4OYUA

Crystal structure of the n-terminal domains of muskelin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
MECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNYPPQYLILKLERPAIVQNITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHKIDEQMFPCRFIKIVPLLSWGPSFNFSIWYVELSGIDDPDIVQPCLNWYSKYREQEAIRLCLKHFRQHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Muskelin
publication title The LisH Motif of Muskelin Is Crucial for Oligomerization and Governs Intracellular Localization.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 47
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4oyuA00
2EIDA 3T0AA 5A1AA 2EIEA 3LQCA 2VZQA 2W3JA 4OZOA 3I2KA 3T09A 3A7QA 4QDQA 4BK4A 4PQQA 1NX9A 5C70A 4OMDA 1KEXA 2WZ8A 4XUPA 3C7OA 1F4AA 2YFZA 3IAQA 3C7HA 1JZ5A 1XNTA 5LA1A 1PMHX 5C7GA 1F4HA 4BJ0A 3VD9A 2VZPA 2VM9A 1W99A 3P6BA 1KGYA 3IIIA 4A4AA 4RN5A 2WAOA 2WDBA 3ECQA 4A41A 4OYUA 2WN3A 1NKGA 5C71A 2J22A 4GZ9A 2J1VA 4CUBA 2WABA 2VJXA 3VD7A 4FI9A 3HNMA 4MOAA 4A6OA 2VL4A 5JMOA 2XQXA 3ACHA 1UWWA 3UETA 2Y6LA 3ABZA 2VZ3A 3WNPA 2W5FA 4IUGA 4JKLA 2W9XA 2Y6GA 3VD5A 3WNOA 4Z2AA 4TTGA 3I3BA 3CIHA 3PUIA 4W50A 3MUZ1 4MGSA 2J1TA 5IJRA 4DUWA 3I2HA 3THDA 3EB7A 4QX3A 1GOFA 1JZ6A 2YB7A 1CZSA 1T2XA 2VOTA 4YPJA 4E8CA 2HLEA 3LEKA 4JKMA 3T08A 3K77A 5EIYB 3NQHA 2BZDA 5I0DA 3LEGA 2RVAA 5JXGA 3UESA 2VO5A 4DXRA 1UXXX 1O59A 1JI6A 3WEZA 2W46A 2RV9A 4P08A 3W5MA 3T2QA 2VZTA 3D3AA 2JDAA 3HNYM 3BGAA 3SKVA 4QAWA 2QQJA 3OGRA 3K46A 4XUNA 5DMYA 3LE0A 3ZM8A 2J7MA 3LPGA 4QB1A 1JYNA 3WQBA 5EJ1B 3CQOA 1ULPA 1W9TA 3SKJE 4DEQA 2VTFA 3OGSA 1JZ2A 1WCQA 3CMGA 3GDBA 2ZEWA 2Y6JA 1H6YA 1W8OA 3OEBA 3C7EA 1W8NA 3WNMA 2CDOA 3VD3A 2VZSA 2WBKA 5B4NA 1CX1A 4JHZA 1JHJA 4A44A 5B4XA 3WSOA 3ACGA 1JZ4A 1W9SA 5CZKA 4KMQA 4CU9A 2ZEZA 2ORZA 4CUCA 4TXWA 1UY4A 2J1EA 2OKXA 3VDCA 1PX4A 4OMCA 3FL7A 2KD7A 4BXSV 2J1UA 3NJXA 4CVUA 3NRUA 1OH4A 3LPFA 1GOGA 1UYZA 2DCKA 1MPXA 1DLCA 1W9WA 3IAPA 1HN1A 1XC6A 3I3EA 4AG4A 3F2ZA 4A3ZA 4D0QA 2V4VA 2YG0A 3C7FA 5J1XA 1UYYA 4M4RA 3WF4A 3J7HA 4QDSA 4UAPA 3CDZB 3DYMA 2VZVA 4GWJA 3CZJA 3DYPA 4XURA 3SEEA 2W1SA 3OBAA 3MO4A 2WN2A 1YQ2A 2CDPA 3ETPA 2VCBA 2W92A 4XUOA 1GQPA 4KWUA 2LW8A 2VMCA 2J1AA 3DECA 1CZTA 1GNYA 5IHRA 4PF1A 2BGOA 3A22A 2ID4A 2J1SA 2JD9A 2EICA 4MADA 1XPWA 1UMIA 2VCAA 4AAXA 4QDRA 1L7QA 1IQDC 1UY0A 4CU7A 1K42A 4QX1A 2LS6A 2C26A 2DCJA 2BBAA 2BERA 4P02B 1US2A 2VMDA 1SG3A 3K4DA 5F7UA 4XZUG 3W5NA 3OB8A 2C9KA 1J83A 1LNSA 3T2PA 5JXJA 2WUHA 1OT5A 3FN9A 1UX7A 2V72A 3AC0A 2EIBA 2VMEA 5IFTA 5LA2A 1UY1A 2Z4FA 1JZ8A 2X10A 1JU4A 1UY3A 5HXMA 3WF0A 2C4XA 2Y8KA 2WO3A 5IYYA 1OF4A 1K3IA 2Y6KA 4ZY9A 5DN2A 4ARYA 1GMMA 4W4ZA 1UY2A 3VD4A 2E33A 3ACIA 3WF2A 4CUAA 2WAAA 4KI5M 3GXUA 1ULOA 4ZZ5A 2W94A 5JXIA 1R64A 3I2IA 4QPWA 3CKHA 5CYYA 5G05L 2HYXA 4QB2A 4BDVB 3T0BA 5JUVA 3SEPA 1K45A 2ZXQA 4LKSA 3THCA 1JZ7A 3WF1A 3I3DA 4ET7A 4DXTA 1TVGA 2QQIA 5DPNA 4DXSA 2WQ8A 3GM8A 2VZUA 2W1QA 1OF3A 2QQOA 2VQUA 2Y64A 2Y6HA 1UYXA 2L9LA 5G04L 3GGLA 3MBWA 4QB6A 3HNBM 3WNKA 3K75B 3WNLA 5EJZB 4RYDA 4MO3M 4QX2A 1P8JA 1OD3A 2R7EB 4XUTA 2WO1A 1JYXA 2VR4A 2QQKA 4BK5A 3T0DA 3DYOA 3WNNA 2VZOA 3ACFA 4UI9L 3C7GA 3I97A 2QQMA 3IDAA 3MV11 3OGVA 4HG6B 4LQRA 3JXSA 4CU8A 5LA0A 1CZVA 1JZ3A 1UXZA 3A23A 2VZRA 2J1RA 1D7PM 2YC2A 3MUY1 5FUIA 1O8PA 2W95A 3I2FA 4DEVA 4DUVA 3CZUA 2JKXA 3EYPA 4JKKA 4L0PA 1SDDB 3C8XA 2W1UA 2XOMA 3VDBA 1WKYA 4LPLA 1JYVA 3HEIA 1GOHA 2QQNA 4UOJA 1DYOA 1XNAA 3FHQA 3NNGA 4D8MA 3IB3A 2PQSA 1JU3A 3FHAA 5JR2A 2B4KA 2W91A 4M4PA 3WF3A 2DDUA 3A21A 5IFPA 4JX0A 1UZ0A 2XHNA 1W0NA 1GUIA 4ZXEA 3T2OA 5JXHA 2QBXA 4PT6A 1DP0A 2YC4A 1PMJX 3BN6A 2V5DA 1PX3A 1BHGA 4DUXA 3HN3A 3PUHA 3K4AA 2ZEXA 2E32A 3OG2A 3HJRA 2X05A 2WZEA 1CIYA 2ORXA 4E8DA 2XONA 4GWIA 2W87A 2VMFA 4LHSA 5DQ0A 2E26A 3VDAA 1EUUA 2VQTA 4P00B 1O8SA 2W47A 2YFUA 1NAEA 5LCWL 1K12A 3I2GA 4P5YA 4XVHA 1SHWB 2W1WA 4OUEA 2WYSA 3MV01 1EUTA 1GU3A 2QQLA 3HPNA 2RJ2A 3P1IA 2X09A 3E1F1 4MGQA 4QX0A 2VC9A 4ZZ8A 3K4ZA 5HPOA 2VZ1A 1H6XA 1US3A 4W8JA 1I5PA 3UNPA 3OEAA 2ZEYA 3I2JA 3U37A 4A45A 2E31A 3HOBA 1TG7A 4A42A 2WO2A 4ARXA 4CU6A 1JYWA 1J84A 1RYYA 1UMHA 2BGPA 3NJVA 2B9VA 1NUKA 2JE8A 4XUQA 3LEIA 2VCCA 1L7RA
chains in the Genus database with same CATH superfamily
4H7LA 5J36A 4Q4X3 5A1AA 4MUVA 3USUA 4COZA 1Z0HA 5FZ4A 1Q5OA 4GMP3 1HRI2 2WIIB 2ZGTA 3I2KA 1RUH1 4EWDA 1Y9QA 1YFUA 1DQ1A 3WCRA 2VE1A 2ZMNA 1ENRA 1CQ9A 2JDKA 3KF3A 1MACA 2RG4A 3FC0A 4CP0A 1APNA 1EV11 1GV9A 2GP3A 5C70A 3H9AA 4FTEA 4YZ5A 4GKYA 1W8FA 3BPZA 4LO7A 1CAVA 1HV0A 1JZ5A 1XNTA 1N3QA 1ZVFA 3OUHA 4Q4Y1 3WDVA 1RUF2 4JTNA 4PI0A 5KHIA 4FPJA 5LA1A 1M06G 2XR4A 2OUHA 3VD9A 1PGL2 2OA2A 4GB31 3VZLA 1SLBA 4BU2A 3BUCA 3AYCA 1GWKA 3BYWA 4YG0A 5LBCA 4A4AA 1AL23 4RN5A 4O65A 3AMQA 3Q8BA 4Y4RA 1OQ1A 3ECQA 1E5HA 2GC2A 3GZUC 2J22A 4CUBA 2VXJA 2WABA 2VJXA 4HETA 1YC61 1LU1A 4MOAA 2YC0A 3K2OA 4A6OA 5JMOA 2WRAA 1KFXL 3MHZA 3NO8A 4EV0A 1VBB2 2YBSA 1RUG2 1W9FA 4ZPIA 2VZ3A 4IUGA 3PIGA 4JKLA 1GP6A 4M00A 3Q9OA 4PLMA 4Q4X1 3WNOA 4Z2AA 3QH6A 3ASIA 4GMP1 5GM0A 3RNSA 1KRIA 1V6LA 2E6VA 4M3CF 5C3QA 5BYNA 1QJY2 1AYM3 4KBZA 1GZCA 2J1TA 3OY8A 4DUWA 1A3KA 2Q5TA 3IIAA 4JRAA 3V0AB 5H9PA 1H2KA 3LEMA 1I9RA 2Z42A 1C8M2 1HRV2 4RR3C 1T2XA 2XKPA 4X8PA 2R32A 3JD72 4E8CA 5HXVA 3LEKA 4N9IA 4JV4A 1FI2A 2QKDA 3VZKA 5I0RA 2XWBB 1BK1A 4CDWB 3FLPA 2RM22 2HYKA 1AR72 4NRMA 1AL21 5I0DA 1AJOA 3WUCA 3OD0A 3OGJA 2CV6A 2E51A 1V6JA 1MS1A 1U5XA 2JWPA 1QQP2 1SMVA 3E5QA 1O59A 5FMOL 2I07B 2I2SA 2ZKLA 3HBZA 3WEZA 2W46A 2ZHNA 2RV9A 3DKWA 4P08A 3VDDB 1H2MA 1R1ZA 4WZCA 2WKKA 5F32A 2OZJA 3M1HA 4RQPC 1HV1A 5F5AA 4OULA 2BNNA 2TEPA 1TNRA 1ULDA 4INDA 1EAH3 4RD7A 3NSTA 3O1UA 5HBAA 2JE9A 5EZWA 3RJ2X 2R30A 4QPGA 4XUNA 4BISA 4LK7A 5DMYA 3ZM8A 2W52A 2Y0IA 3LB9A 4OI0A 4XPVA 5BNNC 5A3OA 4IXLA 2WNOA 3AZWA 2XLGA 1BMV1 2BWAA 4B4RA 4AW7A 1AYM1 3NJZA 5CEHA 2XJSA 1OOPA 4AVAA 2DYCA 4IE6A 5EJ1B 2UY8A 4F8AA 2IZWA 5FYCA 1YCIA 1RUC2 3CJIA 4HK9A 3OGSA 4NPLA 1WCQA 2XUMA 3CMGA 2OXBA 3GDBA 1JODA 5A32B 2DURA 1FPN3 2ZGSA 4QGNA 3I49A 4PIZA 2NN8A 2XQRA 4GH4A 3TEZA 1W8OA 4LIVA 4PQ9A 5FK8A 3T1MA 1ND3B 2QQWA 1OLQA 5KR7A 2CDOA 2VZSA 1X9PA 2WBKA 1PGSA 4JHZA 2E53A 3AKPA 1QDCA 2PHTA 3HQXA 2UWCA 2VQAA 5CNAA 5FYZA 2QUOA 1UOJA 3ACGA 4AFAA 4FPLA 4XCAA 4KMQA 4AEJA 1W2NA 2CYFA 4ZU4A 3IWZA 4OI1A 1AUYA 1C57A 2ZEZA 2JIGA 1CAXA 2ARBA 1UY4A 3K3OA 1F2NA 4CCDA 1J3QA 3GBGA 1SBFA 4R9BA 4CP9B 1EAH1 2RDNA 3ZFGB 3FL7A 1ZA4A 5L19A 3BKZA 1DIWA 5C6CA 4XACA 4Y26A 3BU0A 3LF7A 4K8RB 3NKTA 3NV1A 1ND2B 4YRDA 1RGSA 5A7OA 1UQXA 2CHHA 3MW4A 5FUNA 1PGW2 1YI9A 1OH4A 2PFWA 1GOGA 1MPXA 2PLV2 3GZTB 3UV9A 4JRLA 4GJZA 2VY0A 3NAPA 2XXZA 5I0TA 4RHV3 3MZHA 1COV3 2ZACA 3IAPA 4MXWA 2ZS6B 3I3EA 1HN0A 1QJFA 3F2ZA 3FE5A 4GAZA 4D0QA 2V4VA 1ODMA 2ES3A 2YG0A 4FO9A 2FCTA 2ZOEB 4M4RA 1Q8QA 2AR6A 1JUHA 1DDLA 1FPN1 4XFAA 2P3IA 3AK0A 4QDSA 4Y3OA 4LO5B 4PDWC 5F3IA 4A7YA 4K8FA 5HCBA 1C1FA 1GR3A 4V2WA 3W59A 3DYMA 2VZVA 4AEDA 4QPYA 3ZDVA 1QU0A 2W2IA 5IVEA 3IN9A 1YQ2A 1MS4A 2CAUA 1YFYA 4XXPA 1NA1A 2CSGA 4FXKB 3ETPA 5D1IA 1EYBA 2VCBA 5IWFA 4XUOA 3U0ZA 5A3TA 4HVRA 4Q1RA 1CVNA 3SH5A 3T3YA 4FAGA 4X6QB 4LUKA 1DYPA 2IXLA 1FYUA 1VRH1 2JX9A 2OPWA 4ASKA 1RUE3 4QU2A 1JOBA 2GMMA 1HQNA 4AXOA 5A3LA 3I7DA 3KV9A 2CWSA 3ZR5A 3A22A 2JB8A 2FDHA 2ETEA 4CXYA 1N1VA 1UIJA 2J1SA 3VBHA 2JD9A 4KGQA 5A6YA 1OA4A 4IETA 1QWRA 1K42A 1IQDC 2R042 2ZX0A 3EHKA 4CU7A 3SQOA 1W6MB 4RHV1 1COV1 3PNAA 3VHNA 3PURA 3D6EA 5FYBA 2ILMA 4FT8A 4UYBA 3RWKX 4BMEA 4ZONA 1SCSA 1SG3A 5L36A 4RS5C 3NV2A 3ES1A 4KQ7A 5A33B 3OCPA 1J83A 5FZ9A 1PO22 3T2PA 1WD3A 2V73A 5LEJA 1ULFA 5DUXA 4IW3A 1OT5A 1ASJ1 1VBC3 1BLZA 5CIRA 2EIBA 4AI0A 2WQ4A 5LW9A 3OOXA 5IFTA 3ZN6A 1XYPA 4XABA 3GYDA 4GA9A 1S2KA 1ZZ6A 4JGYC 1O4YA 3WDTA 4LOSA 2C4XA 2Y8KA 3D4KA 1MR5A 2CGOA 2RS13 2WO3A 5LY1A 1YEWA 1RB8G 1RTVA 1SQ4A 1S0BA 2QE3A 1RUE1 2WT0A 3AP4A 4DY3A 3ELNA 5F3GA 4EJRA 5JPNB 1SLAA 2FDJA 4DOUA 5FZ0A 1UOBA 3UKTA 2QQUA 2QQPA 4NIIA 3SITA 2ZHKA 3GCWA 3WF2A 5I8YA 4ASMB 4FFFA 2D97A 4KI5M 4YM3A 3B3QE 3DL3A 4FPCA 3DEMA 4HPKB 3DPRB 1NCQB 1ULOA 5F5IA 1ND3C 3OYWA 5A80A 1PK6B 2D6PA 4CPBA 1H1IA 1ENXA 4WM8B 2W94A 5LWBA 2Z5WA 4XBLA 2G19A 1H8TA 5EP9A 5CYYA 1W9YA 1QGLA 3O1VA 5FPBA 1SBDA 1WCUA 2I45A 4BQ5A 1IKPA 1JUIA 4Y22B 5BNPC 4FPKA 4HZFA 5JWPA 3T0BA 4BH9A 2Q8OA 1PZ9A 2G1MA 3SEPA 5JUVA 1V6IA 4XQDA 4ONUA 3THPA 3THCA 4AYUA 5CG9A 1VP6A 1JZ7A 2XVLA 3L9JT 4QHBA 3WF1A 5FZIA 2ARAA 4XILA 3ZYHA 2WZR3 3HAGA 1VBC1 5C9AC 2D44A 4Y20A 1IS4A 1VIWB 3E6CC 3USSA 4C90A 2YMZA 1XYOA 1NY71 4FOYA 4S2HA 5JLVA 1QNWA 4W65A 2Y64A 2VQUA 4QKNA 4R8HA 4AEKA 4EZHA 1JYTA 3BTYA 4D6RA 2UWAA 3RPQA 4A3XA 3GGLA 3MBWA 3B93A 5DDJ2 1ZZ9A 2RS11 4HT1T 3RZMA 1DGWA 5IUQA 4AFBA 3WD5A 3T30A 2GU9A 4QX2A 2BFUS 2K9ZA 4XF0A 4B29A 1OD3A 2WWJA 3CJXA 2GNDA 4AGRA 5ABJC 4LE3A 2VOVA 4LO8A 4OFGA 4BK5A 1NZIA 3SMHA 2A7AA 4F83A 4LBOA 3U11A 3R4SA 3ACFA 4FTBA 3H1YA 4NROA 1MZFA 2QQMA 4Q0SA 4Q4W2 2ADDA 1W2TA 2PA7A 4R9AA 1W0PA 3VBRB 3WY6A 4CCOA 1ZZBA 4XFGA 4CU8A 5FPXA 3VBUA 1J1LA 5I0SA 3U4XA 3T1LA 2HWC3 5F2SA 1PVC3 1R1A2 1TMF3 3AP6A 3O12A 3HR9A 1SPPA 3LIHA 2YC2A 1GZWB 2YPJA 5FP4A 4FP3A 4ATEA 1D0GA 3VBFB 2JJ6A 2OYZA 2IVIB 1J58A 1VAVA 2EAAA 1GWMA 1D0HA 3GBFA 4CCCA 5A7WB 1POV3 3IPVA 1DG6A 4DB5A 4DEVA 2WZR1 5FUPA 4IEOA 3CZUA 3PHMA 1YQ8A 4R4ZA 4L0PA 1O3TA 4EN9B 1FNZA 4LMFA 1CONA 4B7EA 4E4DX 2XKOA 4AQSA 1S0FA 2HWB2 5FZOA 3VDBA 2VU9A 2XG3A 4DNYA 5CVRA 1AXZA 4EN6B 2Z69A 1VR3A 3NNGA 2B9UA 4ZU5A 5L9BA 1JTZX 4BQYA 1JU3A 3VBOA 4QXBA 1DQ5A 2RMU2 2A5ZA 3VKMA 1VBD2 3B01A 2OT7A 1HQLA 2ARXA 4UW4A 4YM1A 4YZ2A 2YDEA 3N9MA 3BIWE 2HWF3 5IT6A 2TNFA 1LOFA 3OBTA 4BLJA 3GJBA 4PCRA 2XHNA 2ADEA 1H2NA 5EPAA 4FPYA 1ALYA 4A6SA 2VAUA 1VMHA 4FPEA 4LBJA 2JG8C 2Q1FA 2GZWA 2HWC1 5FR3A 1DP0A 1PVC1 3DV8A 2E7AA 1TMF1 2FDIA 4OQ8A 3NL1A 3N35A 4XW3A 5K8SA 3LSDA 1PMJX 3BN6A 5F3EA 2KXLA 5FCCA 1ZBE3 4DUXA 4CDUB 2X53S 1UKRA 2B7YA 1XQNA 2E32A 2ZEXA 4IGOA 4TLGA 3V56A 3AKSA 4AR2A 4OVEA 2ORXA 4N9HA 3V65A 2WNUA 4KBBA 4CDQA 1VE0A 3DN7A 1XU1A 4Q8LA 3VV1A 1GNZA 1K5JA 5DXDA 2BBVA 4XIKA 3ZFFA 1DQ0A 4P9JA 4JDOA 2E26A 1OPOA 4LT5A 2VQTA 5A6XA 3HT2A 2A6ZA 2W47A 4D7SA 2YFUA 3AKQA 5BXXA 4ISQA 3R6SA 1QXPA 4XDQA 4XOGA 5FZCA 5A70A 5L7OB 4CDXA 2D6MA 4W6YA 2NMNA 4WM8C 3JUUA 5FLJA 2W1WA 3WCSA 5ISLA 3UL2A 2HWF1 2PHLA 2WNVC 1EUTA 2LALA 3AYEA 3L2HA 2JDNA 1FMD2 3UKNA 2DVBA 2B45X 3T4HB 1YI7A 4MGKE 5ACA2 1WMDA 1JXNA 3ZXAC 1Q3EA 2X09A 3EMRA 4XFIA 3BI3A 2YGMA 4N53B 4NHKA 4FQZA 4AWDA 5FPAA 5JXGA 3N9OA 4ZZ8A 3K4ZA 3IZOA 3ZO0B 4QPIC 5HPOA 2PHWA 4W8JA 2W0XA 2NPIA 2CAVA 1RXFA 2D6KA 3NW4A 4HKLA 1ZBE1 4DRRA 5GLZA 3I2JA 3U37A 3KV5A 1VBE3 2DU1A 5T52A 2XJPA 1VB2A 1BZWA 3AYAA 4A42A 3WG2A 4ARXA 4AHXA 4CZSA 4CU6A 1JYWA 3KM5A 4MV2A 3S5AA 1MEC2 1PMIA 2BNOA 3ZXFA 4YVSB 1IHMA 2B9VA 1I3HA 5C8WA 1XXNA 5C4WB 4CYDA 2EIDA 3T0AA 4WM7B 2QDRA 2VZQA 3TBDA 1XYNA 4BM8A 1FXZA 2AEZA 3KV6A 3VBRC 3T09A 3J8F3 3A7QA 2FQPA 3J26N 1OC1A 1VRBA 4QX8A 5T55A 3LDBA 4PQQA 4QHOA 5A7NA 2XJQA 5FP8A 1URXA 5A7PA 2DCZA 4HXCA 3F95A 4UBGA 5FZ3A 1HRI3 1Y7BA 4XUPA 4URAA 5I93A 5LRRA 5E89A 3IMMA 4XCBA 3PUAA 4YGBA 3VBFC 5IK7A 5FKBA 3POFA 5C7GA 3ZMOA 5K0UB 2VZPA 3LZZA 3OSDA 1W99A 3T2TA 5JOZA 1LOEA 4NAMA 1VMJA 1UOFA 3VZOA 1KGYA 1IG3A 5GLTA 3EXUA 5CFDB 1YO8A 1AR93 1XB9A 3OUIA 4CUGA 4A41A 1MZ5A 1KD7A 4HKWA 4AI3A 1NKGA 1VBE1 3BB6A 4XQ4A 4JVAA 3CHXA 2VUCA 1H9PA 1H9WA 2OIIA 3MW2A 4FPHA 4XETA 4N43A 4IV3C 4XFBA 4NIHA 3WR0A 1WCDJ 4HK8A 2C5DA 3ACHA 1RMU3 1UWWA 5BPXA 4R4XA 3RZHA 4BIOA 2Y6LA 2YHJA 4Z8BA 3WNPA 1RUI2 2NZ9A 3EBRA 1HXS3 4XC9A 2SLIA 1EPZA 2Y6GA 1WW7A 2RS33 4Z1VA 4PIXA 4YW2A 1HB3A 1W6NA 2WR9A 3PUIA 4P14A 4AL9A 4NN0A 3ST7A 1EPWA 4HVQA 1LJ7A 2JICA 3E97A 2YXSA 3J8F1 2AZ5A 4I09A 1OH3A 4JDNA 2RDSA 4FCAA 4Y5Z0 3I2HA 2OUJA 3EO6A 5FJKA 5D2AA 5FZLA 4A7KA 5FYMA 2RDRA 4L8QA 1HRI1 2VMHA 4QX3A 1BEV2 2D98A 4ZHNA 3CO2A 1CZSA 4G4FA 2R49A 4YPJA 5BNOC 2HWE2 4XTMA 2PQQA 3B7MA 4UFIA 4JKMA 5JSOA 4I0WB 3O0WA 4HONA 4O9EA 2YBPA 1STMA 4EE2A 2J42A 1FT9A 3WOGA 3ES4A 2ZKNA 5L73A 3JD73 3VBSB 4NIDA 2K0GA 3IM0A 5H9SA 1Z78A 1AR91 1F8VA 3DGTA 1WLTA 5AVAA 5KC6A 2GC3A 5DZGA 1AR83 4XF3A 4Z07A 2XL7A 4XZPA 3TN92 1G9DA 1MQTB 4S2FA 4L11A 2RR12 5L7OC 3KCXA 2ZGOA 5CADA 1RMU1 1ULEA 3MYXA 1RL3A 4ZU7A 3VL8A 5C3OA 1ZREA 5LBEA 2ZCWA 4YVWC 2YGLA 1HXS1 3OGRA 1PHMA 1HDKA 1XNBA 2RS31 3ZXLA 2YPDA 3WXPA 3N7LA 1V00A 1K5MA 2Q0AA 4XMIA 5DUWA 5JZGC 4HL0A 2BYVE 2FZ2A 4BXFA 4CEWA 1LEMA 1HJFA 4GMP0 3ZDSA 2JG9B 2LRPA 5CAZA 2VBDA 4GD4A 2FZ1A 2TBVA 3ZYGA 1S0EA 4DEQA 1JZ2A 1V9U2 2BP6A 1QJX1 2WWSA 2Y6JA 3LFMA 2KA3A 3RSJA 1J3PA 3OEBA 3O1RA 4KNCA 4UW3A 1NCRA 5B4NA 1OPMA 3JD71 1GP5A 1OLRA 1JHJA 1SLLA 4O9GA 4C0BA 1C5HA 4LBKA 4QKDA 5B4XA 4EWEA 5A7QA 1OBNA 4M0HA 4ES8A 1AR81 1MVEA 2BU9A 4WM7C 4Y1XA 1N1TA 1W9SA 1JZ4A 1DGWX 2UWBA 4XTPA 1VAMA 5IVFA 1V6OA 3MF9A 3ZSLA 5JR7B 1ULGA 2PAEA 4XJAA 3OUJA 3ZFEA 1J1TA 1JOJA 3AM2A 4CSWA 5C8CA 4GWNA 4META 3C3VA 1W6OB 4Y1UA 2VGDA 2Q8DA 4UFHA 5GZFA 2KD7A 3BODA 4BXSV 4K1YA 1AYN3 2HWD2 3WW3A 4ORFA 1DGLA 2X5IA 2PHDA 1WZXA 5FYVA 4C91A 4CVUA 2OW4A 1OI6A 4OCTA 5K0UC 3L2YA 2PTMA 2W39A 3H3UA 1KDMA 3M4FA 1L3JA 2HH9A 1IQAA 3HIFA 1GICA 3ZXGA 4A3ZA 4CCLA 5CFDC 3N9QA 4Q2FA 4M3CA 5J1XA 3VZMA 2YU2A 4RL7A 1Y9MA 2K46A 4W6WA 3WF4A 1MS9A 3UGFA 4BMBA 1LTEA 4M0NA 4MHUA 4PDWB 1LOBA 4GWJA 1ST8A 3CZJA 3ZR6A 2QVSB 3DYPA 3KF5A 4XURA 4QX5A 4I01A 5H9QA 3DUIA 3MO4A 3N3HA 3GBWA 4E4HA 4Q4V2 2CDPA 1UU5A 2ZGLA 1REDA 4GULA 2B5HA 2FBEA 4ISRA 1CAWA 5FMBA 1UU6A 2W92A 1S0JA 2LW8A 4D3WA 3TWIA 1KQRA 2VMCA 4YW7A 3AMNA 5E1RA 5FOBB 4BE3A 1TE1B 1GKBA 1QOTA 2X29A 4IE0A 1QJU3 3DECA 4AGVA 4YLZA 1OSGA 4MHRA 5C3SA 4PF1A 3V0BB 1E5IA 1PIV3 3S7EA 5DABA 2YV8A 1CAUA 1DZTA 2BEOA 1AYN1 2ID4A 4KH9A 2WO7A 3MEPA 3TEXA 1YQ5A 4L9BA 3BTZA 2VCAA 4AAXA 1RUOA 1L7QA 1OVPA 4E27A 4YARA 4AVTA 1WBFA 5KHJA 4XJZA 4Y5TA 3MI8A 2BBAA 1BBT2 1ZBA3 2AUYA 4IEWA 3DKQA 4NHYA 5CKMA 3VBSC 1US2A 2XBO2 5CFCA 1N47A 2VMDA 1POQA 2XLFA 4YSFA 1NQDA 4XZUG 2PAKA 2R043 2Y38A 2UYAA 4AQ2A 2C9KA 2WL1A 2WFF2 3I59B 1LNSA 1MQTC 1QNYA 4RS5B 5LK5A 1JOPA 3WP4A 4B8EA 4PHZA 4RR3A 4FSJA 4GALA 1AR62 1WA4A 4OHZA 2EXKA 4WVMB 3HD8B 4KWJA 5FXZA 1N1SA 3ALQA 4QM8A 2YY1A 2VMEA 2O8OA 3VKFC 1LOCA 1LHUA 4WBBA 1YJKA 1DGRA 1GQHA 3POJA 4GIQA 1JN2P 5A1FA 2C6SA 3H8RA 1IOAA 1UY1A 1JZ8A 4MGTA 4QXHA 2AYHA 2VNOA 1KFUL 2BPA2 1W03A 1Q8OA 4KU8A 3MGUA 3I3QA 3PMSA 3WP6A 2H6CA 4IESA 3WQ0A 4JGYB 2JG9C 1CIWA 4XFHA 1QJU1 1CESA 1RUH2 2BRTA 3FJSA 4BIFA 3HBKA 1PM7A 4RQPA 1PIV1 3KT4A 3VD4A 1OVSA 2CTVA 2CGPA 5K9YA 4QQPA 1DQ4A 4MLOA 3M70A 4C1WA 3CJIC 4U36A 4LHKA 5EQUA 5BNNA 1UW8A 4Q4Y2 2P6HA 4N7UA 2C9AA 3AXEA 5JXIA 1UKGA 1YUDA 4YYOA 1R64A 1ZBA1 2CU5A 4GB32 4Q1PA 4X6RB 4FBFA 2DF7A 3RG0A 5G05L 3FFZA 4QT6A 3ZYPA 1JMUB 2HEYF 1MZEA 3X29B 1I6XA 3KSCA 2R041 1IZ3A 4PBPA 2UU8A 5BNPB 2NM1A 2D7FA 1UD1A 3WZ1A 4HSJA 4BB3A 1GP4A 2BVBA 2IWGB 3VKOA 2VG9A 2ZAHA 4Q0PA 1ZZ8A 4DXSA 2WQ8A 3GM8A 3ZPYA 5C9AB 1OUXA 1WW4A 1QKQA 3MIHA 3MFAA 5GLVA 2FD8A 1OF3A 5FZAA 1BXHA 1UYXA 4N8MA 2BFUL 5GJ6A 5A3NA 1SACA 3P3PA 3GZAA 5E16A 1WGPA 1RHI3 2A6WA 2JDUA 2FDFA 2VR4A 1FAYA 3ZKYA 4CP1A 2LROA 4AHZA 3DYOA 3NAPC 4IEUA 5ABJB 4UI9L 1G8WA 1RVF3 3FFQA 4IV1B 3I97A 2WINB 2ZGNA 2PHXA 1ZRDA 2BOIA 1WCSA 4P9WA 5F5CA 1QJEA 5LA0A 2RJLA 1ULCA 1CZVA 2A6XA 3RYRA 1JZ3A 4XBQA 4LE4A 4EWAA 1CD3G 1IS5A 1AL22 5GKAC 5GLUA 2E7QA 5SV8A 2WS93 3AJYA 4H3WA 2Y33A 1OQDA 1HKDA 3GF6A 2VW0A 2XJTA 3G7DA 2RS53 4LKDA 4PLOA 1BCXA 1WLWA 1E57A 3M8LA 5I0UA 4BQXA 4LIUA 3C8XA 2GP5A 4NOTA 1W06A 1NLSA 4JC1A 3HEIA 3MF6A 3TRSB 4D8MA 3QD6A 3FHQA 1PO12 2PQSA 1RHI1 4JGZB 4F3JA 3LGRA 3ZYIB 1EP0A 2HWB3 2N7GA 5M0TA 1BMV2 1IS3A 1NT0A 1AYM2 1RUNA 4Z82A 1ENQA 4P9GA 1WWYA 2NLRA 4P9YA 4MX3A 2VOXA 2P37A 1G6NA 1U5IA 3H42B 4QHZA 3DF0A 3WF3A 1RITA 3G6JB 3AYDA 3ME2A 3LD8A 3H7JA 4JX0A 1RVF1 3V0AA 3MFCA 4QX7A 1WD4A 1S1AA 3TNPB 2RJKA 5JXHA 1Z7S3 3S57A 4BHPA 1JYIA 1I5ZA 4XJ8A 5E88A 4MGZE 1H4HA 4OI2A 3GHMA 5FP7A 2XJVA 5J7MA 1TME3 4CDWA 4LO6B 2JG8B 3H50A 1NLRA 2WFPA 2WS91 1PX3A 1BHGA 2WA4A 3LA7A 3HN3A 4IQPA 3PUHA 2EALA 4LA2A 4XE9A 3K4AA 3LDKA 3W21A 2RS51 2JDHA 2X05A 2VVEA 5LEKA 2Y6FA 4N7IA 3VDDA 1D4M3 2OQ6A 4E8DA 2GDFA 3FBYA 4Q0QA 2IUWA 4LTAA 1G9CA 4BOWA 1DZQA 3CF6E 2VMFA 5DQ0A 1UMZA 1Q8PA 2A73B 1EAH2 1YRZA 4GWMA 4QXKA 5LB6A 3WW1A 3ZYBA 5B2GB 3S0MA 1PZ8A 1N1YA 4FFIA 5EYXA 4P00B 1O8SA 1GZTA 4UFJA 2KR2A 4JQTA 2ZHLA 5FPLA 2BUKA 4B4QA 1UF2C 5LCWL 4K1ZA 4L92A 1CR7A 4XVHA 1W6QB 1F5JA 1W6PB 2R16A 5FZDA 4C8DA 1ONAA 4COWA 4XF1A 1NLQA 4OUEA 2BV4A 2JE7A 2WYSA 5AFEA 2NP0A 4FFHA 3MV01 5KC5A 3ILRA 5FXXA 2VUDA 2OZ6A 4DZGA 2WNVB 2QQVA 3HPNA 1RUJ3 1H8TC 2RJ2A 4LBQB 3B5LB 3IDEA 5DAPA 5A32A 1Z7S1 1FPN2 1YNAA 4XMAA 3WQ1A 2VC9A 5FZMA 1FMD3 3WLUA 3AFGA 1TME1 1US3A 5ACA3 1ND3A 1I5PA 4QPIB 3OEAA 1LHOA 4FP2A 1IG0A 1AXYA 4MXVA 1VBA3 4UFMA 4BQ2A 1UZYA 4QU1A 3WG1A 4A45A 2B8MA 4KWKA 2G9GA 3OTFA 5ERLA 2WZPP 1BKZA 3H1MA 1WMXA 1VLNA 1D4M1 1AZDA 3HT1A 2E9QA 1POV0 4EN7B 3SNMA 4IGQA 3VLBB 2JE8A 1WUVA 3K51A 1VRH2 3OBRA 3RI8A 5FO9B 3LEIA 1RIRA 1C8NA 4NPRA 2VCCA 1O4ZA 1L7RA 3KS7A 3ZFGA 4CP9A 1LGBA 2YBKA 1W2OA 3IDBB 4FTSA 1R083 2EIEA 3KGLA 3A4UA 3LQCA 1LCLA 1MEC3 4HVOA 4IV1C 3RS6A 2W3JA 1A6CA 4OZOA 1XJAA 1ND2A 2ZZQA 3KT1A 2DFBA 1Q8VA 2DV9A 4BK4A 5IAVA 2ZMKA 2VULA 5LY2A 2YYOA 4LBMA 4OMDA 2WC2A 1KEXA 4RHV2 5FZGA 2VCMA 5EYYA 4BA6A 2WZ8A 3C7OA 5FYHA 1DFQA 3VBUC 1F4AA 1X82A 2O8QA 2YFZA 3IAQA 3PLQA 3THTA 3KHBA 1RUJ1 4IEXA 4HN1A 5CB7A 1F4HA 2WSUA 4BJ0A 2YROA 4DQAA 1UOGA 1LGNA 3P6BA 4BPZA 5ACA1 5KXEA 3IIIA 1ASJ2 2WDBA 3O5SA 3VZNA 1A8MA 1VBA1 4OYUA 3FX3A 5JOYA 2DVFA 1NZCA 5JIUA 4GZ9A 4TLFA 1HB1A 1ZNPA 3JBG3 4QMAA 3D82A 4COVA 4ES9A 4UWDA 3VD7A 4FI9A 1RUD3 4JGZC 4OHVA 4LBQD 2EF6A 3ZYRA 2AACA 4IV3B 2SBAA 1O3SA 5EWSA 4KU7A 3Q8EA 3UETA 3ORJA 1RUE2 2CL2A 2P3KA 5KHGA 2R073 4IL7A 2HJIA 5IVBA 3VD5A 3UYJA 1R081 3RZLA 1BVP1 3EJKA 3KV4A 3I3BA 4TTGA 5A3UA 2EXHA 2BQPA 4W50A 5F2WA 1C1LA 3B00A 1REEA 1U0AA 3OBZA 2QTWB 2IFRA 4IEQA 1LULA 2EXJA 4MGSA 2BGCA 2Q8CA 3D5OA 4Q0VA 4ZKTB 1TNFA 4OI4A 1IPJA 2XPJA 4NRPA 3THDA 2CY6A 4BWOA 3A0KA 3KGZA 5LASA 3EB7A 5JSRA 1W6MA 3N7KA 2IXCA 3J9SA 2YB7A 4IE7A 1W05A 2VOTA 2IXKA 3ZPOA 4AK3A 2HLEA 4NHLA 1CWPA 3WQ7A 3T08A 2JD4A 5A33A 5BNOB 2WJSA 4CCMA 2Z2SB 5T5PA 5EIYB 3NQHA 2BZDA 1POV1 4AFDA 3S7IA 5FPZA 2G9ZA 1FOD3 4UFLA 2EIGA 5H9RA 1IKQA 1VBC2 5FAXA 2ET1A 3N9NA 4LEJA 4G3YC 1I1EA 4YGCA 5D8AB 1NY72 2VNGA 2W68A 4UT5A 4R52A 4D6QA 4TN7A 3JBG1 3H3ZA 3O0VA 3RZKA 1BQPA 1RUD1 3KHCA 5JVVA 5JSPA 2VNRA 1ZX5A 1EY2A 2RS12 3B9IA 3D3AA 2G4IA 2JDAA 1HB2A 1LOGA 3GZEA 3HNYM 5DAWA 3TB0A 1RJ8A 2R071 4XF4A 1CX4A 3NJYA 3NKGA 1KJLA 1ZZ7A 4YVWB 2AC1A 4XEZA 2J7MA 2P5BA 2IXHA 3LPGA 5A3MA 1SCRA 2K2SA 5JZGB 3ZIXA 1JYNA 3WUDA 1B35A 1W8ZA 2DUQA 4AFMA 3WQBA 5AC92 3ROUA 1H1MA 4HPKA 3DPRA 1NCQA 2Y34A 4M3CE 4E2SA 5IATA 1PK6A 4H55A 2VNVA 3JQXA 1ULPA 4HBNA 4MZUA 4EROA 1NXMA 5C3RA 2VTFA 3LSEA 4WM8A 5DAXA 2R063 3FMGA 3J7MA 3M3EA 2ZEWA 4BQ1A 2MEV3 1OLME 5CU1A 2CNAA 1H6YA 5FQ0B 3PUSA 2C24A 4NUBA 1BVVA 4DMIA 2IXIA 3LA2A 1LOAA 2UURA 3C7EA 3MIBA 1W8NA 4AQ6A 2B46X 4NPMA 4UF0A 1R093 1FOD1 3H0OA 3S6PA 3MIEA 2WZR2 2Y60A 1REFA 3LOBA 2RE9A 1DZRA 2D43A 2VOKA 2I74A 2JENA 3WSOA 4FPOB 3QBQA 4ASLA 1YYNA 4LHNA 2ZGUA 5SV5A 3SCGA 4CU9A 4CUCA 4YM0A 4TXWA 3VDCA 1PX4A 1ZRCA 4MVTA 4K21A 4CEYA 4F7ZA 1QF3A 4OMCA 3KMHA 3PTRB 3USUB 4CCNA 2V09A 3PVEA 3I54A 2JEMA 4Y4YA 5DAQA 1OURA 5APAA 2EVXA 3MPPG 1KDKA 4ZXKA 5K7PA 3U78A 1SLIA 5IAXA 4YGEA 2HKXA 1YJLA 2J1UA 3MIDA 3R05A 2D3SA 3DXTA 2DCKA 1OXCA 1YFXA 1LESA 4TYSA 1W9WA 3ZMNA 1LRHA 2GC0A 1OQEA 5DG2A 1XNCA 3A0NA 1UIKA 3PDQA 2A75A 5FK7A 1HN1A 1XC6A 3TYJA 3VBRA 5J96B 3TEWA 1CAVB 4CRQA 3ZSJA 1OKOA 3N7MA 2HWC2 3WVJA 1PVC2 1UYYA 2R061 2VTXJ 1TMF2 3GCXA 1RUF3 2F17A 2MEV1 5FTTC 2R1DA 3BU7A 3E5XA 5JI7A 3AKTA 1NE4A 2VD7A 1W0OA 2VMIA 4UAPA 1FV2A 1GZWA 1D2SA 1FATA 1VPHA 3SCHA 4Q8KA 4FVVA 5C3PA 1X50A 2C1FA 1N3PA 3VBFA 1R091 2GNTA 5CBLA 1LKNA 1XSQA 1WLDA 5GALA 5A7WA 3URFA 2W1SA 2GMEA 4N43C 4O61A 3WX5A 3M7AA 5CG8A 5FREA 3P5BA 1O6UA 4PBOA 2PAMA 4KWUA 5ANNA 3SH4A 3M3CA 4LXLA 4WVWA 3UKVA 4N90A 1VBB3 4HSLA 1RUG3 4QQ2A 5AVPA 1F5FA 3U75A 3VN4A 4DFSA 5JAXA 1LB2A 5FZ6A 3I3MA 4FOQA 3P3NA 5IHRA 1AXKA 4K3UA 5FMDA 4OHWA 4L2NA 1AJKA 4NIAA 2HWF2 2HEVF 3OY8B 1NOVA 3PUQA 1QJY3 2EICA 3MIGA 1XPWA 4HN0A 3ON7A 1F15A 1XE7A 2C26A 3VHRA 5DUVA 2DCJA 2PHRA 2ZX1A 4LULA 2BWCA 1C8M3 1HRV3 3I2DA 2BERA 2ENRA 2EAKA 4HFSA 1F9KA 4KL1A 5J98B 3QOPA 5F7UA 5FYTA 1Y3TA 1RUF1 1MZ6A 3OB8A 5D8AC 4D7TA 3HQRA 4NHXA 4XDOA 1ZBE2 2WA3A 2XUEA 2BW8A 2PMWB 4X8NA 5IVCA 2BVVA 3N4MA 1PGL1 5DUUA 4O7XA 3FN9A 3ZKUA 2RM23 2E7TA 3NWKA 1AR73 4CDUA 3AC0A 4CCKA 3M3IA 1WMFA 2F6BA 3FUQA 1MS5A 3MLLA 3AMMA 4XFFA 4AF9A 3BIEA 3MDPA 2WFF3 1AX1A 1QQP3 5T3NA 4AVSA 3AP9A 3EQEA 4KWLA 3IDCB 4FXGB 4KG0A 4CXWA 2Z4FA 4K6BA 2A1XA 2X10A 5IK4A 5KWRA 4AHYA 3WDUA 2P6CA 1UY3A 3VL9A 5HXMA 3KLSA 2JDZA 1AVBA 5JCTA 1Y4WA 5A6QA 2JIJA 2ZA9A 5C33A 4HKOA 1D4VB 1OF4A 4ATFA 1VBB1 5IYYA 1RUG1 1K3IA 3SXWA 4QPGB 4ZY9A 1K5MC 1ZRRA 3AXDA 3KVAA 4B1MA 3ZSKA 4DINB 4UW5A 4K9SA 4ARYA 5FJHA 1GMMA 5L7OA 4NIGA 1VALA 2GNBA 1ODNA 3ITQA 2AEYA 2UY9A 3FLTA 1UY2A 4GXLA 4W4ZA 3J7LA 1S0CA 2GAUA 3ACIA 2DUOA 4CUAA 2OPKA 1QJY1 2WAAA 1OOPB 3AB0A 3GXUA 3NNLA 2FDKA 1TQ5A 3WDWA 4QKFA 1HLCA 4QQOA 3CJIB 4ZZ5A 1RUC3 4N53A 1C8M1 1HRV1 2CGNA 2ZGPA 3I2IA 3QCWA 4IDZA 3UJQA 2D3RA 2WNEA 3CKHA 5FZ1A 4RGGA 2HYXA 1W90A 2VECA 3HMYA 4GH4B 4QB2A 1W39A 3QH7A 3E6BA 4NAOA 2O14A 2OX0A 4BDVB 1JHNA 3KVBA 4L99A 5JPMB 4LKSA 2ZXQA 1VBE2 1SFYA 2DCYA 2DVDA 2PELA 2RM21 1AR71 1D2QA 2XL9A 3I3DA 1H1AA 1TVGA 5C5TA 1CPNA 3DXUA 2VOWA 2GALA 2WFF1 1QQP1 5J37A 4YW4A 5F37A 2C0ZA 1GLHA 2ZAAA 5ANQA 4YVSA 2QQOA 1DBNA 3U4SA 1CAXB 4LHLA 1IPSA 4XHBA 3HQUA 4QB6A 2XHKA 5C4WA 4CP2A 3HNBM 2AREA 5FY4A 4WM7A 3K75B 3O1SA 5FO7B 4RYDA 1AHSA 3J8F2 2VVFA 1AX0A 2WO1A 4XUTA 2X5IC 3AMHA 3ZXDA 2QQKA 4XHXA 2MHFA 3T0DA 1IGOA 5FBJA 4BQ3A 2DBIA 2YU1A 5KXBA 3LAGA 4HMZA 4RGAA 3WNNA 2IVJA 1WLCA 4Q29A 3C7GA 2PLV3 1XRUA 2F4PA 2JDYA 2VBBA 2Q1MA 1U5ZA 2X8KA 3NAPB 3MV11 1QOSA 3OGVA 4MXWB 2ZGQA 4P5HA 5T50A 1UNBA 4I0AA 1X9TA 1YLLA 3O1MA 1OLMA 2ERFA 3WHUA 3ILFA 3OPTA 4I3GA 1RUC1 3U14A 3RZGA 5K0UA 1UXZA 3A23A 2WWUA 1UX6A 4FOWA 1D7PM 2D6LX 1JW6A 4DXZA 3PL0A 1J59A 3FUOA 3MUY1 1AR92 1W3VA 5CFDA 1G9FA 2GC1A 4IEZA 4AEDB 4XAAA 4IEYA 4XJ9A 3C2UA 2OQ7A 4DUVA 4K40A 4YZ3A 2D5FA 4Y1ZA 3RRDA 2D5HA 1VB4A 1NA1B 2KM2A 4LORA 3GHNA 1ACCA 3RMYA 2HEWF 5HI0A 1RMU2 4PLNA 5JIAA 2XOMA 4JAAA 1NG0A 3BALA 1WKYA 5FWJA 4NO4A 2Y26A 1E5RA 1JYVA 5FY5A 1HXS2 4QKBA 1QMJA 1UU4A 3HN1A 2QQNA 3RJRA 1DYOA 1XNAA 2RS32 3ZYJB 3RMXA 1UPSA 1NQJA 4Z2WA 2HBUA 4PF5A 5HCAA 4BYYA 1W04A 1V6MA 3RQ0A 5JR2A 2W91A 4AI9A 3POGA 1PO13 3VBHB 2DDUA 3E6DA 5EFUA 2JECA 1PGW1 2VTXA 3AFKA 4YZ4A 4E2QA 1UZ0A 2PLV1 2RDQA 4DRVA 5CFCC 5LRSA 4J1WA 2R0HA 2ZBJA 1QJX2 4QM9A 3T2OA 2QBXA 3AX4A 3LA3A 4Y33A 5BY5A 2GSYA 3OD4A 3PVOA 2YC4A 3J4UH 1LR5A 3UJOA 5FBZA 1PO23 2V5DA 3CU7A 3VBSA 3ZSEA 3POSA 4LITA 1QH6A 4SBVA 1AR82 2BOJA 2FHRA 3OG2A 2EA7A 1CIYA 5LZ6A 1MQTA 5FY1A 4QPGC 3ZN6B 4GWIA 1YQ6A 4IEPA 4CCJA 2H0BA 2VBPA 4XYXA 4LHSA 1FX5A 3H3LA 2ZTNA 1OFNA 3VDAA 1EUUA 1CN1A 1EV12 3NV3A 1OOPC 3B69A 4BZ4A 2TUNA 4DO0A 3PU8A 3ZXJA 4YNIA 3FHIB 3PU3A 3I2GA 4P5YA 5IVYA 5FZ8A 1X8EA 1SLCA 4MGYE 5FFOC 4AZZA 1KJRA 1S0IA 1LHNA 3UGHA 3WW4A 1L7LA 2JG9A 4H2AA 2A71A 1DGRN 1PO11 1OMIA 2NQYA 1GU3A 5KHHA 5JDBA 2XJRA 2FMYA 4GH4C 1CPMA 1OA3A 1SFNA 5LATA 3OYWB 2A3YA 4H7MA 5FYSA 5CA6A 1IPKA 1QXJA 2O0OA 1H8TB 3E1F1 3SLIA 4E9KA 2QJVA 5A1LA 4QWNA 4MH0E 3WINE 3HWJA 4FOVA 3MIFA 1H6XA 4EZ4A 2XVGA 2CWMA 4I3PA 2A6VA 2G9FA 1YHFA 2A70A 1PO21 2ZX4A 4URTA 4UFKA 3HOBA 4CE8A 3LOIA 3H8XA 1KITA 1Q56A 2Q8EA 4Y20B 2WO2A 3H1WA 3MICA 2VQ0A 4XJWA 4Q4X2 4AFCA 1J84A 1T6BX 4JZRA 1GFF2 3ZXEA 2OVUA 1UMHA 2BGPA 1Q8SA 1S0DA 1NUKA 4Y1VA 4Y24A 4OUMA 1A78A 2IFWA 3R4UA 2JKBA 2DFCA 5AFBA 5DDJ3 3ZN5A 3TAYA 1J3RA 5FWEA 1W6OA 2V5YA 4IE4A 1AYN2 2A6YA 1VRH3 3JQWA 5I91A 3PTYA 4JCKA 4QDQA 3AVRA 1HJGA 1V6NA 1VJ2A 3ZSMA 4AAPA 2H6BA 2VMGA 5HV4A 1NX9A 1H4GA 1NE6A 4SLIA 4LBNA 2DU0A 2JB4A 4BLIA 4Q4W3 3C7HA 5LA9A 4AVCA 1DYKA 1MS3A 1S0GA 3OF1A 5T54A 2VUJA 3VBUB 4Y5SA 1PMHX 3WDYA 4KG8A 1WMEA 4AEDC 3N9LA 5FYYA 4D69A 1GNHA 1S55A 1R1A3 1UZVA 2VM9A 5FO8B 1SPPB 1NA1C 1KXGA 2XB6C 4WZFA 5IVJA 2WAOA 3O0XA 4PDWA 3WP3A 4YFZA 3I2OA 3D0JA 4B1LA 4C1XA 5FXVA 2W08A 5I8SA 3TOJA 2R0FA 3NNMA 2WN3A 5DAVA 4GQ7A 5C71A 5GLWA 3IPVB 2J1VA 3RGBA 4G9SB 4E2GA 1ASJ3 5F3CA 2V4AA 1HB4A 3HNMA 3ZN4A 4XXAA 4CPBD 2VL4A 4AEMA 2XQXA 5FZOB 4LA3A 3BOWA 1X7NA 4FFGA 1C3HA 1QJU2 3ABZA 5A7SA 2W5FA 3SISA 3WG3A 4RGKA 1WW5A 3VBHC 2ET7A 2W9XA 5DDJ1 3VGIA 4OZXA 3B9CA 1PIV2 4MYEA 5JOWA 3CIHA 3VBOB 3T4VA 3V0BA 3U10A 3JCIA 3GALA 2RMU3 3MUZ1 2ZX2A 5FOJB 2VPVA 3RVHA 2ZPXA 4XQWA 3LDRA 1U12A 5IJRA 1VBD3 3AZZA 3FWEA 1BYHA 2D40A 3RFRA 3MLJA 1MS0A 2VW1A 4QQHA 1KS5A 2Z79A 1YIPA 1ZRIA 2JDMA 1UZWA 3H8UA 1GOFA 3M2MA 5EHDA 1JZ6A 1ZBA2 4Q4W1 4YG3A 2ARCA 5FPUA 3AZXA 4AE2A 1WW6A 3NVCA 5FXWA 1GQGA 5EV7A 4CDWC 4LJHA 3PVNA 3ZLIA 3K77A 3AP5A 3I59A 4JQRA 1UPIA 4RS5A 1R1A1 3LIGA 3ZVXA 3H7YA 4OHXA 2LTNA 3H8OA 3TNQA 4JHTA 1V0AA 4YZ1A 3LEGA 5F9TA 2RVAA 4NR1A 1O5UA 4WVMA 1GBGA 1C4RA 3LFIA 4V1PA 2VO5A 4YW5A 1UXXX 1SFPA 3VDDC 4DXRA 1JI6A 2XH6A 3CLPA 3E5UA 4JDMA 5IK5A 2BNMA 3SHRA 1JYCA 2DTWA 5KXCA 1AF9A 1OD5A 2WNUB 2VW2A 3W5MA 5FMOS 4J6GA 2EXIA 4CDQB 5E6HA 1O4TA 4XDPA 3ILNA 3W20A 3T2QA 2VZTA 3ZFFB 1QJZA 2QNKA 3BGAA 3SKVA 2HWB1 3AL5A 3Q8CA 1Y43B 2QQJA 4JGYA 4QAWA 4DPNA 4YGDA 5FYUA 3K46A 1TZOA 2DWRA 2P3YA 3RI9A 2GNMA 1CJPA 2B42B 3LE0A 5FKCA 3V64A 1QDOA 2OS2A 4CDXB 1SLTA 1VMFA 1XNKA 2FCUA 2RMU1 3R4DB 1PVXA 1PNGA 3I4IA 4EN8B 2XMLA 2ZJCA 3RYPA 1VBD1 4E4SA 3KWVA 4RFRB 1RC6A 3CNAA 4NWVA 4D94A 3CQOA 3WDXA 3SKJE 1W9TA 2D93A 3POBA 4WVVA 3ZX7A 2JXAA 1B35B 3KCYA 5FIXA 3KT7A 1ZRFA 5AC93 5FLHA 4ZS2A 3KQ4B 3VB9A 1UZZA 2RHPA 1N3OA 1DQ2A 1F35A 1HQWA 3APBA 4XJUA 5BNPA 1IS6A 3WNMA 1O7FA 5KBFA 3VD3A 3ACLA 1CX1A 4QGMA 4A44A 4B4PA 3O1TA 1AL0G 2UYBA 3JB8A 2BDRA 1UL9A 3ZOIA 4UF0B 5CZKA 3IT8A 4COYA 5C9AA 5GZDA 3PIJA 2O1QA 3JB4C 3MLKA 2ORZA 4YW3A 2HBTA 3UESA 2J1EA 3ZFGC 2OKXA 4EQVA 5IVVA 1ZZCA 5FP9A 4IGPA 1RHI2 1G9AA 5EJ3A 3UT0A 4CA9A 4C0HA 1ND2C 4OQ9A 1RINA 5T5LA 1DF0A 1NYWA 1COV2 4CEYB 4LBLA 5BUVA 1LU2A 5BV6A 1A34A 4I2OA 4XF9A 3NJXA 3ENRA 2DCTA 5D21A 3WW2A 3NRUA 5HCHA 3LPFA 3FZ3A 1RVF2 5ABJA 1UYZA 3AMPA 3AZVA 1DLCA 1HX6A 3BTAA 4IV1A 2XWJB 3IMNA 1XSRA 1WCKA 3AJZA 5FY8A 3S30A 4AG4A 1PZ7A 4JTOA 2ZABA 1FMD1 4QD2A 4RA0A 4XAEA 5HCFA 5GZCA 1H0BA 1QH7A 3C7FA 5CISA 4UW6A 3KQRA 1JS9A 4K20A 1SBEA 5A6ZA 3BOPA 3J7HA 4AI8A 5AC91 1O3QA 2WS92 1O91A 5DG1A 5FZEA 1M4WA 3CDZB 2WLPA 3NNJA 2GH8A 3CEWA 3AP7A 5DZFA 3W9AA 2RS52 4YFWA 2DVAA 5I8TA 5J3UA 3SEEA 1XNDA 1C5IA 3OBAA 4MSVA 5FYIA 2WN2A 3RYKA 3PJQA 5EXOA 4N43B 2JDPA 3VZJA 1PNFA 2VUAA 1GQPA 3VBOC 2LUWA 1T6GC 3RDIA 1MEC1 3M3OA 1ZM1A 4Q0UA 3NMBA 1UN1A 1MS8A 2QFEA 3AL6A 5IW0A 2ZGMA 4BCUA 2J1AA 3IBMA 2P3JA 4R9DA 3KB5A 5CKNA 4RSUA 1RUI3 1HIXA 1CZTA 1LOFC 1OUSA 1GNYA 1QY4A 3CBNA 3INAA 4JGZA 4UXAA 5FPVA 1W6NB 5FRAA 4COUA 4J25A 2BGOA 1WBLA 2GN3A 5GZEA 5A3PA 3KZ4C 4AVVA 4YG6A 1V6KA 4V2VA 4MADA 4FAHA 1W2UA 3KD4A 1UMIA 3VHPA 4CXXA 4QDRA 1UY0A 4QX1A 2LS6A 4YW1A 4LKEA 1W28A 2BJSA 1Z7S2 2IXJA 4YW6A 1BEV3 5FY7A 4P02B 2LM3A 1TME2 3W5NA 2HWE3 3K4DA 1H30A 1DQ6A 3OPZA 4Y1YA 2GN7A 3POIA 2JG8A 2WNUC 1BK0A 4CDQC 3QLQA 5JXJA 2WUHA 1UX7A 2B39A 2V72A 3ZFFC 2VXRA 3VUOA 1GZ9A 5JOXA 3FLRA 1D4M2 3BPSA 5T5JA 3Q8FA 4IE5A 5FDBA 5LA2A 4PIYA 5JI9A 1ENSA 4NWWA 4XIOA 3TN93 2A3XA 4Q26A 5L9RA 3M3QA 3O1OA 2ATFA 2RR13 1JU4A 1W8HA 2IC1A 4CDXC 3WF0A 2XDVA 5IK8A 3CL1A 2PXJA 2Q1ZB 2Q4SA 4TWTA 5T5OA 3ZIWA 4I30A 1BJQA 2Y6KA 1RUI1 2R1BA 1W3XA 2DTYA 5DN2A 3UK9A 3R0RA 1OHFA 5FZFA 2QDNA 1K5MB 4IERA 1XE8A 3PMEA 5FLIA 1W6QA 1W6PA 1B35C 4CEWB 2WSVA 2E33A 3K3NA 4IEVA 4H14A 3DPRC 1NCQC 3PVBB 3VKLA 4A7ZA 2DUPA 3POWA 1O3RA 3K48A 4W6XA 1PK6C 1XBFA 3ATGA 2WQZC 1B09A 1RUJ2 1S4CA 1ZA7A 1LECA 2WNVA 5C5UA 4Y22A 4LBQA 4Q27A 1BEV1 4LR4A 3SCFA 4LLFA 1QIQA 1YWKA 5BNQA 1AX2A 4QPWA 3B02A 2FMDA 4QQLA 3N36A 5FZHA 1TEIA 1V9U3 2HWE1 2D6NA 5LBFA 1GANA 4QPIA 4I02A 3RZZA 4AHWA 1VBA2 5F5QA 1K45A 3GJAA 1NCRB 4GJYA 2PN5A 1OA2A 4ET7A 1LHVA 1YQCA 3FBMA 2H0VA 4LLOA 4DXTA 2QQIA 5DPNA 1YFWA 3WT3A 2AGSA 3N7JA 3PJYA 1E5SA 2VZUA 1OFSA 1SZBA 4OLLA 3BTXA 2YUEA 2W1QA 3TN91 1LENA 2NMOA 2QZ2A 3AKRA 3O14A 4CEYC 2Y6HA 5G04L 2L9LA 3ZFEB 2RR11 2XLAA 3VHOA 4YWAA 2YZ4A 3SC7X 1R082 3WNKA 4MGIE 3WNLA 5EJZB 4L97A 5C8CB 5FZKA 4HOOA 1OKQA 4MO3M 4LUMA 1P8JA 2R7EB 2WT1A 2MPFA 2XGXA 5F6KA 4D7YA 1F31A 4PI2A 4B3NA 5HV0A 3D0SA 1JYXA 1DU3D 3OPWA 4PJYA 4YM2A 1CJDA 3SH3A 3WP5A 2GMPA 1G9BA 2HWD3 2X5IB 1O5LA 4UBHA 3W58A 4A2UA 3N9PA 2VZOA 5J48A 1UAIA 3IDAA 4HG6B 4LQRA 1S2EA 2P17A 3I8TA 4Z92B 3JXSA 2QZ3A 1VAKA 2ZZJA 1WA6X 5E8AA 3ETQA 4M3CB 1CGPA 4ZS3A 4QGLA 3U07A 4TZDA 2VZRA 1V9U1 3IKWA 2J1RA 3WNXA 4OUSA 1XE0A 2Y0OA 1SDWA 4AGGA 4E4ZA 3LCPA 4WVZA 2QCSB 5FUIA 4EYUA 5JMCA 1O8PA 1XOYA 1SEFA 2W95A 3I2FA 3MPBA 3WV6A 1QHDA 4D6SA 1C28A 1LODA 2F4LA 1LAJA 3JBG2 4BQWA 2JKXA 3EYPA 2DVGA 4JKKA 1RUD2 4Q4V3 1SDDB 1CAWB 2A3WA 4KGGA 4LOTA 3WHTA 3S5QA 2W1UA 4IV3A 4AVBA 3B94A 1S2BA 2D3PA 3POYA 4HLTA 4NRQA 4FPGA 5FMCA 4K7JA 2R072 4FQ4A 3POEA 4LPLA 4OHYA 3JZVA 1GOHA 4UOJA 4XFCA 2PHFA 1PM4A 2DBNA 3O1PA 3IB3A 5K4LA 1UO9A 1W8UA 1QEXA 5TSWA 1X36A 4XBNA 1Y9GA 1ZYBA 3FHAA 4RFT0 5FY0A 2B4KA 1CAUB 3JU9A 5FZBA 3VKNA 4DIQA 3TEYA 1LEDA 4M4PA 1FNYA 2ZMLA 2HWD1 3GNEA 3A21A 5IFPA 4ITCA 4NHMA 3UGGA 1W0NA 1GUIA 1LHWA 3OGGA 3Q8AA 5FV3A 3HVDA 4ZXEA 2ZX3A 3BVCA 4NVPA 1V70A 5CFCB 2VH9A 4R9CA 4P9LA 3DCQA 1BBT3 4Q5OA 2PYTA 4DY5A 1RXGA 3ZYFA 2XBO3 1DCSA 4PT6A 5BNOA 2P34A 1DLLA 4P9XA 1MVQA 1FV3A 1QOOA 2XVKA 2E63A 1A8DA 1FOD2 5KXDA 1QJX3 4CDUC 4RR3B 5J09A 5GZGA 3RZJA 5LK7B 1JH5A 4QXCA 1AR63 4FPFA 1U5YA 3LKJA 3O7OA 4U2AA 3ZXKA 5F39A 3HJRA 5D8AA 1KS4A 2WZEA 4I0BA 2WT2A 3AZYA 4AI1A 5FP3A 2P4EA 2ZGKA 4AOCA 3QACA 1G86A 2XONA 4Q4V1 1QXRA 2W87A 3RWNA 4CCEA 3MW3A 1RJ7A 1YIFA 4CEWC 1UYPA 3J7NA 5A3WA 1UCXA 4GKXA 4DS0A 4EN0A 4NE9A 2FCVA 3NV4A 5FZ7A 5F8PA 4M01A 1NXD1 4NJ4A 1NAEA 5CKQA 1RUH3 2BTVC 1K12A 4YVWA 2WLQA 4RQPB 4J1XA 4NMIA 2ZGRA 2P1BA 2XJUA 1SHWB 5F1RA 5JZGA 4P9IA 1EV13 1YXWA 4LNVA 1G7YA 1GSLA 1W2AX 1JBCA 2P2KA 3AVSA 2QQLA 1W8WA 2NYYA 4BQ4A 1X33A 4N53C 5BNNB 4AI2A 3P1IA 2R062 2WYFA 4Q4Y3 3D8CA 5DZEA 1NCRC 2MEV2 4LK6A 2AENA 1GYKA 3BCWA 4MGQA 2VVDA 1BBT1 4QX0A 5LBBA 1DHKB 4GB33 5FQ0A 4MG2A 2XBO1 2FDGA 4HANA 4S2DA 2VZ1A 2MNGA 3UNPA 1R092 5L9VA 1HW5A 2ZEYA 3ZFEC 1Q43A 2AH2A 2E31A 4LKFA 3KCCA 1AR61 1W8TA 4TSVA 1TG7A 4B7KA 4CTEA 2PHUA 1XU2A 2D6OX 1GWLA 2GH2A 4LO4B 5C8CC 1X8MA 2ZHMA 3NNFA 4YVSC 1H2LA 2Q30A 5KHKA 1RYYA 4S2GA 1H8VA 4WV8A 5F6LB 1LGCA 5FY9A 3U1XA 4AQTA 3WG4A 3OJBA 2R6QA 3NJVA 4XUQA 5C4WC 3LWCA 4QB1A
chains in the Genus database with same CATH topology
2EIDA 3T0AA 5A1AA 2EIEA 3LQCA 2VZQA 2W3JA 4OZOA 3I2KA 3T09A 3A7QA 4QDQA 4BK4A 4PQQA 1NX9A 5C70A 4OMDA 1KEXA 2WZ8A 4XUPA 3C7OA 1F4AA 2YFZA 3IAQA 3C7HA 1JZ5A 1XNTA 5LA1A 1PMHX 5C7GA 1F4HA 4BJ0A 3VD9A 2VZPA 2VM9A 1W99A 3P6BA 1KGYA 3IIIA 4A4AA 4RN5A 2WAOA 2WDBA 3ECQA 4A41A 4OYUA 2WN3A 1NKGA 5C71A 2J22A 4GZ9A 2J1VA 4CUBA 2WABA 2VJXA 3VD7A 4FI9A 3HNMA 4MOAA 4A6OA 2VL4A 5JMOA 2XQXA 3ACHA 1UWWA 3UETA 2Y6LA 3ABZA 2VZ3A 3WNPA 2W5FA 4IUGA 4JKLA 2W9XA 2Y6GA 3VD5A 3WNOA 4Z2AA 4TTGA 3I3BA 3CIHA 3PUIA 4W50A 3MUZ1 4MGSA 2J1TA 5IJRA 4DUWA 3I2HA 3THDA 3EB7A 4QX3A 1GOFA 1JZ6A 2YB7A 1CZSA 1T2XA 2VOTA 4YPJA 4E8CA 2HLEA 3LEKA 4JKMA 3T08A 3K77A 5EIYB 3NQHA 2BZDA 5I0DA 3LEGA 2RVAA 5JXGA 3UESA 2VO5A 4DXRA 1UXXX 1O59A 1JI6A 3WEZA 2W46A 2RV9A 4P08A 3W5MA 3T2QA 2VZTA 3D3AA 2JDAA 3HNYM 3BGAA 3SKVA 4QAWA 2QQJA 3OGRA 3K46A 4XUNA 5DMYA 3LE0A 3ZM8A 2J7MA 3LPGA 4QB1A 1JYNA 3WQBA 5EJ1B 3CQOA 1ULPA 1W9TA 3SKJE 4DEQA 2VTFA 3OGSA 1JZ2A 1WCQA 3CMGA 3GDBA 2ZEWA 2Y6JA 1H6YA 1W8OA 3OEBA 3C7EA 1W8NA 3WNMA 2CDOA 3VD3A 2VZSA 2WBKA 5B4NA 1CX1A 4JHZA 1JHJA 4A44A 5B4XA 3WSOA 3ACGA 1JZ4A 1W9SA 5CZKA 4KMQA 4CU9A 2ZEZA 2ORZA 4CUCA 4TXWA 1UY4A 2J1EA 2OKXA 3VDCA 1PX4A 4OMCA 3FL7A 2KD7A 4BXSV 2J1UA 3NJXA 4CVUA 3NRUA 1OH4A 3LPFA 1GOGA 1UYZA 2DCKA 1MPXA 1DLCA 1W9WA 3IAPA 1HN1A 1XC6A 3I3EA 4AG4A 3F2ZA 4A3ZA 4D0QA 2V4VA 2YG0A 3C7FA 5J1XA 1UYYA 4M4RA 3WF4A 3J7HA 4QDSA 4UAPA 3CDZB 3DYMA 2VZVA 4GWJA 3CZJA 3DYPA 4XURA 3SEEA 2W1SA 3OBAA 3MO4A 2WN2A 1YQ2A 2CDPA 3ETPA 2VCBA 2W92A 4XUOA 1GQPA 4KWUA 2LW8A 2VMCA 2J1AA 3DECA 1CZTA 1GNYA 5IHRA 4PF1A 2BGOA 3A22A 2ID4A 2J1SA 2JD9A 2EICA 4MADA 1XPWA 1UMIA 2VCAA 4AAXA 4QDRA 1L7QA 1IQDC 1UY0A 4CU7A 1K42A 4QX1A 2LS6A 2C26A 2DCJA 2BBAA 2BERA 4P02B 1US2A 2VMDA 1SG3A 3K4DA 5F7UA 4XZUG 3W5NA 3OB8A 2C9KA 1J83A 1LNSA 3T2PA 5JXJA 2WUHA 1OT5A 3FN9A 1UX7A 2V72A 3AC0A 2EIBA 2VMEA 5IFTA 5LA2A 1UY1A 2Z4FA 1JZ8A 2X10A 1JU4A 1UY3A 5HXMA 3WF0A 2C4XA 2Y8KA 2WO3A 5IYYA 1OF4A 1K3IA 2Y6KA 4ZY9A 5DN2A 4ARYA 1GMMA 4W4ZA 1UY2A 3VD4A 2E33A 3ACIA 3WF2A 4CUAA 2WAAA 4KI5M 3GXUA 1ULOA 4ZZ5A 2W94A 5JXIA 1R64A 3I2IA 4QPWA 3CKHA 5CYYA 5G05L 2HYXA 4QB2A 4BDVB 3T0BA 5JUVA 3SEPA 1K45A 2ZXQA 4LKSA 3THCA 1JZ7A 3WF1A 3I3DA 4ET7A 4DXTA 1TVGA 2QQIA 5DPNA 4DXSA 2WQ8A 3GM8A 2VZUA 2W1QA 1OF3A 2QQOA 2VQUA 2Y64A 2Y6HA 1UYXA 2L9LA 5G04L 3GGLA 3MBWA 4QB6A 3HNBM 3WNKA 3K75B 3WNLA 5EJZB 4RYDA 4MO3M 4QX2A 1P8JA 1OD3A 2R7EB 4XUTA 2WO1A 1JYXA 2VR4A 2QQKA 4BK5A 3T0DA 3DYOA 3WNNA 2VZOA 3ACFA 4UI9L 3C7GA 3I97A 2QQMA 3IDAA 3MV11 3OGVA 4HG6B 4LQRA 3JXSA 4CU8A 5LA0A 1CZVA 1JZ3A 1UXZA 3A23A 2VZRA 2J1RA 1D7PM 2YC2A 3MUY1 5FUIA 1O8PA 2W95A 3I2FA 4DEVA 4DUVA 3CZUA 2JKXA 3EYPA 4JKKA 4L0PA 1SDDB 3C8XA 2W1UA 2XOMA 3VDBA 1WKYA 4LPLA 1JYVA 3HEIA 1GOHA 2QQNA 4UOJA 1DYOA 1XNAA 3FHQA 3NNGA 4D8MA 3IB3A 2PQSA 1JU3A 3FHAA 5JR2A 2B4KA 2W91A 4M4PA 3WF3A 2DDUA 3A21A 5IFPA 4JX0A 1UZ0A 2XHNA 1W0NA 1GUIA 4ZXEA 3T2OA 5JXHA 2QBXA 4PT6A 1DP0A 2YC4A 1PMJX 3BN6A 2V5DA 1PX3A 1BHGA 4DUXA 3HN3A 3PUHA 3K4AA 2ZEXA 2E32A 3OG2A 3HJRA 2X05A 2WZEA 1CIYA 2ORXA 4E8DA 2XONA 4GWIA 2W87A 2VMFA 4LHSA 5DQ0A 2E26A 3VDAA 1EUUA 2VQTA 4P00B 1O8SA 2W47A 2YFUA 1NAEA 5LCWL 1K12A 3I2GA 4P5YA 4XVHA 1SHWB 2W1WA 4OUEA 2WYSA 3MV01 1EUTA 1GU3A 2QQLA 3HPNA 2RJ2A 3P1IA 2X09A 3E1F1 4MGQA 4QX0A 2VC9A 4ZZ8A 3K4ZA 5HPOA 2VZ1A 1H6XA 1US3A 4W8JA 1I5PA 3UNPA 3OEAA 2ZEYA 3I2JA 3U37A 4A45A 2E31A 3HOBA 1TG7A 4A42A 2WO2A 4ARXA 4CU6A 1JYWA 1J84A 1RYYA 1UMHA 2BGPA 3NJVA 2B9VA 1NUKA 2JE8A 4XUQA 3LEIA 2VCCA 1L7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EID A;  3T0A A;  5A1A A;  2EIE A;  3LQC A;  2VZQ A;  2W3J A;  4OZO A;  3I2K A;  3T09 A;  3A7Q A;  4QDQ A;  4BK4 A;  4PQQ A;  1NX9 A;  5C70 A;  4OMD A;  1KEX A;  2WZ8 A;  4XUP A;  3C7O A;  1F4A A;  2YFZ A;  3IAQ A;  3C7H A;  1JZ5 A;  1XNT A;  5LA1 A;  1PMH X;  5C7G A;  1F4H A;  4BJ0 A;  3VD9 A;  2VZP A;  2VM9 A;  1W99 A;  3P6B A;  1KGY A;  3III A;  4A4A A;  4RN5 A;  2WAO A;  2WDB A;  3ECQ A;  4A41 A;  4OYU A;  2WN3 A;  1NKG A;  5C71 A;  2J22 A;  4GZ9 A;  2J1V A;  4CUB A;  2WAB A;  2VJX A;  3VD7 A;  4FI9 A;  3HNM A;  4MOA A;  4A6O A;  2VL4 A;  5JMO A;  2XQX A;  3ACH A;  1UWW A;  3UET A;  2Y6L A;  3ABZ A;  2VZ3 A;  3WNP A;  2W5F A;  4IUG A;  4JKL A;  2W9X A;  2Y6G A;  3VD5 A;  3WNO A;  4Z2A A;  4TTG A;  3I3B A;  3CIH A;  3PUI A;  4W50 A;  3MUZ 1;  4MGS A;  2J1T A;  5IJR A;  4DUW A;  3I2H A;  3THD A;  3EB7 A;  4QX3 A;  1GOF A;  1JZ6 A;  2YB7 A;  1CZS A;  1T2X A;  2VOT A;  4YPJ A;  4E8C A;  2HLE A;  3LEK A;  4JKM A;  3T08 A;  3K77 A;  5EIY B;  3NQH A;  2BZD A;  5I0D A;  3LEG A;  2RVA A;  5JXG A;  3UES A;  2VO5 A;  4DXR A;  1UXX X;  1O59 A;  1JI6 A;  3WEZ A;  2W46 A;  2RV9 A;  4P08 A;  3W5M A;  3T2Q A;  2VZT A;  3D3A A;  2JDA A;  3HNY M;  3BGA A;  3SKV A;  4QAW A;  2QQJ A;  3OGR A;  3K46 A;  4XUN A;  5DMY A;  3LE0 A;  3ZM8 A;  2J7M A;  3LPG A;  4QB1 A;  1JYN A;  3WQB A;  5EJ1 B;  3CQO A;  1ULP A;  1W9T A;  3SKJ E;  4DEQ A;  2VTF A;  3OGS A;  1JZ2 A;  1WCQ A;  3CMG A;  3GDB A;  2ZEW A;  2Y6J A;  1H6Y A;  1W8O A;  3OEB A;  3C7E A;  1W8N A;  3WNM A;  2CDO A;  3VD3 A;  2VZS A;  2WBK A;  5B4N A;  1CX1 A;  4JHZ A;  1JHJ A;  4A44 A;  5B4X A;  3WSO A;  3ACG A;  1JZ4 A;  1W9S A;  5CZK A;  4KMQ A;  4CU9 A;  2ZEZ A;  2ORZ A;  4CUC A;  4TXW A;  1UY4 A;  2J1E A;  2OKX A;  3VDC A;  1PX4 A;  4OMC A;  3FL7 A;  2KD7 A;  4BXS V;  2J1U A;  3NJX A;  4CVU A;  3NRU A;  1OH4 A;  3LPF A;  1GOG A;  1UYZ A;  2DCK A;  1MPX A;  1DLC A;  1W9W A;  3IAP A;  1HN1 A;  1XC6 A;  3I3E A;  4AG4 A;  3F2Z A;  4A3Z A;  4D0Q A;  2V4V A;  2YG0 A;  3C7F A;  5J1X A;  1UYY A;  4M4R A;  3WF4 A;  3J7H A;  4QDS A;  4UAP A;  3CDZ B;  3DYM A;  2VZV A;  4GWJ A;  3CZJ A;  3DYP A;  4XUR A;  3SEE A;  2W1S A;  3OBA A;  3MO4 A;  2WN2 A;  1YQ2 A;  2CDP A;  3ETP A;  2VCB A;  2W92 A;  4XUO A;  1GQP A;  4KWU A;  2LW8 A;  2VMC A;  2J1A A;  3DEC A;  1CZT A;  1GNY A;  5IHR A;  4PF1 A;  2BGO A;  3A22 A;  2ID4 A;  2J1S A;  2JD9 A;  2EIC A;  4MAD A;  1XPW A;  1UMI A;  2VCA A;  4AAX A;  4QDR A;  1L7Q A;  1IQD C;  1UY0 A;  4CU7 A;  1K42 A;  4QX1 A;  2LS6 A;  2C26 A;  2DCJ A;  2BBA A;  2BER A;  4P02 B;  1US2 A;  2VMD A;  1SG3 A;  3K4D A;  5F7U A;  4XZU G;  3W5N A;  3OB8 A;  2C9K A;  1J83 A;  1LNS A;  3T2P A;  5JXJ A;  2WUH A;  1OT5 A;  3FN9 A;  1UX7 A;  2V72 A;  3AC0 A;  2EIB A;  2VME A;  5IFT A;  5LA2 A;  1UY1 A;  2Z4F A;  1JZ8 A;  2X10 A;  1JU4 A;  1UY3 A;  5HXM A;  3WF0 A;  2C4X A;  2Y8K A;  2WO3 A;  5IYY A;  1OF4 A;  1K3I A;  2Y6K A;  4ZY9 A;  5DN2 A;  4ARY A;  1GMM A;  4W4Z A;  1UY2 A;  3VD4 A;  2E33 A;  3ACI A;  3WF2 A;  4CUA A;  2WAA A;  4KI5 M;  3GXU A;  1ULO A;  4ZZ5 A;  2W94 A;  5JXI A;  1R64 A;  3I2I A;  4QPW A;  3CKH A;  5CYY A;  5G05 L;  2HYX A;  4QB2 A;  4BDV B;  3T0B A;  5JUV A;  3SEP A;  1K45 A;  2ZXQ A;  4LKS A;  3THC A;  1JZ7 A;  3WF1 A;  3I3D A;  4ET7 A;  4DXT A;  1TVG A;  2QQI A;  5DPN A;  4DXS A;  2WQ8 A;  3GM8 A;  2VZU A;  2W1Q A;  1OF3 A;  2QQO A;  2VQU A;  2Y64 A;  2Y6H A;  1UYX A;  2L9L A;  5G04 L;  3GGL A;  3MBW A;  4QB6 A;  3HNB M;  3WNK A;  3K75 B;  3WNL A;  5EJZ B;  4RYD A;  4MO3 M;  4QX2 A;  1P8J A;  1OD3 A;  2R7E B;  4XUT A;  2WO1 A;  1JYX A;  2VR4 A;  2QQK A;  4BK5 A;  3T0D A;  3DYO A;  3WNN A;  2VZO A;  3ACF A;  4UI9 L;  3C7G A;  3I97 A;  2QQM A;  3IDA A;  3MV1 1;  3OGV A;  4HG6 B;  4LQR A;  3JXS A;  4CU8 A;  5LA0 A;  1CZV A;  1JZ3 A;  1UXZ A;  3A23 A;  2VZR A;  2J1R A;  1D7P M;  2YC2 A;  3MUY 1;  5FUI A;  1O8P A;  2W95 A;  3I2F A;  4DEV A;  4DUV A;  3CZU A;  2JKX A;  3EYP A;  4JKK A;  4L0P A;  1SDD B;  3C8X A;  2W1U A;  2XOM A;  3VDB A;  1WKY A;  4LPL A;  1JYV A;  3HEI A;  1GOH A;  2QQN A;  4UOJ A;  1DYO A;  1XNA A;  3FHQ A;  3NNG A;  4D8M A;  3IB3 A;  2PQS A;  1JU3 A;  3FHA A;  5JR2 A;  2B4K A;  2W91 A;  4M4P A;  3WF3 A;  2DDU A;  3A21 A;  5IFP A;  4JX0 A;  1UZ0 A;  2XHN A;  1W0N A;  1GUI A;  4ZXE A;  3T2O A;  5JXH A;  2QBX A;  4PT6 A;  1DP0 A;  2YC4 A;  1PMJ X;  3BN6 A;  2V5D A;  1PX3 A;  1BHG A;  4DUX A;  3HN3 A;  3PUH A;  3K4A A;  2ZEX A;  2E32 A;  3OG2 A;  3HJR A;  2X05 A;  2WZE A;  1CIY A;  2ORX A;  4E8D A;  2XON A;  4GWI A;  2W87 A;  2VMF A;  4LHS A;  5DQ0 A;  2E26 A;  3VDA A;  1EUU A;  2VQT A;  4P00 B;  1O8S A;  2W47 A;  2YFU A;  1NAE A;  5LCW L;  1K12 A;  3I2G A;  4P5Y A;  4XVH A;  1SHW B;  2W1W A;  4OUE A;  2WYS A;  3MV0 1;  1EUT A;  1GU3 A;  2QQL A;  3HPN A;  2RJ2 A;  3P1I A;  2X09 A;  3E1F 1;  4MGQ A;  4QX0 A;  2VC9 A;  4ZZ8 A;  3K4Z A;  5HPO A;  2VZ1 A;  1H6X A;  1US3 A;  4W8J A;  1I5P A;  3UNP A;  3OEA A;  2ZEY A;  3I2J A;  3U37 A;  4A45 A;  2E31 A;  3HOB A;  1TG7 A;  4A42 A;  2WO2 A;  4ARX A;  4CU6 A;  1JYW A;  1J84 A;  1RYY A;  1UMH A;  2BGP A;  3NJV A;  2B9V A;  1NUK A;  2JE8 A;  4XUQ A;  3LEI A;  2VCC A;  1L7R A; 
#chains in the Genus database with same CATH topology
 4H7L A;  5J36 A;  4Q4X 3;  5A1A A;  4MUV A;  3USU A;  4COZ A;  1Z0H A;  5FZ4 A;  1Q5O A;  4GMP 3;  1HRI 2;  2WII B;  2ZGT A;  3I2K A;  1RUH 1;  4EWD A;  1Y9Q A;  1YFU A;  1DQ1 A;  3WCR A;  2VE1 A;  2ZMN A;  1ENR A;  1CQ9 A;  2JDK A;  3KF3 A;  1MAC A;  2RG4 A;  3FC0 A;  4CP0 A;  1APN A;  1EV1 1;  1GV9 A;  2GP3 A;  5C70 A;  3H9A A;  4FTE A;  4YZ5 A;  4GKY A;  1W8F A;  3BPZ A;  4LO7 A;  1CAV A;  1HV0 A;  1JZ5 A;  1XNT A;  1N3Q A;  1ZVF A;  3OUH A;  4Q4Y 1;  3WDV A;  1RUF 2;  4JTN A;  4PI0 A;  5KHI A;  4FPJ A;  5LA1 A;  1M06 G;  2XR4 A;  2OUH A;  3VD9 A;  1PGL 2;  2OA2 A;  4GB3 1;  3VZL A;  1SLB A;  4BU2 A;  3BUC A;  3AYC A;  1GWK A;  3BYW A;  4YG0 A;  5LBC A;  4A4A A;  1AL2 3;  4RN5 A;  4O65 A;  3AMQ A;  3Q8B A;  4Y4R A;  1OQ1 A;  3ECQ A;  1E5H A;  2GC2 A;  3GZU C;  2J22 A;  4CUB A;  2VXJ A;  2WAB A;  2VJX A;  4HET A;  1YC6 1;  1LU1 A;  4MOA A;  2YC0 A;  3K2O A;  4A6O A;  5JMO A;  2WRA A;  1KFX L;  3MHZ A;  3NO8 A;  4EV0 A;  1VBB 2;  2YBS A;  1RUG 2;  1W9F A;  4ZPI A;  2VZ3 A;  4IUG A;  3PIG A;  4JKL A;  1GP6 A;  4M00 A;  3Q9O A;  4PLM A;  4Q4X 1;  3WNO A;  4Z2A A;  3QH6 A;  3ASI A;  4GMP 1;  5GM0 A;  3RNS A;  1KRI A;  1V6L A;  2E6V A;  4M3C F;  5C3Q A;  5BYN A;  1QJY 2;  1AYM 3;  4KBZ A;  1GZC A;  2J1T A;  3OY8 A;  4DUW A;  1A3K A;  2Q5T A;  3IIA A;  4JRA A;  3V0A B;  5H9P A;  1H2K A;  3LEM A;  1I9R A;  2Z42 A;  1C8M 2;  1HRV 2;  4RR3 C;  1T2X A;  2XKP A;  4X8P A;  2R32 A;  3JD7 2;  4E8C A;  5HXV A;  3LEK A;  4N9I A;  4JV4 A;  1FI2 A;  2QKD A;  3VZK A;  5I0R A;  2XWB B;  1BK1 A;  4CDW B;  3FLP A;  2RM2 2;  2HYK A;  1AR7 2;  4NRM A;  1AL2 1;  5I0D A;  1AJO A;  3WUC A;  3OD0 A;  3OGJ A;  2CV6 A;  2E51 A;  1V6J A;  1MS1 A;  1U5X A;  2JWP A;  1QQP 2;  1SMV A;  3E5Q A;  1O59 A;  5FMO L;  2I07 B;  2I2S A;  2ZKL A;  3HBZ A;  3WEZ A;  2W46 A;  2ZHN A;  2RV9 A;  3DKW A;  4P08 A;  3VDD B;  1H2M A;  1R1Z A;  4WZC A;  2WKK A;  5F32 A;  2OZJ A;  3M1H A;  4RQP C;  1HV1 A;  5F5A A;  4OUL A;  2BNN A;  2TEP A;  1TNR A;  1ULD A;  4IND A;  1EAH 3;  4RD7 A;  3NST A;  3O1U A;  5HBA A;  2JE9 A;  5EZW A;  3RJ2 X;  2R30 A;  4QPG A;  4XUN A;  4BIS A;  4LK7 A;  5DMY A;  3ZM8 A;  2W52 A;  2Y0I A;  3LB9 A;  4OI0 A;  4XPV A;  5BNN C;  5A3O A;  4IXL A;  2WNO A;  3AZW A;  2XLG A;  1BMV 1;  2BWA A;  4B4R A;  4AW7 A;  1AYM 1;  3NJZ A;  5CEH A;  2XJS A;  1OOP A;  4AVA A;  2DYC A;  4IE6 A;  5EJ1 B;  2UY8 A;  4F8A A;  2IZW A;  5FYC A;  1YCI A;  1RUC 2;  3CJI A;  4HK9 A;  3OGS A;  4NPL A;  1WCQ A;  2XUM A;  3CMG A;  2OXB A;  3GDB A;  1JOD A;  5A32 B;  2DUR A;  1FPN 3;  2ZGS A;  4QGN A;  3I49 A;  4PIZ A;  2NN8 A;  2XQR A;  4GH4 A;  3TEZ A;  1W8O A;  4LIV A;  4PQ9 A;  5FK8 A;  3T1M A;  1ND3 B;  2QQW A;  1OLQ A;  5KR7 A;  2CDO A;  2VZS A;  1X9P A;  2WBK A;  1PGS A;  4JHZ A;  2E53 A;  3AKP A;  1QDC A;  2PHT A;  3HQX A;  2UWC A;  2VQA A;  5CNA A;  5FYZ A;  2QUO A;  1UOJ A;  3ACG A;  4AFA A;  4FPL A;  4XCA A;  4KMQ A;  4AEJ A;  1W2N A;  2CYF A;  4ZU4 A;  3IWZ A;  4OI1 A;  1AUY A;  1C57 A;  2ZEZ A;  2JIG A;  1CAX A;  2ARB A;  1UY4 A;  3K3O A;  1F2N A;  4CCD A;  1J3Q A;  3GBG A;  1SBF A;  4R9B A;  4CP9 B;  1EAH 1;  2RDN A;  3ZFG B;  3FL7 A;  1ZA4 A;  5L19 A;  3BKZ A;  1DIW A;  5C6C A;  4XAC A;  4Y26 A;  3BU0 A;  3LF7 A;  4K8R B;  3NKT A;  3NV1 A;  1ND2 B;  4YRD A;  1RGS A;  5A7O A;  1UQX A;  2CHH A;  3MW4 A;  5FUN A;  1PGW 2;  1YI9 A;  1OH4 A;  2PFW A;  1GOG A;  1MPX A;  2PLV 2;  3GZT B;  3UV9 A;  4JRL A;  4GJZ A;  2VY0 A;  3NAP A;  2XXZ A;  5I0T A;  4RHV 3;  3MZH A;  1COV 3;  2ZAC A;  3IAP A;  4MXW A;  2ZS6 B;  3I3E A;  1HN0 A;  1QJF A;  3F2Z A;  3FE5 A;  4GAZ A;  4D0Q A;  2V4V A;  1ODM A;  2ES3 A;  2YG0 A;  4FO9 A;  2FCT A;  2ZOE B;  4M4R A;  1Q8Q A;  2AR6 A;  1JUH A;  1DDL A;  1FPN 1;  4XFA A;  2P3I A;  3AK0 A;  4QDS A;  4Y3O A;  4LO5 B;  4PDW C;  5F3I A;  4A7Y A;  4K8F A;  5HCB A;  1C1F A;  1GR3 A;  4V2W A;  3W59 A;  3DYM A;  2VZV A;  4AED A;  4QPY A;  3ZDV A;  1QU0 A;  2W2I A;  5IVE A;  3IN9 A;  1YQ2 A;  1MS4 A;  2CAU A;  1YFY A;  4XXP A;  1NA1 A;  2CSG A;  4FXK B;  3ETP A;  5D1I A;  1EYB A;  2VCB A;  5IWF A;  4XUO A;  3U0Z A;  5A3T A;  4HVR A;  4Q1R A;  1CVN A;  3SH5 A;  3T3Y A;  4FAG A;  4X6Q B;  4LUK A;  1DYP A;  2IXL A;  1FYU A;  1VRH 1;  2JX9 A;  2OPW A;  4ASK A;  1RUE 3;  4QU2 A;  1JOB A;  2GMM A;  1HQN A;  4AXO A;  5A3L A;  3I7D A;  3KV9 A;  2CWS A;  3ZR5 A;  3A22 A;  2JB8 A;  2FDH A;  2ETE A;  4CXY A;  1N1V A;  1UIJ A;  2J1S A;  3VBH A;  2JD9 A;  4KGQ A;  5A6Y A;  1OA4 A;  4IET A;  1QWR A;  1K42 A;  1IQD C;  2R04 2;  2ZX0 A;  3EHK A;  4CU7 A;  3SQO A;  1W6M B;  4RHV 1;  1COV 1;  3PNA A;  3VHN A;  3PUR A;  3D6E A;  5FYB A;  2ILM A;  4FT8 A;  4UYB A;  3RWK X;  4BME A;  4ZON A;  1SCS A;  1SG3 A;  5L36 A;  4RS5 C;  3NV2 A;  3ES1 A;  4KQ7 A;  5A33 B;  3OCP A;  1J83 A;  5FZ9 A;  1PO2 2;  3T2P A;  1WD3 A;  2V73 A;  5LEJ A;  1ULF A;  5DUX A;  4IW3 A;  1OT5 A;  1ASJ 1;  1VBC 3;  1BLZ A;  5CIR A;  2EIB A;  4AI0 A;  2WQ4 A;  5LW9 A;  3OOX A;  5IFT A;  3ZN6 A;  1XYP A;  4XAB A;  3GYD A;  4GA9 A;  1S2K A;  1ZZ6 A;  4JGY C;  1O4Y A;  3WDT A;  4LOS A;  2C4X A;  2Y8K A;  3D4K A;  1MR5 A;  2CGO A;  2RS1 3;  2WO3 A;  5LY1 A;  1YEW A;  1RB8 G;  1RTV A;  1SQ4 A;  1S0B A;  2QE3 A;  1RUE 1;  2WT0 A;  3AP4 A;  4DY3 A;  3ELN A;  5F3G A;  4EJR A;  5JPN B;  1SLA A;  2FDJ A;  4DOU A;  5FZ0 A;  1UOB A;  3UKT A;  2QQU A;  2QQP A;  4NII A;  3SIT A;  2ZHK A;  3GCW A;  3WF2 A;  5I8Y A;  4ASM B;  4FFF A;  2D97 A;  4KI5 M;  4YM3 A;  3B3Q E;  3DL3 A;  4FPC A;  3DEM A;  4HPK B;  3DPR B;  1NCQ B;  1ULO A;  5F5I A;  1ND3 C;  3OYW A;  5A80 A;  1PK6 B;  2D6P A;  4CPB A;  1H1I A;  1ENX A;  4WM8 B;  2W94 A;  5LWB A;  2Z5W A;  4XBL A;  2G19 A;  1H8T A;  5EP9 A;  5CYY A;  1W9Y A;  1QGL A;  3O1V A;  5FPB A;  1SBD A;  1WCU A;  2I45 A;  4BQ5 A;  1IKP A;  1JUI A;  4Y22 B;  5BNP C;  4FPK A;  4HZF A;  5JWP A;  3T0B A;  4BH9 A;  2Q8O A;  1PZ9 A;  2G1M A;  3SEP A;  5JUV A;  1V6I A;  4XQD A;  4ONU A;  3THP A;  3THC A;  4AYU A;  5CG9 A;  1VP6 A;  1JZ7 A;  2XVL A;  3L9J T;  4QHB A;  3WF1 A;  5FZI A;  2ARA A;  4XIL A;  3ZYH A;  2WZR 3;  3HAG A;  1VBC 1;  5C9A C;  2D44 A;  4Y20 A;  1IS4 A;  1VIW B;  3E6C C;  3USS A;  4C90 A;  2YMZ A;  1XYO A;  1NY7 1;  4FOY A;  4S2H A;  5JLV A;  1QNW A;  4W65 A;  2Y64 A;  2VQU A;  4QKN A;  4R8H A;  4AEK A;  4EZH A;  1JYT A;  3BTY A;  4D6R A;  2UWA A;  3RPQ A;  4A3X A;  3GGL A;  3MBW A;  3B93 A;  5DDJ 2;  1ZZ9 A;  2RS1 1;  4HT1 T;  3RZM A;  1DGW A;  5IUQ A;  4AFB A;  3WD5 A;  3T30 A;  2GU9 A;  4QX2 A;  2BFU S;  2K9Z A;  4XF0 A;  4B29 A;  1OD3 A;  2WWJ A;  3CJX A;  2GND A;  4AGR A;  5ABJ C;  4LE3 A;  2VOV A;  4LO8 A;  4OFG A;  4BK5 A;  1NZI A;  3SMH A;  2A7A A;  4F83 A;  4LBO A;  3U11 A;  3R4S A;  3ACF A;  4FTB A;  3H1Y A;  4NRO A;  1MZF A;  2QQM A;  4Q0S A;  4Q4W 2;  2ADD A;  1W2T A;  2PA7 A;  4R9A A;  1W0P A;  3VBR B;  3WY6 A;  4CCO A;  1ZZB A;  4XFG A;  4CU8 A;  5FPX A;  3VBU A;  1J1L A;  5I0S A;  3U4X A;  3T1L A;  2HWC 3;  5F2S A;  1PVC 3;  1R1A 2;  1TMF 3;  3AP6 A;  3O12 A;  3HR9 A;  1SPP A;  3LIH A;  2YC2 A;  1GZW B;  2YPJ A;  5FP4 A;  4FP3 A;  4ATE A;  1D0G A;  3VBF B;  2JJ6 A;  2OYZ A;  2IVI B;  1J58 A;  1VAV A;  2EAA A;  1GWM A;  1D0H A;  3GBF A;  4CCC A;  5A7W B;  1POV 3;  3IPV A;  1DG6 A;  4DB5 A;  4DEV A;  2WZR 1;  5FUP A;  4IEO A;  3CZU A;  3PHM A;  1YQ8 A;  4R4Z A;  4L0P A;  1O3T A;  4EN9 B;  1FNZ A;  4LMF A;  1CON A;  4B7E A;  4E4D X;  2XKO A;  4AQS A;  1S0F A;  2HWB 2;  5FZO A;  3VDB A;  2VU9 A;  2XG3 A;  4DNY A;  5CVR A;  1AXZ A;  4EN6 B;  2Z69 A;  1VR3 A;  3NNG A;  2B9U A;  4ZU5 A;  5L9B A;  1JTZ X;  4BQY A;  1JU3 A;  3VBO A;  4QXB A;  1DQ5 A;  2RMU 2;  2A5Z A;  3VKM A;  1VBD 2;  3B01 A;  2OT7 A;  1HQL A;  2ARX A;  4UW4 A;  4YM1 A;  4YZ2 A;  2YDE A;  3N9M A;  3BIW E;  2HWF 3;  5IT6 A;  2TNF A;  1LOF A;  3OBT A;  4BLJ A;  3GJB A;  4PCR A;  2XHN A;  2ADE A;  1H2N A;  5EPA A;  4FPY A;  1ALY A;  4A6S A;  2VAU A;  1VMH A;  4FPE A;  4LBJ A;  2JG8 C;  2Q1F A;  2GZW A;  2HWC 1;  5FR3 A;  1DP0 A;  1PVC 1;  3DV8 A;  2E7A A;  1TMF 1;  2FDI A;  4OQ8 A;  3NL1 A;  3N35 A;  4XW3 A;  5K8S A;  3LSD A;  1PMJ X;  3BN6 A;  5F3E A;  2KXL A;  5FCC A;  1ZBE 3;  4DUX A;  4CDU B;  2X53 S;  1UKR A;  2B7Y A;  1XQN A;  2E32 A;  2ZEX A;  4IGO A;  4TLG A;  3V56 A;  3AKS A;  4AR2 A;  4OVE A;  2ORX A;  4N9H A;  3V65 A;  2WNU A;  4KBB A;  4CDQ A;  1VE0 A;  3DN7 A;  1XU1 A;  4Q8L A;  3VV1 A;  1GNZ A;  1K5J A;  5DXD A;  2BBV A;  4XIK A;  3ZFF A;  1DQ0 A;  4P9J A;  4JDO A;  2E26 A;  1OPO A;  4LT5 A;  2VQT A;  5A6X A;  3HT2 A;  2A6Z A;  2W47 A;  4D7S A;  2YFU A;  3AKQ A;  5BXX A;  4ISQ A;  3R6S A;  1QXP A;  4XDQ A;  4XOG A;  5FZC A;  5A70 A;  5L7O B;  4CDX A;  2D6M A;  4W6Y A;  2NMN A;  4WM8 C;  3JUU A;  5FLJ A;  2W1W A;  3WCS A;  5ISL A;  3UL2 A;  2HWF 1;  2PHL A;  2WNV C;  1EUT A;  2LAL A;  3AYE A;  3L2H A;  2JDN A;  1FMD 2;  3UKN A;  2DVB A;  2B45 X;  3T4H B;  1YI7 A;  4MGK E;  5ACA 2;  1WMD A;  1JXN A;  3ZXA C;  1Q3E A;  2X09 A;  3EMR A;  4XFI A;  3BI3 A;  2YGM A;  4N53 B;  4NHK A;  4FQZ A;  4AWD A;  5FPA A;  5JXG A;  3N9O A;  4ZZ8 A;  3K4Z A;  3IZO A;  3ZO0 B;  4QPI C;  5HPO A;  2PHW A;  4W8J A;  2W0X A;  2NPI A;  2CAV A;  1RXF A;  2D6K A;  3NW4 A;  4HKL A;  1ZBE 1;  4DRR A;  5GLZ A;  3I2J A;  3U37 A;  3KV5 A;  1VBE 3;  2DU1 A;  5T52 A;  2XJP A;  1VB2 A;  1BZW A;  3AYA A;  4A42 A;  3WG2 A;  4ARX A;  4AHX A;  4CZS A;  4CU6 A;  1JYW A;  3KM5 A;  4MV2 A;  3S5A A;  1MEC 2;  1PMI A;  2BNO A;  3ZXF A;  4YVS B;  1IHM A;  2B9V A;  1I3H A;  5C8W A;  1XXN A;  5C4W B;  4CYD A;  2EID A;  3T0A A;  4WM7 B;  2QDR A;  2VZQ A;  3TBD A;  1XYN A;  4BM8 A;  1FXZ A;  2AEZ A;  3KV6 A;  3VBR C;  3T09 A;  3J8F 3;  3A7Q A;  2FQP A;  3J26 N;  1OC1 A;  1VRB A;  4QX8 A;  5T55 A;  3LDB A;  4PQQ A;  4QHO A;  5A7N A;  2XJQ A;  5FP8 A;  1URX A;  5A7P A;  2DCZ A;  4HXC A;  3F95 A;  4UBG A;  5FZ3 A;  1HRI 3;  1Y7B A;  4XUP A;  4URA A;  5I93 A;  5LRR A;  5E89 A;  3IMM A;  4XCB A;  3PUA A;  4YGB A;  3VBF C;  5IK7 A;  5FKB A;  3POF A;  5C7G A;  3ZMO A;  5K0U B;  2VZP A;  3LZZ A;  3OSD A;  1W99 A;  3T2T A;  5JOZ A;  1LOE A;  4NAM A;  1VMJ A;  1UOF A;  3VZO A;  1KGY A;  1IG3 A;  5GLT A;  3EXU A;  5CFD B;  1YO8 A;  1AR9 3;  1XB9 A;  3OUI A;  4CUG A;  4A41 A;  1MZ5 A;  1KD7 A;  4HKW A;  4AI3 A;  1NKG A;  1VBE 1;  3BB6 A;  4XQ4 A;  4JVA A;  3CHX A;  2VUC A;  1H9P A;  1H9W A;  2OII A;  3MW2 A;  4FPH A;  4XET A;  4N43 A;  4IV3 C;  4XFB A;  4NIH A;  3WR0 A;  1WCD J;  4HK8 A;  2C5D A;  3ACH A;  1RMU 3;  1UWW A;  5BPX A;  4R4X A;  3RZH A;  4BIO A;  2Y6L A;  2YHJ A;  4Z8B A;  3WNP A;  1RUI 2;  2NZ9 A;  3EBR A;  1HXS 3;  4XC9 A;  2SLI A;  1EPZ A;  2Y6G A;  1WW7 A;  2RS3 3;  4Z1V A;  4PIX A;  4YW2 A;  1HB3 A;  1W6N A;  2WR9 A;  3PUI A;  4P14 A;  4AL9 A;  4NN0 A;  3ST7 A;  1EPW A;  4HVQ A;  1LJ7 A;  2JIC A;  3E97 A;  2YXS A;  3J8F 1;  2AZ5 A;  4I09 A;  1OH3 A;  4JDN A;  2RDS A;  4FCA A;  4Y5Z 0;  3I2H A;  2OUJ A;  3EO6 A;  5FJK A;  5D2A A;  5FZL A;  4A7K A;  5FYM A;  2RDR A;  4L8Q A;  1HRI 1;  2VMH A;  4QX3 A;  1BEV 2;  2D98 A;  4ZHN A;  3CO2 A;  1CZS A;  4G4F A;  2R49 A;  4YPJ A;  5BNO C;  2HWE 2;  4XTM A;  2PQQ A;  3B7M A;  4UFI A;  4JKM A;  5JSO A;  4I0W B;  3O0W A;  4HON A;  4O9E A;  2YBP A;  1STM A;  4EE2 A;  2J42 A;  1FT9 A;  3WOG A;  3ES4 A;  2ZKN A;  5L73 A;  3JD7 3;  3VBS B;  4NID A;  2K0G A;  3IM0 A;  5H9S A;  1Z78 A;  1AR9 1;  1F8V A;  3DGT A;  1WLT A;  5AVA A;  5KC6 A;  2GC3 A;  5DZG A;  1AR8 3;  4XF3 A;  4Z07 A;  2XL7 A;  4XZP A;  3TN9 2;  1G9D A;  1MQT B;  4S2F A;  4L11 A;  2RR1 2;  5L7O C;  3KCX A;  2ZGO A;  5CAD A;  1RMU 1;  1ULE A;  3MYX A;  1RL3 A;  4ZU7 A;  3VL8 A;  5C3O A;  1ZRE A;  5LBE A;  2ZCW A;  4YVW C;  2YGL A;  1HXS 1;  3OGR A;  1PHM A;  1HDK A;  1XNB A;  2RS3 1;  3ZXL A;  2YPD A;  3WXP A;  3N7L A;  1V00 A;  1K5M A;  2Q0A A;  4XMI A;  5DUW A;  5JZG C;  4HL0 A;  2BYV E;  2FZ2 A;  4BXF A;  4CEW A;  1LEM A;  1HJF A;  4GMP 0;  3ZDS A;  2JG9 B;  2LRP A;  5CAZ A;  2VBD A;  4GD4 A;  2FZ1 A;  2TBV A;  3ZYG A;  1S0E A;  4DEQ A;  1JZ2 A;  1V9U 2;  2BP6 A;  1QJX 1;  2WWS A;  2Y6J A;  3LFM A;  2KA3 A;  3RSJ A;  1J3P A;  3OEB A;  3O1R A;  4KNC A;  4UW3 A;  1NCR A;  5B4N A;  1OPM A;  3JD7 1;  1GP5 A;  1OLR A;  1JHJ A;  1SLL A;  4O9G A;  4C0B A;  1C5H A;  4LBK A;  4QKD A;  5B4X A;  4EWE A;  5A7Q A;  1OBN A;  4M0H A;  4ES8 A;  1AR8 1;  1MVE A;  2BU9 A;  4WM7 C;  4Y1X A;  1N1T A;  1W9S A;  1JZ4 A;  1DGW X;  2UWB A;  4XTP A;  1VAM A;  5IVF A;  1V6O A;  3MF9 A;  3ZSL A;  5JR7 B;  1ULG A;  2PAE A;  4XJA A;  3OUJ A;  3ZFE A;  1J1T A;  1JOJ A;  3AM2 A;  4CSW A;  5C8C A;  4GWN A;  4MET A;  3C3V A;  1W6O B;  4Y1U A;  2VGD A;  2Q8D A;  4UFH A;  5GZF A;  2KD7 A;  3BOD A;  4BXS V;  4K1Y A;  1AYN 3;  2HWD 2;  3WW3 A;  4ORF A;  1DGL A;  2X5I A;  2PHD A;  1WZX A;  5FYV A;  4C91 A;  4CVU A;  2OW4 A;  1OI6 A;  4OCT A;  5K0U C;  3L2Y A;  2PTM A;  2W39 A;  3H3U A;  1KDM A;  3M4F A;  1L3J A;  2HH9 A;  1IQA A;  3HIF A;  1GIC A;  3ZXG A;  4A3Z A;  4CCL A;  5CFD C;  3N9Q A;  4Q2F A;  4M3C A;  5J1X A;  3VZM A;  2YU2 A;  4RL7 A;  1Y9M A;  2K46 A;  4W6W A;  3WF4 A;  1MS9 A;  3UGF A;  4BMB A;  1LTE A;  4M0N A;  4MHU A;  4PDW B;  1LOB A;  4GWJ A;  1ST8 A;  3CZJ A;  3ZR6 A;  2QVS B;  3DYP A;  3KF5 A;  4XUR A;  4QX5 A;  4I01 A;  5H9Q A;  3DUI A;  3MO4 A;  3N3H A;  3GBW A;  4E4H A;  4Q4V 2;  2CDP A;  1UU5 A;  2ZGL A;  1RED A;  4GUL A;  2B5H A;  2FBE A;  4ISR A;  1CAW A;  5FMB A;  1UU6 A;  2W92 A;  1S0J A;  2LW8 A;  4D3W A;  3TWI A;  1KQR A;  2VMC A;  4YW7 A;  3AMN A;  5E1R A;  5FOB B;  4BE3 A;  1TE1 B;  1GKB A;  1QOT A;  2X29 A;  4IE0 A;  1QJU 3;  3DEC A;  4AGV A;  4YLZ A;  1OSG A;  4MHR A;  5C3S A;  4PF1 A;  3V0B B;  1E5I A;  1PIV 3;  3S7E A;  5DAB A;  2YV8 A;  1CAU A;  1DZT A;  2BEO A;  1AYN 1;  2ID4 A;  4KH9 A;  2WO7 A;  3MEP A;  3TEX A;  1YQ5 A;  4L9B A;  3BTZ A;  2VCA A;  4AAX A;  1RUO A;  1L7Q A;  1OVP A;  4E27 A;  4YAR A;  4AVT A;  1WBF A;  5KHJ A;  4XJZ A;  4Y5T A;  3MI8 A;  2BBA A;  1BBT 2;  1ZBA 3;  2AUY A;  4IEW A;  3DKQ A;  4NHY A;  5CKM A;  3VBS C;  1US2 A;  2XBO 2;  5CFC A;  1N47 A;  2VMD A;  1POQ A;  2XLF A;  4YSF A;  1NQD A;  4XZU G;  2PAK A;  2R04 3;  2Y38 A;  2UYA A;  4AQ2 A;  2C9K A;  2WL1 A;  2WFF 2;  3I59 B;  1LNS A;  1MQT C;  1QNY A;  4RS5 B;  5LK5 A;  1JOP A;  3WP4 A;  4B8E A;  4PHZ A;  4RR3 A;  4FSJ A;  4GAL A;  1AR6 2;  1WA4 A;  4OHZ A;  2EXK A;  4WVM B;  3HD8 B;  4KWJ A;  5FXZ A;  1N1S A;  3ALQ A;  4QM8 A;  2YY1 A;  2VME A;  2O8O A;  3VKF C;  1LOC A;  1LHU A;  4WBB A;  1YJK A;  1DGR A;  1GQH A;  3POJ A;  4GIQ A;  1JN2 P;  5A1F A;  2C6S A;  3H8R A;  1IOA A;  1UY1 A;  1JZ8 A;  4MGT A;  4QXH A;  2AYH A;  2VNO A;  1KFU L;  2BPA 2;  1W03 A;  1Q8O A;  4KU8 A;  3MGU A;  3I3Q A;  3PMS A;  3WP6 A;  2H6C A;  4IES A;  3WQ0 A;  4JGY B;  2JG9 C;  1CIW A;  4XFH A;  1QJU 1;  1CES A;  1RUH 2;  2BRT A;  3FJS A;  4BIF A;  3HBK A;  1PM7 A;  4RQP A;  1PIV 1;  3KT4 A;  3VD4 A;  1OVS A;  2CTV A;  2CGP A;  5K9Y A;  4QQP A;  1DQ4 A;  4MLO A;  3M70 A;  4C1W A;  3CJI C;  4U36 A;  4LHK A;  5EQU A;  5BNN A;  1UW8 A;  4Q4Y 2;  2P6H A;  4N7U A;  2C9A A;  3AXE A;  5JXI A;  1UKG A;  1YUD A;  4YYO A;  1R64 A;  1ZBA 1;  2CU5 A;  4GB3 2;  4Q1P A;  4X6R B;  4FBF A;  2DF7 A;  3RG0 A;  5G05 L;  3FFZ A;  4QT6 A;  3ZYP A;  1JMU B;  2HEY F;  1MZE A;  3X29 B;  1I6X A;  3KSC A;  2R04 1;  1IZ3 A;  4PBP A;  2UU8 A;  5BNP B;  2NM1 A;  2D7F A;  1UD1 A;  3WZ1 A;  4HSJ A;  4BB3 A;  1GP4 A;  2BVB A;  2IWG B;  3VKO A;  2VG9 A;  2ZAH A;  4Q0P A;  1ZZ8 A;  4DXS A;  2WQ8 A;  3GM8 A;  3ZPY A;  5C9A B;  1OUX A;  1WW4 A;  1QKQ A;  3MIH A;  3MFA A;  5GLV A;  2FD8 A;  1OF3 A;  5FZA A;  1BXH A;  1UYX A;  4N8M A;  2BFU L;  5GJ6 A;  5A3N A;  1SAC A;  3P3P A;  3GZA A;  5E16 A;  1WGP A;  1RHI 3;  2A6W A;  2JDU A;  2FDF A;  2VR4 A;  1FAY A;  3ZKY A;  4CP1 A;  2LRO A;  4AHZ A;  3DYO A;  3NAP C;  4IEU A;  5ABJ B;  4UI9 L;  1G8W A;  1RVF 3;  3FFQ A;  4IV1 B;  3I97 A;  2WIN B;  2ZGN A;  2PHX A;  1ZRD A;  2BOI A;  1WCS A;  4P9W A;  5F5C A;  1QJE A;  5LA0 A;  2RJL A;  1ULC A;  1CZV A;  2A6X A;  3RYR A;  1JZ3 A;  4XBQ A;  4LE4 A;  4EWA A;  1CD3 G;  1IS5 A;  1AL2 2;  5GKA C;  5GLU A;  2E7Q A;  5SV8 A;  2WS9 3;  3AJY A;  4H3W A;  2Y33 A;  1OQD A;  1HKD A;  3GF6 A;  2VW0 A;  2XJT A;  3G7D A;  2RS5 3;  4LKD A;  4PLO A;  1BCX A;  1WLW A;  1E57 A;  3M8L A;  5I0U A;  4BQX A;  4LIU A;  3C8X A;  2GP5 A;  4NOT A;  1W06 A;  1NLS A;  4JC1 A;  3HEI A;  3MF6 A;  3TRS B;  4D8M A;  3QD6 A;  3FHQ A;  1PO1 2;  2PQS A;  1RHI 1;  4JGZ B;  4F3J A;  3LGR A;  3ZYI B;  1EP0 A;  2HWB 3;  2N7G A;  5M0T A;  1BMV 2;  1IS3 A;  1NT0 A;  1AYM 2;  1RUN A;  4Z82 A;  1ENQ A;  4P9G A;  1WWY A;  2NLR A;  4P9Y A;  4MX3 A;  2VOX A;  2P37 A;  1G6N A;  1U5I A;  3H42 B;  4QHZ A;  3DF0 A;  3WF3 A;  1RIT A;  3G6J B;  3AYD A;  3ME2 A;  3LD8 A;  3H7J A;  4JX0 A;  1RVF 1;  3V0A A;  3MFC A;  4QX7 A;  1WD4 A;  1S1A A;  3TNP B;  2RJK A;  5JXH A;  1Z7S 3;  3S57 A;  4BHP A;  1JYI A;  1I5Z A;  4XJ8 A;  5E88 A;  4MGZ E;  1H4H A;  4OI2 A;  3GHM A;  5FP7 A;  2XJV A;  5J7M A;  1TME 3;  4CDW A;  4LO6 B;  2JG8 B;  3H50 A;  1NLR A;  2WFP A;  2WS9 1;  1PX3 A;  1BHG A;  2WA4 A;  3LA7 A;  3HN3 A;  4IQP A;  3PUH A;  2EAL A;  4LA2 A;  4XE9 A;  3K4A A;  3LDK A;  3W21 A;  2RS5 1;  2JDH A;  2X05 A;  2VVE A;  5LEK A;  2Y6F A;  4N7I A;  3VDD A;  1D4M 3;  2OQ6 A;  4E8D A;  2GDF A;  3FBY A;  4Q0Q A;  2IUW A;  4LTA A;  1G9C A;  4BOW A;  1DZQ A;  3CF6 E;  2VMF A;  5DQ0 A;  1UMZ A;  1Q8P A;  2A73 B;  1EAH 2;  1YRZ A;  4GWM A;  4QXK A;  5LB6 A;  3WW1 A;  3ZYB A;  5B2G B;  3S0M A;  1PZ8 A;  1N1Y A;  4FFI A;  5EYX A;  4P00 B;  1O8S A;  1GZT A;  4UFJ A;  2KR2 A;  4JQT A;  2ZHL A;  5FPL A;  2BUK A;  4B4Q A;  1UF2 C;  5LCW L;  4K1Z A;  4L92 A;  1CR7 A;  4XVH A;  1W6Q B;  1F5J A;  1W6P B;  2R16 A;  5FZD A;  4C8D A;  1ONA A;  4COW A;  4XF1 A;  1NLQ A;  4OUE A;  2BV4 A;  2JE7 A;  2WYS A;  5AFE A;  2NP0 A;  4FFH A;  3MV0 1;  5KC5 A;  3ILR A;  5FXX A;  2VUD A;  2OZ6 A;  4DZG A;  2WNV B;  2QQV A;  3HPN A;  1RUJ 3;  1H8T C;  2RJ2 A;  4LBQ B;  3B5L B;  3IDE A;  5DAP A;  5A32 A;  1Z7S 1;  1FPN 2;  1YNA A;  4XMA A;  3WQ1 A;  2VC9 A;  5FZM A;  1FMD 3;  3WLU A;  3AFG A;  1TME 1;  1US3 A;  5ACA 3;  1ND3 A;  1I5P A;  4QPI B;  3OEA A;  1LHO A;  4FP2 A;  1IG0 A;  1AXY A;  4MXV A;  1VBA 3;  4UFM A;  4BQ2 A;  1UZY A;  4QU1 A;  3WG1 A;  4A45 A;  2B8M A;  4KWK A;  2G9G A;  3OTF A;  5ERL A;  2WZP P;  1BKZ A;  3H1M A;  1WMX A;  1VLN A;  1D4M 1;  1AZD A;  3HT1 A;  2E9Q A;  1POV 0;  4EN7 B;  3SNM A;  4IGQ A;  3VLB B;  2JE8 A;  1WUV A;  3K51 A;  1VRH 2;  3OBR A;  3RI8 A;  5FO9 B;  3LEI A;  1RIR A;  1C8N A;  4NPR A;  2VCC A;  1O4Z A;  1L7R A;  3KS7 A;  3ZFG A;  4CP9 A;  1LGB A;  2YBK A;  1W2O A;  3IDB B;  4FTS A;  1R08 3;  2EIE A;  3KGL A;  3A4U A;  3LQC A;  1LCL A;  1MEC 3;  4HVO A;  4IV1 C;  3RS6 A;  2W3J A;  1A6C A;  4OZO A;  1XJA A;  1ND2 A;  2ZZQ A;  3KT1 A;  2DFB A;  1Q8V A;  2DV9 A;  4BK4 A;  5IAV A;  2ZMK A;  2VUL A;  5LY2 A;  2YYO A;  4LBM A;  4OMD A;  2WC2 A;  1KEX A;  4RHV 2;  5FZG A;  2VCM A;  5EYY A;  4BA6 A;  2WZ8 A;  3C7O A;  5FYH A;  1DFQ A;  3VBU C;  1F4A A;  1X82 A;  2O8Q A;  2YFZ A;  3IAQ A;  3PLQ A;  3THT A;  3KHB A;  1RUJ 1;  4IEX A;  4HN1 A;  5CB7 A;  1F4H A;  2WSU A;  4BJ0 A;  2YRO A;  4DQA A;  1UOG A;  1LGN A;  3P6B A;  4BPZ A;  5ACA 1;  5KXE A;  3III A;  1ASJ 2;  2WDB A;  3O5S A;  3VZN A;  1A8M A;  1VBA 1;  4OYU A;  3FX3 A;  5JOY A;  2DVF A;  1NZC A;  5JIU A;  4GZ9 A;  4TLF A;  1HB1 A;  1ZNP A;  3JBG 3;  4QMA A;  3D82 A;  4COV A;  4ES9 A;  4UWD A;  3VD7 A;  4FI9 A;  1RUD 3;  4JGZ C;  4OHV A;  4LBQ D;  2EF6 A;  3ZYR A;  2AAC A;  4IV3 B;  2SBA A;  1O3S A;  5EWS A;  4KU7 A;  3Q8E A;  3UET A;  3ORJ A;  1RUE 2;  2CL2 A;  2P3K A;  5KHG A;  2R07 3;  4IL7 A;  2HJI A;  5IVB A;  3VD5 A;  3UYJ A;  1R08 1;  3RZL A;  1BVP 1;  3EJK A;  3KV4 A;  3I3B A;  4TTG A;  5A3U A;  2EXH A;  2BQP A;  4W50 A;  5F2W A;  1C1L A;  3B00 A;  1REE A;  1U0A A;  3OBZ A;  2QTW B;  2IFR A;  4IEQ A;  1LUL A;  2EXJ A;  4MGS A;  2BGC A;  2Q8C A;  3D5O A;  4Q0V A;  4ZKT B;  1TNF A;  4OI4 A;  1IPJ A;  2XPJ A;  4NRP A;  3THD A;  2CY6 A;  4BWO A;  3A0K A;  3KGZ A;  5LAS A;  3EB7 A;  5JSR A;  1W6M A;  3N7K A;  2IXC A;  3J9S A;  2YB7 A;  4IE7 A;  1W05 A;  2VOT A;  2IXK A;  3ZPO A;  4AK3 A;  2HLE A;  4NHL A;  1CWP A;  3WQ7 A;  3T08 A;  2JD4 A;  5A33 A;  5BNO B;  2WJS A;  4CCM A;  2Z2S B;  5T5P A;  5EIY B;  3NQH A;  2BZD A;  1POV 1;  4AFD A;  3S7I A;  5FPZ A;  2G9Z A;  1FOD 3;  4UFL A;  2EIG A;  5H9R A;  1IKQ A;  1VBC 2;  5FAX A;  2ET1 A;  3N9N A;  4LEJ A;  4G3Y C;  1I1E A;  4YGC A;  5D8A B;  1NY7 2;  2VNG A;  2W68 A;  4UT5 A;  4R52 A;  4D6Q A;  4TN7 A;  3JBG 1;  3H3Z A;  3O0V A;  3RZK A;  1BQP A;  1RUD 1;  3KHC A;  5JVV A;  5JSP A;  2VNR A;  1ZX5 A;  1EY2 A;  2RS1 2;  3B9I A;  3D3A A;  2G4I A;  2JDA A;  1HB2 A;  1LOG A;  3GZE A;  3HNY M;  5DAW A;  3TB0 A;  1RJ8 A;  2R07 1;  4XF4 A;  1CX4 A;  3NJY A;  3NKG A;  1KJL A;  1ZZ7 A;  4YVW B;  2AC1 A;  4XEZ A;  2J7M A;  2P5B A;  2IXH A;  3LPG A;  5A3M A;  1SCR A;  2K2S A;  5JZG B;  3ZIX A;  1JYN A;  3WUD A;  1B35 A;  1W8Z A;  2DUQ A;  4AFM A;  3WQB A;  5AC9 2;  3ROU A;  1H1M A;  4HPK A;  3DPR A;  1NCQ A;  2Y34 A;  4M3C E;  4E2S A;  5IAT A;  1PK6 A;  4H55 A;  2VNV A;  3JQX A;  1ULP A;  4HBN A;  4MZU A;  4ERO A;  1NXM A;  5C3R A;  2VTF A;  3LSE A;  4WM8 A;  5DAX A;  2R06 3;  3FMG A;  3J7M A;  3M3E A;  2ZEW A;  4BQ1 A;  2MEV 3;  1OLM E;  5CU1 A;  2CNA A;  1H6Y A;  5FQ0 B;  3PUS A;  2C24 A;  4NUB A;  1BVV A;  4DMI A;  2IXI A;  3LA2 A;  1LOA A;  2UUR A;  3C7E A;  3MIB A;  1W8N A;  4AQ6 A;  2B46 X;  4NPM A;  4UF0 A;  1R09 3;  1FOD 1;  3H0O A;  3S6P A;  3MIE A;  2WZR 2;  2Y60 A;  1REF A;  3LOB A;  2RE9 A;  1DZR A;  2D43 A;  2VOK A;  2I74 A;  2JEN A;  3WSO A;  4FPO B;  3QBQ A;  4ASL A;  1YYN A;  4LHN A;  2ZGU A;  5SV5 A;  3SCG A;  4CU9 A;  4CUC A;  4YM0 A;  4TXW A;  3VDC A;  1PX4 A;  1ZRC A;  4MVT A;  4K21 A;  4CEY A;  4F7Z A;  1QF3 A;  4OMC A;  3KMH A;  3PTR B;  3USU B;  4CCN A;  2V09 A;  3PVE A;  3I54 A;  2JEM A;  4Y4Y A;  5DAQ A;  1OUR A;  5APA A;  2EVX A;  3MPP G;  1KDK A;  4ZXK A;  5K7P A;  3U78 A;  1SLI A;  5IAX A;  4YGE A;  2HKX A;  1YJL A;  2J1U A;  3MID A;  3R05 A;  2D3S A;  3DXT A;  2DCK A;  1OXC A;  1YFX A;  1LES A;  4TYS A;  1W9W A;  3ZMN A;  1LRH A;  2GC0 A;  1OQE A;  5DG2 A;  1XNC A;  3A0N A;  1UIK A;  3PDQ A;  2A75 A;  5FK7 A;  1HN1 A;  1XC6 A;  3TYJ A;  3VBR A;  5J96 B;  3TEW A;  1CAV B;  4CRQ A;  3ZSJ A;  1OKO A;  3N7M A;  2HWC 2;  3WVJ A;  1PVC 2;  1UYY A;  2R06 1;  2VTX J;  1TMF 2;  3GCX A;  1RUF 3;  2F17 A;  2MEV 1;  5FTT C;  2R1D A;  3BU7 A;  3E5X A;  5JI7 A;  3AKT A;  1NE4 A;  2VD7 A;  1W0O A;  2VMI A;  4UAP A;  1FV2 A;  1GZW A;  1D2S A;  1FAT A;  1VPH A;  3SCH A;  4Q8K A;  4FVV A;  5C3P A;  1X50 A;  2C1F A;  1N3P A;  3VBF A;  1R09 1;  2GNT A;  5CBL A;  1LKN A;  1XSQ A;  1WLD A;  5GAL A;  5A7W A;  3URF A;  2W1S A;  2GME A;  4N43 C;  4O61 A;  3WX5 A;  3M7A A;  5CG8 A;  5FRE A;  3P5B A;  1O6U A;  4PBO A;  2PAM A;  4KWU A;  5ANN A;  3SH4 A;  3M3C A;  4LXL A;  4WVW A;  3UKV A;  4N90 A;  1VBB 3;  4HSL A;  1RUG 3;  4QQ2 A;  5AVP A;  1F5F A;  3U75 A;  3VN4 A;  4DFS A;  5JAX A;  1LB2 A;  5FZ6 A;  3I3M A;  4FOQ A;  3P3N A;  5IHR A;  1AXK A;  4K3U A;  5FMD A;  4OHW A;  4L2N A;  1AJK A;  4NIA A;  2HWF 2;  2HEV F;  3OY8 B;  1NOV A;  3PUQ A;  1QJY 3;  2EIC A;  3MIG A;  1XPW A;  4HN0 A;  3ON7 A;  1F15 A;  1XE7 A;  2C26 A;  3VHR A;  5DUV A;  2DCJ A;  2PHR A;  2ZX1 A;  4LUL A;  2BWC A;  1C8M 3;  1HRV 3;  3I2D A;  2BER A;  2ENR A;  2EAK A;  4HFS A;  1F9K A;  4KL1 A;  5J98 B;  3QOP A;  5F7U A;  5FYT A;  1Y3T A;  1RUF 1;  1MZ6 A;  3OB8 A;  5D8A C;  4D7T A;  3HQR A;  4NHX A;  4XDO A;  1ZBE 2;  2WA3 A;  2XUE A;  2BW8 A;  2PMW B;  4X8N A;  5IVC A;  2BVV A;  3N4M A;  1PGL 1;  5DUU A;  4O7X A;  3FN9 A;  3ZKU A;  2RM2 3;  2E7T A;  3NWK A;  1AR7 3;  4CDU A;  3AC0 A;  4CCK A;  3M3I A;  1WMF A;  2F6B A;  3FUQ A;  1MS5 A;  3MLL A;  3AMM A;  4XFF A;  4AF9 A;  3BIE A;  3MDP A;  2WFF 3;  1AX1 A;  1QQP 3;  5T3N A;  4AVS A;  3AP9 A;  3EQE A;  4KWL A;  3IDC B;  4FXG B;  4KG0 A;  4CXW A;  2Z4F A;  4K6B A;  2A1X A;  2X10 A;  5IK4 A;  5KWR A;  4AHY A;  3WDU A;  2P6C A;  1UY3 A;  3VL9 A;  5HXM A;  3KLS A;  2JDZ A;  1AVB A;  5JCT A;  1Y4W A;  5A6Q A;  2JIJ A;  2ZA9 A;  5C33 A;  4HKO A;  1D4V B;  1OF4 A;  4ATF A;  1VBB 1;  5IYY A;  1RUG 1;  1K3I A;  3SXW A;  4QPG B;  4ZY9 A;  1K5M C;  1ZRR A;  3AXD A;  3KVA A;  4B1M A;  3ZSK A;  4DIN B;  4UW5 A;  4K9S A;  4ARY A;  5FJH A;  1GMM A;  5L7O A;  4NIG A;  1VAL A;  2GNB A;  1ODN A;  3ITQ A;  2AEY A;  2UY9 A;  3FLT A;  1UY2 A;  4GXL A;  4W4Z A;  3J7L A;  1S0C A;  2GAU A;  3ACI A;  2DUO A;  4CUA A;  2OPK A;  1QJY 1;  2WAA A;  1OOP B;  3AB0 A;  3GXU A;  3NNL A;  2FDK A;  1TQ5 A;  3WDW A;  4QKF A;  1HLC A;  4QQO A;  3CJI B;  4ZZ5 A;  1RUC 3;  4N53 A;  1C8M 1;  1HRV 1;  2CGN A;  2ZGP A;  3I2I A;  3QCW A;  4IDZ A;  3UJQ A;  2D3R A;  2WNE A;  3CKH A;  5FZ1 A;  4RGG A;  2HYX A;  1W90 A;  2VEC A;  3HMY A;  4GH4 B;  4QB2 A;  1W39 A;  3QH7 A;  3E6B A;  4NAO A;  2O14 A;  2OX0 A;  4BDV B;  1JHN A;  3KVB A;  4L99 A;  5JPM B;  4LKS A;  2ZXQ A;  1VBE 2;  1SFY A;  2DCY A;  2DVD A;  2PEL A;  2RM2 1;  1AR7 1;  1D2Q A;  2XL9 A;  3I3D A;  1H1A A;  1TVG A;  5C5T A;  1CPN A;  3DXU A;  2VOW A;  2GAL A;  2WFF 1;  1QQP 1;  5J37 A;  4YW4 A;  5F37 A;  2C0Z A;  1GLH A;  2ZAA A;  5ANQ A;  4YVS A;  2QQO A;  1DBN A;  3U4S A;  1CAX B;  4LHL A;  1IPS A;  4XHB A;  3HQU A;  4QB6 A;  2XHK A;  5C4W A;  4CP2 A;  3HNB M;  2ARE A;  5FY4 A;  4WM7 A;  3K75 B;  3O1S A;  5FO7 B;  4RYD A;  1AHS A;  3J8F 2;  2VVF A;  1AX0 A;  2WO1 A;  4XUT A;  2X5I C;  3AMH A;  3ZXD A;  2QQK A;  4XHX A;  2MHF A;  3T0D A;  1IGO A;  5FBJ A;  4BQ3 A;  2DBI A;  2YU1 A;  5KXB A;  3LAG A;  4HMZ A;  4RGA A;  3WNN A;  2IVJ A;  1WLC A;  4Q29 A;  3C7G A;  2PLV 3;  1XRU A;  2F4P A;  2JDY A;  2VBB A;  2Q1M A;  1U5Z A;  2X8K A;  3NAP B;  3MV1 1;  1QOS A;  3OGV A;  4MXW B;  2ZGQ A;  4P5H A;  5T50 A;  1UNB A;  4I0A A;  1X9T A;  1YLL A;  3O1M A;  1OLM A;  2ERF A;  3WHU A;  3ILF A;  3OPT A;  4I3G A;  1RUC 1;  3U14 A;  3RZG A;  5K0U A;  1UXZ A;  3A23 A;  2WWU A;  1UX6 A;  4FOW A;  1D7P M;  2D6L X;  1JW6 A;  4DXZ A;  3PL0 A;  1J59 A;  3FUO A;  3MUY 1;  1AR9 2;  1W3V A;  5CFD A;  1G9F A;  2GC1 A;  4IEZ A;  4AED B;  4XAA A;  4IEY A;  4XJ9 A;  3C2U A;  2OQ7 A;  4DUV A;  4K40 A;  4YZ3 A;  2D5F A;  4Y1Z A;  3RRD A;  2D5H A;  1VB4 A;  1NA1 B;  2KM2 A;  4LOR A;  3GHN A;  1ACC A;  3RMY A;  2HEW F;  5HI0 A;  1RMU 2;  4PLN A;  5JIA A;  2XOM A;  4JAA A;  1NG0 A;  3BAL A;  1WKY A;  5FWJ A;  4NO4 A;  2Y26 A;  1E5R A;  1JYV A;  5FY5 A;  1HXS 2;  4QKB A;  1QMJ A;  1UU4 A;  3HN1 A;  2QQN A;  3RJR A;  1DYO A;  1XNA A;  2RS3 2;  3ZYJ B;  3RMX A;  1UPS A;  1NQJ A;  4Z2W A;  2HBU A;  4PF5 A;  5HCA A;  4BYY A;  1W04 A;  1V6M A;  3RQ0 A;  5JR2 A;  2W91 A;  4AI9 A;  3POG A;  1PO1 3;  3VBH B;  2DDU A;  3E6D A;  5EFU A;  2JEC A;  1PGW 1;  2VTX A;  3AFK A;  4YZ4 A;  4E2Q A;  1UZ0 A;  2PLV 1;  2RDQ A;  4DRV A;  5CFC C;  5LRS A;  4J1W A;  2R0H A;  2ZBJ A;  1QJX 2;  4QM9 A;  3T2O A;  2QBX A;  3AX4 A;  3LA3 A;  4Y33 A;  5BY5 A;  2GSY A;  3OD4 A;  3PVO A;  2YC4 A;  3J4U H;  1LR5 A;  3UJO A;  5FBZ A;  1PO2 3;  2V5D A;  3CU7 A;  3VBS A;  3ZSE A;  3POS A;  4LIT A;  1QH6 A;  4SBV A;  1AR8 2;  2BOJ A;  2FHR A;  3OG2 A;  2EA7 A;  1CIY A;  5LZ6 A;  1MQT A;  5FY1 A;  4QPG C;  3ZN6 B;  4GWI A;  1YQ6 A;  4IEP A;  4CCJ A;  2H0B A;  2VBP A;  4XYX A;  4LHS A;  1FX5 A;  3H3L A;  2ZTN A;  1OFN A;  3VDA A;  1EUU A;  1CN1 A;  1EV1 2;  3NV3 A;  1OOP C;  3B69 A;  4BZ4 A;  2TUN A;  4DO0 A;  3PU8 A;  3ZXJ A;  4YNI A;  3FHI B;  3PU3 A;  3I2G A;  4P5Y A;  5IVY A;  5FZ8 A;  1X8E A;  1SLC A;  4MGY E;  5FFO C;  4AZZ A;  1KJR A;  1S0I A;  1LHN A;  3UGH A;  3WW4 A;  1L7L A;  2JG9 A;  4H2A A;  2A71 A;  1DGR N;  1PO1 1;  1OMI A;  2NQY A;  1GU3 A;  5KHH A;  5JDB A;  2XJR A;  2FMY A;  4GH4 C;  1CPM A;  1OA3 A;  1SFN A;  5LAT A;  3OYW B;  2A3Y A;  4H7M A;  5FYS A;  5CA6 A;  1IPK A;  1QXJ A;  2O0O A;  1H8T B;  3E1F 1;  3SLI A;  4E9K A;  2QJV A;  5A1L A;  4QWN A;  4MH0 E;  3WIN E;  3HWJ A;  4FOV A;  3MIF A;  1H6X A;  4EZ4 A;  2XVG A;  2CWM A;  4I3P A;  2A6V A;  2G9F A;  1YHF A;  2A70 A;  1PO2 1;  2ZX4 A;  4URT A;  4UFK A;  3HOB A;  4CE8 A;  3LOI A;  3H8X A;  1KIT A;  1Q56 A;  2Q8E A;  4Y20 B;  2WO2 A;  3H1W A;  3MIC A;  2VQ0 A;  4XJW A;  4Q4X 2;  4AFC A;  1J84 A;  1T6B X;  4JZR A;  1GFF 2;  3ZXE A;  2OVU A;  1UMH A;  2BGP A;  1Q8S A;  1S0D A;  1NUK A;  4Y1V A;  4Y24 A;  4OUM A;  1A78 A;  2IFW A;  3R4U A;  2JKB A;  2DFC A;  5AFB A;  5DDJ 3;  3ZN5 A;  3TAY A;  1J3R A;  5FWE A;  1W6O A;  2V5Y A;  4IE4 A;  1AYN 2;  2A6Y A;  1VRH 3;  3JQW A;  5I91 A;  3PTY A;  4JCK A;  4QDQ A;  3AVR A;  1HJG A;  1V6N A;  1VJ2 A;  3ZSM A;  4AAP A;  2H6B A;  2VMG A;  5HV4 A;  1NX9 A;  1H4G A;  1NE6 A;  4SLI A;  4LBN A;  2DU0 A;  2JB4 A;  4BLI A;  4Q4W 3;  3C7H A;  5LA9 A;  4AVC A;  1DYK A;  1MS3 A;  1S0G A;  3OF1 A;  5T54 A;  2VUJ A;  3VBU B;  4Y5S A;  1PMH X;  3WDY A;  4KG8 A;  1WME A;  4AED C;  3N9L A;  5FYY A;  4D69 A;  1GNH A;  1S55 A;  1R1A 3;  1UZV A;  2VM9 A;  5FO8 B;  1SPP B;  1NA1 C;  1KXG A;  2XB6 C;  4WZF A;  5IVJ A;  2WAO A;  3O0X A;  4PDW A;  3WP3 A;  4YFZ A;  3I2O A;  3D0J A;  4B1L A;  4C1X A;  5FXV A;  2W08 A;  5I8S A;  3TOJ A;  2R0F A;  3NNM A;  2WN3 A;  5DAV A;  4GQ7 A;  5C71 A;  5GLW A;  3IPV B;  2J1V A;  3RGB A;  4G9S B;  4E2G A;  1ASJ 3;  5F3C A;  2V4A A;  1HB4 A;  3HNM A;  3ZN4 A;  4XXA A;  4CPB D;  2VL4 A;  4AEM A;  2XQX A;  5FZO B;  4LA3 A;  3BOW A;  1X7N A;  4FFG A;  1C3H A;  1QJU 2;  3ABZ A;  5A7S A;  2W5F A;  3SIS A;  3WG3 A;  4RGK A;  1WW5 A;  3VBH C;  2ET7 A;  2W9X A;  5DDJ 1;  3VGI A;  4OZX A;  3B9C A;  1PIV 2;  4MYE A;  5JOW A;  3CIH A;  3VBO B;  3T4V A;  3V0B A;  3U10 A;  3JCI A;  3GAL A;  2RMU 3;  3MUZ 1;  2ZX2 A;  5FOJ B;  2VPV A;  3RVH A;  2ZPX A;  4XQW A;  3LDR A;  1U12 A;  5IJR A;  1VBD 3;  3AZZ A;  3FWE A;  1BYH A;  2D40 A;  3RFR A;  3MLJ A;  1MS0 A;  2VW1 A;  4QQH A;  1KS5 A;  2Z79 A;  1YIP A;  1ZRI A;  2JDM A;  1UZW A;  3H8U A;  1GOF A;  3M2M A;  5EHD A;  1JZ6 A;  1ZBA 2;  4Q4W 1;  4YG3 A;  2ARC A;  5FPU A;  3AZX A;  4AE2 A;  1WW6 A;  3NVC A;  5FXW A;  1GQG A;  5EV7 A;  4CDW C;  4LJH A;  3PVN A;  3ZLI A;  3K77 A;  3AP5 A;  3I59 A;  4JQR A;  1UPI A;  4RS5 A;  1R1A 1;  3LIG A;  3ZVX A;  3H7Y A;  4OHX A;  2LTN A;  3H8O A;  3TNQ A;  4JHT A;  1V0A A;  4YZ1 A;  3LEG A;  5F9T A;  2RVA A;  4NR1 A;  1O5U A;  4WVM A;  1GBG A;  1C4R A;  3LFI A;  4V1P A;  2VO5 A;  4YW5 A;  1UXX X;  1SFP A;  3VDD C;  4DXR A;  1JI6 A;  2XH6 A;  3CLP A;  3E5U A;  4JDM A;  5IK5 A;  2BNM A;  3SHR A;  1JYC A;  2DTW A;  5KXC A;  1AF9 A;  1OD5 A;  2WNU B;  2VW2 A;  3W5M A;  5FMO S;  4J6G A;  2EXI A;  4CDQ B;  5E6H A;  1O4T A;  4XDP A;  3ILN A;  3W20 A;  3T2Q A;  2VZT A;  3ZFF B;  1QJZ A;  2QNK A;  3BGA A;  3SKV A;  2HWB 1;  3AL5 A;  3Q8C A;  1Y43 B;  2QQJ A;  4JGY A;  4QAW A;  4DPN A;  4YGD A;  5FYU A;  3K46 A;  1TZO A;  2DWR A;  2P3Y A;  3RI9 A;  2GNM A;  1CJP A;  2B42 B;  3LE0 A;  5FKC A;  3V64 A;  1QDO A;  2OS2 A;  4CDX B;  1SLT A;  1VMF A;  1XNK A;  2FCU A;  2RMU 1;  3R4D B;  1PVX A;  1PNG A;  3I4I A;  4EN8 B;  2XML A;  2ZJC A;  3RYP A;  1VBD 1;  4E4S A;  3KWV A;  4RFR B;  1RC6 A;  3CNA A;  4NWV A;  4D94 A;  3CQO A;  3WDX A;  3SKJ E;  1W9T A;  2D93 A;  3POB A;  4WVV A;  3ZX7 A;  2JXA A;  1B35 B;  3KCY A;  5FIX A;  3KT7 A;  1ZRF A;  5AC9 3;  5FLH A;  4ZS2 A;  3KQ4 B;  3VB9 A;  1UZZ A;  2RHP A;  1N3O A;  1DQ2 A;  1F35 A;  1HQW A;  3APB A;  4XJU A;  5BNP A;  1IS6 A;  3WNM A;  1O7F A;  5KBF A;  3VD3 A;  3ACL A;  1CX1 A;  4QGM A;  4A44 A;  4B4P A;  3O1T A;  1AL0 G;  2UYB A;  3JB8 A;  2BDR A;  1UL9 A;  3ZOI A;  4UF0 B;  5CZK A;  3IT8 A;  4COY A;  5C9A A;  5GZD A;  3PIJ A;  2O1Q A;  3JB4 C;  3MLK A;  2ORZ A;  4YW3 A;  2HBT A;  3UES A;  2J1E A;  3ZFG C;  2OKX A;  4EQV A;  5IVV A;  1ZZC A;  5FP9 A;  4IGP A;  1RHI 2;  1G9A A;  5EJ3 A;  3UT0 A;  4CA9 A;  4C0H A;  1ND2 C;  4OQ9 A;  1RIN A;  5T5L A;  1DF0 A;  1NYW A;  1COV 2;  4CEY B;  4LBL A;  5BUV A;  1LU2 A;  5BV6 A;  1A34 A;  4I2O A;  4XF9 A;  3NJX A;  3ENR A;  2DCT A;  5D21 A;  3WW2 A;  3NRU A;  5HCH A;  3LPF A;  3FZ3 A;  1RVF 2;  5ABJ A;  1UYZ A;  3AMP A;  3AZV A;  1DLC A;  1HX6 A;  3BTA A;  4IV1 A;  2XWJ B;  3IMN A;  1XSR A;  1WCK A;  3AJZ A;  5FY8 A;  3S30 A;  4AG4 A;  1PZ7 A;  4JTO A;  2ZAB A;  1FMD 1;  4QD2 A;  4RA0 A;  4XAE A;  5HCF A;  5GZC A;  1H0B A;  1QH7 A;  3C7F A;  5CIS A;  4UW6 A;  3KQR A;  1JS9 A;  4K20 A;  1SBE A;  5A6Z A;  3BOP A;  3J7H A;  4AI8 A;  5AC9 1;  1O3Q A;  2WS9 2;  1O91 A;  5DG1 A;  5FZE A;  1M4W A;  3CDZ B;  2WLP A;  3NNJ A;  2GH8 A;  3CEW A;  3AP7 A;  5DZF A;  3W9A A;  2RS5 2;  4YFW A;  2DVA A;  5I8T A;  5J3U A;  3SEE A;  1XND A;  1C5I A;  3OBA A;  4MSV A;  5FYI A;  2WN2 A;  3RYK A;  3PJQ A;  5EXO A;  4N43 B;  2JDP A;  3VZJ A;  1PNF A;  2VUA A;  1GQP A;  3VBO C;  2LUW A;  1T6G C;  3RDI A;  1MEC 1;  3M3O A;  1ZM1 A;  4Q0U A;  3NMB A;  1UN1 A;  1MS8 A;  2QFE A;  3AL6 A;  5IW0 A;  2ZGM A;  4BCU A;  2J1A A;  3IBM A;  2P3J A;  4R9D A;  3KB5 A;  5CKN A;  4RSU A;  1RUI 3;  1HIX A;  1CZT A;  1LOF C;  1OUS A;  1GNY A;  1QY4 A;  3CBN A;  3INA A;  4JGZ A;  4UXA A;  5FPV A;  1W6N B;  5FRA A;  4COU A;  4J25 A;  2BGO A;  1WBL A;  2GN3 A;  5GZE A;  5A3P A;  3KZ4 C;  4AVV A;  4YG6 A;  1V6K A;  4V2V A;  4MAD A;  4FAH A;  1W2U A;  3KD4 A;  1UMI A;  3VHP A;  4CXX A;  4QDR A;  1UY0 A;  4QX1 A;  2LS6 A;  4YW1 A;  4LKE A;  1W28 A;  2BJS A;  1Z7S 2;  2IXJ A;  4YW6 A;  1BEV 3;  5FY7 A;  4P02 B;  2LM3 A;  1TME 2;  3W5N A;  2HWE 3;  3K4D A;  1H30 A;  1DQ6 A;  3OPZ A;  4Y1Y A;  2GN7 A;  3POI A;  2JG8 A;  2WNU C;  1BK0 A;  4CDQ C;  3QLQ A;  5JXJ A;  2WUH A;  1UX7 A;  2B39 A;  2V72 A;  3ZFF C;  2VXR A;  3VUO A;  1GZ9 A;  5JOX A;  3FLR A;  1D4M 2;  3BPS A;  5T5J A;  3Q8F A;  4IE5 A;  5FDB A;  5LA2 A;  4PIY A;  5JI9 A;  1ENS A;  4NWW A;  4XIO A;  3TN9 3;  2A3X A;  4Q26 A;  5L9R A;  3M3Q A;  3O1O A;  2ATF A;  2RR1 3;  1JU4 A;  1W8H A;  2IC1 A;  4CDX C;  3WF0 A;  2XDV A;  5IK8 A;  3CL1 A;  2PXJ A;  2Q1Z B;  2Q4S A;  4TWT A;  5T5O A;  3ZIW A;  4I30 A;  1BJQ A;  2Y6K A;  1RUI 1;  2R1B A;  1W3X A;  2DTY A;  5DN2 A;  3UK9 A;  3R0R A;  1OHF A;  5FZF A;  2QDN A;  1K5M B;  4IER A;  1XE8 A;  3PME A;  5FLI A;  1W6Q A;  1W6P A;  1B35 C;  4CEW B;  2WSV A;  2E33 A;  3K3N A;  4IEV A;  4H14 A;  3DPR C;  1NCQ C;  3PVB B;  3VKL A;  4A7Z A;  2DUP A;  3POW A;  1O3R A;  3K48 A;  4W6X A;  1PK6 C;  1XBF A;  3ATG A;  2WQZ C;  1B09 A;  1RUJ 2;  1S4C A;  1ZA7 A;  1LEC A;  2WNV A;  5C5U A;  4Y22 A;  4LBQ A;  4Q27 A;  1BEV 1;  4LR4 A;  3SCF A;  4LLF A;  1QIQ A;  1YWK A;  5BNQ A;  1AX2 A;  4QPW A;  3B02 A;  2FMD A;  4QQL A;  3N36 A;  5FZH A;  1TEI A;  1V9U 3;  2HWE 1;  2D6N A;  5LBF A;  1GAN A;  4QPI A;  4I02 A;  3RZZ A;  4AHW A;  1VBA 2;  5F5Q A;  1K45 A;  3GJA A;  1NCR B;  4GJY A;  2PN5 A;  1OA2 A;  4ET7 A;  1LHV A;  1YQC A;  3FBM A;  2H0V A;  4LLO A;  4DXT A;  2QQI A;  5DPN A;  1YFW A;  3WT3 A;  2AGS A;  3N7J A;  3PJY A;  1E5S A;  2VZU A;  1OFS A;  1SZB A;  4OLL A;  3BTX A;  2YUE A;  2W1Q A;  3TN9 1;  1LEN A;  2NMO A;  2QZ2 A;  3AKR A;  3O14 A;  4CEY C;  2Y6H A;  5G04 L;  2L9L A;  3ZFE B;  2RR1 1;  2XLA A;  3VHO A;  4YWA A;  2YZ4 A;  3SC7 X;  1R08 2;  3WNK A;  4MGI E;  3WNL A;  5EJZ B;  4L97 A;  5C8C B;  5FZK A;  4HOO A;  1OKQ A;  4MO3 M;  4LUM A;  1P8J A;  2R7E B;  2WT1 A;  2MPF A;  2XGX A;  5F6K A;  4D7Y A;  1F31 A;  4PI2 A;  4B3N A;  5HV0 A;  3D0S A;  1JYX A;  1DU3 D;  3OPW A;  4PJY A;  4YM2 A;  1CJD A;  3SH3 A;  3WP5 A;  2GMP A;  1G9B A;  2HWD 3;  2X5I B;  1O5L A;  4UBH A;  3W58 A;  4A2U A;  3N9P A;  2VZO A;  5J48 A;  1UAI A;  3IDA A;  4HG6 B;  4LQR A;  1S2E A;  2P17 A;  3I8T A;  4Z92 B;  3JXS A;  2QZ3 A;  1VAK A;  2ZZJ A;  1WA6 X;  5E8A A;  3ETQ A;  4M3C B;  1CGP A;  4ZS3 A;  4QGL A;  3U07 A;  4TZD A;  2VZR A;  1V9U 1;  3IKW A;  2J1R A;  3WNX A;  4OUS A;  1XE0 A;  2Y0O A;  1SDW A;  4AGG A;  4E4Z A;  3LCP A;  4WVZ A;  2QCS B;  5FUI A;  4EYU A;  5JMC A;  1O8P A;  1XOY A;  1SEF A;  2W95 A;  3I2F A;  3MPB A;  3WV6 A;  1QHD A;  4D6S A;  1C28 A;  1LOD A;  2F4L A;  1LAJ A;  3JBG 2;  4BQW A;  2JKX A;  3EYP A;  2DVG A;  4JKK A;  1RUD 2;  4Q4V 3;  1SDD B;  1CAW B;  2A3W A;  4KGG A;  4LOT A;  3WHT A;  3S5Q A;  2W1U A;  4IV3 A;  4AVB A;  3B94 A;  1S2B A;  2D3P A;  3POY A;  4HLT A;  4NRQ A;  4FPG A;  5FMC A;  4K7J A;  2R07 2;  4FQ4 A;  3POE A;  4LPL A;  4OHY A;  3JZV A;  1GOH A;  4UOJ A;  4XFC A;  2PHF A;  1PM4 A;  2DBN A;  3O1P A;  3IB3 A;  5K4L A;  1UO9 A;  1W8U A;  1QEX A;  5TSW A;  1X36 A;  4XBN A;  1Y9G A;  1ZYB A;  3FHA A;  4RFT 0;  5FY0 A;  2B4K A;  1CAU B;  3JU9 A;  5FZB A;  3VKN A;  4DIQ A;  3TEY A;  1LED A;  4M4P A;  1FNY A;  2ZML A;  2HWD 1;  3GNE A;  3A21 A;  5IFP A;  4ITC A;  4NHM A;  3UGG A;  1W0N A;  1GUI A;  1LHW A;  3OGG A;  3Q8A A;  5FV3 A;  3HVD A;  4ZXE A;  2ZX3 A;  3BVC A;  4NVP A;  1V70 A;  5CFC B;  2VH9 A;  4R9C A;  4P9L A;  3DCQ A;  1BBT 3;  4Q5O A;  2PYT A;  4DY5 A;  1RXG A;  3ZYF A;  2XBO 3;  1DCS A;  4PT6 A;  5BNO A;  2P34 A;  1DLL A;  4P9X A;  1MVQ A;  1FV3 A;  1QOO A;  2XVK A;  2E63 A;  1A8D A;  1FOD 2;  5KXD A;  1QJX 3;  4CDU C;  4RR3 B;  5J09 A;  5GZG A;  3RZJ A;  5LK7 B;  1JH5 A;  4QXC A;  1AR6 3;  4FPF A;  1U5Y A;  3LKJ A;  3O7O A;  4U2A A;  3ZXK A;  5F39 A;  3HJR A;  5D8A A;  1KS4 A;  2WZE A;  4I0B A;  2WT2 A;  3AZY A;  4AI1 A;  5FP3 A;  2P4E A;  2ZGK A;  4AOC A;  3QAC A;  1G86 A;  2XON A;  4Q4V 1;  1QXR A;  2W87 A;  3RWN A;  4CCE A;  3MW3 A;  1RJ7 A;  1YIF A;  4CEW C;  1UYP A;  3J7N A;  5A3W A;  1UCX A;  4GKX A;  4DS0 A;  4EN0 A;  4NE9 A;  2FCV A;  3NV4 A;  5FZ7 A;  5F8P A;  4M01 A;  1NXD 1;  4NJ4 A;  1NAE A;  5CKQ A;  1RUH 3;  2BTV C;  1K12 A;  4YVW A;  2WLQ A;  4RQP B;  4J1X A;  4NMI A;  2ZGR A;  2P1B A;  2XJU A;  1SHW B;  5F1R A;  5JZG A;  4P9I A;  1EV1 3;  1YXW A;  4LNV A;  1G7Y A;  1GSL A;  1W2A X;  1JBC A;  2P2K A;  3AVS A;  2QQL A;  1W8W A;  2NYY A;  4BQ4 A;  1X33 A;  4N53 C;  5BNN B;  4AI2 A;  3P1I A;  2R06 2;  2WYF A;  4Q4Y 3;  3D8C A;  5DZE A;  1NCR C;  2MEV 2;  4LK6 A;  2AEN A;  1GYK A;  3BCW A;  4MGQ A;  2VVD A;  1BBT 1;  4QX0 A;  5LBB A;  1DHK B;  4GB3 3;  5FQ0 A;  4MG2 A;  2XBO 1;  2FDG A;  4HAN A;  4S2D A;  2VZ1 A;  2MNG A;  3UNP A;  1R09 2;  5L9V A;  1HW5 A;  2ZEY A;  3ZFE C;  1Q43 A;  2AH2 A;  2E31 A;  4LKF A;  3KCC A;  1AR6 1;  1W8T A;  4TSV A;  1TG7 A;  4B7K A;  4CTE A;  2PHU A;  1XU2 A;  2D6O X;  1GWL A;  2GH2 A;  4LO4 B;  5C8C C;  1X8M A;  2ZHM A;  3NNF A;  4YVS C;  1H2L A;  2Q30 A;  5KHK A;  1RYY A;  4S2G A;  1H8V A;  4WV8 A;  5F6L B;  1LGC A;  5FY9 A;  3U1X A;  4AQT A;  3WG4 A;  3OJB A;  2R6Q A;  3NJV A;  4XUQ A;  5C4W C;  3LWC A;  4QB1 A; 
#chains in the Genus database with same CATH homology
 2EID A;  3T0A A;  5A1A A;  2EIE A;  3LQC A;  2VZQ A;  2W3J A;  4OZO A;  3I2K A;  3T09 A;  3A7Q A;  4QDQ A;  4BK4 A;  4PQQ A;  1NX9 A;  5C70 A;  4OMD A;  1KEX A;  2WZ8 A;  4XUP A;  3C7O A;  1F4A A;  2YFZ A;  3IAQ A;  3C7H A;  1JZ5 A;  1XNT A;  5LA1 A;  1PMH X;  5C7G A;  1F4H A;  4BJ0 A;  3VD9 A;  2VZP A;  2VM9 A;  1W99 A;  3P6B A;  1KGY A;  3III A;  4A4A A;  4RN5 A;  2WAO A;  2WDB A;  3ECQ A;  4A41 A;  4OYU A;  2WN3 A;  1NKG A;  5C71 A;  2J22 A;  4GZ9 A;  2J1V A;  4CUB A;  2WAB A;  2VJX A;  3VD7 A;  4FI9 A;  3HNM A;  4MOA A;  4A6O A;  2VL4 A;  5JMO A;  2XQX A;  3ACH A;  1UWW A;  3UET A;  2Y6L A;  3ABZ A;  2VZ3 A;  3WNP A;  2W5F A;  4IUG A;  4JKL A;  2W9X A;  2Y6G A;  3VD5 A;  3WNO A;  4Z2A A;  4TTG A;  3I3B A;  3CIH A;  3PUI A;  4W50 A;  3MUZ 1;  4MGS A;  2J1T A;  5IJR A;  4DUW A;  3I2H A;  3THD A;  3EB7 A;  4QX3 A;  1GOF A;  1JZ6 A;  2YB7 A;  1CZS A;  1T2X A;  2VOT A;  4YPJ A;  4E8C A;  2HLE A;  3LEK A;  4JKM A;  3T08 A;  3K77 A;  5EIY B;  3NQH A;  2BZD A;  5I0D A;  3LEG A;  2RVA A;  5JXG A;  3UES A;  2VO5 A;  4DXR A;  1UXX X;  1O59 A;  1JI6 A;  3WEZ A;  2W46 A;  2RV9 A;  4P08 A;  3W5M A;  3T2Q A;  2VZT A;  3D3A A;  2JDA A;  3HNY M;  3BGA A;  3SKV A;  4QAW A;  2QQJ A;  3OGR A;  3K46 A;  4XUN A;  5DMY A;  3LE0 A;  3ZM8 A;  2J7M A;  3LPG A;  4QB1 A;  1JYN A;  3WQB A;  5EJ1 B;  3CQO A;  1ULP A;  1W9T A;  3SKJ E;  4DEQ A;  2VTF A;  3OGS A;  1JZ2 A;  1WCQ A;  3CMG A;  3GDB A;  2ZEW A;  2Y6J A;  1H6Y A;  1W8O A;  3OEB A;  3C7E A;  1W8N A;  3WNM A;  2CDO A;  3VD3 A;  2VZS A;  2WBK A;  5B4N A;  1CX1 A;  4JHZ A;  1JHJ A;  4A44 A;  5B4X A;  3WSO A;  3ACG A;  1JZ4 A;  1W9S A;  5CZK A;  4KMQ A;  4CU9 A;  2ZEZ A;  2ORZ A;  4CUC A;  4TXW A;  1UY4 A;  2J1E A;  2OKX A;  3VDC A;  1PX4 A;  4OMC A;  3FL7 A;  2KD7 A;  4BXS V;  2J1U A;  3NJX A;  4CVU A;  3NRU A;  1OH4 A;  3LPF A;  1GOG A;  1UYZ A;  2DCK A;  1MPX A;  1DLC A;  1W9W A;  3IAP A;  1HN1 A;  1XC6 A;  3I3E A;  4AG4 A;  3F2Z A;  4A3Z A;  4D0Q A;  2V4V A;  2YG0 A;  3C7F A;  5J1X A;  1UYY A;  4M4R A;  3WF4 A;  3J7H A;  4QDS A;  4UAP A;  3CDZ B;  3DYM A;  2VZV A;  4GWJ A;  3CZJ A;  3DYP A;  4XUR A;  3SEE A;  2W1S A;  3OBA A;  3MO4 A;  2WN2 A;  1YQ2 A;  2CDP A;  3ETP A;  2VCB A;  2W92 A;  4XUO A;  1GQP A;  4KWU A;  2LW8 A;  2VMC A;  2J1A A;  3DEC A;  1CZT A;  1GNY A;  5IHR A;  4PF1 A;  2BGO A;  3A22 A;  2ID4 A;  2J1S A;  2JD9 A;  2EIC A;  4MAD A;  1XPW A;  1UMI A;  2VCA A;  4AAX A;  4QDR A;  1L7Q A;  1IQD C;  1UY0 A;  4CU7 A;  1K42 A;  4QX1 A;  2LS6 A;  2C26 A;  2DCJ A;  2BBA A;  2BER A;  4P02 B;  1US2 A;  2VMD A;  1SG3 A;  3K4D A;  5F7U A;  4XZU G;  3W5N A;  3OB8 A;  2C9K A;  1J83 A;  1LNS A;  3T2P A;  5JXJ A;  2WUH A;  1OT5 A;  3FN9 A;  1UX7 A;  2V72 A;  3AC0 A;  2EIB A;  2VME A;  5IFT A;  5LA2 A;  1UY1 A;  2Z4F A;  1JZ8 A;  2X10 A;  1JU4 A;  1UY3 A;  5HXM A;  3WF0 A;  2C4X A;  2Y8K A;  2WO3 A;  5IYY A;  1OF4 A;  1K3I A;  2Y6K A;  4ZY9 A;  5DN2 A;  4ARY A;  1GMM A;  4W4Z A;  1UY2 A;  3VD4 A;  2E33 A;  3ACI A;  3WF2 A;  4CUA A;  2WAA A;  4KI5 M;  3GXU A;  1ULO A;  4ZZ5 A;  2W94 A;  5JXI A;  1R64 A;  3I2I A;  4QPW A;  3CKH A;  5CYY A;  5G05 L;  2HYX A;  4QB2 A;  4BDV B;  3T0B A;  5JUV A;  3SEP A;  1K45 A;  2ZXQ A;  4LKS A;  3THC A;  1JZ7 A;  3WF1 A;  3I3D A;  4ET7 A;  4DXT A;  1TVG A;  2QQI A;  5DPN A;  4DXS A;  2WQ8 A;  3GM8 A;  2VZU A;  2W1Q A;  1OF3 A;  2QQO A;  2VQU A;  2Y64 A;  2Y6H A;  1UYX A;  2L9L A;  5G04 L;  3GGL A;  3MBW A;  4QB6 A;  3HNB M;  3WNK A;  3K75 B;  3WNL A;  5EJZ B;  4RYD A;  4MO3 M;  4QX2 A;  1P8J A;  1OD3 A;  2R7E B;  4XUT A;  2WO1 A;  1JYX A;  2VR4 A;  2QQK A;  4BK5 A;  3T0D A;  3DYO A;  3WNN A;  2VZO A;  3ACF A;  4UI9 L;  3C7G A;  3I97 A;  2QQM A;  3IDA A;  3MV1 1;  3OGV A;  4HG6 B;  4LQR A;  3JXS A;  4CU8 A;  5LA0 A;  1CZV A;  1JZ3 A;  1UXZ A;  3A23 A;  2VZR A;  2J1R A;  1D7P M;  2YC2 A;  3MUY 1;  5FUI A;  1O8P A;  2W95 A;  3I2F A;  4DEV A;  4DUV A;  3CZU A;  2JKX A;  3EYP A;  4JKK A;  4L0P A;  1SDD B;  3C8X A;  2W1U A;  2XOM A;  3VDB A;  1WKY A;  4LPL A;  1JYV A;  3HEI A;  1GOH A;  2QQN A;  4UOJ A;  1DYO A;  1XNA A;  3FHQ A;  3NNG A;  4D8M A;  3IB3 A;  2PQS A;  1JU3 A;  3FHA A;  5JR2 A;  2B4K A;  2W91 A;  4M4P A;  3WF3 A;  2DDU A;  3A21 A;  5IFP A;  4JX0 A;  1UZ0 A;  2XHN A;  1W0N A;  1GUI A;  4ZXE A;  3T2O A;  5JXH A;  2QBX A;  4PT6 A;  1DP0 A;  2YC4 A;  1PMJ X;  3BN6 A;  2V5D A;  1PX3 A;  1BHG A;  4DUX A;  3HN3 A;  3PUH A;  3K4A A;  2ZEX A;  2E32 A;  3OG2 A;  3HJR A;  2X05 A;  2WZE A;  1CIY A;  2ORX A;  4E8D A;  2XON A;  4GWI A;  2W87 A;  2VMF A;  4LHS A;  5DQ0 A;  2E26 A;  3VDA A;  1EUU A;  2VQT A;  4P00 B;  1O8S A;  2W47 A;  2YFU A;  1NAE A;  5LCW L;  1K12 A;  3I2G A;  4P5Y A;  4XVH A;  1SHW B;  2W1W A;  4OUE A;  2WYS A;  3MV0 1;  1EUT A;  1GU3 A;  2QQL A;  3HPN A;  2RJ2 A;  3P1I A;  2X09 A;  3E1F 1;  4MGQ A;  4QX0 A;  2VC9 A;  4ZZ8 A;  3K4Z A;  5HPO A;  2VZ1 A;  1H6X A;  1US3 A;  4W8J A;  1I5P A;  3UNP A;  3OEA A;  2ZEY A;  3I2J A;  3U37 A;  4A45 A;  2E31 A;  3HOB A;  1TG7 A;  4A42 A;  2WO2 A;  4ARX A;  4CU6 A;  1JYW A;  1J84 A;  1RYY A;  1UMH A;  2BGP A;  3NJV A;  2B9V A;  1NUK A;  2JE8 A;  4XUQ A;  3LEI A;  2VCC A;  1L7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...