 1C5HA 1VMJA 1YJLA 3BGAA 4N43A 4UWDA 5FYSA 3WQBA 5C4WB 2DFBA 2GAUA 4QB6A 1H8TA 2GC3A 1OH4A 2YV8A 2XJVA 3MLJA 3NMBA 5CFDB 3ZYPA 1S4CA 1LHNA 3N4MA 4NHYA 5T3NA 1W6NA 3LGRA 1SLAA 1RINA 2P4EA 2IZWA 3CJIC 3POSA 5L36A 2C24A 1UY0A 4AFCA 4I0AA 1VLNA 1AJOA 3MICA 2JDYA 1UY1A 1OA4A 3APBA 2JJ6A 1UD1A 4TLGA 4DS0A 1HXS2 1S0IA 1J84A 4BQYA 5F37A 1YFYA 3AYAA 3NKGA 4PLOA 2V5YA 3WINE 1POV0 1A34A 1G7YA 1R1ZA 4KU7A 5FPBA 5FO8B 1FPN2 2H0BA 1HQNA 1QDOA 1YI9A 4XUTA 4CCKA 3FFZA 3R4UA 4CEYA 5LW9A 3LFMA 3ZYHA 4M3CA 2ZS6B 3UGGA 4ZXEA 3PUQA 3ZXFA 4Y4YA 1MS0A 4CEWC 3ZXLA 4URTA 3M3QA 1DYOA 1M4WA 1ULEA 5C4WC 3VN4A 2ADDA 3KF5A 1ZZ6A 4AHXA 5A3UA 5BV6A 2G9FA 2J7MA 3KZ4C 5CFDC 4XMAA 3P3PA 1I1EA 1PGSA 3KT1A 4Q4V1 3B5LB 5A3OA 4Q4X2 1V6LA 2OZJA 1AL21 2Y8KA 3PTRB 4JV4A 5FK8A 1W8WA 5L73A 3AYCA 4DRRA 4YGEA 4A4AA 1F15A 3CDZB 4PIXA 2XVKA 4LHSA 3AZVA 5LRSA 2P5BA 3IDAA 2VULA 5A7WB 3RGBA 4YZ5A 4YFWA 3QH7A 2XG3A 3MFAA 2HBTA 5IAVA 4TN7A 1GWMA 1H9WA 1E5IA 3P5BA 4MUVA 3PMSA 1WA4A 2Y0OA 5DXDA 4QM9A 1B35B 2XUMA 1O59A 1O91A 4FFIA 3FFQA 2R073 4OI1A 1RUOA 1H30A 4GKXA 1OHFA 2GN7A 4INDA 1W9SA 5F1RA 1XNKA 2RMU3 1RUJ2 1YCIA 5FZHA 3IDEA 1F5FA 2PFWA 5HPOA 1PM7A 3CEWA 4YG3A 3MO4A 3VUOA 3IDBB 1QOOA 5C33A 3FBMA 2WABA 4I3PA 1BYHA 1IKQA 1MS8A 3ZPYA 4M01A 4AI1A 3MW3A 1W28A 1EPWA 1ULDA 2DVFA 3CZUA 5CG8A 3P1IA 3FHIB 4R9AA 1S2BA 3I8TA 1NT0A 1WLTA 1XSRA 3GZAA 4HBNA 4QX2A 2GALA 3O0VA 5GZEA 5E16A 1LU1A 4UXAA 4OHWA 4XACA 2A1XA 4PIYA 3FLRA 1DGLA 2O14A 4XJ8A 5JXIA 4RHV2 2GMPA 4HVQA 1OA2A 3PJYA 4ZXKA 5LBBA 4KH9A 4RD7A 3VHOA 1RVF3 4CXWA 4EZ4A 3UJOA 4AGVA 4JDMA 1TE1B 2ORZA 5FV3A 1L7RA 5FYBA 4E4DX 1XNBA 1B35C 4YSFA 2Z42A 4FPOB 2WZ8A 1JU4A 2D6MA 3MIBA 4YGBA 4DY5A 4EROA 1KGYA 2XPJA 2PAMA 2EXIA 2WYSA 4CE8A 2RDNA 3PJQA 3LEGA 2W95A 4CDUB 3NO8A 2CGOA 1AR83 4XJZA 2HBUA 4FQ4A 4LTAA 3ZN5A 4PF1A 5FXZA 2VZVA 1LU2A 3W21A 2ZEZA 3E5UA 2HEVF 3IKWA 1RUG2 5FYIA 3VBOB 4H7LA 2X09A 2XKOA 1XYPA 2CNAA 5GJ6A 4QQHA 2VR4A 4XBQA 5C5UA 5F32A 3SEPA 3D82A 3RSJA 1DLCA 1NY71 4S2DA 4YRDA 5E6HA 5GALA 4K8RB 1YIFA 5JPMB 1HQWA 1BMV1 5F3IA 2TNFA 4JQTA 2E51A 2ZX2A 1WUVA 1GWKA 1K5MA 4P02B 4OUSA 5BNPB 3RZMA 3LDRA 3AK0A 2TUNA 2YHJA 4Z82A 5EXOA 3VBFB 1YFWA 5FWJA 4OI4A 2R6QA 3GHMA 5FPZA 3T30A 4BQXA 2WN3A 1GR3A 1OLMA 4KWKA 4A44A 1BEV2 4GJYA 4R4ZA 3K46A 3DKQA 5JVVA 4B1LA 4P9IA 1G86A 2RS51 1YWKA 1QJY1 2H6CA 1RC6A 4M0HA 4XXPA 5C8CB 1PZ7A 2AREA 3PUHA 2WQ8A 4OMDA 4CDUC 5F3CA 2XLGA 3EB7A 4Q0QA 4Y26A 5EJ3A 3AP6A 1W04A 1T6BX 3K2OA 5H9RA 2XR4A 4PDWB 4LMFA 5FJHA 4RS5B 1ZRDA 4R8HA 1AR72 1JS9A 5H9PA 1V6KA 3VBOC 1MS5A 5A7NA 3VBHB 4YNIA 3AP9A 1R082 2E32A 2Q5TA 3OPZA 5F8PA 5T5JA 4BLIA 4DRVA 1AVBA 5C3SA 5FPUA 4P9JA 1WWYA 2RS12 3LB9A 3QCWA 4LLFA 4B4PA 1HN1A 3NW4A 4OVEA 3IPVA 1NLRA 1COV2 1XU1A 1B09A 2DDUA 4ZU5A 3OEBA 2IFRA 1O5LA 2E7AA 2VMGA 4GWNA 5F2SA 5FZ6A 1WW6A 3DYOA 2Q30A 3AMMA 3MLLA 3VBFC 4C1XA 2BBVA 1QMJA 3HNBM 3KB5A 1RUNA 2VXRA 4GJZA 3SH3A 3T1LA 4L11A 3MF6A 5JZGB 3ZMNA 3POBA 1XNDA 4XF3A 3WW2A 2YROA 5LA1A 4XFBA 1MACA 2OYZA 2ZXQA 1W03A 3TEXA 5C8CC 1ZBE2 1N1TA 1YQ2A 3ES1A 4QAWA 1A8DA 1NLSA 4ES8A 1KITA 4HPKB 1AYN1 2R062 2XMLA 5HI0A 4N43B 2VMCA 2YBPA 4PDWC 4AOCA 4GMP0 4MHRA 1H8TB 1VBA3 4RS5C 1JZ2A 3K3NA 2VGDA 1OUXA 3AZZA 1RUH2 2ZJCA 2ZX4A 4I09A 4UBGA 3AKRA 3WV6A 4FAHA 3VBHC 1KS4A 1EYBA 1ZBA2 2Y6GA 2NMNA 2ZCWA 3WXPA 4V1PA 2NYYA 4CCEA 1AYM1 2EALA 4K21A 4BQ3A 4E27A 3E5XA 1FMD3 1AZDA 2K9ZA 3M3CA 3I4IA 5FZ9A 4MV2A 1SHWB 4XDQA 1DGRN 4YM2A 4COUA 2ZGOA 2ZHMA 3JB4C 4NRPA 1UAIA 1HB4A 5KC6A 1J58A 4YW6A 2G4IA 1O8PA 4GB32 2XBO1 3ZYBA 2ZGUA 2C6SA 2CL2A 4LKDA 2VMEA 3FE5A 3H7YA 4NHLA 4XEZA 5DPNA 5FCCA 1VR3A 4OI0A 3HNMA 4XXAA 3GNEA 5GLTA 3U4XA 3MUZ1 5JZGC 4O7XA 1KRIA 1SBFA 4CEYB 2PHXA 1REEA 4YZ2A 4M3CB 1VALA 3WSOA 3RZGA 3THCA 1AR92 4CP1A 2IXCA 1SPPA 2JE9A 2ZX1A 4KL1A 4MXWA 5FZ3A 2ZGLA 1G9DA 3FUQA 1PNFA 1OKOA 1RMU1 1FV3A 2E7TA 2WA3A 4Y5SA 3DYPA 4N43C 4CUGA 2WO3A 2EIEA 2F17A 3ZYRA 1H8TC 1VAMA 1C8M2 2DCKA 2W94A 2CTVA 2W9XA 2Y6KA 3ZSJA 1QJX3 3PTYA 5GZFA 4BCUA 5L9BA 4BQ5A 4I0BA 4M0NA 4HN1A 5DAPA 2YUEA 2GH8A 5F6LB 3OUJA 1XOYA 4AXOA 3W5NA 5DQ0A 4OULA 3U75A 2ZGRA 2OKXA 1GICA 1I9RA 4MGQA 2QQJA 4HVRA 3SCGA 4GULA 1HXS3 1TME1 2D6KA 1RUE2 4MGSA 3THTA 5FZ4A 1E5RA 3HEIA 3E6DA 2HWD2 5LASA 4FVVA 4D0QA 4W4ZA 2PELA 4C91A 1LHWA 2DTYA 4EYUA 3VKLA 1Z0HA 5G04L 1FI2A 4TZDA 1O5UA 4Q4Y2 4DQAA 1TMF2 4CEYC 5L19A 1JH5A 1GFF2 4OUEA 3ZN6B 4N9IA 2CWMA 3U10A 4B7EA 2AYHA 4IEVA 2GMMA 3O1PA 5I93A 2ZBJA 4KWUA 4KU8A 1I3HA 4QXKA 1LOGA 2ETEA 1PVC1 3Q9OA 1D4M3 3RYKA 4AL9A 2EICA 5FAXA 3LDKA 4WV8A 5FPVA 5FZDA 1T6GC 5AC91 5BNNA 2C5DA 1EPZA 4Q4X3 3LA2A 3ZXAC 4NAOA 4YVWA 4JHTA 2WFF2 4RL7A 5FP3A 4R9CA 3SISA 3H8OA 5KXDA 3H9AA 2LROA 3TNPB 2OW4A 4S2HA 1PZ9A 2XJUA 2LS6A 4WVMA 1X8MA 4L92A 3EHKA 4CCCA 5HXMA 3VD4A 3FBYA 3ZDVA 3OGSA 2P34A 1V9U1 3L9JT 4KQ7A 3WZ1A 1V6NA 5FYCA 1JMUB 1ASJ2 3WG3A 3TN91 4Q4W3 3TEWA 1PGW1 4Z2WA 4QX1A 1GOHA 2VNVA 1HV0A 5D2AA 1RUJ3 1OLRA 1DYKA 3O1OA 5IT6A 2UY8A 4CCOA 1UYPA 4FAGA 2WZR1 3ACLA 4SLIA 5EFUA 1D0GA 4QQPA 3NNGA 1LESA 3BYWA 3UKVA 2QCSB 3VLBB 2DTWA 5F5AA 3M2MA 5GLWA 1OD5A 2VY0A 3P6BA 1X50A 4CUCA 5JLVA 3I3QA 3KF3A 1ZYBA 1CIYA 4K7JA 2K46A 1H0BA 4NROA 1W6PA 4QWNA 5LATA 1IQAA 4RGGA 3RNSA 1QY4A 2DVGA 2VTXA 3UESA 5BNOA 1MS3A 1K12A 2V73A 3GXUA 1C8NA 1LHVA 1F4AA 1JZ5A 2HEYF 4FO9A 4RHV3 5F2WA 3BUCA 3T08A 2VAUA 3IIAA 4UFJA 2QUOA 1NAEA 1NE6A 5FYZA 1RYYA 1K5MB 2MNGA 4YYOA 1PO21 2VL4A 4NIDA 1VBD1 3WT3A 4XDPA 2Y38A 3WDWA 1YEWA 1IS4A 2BVVA 1S0DA 4ZS3A 3SITA 1O3RA 1DFQA 3RYRA 3H7JA 3H3UA 4XOGA 3J7HA 3OG2A 4NAMA 3ZXJA 3PHMA 5ACA1 2ZGTA 4BYYA 4QU1A 2RM22 3I7DA 2A6XA 4CU6A 5M0TA 3AMNA 3VV1A 5IK8A 4OHVA 1AX2A 5A6XA 1SCRA 1W6OA 1IG0A 2ET1A 4UF0B 4AHWA 4Y1ZA 2YXSA 2D3SA 4ET7A 2WS91 3VHRA 4ZU7A 3WDXA 3PIGA 3C7OA 3LEMA 1HDKA 4FP3A 1K45A 2F4LA 4CTEA 3W59A 1RUG3 2ZAHA 1POQA 2ARAA 2EA7A 2A75A 4M3CE 4IW3A 4P9XA 2W68A 4XBLA 1KJLA 2WAAA 2X5IA 1OFNA 1WLCA 4LITA 3CIHA 1ZRCA 5LA9A 1YUDA 5IAXA 2ET7A 3IPVB 4KMQA 4XUPA 1K5MC 1PHMA 1O8SA 1QQP1 5FKBA 4MH0E 2MPFA 1RGSA 4K1ZA 3FZ3A 1RUI1 4XJ9A 2WWJA 1VB2A 2NN8A 3C3VA 4XFHA 4NHMA 4NWVA 3B01A 4AQTA 2HWB2 1QH6A 1BEV3 5BNPA 3QLQA 1H1MA 1DF0A 5JIAA 4BIFA 4HFSA 5BUVA 2WRAA 2DUPA 4AHYA 2ZPXA 4XTMA 3V0AA 2QQUA 2O1QA 1L3JA 4J1XA 1Q8QA 1DQ1A 5E1RA 1H2KA 3U14A 3WW3A 1JYCA 1NZIA 2C0ZA 1AR73 1XB9A 3RDIA 5JXJA 1IS5A 2VOWA 4QT6A 1VBE1 5FBZA 2PAEA 2RG4A 4CCJA 4LIVA 1W0PA 1EAH3 2BDRA 3CJXA 3HJRA 2CDOA 5LEKA 1C4RA 1HB3A 1U5IA 2OX0A 5J1XA 2WQZC 1W2OA 3N36A 2IXHA 4NJ4A 2FZ2A 4Q26A 3WP4A 1VPHA 4BK4A 5IK4A 3AZWA 3M4FA 3E5QA 3AP7A 5T5OA 2W87A 4DXSA 1COV3 1A8MA 5FY9A 4YG0A 2KXLA 2ZGMA 2RJ2A 2VOKA 3VD7A 5L7OA 2PN5A 3S0MA 1ZVFA 2A6ZA 2BOJA 3U07A 3HOBA 1JXNA 2QQPA 1AF9A 1CZTA 2AC1A 2QBXA 2XB6C 3JXSA 1MEC2 3THPA 2RJLA 4BHPA 1Y9MA 3BIWE 5ISLA 4YM3A 2MHFA 1CESA 1GANA 5A7SA 2NMOA 1KDKA 3WD5A 4C0HA 1SPPB 1JU3A 4MXWB
chains in the Genus database with same CATH topology
4QHBA 1LOFA 1ZBE3 4Q4V2 2WWSA 3L2YA 1DZRA 4P9GA 1C1LA 3ENRA 4BM8A 3WUDA 4O9GA 5IK7A 4BIOA 3IMNA 2XLAA 2VNGA 3O0XA 3H0OA 4Q29A 1RUH3 5KHKA 3O5SA 4OZXA 3GBGA 2JX9A 2LUWA 1ZBA3 3UK9A 1UU4A 2PLV1 2IC1A 1LECA 1S0GA 3NKTA 4MLOA 2A73B 4AEDA 4MYEA 1AJKA 2X29A 3MLKA 4HL0A 1U5XA 5DG1A 3ES4A 1MVEA 2GC1A 1BKZA 2RS32 2ZGSA 2CGNA 3QBQA 3WQ7A 3BODA 1KQRA 1X36A 4HLTA 3VHPA 4C1WA 3CF6E 4Q8KA 3IWZA 2LM3A 4FOVA 3KM5A 5EWSA 5K0UA 2WT0A 1NCQB 1VRH2 4EWAA 1LENA 2QKDA 2Q1MA 4FPCA 2DYCA 5BNNB 1MVQA 1LULA 4YVWB 3MEPA 1PIV1 2I74A 5FLJA 1ENQA 4XIKA 2WQ4A 4FCAA 4NPRA 4UBHA 4BWOA 1Y3TA 4WVMB 3WLUA 4AVAA 4LBNA 5CBLA 5K9YA 1R1A1 4FTSA 5AFBA 3GBWA 3VKMA 1Y43B 3J8F2 1PVXA 2HWD3 3EO6A 1VBC2 2VVDA 3AB0A 2Q0AA 1F5JA 3M1HA 4Q4Y3 2D40A 1FATA 1TMF3 1G9FA 3MIEA 2B5HA 1OFSA 1CN1A 2IXKA 1UPSA 4Q27A 2H0VA 1KFXL 2VOVA 1ZA4A 1NCQC 3OBRA 3IDCB 4HKLA 4HKWA 5J48A 1QXRA 4YZ4A 4FBFA 5BNNC 2VW0A 4WBBA 4Y22A 1BMV2 2OPKA 3USSA 3R4DB 4YVWC 2JDZA 1NZCA 2CV6A 1JN2P 1W6PB 2WFF3 5BNOB 2EXHA 1ENRA 1ZZ8A 3DPRA 3SCFA 5KXCA 4IV1B 3OD4A 5SV5A 1NG0A 5AFEA 5GZCA 4MGKE 3ZMOA 1SLTA 1O4ZA 5I8YA 1ASJ3 1ZM1A 4TWTA 2ZX3A 3N7KA 2CGPA 2XWJB 4YW1A 4E2QA 4XBNA 4JGZA 2HWC2 2ZGPA 1S0FA 3POWA 4JDOA 5GM0A 2TEPA 3RJRA 4NOTA 2IXLA 1PGL1 4P9LA 1UW8A 1QKQA 2DCTA 3O14A 2DUOA 2ZHNA 2G9GA 1OMIA 5J37A 2EXKA 3X29B 1SMVA 4C90A 1GKBA 4G4FA 5BNOC 4IEOA 2JE7A 2X5IB 1G9CA 4AF9A 1VP6A 1SDWA 4IV1C 1YFUA 1LTEA 3WDTA 3VZOA 4FPFA 3JBG3 3L2HA 3N7JA 2ZKLA 1GYKA 3O0WA 1BJQA 4IETA 4EWEA 2R16A 5KHJA 4NN0A 5I8TA 1Q8VA 5BNPB 4LA2A 1CAXB 2R071 1Q8SA 3WHTA 4N53A 3SH4A 5KBFA 3GBFA 2RM23 2RMU1 1RUC2 2O8QA 4GIQA 3VHNA 5DUVA 4Y1XA 1UU5A 3V0BA 1AYM2 1I6XA 1CPNA 2BWCA 3OD0A 3WP6A 1O4TA 2YY1A 3RZZA 2ZGNA 1NYWA 5FRAA 2OIIA 2RR11 5D8AA 3VL9A 2X5IC 4L9BA 3WG1A 2WT2A 1JUIA 3S7EA 1ZRRA 2ZMLA 3JUUA 1EP0A 1ENSA 3ST7A 5FREA 2RE9A 1BCXA 1UIJA 2HYKA 5DG2A 1J3RA 2D43A 1BBT1 1RVF1 1NA1B 3BALA 5BNPC 2F6BA 1NQJA 4KGQA 1XXNA 2SBAA 4AYUA 2D5HA 2B7YA 1PNGA 3RG0A 3QACA 4R4XA 4YW4A 5BPXA 5HCAA 5CAZA 4FQZA 4QD2A 1DLLA 1G9BA 1AR81 1N3OA 4K20A 2ZMKA 5JIUA 2VG9A 1GNHA 1NXMA 4AI8A 1W6QA 2DVAA 1GZCA 4JAAA 4JVAA 1J1LA 1RHI2 4LNVA 3NWKA 3VDDA 1YIPA 5CU1A 4COZA 5T5LA 4FTEA 4YZ3A 4LBJA 5F6KA 3SMHA 3WVJA 5JOXA 2R043 2R0FA 2PHWA 3B7MA 3DUIA 1X33A 4AEDB 2JICA 3GALA 5ABJA 5JI9A 3GZTB 1UKGA 1RJ8A 3M3OA 1NA1C 3TYJA 1AR61 1C28A 3WHUA 1MEC3 2AZ5A 2OUJA 1IPJA 4JGYA 1V70A 1Q8OA 2FZ1A 4ASMB 4S2FA 5C6CA 1LOFC 3A4UA 4D7TA 3HD8B 1AXZA 1Q56A 1C5IA 4LO8A 5AC92 4YLZA 4Q4V3 5JMCA 5DZFA 1LR5A 3RQ0A 1ND3A 1E57A 4ISRA 1ULGA 4AI2A 1PK6A 2HWF2 1UZYA 4KGGA 1MS9A 1V9U2 1C3HA 1GNZA 3VBSA 5DZEA 1HLCA 2UWBA 5JCTA 1PGW2 2D7FA 3R6SA 4AEDC 2PHLA 3WDVA 3T1MA 4L2NA 2DCJA 2C1FA 4K8FA 1QU0A 5DDJ2 3NVCA 1CVNA 1LODA 2RS33 2XHKA 4XJUA 1DGRA 2Q1ZB 1R092 4A7KA 2JEMA 3FJSA 1UIKA 1HRV3 2JG9A 1S0JA 5K0UC 1IKPA 1OPOA 3JQWA 5KHIA 2VU9A 3MW4A 2LTNA 1VRH3 4XF0A 2R32A 1CD3G 3LCPA 4K1YA 5A3MA 1H4HA 4ZU4A 2XGXA 2GDFA 4IEQA 1VBA1 5C8WA 2D6OX 2D3PA 5FMOS 1VBD2 2ZMNA 3DPRB 3IN9A 2ZHKA 4IERA 4X8PA 2WLPA 2DV9A 3HIFA 3JB8A 1G6NA 2ZAAA 2MEV3 4FP2A 1UPIA 2DF7A 3CU7A 3J8F3 1OSGA 1HRI1 5FPXA 1ZZ9A 1VBC3 3FMGA 2FMYA 2B42B 2BQPA 3RPQA 4LO5B 4K3UA 3M70A 1H1AA 2EVXA 2DCZA 3AMPA 2HWE2 3URFA 3HMYA 2CAUA 2UU8A 2PHDA 3LSEA 4JGZB 4JTOA 4TYSA 2D6LX 3QH6A 1VAKA 5I91A 1X8EA 4CDQB 2JENA 2A6WA 4DB5A 4MZUA 2VH9A 1Y9QA 4F83A 1QNWA 2ZABA 1ZZCA 3JU9A 3U0ZA 1SEFA 1QJU2 4H3WA 5IK5A 1JTZX 4XYXA 2HKXA 1QJX1 1QQP2 4HSLA 5F5QA 3JD72 3DPRC 4XE9A 1W6NB 1HQLA 3MFCA 3R05A 2ZKNA 5T5PA 4HVOA 2Q8OA 1ALYA 1HXS1 2P17A 2CAVA 3BOWA 4Z07A 3WP3A 1ENXA 1WCSA 3FLTA 3I54A 3MIHA 2CY6A 5BYNA 1GZWA 2GN3A 4JGZC 4FPYA 5BXXA 2HWC3 4X6RB 1ZREA 2XVLA 1WBFA 2ZGKA 4CDQC 3HR9A 1W0OA 4WM8A 3V0BB 2UWCA 4DY3A 1D4M1 5GLUA 3EJKA 4IQPA 1N3QA 2QDRA 1WCDJ 4XHBA 4CDWA 3AM2A 1DYPA 2JG8A 3RYPA 3W58A 2FQPA 5D8AB 1SACA 4Q4X1 1HIXA 3UKTA 3BPZA 4B7KA 1YI7A 1WW5A 1GQHA 3H8UA 4LUMA 4K6BA 5SV8A 3EXUA 1VBB2 2VUJA 1Q8PA 3B94A 5A33A 1G8WA 1OQ1A 1SLIA 1GQGA 2WSVA 3B9CA 2D98A 3FC0A 4AQ6A 1DQ5A 1WD4A 4Q4W1 4A7YA 1FPN3 4FT8A 1JUHA 1FAYA 1NOVA 2NPIA 2K0GA 2X53S 1RUC3 1QXJA 1RUJ1 3J4UH 3PLQA 1W39A 3LA3A 4IV3A 2JKBA 4DZGA 1AYM3 2PLV2 4LUKA 4P9WA 1QXPA 1U0AA 5JPNB 4LO4B 2VW1A 1CJPA 4QX5A 5D8AC 3AXDA 3ZFEA 2BW8A 4YW5A 4HANA 4HMZA 3VDDB 1J1TA 3DF0A 4I0WB 5GLVA 2AUYA 2XVGA 1BVP1 4AQSA 3AX4A 1WMDA 3MF9A 3KD4A 4RHV1 2YYOA 5ABJB 3ZIXA 3LA7A 3S30A 2WJSA 3AKTA 3KT4A 4JGYB 5FOBB 4MGZE 1D2SA 1IOAA 1BZWA 1UF2C 2P37A 4DMIA 1WW7A 5LK5A 3TRSB 4EN6B 4AVSA 3ASIA 3PVBB 4XJAA 1H2NA 1RB8G 4N7UA 1ND3B 1NCRA 4GH4A 1PIV2 1Z7S2 3EQEA 4IEWA 2Y0IA 1PK6B 4O9EA 4HETA 1POV3 1V6OA 3ZXGA 2A70A 5IUQA 1A78A 1RUG1 2PYTA 3VDDC 1RHI3 5EV7A 4META 3VBSB 1YLLA 4IL7A 3WG2A 1PZ8A 1D4VB 1FOD2 1U5YA 2OVUA 4E9KA 3K48A 1EV11 5ABJC 4FPJA 3MDPA 4H55A 5CB7A 3NV1A 4Y20A 5J96B 3LZZA 2ENRA 4JGYC 1QF3A 2BNNA 2AENA 1CAVA 3GF6A 2WIIB 3MYXA 4IEUA 4WVVA 1ND3C 3LKJA 2QE3A 3GHNA 3PVNA 5E89A 1UCXA 2XWBB 4MX3A 1IS3A 1PK6C 3HT1A 4LULA 5L7OA 1BVVA 1RUF2 2HWF3 1KD7A 2XJRA 2R0HA 3VGIA 1AR71 3AP4A 4QGLA 1Q43A 1LOEA 3OTFA 1U12A 1LEDA 3ILNA 3VBSC 4BMBA 5I0SA 1EAH1 4FPEA 1MZFA 2VVFA 3OGGA 3IM0A 2B46X 1RIRA 4Q2FA 4CP2A 3OY8A 5FTTC 5LEJA 3OF1A 2GNMA 1COV1 2BUKA 3OYWA 3NSTA 5DDJ3 4PF5A 2BFUS 2QDNA 2BPA2 5DZGA 1IPKA 4OUMA 3M8LA 3TB0A 1RUD2 4AFMA 1QNYA 3H3ZA 4WM7A 2A6YA 4JRAA 1VIWB 1J59A 1PGL2 1YO8A 1R093 5C9AA 4ASLA 1PO12 1H1IA 2DVBA 1APNA 3AJZA 4Y1UA 5C4WA 5JDBA 1LHOA 3HWJA 1CIWA 1ZBE1 1OQDA 2VPVA 4A2UA 4DPNA 2E6VA 4E4SA 1XNCA 4YW2A 1RUH1 2A3WA 2R1DA 3KT7A 1BK1A 1S55A 4XILA 3ZXKA 4Z92B 1HV1A 1R083 3WX5A 4DOUA 5LK7B 3TBDA 1AX1A 2RS13 1CPMA 4IEYA 3WR0A 3N4MA 4PJYA 2R072 3ILFA 4G9SB 4C0BA 2WL1A 4FOWA 3VZJA 3TWIA 3S7IA 4EN7B 2IWGB 4Y1VA 1SBEA 5K7PA 2HWE3 3B3QE 2E53A 3WW4A 2CWSA 3J26N 4WM8B 2RR12 3RRDA 5KHGA 1LOAA 4QPYA 4AVBA 1S2KA 4LBQA 3KGLA 1F31A 3ROUA 4DFSA 2PQQA 1AL22 2R063 4KWLA 4CDWB 1QJU3 3AFGA 2JECA 2JG8B 3QOPA 4XFIA 1QJZA 3AYEA 3RS6A 3V56A 2WFPA 3ZFFA 4BQ1A 4XW3A 4EJRA 3LOBA 3NV4A 3JD73 2W52A 1CQ9A 4I02A 3UKNA 1BBT2 4LEJA 3ETQA 2NP0A 3RWNA 1LGBA 4U2AA 3N7MA 3KLSA 3ZXDA 1FYUA 3B00A 4F3JA 1C1FA 2HWD1 2P2KA 4GB33 4YVSA 1A3KA 4ISQA 3VZLA 2AH2A 4Q4Y1 1TMF1 4QQOA 2Z79A 2E63A 2XKPA 2W39A 1F8VA 1QOSA 4WM8C 4IV3B 3WUCA 5KHHA 4AGGA 1AR93 2WNEA 5AVPA 3KMHA 2IXJA 4WVWA 5KC6A 5CA6A 4XFFA 2ARXA 2PHFA 4AK3A 1M06G 3NAPA 4XETA 4CDWC 2JG8C 3ZFEB 2H6BA 4LE3A 1C8M3 1VB4A 4L8QA 2YGLA 3VBRA 4FPLA 4EN8B 2WFF1 1NXD1 4FOQA 2ZACA 2JXAA 1AR62 1LOBA 4N90A 1VBB3 4B4RA 3H1WA 4X8NA 4GMP3 3O12A 4RQPA 4I30A 2ES3A 3JCIA 1RUE3 4CYDA 3JQXA 1ASJ1 4UW4A 3D4KA 1MS4A 1YJKA 4IXLA 4IV3C 4XFGA 4SBVA 3VKNA 4GH4B 1NCRB 1BXHA 2EF6A 3LWCA 1OOPA 2I07B 2WSUA 1TEIA 3ZFEC 1DZTA 2D44A 1NY72 1RJ7A 4PBOA 4AI3A 4XHXA 3PVEA 1O3QA 2NZ9A 3AYDA 3VBFA 1DU3D 3ZDSA 3ZSMA 4BOWA 4QGMA 3ZSKA 1CR7A 3AMHA 4LLOA 4LHLA 4XIOA 3ZN4A 5FOJB 5KC5A 3JBG1 4BPZA 4BLJA 2RS52 5C8CA 4WVZA 1QJY2 1SQ4A 1CAVB 3VBUA 1OPMA 4XFCA 1VBA2 4FXGB 4PDWA 4GH4C 1NCRC 2RM21 4CDXA 1SLBA 4RR3A 1Z7S3 5HCBA 3VBHA 2VQ0A 5L7OB 4BZ4A 1D2QA 2DWRA 4ES9A 1W6OB 1UX6A 3QD6A 2XJPA 1X82A 2GNTA 3MIDA 3CLPA 1LKNA 1HRI2 2B8MA 3NJZA 3VKFC 3KCXA 1FOD3 3OY8B 4Q8LA 4DINB 1DDLA 4LHKA 5H9QA 4HKOA 3OYWB 5CIRA 4TLFA 3ZSLA 5J36A 3AMQA 3NL1A 2AGSA 2A3XA 1WD3A 4QM8A 4WM7B 4R9DA 5C9AB 3VZKA 3WQ0A 1QWRA 3A0NA 1V00A 1XRUA 4Y5Z0 3ZYIB 1XYOA 1AYN2 1H4GA 3RMXA 3WP5A 3AKSA 1S0CA 1YRZA 4HK8A 2DURA 1QJX2 4GKYA 4F8AA 5L7OC 3V0AB 3DGTA 2QNKA 4XQDA 1RUF3 2VUAA 1ZNPA 3KSCA 1MS1A 4QU2A 4XF9A 1H2MA 1UU6A 3E6BA 2PA7A 2A3YA 2XBO2 1QDCA 2NQYA 2R041 1O7FA 2VNRA 5DUWA 3SNMA 3JZVA 3PVOA 4PBPA 2WNVA 4B4QA 4FTBA 1CX4A 3M3IA 4AW7A 4WM7C 2UWAA 1RUD3 4XPVA 5C9AC 1MEC1 2BVBA 4Z8BA 3MI8A 1D4M2 5FQ0A 1PO13 3D5OA 1RMU2 4XTPA 2HWB3 5CG9A 3AP5A 4H7MA 4LT5A 2D6PA 1HKDA 1DQ4A 2A6VA 4GALA 1WLDA 4LBQB 1LGNA 4LR4A 2QZ3A 1DQ6A 1DIWA 1CAUA 4ATFA 4OI2A 2OA2A 3ZXEA 4HN0A 3P3NA 4X6QB 1OQEA 3ZFFB 2UYAA 1DBNA 4JDNA 4AVVA 1ZZBA 4YZ1A 2GMEA 3USUA 4P5HA 3ZFGA 1TME2 5E88A 5FFOC 1UL9A 2XLFA 2YMZA 4Q4W2 1H8VA 4E4ZA 4D69A 1DQ2A 1AHSA 4WZCA 3MIGA 4KWJA 3ZN6A 2QZ2A 4ZKTB 4LBKA 1AXKA 3D0SA 3IBMA 4BA6A 1RL3A 4YVSB 3CL1A 4AEJA 3RI8A 2RS31 3MZHA 1PVC2 1S1AA 4AGRA 4QPIA 4D7SA 2A5ZA 4MXVA 3SHRA 1MZ5A 4EN9B 1HRV1 1QH7A 2RR13 1IHMA 2O8OA 3OJBA 4F7ZA 1I5ZA 4AVCA 4W65A 4YG6A 1N3PA 2XH6A 1PMIA 5K0UB 1VRH1 3ZYJB 3GZUC 4CP0A 1AL23 3NAPB 3RMYA 1N1YA 2P3KA 3ZSEA 3CNAA 3ZFFC 4D3WA 2FMDA 4EV0A 3HN1A 1N47A 1RITA 2R30A 1MQTA 2VMIA 2DU0A 4IEXA 4XF1A 4YGCA 3WCSA 3VBRB 2EAAA 3H1YA 1BBT3 3ECQA 3E6CC 3FX3A 4QQ2A 4ATEA 2Z2SB 1GZ9A 1GSLA 2GC2A 4LO6B 2E7QA 3MPPG 4AFDA 1FV2A 2MEV1 3SLIA 3TN92 3DL3A 3J8F1 4AI0A 4RQPB 4AG4A 2EXJA 4YVSC 1VBC1 1HW5A 4Q1RA 2WZR2 2SLIA 3N3HA 3INAA 4I01A 2RJKA 3ALQA 2WINB 5T52A 1X7NA 5JWPA 4COYA 2ATFA 4GQ7A 4NWWA 1ULCA 1JOJA 5FLIA 3K51A 1OOPB 5I8SA 1MR5A 2RHPA 4TSVA 2PHTA 3NAPC 3UJQA 1J3QA 4K40A 4LE4A 1MZ6A 1JYIA 3NV3A 2XL9A 3U11A 1EV12 3VBRC 4Y22B 1REDA 1KXGA 2ZOEB 1CAWA 4IEPA 2EIGA 4N9HA 4AEMA 1DGWA 3LAGA 1PO22 1AR63 1YHFA 4QPGA 2CYFA 2OUHA 3W9AA 1FMD1 1BQPA 2DFCA 4RQPC 4YGDA 2V09A 5HBAA 5ACA2 4JTNA 3G6JB 3AFKA 1LJ7A 5FLHA 4FPKA 3VBUB 2B45X 2GZWA 4XMIA 4CDXB 5I0UA 2WS92 2HWC1 4FOYA 4RR3B 3WG4A 1Z78A 1OOPC 1DHKB 1Q5OA 3FUOA 4DNYA 5JSRA 1EAH2 1A6CA 3ELNA 3WQ1A 4B3NA 3UV9A 3LSDA 5J7MA 3E97A 3VL8A 5JOWA 4LBLA 4E2SA 3B02A 3VZNA 2R1BA 1Q3EA 5A3LA 1W6MA 3ME2A 2I2SA 3H1MA 3I59A 3OCPA 5LRRA 1RUI2 2IXIA 1OA3A 4Q1PA 3D0JA 2ZGQA 4R9BA 1CGPA 3ILRA 5FMOL 3ZVXA 1SCSA 4EN0A 4B8EA 2BNMA 2RS53 1QJY3 4WZFA 3VBUC 2DU1A 3WCRA 4G3YC 5A32A 4Y24A 5JOYA 3MGUA 4PLMA 1FPN1 4CDXC 4N53B 4P9YA 4QMAA 4RR3C 3TNQA 1RUC1 4LA3A 1URXA 1VBE2 1ND2A 5GKAC 4W6YA 2P3JA 1REFA 2ZHLA 1DG6A 3OBTA 2QVSB 3D8CA 1S0EA 1HRI3 4FPHA 4CZSA 3T2TA 4L99A 3G7DA 4J1WA 2UURA 1HX6A 3AKQA 3AXEA 2TBVA 3LOIA 4W6WA 1ZZ7A 2BGCA 2FHRA 2WNVB 1F9KA 1V6JA 4NO4A 2VQAA 2GNDA 2PAKA 1GBGA 1ZRFA 5FQ0B 4AWDA 4LO7A 1AYN3 4N53C 2YC0A 1C57A 5J09A 4A3XA 1QGLA 4NHKA 4Q0VA 1CAUB 4QQLA 2KA3A 4LHNA 5K8SA 1YFXA 1WBLA 4LBOA 4XF4A 1POV1 4YW3A 5H9SA 1LGCA 3HT2A 3USUB 1W6QB 4IEZA 1ZX5A 1WGPA 3ZFGB 1RHI1 1AL0G 2XBO3 3BOPA 3BU7A 4NR1A 2GNBA 2WNVC 5CADA 4XFAA 5EYYA 3A0KA 2C9AA 3GYDA 2Z5WA 4MVTA 2VVEA 4RFT0 4UW3A