1AYN3

Human rhinovirus 16 coat protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The structure of human rhinovirus 16.
pubmed doi rcsb
source organism Human rhinovirus sp.
total genus 39
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ayn300
4N43C 1GFF2 3J8F1 3VBSB 1PGL2 1QJX3 3VBUB 2VQ0A 4QPGC 1NCQA 5C4WC 1C8M3 5BNPA 1HRI2 2RMU2 2WLPA 1POV1 1NCRC 1MQTB 4RQPB 4LLFA 1BEV1 4CDQB 1QJU1 5DDJ1 1K5MB 1VBC2 1AL22 5ABJB 2ZAHA 1IHMA 4CEYB 5L7OB 4RS5B 2WS91 3ZFEB 1PO11 2R071 1HXS3 4JGZC 1X33A 2BBVA 2BFUL 1RHI2 1VRH3 1RUF3 2WFF2 5BNOB 1ND2A 1RUH3 4EJRA 2HWD1 2RS53 1R082 1AR91 5CFCB 5J98B 4FTSA 2PLV1 1OOPC 3ZFGC 2X5IC 4WM7C 2BUKA 1R093 1VBD2 2RS33 5CFDC 1AR82 4FSJA 3IDEA 4YVWA 1F2NA 1B35C 4PDWB 1RVF3 4AEDB 1FMD1 4Y5Z0 2QQPA 3NAPA 1HRV3 2RR12 1RHI3 3VBOC 2R061 1RUG2 2RS13 2HWC1 1F8VA 1C8M1 1VBE3 1R1A2 3J8F2 4RHV1 4WM8B 1QQP3 2HWE3 4QPGA 2FZ1A 5K0UC 1R083 5C4WA 1AR73 1POV0 1NA1C 1ND3C 4JGYB 1NCRA 4GH4B 1EV12 1VBD3 2RM21 1AYM1 1AR83 1BEV2 1MEC3 4N53B 3DPRC 1QJU2 1AYN1 3VBFC 1QJY2 1WCDJ 4JGZA 2Y26A 2WS92 2RR13 1RUH1 1RUG3 2RS51 1ZBA3 4RR3B 1R1A3 1TME3 2HWD2 3LOBA 4RFT0 1NY71 5AC91 1PIV3 1RUE3 1V9U1 2RS31 1RUD1 1OOPA 1E57A 3ZFGA 1EAH1 2X5IA 2HWB1 4WM7A 4CDXC 2WZR2 1MQTC 5CFDA 4RQPC 1RVF1 4CDQC 2GSYA 1B35A 2ZTNA 1K5MC 1ASJ3 1FOD3 1QJY3 4CEYC 5L7OC 4RS5C 5A33A 2RS11 1FMD2 3VBOA 3JD71 2XBO2 5BNOC 3VBHC 1BBT1 1PGW2 1AR63 2HWC2 1TMF2 4GMP3 4RHV2 5K0UA 5CFCC 1NCQB 1M06G 5BNPB 4IV3C 1NA1A 1ND3A 2WZR3 4Q4W1 5LK7B 1AYM2 5C9AB 5D8AB 3DPRA 1PVC2 3VBFA 4PDWC 1RUI2 5BNNB 1CD3G 4AEDC 4Q4X2 4Q4Y3 4IV1C 5JZGB 1PO23 1ZBA1 3TN91 2MEV3 3VBRC 4CEWB 4Q4V1 1ND2B 1FPN2 1QJZA 2ZZQA 5AC92 1ZBE1 5ACA1 3JBG2 2R042 4CDXA 1EAH2 2DF7A 4JGYC 4GH4C 4GB31 1MQTA 4RQPA 1VBA1 1COV1 4CDQA 1HRI3 1Z7S2 2RMU3 1RMU1 1D4M2 5C8CB 1PVC3 1K5MA 4QPIC 4YVWB 4CEYA 1VBB1 1BMV1 1W39A 4NWWA 5GKAC 1VBC3 1AL23 3NAPB 1RUC1 1RUJ1 4FTEA 5BNOA 2HWF2 3JD72 3VBHA 5A32A 1H8TB 1FPN3 2WFF3 1QJX1 4N43A 5CFCA 3CJIB 5FMOS 4QPGB 5C4WB 4Z92B 4IV3A 2R043 4YVSC 3VDDB 1NCRB 1OHFA 4Q4W2 1NOVA 1Z7S3 1D4M3 1PO21 4PDWA 4AEDA 2MEV1 1HXS1 4IV1A 5DDJ2 1VRH1 1RUF1 3VBRA 3TN92 1PO12 2GH8A 2R072 3ZFFB 4CDUC 4CDWB 2HWF3 4Q4V2 2FZ2A 1PGL1 2IZWA 1VB2A 3VBSC 1ZBE2 3J8F3 3JB8A 3VBUC 5ACA2 4JGYA 1AR92 2X5IB 4GH4A 5J96B 1R091 4WM7B 3FBMA 4GB32 1VBA2 2PLV2 1COV2 5C9AC 1AL0G 5D8AC 4QPIA 1POV3 1RMU2 1VBC1 3M8LA 1EV13 5BNNC 1BEV3 1AUYA 5A33B 1QJU3 1OPOA 5JZGC 1HRV1 1HQNA 1RHI1 5ABJC 3ZFEC 2WS93 4CEWC 2R073 1VBE1 1QQP1 2HWE1 2R062 1QJX2 1R081 5K0UB 1AR71 2BFUS 1C8M2 2HWD3 1DDLA 4YVSA 1AR93 1VBD1 4BCUA 1MEC1 1AR81 2TBVA 1VB4A 2PLV3 3S6PA 5C8CC 4YVWC 3VBFB 3JB4C 2RM22 1AYN2 2RR11 1VRH2 1RUF2 1HX6A 4CDUA 1RUG1 1FMD3 1RUH2 1R1A1 1H8TC 1VAKA 1TME1 2XBO3 2R063 2HWC3 2RS52 1PIV1 1TMF3 3CJIC 3VBSA 1RUE1 4WM8C 3VBUA 4RHV3 1NY72 4CDXB 3VDDC 1R092 1EV11 1V9U2 2RS32 1RUD2 5C9AA 4Y4YA 5D8AA 2HWB2 1ASJ1 1FOD1 1RVF2 1QJY1 5BNNA 1AYM3 2RM23 4N53C 5JZGA 5ABJA 1HRV2 1AYN3 5L7OA 1RUI3 4RS5A 3ZFEA 4Q4X3 4CEWA 4CDWC 2RS12 3ZFFC 1AR61 3VBHB 4GMP1 5A32B 1SMVA 1VBE2 1QQP2 2HWE2 1BBT2 4N43B 3ZXAC 4RR3C 1AR72 4IV3B 5AC93 2WZR1 5FOJB 1X36A 1V9U3 1RUD3 1MEC2 3JBG3 1EAH3 5C8CA 2HWB3 4Q4Y1 4FTBA 4IV1B 3VBRB 4JGZB 2XBO1 1RB8G 1PGW1 1TMF1 1ZBA2 1H8TA 1TME2 3JD73 3CJIA 1BBT3 1PIV2 1RUE2 4WM8A 3VDDA 1NCQC 1HRI1 5BNPC 1OOPB 3ZFGB 2RMU1 1PVC1 4QPIB 4Q4W3 5CFDB 1ASJ2 1RUI1 1FOD2 4N53A 4Q4X1 1B35B 1AL21 2WWSA 3HAGA 1CJDA 1VBB2 4CDWA 4GMP0 1BMV2 3ZFFA 5DDJ3 5FMOL 1AR62 3VBOB 1RUC2 1FPN1 2WFF1 4SBVA 1RUJ2 3TN93 1PO13 1C8NA 2BPA2 4Q4V3 4RR3A 2XPJA 1ND2C 3JBG1 2R041 4YVSB 1ZBE3 1A6CA 5ACA3 1NA1B 1ND3B 1Z7S1 4NWVA 1D4M1 4GB33 1NG0A 1VBA3 1COV3 4Q4Y2 3DPRB 1RMU3 1PO22 1VBB3 2MEV2 1HXS2 4CDUB 2HWF1 3NAPC 1RUC3 1RUJ3
chains in the Genus database with same CATH superfamily
1ZNPA 5FPLA 3LPFA 4XXAA 1BVVA 4UAPA 2YROA 2A6WA 2W91A 3E5XA 1UZZA 1IQDC 1QJX3 1UX7A 1YI9A 2KM2A 2P17A 1TZOA 5FJKA 3O1MA 1NCQA 4ZZ8A 3BKZA 5FUNA 2VO5A 5A7PA 1RTVA 3OPZA 1HRI2 3D8CA 2Y33A 4HKWA 3A21A 2RMU2 2GC2A 2VZ1A 4O61A 3LGRA 3NNMA 1MQTB 5EJ3A 1O7FA 2ZGNA 3U07A 1SFPA 3SXWA 5LRRA 1QJU1 4LA3A 1JYNA 1K5MB 1GNHA 3W58A 4QHOA 1IHMA 1M4WA 3POBA 4RS5B 3CF6E 1PO11 2P1BA 1HXS3 4JGZC 1UZVA 4NHXA 4R8HA 5FO7B 1F35A 5HCBA 3TB0A 5C8WA 2BFUL 1OLQA 3PNAA 4MHUA 1RUF3 5DZGA 2OYZA 3J9SA 2BGOA 3WDXA 1JHNA 2D6PA 3FL7A 3I3DA 3OUHA 1KJRA 4KWJA 1KQRA 3B7MA 4JV4A 2UWCA 4ZS3A 4KWKA 3POJA 3N9PA 3WINE 5KXCA 2YFUA 4QXHA 2H0VA 3M3EA 4WZCA 2WC2A 4MV2A 4DRVA 1LR5A 4P9GA 4FTSA 3U0ZA 4D7TA 3H50A 3ZSJA 2Q1ZB 2VTFA 4W6XA 4HXCA 1X8MA 2X5IC 4YGEA 2WNVB 1C1FA 1V6JA 4LLOA 2BRTA 2VBPA 1R093 3E1F1 4YW6A 2D7FA 2XOMA 5JDBA 2JD4A 4F3JA 3IDEA 3WOGA 2YC0A 3UGFA 4XDPA 1B35C 2WR9A 2XMLA 4JHTA 1Q8QA 2PHLA 5T5PA 4EN6B 4Y5Z0 4Z82A 3MICA 5HCAA 2QQPA 1AX2A 2AC1A 2C1FA 5I8SA 2JDKA 4L97A 3KMHA 3LDRA 4AHXA 1W0NA 5JOZA 1GZTA 4FAGA 5CADA 3B02A 2TNFA 3J8F2 1K45A 1PMHX 4URTA 2D3RA 4L92A 4WM8B 5EHDA 1QQP3 2VW2A 4D6SA 2FZ1A 5K0UC 3PMEA 3T3YA 1QWRA 3D4KA 1P8JA 4UFJA 5KHJA 1PM4A 1DQ4A 2YB7A 5FK8A 2YYOA 2KA3A 5FXZA 1NCRA 2C5DA 4UF0A 1W6OA 2BZDA 3PU8A 3RZGA 4BB3A 1REEA 2R16A 4XUTA 2D93A 1IPJA 2K46A 2ORXA 1DQ6A 4FOQA 4KBZA 5KXBA 3N4MA 2CSGA 2OZ6A 1K3IA 4XJWA 5D1IA 1CVNA 2PHDA 1GANA 1WCDJ 3F2ZA 2ZOEB 4JDOA 2Y26A 2EVXA 2WS92 3CZUA 1Y9QA 3LWCA 2IFWA 5AFBA 2ZGPA 1RUH1 4LUKA 3EJKA 4FFIA 4IEQA 4EWAA 3OGVA 3OF1A 2XHKA 4FFGA 1UIJA 2RS51 3OYWB 5LEJA 2A70A 4E9KA 2WINB 2XQXA 1CX1A 2W47A 4YARA 1NY71 5M0TA 3M3IA 4LBNA 1PIV3 1DGLA 3SH5A 4E8CA 1RUE3 1V9U1 5FPVA 1RUD1 2BVBA 4XE9A 4QQ2A 3WW2A 3ZLIA 2QNKA 1GLHA 1EAH1 3K4ZA 3OOXA 2VNRA 4NRPA 1FX5A 2HWB1 1OKQA 3UJQA 1UX6A 2WZR2 3U4XA 1CPMA 5CFDA 1LEMA 4RQPC 3HNMA 4Y5SA 2A7AA 2PHTA 4X8NA 3AYCA 2GSYA 4FPCA 4XBLA 3ACIA 4QKNA 3C7GA 2NN8A 3VKMA 3WV6A 3VHPA 3WW1A 5IFTA 2AENA 4KL1A 3WQ7A 1QDCA 5FV3A 4MXVA 2VOVA 2FDFA 1QHDA 1WA4A 4HPKB 1WBLA 3JD71 2HWC2 1PGW2 1AR63 4TYSA 3HNBM 4GMP3 1AJOA 1UIKA 2V4VA 3BI3A 1CAWB 3HQXA 4XFFA 3KV5A 5LZ6A 2W46A 4Q26A 5CFCC 4A44A 5LCWL 4J6GA 2A73B 2VMCA 3BIEA 1Q56A 3VB9A 2RV9A 1MR5A 4A2UA 2E7AA 5BY5A 4XUOA 3O0XA 2WZR3 4I2OA 3LEMA 2BJSA 5A1AA 5LK7B 1LCLA 1W8WA 2ARAA 1J3QA 2PHWA 3POFA 3MLLA 1DZTA 5FZ9A 4AHYA 1UOGA 3OEBA 2A6YA 5KHIA 1OFNA 4XF9A 2WABA 4AEDC 2ZHLA 4Q4Y3 4DUVA 4BIOA 3LIHA 4CCDA 5L9RA 1IS5A 3ZKYA 3I4IA 3THPA 2ENRA 2HBUA 4AGGA 3VBRC 3KHCA 1GQPA 3CLPA 1YC61 3ZM8A 3DYPA 4BZ4A 4LKDA 1DQ2A 1NUKA 2ZGSA 1UYZA 3AMPA 1ZA4A 3BU0A 5FZDA 4XPVA 1QJZA 2BNMA 4MGQA 5AC92 4IEXA 4QGNA 4LBKA 2PA7A 5H9PA 2ZHKA 3RI8A 2BOJA 4I30A 1W8ZA 2YUEA 1B09A 1YQCA 4JGYC 2DF7A 1FYUA 4GALA 1MQTA 4GH4C 4XQWA 3RPQA 1VBA1 3H7JA 1COV1 3VDAA 4Y33A 1QEXA 3AXDA 1GP6A 2W1SA 3U10A 1RMU1 4AI3A 5C8CB 4TLFA 1K5MA 3S5QA 1W9YA 1CZTA 1MS0A 1U0AA 4QWNA 3VKLA 2AEYA 1H2NA 1MVQA 4ARYA 3I3MA 2VE1A 4NWWA 4Q1RA 4UW4A 3LDBA 1VBC3 2YFZA 3BOWA 5CIRA 1UOBA 1RUC1 1OFSA 1IKQA 1LODA 4XIOA 4FOVA 2VMIA 5BNOA 2V5DA 3VBHA 5IVJA 3FUQA 3WY6A 5A32A 4HN0A 3ZXFA 3I8TA 4YZ3A 5A6ZA 4MH0E 1CAVB 2WFF3 4ATEA 1IG3A 2VCBA 1QJX1 4YWAA 2A3YA 2UYAA 4N43A 3CJIB 4IUGA 5FMOS 1KJLA 2O14A 5C4WB 4QMAA 2W92A 2ZGKA 3WW3A 2QZ3A 4GXLA 5HXVA 5I0TA 4GQ7A 4IV3A 3HMYA 1ZZ9A 3MYXA 3WCSA 3UKNA 5AFEA 1X8EA 4B4QA 5G05L 1UY2A 5L19A 2OUJA 1G7YA 1H1MA 1QIQA 2IXLA 1PO21 1EPWA 4I0WB 2RJKA 4XTPA 3ZMNA 4EROA 2Z79A 1XU1A 2MEV1 1HXS1 3AZZA 4FFHA 3LEGA 4IV1A 3O12A 5F39A 4AGRA 5A6YA 2BERA 5FZ3A 1HIXA 4YRDA 1RUF1 1K12A 4EZHA 1TE1B 5JWPA 1H9WA 1WMXA 2V72A 4CDUC 5GLVA 4HL0A 4Q0QA 5FYMA 4Q4V2 3IT8A 2L9LA 5IVYA 3FFZA 2CAUA 5FAXA 1IPSA 2JKBA 1MS4A 2VVFA 2PHXA 2IZWA 1VB2A 1LOAA 3UJOA 2PFWA 2BNOA 5EV7A 3ZXLA 3VD7A 3JB8A 4JZRA 4K20A 4D94A 3SQOA 2J1SA 4QT6A 3CJXA 1HJGA 1R091 1VPHA 4YG0A 1W8HA 2PLV2 3IPVA 1QJEA 2XJTA 4KU8A 3N7KA 1WMDA 1OLMA 1GP4A 3M8LA 3WQ1A 1EV13 4XMAA 5C3SA 1BEV3 1EPZA 1JZ8A 2P6CA 3WF0A 4MVTA 2ZX4A 3WNLA 5JZGC 5JUVA 3MV01 3L2HA 3ITQA 4QM8A 5FZMA 1E5SA 1MPXA 1YIFA 2DVFA 2G9ZA 4IE5A 4QKFA 4QQLA 1ENXA 4COWA 4A7ZA 1LENA 1LHOA 1QQP1 2R062 4FOYA 5FYCA 5IW0A 2PTMA 4D0QA 4XJAA 4NE9A 3VKFC 1W9WA 3DF0A 2I45A 1ZZ6A 3OGGA 3I2FA 4QGMA 2ZEXA 4U36A 4BE3A 5GZGA 2JE8A 5FLJA 5FY4A 3M1HA 2K0GA 1AXYA 4WVZA 5FYIA 2PLV3 4EQVA 2WNVC 2IXIA 2JB8A 2E51A 2EIDA 3VBFB 1YHFA 5E89A 2P4EA 2RM22 1WMFA 1SLAA 4F83A 3ST7A 3Q8FA 4H7LA 3ZVXA 1YFYA 4BQ4A 4MG2A 3ZIWA 1F4HA 1VRH2 3N9OA 5A3PA 1OD5A 2XLAA 4YG6A 5A3OA 1F31A 2P2KA 2ZJCA 2CGNA 1SPPB 4CU7A 3IN9A 1O4ZA 2VXRA 4NUBA 4XFHA 2C6SA 3WNKA 2R063 2CAVA 3B01A 1PIV1 1TMF3 4KG8A 3VBSA 1RUE1 4LUMA 2BU9A 4IE6A 4JDNA 4EWDA 5FYHA 4WM8C 3VD3A 2WT0A 2Q1FA 1PHMA 3GZTB 3AP9A 3VDDC 1WKYA 1KGYA 1UWWA 3CKHA 2RS32 4YLZA 2KD7A 2XDVA 5F37A 3SCGA 2JB4A 2ORZA 4O7XA 1XNBA 3DXTA 1LRHA 4M01A 2EA7A 1NE4A 2IC1A 4GWIA 4AVTA 1RVF2 1YJKA 2LW8A 4DUXA 5FKBA 1AYM3 1YRZA 2RM23 4P9XA 1OBNA 1BK1A 2ZACA 2PAEA 1YQ2A 1W0OA 2VGDA 5ABJA 1HRV2 5L7OA 1EY2A 2VULA 1OQEA 4YW2A 2Q8DA 4WVMB 5FMDA 4AVCA 2X53S 5JMCA 2RS12 1ULDA 4D8MA 1AR61 3VL9A 2A6VA 2HYXA 2YC2A 4GMP1 2FDIA 3APBA 4FFFA 2LUWA 2WO1A 4I3PA 4UFHA 4DEVA 4UOJA 2ZMNA 3POEA 3RZJA 1BBT2 4S2HA 3H1WA 1UY1A 1URXA 4XF0A 1T6BX 4E4DX 3N35A 4DZGA 4ZU7A 2DTWA 3PIJA 2X8KA 2D44A 2WZR1 5FWJA 3BB6A 1YEWA 2QUOA 5E6HA 3SCHA 1MEC2 4BYYA 4AW7A 1W8TA 1NZCA 4EN7B 5C8CA 2EXJA 5C3OA 3K4DA 5GM0A 4K21A 1F5FA 3FE5A 4DMIA 2ZGMA 4Q4Y1 4NIGA 1W2NA 1GU3A 2W2IA 5IAVA 2D6KA 4YM1A 4HFSA 5BYNA 4JGZB 1RIRA 2WLQA 1PGW1 1ZBA2 3BIWE 5FZOB 1H1AA 1V70A 1W06A 1CAVA 1J3RA 4HKOA 1EYBA 4YW4A 5FDBA 2VZSA 1CAUB 1TME2 3ZN5A 5GLTA 2CV6A 2CYFA 3CJIA 3OB8A 1BBT3 3CNAA 5C71A 2JJ6A 1ULPA 4LOSA 2JXAA 4FXKB 2IVJA 4CXYA 4XIKA 1NKGA 2B9VA 1GP5A 3UETA 3ABZA 1W90A 1MS9A 1GWKA 4XJUA 4AQSA 1J59A 3WP6A 2D43A 3EO6A 4U2AA 4B7KA 3AM2A 4QPIB 4XURA 4CZSA 2JIGA 2WYSA 4Q4W3 5LY1A 4XZUG 5B2GB 2V73A 2BDRA 4N53A 3CL1A 2JIJA 3PUHA 2I74A 3C7EA 1B35B 1FV2A 4W8JA 2ADDA 2VAUA 4BQYA 3WNOA 1SLTA 1REFA 4CVUA 1VBB2 2PHUA 2D6LX 3KGZA 4GMP0 3W9AA 1BMV2 3SHRA 2JDPA 2Z4FA 1XNDA 1KDKA 2WFF1 4YM2A 4YW5A 1DQ0A 4K1ZA 1PO13 3TN93 1JYXA 5FZ1A 1FI2A 3N9NA 4XF4A 2YMZA 4RR3A 1MVEA 2XPJA 2QBXA 4C1XA 4DS0A 5FTTC 2JDAA 4LO5B 4X8PA 4R9CA 1VMFA 1JH5A 2YPDA 3OGSA 2GMPA 1GBGA 3VZKA 4CP1A 4GZ9A 4LE4A 3BU7A 2DV9A 4AI0A 1QH7A 1US3A 3H7YA 4CSWA 2PMWB 5JOXA 1ZRCA 2VZUA 4AQ2A 1WW7A 1ULCA 1O4YA 2NYYA 1DGWA 3H3LA 2QVSB 1YCIA 3ROUA 4NAOA 3VZLA 1RXFA 5FYTA 1VBB3 4LPLA 2R7EB 2GH2A 5K4LA 3UNPA 4PCRA 1DHKB 2JG8A 2W5FA 1D2SA 2XJRA 2E6VA 2Y6JA 3DYMA 5FZFA 3RJRA 3BCWA 4BISA 1JN2P 2E53A 3H3ZA 3PMSA 3B94A 4I01A 4AFAA 4UBHA 1S0GA 3EQEA 4CRQA 3MF9A 1JOPA 4NIAA 1HB1A 1QH6A 1O4TA 4XDQA 1GFF2 3AYDA 3TNPB 1PGL2 1QOSA 3UYJA 4PHZA 2ET7A 2VQ0A 4MUVA 3I2JA 5C4WC 5DAQA 3KD4A 1PK6B 1JXNA 1GR3A 2WN2A 5BNPA 2H6CA 3WF3A 2P5BA 3GF6A 3N9QA 5GLUA 4O9GA 1N3PA 4RQPB 1BEV1 1I1EA 2WO7A 2FDGA 1XE0A 3C7OA 2CU5A 4UFKA 2VG9A 3R0RA 4RGKA 1AL22 4DFSA 2QDNA 1HQLA 4KGGA 5T55A 1FAYA 1X33A 1VMJA 3T4HB 1C5HA 2BBVA 1SPPA 1RHI2 3MHZA 4AE2A 4I3GA 5GLZA 4HETA 3OSDA 1O5LA 5JR7B 3S30A 3O1TA 1W04A 3AB0A 4YW7A 3BN6A 2ZABA 4PI0A 4M3CB 3LDKA 3WF1A 1RUH3 5BNQA 3AKQA 3LEKA 2JDUA 3CMGA 4JC1A 5KC5A 1AHSA 1HB4A 2RS53 5CFCB 5JXIA 2EIGA 1HKDA 1W6QB 4QX7A 3A23A 4CA9A 3ZSMA 3RZMA 2PLV1 1OOPC 5A3LA 4AR2A 4UWDA 3TYJA 3R05A 2P34A 3S5AA 1VBD2 5FZCA 1U5ZA 4YGBA 3K3NA 5I93A 5EQUA 3N7LA 3SKJE 1OUXA 3KVAA 1DZQA 2Z69A 1F2NA 5DPNA 4YVWA 1XSRA 3RWNA 4AEDB 4OUMA 4WVMA 1AZDA 1ZM1A 5F7UA 5FMCA 4JKKA 1WGPA 2XLGA 3NAPA 1KS5A 3KS7A 3LAGA 3LCPA 1RHI3 3ACLA 4Q0UA 4Q1PA 3FLRA 3QH6A 5F5QA 4M4RA 2R061 1RUG2 3IDAA 4HKLA 4QD2A 5GLWA 3KGLA 3TBDA 2VBBA 4RSUA 1F8VA 1VBE3 1R1A2 3U78A 2XG3A 1PGSA 5FBJA 1ZREA 2ZGQA 2HWE3 4D6RA 2GP3A 2B45X 4A6OA 3VV1A 2JEMA 4CCOA 1V6IA 2VH9A 1NA1C 2ZZJA 3AMHA 4JGYB 4GH4B 5EPAA 4GULA 1GZ9A 1VBD3 3POWA 1AYM1 2R1BA 1IKPA 2RM21 4FI9A 1G6NA 2C9KA 2OUHA 2RHPA 3DPRC 3LOIA 3VBFC 2WSUA 4KI5M 1DYKA 1E5RA 4FPHA 5F3CA 5J7MA 5JIUA 3MPPG 3SNMA 1LNSA 4JGZA 4KH9A 4MGZE 1S2EA 4WZFA 4P9WA 1H8VA 5C6CA 5FZOA 3OBAA 4AEDA 4B29A 4ZKTB 2CDPA 4AZZA 5KHGA 2WDBA 1RUG3 2ZA9A 3PUAA 3INAA 4OUEA 3PVNA 1IG0A 1JTZX 1VLNA 1NE6A 1W3XA 2B8MA 4MXWB 4OMDA 1R1A3 4Q8KA 2W1QA 4BM8A 2HWD2 4HN1A 5FQ0B 4FPLA 1PZ9A 3Q8AA 4X6RB 3UK9A 1SG3A 3VZMA 2RS31 4OI0A 2IWGB 3W59A 2X5IA 4LMFA 2Y38A 3K2OA 4B4RA 3LPGA 1QGLA 3MBWA 2HJIA 1RVF1 3HQRA 2J1AA 4LKEA 4E2GA 1GKBA 4CDQC 5FYSA 5HV4A 4W50A 4BQ3A 2A3WA 1B35A 2CGPA 2ZTNA 2YXSA 1OI6A 4LKSA 5HV0A 3AMMA 1DCSA 5I91A 2GC1A 3ES1A 4CEYC 1O3QA 2HYKA 5A33A 2DCZA 2RS11 1FMD2 2YG0A 3B69A 5SV5A 3ZXKA 4NOTA 3AP6A 1XRUA 2VUJA 3THTA 3VD5A 1W6NA 2VMFA 2ZEWA 4DEQA 3OD0A 4AHWA 1DYPA 2JD9A 2XBO2 1BBT1 3E97A 3W20A 3WG4A 2VW1A 4CUAA 4NHMA 3OGRA 3KV9A 4RHV2 5K0UA 4R9AA 4NHKA 3ZN6B 1IPKA 3A0NA 4XTMA 1C5IA 3POIA 4XVHA 3IM0A 4WBBA 1LOEA 4ZS2A 1BK0A 5LA1A 4Q4W1 3AZXA 1BHGA 5FYZA 5FOBB 1FV3A 1S1AA 5IVEA 3O1RA 5DAXA 4A3XA 2BBAA 2OXBA 2GMEA 4H55A 4PDWC 5FP9A 1H1IA 3RMXA 4FXGB 4LQRA 3GJBA 1D0HA 2F4PA 1VRBA 2OT7A 4H14A 5JZGB 1PO23 2DCJA 4Y22A 1WLWA 2JENA 1ZBA1 3ILRA 1N3QA 3GALA 4PBOA 4AFDA 4UT5A 2VZVA 3TN91 2MEV3 1CIWA 4QX8A 3WQ0A 4CYDA 2WZPP 3N3HA 2P3JA 3FLPA 4IETA 3VZJA 4COYA 1CPNA 1ND2B 2WKKA 4K6BA 2EAAA 3WUDA 2XLFA 1AX1A 2D3PA 1MACA 2A75A 2E32A 1JHJA 1PX3A 4ES9A 1W6MB 3SISA 3GZEA 4YGDA 4LBMA 1W8FA 1O91A 4M0NA 4RQPA 5C3QA 4R4ZA 3ZSKA 4A41A 3BOPA 4AHZA 1HRI3 1YLLA 3C2UA 3WX5A 2RMU3 5JI9A 1WUVA 4QPIC 2JDMA 1WMEA 4AF9A 3SEEA 1VBB1 1LHUA 4MGYE 1BMV1 3S7EA 1YQ6A 5FZIA 2ZEYA 5GKAC 3MI8A 4OQ8A 5JPNB 5A3WA 1XBFA 2JG9C 1FT9A 2W08A 2Y6KA 3MIDA 3HR9A 4M3CA 2XKPA 5FUPA 5AVAA 2ZXQA 1QNWA 3K46A 5FPBA 5T5JA 3NJZA 5CFCA 2OQ7A 4QQHA 4QPGB 1JOBA 1UY3A 1RYYA 1W6QA 3WXPA 4BPZA 1LTEA 2IFRA 3V64A 2WZEA 4LA2A 3G6JB 4AI1A 3O1PA 3P3PA 1DGWX 3PDQA 3PVEA 4LIVA 2WNEA 1SCRA 4MGIE 5FY1A 1OHFA 3I3EA 3VDDB 4IEUA 3ATGA 4D69A 2B7YA 4DXZA 5JSRA 3O1VA 3KSCA 1NOVA 1LKNA 2ZKNA 1OPMA 1UY0A 1UPIA 2KR2A 2VMGA 3CEWA 4LOTA 2WWUA 4ZPIA 2IXKA 5G04L 3SC7X 2VNOA 5KHHA 3DKWA 1ZZCA 1CONA 3N9LA 4NHYA 5FK7A 5JI7A 3LB9A 1H2LA 2WO2A 4OHWA 4AFBA 2VM9A 4ZU4A 3VBRA 1HN1A 1G9BA 4QX2A 4ZHNA 4LHNA 4IGPA 2DVBA 3LA7A 4IEOA 5B4NA 2FZ2A 1DF0A 4KU7A 1PGL1 2PXJA 3KT7A 5FYYA 3MFAA 5LATA 5T5LA 2ZEZA 5DZFA 2B46X 1UKRA 1UY4A 1VR3A 4IGQA 3RG0A 4DRRA 1QDOA 1ZBE2 3RZKA 3J8F3 5JOWA 1C1LA 3Q9OA 3T2OA 4Y1VA 5ACA2 4JGYA 1OC1A 2IXCA 4BQ5A 4GH4A 3AJYA 4WM7B 1PK6C 4GB32 1OQDA 5I8YA 2N7GA 5D8AC 2E31A 1X9TA 4OI1A 4CCKA 1POV3 3KF3A 1O3SA 5FIXA 3DKQA 2G1MA 3AKTA 2DBNA 5BNNC 3V0BA 1S0IA 2DDUA 2YC4A 4L11A 2J1UA 3KWVA 4HT1T 1KFXL 2O8OA 1H2KA 1OPOA 1SQ4A 5DG2A 5IK4A 3J4UH 3TEWA 1RHI1 2BP6A 5H9QA 3P1IA 3N9MA 2WS93 4DXTA 5DUVA 3PUIA 1LAJA 3O1OA 1VBE1 4AAXA 4MXWA 2DFBA 4QHZA 2B5HA 1A78A 2OW4A 1E5IA 2HWE1 1W99A 1ZRIA 1H9PA 2R0HA 2XVKA 1JZ3A 3D82A 4Y24A 4Z2AA 1HB3A 3AMNA 2BFUS 3MLJA 1C8M2 1CAXB 2Q8CA 2QQKA 2VTXA 1VMHA 4E2SA 2NZ9A 2NM1A 4MGSA 3JXSA 1VBD1 3AP4A 1RC6A 3M2MA 1XE8A 1OA4A 2TBVA 3NJVA 5DUUA 5EXOA 5IUQA 4TTGA 3NNFA 1XYOA 3URFA 4I02A 3ZPOA 3MW3A 3JB4C 1UU4A 2PHFA 2WJSA 4FP3A 1NLQA 1FATA 4ORFA 4JKMA 1I9RA 1UN1A 2W1UA 5L73A 1Z78A 4JQTA 1AYN2 3RZLA 2J22A 4IEWA 4CDUA 3FX3A 1RUG1 3H8RA 4QX5A 5KC6A 1KEXA 3BUCA 2WRAA 2VQUA 1YQ8A 1SLCA 4LORA 4BMEA 1R1A1 4K1YA 5A3MA 1H4HA 1OLME 4FPYA 2HWC3 3OCPA 4P5YA 4RFRB 3TWIA 3ZN6A 1OH3A 3AVRA 4L99A 3RYRA 1GWMA 1BXHA 1UMIA 4KNCA 4CDXB 2YBKA 3FZ3A 1Q8OA 3CZJA 3NW4A 3MV11 2J1VA 2CHHA 2AR6A 1JODA 5T3NA 1GQGA 1X9PA 1OT5A 3UKVA 2QQWA 4AOCA 1SHWB 3PHMA 5CU1A 1WCUA 4JAAA 1G9CA 5JZGA 1O59A 3JZVA 1ZA7A 2VUDA 2WQZC 3FFQA 4YG3A 1AYN3 1S0CA 2CWMA 1X50A 4RS5A 5FKCA 1WA6X 5FXVA 3GXUA 4CDWC 3ZFFC 4XFBA 3H9AA 4J1XA 1WLCA 4P9YA 3T1LA 2YU2A 4IEPA 3R4DB 3H42B 5LEKA 3NJYA 1AR72 2JX9A 5FZGA 1W6MA 4R4XA 5A7SA 2CTVA 3GBWA 1E5HA 2CDOA 1ENQA 5DG1A 3BTZA 4IE4A 1XU2A 5AC93 2R1DA 4W65A 5FZ4A 4TLGA 5ISLA 5GZFA 3ZYBA 2WNVA 4NO4A 2R6QA 3B9IA 2VZTA 1S0FA 4QQOA 5FLIA 4Q0VA 1JYWA 4IERA 4BQWA 3SITA 5H9SA 1WCKA 1ACCA 3PLQA 2Y8KA 4CU9A 1CN1A 1H6YA 4JHZA 2XBO1 4K8FA 3ZXEA 2DUQA 3J7NA 4QGLA 4BIFA 1NAEA 4NJ4A 4CU8A 1CIYA 1NLSA 5CNAA 1BQPA 5BXXA 3KV6A 4AEMA 1C57A 5I0RA 2BWCA 5CEHA 4PT6A 5KBFA 4YW3A 2Q30A 3O1UA 2R0FA 1AX0A 3U14A 4WM8A 4BHPA 2DVAA 4A7KA 2OKXA 3RYPA 3WNXA 2C9AA 4K9SA 5TSWA 1LOGA 1XJAA 3VDDA 4MLOA 2QE3A 5KXDA 1HRI1 3LF7A 1OOPB 2E7QA 2D6NA 1A3KA 5DZEA 5FY5A 2RMU1 4A4AA 4A6SA 1IS4A 1RGSA 2X05A 4RA0A 1ASJ2 1GOFA 1FOD2 1MZ6A 2VC9A 4FP2A 4G4FA 1G8WA 1ZX5A 1YIPA 2H0BA 2P37A 4JVAA 3ON7A 2VY0A 1KDMA 5FZ7A 4NPLA 3TEYA 2DBIA 4ET7A 3MZHA 4H7MA 1JMUB 3I59B 1CJDA 4IEVA 2IVIB 5HI0A 4AFMA 2OIIA 4JKLA 4Q8LA 3SH4A 1ZVFA 4AAPA 3E5QA 3VDBA 1C8NA 3OYWA 2IUWA 4Q4V3 4GA9A 3ZDVA 1ND2C 4YM0A 3U75A 2GDFA 3I49A 1CR7A 3I2HA 4WV8A 1EUTA 1MZ5A 4XFIA 1A34A 3GNEA 4UBGA 3ZYHA 4YVSB 4HZFA 3MFCA 2Y60A 4N9IA 4OHZA 3BODA 1KRIA 3HNYM 1NA1B 4NROA 4L8QA 4ZONA 3QCWA 1JI6A 2B42B 1NG0A 3WF2A 4CP2A 2WNUC 2Q8OA 2QDRA 1O8SA 4QAWA 3DPRB 1HN0A 4LHLA 5B4XA 3U11A 4PF1A 4E2QA 3BPSA 1CJPA 2JE7A 1TG7A 2ZMLA 3A4UA 2IXJA 1CESA 2GAUA 1JZ7A 3HBKA 3R6SA 1BYHA 1HV1A 4HPKA 2WNOA 4UW6A 4YM3A 4L0PA 4Y26A 1S55A 4RGAA 2XJQA 1UMHA 1CGPA 4N43C 1CAXA 3J8F1 3OUIA 3ZN4A 1XQNA 1CAWA 1W2OA 2Y64A 4KQ7A 4E4ZA 1W9TA 1UMZA 2A5ZA 3ZOIA 5HXMA 3VBUB 4P9JA 3ASIA 4QPGC 5CA6A 4EN0A 2FHRA 1LU1A 4C91A 3SKVA 2VR4A 1WD3A 3AK0A 4V2WA 2RDQA 2VCCA 2WLPA 1POV1 4LLFA 1LGCA 4CTEA 4FBFA 4CDQB 5A7NA 2XXZA 1QOOA 2VMDA 2FMDA 4NRMA 1GOGA 3GCWA 1C28A 2W94A 3NNJA 5A6XA 5DXDA 2P6HA 2ZAHA 3PJQA 4CEYB 4WVWA 2WS91 3ZFEB 1U12A 1SDDB 2V09A 3EMRA 5D2AA 4Q29A 1VRH3 2BNNA 2P3IA 1ZZ8A 4CUCA 2H6BA 3WUCA 4HONA 4IXLA 3S0MA 1W0PA 5F3EA 3WP4A 5A6QA 3TOJA 5A70A 3JU9A 4EJRA 1NQDA 5CYYA 2ERFA 5JIAA 2XVLA 4KMQA 1R082 1SBDA 1UYXA 2TEPA 4QXBA 4YPJA 1LEDA 2ARBA 2Y6GA 4OCTA 3U37A 2ZPXA 4URAA 3HN1A 4K3UA 1BLZA 2WA3A 3OGJA 3ZFGC 5CKMA 2D40A 1GMMA 4WM7C 3KZ4C 5I0SA 2HEWF 4BXFA 3V56A 2RS33 1AR82 4A45A 2HEVF 4FSJA 1V6LA 3U4SA 4ATFA 1UZYA 4OYUA 3TEZA 4PDWB 1RVF3 1Y9GA 1HDKA 2A3XA 2ZMKA 5BPXA 5J09A 4XACA 1R64A 5JSPA 1JYCA 3E6CC 4LO6B 2ZX3A 1U5IA 4Y5TA 1HRV3 3ZR6A 3VBOC 1QU0A 4A42A 3I54A 3KCXA 2RS13 4LBQB 3ZSEA 5FXWA 2HWC1 2BEOA 5F1RA 3VGIA 3AJZA 1C8M1 2EIBA 3U1XA 4DY5A 4QHBA 5IVFA 4ZU5A 2I2SA 3LD8A 4Y20B 4SLIA 1ODMA 1R083 5FPAA 5C4WA 5T5OA 3O1SA 4AVVA 1POV0 1XB9A 3OEAA 4QKDA 1O5UA 1ND3C 5AVPA 1WD4A 4AI9A 3O0VA 1XPWA 3OTFA 2BOIA 4CCLA 1CWPA 1WBFA 3HD8B 3R4UA 5ANQA 5LK5A 1UYPA 4Z2WA 1MEC3 1AR83 1TEIA 4XJZA 1LJ7A 2PAKA 1QJU2 5FY9A 1AYN1 3LA2A 5JXJA 4FPKA 2QQNA 1T6GC 1QJY2 3JQWA 1QJFA 1VALA 4LTAA 4MSVA 4BXSV 4DQAA 5LRSA 3VKNA 1GZWB 1YXWA 1ZRRA 1UXZA 2WIIB 2YGMA 5JSOA 5E8AA 4H3WA 4OZXA 1SLIA 3POSA 1DIWA 2LTNA 3CU7A 2J7MA 3TAYA 2JG9B 5JPMB 1K5JA 5CVRA 1ZBA3 4BLIA 2BTVC 3RDIA 3K4AA 4LNVA 1IS6A 1TME3 4GJZA 5FZAA 5CBLA 5AC91 4Y1ZA 3H1YA 3HOBA 4LHSA 5FCCA 2RG4A 3B5LB 3C7FA 4HSLA 4BH9A 4W6YA 4DOUA 1OOPA 1QNYA 3ME2A 1E57A 5BNOB 4CDXC 2J42A 2VPVA 3AZWA 5HPOA 4XJ9A 2GC3A 2XHNA 2R30A 2W0XA 2JE9A 4HVOA 2VECA 4HVRA 1MZFA 2VCAA 1SLBA 3I2KA 4YYOA 2FDJA 3MIEA 5IK7A 1S0BA 4YFZA 1S0JA 5IVVA 1QJY3 4XUNA 4AYUA 5L7OC 3NSTA 2GP5A 2D5HA 2OZJA 2Z5WA 4DXRA 4NIHA 3GHNA 4XOGA 2WL1A 4XCAA 3WG2A 4HVQA 3FHQA 4ISRA 2ZKLA 2CWSA 4C0HA 4XW3A 3OG2A 4CPBD 4CXXA 4AQ6A 1W9SA 3DXUA 3A7QA 3FN9A 3AYAA 1IQAA 2ZGUA 3KM5A 1NCQB 3TEXA 1M06G 5DMYA 1N1YA 1W05A 4MYEA 2YV8A 1NA1A 1DLLA 1FXZA 3M3OA 4E27A 4HK9A 4CCNA 4NN0A 3IDBB 4ISQA 5JXHA 3D6EA 3J7LA 3RMYA 5D8AB 2ZBJA 3AYEA 3DPRA 2DYCA 1UKGA 1OVSA 1UYYA 2OA2A 2VD7A 2ZGTA 3VBFA 1RUI2 3BTXA 2P3YA 2DCTA 3PVOA 4MHRA 5FP4A 5BNNB 3ELNA 4Q4X2 3WDYA 5C70A 3KB5A 3RS6A 2VXJA 1V6NA 1S2KA 3I2GA 1SFYA 3AXEA 4Z8BA 3NMBA 2A1XA 2QFEA 4Q27A 4Q4V1 3QLQA 4L2NA 4ZXEA 4Z1VA 4XILA 1QXPA 3JCIA 2ZZQA 4R9BA 3T1MA 4GWNA 3VHRA 4KG0A 5EYYA 5FXXA 2BV4A 2EIEA 3JBG2 3ZXJA 2R042 1JZ6A 1EAH2 3AZYA 4Y3OA 5FY0A 4EWEA 4C90A 3X29B 5EZWA 2AACA 3LEIA 5FUIA 2QZ2A 4HMZA 4CDQA 2UY9A 4GWJA 4ZXKA 4IDZA 4JCKA 5FPUA 4Q0PA 2PAMA 4FPGA 3S57A 4MGTA 4CPBA 3LQCA 2J1EA 4CEYA 1W39A 3G7DA 1LOFC 2B39A 2D97A 3FHIB 1YFUA 3AKRA 1A8MA 3LKJA 1AL23 1IGOA 1LHVA 5IVCA 4BU2A 2Q0AA 4K8RB 3OBZA 3CO2A 3I3QA 4UFMA 1RUOA 4ASKA 3LFIA 5T52A 3JD72 1OUSA 2Y0OA 4HG6B 2FCUA 5A1FA 3MUY1 5EJZB 5SV8A 5ERLA 5DQ0A 4OHYA 4QX0A 4AGVA 4K40A 1J84A 3ACHA 4XFGA 3POGA 4MZUA 4Z92B 4OULA 3M7AA 2TUNA 3QBQA 5KWRA 2C24A 2R043 5K7PA 2D6MA 4YVSC 5LB6A 3J7MA 5LBBA 1NCRB 3THCA 4XYXA 4UF0B 1W6OB 3N7MA 2LS6A 3M70A 1JS9A 2ADEA 2ZS6B 3ECQA 1CX4A 1JU4A 2VUCA 4N7UA 4QB2A 4FPEA 5FY7A 5DUXA 4I0AA 4PDWA 3ETQA 3C3VA 3OY8B 4GWMA 4AWDA 2Q4SA 4XETA 4KBBA 1UF2C 5F6LB 5DDJ2 2WBKA 1VRH1 3AFGA 3MUZ1 1SACA 5DN2A 3RGBA 1HW5A 5IAXA 5JLVA 3OJBA 2AEZA 2VNGA 2R072 2GH8A 3FLTA 3IAQA 4PQQA 4V2VA 5F6KA 3ZFFB 4CDWB 3W5NA 3ZMOA 5F9TA 2RVAA 3WNNA 4ZY9A 3CDZB 1CAUA 2O1QA 1XNTA 4Y20A 3VZNA 2GNBA 4HK8A 5FO9B 1DU3D 3AP5A 4OLLA 4HBNA 3I97A 2VU9A 2Y34A 1ZRFA 3D3AA 3NV2A 4TXWA 3VBUC 5L9VA 1OA3A 1AR92 5J96B 3ZPYA 2PN5A 1WWYA 2UURA 3FBMA 3J26N 5J1XA 2XJVA 1VBA2 1COV2 4M3CE 4K7JA 4GAZA 1UW8A 4ES8A 5C9AC 4QPIA 1RMU2 4KWLA 5K9YA 2NPIA 3LIGA 2XL7A 2JICA 2VBDA 3K51A 2XUMA 5F3GA 1GZWA 1UU5A 1Q8PA 4BWOA 2WFPA 1L3JA 1HRV1 4M4PA 4MO3M 1UXXX 3ZFEC 3LZZA 2W87A 4CEWC 2JG9A 2OX0A 2R073 3D5OA 1RITA 5LBEA 2C4XA 1AVBA 3MIFA 4XBNA 2W39A 4RD7A 5K8SA 2VL4A 3LSDA 3T2TA 4XZPA 1QJX2 3DECA 3ZXGA 1R081 1DYOA 3DUIA 1QXRA 1OA2A 3NNLA 2PHRA 3QOPA 3UGHA 2HWD3 1DDLA 4P08A 4AEJA 1AR93 1JW6A 1R1ZA 3K75B 3OPWA 5KXEA 4BCUA 1MEC1 1AR81 1Q8VA 1VB4A 5C7GA 2Y0IA 2W9XA 3NKGA 4N9HA 1MZEA 2J1RA 1UAIA 3WR0A 4Q0SA 4YVWC 2BVVA 4INDA 2BGPA 4EN8B 3K3OA 4B1MA 5EP9A 5FBZA 3F95A 4JX0A 3DGTA 3DN7A 1ALYA 2MNGA 3AFKA 4YGCA 4QQPA 2QQJA 1RUF2 2JWPA 1BJQA 1FMD3 4LR4A 4F8AA 4GKYA 5BUVA 2VVDA 3SLIA 4CCMA 1H8TC 1EP0A 3BVCA 1VAKA 1TME1 2VMEA 1UOFA 1AXKA 1D0GA 3MEPA 2XBO3 4M3CF 1GOHA 2UWAA 5FFOC 5EJ1B 1UCXA 1U5XA 3L9JT 3NV3A 3T2PA 3UESA 2Q8EA 4OFGA 3NWKA 3ETPA 2JDHA 4XXPA 3KCYA 3K48A 4RHV3 3PVBB 1PK6A 1R092 4QPWA 4PI2A 5FZBA 3VHNA 4YZ1A 2FD8A 5D8AA 3FMGA 3JUUA 4S2DA 2W95A 4A3ZA 2WNUB 1QJY1 4ASLA 5BNNA 2A6XA 2OQ6A 4MOAA 2YHJA 4BA6A 1JUHA 1TNFA 1NZIA 1S0EA 1JZ4A 2XKOA 5A7OA 3M3QA 2VOWA 4CU6A 3VBHB 1KITA 5A32B 4JRLA 2DVGA 2VZQA 3DEMA 4FQZA 4XFCA 5A80A 3W5MA 4C8DA 1Y43B 2F17A 1NYWA 1W03A 1DP0A 2WYFA 1DBNA 1QQP2 5FJHA 5IYYA 1J83A 3VD9A 4N43B 5T54A 5IFPA 4DIQA 3V65A 3ACFA 5E88A 3WSOA 4BK4A 3OPTA 1RUNA 2CGOA 1QXJA 4IV3B 4PIXA 4QU1A 2RJLA 1NLRA 4O65A 4KWUA 4AXOA 2LROA 1X36A 1GWLA 2AZ5A 2XGXA 3HIFA 3NV1A 3RYKA 5BV6A 4RN5A 1C4RA 1PM7A 3B00A 4ITCA 1G86A 1VAMA 4YW1A 4IL7A 5A3UA 2DUPA 5JR2A 1PVXA 4META 1XNCA 2Q1MA 4NIIA 4FTBA 3ZX7A 2NMNA 2XH6A 3KV4A 1OF3A 2W52A 2XJUA 3POYA 4IV1B 4AL9A 3QACA 3D0SA 3O14A 4LULA 4CP0A 3FC0A 2R49A 2GU9A 2ZHNA 1NQJA 1YO8A 1RB8G 2BWAA 3ZYRA 1X7NA 1Q43A 2GN3A 1QY4A 1VAVA 1PIV2 4HOOA 5T50A 4B4PA 1RUE2 4UYBA 2JKXA 4XUPA 3USUB 1W8NA 1GYKA 5KR7A 1WLTA 4FQ4A 1NCQC 2AYHA 1SDWA 2X29A 3B9CA 4LK6A 1QKQA 5EIYB 2EF6A 2ZCWA 3ZFGB 1LOBA 3IPVB 1LU2A 1YNAA 2YY1A 4OHVA 5FWEA 4XMIA 4EV0A 5IK5A 3ORJA 3OY8A 4MX3A 1RUI1 3IMNA 4NPRA 4W4ZA 5FP7A 4BJ0A 1I3HA 4Q4X1 5IATA 4LEJA 3IDCB 2AREA 1APNA 2QQMA 4JTNA 1AL21 2WWSA 4XQ4A 3HAGA 3A0KA 2LM3A 3IKWA 4QM9A 5APAA 5ANNA 3HPNA 3GYDA 4CDWA 4M00A 3ZFFA 4CXWA 5FMOL 1AR62 4BQXA 4QXCA 3VBOB 2JDNA 1JYTA 3P3NA 4XBQA 4CUBA 2VNVA 1RUJ2 2JECA 4BQ2A 1UZ0A 3OUJA 2XQRA 1JYIA 2QQLA 5IK8A 1LGNA 1I5PA 3IIIA 1OVPA 3AMQA 3JBG1 2R041 3I7DA 5FQ0A 3ZYPA 1DZRA 1N3OA 1W2TA 2XWBB 1WCQA 1TVGA 1ZBE3 2UWBA 2YU1A 3O7OA 1A6CA 3NL1A 3PTYA 3ZR5A 2C0ZA 5ACA3 2QCSB 1ND3B 3UGGA 5IHRA 4NWVA 1I6XA 3JQXA 1H6XA 4GB33 2HLEA 5GZEA 4NRQA 1YI7A 4QX3A 2VCMA 4Q4Y2 3MIBA 4XAEA 1UZWA 1WZXA 4FOWA 3FWEA 3KLSA 2Z2SB 3PUQA 4B8EA 1JUIA 2ETEA 1BZWA 2QQUA 2W3JA 1I5ZA 2WT2A 4NR1A 4PF5A 3T30A 3WG3A 4TZDA 3IBMA 4AK3A 2ET1A 2EXHA 1RUJ3 3ZYGA 5C33A 1O3RA 2DU1A 4P5HA 5FPZA 4DY3A 5DAPA 1JZ5A 2RDRA 5F2WA 2WQ4A 2YBSA 3KHBA 2Y6HA 3I3BA 3VBSB 2R32A 1GICA 2OPWA 1H2MA 3PU3A 3WDWA 4DB5A 4CCCA 4C1WA 2ARXA 2YPJA 2NP0A 1C8M3 3EBRA 1WLDA 3ACGA 2E33A 2ZGRA 3KQRA 4P14A 3WDTA 3WP5A 1JZ2A 3RJ2X 2VW0A 1NCRC 5EYXA 2F4LA 3DL3A 3SCFA 1W2AX 3WLUA 2VZOA 5A3NA 1D4VB 2E7TA 3B3QE 4P9LA 1HJFA 5DDJ1 1US2A 1VBC2 5ABJB 5LA2A 5L7OB 4EE2A 1XYNA 2R071 2VUAA 4JRAA 2RJ2A 2PELA 5GJ6A 2O0OA 3UL2A 1N1TA 5J3UA 3AL5A 3LE0A 4E4SA 4XDOA 2WFF2 1ZRDA 2FQPA 4FPOB 4H2AA 4OI2A 2DVDA 5JMOA 1ND2A 1SEFA 2BYVE 3ZXDA 3CHXA 1MS1A 3HJRA 2ZGLA 3GHMA 4LO4B 4S2GA 4PLNA 4S2FA 3VN4A 2HWD1 2V4AA 2GC0A 5F5IA 4UFLA 3T08A 1AR91 1G9FA 5J98B 2G19A 4A7YA 2W1WA 1RINA 4Y1XA 2XR4A 1L7LA 3T0BA 1ZZBA 3SEPA 2BUKA 2E26A 2WNUA 2YDEA 5CFDC 2HH9A 4XCBA 2WAAA 2GN7A 4MGKE 4C0BA 2CNAA 5CG9A 4IE0A 2FMYA 2VOKA 1FMD1 1RJ7A 1OKOA 1NXMA 2DCYA 5F5AA 3WF4A 3ZYJB 1O8PA 1RJ8A 2RR12 2XJSA 4LT5A 3UKTA 3USSA 1XNAA 1YYNA 5JCTA 4V1PA 1KFUL 1UOJA 3WD5A 3NO8A 1KXGA 2HKXA 4NVPA 4XHXA 2DUOA 5JVVA 2XONA 1GUIA 2FCTA 2VOXA 3GBFA 4RHV1 4YNIA 4EYUA 5A1LA 4QPGA 4XC9A 2B4KA 4CCEA 2XL9A 1AR73 2ATFA 4KGQA 1PNGA 3KCCA 3GDBA 4GKXA 3THDA 3GGLA 1GZCA 5IT6A 4YFWA 4LO7A 1EV12 2ZX1A 3MLKA 1LESA 5EWSA 1Q5OA 1BEV2 1ONAA 4L9BA 4XABA 5FYUA 4IGOA 4N53B 2WSVA 3LFMA 4FVVA 1N1VA 1W6PB 2DFCA 2CL2A 1LECA 1VP6A 2VZRA 5FZLA 2J1TA 4W6WA 4LBLA 4LITA 1Z0HA 2RR13 3DV8A 3EB7A 5FZ8A 4O9EA 2CY6A 2JDZA 2UYBA 3J7HA 2WO3A 3AX4A 3T0AA 2P3KA 4RR3B 2WT1A 1YQ5A 1YWKA 3USUA 3WQBA 5CG8A 3IZOA 2DCKA 4QPYA 3LOBA 4RFT0 3VZOA 3MIGA 4DNYA 2AUYA 2Y6LA 3WEZA 5FO8B 1V0AA 1VIWB 4E4HA 4QB6A 4BLJA 3ZFGA 3DYOA 1F15A 4OUSA 1PMJX 3ZSLA 4P9IA 4WM7A 1MQTC 2Y6FA 4BK5A 4QDQA 4BOWA 4WVVA 3E6DA 1DGRA 1G9AA 3CIHA 1K5MC 3EXUA 5D21A 1DFQA 1ASJ3 2QTWB 1FOD3 5IJRA 3RNSA 2QQIA 1SBFA 4RS5C 1Y7BA 1V00A 1POQA 3SMHA 1XE7A 3T2QA 5FR3A 2JG8B 2YGLA 3VBOA 1G9DA 4AEKA 2EICA 5BNOC 3VBHC 2NLRA 1TMF2 2XWJB 3PURA 1S2BA 4DUWA 2VQTA 2SLIA 4P00B 3VDCA 3D0JA 1LGBA 3LA3A 5BNPB 4IV3C 1ND3A 1ODNA 4RGGA 3WDUA 3OBRA 4FPJA 5F5CA 3V0AB 3VD4A 4PIZA 1YUDA 1GNYA 2KXLA 1JBCA 3L2YA 1AYM2 5C9AB 1SZBA 1PVC2 4GD4A 1C3HA 2QQVA 1TNRA 3IB3A 5DAVA 1YJLA 4J1WA 1K42A 2V5YA 1CD3G 4HSJA 4RL7A 3ZIXA 1LULA 3AZVA 3N36A 1KD7A 4IV1C 1PMIA 1Q8SA 2K9ZA 5IVBA 3WT3A 4AI2A 3VL8A 1DQ5A 3NKTA 5IWFA 1CZVA 1W3VA 2ILMA 2K2SA 2Q5TA 3I2DA 4CEWB 4RYDA 1GV9A 1XOYA 4OZOA 5LASA 1FPN2 2VZ3A 3HBZA 1O3TA 3B93A 3HQUA 4TN7A 4ASMB 3RI9A 4CP9B 1UO9A 4Z07A 3UV9A 3VHOA 3DCQA 3N7JA 1ULGA 4XHBA 1ZBE1 4UFIA 4R9DA 3GJAA 5ACA1 2D3SA 2OVUA 2YBPA 3ALQA 1JOJA 3IAPA 4AVSA 4CDXA 4GB31 1L7RA 2PQSA 3GZUC 1S4CA 5FYVA 1UNBA 3MIHA 3WCRA 3VUOA 3P5BA 4XAAA 2OPKA 2ZX0A 4HANA 1D2QA 4BDVB 1WW6A 1FNYA 5LW9A 1Z7S2 1RL3A 1VJ2A 1D4M2 1F4AA 1PVC3 4Q2FA 5DABA 4YVWB 2X09A 5JXGA 3ZYIB 3KF5A 4BMBA 2PQQA 5JOYA 4X6QB 1SLLA 3NVCA 4TSVA 3NAPB 3Q8EA 3MDPA 4NHLA 1RUJ1 1REDA 1DGRN 3EHKA 5FP8A 3ZKUA 4FTEA 4UW3A 2HWF2 3W21A 5F8PA 4AG4A 3WDVA 1EUUA 3HVDA 1OURA 1H8TB 1FPN3 4QXKA 4D6QA 4JDMA 4LBOA 1V6KA 4NIDA 3PIGA 3BTYA 3IWZA 4DPNA 1Y4WA 5FZ6A 5J36A 1V6OA 1WW5A 4I0BA 4COZA 1CQ9A 2HBTA 1H30A 4IEYA 2GNDA 3GCXA 5HBAA 2YZ4A 4LKFA 4Q4W2 4BQ1A 3AL6A 3NRUA 2G4IA 4IEZA 1Z7S3 4PLOA 5LA9A 1D4M3 5LBFA 5FPXA 2ES3A 4PQ9A 5CKQA 3WP3A 2XJPA 2ZAAA 1OF4A 4LE3A 3O0WA 4XEZA 1AJKA 1AF9A 3FJSA 3FHAA 3HEIA 3KT1A 2E63A 4NPMA 1IOAA 5A7WB 3T4VA 4E8DA 2DU0A 2G9GA 1WW4A 1PNFA 3NQHA 1BCXA 1OH4A 4MADA 1PO12 4NAMA 2FCVA 1XSQA 4Y1YA 2JDYA 5FMBA 3TN92 2UU8A 2HWF3 5FZHA 1MS8A 4FT8A 4I09A 4AFCA 2GNTA 1J58A 1PX4A 3MW4A 3R4SA 3ENRA 3FBYA 4D7YA 1F9KA 1J1LA 1D7PM 1BKZA 1ULFA 4IESA 4UI9L 4XJ8A 3VLBB 2ZX2A 4R52A 1SFNA 3VBSC 4IE7A 4AI8A 1J1TA 4Q5OA 1W2UA 5E16A 5C3RA 3K77A 2RDNA 2X5IB 4Y4RA 3OD4A 1FNZA 2AH2A 4DXSA 3BALA 4YSFA 1HV0A 1ULEA 1OMIA 1X82A 2E9QA 5C3PA 3T09A 4IW3A 5KHKA 1AL0G 1HLCA 1DQ1A 1VBC1 1W6PA 3I2IA 5FLHA 1JYVA 5F32A 1AUYA 2EAKA 1LOFA 5A33B 4ARXA 4CUGA 1QJU3 5L36A 3AVSA 3WNPA 5CAZA 1HQNA 1Y3TA 2ZHMA 3I59A 5ABJC 1SCSA 2WAOA 1IS3A 1W6NB 2VMHA 3ILNA 4ZZ5A 2NQYA 3GZAA 4UW5A 1HQWA 5I8TA 4QKBA 3AP7A 3EYPA 1CZSA 1PZ7A 2QKDA 5FRAA 1ENSA 1QOTA 1AXZA 1ULOA 2FBEA 3AKSA 3ZO0B 3KQ4B 5K0UB 1AR71 1A8DA 2VVEA 4HLTA 5C5UA 3A22A 4TWTA 1T2XA 3BGAA 4YVSA 2VJXA 4PBPA 5FY8A 5CISA 1F5JA 2PYTA 5F2SA 2GZWA 2XUEA 3IMMA 4G9SB 3MW2A 4FO9A 3S6PA 3PUSA 5C8CC 2DTYA 1LHNA 2LALA 3H1MA 1NX9A 1YFWA 3WHTA 2AGSA 2WUHA 1LOCA 2RR11 5J48A 4JQRA 4Y22B 3MPBA 1YFXA 1HX6A 3PL0A 3QH7A 4OMCA 2XVGA 3ES4A 1RUH2 1W8UA 1IZ3A 3VKOA 1MS3A 5LY2A 3HWJA 2LRPA 2RS52 2ARCA 1WCSA 3CJIC 2FDHA 3LSEA 3BYWA 3H0OA 4FCAA 3TRSB 5LBCA 4ONUA 3VBUA 4NMIA 1KS4A 2HEYF 1NY72 1O6UA 1XXNA 3V0AA 2GNMA 3UT0A 4YZ5A 2BGCA 5FREA 1OXCA 1EV11 1V9U2 4DO0A 5FYBA 5HCFA 1RUD2 4OHXA 4LBQD 5C9AA 4XUQA 4Y4YA 3AKPA 1UD1A 2HWB2 3E5UA 4GJYA 4COUA 3SH3A 1ASJ1 4GIQA 1FOD1 2RDSA 3WHUA 4AVAA 3T0DA 2EXKA 1N1SA 2IXHA 4N53C 3NNGA 3H8UA 3WW4A 4CE8A 1DG6A 2QJVA 1RUI3 2A6ZA 3ZFEA 1OLRA 2C26A 2WN3A 4Q4X3 4CEWA 2D98A 2FDKA 4Y1UA 3Q8CA 4PLMA 2X10A 1SMVA 1VBE2 2WWJA 4PJYA 4CP9A 1MS5A 4YZ4A 2HWE2 1DLCA 2OS2A 1J3PA 2GMMA 3C7HA 4LHKA 3ZXAC 2F6BA 4RR3C 1SBEA 1RXGA 1H4GA 3WZ1A 4XF1A 1Q3EA 1XC6A 2D6OX 4LK7A 4FPFA 4YZ2A 4N8MA 1XNKA 2DWRA 5FOJB 3FUOA 1W28A 3ZDSA 5I0UA 1V9U3 4D7SA 1ST8A 1RUD3 3JBG3 5EFUA 1EAH3 2HWB3 2MHFA 4M0HA 4DINB 5JAXA 4JTOA 2DURA 1V6MA 3HN3A 2VTXJ 2W68A 4B1LA 1XYPA 3GBGA 3HT2A 3O5SA 1UL9A 4QDRA 4COVA 1PZ8A 4LXLA 3I2OA 1L7QA 1JU3A 1GQHA 1W9FA 3VBRB 2O8QA 2BW8A 3S7IA 1ENRA 2EXIA 3WG1A 1TMF1 2JG8C 4F7ZA 4J25A 5FZ0A 1H8TA 4LBQA 3QD6A 3TNQA 4AQTA 1LHWA 3CBNA 3JD73 4AVBA 2B9UA 4LO8A 2A71A 4UXAA 5L9BA 2QQOA 5FZKA 4P02B 5LA0A 3P6BA 1STMA 3M3CA 4IQPA 5A7QA 3RFRA 2WQ8A 4N7IA 1W8OA 5CB7A 2GALA 5C5TA 3ILFA 3CQOA 3E6BA 3MGUA 4XFAA 5BNPC 3RZHA 1H0BA 1PVC1 3KVBA 4XF3A 1GSLA 1OQ1A 2WA4A 2WZ8A 2ID4A 5CFDB 1NT0A 4B7EA 3AC0A 1UU6A 1BVP1 1OSGA 3ZYFA 3V0BB 3WNMA 2BQPA 5A7WA 5DAWA 1N47A 3M4FA 3BTAA 5F3IA 3KT4A 5GZDA 4FAHA 1QMJA 2Z42A 3H3UA 5LWBA 5DDJ3 3C8XA 4LBJA 5I0DA 5A3TA 1RUC2 1FPN1 2UY8A 2XB6C 4SBVA 3HT1A 4G3YC 2VQAA 3PJYA 1S0DA 2BPA2 1OD3A 4CCJA 2RE9A 3PTRB 3RVHA 1NXD1 2MPFA 3NJXA 4QDSA 5CZKA 4B3NA 4D3WA 4PIYA 1VE0A 5GZCA 4OVEA 3RSJA 4LIUA 1Z7S1 3BPZA 2SBAA 4XQDA 3RQ0A 1D4M1 3GM8A 3IIAA 3RWKX 5J37A 3H8XA 2VZPA 4EN9B 1UQXA 1VBA3 2ZGOA 1COV3 3MF6A 3MO4A 5FZEA 1GNZA 1ZZ7A 3WVJA 1HB2A 1ZYBA 5H9RA 4QB1A 1RMU3 2D5FA 1PO22 5DUWA 1U5YA 5GALA 4EZ4A 2NMOA 1Y9MA 5HCHA 1LB2A 3RRDA 5E1RA 1TQ5A 2MEV2 1HXS2 2G9FA 3OBTA 4QU2A 3NV4A 2VOTA 4QX1A 2HWF1 4OQ9A 4CDUB 2EALA 3H8OA 4LJHA 3NAPC 3Q8BA 3RZZA 1QF3A 1RUC3 4OI4A 2I07B 1UPSA 4N90A 5FP3A 5CKNA
chains in the Genus database with same CATH topology
1ZNPA 4XXAA 1BVVA 2YROA 2A6WA 3E5XA 1UZZA 1QJX3 1YI9A 2P17A 2KM2A 1NCQA 1RTVA 3OPZA 1HRI2 3D8CA 4HKWA 2RMU2 2GC2A 3LGRA 1MQTB 5EJ3A 1O7FA 2ZGNA 3U07A 3SXWA 5LRRA 1QJU1 4LA3A 1K5MB 1GNHA 3W58A 1IHMA 1M4WA 4RS5B 3CF6E 1PO11 4JGZC 1HXS3 4R8HA 3TB0A 5FO7B 5HCBA 5C8WA 2BFUL 1OLQA 3PNAA 1RUF3 5DZGA 2OYZA 3J9SA 3WDXA 5BNOB 1JHNA 2D6PA 1KJRA 4KWJA 1KQRA 3B7MA 4JV4A 2UWCA 4KWKA 3WINE 5KXCA 4WZCA 2H0VA 3M3EA 2WC2A 4MV2A 4DRVA 1LR5A 4P9GA 4FTSA 3U0ZA 4D7TA 3H50A 3ZSJA 2Q1ZB 4W6XA 4YGEA 1X8MA 2X5IC 2WNVB 1C1FA 1V6JA 4LLOA 1R093 2D7FA 5JDBA 2JD4A 4F3JA 3IDEA 3WOGA 2YC0A 1B35C 5T5PA 1Q8QA 2PHLA 4EN6B 4Y5Z0 4Z82A 3MICA 5HCAA 2QQPA 1AX2A 2C1FA 5I8SA 4L97A 3KMHA 4AHXA 5JOZA 4FAGA 5CADA 3B02A 2TNFA 3J8F2 4URTA 2D3RA 4L92A 4WM8B 1QQP3 2VW2A 2FZ1A 5K0UC 3PMEA 1QWRA 3D4KA 5KHJA 1DQ4A 2YYOA 2KA3A 1NCRA 2C5DA 1W6OA 1REEA 2R16A 2D93A 1IPJA 1DQ6A 4FOQA 5KXBA 3N4MA 2OZ6A 4XJWA 5D1IA 1CVNA 2PHDA 1GANA 1WCDJ 2ZOEB 4JDOA 2Y26A 2EVXA 2WS92 1Y9QA 3LWCA 2IFWA 5AFBA 2ZGPA 1RUH1 4LUKA 3EJKA 4IEQA 4EWAA 3OF1A 2XHKA 1UIJA 2RS51 3OYWB 5LEJA 2A70A 4E9KA 2WINB 4YARA 1NY71 3M3IA 4LBNA 1PIV3 1DGLA 3SH5A 1RUE3 1V9U1 1RUD1 2BVBA 4XE9A 4QQ2A 3WW2A 2QNKA 1GLHA 1EAH1 2VNRA 1FX5A 2HWB1 1OKQA 3UJQA 1UX6A 2WZR2 3U4XA 1CPMA 5CFDA 1LEMA 4RQPC 2A7AA 2PHTA 4X8NA 3AYCA 2GSYA 4FPCA 4XBLA 2NN8A 3VKMA 3WV6A 3VHPA 3WW1A 2AENA 4KL1A 3WQ7A 1QDCA 4MXVA 2VOVA 1QHDA 1WA4A 4HPKB 1WBLA 3JD71 2HWC2 1PGW2 1AR63 4TYSA 4GMP3 1AJOA 1UIKA 1CAWB 3HQXA 4XFFA 4Q26A 5CFCC 4J6GA 2A73B 1Q56A 1MR5A 4A2UA 2E7AA 5BY5A 3O0XA 2WZR3 4I2OA 5LK7B 1LCLA 1J3QA 2PHWA 4AHYA 3MLLA 1DZTA 2A6YA 5KHIA 1OFNA 4XF9A 4AEDC 2ZHLA 4Q4Y3 4BIOA 1IS5A 3I4IA 3THPA 2ENRA 4AGGA 3VBRC 3CLPA 4BZ4A 1DQ2A 3AMPA 2ZGSA 1ZA4A 4XPVA 1QJZA 2BNMA 5AC92 4IEXA 4QGNA 4LBKA 2PA7A 5H9PA 2ZHKA 3RI8A 4I30A 2YUEA 1B09A 4JGYC 2DF7A 1FYUA 4GALA 1MQTA 4GH4C 4XQWA 3RPQA 1VBA1 3H7JA 1COV1 3AXDA 3U10A 1RMU1 4AI3A 5C8CB 4TLFA 1K5MA 1MS0A 1U0AA 3VKLA 1H2NA 1MVQA 4NWWA 4Q1RA 4UW4A 1VBC3 3BOWA 5CIRA 1RUC1 1OFSA 1IKQA 1LODA 4XIOA 4FOVA 2VMIA 5BNOA 3VBHA 3FUQA 3WY6A 5A32A 4HN0A 3ZXFA 3I8TA 4YZ3A 4MH0E 1CAVB 2WFF3 4ATEA 1QJX1 2A3YA 2UYAA 4N43A 3CJIB 5FMOS 1KJLA 5C4WB 4QMAA 2ZGKA 3WW3A 2QZ3A 4GXLA 5HXVA 5I0TA 4GQ7A 4IV3A 3HMYA 1ZZ9A 3MYXA 3WCSA 3UKNA 5AFEA 1X8EA 4B4QA 2OUJA 1G7YA 1H1MA 2IXLA 1PO21 1EPWA 4I0WB 2RJKA 4XTPA 3ZMNA 4EROA 2Z79A 1XU1A 2MEV1 1HXS1 3AZZA 4IV1A 3O12A 4AGRA 1HIXA 4YRDA 1RUF1 1TE1B 5JWPA 1H9WA 4CDUC 5GLVA 4HL0A 4Q0QA 4Q4V2 3IT8A 3FFZA 2CAUA 5FAXA 2JKBA 1MS4A 2VVFA 2PHXA 2IZWA 1VB2A 1LOAA 3UJOA 2PFWA 2BNOA 5EV7A 3ZXLA 3JB8A 4D94A 4K20A 4QT6A 3CJXA 1R091 4YG0A 2PLV2 3IPVA 2XJTA 4KU8A 3N7KA 1WMDA 3M8LA 3WQ1A 1EV13 4XMAA 1BEV3 1EPZA 5JZGC 4MVTA 2ZX4A 3L2HA 4QM8A 1YIFA 2DVFA 4QQLA 4COWA 1ENXA 4A7ZA 1LENA 1LHOA 1QQP1 2R062 4FOYA 2PTMA 4XJAA 3VKFC 3DF0A 2I45A 1ZZ6A 3OGGA 4QGMA 4U36A 4BE3A 5GZGA 5FLJA 3M1HA 2K0GA 1AXYA 4WVZA 2PLV3 2WNVC 2IXIA 2E51A 3VBFB 1YHFA 5E89A 4F83A 2RM22 1WMFA 1SLAA 3ST7A 4H7LA 3ZVXA 1YFYA 3ZIWA 1VRH2 1OD5A 2XLAA 4YG6A 1F31A 2P2KA 2ZJCA 2CGNA 3IN9A 1O4ZA 2VXRA 4XFHA 2R063 2CAVA 3B01A 1PIV1 1TMF3 4KG8A 3VBSA 1RUE1 4LUMA 4JDNA 4EWDA 4WM8C 2WT0A 3GZTB 1PHMA 3AP9A 3VDDC 2RS32 4YLZA 3SCGA 1XNBA 1LRHA 4M01A 2EA7A 1NE4A 2IC1A 4AVTA 1RVF2 1YJKA 1AYM3 1YRZA 2RM23 4P9XA 2ZACA 1BK1A 2PAEA 1W0OA 2VGDA 5ABJA 1HRV2 5L7OA 1EY2A 2VULA 1OQEA 4YW2A 4WVMB 4AVCA 2X53S 5JMCA 2RS12 1ULDA 1AR61 3VL9A 2A6VA 4GMP1 3APBA 2LUWA 4I3PA 2ZMNA 1BBT2 4S2HA 3H1WA 1URXA 4XF0A 4E4DX 3N35A 4DZGA 4ZU7A 2DTWA 2X8KA 2D44A 2WZR1 3BB6A 3SCHA 2QUOA 4BYYA 1MEC2 4AW7A 1NZCA 4EN7B 5C8CA 2EXJA 5GM0A 4K21A 1F5FA 3FE5A 4DMIA 2ZGMA 4Q4Y1 2D6KA 4YM1A 4HFSA 5BYNA 4JGZB 1RIRA 2WLQA 1PGW1 1ZBA2 3BIWE 1H1AA 1V70A 4HKOA 1CAVA 1J3RA 4YW4A 1EYBA 5FDBA 1CAUB 1TME2 3ZN5A 5GLTA 2CV6A 2CYFA 3CJIA 1BBT3 3CNAA 2JJ6A 2JXAA 4FXKB 4XIKA 4AQSA 1MS9A 4XJUA 1J59A 3WP6A 2D43A 3EO6A 4U2AA 4B7KA 3AM2A 4QPIB 4CZSA 4Q4W3 5B2GB 2V73A 4N53A 3CL1A 2I74A 1B35B 1FV2A 1SLTA 1REFA 1VBB2 2PHUA 2D6LX 3KGZA 4GMP0 3W9AA 1BMV2 3SHRA 1XNDA 1KDKA 2WFF1 4YM2A 4YW5A 1DQ0A 4K1ZA 1PO13 3TN93 1FI2A 4XF4A 2YMZA 4RR3A 1MVEA 2XPJA 4C1XA 4DS0A 5FTTC 4LO5B 4X8PA 4R9CA 1JH5A 2GMPA 1GBGA 3VZKA 4CP1A 4LE4A 3BU7A 2DV9A 4AI0A 1QH7A 3H7YA 5JOXA 1ZRCA 4AQ2A 1WW7A 1ULCA 1O4YA 2NYYA 1DGWA 2QVSB 1YCIA 3ROUA 3VZLA 1VBB3 2GH2A 4PCRA 1DHKB 2JG8A 2XJRA 1D2SA 4DPNA 2E6VA 3RJRA 3BCWA 1JN2P 2E53A 3H3ZA 3PMSA 3B94A 4I01A 4AFAA 4UBHA 1S0GA 3EQEA 4CRQA 3MF9A 1QH6A 1O4TA 4XDQA 1GFF2 3AYDA 3TNPB 1PGL2 1QOSA 2ET7A 2VQ0A 4MUVA 5C4WC 3KD4A 1PK6B 1JXNA 1GR3A 5BNPA 2H6CA 3GF6A 5GLUA 4O9GA 1N3PA 4RQPB 1BEV1 1I1EA 2VG9A 3R0RA 1AL22 4DFSA 2QDNA 1HQLA 4KGGA 5T55A 1FAYA 1X33A 2BBVA 1C5HA 1RHI2 4AE2A 4I3GA 5GLZA 4HETA 1O5LA 5JR7B 3S30A 3AB0A 2ZABA 4M3CB 1RUH3 5BNQA 3AKQA 4JC1A 5KC5A 1AHSA 2RS53 5CFCB 2EIGA 1HKDA 1W6QB 3ZSMA 2PLV1 1OOPC 5A3LA 3TYJA 3R05A 2P34A 1VBD2 1U5ZA 4YGBA 5I93A 3N7LA 1DZQA 2Z69A 1F2NA 4YVWA 3RWNA 4AEDB 4OUMA 4WVMA 1AZDA 1ZM1A 1WGPA 2XLGA 3NAPA 1KS5A 3KS7A 3LAGA 3LCPA 1RHI3 3ACLA 4Q0UA 4Q1PA 3FLRA 3QH6A 5F5QA 2R061 1RUG2 4HKLA 4QD2A 5GLWA 3TBDA 3KGLA 1F8VA 4RSUA 1VBE3 1R1A2 2XG3A 1PGSA 1ZREA 2ZGQA 2HWE3 2B45X 3VV1A 2JEMA 1V6IA 2VH9A 1NA1C 2ZZJA 3AMHA 4JGYB 4GH4B 4GULA 1GZ9A 1VBD3 3POWA 2R1BA 1AYM1 1IKPA 2RM21 1G6NA 2OUHA 2RHPA 3DPRC 3LOIA 3VBFC 2WSUA 1DYKA 4FPHA 5J7MA 5JIUA 3MPPG 3SNMA 4JGZA 4WZFA 4KH9A 4MGZE 4P9WA 1H8VA 5C6CA 4B29A 4ZKTB 5KHGA 1RUG3 2ZA9A 3INAA 3PVNA 1JTZX 1VLNA 1NE6A 2B8MA 4MXWB 1R1A3 4Q8KA 4BM8A 2HWD2 4HN1A 5FQ0B 4FPLA 1PZ9A 4X6RB 3UK9A 3VZMA 2RS31 4OI0A 2IWGB 3W59A 2X5IA 2Y38A 4B4RA 1QGLA 2HJIA 1RVF1 4E2GA 1GKBA 4CDQC 2A3WA 1B35A 2CGPA 2ZTNA 2YXSA 1OI6A 3AMMA 5I91A 2GC1A 3ES1A 4CEYC 1O3QA 2HYKA 5A33A 2DCZA 2RS11 1FMD2 3B69A 5SV5A 3ZXKA 4NOTA 3AP6A 1XRUA 2VUJA 3THTA 1W6NA 3OD0A 4AHWA 1DYPA 2XBO2 1BBT1 3E97A 3WG4A 2VW1A 4NHMA 4RHV2 5K0UA 4R9AA 4NHKA 3ZN6B 1IPKA 3A0NA 4XTMA 1C5IA 3IM0A 4WBBA 1LOEA 4Q4W1 3AZXA 5FOBB 1FV3A 1S1AA 4A3XA 2GMEA 4H55A 4PDWC 1H1IA 3RMXA 4FXGB 1D0HA 2F4PA 4H14A 5JZGB 1PO23 2DCJA 4Y22A 1WLWA 2JENA 1ZBA1 3ILRA 1N3QA 3GALA 4PBOA 4AFDA 3TN91 2MEV3 1CIWA 3WQ0A 4CYDA 2WZPP 3N3HA 2P3JA 3FLPA 4IETA 3VZJA 4COYA 1CPNA 1ND2B 2WKKA 4K6BA 2EAAA 3WUDA 2XLFA 1AX1A 2D3PA 1MACA 2A75A 4ES9A 1W6MB 3SISA 4YGDA 4LBMA 1O91A 4M0NA 4RQPA 4R4ZA 3ZSKA 4AHZA 3BOPA 1HRI3 1YLLA 3C2UA 3WX5A 2RMU3 5JI9A 1WUVA 4QPIC 1WMEA 4AF9A 1VBB1 1LHUA 4MGYE 1BMV1 3S7EA 5GKAC 3MI8A 5JPNB 2JG9C 1FT9A 2W08A 3MIDA 4M3CA 3HR9A 2XKPA 5AVAA 1QNWA 5T5JA 3NJZA 5CFCA 4QQHA 4QPGB 1W6QA 3WXPA 4BPZA 1LTEA 2IFRA 3V64A 4LA2A 4AI1A 3G6JB 3P3PA 1DGWX 3PVEA 3VDDB 3WDYA 2WNEA 1SCRA 4MGIE 4D69A 1OHFA 4IEUA 3ATGA 2B7YA 4DXZA 5JSRA 3KSCA 1NOVA 1LKNA 2ZKNA 1OPMA 2VMGA 1UPIA 3CEWA 4AEDA 2IXKA 2VNOA 5KHHA 3DKWA 1ZZCA 1CONA 5JI7A 3LB9A 1H2LA 4AFBA 4OHWA 4ZU4A 3VBRA 1G9BA 4LHNA 2DVBA 3LA7A 4IEOA 2FZ2A 1DF0A 4KU7A 1PGL1 3KT7A 3MFAA 5T5LA 5DZFA 2B46X 1UKRA 1VR3A 3RG0A 4DRRA 1QDOA 1ZBE2 3J8F3 5JOWA 1C1LA 3Q9OA 4Y1VA 5ACA2 4JGYA 2IXCA 4GH4A 3AJYA 4WM7B 1PK6C 4GB32 1OQDA 5I8YA 2N7GA 5D8AC 4OI1A 1POV3 1O3SA 3AKTA 3V0BA 5BNNC 1S0IA 4L11A 4HT1T 1KFXL 2O8OA 1H2KA 1OPOA 1SQ4A 5DG2A 5IK4A 3J4UH 1RHI1 5H9QA 2WS93 5DUVA 1VBE1 4MXWA 2DFBA 2B5HA 1A78A 2OW4A 2HWE1 2R0HA 1H9PA 2XVKA 3D82A 4Y24A 3AMNA 2BFUS 3MLJA 1C8M2 1CAXB 4E2SA 2NZ9A 2NM1A 1VBD1 3AP4A 1RC6A 3M2MA 1XE8A 1OA4A 2TBVA 5EXOA 5DUUA 5IUQA 1XYOA 3URFA 4I02A 3MW3A 3JB4C 1UU4A 2PHFA 2WJSA 4FP3A 1FATA 4ORFA 1I9RA 1UN1A 5L73A 1Z78A 1AYN2 4IEWA 4CDUA 3FX3A 1RUG1 4QX5A 5KC6A 1SLCA 4BMEA 1R1A1 4K1YA 5A3MA 1H4HA 4FPYA 2HWC3 3OCPA 3TWIA 3ZN6A 4L99A 3RYRA 1BXHA 4KNCA 4CDXB 3FZ3A 1Q8OA 3NW4A 2AR6A 5T3NA 1GQGA 3UKVA 3PHMA 5CU1A 4JAAA 1G9CA 5JZGA 3JZVA 3FFQA 2WQZC 4YG3A 1AYN3 1S0CA 1X50A 2CWMA 4RS5A 4CDWC 3ZFFC 4XFBA 3H9AA 4J1XA 1WLCA 4P9YA 3T1LA 4IEPA 3R4DB 5LEKA 1AR72 2JX9A 1W6MA 2CTVA 3GBWA 5DG1A 1ENQA 1XU2A 5AC93 2R1DA 4W65A 5GZFA 2WNVA 4NO4A 2R6QA 3B9IA 5FLIA 1S0FA 4QQOA 4Q0VA 4IERA 3SITA 5H9SA 1WCKA 3PLQA 1CN1A 2XBO1 4K8FA 3ZXEA 2DUQA 4BIFA 4QGLA 1NLSA 5CNAA 1BQPA 5BXXA 4AEMA 1C57A 5I0RA 2BWCA 5KBFA 4YW3A 2Q30A 2R0FA 1AX0A 4WM8A 4BHPA 2DVAA 4A7KA 3RYPA 3WNXA 2C9AA 4K9SA 5TSWA 1LOGA 3VDDA 4MLOA 2QE3A 5KXDA 1HRI1 1OOPB 2D6NA 1A3KA 2E7QA 5DZEA 2RMU1 1IS4A 1RGSA 4RA0A 1ASJ2 1MZ6A 1FOD2 5L19A 4FP2A 4G4FA 1G8WA 1ZX5A 1YIPA 2H0BA 2P37A 4JVAA 2VY0A 1KDMA 3MZHA 4H7MA 3I59B 1CJDA 4IEVA 5HI0A 4AFMA 2OIIA 4Q8LA 3SH4A 1ZVFA 3E5QA 1C8NA 3OYWA 4Q4V3 4GA9A 1ND2C 4YM0A 2GDFA 1CR7A 4WV8A 1MZ5A 4XFIA 3GNEA 4UBGA 4YVSB 4HZFA 3MFCA 4N9IA 4OHZA 3BODA 1KRIA 1NA1B 4L8QA 3QCWA 4CP2A 2B42B 1NG0A 2WNUC 2Q8OA 2QDRA 3DPRB 4LHLA 3U11A 4E2QA 1CJPA 2JE7A 2ZMLA 3A4UA 2IXJA 1CESA 2GAUA 3R6SA 1BYHA 1HV1A 4HPKA 4UW6A 4YM3A 4Y26A 1S55A 4RGAA 2XJQA 1CGPA 4N43C 1CAXA 3J8F1 3ZN4A 1XQNA 1CAWA 4E4ZA 4KQ7A 1UMZA 2A5ZA 3VBUB 4P9JA 3ASIA 4QPGC 5CA6A 4EN0A 2FHRA 1LU1A 4C91A 1WD3A 3AK0A 2WLPA 1POV1 4LLFA 1LGCA 4CTEA 4FBFA 4CDQB 1QOOA 2FMDA 1C28A 5DXDA 3PJQA 2ZAHA 4CEYB 4WVWA 2WS91 3ZFEB 1U12A 2V09A 4Q29A 1VRH3 2BNNA 2P3IA 1ZZ8A 2H6BA 3WUCA 4IXLA 3S0MA 1W0PA 3WP4A 3TOJA 3JU9A 4EJRA 1NQDA 2ERFA 5JIAA 2XVLA 1R082 1SBDA 2TEPA 1LEDA 2ARBA 2ZPXA 3HN1A 4K3UA 2WA3A 3OGJA 3ZFGC 2D40A 4WM7C 3KZ4C 5I0SA 2HEWF 3V56A 2RS33 1AR82 2HEVF 4FSJA 1V6LA 4ATFA 1UZYA 4PDWB 1RVF3 1HDKA 2A3XA 2ZMKA 5BPXA 5J09A 5JSPA 1JYCA 3E6CC 4LO6B 2ZX3A 1U5IA 1HRV3 3VBOC 1QU0A 3I54A 3KCXA 2RS13 4LBQB 3ZSEA 5F1RA 2HWC1 2BEOA 3VGIA 3AJZA 1C8M1 4DY5A 4QHBA 4ZU5A 2I2SA 4Y20B 4SLIA 1R083 5C4WA 5T5OA 4AVVA 1POV0 1O5UA 1ND3C 5AVPA 1WD4A 3O0VA 3OTFA 1WBFA 3HD8B 3R4UA 5LK5A 4Z2WA 1MEC3 1AR83 1TEIA 4XJZA 1LJ7A 2PAKA 1QJU2 1AYN1 3LA2A 4FPKA 3JQWA 1T6GC 1QJY2 4MSVA 1VALA 4LTAA 4DQAA 5LRSA 3VKNA 1GZWB 1YXWA 1ZRRA 2WIIB 2YGMA 5JSOA 5E8AA 4H3WA 4OZXA 1SLIA 3POSA 1DIWA 2LTNA 3CU7A 3TAYA 2JG9B 5JPMB 5CVRA 1ZBA3 4BLIA 2BTVC 3RDIA 4LNVA 1IS6A 1TME3 5CBLA 5AC91 4Y1ZA 3H1YA 5FCCA 4DOUA 3B5LB 4HSLA 4BH9A 4W6YA 1OOPA 1QNYA 3ME2A 1E57A 4CDXC 2VPVA 3AZWA 4XJ9A 2GC3A 2R30A 2W0XA 2JE9A 4HVOA 2VECA 4HVRA 1MZFA 4YYOA 1SLBA 3MIEA 5IK7A 1S0BA 4YFZA 1S0JA 1QJY3 4AYUA 5L7OC 3NSTA 2D5HA 2OZJA 2Z5WA 3GHNA 4XOGA 2WL1A 3WG2A 4HVQA 4ISRA 2ZKLA 2CWSA 4C0HA 4XW3A 4AQ6A 3AYAA 1IQAA 2ZGUA 3KM5A 1NCQB 1M06G 1N1YA 4MYEA 2YV8A 1NA1A 1DLLA 1FXZA 3M3OA 4E27A 4HK9A 4NN0A 3IDBB 4ISQA 3D6EA 3RMYA 5D8AB 2ZBJA 3AYEA 3DPRA 2DYCA 1UKGA 2OA2A 3VBFA 2ZGTA 1RUI2 2DCTA 3PVOA 5BNNB 3ELNA 4Q4X2