1YUDA

X-ray crystal structure of protein so0799 from shewanella oneidensis. northeast structural genomics consortium target sor12.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
158
structure length
158
Chain Sequence
MQNADDFIKFLELEQHVEGGFYRSSYRSETAFDPSRQLWSSIYFLLRTGEVSHFHRLTADEMWYFHAGQSLTIYMISPEGELTTAQLGLDLAAGERPQFLVPKGCIFGSAMNQDGFSLVGCMVSPGFTFDDFELFSQEALLAMYPQHKAVVQKLSRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SO0799
publication title Crystal structure of hypothetical protein SO0799 from Shewanella oneidensis
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
total genus 26
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06172 Cupin_5 Cupin superfamily (DUF985)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yudA01
2Q0AA 5I0RA 2XL7A 4F8AA 2GC0A 3ZDSA 1PMIA 1J3QA 3H3UA 2N7GA 2XKOA 2XHKA 1OI6A 3WW4A 3E6BA 2OA2A 4LUKA 2QDRA 4HBNA 2EAAA 2WFPA 4X6RB 2UY9A 2PAEA 4LUMA 1Q43A 1SQ4A 4QGNA 1LB2A 4K8FA 3SXWA 3HT2A 5CU1A 2PAKA 4IERA 4KWLA 4BH9A 3EBRA 3HT1A 1EP0A 1HW5A 4LTAA 2B9UA 1ZNPA 5KHJA 1X82A 3RNSA 5AVPA 5I8SA 5HI0A 4L2NA 5I93A 5J7MA 1YHFA 1UD1A 2Z69A 4AVAA 5CVRA 1UPIA 1FT9A 1J1LA 5KHKA 3PLQA 2XGXA 3UKNA 2CAUA 2D93A 3ST7A 1CAXB 3L2HA 4XF1A 3USSA 3VHRA 4XFFA 3FZ3A 4X6QB 4PIXA 1CX4A 5KHHA 2PFWA 4KU8A 1VP6A 3D82A 5FDBA 3R6SA 4QMAA 3SCHA 4N9IA 3E6DA 3HIFA 5E16A 3ACLA 3O14A 4XFIA 4AQ6A 2O1QA 2Q30A 3LZZA 3LAGA 5FQ0B 3CO2A 4B29A 1NXMA 2OZJA 4QM8A 2BYVE 3E5QA 3KSCA 3IDCB 4AXOA 2BEOA 3MDPA 3WW2A 1WGPA 1ZRFA 4ZU4A 3G7DA 2D5HA 4EWAA 2ZKLA 2EA7A 4MH0E 1IPJA 2CGPA 5I8TA 3H3ZA 4JV4A 2FQPA 2XLGA 1RUNA 1ZZ9A 1QWRA 4XF9A 4XFCA 2PHDA 1Y3TA 3LWCA 4FAGA 1DZTA 3E5XA 2GU9A 3DV8A 4FT8A 1SFNA 2PTMA 3FFQA 5FLHA 3S7IA 4Q0UA 4HLTA 5LEJA 1XE7A 1EPZA 3PNAA 4FBFA 4QGLA 4XF3A 1VR3A 3GBFA 4IEWA 3ES4A 4IEUA 2DCTA 1CAWB 4HVRA 4LLOA 1ZRDA 4MV2A 4OFGA 4MX3A 2ET7A 1CGPA 1DZRA 2PQQA 5C6CA 3CL1A 1SEFA 3OGJA 5K8SA 1JUHA 3BCWA 4EWDA 4JTNA 4Q0VA 4P9GA 1J3PA 3ELNA 4HN1A 2B5HA 3SMHA 1UIJA 4IEVA 3NVCA 5T3NA 5I0TA 1O5LA 1NZCA 2ATFA 2IXCA 2XLAA 5EFUA 5JAXA 3IDBB 2PA7A 4QXKA 2BNNA 4PIZA 2VQAA 4IEZA 3IIAA 3BALA 5KHIA 5JSRA 1ZZ8A 3H50A 1FI2A 1XRUA 1O3TA 4I02A 3GYDA 1EYBA 1RTVA 1QY4A 4XF0A 1ZZ7A 1ZZCA 4I0AA 2Y0OA 4Q0QA 1OD5A 2PAMA 4UBHA 5LRRA 5I91A 4YSFA 3MPBA 5C8WA 1ZRCA 5BUVA 4IEPA 4R52A 1LR5A 1V70A 2UYAA 3B02A 2C0ZA 4HN0A 4MUVA 4MZUA 4Q29A 4YYOA 4XFAA 5E1RA 4E2GA 5JR7B 2ET1A 2GC3A 4I2OA 4XETA 3RPQA 4LULA 1L3JA 4UXAA 3I7DA 4LA2A 1YFXA 1UW8A 3QOPA 2I45A 4PIYA 4MGIE 4NVPA 3MYXA 3NJZA 1GQGA 4I09A 3IWZA 3H7YA 2IXIA 4EWEA 2EVXA 2O8QA 4JVAA 4IETA 4XFBA 2K0GA 3JZVA 4A2UA 5BY5A 4HVOA 1IPKA 3H1YA 3RZZA 3I59A 4AVBA 5BXXA 5KBFA 1Q5OA 4E2SA 4EROA 4MGYE 1J58A 5I0SA 4IEQA 2Z2SB 3EHKA 4ORFA 1UIKA 4MGKE 2Q4SA 1O3SA 2OPKA 1RUOA 3WW3A 1EY2A 1OMIA 3ETQA 3FWEA 1NYWA 3H8UA 1YUDA 3NL1A 3PVBB 3U0ZA 2K9ZA 1YFWA 1ZVFA 2CAVA 2GZWA 1CAVA 4JTOA 5FCCA 4IEOA 4ZU5A 4RD7A 4L11A 1O3QA 4AQ2A 1GQHA 1Y9QA 3IBMA 4Z82A 2FMYA 1ZZ6A 4QGMA 3RYRA 3NSTA 3SCGA 5I8YA 1ZRRA 4E2QA 4BHPA 5LRSA 1TQ5A 3OCPA 4I0BA 4J1XA 4CYDA 3D0JA 5FPXA 3E6CC 2QNKA 2UYBA 4HZFA 4Q0SA 3M70A 1QXRA 1X8MA 3LA7A 3LOIA 2KXLA 4UBGA 4XEZA 1U12A 1YFUA 3OF1A 1LKNA 4BYYA 3H7JA 1O4TA 3FE5A 4WBBA 2P17A 5JCTA 4J1WA 4PJYA 3FHIB 3E5UA 2IC1A 3ROUA 2IXJA 1FXZA 3U10A 4O9EA 2H0VA 5BPXA 4XFHA 1RL3A 1CAUA 1OFNA 3WW1A 1XE8A 2D5FA 4D7TA 1LRHA 2BNOA 4MGZE 5BV6A 2E9QA 5I0UA 3H1WA 3HQXA 2H6BA 4N9HA 1YFYA 4H7LA 3I54A 3KCCA 3C3VA 1X7NA 1I5ZA 2IXLA 2GH2A 3DL3A 3TNQA 4D7SA 4YARA 1J59A 4WVZA 3SCFA 3H9AA 4I01A 3BB6A 2XKPA 3RYKA 1PM7A 2GC1A 3UKTA 2QCSB 3KMHA 1RC6A 4WZCA 1H1MA 2V09A 1O5UA 3S7EA 3I59B 2XLFA 1UCXA 1ZX5A 1I6XA 1VJ2A 3LA2A 1WLTA 3KGZA 1J3RA 3FX3A 5KHGA 2ETEA 2WC2A 3N4MA 2PYTA 4DINB 5J48A 4TLFA 2PHLA 3UKVA 4F7ZA 5D1IA 2HKXA 5JSPA 4IESA 1CAXA 3QACA 1G6NA 4ONUA 2CV6A 1Q3EA 1YWKA 2BGCA 3LA3A 1ZZBA 3CF6E 4HSJA 4EV0A 3FJSA 4IEXA 1O7FA 4LA3A 4I3PA 2D40A 3RYPA 2ZCWA 4OLLA 4HVQA 1CAVB 1ZREA 4Q0PA 3TNPB 3CEWA 2OZ6A 2GAUA 2IXKA 4YRDA 2QVSB 1RGSA 2QJVA 2VECA 5FQ0A 1NE4A 4AVCA 4LEJA 2MHFA 4QM9A 2MNGA 4KU7A 3RDIA 3SHRA 4IEYA 3DKWA 4GULA 4META 3E97A 4QX5A 2HJIA 2UY8A 2Q1ZB 4XFGA 1YLLA 2H6CA 3U11A 3NKTA 2IXHA 5CADA 5FPZA 3S0MA 1NE6A 3CLPA 3NW4A 5FLJA 3BU7A 4HMZA 1H1IA 5EZWA 2OYZA 4ZU7A 4O9GA 3CJXA 1DGWA 5JSOA 1O3RA 5F1RA 4XF4A 2F4PA 3OD0A 4FAHA 1DGRA 2XL9A 3ES1A 3EO6A 3BPZA 3EQEA 5J3UA 1WA4A 1QXJA 2MPFA 4HSLA 2B8MA 3M3IA 4Z07A 1X8EA 4BIFA 5LEKA 3MZHA 3KGLA 2BNMA 4R8HA 1CAUB 3EJKA 1CAWA 4KWKA 3DN7A 3H1MA 2VPVA 5FLIA 4YNIA 4KWJA 3OTFA 4KL1A 2GC2A 3D0SA
chains in the Genus database with same CATH superfamily
5I0RA 4XILA 5HBAA 3IPVB 5FKBA 4F8AA 1W6OB 2VZVA 3OPTA 2PXJA 2GC0A 3LIHA 2CL2A 3KCXA 1Q8PA 3ZDSA 3HQRA 5G05L 1POV3 1PMIA 2QQIA 2RS12 4XXPA 3J7LA 3VDCA 3BGAA 2XKOA 2XHKA 1OI6A 3BYWA 4OUSA 4XACA 3E6BA 5FZOA 5FZBA 1MS9A 5A33A 3WW4A 1PNGA 4Q5OA 4HBNA 4X6RB 2WA3A 1PGW2 3ZPYA 1UMIA 2X10A 2PHXA 4QGNA 5IVYA 2BZDA 3OY8A 5CU1A 2PAKA 4B7KA 4BH9A 4EN0A 4RHV1 3LD8A 2TUNA 4CDQA 1QGLA 3CIHA 5FY5A 5CFCC 1JYXA 4YFWA 2ZGLA 4FTSA 1ND2B 1W8ZA 3H3LA 3OGRA 5DAXA 4BQ4A 4LBOA 3MBWA 4K7JA 4UFHA 5HXVA 2CU5A 4PF1A 3NNMA 4UF0A 3VBSB 2TEPA 4DUXA 1XC6A 4AVAA 5CVRA 1W9TA 2VMHA 3ACFA 3AFKA 1FT9A 4BIOA 3J7HA 5KHKA 2XGXA 1XPWA 2D93A 2FDGA 1CAXB 1FPN2 3L2HA 4XF1A 2DUPA 5DAPA 4Q4V1 3VZMA 4NHYA 3ZYRA 4JKMA 1HJFA 4QHBA 4W6YA 4JHZA 2VW2A 1VIWB 1IG0A 1W8TA 3THTA 3UGFA 3ILRA 1H4GA 4KU8A 1NCRA 4P5HA 3C8XA 5FDBA 2W1QA 3APBA 3SCHA 4N9IA 4FOWA 1NY71 3HIFA 2CGOA 3N7JA 1WCUA 1PK6B 3O14A 1PVC1 3ZFGB 1ZRIA 5BNNA 1CR7A 2G1MA 4AQ6A 4JC1A 1SACA 1XB9A 3ZXKA 5F39A 3LAGA 2EIEA 4LQRA 2OX0A 5D2AA 5BNOC 4MG2A 1C8M3 4K6BA 4B4QA 4RQPA 3LSEA 1DYOA 4XQ4A 2AR6A 1W3XA 3AKQA 3SH5A 3GJAA 1Y43B 4YFZA 1V9U3 2VQTA 5APAA 4I30A 2HWD3 3WW2A 3LGRA 5FYUA 2WYFA 5C71A 2WZPP 5CA6A 5IHRA 1BMV2 4URAA 2EA7A 3OEBA 2XJUA 1WCSA 2ENRA 3AM2A 4MH0E 5ANNA 4BQWA 1F5JA 2R0FA 1XSQA 4OQ8A 1I5PA 4AFBA 3QD6A 2LRPA 4OMDA 2FQPA 3URFA 3I2IA 1RUNA 4QKBA 3IDEA 5T52A 2RG4A 5FREA 1KRIA 4YLZA 3I2DA 2P3IA 3OBTA 4CCOA 2J1SA 1SBFA 2Q8EA 4B4RA 3E5XA 4A42A 5ACA2 5FPUA 2Y6JA 3DV8A 1UY0A 4QB2A 2L9LA 5FXWA 5FLHA 4Q0UA 5J96B 3SQOA 2LS6A 1VRH2 3NMBA 1BKZA 3USUA 2D6MA 3ZSLA 2RMU3 2XVGA 4HONA 3K51A 3POSA 1N1YA 1VB2A 1R092 1VR3A 2VG9A 1OQEA 3VZLA 3AVRA 3NV2A 4WVWA 1YRZA 4XMIA 5ANQA 5FYIA 1U0AA 5LATA 4HVRA 5K7PA 1PGW1 4HL0A 4CPBA 2ORXA 5CFDC 1E5RA 3AKTA 4BU2A 1LOCA 3FL7A 4LMFA 4MX3A 2ET7A 1DZRA 3PL0A 4OHYA 2VOWA 5C6CA 1A34A 3ILNA 4CCCA 2VMEA 1J1TA 1H2KA 1FMD2 1SZBA 2HYXA 5I0DA 1WLDA 3MW3A 3T30A 4YW4A 3O1SA 1CVNA 4OI4A 5T3NA 4CU8A 1O5LA 3TB0A 2XLAA 1RVF2 2YYOA 4Q4W2 2C24A 1SCSA 5JAXA 3KT1A 2A1XA 4V2VA 3VBUB 4RA0A 1H8VA 1FPN1 4BDVB 4YZ5A 3OJBA 4YM2A 2BNNA 3UL2A 4PIZA 4IGQA 2VQAA 4IEZA 1XJAA 3HAGA 5EJ1B 1NCQB 4QX0A 5DPNA 1OH3A 2DVAA 4A7YA 5A3OA 2VOVA 2WAOA 3H50A 4IV3C 4QX1A 3VBHC 3GCXA 4AI0A 3G6JB 3I3DA 5GJ6A 1XNCA 1O3TA 4TXWA 4CU9A 3M3CA 3CQOA 1RTVA 3POBA 4OULA 2NP0A 3AZVA 4QQHA 5FBJA 3UV9A 2VTXA 1H0BA 1ZZ7A 3CU7A 1ENXA 4DMIA 1XYOA 5L7OA 4XIOA 3QCWA 2Y0OA 2JG8B 2WN2A 1UOGA 4XAEA 1E5SA 1PO23 4AI3A 5B4XA 2PAMA 2XBO2 5FJKA 2RS52 4CU6A 1SCRA 1DBNA 5TSWA 4UT5A 4W6XA 5JI7A 3T1MA 1JZ7A 2Y8KA 2YROA 5E88A 4AK3A 4DRVA 3HOBA 1AXZA 1ZRCA 4R52A 5FXZA 1BMV1 1LR5A 2WNVB 1V70A 1OA4A 3RI9A 5JOYA 1Y9MA 2EIGA 1HX6A 2VZPA 2E51A 1US2A 1LHOA 4L99A 4LHSA 1ZBA2 4YYOA 3B7MA 4XJWA 4E2GA 3JQWA 5CISA 1HRI3 2RVAA 4FPHA 4ASLA 2WWSA 3ZX7A 1AJKA 2ET1A 2VUDA 2ZGRA 5JPMB 1NQJA 4GWJA 1O6UA 3ZXJA 1JZ3A 4F83A 1L3JA 1CIYA 3VD4A 4YGEA 1AUYA 2XHNA 4XHXA 3K2OA 2ZX3A 5H9PA 5ACA1 1YJLA 3BOWA 1SLBA 5IFPA 2WL1A 3RMYA 4QU2A 1RUD2 3NJZA 1MZFA 4D0QA 5FYTA 2FDIA 5C9AC 3B94A 1UYZA 2VNRA 3TYJA 3MHZA 4CUBA 2NMOA 2KA3A 1BVVA 3FHQA 3P1IA 4E27A 2WR9A 3WP6A 4Y1UA 5FY9A 3H1YA 4JRAA 1WUVA 3RZZA 3VHNA 5AFEA 4Z92B 4JDOA 2ZEXA 3SC7X 4AVBA 2ZACA 2GNTA 1D0GA 2QQVA 1D2SA 4ZS3A 5BXXA 4CUCA 4EZHA 4OCTA 5KBFA 4OVEA 5IT6A 4E2SA 1Z78A 1J58A 4MGYE 4Q27A 3WG4A 4NOTA 1AVBA 1FMD1 4K1ZA 4NRMA 2GMMA 5CIRA 1DYPA 2G4IA 3ZFEB 2LUWA 4XJZA 2Q8CA 1BQPA 1LHWA 1NQDA 3EYPA 2QQMA 5KR7A 4LXLA 2OPKA 3B00A 1X9TA 4Q4X3 1RVF1 4D6SA 4DQAA 3T0BA 1ZA4A 1PIV2 2EXKA 1OMIA 2W87A 4Q4W1 3FWEA 3VD3A 1YUDA 2HBTA 1YQCA 3ZXDA 5C3QA 1WLCA 3WINE 2VNVA 2K9ZA 4NPLA 4XJ9A 5FPVA 5T50A 4CEWB 3OUIA 1HRV2 4RS5C 4A3XA 3LDBA 3PJYA 2EICA 4MYEA 3HBZA 5CFCA 1GICA 4PQ9A 2D6OX 1CAVA 3TN92 2CDOA 1W0OA 5FCCA 1DYKA 4Y1VA 2IZWA 4ZU5A 5F3CA 2B39A 4L11A 1ZBE3 1S0DA 1O3QA 4YVSB 3VL9A 1NT0A 5FZ7A 5GKAC 4LOSA 1GQHA 1LGBA 3R4SA 4Z82A 1KQRA 2UU8A 1ZZ6A 2VBBA 4QGMA 3PJQA 4FP2A 3NSTA 3FMGA 4CDUB 1XYPA 3SCGA 2XBO1 4PDWB 3VDDC 1ZRRA 3WNNA 2RS51 3OYWB 5I8YA 2ARBA 2UWCA 2Z4FA 3I2OA 5HCFA 4EJRA 4J1XA 1RUF3 4CYDA 1YQ5A 2WT1A 3D0JA 5FPXA 5KC6A 1IKPA 1OLQA 4Q4Y3 3JCIA 4KI5M 1C5HA 2K46A 4LE4A 4LO6B 5A7OA 1LHUA 3KZ4C 4QKDA 1W6MA 1YFUA 4HK9A 5BNOA 5FZ0A 1W28A 2KM2A 2Q1FA 3RZMA 1O4YA 2C9AA 4DOUA 4JRLA 1W6QA 3WNOA 3FE5A 4RSUA 4XUPA 4R9AA 1S0JA 1X9PA 2BJSA 4ATEA 3GM8A 4WM8B 5JCTA 1XYNA 2YY1A 3KF3A 1NLRA 3VHOA 4IE4A 1STMA 5A3UA 2ORZA 3ROUA 1WZXA 1UO9A 1SFYA 1T2XA 3RZJA 2WQZC 4O9EA 5BPXA 1RUD1 2XUMA 2XH6A 4XFHA 2R6QA 1CAUA 4Y24A 1IQAA 1QKQA 2XJSA 5JVVA 2XR4A 1KEXA 2WNOA 1XE8A 2QTWB 1W39A 3GZAA 3HN3A 2QKDA 1E5HA 2BNOA 4IQPA 3W9AA 4CCNA 4Z1VA 5BV6A 2JDMA 1VBA2 2ES3A 3J7NA 3H1WA 1YYNA 2XWBB 3ALQA 4AGGA 2H6BA 2VGDA 4CE8A 5IYYA 3I54A 1JOPA 4TTGA 2Y6GA 2IXLA 2ARXA 4FFIA 2GSYA 1MEC3 3DXTA 3PUSA 4X8PA 3MO4A 1XNAA 2DCKA 3BIWE 4QHZA 1TMF2 1ULGA 2E53A 4NWWA 1ACCA 4D3WA 4KH9A 2XKPA 3RRDA 5HV0A 3KWVA 4MLOA 4MXVA 3UKTA 2RM23 3RFRA 1EUUA 2GN3A 2HWC2 1W8WA 3RVHA 2HEYF 4Q26A 3FN9A 5FUPA 5FZLA 5CFDA 4E4HA 3B01A 1S4CA 3T3YA 5F3IA 1GKBA 1AR82 5FUNA 1UCXA 5K4LA 1ZX5A 1CZVA 1HRV1 2HWF3 4YGDA 1SPPA 1US3A 4XAAA 2DF7A 1NKGA 3OBAA 3KGZA 4MXWB 3TN91 1Q8QA 1IOAA 1J3RA 2HWB2 3FX3A 5IK8A 1QU0A 2DU1A 5A6QA 5C4WC 2QZ2A 2WC2A 5J48A 2OUJA 2XJPA 3KT7A 2PHLA 1UZWA 3UKVA 4F7ZA 5D1IA 4N90A 4XBLA 1UYPA 4IESA 4FOYA 2A3XA 1ASJ3 3TWIA 1Q3EA 1YWKA 4IV1B 1ZZBA 2JECA 1RUJ2 1W6NB 4IEXA 5FFOC 3VBRB 1V6JA 5DZGA 4LA3A 4Z2WA 4Y20A 4IV3A 3VBHA 2CSGA 4B8EA 2D40A 4XZPA 4XMAA 1DIWA 2E32A 3RYPA 3GCWA 5DAWA 5FZCA 1ZREA 5FZ4A 1DGWX 3NJVA 5IVCA 2GMPA 3CEWA 5JI9A 2X5IC 1UMZA 2DVFA 4L8QA 4YRDA 2BRTA 5DUXA 2VW1A 1WBFA 2QJVA 4PI2A 3WHUA 5BNPB 4LEJA 2HH9A 4QM9A 5T5LA 5JIUA 2MNGA 4KU7A 1UN1A 4PLMA 1FNZA 3F95A 3RDIA 4Y1XA 3VKNA 5DXDA 5D8AC 3JD71 3UETA 1UOJA 1JYTA 5DDJ1 1DF0A 4R4XA 1OLMA 5CKQA 1HXS1 2O0OA 1UY3A 5EP9A 4MGTA 5DUUA 2HJIA 1I3HA 4WVMA 1BBT2 3VHPA 3AC0A 3J4UH 2UY8A 1REEA 3WSOA 2FDFA 4XFGA 2H6CA 1W8NA 5FWJA 2CGNA 4N43C 4NN0A 5JZGC 2RR12 4QX3A 4AR2A 1UY4A 4QPGB 1VE0A 2VCBA 3MV11 3HVDA 4YG3A 5C3RA 3CZJA 3NW4A 3PIJA 4Y3OA 3WP3A 1OOPB 2F17A 2OYZA 1RUC3 1H4HA 4YW6A 4M3CB 2NM1A 1VBA1 2V5DA 2GNMA 3CJXA 3H0OA 4GMP3 4GQ7A 5KWRA 2OS2A 4UW4A 4IW3A 5SV8A 1AHSA 2W1SA 5FZDA 2PQSA 1SHWB 3POEA 3WVJA 4FFFA 3IM0A 1H8TC 1JODA 1DG6A 3FLRA 4EYUA 1NG0A 5FYSA 4OUEA 2NN8A 5F2SA 2JDZA 3VUOA 1WA4A 1QXJA 2F6BA 2XUEA 3M3IA 3NAPB 4Z07A 1TMF1 3T09A 4BIFA 4YM3A 5LEKA 3MZHA 4U2AA 2RS33 5C9AA 4R8HA 1LCLA 1OURA 3MF9A 3VKLA 2VTFA 1JOJA 2ZEYA 2WFF2 3CKHA 5FTTC 2RDSA 5LCWL 2HWC1 5KXDA 4KWJA 5C8CC 4GJYA 4OHZA 3RJ2X 1WMFA 4KQ7A 4B4PA 4Y5TA 3RZHA 1APNA 2Q0AA 2VOKA 2ZXQA 3WR0A 1HJGA 4QX2A 3T1LA 4RGGA 1V6MA 2ZGOA 4AI2A 1UWWA 1JHNA 3KM5A 4XDQA 5FZAA 1J3QA 1KS5A 2E33A 3H3UA 3OGVA 1TZOA 1C5IA 1X36A 3RQ0A 1F9KA 2Q5TA 2OA2A 3CMGA 3ZXAC 5FZ8A 1H9PA 1RUE3 3LDRA 2A3YA 2UY9A 4LK7A 4LKDA 4AQTA 4LUMA 2BVBA 2Y60A 1Q43A 1SQ4A 1HB3A 3ORJA 2VZ1A 4S2GA 4K8FA 4YW5A 3HT2A 3SXWA 3ZYJB 5GALA 4AI1A 3AB0A 4LIVA 4QX8A 2RV9A 1W8UA 2Y26A 2XWJB 4GB32 3ABZA 4N53B 4KG8A 5A32B 4RS5A 1RUJ1 4ATFA 4HG6B 3MW2A 3U4SA 4CCDA 1W2NA 5F5CA 1WLWA 3RNSA 5AVPA 1QHDA 3KV9A 4MADA 1VBC2 5HI0A 1UYXA 4L2NA 5AC91 1RUI3 4QB6A 1YHFA 1UD1A 5F5AA 1R64A 4OZXA 2Z69A 4CDWB 2Z42A 5CEHA 3MICA 4LE3A 1J1LA 1COV2 1JOBA 4RL7A 4URTA 4BZ4A 3W5NA 1NA1B 3OPZA 2DCJA 1AL0G 4EE2A 5EYYA 4AEDC 2R072 1DZQA 2LTNA 3UK9A 3HJRA 4B1LA 1Q8OA 2YBKA 1DFQA 3K4AA 3VDDA 4PIXA 1CX4A 5IAXA 2J42A 3D82A 3R6SA 2VUJA 3K48A 1LEMA 5T55A 1G7YA 1N1VA 4XFIA 4GH4C 3AJYA 4HXCA 3AKPA 4AGVA 2O1QA 2Q30A 3LZZA 3H8RA 3AKSA 3HPNA 3BOPA 3N35A 1RIRA 4LBMA 4IDZA 4B29A 1RHI2 3AZYA 1NXMA 3PHMA 1EAH2 3WP4A 1ST8A 1QJX3 2D3RA 3KSCA 4XCAA 1GR3A 4YG0A 4AXOA 1PZ9A 4UFKA 4K40A 4W50A 4E4ZA 3MDPA 1GWLA 1WW5A 1LGNA 4ZU4A 3ZFFB 4NROA 2VOXA 2R063 2D5HA 5A7QA 1LTEA 4EWAA 2EAKA 4WZFA 3D4KA 2CGPA 2J22A 2I2SA 3J26N 3QH6A 1ZM1A 3HN1A 2VUAA 2YV8A 1QNWA 1LNSA 1BXHA 1JHJA 3KD4A 1AYN3 5IVJA 2P5BA 3CJIC 4AHYA 2WFF1 1S0IA 4UW5A 4COYA 2YBSA 2IFRA 3POYA 1TNFA 1F8VA 3A0KA 2VCCA 5FP3A 3LSDA 1UY2A 1GWMA 3AZWA 1DZTA 2QDNA 3U37A 3MIEA 2YBPA 3MI8A 3WD5A 5A1LA 2ADEA 1VBE3 1SFNA 3HNMA 3VV1A 2PTMA 3J8F2 3K75B 1BZWA 3FFQA 3R05A 3SEEA 3S7IA 3VZJA 1XE7A 1EPZA 3I8TA 3PNAA 4GKYA 5SV5A 1E5IA 1MVEA 1D0HA 4DY5A 1MS5A 2YFZA 4XF3A 4DZGA 1D4M2 3AXDA 2WZR3 3LQCA 3GDBA 4IEUA 4XABA 4H2AA 3POGA 2D43A 3VD9A 1EUTA 3WUCA 4QB1A 2D97A 4HKLA 5A6ZA 5JOXA 1AYM3 1V9U2 3LF7A 2HWD2 3C7HA 5FYBA 1ZRDA 1RJ8A 4JGYB 1OHFA 1V00A 2GALA 4QPIC 4CEYC 4NHLA 2RJLA 1SEFA 3OGJA 2BERA 1ULCA 3DF0A 1H2NA 2P34A 2VQ0A 2DUQA 2W95A 1B35C 3AMPA 4Q0VA 1J3PA 4HN1A 2W1WA 1VBC1 4JAAA 4IEVA 5AFBA 1OD3A 4FPEA 1MZ6A 4K8RB 3OUJA 5C4WA 3UESA 1O59A 1LOBA 5FZOB 5A33B 1H2MA 1W99A 1OQDA 3JU9A 4C90A 2PA7A 3OBZA 1ODMA 5GZCA 1POQA 2AREA 2W39A 2YGLA 5J09A 1F2NA 3WLUA 1F4HA 2E63A 2R071 3OY8B 1RMU3 3BALA 5H9SA 4CDQB 1OF3A 4DXZA 1POV1 2GN7A 1ZZ8A 3GZEA 1FI2A 1V6OA 1T6GC 3ME2A 3FFZA 3WNMA 2RMU2 1XRUA 2ZGTA 4I02A 2C6SA 2YFUA 1EYBA 3RMXA 2VNOA 4XZUG 1C28A 4RR3C 4XF0A 2X5IA 2WA4A 2VULA 4UF0B 5DZEA 2PELA 4I0AA 5DABA 4QWNA 1HIXA 5B2GB 1MS3A 1RHI1 3BN6A 4XUTA 5JMCA 3L9JT 1EAH1 1UX7A 5EPAA 4FCAA 2VVEA 5D8AA 4A4AA 2ZX0A 4N7UA 1NAEA 1QJEA 2YZ4A 2JEMA 2GH8A 3AP9A 5T5PA 3WNPA 3A22A 4KG0A 4YSFA 3HBKA 3MGUA 3C2UA 1PGL2 1HN0A 2AZ5A 2W46A 3THPA 1NCRB 3M8LA 1N3QA 4DUVA 1WKYA 3N9LA 5FO7B 4HK8A 4KGQA 5L9VA 3IT8A 1S0FA 3DGTA 4N43A 5LA9A 5JZGA 5FYMA 4RHV3 2G9GA 3OBRA 2KD7A 2MEV2 2R042 5BNNB 1IZ3A 1UNBA 2DBNA 2DUOA 4DEVA 1UKGA 3W5MA 3P3PA 1SMVA 4JGZC 5FMOS 4Y1ZA 1AXYA 3Q8CA 5JR7B 3RZLA 5EIYB 3VZKA 1H6XA 1G8WA 2JWPA 4I2OA 4GKXA 3RPQA 4LULA 5T54A 3P6BA 4Y5Z0 1URXA 4RQPB 5FY0A 4A7ZA 4IXLA 2R32A 1QNYA 4XYXA 2DURA 5FR3A 1YFXA 4CA9A 3J8F1 1AL21 1J84A 1H8TA 5F5IA 3RGBA 3V0BA 3E1F1 3HQUA 2I45A 4Q4V3 3P3NA 4D94A 4MGIE 3BTZA 1QDCA 5LBBA 5JWPA 2I74A 2K2SA 1YCIA 3IWZA 3H7YA 1D2QA 2JE8A 4R9BA 1NLSA 5LK5A 1D4M1 2C1FA 2O8QA 5GLZA 2CWSA 2WKKA 4JVAA 4IETA 1PO22 4TSVA 5LY2A 3I3MA 4TYSA 1S0EA 1DU3D 4NAOA 4MO3M 4A2UA 1SBDA 5BY5A 5IVFA 1QJFA 2RE9A 4UYBA 1ND3C 3I59A 3KV5A 5C8CA 1PVC3 1IS3A 2ZX4A 1MQTC 4Q8KA 4S2HA 1M06G 1IHMA 5I0SA 4D69A 5CKNA 3NQHA 5FPAA 4BLIA 4ORFA 5GZGA 1UIKA 5EJZB 1O3SA 4XXAA 2VM9A 3USUB 2D6LX 2YU2A 5D21A 4AG4A 4LBJA 4TN7A 3K77A 4HETA 1EY2A 2W3JA 3ETQA 3LFMA 1DLLA 3H8UA 1CZSA 3M3OA 2QE3A 3TEWA 3LPGA 3NL1A 2YPJA 4M01A 4DS0A 3U0ZA 1VMJA 4FPFA 1W6PA 3H8OA 1PNFA 4LIUA 2RS11 1SLLA 2X29A 3ZMOA 2PHUA 3MIFA 1ZVFA 4A7KA 4EQVA 2GZWA 3WDVA 3FHAA 4RN5A 3WDYA 2DDUA 2SLIA 2C26A 5LASA 1XNTA 4XOGA 5FYHA 5CG8A 4FPKA 5GZFA 3T2OA 3ZXFA 3DXUA 4FQZA 4CP9A 4CU7A 4AQ2A 4BQXA 3Q8BA 3N7KA 4FXGB 4F3JA 2J1UA 3U4XA 3DYPA 1S0BA 4XBQA 2Q8DA 2BFUL 2BGPA 1GUIA 1VAMA 1G86A 3LEKA 1F15A 4MGQA 2XJRA 4AEDA 1U5IA 2VD7A 2D7FA 5J36A 1FOD2 4LBLA 5B4NA 5LRSA 4I0BA 2VJXA 1PGL1 2R49A 1KJRA 1BEV2 4DUWA 1JU4A 2PN5A 4XJUA 1TME2 4JCKA 3SEPA 1PO12 4HZFA 2C5DA 3OG2A 1QXRA 1X8MA 4GH4A 5FPLA 1UX6A 1NZIA 4LITA 4XEZA 2MEV1 2CNAA 2R041 1LODA 3L2YA 4ITCA 3OF1A 1PZ8A 4XE9A 3K3NA 4D6RA 3GHMA 5L7OB 1DGRN 1F35A 2YGMA 2ZKNA 4M0NA 4EZ4A 1JU3A 1O4TA 1OKOA 2FHRA 3RJRA 1F31A 4WBBA 3KCYA 2B45X 2QUOA 2ZHMA 3ZIXA 2P17A 4DPNA 4FPCA 3O1VA 3INAA 2ZZQA 4PJYA 3FHIB 5CAZA 1K5JA 3KQRA 3HNYM 2IC1A 1YI9A 1FPN3 2ZPXA 4Q8LA 5JXJA 4FFGA 5LA1A 2ADDA 3T2PA 4CSWA 5IUQA 3HR9A 1WD4A 4BXFA 3K4ZA 2OQ7A 3WW1A 4INDA 4Y33A 3VN4A 1W9SA 2D5FA 3CJIA 2AYHA 4D8MA 1UMHA 2CYFA 1C4RA 3LFIA 4JHTA 5L73A 5I0UA 3TBDA 3JXSA 1M4WA 4N8MA 5K0UC 4NR1A 2WSUA 3HQXA 4COZA 1JW6A 3M2MA 4NIAA 3ZKUA 3IKWA 1RUF2 3NNJA 3THCA 2AUYA 4IGOA 4UAPA 4AVTA 1RUH2 2FZ1A 2WO1A 3AMHA 4YARA 1KGYA 4XUQA 1DP0A 4Q4Y2 1YO8A 3SCFA 2E7QA 3BTYA 1OPOA 4LBQA 2JDKA 1X33A 2TBVA 2NLRA 1GOHA 5L9RA 1PM7A 5FOBB 2QQUA 4SBVA 1C8NA 2ZAAA 1I9RA 3ZXEA 2DBIA 2HWE2 1H1MA 2JE7A 4BMEA 1LHNA 2NPIA 5DUVA 2WWJA 4QPIA 1VRH1 5CBLA 4XHBA 1KXGA 4CEYA 3ZLIA 1TVGA 4Q1RA 4MVTA 4BXSV 1CD3G 4Q2FA 1O4ZA 3VD7A 3H42B 1B35A 4AVVA 1W0NA 5FO9B 1W90A 5FJHA 1LOFC 1R091 2WLPA 3I3EA 4OHVA 5CNAA 1QOOA 2FDJA 4FPOB 1POV0 2AH2A 2ETEA 2GP5A 2E26A 2W91A 2PYTA 3LPFA 2BTVC 4WV8A 2P6HA 1Y9GA 5FK8A 5FP7A 4OUMA 2XMLA 2C9KA 4Q1PA 2WRAA 4LKFA 2OUHA 2WNUC 4ONUA 1QJU2 2ZEWA 2CV6A 5LW9A 2XONA 2AENA 1MEC2 3LA3A 3CF6E 1VMFA 4HSJA 4NMIA 1FOD1 3MFAA 3ZN6A 1VBB2 2ZHKA 1YIFA 2DTYA 1BEV1 1RJ7A 1RUG2 4KMQA 1XNDA 4V1PA 5CFCB 1QF3A 1CAVB 2VMIA 1TME1 3WP5A 1PO11 3M3EA 1K5MC 1ONAA 1VAVA 1BYHA 4RR3A 1CQ9A 2IXKA 2J1VA 3WG2A 1QIQA 2A7AA 2AACA 1W0PA 2QVSB 3LDKA 5FQ0A 1NE4A 4N7IA 1LHVA 1FMD3 3PUHA 3ZYFA 5F37A 1N3OA 4LBNA 2X09A 3LB9A 3M7AA 2BVVA 3VZOA 2D98A 4GZ9A 2HWF2 1JZ6A 3DKWA 1RXGA 5FY7A 3SITA 4CCJA 5ABJC 1OFSA 4HPKA 4JX0A 4P5YA 3MEPA 4QX5A 2WZEA 1YXWA 4Q4W3 2JENA 2F4LA 2X53S 4U36A 4XURA 2JIGA 3FLTA 2NQYA 3MLJA 1S2BA 4CDXC 3ZO0B 3O0VA 5C5UA 2P6CA 3KB5A 5JUVA 1PGSA 4J25A 3VBFC 1SDWA 2B4KA 1IGOA 4LHNA 4K3UA 4QKFA 5JLVA 4NRPA 5GZEA 5FPZA 1U5XA 4Z2AA 1R082 4OYUA 4HMZA 4JGZA 4OHXA 1AF9A 3ATGA 1W6MB 1MS4A 1UPSA 5BNOB 4MHUA 1MPXA 2VBPA 3T4HB 3ZMNA 1O3RA 1L7RA 2BWAA 5FXXA 1AR62 1W6QB 4CZSA 1RUF1 2JG9C 2F4PA 3DUIA 4UFIA 4LHKA 4XCBA 3WQ0A 5DN2A 4BQ5A 1RUH1 1XQNA 5DUWA 4AYUA 1QQP2 1GV9A 2JDPA 2VZSA 2XXZA 4AHZA 3EO6A 3BPZA 5E8AA 4Q4Y1 1ZBA1 3SLIA 4XTPA 3GZTB 4KNCA 2WYSA 1Q8SA 5FIXA 5J3UA 2MPFA 4HSLA 2B8MA 2QFEA 1X8EA 1GFF2 3KGLA 1AJOA 3POFA 3LEGA 4PF5A 1CAUB 1H1AA 3EJKA 1CAWA 1UY1A 2DFCA 2GDFA 3DN7A 4KWKA 4R9CA 2Y6KA 4YNIA 3WCRA 3LCPA 1A8DA 2WWUA 2HWE1 1GQPA 3HWJA 4WM7C 4KL1A 1ND3A 2EXIA 4A3ZA 3WF0A 4BQ2A 2BOIA 3FLPA 4PLOA 1MQTA 1ENSA 1N1SA 2XL7A 1CJPA 2CDPA 4QXHA 4M3CE 1A8MA 1HDKA 1L7QA 2EIBA 4YVWC 4MGSA 1SLTA 1OC1A 1LGCA 4XW3A 4GWMA 2N7GA 2YPDA 1RUC2 2TNFA 1DGLA 3T2TA 4COWA 3SH4A 5FO8B 2BPA2 3I4IA 3VBOC 3ZPOA 2WFPA 1D7PM 3S5QA 1SBEA 3MPPG 1RUD3 5A3MA 5CFDB 3HNBM 5HXMA 1QJU1 4IERA 2Y64A 3EBRA 2PHRA 1JMUB 5LY1A 4DXTA 1EP0A 3WXPA 2JD4A 1VBB1 2B9UA 1ZNPA 2V73A 5FZ6A 5F2WA 1YEWA 3LEMA 3VKOA 2XVKA 1SPPB 5FWEA 1RUG1 5FPBA 5IW0A 4XTMA 5I93A 2FD8A 4L0PA 1S2KA 1PIV1 1PX3A 1RINA 2R0HA 2RJKA 5GLUA 2I07B 2P37A 3K46A 5F3EA 1D4VB 1UPIA 1REFA 1OVSA 1SG3A 2HEVF 3PLQA 1JZ4A 3UKNA 5F7UA 2CAUA 2VZRA 1W9YA 3VHRA 4Y5SA 4DNYA 1JYVA 4FFHA 4XFFA 2Z5WA 3SH3A 1KD7A 2QQKA 2HWF1 4X6QB 5K0UA 5KHHA 2C4XA 5E6HA 1QMJA 2PFWA 1UZ0A 5FMBA 1Z7S2 1AR92 3WQ1A 1AZDA 4FPLA 5LBCA 3BTAA 5G04L 4A41A 4QMAA 4LO4B 4Y20B 2OXBA 2RJ2A 4IV3B 4UFJA 3VBHB 4AL9A 3E6DA 1GOFA 3ACLA 4LO8A 2JB8A 4AFMA 3DKQA 2OQ6A 4Y26A 5F6KA 3AMMA 3ZM8A 3ZYPA 1RUE2 4FQ4A 4COUA 3JBG2 1PVXA 1R081 3AXEA 3MF6A 2ZEZA 1OT5A 1CPNA 1S1AA 1S2EA 4ES9A 2G9FA 3IDCB 1WD3A 2YU1A 1AR61 1WGPA 1ZRFA 2WBKA 4BQ1A 4WVMB 1AXKA 1QQP1 2YC2A 3HMYA 4LBQD 1RYYA 3POJA 3RZGA 2VOTA 3I2KA 2CTVA 3H3ZA 3PDQA 1BLZA 1UF2C 1CIWA 4JV4A 3VB9A 1RXFA 2GNBA 1IPSA 3DPRC 2XLGA 2Y6LA 1OF4A 5FYYA 3ITQA 3FUQA 1HKDA 1ZZ9A 2WQ4A 1QEXA 2PHDA 1VPHA 2JX9A 3PMEA 2ZGPA 1AR72 4YW3A 5CYYA 1Y3TA 3KHBA 5L9BA 2YMZA 5DG1A 4EN7B 4FAGA 5FBZA 1GZWA 1HN1A 2BWCA 3OSDA 5C70A 4XQWA 2JDYA 2YDEA 2B46X 3W21A 1AX0A 5H9QA 3AP5A 3T0DA 4HLTA 3K3OA 5LEJA 4OI0A 4EN8B 1EV12 3O1RA 2UWAA 5CB7A 3JD73 5DDJ3 4C0BA 1HXS3 1FV2A 2ZJCA 2DVDA 3HEIA 5C9AB 1LU1A 1RUC1 3GBFA 3ES4A 2DCTA 1IG3A 4XIKA 2ZAHA 4AAXA 2W52A 3W58A 4CP2A 2Q1MA 4BWOA 4MV2A 4OFGA 3NRUA 2PQQA 1QJY2 3ECQA 2R062 2OW4A 3RWNA 1LECA 1G9FA 2WS93 3CL1A 3MIHA 1V6NA 3O7OA 5EV7A 4FPJA 2ARCA 1ND2C 4A6OA 2P1BA 3BCWA 4YGBA 5FAXA 4JTNA 1VBA3 4P9GA 1LOFA 4BQ3A 2W68A 4NIGA 2B5HA 3SMHA 2VR4A 2E7AA 5HV4A 3VBSC 2LROA 2RDQA 4FTEA 5F6LB 3TEXA 3SNMA 1NZCA 2JXAA 5C33A 1WW7A 1ZYBA 3GXUA 2VMCA 5EFUA 1DQ2A 3IDBB 2PHTA 3AZZA 3WV6A 3X29B 1AR81 2VMDA 5A3WA 2WNUA 4FOQA 1TMF3 1VBE2 4E4SA 1Z0HA 3RWKX 5F5QA 3IIAA 5FP8A 2IVJA 2R30A 4R4ZA 4BE3A 2HWB1 5JXHA 1ZA7A 1VBD3 1AR91 1Z7S1 4RS5B 4W4ZA 1CONA 3WX5A 1H30A 3VKFC 1PK6C 3GYDA 3J7MA 3ZFGC 2ZGKA 5A1AA 2WZR2 2XB6C 1K5MA 2ZGMA 3M1HA 2WDBA 2VZTA 4I3GA 1T6BX 1WMXA 3VGIA 4LORA 4NHXA 4CCLA 5FMDA 1RUE1 1ZZCA 1AYM2 3JBG1 4YW1A 2D3PA 4LKEA 2ID4A 5A7NA 1JS9A 3AMQA 2WAAA 3SKVA 5A70A 3AL5A 3WDXA 1GP6A 5ABJA 3O12A 3VDDB 1JBCA 2AGSA 4UFMA 3VKMA 1FATA 1R1A3 5BUVA 2D44A 4IEPA 5FYCA 5T5OA 1LU2A 4CDXA 4DY3A 3KQ4B 2UYAA 1JZ2A 5EQUA 3IMMA 2SBAA 4NHMA 3VBFA 2C0ZA 2PLV3 3BUCA 1N3PA 1DQ4A 1PMJX 1WA6X 2YUEA 4HN0A 4QT6A 2QQPA 4BQYA 4Q29A 1RUJ3 4XFAA 5A7WA 3WDUA 4GXLA 4UFLA 4XC9A 4OZOA 5GLVA 2GC3A 1LJ7A 3SKJE 4CP1A 4XETA 1AR71 1RMU2 3NJYA 1E57A 1BBT1 3QBQA 4UXAA 5AC93 1R1ZA 2VW0A 3I7DA 4AEJA 4NIHA 2BBVA 1P8JA 2JG9A 4LOTA 4ZHNA 2RR11 5FZMA 4BMBA 3WDWA 5IK7A 3LIGA 4Y4RA 1UAIA 4PIYA 1EV11 1W2TA 4I09A 3BPSA 3CBNA 2IXIA 4QXCA 3GJBA 4MOAA 2EVXA 4S2FA 1QH7A 1O91A 1W8HA 2A6XA 3C7EA 1OKQA 3JZVA 1CN1A 5M0TA 3WF2A 4JKLA 1LEDA 4WM7A 2DCZA 2W9XA 4A45A 2AEYA 4P9XA 4UI9L 5LA0A 1QJY1 1Q5OA 5EJ3A 3WDTA 1S0GA 4IE7A 3ACIA 3I97A 4AFDA 2Y34A 4NIIA 3O1UA 4CXWA 4AFAA 3EHKA 4M3CF 4YVWA 2QQLA 4MGKE 3B3QE 5F9TA 3S5AA 4P00B 1JXNA 1W8FA 2WABA 1REDA 1UXXX 3ZYGA 1RUOA 3JB8A 2W92A 1YQ8A 4E9KA 2FCVA 4BOWA 1JZ8A 4J6GA 4Y22A 2V5YA 3VBOA 2A5ZA 4FPGA 3VBUC 3ZXLA 1NYWA 5DQ0A 3WUDA 3WZ1A 3PU8A 4LPLA 1VBE1 1CESA 4AOCA 1NCQC 5EXOA 3I2HA 4CVUA 2DCYA 1O8PA 1YFWA 4JQRA 4TWTA 1YC61 4Q4V2 2CAVA 1DQ1A 3O5SA 1C8M2 3ZSJA 5DAVA 4AEMA 2O14A 1WW6A 5ISLA 2A6ZA 2CY6A 1Y7BA 4JTOA 4CXXA 1IQDC 4RD7A 2WO2A 3POWA 5HCHA 3WEZA 4GWIA 1XXNA 1OA3A 2ZTNA 1SDDB 2ERFA 2Y0IA 5FKCA 4CRQA 5C4WB 2FDKA 2JG8C 1AYM1 4ZZ5A 3S6PA 3UT0A 1W04A 3NO8A 4GB31 4Y4YA 3U14A 1OPMA 3PIGA 3UGHA 5FP9A 4LO7A 5LK7B 4YPJA 1GYKA 2YC4A 1ODNA 1VAKA 2VZOA 4LO5B 2QQNA 4BHPA 4E2QA 3AYDA 5A7PA 1RITA 1TQ5A 5KC5A 1DHKB 2WNVC 4GJZA 2OVUA 2XPJA 3E6CC 2VU9A 2QNKA 3SISA 4GALA 4NE9A 3BIEA 2UYBA 3B9IA 3GBGA 4Q0SA 2FDHA 1VMHA 1WMDA 3N9QA 4NUBA 3LOIA 2PMWB 3V0AA 1COV1 3ZDVA 5HCBA 3FBMA 3O1MA 4MHRA 4UBGA 1XSRA 2X5IB 3W59A 1LOAA 5FZHA 1IS5A 3PUAA 4ZXKA 3FUOA 2YC0A 3UNPA 1LKNA 4BYYA 4AQSA 1RMU1 1ENRA 2J7MA 1UU5A 2ZS6B 5D8AB 2WO3A 1MS8A 4QQPA 3MIDA 5A7SA 1G9BA 1G9DA 4E8CA 3DYOA 1GMMA 4LT5A 3E5UA 3GZUC 4QQ2A 3OGGA 3PUIA 3PVNA 1FXZA 2R073 4N43B 2UWBA 5JZGB 3N7LA 1A6CA 3DPRA 4C91A 4OMCA 2YHJA 3RG0A 4PBPA 2O8OA 1OA2A 1VLNA 1LRHA 2W47A 4MGZE 1TG7A 5JIAA 2E9QA 4D7TA 3P5BA 4PQQA 5FZEA 4DO0A 5BYNA 5JR2A 4H7LA 1JH5A 4GMP0 3IPVA 2PHFA 4X8NA 4ZY9A 1CX1A 1W6OA 1UL9A 1X7NA 1I5ZA 2RDRA 2ZGSA 2QBXA 3ZYBA 5IATA 1I1EA 3DL3A 3TNQA 3V56A 1RHI3 4C1WA 3A4UA 3ZFEC 1J59A 1EAH3 1H8TB 1VRBA 2IVIB 3H9AA 5J1XA 3V0BB 2QQWA 3VDBA 4K1YA 2JIJA 4XJAA 3ETPA 1GZTA 2J1EA 4RGKA 2A6WA 4IUGA 2ARAA 2GC1A 2W94A 3MUZ1 5IK5A 2A3WA 1NLQA 3JB4C 4WZCA 3UJQA 1FX5A 3KVAA 5AVAA 3EMRA 4CEWC 5C8CB 3I59B 3AVSA 2XLFA 2WIIB 5ERLA 1UU6A 5CZKA 3MW4A 2DVGA 4PLNA 1ND2A 4UW6A 1VJ2A 5FZ1A 3LA2A 1YIPA 1C8M1 5FZGA 2B42B 4BCUA 4CCKA 2WQ8A 4KBZA 1XU2A 4LHLA 1WMEA 4H14A 4YVSC 3VBSA 5FZKA 1XBFA 3N9NA 5C3OA 1V9U1 2Y38A 4QDRA 2HWD1 4TLFA 3J8F3 1AL23 2DYCA 4YM0A 1BVP1 2HKXA 4XVHA 1CAXA 3I3QA 3QACA 3Q8AA 1G6NA 1SFPA 4CDUC 1KDMA 2DFBA 4NHKA 4PDWC 5C3SA 3H8XA 2P2KA 4QQLA 1NXD1 1QOSA 3ZSEA 1D4M3 3S30A 4EV0A 3FJSA 3VDAA 1W6PB 2FZ2A 3ASIA 4IGPA 1HRI2 4P08A 4DFSA 4I3PA 2R16A 4HVQA 1PK6A 3VZNA 2GNDA 3N7MA 3MV01 3KV6A 5LB6A 2WT0A 4Q0PA 4QKNA 3TNPB 3ZFGA 2OZ6A 3BVCA 1JUIA 3T4VA 4CP9B 1RGSA 5C3PA 1JYIA 1W3VA 1JYNA 2ZABA 1UQXA 2A71A 2OPWA 2X8KA 4IEYA 4M00A 2RMU1 1DQ0A 4META 4WM8C 3A0NA 4AEDB 4L9BA 4CUAA 3TEZA 3FC0A 2VUCA 3AP4A 4DEQA 5A3TA 3ZSMA 2Z79A 1V6LA 3NV4A 3CZUA 2YG0A 1YLLA 2XJVA 3ILFA 1V6KA 1ULFA 3U07A 3NKTA 1G9CA 1VB4A 4OHWA 3ENRA 4GH4B 2RS13 4JKKA 2A6YA 5EYXA 3CLPA 1IKQA 1VALA 3BU7A 4YZ2A 1J83A 2VO5A 4AFCA 5JPNB 4C0HA 4FOVA 4O9GA 2FMDA 5F1RA 3B5LB 4FO9A 4P9JA 4PT6A 3OD0A 3ZN4A 4Q4X2 3THDA 4O7XA 3WT3A 4Y1YA 1N47A 4UW3A 1DGRA 1TNRA 2XL9A 3ES1A 1UOFA 2V4VA 4XBNA 4LR4A 4BK4A 3EQEA 4QX7A 3AP7A 1MACA 2D6NA 3GBWA 3OB8A 5H9RA 5GLWA 5E89A 4NIDA 3IDAA 2NYYA 1NOVA 4QAWA 5DG2A 1GZ9A 1XOYA 5CG9A 1YQ6A 5IVVA 3ZYIB 2XJQA 2VPVA 5FLIA 4DRRA 3WCSA 3CJIB 2VVDA 4ZS2A 4CTEA 1X50A 4XPVA 3EXUA 1QXPA 1W2OA 4AW7A 3D0SA 1ZBE2 4TZDA 2MEV3 2ZMNA 2R043 1LULA 4FXKB 4WVVA 3TAYA 4YGCA 1KFXL 5HPOA 1Y4WA 3KLSA 2ZX1A 2BQPA 1NUKA 1HV0A 1PO21 1FNYA 1CJDA 4LBQB 4BJ0A 3DCQA 3ZN5A 2E7TA 2JE9A 1YNAA 4LUKA 3ZXGA 2QDRA 3F2ZA 2EAAA 3VBUA 4IE5A 5FY1A 3MLLA 2PAEA 1LB2A 4IV1C 2WT2A 4KWLA 1NCQA 1SLCA 3C7OA 4PHZA 3HT1A 1GSLA 1F4AA 2B7YA 3A23A 4QPIB 3VBRC 1HW5A 3AYEA 2V72A 3GF6A 4LTAA 3WY6A 4CEYB 4DIQA 5KHJA 1HRI1 1X82A 2OT7A 4LBKA 4GIQA 1B35B 5FZ9A 5I8SA 3LOBA 2BV4A 1W8OA 4GD4A 5J7MA 3WNLA 1OVPA 3OEAA 3IAPA 5BNPC 2JJ6A 4W65A 3MFCA 2A6VA 3O1PA 4LNVA 3ZYHA 4B1MA 2JG8A 4ZXEA 1UU4A 2Y33A 2V4AA 4W6WA 2CHHA 3DYMA 2B9VA 4QDQA 3LE0A 3ST7A 3Q8EA 3USSA 3O0WA 4YW7A 3FZ3A 4G4FA 1V6IA 2ZZJA 1AX1A 1IS6A 3U75A 1SLIA 3AFGA 4AI9A 5BNQA 3O1OA 4XJ8A 1VP6A 4LK6A 2NZ9A 5FRAA 3ZN6B 5ACA3 2WNVA 2HLEA 3D6EA 1MVQA 4NO4A 4V2WA 4C8DA 5A3LA 4IE0A 2VL4A 3IZOA 1Q8VA 1UYYA 2EXJA 4QPGC 5E16A 1PMHX 4YW2A 1UZVA 5HCAA 4H55A 1VRH3 3CNAA 3ACGA 3O0XA 1WCQA 1BCXA 3N3HA 4RR3B 5EWSA 1OOPC 5FY4A 5FQ0B 3CO2A 1CPMA 1R093 2ZGUA 2OZJA 1K45A 2BGOA 4QM8A 2BYVE 3TRSB 3E5QA 2E6VA 2Y6HA 3AP6A 3QH7A 2BEOA 4HKOA 2LM3A 3BODA 4OI2A 2W2IA 4AF9A 4M0HA 3G7DA 4HPKB 3WF3A 4Q4X1 3BTXA 3ZSKA 2RM22 2WO7A 3A21A 2ZKLA 1TE1B 3UYJA 1IPJA 2FCUA 3NAPC 5I8TA 4K20A 4BM8A 3AYCA 4JZRA 3DEMA 3RI8A 3WG3A 3A7QA 1FOD3 3WNXA 4ASKA 1OH4A 4I0WB 3NKGA 1H9WA 5JOZA 1C1FA 2E31A 1JYCA 2ZGNA 1QWRA 1BEV3 4KBBA 4XF9A 4BA6A 2JDUA 4XFCA 5KXCA 1RVF3 4JGZB 2EALA 3VD5A 1TME3 3LWCA 1PO13 2BU9A 1PX4A 1HLCA 2GU9A 1ZBE1 4FT8A 1HQLA 1C57A 4QU1A 1BHGA 2JICA 4AVSA 3OPWA 5FZIA 3ZFEA 1WWYA 1ASJ2 4M4PA 1GWKA 4FBFA 1A3KA 3NNGA 1OLME 4QGLA 1CZTA 2VAUA 3BI3A 2VQUA 2UURA 3NNFA 4IEWA 1MS1A 1CAWB 3EB7A 3MIBA 4CP0A 3PVOA 5KXBA 3IAQA 4IE6A 5L36A 2BDRA 1GU3A 4LLOA 4CEWA 3N36A 1ND3B 4N53C 1BJQA 1K42A 3DECA 4QDSA 1CGPA 3B9CA 2DWRA 4ZPIA 3V64A 5A6XA 1MQTB 1ULPA 4FI9A 1OUXA 3Q9OA 2BW8A 2XBO3 5K8SA 2IWGB 2RS53 1JUHA 3VLBB 4EN6B 4EWDA 4NPRA 4KGGA 2CWMA 3ELNA 5IK4A 1UIJA 5A80A 4PCRA 4YVSA 3NVCA 2XG3A 4CDWC 5I0TA 1LOGA 2IXCA 2ATFA 1RUH3 2DV9A 3V65A 2JDHA 4RFT0 4W8JA 1NA1C 3W20A 1ZBA3 3J9SA 3TEYA 5JXIA 4NAMA 1JYWA 4LLFA 4QXKA 4CDUA 4ARXA 4PDWA 4OI1A 1WW4A 3OYWA 5GLTA 3T0AA 3WNKA 5KHIA 1W03A 2WJSA 4Z8BA 1G9AA 3S57A 4FP3A 1A78A 1GLHA 2AC1A 3OUHA 3JD72 5FUIA 1HQWA 5DDJ2 4IL7A 2HWE3 1HXS2 3NNLA 3NV1A 1GNYA 1OXCA 3AL6A 1QY4A 5A3NA 4UOJA 3VL8A 2ZMLA 4YZ1A 1MZEA 3IMNA 1XNKA 2ZOEB 4K21A 3AYAA 1MEC1 4AEKA 5JOWA 4CCEA 2P3YA 3RSJA 2WS92 4A6SA 4Q0QA 1QDOA 4CPBD 1OD5A 4UBHA 2NMNA 3PUQA 2WSVA 5LRRA 5I91A 4WM8A 2RS32 3ZFFC 4HKWA 2R7EB 3MPBA 2XOMA 2WNEA 5C8WA 2JKBA 3ACHA 4NWVA 4AE2A 3AKRA 3O1TA 5FYZA 4PI0A 2PHWA 2RM21 2VBDA 1UZYA 4NJ4A 5JXGA 4DXRA 1AX2A 1QJU3 3B02A 3ON7A 3CHXA 3I2JA 3IB3A 4L97A 4P02B 5FMOL 1O8SA 2JDAA 4MUVA 4MZUA 4FPYA 4P9IA 5E1RA 1VBB3 3WG1A 1GP4A 5IJRA 5F8PA 4ISQA 1RUG3 2Y6FA 4HT1T 3CDZB 4TLGA 2BBAA 2H0BA 2W5FA 1PIV3 1LOEA 2ZGQA 4HOOA 4RGAA 4GAZA 3C7GA 3PURA 1VBD2 5F3GA 1PZ7A 2G19A 1UZZA 3OGSA 4LA2A 4P9WA 3AK0A 3WQBA 1UW8A 3QOPA 1HRV3 4HFSA 2RDNA 2ZBJA 1DCSA 2OIIA 1ASJ1 4AGRA 5FOJB 4NVPA 1JI6A 3MYXA 1GQGA 4JDNA 2A73B 2XVLA 5FZFA 3TN93 1L7LA 4EWEA 1YJKA 4G9SB 2IUWA 4NPMA 4XFBA 1DDLA 3B69A 4MSVA 2K0GA 2JD9A 2LALA 2J1RA 4HVOA 1IPKA 5J37A 5K0UB 5FK7A 2J1TA 4JGYC 2QZ3A 1RUI2 1R1A2 1GZWB 1LESA 4E8DA 4D7YA 3MUY1 3RS6A 3T08A 1R083 3GGLA 1BK1A 4EROA 3NWKA 4MXWA 2PLV2 2HBUA 4IEQA 2LW8A 2Z2SB 4UWDA 5T5JA 3ZKYA 4DB5A 3I2FA 1W9FA 2HEWF 2VH9A 2X05A 2Q4SA 1AR63 4O61A 4E4DX 4H3WA 5FY8A 4AHXA 2W08A 3HD8B 3WW3A 5AC92 1QQP3 2VXRA 5FXVA 4L92A 2VZUA 2WINB 3ZIWA 1OSGA 1W2AX 3Q8FA 1GOGA 4K9SA 1HB4A 4IV1A 3PVBB 4S2DA 1W6NA 4ISRA 3K4DA 1K12A 3VBRA 1ALYA 4KWUA 4CDQC 1MS0A 5K9YA 1ENQA 5JDBA 5LZ6A 2ZA9A 3PTRB 4B3NA 1N1TA 1Q56A 3UGGA 4BB3A 3AMNA 1QJX2 3KVBA 4LJHA 5C5TA 4IEOA 4GMP1 2VMGA 2XQXA 3ZR5A 1KJLA 5BNPA 2W1UA 4DXSA 1PHMA 2ZMKA 1GNHA 1H2LA 1Y9QA 5GZDA 2DTWA 3KS7A 3IBMA 3D3AA 2FMYA 1MR5A 1COV3 1ULOA 3RYRA 2WS91 3GHNA 2WNUB 1H6YA 2A75A 2BFUS 2W0XA 2RS31 1AYN2 1NCRC 3OCPA 5A3PA 4YZ3A 1DQ6A 2VTXJ 3KF5A 5DMYA 4JDMA 3OOXA 1LAJA 1KITA 1JN2P 5KXEA 4QPGA 4OQ9A 3M70A 3LA7A 5LA2A 1ULDA 2VY0A 5BNNC 2VZQA 1K5MB 2KXLA 2RHPA 4GWNA 5IVEA 1KS4A 3B93A 1LENA 1OOPA 2VNGA 2VCMA 1U12A 1OBNA 4M3CA 3C7FA 4C1XA 1PM4A 4P9LA 4RQPC 4COVA 3H7JA 4M4RA 2YB7A 2HWC3 1NX9A 2D3SA 2KR2A 1WBLA 3TOJA 3I3BA 2YXSA 4CCMA 4ZKTB 1U5YA 1VBD1 1GBGA 1UXZA 1YQ2A 5ABJB 4J1WA 5A6YA 1W9WA 3ZOIA 1HQNA 1W05A 1AR83 1W06A 2VE1A 4XUNA 5EHDA 3UJOA 1EPWA 4NRQA 5CKMA 3NAPA 2IXJA 4CDXB 2VZ3A 2GMEA 3U78A 3U10A 2H0VA 2FCTA 1GANA 4JQTA 2JKXA 2D6PA 1RL3A 3LEIA 3VBFB 4ARYA 1OFNA 2BUKA 3WOGA 3R4DB 3AX4A 2HWB3 1Z7S3 1AR93 1W2UA 2XQRA 5A7WB 1B09A 4XDPA 3MLKA 3ZR6A 5FZ3A 1JTZX 3RZKA 2R1DA 4ZONA 4N9HA 4ES8A 5C7GA 1YFYA 1RUI1 3KCCA 2DU0A 1R1A1 3C3VA 5IVBA 5LWBA 1QOTA 2JB4A 2JG9B 2GH2A 3JBG3 3M3QA 4D7SA 4HANA 1OQ1A 2QQOA 4WVZA 2PLV1 4AHWA 4G3YC 4I01A 2XJTA 3BB6A 4QQOA 2ILMA 3N9PA 2ZX2A 3RYKA 4GA9A 1WCDJ 3GNEA 1GP5A 1XE0A 3JUUA 2QCSB 1OLRA 3KMHA 5FMCA 3KHCA 1RC6A 2WLQA 4RFRB 3KT4A 2V09A 1BK0A 1O5UA 4LKSA 4B7EA 3S7EA 4WM7B 5F32A 4N53A 4ET7A 5A32A 4FTBA 1KDKA 3GALA 4P14A 3ZVXA 2VC9A 2EF6A 1I6XA 3PMSA 1KFUL 4RYDA 1SLAA 3WQ7A 1AR73 1WLTA 1BBT3 3AJZA 3R4UA 4YVWB 1QJX1 4D6QA 5KHGA 1RB8G 3MIGA 5FV3A 4CDWA 5IAVA 4XDOA 1FV3A 4DINB 5DZFA 3N4MA 2RR13 2FBEA 3D8CA 2IFWA 3WF4A 5JSPA 4AZZA 1NA1A 2R061 4Y22B 3VBOB 2JDNA 2WZ8A 1EV13 3POIA 4YG6A 1OUSA 1GZCA 4BK5A 5L19A 5GM0A 1FYUA 3BU0A 2BGCA 1C3HA 4RHV2 5LBEA 2P4EA 2VMFA 3KV4A 1O7FA 1AYN1 5LBFA 3I2GA 4YZ4A 4YWAA 4BLJA 2HYKA 2ZCWA 4OLLA 2VVFA 4ZZ8A 1IS4A 2P3KA 5IWFA 5A1FA 2GAUA 1QJY3 4AAPA 2VECA 4AVCA 1S55A 1UOBA 5FYVA 2MHFA 5L7OC 4A44A 1HV1A 1UKRA 1F5FA 4BISA 2WFF3 5JSRA 3BKZA 4FVVA 5FP4A 3AZXA 3SHRA 3LKJA 2ZHNA 4GULA 1FAYA 3E97A 2EIDA 4P9YA 2VCAA 3M4FA 3ZFFA 1K3IA 2Q8OA 3NJXA 2D6KA 2WZR1 2QQJA 5JMOA 3I49A 2Q1ZB 4BPZA 3D5OA 2BOJA 1JZ5A 1NY72 3U11A 4YM1A 1PVC2 3WHTA 3PTYA 1QJZA 1AL22 3T2QA 4AI8A 2IXHA 1HB2A 1TEIA 5CADA 1DLCA 3FBYA 3V0AB 3S0MA 1NE6A 3U1XA 5FLJA 2OKXA 2P3JA 4PBOA 3N9MA 1H1IA 2EXHA 3JQXA 3OD4A 2DVBA 4QHOA 4O65A 5EZWA 1GNZA 1S0CA 4ZU7A 5JSOA 1DGWA 1C1LA 2G9ZA 4R9DA 4XUOA 5DAQA 1WCKA 3WF1A 2WUHA 4FSJA 1U5ZA 4XF4A 1DQ5A 4EN9B 4FAHA 4CXYA 4ASMB 2R1BA 4SLIA 4QXBA 4QPYA 2GP3A 1XU1A 4GB33 1CWPA 4CUGA 2A70A 1MZ5A 4QD2A 4QPWA 1HB1A 1XNBA 3PVEA 2J1AA 1VBC3 2BNMA 2WN3A 1ULEA 2BP6A 2VXJA 3DPRB 3IIIA 2AEZA 1QH6A 3H1MA 5IFTA 5J98B 3PU3A 4H7MA 1V0AA 4XQDA 1YI7A 3QLQA 3R0RA 2XDVA 3OTFA 4JGYA 4AWDA 2ZHLA 2GC2A 3NV3A 3IN9A 3N9OA
chains in the Genus database with same CATH topology
5I0RA 4XILA 5HBAA 3IPVB 4F8AA 1W6OB 2GC0A 2CL2A 3KCXA 1Q8PA 3ZDSA 1POV3 1PMIA 4XXPA 2RS12 2XKOA 2XHKA 1OI6A 4OUSA 3WW4A 3E6BA 5A33A 1MS9A 1PNGA 4HBNA 4X6RB 2WA3A 1PGW2 3ZPYA 2PHXA 4QGNA 3OY8A 5CU1A 2PAKA 4B7KA 4BH9A 4EN0A 4RHV1 2TUNA 4CDQA 1QGLA 5CFCC 4YFWA 2ZGLA 4FTSA 1ND2B 4LBOA 4K7JA 5HXVA 3VBSB 2TEPA 4AVAA 5CVRA 2VMHA 3AFKA 1FT9A 4BIOA 5KHKA 2XGXA 2D93A 1CAXB 1FPN2 3L2HA 4XF1A 2DUPA 4Q4V1 3VZMA 3ZYRA 4QHBA 4W6YA 2VW2A 1VIWB 3THTA 3ILRA 1H4GA 4KU8A 1NCRA 4P5HA 5FDBA 3APBA 3SCHA 4N9IA 4FOWA 1NY71 3HIFA 2CGOA 3N7JA 3O14A 1PK6B 1PVC1 3ZFGB 5BNNA 1CR7A 4AQ6A 4JC1A 1SACA 3ZXKA 3LAGA 5BNOC 1C8M3 4K6BA 4B4QA 4RQPA 3LSEA 3SH5A 4XQ4A 2AR6A 3AKQA 1Y43B 4YFZA 1V9U3 3WW2A 4I30A 2HWD3 3LGRA 2WZPP 5CA6A 1BMV2 2EA7A 2XJUA 1WCSA 2ENRA 3AM2A 4MH0E 1F5JA 2R0FA 4AFBA 3QD6A 2FQPA 3URFA 1RUNA 3IDEA 5T52A 5FREA 1KRIA 4YLZA 3I2DA 2P3IA 3OBTA 1SBFA 4B4RA 3E5XA 5ACA2 3DV8A 5FLHA 4Q0UA 5J96B 1VRH2 1BKZA 3USUA 2D6MA 3ZSLA 2RMU3 2XVGA 3K51A 3POSA 1N1YA 1VB2A 1R092 1VR3A 2VG9A 1OQEA 3VZLA 3NV2A 4XMIA 4WVWA 1YRZA 1U0AA 4HVRA 5K7PA 1PGW1 4HL0A 5CFDC 3AKTA 1LOCA 4MX3A 2ET7A 1DZRA 4OHYA 2VOWA 5C6CA 3ILNA 1J1TA 1H2KA 1FMD2 1WLDA 3MW3A 4YW4A 1CVNA 4OI4A 5T3NA 1O5LA 3TB0A 2XLAA 1RVF2 2YYOA 4Q4W2 1SCSA 5JAXA 3KT1A 3VBUB 4RA0A 1H8VA 1FPN1 4YZ5A 3OJBA 4YM2A 2BNNA 3UL2A 4PIZA 2VQAA 4IEZA 3HAGA 1NCQB 2DVAA 4A7YA 2VOVA 3H50A 4IV3C 3VBHC 4AI0A 3G6JB 5GJ6A 1O3TA 1XNCA 3M3CA 1RTVA 2NP0A 4OULA 3AZVA 4QQHA 3UV9A 1H0BA 1ZZ7A 3CU7A 1ENXA 4DMIA 1XYOA 5L7OA 4XIOA 3QCWA 2Y0OA 2JG8B 1PO23 4AI3A 2PAMA 2XBO2 2RS52 1SCRA 1DBNA 5TSWA 4W6XA 5JI7A 3T1MA 2YROA 5E88A 4AK3A 4DRVA 1ZRCA 1AXZA 4R52A 1BMV1 1LR5A 2WNVB 1V70A 1OA4A 3RI9A 5JOYA 2EIGA 1HX6A 2E51A 1LHOA 4L99A 4YYOA 1ZBA2 3B7MA 4XJWA 4E2GA 3JQWA 1HRI3 4FPHA 4ASLA 2WWSA 3ZX7A 1AJKA 2ET1A 2ZGRA 5JPMB 1NQJA 3ZXJA 4F83A 1L3JA 4YGEA 1AUYA 4XHXA 2ZX3A 5H9PA 5ACA1 1YJLA 3BOWA 1SLBA 2WL1A 3RMYA 4QU2A 1RUD2 3NJZA 1MZFA 5C9AC 3B94A 2VNRA 3TYJA 2NMOA 2KA3A 1BVVA 4E27A 3WP6A 4Y1UA 3H1YA 4JRAA 1WUVA 3RZZA 3VHNA 5AFEA 4Z92B 4JDOA 4AVBA 2ZACA 2GNTA 1D0GA 5BXXA 1D2SA 5KBFA 4OVEA 5IT6A 4E2SA 1Z78A 1J58A 4MGYE 4Q27A 3WG4A 4NOTA 1AVBA 1FMD1 4K1ZA 2GMMA 5CIRA 1DYPA 2G4IA 3ZFEB 2LUWA 4XJZA 1BQPA 1LHWA 1NQDA 2OPKA 3B00A 4Q4X3 1RVF1 4DQAA 1ZA4A 1PIV2 2EXKA 1OMIA 4Q4W1 3FWEA 1YUDA 3ZXDA 1WLCA 3WINE 2K9ZA 4CEWB 4XJ9A 5T50A 1HRV2 4RS5C 4A3XA 3PJYA 4MYEA 3HBZA 5CFCA 1GICA 4PQ9A 2D6OX 1CAVA 3TN92 1W0OA 5FCCA 1DYKA 4Y1VA 2IZWA 4ZU5A 2B39A 4L11A 1ZBE3 1S0DA 1O3QA 4YVSB 3VL9A 5GKAC 1GQHA 1LGBA 3R4SA 4Z82A 1KQRA 2UU8A 1ZZ6A 4QGMA 3PJQA 4FP2A 3NSTA 3FMGA 4CDUB 1XYPA 3SCGA 2XBO1 4PDWB 3VDDC 1ZRRA 5I8YA 2RS51 3OYWB 2ARBA 2UWCA 5HCFA 4EJRA 4J1XA 1RUF3 4CYDA 3D0JA 2WT1A 5FPXA 5KC6A 1IKPA 1OLQA 4Q4Y3 3JCIA 1C5HA 4LE4A 4LO6B 1LHUA 3KZ4C 1W6MA 1YFUA 4HK9A 5BNOA 2KM2A 1O4YA 2C9AA 4DOUA 4JRLA 1W6QA 3FE5A 4RSUA 4R9AA 1S0JA 4ATEA 4WM8B 5JCTA 1XYNA 2YY1A 1NLRA 3VHOA 3ROUA 1SFYA 2WQZC 4O9EA 5BPXA 1RUD1 2XUMA 2XH6A 4XFHA 2R6QA 1CAUA 4Y24A 1IQAA 1QKQA 2XJSA 5JVVA 1XE8A 1W39A 3GZAA 2QKDA 2BNOA 4Z1VA 4IQPA 3W9AA 5BV6A 5K9YA 1VBA2 2ES3A 3H1WA 1YYNA 2XWBB 3ALQA 4AGGA 2H6BA 2VGDA 3I54A 2IXLA 2ARXA 2GSYA 1MEC3 4X8PA 2DCKA 3BIWE 1TMF2 1ULGA 2E53A 4NWWA 4D3WA 4KH9A 2XKPA 3RRDA 4MLOA 4MXVA 3UKTA 2RM23 2GN3A 2HWC2 2HEYF 4Q26A 5CFDA 3B01A 1GKBA 1AR82 1UCXA 1ZX5A 1HRV1 2HWF3 4YGDA 2DF7A 3KGZA 4MXWB 3TN91 1Q8QA 1IOAA 1J3RA 2HWB2 3FX3A 5IK8A 1QU0A 2DU1A 5C4WC 2QZ2A 2WC2A 5J48A 2OUJA 2XJPA 3KT7A 2PHLA 3UKVA 4F7ZA 5D1IA 4N90A 4XBLA 4IESA 4FOYA 2A3XA 1ASJ3 3TWIA 1Q3EA 1YWKA 4IV1B 1ZZBA 2JECA 1RUJ2 1W6NB 4IEXA 5FFOC 3VBRB 1V6JA 5DZGA 4LA3A 4Z2WA 4Y20A 4IV3A 3VBHA 4B8EA 2D40A 4XZPA 4XMAA 1DIWA 3RYPA 1ZREA 1DGWX 2GMPA 3CEWA 5JI9A 2X5IC 1UMZA 2DVFA 4L8QA 4YRDA 5DUXA 2VW1A 1WBFA 2QJVA 3WHUA 5BNPB 4LEJA 4QM9A 5T5LA 5JIUA 2MNGA 4KU7A 1UN1A 4PLMA 1FNZA 3RDIA 4Y1XA 3VKNA 5DXDA 5D8AC 3JD71 5DDJ1 1DF0A 4R4XA 1HXS1 2O0OA 5DUUA 2HJIA 1I3HA 4WVMA 1BBT2 3VHPA 3J4UH 2UY8A 1REEA 4XFGA 2H6CA 2CGNA 4N43C 4NN0A 5JZGC 2RR12 4QPGB 4YG3A 3NW4A 3WP3A 1OOPB 2OYZA 1RUC3 1H4HA 4M3CB 2NM1A 1VBA1 2GNMA 3CJXA 3H0OA 4GMP3 4GQ7A 5KWRA 4UW4A 5SV8A 1AHSA 3WVJA 3IM0A 1H8TC 1DG6A 3FLRA 1NG0A 2NN8A 2JDZA 3VUOA 1WA4A 1QXJA 2F6BA 3NAPB 3M3IA 4Z07A 1TMF1 4BIFA 4YM3A 5LEKA 3MZHA 4U2AA 2RS33 5C9AA 4R8HA 1LCLA 3MF9A 3VKLA 1JOJA 2WFF2 5FTTC 2HWC1 5KXDA 4KWJA 5C8CC 4OHZA 3RJ2X 1WMFA 4KQ7A 4B4PA 1APNA 2Q0AA 2VOKA 3WR0A 3T1LA 4RGGA 1V6MA 2ZGOA 4AI2A 1JHNA 3KM5A 4XDQA 1J3QA 1KS5A 3H3UA 1C5IA 1X36A 3RQ0A 1F9KA 2Q5TA 2OA2A 3ZXAC 1H9PA 1RUE3 2A3YA 2UY9A 4AQTA 4LUMA 2BVBA 1Q43A 1SQ4A 4YW5A 3ZYJB 4S2GA 4K8FA 3SXWA 3HT2A 4AI1A 5GALA 3AB0A 2Y26A 2XWJB 4GB32 4N53B 4KG8A 5A32B 4RS5A 1RUJ1 4ATFA 3MW2A 1WLWA 3RNSA 5AVPA 1QHDA 1VBC2 5HI0A 4L2NA 5AC91 1RUI3 1YHFA 1UD1A 4OZXA 2Z69A 4CDWB 2Z42A 3MICA 4LE3A 1J1LA 1COV2 4URTA 4RL7A 4BZ4A 1NA1B 3OPZA 2DCJA 1AL0G 5EYYA 4AEDC 2R072 1DZQA 2LTNA 3UK9A 1Q8OA 1DFQA 3VDDA 4PIXA 1CX4A 3D82A 3R6SA 2VUJA 3K48A 1LEMA 5T55A 1G7YA 1N1VA 4XFIA 4GH4C 3AJYA 3AKPA 4AGVA 2O1QA 2Q30A 3LZZA 3AKSA 3BOPA 3N35A 1RIRA 4LBMA 4B29A 1RHI2 3AZYA 1NXMA 3PHMA 1EAH2 3WP4A 1QJX3 2D3RA 3KSCA 1GR3A 4YG0A 4AXOA 1PZ9A 4K40A 4E4ZA 3MDPA 1WW5A 1LGNA 4ZU4A 3ZFFB 2VOXA 2R063 2D5HA 4EWAA 1LTEA 2EAKA 4WZFA 3D4KA 2CGPA 2I2SA 3J26N 3QH6A 1ZM1A 3HN1A 2VUAA 2YV8A 1QNWA 3KD4A 1BXHA 1AYN3 3CJIC 4AHYA 2WFF1 1S0IA 4UW5A 4COYA 2IFRA 3POYA 1TNFA 1F8VA 3A0KA 3LSDA 3AZWA 1DZTA 2QDNA 3MIEA 3MI8A 3WD5A 1VBE3 1SFNA 3VV1A 2PTMA 3J8F2 3VZJA 1BZWA 3FFQA 3R05A 3S7IA 1XE7A 1EPZA 3I8TA 3PNAA 4GKYA 5SV5A 1MVEA 1D0HA 4DY5A 1MS5A 4XF3A 4DZGA 1D4M2 3AXDA 2WZR3 4IEUA 2D43A 3WUCA 2D97A 4HKLA 5JOXA 1AYM3 1V9U2 2HWD2 1ZRDA 1RJ8A 4JGYB 1OHFA 1V00A 2GALA 4QPIC 4CEYC 4NHLA 2RJLA 1SEFA 3OGJA 1ULCA 3DF0A 1H2NA 2P34A 2VQ0A 2DUQA 3AMPA 1B35C 4Q0VA 1J3PA 4HN1A 1VBC1 4JAAA 4IEVA 5AFBA 4FPEA 1MZ6A 5C4WA 1LOBA 5A33B 1H2MA 1OQDA 3JU9A 4C90A 2PA7A 5GZCA 2AREA 2W39A 2YGLA 5J09A 1F2NA 3WLUA 2E63A 2R071 3OY8B 1RMU3 3BALA 5H9SA 4CDQB 5JSRA 4DXZA 1POV1 2GN7A 1ZZ8A 1FI2A 1V6OA 1T6GC 3ME2A 3FFZA 2RMU2 1XRUA 2ZGTA 4I02A 1EYBA 3RMXA 2VNOA 1C28A 4RR3C 4XF0A 2X5IA 2WA4A 2VULA 5DZEA 2PELA 4I0AA 1HIXA 5B2GB 1MS3A 1RHI1 5JMCA 3L9JT 1EAH1 4FCAA 2VVEA 5D8AA 2ZX0A 4N7UA 2YZ4A 5T5PA 2JEMA 2GH8A 3AP9A 4KG0A 4YSFA 3MGUA 3C2UA 1PGL2 3THPA 2AZ5A 1NCRB 3M8LA 1N3QA 5FO7B 4HK8A 4KGQA 3IT8A 1S0FA 3DGTA 4N43A 5JZGA 4RHV3 2G9GA 3OBRA 2MEV2 2R042 5BNNB 1IZ3A 2DUOA 1UKGA 3P3PA 1SMVA 4JGZC 5FMOS 4Y1ZA 1AXYA 5JR7B 3VZKA 1G8WA 4I2OA 4GKXA 3RPQA 4LULA 5T54A 4Y5Z0 1URXA 4RQPB 4A7ZA 4IXLA 2R32A 1QNYA 4XYXA 2DURA 1YFXA 3J8F1 1AL21 1H8TA 3V0BA 2I45A 4Q4V3 3P3NA 4D94A 4MGIE 1QDCA 5JWPA 2I74A 2K2SA 1YCIA 3IWZA 3H7YA 1D2QA 4R9BA 5LK5A 1NLSA 1D4M1 2C1FA 2O8QA 5GLZA 2CWSA 2WKKA 4JVAA 4IETA 1PO22 4TSVA 4TYSA 1S0EA 1DU3D 4A2UA 5BY5A 1SBDA 2RE9A 1ND3C 3I59A 5C8CA 1PVC3 1IS3A 2ZX4A 1MQTC 4Q8KA 4S2HA 1M06G 1IHMA 5I0SA 4D69A 4BLIA 4ORFA 5GZGA 1UIKA 1O3SA 4XXAA 3USUB 2D6LX 4AG4A 4LBJA 4HETA 1EY2A 3ETQA 1DLLA 3H8UA 3M3OA 2QE3A 3NL1A 2YPJA 4M01A 4DS0A 3U0ZA 4FPFA 1W6PA 1PNFA 2RS11 1SLLA 2X29A 3ZMOA 2PHUA 3MIFA 1ZVFA 4A7KA 2GZWA 3WDVA 3WDYA 2SLIA 4XOGA 5CG8A 4FPKA 5GZFA 3ZXFA 4FQZA 4AQ2A 3N7KA 4FXGB 4F3JA 3U4XA 1S0BA 4XBQA 2BFUL 1VAMA 1G86A 2XJRA 4AEDA 1U5IA 2D7FA 5J36A 1FOD2 4LBLA 5LRSA 4I0BA 1PGL1 2R49A 1KJRA 1BEV2 2PN5A 4XJUA 1TME2 4JCKA 1PO12 4HZFA 2C5DA 1QXRA 1X8MA 4GH4A 1UX6A 4XEZA 2MEV1 2CNAA 2R041 1LODA 3L2YA 4ITCA 3OF1A 1PZ8A 4XE9A 3GHMA 5L7OB 1DGRN 2YGMA 2ZKNA 4M0NA 1O4TA 2FHRA 3RJRA 1F31A 4WBBA 3KCYA 2B45X 2QUOA 2ZHMA 3ZIXA 2P17A 4DPNA 4FPCA 3INAA 2ZZQA 4PJYA 3FHIB 5CAZA 3KQRA 2IC1A 1YI9A 1FPN3 2ZPXA 4Q8LA 5IUQA 3HR9A 1WD4A 3WW1A 4INDA 3VN4A 2D5FA 3CJIA 2AYHA 2CYFA 1C4RA 3TBDA 5L73A 5K0UC 5I0UA 1M4WA 4NR1A 2WSUA 3HQXA 4COZA 1JW6A 3M2MA 3IKWA 1RUF2 2AUYA 4AVTA 1RUH2 2FZ1A 3AMHA 4YARA 4Q4Y2 1YO8A 3SCFA 2E7QA 1OPOA 4LBQA 1X33A 2TBVA 2NLRA 1PM7A 5FOBB 4SBVA 1C8NA 2ZAAA 1I9RA 3ZXEA 2HWE2 1H1MA 2JE7A 4BMEA 1LHNA 2NPIA 5DUVA 4QPIA 1VRH1 5CBLA 4XHBA 1KXGA 4CEYA 4Q1RA 4MVTA 1CD3G 4Q2FA 1O4ZA 1B35A 4AVVA 5FO9B 1LOFC 1R091 2WLPA 4OHVA 5CNAA 1QOOA 4FPOB 1POV0 2AH2A 2ETEA 2PYTA 2BTVC 4WV8A 4OUMA 4Q1PA 2OUHA 2WNUC 4ONUA 1QJU2 2CV6A 2AENA 1MEC2 3LA3A 3CF6E 4HSJA 1FOD1 3MFAA 3ZN6A 1VBB2 2ZHKA 1YIFA 2DTYA 1BEV1 1RJ7A 1RUG2 1XNDA 4V1PA 5CFCB 1QF3A 1CAVB 2VMIA 1TME1 3WP5A 1PO11 3M3EA 1K5MC 1ONAA 1VAVA 1BYHA 4RR3A 1CQ9A 2IXKA 3WG2A 2A7AA 2QVSB 1W0PA 5FQ0A 1NE4A 4N7IA 1LHVA 1FMD3 1N3OA 4LBNA 3LB9A 3M7AA 2BVVA 3VZOA 2D98A 2HWF2 3DKWA 3SITA 5ABJC 1OFSA 4HPKA 4QX5A 3MEPA 1YXWA 4Q4W3 2JENA 2X53S 4U36A 3FLTA 2NQYA 3MLJA 1S2BA 4CDXC 3ZO0B 3O0VA 3KB5A 1PGSA 3VBFC 1SDWA 4LHNA 1IGOA 4K3UA 5JLVA 5GZEA 5FPZA 1U5XA 1R082 4HMZA 4JGZA 4OHXA 1AF9A 3ATGA 1W6MB 1MS4A 1UPSA 5BNOB 3ZMNA 1O3RA 2BWAA 1AR62 1W6QB 4CZSA 1RUF1 2JG9C 2F4PA 3DUIA 3WQ0A 4LHKA 1RUH1 1XQNA 5DUWA 4AYUA 1QQP2 1GV9A 4AHZA 3EO6A 3BPZA 5E8AA 4Q4Y1 1ZBA1 3SLIA 4XTPA 3GZTB 4KNCA 5J3UA 1Q8SA 2MPFA 4HSLA 2B8MA 2QFEA 1X8EA 1GFF2 3KGLA 1AJOA 4PF5A 1CAUB 1H1AA 3EJKA 1CAWA 2DFCA 2GDFA 3DN7A 4KWKA 4R9CA 3WCRA 4YNIA 3LCPA 1A8DA 2HWE1 3HWJA 4WM7C 4KL1A 1ND3A 2EXIA 3FLPA 4PLOA 1MQTA 1ENSA 1N1SA 2XL7A 1CJPA 4M3CE 1A8MA 1HDKA 4YVWC 1SLTA 1LGCA 4XW3A 4GWMA 2N7GA 1RUC2 2TNFA 1DGLA 3T2TA 4COWA 3SH4A 5FO8B 2BPA2 3I4IA 3VBOC 2WFPA 1SBEA 3MPPG 1RUD3 5A3MA 5CFDB 1QJU1 4IERA 3EBRA 2PHRA 1EP0A 3WXPA 2JD4A 1VBB1 2B9UA 1ZNPA 2V73A 3VKOA 2XVKA 1RUG1 4XTMA 5I93A 1S2KA 1PIV1 5GLUA 1RINA 2R0HA 2RJKA 2I07B 2P37A 1D4VB 1UPIA 1REFA 2HEVF 3PLQA 3UKNA 2CAUA 3VHRA 4DNYA 4XFFA 2Z5WA 3SH3A 1KD7A 4X6QB 2HWF1 5KHHA 1QMJA 2PFWA 1Z7S2 1AR92 3WQ1A 1AZDA 4FPLA 3BTAA 4QMAA 4LO4B 4Y20B 4IV3B 3VBHB 3E6DA 3ACLA 4LO8A 4AFMA 4Y26A 5F6KA 3AMMA 3ZYPA 1RUE2 4FQ4A 4COUA 3JBG2 1PVXA 1R081 3AXEA 3MF6A 1CPNA 1S1AA 4ES9A 2G9FA 3IDCB 1WD3A 1AR61 1WGPA 1ZRFA 4BQ1A 4WVMB 1AXKA 1QQP1 4LBQD 3HMYA 2CTVA 3H3ZA 1UF2C 1CIWA 4JV4A 2GNBA 3DPRC 2XLGA 3FUQA 1HKDA 1ZZ9A 2WQ4A 2PHDA 5K0UA 2JX9A 3PMEA 2ZGPA 1AR72 4YW3A 4EN7B 1Y3TA 4FAGA 2YMZA 5DG1A 5FBZA 1GZWA 2BWCA 4XQWA 2YDEA 2B46X 1AX0A 5H9QA 3AP5A 4HLTA 4OI0A 5LEJA 4EN8B 1EV12 2UWAA 5CB7A 3JD73 5DDJ3