1AYN3

Human rhinovirus 16 coat protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The structure of human rhinovirus 16.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 39
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ayn300
1QJZA 1VB2A 1R1A2 4QPGA 3VBSC 4N53A 1RB8G 4GB32 5ACA2 1VBB3 1OOPA 1QJY3 5D8AB 2X5IA 4CEYA 2RR11 1MEC2 1X33A 1AYM1 2R061 2R071 4Q4V2 1EAH1 4N43C 4Q4Y1 2R041 1VBA3 3CJIB 2BBVA 2HWB2 4CDWC 5FOJB 1NCRC 5CFCA 1EV11 4PDWC 2WS93 1COV2 3VBRC 1TME1 1ZBE2 1Z7S1 2RM23 1RUE1 1AL0G 3J8F1 1RUC1 1VBC1 4CDQB 1QQP2 2XBO3 5K0UA 2VQ0A 3TN91 1RUI1 4YVWC 2R063 1AYM3 4CEWB 4CDUC 3VBSA 4RR3B 1EAH3 4SBVA 5ABJC 1PIV3 5C4WB 2WLPA 1AL23 3JBG3 5BNPB 4RQPB 2PLV1 2RS11 4NWVA 4N43A 1Z7S3 1R092 4CDWA 1RUE3 1NCRA 4CDXC 1RUC3 1VBC3 4PDWA 3TN93 1RUI3 3VBRA 4Q4W3 1PGL1 1QJU2 5DDJ3 4YVWA 1BMV2 1POV1 2HWF3 4IV3C 1V9U3 1MQTB 4JGYC 4CDUA 1NY72 4CDQC 5ABJA 4AEDB 3S6PA 4CEWC 1VBD2 4RR3C 1R082 1RUJ3 1C8M3 5C4WC 1HX6A 1AR71 5BNPC 4WM7B 1R1A1 4RQPC 4EJRA 3ZFGC 1FOD3 2RS53 4GB31 5ACA1 4FSJA 4FTSA 1MEC1 4Q4V1 3JB8A 4JGYA 1AR82 4CDQA 3VDDB 2BFUL 2WZR2 1AR93 1ZBE1 1HXS1 1R1A3 1X36A 4CEWA 4RR3A 1HRV3 1RVF2 4GH4B 4AEDC 5C4WA 1C8NA 5BNPA 1PVC2 3IDEA 4RQPA 5A32B 1VBE2 3ZFEC 3ZFGA 1SMVA 3FBMA 5AC93 1HRI2 1AUYA 2RS32 1ASJ3 1RUD3 2BUKA 1HXS3 1PGW2 4JGZB 4NWWA 2BFUS 4FTBA 1W39A 3JB4C 3JD72 5CFDB 1FPN2 1VRH2 5A33B 1MQTA 1OPOA 1H8TB 1QJX2 4AEDA 3DPRC 1QJU1 1FMD2 1BMV1 1AYN2 3ZFEA 2WFF3 3VBFC 1NY71 1ZBA2 1TMF1 2XPJA 4WM8B 5J96B 1VBD1 1D4M2 1R081 1AR62 2HWE3 1BEV3 2RMU1 1RUF2 1PO22 1BBT3 1NOVA 4JGZC 1NA1B 5BNOC 3DPRA 1TMF3 1NCQB 2RR13 3VBFA 1AR81 2R073 4Q4Y3 2R043 1RUG1 2WZR1 2MEV2 1RMU2 2RMU3 2HWC2 1EV13 5LK7B 1RVF1 2HWD2 1TME3 1PVC1 5D8AC 1PO11 4Q4X2 4RHV1 4WM8C 3J8F3 1VBE1 4RS5B 2GSYA 1GFF2 1HRI1 4JGZA 3CJIC 5BNOA 2RS31 1RUG3 1RUH2 5A33A 4GMP1 1PGW1 1RHI1 2PLV3 2RS13 3JD71 1B35B 1FPN1 1PO13 1VRH1 4RHV3 3ZFFB 2FZ2A 1VBB2 1QJY2 1QJX1 5BNNB 1POV0 1FMD1 5D8AA 4WM8A 1VBA2 1AYN1 2RS33 3M8LA 1POV3 3CJIA 4IV1B 1RHI3 4YVSB 2RM22 1D4M1 1AR61 2XBO2 1QJX3 2HWB1 1AYM2 4QPGB 1AR73 4N53B 1AYN3 1COV1 1F2NA 1MQTC 1PIV2 1OOPB 1AL22 3JBG2 3NAPB 4GB33 5ACA3 1QQP1 3ZFFC 1Z7S2 1E57A 3VBUB 1MEC3 1RUE2 1RUC2 4Q4V3 3ZXAC 2MEV1 1RMU1 2HWB3 4WM7C 2HWC1 4Q4W2 2HWD1 1COV3 1K5MB 4IV1C 1ZBE3 5DDJ2 1R091 2HWF2 4Q4X1 1V9U2 1QQP3 2Y26A 3VBSB 4Y5Z0 1A6CA 4RFT0 2DF7A 1ND2B 3VDDC 1RUH1 3ZFFA 1RUJ2 4N43B 1C8M2 4BCUA 4QPIB 4GH4C 2HWD3 3NAPC 5FMOS 1NCRB 4WM7A 1FOD2 1R093 2ZZQA 5C8CB 1NG0A 2RS52 3VBRB 3VBUC 1QJY1 2TBVA 4IV1A 4YVWB 1VBA1 2QQPA 1QJU3 4CDUB 1K5MC 1CJDA 3HAGA 1AR92 3VDDA 5CFDC 1HRV2 2RM21 1ND3B 2XBO1 1H8TC 1VBD3 4GH4A 3NAPA 1ND2C 4CDXB 1R083 4Z92B 5AC92 5L7OB 2ZTNA 3VBUA 4QPIC 5A32A 3LOBA 1PIV1 1AL21 3JBG1 1ASJ2 1WCDJ 5C8CC 1RUD2 1HXS2 4IV3B 4JGYB 3VBOB 1K5MA 5JZGB 4Y4YA 1AR83 5CFDA 4Q4W1 2WZR3 1DDLA 1VAKA 1H8TA 5DDJ1 1NA1C 1ND2A 1RVF3 2HWF1 5GKAC 1V9U1 2WFF2 1M06G 3ZFGB 1ND3C 2BPA2 1PVC3 4QPIA 2FZ1A 1NCQC 1VBE3 5J98B 2GH8A 4GMP0 5C9AB 1HRI3 5C8CA 5L7OC 1RUJ1 3VBHB 1C8M1 2HWE2 1BEV2 1VB4A 1IHMA 4GMP3 2WS92 1BBT2 1ZBA1 1FOD1 2RS51 3VBOC 3JD73 1FPN3 5JZGC 4RS5C 5K0UC 1VRH3 1TMF2 1NA1A 2RR12 3ZFEB 2R062 1FMD3 1ND3A 1RUF1 2R072 1EAH2 1PO21 4Q4Y2 2R042 1AR91 1NCQA 2RMU2 4CDXA 1EV12 5L7OA 2X5IB 1B35C 1HRV1 4CEYB 1ZBA3 1TME2 2IZWA 1OHFA 5BNNC 5C9AC 3J8F2 1VBC2 1D4M3 1AR63 5CFCB 5AC91 3TN92 5FMOL 3VBHC 1RUI2 4IV3A 3VBOA 1RUF3 4LLFA 1F8VA 5JZGA 4RS5A 1PO23 3DPRB 1ASJ1 1RUG2 1RUD1 5K0UB 4YVSC 2PLV2 3VBFB 2RS12 1HQNA 1PO12 4RHV2 1B35A 4QPGC 2MEV3 1RMU3 4N53C 2HWC3 1OOPC 5BNNA 5C9AA 1PGL2 2X5IC 4CDWB 4CEYC 2WFF1 4PDWB 3VBHA 4Q4X3 1CD3G 1VBB1 1RHI2 5BNOB 5CFCC 2ZAHA 4YVSA 2HWE1 1BEV1 1RUH3 1BBT1 5ABJB 4FTEA 2WS91 1AR72 2WWSA
chains in the Genus database with same CATH superfamily
1QJZA 1VB2A 3FHQA 4WVVA 3D0JA 4MVTA 3RYRA 4MXVA 5AVPA 4E4SA 1KDMA 1Y9GA 2CWMA 2WL1A 4JHZA 5FZGA 2NP0A 1RB8G 2LTNA 2VUJA 1OOPA 4QQHA 4NHLA 1YI9A 2WNEA 1GP4A 4YZ4A 1MVQA 1DG6A 3M3OA 4FQ4A 1MEC2 1JYTA 1X33A 1AYM1 4TSVA 2P4EA 2XLGA 4Q4V2 1RUNA 3AMNA 3OF1A 1IS4A 3GZEA 3FMGA 5A3UA 2XWJB 3IIAA 2HWB2 3LPFA 4M00A 4XTMA 4UBGA 4CDWC 1VALA 5FOJB 1QEXA 2JDMA 2WS93 2J1SA 5JVVA 4IETA 3ZXJA 4N8MA 4BHPA 3AYEA 1TME1 2OKXA 5FJHA 2HEWF 4MHRA 2V09A 5GLZA 3AZXA 4LHLA 1RUC1 1VBC1 2H0BA 5B4XA 5K9YA 2XBO3 4XJUA 1DQ1A 3WHUA 4FPFA 1X7NA 3TN91 5FZLA 4YVWC 1W9FA 5HXMA 2R063 5FDBA 4CEWB 4YW6A 1E5RA 3SITA 4AVBA 2R6QA 4Y1ZA 1W6PB 2QDRA 4BOWA 4Q1RA 5AVAA 4XDPA 5FR3A 4AAXA 5BNPB 1PZ7A 2YB7A 4RQPB 2PLV1 3N7MA 4YZ1A 3WDUA 2JIJA 5IVYA 1YI7A 1Z7S3 4COZA 4CDWA 1RUE3 2BV4A 5LASA 3TEXA 3WF2A 1QNWA 3LEMA 3Q8EA 2VH9A 3MZHA 5LY2A 2ZKLA 4F83A 5FZMA 3B9IA 4A45A 4Q4W3 1VIWB 5FZ0A 5FZ9A 1PGL1 2O1QA 1OSGA 5LZ6A 4I01A 4LBKA 3LAGA 5DDJ3 4RL7A 4YNIA 4YFWA 4YVWA 1BMV2 2HWF3 5FZFA 5H9RA 1ZVFA 4JGYC 3W58A 2GP5A 3O7OA 4Q8LA 1NY72 4MGZE 3PUHA 4AI2A 2YZ4A 5H9SA 5LA0A 3IBMA 1VAVA 1A8MA 1UWWA 2F4LA 3I59B 3LOIA 3ZXEA 3JU9A 1BVP1 1YFWA 4G9SB 3AZYA 4PQQA 5J7MA 3NNLA 2YBSA 1DQ6A 1JUIA 1V6MA 4WVZA 4COYA 1R1A1 4EJRA 1OQDA 2WNVC 2VOVA 1FOD3 4LITA 4GB31 4W6WA 1QXJA 3LFIA 4CP9B 1BK1A 1YFXA 2E33A 3O12A 5J37A 2RE9A 3ENRA 4IE4A 2ERFA 4JGYA 4KU8A 2QZ2A 4AEMA 3VDDB 2WZR2 3MF9A 2H6BA 4ZHNA 1CPNA 2VO5A 5SV5A 3TRSB 4IUGA 1DQ5A 4O7XA 3W5NA 1AXZA 1HRV3 1XRUA 1VPHA 4INDA 2OYZA 1ZA7A 1HB2A 4BMBA 1JW6A 4EN6B 4B7KA 1KS5A 5JOWA 1AXYA 5A32B 3OUIA 3ZFEC 1XE0A 3MIEA 3N9PA 2Q8DA 2WNVA 3H7YA 3IDBB 1NT0A 3B7MA 3IAQA 3WW4A 2R1BA 4ZU4A 4W65A 4A41A 5EP9A 5GJ6A 1WD3A 4Q0SA 2AR6A 1AUYA 2DURA 3APBA 4UWDA 2W52A 4XF4A 3BIEA 4B1LA 2BUKA 5KC5A 3KVAA 1BHGA 4XQWA 1JZ2A 2BFUS 1YEWA 1MS4A 5EV7A 3UK9A 4MH0E 3HN3A 4GWIA 4K20A 4J1WA 1VRH2 2BOIA 1W9WA 2R0HA 2W08A 4C8DA 3AP9A 1GR3A 3ACLA 3I8TA 2FDFA 1QJX2 3I2DA 4LXLA 4XE9A 1WA6X 1PMHX 2NYYA 4Y1VA 2V73A 5IATA 1O6UA 2DVBA 2G19A 4AFDA 5EPAA 3SCHA 3ZFEA 3MIHA 3D3AA 2BW8A 3VBFC 3WXPA 2W92A 1QY4A 2YGLA 1W05A 2ARAA 3OPTA 4KGGA 4L97A 2HKXA 1TMF1 3GCWA 1DYKA 1SCSA 4OYUA 2Q8EA 1OVSA 5G05L 2PAKA 3I2FA 1J3PA 3D4KA 1R081 3OYWB 5FUPA 1CZSA 3PHMA 1XNBA 3CU7A 1NOVA 5CKQA 2OT7A 4AVCA 1GWLA 3QLQA 4D7SA 1ZRIA 1HB1A 1US2A 2XWBB 1H4HA 4YW4A 4FPGA 2Y6FA 2ZA9A 4CZSA 3RZZA 3A7QA 1C28A 4HG6B 1GZ9A 2WDBA 2XKPA 3PDQA 1FATA 4KWUA 1NCQB 2J1UA 3FE5A 1E5HA 1LU2A 3X29B 2Z79A 3VBFA 1AR81 5IFTA 4QB2A 1JODA 1W6QA 1BCXA 3BGAA 2QQMA 2R043 4XBLA 4E4ZA 5A6QA 2MEV2 4HVRA 2RMU3 3WINE 1MS3A 2EVXA 4QXCA 2HWC2 3S7EA 3ZYGA 4I3PA 5FZCA 5LK7B 4CTEA 2QJVA 3GXUA 2XVLA 3FUOA 5D8AC 4WM8C 1DGWX 3J8F3 1DU3D 1VBE1 2BWCA 2NMNA 2YUEA 4W4ZA 2JD4A 1GWKA 2VBPA 5LEJA 1H1AA 2LM3A 5FY1A 3DYOA 2EXKA 5C70A 1STMA 3ZSEA 4ITCA 3ZN6A 1JZ8A 1GQGA 5J1XA 4HN1A 3MUZ1 1S1AA 4XXAA 2RS31 3KGLA 4N9HA 5A33A 2J42A 2VCCA 2ZX3A 2FCVA 4LBQB 1PGW1 4XYXA 3P6BA 2E7TA 2FDJA 3FWEA 2RS13 4Q27A 3C3VA 5HV0A 1B35B 1FPN1 4EZHA 2CGPA 4QPYA 4OHYA 3ASIA 3DV8A 1AVBA 4RHV3 3LCPA 4B4RA 1REDA 3NNGA 3N3HA 2WNOA 4OUEA 3WF4A 3S0MA 4I09A 5D8AA 4UFIA 4WM8A 1AYN1 4R52A 1UPIA 4W6XA 1N3OA 4Z07A 1ZZBA 3IM0A 4JKKA 5EYYA 2IFWA 4CCJA 1TE1B 2OUHA 4CUCA 2ZMLA 1MS0A 4GZ9A 2OA2A 2VZTA 4ZXKA 4AI9A 1JXNA 5FOBB 4LIUA 2ZGQA 5AFBA 1CZVA 5IK5A 3WUDA 5JLVA 3TNQA 4GALA 3MW3A 1D4M1 3KSCA 1U5IA 4OVEA 4JC1A 5DAPA 2NM1A 4XZUG 2WQ8A 4A2UA 1N3QA 2WT2A 4AGGA 1MQTC 1PIV2 4KL1A 2D6NA 3TWIA 3O1VA 3ZSMA 1AL22 1JHNA 1FNZA 2QUOA 3NV1A 4KWLA 4DEVA 4BB3A 4CCNA 1JHJA 5GALA 1MEC3 1DGLA 1SLAA 4Q4V3 3OJBA 3I2JA 3USUA 1GBGA 2WT0A 1APNA 4WM7C 2HWB3 1W2OA 2QVSB 2VW1A 2XHKA 2GNTA 4BH9A 3OY8A 2W9XA 2NZ9A 2E53A 5LBBA 3WG4A 4RGAA 4AGVA 4TTGA 3LPGA 4IV1C 1YO8A 2DTYA 2O8OA 4M3CB 2QNKA 4I30A 5FUIA 1R091 4IEPA 4Q4X1 2HYKA 2VMCA 2W47A 1EPWA 4PLOA 3QH6A 5FTTC 2VMFA 1DLCA 1OD5A 2KM2A 2WQ4A 2ZACA 3LSEA 4LHSA 3GYDA 5JPMB 2A3XA 1UKGA 2ARXA 4Y5Z0 4RFT0 2DF7A 1ND2B 3OBAA 3OEAA 2VOWA 2ZGUA 4IEQA 1SLBA 1RUH1 3OGGA 2W3JA 3OPWA 4QKBA 3J7HA 4YGCA 1UIJA 1H1IA 1RUJ2 1CAWA 2PHDA 2WRAA 3LSDA 4JVAA 4N43B 1O3QA 1UYYA 3DECA 2QDNA 2FDKA 3I7DA 2AGSA 2HWD3 3NAPC 5SV8A 1XE8A 3UGHA 3AMHA 2IVIB 5LW9A 2JG8B 2ZZQA 4WM7A 3WEZA 2ZGTA 3VBUC 3KVBA 3WP3A 5JUVA 4MGTA 3RQ0A 1ZX5A 4LBNA 4IV1A 3BI3A 2K9ZA 4R9CA 2RDQA 2YYOA 1OLMA 3AB0A 4XW3A 3T2QA 2BWAA 1QMJA 1CJDA 3HAGA 3P1IA 3T09A 4AQ2A 1AR92 4CRQA 5JWPA 5FMCA 1RIRA 4IQPA 4DY3A 1XE7A 4B8EA 2OPKA 2BQPA 2WSVA 3KF5A 1WMDA 3H50A 3WDVA 2IXIA 4A7ZA 4QX1A 3LEGA 4AI8A 4D0QA 2XBO1 3V0AB 2V4AA 3KT1A 3AKSA 3VZKA 5ISLA 4QDRA 3NAPA 5FWEA 5ERLA 2QQLA 3WV6A 3KT7A 5FYSA 4AVSA 4Z92B 5AC92 2JJ6A 2ZTNA 3O1SA 4EWEA 3VBUA 4BQWA 3GJBA 3LOBA 3BVCA 1MR5A 1S0EA 3UGGA 4ARYA 1WCDJ 5FZDA 5C8CC 4BQXA 1RUD2 4RGKA 4YZ3A 1OF4A 3QH7A 2VMGA 3WUCA 1UZ0A 4IV3B 3VBOB 2DV9A 2MPFA 1WCKA 2VTFA 4AVVA 2VOXA 4R4ZA 2ZGSA 5A3OA 5A3NA 1KFUL 4KWJA 4HANA 4KG8A 4N90A 4EE2A 4Q4W1 2ARBA 2Q30A 1WLWA 2D6KA 2WZR3 2Y6HA 2DDUA 4DRVA 1ZRCA 3OCPA 1S0JA 4QX7A 2GP3A 5DDJ1 1NA1C 5A6XA 5GKAC 2HWF1 2CYFA 2XJRA 5FYTA 3O1PA 1CN1A 1M06G 2WQZC 2K0GA 3FZ3A 3THPA 4AR2A 4P9IA 5C71A 3I54A 5FKBA 5JXGA 2VCBA 2YDEA 5J09A 2HJIA 1GU3A 3KWVA 3OOXA 1GYKA 2VNRA 1QH7A 3LA3A 4U36A 5C8CA 5JSRA 4NRQA 5CVRA 2VMHA 4HONA 3WLUA 5IK8A 1ZRFA 1CX1A 2BU9A 2PHFA 5C33A 4YSFA 2GAUA 1BEV2 3H3LA 1LU1A 3R4SA 5DUUA 5A1FA 4BLIA 4LBLA 5C6CA 4GMP3 2BP6A 2PHTA 2WS92 2VZSA 1ZBA1 1FOD1 4PJYA 1KD7A 4DXRA 3HBKA 3ZM8A 5EHDA 2ZGRA 3KM5A 4Y22A 5JZGC 1G9BA 1VRH3 1Y3TA 4DXSA 4I02A 1NA1A 3I2IA 3KZ4C 3NV4A 4R9AA 5FP4A 3P3PA 1ZZ9A 1LHUA 5I8YA 1A34A 2FBEA 3M1HA 3VHNA 3OBZA 3LDBA 2P5BA 2R062 4FOYA 5GZFA 4C0HA 1CR7A 2BYVE 4HT1T 4Q4Y2 2XGXA 1REEA 3OPZA 5FQ0B 5BY5A 1NX9A 1N1YA 1OUSA 2A6ZA 3IMMA 3ES1A 2YPDA 4Y20B 2C24A 1WGPA 4QHZA 2EXJA 3N7KA 3Q8CA 5JOZA 4B7EA 2X5IB 1HRV1 1M4WA 4CEYB 5LRSA 1O3SA 1QIQA 4MXWB 3PNAA 1QOSA 4TXWA 1CONA 1HW5A 1WKYA 2LALA 2VNGA 3EMRA 1G6NA 1NLRA 1OH3A 1VRBA 2W0XA 5CFCB 2DCJA 5FMOL 2J1VA 3E5XA 1TZOA 2RJLA 2PHUA 1V6NA 5T50A 4BA6A 4NIDA 2VCAA 4Q29A 5JZGA 4FPOB 3AKRA 3RRDA 4EYUA 3DPRB 2C1FA 1RUG2 3BOWA 3ZIXA 2VC9A 3FN9A 4FOQA 2GNBA 1ULGA 3TNPB 4CCMA 4YVSC 2W91A 1RXGA 1JOPA 3P5BA 4WVMB 4DZGA 4MG2A 2WNUC 4IEXA 1CAVB 1W6MA 2DCKA 4LO7A 1WMXA 3LWCA 2XB6C 5FLIA 3RI9A 1KXGA 1SG3A 5F3IA 1OFSA 1UN1A 2MEV3 5FYHA 4N53C 4XC9A 2HWC3 3POFA 2J1RA 1IPKA 2R49A 1X8MA 5DZFA 4E4DX 4HKWA 5F3GA 5FFOC 5GZCA 2PAMA 3K3NA 3KHCA 3THDA 4JDOA 1I6XA 4L0PA 3T4VA 3V56A 5IWFA 5IVFA 3LZZA 1VBB1 2XJQA 2VBBA 3LA2A 3J7MA 3KV4A 4HLTA 1S0DA 3RDIA 3LKJA 1W6NB 2ATFA 5DABA 5KXEA 3RZKA 1XPWA 4R4XA 2GMEA 1GOHA 2ZAHA 4R9DA 4QKNA 4QPWA 4YVSA 2B45X 2EIDA 1YC61 2WNUA 5ABJB 4FTEA 1PZ8A 1PK6B 2WWSA 5CG8A 1IZ3A 3MICA 3S7IA 3THCA 4M3CE 4XACA 4N53A 1W9SA 2L9LA 2HH9A 5GLWA 1YRZA 2BGOA 1O8SA 5L36A 1UZVA 1NLQA 3HQUA 3OD0A 2NPIA 4S2HA 5KHIA 3GBWA 2AACA 3QD6A 3SLIA 4O61A 2R041 5C3QA 3CJIB 3MPPG 1YQ8A 4CSWA 3ZDSA 1GNHA 2I74A 4ZKTB 1GNZA 2JIGA 3CDZB 3DKWA 1JU4A 1W9TA 1W6OA 1Y9MA 2H0VA 3E97A 3Q8AA 3S30A 3GJAA 4KBZA 3VBRC 2Y33A 1ZBE2 3ZSKA 4COWA 4LBQD 3LDRA 3AFKA 4NMIA 4QX2A 4XUTA 1CWPA 3J8F1 4XF3A 4CDQB 1WCQA 1W2TA 1WCSA 1OFNA 4LJHA 5KHJA 3OBTA 3KMHA 4RR3B 1EAH3 4SBVA 5KHGA 5JMOA 4Q0PA 2B9VA 5KHKA 1NQDA 1PIV3 2JKBA 5KBFA 2FHRA 2WLPA 1RUOA 1AL23 4PIZA 3AP7A 4HBNA 3W20A 1SBEA 2CU5A 4CP0A 2AENA 5IHRA 5FPVA 2C26A 1LOGA 2RS11 1IQAA 1SDWA 2J1TA 4HSJA 4OMCA 2CL2A 4RN5A 4OFGA 4DIQA 2D6LX 4JRAA 1EP0A 3RNSA 4CDXC 5DAQA 2OPWA 2QQKA 1OH4A 1N1TA 3PVEA 5F6LB 4NIAA 3RS6A 1RUI3 3VBRA 2VTXA 1IG3A 2JDNA 4MGYE 1MS1A 2VD7A 3WDWA 3ZYFA 4MGQA 3BYWA 5JIAA 5FP7A 1ACCA 4S2GA 4IERA 1IOAA 1UF2C 2ZHLA 3WP4A 4YG6A 2SBAA 3FLTA 4QWNA 5CG9A 4QAWA 3WW3A 1OPMA 4GKYA 3DXTA 1UNBA 3KV9A 2OVUA 3H1YA 3N9LA 3OEBA 4AEDB 4H3WA 4LKEA 2Z42A 3Q8BA 2JDPA 3AK0A 3VZLA 4CEWC 5F3CA 5I91A 1XNKA 1F5JA 1JU3A 1RUJ3 4XQ4A 3WNOA 1QWRA 4MV2A 1YJLA 2J22A 5BNPC 2X8KA 1QOTA 1ULOA 4RQPC 4BE3A 4KI5M 4BQ4A 2A5ZA 3OB8A 3POWA 2KXLA 2D6PA 4HN0A 4XDQA 4FI9A 4LKSA 4BPZA 1YJKA 2W39A 4FSJA 3VDBA 2O0OA 1MEC1 3RGBA 3POJA 1UMIA 5LBCA 1Y7BA 4Q4V1 2VCMA 3JB8A 2JG9B 5EJ1B 2ET1A 3PIGA 3SCGA 3RWNA 2QCSB 3HR9A 1UY2A 4P5HA 1TG7A 4LBJA 1R1ZA 2VNVA 2VU9A 1AR93 2YU1A 4LOSA 1YQCA 4QHBA 3WP5A 1RYYA 3V64A 4NRPA 1HXS1 3AJYA 1DCSA 4JKMA 4CEWA 1SPPB 4HPKB 4GH4B 1W6PA 3WDYA 2WA3A 4MUVA 5GLVA 2QZ3A 3PUQA 3UJOA 1PVC2 2P6HA 5BNPA 1FX5A 4RQPA 4LMFA 2R32A 3PVOA 4QD2A 1QNYA 4UI9L 5JR7B 2VXJA 3ZXKA 1WUVA 4KBBA 5AC93 3OGSA 5JAXA 1DHKB 3R05A 2NLRA 2D97A 3MGUA 4XJ8A 2C6SA 5FYUA 3PTYA 4XABA 3ROUA 4QXKA 1H4GA 4CUBA 1KEXA 1RUD3 1ULFA 3WNNA 4PIYA 5A7PA 3OTFA 2EAAA 4JGZB 3R4UA 3B02A 4NWWA 4YW2A 4D94A 4FTBA 3EJKA 4PF1A 1OBNA 5F5CA 3EBRA 3ILRA 2WJSA 5CFDB 1ST8A 4FFIA 4GWNA 4NVPA 4UW3A 3ZYJB 1HQLA 2D3RA 2W1UA 1OPOA 2OZJA 1H8TB 2RHPA 3OGRA 3VN4A 2ZEYA 2XKOA 3NJXA 5A1AA 4O9GA 4V2VA 1KITA 2Z5WA 3NJVA 3I59A 3B01A 4K21A 4A7YA 1BMV1 5F1RA 3N9NA 5I93A 4MSVA 1NY71 4W6YA 1YIFA 3K77A 4YARA 4PBOA 4JTNA 1DQ2A 3BKZA 4ASKA 3HNMA 2C9AA 4L9BA 2JB4A 5CIRA 4COUA 3ZYRA 4KG0A 3URFA 4IE6A 1QJFA 5FAXA 2JDZA 4GWJA 3AP6A 1MVEA 1WWYA 3VL9A 5F7UA 5JSOA 1AR62 2BNMA 3ZPYA 4YM0A 1OVPA 5A1LA 1BEV3 2LRPA 1WW4A 1L3JA 1OLQA 2QFEA 5IVCA 5CB7A 1RUF2 3DYMA 3UV9A 4NPMA 1HKDA 1UZWA 5DZEA 2W2IA 1C57A 5A7QA 2DVDA 5BNOC 5DG2A 2RV9A 3N9QA 1GV9A 2ZXQA 3ZXGA 3GDBA 2XG3A 4HETA 3T0AA 4FFFA 1X9PA 2OX0A 3GBGA 1A8DA 2CDPA 4LUMA 3SQOA 4HVOA 4JV4A 1K3IA 4IL7A 2WZR1 4Q4Y3 1UOJA 3ON7A 1RMU2 3BODA 1JOBA 3PLQA 4Y33A 4DINB 3WNMA 1A78A 4FPYA 4UYBA 5E8AA 4P9GA 4Z82A 3RG0A 2XJUA 1IPSA 2ADDA 2HWD2 4BIOA 1NKGA 2YY1A 1ODNA 3P3NA 1UY3A 2EF6A 2LROA 4X8NA 1PO11 5HPOA 3B93A 3HD8B 1V6JA 2YC0A 2F4PA 1S0FA 1UY4A 4ES9A 2E9QA 4RS5B 2GSYA 1T2XA 1H2LA 5EQUA 2D5HA 2KR2A 3AL6A 3ILNA 3NNFA 4D6SA 1UYZA 4N7IA 5BNOA 1UKRA 1W8OA 3VHOA 1HB4A 5IVJA 1RUG3 1GWMA 2WZEA 2X09A 4M0HA 5A3LA 1CESA 2IFRA 5FY4A 2V5YA 4GMP1 4ISRA 1XYNA 2KA3A 5FCCA 2WINB 1JYNA 3DXUA 1RHI1 3WF1A 2P17A 3I97A 1WCUA 3ZO0B 4JAAA 3JQXA 5F9TA 1CQ9A 5GZGA 2QQOA 4HZFA 3K46A 1VRH1 4LK7A 3ZFFB 2I07B 4DY5A 2WZPP 1QJY2 4MGIE 1QJX1 5FZ1A 5BNNB 1POV0 4R9BA 2UY9A 3D82A 4JDNA 4NHMA 3A0NA 3QOPA 2YG0A 1VBA2 4DB5A 2UYAA 3E6BA 4D69A 2BOJA 2LS6A 3T30A 3M8LA 4XAAA 3CZJA 3ZXLA 3GZAA 3IN9A 4FBFA 5JDBA 1LULA 4KH9A 2RM22 2ZX1A 4P9YA 5KHHA 3POSA 2VMDA 1SZBA 2WYFA 4NRMA 1LKNA 1DP0A 5FMBA 4A42A 4PF5A 1WLTA 4AF9A 1AYM2 2PFWA 2VECA 4RGGA 1C1FA 3Q8FA 4M0NA 1COV1 1F2NA 1JYIA 5APAA 2WWUA 2Q8CA 1OOPB 4Q1PA 5G04L 1GOFA 2EALA 3JBG2 4K1ZA 4B4PA 4XJZA 4KGQA 5FLJA 2VY0A 1QQP1 3SNMA 5KC6A 4DUVA 2WABA 2VZUA 5E1RA 5C3SA 2F6BA 2ES3A 3KB5A 1KJRA 2Y0IA 2JXAA 1RUC2 2LUWA 2ZEWA 2WBKA 5GLUA 1JYCA 2MEV1 4XIOA 5A6YA 2JE8A 2QQUA 2HWC1 4EN8B 4B1MA 1J3QA 1SQ4A 1G9CA 2CAVA 1AX1A 1K5MB 1WZXA 5DG1A 2Y60A 1ZBE3 3PUIA 1W8NA 2MNGA 5CU1A 3WT3A 1YUDA 3G6JB 1V9U2 1O5LA 1K12A 2Y26A 4DUXA 2WKKA 4LBQA 2GMPA 1S0CA 4DXZA 3AXEA 2DYCA 4BZ4A 4XIKA 1C5IA 1A6CA 3NKGA 4NIHA 4CUGA 1NQJA 4C1XA 4K6BA 2XQRA 1AJOA 1C8M2 4H7MA 2WN3A 1HJFA 2CHHA 1GP6A 5FMOS 3KQRA 1UX7A 1OQ1A 5T5JA 4TWTA 3NO8A 1XOYA 3BOPA 1BQPA 3MIGA 4MOAA 3AZWA 1LOCA 2TBVA 1YQ2A 2OS2A 3K75B 3ZXDA 4IXLA 5FO7B 2B9UA 5FREA 5FY0A 4HOOA 4YVWB 3MFCA 2E51A 3FBYA 3UETA 2DBIA 3OBRA 1B09A 3HWJA 1J83A 4P02B 2VPVA 3JUUA 5EXOA 1LOAA 2PHWA 3EB7A 4PHZA 3KCCA 2X05A 3VD3A 3AMMA 1KRIA 3AKPA 1G9FA 4XCAA 3SH3A 3I2OA 4QQPA 4DQAA 1ALYA 2Y6GA 1YFYA 2CAUA 2PMWB 5DQ0A 1RJ7A 3ZN4A 2DVFA 3WG1A 1ND2C 1H8VA 1H1MA 1NXMA 1RTVA 2UY8A 4WV8A 5BYNA 2D6MA 5T5OA 4AHWA 3J9SA 1CJPA 1G86A 1YWKA 1K42A 4QKFA 3LE0A 4D7YA 1PIV1 3VD4A 4TZDA 2PQSA 5DAWA 1AL21 2PXJA 4L8QA 2KD7A 5IAXA 5EJ3A 1LESA 2W94A 4ZU5A 2JG8C 5L73A 3WF0A 1ULDA 5FZ6A 1HDKA 4JGYB 2D40A 2O14A 2JKXA 2CNAA 3NJZA 1XNAA 4P9JA 4CXXA 3WQ7A 2Q1FA 4QM9A 3SH4A 2V72A 5IVBA 5KXBA 4UT5A 4D8MA 4QDSA 1DGRA 3ZR5A 3DGTA 3SKVA 3VDCA 1GZWA 4MZUA 2YROA 2CGNA 1XSQA 5HV4A 3UNPA 1ND2A 1OUXA 3BUCA 1F4AA 1UZZA 1IPJA 1JI6A 4FOWA 2JDUA 2WFF2 4FXGB 4JX0A 3UGFA 4OI1A 5IW0A 2WNVB 4XJ9A 1H6YA 1PVC3 2PHRA 4YM1A 3WCRA 5JXHA 1SHWB 1WMEA 5EZWA 1SEFA 1EYBA 1LOBA 1PGSA 1HQWA 1H9PA 3NRUA 3TAYA 5C9AB 2JG8A 3L2YA 5FJKA 4DRRA 5JMCA 1RUJ1 2RDRA 3VGIA 1V6LA 3O0XA 5C3PA 1KQRA 1N47A 2GU9A 1VB4A 2HWE2 5JR2A 1IHMA 3RSJA 4L2NA 1GANA 3WW1A 1JZ7A 4EN9B 3B00A 1XB9A 1YXWA 3GHNA 3ZKYA 4META 5DPNA 3VBOC 3FUQA 1O5UA 1UPSA 4QXBA 3VLBB 1J1LA 1TMF2 4FPEA 3NMBA 4C90A 2IXCA 2VZQA 1WW6A 3NSTA 2QQVA 2RR12 2DVGA 2ETEA 2Y6LA 3K3OA 3ZFEB 4EN7B 5FPZA 2R072 4QMAA 1ZNPA 1EAH2 1PO21 1LCLA 1POQA 4OHWA 5F5IA 1AR91 3V0AA 1ENQA 3POGA 4P5YA 3KS7A 4Q0VA 3BPSA 3RYKA 4BJ0A 3OGVA 1EV12 3AMPA 3RJRA 5FP8A 1FXZA 3SC7X 4WBBA 5FPAA 3SISA 3ACGA 1LR5A 3BCWA 4UFHA 1JMUB 1NAEA 4J25A 4DXTA 3CIHA 4CU8A 4LHNA 3IPVB 1S2KA 1AR63 4EV0A 1ZA4A 3LD8A 5AC91 3I3MA 5DUXA 2AZ5A 5FZHA 1RUI2 4IV3A 1JH5A 3VBOA 1V00A 1RUF3 2D98A 3NJYA 5LWBA 4AHZA 1CIWA 4JTOA 2CV6A 1RUD1 3LEKA 5B2GB 5K0UB 3V0BB 4XCBA 2WA4A 1TNFA 4HK9A 4CU6A 4E27A 4IEYA 3VBFB 5IYYA 4HKOA 2ZCWA 3HMYA 1OD3A 1ULEA 2XXZA 3B94A 3SKJE 4QX0A 4A6OA 4ZY9A 4SLIA 4QU1A 4TN7A 2G9GA 3O0WA 2FDHA 4YW5A 3T0DA 4QPGC 4C1WA 2SLIA 4HL0A 1QDOA 1RMU3 3HT2A 4YGEA 4BXFA 4ASLA 2YHJA 2K46A 2X5IC 1UL9A 5K4LA 1H2NA 4CEYC 3D8CA 2XUEA 1AF9A 2BNOA 4PDWB 4W50A 5LEKA 2A71A 2XVGA 3NVCA 3J26N 1OA2A 2WWJA 4IE5A 4V1PA 4AXOA 2DU0A 1CAXA 2DU1A 5CFCC 4Y1UA 4KMQA 2PELA 3ETQA 5DN2A 3JXSA 3M2MA 3ST7A 4YGBA 1LRHA 3M4FA 2G1MA 1BEV1 4XILA 4XFCA 3FJSA 3UJQA 4UW6A 2WS91 1AR72 1TQ5A 1Q8VA 3ATGA 2VM9A 5FK8A 3O1MA 4NROA 4CPBA 1FI2A 3ACHA 1PHMA 2VQTA 4QPGA 1GP5A 3H7JA 4YWAA 3V65A 3PUSA 3VBSC 1KDKA 1XU1A 4Y20A 2GC1A 5ACA2 3QBQA 1QJY3 4PI0A 2VG9A 1HLCA 5D8AB 2X5IA 1UW8A 1T6BX 5A7OA 4CEYA 3R6SA 2R061 1VP6A 2ORXA 3I3EA 4MXWA 1EUUA 4YFZA 4ISQA 1TEIA 4Q4Y1 4Y5TA 1VBA3 2BBVA 1RINA 1UQXA 3KV5A 4LORA 1LHVA 1NCRC 4LA2A 4AVAA 2X29A 4LOTA 4AZZA 3F2ZA 3OUJA 3QCWA 4LQRA 4XFFA 2JE7A 3L2HA 4XUOA 1Z7S1 1ZZ8A 1BZWA 1TNRA 1HN0A 3NKTA 2RM23 2VZVA 1RUE1 1AL0G 3AP4A 3FHAA 3MBWA 4GULA 4PIXA 5FP9A 3D5OA 3W59A 4B3NA 4UFJA 2VZ3A 3FLPA 4QHOA 3LQCA 3ZN5A 4LEJA 1AYM3 1SLLA 4Y26A 5F2WA 4CDUC 4WVMA 1SLCA 3VBSA 4X6RB 2A3WA 3LB9A 1RITA 5ABJC 1PK6C 1CAVA 4TYSA 3AYDA 5C4WB 2D6OX 3ZOIA 3TEZA 3JBG3 4F8AA 3ZXFA 3IMNA 4FXKB 3USUB 2VVFA 2XOMA 2YFZA 1BXHA 3GF6A 3ZSLA 1R092 4GD4A 2ZEZA 3BU0A 1NCRA 1UZYA 1DIWA 1RUC3 1VBC3 1X50A 3DF0A 4RSUA 3TN93 3I2GA 4QM8A 1U5YA 3SEEA 3CBNA 3U4XA 1IS5A 1W3XA 1VAMA 2YBKA 3D0SA 3LIGA 3U37A 4UBHA 5JI7A 1QJU2 3CMGA 1W6NA 4Y1YA 1IS6A 3ZMNA 4NIGA 2W1SA 3S57A 2ZJCA 3NQHA 1PX4A 2E31A 1V9U3 1OKOA 1UIKA 1MQTB 4CDUA 2FQPA 1GUIA 3IT8A 4RYDA 2A70A 4CDQC 5ABJA 1PK6A 3U1XA 3CNAA 4P9XA 4XAEA 4BLJA 4CE8A 3PURA 3S6PA 4BQ3A 1GZTA 2FDIA 1VBD2 4XFBA 4JZRA 4RR3C 1LECA 5FYBA 4MX3A 1DFQA 1EUTA 1PVXA 1WLDA 2VXRA 4QKDA 5FBJA 1C8M3 3AMQA 1HX6A 4BK4A 4A6SA 4WM7B 1DBNA 1XNTA 5LCWL 2ZBJA 4CP1A 3ZFGC 2CWSA 3ZX7A 4XBNA 3TB0A 1D0HA 1IS3A 2JE9A 4XHBA 3VV1A 2BGCA 2ZMNA 2GNDA 3M3IA 5FYZA 1RXFA 1IKQA 3CEWA 2VAUA 4MGSA 4XUNA 1F35A 3SHRA 3C7HA 5CKNA 1W9YA 3O0VA 4K8RB 3T4HB 1J1TA 1V70A 4CCLA 2MHFA 5CISA 4CDQA 3VHPA 3N4MA 3RZJA 2BFUL 1SFYA 1QH6A 1REFA 1UY0A 1ZBE1 1R1A3 4RR3A 1RVF2 5IT6A 2I45A 1O59A 4AEDC 5J48A 2OXBA 1SACA 1W04A 1C8NA 2CGOA 2PYTA 3IDEA 4EZ4A 3W5MA 3K51A 1LHNA 4NHXA 3ZFGA 3MPBA 2EXHA 3FBMA 4I3GA 5FBZA 4AQTA 1JYVA 1U5XA 2IXHA 1HRI2 4GWMA 2P2KA 4JDMA 2IXJA 2GC3A 5C3OA 3U10A 4XF1A 2C4XA 4NE9A 4LT5A 4I0WB 3N9OA 1D2SA 3MEPA 5FZ3A 1QU0A 2XHNA 3VZOA 3SXWA 1W2AX 3ABZA 3M3QA 3C7GA 5EFUA 4JRLA 3JD72 3I4IA 3WVJA 1K5JA 3PU8A 4XVHA 4YW3A 5FKCA 4AOCA 2BTVC 3A4UA 4AEDA 4FCAA 3I2HA 4AI3A 1FMD2 4NIIA 4S2DA 4YLZA 1GQHA 4LO6B 1JYXA 2WFF3 2A75A 5JXIA 4FQZA 1ZBA2 1IQDC 5CKMA 1SFPA 1CVNA 4JQTA 1S0BA 1E5IA 2XPJA 2XJVA 5HXVA 3CQOA 1CIYA 3J7LA 2EAKA 3KLSA 3VKMA 4D6QA 3RZHA 2FD8A 4IGPA 4LO8A 2R16A 4LNVA 2HWE3 2RMU1 5FPUA 1C1LA 1OT5A 4XOGA 4NOTA 4X6QB 4Y22B 3EXUA 4JGZC 1P8JA 4XZPA 5IFPA 1NA1B 4E8DA 3RZGA 3FX3A 1JYWA 4IEZA 5T5LA 3Q9OA 5GM0A 1E5SA 2YGMA 2P3IA 1TMF3 2DTWA 4XTPA 2EIGA 4N9IA 3K4ZA 1UXXX 1LOEA 2A1XA 2RR13 4QQ2A 1LAJA 2R073 4LLOA 4QX3A 4XQDA 2J1EA 1W0NA 3ETPA 2D43A 2A3YA 5LA9A 1ENXA 4AAPA 4XETA 2OZ6A 5CFCA 3RMXA 2A6VA 2ZGKA 2VULA 1NXD1 1EV13 1HJGA 3L9JT 3WP6A 2Q0AA 1XNDA 2X53S 4XUPA 4LIVA 2D5FA 3ZMOA 1J59A 1S55A 3WOGA 4K3UA 2B46X 2NN8A 1PVC1 5FZKA 1LEDA 2QTWB 3SCFA 4RHV1 1W2UA 4HK8A 5F8PA 3RFRA 5BUVA 1CAUA 1S2BA 1U12A 2TNFA 1PMIA 4AYUA 3VHRA 2HEVF 2JDKA 3GHMA 1G7YA 1LOFC 4FFGA 4JGZA 3A22A 4ZU7A 3A0KA 5D21A 5HI0A 3HNBM 1GICA 4GIQA 3K48A 1W8ZA 3ME2A 5D2AA 3VZJA 5A7WB 4URAA 1N1VA 4ZZ5A 1XYPA 3DKQA 3RWKX 1W6MB 1ZZ6A 1DZTA 2Q5TA 4UAPA 4UF0B 4TLGA 1OQEA 4C0BA 1SFNA 3U78A 2FZ2A 3MI8A 1NZCA 1IKPA 1VBB2 3JZVA 3KHBA 4M4PA 1UOBA 5FZ7A 3WZ1A 4ES8A 2XL7A 4K8FA 4H55A 2ENRA 4IE7A 4Y1XA 5KXDA 2G9ZA 3O14A 2ZX4A 3AL5A 1UU4A 1XNCA 2VZRA 3RYPA 2RS33 2TEPA 4QX5A 2VQUA 3ZR6A 1U5ZA 4E9KA 1LOFA 1POV3 4QQOA 5FO8B 2ZMKA 1C3HA 4XURA 2ARCA 2W1QA 3C7OA 4XMAA 4CCKA 3WG2A 4XDOA 4YVSB 1GMMA 3PJYA 1W90A 4QQLA 1AR61 2F17A 1VR3A 4LULA 1MACA 3TEYA 2VR4A 5FY9A 2HWB1 1HB3A 3DUIA 2XR4A 2VQAA 3PJQA 4A3ZA 4P9WA 5L19A 5A80A 1RGSA 2FCTA 1AR73 4P14A 5JOXA 3H8RA 4ATFA 4N53B 3BTZA 1AYN3 4ARXA 4PCRA 1EY2A 3RZLA 3I49A 4UW4A 4AFCA 4C91A 1CPMA 4URTA 4GXLA 2EIEA 5ACA3 1JZ3A 2CY6A 4K7JA 1QXRA 3ZFFC 1E57A 1VMJA 3GALA 2VL4A 4M4RA 2W95A 4QGMA 4GJZA 4YGDA 5F5QA 5I8TA 1UO9A 4AI1A 1IG0A 5IVEA 2VBDA 3NNJA 1W6OB 1RMU1 3GNEA 4KWKA 3N7LA 4E2QA 1AX0A 1YLLA 1KFXL 2HWD1 1I1EA 3KGZA 4D7TA 1GOGA 1S0IA 2Q4SA 3T2TA 3M7AA 3RJ2X 4JHTA 3AKQA 2E7QA 4CCOA 2XUMA 4CCEA 4FVVA 1SLTA 3NV2A 2ZGNA 1O91A 5I0DA 2E6VA 2D93A 1LGNA 3POYA 4XPVA 4M3CF 2WUHA 1UMZA 3VDDC 3MV01 1KGYA 3CF6E 3ZFFA 2XMLA 1EPZA 3ACFA 5C5UA 1W8FA 3NWKA 2JDAA 4BCUA 2WAAA 2X10A 1DYPA 4QPIB 4DOUA 4BQ1A 3C2UA 3H9AA 2JDYA 3MUY1 1LENA 5L9RA 5K7PA 4BQYA 1R093 5DMYA 2VVDA 2RS52 3VBRB 1QHDA 1QJY1 3WNLA 5L9BA 4PLNA 4OQ8A 3HNYM 4IE0A 4OI4A 4CP9A 5BPXA 3UL2A 2IVJA 3WW2A 1VBA1 1QF3A 1QJU3 1ZZCA 2Y38A 2B8MA 1K5MC 1K45A 1S4CA 2E26A 5FY5A 2W5FA 3U75A 3ZYIB 5JI9A 2WO2A 4PBPA 3H8OA 5F37A 4XUQA 2DUPA 3VDDA 2YV8A 3HJRA 2RM21 5EIYB 4IGOA 1ND3B 4QB1A 4DEQA 4OZOA 2IUWA 4FO9A 1MPXA 5EWSA 1XC6A 2JEMA 4ZS3A 5T54A 1YQ5A 1VBD3 2VZ1A 3GZTB 3H1WA 3MV11 3MW2A 4CDXB 5J3UA 1Q56A 1F4HA 4RFRB 2WLQA 5FZOB 1FAYA 5L7OB 1DQ0A 1JOJA 2DCZA 4D3WA 1G8WA 5A32A 5LRRA 1W06A 3JBG1 5FYVA 3ZPOA 2ZAAA 2ZHKA 3J7NA 1ASJ2 1F15A 4OQ9A 2GZWA 5J36A 1QOOA 3O5SA 2VJXA 4FAGA 5I8SA 1H9WA 1HXS2 1J58A 1DYOA 3WNPA 2QBXA 1K5MA 5JPNB 5DUWA 1ZYBA 1Y43B 2WFPA 2FDGA 4Y4YA 2UU8A 3MFAA 1PNGA 1XYOA 3AX4A 4FP3A 4A4AA 3E6DA 4CPBD 3WQ1A 3BTYA 1DDLA 1TVGA 3PMEA 2ZGMA 5FV3A 1VAKA 5HCAA 3O1UA 1NYWA 1JTZX 3UT0A 1RVF3 1V9U1 3B9CA 2VMIA 4DFSA 4S2FA 1W3VA 2FMYA 4OULA 4M01A 1NCQC 3EO6A 5J98B 3DEMA 2VGDA 4ORFA 2GH8A 3PVBB 4NPLA 3WR0A 1VMHA 3ALQA 3BPZA 3DN7A 5A3PA 1HRI3 5F32A 4NUBA 3LGRA 4XJWA 3PL0A 4LPLA 4K1YA 3VBHB 1AJKA 1C8M1 2DWRA 3B3QE 5HCFA 2GN7A 5EYXA 4A44A 4AHYA 2GN3A 1S0GA 3BIWE 3N36A 3OYWA 4XMIA 1BBT2 2YPJA 2UWCA 2BGPA 4AQ6A 3JD73 2JD9A 4GA9A 2PN5A 5FPXA 4HFSA 4XF9A 2B4KA 2ID4A 2RG4A 1UY1A 1FMD3 3ACIA 1Q8QA 3IDAA 1NCQA 4YW1A 4G4FA 4JKLA 1I5PA 4AEKA 4OZXA 5JIUA 1B35C 3AKTA 2ZGLA 1ZBA3 4FT8A 1TME2 2Y34A 2QE3A 3U07A 4UFMA 2IZWA 2VOKA 3IKWA 4E4HA 1WA4A 5C9AC 5E16A 1VBC2 2JWPA 2UWAA 4XBQA 3IIIA 1VLNA 2BERA 3TN92 2OIIA 4E2GA 4CVUA 5LB6A 4Z2WA 5FPLA 4FPLA 3VDAA 4LLFA 1F8VA 1QJEA 1ZRRA 3VKOA 3PTRB 3HT1A 1OXCA 4BM8A 3FHIB 4Q0UA 1YQ6A 2PLV2 1US3A 3N7JA 2D3PA 4GQ7A 3RI8A 1HQNA 4FFHA 4PLMA 3WDTA 2E63A 1DZRA 1PO12 4OUSA 1LODA 4COVA 1VE0A 1B35A 4L92A 2DVAA 1ZM1A 3NL1A 3WCSA 1Z78A 3AYAA 5T52A 5A6ZA 5M0TA 4OHXA 2WN2A 4AFAA 4UXAA 3WY6A 5C9AA 1PGL2 3U11A 4CDWB 2DUQA 1BLZA 2WFF1 1KJLA 2BEOA 3AZVA 2WZ8A 1L7RA 4EWDA 3CLPA 5I0TA 1RHI2 3VB9A 3WNKA 2W87A 4XFAA 5BNOB 1O3RA 2ZGOA 3SMHA 2BDRA 1LGCA 5FYCA 3T0BA 4NHYA 2ILMA 2Y6KA 1Q8SA 2XVKA 2HWE1 3ZVXA 3E6CC 5HCHA 5T3NA 5DXDA 4DPNA 3U4SA 5K0UC 1DZQA 4NPRA 4FP2A 3UESA 5FUNA 2EIBA 3IB3A 1R1A2 3KCXA 3MLLA 4AEJA 4Q0QA 4GB32 4Y24A 1VBB3 2B5HA 1FV2A 4BMEA 3WNXA 1W8TA 3INAA 2ZPXA 1MS9A 2RR11 2ZOEB 4IW3A 4J6GA 4O9EA 4PI2A 4BWOA 2GC0A 2R071 3THTA 1EAH1 4PQ9A 4N43C 2H6CA 1Q5OA 1RC6A 3AM2A 1V6KA 3IPVA 3PUAA 1OI6A 5FRAA 4QU2A 4I0AA 4OI0A 2VUDA 3OUHA 5A3MA 1EV11 3EQEA 3W21A 1BYHA 4P08A 2P3KA 4PDWC 5CBLA 2P34A 1COV2 3C7FA 1U0AA 1CZTA 5GLTA 2UYBA 3BTXA 3LDKA 1GNYA 1UXZA 2JX9A 3C8XA 4FPJA 2WO1A 2R7EB 4HMZA 1C5HA 4FAHA 1QQP2 1X82A 4M3CA 2VQ0A 5K0UA 4AI0A 4CCDA 3V0BA 2TUNA 1WBLA 1RUI1 2E32A 2QQWA 4QGLA 2HEYF 3K2OA 1NE6A 2RJKA 3CL1A 1H6XA 5FZ8A 3ZDVA 1ULPA 3K4AA 3AVSA 3MLKA 4ZONA 1WLCA 3M3EA 1ZREA 3T2PA 3ECQA 1H30A 4Q26A 1UD1A 4OMDA 3HBZA 2QQNA 4NWVA 5FZBA 2YC4A 4N43A 4Q8KA 2GMMA 1LB2A 3ZYHA 3NW4A 3ITQA 1FYUA 3B5LB 3PMSA 5E88A 4PDWA 1W8HA 3H42B 5CZKA 4V2WA 4E8CA 5BV6A 5FXWA 1J84A 3AXDA 1YHFA 4K9SA 4QDQA 1WW5A 2QKDA 5BNQA 5CADA 2A6XA 2ZX0A 2XH6A 1FV3A 4MYEA 2LW8A 4ASMB 4CP2A 2G4IA 2W46A 3PVNA 5F39A 3I3DA 4IEUA 1POV1 3A23A 5C7GA 3R4DB 4IV3C 1MZFA 3CJXA 4NAMA 1YYNA 1AZDA 1H0BA 5L9VA 2CSGA 1F5FA 4IESA 4AW7A 1MZ6A 2ZABA 5E6HA 3WHTA 3PIJA 3BTAA 4O65A 4OHZA 3D6EA 3HIFA 1R082 4FPKA 4A7KA 5GZEA 5C4WC 1AR71 2OW4A 1PNFA 2DFBA 3ES4A 2E7AA 3AVRA 3MW4A 5FYMA 5LA2A 1UX6A 3AZZA 1Q8OA 3DYPA 2RS53 5D1IA 5ACA1 2PQQA 2XL9A 1XSRA 1PM4A 2BRTA 4ZZ8A 1WD4A 3O1RA 4FTSA 4XF0A 3ZLIA 2YC2A 3G7DA 1W0OA 2C0ZA 2WO3A 3WSOA 3MLJA 4WVWA 1LHWA 5LBEA 4YM3A 1AR82 1BJQA 1DLLA 1HV1A 2DCTA 3FFZA 2VE1A 1V6IA 1UMHA 5DAVA 5A3WA 3H0OA 3UYJA 1D7PM 1X36A 4IEOA 3RZMA 2IWGB 5IUQA 3POEA 1T6GC 1W6QB 5C4WA 2VUAA 4LBMA 1OA4A 4NJ4A 1VBE2 3BU7A 3VL8A 1SMVA 3VD7A 1Q43A 4LHKA 3C7EA 2D7FA 4CXWA 2BVVA 5A70A 5I0SA 4XJAA 3GBFA 5I0RA 3HEIA 1UCXA 2BJSA 2RS32 1ASJ3 1H2MA 2GH2A 2VUCA 3OSDA 4ZPIA 1LEMA 5CEHA 2JDHA 1MS8A 1W03A 2BZDA 1HXS3 1PGW2 4F3JA 4YZ5A 5KR7A 1JUHA 2Y64A 3KV6A 4Z8BA 3ZN6B 4MGKE 3JCIA 1W39A 2ZX2A 3H3UA 2XQXA 1FPN2 1ENSA 3JB4C 3T08A 5C8WA 3NV3A 2J1AA 3ELNA 4X8PA 4UW5A 5A33B 1GZWB 1MQTA 3CHXA 5KXCA 5ANQA 5GZDA 1V6OA 1BVVA 3H3ZA 1AHSA 4AQSA 1NE4A 5F2SA 2JB8A 3VUOA 1C4RA 1QJU1 2BNNA 3DPRC 3MYXA 5FXVA 4ZXEA 1Y4WA 4MO3M 2Q1ZB 5DZGA 1JZ5A 1AYN2 3VKLA 4AE2A 2OQ7A 1WMFA 2RVAA 3POBA 4LTAA 2XLFA 3ZKUA 4DO0A 5FYYA 5FQ0A 1Y9QA 1UOGA 1Z0HA 3MIBA 2YXSA 4Q2FA 3W9AA 4WM8B 5J96B 1WBFA 1VBD1 1OMIA 1YIPA 2ZHMA 2A6WA 4WZFA 5CYYA 4CA9A 1V0AA 3E5QA 1D4M2 4BQ5A 1JBCA 4BYYA 1JZ4A 4FPCA 2A7AA 3MF6A 1LNSA 1PMJX 1QKQA 4Y3OA 3ZSJA 3DL3A 3T1LA 4BISA 3O1OA 3GCXA 2DFCA 2GC2A 1PO22 1BBT3 2VZPA 5DAXA 2A6YA 1D4VB 4HSLA 2RDNA 4E2SA 3ORJA 2OUJA 5LY1A 1JZ6A 1PX3A 3OD4A 1X9TA 5CNAA 5K8SA 3DPRA 1OKQA 1N1SA 3UKTA 2JENA 3MO4A 4H2AA 2YBPA 5FXZA 2P1BA 1ENRA 4HXCA 3WD5A 4HKLA 1WW7A 5T55A 1QDCA 1NUKA 5C5TA 1RUG1 1KS4A 5IK4A 2J7MA 2VMEA 3FC0A 2Z2SB 2Z4FA 1RVF1 2AH2A 4UFKA 4H14A 3WX5A 4RA0A 1TME3 2WC2A 2XJTA 5F5AA 2ZZJA 2UURA 3FLRA 5A3TA 4GKXA 1OURA 4EROA 4Q4X2 1L7QA 2HBUA 3OY8B 2DCYA 5FZ4A 4DUWA 1GFF2 1HRI1 3CJIC 1UYPA 5FY8A 1UAIA 2NMOA 2P3YA 5FPBA 1O8PA 5ANNA 3KT4A 5HCBA 2AEZA 2PTMA 4ZS2A 1RUH2 3J4UH 3T2OA 1D0GA 1F31A 4LE4A 2VTXJ 3LEIA 4OLLA 5IAVA 3A21A 2ADEA 2PLV3 2AUYA 3JD71 2Q8OA 1ODMA 2G9FA 2V4VA 3LIHA 4DS0A 4Y5SA 1PO13 2ZS6B 5FZAA 4OI2A 4ONUA 1CAWB 5I0UA 1O4TA 4W8JA 4NR1A 3MDPA 1UU5A 1XQNA 1FMD1 4QB6A 1LHOA 5CA6A 4G3YC 5A7SA 3ZYPA 2PHLA 4AFBA 1O4ZA 4Y4RA 1CAXB 3CJIA 4AHXA 3QACA 3R0RA 4IV1B 4L11A 1RHI3 1I9RA 3AYCA 2N7GA 4JCKA 4R8HA 1O7FA 3OGJA 5FYIA 2WO7A 3VKFC 1YNAA 1SCRA 1H2KA 2QQJA 1ONAA 3TEWA 5H9PA 2XBO2 2YFUA 2FCUA 4CUAA 1OLRA 1QJX3 2AYHA 1GLHA 2XLAA 3UKVA 4LK6A 1QGLA 2PHXA 4QPGB 3MHZA 2Y8KA 4AFMA 4EN0A 5FY7A 3CZUA 1G9AA 1A3KA 1BKZA 2W68A 3NAPB 3U14A 1OC1A 4NO4A 3B69A 4GB33 4YG3A 5E89A 5DUVA 3RVHA 3USSA 2ET7A 3K4DA 3H8UA 3I2KA 5JSPA 1Z7S2 3FL7A 3VBUB 5LA1A 4IEWA 1RUE2 5IK7A 3TBDA 4KQ7A 3VZMA 3ZXAC 4U2AA 3KQ4B 5FLHA 5H9QA 4CU7A 3FFQA 3AP5A 4Q4W2 1G9DA 2WT1A 3WG3A 2HYXA 3M3CA 4YPJA 4K40A 1COV3 3HQRA 2CTVA 3VD5A 5DDJ2 1DF0A 2HWF2 4I2OA 3JQWA 3N9MA 2HLEA 5B4NA 1QXPA 5A7WA 1QQP3 2A73B 4XHXA 2QQIA 3VBSB 2JG9C 3HVDA 4LKFA 3SEPA 3LFMA 4UFLA 1AX2A 4BDVB 2YMZA 2AC1A 4CCCA 5FIXA 1W2NA 2AEYA 2R0FA 4UF0A 1FT9A 2WR9A 4AL9A 2IXKA 2ZHNA 2UWBA 3ILFA 4XFIA 3BALA 2WAOA 4D6RA 5FWJA 4Z1VA 3H8XA 3S5AA 2B42B 3TOJA 2D44A 1W8UA 4GH4C 4BK5A 4F7ZA 1NCRB 1S2EA 3POIA 3O1TA 1Q8PA 5C8CB 1FOD2 3N35A 5FXXA 4LO4B 3EHKA 1NG0A 1VJ2A 2BVBA 5JCTA 1YFUA 3WF3A 3WQ0A 3F95A 5BXXA 4QT6A 4UOJA 4L99A 1MS5A 3DCQA 2DBNA 2Q1MA 4N7UA 4MLOA 1MZEA 1PM7A 2QQPA 1L7LA 2WYSA 4IDZA 2Y0OA 5HBAA 4CDUB 5IJRA 2JG9A 1HV0A 1SLIA 2D3SA 2I2SA 4Z2AA 5KWRA 3BB6A 4YG0A 4XXPA 3TYJA 1DGRN 2R1DA 5CFDC 1AXKA 1HRV2 4GAZA 4B29A 4B4QA 3U0ZA 4MADA 2EXIA 1DQ4A 3RPQA 5LATA 2XJPA 1H8TC 1SPPA 1GKBA 4HPKA 1PZ9A 4XEZA 4GH4A 5JXJA 1GZCA 4QXHA 1R083 2P3JA 3LF7A 4J1XA 2AREA 1UYXA 4LE3A 1W8WA 1HIXA 2IXLA 4CYDA 3MIFA 4QPIC 5FZEA 1I5ZA 3RMYA 2PA7A 5F6KA 2RJ2A 4KNCA 3ZYBA 5TSWA 4I0BA 1NLSA 1JN2P 1R64A 2JICA 1N3PA 1SBDA 5LK5A 5AFEA 2XJSA 3HPNA 4AWDA 3IWZA 1XXNA 3CKHA 3S5QA 5T5PA 5JZGB 2VVEA 3E5UA 4DMIA 3VZNA 1XU2A 4FPHA 4YW7A 1AR83 4CU9A 4IEVA 5CFDA 2C5DA 2V5DA 2P37A 1O4YA 1IGOA 2GNMA 4BQ2A 1DGWA 1H8TA 1F9KA 1OA3A 4ATEA 3HQXA 3BN6A 5JOYA 1RL3A 4HVQA 3ZFGB 1ND3C 3AFGA 5IVVA 2XDVA 4QPIA 2BPA2 2FZ1A 2NQYA 1VBE3 4H7LA 4LUKA 4LO5B 4AGRA 2DUOA 2ZKNA 4GMP0 4A3XA 4EQVA 2HBTA 5L7OC 1LTEA 4EWAA 1SDDB 3H1MA 3GZUC 2C9KA 3WQBA 3IDCB 2O8QA 4DNYA 2ZEXA 2BBAA 3GGLA 1D2QA 3T3YA 3PU3A 1HN1A 4AK3A 1Q3EA 1XJAA 2RS51 4NN0A 2WSUA 1UOFA 1UU6A 1XBFA 4NAOA 2P6CA 1FPN3 2R30A 4OHVA 4LA3A 4LKDA 3KCYA 1JS9A 4RS5C 4BU2A 1O3TA 2WNUB 5FMDA 4KU7A 2PAEA 4QX8A 3HN1A 4IGQA 4OUMA 1VMFA 2VW0A 4LR4A 4BXSV 1I3HA 3KD4A 1ND3A 1RUF1 4JQRA 3IZOA 4XFHA 1W28A 5LBFA 3E1F1 2R042 3EYPA 2RMU2 4CDXA 3OG2A 5FZOA 4ET7A 4YZ2A 5L7OA 1J3RA 4WZCA 3NNMA 1BK0A 1MZ5A 2CDOA 4BIFA 4YM2A 1OHFA 3I3BA 5C3RA 2B7YA 5BNNC 5FK7A 3J8F2 1D4M3 2GDFA 3MIDA 2W1WA 2YU2A 3VBHC 3WDXA 3CO2A 4RD7A 2OQ6A 4AG4A 2K2SA 1GQPA 4RS5A 1PO23 1GSLA 1ASJ1 3VD9A 2VZOA 1CX4A 1LJ7A 2Y6JA 4YRDA 1FNYA 3SH5A 1LGBA 4Q5OA 1ZRDA 4LBOA 3KF3A 1OF3A 2RS12 4CXYA 2XONA 2B39A 1OLME 1X8EA 3T1MA 2WIIB 5FZIA 3LA7A 4FOVA 4RHV2 5CAZA 3I3QA 3VKNA 2EA7A 1SBFA 2VW2A 3IAPA 2JECA 1YCIA 3AJZA 1URXA 1W0PA 5F3EA 1CGPA 4OCTA 2IC1A 1OOPC 1W99A 2Z69A 5A7NA 2FMDA 3M70A 4P00B 3ZIWA 4TLFA 5BNNA 3HOBA 3UKNA 2ZGPA 4QGNA 1CAUB 4GJYA 3VBHA 1ULCA 3GM8A 4Q4X3 1CD3G 4NHKA 4MHUA 2ORZA 2RDSA 4PT6A 4XFGA 5EJZB 1RJ8A 3AC0A 4P9LA 4AVTA 2GALA 2VNOA 4YYOA 2EICA 5FO9B 2VOTA 5FP3A 1RUH3 1NZIA 1ZZ7A 1BBT1
chains in the Genus database with same CATH topology
1QJZA 1VB2A 4WVVA 3D0JA 4MVTA 3RYRA 4MXVA 5AVPA 4E4SA 1KDMA 2CWMA 2WL1A 1RB8G 2LTNA 2VUJA 1OOPA 4QQHA 4NHLA 1YI9A 2WNEA 4YZ4A 1MVQA 1DG6A 3M3OA 4FQ4A 1MEC2 1X33A 1AYM1 4TSVA 2XLGA 4Q4V2 1RUNA 3AMNA 3OF1A 1IS4A 3FMGA 2XWJB 3IIAA 2HWB2 4M00A 4XTMA 4UBGA 4CDWC 1VALA 5FOJB 2WS93 3ZXJA 5JVVA 4IETA 4BHPA 3AYEA 1TME1 2HEWF 2V09A 5GLZA 3AZXA 4LHLA 1RUC1 1VBC1 2H0BA 5K9YA 2XBO3 4XJUA 1DQ1A 3WHUA 4FPFA 1X7NA 3TN91 4YVWC 2R063 5FDBA 4CEWB 3SITA 4AVBA 2R6QA 4Y1ZA 1W6PB 2QDRA 4BOWA 4Q1RA 5AVAA 5BNPB 1PZ7A 4RQPB 2PLV1 3N7MA 4YZ1A 3WDUA 1YI7A 1Z7S3 4COZA 4CDWA 1RUE3 1QNWA 2VH9A 3MZHA 2ZKLA 4F83A 3B9IA 4Q4W3 1VIWB 1PGL1 2O1QA 1OSGA 4I01A 4LBKA 3LAGA 5DDJ3 4RL7A 4YNIA 4YFWA 4YVWA 1BMV2 2HWF3 5H9RA 1ZVFA 4JGYC 3W58A 3O7OA 4Q8LA 1NY72 4MGZE 4AI2A 2YZ4A 5H9SA 3IBMA 1VAVA 1A8MA 3I59B 3LOIA 3ZXEA 3JU9A 1BVP1 1YFWA 4G9SB 3AZYA 5J7MA 1DQ6A 1JUIA 1V6MA 4WVZA 4COYA 1R1A1 4EJRA 1OQDA 2WNVC 2VOVA 1FOD3 4GB31 4W6WA 1QXJA 1BK1A 1YFXA 3O12A 5J37A 2RE9A 3ENRA 2ERFA 4JGYA 4KU8A 2QZ2A 4AEMA 3VDDB 2WZR2 3MF9A 2H6BA 1CPNA 5SV5A 3TRSB 1DQ5A 1AXZA 1HRV3 1XRUA 4INDA 2OYZA 4BMBA 1JW6A 4EN6B 4B7KA 1KS5A 5JOWA 1AXYA 5A32B 3ZFEC 3MIEA 2WNVA 3H7YA 3IDBB 3B7MA 3WW4A 2R1BA 4ZU4A 4W65A 5GJ6A 1WD3A 4Q0SA 2AR6A 1AUYA 2DURA 3APBA 2W52A 4XF4A 2BUKA 5KC5A 4XQWA 2BFUS 5EV7A 1MS4A 3UK9A 4MH0E 4K20A 4J1WA 1VRH2 2W08A 2R0HA 3AP9A 1GR3A 3ACLA 3I8TA 1QJX2 3I2DA 4XE9A 4Y1VA 2NYYA 2V73A 2DVBA 4AFDA 3SCHA 3ZFEA 3MIHA 2BW8A 3VBFC 3WXPA 2YGLA 1QY4A 4KGGA 4L97A 2HKXA 1TMF1 1DYKA 1SCSA 2PAKA 1J3PA 3D4KA 1R081 3OYWB 3PHMA 1XNBA 3CU7A 1NOVA 4AVCA 3QLQA 4D7SA 2XWBB 4YW4A 1H4HA 4FPGA 2ZA9A 4CZSA 3RZZA 1C28A 1GZ9A 2XKPA 1FATA 1NCQB 3FE5A 3X29B 1LU2A 2Z79A 3VBFA 1AR81 1W6QA 1BCXA 4XBLA 2R043 4E4ZA 2MEV2 4HVRA 2RMU3 3WINE 1MS3A 2EVXA 3S7EA 2HWC2 3ZYGA 4I3PA 5LK7B 4CTEA 2QJVA 2XVLA 3FUOA 5D8AC 4WM8C 1DGWX 3J8F3 1DU3D 1VBE1 2BWCA 2NMNA 2YUEA 2JD4A 5LEJA 1H1AA 2LM3A 2EXKA 3ZSEA 4ITCA 3ZN6A 1GQGA 4HN1A 1S1AA 4XXAA 2RS31 3KGLA 4N9HA 5A33A 2ZX3A 4LBQB 1PGW1 4XYXA 2E7TA 3FWEA 4Q27A 2RS13 3C3VA 1B35B 1FPN1 2CGPA 4QPYA 4OHYA 3ASIA 3DV8A 1AVBA 4RHV3 3LCPA 4B4RA 1REDA 3N3HA 3S0MA 4I09A 5D8AA 4WM8A 1AYN1 4R52A 1UPIA 4W6XA 1N3OA 4Z07A 1ZZBA 3IM0A 5EYYA 2IFWA 1TE1B 2OUHA 2ZMLA 1MS0A 2OA2A 4ZXKA 1JXNA 5FOBB 2ZGQA 5AFBA 5IK5A 3WUDA 5JLVA 3TNQA 4GALA 3MW3A 1D4M1 3KSCA 1U5IA 4OVEA 4JC1A 2NM1A 4A2UA 1N3QA 2WT2A 4AGGA 1MQTC 1PIV2 4KL1A 2D6NA 3TWIA 3ZSMA 1AL22 1JHNA 1FNZA 2QUOA 3NV1A 4KWLA 5GALA 1MEC3 1DGLA 1SLAA 4Q4V3 3OJBA 3USUA 1GBGA 2WT0A 1APNA 4WM7C 2HWB3 2QVSB 2VW1A 2XHKA 2GNTA 4BH9A 3OY8A 2NZ9A 2E53A 3WG4A 4RGAA 4AGVA 4IV1C 1YO8A 2DTYA 2O8OA 4M3CB 2QNKA 4I30A 1R091 4IEPA 4Q4X1 2HYKA 5FTTC 1EPWA 4PLOA 3QH6A 1OD5A 2KM2A 2WQ4A 2ZACA 3LSEA 5JPMB 3GYDA 2A3XA 1UKGA 2ARXA 4Y5Z0 4RFT0 2DF7A 1ND2B 4IEQA 4JVAA 2VOWA 2ZGUA 3WP4A 1SLBA 1RUH1 3OGGA 4YGCA 4HVQA 1UIJA 1H1IA 1RUJ2 1CAWA 2PHDA 3LSDA 4N43B 1O3QA 2QDNA 3I7DA 2AGSA 2HWD3 3NAPC 5SV8A 1XE8A 3AMHA 2JG8B 2ZZQA 4WM7A 2ZGTA 3VBUC 3WP3A 3RQ0A 1ZX5A 4LBNA 4IV1A 2K9ZA 4R9CA 2YYOA 3AB0A 4XW3A 2BWAA 1QMJA 1CJDA 3HAGA 4AQ2A 4CRQA 5JWPA 1AR92 4DY3A 1RIRA 4IQPA 1XE7A 4B8EA 2OPKA 2BQPA 2WSVA 1WMDA 3H50A 3WDVA 2IXIA 4A7ZA 4AI8A 2XBO1 3V0AB 3KT1A 3AKSA 3VZKA 3NAPA 3WV6A 4AVSA 4Z92B 3KT7A 5AC92 2JJ6A 2ZTNA 4EWEA 3VBUA 3LOBA 1MR5A 1S0EA 1WCDJ 5C8CC 1RUD2 4YZ3A 3QH7A 2VMGA 3WUCA 4IV3B 3VBOB 2DV9A 2MPFA 1WCKA 4AVVA 2VOXA 4R4ZA 2ZGSA 1KFUL 4KWJA 4HANA 4KG8A 4N90A 4Q4W1 2ARBA 2Q30A 1WLWA 2D6KA 2WZR3 4DRVA 1ZRCA 3OCPA 1S0JA 5DDJ1 1NA1C 5GKAC 2HWF1 2CYFA 2XJRA 1CN1A 1M06G 2WQZC 2K0GA 3FZ3A 3THPA 4P9IA 3I54A 2YDEA 5J09A 2HJIA 2NP0A 1GYKA 2VNRA 1QH7A 3LA3A 4U36A 5C8CA 5JSRA 5CVRA 2VMHA 5IK8A 3WLUA 1ZRFA 2PHFA 5C33A 4YSFA 2GAUA 1BEV2 5DUUA 1LU1A 3R4SA 4BLIA 4LBLA 5C6CA 4GMP3 2PHTA 2WS92 1ZBA1 1FOD1 4PJYA 1KD7A 5JZGC 2ZGRA 3KM5A 4Y22A 1G9BA 1VRH3 1Y3TA 4I02A 1NA1A 3KZ4C 3NV4A 4R9AA 3P3PA 1ZZ9A 1LHUA 5I8YA 2FBEA 3M1HA 3VHNA 2R062 4FOYA 5GZFA 4C0HA 1CR7A 2BYVE 4HT1T 4Q4Y2 2XGXA 1REEA 3OPZA 5FQ0B 5BY5A 1N1YA 2A6ZA 4Y20B 3ES1A 1WGPA 2EXJA 3N7KA 5JOZA 4B7EA 2X5IB 1HRV1 1M4WA 4CEYB 5LRSA 1O3SA 4MXWB 3PNAA 1QOSA 1CONA 1HW5A 2LALA 2VNGA 1G6NA 1NLRA 2W0XA 5CFCB 2DCJA 5FMOL 5T50A 3E5XA 2RJLA 2PHUA 1V6NA 4BA6A 4Q29A 5JZGA 4FPOB 3AKRA 3RRDA 3DPRB 2C1FA 1RUG2 3BOWA 3ZIXA 4FOQA 2GNBA 1ULGA 3TNPB 4YVSC 4WVMB 4DZGA 2WNUC 4IEXA 1CAVB 1W6MA 2DCKA 4LO7A 3LWCA 2XB6C 5FLIA 3RI9A 1KXGA 1OFSA 1UN1A 2MEV3 4N53C 2HWC3 1IPKA 2R49A 1X8MA 5DZFA 4E4DX 4HKWA 5FFOC 5GZCA 2PAMA 4JDOA 1I6XA 3V56A 3LZZA 1VBB1 2XJQA 3LA2A 3RDIA 4HLTA 1S0DA 3LKJA 1W6NB 2ATFA 5KXEA 4R4XA 2GMEA 2ZAHA 4R9DA 4YVSA 2B45X 2WNUA 5ABJB 4FTEA 1PZ8A 1PK6B 2WWSA 5CG8A 1IZ3A 3MICA 3S7IA 4M3CE 4N53A 5GLWA 1YRZA 5L36A 3OD0A 2NPIA 4S2HA 5KHIA 3GBWA 3QD6A 3SLIA 2R041 3CJIB 3MPPG 3ZDSA 1GNHA 2I74A 4ZKTB 1GNZA 3DKWA 2H0VA 1W6OA 3S30A 3E97A 3VBRC 4COWA 1ZBE2 3ZSKA 4LBQD 3AFKA 3J8F1 4XF3A 4CDQB 1WCSA 1OFNA 5KHJA 3OBTA 3KMHA 4RR3B 1EAH3 4SBVA 5KHGA 4Q0PA 5KHKA 1NQDA 1PIV3 2JKBA 5KBFA 2FHRA 2WLPA 1RUOA 1AL23 4PIZA 3AP7A 4HBNA 4CP0A 1SBEA 2AENA 1LOGA 2RS11 1IQAA 1SDWA 4HSJA 2CL2A 4OFGA 2D6LX 4JRAA 1EP0A 3RNSA 4CDXC 1N1TA 3PVEA 5F6LB 3RS6A 1RUI3 3VBRA 4MGYE 1MS1A 3WDWA 5JIAA 4S2GA 4IERA 1IOAA 1UF2C 2ZHLA 4YG6A 2SBAA 3FLTA 5CG9A 3WW3A 1OPMA 4GKYA 2OVUA 3H1YA 4AEDB 4H3WA 2Z42A 3VZLA 3AK0A 4CEWC 5I91A 1XNKA 1F5JA 1RUJ3 4XQ4A 1QWRA 4MV2A 1YJLA 5BNPC 2X8KA 1QOTA 4BE3A 4RQPC 2A5ZA 3POWA 2KXLA 2D6PA 4HN0A 4XDQA 4BPZA 1YJKA 2W39A 4FSJA 2O0OA 1MEC1 1Y7BA 4Q4V1 3JB8A 2JG9B 2ET1A 3SCGA 3RWNA 2QCSB 3HR9A 4P5HA 4LBJA 1R1ZA 4QHBA 2VU9A 1AR93 3WP5A 3V64A 4CEWA 1HXS1 3AJYA 4HPKB 4GH4B 1W6PA 3WDYA 2WA3A 4MUVA 5GLVA 2QZ3A 5BNPA 3UJOA 1PVC2 1FX5A 4RQPA 2R32A 3PVOA 4QD2A 1QNYA 5JR7B 3ZXKA 5JAXA 5AC93 1WUVA 4KBBA 1DHKB 3R05A 2NLRA 2D97A 3MGUA 4XJ8A 3PTYA 3ROUA 4QXKA 1H4GA 1RUD3 1ULFA 4PIYA 3OTFA 2EAAA 4JGZB 3R4UA 3B02A 4NWWA 4YW2A 4D94A 4FTBA 3EJKA 3EBRA 3ILRA 2WJSA 5CFDB 4GWNA 4NVPA 4UW3A 3ZYJB 1HQLA 2D3RA 1OPOA 2OZJA 1H8TB 2RHPA 3VN4A 2XKOA 4O9GA 1KITA 2Z5WA 3I59A 3B01A 4K21A 4A7YA 1BMV1 5F1RA 5I93A 4MSVA 1NY71 4W6YA 1YIFA 4YARA 4PBOA 4JTNA 1DQ2A 2C9AA 4L9BA 5CIRA 4COUA 3ZYRA 4KG0A 3URFA 5FAXA 2JDZA 3VL9A 3AP6A 1MVEA 1AR62 5JSOA 2BNMA 3ZPYA 4YM0A 1BEV3 1WW4A 1L3JA 1OLQA 2QFEA 5CB7A 1RUF2 3UV9A 1HKDA 5DZEA 1C57A 5BNOC 2DVDA 5DG2A 1GV9A 3ZXGA 2XG3A 4HETA 3GBGA 1A8DA 4LUMA 4HVOA 4JV4A 4IL7A 4Q4Y3 2WZR1 1RMU2 3BODA 3PLQA 4DINB 1A78A 4FPYA 5E8AA 4P9GA 4Z82A 3RG0A 2XJUA 2HWD2 4BIOA 2YY1A 3P3NA 2EF6A 4X8NA 1PO11 3B93A 3HD8B 1V6JA 2YC0A 2F4PA 1S0FA 4ES9A 2E9QA 4RS5B 2GSYA 1H2LA 2D5HA 3ILNA 4N7IA 5BNOA 1UKRA 3VHOA 1RUG3 4M0HA 5A3LA 1CESA 2IFRA 2V5YA 4GMP1 4ISRA 1XYNA 2KA3A 5FCCA 2WINB 1RHI1 2P17A 3ZO0B 4JAAA 3JQXA 5F9TA 1CQ9A 5GZGA 4HZFA 1VRH1 3ZFFB 2I07B 4DY5A 2WZPP 1QJY2 4MGIE 1QJX1 5BNNB 1POV0 4R9BA 2UY9A 3D82A 4JDNA 4NHMA 3A0NA 3QOPA 4DB5A 1VBA2 2UYAA 3E6BA 4D69A 3M8LA 3ZXLA 3GZAA 3IN9A 4FBFA 5JDBA 1LULA 4KH9A 2RM22 2ZX1A 4P9YA 5KHHA 3POSA 1LKNA 4PF5A 1WLTA 4AF9A 1AYM2 2PFWA 2VECA 4RGGA 1C1FA 4M0NA 1COV1 1F2NA 1JYIA 1OOPB 4Q1PA 2EALA 3JBG2 4K1ZA 4B4PA 4XJZA 4KGQA 5FLJA 2VY0A 1QQP1 3SNMA 5KC6A 5E1RA 2F6BA 2ES3A 3KB5A 1KJRA 2Y0IA 2JXAA 1RUC2 2LUWA 5GLUA 1JYCA 2MEV1 4XIOA 2HWC1 4EN8B 1J3QA 1SQ4A 1G9CA 2CAVA 1AX1A 1K5MB 5DG1A 1ZBE3 3WT3A 2MNGA 5CU1A 1YUDA 3G6JB 1V9U2 1O5LA 2Y26A 2WKKA 4LBQA 2GMPA 1S0CA 4DXZA 3AXEA 2DYCA 4BZ4A 4XIKA 1C5IA 1A6CA 3NKGA 1NQJA 4C1XA 4K6BA 1AJOA 1C8M2 4H7MA 5FMOS 3KQRA 1OQ1A 5T5JA 4TWTA 3NO8A 3BOPA 1BQPA 3MIGA 3AZWA 1LOCA 2TBVA 3ZXDA 4IXLA 5FO7B 2B9UA 5FREA 4YVWB 3MFCA 2E51A 3FBYA 3OBRA 1B09A 3HWJA 2VPVA 3JUUA 5EXOA 1LOAA 2PHWA 3KCCA 3AMMA 1KRIA 3AKPA 1G9FA 3SH3A 4QQPA 4DQAA 1ALYA 1YFYA 2CAUA 1RJ7A 3ZN4A 2DVFA 3WG1A 1ND2C 1H8VA 1H1MA 1NXMA 1RTVA 2UY8A 4WV8A 5BYNA 2D6MA 5T5OA 4AHWA 3J9SA 1CJPA 1G86A 1YWKA 4D7YA 1PIV1 4TZDA 1AL21 4L8QA 5EJ3A 1LESA 4ZU5A 2JG8C 5L73A 1ULDA 1HDKA 4JGYB 2D40A 3NJZA 2CNAA 4P9JA 3WQ7A 4QM9A 3SH4A 5KXBA 1DGRA 3DGTA 1GZWA 4MZUA 2YROA 2CGNA 1ND2A 1UZZA 1IPJA 4FXGB 4FOWA 2WFF2 4OI1A 2WNVB 4XJ9A 1PVC3 2PHRA 4YM1A 3WCRA 5EZWA 1WMEA 1SEFA 1EYBA 1LOBA 1PGSA 1HQWA 1H9PA 3TAYA 5C9AB 2JG8A 3L2YA 4DRRA 5JMCA 1RUJ1 3VGIA 1V6LA 3O0XA 1KQRA 1N47A 2GU9A 1VB4A 2HWE2 1IHMA 3RSJA 4L2NA 1GANA 3WW1A 4EN9B 3B00A 1YXWA 3GHNA 4META 3VBOC 3FUQA 1O5UA 1UPSA 3VLBB 1J1LA 1TMF2 4FPEA 4C90A 2IXCA 1WW6A 3NSTA 2RR12 3ZFEB 2DVGA 2ETEA 4EN7B 5FPZA 2R072 4QMAA 1ZNPA 1EAH2 1PO21 1LCLA 4OHWA 3V0AA 1AR91 1ENQA 3KS7A 4Q0VA 3RYKA 1EV12 3AMPA 3RJRA 1FXZA 4WBBA 3SISA 1LR5A 3BCWA 4LHNA 3IPVB 1S2KA 1AR63 4EV0A 1ZA4A 5AC91 5DUXA 2AZ5A 1RUI2 4IV3A 1JH5A 3VBOA 1V00A 1RUF3 2D98A 4AHZA 1CIWA 4JTOA 2CV6A 1RUD1 5B2GB 5K0UB 3V0BB 2WA4A 1TNFA 4HK9A 4E27A 4IEYA 3VBFB 4HKOA 2ZCWA 3HMYA 1ULEA 3B94A 4SLIA 2G9GA 3O0WA 4YW5A 4QPGC 4C1WA 2SLIA 4HL0A 1QDOA 1RMU3 3HT2A 4YGEA 4ASLA 2YHJA 2X5IC 1UL9A 4CEYC 1H2NA 3D8CA 1AF9A 2BNOA 4PDWB 5LEKA 2A71A 2XVGA 3NVCA 3J26N 1OA2A 4V1PA 4AXOA 2DU0A 1CAXA 2DU1A 5CFCC 4Y1UA 2PELA 3ETQA 3M2MA 3ST7A 4YGBA 1LRHA 3M4FA 4XILA 1BEV1 4XFCA 3FJSA 3UJQA 4UW6A 2WS91 1AR72 1TQ5A 1Q8VA 3ATGA 1FI2A 1PHMA 4QPGA 3H7JA 3VBSC 3V65A 1KDKA 1XU1A 4Y20A 2GC1A 5ACA2 3QBQA 1QJY3 2VG9A 1HLCA 5D8AB 2X5IA 1UW8A 4CEYA 3R6SA 2R061 1VP6A 4MXWA 4YFZA 4ISQA 1TEIA 4Q4Y1 1VBA3 2BBVA 1RINA 1LHVA 1NCRC 4LA2A 4AVAA 2X29A 5CFCA 3QCWA 4XFFA 2JE7A 3L2HA 1Z7S1 1ZZ8A 1BZWA 1TNRA 3NKTA 4GULA 2RM23 4XOGA 1RUE1 1AL0G 3AP4A 3W59A 4B3NA 4PIXA 3D5OA 3FLPA 3ZN5A 4LEJA 1AYM3 1SLLA 4Y26A 4CDUC 4WVMA 1SLCA 3VBSA 4X6RB 2A3WA 3LB9A 1RITA 5ABJC 1PK6C 1CAVA 4TYSA 3AYDA 5C4WB 2D6OX 3JBG3 4F8AA 3ZXFA 3IMNA 4FXKB 3USUB 2VVFA 3GF6A 1BXHA 3ZSLA 1R092 1NCRA 1UZYA 1DIWA 1RUC3 1VBC3 1X50A 3DF0A 4RSUA 3TN93 4QM8A 1U5YA 3U4XA 1IS5A 1VAMA 3D0SA 4UBHA 5JI7A 1QJU2 1W6NA 4Y1YA 1IS6A 3ZMNA 2ZJCA 1V9U3 1UIKA 1MQTB 4CDUA 2FQPA 3IT8A 4CDQC 5ABJA 2A70A 1PK6A 3CNAA 4P9XA 4BLJA 3S6PA 1VBD2 4XFBA 4RR3C 1LECA 4MX3A 1DFQA 1PVXA 2VXRA 1WLDA 1C8M3 3AMQA 1HX6A 4WM7B 1DBNA 2ZBJA 4CP1A 3ZFGC 2CWSA 3ZX7A 4XBNA 3TB0A 1D0HA 1IS3A 2JE9A 4XHBA 3VV1A 2BGCA 2ZMNA 2GNDA 3M3IA 3CEWA 1IKQA 3SHRA 3O0VA 1J1TA 1V70A 2MHFA 4CDQA 3VHPA 3N4MA 2BFUL 1SFYA 1QH6A 1REFA 1ZBE1 1R1A3 4RR3A 1RVF2 5IT6A 2I45A 4AEDC 5J48A 1SACA 1C8NA 2CGOA 2PYTA 3IDEA 3K51A 1LHNA 3ZFGA 3MPBA 2EXHA 3FBMA 4I3GA 5FBZA 4AQTA 1U5XA 2IXHA 1HRI2 4GWMA 2P2KA 4JDMA 2IXJA 2GC3A 3U10A 4XF1A 4LT5A 4I0WB 1D2SA 3MEPA 1QU0A 3VZOA 3SXWA