1AYN3

Human rhinovirus 16 coat protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The structure of human rhinovirus 16.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 39
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ayn300
1EV13 1RUJ2 4IV3A 2HWF2 2R061 1AR73 4N53C 1K5MB 5FMOL 1TME3 4Q4X3 3VBHB 2PLV1 4NWWA 2R071 1AL22 4WM7B 1H8TC 5CFDC 1R083 1QJU3 2R043 1QJX1 1RHI2 1H8TA 5CFDA 1PO12 1RUH2 4RQPC 4GMP1 4JGZB 4CDXA 1ND3C 4N43C 1VBE2 4RQPA 3ZFFC 5JZGA 1HRI1 1ND3A 4N43A 4AEDC 1D4M1 1RUG2 3ZFFA 1QJY3 4Q4W3 3NAPB 1HXS2 2FZ2A 1B35C 3ZFEC 1FPN1 1AL23 5BNPA 1CJDA 3ZFEA 5BNNA 1R091 1WCDJ 3IDEA 4CEYB 1PVC2 1V9U1 3VBSB 3ZFGC 1IHMA 1W39A 1RHI3 3VDDA 1VBD1 2RS33 3ZFGA 1NG0A 1RUD2 4QPIC 2MEV2 1FOD3 2BFUL 5C4WB 1VBE3 5LK7B 1HQNA 2RM21 1RUF1 3J8F1 1VB4A 2WFF1 2RR12 1SMVA 1C8M1 3CJIA 1HRV3 5CFCC 1AYN2 1TMF2 1RB8G 2R063 2HWB2 1VBA1 5CFCA 4RR3C 5DDJ1 4IV1B 5ABJC 5C9AB 4RR3A 2PLV3 1OPOA 4RFT0 1VAKA 4SBVA 2HWC1 2R073 5L7OC 1AR62 1X33A 1RUD3 2GSYA 5C8CC 4RHV2 5L7OA 4FTBA 1QJX3 3VBOC 1PO22 1QJU1 2R041 3FBMA 1NY71 5C8CA 1R1A2 2RR13 4GB32 4RS5C 5A33A 1VBB2 3VBOA 3VBRC 1PGW1 1F8VA 4JGYA 1TMF3 1RUE2 4RS5A 4WM8A 1HRI3 1BEV2 3VBRA 1RUJ1 2HWF1 1D4M3 1VBC2 4CEWC 1AR82 1RVF2 1FPN3 1BBT2 1AR63 1R093 1AL21 2HWD2 1VRH2 2XPJA 1ND2B 1PO23 1R1A3 1K5MC 1VBD3 1RHI1 2WLPA 1PO11 1RUH1 3VBHC 1K5MA 2RM23 1RUF3 1VBE1 3VBHA 4WM7C 1ZBE2 1VBC3 2RS12 1RUG1 1EAH2 1VBA3 1HXS1 5DDJ3 4JGZC 1PIV2 5FOJB 1AUYA 4JGZA 4N53A 2BPA2 2GH8A 2HWC3 4FSJA 1PVC1 1Z7S2 1PGL2 3NAPC 5K0UB 1RUD1 2MEV1 4EJRA 2RR11 4CEYC 3VBSC 4FTSA 1AYN1 1TMF1 1RUJ3 3S6PA 4CEYA 1RUC2 2HWF3 2HWB1 3VBSA 1QJZA 4Z92B 5C4WC 1NCQB 4AEDA 5C4WA 1POV3 1Z7S3 1DDLA 5ACA2 1AR61 1CD3G 1B35A 3JBG2 2RS52 1OHFA 1NCRB 1M06G 4RHV1 4IV1C 2HWE2 1PO21 1PO13 1RUH3 5C9AC 1ASJ2 1R1A1 4GB31 1VBB1 4IV1A 1RUE1 5D8AB 4QPIA 1RUC3 1BEV1 4CDUC 1POV0 4YVWB 2WZR2 1RUG3 1COV2 2FZ1A 4CDXB 1VBC1 1HXS3 5A32B 4Y5Z0 1AR81 5JZGB 1RVF1 1AR92 1MEC2 1PVC3 2ZZQA 5ABJA 2HWD1 1RMU2 1VRH1 4QPGB 4CDUB 5BNPB 2MEV3 1FMD2 1E57A 1ZBE1 3VDDB 1ND2C 1AYN3 3JD72 2RS11 2HWB3 3LOBA 1RUI2 1EAH1 1ND2A 4Q4V2 3TN92 1PIV1 3VBFB 3CJIB 1BMV2 2XBO2 1NA1B 1AYM2 2WS92 1POV1 1Z7S1 1ZBA2 4CEWA 4CDQB 1PGL1 4RHV3 3VBUB 2TBVA 5AC92 4GB33 1VBB3 1C8M2 4NWVA 3DPRB 5J96B 5GKAC 3JD73 1RUE3 2VQ0A 1OOPB 1BEV3 4Q4V3 3TN93 1EV12 1RUC1 5BNOB 5K0UC 1AR72 2RMU2 4PDWB 4JGYB 4WM7A 5K0UA 1AR83 1AYM3 1F2NA 1RVF3 2WS93 1BBT3 1TME2 4Q4X2 4YVSB 1QQP2 3JB4C 2BFUS 4CDWB 5ACA1 2HWD3 4Y4YA 1VRH3 2ZTNA 3JBG1 2RS51 1R082 2HWE1 1NCQC 5AC93 2Y26A 1ASJ1 2X5IB 3NAPA 1ZBE3 2WZR1 1NCRC 2RMU3 2RS13 2DF7A 4FTEA 1COV1 1EAH3 3HAGA 1QJY2 1NCRA 4Q4W2 1QQP3 1PIV3 1MQTB 4GH4B 1AL0G 1X36A 5D8AC 2BUKA 1AR91 1MEC1 4YVWC 4IV3B 5D8AA 1RMU1 4CDXC 2BBVA 4YVWA 4Q4Y2 2RS32 4N53B 5JZGC 1FMD1 1FOD2 5A32A 3M8LA 5J98B 5C9AA 3JD71 4QPGC 1HRV2 3JB8A 1A6CA 1H8TB 1RUI1 2R062 5BNPC 4Q4V1 3TN91 5CFDB 5BNNC 4QPGA 4CDUA 1BMV1 2ZAHA 2QQPA 2PLV2 2XBO1 4RQPB 3VDDC 1AYM1 2WS91 1GFF2 1ND3B 1BBT1 5ACA3 4N43B 2R072 1NOVA 1ZBA1 2IZWA 4Q4Y3 3JBG3 2RS53 3ZFFB 4AEDB 2HWE3 1QJX2 1ASJ3 3VBFC 3CJIC 5AC91 1NA1C 1B35B 3ZFEB 5BNNB 3VBFA 4CDQC 1NA1A 1HRI2 2WZR3 1EV11 3VBUC 3ZFGB 4CDQA 5FMOS 1COV3 1D4M2 1AR71 2RMU1 3VBUA 2WWSA 4QPIB 3DPRC 1TME1 4Q4X1 1FPN2 1QQP1 1AR93 1MEC3 1OOPC 1R092 3DPRA 5BNOC 1RMU3 1V9U2 1R081 1OOPA 5CFCB 4PDWC 4JGYC 5BNOA 1VBD2 4GMP3 4WM8C 1FMD3 4RR3B 4YVSC 4PDWA 5ABJB 2RM22 4CDWC 1RUF2 3J8F2 2WFF2 4YVSA 1C8NA 4CDWA 5L7OB 1RUI3 2X5IC 1QJY1 4Q4W1 1VBA2 4LLFA 5C8CB 5DDJ2 5A33B 3VBOB 2X5IA 4GMP0 2XBO3 1V9U3 4RS5B 4WM8B 1VB2A 3VBRB 2HWC2 1ZBA3 4BCUA 4Q4Y1 1HX6A 2RS31 1MQTC 4GH4C 1FOD1 1QJU2 2R042 1NY72 3J8F3 2WFF3 4CEWB 1C8M3 1MQTA 1PGW2 4GH4A 4IV3C 1NCQA 3ZXAC 1HRV1
chains in the Genus database with same CATH superfamily
5HCHA 1RUJ2 4IV3A 3D6EA 2QQWA 1EPWA 5FYVA 4BHPA 5BV6A 3H3LA 3VKFC 4BM8A 1W05A 4LHLA 5C7GA 4B3NA 3M3EA 1K3IA 1IGOA 2PHTA 4LKDA 3O1TA 4QQLA 4Q4X3 2WKKA 5JPMB 5K8SA 2AACA 5F5CA 3MICA 1W3VA 2R071 3MF6A 2B9UA 1UO9A 5CFDC 4N90A 2JG9C 4CCDA 1QJX1 5JIUA 3I3MA 4AVVA 1UYYA 5CFDA 1YJKA 5A1AA 2PMWB 2ZS6B 1YYNA 2VNGA 3MV11 4GXLA 4JGZB 5GZDA 3RPQA 3ZMOA 4JHZA 2LUWA 4CDXA 1JXNA 1JOJA 2X09A 3T1LA 1YNAA 1U5ZA 1RYYA 3S7IA 1WD4A 4OMDA 3EQEA 2O8QA 4ITCA 2NP0A 4MSVA 4KU8A 3E1F1 1S55A 3ASIA 3NAPB 4JRLA 1VMHA 2YC4A 5GZFA 3BTZA 4K40A 3P3NA 2VOXA 1DQ1A 4NPLA 3RJ2X 2D98A 3I4IA 5IVBA 5EJZB 5BNPA 1UOFA 2XJQA 2DWRA 3KHCA 1SLIA 1WCDJ 3IDEA 4I0WB 4LUKA 3BALA 3ZFGC 4YW6A 2Y6FA 5T3NA 1UY2A 4P02B 1QY4A 4ISQA 4W4ZA 4AHZA 5DAVA 1VBD1 5T5PA 3ZFGA 4Q27A 4QPIC 4BIOA 1HN1A 3KM5A 3NV3A 3OOXA 4D7TA 2E63A 1OD5A 4MYEA 2P3IA 4JV4A 1RUF1 5CB7A 4I2OA 3BU7A 3CJIA 4AR2A 1W06A 4EWDA 4FPLA 3KCCA 5L36A 1MVEA 2ZOEB 4L99A 1CAXA 1GOGA 3BOPA 2Q1ZB 2VQAA 4PIZA 3ETPA 1W9SA 3FLTA 5FMDA 1VAKA 3GBGA 3ZYIB 1VP6A 4PLNA 4SBVA 2A6VA 1MS9A 1NXMA 1FATA 2D7FA 4R9AA 3O0WA 4KG8A 1D4VB 1H2MA 2RJLA 4M0HA 4RHV2 5IYYA 3KF3A 1OKQA 1QJU1 2R041 4E4SA 2RR13 4QXKA 1F5JA 5A33A 1VBB2 2WZEA 1D2QA 1PGW1 4HPKA 4CRQA 3CQOA 4XVHA 1ZNPA 4WM8A 3IAPA 4WVZA 1BEV2 4ATEA 1DQ0A 3USUB 4WBBA 2W2IA 2YHJA 2WUHA 2WO2A 3NNFA 5EZWA 1IZ3A 4JAAA 3JU9A 5KHIA 1YLLA 1F4HA 1GKBA 4E4ZA 5A6YA 1ZRFA 1W9YA 3P3PA 4JDNA 2BEOA 4LBJA 3WNLA 1FPN3 2VO5A 4XPVA 2WYSA 4HVRA 4J25A 4RN5A 4B1LA 1A3KA 5CU1A 4HKOA 2O8OA 1R093 1XPWA 4M4RA 1AL21 1AHSA 4A7YA 1JZ7A 3E97A 4LBOA 5FPLA 1SLBA 5FUIA 2OQ7A 1LHOA 4NRMA 3PLQA 1U0AA 4LMFA 1PZ9A 1R1A3 1K5MC 3I2DA 1RHI1 3HEIA 3NRUA 3MFAA 3SHRA 1OVSA 2OUHA 2R1BA 3KT7A 5FPZA 3I2FA 2WO1A 4QMAA 5A7PA 2PHDA 5JXHA 3KV9A 1K5MA 4YLZA 1IG3A 1VBE1 5F3IA 5FYCA 4QB1A 3FJSA 3WF1A 1LULA 2XLGA 3THDA 1G6NA 1Q43A 4QDSA 2W46A 4PJYA 3P5BA 4ISRA 4GKYA 2WNUC 1O91A 4LJHA 3SKJE 1EAH2 5T5OA 3B69A 1D0GA 2WNUA 5FOJB 2QQUA 5HV4A 4ES8A 1AUYA 1Y9MA 5TSWA 2GH8A 5CVRA 2XUEA 4YFWA 4FSJA 3VKMA 5FXVA 2ZX2A 4AGGA 4Y24A 2QE3A 5I8YA 1JYIA 2A71A 3ZDVA 3WNNA 2H0BA 2VH9A 3KQ4B 3T08A 2V4AA 1LJ7A 1SFYA 4UFIA 3TRSB 1GU3A 1OC1A 3KCYA 3B01A 1ENSA 1YIFA 1A34A 4XAEA 4CEYC 3RYKA 1C57A 4MHRA 1REDA 1OA4A 3LDKA 3A0NA 4I09A 1TMF1 2VZUA 3HQRA 2VTFA 3ILRA 3MV01 3VKLA 5KC6A 3NNLA 2HWF3 4CEYA 3MI8A 2GP3A 4LO7A 2YV8A 4QX5A 2Z42A 3RZGA 1NE6A 3T3YA 1NCQB 4D7SA 4CCLA 3O1OA 3HPNA 2J22A 3JZVA 3ABZA 1I1EA 3PVEA 4LO8A 3JQWA 4PT6A 3OF1A 4CPBA 3LDRA 4A3XA 2Y60A 4LPLA 1AR61 1CD3G 1H6YA 3J7MA 1B35A 3E6DA 1ZZ9A 1ZZ6A 5FIXA 2D6LX 3NV2A 1NCRB 1D0HA 2DFBA 3E6BA 2VW0A 1SPPB 3OB8A 2ZGPA 1XU2A 2HWE2 3JXSA 3OUHA 3MF9A 4KQ7A 3H1MA 3I2OA 1HB3A 1W90A 2CL2A 4INDA 2OUJA 2P37A 2BWAA 2VMHA 2TEPA 3D8CA 3ZN6A 1YFWA 3RS6A 4QHOA 4B7EA 1CAVB 2GU9A 1JHJA 1LECA 5CYYA 4BU2A 1KS4A 3O14A 4FOYA 4C1WA 1JYVA 4YVWB 4FFFA 2MHFA 5JOZA 4NUBA 1RC6A 4H7LA 1GZTA 1RUG3 3H9AA 1NZIA 5FY5A 5FYMA 1ENXA 2E32A 2IXJA 4XAAA 1HXS3 5LK5A 3ZN4A 2XJRA 3ZXGA 1YO8A 1HJGA 2Y0IA 3DL3A 2JECA 2D3RA 2WT1A 5F3EA 5KXCA 1W6OB 5EYYA 3E6CC 1UMHA 2E7QA 2A3XA 3NVCA 1MEC2 2XDVA 2UYAA 3H7JA 3UGGA 1C3HA 2GP5A 2Y6GA 4EN7B 2HWD1 2YBPA 4LOTA 1REFA 1RMU2 4QKFA 4MXWB 4EV0A 1UKGA 3DN7A 5FZ1A 3MIFA 5I0UA 1N1YA 1SLTA 2JX9A 1UY0A 4YZ3A 4AYUA 2MEV3 5E1RA 2YG0A 1PNFA 1WMDA 2C5DA 1FAYA 5EQUA 2SLIA 1AXKA 4QDRA 1LAJA 2XXZA 3WLUA 5E88A 1ND2C 1AYN3 2QBXA 1PX4A 3C7GA 4XFCA 2HWB3 5FWEA 1YIPA 1NUKA 3LOBA 1RUI2 3ZPYA 1ND2A 1CONA 3TN92 5DZEA 4XF9A 3VD5A 2JG8B 3NJZA 2GNDA 2J7MA 1Q8PA 3M3QA 2I2SA 4U36A 3WF4A 3ZXEA 4BK4A 2XBO2 1NA1B 3A4UA 3KGZA 1LEDA 4XZUG 1POV1 3AMMA 1Z7S1 4CEWA 5DMYA 3VHNA 4F8AA 3K51A 2FDGA 5F3GA 1H2NA 4FPGA 3W59A 5DG1A 2ZEXA 1W9FA 1EP0A 5KHJA 3QCWA 1CR7A 4S2FA 4GB33 5AC92 1UL9A 1YFYA 1GWKA 4CXWA 2E26A 3FWEA 3ILFA 4XF3A 1MZEA 3DXTA 1RUE3 1W6MA 3ZYJB 2UY9A 1UU5A 2W95A 3S5AA 5K0UC 4YRDA 4Y26A 5BNOB 3ILNA 4ZHNA 1RIRA 2DBIA 3AP7A 4K9SA 3AKTA 1AR72 2JWPA 5FZ3A 2C24A 4NHYA 4MZUA 5DAWA 5DZGA 1OLRA 2VMEA 2YC2A 4PDWB 4XXPA 5K0UA 4YPJA 1AR83 4QU2A 1DBNA 3Q8CA 1AYM3 5C3SA 4CP1A 3UNPA 1MVQA 1QQP2 3PTRB 2JENA 3NV4A 3L2YA 2CAUA 1PNGA 4KL1A 2BQPA 4N9HA 4XUQA 2KD7A 4O65A 1QNWA 1XB9A 3WNMA 4ASMB 3QH7A 4Y4YA 4A3ZA 4ZU7A 3R05A 4FFGA 3ECQA 5IK8A 3PVBB 4ZZ8A 2P6CA 2Y26A 1ASJ1 3VL8A 1WA4A 2C9AA 2VNVA 4BQYA 3PIGA 1XU1A 4UWDA 4CVUA 2RG4A 2VZOA 5AVAA 5A3NA 4HSLA 3NAPA 2JEMA 4QB6A 4V2WA 1ZBE3 2P3YA 2AR6A 2WYFA 4HETA 4ARXA 1KRIA 4BOWA 5E8AA 2RMU3 4MGQA 5F6KA 1SFPA 2RS13 4HN1A 4TN7A 1V70A 4GWIA 1KGYA 4A6SA 4X8PA 3HAGA 2PELA 3K77A 5FTTC 4Q4W2 2NM1A 1JZ8A 5FDBA 5GLUA 2DVFA 2P3KA 4I3PA 1PIV3 1XNKA 2YPJA 1MQTB 2B39A 2WNEA 2ZMNA 3B00A 4GH4B 3WQ7A 5H9SA 4AVBA 2FQPA 3MW3A 4XEZA 4JVAA 2RV9A 3WG2A 2XHKA 3U0ZA 3IPVB 3BKZA 3NW4A 4ZXEA 2ARXA 2R7EB 4IV3B 2BZDA 4Y1YA 3HNBM 2WBKA 3BODA 4NRPA 3N7JA 4Q8KA 4CE8A 2BGCA 2RS32 4JX0A 4DIQA 1FOD2 4G9SB 2RJ2A 4BQXA 1LOEA 2AYHA 1O4YA 2VQUA 1LHVA 1Q8SA 4FCAA 1W03A 4FQ4A 4I30A 2R0HA 1N3QA 1BZWA 4HT1T 4DINB 4MGIE 4QPYA 4QKDA 3JD71 1HRV2 3JB8A 3MW4A 5CFDB 1YI7A 5BNNC 4QDQA 3BIEA 4AFCA 1LR5A 2EIDA 3RYPA 5FLIA 5HBAA 5FRAA 3K4AA 4AI9A 4LBQD 2ZGNA 3V0AA 2DCYA 1XQNA 2ZABA 4UW5A 1ZX5A 4HOOA 1LOFC 5FPBA 4XFAA 5ACA3 2R072 1FXZA 1NOVA 1ZBA1 1H4HA 1MS0A 4C0BA 1AZDA 5CKMA 4MLOA 1LOFA 2WSUA 1G9CA 4AFBA 3KLSA 3I54A 1GICA 1QJX2 3BGAA 2ARBA 3BPSA 3SH3A 1ZRIA 2WC2A 2J1SA 1OSGA 2YGMA 1EY2A 3BTAA 1RXFA 5G05L 2WL1A 3VV1A 4Y20B 2RHPA 4YNIA 4CDQC 2E7TA 2OZ6A 2ZEYA 3VHOA 2UURA 2WZR3 1O3SA 3ZXKA 5C3PA 1UU6A 2VQTA 3KGLA 3VBUC 3ZFGB 4CDQA 5HCFA 1COV3 2VBBA 2XB6C 2YBKA 5AFBA 4OI1A 3MZHA 4AQ2A 2WWJA 1HKDA 4QU1A 3VBUA 2WWSA 3VHRA 3N9OA 2WO3A 4QPIB 2V5YA 3WQ0A 4MGTA 5I91A 4Q4X1 5FY9A 1GNZA 2ZKLA 2D6NA 1ZZ8A 5A3OA 5J36A 1OOPC 3TBDA 4CZSA 2NYYA 4LBNA 4YM3A 5IVEA 2CDOA 1JYCA 2VBPA 4MX3A 1OOPA 4X8NA 4YZ2A 4OHYA 2J1AA 2EALA 5BNQA 1VBD2 1H0BA 4S2DA 1JOBA 1JYWA 5FZGA 2Q8OA 4YVSC 1DGLA 2A6WA 3MW2A 4GWNA 3JCIA 3WNKA 1DZQA 1ZRRA 1RUF2 4Q2FA 3O1RA 3MIGA 4W65A 4YVSA 3SNMA 3B7MA 3LEGA 4IW3A 1HB1A 1UIJA 1ULGA 2KR2A 1WGPA 3N9MA 5FBZA 2VW2A 1Z78A 3KV6A 3SCHA 4XHBA 3GF6A 1QJFA 3MLLA 5A33B 1YFUA 1J83A 3AC0A 1U5IA 2W39A 3QACA 5IATA 1UZVA 4HPKB 2VCBA 4GMP0 3WW4A 4Y1ZA 5GLWA 3ZIXA 4BISA 5FWJA 4LHSA 2BNMA 4M4PA 4WM8B 1QJEA 5EYXA 2IXHA 2VGDA 1MS4A 2PHLA 4R4XA 2BGOA 3IIIA 3ENRA 3POEA 4GWJA 4BCUA 3NKTA 3AYCA 3LSDA 2FCUA 4M00A 2FCVA 4Q4Y1 1RINA 3SISA 3C7FA 5A3WA 2GC3A 3ACGA 5A3TA 4EZ4A 5FZ9A 4AK3A 1QJU2 2R042 3J8F3 3AB0A 1UF2C 4GALA 2XKPA 1PGW2 1OI6A 4QQ2A 1NCQA 5HV0A 1FNZA 1I9RA 5ERLA 1GNYA 2XOMA 1TG7A 1GR3A 5E89A 4NJ4A 1EV13 2PN5A 4DFSA 4H7MA 3NJYA 1RGSA 1SBDA 3MIDA 3T0DA 2LS6A 4JZRA 2Y6KA 1K5MB 1XOYA 4CCJA 5IW0A 3WDWA 1TME3 1SPPA 4XIOA 4BMEA 2WFPA 2QCSB 1JW6A 4XUOA 1VR3A 5FYTA 5T5LA 5D2AA 3G6JB 2ERFA 1AL22 3D5OA 4NIHA 3AKQA 1QMJA 4NROA 2D44A 3BYWA 3HT2A 4HVQA 1ULDA 4IUGA 4QGMA 3TEXA 1RHI2 2WNUB 3LIGA 2DVAA 3WD5A 3WUCA 4FOWA 4AQ6A 2A6YA 4RQPC 1C28A 3WP6A 3WSOA 1AX2A 5IVCA 1W8FA 4N43C 2BV4A 1VBE2 5H9PA 2LM3A 4RQPA 3OEAA 2JIJA 3ZFFC 4XYXA 1W6OA 1JODA 4N43A 3J9SA 5FZOB 3KB5A 5ANQA 3I3QA 1F9KA 3LF7A 4JKKA 4DUXA 1O5LA 3ZFFA 4D6QA 2DVBA 1QJY3 3IMMA 5BUVA 2VD7A 4DEQA 5JSOA 1W04A 2FZ2A 3E5UA 3RI8A 1NYWA 2AUYA 3NJXA 4YG3A 2D6PA 2I45A 1CN1A 1FPN1 4DXRA 2ZGQA 3MEPA 4UYBA 4B8EA 4V2VA 1DQ4A 1R091 4UOJA 1ZZ7A 4CEYB 1V9U1 5LA1A 3KT1A 1BVP1 3HN3A 4AVTA 3PUQA 3GZUC 4Y22A 2CSGA 2VVEA 4RFRB 2YFZA 3U4SA 3GZAA 4O61A 3U14A 5DPNA 2WIIB 3PL0A 2VVDA 1HQNA 3DXUA 4H2AA 3VDCA 4NN0A 1DQ5A 1GZCA 5JVVA 1SMVA 5FY8A 1QF3A 2P1BA 2J1EA 3RMXA 3OGRA 4R9CA 4RGAA 1TMF2 4XCBA 2JDZA 1U5XA 4AEKA 4TSVA 2R063 1BJQA 4QX3A 3DYOA 1H2KA 1BK1A 5F2WA 1WW6A 1UYZA 1ONAA 5FZAA 4HKLA 3FUOA 2DBNA 4Q0SA 5FYZA 1W8ZA 2HEWF 3KS7A 3WEZA 3URFA 4RFT0 3WDTA 4DQAA 4AHYA 4AAXA 4HG6B 3PURA 5CISA 3TAYA 4MXVA 4D69A 5L7OC 4BYYA 1AR62 1CESA 3AP5A 1QOSA 2GSYA 4CU7A 4FAGA 2CGOA 2XJPA 4OHWA 3EBRA 1Y4WA 4Y5SA 5C8CC 5L7OA 4LK6A 1QH6A 1CPMA 2W3JA 5IUQA 1RUOA 5CNAA 1LGCA 5C8CA 4MHUA 4A41A 2E6VA 3D4KA 5A7WA 4B4PA 5A3PA 1F8VA 4NO4A 4CUCA 5C5UA 5D1IA 5GLVA 2HWF1 1D4M3 1SLCA 2W08A 5JMCA 4EWAA 1I3HA 3K46A 1JN2P 2D6MA 1OUSA 1JYXA 1HIXA 4A44A 3Q8FA 4XTMA 4WVMA 4F3JA 1SCRA 4URTA 3UK9A 1SFNA 4URAA 5F32A 2OQ6A 3AL5A 4UF0A 4XF0A 3HBKA 4I0AA 4ASKA 1LGBA 2HWD2 1OF4A 1ND2B 1SLLA 1T6GC 2BVVA 5FZFA 4D8MA 3UV9A 4DRRA 5B4XA 3A23A 3OEBA 2C6SA 2WLPA 4DNYA 4CU6A 2FDIA 4UAPA 2GAUA 2WSVA 3VBHC 2A5ZA 1UY3A 1QGLA 3I2GA 3SMHA 2ZHLA 3IDBB 1SACA 4GA9A 2K2SA 2PHXA 3GBWA 2GNTA 3VBHA 4X6QB 4WM7C 3WUDA 2ZEZA 3GJAA 2ADEA 1UAIA 4YW1A 2B8MA 1RUG1 4BQ4A 3IPVA 4LHNA 4QQOA 1VBA3 3B5LB 3WX5A 1HXS1 5F3CA 3TEYA 5FYHA 1DQ2A 2FMDA 1DYKA 2V09A 3EO6A 3I97A 4NIAA 2RDSA 3UJQA 2Y0OA 5IFPA 4DUVA 4CP2A 1ZZBA 2ZPXA 3ACHA 3ES1A 4CUGA 1W6MB 2NPIA 3C7EA 4FPKA 4IE5A 4PLMA 3IT8A 2BPA2 3PUHA 3ZYHA 2YMZA 4IETA 1OLQA 3FFQA 1L7LA 5F9TA 3SKVA 1Z7S2 4GQ7A 3IBMA 3AMNA 3MIHA 5F8PA 5K0UB 4HVOA 4COYA 4MADA 1RUD1 3TNPB 1BQPA 3T2OA 2MEV1 4FPOB 4XIKA 5A7NA 4NIGA 2E33A 2W68A 3FLPA 3KT4A 4QD2A 2JG9A 1CIYA 1S0BA 5T50A 3BN6A 3THCA 4C91A 3VBSC 5J37A 1GWMA 4H3WA 4ORFA 1AYN1 1TQ5A 2VNOA 1KD7A 1UPSA 4Q29A 1QKQA 1V6LA 2HWB1 4K7JA 5FYSA 3VBSA 2EVXA 4UBHA 5FYUA 1NLRA 4B1MA 5A80A 2F4LA 1F31A 4QX2A 5I0RA 5EP9A 2OPKA 4CU9A 3RQ0A 2W0XA 3ES4A 4D3WA 1O8PA 5LZ6A 3HD8B 3WG1A 3WF3A 1C1LA 3BOWA 2PHWA 5FZ6A 3MUZ1 2CWSA 3NNJA 2G19A 4AHXA 1PZ8A 4P9WA 3V65A 2ZAAA 4KWKA 4Y20A 1M06G 5FZLA 4MO3M 2HH9A 4UFJA 4J6GA 1PO21 1LHWA 1PO13 1RUH3 2CYFA 2GNMA 1ASJ2 1Y43B 4OCTA 4XJZA 5FMCA 5C9AC 4GB31 3APBA 1S0GA 2ZX4A 5J7MA 1JZ3A 1WKYA 1G9BA 1RL3A 1RUE1 4QB2A 4QPIA 4XJWA 3W58A 5FKBA 2DUQA 4ZS3A 5JPNB 5FXWA 4CDUC 4MGSA 2YY1A 1HV1A 3RNSA 1CAUA 2FZ1A 2EA7A 1VBC1 1XJAA 3QLQA 5IWFA 2RDNA 2ZKNA 5LRSA 3AZWA 1AR81 5FBJA 1LOAA 3UYJA 4NHMA 4LKEA 2Y33A 4KH9A 3GJBA 3N9LA 1WBLA 3B3QE 1PVC3 3V56A 2VAUA 2P4EA 3WF2A 2BNNA 1LOCA 4NHXA 3ZR5A 4NR1A 3T4VA 1S4CA 1T2XA 1SBEA 3AZVA 5JXIA 1GWLA 2WNOA 5ANNA 2V72A 3V0AB 4XUNA 1CIWA 5HI0A 3ZR6A 1E57A 2PTMA 1ZBE1 3PNAA 5EFUA 2GC1A 4YZ5A 4HBNA 3ALQA 4FFHA 1DZRA 3JD72 2RS11 4E2SA 4M3CF 2PFWA 4YGCA 5FP9A 4CXYA 4LBMA 3IN9A 3VDAA 1XBFA 4ET7A 1NZCA 2ES3A 1J3PA 1PIV1 1X9PA 2YZ4A 4OLLA 3N36A 1UMZA 4XUPA 4IL7A 1E5RA 2O0OA 3AP4A 1CX4A 1WA6X 4R9BA 3ATGA 4P00B 2J42A 2IFWA 5CBLA 4CDQB 1ZBA2 5M0TA 1JS9A 1XXNA 2DU0A 3GZEA 4LA3A 4Y4RA 1IKQA 2F17A 4OVEA 2JB8A 1J3QA 3VBUB 3VZJA 1QXPA 2DUOA 3VZKA 3SLIA 3KZ4C 3ON7A 3D82A 3E5QA 4GULA 3AKPA 4YZ4A 3SEEA 3B9IA 3WW1A 4E4DX 4EN8B 3RZHA 3E5XA 1UNBA 2VZRA 1C8M2 3EXUA 2VMIA 4NWVA 1NXD1 4LBQA 1LU2A 4PQ9A 1WBFA 1OOPB 2B46X 2JE8A 3AYAA 1I6XA 2K0GA 3TN93 1RUC1 2VZSA 4Y1XA 4FPFA 5HPOA 5C3QA 5KHKA 3HMYA 4KU7A 3W5NA 4HFSA 3VZMA 4ZZ5A 2HKXA 5C3RA 4L8QA 1RVF3 1J1TA 1BBT3 3CF6E 4Q4X2 4YVSB 3VKNA 3MUY1 2OYZA 1D7PM 1OQDA 2QQOA 4IE6A 5ACA1 2CU5A 2HEYF 4GZ9A 1VRH3 2PAEA 3OUIA 2IXKA 5IAXA 3WCRA 1N3OA 1W8HA 5AC93 1LOGA 2JKXA 2WQ4A 5IVJA 2E53A 3N7LA 5FZOA 1XE0A 4JKMA 4NMIA 5GZEA 2DTYA 4QX7A 4P9YA 3IZOA 5GM0A 2CHHA 2DFCA 5LBBA 4CYDA 4QM8A 1Y7BA 2O1QA 2WZR1 4OI0A 3RVHA 2Q5TA 2DF7A 3OCPA 4L11A 4FTEA 1DLLA 1COV1 1G9FA 3NQHA 1CWPA 3B9CA 5LW9A 3N35A 2QZ2A 4TTGA 1UOJA 4G4FA 2WAAA 4DZGA 1IS5A 2FDJA 2FDHA 5DAXA 3S30A 2W92A 1QQP3 4V1PA 2VOWA 5GZCA 4MG2A 3OPZA 1AL0G 2VCCA 5D8AC 2VUJA 5JWPA 1WMEA 4Q0UA 4DMIA 1WWYA 3VZOA 1US2A 5D8AA 1OLME 2DCTA 2VECA 5FYIA 1HLCA 2QQVA 3KVBA 4Q4Y2 4M3CE 3FLRA 4FOVA 3VZLA 4IE4A 5FZ7A 5JZGC 3F2ZA 2ZBJA 3MIBA 2E31A 3WHUA 3BI3A 3THTA 4G3YC 1RITA 4AI1A 1WLCA 1TVGA 4EWEA 1CJPA 5IFTA 5JUVA 3R4UA 4MUVA 4EROA 3VDBA 3M8LA 4FT8A 2BBAA 3U10A 3RZMA 3C7HA 1JYTA 3UKVA 2ZHKA 3I2JA 4QPGC 3AZYA 1DLCA 3MYXA 1A6CA 1NQJA 1XYNA 2NLRA 3OGJA 1XYOA 3Q8AA 4Q4V1 4JCKA 4QPGA 4BQ3A 5C71A 3UGFA 1TNFA 1RJ7A 3IDAA 3J7NA 5K9YA 3HWJA 5F5QA 5L9BA 2BERA 1BMV1 2ZAHA 3DECA 2QQPA 2GN7A 1Q5OA 3HJRA 4RQPB 3VDDC 4D6RA 3BTXA 2WS91 4XOGA 3TB0A 5DXDA 4KBZA 2XHNA 3L2HA 3M3CA 4N43B 2WA3A 3GYDA 5J1XA 4EE2A 2FMYA 2C1FA 3JBG3 3WR0A 2RS53 3ZFFB 5FXZA 2EIGA 1IKPA 1GLHA 3UL2A 1SG3A 1ODMA 2D93A 5F6LB 2ZACA 2Y6HA 1BYHA 4KI5M 4FPHA 5CKNA 1GQHA 1QU0A 2ZGTA 1EPZA 4IERA 1NLSA 1ZREA 2JD9A 2ZMLA 1MS1A 4AEJA 2J1UA 2PAMA 5FZKA 1NQDA 1EV11 5CKQA 4Y22B 5F2SA 1LNSA 1I5PA 2OT7A 3N7MA 3MO4A 3LQCA 4IGQA 1TZOA 4IEQA 5FPVA 1UY1A 2L9LA 4XDQA 4XQ4A 3C2UA 2P6HA 1Q8OA 3CLPA 1TME1 4B4RA 5JOXA 1FPN2 2BJSA 1NKGA 1W6QB 1AR93 2JDNA 4I02A 2E7AA 2ZGUA 5F39A 2Q4SA 1R092 3AYEA 4PHZA 1GBGA 1V9U2 2WNVC 4K3UA 5FY7A 4LBKA 1ULEA 3VD9A 1OUXA 3CMGA 4JGYC 2CY6A 3WDYA 3GDBA 2WNVA 4WVWA 2JDHA 2Q1FA 1FMD3 2RE9A 2K9ZA 3B93A 4FVVA 1W8OA 4HONA 4PIYA 3ZPOA 4AF9A 2BDRA 4Z1VA 3RZLA 1S0FA 1DGRN 1G7YA 1C8NA 1Q8VA 2IXCA 1YC61 4Y5TA 1QXRA 5L7OB 3DYMA 1NE4A 2F6BA 4CCMA 4AL9A 1QJY1 2VOKA 3ZVXA 4XQWA 5C8CB 1JU3A 4XFFA 5A7WB 1PM4A 4TWTA 1NAEA 1AX1A 1IG0A 2A70A 3OBRA 4R9DA 4JRAA 5H9RA 3USSA 3CU7A 5LEKA 3GXUA 1VB2A 4FPCA 5EV7A 5IT6A 4AI3A 1L7RA 5AVPA 5FJHA 1W0NA 1RJ8A 1OA3A 1KQRA 2VZQA 1XRUA 2D5FA 5DUUA 1LKNA 4IGPA 1LOBA 1HW5A 2EXHA 4Z82A 4K8RB 1H8VA 2EXKA 4GKXA 4WVMB 5LASA 3LZZA 1PM7A 1QIQA 1X82A 3PUIA 2H6BA 1UZYA 2YU1A 4UF0B 3H1YA 5C70A 5FZEA 2VU9A 2QQNA 2VUAA 1V6JA 5I0TA 4OQ9A 3ZO0B 2ZCWA 1WD3A 2AREA 3ZYPA 2HWF2 2R061 5GLTA 2CGPA 4N53C 5EJ3A 5JR2A 1VPHA 5JSPA 3CHXA 1FYUA 3BU0A 3VBHB 3ZSEA 2XUMA 4PQQA 4COZA 4NWWA 3TYJA 1QHDA 3IB3A 5FZDA 4WM7B 1H8TC 1W3XA 1R083 3THPA 4HKWA 4Q1PA 4XFBA 3ZXJA 3U75A 1QJU3 1UQXA 2R043 5EHDA 3FBYA 4YM0A 2P5BA 3WDVA 2PHFA 4BIFA 4LITA 2OZJA 1H8TA 3S5QA 1ZRCA 5FQ0A 2IUWA 3SCGA 1WLDA 3LAGA 3UKNA 5JLVA 5FYYA 5KWRA 3MPBA 4GMP1 5FFOC 1ND3C 5KXDA 3BB6A 2BGPA 3PVNA 4KWLA 4OHXA 2R32A 3NMBA 1ND3A 5IVYA 1JUIA 4P9IA 2VTXA 4AEDC 1D4M1 3RZJA 1RUG2 2VOTA 3FX3A 4GD4A 1HXS2 2W1QA 4ZONA 1UOGA 2JG9B 1JZ2A 3J7LA 4GAZA 2A75A 3LCPA 1GP5A 4XF1A 1AL23 4XZPA 3RI9A 3CZUA 1CJDA 1UU4A 5BNNA 1QXJA 2JICA 2A73B 4XDPA 1IPJA 4XE9A 3LA3A 5F5IA 3VBSB 4LA2A 4F83A 3RZKA 2C0ZA 1RHI3 4LIUA 4XW3A 2MPFA 5A7QA 1SHWB 3IMNA 3OGGA 4IEOA 4QQHA 5T5JA 1FNYA 2B7YA 4PBOA 3N4MA 2WT2A 1RUD2 2IVIB 2MEV2 1KITA 4JDOA 4TXWA 5DUWA 1VBE3 4QGLA 1J1LA 2JJ6A 2YBSA 4UT5A 4AXOA 4DRVA 1DZTA 2WFF1 2R0FA 4Q0PA 2Z4FA 1UPIA 3AMQA 1C8M1 1IS6A 3B02A 2Q8EA 4CUAA 4MGYE 1AYN2 2B9VA 2JKBA 2HWB2 1HB2A 1MS3A 4XFHA 3WG4A 1VBA1 2D3PA 2XR4A 4RR3C 2W94A 2G9FA 5KXEA 2WQZC 5ABJC 5C9AB 3LE0A 2HYXA 5I93A 3TOJA 4QXBA 1PMJX 4RR3A 2PLV3 2ATFA 3LA2A 4EN9B 1WW7A 4ZKTB 4JHTA 3VZNA 1GUIA 1Q3EA 3M7AA 2WINB 4CP0A 3OPTA 1S0JA 2V73A 4L2NA 1CAUB 2ZX3A 1X33A 3AKSA 4XABA 2I74A 5KXBA 5FZ4A 4FTBA 1YQ2A 2JDMA 2JDUA 3VBOC 1PO22 2A3WA 1I5ZA 1S2EA 4LKSA 4XCAA 2V5DA 1NY71 2VOVA 3Q8EA 5FZHA 1PMHX 4DPNA 4WZFA 4OULA 3BUCA 4GB32 4RS5C 3VBOA 3VBRC 3S7EA 4BMBA 4DB5A 1TMF3 2BVBA 1RUE2 4BE3A 1OQ1A 1BVVA 4RS5A 1HRI3 4QX1A 2KXLA 3LB9A 3VBRA 2VCMA 1N1VA 1W9TA 2K46A 4W6WA 1VBC2 2SBAA 3V64A 3WP5A 1XNTA 5FREA 4LXLA 2AEZA 4P08A 5HXMA 2Y6LA 4YW7A 1AF9A 1AR82 3VGIA 5T54A 3RG0A 1AR63 2YC0A 4IEPA 1VMFA 4AI0A 5EIYB 3LFIA 1IPKA 1STMA 4YSFA 2YXSA 1YQ5A 2ILMA 2R16A 3TWIA 4D7YA 2XPJA 2J1VA 3ROUA 4XBNA 4CPBD 3I3BA 4I3GA 5I0SA 1PO11 1RUH1 3K2OA 2BTVC 2DVDA 4BQ2A 1A78A 1HV0A 2RM23 1W8UA 3CDZB 4NPMA 2FHRA 1WZXA 3WXPA 4XBQA 1QEXA 1ZBE2 1FI2A 3O1SA 4XILA 3EJKA 4FO9A 2OPWA 2RS12 1W6NB 3B94A 2XVGA 1YWKA 5DDJ3 3UGHA 2DDUA 2Y6JA 1W28A 1Y9QA 5CA6A 4CCNA 5C8WA 1PIV2 4LEJA 3MLJA 4NOTA 5H9QA 2D97A 4LBQB 2B45X 2H6CA 2WA4A 3LEKA 1KDMA 2YDEA 2HWC3 2P17A 3ZDSA 4FFIA 1PVC1 4E9KA 5LEJA 4QHBA 4YFZA 2W1WA 4DEVA 4NAOA 3RZZA 3P6BA 3POGA 3H3ZA 4A42A 5DG2A 4ES9A 2QFEA 1U5YA 2D43A 2EIBA 1L7QA 4QM9A 1H4GA 1LODA 1GP6A 4ARYA 1K45A 4BQ1A 5FPXA 2QZ3A 4QXCA 4PIXA 2G9ZA 4AHWA 3IM0A 2RR11 2ZGSA 3AJZA 3N9NA 4BLJA 5EPAA 4LT5A 5FR3A 5FZMA 4COWA 3AXDA 3O7OA 1RUJ3 3FFZA 3KVAA 5FXXA 4LNVA 1RUC2 4XF4A 3WINE 2GC2A 1CZTA 2I07B 1QJZA 4Z92B 5C4WC 5SV8A 3FN9A 1OLMA 4LE4A 4Y1VA 5FOBB 1N3PA 1IS3A 1XNDA 1KFUL 2QQKA 4EYUA 2P3JA 2ADDA 2WQ8A 4M3CA 5FZ0A 3ELNA 1HB4A 5C4WA 2C9KA 1POV3 1Z7S3 3A0KA 3ACIA 3KHBA 4UW4A 2P34A 4Y3OA 4CA9A 1DDLA 3HNYM 5ACA2 2JDYA 4QPWA 1X7NA 4NHKA 3I8TA 3POIA 1W6PA 1G8WA 4IV1C 2BU9A 3SC7X 3EMRA 4A2UA 3G7DA 4QX8A 3AFGA 4BZ4A 5IVVA 1R1A1 1S0EA 1WUVA 4IEVA 5DQ0A 2FDFA 2GC0A 3K3OA 5FCCA 4IV1A 4Z8BA 3KCXA 4FAHA 1VIWB 5GLZA 5D8AB 3R4DB 1S1AA 2XMLA 1OBNA 5JDBA 2WZR2 1W6QA 3PDQA 3POBA 4P14A 3O1UA 5BPXA 1COV2 1HJFA 1P8JA 1AJOA 3T1MA 4BWOA 2QKDA 4Y5Z0 2OKXA 1Y3TA 4I01A 1JZ4A 5JZGB 1RVF1 1NX9A 1V6OA 2YROA 2XH6A 5B2GB 4QKNA 3IIAA 4P9JA 4AI2A 4QT6A 4RD7A 1L3JA 2DV9A 2ZGRA 2ZZQA 2D5HA 1EUTA 4Y33A 1VRH1 2N7GA 3LEMA 3RMYA 4DUWA 1JZ6A 4Q0VA 4FOQA 4QPGB 4IQPA 4PBPA 3O0XA 5LA9A 1GOHA 3VD3A 3I49A 5J48A 2ZGOA 3T2TA 1CZSA 4FQZA 2OIIA 5FUNA 4BQ5A 3EHKA 5EXOA 1IS4A 2EAKA 1J84A 1WW4A 2DYCA 3QOPA 3RWKX 1YHFA 3GCWA 5JIAA 3VDDB 1YUDA 1GQGA 4BDVB 3KV5A 4DXSA 1W0OA 3NL1A 2VNRA 5JI9A 1H6XA 2GH2A 4J1WA 3ZSMA 2DUPA 3PMEA 2WR9A 4Q4V2 4XJAA 2J1RA 1ACCA 3DF0A 2Q8DA 3HR9A 1D2SA 1N47A 3ZXDA 1LESA 3VHPA 3D0JA 2BW8A 1BMV2 5JSRA 2X8KA 3C8XA 3U37A 1W2OA 4AGRA 1S0CA 4BJ0A 2WS92 2EXIA 3TEWA 2G4IA 2VMGA 3H0OA 3I2KA 4NPRA 2P2KA 2FDKA 1PGL1 4JQRA 4RHV3 2JDAA 4FI9A 3WZ1A 4FXGB 4LLOA 3WW3A 4BH9A 2QVSB 2HEVF 2BOJA 5KR7A 4OQ8A 4IEUA 5FPUA 1ZZCA 1VBB3 1O3TA 1JH5A 4IDZA 3SH4A 2W1UA 4DOUA 2PAKA 3JD73 5GKAC 1ZA7A 4A45A 5FO9B 5SV5A 4MGZE 2VQ0A 4A7ZA 1BEV3 5LB6A 2CGNA 1DQ6A 3M1HA 4DXZA 3VUOA 3H8OA 1EV12 1O3QA 2WDBA 1X8MA 4CTEA 4O9GA 2WNVB 2OX0A 3U1XA 1MS8A 4YW2A 4GWMA 4JGYB 4WM7A 3QBQA 2AEYA 4AEMA 1F2NA 4RA0A 5BY5A 1TME2 2Z2SB 1J58A 3C3VA 3LFMA 1SCSA 3JB4C 2A3YA 2BFUS 3C7OA 4Q8LA 5DUVA 2YUEA 3ZM8A 3VN4A 5JI7A 2RJKA 2ZTNA 3JBG1 3NJVA 1HN0A 2RS51 5J3UA 1AXYA 2EXJA 1UW8A 4IXLA 1UXXX 1DG6A 4K6BA 5FUPA 3ZXLA 3S57A 5KHGA 1CAWA 5FMBA 5GZGA 3D3AA 3GHMA 4KWJA 2WN3A 3JQXA 2ORXA 4FPJA 4RL7A 1GSLA 2ZHNA 4JTOA 1KXGA 4S2HA 2Z69A 5EJ1B 1W8WA 3PVOA 3H8RA 4O7XA 1LCLA 5IHRA 4BK5A 2W91A 3IKWA 4AAPA 1EAH3 1QJY2 4LIVA 4META 1DGWA 1VJ2A 2OW4A 1UKRA 3FHIB 1H1MA 4LK7A 1SQ4A 3OYWA 2GNBA 2BUKA 1AR91 2WZ8A 4HL0A 1LEMA 4E2GA 4HK9A 2RDRA 2TNFA 2XL7A 2Q30A 2CAVA 3HT1A 5CIRA 1UZ0A 4CDXC 2IWGB 4FP3A 3DGTA 4GJYA 1ALYA 4IEZA 2BNOA 1E5HA 4N53B 4OHVA 4IE0A 3CJXA 4AFAA 1FMD1 4Z2WA 5A32A 3AP9A 4R4ZA 4EN0A 4CDWB 1AVBA 5A1LA 3DCQA 4LULA 1BK0A 4YW3A 2XWBB 1O7FA 3H7YA 4LOSA 4UFLA 5C9AA 3LIHA 1JYNA 5I8TA 5IAVA 1CGPA 2VR4A 2NZ9A 1KJLA 1H8TB 1H9WA 2R062 5BNPC 5FQ0B 4RSUA 1KFXL 3OD4A 1MS5A 3AFKA 5A3UA 2DCJA 2YYOA 4CDUA 4NRQA 5LWBA 1GZWA 5E6HA 4KG0A 3U11A 2ARAA 3NO8A 1VALA 2BRTA 1AYM1 2GMPA 3N9PA 4CP9A 1ND3B 4YZ1A 1UXZA 3O1PA 3INAA 3CKHA 4Q4Y3 4N7IA 5LBCA 5FAXA 3POWA 1FT9A 2NN8A 2YFUA 3BPZA 2WWUA 3ZIWA 3DKWA 4AEDB 1MZ5A 2HWE3 3AKRA 3LPFA 4OYUA 4Q0QA 4XDOA 3VBFC 5CEHA 3CJIC 4JC1A 3DEMA 2A1XA 4P5HA 1K5JA 1OPMA 2RDQA 4I0BA 1TNRA 4QQPA 3K75B 5BNNB 3VBFA 3OUJA 2OA2A 3I2HA 2QUOA 3AZXA 4CCKA 3N3HA 1H30A 3KD4A 3WNPA 4DS0A 3M3IA 4XJ9A 4AG4A 1D4M2 3IDCB 2RMU1 1IQAA 4L92A 1UCXA 5LATA 1UYPA 5FV3A 3AVRA 3DPRC 3PJQA 4IEXA 1W2UA 2J1TA 2JB4A 3HQXA 2X05A 5CAZA 1MEC3 1QNYA 2VULA 2Y8KA 4LHKA 2XONA 4TLGA 3DPRA 1KDKA 2VVFA 4MV2A 5JR7B 1RMU3 1R081 3NNGA 2VZVA 4YG0A 3AJYA 4BA6A 3MGUA 1ENRA 4TYSA 2IVJA 3CEWA 4WM8C 3QH6A 3GBFA 3T4HB 1QOTA 1W6NA 4RR3B 2KM2A 4IESA 3H1WA 3ZXFA 3LA7A 4ATFA 5ABJB 2ZX0A 4CUBA 4XHXA 2WFF2 3WHTA 1QH7A 2Y34A 4LQRA 1LENA 4E8DA 3PMSA 3PUAA 2LW8A 3BTYA 3RSJA 1Q56A 1SDWA 1RUI3 1TE1B 1LB2A 2X5IC 5A1FA 2DU1A 2CTVA 3LDBA 1VBA2 1O4ZA 4NVPA 4EN6B 3SQOA 3AM2A 3VBOB 3K4DA 3KSCA 3ZSKA 2IXLA 2X5IA 4ONUA 1ST8A 3LOIA 3V0BB 3DV8A 3AP6A 3AMPA 3N7KA 2UWCA 1YI9A 1LRHA 1V9U3 2XBO3 4NHLA 4RS5B 1G86A 3VBRB 4QHZA 5LRRA 3PU8A 4JKLA 5A70A 1H1AA 5FZCA 3ZMNA 4BPZA 4L0PA 1S2BA 4XMAA 4L9BA 1YQCA 3POSA 2EICA 1YEWA 2YPDA 1PMIA 2ZHMA 3D0SA 1US3A 5CZKA 4YW4A 3LWCA 1VLNA 1SDDB 3U07A 1CZVA 2G1MA 1NY72 2G9GA 5FJKA 4OHZA 2B5HA 3ME2A 4CXXA 4LO6B 1OFSA 1Z0HA 5DAQA 1JHNA 4AGVA 1J59A 4N8MA 1PX3A 3OY8B 4ZU5A 3VB9A 2B4KA 1JBCA 5FO7B 2IXIA 4ZU4A 3GHNA 3W9AA 4NIDA 1AR73 2W9XA 3HQUA 4E2QA 2CNAA 3FC0A 4COUA 4UFHA 1F35A 2HLEA 2JD4A 1LGNA 2VCAA 5FMOL 1XNCA 4BLIA 2PLV1 1E5IA 2ID4A 2QDRA 4W6XA 1VMJA 2ZGMA 2VZPA 2XQRA 1GV9A 1UMIA 2VZ3A 2DCZA 2PQQA 2ZXQA 3FUQA 5A6XA 5JAXA 5CG9A 1XNBA 2HBUA 1UX6A 3AK0A 4OUSA 3ST7A 1K42A 3OPWA 1XC6A 3FHQA 3P1IA 4AFDA 4PF1A 2F4PA 4JTNA 3UESA 1PO12 1RUH2 1GNHA 3EYPA 1QDOA 3GALA 4W8JA 5K4LA 3T0BA 3AMHA 3OJBA 4A4AA 2B42B 2PYTA 3LEIA 3NNMA 5JZGA 1HRI1 5GALA 2VMCA 5ISLA 1Y9GA 5APAA 2NQYA 1OURA 1RTVA 4AVCA 2VMFA 3I3EA 4UW6A 3ZX7A 4Q4W3 2LTNA 1WW5A 1O6UA 4QWNA 3ZYBA 1B35C 3ZFEC 5I0DA 4Z2AA 4HANA 3KV4A 1YJLA 2QDNA 3T2QA 4OI4A 1JUHA 3ZFEA 2DVGA 1MZ6A 5JOYA 1BKZA 1PVC2 1IHMA 1W39A 4O9EA 2GN3A 2CDPA 3R6SA 4E8CA 3VDDA 2RS33 3CBNA 1NG0A 1WMXA 1OH3A 1UYXA 2VE1A 4CCEA 2JDPA 4MOAA 1FOD3 2BFUL 2VMDA 1AX0A 3HOBA 3MDPA 3CO2A 4L97A 4M3CB 5C4WB 1O4TA 5L19A 5LK7B 1C5IA 1R1ZA 2JXAA 2RM21 1CPNA 1QOOA 3J26N 1OQEA 3DUIA 3O12A 3J8F1 1VB4A 3Q8BA 4HSJA 2RR12 2CWMA 1JMUB 4UBGA 4D0QA 4FBFA 1LTEA 3OD0A 3OBAA 1HRV3 1W6PB 1WLTA 4LE3A 3PTYA 5EWSA 2VXRA 5CFCC 1RB8G 3SXWA 1WCKA 2FD8A 5CFCA 1OH4A 1LHNA 2XJTA 3H8UA 5DDJ1 5FZ8A 4IV1B 1CVNA 5FP3A 5DUXA 5LBEA 1WLWA 3TEZA 1HQLA 1JOPA 1PGSA 4GJZA 1OPOA 2VTXJ 1OKOA 2KA3A 4IEWA 2HWC1 2R073 4LO4B 4DXTA 1WCSA 5FKCA 1RUD3 3VD7A 2LALA 2E51A 4B4QA 5J09A 3I59A 1YRZA 3O5SA 1QJX3 2XJSA 2H0VA 5F37A 3WCSA 3FBMA 1F5FA 1JU4A 1OVPA 1R1A2 2Y64A 3FHAA 2ARCA 2WZPP 4P9GA 2AC1A 3WNXA 2JDKA 4JGYA 2O14A 1FV3A 1ZM1A 2QJVA 3DKQA 1POQA 1PK6C 1RUJ1 2W52A 1TEIA 4XC9A 4U2AA 4ASLA 2ZJCA 1GANA 3WT3A 2WLQA 1V0AA 5FLHA 5IJRA 1PK6A 3IAQA 2D40A 4N7UA 4CEWC 2ZA9A 2A6XA 4K1ZA 2D6KA 1RVF2 3A21A 4OFGA 4HN0A 1BBT2 2WO7A 2FBEA 3W21A 2GZWA 3SH5A 3BVCA 3X29B 4FPYA 4OI2A 4GIQA 4LTAA 1VRH2 3RGBA 2VUDA 1PO23 3W20A 1G9AA 2V4VA 4XJUA 2XQXA 1BLZA 3MBWA 5AFEA 1VBD3 2Y38A 3ZN5A 4XFIA 2XKOA 3FL7A 1RUF3 1W2TA 2W87A 4HZFA 1NT0A 2VC9A 3WQBA 3JUUA 5D21A 5FO8B 5I8SA 2UY8A 1UZZA 1VBC3 3I7DA 4CU8A 4C8DA 1YQ6A 4YARA 3U78A 5BYNA 4XETA 3GCXA 4TZDA 2C26A 2Z79A 4JGZC 1KJRA 3HN1A 4UXAA 2D3SA 3HVDA 2LRPA 4JQTA 4WV8A 4H14A 2LROA 2UWBA 4KNCA 4XBLA 2ZX1A 4JGZA 4N53A 4OZXA 4CSWA 1RUNA 4UFMA 2JE9A 3ZSJA 2C4XA 2AENA 2WN2A 3BIWE 4E4HA 4IE7A 1PGL2 4AWDA 4FPEA 4OUMA 5GJ6A 3NAPC 3H50A 4B29A 3KQRA 4EJRA 4YWAA 4AVSA 1UZWA 2HJIA 4XURA 3O1MA 1ZRDA 1O3RA 4XUTA 3I3DA 1X8EA 4D6SA 3WV6A 4LUMA 3N9QA 1ODNA 5LBFA 4FTSA 1DF0A 4YM1A 3S6PA 3GM8A 4HMZA 1JZ5A 3AVSA 1CAWB 1AXZA 1PHMA 3WDUA 2PHRA 1GZ9A 2XLFA 2ZMKA 3FZ3A 5FZBA 3F95A 4OMCA 5LY2A 2XJUA 2GALA 2EAAA 3POJA 2MNGA 4AEDA 5B4NA 5A6ZA 2XG3A 2QNKA 5LA2A 5FY4A 3WP3A 2JE7A 4DY3A 4XTPA 4W50A 1XSRA 2VPVA 1S0DA 1ULFA 5A3LA 3M2MA 3JBG2 2RS52 1SZBA 4Q26A 1OHFA 4DO0A 4RHV1 3CZJA 1OA2A 4OZOA 5LA0A 3OYWB 4IGOA 3A7QA 3AXEA 2AH2A 3AL6A 1VBB1 2ZGKA 3OTFA 1KEXA 4AVAA 1UY4A 1GP4A 2VUCA 2OVUA 1BXHA 1RUC3 3RYRA 1QDCA 1Q8QA 1BEV1 1VRBA 1POV0 3PU3A 3ITQA 4OUEA 5FLJA 2VW1A 4P9LA 2DTWA 2EIEA 3PHMA 2WRAA 5DN2A 4CCOA 4CDXB 5A32B 1GQPA 4RGGA 3MFCA 3IWZA 1CQ9A 3VD4A 3WVJA 3WY6A 3POYA 1AR92 3HBZA 5JOWA 1O5UA 4ZPIA 1W2AX 1ZA4A 2WJSA 5ABJA 2WT0A 1GMMA 2VL4A 4XACA 1ULOA 1F15A 4IEYA 3T09A 3USUA 4COVA 2R30A 1PVXA 1WCQA 2BP6A 3NKGA 1XE7A 4CDUB 4Q5OA 5BNPB 3M3OA 2ZGLA 2HYKA 1GZWB 4QAWA 1FMD2 5IK4A 4CP9B 4M0NA 3OBTA 3WNOA 2CV6A 3AX4A 4Q1RA 4LR4A 5KHHA 1DP0A 4YGEA 1DFQA 2ET7A 3SEPA 1A8MA 2XVLA 4SLIA 4QGNA 1SBFA 3WDXA 3V0BA 3W5MA 2OS2A 4XXAA 3U4XA 4AZZA 2ZEWA 4A6OA 2DCKA 1EAH1 3ZLIA 3TNQA 4HXCA 1JTZX 1OF3A 3H8XA 3CL1A 5CG8A 1N1SA 2UWAA 1E5SA 1LU1A 2VY0A 1W8NA 1VE0A 5L9RA 3RWNA 3UKTA 1H9PA 2R49A 3CJIB 2IC1A 2PQSA 4KWUA 3RRDA 3VBFB 4ZS2A 3A22A 5IK5A 1AYM2 1M4WA 2VZTA 5FZIA 4AE2A 1CAXB 1OT5A 1NLQA 3M4FA 1JI6A 5F5AA 3OY8A 2XL9A 1FX5A 3J4UH 3T2PA 1URXA 2VBDA 1J3RA 4ZXKA 5JXGA 2IFRA 2TBVA 4Z07A 3UETA 3O1VA 4NAMA 4PCRA 3VLBB 5C3OA 1OFNA 3WW2A 2QQIA 5FY0A 1MZFA 1LHUA 2Q0AA 3DPRB 5J96B 1G9DA 4E27A 1C1FA 1DIWA 4QXHA 3KF5A 1YCIA 1T6BX 1DGRA 3H3UA 2UYBA 4Q4V3 1MR5A 3HNMA 4UW3A 3T0AA 4WVVA 3RJRA 2DURA 2RMU2 4RYDA 4XQDA 4BXSV 2WS93 4BXFA 4XJ8A 4MH0E 5A7SA 1XSQA 2ORZA 1W8TA 2WAOA 3ZKUA 4LBLA 2PHUA 4AQSA 1MPXA 4NIIA 2HWD3 3OGVA 2NMNA 2XGXA 1R082 4PI2A 5F1RA 2HWE1 1NCQC 4WZCA 1OD3A 4LO5B 1KS5A 2W1SA 2X5IB 2VZ1A 3ZOIA 5F7UA 1V6NA 2X10A 1OXCA 1X50A 1HQWA 4PI0A 4FXKB 1GOFA 5T52A 5FK7A 1YXWA 4K8FA 5G04L 5HXVA 1NCRC 2R6QA 3LSEA 2XJVA 1UWWA 2UU8A 2Z5WA 5JMOA 4AFMA 1B09A 3MHZA 3CIHA 3M70A 1NCRA 1REEA 3ZSLA 1O59A 4UI9L 3L9JT 4C1XA 3BCWA 3HIFA 1AJKA 1RXGA 2QTWB 1R64A 2D6OX 1X36A 3NSTA 4RGKA 2ET1A 3UJOA 1MEC1 2VG9A 4YVWC 2PA7A 2XLAA 1CAVA 3KMHA 3GGLA 4P5YA 1RMU1 1APNA 1C5HA 3LKJA 3OBZA 2YU2A 2E9QA 3ZYGA 4BB3A 2BBVA 4YVWA 4YM2A 4PF5A 1A8DA 2Q8CA 3POFA 3Q9OA 4MVTA 4KGQA 5LY1A 3O0VA 3R0RA 1N1TA 3LPGA 1XE8A 2QQJA 2VJXA 3R4SA 3AYDA 3QD6A 5JXJA 3SITA 3VKOA 2PXJA 5T55A 3FMGA 3KWVA 5A6QA 5L73A 5J98B 4F7ZA 4UFKA 3WOGA 3ZYRA 1EYBA 3EB7A 3ZYFA 5FY1A 3PIJA 1ULPA 2ENRA 4R8HA 2AZ5A 2A6ZA 1RUI1 3OG2A 4MXWA 1DYPA 2GMMA 1UIKA 3TN91 1SEFA 1IPSA 3ORJA 3S0MA 3K48A 2X53S 5C5TA 4AI8A 3AZZA 2YB7A 4XMIA 1UX7A 5C6CA 1V6IA 2YGLA 5FP4A 2NMOA 2PLV2 2XBO1 2RVAA 1DYOA 1GFF2 2XVKA 1FV2A 3CNAA 1BBT1 3K4ZA 3NWKA 4YYOA 3PUSA 4BQWA 2IZWA 4EZHA 3UT0A 1F4AA 1YFXA 1QWRA 4HLTA 4KMQA 1UOBA 5A7OA 4EQVA 1WMFA 4TLFA 4YW5A 1SLAA 1DU3D 1PZ7A 2JG8C 3OSDA 1X9TA 2BWCA 1ASJ3 3ACLA 3ETQA 1CX1A 1W99A 3H42B 2A7AA 4JDMA 4H55A 4K1YA 3WQ1A 4AW7A 5AC91 2JG8A 1NA1C 4K20A 1B35B 3LD8A 3ZFEB 3ZKYA 2GDFA 1H2LA 2HBTA 5DAPA 2WABA 1W2NA 1ENQA 5E16A 1NA1A 1HRI2 5C33A 2EF6A 4FP2A 3MIEA 5FMOS 1AR71 3NV1A 4J1XA 1ULCA 4KGGA 5FK8A 5FP8A 3T30A 1S0IA 3ZN6B 1W0PA 1UN1A 1IQDC 1ZYBA 2AGSA 4K21A 1BCXA 4R52A 1MACA 1QQP1 4YGBA 1O8SA 3ACFA 2JIGA 1VAVA 1GYKA 4LORA 5K7PA 1DGWX 5BNOC 3K3NA 3WG3A 1S2KA 5FPAA 2OXBA 1VAMA 4AQTA 3MPPG 1V00A 5CFCB 4PDWC 2W5FA 1DCSA 2W47A 4AOCA 5BNOA 4X6RB 4B7KA 4GMP3 1BHGA 3I2IA 2XWJB 3PJYA 4C0HA 2Q1MA 2VXJA 5FYBA 4PDWA 5CADA 2BYVE 2GMEA 3RDIA 3WP4A 2RM22 1W9WA 1XNAA 4M01A 4YGDA 2X29A 4CDWC 5JCTA 3GNEA 3J8F2 1HDKA 1V6KA 4YG6A 5BXXA 5L9VA 2QQLA 2R1DA 4NE9A 1XYPA 1OMIA 1UD1A 1DHKB 4CDWA 2TUNA 5DZFA 2ETEA 1EUUA 3I59B 3MLKA 1K12A 5DABA 1WCUA 3FE5A 5A3MA 4KBBA 3LGRA 1YQ8A 4Q4W1 4LLFA 3RFRA 4ZY9A 4PLOA 1IOAA 5LCWL 5DDJ2 3SCFA 1U12A 5IVFA 3OGSA 4Y1UA 2ZZJA 4C90A 5IK7A 2HWC2 3VL9A 1ZBA3 4DY5A 1ZVFA 4W6YA 1C4RA 4D94A 4LKFA 1PK6B 4MGKE 1HX6A 1H1IA 2RS31 4A7KA 4XFGA 2BOIA 4QX0A 1MQTC 4HK8A 4GH4C 5HCBA 1V6MA 1FOD1 2VM9A 2WFF3 3DYPA 3J7HA 4N9IA 4CEWB 1C8M3 3WF0A 1MQTA 5KBFA 4GH4A 5HCAA 4IV3C 5KC5A 4QKBA 4S2GA 4P9XA 5FP7A 4CCCA 3ZXAC 2FCTA 3GZTB 1HRV1 2QQMA
chains in the Genus database with same CATH topology
1RUJ2 4IV3A 3D6EA 1EPWA 4BHPA 5BV6A 3VKFC 4BM8A 4LHLA 4B3NA 3M3EA 1IGOA 2PHTA 4QQLA 4Q4X3 2WKKA 5JPMB 5K8SA 3MICA 2R071 3MF6A 2B9UA 5CFDC 4N90A 2JG9C 1QJX1 5JIUA 4AVVA 5CFDA 1YJKA 2ZS6B 1YYNA 2VNGA 4JGZB 4GXLA 4CDXA 5GZDA 3RPQA 3ZMOA 2LUWA 1JXNA 1JOJA 3T1LA 1YNAA 1U5ZA 3S7IA 1WD4A 3EQEA 2O8QA 4ITCA 2NP0A 4MSVA 4KU8A 1S55A 3ASIA 3NAPB 4JRLA 5GZFA 4K40A 3P3NA 2VOXA 1DQ1A 3RJ2X 2D98A 3I4IA 5BNPA 2XJQA 2DWRA 1SLIA 1WCDJ 3IDEA 4I0WB 4LUKA 3BALA 3ZFGC 5T3NA 1QY4A 4ISQA 4AHZA 1VBD1 5T5PA 3ZFGA 4Q27A 4QPIC 4BIOA 3KM5A 3NV3A 4D7TA 2E63A 1OD5A 4MYEA 2P3IA 4JV4A 1RUF1 5CB7A 4I2OA 3BU7A 3CJIA 4FPLA 3KCCA 5L36A 1MVEA 2ZOEB 4L99A 1CAXA 3BOPA 2Q1ZB 2VQAA 4PIZA 3FLTA 1VAKA 3GBGA 3ZYIB 1VP6A 4PLNA 4SBVA 2A6VA 1MS9A 1NXMA 1FATA 2D7FA 4R9AA 3O0WA 4KG8A 1D4VB 1H2MA 2RJLA 4M0HA 4RHV2 1OKQA 1QJU1 2R041 4E4SA 2RR13 4QXKA 1F5JA 5A33A 1VBB2 1D2QA 1PGW1 4HPKA 4CRQA 1ZNPA 4WM8A 4WVZA 1BEV2 4ATEA 1DQ0A 3USUB 4WBBA 2YHJA 5EZWA 1IZ3A 4JAAA 3JU9A 5KHIA 1YLLA 1GKBA 4E4ZA 1ZRFA 3P3PA 4LBJA 4JDNA 2BEOA 1FPN3 4XPVA 4HVRA 1A3KA 5CU1A 4HKOA 2O8OA 1R093 4A7YA 1AL21 1AHSA 3E97A 4LBOA 1SLBA 1LHOA 3PLQA 1U0AA 1PZ9A 1R1A3 1K5MC 3I2DA 1RHI1 3MFAA 3SHRA 2OUHA 2R1BA 3KT7A 5FPZA 4QMAA 2PHDA 1K5MA 4YLZA 1VBE1 3FJSA 1LULA 2XLGA 1G6NA 1Q43A 4PJYA 4ISRA 4GKYA 2WNUC 1O91A 1EAH2 5T5OA 3B69A 1D0GA 2WNUA 5FOJB 4ES8A 1AUYA 5TSWA 2GH8A 5CVRA 4YFWA 4FSJA 3VKMA 2ZX2A 4AGGA 4Y24A 2QE3A 5I8YA 1JYIA 2A71A 2H0BA 2VH9A 1LJ7A 1SFYA 3TRSB 3KCYA 3B01A 1ENSA 1YIFA 4CEYC 3RYKA 1C57A 1REDA 1OA4A 3A0NA 4I09A 1TMF1 3ILRA 5KC6A 3VKLA 4CEYA 2HWF3 3MI8A 4LO7A 2YV8A 4QX5A 2Z42A 1NE6A 1NCQB 4D7SA 3JZVA 1I1EA 3PVEA 4LO8A 3JQWA 3OF1A 4A3XA 1AR61 1CD3G 1B35A 3E6DA 1ZZ9A 1ZZ6A 2D6LX 3NV2A 1NCRB 1D0HA 2DFBA 3E6BA 2VW0A 2ZGPA 1XU2A 2HWE2 3MF9A 4KQ7A 3H1MA 2CL2A 4INDA 2OUJA 2P37A 2BWAA 2VMHA 2TEPA 3D8CA 3ZN6A 1YFWA 3RS6A 4B7EA 1CAVB 2GU9A 1LECA 1KS4A 3O14A 4FOYA 4C1WA 4YVWB 2MHFA 5JOZA 1RC6A 4H7LA 1RUG3 3H9AA 1ENXA 2IXJA 5LK5A 1HXS3 3ZN4A 2XJRA 3ZXGA 1YO8A 2Y0IA 3DL3A 2JECA 2D3RA 2WT1A 5KXCA 1W6OB 5EYYA 3E6CC 2E7QA 2A3XA 3NVCA 1MEC2 2UYAA 3H7JA 1C3HA 4EN7B 2HWD1 1REFA 1RMU2 4MXWB 4EV0A 1UKGA 3DN7A 3MIFA 5I0UA 1N1YA 1SLTA 2JX9A 4YZ3A 4AYUA 2MEV3 5E1RA 1PNFA 1WMDA 2C5DA 1FAYA 2SLIA 1AXKA 3WLUA 5E88A 1ND2C 1AYN3 4XFCA 2HWB3 1YIPA 3LOBA 1RUI2 3ZPYA 1ND2A 1CONA 3TN92 5DZEA 4XF9A 2JG8B 3NJZA 2GNDA 1Q8PA 3M3QA 2I2SA 4U36A 3ZXEA 2XBO2 1NA1B 3A4UA 3KGZA 1LEDA 1POV1 3AMMA 1Z7S1 4CEWA 3VHNA 4F8AA 3K51A 1H2NA 4FPGA 3W59A 5DG1A 1EP0A 5KHJA 3QCWA 1CR7A 4S2FA 4GB33 5AC92 1UL9A 1YFYA 3FWEA 3ILFA 4XF3A 1MZEA 1RUE3 1W6MA 3ZYJB 2UY9A 1UU5A 5K0UC 4YRDA 4Y26A 5BNOB 3ILNA 1RIRA 3AP7A 4K9SA 3AKTA 1AR72 5DZGA 4MZUA 1OLRA 4PDWB 4XXPA 5K0UA 1AR83 4QU2A 1DBNA 1AYM3 4CP1A 1MVQA 1QQP2 2JENA 3NV4A 3L2YA 2CAUA 1PNGA 4KL1A 2BQPA 4N9HA 4CDWB 1QNWA 4ASMB 3QH7A 4Y4YA 4ZU7A 3R05A 3ECQA 5IK8A 3PVBB 2Y26A 1ASJ1 3VL8A 1WA4A 2C9AA 1XU1A 5AVAA 4HSLA 3NAPA 2JEMA 1ZBE3 2AR6A 4HETA 1KRIA 4BOWA 5E8AA 2RMU3 5F6KA 2RS13 4HN1A 1V70A 4X8PA 3HAGA 2PELA 5FTTC 4Q4W2 2NM1A 5FDBA 5GLUA 2DVFA 2P3KA 4I3PA 1PIV3 1XNKA 2YPJA 1MQTB 2B39A 2WNEA 2ZMNA 3B00A 4GH4B 3WQ7A 5H9SA 4AVBA 2FQPA 3MW3A 4XEZA 4JVAA 3WG2A 2XHKA 3U0ZA 3IPVB 3NW4A 2ARXA 4IV3B 4Y1YA 3BODA 4Q8KA 3N7JA 2BGCA 2RS32 1FOD2 4G9SB 1LOEA 2AYHA 1O4YA 1LHVA 1Q8SA 4FCAA 4FQ4A 4I30A 2R0HA 1N3QA 1BZWA 4HT1T 4DINB 4MGIE 4QPYA 3JD71 1HRV2 3JB8A 3MW4A 5CFDB 1YI7A 5BNNC 4AFCA 1LR5A 3RYPA 5FLIA 5HBAA 5FRAA 4LBQD 2ZGNA 3V0AA 2DCYA 1XQNA 2ZABA 4UW5A 1ZX5A 1LOFC 5ACA3 4XFAA 2R072 1FXZA 1NOVA 1ZBA1 1H4HA 1MS0A 4C0BA 1AZDA 4MLOA 1LOFA 2WSUA 1G9CA 4AFBA 3KLSA 3I54A 1GICA 1QJX2 2ARBA 3SH3A 2WC2A 2YGMA 1OSGA 3BTAA 1EY2A 2WL1A 3VV1A 4Y20B 2RHPA 4YNIA 4CDQC 2E7TA 2OZ6A 3VHOA 2UURA 2WZR3 1O3SA 3ZXKA 1UU6A 3KGLA 3VBUC 3ZFGB 4CDQA 5HCFA 1COV3 2XB6C 5AFBA 4OI1A 3MZHA 4AQ2A 1HKDA 3VHRA 3VBUA 2WWSA 4QPIB 2V5YA 3WQ0A 5I91A 4Q4X1 1GNZA 2ZKLA 2D6NA 1ZZ8A 5J36A 1OOPC 3TBDA 4CZSA 2NYYA 4LBNA 4YM3A 1JYCA 4MX3A 1OOPA 4X8NA 4YZ2A 4OHYA 2EALA 5BNQA 1VBD2 1H0BA 4S2DA 2Q8OA 4YVSC 1DGLA 2A6WA 3MW2A 4GWNA 3JCIA 1DZQA 1ZRRA 1RUF2 4Q2FA 3MIGA 4W65A 4YVSA 3SNMA 3B7MA 1UIJA 1ULGA 1WGPA 5FBZA 2VW2A 1Z78A 3SCHA 4XHBA 3GF6A 3MLLA 5A33B 1YFUA 3QACA 1U5IA 2W39A 4HPKB 4GMP0 3WW4A 3ZIXA 4Y1ZA 5GLWA 2BNMA 4WM8B 5EYXA 2IXHA 2VGDA 1MS4A 2PHLA 4R4XA 3ENRA 4BCUA 3NKTA 3AYCA 3LSDA 4M00A 4Q4Y1 1RINA 3SISA 2GC3A 4AK3A 1QJU2 2R042 3J8F3 3AB0A 1UF2C 4GALA 2XKPA 1PGW2 1OI6A 4QQ2A 1NCQA 1FNZA 1I9RA 1GR3A 5E89A 1EV13 2PN5A 4DFSA 4H7MA 1RGSA 1SBDA 3MIDA 1K5MB 3WDWA 1TME3 4XIOA 4BMEA 2WFPA 2QCSB 1JW6A 5T5LA 1VR3A 3G6JB 2ERFA 1AL22 3D5OA 3AKQA 1QMJA 2D44A 4HVQA 3HT2A 1ULDA 4QGMA 1RHI2 2WNUB 2DVAA 3WD5A 3WUCA 4FOWA 4AQ6A 2A6YA 4RQPC 1C28A 3WP6A 1AX2A 4N43C 5H9PA 1VBE2 2LM3A 4RQPA 3ZFFC 4XYXA 1W6OA 4N43A 3J9SA 3KB5A 1F9KA 1RUOA 1O5LA 3ZFFA 2DVBA 1QJY3 5BUVA 5JSOA 2FZ2A 3E5UA 3RI8A 1NYWA 2AUYA 4YG3A 2D6PA 2I45A 1CN1A 1FPN1 2ZGQA 3MEPA 4B8EA 1DQ4A 1R091 1ZZ7A 4CEYB 1V9U1 3KT1A 1BVP1 4AVTA 3GZUC 4Y22A 2VVEA 3GZAA 2WIIB 2VVDA 1HQNA 4NN0A 1DQ5A 1GZCA 5JVVA 1SMVA 1QF3A 3RMXA 4R9CA 4RGAA 1TMF2 2JDZA 1U5XA 4AEKA 4TSVA 2R063 1BJQA 1H2KA 1BK1A 1WW6A 1ONAA 4HKLA 3FUOA 4Q0SA 2HEWF 3KS7A 3URFA 4RFT0 3WDTA 4DQAA 4AHYA 3TAYA 4MXVA 4D69A 5L7OC 4BYYA 1AR62 1CESA 3AP5A 1QOSA 2GSYA 4FAGA 2CGOA 2XJPA 4OHWA 3EBRA 5C8CC 5L7OA 1QH6A 1CPMA 5IUQA 5CNAA 1LGCA 5C8CA 2E6VA 3D4KA 4B4PA 1F8VA 4NO4A 5D1IA 5GLVA 2HWF1 1D4M3 1SLCA 2W08A 5JMCA 4EWAA 1I3HA 1JN2P 2D6MA 1HIXA 4XTMA 4WVMA 4F3JA 1SCRA 4URTA 3UK9A 1SFNA 4XF0A 4I0AA 1LGBA 2HWD2 1ND2B 1SLLA 1T6GC 2BVVA 4DRRA 3UV9A 4DNYA 2WLPA 2GAUA 2WSVA 3VBHC 2A5ZA 1QGLA 3SMHA 2ZHLA 3IDBB 1SACA 4GA9A 2K2SA 2PHXA 3GBWA 2GNTA 3VBHA 4X6QB 4WM7C 3WUDA 1UAIA 4YW1A 2B8MA 1RUG1 3IPVA 4LHNA 4QQOA 1VBA3 3B5LB 3WX5A 1HXS1 1DQ2A 2FMDA 1DYKA 2V09A 3EO6A 4EWDA 3UJQA 2Y0OA 4CP2A 1ZZBA 2ZPXA 3ES1A 1W6MB 2NPIA 4FPKA 4PLMA 3IT8A 2BPA2 2YMZA 4IETA 1OLQA 3FFQA 5F9TA 1Z7S2 4GQ7A 3IBMA 3AMNA 3MIHA 5K0UB 4HVOA 4COYA 3TNPB 1RUD1 1BQPA 2MEV1 4FPOB 4XIKA 4QD2A 2W68A 3FLPA 3KT4A 2JG9A 1S0BA 5T50A 4C91A 3VBSC 5J37A 4H3WA 4ORFA 1AYN1 1TQ5A 2VNOA 1KD7A 1UPSA 4Q29A 1QKQA 1V6LA 2HWB1 4K7JA 3VBSA 2EVXA 4UBHA 1NLRA 1F31A 5I0RA 2OPKA 3RQ0A 2W0XA 3ES4A 4D3WA 3HD8B 3WG1A 1C1LA 3BOWA 2PHWA 2CWSA 4AHXA 1PZ8A 4P9WA 3V65A 2ZAAA 4KWKA 4Y20A 1M06G 4J6GA 1PO21 1LHWA 1PO13 1RUH3 2CYFA 2GNMA 1ASJ2 1Y43B 5C9AC 4XJZA 4GB31 3APBA 1S0GA 2ZX4A 5J7MA 1G9BA 1RL3A 1RUE1 4XJWA 4QPIA 3W58A 5JPNB 2DUQA 4CDUC 2YY1A 1HV1A 3RNSA 1CAUA 2EA7A 2FZ1A 1VBC1 3QLQA 2ZKNA 5LRSA 3AZWA 1AR81 1LOAA 4NHMA 4KH9A 1WBLA 3B3QE 1PVC3 3V56A 2BNNA 1LOCA 4NR1A 3AZVA 1SBEA 3V0AB 1CIWA 5HI0A 1E57A 2PTMA 1ZBE1 3PNAA 5EFUA 2GC1A 4YZ5A 4HBNA 3ALQA 1DZRA 3JD72 2RS11 4E2SA 4M3CF 2PFWA 4YGCA 4LBMA 3IN9A 1NZCA 2ES3A 1J3PA 1PIV1 2YZ4A 4OLLA 3N36A 1UMZA 4IL7A 2O0OA 3AP4A 1CX4A 4R9BA 3ATGA 2IFWA 5CBLA 4CDQB 1ZBA2 1XXNA 4LA3A 2DU0A 1IKQA 4OVEA 1J3QA 3VBUB 3VZJA 1QXPA 2DUOA 3VZKA 3SLIA 3KZ4C 3D82A 3E5QA 4GULA 3AKPA 4YZ4A 3B9IA 3WW1A 4E4DX 4EN8B 3E5XA 1C8M2 3EXUA 2VMIA 4NWVA 1NXD1 4LBQA 1LU2A 4PQ9A 1WBFA 1OOPB 2B46X 3AYAA 1I6XA 2K0GA 3TN93 1RUC1 4Y1XA 4FPFA 5KHKA 3HMYA 4KU7A 4HFSA 3VZMA 2HKXA 4L8QA 1RVF3 1J1TA 1BBT3 3CF6E 4Q4X2 4YVSB 3VKNA 2OYZA 1OQDA 5ACA1 2HEYF 1VRH3 2PAEA 2IXKA 3WCRA 1N3OA 5AC93 1LOGA 2WQ4A 2E53A 3N7LA 5GZEA 2DTYA 4P9YA 5GM0A 2DFCA 4CYDA 4QM8A 1Y7BA 2O1QA 2WZR1 4OI0A 2Q5TA 2DF7A 3OCPA 4L11A 4FTEA 1DLLA 1COV1 1G9FA 3B9CA 3N35A 2QZ2A 4G4FA 4DZGA 1IS5A 3S30A 1QQP3 4V1PA 2VOWA 5GZCA 3OPZA 1AL0G 5D8AC 2VUJA 5JWPA 1WMEA 4Q0UA 4DMIA 3VZOA 5D8AA 2DCTA 2VECA 1HLCA 4Q4Y2 4M3CE 3FLRA 4FOVA 3VZLA 5JZGC 2ZBJA 3MIBA 3WHUA 3THTA 4G3YC 1RITA 4AI1A 1WLCA 4EWEA 1CJPA 3R4UA 4MUVA 4EROA 3M8LA 4FT8A 3U10A 3UKVA 2ZHKA 4QPGC 3AZYA 3MYXA 1A6CA 1NQJA 2NLRA 1XYNA 3OGJA 1XYOA 4Q4V1 4JCKA 4QPGA 1TNFA 1RJ7A 5K9YA 3HWJA 5F5QA 1BMV1 2ZAHA 2QQPA 2GN7A 1Q5OA 4RQPB 3VDDC 2WS91 4XOGA 3TB0A 5DXDA 3L2HA 3M3CA 4N43B 2WA3A 3GYDA 2FMYA 2C1FA 3JBG3 3WR0A 2RS53 3ZFFB 2EIGA 1IKPA 1GLHA 3UL2A 2D93A 5F6LB 2ZACA 1BYHA 4FPHA 1GQHA 1QU0A 2ZGTA 1EPZA 4IERA 1NLSA 1ZREA 2ZMLA 1MS1A 4AEJA 2PAMA 1NQDA 1EV11 4Y22B 3N7MA 4IEQA 4XQ4A 4XDQA 3C2UA 3CLPA 1Q8OA 1TME1 4B4RA 5JOXA 1FPN2 1W6QB 1AR93 4I02A 2E7AA 2ZGUA 2Q4SA 1R092 3AYEA 1GBGA 1V9U2 2WNVC 4K3UA 4LBKA 1ULEA 4JGYC 2CY6A 3WDYA 4WVWA 2WNVA 1FMD3 2RE9A 2K9ZA 3B93A 4FVVA 4PIYA 4AF9A 4Z1VA 1S0FA 1DGRN 1G7YA 1C8NA 1Q8VA 2IXCA 5L7OB 1QXRA 1NE4A 2F6BA 1QJY1 2VOKA 3ZVXA 4XQWA 5C8CB 4XFFA 4TWTA 1AX1A 2A70A 3OBRA 4R9DA 4JRAA 5H9RA 3USSA 3CU7A 5LEKA 1VB2A 4FPCA 5EV7A 5IT6A 4AI3A 5AVPA 1RJ8A 1OA3A 1KQRA 1XRUA 2D5FA 5DUUA 1LKNA 1LOBA 1HW5A 2EXHA 4Z82A 1H8VA 2EXKA 4GKXA 4WVMB 3LZZA 1PM7A 1X82A 2H6BA 1UZYA 3H1YA 2VU9A 2VUAA 5I0TA 1V6JA 3ZO0B 2ZCWA 1WD3A 2AREA 3ZYPA 2HWF2 2R061 5GLTA 2CGPA 4N53C 5EJ3A 5JSPA 1FYUA 3VBHB 3ZSEA 2XUMA 4COZA 4NWWA 3TYJA 1QHDA 4WM7B 1H8TC 1R083 3THPA 4HKWA 4Q1PA 4XFBA 3ZXJA 1QJU3 2R043 3WDVA 3FBYA 4YM0A 4BIFA 2PHFA 2OZJA 1H8TA 1ZRCA 5FQ0A 3SCGA 1WLDA 3LAGA 3UKNA 5JLVA 5KWRA 3MPBA 4GMP1 5FFOC 1ND3C 5KXDA 3BB6A 3PVNA 4KWLA 4OHXA 2R32A 1ND3A 1JUIA 4P9IA 4AEDC 1D4M1 1RUG2 3FX3A 1HXS2 2JG9B 2A75A 3LCPA 4XF1A 1AL23 4XZPA 3RI9A 1CJDA 1UU4A 5BNNA 1QXJA 2JICA 2A73B 1IPJA 4XE9A 3LA3A 3VBSB 4LA2A 4F83A 2C0ZA 1RHI3 4XW3A 2MPFA 3IMNA 3OGGA 4IEOA 4QQHA 5T5JA 1FNYA 2B7YA 4PBOA 3N4MA 2WT2A 1RUD2 2MEV2 1KITA 4JDOA 5DUWA 1VBE3 4QGLA 1J1LA 2JJ6A 4AXOA 4DRVA 1DZTA 2WFF1 2R0FA 4Q0PA 1UPIA 3AMQA 1C8M1 1IS6A 3B02A 4MGYE 1AYN2 2JKBA 2HWB2 1MS3A 4XFHA 3WG4A 1VBA1 2D3PA 4RR3C 2G9FA 5KXEA 2WQZC 5ABJC 5C9AB 5I93A 3TOJA 4RR3A 4EN9B 2PLV3 2ATFA 3LA2A 1WW7A 4ZKTB 3VZNA 1Q3EA 3M7AA 2WINB 4CP0A 1S0JA 2V73A 4L2NA 1CAUB 2ZX3A 1X33A 3AKSA 5KXBA 2I74A 4FTBA 3VBOC 1PO22 2A3WA 1I5ZA 1NY71 2VOVA 4DPNA 4WZFA 4OULA 4GB32 4RS5C 3VBOA 3VBRC 3S7EA 4BMBA 4DB5A 1TMF3 2BVBA 1RUE2 4BE3A 1OQ1A 1BVVA 4RS5A 1HRI3 2KXLA 3LB9A 3VBRA 1N1VA 4W6WA 1VBC2 2SBAA 3V64A 3WP5A 5FREA 1AF9A 1AR82 3VGIA 5T54A 3RG0A 1AR63 2YC0A 4IEPA 4AI0A 1IPKA 4YSFA 2YXSA 2R16A 2ILMA 3TWIA 4D7YA 2XPJA 3ROUA 4XBNA 5I0SA 4I3GA 1PO11 1RUH1 2BTVC 2DVDA 1A78A 1HV0A 2RM23 2FHRA 3WXPA 4XBQA 1ZBE2 1FI2A 4XILA 3EJKA 4FO9A 2RS12 1W6NB 3B94A 2XVGA 1YWKA 5DDJ3 1Y9QA 5CA6A 5C8WA 1PIV2 4LEJA 3MLJA 4NOTA 5H9QA 2D97A 4LBQB 2B45X 2H6CA 2WA4A 1KDMA 2YDEA 2HWC3 2P17A 3ZDSA 1PVC1 4E9KA 5LEJA 4QHBA 4YFZA 3RZZA 4ES9A 3H3ZA 5DG2A 2QFEA 1U5YA 2D43A 5FPXA 4QM9A