4OYUA

Crystal structure of the n-terminal domains of muskelin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
b'MECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNYPPQYLILKLERPAIVQNITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHKIDEQMFPCRFIKIVPLLSWGPSFNFSIWYVELSGIDDPDIVQPCLNWYSKYREQEAIRLCLKHFRQHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muskelin
publication title The LisH Motif of Muskelin Is Crucial for Oligomerization and Governs Intracellular Localization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 47
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4oyuA00
1WCQA 2ORZA 2WAOA 2Y8KA 5IFPA 2WN3A 5EIYB 4LHSA 1GNYA 5JR2A 3ACHA 3OB8A 1L7RA 2VMDA 2EIDA 3IAQA 3VDCA 3HNMA 4LQRA 1OD3A 4UI9L 4TXWA 2VM9A 2J1EA 4JHZA 3MUY1 1UYXA 2VZ3A 4FI9A 3GXUA 1TVGA 2ZXQA 2VCCA 1CZVA 3WNNA 3C7GA 4DUWA 2WDBA 5C70A 2J1SA 2W87A 1CZSA 3WEZA 3NQHA 2W1WA 4ZZ5A 3OG2A 2QQJA 3EYPA 2PQSA 2YFZA 3T2PA 2J1UA 3WF0A 4Z2AA 3SKJE 2ZEZA 3CQOA 3SEEA 3D3AA 3WSOA 2YB7A 4UAPA 1NUKA 4A41A 2W1QA 3THCA 4MGQA 3VD7A 3P1IA 1OF4A 2X10A 1TG7A 5F7UA 2VQTA 4CU7A 4QAWA 2X09A 1JHJA 2ZEYA 4CU8A 5LA2A 2QBXA 1GOHA 5B4XA 1DYOA 1J83A 3WNKA 5LA0A 2E26A 4OYUA 2XONA 3LEKA 4ZZ8A 3OGVA 2BGOA 3FN9A 1UMHA 4LPLA 5IJRA 3U37A 1JZ5A 2OKXA 2ZEWA 4QB2A 4QB1A 3IIIA 2V4VA 2C9KA 3CZJA 3J7HA 1XPWA 2W46A 3W5MA 4QX3A 5LCWL 5CYYA 4BK5A 2WQ8A 2BZDA 2BERA 4QPWA 1OF3A 1UXZA 3CKHA 4M4RA 3THDA 3MV11 3I3BA 3UETA 2B9VA 5DN2A 2VZTA 3NNGA 5A1AA 2ORXA 2WBKA 1L7QA 3LEIA 4QX1A 1OH4A 2WAAA 2ZEXA 3MUZ1 2W1SA 4E8DA 1ULOA 4DXSA 1H6XA 4QX0A 3T09A 4W4ZA 2RV9A 2Y6LA 3UNPA 4GZ9A 4AG4A 4JKLA 1F4AA 5JXJA 3K46A 4XUNA 2R7EB 1DLCA 1H6YA 2VR4A 4MOAA 3ACFA 3GGLA 1I5PA 1HN1A 5EJ1B 1UZ0A 1P8JA 4JKKA 2QQIA 4CVUA 3P6BA 4HG6B 1KGYA 1RYYA 3NJVA 3W5NA 3HPNA 1EUTA 1K45A 3K4DA 5HXMA 5IYYA 1GOFA 1UY1A 3FHAA 4MADA 3HJRA 2HYXA 4A42A 2YFUA 3K4ZA 5DMYA 5JXHA 2L9LA 3CZUA 2E31A 2JD9A 4PF1A 4W8JA 2QQKA 4P02B 1W9WA 5JUVA 3CDZB 2VL4A 1UXXX 1YQ2A 2WYSA 4IUGA 4BK4A 4KI5M 4DEVA 4MGSA 4LKSA 1UYYA 2LW8A 5LA1A 2JKXA 2VZ1A 1CZTA 2EIBA 3VDAA 3AC0A 4A6OA 4OUEA 2CDOA 1BHGA 3ZM8A 2W95A 1R64A 2XOMA 3ETPA 3I2HA 3FL7A 3T08A 1F4HA 4A45A 2KD7A 3DYMA 2X05A 1W9SA 3VD9A 3HN3A 3IDAA 4P00B 3MV01 2YC2A 3WF3A 2Y6KA 4BJ0A 3VDBA 5J1XA 3I3EA 3NRUA 1W99A 4P5YA 4TTGA 1SHWB 3WNPA 2EIEA 2VJXA 2WZEA 2LS6A 2XHNA 2W92A 3C7HA 1W9TA 1XNAA 2CDPA 4CU6A 3GDBA 3EB7A 4XURA 2VTFA 3ABZA 1UY2A 3VD3A 1GMMA 2Y6HA 4XUOA 3IB3A 4BXSV 4QDSA 3BN6A 3LPFA 4XUQA 4DXRA 3UESA 3SKVA 4XVHA 4GWIA 1IQDC 3FHQA 4UOJA 4CU9A 1OT5A 2J22A 1US2A 2W9XA 1UY4A 3T0AA 2Z4FA 1W8OA 3OGRA 4JX0A 4OMCA 3GM8A 3DYOA 1K3IA 2VZRA 1CIYA 2E32A 4QX2A 4OMDA 1PX4A 1JYNA 2C4XA 2VZQA 1JZ3A 1EUUA 3C7OA 3I2GA 1GQPA 2VQUA 1JZ7A 2J1TA 3CIHA 4XUPA 3WNOA 3WF2A 4CUAA 1JI6A 3T0DA 4QDQA 4A3ZA 2QQLA 5CZKA 3HNBM 2QQNA 2DCJA 1K42A 2WUHA 4QDRA 3T2QA 2W3JA 5FUIA 2JDAA 2BBAA 3ACGA 2W91A 3CMGA 4ARYA 1SDDB 4OZOA 4L0PA 5I0DA 3ACIA 1UYZA 3K77A 1US3A 5DPNA 1GUIA 3LPGA 4D8MA 1O59A 4RYDA 4CUBA 1ULPA 3WQBA 3WNMA 1MPXA 3WF1A 1JZ8A 3I2JA 2VOTA 3PUHA 2W47A 4ZXEA 3A22A 4ZY9A 2W5FA 5C7GA 2VZOA 4PQQA 3BGAA 5B4NA 5JXIA 1NKGA 1D7PM 3DECA 4DEQA 2J1RA 5HPOA 3VD4A 4RN5A 3A7QA 5EJZB 3ECQA 3IAPA 1JZ2A 3SEPA 5G04L 3HNYM 4A4AA 1JU3A 3C8XA 2VZSA 1T2XA 1XC6A 1J84A 3MBWA 2V5DA 1K12A 1UWWA 3I2KA 3LQCA 1JZ4A 2VO5A 5C71A 4JKMA 2VCAA 3VD5A 3WNLA 4KMQA 2VMEA 3LEGA 1W8NA 4DXTA 5JMOA 2VZUA 3HEIA 2W1UA 5IHRA 2DDUA 2VMCA 2W94A 1JYXA 5JXGA 3I2IA 1JZ6A 4ARXA 1CX1A 3A23A 2B4KA 3E1F1 2YG0A 4MO3M 2ID4A 2VZVA 2Y6GA 3HOBA 2RJ2A 5G05L 1O8SA 2QQOA 1XNTA 4KWUA 2J1AA 2EICA 1SG3A 2E33A 2VMFA 3MO4A 4ET7A 2WO3A 4DUXA 1UMIA 1GOGA 3OEAA 1NAEA 4DUVA 1NX9A 3OGSA 2HLEA 1UX7A 5IFTA 4D0QA 2YC4A 2JE8A 1UY3A 3T2OA 2WABA 4M4PA 3I3DA 3LE0A 1UY0A 3PUIA 2DCKA 3F2ZA 2VZPA 4CUCA 4P08A 3WF4A 1JYWA 4YPJA 2WO2A 5DQ0A 3DYPA 1O8PA 3K4AA 4BDVB 3I97A 3OBAA 1DP0A 3C7EA 1GU3A 2XQXA 2J1VA 4AAXA 3A21A 4XZUG 2BGPA 4XUTA 2WO1A 3JXSA 1PX3A 2QQMA 2RVAA 1JYVA 4PT6A 1WKYA 4W50A 3I2FA 4A44A 2J7MA 1KEXA 1LNSA 4GWJA 4QB6A 2VC9A 1JU4A 2V72A 3K75B 2VCBA 2WZ8A 3C7FA 3OEBA 1PMHX 2WN2A 3T0BA 4E8CA 2Y6JA 1W0NA 1PMJX 2C26A 2Y64A 3NJXA
chains in the Genus database with same CATH superfamily
2ORZA 2Y8KA 4GJZA 1ACCA 5IFPA 2R042 4Q0SA 1RUD1 4LHSA 4MSVA 3OY8A 1TMF3 3I3QA 2BUKA 2WNVC 1CN1A 1L7RA 5A32B 4COUA 2IXHA 1DF0A 4HFSA 3KQ4B 3GBWA 3KV9A 2RS13 1RHI3 3N7MA 5CIRA 4UFKA 5T54A 4BQ5A 4ISQA 5F3IA 1AYM1 4UI9L 4HL0A 5C8CB 5BNPC 4CEWB 1QXRA 2DWRA 2JDHA 3W9AA 3O1MA 2WNVA 2WQZC 2Y33A 1EAH1 1T6GC 3MUY1 1UYXA 4FOYA 4AI8A 3ILNA 4HLTA 1H2LA 2YV8A 1ZBA1 3KCYA 3SISA 2Y60A 4I0AA 4WM8B 4MUVA 1VLNA 1F35A 2D3SA 4CZSA 2JICA 3WUCA 4CYDA 3WP4A 3PTRB 4DOUA 4EZ4A 3OPZA 5BNPA 4Y5SA 2A6ZA 3OYWB 1S1AA 1CAVB 2HWE3 5FYVA 4CXXA 4A7ZA 3N7JA 1OVPA 3D6EA 3C3VA 3WUDA 1G9DA 2YB7A 4N7IA 1AR92 2WNUB 3T30A 3EMRA 1C8M2 1NUKA 4XIOA 4IGQA 1ZBE1 3GZEA 2R0FA 4YW6A 5CISA 3EJKA 4X8PA 5HBAA 2ZX3A 3KGZA 4R8HA 3QCWA 4URAA 3ZDSA 5BYNA 5BNNB 4OI1A 1OH3A 4QMAA 1J1LA 5F5AA 5FZCA 4YLZA 2D6LX 1TG7A 2O8OA 1H8TB 1BXHA 4QQLA 4YW3A 4NHKA 4FAGA 2VQTA 1V6KA 2C6SA 3O1OA 2D6KA 2ET1A 1TE1B 4TN7A 2VVFA 4QAWA 4TLGA 5E16A 2HWD2 5BNQA 3ZSJA 5I93A 3VKLA 2SLIA 3RZGA 2QBXA 3MEPA 1W6MB 1PGSA 1DYOA 2HWC1 1BBT2 1YWKA 4Z1VA 1ULCA 2ZHNA 5LA0A 1RMU2 2GP5A 3I4IA 2A6XA 4M01A 4NJ4A 3LEKA 4PBPA 1W2AX 3M3IA 1PZ9A 1Y3TA 1ZRDA 4LPLA 1CESA 1HXS3 1YJKA 4X6QB 4MHRA 3VBHA 4D7TA 3ETQA 2MHFA 4WM7C 3VN4A 4XQDA 1N3QA 2C9KA 3CZJA 1RUE3 4XFCA 3KVAA 5FBJA 1UZVA 5EZWA 4QHOA 1IPSA 3VBSB 1AR72 1NT0A 1S0IA 2X29A 2WZPP 2RJLA 3PJYA 4PIYA 3VHRA 5CYYA 5ACA2 3TWIA 5ABJC 3AL5A 2WQ8A 5F5CA 5A33A 3S30A 2OS2A 2Y26A 3WQ1A 3AP6A 3ZFGC 4WM7A 5T50A 4FQ4A 3WOGA 1FYUA 3THPA 1HJFA 4NUBA 4K8RB 4XJ8A 4FTBA 4DO0A 4Y24A 1A6CA 1K5MC 2QDRA 2EVXA 3W59A 2QNKA 2XKPA 4EV0A 1M4WA 3M4FA 2ZGTA 5A1AA 3WG3A 1ZZ8A 4XMAA 5FZOA 4U2AA 4FPEA 2ORXA 5FK7A 3ZFGA 1OA4A 5I0SA 2FZ2A 4FSJA 2TEPA 4JZRA 5DDJ1 1VJ2A 3V64A 3MUZ1 1HB2A 3PUSA 5FY8A 3R6SA 2XDVA 2LTNA 1MQTB 4DXSA 1NZIA 1QWRA 1H6XA 3NNMA 3DV8A 3T09A 4K1YA 4W4ZA 2RV9A 3B9CA 3P5BA 2UURA 2QQUA 1V6IA 4H3WA 2CGNA 1JN2P 1Q8VA 1UOJA 4JKLA 4FPYA 1F4AA 2DVAA 5FZFA 4PJYA 5JXJA 5T5JA 1MVEA 1MZEA 3U14A 3MIHA 2MNGA 2XKOA 4QHBA 1I5PA 1AXZA 2HBTA 4P9WA 2MEV1 3FX3A 3WDXA 2WNOA 2BRTA 3P6BA 2IVIB 2OT7A 2ZGOA 1QU0A 5E88A 4HN1A 2QJVA 3W5NA 1CD3G 1PM4A 3HPNA 4CDQC 4JTNA 5BNOC 2DYCA 1QOTA 2RR11 3IMMA 3A4UA 2VUDA 1RJ7A 1RB8G 1LULA 1ASJ2 3RZJA 1XSQA 1CVNA 4QKDA 4CCLA 4FVVA 3RG0A 5FXVA 2HYXA 4NIIA 2DFCA 2YFUA 2EIGA 4AI3A 1VBC1 5DMYA 1AR61 2L9LA 4S2FA 2JG9A 2EAKA 3POYA 2XGXA 1UPSA 3BODA 3VZKA 1HRI1 4YG6A 3ATGA 3QH6A 5HV0A 2QQKA 4DRVA 1W9WA 3PUAA 2ZX2A 3ELNA 3POGA 2WYSA 4HT1T 2W0XA 1S0CA 3BPZA 1FOD3 1YQCA 1ZZ7A 3N9QA 4MGSA 4N90A 5C3RA 5FDBA 3AMHA 2JG8A 3FC0A 1RUF1 1XNBA 1HRV2 1ZM1A 4DNYA 1XE7A 4L11A 2CHHA 3URFA 3AKRA 5LBEA 4FPFA 4OHVA 4DS0A 1YIPA 2K46A 3U4XA 4IV1B 2D6PA 2VNGA 3S7EA 3WG4A 4M3CF 5FMOL 4Q4W3 2CDOA 5FQ0B 5CKMA 3Q8FA 2DVFA 3FL7A 2X05A 4CP1A 3ZSEA 4JDMA 3H1WA 2LALA 2RDRA 4OHWA 2GH8A 3IDAA 3N7LA 1HJGA 4P00B 3V56A 2JDNA 1FT9A 3MV01 2XLFA 1DGWA 3AMPA 3USSA 5FPUA 4J6GA 3BTZA 2H0BA 3BPSA 3WVJA 3GBGA 3WF3A 2ZJCA 2NN8A 4LXLA 1QDOA 5DZEA 5J1XA 2AUYA 5JZGB 4XQ4A 1H9WA 4P5YA 4BMEA 3RZKA 2FCTA 4LK7A 1IHMA 4TSVA 2XPJA 4LORA 2FDGA 3VGIA 4D3WA 1LKNA 2E51A 4Q8LA 4M0NA 1GR3A 2VJXA 4XFHA 4HVRA 2XVGA 4LLFA 4N43A 2QQPA 4PQ9A 1DIWA 2OW4A 3TNQA 1BYHA 1VE0A 3AL6A 2CGOA 4CU6A 3GDBA 3NMBA 4LEJA 4Z92B 2OQ7A 4QWNA 4UW5A 3ABZA 1NXMA 1UY2A 1O4YA 1SPPA 4LMFA 1JOJA 4CDWC 3R0RA 5FYSA 1LHVA 2R1BA 4IE6A 3USUB 4AYUA 2BPA2 3D8CA 3RI9A 1AXKA 4QXCA 4AFMA 4XMIA 3WNXA 1QH6A 4KWKA 3AP7A 3HBKA 1HXS2 1U5ZA 3LPFA 1GLHA 2VBBA 3FLRA 2C5DA 3LAGA 2B46X 3IKWA 2WZR3 4KQ7A 4XVHA 1SLCA 2P3IA 1IS5A 4C0BA 4CDWA 5CG8A 4J25A 1S2KA 1UU4A 2F6BA 5ISLA 4CU9A 2VOXA 3POWA 1XYNA 2ZKLA 1UY4A 4I01A 3EXUA 1W6OA 3LOBA 2RS33 4FCAA 3CL1A 1MS4A 4OMCA 3PU3A 4IE7A 3GM8A 2VMGA 1KXGA 3DYOA 4L2NA 1REEA 4ASMB 4PCRA 4AVSA 1QDCA 3V0BA 2WWJA 2AH2A 4YVSC 2E32A 1R092 2N7GA 2RDSA 4FPLA 3VV1A 5LASA 1LU2A 5JPMB 1H4GA 2C4XA 3VBOC 1KD7A 4PIZA 3Q9OA 1MZ5A 1UAIA 3NW4A 3WDYA 1OLQA 4OI2A 2I45A 4HANA 1WWYA 2A3WA 3W58A 5A7SA 1ODMA 2CNAA 3BOPA 1ZRCA 4Q4X3 1C5HA 2VTXJ 3RQ0A 5EYXA 2HH9A 2J1TA 1YCIA 4YVSA 2ZGPA 2ADDA 1SMVA 1XSRA 3WNOA 1RUNA 1TME3 1GZWA 4K3UA 3IMNA 1RXGA 3VBOA 2FDIA 4CUAA 2XJPA 5E1RA 1AR81 3MLJA 2CY6A 4N8MA 4A2UA 1NLSA 4QDQA 4A3ZA 2QQLA 5CZKA 2G4IA 1W6QB 1BMV1 1HKDA 2HEYF 2WUHA 2W3JA 4OHXA 3T2QA 1FMD3 2BYVE 2CSGA 1VBB1 4XFGA 3BIEA 1J3RA 4YVWC 5K8SA 1W8ZA 2W91A 4DY3A 5J48A 4RQPA 5FP9A 4GD4A 2XUEA 1LOEA 2WT0A 5A7PA 3TYJA 5I0DA 1JZ6A 4NIDA 1UYZA 1NY72 1VBE1 3K77A 1WBLA 3IBMA 4LO4B 1W6NB 4FOWA 2B42B 5EWSA 3ZN4A 4K20A 1E5IA 1O59A 3JD73 1YO8A 3Q8EA 4RYDA 3KHCA 1ULPA 4I30A 3WNMA 3DGTA 1HX6A 2D98A 1WW5A 1LHNA 3I2JA 2VOTA 3LSEA 3M2MA 4QPIC 3O5SA 5FMCA 1QY4A 2WS93 4N9HA 5LY2A 1PNFA 3LFIA 2NZ9A 2VMIA 3RYPA 4IETA 1DDLA 5A1FA 2V4AA 3H3UA 4Y1XA 2ZKNA 1YJLA 3GBFA 5JXIA 2IXCA 3B5LB 4GB31 4LLOA 1VAMA 3B69A 4FQZA 1RUG1 3NAPB 3AYAA 3U10A 4EROA 1PIV2 1C28A 4BA6A 1M06G 1ND2C 1WA4A 5HPOA 4MGIE 3VD4A 5IVFA 3OY8B 1UCXA 2W08A 3LEMA 3A7QA 5T55A 3WP3A 2BU9A 2UU8A 1SBFA 2IFRA 5E6HA 3MDPA 3GYDA 1X9PA 1YUDA 2A70A 3MGUA 3HNYM 4BQ2A 1JU3A 4IGPA 2VUCA 4UFMA 2WQ4A 1D0GA 1T2XA 1XC6A 4Q4W2 3DPRC 4DIQA 1QQP1 5IAVA 4AE2A 2PFWA 3MBWA 4B4PA 1TZOA 1JYCA 2YZ4A 4JRLA 3HQRA 5C71A 4GA9A 2WNVB 1Z7S3 4L97A 1DCSA 2FDJA 4LBJA 3J8F3 4AI1A 3WNLA 3OF1A 2QUOA 1RUC1 3LEGA 2PHXA 2IXLA 2GSYA 3FUOA 4LHKA 3KV6A 5IHRA 2DDUA 1IPJA 5DUWA 1CAXA 2XHKA 1JYXA 5GLWA 1UZWA 2QCSB 1V6LA 2XBO1 5BY5A 4UF0A 1RUI3 2B4KA 1QXJA 4JGYA 1EV11 2E53A 1WMFA 4QX8A 2VZVA 2Y6GA 3GZUC 4M3CA 1EPWA 1NZCA 3JBG1 2QQOA 1XNTA 1HQNA 3A0NA 4XFAA 5C9AB 1LR5A 2WIIB 1T6BX 1XU2A 3S5QA 2DCYA 4DUXA 1GWMA 3PU8A 2ZMLA 4LK6A 2YBPA 3ZDVA 4JGZA 4QM9A 1NX9A 2HLEA 5JI7A 2ZTNA 2GP3A 1FPN3 2BTVC 2UYAA 3B93A 1COV3 1XE8A 1RINA 1UY3A 3O7OA 3RVHA 3T2OA 5LRSA 1H30A 2WABA 4YW1A 1SDWA 4FXGB 1RVF3 3H0OA 1NE4A 4MGYE 3PUIA 1GV9A 3WP5A 5C4WC 2WSUA 3MPBA 3ZYBA 5BV6A 5FUPA 4YGBA 1E57A 1W04A 4P08A 3WF4A 4AAPA 1REDA 2WZR2 1ND3A 4YGCA 5CFCC 1OHFA 1PO13 2Y0IA 4B7KA 4BDVB 3V0AB 4CPBA 2R061 4IEPA 3C7EA 4NO4A 4NRQA 4I3GA 3KF3A 2VG9A 3POIA 4Y22A 5KWRA 3TN93 2PYTA 5GM0A 1NCRC 4AFCA 2RS32 3MW2A 1MEC1 4HK9A 3ZXEA 4BYYA 1W9FA 4AVAA 1W39A 1RL3A 2IUWA 1F8VA 4NHXA 1JYVA 1FNZA 2GDFA 5FOJB 4PT6A 3ZYFA 2DUQA 1QJU3 3VL8A 3ZIXA 1SLBA 4GMP1 5F2SA 4LBQA 3ME2A 4K21A 1OQ1A 5A33B 5AFBA 1NCRA 1LNSA 2P34A 4O9GA 5A3TA 4QXBA 3N9MA 3LF7A 3ILFA 4MLOA 4WVVA 1QJX1 1X9TA 3DXTA 1TEIA 4NHLA 4Q4X2 4D6RA 1E5SA 2VOWA 4JDOA 4E9KA 2QZ2A 1OLMA 1POQA 2QE3A 2WZ8A 4H7LA 2XR4A 3C7FA 2FDFA 1OA3A 1TME2 3OGGA 2BNMA 2VQAA 3UGGA 2WN2A 4UFLA 5FK8A 4E8CA 1ZX5A 2RJKA 2Y6JA 4HBNA 5F5IA 3PMEA 4NR1A 4XW3A 3ZFGB 1A8MA 1WLTA 4D69A 1OD5A 1FMD2 2R6QA 4CP9A 3X29B 1WCQA 1UKGA 2IXKA 2WAOA 4P9LA 4FFFA 4XDPA 3WW3A 5JOZA 2WN3A 5FPLA 5JR2A 3ACHA 3J4UH 4DZGA 1CX4A 3OB8A 5FY9A 5LEJA 1VIWB 2R0HA 2AEYA 5GLTA 3T4VA 1AX1A 1QF3A 2R041 3BALA 1WBFA 1AXYA 4RR3C 2HWF3 4TWTA 3WHTA 4IERA 5FZ7A 5C5UA 1XQNA 1ENSA 2K0GA 2O14A 3LDRA 1PZ7A 2FCVA 2XMLA 3JD72 2BFUL 4LO6B 3AKQA 1WD3A 2HEVF 5J98B 1QGLA 3NWKA 4P5HA 1ENRA 1ENXA 5FRAA 4PDWC 1DYPA 4YFZA 4JHZA 1GZTA 2EF6A 4FI9A 5FZ3A 4COZA 1POV3 2WS92 2ZXQA 3DN7A 4BQ1A 2ZGLA 1RC6A 4OLLA 2VW1A 2PAMA 3WNNA 4DUWA 4RR3A 3WEZA 4AHXA 1LRHA 2I74A 4ASKA 2HWB2 4WZFA 3OG2A 5ANNA 3J7NA 3WT3A 1I1EA 3TNPB 2J1UA 4Z2AA 1YFXA 5F39A 1ODNA 3SKJE 4C90A 4O7XA 4XACA 3SMHA 3CEWA 3WSOA 4RA0A 3BYWA 3RFRA 4CP0A 2OQ6A 4EN7B 4UAPA 5FYIA 5I91A 4Y4YA 4UFJA 4A41A 2JG9B 4FP3A 2XL7A 5LA9A 1R083 2CYFA 4MGQA 2YU1A 3VD7A 1VBA1 3AMNA 3KCCA 5C8WA 1OI6A 1OF4A 2X10A 1C8M1 3H3ZA 2SBAA 2P3YA 1FAYA 2G1MA 5SV5A 2JG8B 1ZA7A 1LB2A 1Q5OA 4NHMA 3ES4A 4I09A 3BVCA 1NYWA 1ULGA 4BU2A 2ZZQA 1EY2A 4QU2A 4YGDA 1SFPA 2HWD1 4XQWA 2BGOA 2VU9A 3PIJA 4XEZA 1DFQA 3U37A 1JOBA 1RUI2 2JIJA 4JV4A 1E5RA 1NLQA 2OKXA 2V09A 1BBT1 4AQTA 1VALA 3M3EA 1IQAA 1CJDA 3IIIA 1RMU1 2HBUA 3VDDB 2NMOA 2ZHKA 1S2EA 1UOGA 4FO9A 2PHFA 3IPVB 1SEFA 5LEKA 1XPWA 1C3HA 4FTSA 2ZA9A 4AEDC 3OD0A 1UOBA 4OUSA 1NA1C 3OCPA 4FPGA 4CCNA 2JE9A 4FTEA 5FLIA 2R49A 2BERA 1V00A 1FPN2 1OF3A 1OKQA 3D4KA 1AR71 3D5OA 1X8MA 4N43B 4Y5Z0 4CUGA 4M4RA 2Y34A 5ACA1 1RVF2 1PVC2 3O0WA 1BKZA 1QMJA 4UW3A 3WCRA 3TEZA 2B9VA 4L99A 5DN2A 1NA1A 1AL22 2D5FA 2DVBA 1XYPA 3DF0A 3NNGA 3UGFA 1PO12 3OOXA 2FMYA 1D2QA 4AVVA 1W2NA 2EA7A 5L36A 1L7QA 5E89A 2NQYA 2X8KA 1ZZBA 3LEIA 3M70A 2P3JA 2ZEXA 3TN92 3VBUB 1VMHA 2W1SA 4E8DA 2XLAA 4P14A 1ZZCA 4CEYC 4QX0A 5K7PA 2J42A 4Y1UA 3UNPA 1G8WA 3MW3A 4IV3A 4CDWB 3N9NA 2VW2A 1V6OA 3SHRA 1QJU2 1UIKA 3CJXA 3K46A 2R7EB 1DLCA 4K7JA 3SCGA 5F3CA 1W6OB 3KZ4C 1H6YA 2VR4A 4MOAA 3ACFA 4JAAA 3ZFEA 4SLIA 3V0BB 1QKQA 2QQIA 4F83A 4CVUA 1MR5A 4YZ4A 4CEYA 1RIRA 2ZX0A 4W6YA 5J37A 1RUD3 1JUIA 5GLUA 1W90A 4EWEA 1KGYA 2QVSB 3O1TA 1UO9A 2YBKA 3NJVA 4GULA 5FYZA 1PMIA 1K45A 2RS51 2UY8A 4YFWA 4E27A 5FZ4A 3UL2A 3ZFFC 1IS6A 4AK3A 4QGMA 1ONAA 5KC5A 4XDOA 1KJRA 4YYOA 1GOFA 5T5LA 1AYM3 4BIFA 4QGNA 3SC7X 3HJRA 2ZMKA 2JE7A 4RGGA 4K8FA 4QGLA 1U5YA 2RM23 1Y4WA 4Y26A 1EAH3 3VBOB 3OGJA 3FBMA 4L92A 2ADEA 1Q3EA 3KGLA 1DQ2A 4HXCA 5ERLA 3ZFFA 2JD9A 4QM8A 5T3NA 4KG8A 2GALA 4P02B 5JI9A 5JUVA 2HWF2 4DY5A 1W05A 4YSFA 1W6PA 1YQ2A 3K3NA 5AC93 2ENRA 4IUGA 2OVUA 1GBGA 3ZXFA 5FP8A 1LU1A 3VB9A 4DEVA 4RQPB 5FZEA 4CDUC 5CFDC 5FP7A 5LK5A 1YLLA 4BQXA 2VBPA 1Y9QA 1KITA 3DKQA 2ARXA 3NJZA 4KG0A 3SCFA 5L9VA 1BEV3 4N53C 1ZBE3 4I0BA 4FAHA 3POBA 1Q8PA 3ZM8A 3E6BA 4RS5C 1HRV1 2CWMA 1AJKA 2XOMA 1N3OA 3ETPA 1Z0HA 1RJ8A 4AGGA 1W9SA 1GQGA 2VNRA 1HQLA 1VPHA 2YC0A 4PIXA 5DAVA 1WGPA 3HN3A 1HB4A 1YHFA 1FXZA 2YC2A 1JS9A 2P6CA 4N53A 4EE2A 4OCTA 2OPKA 3N9OA 4GQ7A 3VBRC 1WMDA 1G7YA 2HWC3 3H9AA 5JAXA 5FXZA 1R082 2RG4A 3AP9A 2XJVA 4RHV2 3FJSA 3WW4A 4O61A 1SHWB 4XYXA 3WNPA 2EIEA 3FE5A 2WZEA 4QPGB 2JWPA 3C7HA 4RSUA 1W8UA 5EHDA 4URTA 1XNAA 1OSGA 1W8WA 3EB7A 4WBBA 4XURA 4FP2A 3HN1A 3VBRA 2CU5A 2PHTA 4XAEA 3S0MA 1ZRRA 3C2UA 3GHNA 4QX5A 5FMBA 3AB0A 3WDUA 2Y6HA 3SH4A 4CPBD 3MHZA 4EJRA 2VY0A 3EO6A 4AVBA 1AZDA 1VRH3 1STMA 2WO7A 3IM0A 3J7LA 4CXWA 4XJUA 3VBFC 5E8AA 4DXRA 2B8MA 4TZDA 3MFAA 3RJ2X 1IQDC 2RHPA 1CAXB 3CU7A 1F31A 3FHQA 1F2NA 1HXS1 1OQEA 2IZWA 4Q4W1 1OT5A 4R4ZA 4XBLA 1US2A 2D3RA 2BWAA 1DG6A 4ZU7A 2OX0A 4CDXC 1HIXA 1OUXA 1KQRA 2P1BA 4JGYB 4LBQD 5C3SA 3WW2A 3PMSA 2R30A 4M3CB 4B1MA 3OGRA 4JX0A 4RGAA 4Y1VA 3ZYRA 5ABJA 5DDJ3 5GZGA 5JLVA 3VHPA 2OZ6A 1K3IA 3OBZA 3VBFA 1OPMA 5FKBA 2JDPA 5EJ3A 4QX2A 3AJZA 1LENA 1QOOA 3I2OA 1J1TA 1I9RA 4KBZA 3RS6A 2VZQA 3OUHA 1JYNA 2A3YA 4JGZB 2Q8DA 1JZ3A 5A1LA 5FZKA 1K5MA 4CCCA 3WR0A 1YRZA 1GYKA 1C1LA 4JRAA 2P17A 1C4RA 5FPZA 3VKOA 1R091 4FFGA 1FV3A 1ZRIA 3M3OA 3C7OA 1V6MA 1JZ7A 3ST7A 5FZAA 4NWWA 4AZZA 1A34A 2A6VA 1QJZA 1S0EA 3PJQA 3KV4A 3AVRA 4BQYA 2BGCA 4XIKA 1ND3B 1GP5A 3WDTA 3T0DA 2UWBA 5F9TA 1K42A 1YFYA 2XJRA 3RI8A 4D6SA 2O0OA 1AJOA 2RR13 4IQPA 2DU0A 5FFOC 1UU5A 4U36A 1N1TA 3ACGA 3RZLA 4ISRA 1YIFA 5EQUA 4NIGA 5CNAA 5DUVA 2EALA 2IC1A 2BWCA 5GKAC 1RUD2 4C1XA 3ACIA 1IS4A 2ZGMA 3LA7A 3ROUA 1US3A 1TMF2 4CDQA 3S5AA 5BNOA 1ST8A 4LBQB 2PHRA 3MZHA 4LJHA 1NCRB 1GZ9A 1JHNA 1HQWA 4R4XA 1MPXA 2RS12 1NY71 3KF5A 3NSTA 3I49A 1RHI2 4MG2A 4BE3A 2LM3A 3U4SA 4HKOA 5BUVA 1LTEA 4HSJA 1VBD3 1WMXA 1OXCA 1RUF3 3ZN5A 2RM22 3PVNA 3ZLIA 3LOIA 5KHJA 2R073 4XF4A 4AL9A 4PQQA 1LESA 3MIGA 4NE9A 3B3QE 4DPNA 1HW5A 1NKGA 3TB0A 2QQWA 4CP9B 2AENA 1ZZ9A 4IDZA 3D0JA 5AC92 4G9SB 3AVSA 4Y20A 2ZX1A 4ASLA 4Y33A 4FFIA 3MIFA 1V9U3 1MS9A 1LOAA 5KXBA 5EJZB 2P4EA 2DURA 4GKXA 3IAPA 1PIV1 1R1A3 2JJ6A 4KU7A 2HWE2 5H9SA 3LWCA 3VBHC 4IGOA 1LEMA 4P9JA 2IWGB 3SEPA 4A4AA 5KR7A 3J26N 4MXWA 5FXWA 1BEV2 1ZBE2 2Z5WA 4UFHA 2ILMA 2VZSA 4QT6A 5GZCA 1AHSA 5K0UC 3O1SA 1N1YA 1K12A 1H9PA 1UWWA 1NQJA 3BU7A 3LQCA 2VO5A 1N3PA 3WCSA 2X5IC 5A3PA 5JSPA 3CHXA 3BOWA 4KMQA 2VMEA 1LECA 1G86A 2BQPA 1AUYA 2WFPA 3DCQA 3KM5A 3NVCA 4GIQA 2VZUA 3KCXA 4IESA 2W1UA 2XJTA 5AVAA 5C5TA 5JMOA 3E5QA 4RR3B 3EHKA 3POFA 5K0UA 5DZGA 2NLRA 1I6XA 5HCHA 4P9IA 5FZ9A 2ZAAA 2YG0A 3AK0A 4YW2A 1YFUA 4MO3M 4GH4C 3VKFC 1DQ1A 1LOFC 5SV8A 2UY9A 2G19A 2O1QA 2Z42A 2X5IA 1VR3A 2ZOEB 2Y38A 4L8QA 4S2GA 4MGZE 3V65A 4LKDA 4DUVA 4HPKA 4GKYA 4BHPA 3LFMA 1RUE2 4QPYA 5L7OC 2JX9A 2XWBB 3QH7A 4INDA 3O0VA 1K5JA 3OTFA 3GALA 1SACA 1CAWA 3I3DA 1S0BA 2EXHA 2QTWB 1VRH2 1WW7A 4CUCA 1OMIA 3DXUA 4LO7A 4XBQA 3LDBA 5FO8B 3ZOIA 4LUKA 3HT2A 3T2TA 2CL2A 3DYPA 1O8PA 4ATEA 2P37A 4KNCA 2K9ZA 1X8EA 2IXIA 2YPJA 4LITA 5FKCA 1DP0A 2A6WA 4AAXA 1LCLA 1W9YA 5FZLA 1CR7A 4ZKTB 2P2KA 2BGPA 2OUJA 4XUTA 3RWNA 3VZLA 4I2OA 2WO1A 3VHOA 4OHYA 5FMDA 5DDJ2 3CBNA 3CJIB 4PI2A 3O1RA 1PZ8A 1F5JA 5HV4A 5F5QA 4MGKE 3RZHA 2RS31 1AR83 4BWOA 4R9BA 4DINB 5L9RA 4A44A 4XJ9A 4HKLA 4IE4A 2BVVA 3NJYA 4BMBA 5C8CC 1VBB3 5CEHA 5D8AB 1MZ6A 1D0HA 2VC9A 3R05A 5IAXA 2D6OX 3AKSA 3K75B 3LGRA 4XHBA 5FZIA 2DFBA 2VCBA 1AYN1 4CCMA 1X50A 1GNZA 1XU1A 3U11A 2W68A 4XXPA 3WW1A 1PMHX 5DXDA 4D7SA 1RTVA 3OUIA 2AZ5A 2ZX4A 5FZGA 5IWFA 3UK9A 1W0NA 4IEWA 4XILA 1PMJX 4OUMA 3GCWA 1WZXA 2W52A 2JB8A 2E7TA 4ZZ8A 1TME1 1RUJ1 3NJXA 5A3LA 4WVZA 3M3QA 3Q8CA 5APAA 1GNYA 5FYUA 1QJEA 1FMD1 4IV3B 2YGMA 2Y6FA 3RDIA 3IWZA 2EIDA 2JECA 4HOOA 1QNWA 4MV2A 1CPNA 5BNNC 3UJOA 2AREA 2A1XA 3EBRA 3HNMA 4LQRA 4NAOA 2CV6A 1CAVA 1CIWA 1H8TC 4ZU4A 4LE4A 5FPVA 3ZFEB 4MGTA 1OD3A 5FZ8A 4TXWA 4YZ3A 2Q8OA 5HCFA 4CEYB 1DZQA 3K51A 2ZGUA 3AX4A 2J1EA 3EQEA 2AC1A 1BJQA 1W2TA 1N1VA 3GJBA 4QPIA 4A7KA 1TVGA 1CPMA 1FOD2 1VBD2 1CZVA 3JD71 4MX3A 5IVYA 4CCJA 5C70A 1D2SA 2J1SA 5BNNA 1AX0A 1DQ0A 1CZSA 1NLRA 2R072 1NE6A 3THTA 5GZFA 4ZZ5A 1SLIA 1O7FA 3EYPA 2WS91 2PLV3 2YFZA 3OUJA 4O65A 3T2PA 3UV9A 5FMOS 1HLCA 5A7WA 3M8LA 5FR3A 2BEOA 5EYYA 3CQOA 3SEEA 1ND2A 3L2YA 3UKTA 2HWB1 3D3AA 1HV1A 5CAZA 1V9U2 2BV4A 2KA3A 1RUC3 2W1QA 3N7KA 4E4HA 5FYTA 2WYFA 3WLUA 1R1A2 3THCA 1UX6A 1QIQA 4QKNA 3H8UA 4FXKB 2XBO3 5I8YA 2ZBJA 5J96B 3FHIB 3P1IA 1W6PB 4JQRA 1UW8A 1EV13 3UJQA 3DPRA 2XVKA 1VAVA 4ZU5A 3AMQA 2WNEA 4FBFA 5AVPA 3UKVA 4YZ5A 2XXZA 5BNPB 1JHJA 2ZEYA 4LBKA 4CU8A 5C3QA 5LA2A 4M3CE 5I8SA 1GOHA 5C6CA 5KHIA 3MF6A 3HBZA 2F4PA 2RDNA 2GMPA 4NRMA 4Y5TA 3WNKA 5IK4A 4F3JA 2WWUA 2E26A 2P6HA 3VZOA 4Q1RA 4OYUA 4LBOA 2F4LA 3OGVA 1ULFA 5IJRA 1ALYA 1UMHA 4J1XA 3J7MA 2VVDA 3PIGA 1YFWA 2A5ZA 2QDNA 2ZEWA 3MLLA 1MQTC 1CQ9A 4IXLA 1XNCA 4QB1A 1G9BA 4CCEA 3RRDA 2ZGQA 2GC3A 2V4VA 1AX2A 2BW8A 5JDBA 3RZMA 4RD7A 4Q29A 3WHUA 5KHHA 1W3XA 1OKOA 3J7HA 4N53B 2YXSA 1O5LA 5FYCA 5FZ1A 5KXCA 3TEWA 1RGSA 1V70A 4WZCA 3ORJA 4QX3A 5LCWL 1YEWA 3OBRA 1KJLA 2D43A 1PO23 2BZDA 3MICA 1A3KA 1O4ZA 2Q8EA 4WVMA 3TAYA 3NV4A 1LAJA 4XXAA 2LRPA 4PI0A 1UXZA 2OZJA 4XABA 4CTEA 4NVPA 1MEC3 2WA3A 3RPQA 3CKHA 3AMMA 2IXJA 2CAUA 5C4WA 3I3BA 3UETA 3B01A 4CA9A 4XFIA 4N7UA 1FPN1 4HONA 2VZTA 3ZN6A 4NRPA 5IVJA 5CFCA 4Q4V3 1GQHA 3NO8A 4QD2A 4AOCA 3NV2A 1PVC1 4XPVA 4XCAA 4PLOA 1LODA 1H1MA 3K48A 4QX1A 4NPRA 2YGLA 1AL21 4FPHA 4WM7B 5FYMA 5A3WA 3H8OA 4XAAA 3ZMNA 4N9IA 4NN0A 2BJSA 4AEMA 1UN1A 2R16A 2B9UA 4GZ9A 2CWSA 3T1LA 2XG3A 4AG4A 1GWLA 1O5UA 1CAUA 3TN91 1MZFA 2E7AA 5DAWA 1OLME 1Q56A 4PBOA 4AQ2A 1UMZA 5LRRA 4OULA 5HI0A 2E7QA 1KS5A 1J3QA 4GXLA 1Z78A 4GWMA 4UBHA 5ABJB 1BMV2 2DCZA 1RUH3 1HN1A 4R9DA 3GJAA 3CF6E 1UZ0A 3IDCB 5FZOB 4JKKA 1OA2A 1R1ZA 1VBB2 4LUMA 3SLIA 1OC1A 1QJU1 3IIAA 4KGQA 2WJSA 4HG6B 2MPFA 4COWA 1O3TA 2G9ZA 3QOPA 4IV1C 1RYYA 5FZDA 4B4RA 3LIHA 2Z69A 4KWJA 4UFIA 4AI9A 3KD4A 1UZZA 1K5MB 3HQUA 5HXMA 5IYYA 2R043 5CVRA 1NXD1 4OQ9A 4B1LA 4QQOA 4BLIA 4S2HA 5D21A 4QX7A 4Q5OA 1G9FA 1MS1A 2PXJA 3FHAA 3KQRA 1LJ7A 4ORFA 3VHNA 3SCHA 2WINB 1VMFA 1DLLA 1QJY3 3AFKA 5LATA 5A7OA 1YYNA 4IL7A 4A3XA 4Q2FA 1H2NA 5JZGC 3CZUA 2E31A 4GWNA 5F3GA 4QQ2A 4PF1A 2ZPXA 1IG3A 1QOSA 1RITA 2VL4A 3CDZB 1S0FA 5IVVA 2EXJA 1ENQA 5FY4A 2A3XA 4FT8A 1B35C 5L19A 3ON7A 4LKSA 1I3HA 3NKGA 4CRQA 3RSJA 2LW8A 3L9JT 2ZGKA 2VZ1A 5LA1A 2OIIA 1CZTA 4PDWA 5JZGA 3F95A 4DMIA 1YXWA 1BZWA 3MIDA 1W8HA 3VDAA 5A6ZA 3AC0A 4R52A 4A6OA 4CDQB 4HETA 4B3NA 1ZYBA 1XOYA 3WDWA 4AEKA 4E2QA 1BHGA 5BNOB 2W95A 4LHNA 5LWBA 3S6PA 2KR2A 1VBA3 3BKZA 5FYBA 3SITA 1F4HA 1B35A 3T08A 2KD7A 3DYMA 4ES8A 1POV1 5DG1A 2PLV2 5FWEA 3VD9A 1DU3D 1AR91 4YW4A 3VKNA 4BQ4A 3HIFA 1IGOA 4H7MA 2KM2A 5BXXA 2ARAA 5IUQA 4R9AA 1Z7S2 3VDBA 4NPLA 3FLPA 3I3EA 1OPOA 1W99A 3J8F2 3KVBA 3NRUA 3PTYA 4H14A 4AHWA 3Q8AA 5FZMA 4TTGA 4ZXKA 5KXEA 1B09A 2ZABA 4L9BA 3M3CA 4E4DX 1EV12 4XHXA 3H3LA 1KDKA 2XHNA 2W92A 3ZKUA 3AKPA 1R081 2ERFA 1RMU3 1UKRA 1W8TA 4RHV1 3O1PA 3UKNA 3HMYA 2RMU3 4LOSA 3CO2A 2VTFA 4LBMA 4J1WA 3WQ7A 3VD3A 4MXWB 3B9IA 2QQVA 2PN5A 5JR7B 3TEYA 5FAXA 4RGKA 1JOPA 2DBNA 2OUHA 2ZACA 2JDUA 4QDSA 2OYZA 4BB3A 2BNNA 1O4TA 3BN6A 4COYA 3BUCA 3NL1A 4IEQA 5LW9A 5GZDA 3VBHB 1COV2 4GWIA 1G9CA 3AZZA 4XZPA 1IPKA 5A3MA 1F15A 2WLQA 4ZS2A 3OSDA 3PHMA 4AEDA 3BB6A 1QHDA 1D4M3 1SFYA 2JKBA 4XTPA 3SH3A 2Z4FA 1SPPB 5H9QA 2D3PA 1F5FA 4IEVA 2FBEA 5A7NA 3NV3A 1PO22 2DCTA 2R1DA 1PGW2 2D97A 2VZRA 1CIYA 1HB1A 3RGBA 4XJAA 1Q8OA 4Y1YA 3RMYA 3RWKX 4PF5A 4B7EA 3PVOA 1PX4A 2NM1A 2C0ZA 5HXVA 4AR2A 1CONA 4Q4Y3 5LB6A 3QACA 4ZPIA 4Z82A 2XQRA 1XRUA 4BZ4A 3IZOA 5DG2A 4Q4V2 4F7ZA 2WFF3 2Y0OA 2PTMA 4JDNA 4YG0A 3N9LA 3WD5A 1S55A 2WT2A 3B02A 3TOJA 3I2GA 1W28A 2VQUA 4K6BA 3RYRA 1NG0A 4BPZA 1BK1A 3CIHA 3PDQA 1C1FA 4BQ3A 3WF2A 1H2KA 5IK5A 1OURA 1DQ6A 1ULDA 1JI6A 2YDEA 4LNVA 4AI2A 4EYUA 2YBSA 2HEWF 1O3SA 1MS8A 3NAPC 3Q8BA 1IZ3A 2QQNA 2RS53 2X53S 2Z79A 3DKWA 4M00A 2JENA 4QDRA 2VMHA 4WVWA 3QD6A 2GU9A 3JQWA 4YRDA 4KWLA 4BCUA 1OFSA 3E5XA 3CMGA 4LBLA 4BISA 3ZR6A 1PGL2 3WV6A 1RUH2 1IS3A 4ZONA 2PQQA 1J3PA 1SDDB 3E5UA 3RYKA 2UWAA 2ZGSA 2ES3A 2XWJB 3QLQA 4OZOA 4UWDA 4L0PA 4YVSB 5JMCA 2ZAHA 5FPBA 2NPIA 4YVWA 3ZMOA 1GZWB 1WLWA 1LGCA 4JHTA 1ASJ1 1ULEA 1XNDA 1GP4A 1FATA 5A70A 1CJPA 1ZBA3 4CUBA 4IEUA 2DUPA 4UT5A 3WQBA 4QXHA 1N1SA 3DUIA 4X8NA 2VTXA 1H2MA 1JZ8A 3SNMA 1TMF1 2W47A 4DRRA 5JCTA 1H8VA 2BFUS 2DBIA 1NCQC 4MHUA 4Y1ZA 5GJ6A 3A22A 3SXWA 2W5FA 5C7GA 3I59A 3FBYA 4A7YA 2VZOA 1QJY2 2YYOA 4NOTA 2RS11 2PMWB 5FJKA 5B4NA 3MF9A 1RHI1 3RMXA 3VL9A 1EPZA 5CBLA 2ARCA 5IVCA 2Q8CA 1QXPA 1SLTA 3SH5A 2A73B 4I3PA 1HRV3 2RM21 1D7PM 1UNBA 2D93A 1VRBA 1WW4A 5KHKA 5C9AC 2J1RA 4XCBA 2VGDA 3LD8A 2JDZA 4UW6A 1NCQA 2DU1A 4RN5A 2GNMA 4CDUA 2GH2A 5CFDA 4Q27A 2G9FA 4AQSA 1LHWA 2PAKA 1CWPA 4XETA 3ZXGA 1JZ2A 5AC91 1SBEA 4META 2VAUA 1IKPA 2WRAA 2YU2A 1EYBA 2O8QA 1XYOA 3AP4A 3ZYPA 1J84A 2Q1FA 2VD7A 3H7JA 5C9AA 4X6RB 3N3HA 4RS5A 2PELA 2D6NA 2ATFA 2V5DA 2HWE1 1VBA2 1YQ6A 3FUQA 3I2KA 2VE1A 1JZ4A 1OQDA 4XOGA 1QNYA 2VCAA 4JKMA 1BEV1 3VD5A 1FNYA 2GC1A 4QPIB 4TLFA 1Y43B 3LA2A 1W8NA 3PL0A 3LSDA 4GJYA 1E5HA 3HEIA 1DGWX 4MYEA 4DXTA 1KDMA 1S0DA 2VMCA 1H1IA 4IEOA 1SCSA 2EAAA 3I2IA 1CX1A 4ARXA 3OPTA 3PLQA 3A23A 3CNAA 4KH9A 4V1PA 4BIOA 3AM2A 3PUQA 5A7WB 1DGLA 1LHUA 3MIBA 1IOAA 3HOBA 3JUUA 5G05L 4CCKA 1O8SA 2Q0AA 3AYEA 5IVEA 1ND2B 2J1AA 4LA2A 2E33A 2PHLA 3JCIA 2LUWA 2E6VA 4ET7A 1DHKB 3V0AA 2WO3A 1PNGA 4JVAA 5DABA 1UMIA 3OEAA 5CG9A 1NAEA 3KWVA 2RMU2 3HR9A 3OGSA 1UX7A 1W06A 5HCAA 3N4MA 2AR6A 3WG1A 4XBNA 4D0QA 3GNEA 4JTOA 3ENRA 3U78A 2BP6A 4UXAA 4LKEA 3TRSB 3DPRB 4UF0B 2GNTA 4M4PA 3MIEA 1UY0A 1RUE1 2DCKA 3F2ZA 3P3NA 2VZPA 1G9AA 4Q26A 4AF9A 4AHYA 5FZHA 3T3YA 2XH6A 4DQAA 5KBFA 1BK0A 4QKBA 5DQ0A 2OXBA 3K4AA 3N9PA 1YI7A 1JMUB 3I97A 4FOQA 4ZS3A 4AGRA 3OBAA 4CE8A 4LT5A 4AFBA 2ET7A 1GU3A 2XQXA 3NV1A 1VRH1 4FPJA 2B45X 1LOBA 1R093 1D4M2 4XZUG 4CDXA 1U12A 5F8PA 4G4FA 3JXSA 3G6JB 4LA3A 4ATFA 5JXGA 1PX3A 5A3OA 5LBCA 2VW0A 2RVAA 2FDKA 2GMMA 2MEV3 3WY6A 5DZFA 1WKYA 1BCXA 4OI4A 1W3VA 4Q4Y2 5A6XA 1GFF2 5I8TA 2J7MA 4WVMB 3I7DA 2WFF2 4GWJA 4QB6A 4PLNA 4Y22B 2V72A 4AI0A 1XXNA 1H1AA 1HN0A 1Y9GA 2DTWA 4XJZA 1U5XA 5C4WB 2TBVA 5JOYA 4FPOB 4A6SA 1WA6X 5LY1A 5FV3A 1XNKA 3ZN6B 3T0BA 5CFCB 1TNRA 1VBC3 1AR63 2RS52 1WMEA 3JU9A 2Y64A 3H50A 4YGEA 3VUOA 1DQ4A 4EN9B 1HRI3 1TNFA 2ARBA 2Q1MA 4IEXA 5EIYB 1S0GA 4YWAA 4E4SA 1XB9A 3ALQA 1HV0A 2I2SA 2VMDA 2JG9C 5CB7A 5J3UA 1AYM2 1HB3A 2G9GA 2P5BA 1VB2A 2DVDA 1CAUB 5FZBA 5JIAA 3O1VA 4OQ8A 3IAQA 1EAH2 3VDCA 1SCRA 4IEYA 2K2SA 3ZO0B 2QZ3A 1ZBA2 3P3PA 2WSVA 4ZHNA 2JG8C 1WW6A 2VM9A 5FY7A 1AF9A 1F9KA 2VZ3A 3H42B 4LIUA 3GXUA 5FLJA 2VCCA 2LROA 3CLPA 1C5IA 1PIV3 2WDBA 3C7GA 5T5OA 3VKMA 1PK6C 5LK7B 2D44A 2W87A 3T1MA 3WP6A 4YM3A 5JPNB 1SLAA 2DF7A 2JIGA 2YUEA 3NQHA 4DB5A 5FO9B 2VNVA 2W1WA 4LR4A 4OHZA 5IATA 3H7YA 1SBDA 2QQJA 1SFNA 2PQSA 3GF6A 4W6WA 1FOD1 1VBD1 4YM0A 3QBQA 3TBDA 3WF0A 1YC61 5LBFA 4EN8B 3IN9A 4OVEA 2ZEZA 2R071 3VDDC 2W2IA 4OFGA 2Q30A 4H55A 1W0PA 2JB4A 1WCSA 3ZXJA 4CP2A 1PM7A 1PK6A 5I0UA 1W0OA 2NYYA 1LHOA 4XF1A 2IFWA 2DUOA 1GZCA 2BOIA 1V9U1 3H8RA 5F7UA 4N43C 3VDDA 2HWC2 3AJYA 1A8DA 1R1A1 1SQ4A 1URXA 1W2UA 3H1YA 3KT1A 4C91A 4CU7A 3IPVA 2B5HA 4YZ1A 1FX5A 2HKXA 2X09A 1C8NA 3M1HA 3NNJA 5LBBA 4PDWB 3KHBA 2AEZA 3FFZA 3LA3A 4HKWA 5FJHA 4UBGA 5B4XA 5A3NA 4EZHA 1J83A 4NIAA 1MVQA 2XJQA 5KXDA 2XONA 2XVLA 4OI0A 2KXLA 1B35B 3FN9A 5ANQA 2YMZA 3IT8A 3VBUC 2AGSA 5JSOA 1BQPA 3GHMA 4OZXA 3ZKYA 4GH4A 1JBCA 4HSLA 4QB2A 4UW4A 1LOFA 5F32A 4ES9A 3B00A 1X33A 1DYKA 4UYBA 5L73A 1ZRFA 1JH5A 4AGVA 2CAVA 5H9PA 4GMP0 2W46A 3W5MA 2YY1A 1AL0G 4BK5A 3VBUA 4F8AA 4NIHA 4IE0A 1OOPC 5L7OA 1ZNPA 1SZBA 1UZYA 2C1FA 4QPWA 2DVGA 5FP4A 3ZR5A 1DZRA 2PAEA 1OLRA 2WZR1 3THDA 5IVBA 3MV11 1UD1A 4Z07A 5FTTC 5FY0A 3SQOA 1FI2A 2UYBA 3A0KA 2WKKA 4EN6B 3POEA 3B94A 4AVTA 4D94A 1OOPA 2BVBA 1GP6A 1ZA4A 3AFGA 3RNSA 5IW0A 2WBKA 5J09A 4KBBA 1OH4A 2PHDA 2WAAA 4BXFA 1ZVFA 3N36A 5I0RA 2WL1A 2BBVA 1ULOA 3R4SA 5T52A 4TYSA 4CEWC 3DL3A 3U07A 4WV8A 1AYN3 1LGBA 5DAPA 5A32A 2Y6LA 1O3RA 1G6NA 3HWJA 1WCKA 2MEV2 3ZYGA 3KT7A 1LOGA 4NAMA 1FV2A 4AEDB 1X82A 4WM8C 1QJFA 3HQXA 4JC1A 3AZWA 4XUNA 1AVBA 1NA1B 3S7IA 1VBE3 4Q4X1 1S4CA 3GGLA 4Q0VA 5EJ1B 2ZS6B 4RQPC 1RUJ3 1P8JA 1YNAA 2D6MA 5CU1A 3U1XA 4QQPA 4CEWA 5C8CA 2RR12 5DUXA 3KMHA 1DGRN 2YPDA 5F6KA 1JW6A 4BLJA 3ZYIB 2RE9A 3LB9A 3B7MA 2A7AA 2WLPA 1EUTA 4HZFA 3MI8A 1ZREA 2WNUC 4WM8A 1ZZ6A 3K4DA 4RFT0 3ACLA 2VUJA 4CSWA 3VZJA 4YNIA 3DEMA 1SLLA 2DTYA 5C3PA 1VBC2 3BI3A 1AR62 1UQXA 4XDQA 1UY1A 2WWSA 3OD4A 1JUHA 3FWEA 4GB33 4BM8A 3G7DA 3OYWA 4MADA 5CA6A 1RUG3 4A42A 1HRI2 4XFFA 1DQ5A 3U0ZA 1MS3A 1YI9A 1H0BA 5A80A 3K4ZA 5CADA 4DFSA 2JXAA 1POV0 3IDBB 1NOVA 3ZIWA 1VAKA 1XE0A 2WNUA 3ZSLA 4RL7A 5JXHA 2JDKA 3GZAA 5EFUA 4AW7A 3FMGA 4B8EA 4W8JA 1RUF2 4B4QA 1QEXA 3U75A 2BOJA 4NROA 4E2GA 1WLCA 4C0HA 1UXXX 4QPGC 1H8TA 4BK4A 4KI5M 4M0HA 3KB5A 1UYYA 2ETEA 3GCXA 2FDHA 4R9CA 3M7AA 4G3YC 1OVSA 1QQP3 4MVTA 5FY1A 2JKXA 3MLKA 3R4DB 5FOBB 2HWB3 2W39A 2EIBA 5F37A 4FOVA 1GICA 1W6MA 1VB4A 3ES1A 4YVWB 4K1ZA 4AWDA 1WCUA 3VBSC 4OUEA 2AACA 3UYJA 5H9RA 4LO5B 1R64A 2GMEA 3L2HA 4QPGA 3ZFFB 3I2HA 4A45A 3ZXKA 4LKFA 1JYTA 1OFNA 3WDVA 5T5PA 3LKJA 1UYPA 4LE3A 4PHZA 4V2WA 1N47A 2VXJA 3T4HB 1JYIA 3I59B 3JBG3 3IDEA 3LIGA 4BQWA 1WCDJ 3VBSA 5FCCA 2Y6KA 2BDRA 2JDMA 2OPWA 2PLV1 4BJ0A 4QHZA 2RDQA 4JGYC 3BCWA 2V5YA 4B29A 3I8TA 5F2WA 4BH9A 1BLZA 2Q5TA 5JSRA 2PA7A 4W6XA 3ZPOA 2EXKA 1L3JA 3NNLA 4IEZA 3ZX7A 1Z7S1 3OBTA 1NCQB 2GZWA 2LS6A 3J8F1 2JEMA 4FPKA 5GLZA 2VECA 4K40A 1W9TA 4CDUB 2Q4SA 3GZTB 2CDPA 2XLGA 3AKTA 5CFDB 5M0TA 4JGZC 5FP3A 5F1RA 3D0SA 2D5HA 1YQ5A 4XC9A 1GMMA 1V6JA 2JD4A 1BVVA 4QU1A 1Y7BA 2D40A 5DAQA 1UL9A 1EP0A 1RUI1 4XUOA 3BIWE 3IB3A 5J36A 4BXSV 4Z2WA 3MFCA 4RS5B 5FPXA 5EP9A 4D6QA 4S2DA 3AYCA 1Q8QA 2R063 2VNOA 4SBVA 1XJAA 2YHJA 3FZ3A 5FIXA 5FPAA 4Q0PA 4C8DA 3KS7A 1XBFA 1RUOA 1MQTA 3PNAA 4XUQA 5FZ6A 3UESA 3ZXDA 3SKVA 1ND3C 1JODA 3AZXA 4PLMA 4Q8KA 2GAUA 2QKDA 1U0AA 2EXIA 4BOWA 4JCKA 2H6BA 3POSA 4QXKA 4UOJA 2J22A 3VBRB 2W9XA 1BVP1 3KT4A 1UIJA 4I0WB 3T0AA 2XJSA 3D82A 3ZVXA 4Y4RA 5GLVA 1COV1 5GZEA 1PVC3 1OBNA 1W8OA 4H2AA 5FY5A 1RVF1 1PHMA 3ZSMA 4GMP3 3LDKA 4YG3A 4JQTA 5FYYA 1AL23 4YM2A 4Q1PA 1TQ5A 1KRIA 5FO7B 3E6CC 2Q1ZB 3JQXA 2HYKA 4OMDA 2I07B 4AHZA 2CGPA 3O1UA 3KV5A 4COVA 1QJX3 1JZ5A 1PO11 2B39A 1PVXA 3ZYHA 1PO21 4AQ6A 3ITQA 4W65A 4EQVA 5BPXA 1PGW1 3KSCA 3ASIA 2TNFA 3RJRA 1U5IA 4NWVA 4ONUA 5IT6A 5K9YA 2P3KA 1KFUL 1AR82 1EUUA 2DV9A 3VLBB 4EWDA 1GQPA 4AVCA 5HCBA 2QFEA 2ZCWA 3O12A 2V73A 4RFRB 4XUPA 5EPAA 2D7FA 2ZHLA 3AZYA 3ZXLA 4Q4V1 3VBFB 4LTAA 1A78A 4NHYA 3FLTA 1JXNA 1AYN2 3HT1A 3OJBA 3PVEA 3N35A 4NMIA 3O14A 3AP5A 2PHUA 2VH9A 3HNBM 2DCJA 4HVOA 4P9XA 3WG2A 5FUIA 2JDAA 4XJWA 2BBAA 1W2OA 4O9EA 2WC2A 4CDXB 3KLSA 1VBE2 4KU8A 4Z8BA 4C1WA 4EWAA 4ARYA 5FYHA 1RUJ2 1W03A 4AEJA 3AYDA 1O6UA 2FCUA 3ILRA 5FBZA 5A6YA 5D2AA 4LULA 4KGGA 3AZVA 2NMNA 3OPWA 4YW7A 4IV1A 1PGL1 1RUH1 2XL9A 5DPNA 1GUIA 5AFEA 5IK8A 4Q0UA 4QQHA 2ZMNA 3LPGA 3JB8A 4FPCA 2XJUA 2ZZJA 4D8MA 5FQ0A 3I3MA 1YQ8A 2R32A 2F17A 4LHLA 5FXXA 1UF2C 3JZVA 3LCPA 2JDYA 1IKQA 3WF1A 2C9AA 2GNBA 3PUHA 2HJIA 4GB32 3W20A 1RUG2 2PHWA 1Y9MA 2VVEA 4QKFA 4XE9A 5F3EA 4ZXEA 4ZY9A 2FMDA 3TEXA 3UGHA 5JIUA 5JOXA 1DBNA 2H0VA 3ZYJB 4AXOA 5FLHA 1UOFA 1W8FA 2A71A 2WR9A 3BGAA 4MZUA 1LGNA 2HWF1 4FFHA 4YARA 5GALA 3VZNA 2YROA 1QH7A 1QJY1 3DECA 4DXZA 2FZ1A 3LZZA 4DEQA 2VOVA 5CKNA 3BU0A 4HK8A 1UPIA 2WT1A 5K4LA 1JTZX 5DUUA 5F6LB 1AR93 3BTAA 5CKQA 4LIVA 1C8M3 4E2SA 4HVQA 1J59A 3ECQA 1QQP2 4HN0A 3HAGA 4GALA 4LO8A 5KHGA 1OUSA 2Z2SB 3MW4A 1I5ZA 5G04L 4K9SA 2B7YA 3HVDA 3USUA 3C8XA 1RUC2 2A75A 2FQPA 3WINE 3WX5A 2CTVA 3I2DA 2HWD3 5FZ0A 1LEDA 2UWCA 2XBO2 3E6DA 5FREA 5L9BA 3ZPYA 4Y3OA 4CXYA 4Y20B 3H8XA 1BBT3 4RHV3 3JBG2 2GC2A 2VBDA 1KFXL 2VCMA 2W94A 3HD8B 4MXVA 4LBNA 3WQ0A 3WXPA 4P9YA 4IE5A 2AYHA 3RZZA 5A3UA 2E63A 4MH0E 2FHRA 4EN0A 3E1F1 4HMZA 3AXDA 1REFA 3R4UA 5EV7A 4XTMA 2ID4A 2RJ2A 2OA2A 1O91A 1L7LA 5TSWA 2TUNA 4IW3A 4KWUA 3CJIC 2EICA 1SG3A 2VULA 2VMFA 4XF0A 3UT0A 1DZTA 1WLDA 3MO4A 4AFAA 4V2VA 5JOWA 1PK6B 1MS5A 1AR73 1GOGA 2VOKA 1V0AA 3S57A 5JVVA 5KC6A 4KL1A 4Q0QA 5ACA3 3K3OA 2E9QA 1WUVA 4P9GA 5A7QA 5IFTA 4XF3A 2GN3A 2XB6C 3AXEA 3E97A 2YC4A 5D8AC 5K0UB 1GWKA 2JE8A 2GC0A 1WD4A 1HDKA 3CJIA 2RMU1 3MPPG 1S0JA 5D1IA 2R062 3LE0A 1NQDA 4CCDA 4NPMA 1Q8SA 3PURA 2X5IB 3FFQA 1JYWA 1GKBA 4I02A 2WO2A 2GNDA 4YPJA 1MEC2 4AFDA 2NP0A 2IVJA 4LOTA 1W6QA 2J1VA 5D8AA 4HPKB 1MACA 3A21A 1KS4A 1GNHA 4YM1A 3NNFA 3ZSKA 3K2OA 4GH4B 2H6CA 3ZXAC 3O0XA 5IK7A 5LZ6A 2ZHMA 5FUNA 5J7MA 3POJA 1CAWB 2QQMA 5I0TA 4IV3C 2VQ0A 2BNOA 2ZGNA 4CCOA 1D4M1 3MYXA 1S2BA 1X7NA 4W50A 1IG0A 3I2FA 1QJX2 2GN7A 2ZGRA 4YW5A 5JWPA 1W6NA 1VP6A 2WA4A 2A6YA 3H1MA 5DAXA 4ITCA 3W21A 5B2GB 1V6NA 3BTYA 1CGPA 2FD8A 5FWJA 3I54A 3ZFEC 5C3OA 5L7OB 1KEXA 3JB4C 1APNA 4GAZA 1VMJA 4E4ZA 1Q43A 1X36A 1MS0A 5EXOA 1JU4A 4XFBA 4Q4Y1 1H4HA 2VPVA 3NKTA 3VZMA 1O3QA 1C57A 1UU6A 3PVBB 1D4VB 3OEBA 1J58A 4YZ2A 5A6QA 3INAA 2WFF1 1DGRA 3APBA 2VXRA 2VUAA 4XF9A 3WZ1A 1RXFA 3BTXA 1OOPB 2C24A 3J9SA 5C33A 1ASJ3 2C26A 3NAPA 2XUMA 1GSLA 4D7YA 1GANA 1LOCA
chains in the Genus database with same CATH topology
1WCQA 2ORZA 2WAOA 2Y8KA 5IFPA 2WN3A 5EIYB 4LHSA 1GNYA 5JR2A 3ACHA 3OB8A 1L7RA 2VMDA 2EIDA 3IAQA 3VDCA 3HNMA 4LQRA 1OD3A 4UI9L 4TXWA 2VM9A 2J1EA 4JHZA 3MUY1 1UYXA 2VZ3A 4FI9A 3GXUA 1TVGA 2ZXQA 2VCCA 1CZVA 3WNNA 3C7GA 4DUWA 2WDBA 5C70A 2J1SA 2W87A 1CZSA 3WEZA 3NQHA 2W1WA 4ZZ5A 3OG2A 2QQJA 3EYPA 2PQSA 2YFZA 3T2PA 2J1UA 3WF0A 4Z2AA 3SKJE 2ZEZA 3CQOA 3SEEA 3D3AA 3WSOA 2YB7A 4UAPA 1NUKA 4A41A 2W1QA 3THCA 4MGQA 3VD7A 3P1IA 1OF4A 2X10A 1TG7A 5F7UA 2VQTA 4CU7A 4QAWA 2X09A 1JHJA 2ZEYA 4CU8A 5LA2A 2QBXA 1GOHA 5B4XA 1DYOA 1J83A 3WNKA 5LA0A 2E26A 4OYUA 2XONA 3LEKA 4ZZ8A 3OGVA 2BGOA 3FN9A 1UMHA 4LPLA 5IJRA 3U37A 1JZ5A 2OKXA 2ZEWA 4QB2A 4QB1A 3IIIA 2V4VA 2C9KA 3CZJA 3J7HA 1XPWA 2W46A 3W5MA 4QX3A 5LCWL 5CYYA 4BK5A 2WQ8A 2BZDA 2BERA 4QPWA 1OF3A 1UXZA 3CKHA 4M4RA 3THDA 3MV11 3I3BA 3UETA 2B9VA 5DN2A 2VZTA 3NNGA 5A1AA 2ORXA 2WBKA 1L7QA 3LEIA 4QX1A 1OH4A 2WAAA 2ZEXA 3MUZ1 2W1SA 4E8DA 1ULOA 4DXSA 1H6XA 4QX0A 3T09A 4W4ZA 2RV9A 2Y6LA 3UNPA 4GZ9A 4AG4A 4JKLA 1F4AA 5JXJA 3K46A 4XUNA 2R7EB 1DLCA 1H6YA 2VR4A 4MOAA 3ACFA 3GGLA 1I5PA 1HN1A 5EJ1B 1UZ0A 1P8JA 4JKKA 2QQIA 4CVUA 3P6BA 4HG6B 1KGYA 1RYYA 3NJVA 3W5NA 3HPNA 1EUTA 1K45A 3K4DA 5HXMA 5IYYA 1GOFA 1UY1A 3FHAA 4MADA 3HJRA 2HYXA 4A42A 2YFUA 3K4ZA 5DMYA 5JXHA 2L9LA 3CZUA 2E31A 2JD9A 4PF1A 4W8JA 2QQKA 4P02B 1W9WA 5JUVA 3CDZB 2VL4A 1UXXX 1YQ2A 2WYSA 4IUGA 4BK4A 4KI5M 4DEVA 4MGSA 4LKSA 1UYYA 2LW8A 5LA1A 2JKXA 2VZ1A 1CZTA 2EIBA 3VDAA 3AC0A 4A6OA 4OUEA 2CDOA 1BHGA 3ZM8A 2W95A 1R64A 2XOMA 3ETPA 3I2HA 3FL7A 3T08A 1F4HA 4A45A 2KD7A 3DYMA 2X05A 1W9SA 3VD9A 3HN3A 3IDAA 4P00B 3MV01 2YC2A 3WF3A 2Y6KA 4BJ0A 3VDBA 5J1XA 3I3EA 3NRUA 1W99A 4P5YA 4TTGA 1SHWB 3WNPA 2EIEA 2VJXA 2WZEA 2LS6A 2XHNA 2W92A 3C7HA 1W9TA 1XNAA 2CDPA 4CU6A 3GDBA 3EB7A 4XURA 2VTFA 3ABZA 1UY2A 3VD3A 1GMMA 2Y6HA 4XUOA 3IB3A 4BXSV 4QDSA 3BN6A 3LPFA 4XUQA 4DXRA 3UESA 3SKVA 4XVHA 4GWIA 1IQDC 3FHQA 4UOJA 4CU9A 1OT5A 2J22A 1US2A 2W9XA 1UY4A 3T0AA 2Z4FA 1W8OA 3OGRA 4JX0A 4OMCA 3GM8A 3DYOA 1K3IA 2VZRA 1CIYA 2E32A 4QX2A 4OMDA 1PX4A 1JYNA 2C4XA 2VZQA 1JZ3A 1EUUA 3C7OA 3I2GA 1GQPA 2VQUA 1JZ7A 2J1TA 3CIHA 4XUPA 3WNOA 3WF2A 4CUAA 1JI6A 3T0DA 4QDQA 4A3ZA 2QQLA 5CZKA 3HNBM 2QQNA 2DCJA 1K42A 2WUHA 4QDRA 3T2QA 2W3JA 5FUIA 2JDAA 2BBAA 3ACGA 2W91A 3CMGA 4ARYA 1SDDB 4OZOA 4L0PA 5I0DA 3ACIA 1UYZA 3K77A 1US3A 5DPNA 1GUIA 3LPGA 4D8MA 1O59A 4RYDA 4CUBA 1ULPA 3WQBA 3WNMA 1MPXA 3WF1A 1JZ8A 3I2JA 2VOTA 3PUHA 2W47A 4ZXEA 3A22A 4ZY9A 2W5FA 5C7GA 2VZOA 4PQQA 3BGAA 5B4NA 5JXIA 1NKGA 1D7PM 3DECA 4DEQA 2J1RA 5HPOA 3VD4A 4RN5A 3A7QA 5EJZB 3ECQA 3IAPA 1JZ2A 3SEPA 5G04L 3HNYM 4A4AA 1JU3A 3C8XA 2VZSA 1T2XA 1XC6A 1J84A 3MBWA 2V5DA 1K12A 1UWWA 3I2KA 3LQCA 1JZ4A 2VO5A 5C71A 4JKMA 2VCAA 3VD5A 3WNLA 4KMQA 2VMEA 3LEGA 1W8NA 4DXTA 5JMOA 2VZUA 3HEIA 2W1UA 5IHRA 2DDUA 2VMCA 2W94A 1JYXA 5JXGA 3I2IA 1JZ6A 4ARXA 1CX1A 3A23A 2B4KA 3E1F1 2YG0A 4MO3M 2ID4A 2VZVA 2Y6GA 3HOBA 2RJ2A 5G05L 1O8SA 2QQOA 1XNTA 4KWUA 2J1AA 2EICA 1SG3A 2E33A 2VMFA 3MO4A 4ET7A 2WO3A 4DUXA 1UMIA 1GOGA 3OEAA 1NAEA 4DUVA 1NX9A 3OGSA 2HLEA 1UX7A 5IFTA 4D0QA 2YC4A 2JE8A 1UY3A 3T2OA 2WABA 4M4PA 3I3DA 3LE0A 1UY0A 3PUIA 2DCKA 3F2ZA 2VZPA 4CUCA 4P08A 3WF4A 1JYWA 4YPJA 2WO2A 5DQ0A 3DYPA 1O8PA 3K4AA 4BDVB 3I97A 3OBAA 1DP0A 3C7EA 1GU3A 2XQXA 2J1VA 4AAXA 3A21A 4XZUG 2BGPA 4XUTA 2WO1A 3JXSA 1PX3A 2QQMA 2RVAA 1JYVA 4PT6A 1WKYA 4W50A 3I2FA 4A44A 2J7MA 1KEXA 1LNSA 4GWJA 4QB6A 2VC9A 1JU4A 2V72A 3K75B 2VCBA 2WZ8A 3C7FA 3OEBA 1PMHX 2WN2A 3T0BA 4E8CA 2Y6JA 1W0NA 1PMJX 2C26A 2Y64A 3NJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCQ A;  2ORZ A;  2WAO A;  2Y8K A;  5IFP A;  2WN3 A;  5EIY B;  4LHS A;  1GNY A;  5JR2 A;  3ACH A;  3OB8 A;  1L7R A;  2VMD A;  2EID A;  3IAQ A;  3VDC A;  3HNM A;  4LQR A;  1OD3 A;  4UI9 L;  4TXW A;  2VM9 A;  2J1E A;  4JHZ A;  3MUY 1;  1UYX A;  2VZ3 A;  4FI9 A;  3GXU A;  1TVG A;  2ZXQ A;  2VCC A;  1CZV A;  3WNN A;  3C7G A;  4DUW A;  2WDB A;  5C70 A;  2J1S A;  2W87 A;  1CZS A;  3WEZ A;  3NQH A;  2W1W A;  4ZZ5 A;  3OG2 A;  2QQJ A;  3EYP A;  2PQS A;  2YFZ A;  3T2P A;  2J1U A;  3WF0 A;  4Z2A A;  3SKJ E;  2ZEZ A;  3CQO A;  3SEE A;  3D3A A;  3WSO A;  2YB7 A;  4UAP A;  1NUK A;  4A41 A;  2W1Q A;  3THC A;  4MGQ A;  3VD7 A;  3P1I A;  1OF4 A;  2X10 A;  1TG7 A;  5F7U A;  2VQT A;  4CU7 A;  4QAW A;  2X09 A;  1JHJ A;  2ZEY A;  4CU8 A;  5LA2 A;  2QBX A;  1GOH A;  5B4X A;  1DYO A;  1J83 A;  3WNK A;  5LA0 A;  2E26 A;  4OYU A;  2XON A;  3LEK A;  4ZZ8 A;  3OGV A;  2BGO A;  3FN9 A;  1UMH A;  4LPL A;  5IJR A;  3U37 A;  1JZ5 A;  2OKX A;  2ZEW A;  4QB2 A;  4QB1 A;  3III A;  2V4V A;  2C9K A;  3CZJ A;  3J7H A;  1XPW A;  2W46 A;  3W5M A;  4QX3 A;  5LCW L;  5CYY A;  4BK5 A;  2WQ8 A;  2BZD A;  2BER A;  4QPW A;  1OF3 A;  1UXZ A;  3CKH A;  4M4R A;  3THD A;  3MV1 1;  3I3B A;  3UET A;  2B9V A;  5DN2 A;  2VZT A;  3NNG A;  5A1A A;  2ORX A;  2WBK A;  1L7Q A;  3LEI A;  4QX1 A;  1OH4 A;  2WAA A;  2ZEX A;  3MUZ 1;  2W1S A;  4E8D A;  1ULO A;  4DXS A;  1H6X A;  4QX0 A;  3T09 A;  4W4Z A;  2RV9 A;  2Y6L A;  3UNP A;  4GZ9 A;  4AG4 A;  4JKL A;  1F4A A;  5JXJ A;  3K46 A;  4XUN A;  2R7E B;  1DLC A;  1H6Y A;  2VR4 A;  4MOA A;  3ACF A;  3GGL A;  1I5P A;  1HN1 A;  5EJ1 B;  1UZ0 A;  1P8J A;  4JKK A;  2QQI A;  4CVU A;  3P6B A;  4HG6 B;  1KGY A;  1RYY A;  3NJV A;  3W5N A;  3HPN A;  1EUT A;  1K45 A;  3K4D A;  5HXM A;  5IYY A;  1GOF A;  1UY1 A;  3FHA A;  4MAD A;  3HJR A;  2HYX A;  4A42 A;  2YFU A;  3K4Z A;  5DMY A;  5JXH A;  2L9L A;  3CZU A;  2E31 A;  2JD9 A;  4PF1 A;  4W8J A;  2QQK A;  4P02 B;  1W9W A;  5JUV A;  3CDZ B;  2VL4 A;  1UXX X;  1YQ2 A;  2WYS A;  4IUG A;  4BK4 A;  4KI5 M;  4DEV A;  4MGS A;  4LKS A;  1UYY A;  2LW8 A;  5LA1 A;  2JKX A;  2VZ1 A;  1CZT A;  2EIB A;  3VDA A;  3AC0 A;  4A6O A;  4OUE A;  2CDO A;  1BHG A;  3ZM8 A;  2W95 A;  1R64 A;  2XOM A;  3ETP A;  3I2H A;  3FL7 A;  3T08 A;  1F4H A;  4A45 A;  2KD7 A;  3DYM A;  2X05 A;  1W9S A;  3VD9 A;  3HN3 A;  3IDA A;  4P00 B;  3MV0 1;  2YC2 A;  3WF3 A;  2Y6K A;  4BJ0 A;  3VDB A;  5J1X A;  3I3E A;  3NRU A;  1W99 A;  4P5Y A;  4TTG A;  1SHW B;  3WNP A;  2EIE A;  2VJX A;  2WZE A;  2LS6 A;  2XHN A;  2W92 A;  3C7H A;  1W9T A;  1XNA A;  2CDP A;  4CU6 A;  3GDB A;  3EB7 A;  4XUR A;  2VTF A;  3ABZ A;  1UY2 A;  3VD3 A;  1GMM A;  2Y6H A;  4XUO A;  3IB3 A;  4BXS V;  4QDS A;  3BN6 A;  3LPF A;  4XUQ A;  4DXR A;  3UES A;  3SKV A;  4XVH A;  4GWI A;  1IQD C;  3FHQ A;  4UOJ A;  4CU9 A;  1OT5 A;  2J22 A;  1US2 A;  2W9X A;  1UY4 A;  3T0A A;  2Z4F A;  1W8O A;  3OGR A;  4JX0 A;  4OMC A;  3GM8 A;  3DYO A;  1K3I A;  2VZR A;  1CIY A;  2E32 A;  4QX2 A;  4OMD A;  1PX4 A;  1JYN A;  2C4X A;  2VZQ A;  1JZ3 A;  1EUU A;  3C7O A;  3I2G A;  1GQP A;  2VQU A;  1JZ7 A;  2J1T A;  3CIH A;  4XUP A;  3WNO A;  3WF2 A;  4CUA A;  1JI6 A;  3T0D A;  4QDQ A;  4A3Z A;  2QQL A;  5CZK A;  3HNB M;  2QQN A;  2DCJ A;  1K42 A;  2WUH A;  4QDR A;  3T2Q A;  2W3J A;  5FUI A;  2JDA A;  2BBA A;  3ACG A;  2W91 A;  3CMG A;  4ARY A;  1SDD B;  4OZO A;  4L0P A;  5I0D A;  3ACI A;  1UYZ A;  3K77 A;  1US3 A;  5DPN A;  1GUI A;  3LPG A;  4D8M A;  1O59 A;  4RYD A;  4CUB A;  1ULP A;  3WQB A;  3WNM A;  1MPX A;  3WF1 A;  1JZ8 A;  3I2J A;  2VOT A;  3PUH A;  2W47 A;  4ZXE A;  3A22 A;  4ZY9 A;  2W5F A;  5C7G A;  2VZO A;  4PQQ A;  3BGA A;  5B4N A;  5JXI A;  1NKG A;  1D7P M;  3DEC A;  4DEQ A;  2J1R A;  5HPO A;  3VD4 A;  4RN5 A;  3A7Q A;  5EJZ B;  3ECQ A;  3IAP A;  1JZ2 A;  3SEP A;  5G04 L;  3HNY M;  4A4A A;  1JU3 A;  3C8X A;  2VZS A;  1T2X A;  1XC6 A;  1J84 A;  3MBW A;  2V5D A;  1K12 A;  1UWW A;  3I2K A;  3LQC A;  1JZ4 A;  2VO5 A;  5C71 A;  4JKM A;  2VCA A;  3VD5 A;  3WNL A;  4KMQ A;  2VME A;  3LEG A;  1W8N A;  4DXT A;  5JMO A;  2VZU A;  3HEI A;  2W1U A;  5IHR A;  2DDU A;  2VMC A;  2W94 A;  1JYX A;  5JXG A;  3I2I A;  1JZ6 A;  4ARX A;  1CX1 A;  3A23 A;  2B4K A;  3E1F 1;  2YG0 A;  4MO3 M;  2ID4 A;  2VZV A;  2Y6G A;  3HOB A;  2RJ2 A;  5G05 L;  1O8S A;  2QQO A;  1XNT A;  4KWU A;  2J1A A;  2EIC A;  1SG3 A;  2E33 A;  2VMF A;  3MO4 A;  4ET7 A;  2WO3 A;  4DUX A;  1UMI A;  1GOG A;  3OEA A;  1NAE A;  4DUV A;  1NX9 A;  3OGS A;  2HLE A;  1UX7 A;  5IFT A;  4D0Q A;  2YC4 A;  2JE8 A;  1UY3 A;  3T2O A;  2WAB A;  4M4P A;  3I3D A;  3LE0 A;  1UY0 A;  3PUI A;  2DCK A;  3F2Z A;  2VZP A;  4CUC A;  4P08 A;  3WF4 A;  1JYW A;  4YPJ A;  2WO2 A;  5DQ0 A;  3DYP A;  1O8P A;  3K4A A;  4BDV B;  3I97 A;  3OBA A;  1DP0 A;  3C7E A;  1GU3 A;  2XQX A;  2J1V A;  4AAX A;  3A21 A;  4XZU G;  2BGP A;  4XUT A;  2WO1 A;  3JXS A;  1PX3 A;  2QQM A;  2RVA A;  1JYV A;  4PT6 A;  1WKY A;  4W50 A;  3I2F A;  4A44 A;  2J7M A;  1KEX A;  1LNS A;  4GWJ A;  4QB6 A;  2VC9 A;  1JU4 A;  2V72 A;  3K75 B;  2VCB A;  2WZ8 A;  3C7F A;  3OEB A;  1PMH X;  2WN2 A;  3T0B A;  4E8C A;  2Y6J A;  1W0N A;  1PMJ X;  2C26 A;  2Y64 A;  3NJX A; 
#chains in the Genus database with same CATH topology
 2ORZ A;  2Y8K A;  4GJZ A;  1ACC A;  5IFP A;  2R04 2;  4Q0S A;  1RUD 1;  4LHS A;  4MSV A;  3OY8 A;  1TMF 3;  3I3Q A;  2BUK A;  2WNV C;  1CN1 A;  1L7R A;  5A32 B;  4COU A;  2IXH A;  1DF0 A;  4HFS A;  3KQ4 B;  3GBW A;  3KV9 A;  2RS1 3;  1RHI 3;  3N7M A;  5CIR A;  4UFK A;  5T54 A;  4BQ5 A;  4ISQ A;  5F3I A;  1AYM 1;  4UI9 L;  4HL0 A;  5C8C B;  5BNP C;  4CEW B;  1QXR A;  2DWR A;  2JDH A;  3W9A A;  3O1M A;  2WNV A;  2WQZ C;  2Y33 A;  1EAH 1;  1T6G C;  3MUY 1;  1UYX A;  4FOY A;  4AI8 A;  3ILN A;  4HLT A;  1H2L A;  2YV8 A;  1ZBA 1;  3KCY A;  3SIS A;  2Y60 A;  4I0A A;  4WM8 B;  4MUV A;  1VLN A;  1F35 A;  2D3S A;  4CZS A;  2JIC A;  3WUC A;  4CYD A;  3WP4 A;  3PTR B;  4DOU A;  4EZ4 A;  3OPZ A;  5BNP A;  4Y5S A;  2A6Z A;  3OYW B;  1S1A A;  1CAV B;  2HWE 3;  5FYV A;  4CXX A;  4A7Z A;  3N7J A;  1OVP A;  3D6E A;  3C3V A;  3WUD A;  1G9D A;  2YB7 A;  4N7I A;  1AR9 2;  2WNU B;  3T30 A;  3EMR A;  1C8M 2;  1NUK A;  4XIO A;  4IGQ A;  1ZBE 1;  3GZE A;  2R0F A;  4YW6 A;  5CIS A;  3EJK A;  4X8P A;  5HBA A;  2ZX3 A;  3KGZ A;  4R8H A;  3QCW A;  4URA A;  3ZDS A;  5BYN A;  5BNN B;  4OI1 A;  1OH3 A;  4QMA A;  1J1L A;  5F5A A;  5FZC A;  4YLZ A;  2D6L X;  1TG7 A;  2O8O A;  1H8T B;  1BXH A;  4QQL A;  4YW3 A;  4NHK A;  4FAG A;  2VQT A;  1V6K A;  2C6S A;  3O1O A;  2D6K A;  2ET1 A;  1TE1 B;  4TN7 A;  2VVF A;  4QAW A;  4TLG A;  5E16 A;  2HWD 2;  5BNQ A;  3ZSJ A;  5I93 A;  3VKL A;  2SLI A;  3RZG A;  2QBX A;  3MEP A;  1W6M B;  1PGS A;  1DYO A;  2HWC 1;  1BBT 2;  1YWK A;  4Z1V A;  1ULC A;  2ZHN A;  5LA0 A;  1RMU 2;  2GP5 A;  3I4I A;  2A6X A;  4M01 A;  4NJ4 A;  3LEK A;  4PBP A;  1W2A X;  3M3I A;  1PZ9 A;  1Y3T A;  1ZRD A;  4LPL A;  1CES A;  1HXS 3;  1YJK A;  4X6Q B;  4MHR A;  3VBH A;  4D7T A;  3ETQ A;  2MHF A;  4WM7 C;  3VN4 A;  4XQD A;  1N3Q A;  2C9K A;  3CZJ A;  1RUE 3;  4XFC A;  3KVA A;  5FBJ A;  1UZV A;  5EZW A;  4QHO A;  1IPS A;  3VBS B;  1AR7 2;  1NT0 A;  1S0I A;  2X29 A;  2WZP P;  2RJL A;  3PJY A;  4PIY A;  3VHR A;  5CYY A;  5ACA 2;  3TWI A;  5ABJ C;  3AL5 A;  2WQ8 A;  5F5C A;  5A33 A;  3S30 A;  2OS2 A;  2Y26 A;  3WQ1 A;  3AP6 A;  3ZFG C;  4WM7 A;  5T50 A;  4FQ4 A;  3WOG A;  1FYU A;  3THP A;  1HJF A;  4NUB A;  4K8R B;  4XJ8 A;  4FTB A;  4DO0 A;  4Y24 A;  1A6C A;  1K5M C;  2QDR A;  2EVX A;  3W59 A;  2QNK A;  2XKP A;  4EV0 A;  1M4W A;  3M4F A;  2ZGT A;  5A1A A;  3WG3 A;  1ZZ8 A;  4XMA A;  5FZO A;  4U2A A;  4FPE A;  2ORX A;  5FK7 A;  3ZFG A;  1OA4 A;  5I0S A;  2FZ2 A;  4FSJ A;  2TEP A;  4JZR A;  5DDJ 1;  1VJ2 A;  3V64 A;  3MUZ 1;  1HB2 A;  3PUS A;  5FY8 A;  3R6S A;  2XDV A;  2LTN A;  1MQT B;  4DXS A;  1NZI A;  1QWR A;  1H6X A;  3NNM A;  3DV8 A;  3T09 A;  4K1Y A;  4W4Z A;  2RV9 A;  3B9C A;  3P5B A;  2UUR A;  2QQU A;  1V6I A;  4H3W A;  2CGN A;  1JN2 P;  1Q8V A;  1UOJ A;  4JKL A;  4FPY A;  1F4A A;  2DVA A;  5FZF A;  4PJY A;  5JXJ A;  5T5J A;  1MVE A;  1MZE A;  3U14 A;  3MIH A;  2MNG A;  2XKO A;  4QHB A;  1I5P A;  1AXZ A;  2HBT A;  4P9W A;  2MEV 1;  3FX3 A;  3WDX A;  2WNO A;  2BRT A;  3P6B A;  2IVI B;  2OT7 A;  2ZGO A;  1QU0 A;  5E88 A;  4HN1 A;  2QJV A;  3W5N A;  1CD3 G;  1PM4 A;  3HPN A;  4CDQ C;  4JTN A;  5BNO C;  2DYC A;  1QOT A;  2RR1 1;  3IMM A;  3A4U A;  2VUD A;  1RJ7 A;  1RB8 G;  1LUL A;  1ASJ 2;  3RZJ A;  1XSQ A;  1CVN A;  4QKD A;  4CCL A;  4FVV A;  3RG0 A;  5FXV A;  2HYX A;  4NII A;  2DFC A;  2YFU A;  2EIG A;  4AI3 A;  1VBC 1;  5DMY A;  1AR6 1;  2L9L A;  4S2F A;  2JG9 A;  2EAK A;  3POY A;  2XGX A;  1UPS A;  3BOD A;  3VZK A;  1HRI 1;  4YG6 A;  3ATG A;  3QH6 A;  5HV0 A;  2QQK A;  4DRV A;  1W9W A;  3PUA A;  2ZX2 A;  3ELN A;  3POG A;  2WYS A;  4HT1 T;  2W0X A;  1S0C A;  3BPZ A;  1FOD 3;  1YQC A;  1ZZ7 A;  3N9Q A;  4MGS A;  4N90 A;  5C3R A;  5FDB A;  3AMH A;  2JG8 A;  3FC0 A;  1RUF 1;  1XNB A;  1HRV 2;  1ZM1 A;  4DNY A;  1XE7 A;  4L11 A;  2CHH A;  3URF A;  3AKR A;  5LBE A;  4FPF A;  4OHV A;  4DS0 A;  1YIP A;  2K46 A;  3U4X A;  4IV1 B;  2D6P A;  2VNG A;  3S7E A;  3WG4 A;  4M3C F;  5FMO L;  4Q4W 3;  2CDO A;  5FQ0 B;  5CKM A;  3Q8F A;  2DVF A;  3FL7 A;  2X05 A;  4CP1 A;  3ZSE A;  4JDM A;  3H1W A;  2LAL A;  2RDR A;  4OHW A;  2GH8 A;  3IDA A;  3N7L A;  1HJG A;  4P00 B;  3V56 A;  2JDN A;  1FT9 A;  3MV0 1;  2XLF A;  1DGW A;  3AMP A;  3USS A;  5FPU A;  4J6G A;  3BTZ A;  2H0B A;  3BPS A;  3WVJ A;  3GBG A;  3WF3 A;  2ZJC A;  2NN8 A;  4LXL A;  1QDO A;  5DZE A;  5J1X A;  2AUY A;  5JZG B;  4XQ4 A;  1H9W A;  4P5Y A;  4BME A;  3RZK A;  2FCT A;  4LK7 A;  1IHM A;  4TSV A;  2XPJ A;  4LOR A;  2FDG A;  3VGI A;  4D3W A;  1LKN A;  2E51 A;  4Q8L A;  4M0N A;  1GR3 A;  2VJX A;  4XFH A;  4HVR A;  2XVG A;  4LLF A;  4N43 A;  2QQP A;  4PQ9 A;  1DIW A;  2OW4 A;  3TNQ A;  1BYH A;  1VE0 A;  3AL6 A;  2CGO A;  4CU6 A;  3GDB A;  3NMB A;  4LEJ A;  4Z92 B;  2OQ7 A;  4QWN A;  4UW5 A;  3ABZ A;  1NXM A;  1UY2 A;  1O4Y A;  1SPP A;  4LMF A;  1JOJ A;  4CDW C;  3R0R A;  5FYS A;  1LHV A;  2R1B A;  4IE6 A;  3USU B;  4AYU A;  2BPA 2;  3D8C A;  3RI9 A;  1AXK A;  4QXC A;  4AFM A;  4XMI A;  3WNX A;  1QH6 A;  4KWK A;  3AP7 A;  3HBK A;  1HXS 2;  1U5Z A;  3LPF A;  1GLH A;  2VBB A;  3FLR A;  2C5D A;  3LAG A;  2B46 X;  3IKW A;  2WZR 3;  4KQ7 A;  4XVH A;  1SLC A;  2P3I A;  1IS5 A;  4C0B A;  4CDW A;  5CG8 A;  4J25 A;  1S2K A;  1UU4 A;  2F6B A;  5ISL A;  4CU9 A;  2VOX A;  3POW A;  1XYN A;  2ZKL A;  1UY4 A;  4I01 A;  3EXU A;  1W6O A;  3LOB A;  2RS3 3;  4FCA A;  3CL1 A;  1MS4 A;  4OMC A;  3PU3 A;  4IE7 A;  3GM8 A;  2VMG A;  1KXG A;  3DYO A;  4L2N A;  1REE A;  4ASM B;  4PCR A;  4AVS A;  1QDC A;  3V0B A;  2WWJ A;  2AH2 A;  4YVS C;  2E32 A;  1R09 2;  2N7G A;  2RDS A;  4FPL A;  3VV1 A;  5LAS A;  1LU2 A;  5JPM B;  1H4G A;  2C4X A;  3VBO C;  1KD7 A;  4PIZ A;  3Q9O A;  1MZ5 A;  1UAI A;  3NW4 A;  3WDY A;  1OLQ A;  4OI2 A;  2I45 A;  4HAN A;  1WWY A;  2A3W A;  3W58 A;  5A7S A;  1ODM A;  2CNA A;  3BOP A;  1ZRC A;  4Q4X 3;  1C5H A;  2VTX J;  3RQ0 A;  5EYX A;  2HH9 A;  2J1T A;  1YCI A;  4YVS A;  2ZGP A;  2ADD A;  1SMV A;  1XSR A;  3WNO A;  1RUN A;  1TME 3;  1GZW A;  4K3U A;  3IMN A;  1RXG A;  3VBO A;  2FDI A;  4CUA A;  2XJP A;  5E1R A;  1AR8 1;  3MLJ A;  2CY6 A;  4N8M A;  4A2U A;  1NLS A;  4QDQ A;  4A3Z A;  2QQL A;  5CZK A;  2G4I A;  1W6Q B;  1BMV 1;  1HKD A;  2HEY F;  2WUH A;  2W3J A;  4OHX A;  3T2Q A;  1FMD 3;  2BYV E;  2CSG A;  1VBB 1;  4XFG A;  3BIE A;  1J3R A;  4YVW C;  5K8S A;  1W8Z A;  2W91 A;  4DY3 A;  5J48 A;  4RQP A;  5FP9 A;  4GD4 A;  2XUE A;  1LOE A;  2WT0 A;  5A7P A;  3TYJ A;  5I0D A;  1JZ6 A;  4NID A;  1UYZ A;  1NY7 2;  1VBE 1;  3K77 A;  1WBL A;  3IBM A;  4LO4 B;  1W6N B;  4FOW A;  2B42 B;  5EWS A;  3ZN4 A;  4K20 A;  1E5I A;  1O59 A;  3JD7 3;  1YO8 A;  3Q8E A;  4RYD A;  3KHC A;  1ULP A;  4I30 A;  3WNM A;  3DGT A;  1HX6 A;  2D98 A;  1WW5 A;  1LHN A;  3I2J A;  2VOT A;  3LSE A;  3M2M A;  4QPI C;  3O5S A;  5FMC A;  1QY4 A;  2WS9 3;  4N9H A;  5LY2 A;  1PNF A;  3LFI A;  2NZ9 A;  2VMI A;  3RYP A;  4IET A;  1DDL A;  5A1F A;  2V4A A;  3H3U A;  4Y1X A;  2ZKN A;  1YJL A;  3GBF A;  5JXI A;  2IXC A;  3B5L B;  4GB3 1;  4LLO A;  1VAM A;  3B69 A;  4FQZ A;  1RUG 1;  3NAP B;  3AYA A;  3U10 A;  4ERO A;  1PIV 2;  1C28 A;  4BA6 A;  1M06 G;  1ND2 C;  1WA4 A;  5HPO A;  4MGI E;  3VD4 A;  5IVF A;  3OY8 B;  1UCX A;  2W08 A;  3LEM A;  3A7Q A;  5T55 A;  3WP3 A;  2BU9 A;  2UU8 A;  1SBF A;  2IFR A;  5E6H A;  3MDP A;  3GYD A;  1X9P A;  1YUD A;  2A70 A;  3MGU A;  3HNY M;  4BQ2 A;  1JU3 A;  4IGP A;  2VUC A;  4UFM A;  2WQ4 A;  1D0G A;  1T2X A;  1XC6 A;  4Q4W 2;  3DPR C;  4DIQ A;  1QQP 1;  5IAV A;  4AE2 A;  2PFW A;  3MBW A;  4B4P A;  1TZO A;  1JYC A;  2YZ4 A;  4JRL A;  3HQR A;  5C71 A;  4GA9 A;  2WNV B;  1Z7S 3;  4L97 A;  1DCS A;  2FDJ A;  4LBJ A;  3J8F 3;  4AI1 A;  3WNL A;  3OF1 A;  2QUO A;  1RUC 1;  3LEG A;  2PHX A;  2IXL A;  2GSY A;  3FUO A;  4LHK A;  3KV6 A;  5IHR A;  2DDU A;  1IPJ A;  5DUW A;  1CAX A;  2XHK A;  1JYX A;  5GLW A;  1UZW A;  2QCS B;  1V6L A;  2XBO 1;  5BY5 A;  4UF0 A;  1RUI 3;  2B4K A;  1QXJ A;  4JGY A;  1EV1 1;  2E53 A;  1WMF A;  4QX8 A;  2VZV A;  2Y6G A;  3GZU C;  4M3C A;  1EPW A;  1NZC A;  3JBG 1;  2QQO A;  1XNT A;  1HQN A;  3A0N A;  4XFA A;  5C9A B;  1LR5 A;  2WII B;  1T6B X;  1XU2 A;  3S5Q A;  2DCY A;  4DUX A;  1GWM A;  3PU8 A;  2ZML A;  4LK6 A;  2YBP A;  3ZDV A;  4JGZ A;  4QM9 A;  1NX9 A;  2HLE A;  5JI7 A;  2ZTN A;  2GP3 A;  1FPN 3;  2BTV C;  2UYA A;  3B93 A;  1COV 3;  1XE8 A;  1RIN A;  1UY3 A;  3O7O A;  3RVH A;  3T2O A;  5LRS A;  1H30 A;  2WAB A;  4YW1 A;  1SDW A;  4FXG B;  1RVF 3;  3H0O A;  1NE4 A;  4MGY E;  3PUI A;  1GV9 A;  3WP5 A;  5C4W C;  2WSU A;  3MPB A;  3ZYB A;  5BV6 A;  5FUP A;  4YGB A;  1E57 A;  1W04 A;  4P08 A;  3WF4 A;  4AAP A;  1RED A;  2WZR 2;  1ND3 A;  4YGC A;  5CFC C;  1OHF A;  1PO1 3;  2Y0I A;  4B7K A;  4BDV B;  3V0A B;  4CPB A;  2R06 1;  4IEP A;  3C7E A;  4NO4 A;  4NRQ A;  4I3G A;  3KF3 A;  2VG9 A;  3POI A;  4Y22 A;  5KWR A;  3TN9 3;  2PYT A;  5GM0 A;  1NCR C;  4AFC A;  2RS3 2;  3MW2 A;  1MEC 1;  4HK9 A;  3ZXE A;  4BYY A;  1W9F A;  4AVA A;  1W39 A;  1RL3 A;  2IUW A;  1F8V A;  4NHX A;  1JYV A;  1FNZ A;  2GDF A;  5FOJ B;  4PT6 A;  3ZYF A;  2DUQ A;  1QJU 3;  3VL8 A;  3ZIX A;  1SLB A;  4GMP 1;  5F2S A;  4LBQ A;  3ME2 A;  4K21 A;  1OQ1 A;  5A33 B;  5AFB A;  1NCR A;  1LNS A;  2P34 A;  4O9G A;  5A3T A;  4QXB A;  3N9M A;  3LF7 A;  3ILF A;  4MLO A;  4WVV A;  1QJX 1;  1X9T A;  3DXT A;  1TEI A;  4NHL A;  4Q4X 2;  4D6R A;  1E5S A;  2VOW A;  4JDO A;  4E9K A;  2QZ2 A;  1OLM A;  1POQ A;  2QE3 A;  2WZ8 A;  4H7L A;  2XR4 A;  3C7F A;  2FDF A;  1OA3 A;  1TME 2;  3OGG A;  2BNM A;  2VQA A;  3UGG A;  2WN2 A;  4UFL A;  5FK8 A;  4E8C A;  1ZX5 A;  2RJK A;  2Y6J A;  4HBN A;  5F5I A;  3PME A;  4NR1 A;  4XW3 A;  3ZFG B;  1A8M A;  1WLT A;  4D69 A;  1OD5 A;  1FMD 2;  2R6Q A;  4CP9 A;  3X29 B;  1WCQ A;  1UKG A;  2IXK A;  2WAO A;  4P9L A;  4FFF A;  4XDP A;  3WW3 A;  5JOZ A;  2WN3 A;  5FPL A;  5JR2 A;  3ACH A;  3J4U H;  4DZG A;  1CX4 A;  3OB8 A;  5FY9 A;  5LEJ A;  1VIW B;  2R0H A;  2AEY A;  5GLT A;  3T4V A;  1AX1 A;  1QF3 A;  2R04 1;  3BAL A;  1WBF A;  1AXY A;  4RR3 C;  2HWF 3;  4TWT A;  3WHT A;  4IER A;  5FZ7 A;  5C5U A;  1XQN A;  1ENS A;  2K0G A;  2O14 A;  3LDR A;  1PZ7 A;  2FCV A;  2XML A;  3JD7 2;  2BFU L;  4LO6 B;  3AKQ A;  1WD3 A;  2HEV F;  5J98 B;  1QGL A;  3NWK A;  4P5H A;  1ENR A;  1ENX A;  5FRA A;  4PDW C;  1DYP A;  4YFZ A;  4JHZ A;  1GZT A;  2EF6 A;  4FI9 A;  5FZ3 A;  4COZ A;  1POV 3;  2WS9 2;  2ZXQ A;  3DN7 A;  4BQ1 A;  2ZGL A;  1RC6 A;  4OLL A;  2VW1 A;  2PAM A;  3WNN A;  4DUW A;  4RR3 A;  3WEZ A;  4AHX A;  1LRH A;  2I74 A;  4ASK A;  2HWB 2;  4WZF A;  3OG2 A;  5ANN A;  3J7N A;  3WT3 A;  1I1E A;  3TNP B;  2J1U A;  4Z2A A;  1YFX A;  5F39 A;  1ODN A;  3SKJ E;  4C90 A;  4O7X A;  4XAC A;  3SMH A;  3CEW A;  3WSO A;  4RA0 A;  3BYW A;  3RFR A;  4CP0 A;  2OQ6 A;  4EN7 B;  4UAP A;  5FYI A;  5I91 A;  4Y4Y A;  4UFJ A;  4A41 A;  2JG9 B;  4FP3 A;  2XL7 A;  5LA9 A;  1R08 3;  2CYF A;  4MGQ A;  2YU1 A;  3VD7 A;  1VBA 1;  3AMN A;  3KCC A;  5C8W A;  1OI6 A;  1OF4 A;  2X10 A;  1C8M 1;  3H3Z A;  2SBA A;  2P3Y A;  1FAY A;  2G1M A;  5SV5 A;  2JG8 B;  1ZA7 A;  1LB2 A;  1Q5O A;  4NHM A;  3ES4 A;  4I09 A;  3BVC A;  1NYW A;  1ULG A;  4BU2 A;  2ZZQ A;  1EY2 A;  4QU2 A;  4YGD A;  1SFP A;  2HWD 1;  4XQW A;  2BGO A;  2VU9 A;  3PIJ A;  4XEZ A;  1DFQ A;  3U37 A;  1JOB A;  1RUI 2;  2JIJ A;  4JV4 A;  1E5R A;  1NLQ A;  2OKX A;  2V09 A;  1BBT 1;  4AQT A;  1VAL A;  3M3E A;  1IQA A;  1CJD A;  3III A;  1RMU 1;  2HBU A;  3VDD B;  2NMO A;  2ZHK A;  1S2E A;  1UOG A;  4FO9 A;  2PHF A;  3IPV B;  1SEF A;  5LEK A;  1XPW A;  1C3H A;  4FTS A;  2ZA9 A;  4AED C;  3OD0 A;  1UOB A;  4OUS A;  1NA1 C;  3OCP A;  4FPG A;  4CCN A;  2JE9 A;  4FTE A;  5FLI A;  2R49 A;  2BER A;  1V00 A;  1FPN 2;  1OF3 A;  1OKQ A;  3D4K A;  1AR7 1;  3D5O A;  1X8M A;  4N43 B;  4Y5Z 0;  4CUG A;  4M4R A;  2Y34 A;  5ACA 1;  1RVF 2;  1PVC 2;  3O0W A;  1BKZ A;  1QMJ A;  4UW3 A;  3WCR A;  3TEZ A;  2B9V A;  4L99 A;  5DN2 A;  1NA1 A;  1AL2 2;  2D5F A;  2DVB A;  1XYP A;  3DF0 A;  3NNG A;  3UGF A;  1PO1 2;  3OOX A;  2FMY A;  1D2Q A;  4AVV A;  1W2N A;  2EA7 A;  5L36 A;  1L7Q A;  5E89 A;  2NQY A;  2X8K A;  1ZZB A;  3LEI A;  3M70 A;  2P3J A;  2ZEX A;  3TN9 2;  3VBU B;  1VMH A;  2W1S A;  4E8D A;  2XLA A;  4P14 A;  1ZZC A;  4CEY C;  4QX0 A;  5K7P A;  2J42 A;  4Y1U A;  3UNP A;  1G8W A;  3MW3 A;  4IV3 A;  4CDW B;  3N9N A;  2VW2 A;  1V6O A;  3SHR A;  1QJU 2;  1UIK A;  3CJX A;  3K46 A;  2R7E B;  1DLC A;  4K7J A;  3SCG A;  5F3C A;  1W6O B;  3KZ4 C;  1H6Y A;  2VR4 A;  4MOA A;  3ACF A;  4JAA A;  3ZFE A;  4SLI A;  3V0B B;  1QKQ A;  2QQI A;  4F83 A;  4CVU A;  1MR5 A;  4YZ4 A;  4CEY A;  1RIR A;  2ZX0 A;  4W6Y A;  5J37 A;  1RUD 3;  1JUI A;  5GLU A;  1W90 A;  4EWE A;  1KGY A;  2QVS B;  3O1T A;  1UO9 A;  2YBK A;  3NJV A;  4GUL A;  5FYZ A;  1PMI A;  1K45 A;  2RS5 1;  2UY8 A;  4YFW A;  4E27 A;  5FZ4 A;  3UL2 A;  3ZFF C;  1IS6 A;  4AK3 A;  4QGM A;  1ONA A;  5KC5 A;  4XDO A;  1KJR A;  4YYO A;  1GOF A;  5T5L A;  1AYM 3;  4BIF A;  4QGN A;  3SC7 X;  3HJR A;  2ZMK A;  2JE7 A;  4RGG A;  4K8F A;  4QGL A;  1U5Y A;  2RM2 3;  1Y4W A;  4Y26 A;  1EAH 3;  3VBO B;  3OGJ A;  3FBM A;  4L92 A;  2ADE A;  1Q3E A;  3KGL A;  1DQ2 A;  4HXC A;  5ERL A;  3ZFF A;  2JD9 A;  4QM8 A;  5T3N A;  4KG8 A;  2GAL A;  4P02 B;  5JI9 A;  5JUV A;  2HWF 2;  4DY5 A;  1W05 A;  4YSF A;  1W6P A;  1YQ2 A;  3K3N A;  5AC9 3;  2ENR A;  4IUG A;  2OVU A;  1GBG A;  3ZXF A;  5FP8 A;  1LU1 A;  3VB9 A;  4DEV A;  4RQP B;  5FZE A;  4CDU C;  5CFD C;  5FP7 A;  5LK5 A;  1YLL A;  4BQX A;  2VBP A;  1Y9Q A;  1KIT A;  3DKQ A;  2ARX A;  3NJZ A;  4KG0 A;  3SCF A;  5L9V A;  1BEV 3;  4N53 C;  1ZBE 3;  4I0B A;  4FAH A;  3POB A;  1Q8P A;  3ZM8 A;  3E6B A;  4RS5 C;  1HRV 1;  2CWM A;  1AJK A;  2XOM A;  1N3O A;  3ETP A;  1Z0H A;  1RJ8 A;  4AGG A;  1W9S A;  1GQG A;  2VNR A;  1HQL A;  1VPH A;  2YC0 A;  4PIX A;  5DAV A;  1WGP A;  3HN3 A;  1HB4 A;  1YHF A;  1FXZ A;  2YC2 A;  1JS9 A;  2P6C A;  4N53 A;  4EE2 A;  4OCT A;  2OPK A;  3N9O A;  4GQ7 A;  3VBR C;  1WMD A;  1G7Y A;  2HWC 3;  3H9A A;  5JAX A;  5FXZ A;  1R08 2;  2RG4 A;  3AP9 A;  2XJV A;  4RHV 2;  3FJS A;  3WW4 A;  4O61 A;  1SHW B;  4XYX A;  3WNP A;  2EIE A;  3FE5 A;  2WZE A;  4QPG B;  2JWP A;  3C7H A;  4RSU A;  1W8U A;  5EHD A;  4URT A;  1XNA A;  1OSG A;  1W8W A;  3EB7 A;  4WBB A;  4XUR A;  4FP2 A;  3HN1 A;  3VBR A;  2CU5 A;  2PHT A;  4XAE A;  3S0M A;  1ZRR A;  3C2U A;  3GHN A;  4QX5 A;  5FMB A;  3AB0 A;  3WDU A;  2Y6H A;  3SH4 A;  4CPB D;  3MHZ A;  4EJR A;  2VY0 A;  3EO6 A;  4AVB A;  1AZD A;  1VRH 3;  1STM A;  2WO7 A;  3IM0 A;  3J7L A;  4CXW A;  4XJU A;  3VBF C;  5E8A A;  4DXR A;  2B8M A;  4TZD A;  3MFA A;  3RJ2 X;  1IQD C;  2RHP A;  1CAX B;  3CU7 A;  1F31 A;  3FHQ A;  1F2N A;  1HXS 1;  1OQE A;  2IZW A;  4Q4W 1;  1OT5 A;  4R4Z A;  4XBL A;  1US2 A;  2D3R A;  2BWA A;  1DG6 A;  4ZU7 A;  2OX0 A;  4CDX C;  1HIX A;  1OUX A;  1KQR A;  2P1B A;  4JGY B;  4LBQ D;  5C3S A;  3WW2 A;  3PMS A;  2R30 A;  4M3C B;  4B1M A;  3OGR A;  4JX0 A;  4RGA A;  4Y1V A;  3ZYR A;  5ABJ A;  5DDJ 3;  5GZG A;  5JLV A;  3VHP A;  2OZ6 A;  1K3I A;  3OBZ A;  3VBF A;  1OPM A;  5FKB A;  2JDP A;  5EJ3 A;  4QX2 A;  3AJZ A;  1LEN A;  1QOO A;  3I2O A;  1J1T A;  1I9R A;  4KBZ A;  3RS6 A;  2VZQ A;  3OUH A;  1JYN A;  2A3Y A;  4JGZ B;  2Q8D A;  1JZ3 A;  5A1L A;  5FZK A;  1K5M A;  4CCC A;  3WR0 A;  1YRZ A;  1GYK A;  1C1L A;  4JRA A;  2P17 A;  1C4R A;  5FPZ A;  3VKO A;  1R09 1;  4FFG A;  1FV3 A;  1ZRI A;  3M3O A;  3C7O A;  1V6M A;  1JZ7 A;  3ST7 A;  5FZA A;  4NWW A;  4AZZ A;  1A34 A;  2A6V A;  1QJZ A;  1S0E A;  3PJQ A;  3KV4 A;  3AVR A;  4BQY A;  2BGC A;  4XIK A;  1ND3 B;  1GP5 A;  3WDT A;  3T0D A;  2UWB A;  5F9T A;  1K42 A;  1YFY A;  2XJR A;  3RI8 A;  4D6S A;  2O0O A;  1AJO A;  2RR1 3;  4IQP A;  2DU0 A;  5FFO C;  1UU5 A;  4U36 A;  1N1T A;  3ACG A;  3RZL A;  4ISR A;  1YIF A;  5EQU A;  4NIG A;  5CNA A;  5DUV A;  2EAL A;  2IC1 A;  2BWC A;  5GKA C;  1RUD 2;  4C1X A;  3ACI A;  1IS4 A;  2ZGM A;  3LA7 A;  3ROU A;  1US3 A;  1TMF 2;  4CDQ A;  3S5A A;  5BNO A;  1ST8 A;  4LBQ B;  2PHR A;  3MZH A;  4LJH A;  1NCR B;  1GZ9 A;  1JHN A;  1HQW A;  4R4X A;  1MPX A;  2RS1 2;  1NY7 1;  3KF5 A;  3NST A;  3I49 A;  1RHI 2;  4MG2 A;  4BE3 A;  2LM3 A;  3U4S A;  4HKO A;  5BUV A;  1LTE A;  4HSJ A;  1VBD 3;  1WMX A;  1OXC A;  1RUF 3;  3ZN5 A;  2RM2 2;  3PVN A;  3ZLI A;  3LOI A;  5KHJ A;  2R07 3;  4XF4 A;  4AL9 A;  4PQQ A;  1LES A;  3MIG A;  4NE9 A;  3B3Q E;  4DPN A;  1HW5 A;  1NKG A;  3TB0 A;  2QQW A;  4CP9 B;  2AEN A;  1ZZ9 A;  4IDZ A;  3D0J A;  5AC9 2;  4G9S B;  3AVS A;  4Y20 A;  2ZX1 A;  4ASL A;  4Y33 A;  4FFI A;  3MIF A;  1V9U 3;  1MS9 A;  1LOA A;  5KXB A;  5EJZ B;  2P4E A;  2DUR A;  4GKX A;  3IAP A;  1PIV 1;  1R1A 3;  2JJ6 A;  4KU7 A;  2HWE 2;  5H9S A;  3LWC A;  3VBH C;  4IGO A;  1LEM A;  4P9J A;  2IWG B;  3SEP A;  4A4A A;  5KR7 A;  3J26 N;  4MXW A;  5FXW A;  1BEV 2;  1ZBE 2;  2Z5W A;  4UFH A;  2ILM A;  2VZS A;  4QT6 A;  5GZC A;  1AHS A;  5K0U C;  3O1S A;  1N1Y A;  1K12 A;  1H9P A;  1UWW A;  1NQJ A;  3BU7 A;  3LQC A;  2VO5 A;  1N3P A;  3WCS A;  2X5I C;  5A3P A;  5JSP A;  3CHX A;  3BOW A;  4KMQ A;  2VME A;  1LEC A;  1G86 A;  2BQP A;  1AUY A;  2WFP A;  3DCQ A;  3KM5 A;  3NVC A;  4GIQ A;  2VZU A;  3KCX A;  4IES A;  2W1U A;  2XJT A;  5AVA A;  5C5T A;  5JMO A;  3E5Q A;  4RR3 B;  3EHK A;  3POF A;  5K0U A;  5DZG A;  2NLR A;  1I6X A;  5HCH A;  4P9I A;  5FZ9 A;  2ZAA A;  2YG0 A;  3AK0 A;  4YW2 A;  1YFU A;  4MO3 M;  4GH4 C;  3VKF C;  1DQ1 A;  1LOF C;  5SV8 A;  2UY9 A;  2G19 A;  2O1Q A;  2Z42 A;  2X5I A;  1VR3 A;  2ZOE B;  2Y38 A;  4L8Q A;  4S2G A;  4MGZ E;  3V65 A;  4LKD A;  4DUV A;  4HPK A;  4GKY A;  4BHP A;  3LFM A;  1RUE 2;  4QPY A;  5L7O C;  2JX9 A;  2XWB B;  3QH7 A;  4IND A;  3O0V A;  1K5J A;  3OTF A;  3GAL A;  1SAC A;  1CAW A;  3I3D A;  1S0B A;  2EXH A;  2QTW B;  1VRH 2;  1WW7 A;  4CUC A;  1OMI A;  3DXU A;  4LO7 A;  4XBQ A;  3LDB A;  5FO8 B;  3ZOI A;  4LUK A;  3HT2 A;  3T2T A;  2CL2 A;  3DYP A;  1O8P A;  4ATE A;  2P37 A;  4KNC A;  2K9Z A;  1X8E A;  2IXI A;  2YPJ A;  4LIT A;  5FKC A;  1DP0 A;  2A6W A;  4AAX A;  1LCL A;  1W9Y A;  5FZL A;  1CR7 A;  4ZKT B;  2P2K A;  2BGP A;  2OUJ A;  4XUT A;  3RWN A;  3VZL A;  4I2O A;  2WO1 A;  3VHO A;  4OHY A;  5FMD A;  5DDJ 2;  3CBN A;  3CJI B;  4PI2 A;  3O1R A;  1PZ8 A;  1F5J A;  5HV4 A;  5F5Q A;  4MGK E;  3RZH A;  2RS3 1;  1AR8 3;  4BWO A;  4R9B A;  4DIN B;  5L9R A;  4A44 A;  4XJ9 A;  4HKL A;  4IE4 A;  2BVV A;  3NJY A;  4BMB A;  5C8C C;  1VBB 3;  5CEH A;  5D8A B;  1MZ6 A;  1D0H A;  2VC9 A;  3R05 A;  5IAX A;  2D6O X;  3AKS A;  3K75 B;  3LGR A;  4XHB A;  5FZI A;  2DFB A;  2VCB A;  1AYN 1;  4CCM A;  1X50 A;  1GNZ A;  1XU1 A;  3U11 A;  2W68 A;  4XXP A;  3WW1 A;  1PMH X;  5DXD A;  4D7S A;  1RTV A;  3OUI A;  2AZ5 A;  2ZX4 A;  5FZG A;  5IWF A;  3UK9 A;  1W0N A;  4IEW A;  4XIL A;  1PMJ X;  4OUM A;  3GCW A;  1WZX A;  2W52 A;  2JB8 A;  2E7T A;  4ZZ8 A;  1TME 1;  1RUJ 1;  3NJX A;  5A3L A;  4WVZ A;  3M3Q A;  3Q8C A;  5APA A;  1GNY A;  5FYU A;  1QJE A;  1FMD 1;  4IV3 B;  2YGM A;  2Y6F A;  3RDI A;  3IWZ A;  2EID A;  2JEC A;  4HOO A;  1QNW A;  4MV2 A;  1CPN A;  5BNN C;  3UJO A;  2ARE A;  2A1X A;  3EBR A;  3HNM A;  4LQR A;  4NAO A;  2CV6 A;  1CAV A;  1CIW A;  1H8T C;  4ZU4 A;  4LE4 A;  5FPV A;  3ZFE B;  4MGT A;  1OD3 A;  5FZ8 A;  4TXW A;  4YZ3 A;  2Q8O A;  5HCF A;  4CEY B;  1DZQ A;  3K51 A;  2ZGU A;  3AX4 A;  2J1E A;  3EQE A;  2AC1 A;  1BJQ A;  1W2T A;  1N1V A;  3GJB A;  4QPI A;  4A7K A;  1TVG A;  1CPM A;  1FOD 2;  1VBD 2;  1CZV A;  3JD7 1;  4MX3 A;  5IVY A;  4CCJ A;  5C70 A;  1D2S A;  2J1S A;  5BNN A;  1AX0 A;  1DQ0 A;  1CZS A;  1NLR A;  2R07 2;  1NE6 A;  3THT A;  5GZF A;  4ZZ5 A;  1SLI A;  1O7F A;  3EYP A;  2WS9 1;  2PLV 3;  2YFZ A;  3OUJ A;  4O65 A;  3T2P A;  3UV9 A;  5FMO S;  1HLC A;  5A7W A;  3M8L A;  5FR3 A;  2BEO A;  5EYY A;  3CQO A;  3SEE A;  1ND2 A;  3L2Y A;  3UKT A;  2HWB 1;  3D3A A;  1HV1 A;  5CAZ A;  1V9U 2;  2BV4 A;  2KA3 A;  1RUC 3;  2W1Q A;  3N7K A;  4E4H A;  5FYT A;  2WYF A;  3WLU A;  1R1A 2;  3THC A;  1UX6 A;  1QIQ A;  4QKN A;  3H8U A;  4FXK B;  2XBO 3;  5I8Y A;  2ZBJ A;  5J96 B;  3FHI B;  3P1I A;  1W6P B;  4JQR A;  1UW8 A;  1EV1 3;  3UJQ A;  3DPR A;  2XVK A;  1VAV A;  4ZU5 A;  3AMQ A;  2WNE A;  4FBF A;  5AVP A;  3UKV A;  4YZ5 A;  2XXZ A;  5BNP B;  1JHJ A;  2ZEY A;  4LBK A;  4CU8 A;  5C3Q A;  5LA2 A;  4M3C E;  5I8S A;  1GOH A;  5C6C A;  5KHI A;  3MF6 A;  3HBZ A;  2F4P A;  2RDN A;  2GMP A;  4NRM A;  4Y5T A;  3WNK A;  5IK4 A;  4F3J A;  2WWU A;  2E26 A;  2P6H A;  3VZO A;  4Q1R A;  4OYU A;  4LBO A;  2F4L A;  3OGV A;  1ULF A;  5IJR A;  1ALY A;  1UMH A;  4J1X A;  3J7M A;  2VVD A;  3PIG A;  1YFW A;  2A5Z A;  2QDN A;  2ZEW A;  3MLL A;  1MQT C;  1CQ9 A;  4IXL A;  1XNC A;  4QB1 A;  1G9B A;  4CCE A;  3RRD A;  2ZGQ A;  2GC3 A;  2V4V A;  1AX2 A;  2BW8 A;  5JDB A;  3RZM A;  4RD7 A;  4Q29 A;  3WHU A;  5KHH A;  1W3X A;  1OKO A;  3J7H A;  4N53 B;  2YXS A;  1O5L A;  5FYC A;  5FZ1 A;  5KXC A;  3TEW A;  1RGS A;  1V70 A;  4WZC A;  3ORJ A;  4QX3 A;  5LCW L;  1YEW A;  3OBR A;  1KJL A;  2D43 A;  1PO2 3;  2BZD A;  3MIC A;  1A3K A;  1O4Z A;  2Q8E A;  4WVM A;  3TAY A;  3NV4 A;  1LAJ A;  4XXA A;  2LRP A;  4PI0 A;  1UXZ A;  2OZJ A;  4XAB A;  4CTE A;  4NVP A;  1MEC 3;  2WA3 A;  3RPQ A;  3CKH A;  3AMM A;  2IXJ A;  2CAU A;  5C4W A;  3I3B A;  3UET A;  3B01 A;  4CA9 A;  4XFI A;  4N7U A;  1FPN 1;  4HON A;  2VZT A;  3ZN6 A;  4NRP A;  5IVJ A;  5CFC A;  4Q4V 3;  1GQH A;  3NO8 A;  4QD2 A;  4AOC A;  3NV2 A;  1PVC 1;  4XPV A;  4XCA A;  4PLO A;  1LOD A;  1H1M A;  3K48 A;  4QX1 A;  4NPR A;  2YGL A;  1AL2 1;  4FPH A;  4WM7 B;  5FYM A;  5A3W A;  3H8O A;  4XAA A;  3ZMN A;  4N9I A;  4NN0 A;  2BJS A;  4AEM A;  1UN1 A;  2R16 A;  2B9U A;  4GZ9 A;  2CWS A;  3T1L A;  2XG3 A;  4AG4 A;  1GWL A;  1O5U A;  1CAU A;  3TN9 1;  1MZF A;  2E7A A;  5DAW A;  1OLM E;  1Q56 A;  4PBO A;  4AQ2 A;  1UMZ A;  5LRR A;  4OUL A;  5HI0 A;  2E7Q A;  1KS5 A;  1J3Q A;  4GXL A;  1Z78 A;  4GWM A;  4UBH A;  5ABJ B;  1BMV 2;  2DCZ A;  1RUH 3;  1HN1 A;  4R9D A;  3GJA A;  3CF6 E;  1UZ0 A;  3IDC B;  5FZO B;  4JKK A;  1OA2 A;  1R1Z A;  1VBB 2;  4LUM A;  3SLI A;  1OC1 A;  1QJU 1;  3IIA A;  4KGQ A;  2WJS A;  4HG6 B;  2MPF A;  4COW A;  1O3T A;  2G9Z A;  3QOP A;  4IV1 C;  1RYY A;  5FZD A;  4B4R A;  3LIH A;  2Z69 A;  4KWJ A;  4UFI A;  4AI9 A;  3KD4 A;  1UZZ A;  1K5M B;  3HQU A;  5HXM A;  5IYY A;  2R04 3;  5CVR A;  1NXD 1;  4OQ9 A;  4B1L A;  4QQO A;  4BLI A;  4S2H A;  5D21 A;  4QX7 A;  4Q5O A;  1G9F A;  1MS1 A;  2PXJ A;  3FHA A;  3KQR A;  1LJ7 A;  4ORF A;  3VHN A;  3SCH A;  2WIN B;  1VMF A;  1DLL A;  1QJY 3;  3AFK A;  5LAT A;  5A7O A;  1YYN A;  4IL7 A;  4A3X A;  4Q2F A;  1H2N A;  5JZG C;  3CZU A;  2E31 A;  4GWN A;  5F3G A;  4QQ2 A;  4PF1 A;  2ZPX A;  1IG3 A;  1QOS A;  1RIT A;  2VL4 A;  3CDZ B;  1S0F A;  5IVV A;  2EXJ A;  1ENQ A;  5FY4 A;  2A3X A;  4FT8 A;  1B35 C;  5L19 A;  3ON7 A;  4LKS A;  1I3H A;  3NKG A;  4CRQ A;  3RSJ A;  2LW8 A;  3L9J T;  2ZGK A;  2VZ1 A;  5LA1 A;  2OII A;  1CZT A;  4PDW A;  5JZG A;  3F95 A;  4DMI A;  1YXW A;  1BZW A;  3MID A;  1W8H A;  3VDA A;  5A6Z A;  3AC0 A;  4R52 A;  4A6O A;  4CDQ B;  4HET A;  4B3N A;  1ZYB A;  1XOY A;  3WDW A;  4AEK A;  4E2Q A;  1BHG A;  5BNO B;  2W95 A;  4LHN A;  5LWB A;  3S6P A;  2KR2 A;  1VBA 3;  3BKZ A;  5FYB A;  3SIT A;  1F4H A;  1B35 A;  3T08 A;  2KD7 A;  3DYM A;  4ES8 A;  1POV 1;  5DG1 A;  2PLV 2;  5FWE A;  3VD9 A;  1DU3 D;  1AR9 1;  4YW4 A;  3VKN A;  4BQ4 A;  3HIF A;  1IGO A;  4H7M A;  2KM2 A;  5BXX A;  2ARA A;  5IUQ A;  4R9A A;  1Z7S 2;  3VDB A;  4NPL A;  3FLP A;  3I3E A;  1OPO A;  1W99 A;  3J8F 2;  3KVB A;  3NRU A;  3PTY A;  4H14 A;  4AHW A;  3Q8A A;  5FZM A;  4TTG A;  4ZXK A;  5KXE A;  1B09 A;  2ZAB A;  4L9B A;  3M3C A;  4E4D X;  1EV1 2;  4XHX A;  3H3L A;  1KDK A;  2XHN A;  2W92 A;  3ZKU A;  3AKP A;  1R08 1;  2ERF A;  1RMU 3;  1UKR A;  1W8T A;  4RHV 1;  3O1P A;  3UKN A;  3HMY A;  2RMU 3;  4LOS A;  3CO2 A;  2VTF A;  4LBM A;  4J1W A;  3WQ7 A;  3VD3 A;  4MXW B;  3B9I A;  2QQV A;  2PN5 A;  5JR7 B;  3TEY A;  5FAX A;  4RGK A;  1JOP A;  2DBN A;  2OUH A;  2ZAC A;  2JDU A;  4QDS A;  2OYZ A;  4BB3 A;  2BNN A;  1O4T A;  3BN6 A;  4COY A;  3BUC A;  3NL1 A;  4IEQ A;  5LW9 A;  5GZD A;  3VBH B;  1COV 2;  4GWI A;  1G9C A;  3AZZ A;  4XZP A;  1IPK A;  5A3M A;  1F15 A;  2WLQ A;  4ZS2 A;  3OSD A;  3PHM A;  4AED A;  3BB6 A;  1QHD A;  1D4M 3;  1SFY A;  2JKB A;  4XTP A;  3SH3 A;  2Z4F A;  1SPP B;  5H9Q A;  2D3P A;  1F5F A;  4IEV A;  2FBE A;  5A7N A;  3NV3 A;  1PO2 2;  2DCT A;  2R1D A;  1PGW 2;  2D97 A;  2VZR A;  1CIY A;  1HB1 A;  3RGB A;  4XJA A;  1Q8O A;  4Y1Y A;  3RMY A;  3RWK X;  4PF5 A;  4B7E A;  3PVO A;  1PX4 A;  2NM1 A;  2C0Z A;  5HXV A;  4AR2 A;  1CON A;  4Q4Y 3;  5LB6 A;  3QAC A;  4ZPI A;  4Z82 A;  2XQR A;  1XRU A;  4BZ4 A;  3IZO A;  5DG2 A;  4Q4V 2;  4F7Z A;  2WFF 3;  2Y0O A;  2PTM A;  4JDN A;  4YG0 A;  3N9L A;  3WD5 A;  1S55 A;  2WT2 A;  3B02 A;  3TOJ A;  3I2G A;  1W28 A;  2VQU A;  4K6B A;  3RYR A;  1NG0 A;  4BPZ A;  1BK1 A;  3CIH A;  3PDQ A;  1C1F A;  4BQ3 A;  3WF2 A;  1H2K A;  5IK5 A;  1OUR A;  1DQ6 A;  1ULD A;  1JI6 A;  2YDE A;  4LNV A;  4AI2 A;  4EYU A;  2YBS A;  2HEW F;  1O3S A;  1MS8 A;  3NAP C;  3Q8B A;  1IZ3 A;  2QQN A;  2RS5 3;  2X53 S;  2Z79 A;  3DKW A;  4M00 A;  2JEN A;  4QDR A;  2VMH A;  4WVW A;  3QD6 A;  2GU9 A;  3JQW A;  4YRD A;  4KWL A;  4BCU A;  1OFS A;  3E5X A;  3CMG A;  4LBL A;  4BIS A;  3ZR6 A;  1PGL 2;  3WV6 A;  1RUH 2;  1IS3 A;  4ZON A;  2PQQ A;  1J3P A;  1SDD B;  3E5U A;  3RYK A;  2UWA A;  2ZGS A;  2ES3 A;  2XWJ B;  3QLQ A;  4OZO A;  4UWD A;  4L0P A;  4YVS B;  5JMC A;  2ZAH A;  5FPB A;  2NPI A;  4YVW A;  3ZMO A;  1GZW B;  1WLW A;  1LGC A;  4JHT A;  1ASJ 1;  1ULE A;  1XND A;  1GP4 A;  1FAT A;  5A70 A;  1CJP A;  1ZBA 3;  4CUB A;  4IEU A;  2DUP A;  4UT5 A;  3WQB A;  4QXH A;  1N1S A;  3DUI A;  4X8N A;  2VTX A;  1H2M A;  1JZ8 A;  3SNM A;  1TMF 1;  2W47 A;  4DRR A;  5JCT A;  1H8V A;  2BFU S;  2DBI A;  1NCQ C;  4MHU A;  4Y1Z A;  5GJ6 A;  3A22 A;  3SXW A;  2W5F A;  5C7G A;  3I59 A;  3FBY A;  4A7Y A;  2VZO A;  1QJY 2;  2YYO A;  4NOT A;  2RS1 1;  2PMW B;  5FJK A;  5B4N A;  3MF9 A;  1RHI 1;  3RMX A;  3VL9 A;  1EPZ A;  5CBL A;  2ARC A;  5IVC A;  2Q8C A;  1QXP A;  1SLT A;  3SH5 A;  2A73 B;  4I3P A;  1HRV 3;  2RM2 1;  1D7P M;  1UNB A;  2D93 A;  1VRB A;  1WW4 A;  5KHK A;  5C9A C;  2J1R A;  4XCB A;  2VGD A;  3LD8 A;  2JDZ A;  4UW6 A;  1NCQ A;  2DU1 A;  4RN5 A;  2GNM A;  4CDU A;  2GH2 A;  5CFD A;  4Q27 A;  2G9F A;  4AQS A;  1LHW A;  2PAK A;  1CWP A;  4XET A;  3ZXG A;  1JZ2 A;  5AC9 1;  1SBE A;  4MET A;  2VAU A;  1IKP A;  2WRA A;  2YU2 A;  1EYB A;  2O8Q A;  1XYO A;  3AP4 A;  3ZYP A;  1J84 A;  2Q1F A;  2VD7 A;  3H7J A;  5C9A A;  4X6R B;  3N3H A;  4RS5 A;  2PEL A;  2D6N A;  2ATF A;  2V5D A;  2HWE 1;  1VBA 2;  1YQ6 A;  3FUQ A;  3I2K A;  2VE1 A;  1JZ4 A;  1OQD A;  4XOG A;  1QNY A;  2VCA A;  4JKM A;  1BEV 1;  3VD5 A;  1FNY A;  2GC1 A;  4QPI B;  4TLF A;  1Y43 B;  3LA2 A;  1W8N A;  3PL0 A;  3LSD A;  4GJY A;  1E5H A;  3HEI A;  1DGW X;  4MYE A;  4DXT A;  1KDM A;  1S0D A;  2VMC A;  1H1I A;  4IEO A;  1SCS A;  2EAA A;  3I2I A;  1CX1 A;  4ARX A;  3OPT A;  3PLQ A;  3A23 A;  3CNA A;  4KH9 A;  4V1P A;  4BIO A;  3AM2 A;  3PUQ A;  5A7W B;  1DGL A;  1LHU A;  3MIB A;  1IOA A;  3HOB A;  3JUU A;  5G05 L;  4CCK A;  1O8S A;  2Q0A A;  3AYE A;  5IVE A;  1ND2 B;  2J1A A;  4LA2 A;  2E33 A;  2PHL A;  3JCI A;  2LUW A;  2E6V A;  4ET7 A;  1DHK B;  3V0A A;  2WO3 A;  1PNG A;  4JVA A;  5DAB A;  1UMI A;  3OEA A;  5CG9 A;  1NAE A;  3KWV A;  2RMU 2;  3HR9 A;  3OGS A;  1UX7 A;  1W06 A;  5HCA A;  3N4M A;  2AR6 A;  3WG1 A;  4XBN A;  4D0Q A;  3GNE A;  4JTO A;  3ENR A;  3U78 A;  2BP6 A;  4UXA A;  4LKE A;  3TRS B;  3DPR B;  4UF0 B;  2GNT A;  4M4P A;  3MIE A;  1UY0 A;  1RUE 1;  2DCK A;  3F2Z A;  3P3N A;  2VZP A;  1G9A A;  4Q26 A;  4AF9 A;  4AHY A;  5FZH A;  3T3Y A;  2XH6 A;  4DQA A;  5KBF A;  1BK0 A;  4QKB A;  5DQ0 A;  2OXB A;  3K4A A;  3N9P A;  1YI7 A;  1JMU B;  3I97 A;  4FOQ A;  4ZS3 A;  4AGR A;  3OBA A;  4CE8 A;  4LT5 A;  4AFB A;  2ET7 A;  1GU3 A;  2XQX A;  3NV1 A;  1VRH 1;  4FPJ A;  2B45 X;  1LOB A;  1R09 3;  1D4M 2;  4XZU G;  4CDX A;  1U12 A;  5F8P A;  4G4F A;  3JXS A;  3G6J B;  4LA3 A;  4ATF A;  5JXG A;  1PX3 A;  5A3O A;  5LBC A;  2VW0 A;  2RVA A;  2FDK A;  2GMM A;  2MEV 3;  3WY6 A;  5DZF A;  1WKY A;  1BCX A;  4OI4 A;  1W3V A;  4Q4Y 2;  5A6X A;  1GFF 2;  5I8T A;  2J7M A;  4WVM B;  3I7D A;  2WFF 2;  4GWJ A;  4QB6 A;  4PLN A;  4Y22 B;  2V72 A;  4AI0 A;  1XXN A;  1H1A A;  1HN0 A;  1Y9G A;  2DTW A;  4XJZ A;  1U5X A;  5C4W B;  2TBV A;  5JOY A;  4FPO B;  4A6S A;  1WA6 X;  5LY1 A;  5FV3 A;  1XNK A;  3ZN6 B;  3T0B A;  5CFC B;  1TNR A;  1VBC 3;  1AR6 3;  2RS5 2;  1WME A;  3JU9 A;  2Y64 A;  3H50 A;  4YGE A;  3VUO A;  1DQ4 A;  4EN9 B;  1HRI 3;  1TNF A;  2ARB A;  2Q1M A;  4IEX A;  5EIY B;  1S0G A;  4YWA A;  4E4S A;  1XB9 A;  3ALQ A;  1HV0 A;  2I2S A;  2VMD A;  2JG9 C;  5CB7 A;  5J3U A;  1AYM 2;  1HB3 A;  2G9G A;  2P5B A;  1VB2 A;  2DVD A;  1CAU B;  5FZB A;  5JIA A;  3O1V A;  4OQ8 A;  3IAQ A;  1EAH 2;  3VDC A;  1SCR A;  4IEY A;  2K2S A;  3ZO0 B;  2QZ3 A;  1ZBA 2;  3P3P A;  2WSV A;  4ZHN A;  2JG8 C;  1WW6 A;  2VM9 A;  5FY7 A;  1AF9 A;  1F9K A;  2VZ3 A;  3H42 B;  4LIU A;  3GXU A;  5FLJ A;  2VCC A;  2LRO A;  3CLP A;  1C5I A;  1PIV 3;  2WDB A;  3C7G A;  5T5O A;  3VKM A;  1PK6 C;  5LK7 B;  2D44 A;  2W87 A;  3T1M A;  3WP6 A;  4YM3 A;  5JPN B;  1SLA A;  2DF7 A;  2JIG A;  2YUE A;  3NQH A;  4DB5 A;  5FO9 B;  2VNV A;  2W1W A;  4LR4 A;  4OHZ A;  5IAT A;  3H7Y A;  1SBD A;  2QQJ A;  1SFN A;  2PQS A;  3GF6 A;  4W6W A;  1FOD 1;  1VBD 1;  4YM0 A;  3QBQ A;  3TBD A;  3WF0 A;  1YC6 1;  5LBF A;  4EN8 B;  3IN9 A;  4OVE A;  2ZEZ A;  2R07 1;  3VDD C;  2W2I A;  4OFG A;  2Q30 A;  4H55 A;  1W0P A;  2JB4 A;  1WCS A;  3ZXJ A;  4CP2 A;  1PM7 A;  1PK6 A;  5I0U A;  1W0O A;  2NYY A;  1LHO A;  4XF1 A;  2IFW A;  2DUO A;  1GZC A;  2BOI A;  1V9U 1;  3H8R A;  5F7U A;  4N43 C;  3VDD A;  2HWC 2;  3AJY A;  1A8D A;  1R1A 1;  1SQ4 A;  1URX A;  1W2U A;  3H1Y A;  3KT1 A;  4C91 A;  4CU7 A;  3IPV A;  2B5H A;  4YZ1 A;  1FX5 A;  2HKX A;  2X09 A;  1C8N A;  3M1H A;  3NNJ A;  5LBB A;  4PDW B;  3KHB A;  2AEZ A;  3FFZ A;  3LA3 A;  4HKW A;  5FJH A;  4UBG A;  5B4X A;  5A3N A;  4EZH A;  1J83 A;  4NIA A;  1MVQ A;  2XJQ A;  5KXD A;  2XON A;  2XVL A;  4OI0 A;  2KXL A;  1B35 B;  3FN9 A;  5ANQ A;  2YMZ A;  3IT8 A;  3VBU C;  2AGS A;  5JSO A;  1BQP A;  3GHM A;  4OZX A;  3ZKY A;  4GH4 A;  1JBC A;  4HSL A;  4QB2 A;  4UW4 A;  1LOF A;  5F32 A;  4ES9 A;  3B00 A;  1X33 A;  1DYK A;  4UYB A;  5L73 A;  1ZRF A;  1JH5 A;  4AGV A;  2CAV A;  5H9P A;  4GMP 0;  2W46 A;  3W5M A;  2YY1 A;  1AL0 G;  4BK5 A;  3VBU A;  4F8A A;  4NIH A;  4IE0 A;  1OOP C;  5L7O A;  1ZNP A;  1SZB A;  1UZY A;  2C1F A;  4QPW A;  2DVG A;  5FP4 A;  3ZR5 A;  1DZR A;  2PAE A;  1OLR A;  2WZR 1;  3THD A;  5IVB A;  3MV1 1;  1UD1 A;  4Z07 A;  5FTT C;  5FY0 A;  3SQO A;  1FI2 A;  2UYB A;  3A0K A;  2WKK A;  4EN6 B;  3POE A;  3B94 A;  4AVT A;  4D94 A;  1OOP A;  2BVB A;  1GP6 A;  1ZA4 A;  3AFG A;  3RNS A;  5IW0 A;  2WBK A;  5J09 A;  4KBB A;  1OH4 A;  2PHD A;  2WAA A;  4BXF A;  1ZVF A;  3N36 A;  5I0R A;  2WL1 A;  2BBV A;  1ULO A;  3R4S A;  5T52 A;  4TYS A;  4CEW C;  3DL3 A;  3U07 A;  4WV8 A;  1AYN 3;  1LGB A;  5DAP A;  5A32 A;  2Y6L A;  1O3R A;  1G6N A;  3HWJ A;  1WCK A;  2MEV 2;  3ZYG A;  3KT7 A;  1LOG A;  4NAM A;  1FV2 A;  4AED B;  1X82 A;  4WM8 C;  1QJF A;  3HQX A;  4JC1 A;  3AZW A;  4XUN A;  1AVB A;  1NA1 B;  3S7I A;  1VBE 3;  4Q4X 1;  1S4C A;  3GGL A;  4Q0V A;  5EJ1 B;  2ZS6 B;  4RQP C;  1RUJ 3;  1P8J A;  1YNA A;  2D6M A;  5CU1 A;  3U1X A;  4QQP A;  4CEW A;  5C8C A;  2RR1 2;  5DUX A;  3KMH A;  1DGR N;  2YPD A;  5F6K A;  1JW6 A;  4BLJ A;  3ZYI B;  2RE9 A;  3LB9 A;  3B7M A;  2A7A A;  2WLP A;  1EUT A;  4HZF A;  3MI8 A;  1ZRE A;  2WNU C;  4WM8 A;  1ZZ6 A;  3K4D A;  4RFT 0;  3ACL A;  2VUJ A;  4CSW A;  3VZJ A;  4YNI A;  3DEM A;  1SLL A;  2DTY A;  5C3P A;  1VBC 2;  3BI3 A;  1AR6 2;  1UQX A;  4XDQ A;  1UY1 A;  2WWS A;  3OD4 A;  1JUH A;  3FWE A;  4GB3 3;  4BM8 A;  3G7D A;  3OYW A;  4MAD A;  5CA6 A;  1RUG 3;  4A42 A;  1HRI 2;  4XFF A;  1DQ5 A;  3U0Z A;  1MS3 A;  1YI9 A;  1H0B A;  5A80 A;  3K4Z A;  5CAD A;  4DFS A;  2JXA A;  1POV 0;  3IDB B;  1NOV A;  3ZIW A;  1VAK A;  1XE0 A;  2WNU A;  3ZSL A;  4RL7 A;  5JXH A;  2JDK A;  3GZA A;  5EFU A;  4AW7 A;  3FMG A;  4B8E A;  4W8J A;  1RUF 2;  4B4Q A;  1QEX A;  3U75 A;  2BOJ A;  4NRO A;  4E2G A;  1WLC A;  4C0H A;  1UXX X;  4QPG C;  1H8T A;  4BK4 A;  4KI5 M;  4M0H A;  3KB5 A;  1UYY A;  2ETE A;  3GCX A;  2FDH A;  4R9C A;  3M7A A;  4G3Y C;  1OVS A;  1QQP 3;  4MVT A;  5FY1 A;  2JKX A;  3MLK A;  3R4D B;  5FOB B;  2HWB 3;  2W39 A;  2EIB A;  5F37 A;  4FOV A;  1GIC A;  1W6M A;  1VB4 A;  3ES1 A;  4YVW B;  4K1Z A;  4AWD A;  1WCU A;  3VBS C;  4OUE A;  2AAC A;  3UYJ A;  5H9R A;  4LO5 B;  1R64 A;  2GME A;  3L2H A;  4QPG A;  3ZFF B;  3I2H A;  4A45 A;  3ZXK A;  4LKF A;  1JYT A;  1OFN A;  3WDV A;  5T5P A;  3LKJ A;  1UYP A;  4LE3 A;  4PHZ A;  4V2W A;  1N47 A;  2VXJ A;  3T4H B;  1JYI A;  3I59 B;  3JBG 3;  3IDE A;  3LIG A;  4BQW A;  1WCD J;  3VBS A;  5FCC A;  2Y6K A;  2BDR A;  2JDM A;  2OPW A;  2PLV 1;  4BJ0 A;  4QHZ A;  2RDQ A;  4JGY C;  3BCW A;  2V5Y A;  4B29 A;  3I8T A;  5F2W A;  4BH9 A;  1BLZ A;  2Q5T A;  5JSR A;  2PA7 A;  4W6X A;  3ZPO A;  2EXK A;  1L3J A;  3NNL A;  4IEZ A;  3ZX7 A;  1Z7S 1;  3OBT A;  1NCQ B;  2GZW A;  2LS6 A;  3J8F 1;  2JEM A;  4FPK A;  5GLZ A;  2VEC A;  4K40 A;  1W9T A;  4CDU B;  2Q4S A;  3GZT B;  2CDP A;  2XLG A;  3AKT A;  5CFD B;  5M0T A;  4JGZ C;  5FP3 A;  5F1R A;  3D0S A;  2D5H A;  1YQ5 A;  4XC9 A;  1GMM A;  1V6J A;  2JD4 A;  1BVV A;  4QU1 A;  1Y7B A;  2D40 A;  5DAQ A;  1UL9 A;  1EP0 A;  1RUI 1;  4XUO A;  3BIW E;  3IB3 A;  5J36 A;  4BXS V;  4Z2W A;  3MFC A;  4RS5 B;  5FPX A;  5EP9 A;  4D6Q A;  4S2D A;  3AYC A;  1Q8Q A;  2R06 3;  2VNO A;  4SBV A;  1XJA A;  2YHJ A;  3FZ3 A;  5FIX A;  5FPA A;  4Q0P A;  4C8D A;  3KS7 A;  1XBF A;  1RUO A;  1MQT A;  3PNA A;  4XUQ A;  5FZ6 A;  3UES A;  3ZXD A;  3SKV A;  1ND3 C;  1JOD A;  3AZX A;  4PLM A;  4Q8K A;  2GAU A;  2QKD A;  1U0A A;  2EXI A;  4BOW A;  4JCK A;  2H6B A;  3POS A;  4QXK A;  4UOJ A;  2J22 A;  3VBR B;  2W9X A;  1BVP 1;  3KT4 A;  1UIJ A;  4I0W B;  3T0A A;  2XJS A;  3D82 A;  3ZVX A;  4Y4R A;  5GLV A;  1COV 1;  5GZE A;  1PVC 3;  1OBN A;  1W8O A;  4H2A A;  5FY5 A;  1RVF 1;  1PHM A;  3ZSM A;  4GMP 3;  3LDK A;  4YG3 A;  4JQT A;  5FYY A;  1AL2 3;  4YM2 A;  4Q1P A;  1TQ5 A;  1KRI A;  5FO7 B;  3E6C C;  2Q1Z B;  3JQX A;  2HYK A;  4OMD A;  2I07 B;  4AHZ A;  2CGP A;  3O1U A;  3KV5 A;  4COV A;  1QJX 3;  1JZ5 A;  1PO1 1;  2B39 A;  1PVX A;  3ZYH A;  1PO2 1;  4AQ6 A;  3ITQ A;  4W65 A;  4EQV A;  5BPX A;  1PGW 1;  3KSC A;  3ASI A;  2TNF A;  3RJR A;  1U5I A;  4NWV A;  4ONU A;  5IT6 A;  5K9Y A;  2P3K A;  1KFU L;  1AR8 2;  1EUU A;  2DV9 A;  3VLB B;  4EWD A;  1GQP A;  4AVC A;  5HCB A;  2QFE A;  2ZCW A;  3O12 A;  2V73 A;  4RFR B;  4XUP A;  5EPA A;  2D7F A;  2ZHL A;  3AZY A;  3ZXL A;  4Q4V 1;  3VBF B;  4LTA A;  1A78 A;  4NHY A;  3FLT A;  1JXN A;  1AYN 2;  3HT1 A;  3OJB A;  3PVE A;  3N35 A;  4NMI A;  3O14 A;  3AP5 A;  2PHU A;  2VH9 A;  3HNB M;  2DCJ A;  4HVO A;  4P9X A;  3WG2 A;  5FUI A;  2JDA A;  4XJW A;  2BBA A;  1W2O A;  4O9E A;  2WC2 A;  4CDX B;  3KLS A;  1VBE 2;  4KU8 A;  4Z8B A;  4C1W A;  4EWA A;  4ARY A;  5FYH A;  1RUJ 2;  1W03 A;  4AEJ A;  3AYD A;  1O6U A;  2FCU A;  3ILR A;  5FBZ A;  5A6Y A;  5D2A A;  4LUL A;  4KGG A;  3AZV A;  2NMN A;  3OPW A;  4YW7 A;  4IV1 A;  1PGL 1;  1RUH 1;  2XL9 A;  5DPN A;  1GUI A;  5AFE A;  5IK8 A;  4Q0U A;  4QQH A;  2ZMN A;  3LPG A;  3JB8 A;  4FPC A;  2XJU A;  2ZZJ A;  4D8M A;  5FQ0 A;  3I3M A;  1YQ8 A;  2R32 A;  2F17 A;  4LHL A;  5FXX A;  1UF2 C;  3JZV A;  3LCP A;  2JDY A;  1IKQ A;  3WF1 A;  2C9A A;  2GNB A;  3PUH A;  2HJI A;  4GB3 2;  3W20 A;  1RUG 2;  2PHW A;  1Y9M A;  2VVE A;  4QKF A;  4XE9 A;  5F3E A;  4ZXE A;  4ZY9 A;  2FMD A;  3TEX A;  3UGH A;  5JIU A;  5JOX A;  1DBN A;  2H0V A;  3ZYJ B;  4AXO A;  5FLH A;  1UOF A;  1W8F A;  2A71 A;  2WR9 A;  3BGA A;  4MZU A;  1LGN A;  2HWF 1;  4FFH A;  4YAR A;  5GAL A;  3VZN A;  2YRO A;  1QH7 A;  1QJY 1;  3DEC A;  4DXZ A;  2FZ1 A;  3LZZ A;  4DEQ A;  2VOV A;  5CKN A;  3BU0 A;  4HK8 A;  1UPI A;  2WT1 A;  5K4L A;  1JTZ X;  5DUU A;  5F6L B;  1AR9 3;  3BTA A;  5CKQ A;  4LIV A;  1C8M 3;  4E2S A;  4HVQ A;  1J59 A;  3ECQ A;  1QQP 2;  4HN0 A;  3HAG A;  4GAL A;  4LO8 A;  5KHG A;  1OUS A;  2Z2S B;  3MW4 A;  1I5Z A;  5G04 L;  4K9S A;  2B7Y A;  3HVD A;  3USU A;  3C8X A;  1RUC 2;  2A75 A;  2FQP A;  3WIN E;  3WX5 A;  2CTV A;  3I2D A;  2HWD 3;  5FZ0 A;  1LED A;  2UWC A;  2XBO 2;  3E6D A;  5FRE A;  5L9B A;  3ZPY A;  4Y3O A;  4CXY A;  4Y20 B;  3H8X A;  1BBT 3;  4RHV 3;  3JBG 2;  2GC2 A;  2VBD A;  1KFX L;  2VCM A;  2W94 A;  3HD8 B;  4MXV A;  4LBN A;  3WQ0 A;  3WXP A;  4P9Y A;  4IE5 A;  2AYH A;  3RZZ A;  5A3U A;  2E63 A;  4MH0 E;  2FHR A;  4EN0 A;  3E1F 1;  4HMZ A;  3AXD A;  1REF A;  3R4U A;  5EV7 A;  4XTM A;  2ID4 A;  2RJ2 A;  2OA2 A;  1O91 A;  1L7L A;  5TSW A;  2TUN A;  4IW3 A;  4KWU A;  3CJI C;  2EIC A;  1SG3 A;  2VUL A;  2VMF A;  4XF0 A;  3UT0 A;  1DZT A;  1WLD A;  3MO4 A;  4AFA A;  4V2V A;  5JOW A;  1PK6 B;  1MS5 A;  1AR7 3;  1GOG A;  2VOK A;  1V0A A;  3S57 A;  5JVV A;  5KC6 A;  4KL1 A;  4Q0Q A;  5ACA 3;  3K3O A;  2E9Q A;  1WUV A;  4P9G A;  5A7Q A;  5IFT A;  4XF3 A;  2GN3 A;  2XB6 C;  3AXE A;  3E97 A;  2YC4 A;  5D8A C;  5K0U B;  1GWK A;  2JE8 A;  2GC0 A;  1WD4 A;  1HDK A;  3CJI A;  2RMU 1;  3MPP G;  1S0J A;  5D1I A;  2R06 2;  3LE0 A;  1NQD A;  4CCD A;  4NPM A;  1Q8S A;  3PUR A;  2X5I B;  3FFQ A;  1JYW A;  1GKB A;  4I02 A;  2WO2 A;  2GND A;  4YPJ A;  1MEC 2;  4AFD A;  2NP0 A;  2IVJ A;  4LOT A;  1W6Q A;  2J1V A;  5D8A A;  4HPK B;  1MAC A;  3A21 A;  1KS4 A;  1GNH A;  4YM1 A;  3NNF A;  3ZSK A;  3K2O A;  4GH4 B;  2H6C A;  3ZXA C;  3O0X A;  5IK7 A;  5LZ6 A;  2ZHM A;  5FUN A;  5J7M A;  3POJ A;  1CAW B;  2QQM A;  5I0T A;  4IV3 C;  2VQ0 A;  2BNO A;  2ZGN A;  4CCO A;  1D4M 1;  3MYX A;  1S2B A;  1X7N A;  4W50 A;  1IG0 A;  3I2F A;  1QJX 2;  2GN7 A;  2ZGR A;  4YW5 A;  5JWP A;  1W6N A;  1VP6 A;  2WA4 A;  2A6Y A;  3H1M A;  5DAX A;  4ITC A;  3W21 A;  5B2G B;  1V6N A;  3BTY A;  1CGP A;  2FD8 A;  5FWJ A;  3I54 A;  3ZFE C;  5C3O A;  5L7O B;  1KEX A;  3JB4 C;  1APN A;  4GAZ A;  1VMJ A;  4E4Z A;  1Q43 A;  1X36 A;  1MS0 A;  5EXO A;  1JU4 A;  4XFB A;  4Q4Y 1;  1H4H A;  2VPV A;  3NKT A;  3VZM A;  1O3Q A;  1C57 A;  1UU6 A;  3PVB B;  1D4V B;  3OEB A;  1J58 A;  4YZ2 A;  5A6Q A;  3INA A;  2WFF 1;  1DGR A;  3APB A;  2VXR A;  2VUA A;  4XF9 A;  3WZ1 A;  1RXF A;  3BTX A;  1OOP B;  2C24 A;  3J9S A;  5C33 A;  1ASJ 3;  2C26 A;  3NAP A;  2XUM A;  1GSL A;  4D7Y A;  1GAN A;  1LOC A; 
#chains in the Genus database with same CATH homology
 1WCQ A;  2ORZ A;  2WAO A;  2Y8K A;  5IFP A;  2WN3 A;  5EIY B;  4LHS A;  1GNY A;  5JR2 A;  3ACH A;  3OB8 A;  1L7R A;  2VMD A;  2EID A;  3IAQ A;  3VDC A;  3HNM A;  4LQR A;  1OD3 A;  4UI9 L;  4TXW A;  2VM9 A;  2J1E A;  4JHZ A;  3MUY 1;  1UYX A;  2VZ3 A;  4FI9 A;  3GXU A;  1TVG A;  2ZXQ A;  2VCC A;  1CZV A;  3WNN A;  3C7G A;  4DUW A;  2WDB A;  5C70 A;  2J1S A;  2W87 A;  1CZS A;  3WEZ A;  3NQH A;  2W1W A;  4ZZ5 A;  3OG2 A;  2QQJ A;  3EYP A;  2PQS A;  2YFZ A;  3T2P A;  2J1U A;  3WF0 A;  4Z2A A;  3SKJ E;  2ZEZ A;  3CQO A;  3SEE A;  3D3A A;  3WSO A;  2YB7 A;  4UAP A;  1NUK A;  4A41 A;  2W1Q A;  3THC A;  4MGQ A;  3VD7 A;  3P1I A;  1OF4 A;  2X10 A;  1TG7 A;  5F7U A;  2VQT A;  4CU7 A;  4QAW A;  2X09 A;  1JHJ A;  2ZEY A;  4CU8 A;  5LA2 A;  2QBX A;  1GOH A;  5B4X A;  1DYO A;  1J83 A;  3WNK A;  5LA0 A;  2E26 A;  4OYU A;  2XON A;  3LEK A;  4ZZ8 A;  3OGV A;  2BGO A;  3FN9 A;  1UMH A;  4LPL A;  5IJR A;  3U37 A;  1JZ5 A;  2OKX A;  2ZEW A;  4QB2 A;  4QB1 A;  3III A;  2V4V A;  2C9K A;  3CZJ A;  3J7H A;  1XPW A;  2W46 A;  3W5M A;  4QX3 A;  5LCW L;  5CYY A;  4BK5 A;  2WQ8 A;  2BZD A;  2BER A;  4QPW A;  1OF3 A;  1UXZ A;  3CKH A;  4M4R A;  3THD A;  3MV1 1;  3I3B A;  3UET A;  2B9V A;  5DN2 A;  2VZT A;  3NNG A;  5A1A A;  2ORX A;  2WBK A;  1L7Q A;  3LEI A;  4QX1 A;  1OH4 A;  2WAA A;  2ZEX A;  3MUZ 1;  2W1S A;  4E8D A;  1ULO A;  4DXS A;  1H6X A;  4QX0 A;  3T09 A;  4W4Z A;  2RV9 A;  2Y6L A;  3UNP A;  4GZ9 A;  4AG4 A;  4JKL A;  1F4A A;  5JXJ A;  3K46 A;  4XUN A;  2R7E B;  1DLC A;  1H6Y A;  2VR4 A;  4MOA A;  3ACF A;  3GGL A;  1I5P A;  1HN1 A;  5EJ1 B;  1UZ0 A;  1P8J A;  4JKK A;  2QQI A;  4CVU A;  3P6B A;  4HG6 B;  1KGY A;  1RYY A;  3NJV A;  3W5N A;  3HPN A;  1EUT A;  1K45 A;  3K4D A;  5HXM A;  5IYY A;  1GOF A;  1UY1 A;  3FHA A;  4MAD A;  3HJR A;  2HYX A;  4A42 A;  2YFU A;  3K4Z A;  5DMY A;  5JXH A;  2L9L A;  3CZU A;  2E31 A;  2JD9 A;  4PF1 A;  4W8J A;  2QQK A;  4P02 B;  1W9W A;  5JUV A;  3CDZ B;  2VL4 A;  1UXX X;  1YQ2 A;  2WYS A;  4IUG A;  4BK4 A;  4KI5 M;  4DEV A;  4MGS A;  4LKS A;  1UYY A;  2LW8 A;  5LA1 A;  2JKX A;  2VZ1 A;  1CZT A;  2EIB A;  3VDA A;  3AC0 A;  4A6O A;  4OUE A;  2CDO A;  1BHG A;  3ZM8 A;  2W95 A;  1R64 A;  2XOM A;  3ETP A;  3I2H A;  3FL7 A;  3T08 A;  1F4H A;  4A45 A;  2KD7 A;  3DYM A;  2X05 A;  1W9S A;  3VD9 A;  3HN3 A;  3IDA A;  4P00 B;  3MV0 1;  2YC2 A;  3WF3 A;  2Y6K A;  4BJ0 A;  3VDB A;  5J1X A;  3I3E A;  3NRU A;  1W99 A;  4P5Y A;  4TTG A;  1SHW B;  3WNP A;  2EIE A;  2VJX A;  2WZE A;  2LS6 A;  2XHN A;  2W92 A;  3C7H A;  1W9T A;  1XNA A;  2CDP A;  4CU6 A;  3GDB A;  3EB7 A;  4XUR A;  2VTF A;  3ABZ A;  1UY2 A;  3VD3 A;  1GMM A;  2Y6H A;  4XUO A;  3IB3 A;  4BXS V;  4QDS A;  3BN6 A;  3LPF A;  4XUQ A;  4DXR A;  3UES A;  3SKV A;  4XVH A;  4GWI A;  1IQD C;  3FHQ A;  4UOJ A;  4CU9 A;  1OT5 A;  2J22 A;  1US2 A;  2W9X A;  1UY4 A;  3T0A A;  2Z4F A;  1W8O A;  3OGR A;  4JX0 A;  4OMC A;  3GM8 A;  3DYO A;  1K3I A;  2VZR A;  1CIY A;  2E32 A;  4QX2 A;  4OMD A;  1PX4 A;  1JYN A;  2C4X A;  2VZQ A;  1JZ3 A;  1EUU A;  3C7O A;  3I2G A;  1GQP A;  2VQU A;  1JZ7 A;  2J1T A;  3CIH A;  4XUP A;  3WNO A;  3WF2 A;  4CUA A;  1JI6 A;  3T0D A;  4QDQ A;  4A3Z A;  2QQL A;  5CZK A;  3HNB M;  2QQN A;  2DCJ A;  1K42 A;  2WUH A;  4QDR A;  3T2Q A;  2W3J A;  5FUI A;  2JDA A;  2BBA A;  3ACG A;  2W91 A;  3CMG A;  4ARY A;  1SDD B;  4OZO A;  4L0P A;  5I0D A;  3ACI A;  1UYZ A;  3K77 A;  1US3 A;  5DPN A;  1GUI A;  3LPG A;  4D8M A;  1O59 A;  4RYD A;  4CUB A;  1ULP A;  3WQB A;  3WNM A;  1MPX A;  3WF1 A;  1JZ8 A;  3I2J A;  2VOT A;  3PUH A;  2W47 A;  4ZXE A;  3A22 A;  4ZY9 A;  2W5F A;  5C7G A;  2VZO A;  4PQQ A;  3BGA A;  5B4N A;  5JXI A;  1NKG A;  1D7P M;  3DEC A;  4DEQ A;  2J1R A;  5HPO A;  3VD4 A;  4RN5 A;  3A7Q A;  5EJZ B;  3ECQ A;  3IAP A;  1JZ2 A;  3SEP A;  5G04 L;  3HNY M;  4A4A A;  1JU3 A;  3C8X A;  2VZS A;  1T2X A;  1XC6 A;  1J84 A;  3MBW A;  2V5D A;  1K12 A;  1UWW A;  3I2K A;  3LQC A;  1JZ4 A;  2VO5 A;  5C71 A;  4JKM A;  2VCA A;  3VD5 A;  3WNL A;  4KMQ A;  2VME A;  3LEG A;  1W8N A;  4DXT A;  5JMO A;  2VZU A;  3HEI A;  2W1U A;  5IHR A;  2DDU A;  2VMC A;  2W94 A;  1JYX A;  5JXG A;  3I2I A;  1JZ6 A;  4ARX A;  1CX1 A;  3A23 A;  2B4K A;  3E1F 1;  2YG0 A;  4MO3 M;  2ID4 A;  2VZV A;  2Y6G A;  3HOB A;  2RJ2 A;  5G05 L;  1O8S A;  2QQO A;  1XNT A;  4KWU A;  2J1A A;  2EIC A;  1SG3 A;  2E33 A;  2VMF A;  3MO4 A;  4ET7 A;  2WO3 A;  4DUX A;  1UMI A;  1GOG A;  3OEA A;  1NAE A;  4DUV A;  1NX9 A;  3OGS A;  2HLE A;  1UX7 A;  5IFT A;  4D0Q A;  2YC4 A;  2JE8 A;  1UY3 A;  3T2O A;  2WAB A;  4M4P A;  3I3D A;  3LE0 A;  1UY0 A;  3PUI A;  2DCK A;  3F2Z A;  2VZP A;  4CUC A;  4P08 A;  3WF4 A;  1JYW A;  4YPJ A;  2WO2 A;  5DQ0 A;  3DYP A;  1O8P A;  3K4A A;  4BDV B;  3I97 A;  3OBA A;  1DP0 A;  3C7E A;  1GU3 A;  2XQX A;  2J1V A;  4AAX A;  3A21 A;  4XZU G;  2BGP A;  4XUT A;  2WO1 A;  3JXS A;  1PX3 A;  2QQM A;  2RVA A;  1JYV A;  4PT6 A;  1WKY A;  4W50 A;  3I2F A;  4A44 A;  2J7M A;  1KEX A;  1LNS A;  4GWJ A;  4QB6 A;  2VC9 A;  1JU4 A;  2V72 A;  3K75 B;  2VCB A;  2WZ8 A;  3C7F A;  3OEB A;  1PMH X;  2WN2 A;  3T0B A;  4E8C A;  2Y6J A;  1W0N A;  1PMJ X;  2C26 A;  2Y64 A;  3NJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...