4OYUA

Crystal structure of the n-terminal domains of muskelin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
MECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNYPPQYLILKLERPAIVQNITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHKIDEQMFPCRFIKIVPLLSWGPSFNFSIWYVELSGIDDPDIVQPCLNWYSKYREQEAIRLCLKHFRQHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The LisH Motif of Muskelin Is Crucial for Oligomerization and Governs Intracellular Localization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
molecule keywords Muskelin
total genus 47
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4oyuA00
1UYYA 2E31A 2LW8A 2WABA 1GU3A 3WNPA 4A42A 5C71A 4D8MA 4L0PA 2DCJA 4JKLA 2ZXQA 3P1IA 2HLEA 3BGAA 2KD7A 1UZ0A 5DQ0A 3GXUA 4XURA 4QX2A 3MBWA 1JU4A 4ARYA 2W5FA 1NAEA 3I2FA 4OZOA 5LA1A 3I2HA 3NNGA 4QB2A 2W1SA 3OB8A 3CKHA 1JZ4A 2XONA 2BGPA 3MV01 1UY4A 3T0AA 3WNMA 2V5DA 4HG6B 2BBAA 4A41A 3WF2A 1RYYA 1KEXA 1UY1A 3HJRA 3LPGA 2Z4FA 2W1QA 3NJXA 1F4HA 3WF3A 3OGSA 4JX0A 3SKJE 3EB7A 2VO5A 1TG7A 5I0DA 1L7RA 2E33A 4MADA 4XUQA 4BK5A 2JKXA 1W8OA 3DYPA 5LCWL 1OF3A 3MV11 2WUHA 3DYMA 2PQSA 4OMDA 1W8NA 2VMFA 2VR4A 1UXZA 2RVAA 5J1XA 1US2A 2VC9A 3ACIA 2W94A 1CX1A 3I3EA 1PMHX 3MO4A 2QQLA 3HNYM 4W8JA 3CZJA 3T0DA 4PQQA 2EIDA 2WO1A 4BJ0A 2B4KA 2J22A 3OGRA 5C7GA 3LEKA 2WBKA 4QB6A 3C8XA 4BXSV 1HN1A 1W9WA 3WNOA 4ET7A 1W9SA 1OF4A 1SHWB 2LS6A 1SDDB 3ZM8A 5JXGA 5JMOA 2X09A 2VZTA 2XHNA 3A23A 4PT6A 4A3ZA 3IIIA 4DEVA 3UETA 3I2JA 2VOTA 3CDZB 5EJZB 3VD4A 3CZUA 3FHQA 5CYYA 3HPNA 1JI6A 4YPJA 5B4XA 1UY2A 2WAOA 2WZEA 4JKKA 2W95A 1PX4A 4A6OA 2ORZA 1UMIA 2X10A 3LEGA 4DEQA 4QPWA 3I97A 4XZUG 2J1TA 3EYPA 3VD3A 5IYYA 2QQJA 3C7EA 1YQ2A 3ETPA 4CVUA 3OG2A 3HNBM 4QAWA 1JZ3A 2DCKA 4OYUA 4QDRA 2W87A 1K42A 3MUY1 2Y6KA 1PMJX 2ZEYA 1JZ8A 2C26A 1JYWA 4DXTA 2WYSA 3CQOA 2JD9A 4RYDA 3SEEA 4DUXA 2C9KA 2J1EA 2QQNA 5CZKA 1F4AA 3WEZA 1MPXA 3THDA 1ULPA 2VTFA 2YC4A 3WQBA 5C70A 1UY3A 2VZRA 4CU9A 4M4RA 4GWIA 4QX0A 1W0NA 2YG0A 3C7HA 2VCBA 4KMQA 4AAXA 1WCQA 3VDAA 4A4AA 4CU7A 3K77A 1KGYA 3FL7A 3UNPA 3BN6A 4GZ9A 5G05L 4LKSA 4DXRA 2VMCA 3A22A 2YC2A 3WNKA 5JXIA 2R7EB 3FN9A 4RN5A 3K4AA 2V72A 3T0BA 2VQUA 3DYOA 5JUVA 4LPLA 2VMDA 1EUTA 2ORXA 4MOAA 3WF1A 4DUVA 1JZ7A 1CIYA 2QQMA 1JYXA 2VZ1A 4KI5M 2XQXA 4ZY9A 2WQ8A 4DUWA 2J1SA 3SEPA 3VD7A 4TXWA 1GUIA 1GOHA 4BK4A 2VZUA 3LE0A 3HOBA 4CUAA 2WO3A 3OGVA 2W3JA 3WF0A 2W46A 2EICA 3K75B 1XC6A 2J1UA 4ARXA 3UESA 3T08A 2Y6GA 4QX1A 3T2OA 4A44A 4CU6A 1DP0A 2QBXA 4DXSA 4GWJA 3OBAA 3P6BA 1CZSA 2E26A 1NUKA 1P8JA 2YFZA 4E8DA 3JXSA 3C7FA 1CZVA 4P00B 4QB1A 1GNYA 3C7OA 2EIEA 5A1AA 3GDBA 2ZEZA 4P02B 3IB3A 4W50A 2Y6LA 1BHGA 4JHZA 4MO3M 2CDOA 3I2IA 3HNMA 2YB7A 2Y64A 1W9TA 2WAAA 1SG3A 5FUIA 1GQPA 2W9XA 2VZSA 2W1UA 3E1F1 2DDUA 2QQOA 3NQHA 1H6YA 4CU8A 2VCAA 3J7HA 4XUPA 4UOJA 2CDPA 1UMHA 2RV9A 3OEAA 1GOFA 2WN3A 3I2KA 3WSOA 5JXHA 4UI9L 1UY0A 1DLCA 2ZEWA 1NX9A 1I5PA 3I2GA 3VD5A 3C7GA 3ACHA 1UYZA 5DPNA 4M4PA 1JZ5A 1IQDC 3DECA 4QDQA 5LA0A 4XUTA 2L9LA 1NKGA 1OH4A 3T2QA 1O59A 3HEIA 1EUUA 3GM8A 4BDVB 2VL4A 5DMYA 1XPWA 2BERA 1UXXX 3CMGA 2Y6HA 4CUBA 2J1AA 2C4XA 4Z2AA 1US3A 3D3AA 3K46A 4TTGA 2YFUA 3WF4A 2Y8KA 1D7PM 2W92A 4QDSA 2J1RA 4XUOA 2BGOA 1T2XA 1UWWA 2VZVA 4LHSA 2VJXA 3WNNA 4QX3A 3VD9A 2VZQA 1UYXA 5HXMA 1W99A 3MUZ1 5DN2A 1PX3A 5IJRA 3SKVA 5JXJA 4XUNA 1K12A 3A21A 1WKYA 1TVGA 2J1VA 3OEBA 5EJ1B 2RJ2A 5IFTA 3AC0A 3W5NA 2WZ8A 2ZEXA 4ZZ5A 3IAQA 3FHAA 3VDBA 3CIHA 1L7QA 3I3DA 3NRUA 3LQCA 4W4ZA 5EIYB 5B4NA 4ZZ8A 3WNLA 2E32A 2VMEA 4ZXEA 4E8CA 1GOGA 1DYOA 1LNSA 2J7MA 1JZ6A 1XNAA 1GMMA 2VZPA 2JE8A 3U37A 2XOMA 4FI9A 1K45A 5JR2A 3T09A 3F2ZA 3PUIA 3LPFA 5F7UA 2WO2A 2V4VA 4OUEA 2WDBA 4MGQA 4PF1A 2VCCA 3THCA 1JHJA 4CUCA 1JZ2A 4P08A 5IFPA 1JYNA 2QQIA 3ECQA 2W91A 4XVHA 1JYVA 4OMCA 4P5YA 2B9VA 3LEIA 4AG4A 2BZDA 2X05A 3NJVA 1ULOA 2WN2A 5HPOA 1OD3A 4D0QA 3VDCA 1R64A 1O8PA 2VQTA 2W47A 1H6XA 3ACGA 4KWUA 3HN3A 3I3BA 4MGSA 5G04L 1CZTA 3GGLA 2W1WA 1J83A 2EIBA 1XNTA 1J84A 1O8SA 3ACFA 3PUHA 2VZ3A 3IDAA 3W5MA 4JKMA 3T2PA 3ABZA 1OT5A 2Y6JA 2HYXA 2VZOA 5IHRA 4UAPA 1JU3A 2VM9A 3IAPA 4A45A 4LQRA 2QQKA 3A7QA 4IUGA 2ID4A 3K4DA 2OKXA 5LA2A 1UX7A 1K3IA 2JDAA 3K4ZA
chains in the Genus database with same CATH superfamily
5E8AA 1GU3A 4A42A 2GSYA 2UY9A 2YGLA 4R8HA 3RWNA 4JKLA 1A78A 3DXTA 4GH4C 2VAUA 2HLEA 2LM3A 1JU4A 1WW5A 2P6CA 3CJIB 2VQ0A 1W8UA 1C8M3 1GP5A 1NAEA 4NWVA 1K5JA 2A5ZA 4QQ2A 4ZONA 5BXXA 1MVQA 5T55A 2IVJA 3CKHA 4LHLA 3UKTA 4CEYA 4YW4A 1M06G 3VDDA 1PO22 1CAUB 3O1VA 4HPKB 3MV01 4XF9A 1CAWA 4KQ7A 3U1XA 5FZ3A 4EWEA 4YM3A 1RHI3 3E5UA 1DFQA 3WNMA 2V5DA 4QKBA 2ZGOA 2BBAA 4A41A 1G9CA 1VAVA 3FMGA 3H3ZA 3OCPA 2QKDA 4XXAA 5FZBA 1AR81 5A3MA 1DGWA 5FYMA 4BISA 2W1QA 1HV1A 1ULGA 3NJXA 3RZJA 1O4YA 3LB9A 3WG2A 1CGPA 3SKJE 1A3KA 4AFCA 2UYAA 2VO5A 3EB7A 3LIGA 2DUQA 3OPTA 4XQDA 4I3PA 3WY6A 4BMEA 5C5UA 2F6BA 4MADA 2JWPA 1K5MA 2JKXA 4LHNA 1W8OA 4AGGA 3VKMA 1XSQA 2FMDA 2XWJB 1H9WA 5FXXA 2WUHA 2ZAAA 1KDKA 4OMDA 1HRV2 1PVC3 1F15A 2R043 1XU2A 4C1XA 3PJYA 1F2NA 2RS51 1V00A 2VR4A 1G9FA 4K6BA 5F8PA 3POSA 3VKFC 5FO8B 1RUD3 4WM8C 1ZREA 2VNGA 3PLQA 1US2A 5FZCA 3OTFA 4EWAA 1W2AX 3O1RA 3Q8BA 2DF7A 3J7MA 1XU1A 5D21A 1WLCA 4Z2WA 5I8YA 1XQNA 2ZGMA 4AI1A 1Y7BA 3HMYA 1LOGA 5C3RA 3MO4A 1IPJA 1XRUA 2HBUA 3NKGA 3D0SA 1JMUB 5GALA 3T0DA 1OBNA 3AMQA 4J25A 2TNFA 2GZWA 3MI8A 1A34A 3DGTA 4Q8KA 1Y9MA 2EIDA 3TN93 1MZ6A 4Y33A 5E89A 4MHUA 4NO4A 1W9FA 4IDZA 1AF9A 4CEWC 5J37A 1FXZA 2B4KA 3T1MA 1PGSA 2XG3A 3OGRA 3J8F2 5F3GA 5C7GA 2XGXA 4OUSA 3JD72 5LWBA 1WBFA 2HWB3 2VTXA 3AX4A 1W6PA 4FT8A 4HK8A 4FPJA 3ZKUA 1Q8VA 1W9WA 1IS3A 4QGLA 3TN91 1LOCA 2LS6A 4PQ9A 2NZ9A 5FMBA 2LROA 4NIDA 4WVVA 2UWBA 2HH9A 3AMMA 5K7PA 2HYKA 4YVWC 2OS2A 1DHKB 1YFXA 3CLPA 1VBC2 4XCBA 3S5QA 1QJFA 5FPAA 3O1UA 3VBUA 1UPSA 3PVOA 2LRPA 3AZWA 4PBOA 4ZU5A 4HBNA 1AYM1 3MW3A 3UETA 3ZFGB 4CP2A 1QJZA 4GIQA 3CDZB 1ZYBA 1OLQA 3VD4A 1UX6A 5CYYA 2ENRA 4XF4A 1JI6A 1YO8A 4Q26A 5C9AA 5FWEA 2PLV3 1W6MB 4QGNA 4HZFA 1HV0A 1Y3TA 3AVSA 5B4XA 1IKPA 4N9IA 1UY2A 2WZEA 3JBG2 5D2AA 1D2QA 4AVVA 4ZHNA 3V65A 3UGGA 4XABA 5EV7A 1NCQC 2ILMA 3W9AA 1XJAA 2E6VA 3GZAA 3HAGA 4OI0A 4AHXA 2WFF2 2DTWA 2YY1A 3ZXFA 1G9AA 2J1TA 4RL7A 3VD3A 4CXWA 5JSPA 1MACA 2D93A 3C7EA 5CFDA 2JG8B 3E6BA 2BEOA 5IYYA 5A7QA 3POIA 1G9BA 2ZGKA 3KCYA 1YQ5A 5FYYA 4CCKA 1N1TA 5A3UA 3HNBM 3AJZA 2GN7A 1WCUA 2CU5A 4QDRA 3RI9A 1WA6X 2VBPA 2W87A 3J26N 3IPVB 4EROA 1W39A 2Y6KA 3MUY1 1PMJX 3MICA 3D5OA 1PNGA 3ZFGC 5FZOA 1JYWA 4CDQA 3QLQA 1F5FA 3BTXA 4COYA 3T4VA 1RMU3 2HWF1 3TWIA 2WYSA 4YG0A 1TQ5A 2H6BA 1OLME 1LHOA 4RYDA 4K8RB 3K48A 4A7YA 1AX0A 1QXPA 4DIQA 4COWA 1DGWX 5CZKA 4I01A 5FMOS 4JRLA 4FFIA 1GBGA 3AYEA 3UV9A 5GZFA 4DY3A 3AYDA 4LITA 5H9PA 3WEZA 3THDA 1ULPA 3HQUA 1W6NA 3V0AA 1YIFA 2BQPA 1UY3A 3WQBA 1YQ8A 1OOPB 1D2SA 5FOBB 1BEV1 1J1TA 4QX0A 3O1MA 4WZCA 1I5ZA 1AJOA 4AAXA 1EY2A 1VBA1 2XDVA 2QNKA 1XBFA 2GP5A 3ITQA 2OUJA 5FTTC 5CG9A 1AYN1 1ZBE1 4GB31 2F17A 3PU3A 2JXAA 1BBT1 4CTEA 1G8WA 1LESA 4P9LA 1C28A 4QHBA 5C6CA 1ZZ8A 2CNAA 4S2FA 2OIIA 5LBBA 4EV0A 1AL23 2A6VA 2P4EA 2RDNA 4FPLA 5HCBA 3ZN4A 5GLTA 5A1LA 3DYOA 4NN0A 2JG9B 4LPLA 5FUNA 2A6YA 1C1LA 4UYBA 3T4HB 3ZSKA 4MOAA 4F83A 1JZ7A 1CIYA 4RD7A 5EFUA 1VP6A 2HWD3 1YCIA 3BALA 3THTA 3PVNA 2QQMA 5FYIA 2AGSA 3PU8A 3KT1A 4TLGA 3UKVA 4HSLA 4Z92B 1DDLA 1TMF3 1QJY3 3ETQA 2RS11 3M7AA 4V2VA 2OPWA 4LBLA 2VW0A 2NMNA 5JLVA 2J1SA 2PYTA 2XH6A 3WCRA 1N1VA 3VD7A 4A2UA 3SMHA 2JDNA 4QQLA 2VZUA 3FX3A 4HONA 1XNKA 2PXJA 3LE0A 2GNMA 3OPWA 5BNPB 3HOBA 2OYZA 4LLOA 1BYHA 3OGVA 5FUPA 2YBSA 1GZ9A 5BNOA 2W46A 2JG8C 1D4M3 5C33A 3W58A 2E7TA 2J1UA 1N3OA 4COVA 1RINA 1XYNA 2ZX1A 2Y6GA 3H7JA 5EJ3A 3RRDA 5F3CA 1XNCA 2RS12 3O1PA 3BI3A 5H9QA 4YW7A 1REFA 4AHYA 5HCAA 5DUWA 2XBO1 2W68A 1O5LA 1YFUA 4ITCA 3WW3A 4MXWB 4BOWA 2QBXA 2UURA 4GH4B 4CCDA 4DXSA 4CU6A 2XB6C 3D4KA 4GWJA 4XFHA 1RUNA 4Y20B 3OBAA 3P6BA 5BUVA 2ZHLA 1NUKA 3O0WA 4LNVA 2Z5WA 5DUXA 5F2WA 3ST7A 3VBSA 1J59A 3JQXA 2D6KA 4Q4V2 4I0WB 4QPYA 3ASIA 4XHBA 1BBT3 1CZVA 1HRV1 3ATGA 4P00B 1Z7S2 4S2GA 4YVWA 2D3RA 1MS4A 3I2DA 3RVHA 4Z8BA 3QBQA 2Q8EA 1SDWA 2OVUA 3AM2A 1SBDA 1POV3 2ZEZA 3V0BA 4P02B 5ACA1 3N7MA 1RUF1 2ZABA 4K20A 1TME2 1BJQA 3OYWB 4X8NA 5JR7B 2YGMA 3NV3A 1AR62 5A6YA 4WM7C 2Y64A 3AKSA 5FUIA 1GQPA 5LATA 1SCSA 2W9XA 2VZSA 4N53A 4B4QA 2AZ5A 2W1UA 4INDA 1QIQA 3E1F1 1PNFA 2QQOA 3NQHA 3NO8A 4L9BA 4OUMA 1H6YA 1R092 1MS3A 2Q4SA 2XJUA 4MV2A 2YBKA 4QM8A 1S0FA 1IPSA 1H8TA 1WZXA 4XJZA 4LKFA 4RFT0 3LWCA 5FCCA 4L99A 4YZ2A 3H1WA 5DDJ3 4AZZA 1YWKA 3WG4A 2ZEWA 3CF6E 1NX9A 2G9FA 2GC3A 5JDBA 2IVIB 1I5PA 3O0XA 2D6PA 2CL2A 4KWKA 1EAH2 3C7GA 1UYZA 3W21A 4IEZA 1RUI2 3DECA 4DRRA 1W04A 2RMU3 5LA0A 3ELNA 4WM8B 1YYNA 1H9PA 4YM1A 4M3CB 4F7ZA 2SLIA 4B7KA 4IEYA 5D8AB 2BFUL 2WWJA 3OGGA 5F2SA 4B4RA 2YYOA 3OJBA 3U14A 3NJYA 1NCQA 2DTYA 1S0JA 2MEV3 3HEIA 3IT8A 4MGKE 3SC7X 2WKKA 4N43A 3WP6A 4DY5A 2CAUA 3B69A 1XPWA 4Q0VA 1E5HA 5D8AA 1ASJ2 4MLOA 5FWJA 2J1AA 5L73A 1ZBA3 1JZ3A 4FPYA 3PVEA 5LBFA 5LBEA 1LAJA 1GWKA 2R062 2YFUA 2C5DA 5CU1A 2R073 1NQJA 1SPPA 2RR12 3MPBA 1GKBA 1BVP1 1DG6A 5A7SA 4AGVA 5AFEA 3O7OA 5A7WA 1ONAA 2DURA 1MVEA 1STMA 4W65A 1C8M1 2RS52 3WNNA 3PMSA 2NN8A 1SFPA 2DVGA 3HWJA 3NL1A 5DZGA 1WW4A 3M3QA 1D0HA 3M2MA 5HXMA 5A33A 3WHUA 3OUJA 2ARBA 3LSEA 3VZKA 5KHGA 1JXNA 5DN2A 1PX3A 3AKPA 4I02A 1VBD1 5F39A 4QGMA 1GICA 3MIFA 3POFA 4XUNA 1K12A 3A21A 2QQWA 5CAZA 4WV8A 3AK0A 1MEC2 2C1FA 3N9LA 5EHDA 1CAXB 3O12A 5C8CA 3H8XA 4N53B 3MLLA 3V64A 4COUA 3S7IA 2ZGUA 3KHCA 3KQ4B 1ULEA 1VBD3 1L7QA 4UF0B 1DLLA 3RS6A 5F1RA 5J7MA 3NRUA 3LQCA 4LO4B 2IXIA 4R4ZA 1SEFA 2XJTA 5FPUA 4H7MA 3ZYGA 3I4IA 3V0BB 4ZZ8A 5FZDA 3K3NA 3BOWA 3BIWE 1GOGA 3FE5A 4CP9A 1LNSA 1W03A 4KU7A 1XNAA 3CJXA 1FMD1 3DKWA 2A75A 2PFWA 1BK1A 2VBDA 4OI4A 1H2LA 3CL1A 2VE1A 5F32A 1AL0G 2FD8A 4DPNA 5KR7A 3DPRB 2PHRA 3OD0A 4BQWA 5FZIA 3F95A 4FI9A 1N47A 1CPMA 3LIHA 5JAXA 1LENA 3C2UA 5CISA 3RGBA 1V0AA 3T09A 2ZX2A 3PUIA 5F7UA 2V4VA 4OUEA 4NRPA 4MGQA 4X6QB 3ZN6B 3MEPA 4EN7B 3AKTA 1RUI1 2VCCA 2NPIA 1JHJA 2AYHA 4HVRA 4IE6A 2H6CA 3AKQA 4IV1B 2K0GA 5FAXA 1JTZX 1XB9A 3SXWA 2ZMKA 1BBT2 4LO8A 4RQPA 3R6SA 5GZCA 5FYHA 4AQ2A 1O3RA 1WCSA 4AVTA 2QQIA 3ZOIA 4AEDA 4B7EA 2PHXA 4IE4A 3ECQA 4CPBD 4RHV3 4XVHA 5DZFA 3MIBA 1O7FA 1YXWA 2JICA 1WCDJ 1BMV1 3AP6A 4Q0UA 4EJRA 2IZWA 2WNUC 3KVAA 2VD7A 5EYYA 4YW6A 5IT6A 3NAPC 2XJQA 3NJVA 4DNYA 2ZKLA 4XF1A 3RMYA 3AZXA 4CDWB 1HXS2 4HK9A 4JC1A 5ABJB 5CEHA 1AYM2 4GMP0 5JZGA 4XC9A 5L9BA 3U0ZA 1ND2C 1GZWB 1H6XA 3MIEA 1UAIA 4KWUA 3HN3A 3ACLA 4R9AA 2OUHA 5FREA 4YYOA 1T6BX 1WW6A 4AL9A 5ACA3 3JB8A 3JBG1 1UQXA 4PLMA 4QKDA 4YZ1A 2B9UA 5HV4A 1CZTA 1NYWA 2W1WA 1J83A 2EIBA 4OVEA 1XNTA 1SACA 4BMBA 4DMIA 1FPN2 3KCXA 4W6YA 4N53C 2ATFA 2XLAA 1W9YA 4BHPA 2JJ6A 2IWGB 4CP9B 1QQP2 5GZDA 3IDAA 1VJ2A 1SLTA 3T2PA 3LA7A 3RWKX 3ABZA 4FAHA 4FPEA 1XE7A 4YFZA 2HYXA 1OLRA 4AI9A 1LR5A 4Y26A 2CGOA 5AFBA 2WRAA 4FQ4A 4A45A 1H1MA 5KXBA 2DVAA 4GWNA 3B94A 5JWPA 3VKNA 2ID4A 2WS92 2OKXA 3ZSLA 3MFAA 4XJUA 2ZACA 2LUWA 1OPMA 1U12A 4LA2A 4QQPA 3JD71 2GN3A 2WC2A 2DU0A 5ANQA 3PUQA 3N7JA 1W6NB 2E31A 1PVC1 1J58A 2LW8A 3I54A 2LALA 3K2OA 4UFIA 4Y5SA 5ERLA 3H50A 2EAAA 3AMHA 3HR9A 4L0PA 4D8MA 4LT5A 2P2KA 3P1IA 5FYBA 2WYFA 3ZXKA 4IE0A 1RUD1 4O9GA 3USUB 3OGJA 2EALA 4YVSB 5CADA 4QX2A 1VLNA 5KXCA 2ARAA 2XHKA 2NLRA 2CAVA 4DO0A 3LOBA 4UW5A 5LA1A 4LHKA 5F3IA 5D8AC 1RB8G 2I2SA 2WINB 5IVFA 2W1SA 3DV8A 3LA3A 3A0NA 2XONA 1B35B 3KQRA 3OY8B 2D6LX 4I30A 2D5FA 4XBNA 2WLQA 3BTZA 4E27A 1VBA2 4NHLA 1D0GA 4JRAA 3IDEA 2HWE1 1UMZA 1OVSA 1LU2A 4QX5A 1YFYA 1RYYA 1GR3A 1KEXA 3N9QA 4AVSA 1UY1A 1IS6A 2PHUA 2VVEA 4UBGA 3USSA 5FK7A 4CSWA 2G9GA 1RL3A 2GP3A 2Z4FA 4M0HA 5FY9A 1RC6A 1HDKA 3V56A 3R4SA 1N1YA 3WF3A 4A6SA 5HCHA 3MZHA 4BM8A 2BDRA 3OGSA 4GALA 2PAMA 2VNOA 2VU9A 4YVSA 4AI2A 3R05A 4N43C 4JDOA 4XUQA 5BNNA 4AFDA 4HKLA 4RGAA 3ZSMA 1QDCA 3AJYA 1H4HA 1LEMA 4A3XA 5J36A 1POV1 1W6MA 5LCWL 5A3PA 4XOGA 1O3TA 2BWAA 3DYMA 2WR9A 1YJLA 4I3GA 3SCHA 4DXZA 1QGLA 1W8NA 4GQ7A 3UT0A 2FZ1A 4E9KA 4MGIE 2AACA 1POQA 2FDHA 2VMFA 2PQQA 4IGOA 4UFKA 4FQZA 3AYAA 1UXZA 1W3VA 3NKTA 5IK8A 3ACIA 2W94A 4L11A 2Y26A 3ZFFA 3I3EA 3BPZA 5SV8A 5GLZA 1PMHX 4D6QA 4YARA 1BZWA 1C5IA 2TUNA 3ORJA 2FCTA 4LIVA 3MLJA 5FYTA 3CZJA 2FMYA 2RR13 4FOVA 4LKDA 4XZPA 4LMFA 1RUF2 2R063 1ZA7A 4WVWA 3WG1A 1W8HA 3MW4A 4NAMA 4BJ0A 3GZTB 1E5RA 2B5HA 4QB6A 3C8XA 5HCFA 3SITA 4BCUA 2R49A 3HVDA 3VLBB 1HN1A 1VMJA 4ET7A 1U5XA 2HWF3 1LJ7A 2Y33A 4IE5A 3G6JB 5JZGB 5BNPC 5JXGA 2R042 2BP6A 3WLUA 2E7QA 1V6KA 1AX1A 2X09A 1NCRC 4FP3A 4PI0A 3WW4A 4CDWA 2GC0A 5F3EA 1LKNA 3VBOA 4CCOA 4HXCA 3EQEA 4XJAA 5GLVA 1LU1A 4LXLA 3NAPA 4OQ9A 2KM2A 1YRZA 4MH0E 3N4MA 1EPZA 4XHXA 1GNHA 1VMFA 1JOPA 5EJZB 1MZFA 3CZUA 3FHQA 2RDRA 1C5HA 1Q8OA 3HPNA 3LDRA 4YPJA 3TEZA 3IWZA 3NWKA 3ON7A 1JS9A 1UIKA 3PUAA 1QXRA 5CBLA 2JG9C 4RGGA 1VBC3 1X7NA 2ZGPA 4Q8LA 4I0AA 4A6OA 5KHIA 1NQDA 2XUEA 3GYDA 1R093 4IV1A 1ULFA 2JB8A 2YU1A 4K8FA 4Y3OA 4YGDA 4CCCA 1TMF1 4DEQA 2Y6FA 3M3EA 1VRH2 4BYYA 1LOAA 1OMIA 2ZKNA 1OHFA 1COV1 2ZTNA 1AR92 3Q8FA 2HWB2 1YI7A 2Z42A 4TSVA 2VPVA 2JDKA 5B2GB 4CVUA 4BQ2A 1WLWA 5DUVA 4UFJA 1K42A 1YC61 1PGL1 1CAUA 4RR3A 2LTNA 4DXTA 3QH6A 4TWTA 1R1A3 1ZRRA 1OA2A 1RUH1 2ZOEB 4FFHA 3KCCA 4LE3A 5FJHA 4Y1VA 1REEA 3LDKA 1RVF1 2JD9A 1A8MA 1G86A 3ZFFB 3CJIA 2DYCA 4O61A 4UF0A 5KHHA 3SEEA 2J1EA 1H4GA 2VUDA 4MX3A 3ZIXA 3KLSA 4AYUA 4XFGA 4NHYA 5I93A 4YSFA 1MPXA 4AGRA 1CPNA 2VTXJ 2YC4A 4YLZA 4CZSA 2ZGRA 3ZMOA 3OBTA 5T3NA 4D7SA 5A6XA 5C70A 5J48A 3RZHA 1LHVA 2BOIA 3S7EA 3AZYA 4CU9A 5C4WB 1V9U1 1FOD2 2X5IB 3JU9A 3UKNA 1W28A 2OXBA 3BU7A 2XQRA 3UYJA 1DZQA 3MFCA 5J3UA 3V0AB 5I8SA 1Z7S1 2GALA 5LB6A 5J98B 1DGRN 3TN92 5K0UA 1WCQA 1ZRIA 1RUF3 2HEWF 1QOSA 1WD4A 1EYBA 3NV2A 4FSJA 3CO2A 1LOFC 4A4AA 3IMNA 4CU7A 2VCMA 3K77A 1RTVA 1KGYA 4L92A 1X36A 5ABJC 2PHLA 4PJYA 3BN6A 5FZ6A 4XFFA 3TEWA 1RJ8A 5G05L 1APNA 1J3RA 5FIXA 2D7FA 1VBC1 3A22A 2WSUA 1O3QA 1HXS3 4R9BA 2YC2A 1Y9QA 4RS5A 4DOUA 3FN9A 3POBA 4RN5A 1NCQB 3HBZA 3K4AA 3P3PA 3RI8A 5A6QA 2V72A 1R081 5GLWA 1Q8PA 2VQUA 2ARCA 2Q1MA 4H7LA 5FZ8A 5JUVA 4LBOA 2XPJA 3RDIA 1A8DA 2JG8A 4HANA 4M3CA 2VMDA 1ZRCA 2QFEA 3FLRA 4DUVA 4HKWA 4GAZA 3BYWA 1HXS1 5IAVA 4UFMA 1CJPA 2IXJA 1SBFA 4KI5M 2ZGLA 1R083 2XQXA 3R0RA 2XR4A 4ISQA 4ZY9A 3USUA 5BY5A 3MF9A 4HVOA 5CFCC 1ST8A 1RUG1 1GQGA 4Q4W2 2XLGA 3LFIA 4TXWA 1RMU2 3POEA 4IL7A 1GUIA 1GOHA 2D3SA 3WNXA 4BK4A 2AC1A 2EAKA 5CB7A 5F6KA 3FC0A 3U78A 1H8TB 4XFAA 5C4WA 4CCJA 4CUAA 1XXNA 2W3JA 3Q8CA 5A3OA 5T52A 1WWYA 3M3OA 4E4DX 1PO23 4MHRA 4AOCA 2EXIA 2YXSA 2JDUA 3PTYA 3PTRB 2Y60A 2JIGA 3T08A 4FP2A 4FAGA 1X9PA 4UW4A 1HKDA 2JE9A 3HT1A 5FYSA 2WLPA 3LF7A 4CEWB 3OYWA 4QU2A 4E2QA 3T2OA 2OZJA 4AI3A 4NIIA 1DP0A 3VBUC 5KWRA 4JTOA 1KXGA 4FXGB 5GM0A 3JBG3 1CZSA 3RYPA 4YGBA 3N36A 3T3YA 4OHZA 2YFZA 4JGZB 3SCFA 5AC92 1CESA 1S2EA 4IEPA 5IVJA 1YIPA 2UY8A 3C7OA 5FMDA 1NXD1 2WL1A 2ZX0A 3G7DA 1RXGA 4FTSA 2BVBA 3FBMA 4XJ9A 4CEYC 2B46X 1OSGA 2VW2A 3IB3A 4LORA 1VBA3 2TEPA 2Y6LA 3SH4A 1X82A 2JDZA 4JHZA 2DUOA 2DBIA 2ZZQA 3I2IA 1WD3A 2IXKA 3J7NA 5BPXA 3GCWA 1S0BA 2PAEA 3EO6A 3AKRA 1SG3A 3N9MA 5A7NA 5L7OB 3WQ0A 1HQNA 3S30A 4CP1A 5FZ9A 1PIV2 5FPVA 1OUSA 4CU8A 2ZJCA 3J7HA 1YNAA 3TEXA 1UYPA 4YM0A 3BPSA 3B3QE 4IV3A 3KV4A 2XMLA 3ES4A 1AXYA 2WN3A 2XUMA 1QHDA 4UI9L 3AXDA 5FP7A 5SV5A 1Q5OA 4CPBA 1K5MB 1DLCA 2VNRA 4UXAA 2VY0A 1GZTA 4N90A 1ND3A 4GJYA 4CDQB 2DVFA 5FO9B 2HWC3 2ZGTA 4QPIA 4TN7A 4M4PA 1IQDC 3E5XA 3QCWA 2X8KA 4QDQA 4AR2A 1EV13 4B1MA 5C8WA 2JG9A 3ZYPA 5FY5A 3ZO0B 4XPVA 2W39A 3B5LB 4BQ5A 1N3QA 1VRH3 1OH4A 2ES3A 1O6UA 3OF1A 4HFSA 4JGZA 1EUUA 2PELA 4HPKA 1QNWA 1QMJA 4Q4X1 5DMYA 3VDDB 3I49A 1UXXX 1OQ1A 3CMGA 1VBB3 2Y6HA 4JQRA 1AR73 3ZXLA 1H2NA 4CUBA 5KHJA 3PHMA 1F9KA 1NXMA 5C8CC 3K46A 4N8MA 5IW0A 4IXLA 2MEV2 2N7GA 4JGYB 4QDSA 4EE2A 2J1RA 4CEWA 3VBHC 3ZLIA 2C0ZA 2R6QA 3UJOA 1UWWA 2PLV1 2WA3A 2VZVA 4BH9A 4RR3C 1IQAA 2VZQA 1W05A 2QQVA 4NHXA 4ZPIA 1RUC3 3NV4A 1RXFA 3IMMA 3OBZA 4G9SB 5A3LA 5K9YA 2JDHA 4Z07A 5C3SA 4QXKA 5IJRA 1ENSA 1RUJ2 4UW6A 5A3WA 5JXJA 4ZXKA 2GNDA 3CU7A 1J1LA 5FKBA 3UL2A 3MIDA 1V6MA 3OEBA 5EJ1B 3GZEA 2K2SA 1A6CA 3RMXA 3ZN5A 2XWBB 4K1YA 5BNNB 3KV5A 4LBJA 4ZZ5A 3KB5A 1AR61 3WDXA 4RHV2 4IESA 2ZX4A 4AVAA 3CIHA 1TME1 3I3DA 2ERFA 2R041 1UD1A 4OFGA 2ZA9A 5B4NA 2PMWB 2E32A 1RUE2 2C9AA 2OT7A 5T54A 1DYOA 2J7MA 1JW6A 1W06A 3GJBA 1AR63 4YW2A 5GZEA 1OI6A 1TME3 2GC1A 2O8OA 1GLHA 1W8ZA 3O1SA 2YDEA 1H0BA 2GMEA 3HQXA 3POWA 4QPGC 3ZIWA 1JHNA 3OY8A 4SBVA 2XOMA 5FBZA 3S5AA 3WHTA 1C1FA 1VALA 4IEVA 1H1AA 3PUSA 4CDXC 1E5SA 2HWD1 4PF1A 4JCKA 3MDPA 5FLJA 3THCA 3QH7A 4BQ1A 4COZA 4YGCA 2V4AA 2R16A 3AMPA 4Z1VA 1DQ4A 5LY2A 4D69A 5K0UB 1U5YA 1WMFA 3KWVA 4IGQA 5IFPA 3H1YA 1BLZA 4CUGA 1HB3A 1IS5A 3QD6A 2WNEA 4EN6B 1GNZA 4MGTA 1SFYA 1CVNA 4OZXA 4MZUA 4PLOA 4CDUB 5IVYA 4P5YA 2VVFA 1AR82 3E97A 3LEIA 5J09A 2XJVA 2ZGQA 3ZXEA 1MS8A 3IDCB 2BZDA 3AP7A 1V70A 5FZ0A 3KHBA 1WLDA 4DQAA 1OD3A 3GF6A 5APAA 2WWUA 1GWLA 2E7AA 4R4XA 2XL9A 4P9WA 5HI0A 2RS32 1R64A 1BKZA 2HJIA 2W47A 2A70A 3THPA 4B29A 4AW7A 4BWOA 2JD4A 3C3VA 1ZNPA 4XTPA 2VULA 2DVBA 3B9IA 2WT2A 4RR3B 2D98A 2W52A 1KQRA 2BW8A 1VPHA 2VUAA 1IOAA 1I9RA 1NE4A 2HEYF 2Q1FA 5FY1A 4O65A 2DV9A 5H9RA 5LASA 3ACFA 4PDWC 3OSDA 3VHOA 2VZ3A 3FHIB 4NE9A 2RM21 2WSVA 4X6RB 1QU0A 4NRMA 3RZLA 1UIJA 4IQPA 3MW2A 3SQOA 2VMHA 1NLQA 2VZOA 3GHMA 4EZ4A 4UAPA 5FYCA 3U10A 5FO7B 2VM9A 3J8F1 4FFGA 5FPBA 5BNOB 5F5QA 3ILFA 3FFQA 4BLIA 5FXZA 5L19A 2BVVA 4C8DA 5I0SA 1Q3EA 1T6GC 4IV3B 4JV4A 4QXHA 1GSLA 1HQLA 4CDQC 4Y4RA 3BIEA 2EXJA 3LEMA 3APBA 3K4ZA 3ZFEB 1CONA 3KD4A 3KT7A 1KITA 3PMEA 2DCJA 1K5MC 2AENA 1JUHA 4RQPB 5JPNB 1PK6B 1NG0A 1DGRA 1QF3A 2QCSB 3H1MA 5DQ0A 3GXUA 4XURA 3M70A 3J9SA 3MBWA 4P9XA 4ARYA 3WUDA 4QX7A 4GMP3 3I2FA 2A3YA 4OZOA 1BEV2 1UU6A 1AXZA 1LGNA 1PIV1 1UZYA 3FWEA 3NNMA 2W0XA 4FO9A 4QB2A 4RFRB 4FTEA 3RYRA 2YHJA 3ZYHA 3PL0A 3OB8A 3QACA 1JZ4A 3VKLA 1OKOA 3DPRA 4AQSA 2CTVA 5T5JA 4E4HA 3BU0A 5IVBA 5CG8A 1LCLA 1UY4A 3T0AA 1DQ6A 2D6NA 2QTWB 3ZXJA 2GMMA 4HG6B 4D7YA 4QM9A 4MG2A 4EN8B 4CYDA 3WF2A 4CEYB 1V6LA 1SLCA 1SLBA 3HJRA 3LPGA 1MQTC 2FDJA 1KS5A 5CKQA 1VMHA 1OVPA 1RUC1 4M0NA 4QXBA 2VMGA 1YJKA 1F4HA 1B09A 2D3PA 2NQYA 3P5BA 1RHI1 5LK7B 3VZOA 1SQ4A 1L7RA 2IC1A 1AR72 3J7LA 4QHOA 4S2DA 4GJZA 5FMCA 4XIOA 2A73B 3VN4A 2FDIA 3H7YA 3Q9OA 3SLIA 4Q1RA 3FLPA 2JEMA 2WIIB 2YUEA 3KMHA 3WW2A 1ASJ1 2RS33 3MV11 2PQSA 3JQWA 2JKBA 5C3QA 4LBKA 4P9GA 2CGNA 3O0VA 5CKNA 3H8RA 4I09A 4ASLA 5DUUA 1W8FA 1W6OA 4XBLA 1H8VA 3VBRB 5LZ6A 1RUC2 2VOWA 4U36A 5EWSA 4KWJA 4BQ4A 4NIHA 1AL22 3H3LA 1RVF3 3L2HA 4M01A 4WZFA 3AVRA 1PO13 3L2YA 2KXLA 4NJ4A 4AVCA 2MEV1 1H8TC 4Y1YA 1PHMA 3ZXGA 4FBFA 3N9NA 3ES1A 1H1IA 1MS0A 4MUVA 5T5PA 3VBOC 4AAPA 1AJKA 4W8JA 1WMDA 4FOQA 5DABA 4PQQA 1IZ3A 4AFBA 4ASKA 4OHVA 2FCVA 2FZ2A 4AEDC 3LKJA 1XNBA 4J6GA 2VXJA 3PDQA 2J22A 2O1QA 2BNNA 3FFZA 2W2IA 4KGQA 1HQWA 2O14A 2WBKA 4RS5B 5FPXA 4WVMB 4AHZA 3U11A 4FPGA 3KGLA 2ETEA 2D5HA 1Q56A 4HN0A 1R1A1 3QOPA 4PIXA 1DZRA 1HN0A 1OH3A 5EPAA 3ZDSA 2B8MA 4Y1ZA 5IAXA 1JYTA 4XDOA 4D7TA 1SDDB 3BB6A 4Y22B 3ZM8A 2X53S 2XHNA 4YM2A 5C3PA 4CCEA 1XE8A 3U4XA 4A3ZA 3WX5A 3IIIA 4DEVA 3M4FA 2D6OX 1UKRA 1QDOA 2ADEA 2VOTA 4HL0A 4AEMA 3OOXA 5C9AB 4MGZE 1O5UA 4Y5Z0 1QJY2 4Q1PA 5JMCA 1O3SA 5LRSA 2QDNA 2YPJA 4KBBA 2DUPA 2PHFA 3KM5A 4XJ8A 1UNBA 3LSDA 3VHPA 1AR93 1HW5A 3R4UA 2WNOA 2EIGA 4BQYA 1IG0A 1Z78A 2EXHA 5LEKA 1QJX3 4NOTA 5KC6A 1PX4A 3ZR6A 2QZ2A 2ZAHA 2ORZA 3R4DB 2R1DA 2X10A 2X5IC 3AP9A 4QPWA 2A6XA 1Y4WA 5IVVA 2D40A 4LULA 4JGYA 3I97A 4ORFA 4XACA 4BIOA 3O1TA 2DFBA 1IS4A 2QQJA 2RR11 4DB5A 1FATA 5GLUA 1NT0A 2ET1A 4GKYA 1S0EA 1YQ2A 2R061 3ETPA 1VB2A 4OI2A 3OG2A 4QAWA 3SH5A 1EAH1 1JODA 1M4WA 1RUI3 2DCKA 2GH2A 2WWSA 4PLNA 3VKOA 1BK0A 4BQXA 3ZFFC 2DCYA 2GMPA 3NNLA 1H2KA 3VBSB 2QQPA 2OQ7A 1TMF2 2XXZA 1OA3A 3BUCA 1WMXA 2RJLA 4ZKTB 4MXWA 3WQ7A 1DU3D 2F4PA 1HRI2 3CQOA 4JQTA 4IW3A 1LOFA 3W20A 4QPIB 4BE3A 1ZRFA 5AVAA 3KZ4C 3WCSA 4DUXA 1CD3G 2QQNA 1ND3B 5M0TA 1URXA 2CYFA 2VOXA 2HWB1 1WMEA 5BV6A 3IZOA 4K9SA 2K46A 4BIFA 1OC1A 1F4AA 4PIZA 2VTFA 1TNFA 1RUG3 1C3HA 5E6HA 1KJLA 3RJRA 1HRI3 3EBRA 1VBE2 2A6WA 5JSOA 2FBEA 5LY1A 1XYPA 2WNVC 4IERA 1W0NA 1W2OA 2E9QA 3CHXA 3NMBA 4FPKA 4LK7A 4AEDB 5IUQA 4WBBA 3WDYA 3ZDVA 2YG0A 3C7HA 1JYIA 3NNJA 1HB1A 4URTA 5L7OA 3VDAA 5F5AA 1WBLA 3VBOB 2J42A 2ZS6B 3IN9A 4XIKA 2RM22 2K9ZA 5JCTA 4D6SA 4B8EA 4I2OA 3FL7A 1NCRA 3UJQA 2UYBA 4KG0A 5LBCA 3VBFC 3J4UH 4AVBA 3UNPA 4AI0A 5TSWA 1YUDA 4LKSA 2MHFA 4DXRA 3VZMA 1DYKA 2WS91 1FNZA 1S0IA 3ZVXA 3MIHA 3WOGA 5I0DA 2WNVB 2HEVF 1JBCA 3LAGA 2AUYA 5IK4A 1PGL2 2GAUA 1BXHA 2E51A 1R1ZA 4NPMA 4XE9A 1AYN3 4ATEA 2RS13 2A3WA 3CNAA 4XILA 4YZ3A 2AEYA 4YRDA 5FQ0A 5JZGC 1YEWA 3N7LA 5E88A 2RMU2 2ZHKA 1EUTA 2EA7A 2ORXA 3WF1A 1YLLA 1V6IA 2FQPA 1UW8A 1ODMA 1OQDA 4S2HA 5EYXA 2RS31 3ZXDA 1FV3A 5ISLA 4QPIC 5EXOA 3S57A 1NA1C 1HJGA 2PHTA 4Y4YA 4OI1A 2YZ4A 4XDQA 1AZDA 2WQ8A 4YWAA 5A32A 1MQTB 3POJA 1D4VB 2WZR1 5FZGA 2QZ3A 3VBSC 3E5QA 1HB4A 3JUUA 4ZU4A 4LO7A 2ZMNA 2VW1A 2WA4A 5DG2A 1OA4A 4D6RA 5JOZA 4MYEA 4NRQA 2E63A 3I7DA 3RG0A 2E53A 1OOPA 4OHXA 2VBBA 4TLFA 1VBB1 5KBFA 3WF0A 1FPN1 1REDA 4FPCA 1EPWA 1AHSA 3K75B 3AP5A 4P9YA 1XC6A 4M3CE 5DAVA 3UESA 1TE1B 2AEZA 4HKOA 1HRI1 1OXCA 5L9RA 3VBHA 2P3KA 1SMVA 3SH3A 4QX1A 5D1IA 3I3QA 3ZKYA 4ZU7A 1SPPB 1RUH2 4Q4Y1 4GXLA 3T30A 5A3TA 3DEMA 1D4M1 2XJRA 3WQ1A 4QT6A 3ZFEC 3M1HA 2E26A 5FLIA 4N43B 5KXEA 4L97A 3S6PA 1G9DA 1PO12 1CR7A 5ABJA 2Z79A 3JXSA 3WINE 2AH2A 5C9AC 2B45X 3A0KA 5JI9A 4QB1A 1C57A 1GNYA 1W2NA 4OHWA 3PJQA 5T5OA 5BNOC 2EIEA 4EN0A 4KL1A 4AXOA 2NYYA 1V9U2 3GDBA 1R091 3VZJA 1U0AA 2JDYA 2UWCA 2XJSA 4W50A 4UBHA 5FJKA 3WDTA 4LA3A 1BHGA 1DQ0A 1AXKA 3M8LA 2PHDA 1PVC2 1XE0A 2CDOA 3TYJA 4EZHA 3HNMA 5IATA 1RUJ3 2YB7A 4O7XA 3MLKA 4UWDA 1OPOA 1ACCA 2VG9A 3BKZA 1D4M2 1QQP3 1B35C 5DDJ1 1NZCA 3NVCA 5EQUA 1IGOA 1FMD2 2DDUA 3AZVA 2IFRA 4ISRA 5CKMA 5FZHA 3IIAA 3WT3A 4META 3LDBA 2VCAA 2VH9A 1WUVA 4RS5C 4CA9A 2R30A 3O14A 2X5IA 4UOJA 4Y24A 1V6JA 2CDPA 2ZHMA 4OCTA 1W6QB 4F8AA 1C4RA 2RV9A 1GOFA 1NOVA 3WSOA 2OW4A 3GBWA 3W59A 4Y1XA 3EXUA 5KC5A 1PGW1 1RUH3 1YHFA 1UY0A 4BQ3A 2WZR3 1QH7A 3U07A 5JSRA 5A6ZA 4P14A 3TNQA 3I2GA 2XJPA 2X29A 5CNAA 1JZ5A 1DBNA 1C8NA 1LHUA 3Q8EA 5AVPA 4CCMA 3KF5A 4LO5B 2AREA 1RUOA 5CA6A 4KWLA 1OUXA 3VBRC 2OPKA 2PHWA 5E16A 4C0BA 3FJSA 2WFF3 3LOIA 4Q5OA 2Q5TA 5HBAA 1O59A 4QQHA 1E57A 4JDNA 4BDVB 3GM8A 4XMIA 1NLRA 1KDMA 2EF6A 1PZ8A 2QE3A 2RDSA 4Q4Y3 3H9AA 1KFXL 3HIFA 1UF2C 3AZZA 2P3IA 4Y20A 2RE9A 2C4XA 2GU9A 4Z2AA 1WA4A 2DCZA 3D3AA 4NWWA 1GFF2 4JTNA 3O1OA 5K0UC 1IKQA 4AQ6A 5AC93 5DG1A 3PNAA 2A6ZA 2DCTA 3UGHA 1RJ7A 4A7ZA 3OBRA 4D3WA 2WFF1 4BU2A 1J3PA 5F6LB 3AYCA 1T2XA 2P37A 4LHSA 2VJXA 4UFHA 2OA2A 2QVSB 4Q4Y2 4QX8A 4QX3A 2P3YA 3NSTA 4QWNA 2HBTA 5DAWA 1DIWA 1W99A 3MUZ1 1UOBA 3WUCA 3WXPA 1DQ1A 2AR6A 3UK9A 2PTMA 4QU1A 2R071 3SKVA 3KT4A 1W6QA 1XOYA 4MGYE 2RS53 4CDWC 3IDBB 3A4UA 2D6MA 5IFTA 3W5NA 3NAPB 3B00A 4LBQD 3AFKA 1QXJA 1Y9GA 4QXCA 3IAQA 3PVBB 1DQ2A 1LEDA 3ZN6A 3ZYRA 4W4ZA 5EIYB 1FYUA 1LECA 5I0UA 2Q0AA 3WNLA 4HN1A 5BNNC 2ARXA 2VMEA 2Y0OA 4UW3A 4ZXEA 3LGRA 3ILRA 1R1A2 4E4ZA 4E8CA 5C5TA 1X33A 4RGKA 4ES9A 3PURA 1SZBA 4IV3C 4IV1C 1MZEA 2VZPA 2BRTA 3HD8B 4MSVA 5FZLA 2Y34A 3EHKA 1OFSA 1PMIA 4BB3A 1UL9A 1X9TA 3U37A 2V73A 1JUIA 1ZRDA 3F2ZA 4LTAA 1KFUL 2ZMLA 3FUOA 2WO2A 3MIGA 5JOXA 4IEUA 3MYXA 3ZMNA 2FDKA 3FZ3A 3SISA 3SNMA 3VBHB 3JD73 1CAVA 3FUQA 4ZS2A 5LRRA 1Q43A 1KD7A 1ZBA2 4H2AA 4NHKA 2CY6A 2Q8OA 4CUCA 1CAXA 1FPN3 1S2BA 3VV1A 5C8CB 1SLAA 4LUKA 4HMZA 3B7MA 4CCLA 3ZSJA 4YG3A 1WW7A 4KGGA 1GP4A 2BV4A 2VGDA 3GZUC 3HN1A 3E6CC 4P5HA 3WP3A 2FCUA 3H3UA 1AX2A 4EN9B 1JYVA 1LB2A 1AR91 1UU5A 2XBO2 3RSJA 4AG4A 1PVXA 1NY72 3IKWA 5FK8A 1MQTA 2X05A 4GA9A 2A71A 4IGPA 1YFWA 1ULOA 1X8MA 1O91A 5K4LA 5HPOA 4Q4V1 5FPLA 5A7WB 3VDCA 1XYOA 1RHI2 2VQTA 5I0RA 1JOJA 2JENA 1HRV3 1ZA4A 1DYPA 5FXVA 4KG8A 5C3OA 2R32A 1UO9A 2WZR2 4LO6B 4FPFA 5EP9A 4YW1A 3UGFA 5FQ0B 4MGSA 1UOFA 1DCSA 3D6EA 3NJZA 4KH9A 4PIYA 4PHZA 5G04L 4I0BA 2B42B 1S4CA 3M3CA 3SHRA 1VBE1 3JB4C 2WNVA 4LK6A 1OQEA 1B35A 4IEQA 1OURA 1SLIA 4CXYA 3PUHA 3CBNA 1UOGA 2EVXA 4W6WA 2WS93 4WM8A 4JKMA 5L7OC 1MEC1 1FMD3 1YQCA 5FBJA 5A7OA 3B93A 4NHMA 4YFWA 4DS0A 1I1EA 5FY4A 5FZMA 4CDXB 1VBE3 4QPGA 5IHRA 1CWPA 4Q0PA 5BYNA 3WR0A 2OQ6A 4HLTA 4NAOA 5FY8A 1QJX2 4IEXA 3IAPA 3OUHA 4XFIA 2HWF2 3AP4A 4PI2A 1POV0 1V6NA 2QQKA 3A7QA 4IUGA 1S2KA 2VNVA 4NVPA 4XDPA 3RFRA 3D0JA 2ZGSA 2FDFA 4HT1T 1UX7A 5FZEA 5T50A 3NW4A 4W6XA 3ZFGA 2JDAA 1UYYA 1ZZ7A 2JDMA 2RMU1 2VMIA 2WABA 2W08A 4XQ4A 1U5ZA 1G7YA 4K7JA 5JPMB 2V09A 3AMNA 3VBUB 2ZXQA 4RA0A 1F5JA 5ACA2 3TBDA 1UZZA 3BGAA 2KD7A 1UZ0A 5FMOL 5L36A 5JIAA 1WLTA 1FOD1 2W5FA 1I6XA 4G4FA 1ZZCA 1LRHA 2HWE2 2CSGA 3I2HA 3NNGA 5FZAA 5HV0A 2I07B 2NMOA 3I59A 2BGPA 4JVAA 2HWC2 1LODA 2CV6A 3BODA 4WM7B 5LW9A 5FP3A 4WM7A 1BEV3 1OFNA 2RG4A 2UU8A 4Q4W1 4Q0SA 1UZVA 2WT0A 1BMV2 2GH8A 1DQ5A 2H0BA 4GH4A 2XLFA 1GZWA 5FRAA 5CFCB 3LA2A 3VHNA 2QQUA 4CRQA 4L2NA 2DBNA 4B3NA 1W0PA 2FDGA 2VXRA 4JX0A 1TG7A 3KF3A 1CQ9A 2DVDA 3KV6A 3WG3A 2Q8DA 5F9TA 1UOJA 2E33A 2G19A 1S0DA 1N1SA 1L7LA 2XVLA 3HQRA 2NP0A 1QY4A 4BK5A 4EWDA 1W8WA 1MEC3 2WT1A 2QUOA 3DL3A 4P9JA 3DYPA 3VDDC 1OF3A 4K21A 1S55A 2G4IA 1DF0A 4KNCA 3ZPOA 5FR3A 4Q4X2 3S0MA 3WDVA 1FV2A 5E1RA 4AHWA 2Y38A 4OLLA 4R9DA 1ZM1A 5FYVA 3ZXAC 1OKQA 4LJHA 3GHNA 3OPZA 2WQZC 3ZX7A 1F35A 2RVAA 5J1XA 2VC9A 4XTMA 1ZX5A 1CX1A 3H0OA 4KU8A 2B39A 1LOEA 3MF6A 4FFFA 1FT9A 5DDJ2 1VAKA 2QQLA 3HNYM 3ILNA 5A70A 1W3XA 3H8UA 2WJSA 1ODNA 5FZ1A 3WNPA 4NIGA 1S1AA 5FKCA 4WVMA 1IHMA 5LA9A 2WO1A 2BGCA 5DXDA 4CCNA 3LEKA 2BFUS 3OUIA 1JOBA 2XVKA 3GALA 2WNUA 3WVJA 4BXSV 1KJRA 3H8OA 3AL6A 4G3YC 3WNOA 4MXVA 1ZZ6A 1W9SA 1OF4A 4QMAA 4V1PA 1SHWB 1ZBE3 4GB33 4XYXA 4DFSA 4E2GA 1VB4A 4X8PA 3TAYA 5JMOA 2VZTA 1CN1A 4Z82A 3A23A 4PT6A 3ENRA 1Q8SA 1QWRA 1PGW2 3HBKA 1Z7S3 1RITA 3L9JT 2ZZJA 2D44A 3ZR5A 3RPQA 3I2JA 4LIUA 1NA1B 3BCWA 2ZBJA 1QJU3 3DCQA 3VHRA 4JGZC 5GKAC 2D97A 1O4TA 2DU1A 2YROA 5DAXA 5A33B 2CWMA 4XAEA 5FFOC 2WAOA 4JKKA 4YZ4A 3ZSEA 1AUYA 2W95A 3GCXA 2P6HA 1CJDA 3INAA 2IXHA 1CAVB 1UMIA 1GANA 4N9HA 3LEGA 5FP9A 1QJU1 4Q2FA 2G9ZA 5FY7A 1OOPC 3N7KA 4XZUG 3DN7A 3EYPA 3RZMA 3J8F3 3M3IA 2DFCA 3FLTA 2YMZA 2GDFA 3TEYA 5FZOB 2WZPP 3VBFB 2BJSA 2CHHA 1UZWA 4BLJA 4XCAA 3IPVA 4OYUA 2R072 4NR1A 4LLFA 4XFCA 1J3QA 2ZEYA 1JZ8A 1HJFA 2C26A 3BVCA 2A7AA 4TZDA 1HX6A 2CGPA 5ANNA 3POGA 3K3OA 4E4SA 1CX4A 5I91A 5LK5A 2B7YA 3MPPG 1MS1A 1Y43B 1NCRB 3B02A 1ZZBA 2XVGA 3BOPA 3TNPB 3ZYBA 4GMP1 1VIWB 4C90A 2VECA 2C9KA 1VAMA 1PK6A 1QOTA 4LEJA 4M00A 3WDUA 2JB4A 1ND2A 4AEJA 3VZNA 4J1XA 1LGCA 1ZBE2 4GB32 3WP4A 3DKQA 4N7IA 2BPA2 1ND3C 2VZRA 4XJWA 4YW5A 2F4LA 2IUWA 5FV3A 4XMAA 4LR4A 4M4RA 4GWIA 4H14A 4YW3A 4LOTA 2WFPA 2BNOA 4ATFA 3RZKA 5LEJA 2VCBA 4KMQA 1MS5A 2A1XA 1ZVFA 3P3NA 3IM0A 1OD5A 5FZ4A 4CE8A 4NROA 1UCXA 5IWFA 5JOYA 2UWAA 3URFA 5IVEA 1EP0A 1H30A 1W0OA 3Q8AA 3TRSB 4YG6A 4YZ5A 4JDMA 3T1LA 4GZ9A 1UKGA 4AF9A 3AB0A 1I3HA 1W6PB 4EQVA 1WCKA 2Z2SB 4FCAA 2VMCA 1ASJ3 5JIUA 3CEWA 4B1LA 3WDWA 1UN1A 2VOKA 3WNKA 1S0GA 4YVWB 5JXIA 1GV9A 2R7EB 1AYM3 1TNRA 4K40A 1ENXA 3B01A 1QNYA 5C4WC 1V6OA 3T0BA 2R0FA 1JYCA 2ET7A 4LKEA 1C8M2 2RJKA 4NUBA 4BA6A 2Q30A 3I59B 2GNBA 1ULCA 4XQWA 1FI2A 2D43A 2ZPXA 1JYXA 5A7PA 3KSCA 2ADDA 2VZ1A 1IG3A 4TYSA 4AEKA 1LULA 1O4ZA 1AVBA 5FPZA 3KV9A 1DGLA 2P17A 3PIGA 1NY71 4DUWA 2I74A 4PDWA 2EXKA 4FOWA 4NPRA 3SEPA 1NLSA 1ENQA 1QH6A 1WGPA 4R52A 2VUJA 4RHV1 5EZWA 4QQOA 2JX9A 5BNPA 4IEOA 2ZHNA 3ZYFA 2PAKA 4PF5A 4AFMA 2WO3A 1GWMA 4F3JA 3BTYA 3DUIA 1FAYA 2EICA 1W8TA 4XF0A 4ARXA 1RMU1 5JI7A 1SBEA 2Z69A 5DAQA 3I2OA 1RUG2 2R1BA 3VL9A 2Q8CA 3X29B 3POYA 4Y22A 3MGUA 1XNDA 3DF0A 4PBPA 4YVSC 5H9SA 4A44A 3D8CA 3VZLA 5GJ6A 2O8QA 1AR83 1YQ6A 2PN5A 1VR3A 2PLV2 4FPOB 4M3CF 4YGEA 1VBB2 3RQ0A 4BXFA 4FOYA 3LFMA 1P8JA 4FTBA 5DAPA 2IXCA 2VUCA 4CXXA 4E8DA 5F5CA 3C7FA 4DZGA 1CAWB 1NE6A 4FPHA 3JCIA 3VBFA 1COV2 4OHYA 3WW1A 5JOWA 4OULA 1QJX1 1XSRA 3MHZA 1N3PA 2WQ4A 2HKXA 5A1AA 5A3NA 3D82A 4IETA 4UFLA 3ZYIB 1UPIA 1OLMA 2JIJA 5AC91 4MO3M 1GZCA 4XBQA 3I3MA 4DRVA 4URAA 1W9TA 1LGBA 1ZZ9A 3WP5A 1ENRA 1RIRA 2WAAA 5GZGA 1X8EA 2GNTA 3PIJA 1SFNA 3LZZA 5FZFA 2A3XA 5IK7A 1Q8QA 1W6OB 3VBRA 1X50A 1PO11 4LBMA 1EAH3 1RUE1 4XUPA 2NM1A 2HWC1 2FHRA 5FXWA 4XAAA 1GQHA 3CJIC 1UMHA 1E5IA 5A1FA 1NA1A 4HETA 3OEAA 3I2KA 5JXHA 1BVVA 1CIWA 5FLHA 1LHNA 2XL7A 2YPDA 2C6SA 5A32B 2BNMA 5F5IA 5IK5A 2JDPA 4XF3A 4D94A 3AFGA 3WZ1A 1MZ5A 4JAAA 4O9EA 4PCRA 4XEZA 1FOD3 2BYVE 3RNSA 3VD5A 4A7KA 3ACHA 4JZRA 5DPNA 5FYZA 4YNIA 4QKNA 5FYUA 4B4PA 4AFAA 1FNYA 1PM4A 1QJY1 4FXKB 1AR71 4LE4A 4AQTA 5I8TA 1RVF2 4WVZA 4XUTA 3GNEA 2V5YA 3KGZA 4N7UA 2WNUB 2L9LA 4QHZA 2RHPA 1FX5A 1NKGA 4OQ8A 2HWE3 1JN2P 1QEXA 3LCPA 3T2QA 2CWSA 4GWMA 2VL4A 1LOBA 4AK3A 1PK6C 3N35A 2BERA 1GYKA 2YBPA 4RQPC 1EV11 2OX0A 1US3A 1W2TA 5JVVA 5CFDB 4DINB 4CP0A 4TTGA 2KA3A 3WF4A 2Y8KA 1DZTA 3VB9A 1D7PM 1PZ7A 2W92A 5DZEA 4NMIA 1RUJ1 3KS7A 4XUOA 1KRIA 1VRH1 3H42B 1QJU2 2P1BA 2BGOA 3GBFA 1QJEA 2P34A 4RSUA 2XKPA 4NIAA 5IVCA 1LHWA 3VD9A 5C71A 3VL8A 3NNFA 1UYXA 3ZFEA 5J96B 2JE7A 2YC0A 2C24A 3DPRC 1HLCA 4LBQA 3RZZA 3U4SA 5CIRA 4QKFA 4XW3A 4HSJA 1JH5A 5FZKA 3ALQA 2YU2A 3WD5A 2P3JA 2BU9A 3NV1A 4UT5A 5FP8A 4AE2A 1WKYA 1EV12 1TVGA 2J1VA 1HB2A 4LOSA 1IPKA 4HVQA 1F31A 2RDQA 2RJ2A 4Q4W3 3AC0A 1VRBA 4Q0QA 4PDWB 5KXDA 2WZ8A 1PZ9A 2IFWA 2ZEXA 4K3UA 1RUE3 5FZ7A 2JECA 4C0HA 2VVDA 5I0TA 4H3WA 3FHAA 4Q4V3 3JZVA 3VDBA 2TBVA 4XETA 2BBVA 2BTVC 4U2AA 4GULA 4LUMA 1YI9A 3E6DA 3IBMA 4J1WA 1GP6A 3ROUA 5CFCA 4QD2A 2O0OA 3EMRA 3GJAA 4AWDA 1S0CA 1JZ6A 3K51A 4XXPA 1GMMA 4SLIA 3RYKA 2HWD2 1MS9A 2OZ6A 1AL21 2I45A 2JE8A 2Q1ZB 3LD8A 4P9IA 4IE7A 3FBYA 2IXLA 1BCXA 1ZBA1 4C91A 4HOOA 1K45A 4V2WA 3SCGA 5JR2A 2DWRA 2Y0IA 4C1WA 3LPFA 5CVRA 3RJ2X 2MPFA 4CDUC 2WDBA 4AI8A 2XBO3 4H55A 5T5LA 4GD4A 2YV8A 4Q4X3 1PM7A 1SCRA 3N9OA 4R9CA 3I8TA 3ZPYA 5K8SA 3RZGA 1JZ2A 3AL5A 2R0HA 4Q27A 4P08A 1JYNA 1PO21 3ZYJB 5L9VA 3KVBA 3OD4A 4JHTA 3B9CA 1Z0HA 3AXEA 1SLLA 1HIXA 4CDUA 4E2SA 2W91A 1R082 2MNGA 5A80A 2KR2A 4BZ4A 2GC2A 3ME2A 4OMCA 3DXUA 4GKXA 2B9VA 1L3JA 4L8QA 4LBQB 3T2TA 1QOOA 1PIV3 2BOJA 1ND2B 2WO7A 1W2UA 2WN2A 4QPGB 4Y1UA 4KBZA 3BTAA 5FY0A 4CDXA 3O5SA 4ES8A 4D0QA 2QDRA 1O8PA 1QQP1 1W90A 1G6NA 5FDBA 4ONUA 5F37A 1BQPA 2G1MA 3ACGA 5BNQA 2ZGNA 5KHKA 1NZIA 2PA7A 2RM23 1VBD2 3I3BA 4EYUA 1RGSA 3GGLA 1QKQA 4IEWA 1J84A 3N3HA 1TEIA 1O8SA 1KS4A 1UU4A 5CFDC 3N9PA 2VQAA 3W5MA 2P5BA 1MR5A 2ZCWA 4LBNA 2BWCA 1ULDA 1AYN2 2XKOA 4ASMB 4ZS3A 2SBAA 2ZX3A 1OT5A 3VGIA 2Y6JA 2H0VA 3EJKA 1H2MA 2BUKA 1RUD2 3VUOA 1JU3A 4Y5TA 3TB0A 1F8VA 3GBGA 1COV3 4LQRA 5FP4A 4Q29A 3U75A 4MVTA 1U5IA 3WV6A 4BPZA 3K4DA 4XFBA 1VE0A 1V9U3 5LA2A 5HXVA 2VOVA 4K1ZA 4NPLA 1ALYA 1K3IA 3HT2A 1LTEA 4JGYC 3TOJA 5FOJB 2QJVA 1TZOA 4FVVA
chains in the Genus database with same CATH topology
1UYYA 2E31A 2LW8A 2WABA 1GU3A 3WNPA 4A42A 5C71A 4D8MA 4L0PA 2DCJA 4JKLA 2ZXQA 3P1IA 2HLEA 3BGAA 2KD7A 1UZ0A 5DQ0A 3GXUA 4XURA 4QX2A 3MBWA 1JU4A 4ARYA 2W5FA 1NAEA 3I2FA 4OZOA 5LA1A 3I2HA 3NNGA 4QB2A 2W1SA 3OB8A 3CKHA 1JZ4A 2XONA 2BGPA 3MV01 1UY4A 3T0AA 3WNMA 2V5DA 4HG6B 2BBAA 4A41A 3WF2A 1RYYA 1KEXA 1UY1A 3HJRA 3LPGA 2Z4FA 2W1QA 3NJXA 1F4HA 3WF3A 3OGSA 4JX0A 3SKJE 3EB7A 2VO5A 1TG7A 5I0DA 1L7RA 2E33A 4MADA 4XUQA 4BK5A 2JKXA 1W8OA 3DYPA 5LCWL 1OF3A 3MV11 2WUHA 3DYMA 2PQSA 4OMDA 1W8NA 2VMFA 2VR4A 1UXZA 2RVAA 5J1XA 1US2A 2VC9A 3ACIA 2W94A 1CX1A 3I3EA 1PMHX 3MO4A 2QQLA 3HNYM 4W8JA 3CZJA 3T0DA 4PQQA 2EIDA 2WO1A 4BJ0A 2B4KA 2J22A 3OGRA 5C7GA 3LEKA 2WBKA 4QB6A 3C8XA 4BXSV 1HN1A 1W9WA 3WNOA 4ET7A 1W9SA 1OF4A 1SHWB 2LS6A 1SDDB 3ZM8A 5JXGA 5JMOA 2X09A 2VZTA 2XHNA 3A23A 4PT6A 4A3ZA 3IIIA 4DEVA 3UETA 3I2JA 2VOTA 3CDZB 5EJZB 3VD4A 3CZUA 3FHQA 5CYYA 3HPNA 1JI6A 4YPJA 5B4XA 1UY2A 2WAOA 2WZEA 4JKKA 2W95A 1PX4A 4A6OA 2ORZA 1UMIA 2X10A 3LEGA 4DEQA 4QPWA 3I97A 4XZUG 2J1TA 3EYPA 3VD3A 5IYYA 2QQJA 3C7EA 1YQ2A 3ETPA 4CVUA 3OG2A 3HNBM 4QAWA 1JZ3A 2DCKA 4OYUA 4QDRA 2W87A 1K42A 3MUY1 2Y6KA 1PMJX 2ZEYA 1JZ8A 2C26A 1JYWA 4DXTA 2WYSA 3CQOA 2JD9A 4RYDA 3SEEA 4DUXA 2C9KA 2J1EA 2QQNA 5CZKA 1F4AA 3WEZA 1MPXA 3THDA 1ULPA 2VTFA 2YC4A 3WQBA 5C70A 1UY3A 2VZRA 4CU9A 4M4RA 4GWIA 4QX0A 1W0NA 2YG0A 3C7HA 2VCBA 4KMQA 4AAXA 1WCQA 3VDAA 4A4AA 4CU7A 3K77A 1KGYA 3FL7A 3UNPA 3BN6A 4GZ9A 5G05L 4LKSA 4DXRA 2VMCA 3A22A 2YC2A 3WNKA 5JXIA 2R7EB 3FN9A 4RN5A 3K4AA 2V72A 3T0BA 2VQUA 3DYOA 5JUVA 4LPLA 2VMDA 1EUTA 2ORXA 4MOAA 3WF1A 4DUVA 1JZ7A 1CIYA 2QQMA 1JYXA 2VZ1A 4KI5M 2XQXA 4ZY9A 2WQ8A 4DUWA 2J1SA 3SEPA 3VD7A 4TXWA 1GUIA 1GOHA 4BK4A 2VZUA 3LE0A 3HOBA 4CUAA 2WO3A 3OGVA 2W3JA 3WF0A 2W46A 2EICA 3K75B 1XC6A 2J1UA 4ARXA 3UESA 3T08A 2Y6GA 4QX1A 3T2OA 4A44A 4CU6A 1DP0A 2QBXA 4DXSA 4GWJA 3OBAA 3P6BA 1CZSA 2E26A 1NUKA 1P8JA 2YFZA 4E8DA 3JXSA 3C7FA 1CZVA 4P00B 4QB1A 1GNYA 3C7OA 2EIEA 5A1AA 3GDBA 2ZEZA 4P02B 3IB3A 4W50A 2Y6LA 1BHGA 4JHZA 4MO3M 2CDOA 3I2IA 3HNMA 2YB7A 2Y64A 1W9TA 2WAAA 1SG3A 5FUIA 1GQPA 2W9XA 2VZSA 2W1UA 3E1F1 2DDUA 2QQOA 3NQHA 1H6YA 4CU8A 2VCAA 3J7HA 4XUPA 4UOJA 2CDPA 1UMHA 2RV9A 3OEAA 1GOFA 2WN3A 3I2KA 3WSOA 5JXHA 4UI9L 1UY0A 1DLCA 2ZEWA 1NX9A 1I5PA 3I2GA 3VD5A 3C7GA 3ACHA 1UYZA 5DPNA 4M4PA 1JZ5A 1IQDC 3DECA 4QDQA 5LA0A 4XUTA 2L9LA 1NKGA 1OH4A 3T2QA 1O59A 3HEIA 1EUUA 3GM8A 4BDVB 2VL4A 5DMYA 1XPWA 2BERA 1UXXX 3CMGA 2Y6HA 4CUBA 2J1AA 2C4XA 4Z2AA 1US3A 3D3AA 3K46A 4TTGA 2YFUA 3WF4A 2Y8KA 1D7PM 2W92A 4QDSA 2J1RA 4XUOA 2BGOA 1T2XA 1UWWA 2VZVA 4LHSA 2VJXA 3WNNA 4QX3A 3VD9A 2VZQA 1UYXA 5HXMA 1W99A 3MUZ1 5DN2A 1PX3A 5IJRA 3SKVA 5JXJA 4XUNA 1K12A 3A21A 1WKYA 1TVGA 2J1VA 3OEBA 5EJ1B 2RJ2A 5IFTA 3AC0A 3W5NA 2WZ8A 2ZEXA 4ZZ5A 3IAQA 3FHAA 3VDBA 3CIHA 1L7QA 3I3DA 3NRUA 3LQCA 4W4ZA 5EIYB 5B4NA 4ZZ8A 3WNLA 2E32A 2VMEA 4ZXEA 4E8CA 1GOGA 1DYOA 1LNSA 2J7MA 1JZ6A 1XNAA 1GMMA 2VZPA 2JE8A 3U37A 2XOMA 4FI9A 1K45A 5JR2A 3T09A 3F2ZA 3PUIA 3LPFA 5F7UA 2WO2A 2V4VA 4OUEA 2WDBA 4MGQA 4PF1A 2VCCA 3THCA 1JHJA 4CUCA 1JZ2A 4P08A 5IFPA 1JYNA 2QQIA 3ECQA 2W91A 4XVHA 1JYVA 4OMCA 4P5YA 2B9VA 3LEIA 4AG4A 2BZDA 2X05A 3NJVA 1ULOA 2WN2A 5HPOA 1OD3A 4D0QA 3VDCA 1R64A 1O8PA 2VQTA 2W47A 1H6XA 3ACGA 4KWUA 3HN3A 3I3BA 4MGSA 5G04L 1CZTA 3GGLA 2W1WA 1J83A 2EIBA 1XNTA 1J84A 1O8SA 3ACFA 3PUHA 2VZ3A 3IDAA 3W5MA 4JKMA 3T2PA 3ABZA 1OT5A 2Y6JA 2HYXA 2VZOA 5IHRA 4UAPA 1JU3A 2VM9A 3IAPA 4A45A 4LQRA 2QQKA 3A7QA 4IUGA 2ID4A 3K4DA 2OKXA 5LA2A 1UX7A 1K3IA 2JDAA 3K4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UYY A;  2E31 A;  2LW8 A;  2WAB A;  1GU3 A;  3WNP A;  4A42 A;  5C71 A;  4D8M A;  4L0P A;  2DCJ A;  4JKL A;  2ZXQ A;  3P1I A;  2HLE A;  3BGA A;  2KD7 A;  1UZ0 A;  5DQ0 A;  3GXU A;  4XUR A;  4QX2 A;  3MBW A;  1JU4 A;  4ARY A;  2W5F A;  1NAE A;  3I2F A;  4OZO A;  5LA1 A;  3I2H A;  3NNG A;  4QB2 A;  2W1S A;  3OB8 A;  3CKH A;  1JZ4 A;  2XON A;  2BGP A;  3MV0 1;  1UY4 A;  3T0A A;  3WNM A;  2V5D A;  4HG6 B;  2BBA A;  4A41 A;  3WF2 A;  1RYY A;  1KEX A;  1UY1 A;  3HJR A;  3LPG A;  2Z4F A;  2W1Q A;  3NJX A;  1F4H A;  3WF3 A;  3OGS A;  4JX0 A;  3SKJ E;  3EB7 A;  2VO5 A;  1TG7 A;  5I0D A;  1L7R A;  2E33 A;  4MAD A;  4XUQ A;  4BK5 A;  2JKX A;  1W8O A;  3DYP A;  5LCW L;  1OF3 A;  3MV1 1;  2WUH A;  3DYM A;  2PQS A;  4OMD A;  1W8N A;  2VMF A;  2VR4 A;  1UXZ A;  2RVA A;  5J1X A;  1US2 A;  2VC9 A;  3ACI A;  2W94 A;  1CX1 A;  3I3E A;  1PMH X;  3MO4 A;  2QQL A;  3HNY M;  4W8J A;  3CZJ A;  3T0D A;  4PQQ A;  2EID A;  2WO1 A;  4BJ0 A;  2B4K A;  2J22 A;  3OGR A;  5C7G A;  3LEK A;  2WBK A;  4QB6 A;  3C8X A;  4BXS V;  1HN1 A;  1W9W A;  3WNO A;  4ET7 A;  1W9S A;  1OF4 A;  1SHW B;  2LS6 A;  1SDD B;  3ZM8 A;  5JXG A;  5JMO A;  2X09 A;  2VZT A;  2XHN A;  3A23 A;  4PT6 A;  4A3Z A;  3III A;  4DEV A;  3UET A;  3I2J A;  2VOT A;  3CDZ B;  5EJZ B;  3VD4 A;  3CZU A;  3FHQ A;  5CYY A;  3HPN A;  1JI6 A;  4YPJ A;  5B4X A;  1UY2 A;  2WAO A;  2WZE A;  4JKK A;  2W95 A;  1PX4 A;  4A6O A;  2ORZ A;  1UMI A;  2X10 A;  3LEG A;  4DEQ A;  4QPW A;  3I97 A;  4XZU G;  2J1T A;  3EYP A;  3VD3 A;  5IYY A;  2QQJ A;  3C7E A;  1YQ2 A;  3ETP A;  4CVU A;  3OG2 A;  3HNB M;  4QAW A;  1JZ3 A;  2DCK A;  4OYU A;  4QDR A;  2W87 A;  1K42 A;  3MUY 1;  2Y6K A;  1PMJ X;  2ZEY A;  1JZ8 A;  2C26 A;  1JYW A;  4DXT A;  2WYS A;  3CQO A;  2JD9 A;  4RYD A;  3SEE A;  4DUX A;  2C9K A;  2J1E A;  2QQN A;  5CZK A;  1F4A A;  3WEZ A;  1MPX A;  3THD A;  1ULP A;  2VTF A;  2YC4 A;  3WQB A;  5C70 A;  1UY3 A;  2VZR A;  4CU9 A;  4M4R A;  4GWI A;  4QX0 A;  1W0N A;  2YG0 A;  3C7H A;  2VCB A;  4KMQ A;  4AAX A;  1WCQ A;  3VDA A;  4A4A A;  4CU7 A;  3K77 A;  1KGY A;  3FL7 A;  3UNP A;  3BN6 A;  4GZ9 A;  5G05 L;  4LKS A;  4DXR A;  2VMC A;  3A22 A;  2YC2 A;  3WNK A;  5JXI A;  2R7E B;  3FN9 A;  4RN5 A;  3K4A A;  2V72 A;  3T0B A;  2VQU A;  3DYO A;  5JUV A;  4LPL A;  2VMD A;  1EUT A;  2ORX A;  4MOA A;  3WF1 A;  4DUV A;  1JZ7 A;  1CIY A;  2QQM A;  1JYX A;  2VZ1 A;  4KI5 M;  2XQX A;  4ZY9 A;  2WQ8 A;  4DUW A;  2J1S A;  3SEP A;  3VD7 A;  4TXW A;  1GUI A;  1GOH A;  4BK4 A;  2VZU A;  3LE0 A;  3HOB A;  4CUA A;  2WO3 A;  3OGV A;  2W3J A;  3WF0 A;  2W46 A;  2EIC A;  3K75 B;  1XC6 A;  2J1U A;  4ARX A;  3UES A;  3T08 A;  2Y6G A;  4QX1 A;  3T2O A;  4A44 A;  4CU6 A;  1DP0 A;  2QBX A;  4DXS A;  4GWJ A;  3OBA A;  3P6B A;  1CZS A;  2E26 A;  1NUK A;  1P8J A;  2YFZ A;  4E8D A;  3JXS A;  3C7F A;  1CZV A;  4P00 B;  4QB1 A;  1GNY A;  3C7O A;  2EIE A;  5A1A A;  3GDB A;  2ZEZ A;  4P02 B;  3IB3 A;  4W50 A;  2Y6L A;  1BHG A;  4JHZ A;  4MO3 M;  2CDO A;  3I2I A;  3HNM A;  2YB7 A;  2Y64 A;  1W9T A;  2WAA A;  1SG3 A;  5FUI A;  1GQP A;  2W9X A;  2VZS A;  2W1U A;  3E1F 1;  2DDU A;  2QQO A;  3NQH A;  1H6Y A;  4CU8 A;  2VCA A;  3J7H A;  4XUP A;  4UOJ A;  2CDP A;  1UMH A;  2RV9 A;  3OEA A;  1GOF A;  2WN3 A;  3I2K A;  3WSO A;  5JXH A;  4UI9 L;  1UY0 A;  1DLC A;  2ZEW A;  1NX9 A;  1I5P A;  3I2G A;  3VD5 A;  3C7G A;  3ACH A;  1UYZ A;  5DPN A;  4M4P A;  1JZ5 A;  1IQD C;  3DEC A;  4QDQ A;  5LA0 A;  4XUT A;  2L9L A;  1NKG A;  1OH4 A;  3T2Q A;  1O59 A;  3HEI A;  1EUU A;  3GM8 A;  4BDV B;  2VL4 A;  5DMY A;  1XPW A;  2BER A;  1UXX X;  3CMG A;  2Y6H A;  4CUB A;  2J1A A;  2C4X A;  4Z2A A;  1US3 A;  3D3A A;  3K46 A;  4TTG A;  2YFU A;  3WF4 A;  2Y8K A;  1D7P M;  2W92 A;  4QDS A;  2J1R A;  4XUO A;  2BGO A;  1T2X A;  1UWW A;  2VZV A;  4LHS A;  2VJX A;  3WNN A;  4QX3 A;  3VD9 A;  2VZQ A;  1UYX A;  5HXM A;  1W99 A;  3MUZ 1;  5DN2 A;  1PX3 A;  5IJR A;  3SKV A;  5JXJ A;  4XUN A;  1K12 A;  3A21 A;  1WKY A;  1TVG A;  2J1V A;  3OEB A;  5EJ1 B;  2RJ2 A;  5IFT A;  3AC0 A;  3W5N A;  2WZ8 A;  2ZEX A;  4ZZ5 A;  3IAQ A;  3FHA A;  3VDB A;  3CIH A;  1L7Q A;  3I3D A;  3NRU A;  3LQC A;  4W4Z A;  5EIY B;  5B4N A;  4ZZ8 A;  3WNL A;  2E32 A;  2VME A;  4ZXE A;  4E8C A;  1GOG A;  1DYO A;  1LNS A;  2J7M A;  1JZ6 A;  1XNA A;  1GMM A;  2VZP A;  2JE8 A;  3U37 A;  2XOM A;  4FI9 A;  1K45 A;  5JR2 A;  3T09 A;  3F2Z A;  3PUI A;  3LPF A;  5F7U A;  2WO2 A;  2V4V A;  4OUE A;  2WDB A;  4MGQ A;  4PF1 A;  2VCC A;  3THC A;  1JHJ A;  4CUC A;  1JZ2 A;  4P08 A;  5IFP A;  1JYN A;  2QQI A;  3ECQ A;  2W91 A;  4XVH A;  1JYV A;  4OMC A;  4P5Y A;  2B9V A;  3LEI A;  4AG4 A;  2BZD A;  2X05 A;  3NJV A;  1ULO A;  2WN2 A;  5HPO A;  1OD3 A;  4D0Q A;  3VDC A;  1R64 A;  1O8P A;  2VQT A;  2W47 A;  1H6X A;  3ACG A;  4KWU A;  3HN3 A;  3I3B A;  4MGS A;  5G04 L;  1CZT A;  3GGL A;  2W1W A;  1J83 A;  2EIB A;  1XNT A;  1J84 A;  1O8S A;  3ACF A;  3PUH A;  2VZ3 A;  3IDA A;  3W5M A;  4JKM A;  3T2P A;  3ABZ A;  1OT5 A;  2Y6J A;  2HYX A;  2VZO A;  5IHR A;  4UAP A;  1JU3 A;  2VM9 A;  3IAP A;  4A45 A;  4LQR A;  2QQK A;  3A7Q A;  4IUG A;  2ID4 A;  3K4D A;  2OKX A;  5LA2 A;  1UX7 A;  1K3I A;  2JDA A;  3K4Z A; 
#chains in the Genus database with same CATH topology
 5E8A A;  1GU3 A;  4A42 A;  2GSY A;  2UY9 A;  2YGL A;  4R8H A;  3RWN A;  4JKL A;  1A78 A;  3DXT A;  4GH4 C;  2VAU A;  2HLE A;  2LM3 A;  1JU4 A;  1WW5 A;  2P6C A;  3CJI B;  2VQ0 A;  1W8U A;  1C8M 3;  1GP5 A;  1NAE A;  4NWV A;  1K5J A;  2A5Z A;  4QQ2 A;  4ZON A;  5BXX A;  1MVQ A;  5T55 A;  2IVJ A;  3CKH A;  4LHL A;  3UKT A;  4CEY A;  4YW4 A;  1M06 G;  3VDD A;  1PO2 2;  1CAU B;  3O1V A;  4HPK B;  3MV0 1;  4XF9 A;  1CAW A;  4KQ7 A;  3U1X A;  5FZ3 A;  4EWE A;  4YM3 A;  1RHI 3;  3E5U A;  1DFQ A;  3WNM A;  2V5D A;  4QKB A;  2ZGO A;  2BBA A;  4A41 A;  1G9C A;  1VAV A;  3FMG A;  3H3Z A;  3OCP A;  2QKD A;  4XXA A;  5FZB A;  1AR8 1;  5A3M A;  1DGW A;  5FYM A;  4BIS A;  2W1Q A;  1HV1 A;  1ULG A;  3NJX A;  3RZJ A;  1O4Y A;  3LB9 A;  3WG2 A;  1CGP A;  3SKJ E;  1A3K A;  4AFC A;  2UYA A;  2VO5 A;  3EB7 A;  3LIG A;  2DUQ A;  3OPT A;  4XQD A;  4I3P A;  3WY6 A;  4BME A;  5C5U A;  2F6B A;  4MAD A;  2JWP A;  1K5M A;  2JKX A;  4LHN A;  1W8O A;  4AGG A;  3VKM A;  1XSQ A;  2FMD A;  2XWJ B;  1H9W A;  5FXX A;  2WUH A;  2ZAA A;  1KDK A;  4OMD A;  1HRV 2;  1PVC 3;  1F15 A;  2R04 3;  1XU2 A;  4C1X A;  3PJY A;  1F2N A;  2RS5 1;  1V00 A;  2VR4 A;  1G9F A;  4K6B A;  5F8P A;  3POS A;  3VKF C;  5FO8 B;  1RUD 3;  4WM8 C;  1ZRE A;  2VNG A;  3PLQ A;  1US2 A;  5FZC A;  3OTF A;  4EWA A;  1W2A X;  3O1R A;  3Q8B A;  2DF7 A;  3J7M A;  1XU1 A;  5D21 A;  1WLC A;  4Z2W A;  5I8Y A;  1XQN A;  2ZGM A;  4AI1 A;  1Y7B A;  3HMY A;  1LOG A;  5C3R A;  3MO4 A;  1IPJ A;  1XRU A;  2HBU A;  3NKG A;  3D0S A;  1JMU B;  5GAL A;  3T0D A;  1OBN A;  3AMQ A;  4J25 A;  2TNF A;  2GZW A;  3MI8 A;  1A34 A;  3DGT A;  4Q8K A;  1Y9M A;  2EID A;  3TN9 3;  1MZ6 A;  4Y33 A;  5E89 A;  4MHU A;  4NO4 A;  1W9F A;  4IDZ A;  1AF9 A;  4CEW C;  5J37 A;  1FXZ A;  2B4K A;  3T1M A;  1PGS A;  2XG3 A;  3OGR A;  3J8F 2;  5F3G A;  5C7G A;  2XGX A;  4OUS A;  3JD7 2;  5LWB A;  1WBF A;  2HWB 3;  2VTX A;  3AX4 A;  1W6P A;  4FT8 A;  4HK8 A;  4FPJ A;  3ZKU A;  1Q8V A;  1W9W A;  1IS3 A;  4QGL A;  3TN9 1;  1LOC A;  2LS6 A;  4PQ9 A;  2NZ9 A;  5FMB A;  2LRO A;  4NID A;  4WVV A;  2UWB A;  2HH9 A;  3AMM A;  5K7P A;  2HYK A;  4YVW C;  2OS2 A;  1DHK B;  1YFX A;  3CLP A;  1VBC 2;  4XCB A;  3S5Q A;  1QJF A;  5FPA A;  3O1U A;  3VBU A;  1UPS A;  3PVO A;  2LRP A;  3AZW A;  4PBO A;  4ZU5 A;  4HBN A;  1AYM 1;  3MW3 A;  3UET A;  3ZFG B;  4CP2 A;  1QJZ A;  4GIQ A;  3CDZ B;  1ZYB A;  1OLQ A;  3VD4 A;  1UX6 A;  5CYY A;  2ENR A;  4XF4 A;  1JI6 A;  1YO8 A;  4Q26 A;  5C9A A;  5FWE A;  2PLV 3;  1W6M B;  4QGN A;  4HZF A;  1HV0 A;  1Y3T A;  3AVS A;  5B4X A;  1IKP A;  4N9I A;  1UY2 A;  2WZE A;  3JBG 2;  5D2A A;  1D2Q A;  4AVV A;  4ZHN A;  3V65 A;  3UGG A;  4XAB A;  5EV7 A;  1NCQ C;  2ILM A;  3W9A A;  1XJA A;  2E6V A;  3GZA A;  3HAG A;  4OI0 A;  4AHX A;  2WFF 2;  2DTW A;  2YY1 A;  3ZXF A;  1G9A A;  2J1T A;  4RL7 A;  3VD3 A;  4CXW A;  5JSP A;  1MAC A;  2D93 A;  3C7E A;  5CFD A;  2JG8 B;  3E6B A;  2BEO A;  5IYY A;  5A7Q A;  3POI A;  1G9B A;  2ZGK A;  3KCY A;  1YQ5 A;  5FYY A;  4CCK A;  1N1T A;  5A3U A;  3HNB M;  3AJZ A;  2GN7 A;  1WCU A;  2CU5 A;  4QDR A;  3RI9 A;  1WA6 X;  2VBP A;  2W87 A;  3J26 N;  3IPV B;  4ERO A;  1W39 A;  2Y6K A;  3MUY 1;  1PMJ X;  3MIC A;  3D5O A;  1PNG A;  3ZFG C;  5FZO A;  1JYW A;  4CDQ A;  3QLQ A;  1F5F A;  3BTX A;  4COY A;  3T4V A;  1RMU 3;  2HWF 1;  3TWI A;  2WYS A;  4YG0 A;  1TQ5 A;  2H6B A;  1OLM E;  1LHO A;  4RYD A;  4K8R B;  3K48 A;  4A7Y A;  1AX0 A;  1QXP A;  4DIQ A;  4COW A;  1DGW X;  5CZK A;  4I01 A;  5FMO S;  4JRL A;  4FFI A;  1GBG A;  3AYE A;  3UV9 A;  5GZF A;  4DY3 A;  3AYD A;  4LIT A;  5H9P A;  3WEZ A;  3THD A;  1ULP A;  3HQU A;  1W6N A;  3V0A A;  1YIF A;  2BQP A;  1UY3 A;  3WQB A;  1YQ8 A;  1OOP B;  1D2S A;  5FOB B;  1BEV 1;  1J1T A;  4QX0 A;  3O1M A;  4WZC A;  1I5Z A;  1AJO A;  4AAX A;  1EY2 A;  1VBA 1;  2XDV A;  2QNK A;  1XBF A;  2GP5 A;  3ITQ A;  2OUJ A;  5FTT C;  5CG9 A;  1AYN 1;  1ZBE 1;  4GB3 1;  2F17 A;  3PU3 A;  2JXA A;  1BBT 1;  4CTE A;  1G8W A;  1LES A;  4P9L A;  1C28 A;  4QHB A;  5C6C A;  1ZZ8 A;  2CNA A;  4S2F A;  2OII A;  5LBB A;  4EV0 A;  1AL2 3;  2A6V A;  2P4E A;  2RDN A;  4FPL A;  5HCB A;  3ZN4 A;  5GLT A;  5A1L A;  3DYO A;  4NN0 A;  2JG9 B;  4LPL A;  5FUN A;  2A6Y A;  1C1L A;  4UYB A;  3T4H B;  3ZSK A;  4MOA A;  4F83 A;  1JZ7 A;  1CIY A;  4RD7 A;  5EFU A;  1VP6 A;  2HWD 3;  1YCI A;  3BAL A;  3THT A;  3PVN A;  2QQM A;  5FYI A;  2AGS A;  3PU8 A;  3KT1 A;  4TLG A;  3UKV A;  4HSL A;  4Z92 B;  1DDL A;  1TMF 3;  1QJY 3;  3ETQ A;  2RS1 1;  3M7A A;  4V2V A;  2OPW A;  4LBL A;  2VW0 A;  2NMN A;  5JLV A;  2J1S A;  2PYT A;  2XH6 A;  3WCR A;  1N1V A;  3VD7 A;  4A2U A;  3SMH A;  2JDN A;  4QQL A;  2VZU A;  3FX3 A;  4HON A;  1XNK A;  2PXJ A;  3LE0 A;  2GNM A;  3OPW A;  5BNP B;  3HOB A;  2OYZ A;  4LLO A;  1BYH A;  3OGV A;  5FUP A;  2YBS A;  1GZ9 A;  5BNO A;  2W46 A;  2JG8 C;  1D4M 3;  5C33 A;  3W58 A;  2E7T A;  2J1U A;  1N3O A;  4COV A;  1RIN A;  1XYN A;  2ZX1 A;  2Y6G A;  3H7J A;  5EJ3 A;  3RRD A;  5F3C A;  1XNC A;  2RS1 2;  3O1P A;  3BI3 A;  5H9Q A;  4YW7 A;  1REF A;  4AHY A;  5HCA A;  5DUW A;  2XBO 1;  2W68 A;  1O5L A;  1YFU A;  4ITC A;  3WW3 A;  4MXW B;  4BOW A;  2QBX A;  2UUR A;  4GH4 B;  4CCD A;  4DXS A;  4CU6 A;  2XB6 C;  3D4K A;  4GWJ A;  4XFH A;  1RUN A;  4Y20 B;  3OBA A;  3P6B A;  5BUV A;  2ZHL A;  1NUK A;  3O0W A;  4LNV A;  2Z5W A;  5DUX A;  5F2W A;  3ST7 A;  3VBS A;  1J59 A;  3JQX A;  2D6K A;  4Q4V 2;  4I0W B;  4QPY A;  3ASI A;  4XHB A;  1BBT 3;  1CZV A;  1HRV 1;  3ATG A;  4P00 B;  1Z7S 2;  4S2G A;  4YVW A;  2D3R A;  1MS4 A;  3I2D A;  3RVH A;  4Z8B A;  3QBQ A;  2Q8E A;  1SDW A;  2OVU A;  3AM2 A;  1SBD A;  1POV 3;  2ZEZ A;  3V0B A;  4P02 B;  5ACA 1;  3N7M A;  1RUF 1;  2ZAB A;  4K20 A;  1TME 2;  1BJQ A;  3OYW B;  4X8N A;  5JR7 B;  2YGM A;  3NV3 A;  1AR6 2;  5A6Y A;  4WM7 C;  2Y64 A;  3AKS A;  5FUI A;  1GQP A;  5LAT A;  1SCS A;  2W9X A;  2VZS A;  4N53 A;  4B4Q A;  2AZ5 A;  2W1U A;  4IND A;  1QIQ A;  3E1F 1;  1PNF A;  2QQO A;  3NQH A;  3NO8 A;  4L9B A;  4OUM A;  1H6Y A;  1R09 2;  1MS3 A;  2Q4S A;  2XJU A;  4MV2 A;  2YBK A;  4QM8 A;  1S0F A;  1IPS A;  1H8T A;  1WZX A;  4XJZ A;  4LKF A;  4RFT 0;  3LWC A;  5FCC A;  4L99 A;  4YZ2 A;  3H1W A;  5DDJ 3;  4AZZ A;  1YWK A;  3WG4 A;  2ZEW A;  3CF6 E;  1NX9 A;  2G9F A;  2GC3 A;  5JDB A;  2IVI B;  1I5P A;  3O0X A;  2D6P A;  2CL2 A;  4KWK A;  1EAH 2;  3C7G A;  1UYZ A;  3W21 A;  4IEZ A;  1RUI 2;  3DEC A;  4DRR A;  1W04 A;  2RMU 3;  5LA0 A;  3ELN A;  4WM8 B;  1YYN A;  1H9P A;  4YM1 A;  4M3C B;  4F7Z A;  2SLI A;  4B7K A;  4IEY A;  5D8A B;  2BFU L;  2WWJ A;  3OGG A;  5F2S A;  4B4R A;  2YYO A;  3OJB A;  3U14 A;  3NJY A;  1NCQ A;  2DTY A;  1S0J A;  2MEV 3;  3HEI A;  3IT8 A;  4MGK E;  3SC7 X;  2WKK A;  4N43 A;  3WP6 A;  4DY5 A;  2CAU A;  3B69 A;  1XPW A;  4Q0V A;  1E5H A;  5D8A A;  1ASJ 2;  4MLO A;  5FWJ A;  2J1A A;  5L73 A;  1ZBA 3;  1JZ3 A;  4FPY A;  3PVE A;  5LBF A;  5LBE A;  1LAJ A;  1GWK A;  2R06 2;  2YFU A;  2C5D A;  5CU1 A;  2R07 3;  1NQJ A;  1SPP A;  2RR1 2;  3MPB A;  1GKB A;  1BVP 1;  1DG6 A;  5A7S A;  4AGV A;  5AFE A;  3O7O A;  5A7W A;  1ONA A;  2DUR A;  1MVE A;  1STM A;  4W65 A;  1C8M 1;  2RS5 2;  3WNN A;  3PMS A;  2NN8 A;  1SFP A;  2DVG A;  3HWJ A;  3NL1 A;  5DZG A;  1WW4 A;  3M3Q A;  1D0H A;  3M2M A;  5HXM A;  5A33 A;  3WHU A;  3OUJ A;  2ARB A;  3LSE A;  3VZK A;  5KHG A;  1JXN A;  5DN2 A;  1PX3 A;  3AKP A;  4I02 A;  1VBD 1;  5F39 A;  4QGM A;  1GIC A;  3MIF A;  3POF A;  4XUN A;  1K12 A;  3A21 A;  2QQW A;  5CAZ A;  4WV8 A;  3AK0 A;  1MEC 2;  2C1F A;  3N9L A;  5EHD A;  1CAX B;  3O12 A;  5C8C A;  3H8X A;  4N53 B;  3MLL A;  3V64 A;  4COU A;  3S7I A;  2ZGU A;  3KHC A;  3KQ4 B;  1ULE A;  1VBD 3;  1L7Q A;  4UF0 B;  1DLL A;  3RS6 A;  5F1R A;  5J7M A;  3NRU A;  3LQC A;  4LO4 B;  2IXI A;  4R4Z A;  1SEF A;  2XJT A;  5FPU A;  4H7M A;  3ZYG A;  3I4I A;  3V0B B;  4ZZ8 A;  5FZD A;  3K3N A;  3BOW A;  3BIW E;  1GOG A;  3FE5 A;  4CP9 A;  1LNS A;  1W03 A;  4KU7 A;  1XNA A;  3CJX A;  1FMD 1;  3DKW A;  2A75 A;  2PFW A;  1BK1 A;  2VBD A;  4OI4 A;  1H2L A;  3CL1 A;  2VE1 A;  5F32 A;  1AL0 G;  2FD8 A;  4DPN A;  5KR7 A;  3DPR B;  2PHR A;  3OD0 A;  4BQW A;  5FZI A;  3F95 A;  4FI9 A;  1N47 A;  1CPM A;  3LIH A;  5JAX A;  1LEN A;  3C2U A;  5CIS A;  3RGB A;  1V0A A;  3T09 A;  2ZX2 A;  3PUI A;  5F7U A;  2V4V A;  4OUE A;  4NRP A;  4MGQ A;  4X6Q B;  3ZN6 B;  3MEP A;  4EN7 B;  3AKT A;  1RUI 1;  2VCC A;  2NPI A;  1JHJ A;  2AYH A;  4HVR A;  4IE6 A;  2H6C A;  3AKQ A;  4IV1 B;  2K0G A;  5FAX A;  1JTZ X;  1XB9 A;  3SXW A;  2ZMK A;  1BBT 2;  4LO8 A;  4RQP A;  3R6S A;  5GZC A;  5FYH A;  4AQ2 A;  1O3R A;  1WCS A;  4AVT A;  2QQI A;  3ZOI A;  4AED A;  4B7E A;  2PHX A;  4IE4 A;  3ECQ A;  4CPB D;  4RHV 3;  4XVH A;  5DZF A;  3MIB A;  1O7F A;  1YXW A;  2JIC A;  1WCD J;  1BMV 1;  3AP6 A;  4Q0U A;  4EJR A;  2IZW A;  2WNU C;  3KVA A;  2VD7 A;  5EYY A;  4YW6 A;  5IT6 A;  3NAP C;  2XJQ A;  3NJV A;  4DNY A;  2ZKL A;  4XF1 A;  3RMY A;  3AZX A;  4CDW B;  1HXS 2;  4HK9 A;  4JC1 A;  5ABJ B;  5CEH A;  1AYM 2;  4GMP 0;  5JZG A;  4XC9 A;  5L9B A;  3U0Z A;  1ND2 C;  1GZW B;  1H6X A;  3MIE A;  1UAI A;  4KWU A;  3HN3 A;  3ACL A;  4R9A A;  2OUH A;  5FRE A;  4YYO A;  1T6B X;  1WW6 A;  4AL9 A;  5ACA 3;  3JB8 A;  3JBG 1;  1UQX A;  4PLM A;  4QKD A;  4YZ1 A;  2B9U A;  5HV4 A;  1CZT A;  1NYW A;  2W1W A;  1J83 A;  2EIB A;  4OVE A;  1XNT A;  1SAC A;  4BMB A;  4DMI A;  1FPN 2;  3KCX A;  4W6Y A;  4N53 C;  2ATF A;  2XLA A;  1W9Y A;  4BHP A;  2JJ6 A;  2IWG B;  4CP9 B;  1QQP 2;  5GZD A;  3IDA A;  1VJ2 A;  1SLT A;  3T2P A;  3LA7 A;  3RWK X;  3ABZ A;  4FAH A;  4FPE A;  1XE7 A;  4YFZ A;  2HYX A;  1OLR A;  4AI9 A;  1LR5 A;  4Y26 A;  2CGO A;  5AFB A;  2WRA A;  4FQ4 A;  4A45 A;  1H1M A;  5KXB A;  2DVA A;  4GWN A;  3B94 A;  5JWP A;  3VKN A;  2ID4 A;  2WS9 2;  2OKX A;  3ZSL A;  3MFA A;  4XJU A;  2ZAC A;  2LUW A;  1OPM A;  1U12 A;  4LA2 A;  4QQP A;  3JD7 1;  2GN3 A;  2WC2 A;  2DU0 A;  5ANQ A;  3PUQ A;  3N7J A;  1W6N B;  2E31 A;  1PVC 1;  1J58 A;  2LW8 A;  3I54 A;  2LAL A;  3K2O A;  4UFI A;  4Y5S A;  5ERL A;  3H50 A;  2EAA A;  3AMH A;  3HR9 A;  4L0P A;  4D8M A;  4LT5 A;  2P2K A;  3P1I A;  5FYB A;  2WYF A;  3ZXK A;  4IE0 A;  1RUD 1;  4O9G A;  3USU B;  3OGJ A;  2EAL A;  4YVS B;  5CAD A;  4QX2 A;  1VLN A;  5KXC A;  2ARA A;  2XHK A;  2NLR A;  2CAV A;  4DO0 A;  3LOB A;  4UW5 A;  5LA1 A;  4LHK A;  5F3I A;  5D8A C;  1RB8 G;  2I2S A;  2WIN B;  5IVF A;  2W1S A;  3DV8 A;  3LA3 A;  3A0N A;  2XON A;  1B35 B;  3KQR A;  3OY8 B;  2D6L X;  4I30 A;  2D5F A;  4XBN A;  2WLQ A;  3BTZ A;  4E27 A;  1VBA 2;  4NHL A;  1D0G A;  4JRA A;  3IDE A;  2HWE 1;  1UMZ A;  1OVS A;  1LU2 A;  4QX5 A;  1YFY A;  1RYY A;  1GR3 A;  1KEX A;  3N9Q A;  4AVS A;  1UY1 A;  1IS6 A;  2PHU A;  2VVE A;  4UBG A;  3USS A;  5FK7 A;  4CSW A;  2G9G A;  1RL3 A;  2GP3 A;  2Z4F A;  4M0H A;  5FY9 A;  1RC6 A;  1HDK A;  3V56 A;  3R4S A;  1N1Y A;  3WF3 A;  4A6S A;  5HCH A;  3MZH A;  4BM8 A;  2BDR A;  3OGS A;  4GAL A;  2PAM A;  2VNO A;  2VU9 A;  4YVS A;  4AI2 A;  3R05 A;  4N43 C;  4JDO A;  4XUQ A;  5BNN A;  4AFD A;  4HKL A;  4RGA A;  3ZSM A;  1QDC A;  3AJY A;  1H4H A;  1LEM A;  4A3X A;  5J36 A;  1POV 1;  1W6M A;  5LCW L;  5A3P A;  4XOG A;  1O3T A;  2BWA A;  3DYM A;  2WR9 A;  1YJL A;  4I3G A;  3SCH A;  4DXZ A;  1QGL A;  1W8N A;  4GQ7 A;  3UT0 A;  2FZ1 A;  4E9K A;  4MGI E;  2AAC A;  1POQ A;  2FDH A;  2VMF A;  2PQQ A;  4IGO A;  4UFK A;  4FQZ A;  3AYA A;  1UXZ A;  1W3V A;  3NKT A;  5IK8 A;  3ACI A;  2W94 A;  4L11 A;  2Y26 A;  3ZFF A;  3I3E A;  3BPZ A;  5SV8 A;  5GLZ A;  1PMH X;  4D6Q A;  4YAR A;  1BZW A;  1C5I A;  2TUN A;  3ORJ A;  2FCT A;  4LIV A;  3MLJ A;  5FYT A;  3CZJ A;  2FMY A;  2RR1 3;  4FOV A;  4LKD A;  4XZP A;  4LMF A;  1RUF 2;  2R06 3;  1ZA7 A;  4WVW A;  3WG1 A;  1W8H A;  3MW4 A;  4NAM A;  4BJ0 A;  3GZT B;  1E5R A;  2B5H A;  4QB6 A;  3C8X A;  5HCF A;  3SIT A;  4BCU A;  2R49 A;  3HVD A;  3VLB B;  1HN1 A;  1VMJ A;  4ET7 A;  1U5X A;  2HWF 3;  1LJ7 A;  2Y33 A;  4IE5 A;  3G6J B;  5JZG B;  5BNP C;  5JXG A;  2R04 2;  2BP6 A;  3WLU A;  2E7Q A;  1V6K A;  1AX1 A;  2X09 A;  1NCR C;  4FP3 A;  4PI0 A;  3WW4 A;  4CDW A;  2GC0 A;  5F3E A;  1LKN A;  3VBO A;  4CCO A;  4HXC A;  3EQE A;  4XJA A;  5GLV A;  1LU1 A;  4LXL A;  3NAP A;  4OQ9 A;  2KM2 A;  1YRZ A;  4MH0 E;  3N4M A;  1EPZ A;  4XHX A;  1GNH A;  1VMF A;  1JOP A;  5EJZ B;  1MZF A;  3CZU A;  3FHQ A;  2RDR A;  1C5H A;  1Q8O A;  3HPN A;  3LDR A;  4YPJ A;  3TEZ A;  3IWZ A;  3NWK A;  3ON7 A;  1JS9 A;  1UIK A;  3PUA A;  1QXR A;  5CBL A;  2JG9 C;  4RGG A;  1VBC 3;  1X7N A;  2ZGP A;  4Q8L A;  4I0A A;  4A6O A;  5KHI A;  1NQD A;  2XUE A;  3GYD A;  1R09 3;  4IV1 A;  1ULF A;  2JB8 A;  2YU1 A;  4K8F A;  4Y3O A;  4YGD A;  4CCC A;  1TMF 1;  4DEQ A;  2Y6F A;  3M3E A;  1VRH 2;  4BYY A;  1LOA A;  1OMI A;  2ZKN A;  1OHF A;  1COV 1;  2ZTN A;  1AR9 2;  3Q8F A;  2HWB 2;  1YI7 A;  2Z42 A;  4TSV A;  2VPV A;  2JDK A;  5B2G B;  4CVU A;  4BQ2 A;  1WLW A;  5DUV A;  4UFJ A;  1K42 A;  1YC6 1;  1PGL 1;  1CAU A;  4RR3 A;  2LTN A;  4DXT A;  3QH6 A;  4TWT A;  1R1A 3;  1ZRR A;  1OA2 A;  1RUH 1;  2ZOE B;  4FFH A;  3KCC A;  4LE3 A;  5FJH A;  4Y1V A;  1REE A;  3LDK A;  1RVF 1;  2JD9 A;  1A8M A;  1G86 A;  3ZFF B;  3CJI A;  2DYC A;  4O61 A;  4UF0 A;  5KHH A;  3SEE A;  2J1E A;  1H4G A;  2VUD A;  4MX3 A;  3ZIX A;  3KLS A;  4AYU A;  4XFG A;  4NHY A;  5I93 A;  4YSF A;  1MPX A;  4AGR A;  1CPN A;  2VTX J;  2YC4 A;  4YLZ A;  4CZS A;  2ZGR A;  3ZMO A;  3OBT A;  5T3N A;  4D7S A;  5A6X A;  5C70 A;  5J48 A;  3RZH A;  1LHV A;  2BOI A;  3S7E A;  3AZY A;  4CU9 A;  5C4W B;  1V9U 1;  1FOD 2;  2X5I B;  3JU9 A;  3UKN A;  1W28 A;  2OXB A;  3BU7 A;  2XQR A;  3UYJ A;  1DZQ A;  3MFC A;  5J3U A;  3V0A B;  5I8S A;  1Z7S 1;  2GAL A;  5LB6 A;  5J98 B;  1DGR N;  3TN9 2;  5K0U A;  1WCQ A;  1ZRI A;  1RUF 3;  2HEW F;  1QOS A;  1WD4 A;  1EYB A;  3NV2 A;  4FSJ A;  3CO2 A;  1LOF C;  4A4A A;  3IMN A;  4CU7 A;  2VCM A;  3K77 A;  1RTV A;  1KGY A;  4L92 A;  1X36 A;  5ABJ C;  2PHL A;  4PJY A;  3BN6 A;  5FZ6 A;  4XFF A;  3TEW A;  1RJ8 A;  5G05 L;  1APN A;  1J3R A;  5FIX A;  2D7F A;  1VBC 1;  3A22 A;  2WSU A;  1O3Q A;  1HXS 3;  4R9B A;  2YC2 A;  1Y9Q A;  4RS5 A;  4DOU A;  3FN9 A;  3POB A;  4RN5 A;  1NCQ B;  3HBZ A;  3K4A A;  3P3P A;  3RI8 A;  5A6Q A;  2V72 A;  1R08 1;  5GLW A;  1Q8P A;  2VQU A;  2ARC A;  2Q1M A;  4H7L A;  5FZ8 A;  5JUV A;  4LBO A;  2XPJ A;  3RDI A;  1A8D A;  2JG8 A;  4HAN A;  4M3C A;  2VMD A;  1ZRC A;  2QFE A;  3FLR A;  4DUV A;  4HKW A;  4GAZ A;  3BYW A;  1HXS 1;  5IAV A;  4UFM A;  1CJP A;  2IXJ A;  1SBF A;  4KI5 M;  2ZGL A;  1R08 3;  2XQX A;  3R0R A;  2XR4 A;  4ISQ A;  4ZY9 A;  3USU A;  5BY5 A;  3MF9 A;  4HVO A;  5CFC C;  1ST8 A;  1RUG 1;  1GQG A;  4Q4W 2;  2XLG A;  3LFI A;  4TXW A;  1RMU 2;  3POE A;  4IL7 A;  1GUI A;  1GOH A;  2D3S A;  3WNX A;  4BK4 A;  2AC1 A;  2EAK A;  5CB7 A;  5F6K A;  3FC0 A;  3U78 A;  1H8T B;  4XFA A;  5C4W A;  4CCJ A;  4CUA A;  1XXN A;  2W3J A;  3Q8C A;  5A3O A;  5T52 A;  1WWY A;  3M3O A;  4E4D X;  1PO2 3;  4MHR A;  4AOC A;  2EXI A;  2YXS A;  2JDU A;  3PTY A;  3PTR B;  2Y60 A;  2JIG A;  3T08 A;  4FP2 A;  4FAG A;  1X9P A;  4UW4 A;  1HKD A;  2JE9 A;  3HT1 A;  5FYS A;  2WLP A;  3LF7 A;  4CEW B;  3OYW A;  4QU2 A;  4E2Q A;  3T2O A;  2OZJ A;  4AI3 A;  4NII A;  1DP0 A;  3VBU C;  5KWR A;  4JTO A;  1KXG A;  4FXG B;  5GM0 A;  3JBG 3;  1CZS A;  3RYP A;  4YGB A;  3N36 A;  3T3Y A;  4OHZ A;  2YFZ A;  4JGZ B;  3SCF A;  5AC9 2;  1CES A;  1S2E A;  4IEP A;  5IVJ A;  1YIP A;  2UY8 A;  3C7O A;  5FMD A;  1NXD 1;  2WL1 A;  2ZX0 A;  3G7D A;  1RXG A;  4FTS A;  2BVB A;  3FBM A;  4XJ9 A;  4CEY C;  2B46 X;  1OSG A;  2VW2 A;  3IB3 A;  4LOR A;  1VBA 3;  2TEP A;  2Y6L A;  3SH4 A;  1X82 A;  2JDZ A;  4JHZ A;  2DUO A;  2DBI A;  2ZZQ A;  3I2I A;  1WD3 A;  2IXK A;  3J7N A;  5BPX A;  3GCW A;  1S0B A;  2PAE A;  3EO6 A;  3AKR A;  1SG3 A;  3N9M A;  5A7N A;  5L7O B;  3WQ0 A;  1HQN A;  3S30 A;  4CP1 A;  5FZ9 A;  1PIV 2;  5FPV A;  1OUS A;  4CU8 A;  2ZJC A;  3J7H A;  1YNA A;  3TEX A;  1UYP A;  4YM0 A;  3BPS A;  3B3Q E;  4IV3 A;  3KV4 A;  2XML A;  3ES4 A;  1AXY A;  2WN3 A;  2XUM A;  1QHD A;  4UI9 L;  3AXD A;  5FP7 A;  5SV5 A;  1Q5O A;  4CPB A;  1K5M B;  1DLC A;  2VNR A;  4UXA A;  2VY0 A;  1GZT A;  4N90 A;  1ND3 A;  4GJY A;  4CDQ B;  2DVF A;  5FO9 B;  2HWC 3;  2ZGT A;  4QPI A;  4TN7 A;  4M4P A;  1IQD C;  3E5X A;  3QCW A;  2X8K A;  4QDQ A;  4AR2 A;  1EV1 3;  4B1M A;  5C8W A;  2JG9 A;  3ZYP A;  5FY5 A;  3ZO0 B;  4XPV A;  2W39 A;  3B5L B;  4BQ5 A;  1N3Q A;  1VRH 3;  1OH4 A;  2ES3 A;  1O6U A;  3OF1 A;  4HFS A;  4JGZ A;  1EUU A;  2PEL A;  4HPK A;  1QNW A;  1QMJ A;  4Q4X 1;  5DMY A;  3VDD B;  3I49 A;  1UXX X;  1OQ1 A;  3CMG A;  1VBB 3;  2Y6H A;  4JQR A;  1AR7 3;  3ZXL A;  1H2N A;  4CUB A;  5KHJ A;  3PHM A;  1F9K A;  1NXM A;  5C8C C;  3K46 A;  4N8M A;  5IW0 A;  4IXL A;  2MEV 2;  2N7G A;  4JGY B;  4QDS A;  4EE2 A;  2J1R A;  4CEW A;  3VBH C;  3ZLI A;  2C0Z A;  2R6Q A;  3UJO A;  1UWW A;  2PLV 1;  2WA3 A;  2VZV A;  4BH9 A;  4RR3 C;  1IQA A;  2VZQ A;  1W05 A;  2QQV A;  4NHX A;  4ZPI A;  1RUC 3;  3NV4 A;  1RXF A;  3IMM A;  3OBZ A;  4G9S B;  5A3L A;  5K9Y A;  2JDH A;  4Z07 A;  5C3S A;  4QXK A;  5IJR A;  1ENS A;  1RUJ 2;  4UW6 A;  5A3W A;  5JXJ A;  4ZXK A;  2GND A;  3CU7 A;  1J1L A;  5FKB A;  3UL2 A;  3MID A;  1V6M A;  3OEB A;  5EJ1 B;  3GZE A;  2K2S A;  1A6C A;  3RMX A;  3ZN5 A;  2XWB B;  4K1Y A;  5BNN B;  3KV5 A;  4LBJ A;  4ZZ5 A;  3KB5 A;  1AR6 1;  3WDX A;  4RHV 2;  4IES A;  2ZX4 A;  4AVA A;  3CIH A;  1TME 1;  3I3D A;  2ERF A;  2R04 1;  1UD1 A;  4OFG A;  2ZA9 A;  5B4N A;  2PMW B;  2E32 A;  1RUE 2;  2C9A A;  2OT7 A;  5T54 A;  1DYO A;  2J7M A;  1JW6 A;  1W06 A;  3GJB A;  1AR6 3;  4YW2 A;  5GZE A;  1OI6 A;  1TME 3;  2GC1 A;  2O8O A;  1GLH A;  1W8Z A;  3O1S A;  2YDE A;  1H0B A;  2GME A;  3HQX A;  3POW A;  4QPG C;  3ZIW A;  1JHN A;  3OY8 A;  4SBV A;  2XOM A;  5FBZ A;  3S5A A;  3WHT A;  1C1F A;  1VAL A;  4IEV A;  1H1A A;  3PUS A;  4CDX C;  1E5S A;  2HWD 1;  4PF1 A;  4JCK A;  3MDP A;  5FLJ A;  3THC A;  3QH7 A;  4BQ1 A;  4COZ A;  4YGC A;  2V4A A;  2R16 A;  3AMP A;  4Z1V A;  1DQ4 A;  5LY2 A;  4D69 A;  5K0U B;  1U5Y A;  1WMF A;  3KWV A;  4IGQ A;  5IFP A;  3H1Y A;  1BLZ A;  4CUG A;  1HB3 A;  1IS5 A;  3QD6 A;  2WNE A;  4EN6 B;  1GNZ A;  4MGT A;  1SFY A;  1CVN A;  4OZX A;  4MZU A;  4PLO A;  4CDU B;  5IVY A;  4P5Y A;  2VVF A;  1AR8 2;  3E97 A;  3LEI A;  5J09 A;  2XJV A;  2ZGQ A;  3ZXE A;  1MS8 A;  3IDC B;  2BZD A;  3AP7 A;  1V70 A;  5FZ0 A;  3KHB A;  1WLD A;  4DQA A;  1OD3 A;  3GF6 A;  5APA A;  2WWU A;  1GWL A;  2E7A A;  4R4X A;  2XL9 A;  4P9W A;  5HI0 A;  2RS3 2;  1R64 A;  1BKZ A;  2HJI A;  2W47 A;  2A70 A;  3THP A;  4B29 A;  4AW7 A;  4BWO A;  2JD4 A;  3C3V A;  1ZNP A;  4XTP A;  2VUL A;  2DVB A;  3B9I A;  2WT2 A;  4RR3 B;  2D98 A;  2W52 A;  1KQR A;  2BW8 A;  1VPH A;  2VUA A;  1IOA A;  1I9R A;  1NE4 A;  2HEY F;  2Q1F A;  5FY1 A;  4O65 A;  2DV9 A;  5H9R A;  5LAS A;  3ACF A;  4PDW C;  3OSD A;  3VHO A;  2VZ3 A;  3FHI B;  4NE9 A;  2RM2 1;  2WSV A;  4X6R B;  1QU0 A;  4NRM A;  3RZL A;  1UIJ A;  4IQP A;  3MW2 A;  3SQO A;  2VMH A;  1NLQ A;  2VZO A;  3GHM A;  4EZ4 A;  4UAP A;  5FYC A;  3U10 A;  5FO7 B;  2VM9 A;  3J8F 1;  4FFG A;  5FPB A;  5BNO B;  5F5Q A;  3ILF A;  3FFQ A;  4BLI A;  5FXZ A;  5L19 A;  2BVV A;  4C8D A;  5I0S A;  1Q3E A;  1T6G C;  4IV3 B;  4JV4 A;  4QXH A;  1GSL A;  1HQL A;  4CDQ C;  4Y4R A;  3BIE A;  2EXJ A;  3LEM A;  3APB A;  3K4Z A;  3ZFE B;  1CON A;  3KD4 A;  3KT7 A;  1KIT A;  3PME A;  2DCJ A;  1K5M C;  2AEN A;  1JUH A;  4RQP B;  5JPN B;  1PK6 B;  1NG0 A;  1DGR A;  1QF3 A;  2QCS B;  3H1M A;  5DQ0 A;  3GXU A;  4XUR A;  3M70 A;  3J9S A;  3MBW A;  4P9X A;  4ARY A;  3WUD A;  4QX7 A;  4GMP 3;  3I2F A;  2A3Y A;  4OZO A;  1BEV 2;  1UU6 A;  1AXZ A;  1LGN A;  1PIV 1;  1UZY A;  3FWE A;  3NNM A;  2W0X A;  4FO9 A;  4QB2 A;  4RFR B;  4FTE A;  3RYR A;  2YHJ A;  3ZYH A;  3PL0 A;  3OB8 A;  3QAC A;  1JZ4 A;  3VKL A;  1OKO A;  3DPR A;  4AQS A;  2CTV A;  5T5J A;  4E4H A;  3BU0 A;  5IVB A;  5CG8 A;  1LCL A;  1UY4 A;  3T0A A;  1DQ6 A;  2D6N A;  2QTW B;  3ZXJ A;  2GMM A;  4HG6 B;  4D7Y A;  4QM9 A;  4MG2 A;  4EN8 B;  4CYD A;  3WF2 A;  4CEY B;  1V6L A;  1SLC A;  1SLB A;  3HJR A;  3LPG A;  1MQT C;  2FDJ A;  1KS5 A;  5CKQ A;  1VMH A;  1OVP A;  1RUC 1;  4M0N A;  4QXB A;  2VMG A;  1YJK A;  1F4H A;  1B09 A;  2D3P A;  2NQY A;  3P5B A;  1RHI 1;  5LK7 B;  3VZO A;  1SQ4 A;  1L7R A;  2IC1 A;  1AR7 2;  3J7L A;  4QHO A;  4S2D A;  4GJZ A;  5FMC A;  4XIO A;  2A73 B;  3VN4 A;  2FDI A;  3H7Y A;  3Q9O A;  3SLI A;  4Q1R A;  3FLP A;  2JEM A;  2WII B;  2YUE A;  3KMH A;  3WW2 A;  1ASJ 1;  2RS3 3;  3MV1 1;  2PQS A;  3JQW A;  2JKB A;  5C3Q A;  4LBK A;  4P9G A;  2CGN A;  3O0V A;  5CKN A;  3H8R A;  4I09 A;  4ASL A;  5DUU A;  1W8F A;  1W6O A;  4XBL A;  1H8V A;  3VBR B;  5LZ6 A;  1RUC 2;  2VOW A;  4U36 A;  5EWS A;  4KWJ A;  4BQ4 A;  4NIH A;  1AL2 2;  3H3L A;  1RVF 3;  3L2H A;  4M01 A;  4WZF A;  3AVR A;  1PO1 3;  3L2Y A;  2KXL A;  4NJ4 A;  4AVC A;  2MEV 1;  1H8T C;  4Y1Y A;  1PHM A;  3ZXG A;  4FBF A;  3N9N A;  3ES1 A;  1H1I A;  1MS0 A;  4MUV A;  5T5P A;  3VBO C;  4AAP A;  1AJK A;  4W8J A;  1WMD A;  4FOQ A;  5DAB A;  4PQQ A;  1IZ3 A;  4AFB A;  4ASK A;  4OHV A;  2FCV A;  2FZ2 A;  4AED C;  3LKJ A;  1XNB A;  4J6G A;  2VXJ A;  3PDQ A;  2J22 A;  2O1Q A;  2BNN A;  3FFZ A;  2W2I A;  4KGQ A;  1HQW A;  2O14 A;  2WBK A;  4RS5 B;  5FPX A;  4WVM B;  4AHZ A;  3U11 A;  4FPG A;  3KGL A;  2ETE A;  2D5H A;  1Q56 A;  4HN0 A;  1R1A 1;  3QOP A;  4PIX A;  1DZR A;  1HN0 A;  1OH3 A;  5EPA A;  3ZDS A;  2B8M A;  4Y1Z A;  5IAX A;  1JYT A;  4XDO A;  4D7T A;  1SDD B;  3BB6 A;  4Y22 B;  3ZM8 A;  2X53 S;  2XHN A;  4YM2 A;  5C3P A;  4CCE A;  1XE8 A;  3U4X A;  4A3Z A;  3WX5 A;  3III A;  4DEV A;  3M4F A;  2D6O X;  1UKR A;  1QDO A;  2ADE A;  2VOT A;  4HL0 A;  4AEM A;  3OOX A;  5C9A B;  4MGZ E;  1O5U A;  4Y5Z 0;  1QJY 2;  4Q1P A;  5JMC A;  1O3S A;  5LRS A;  2QDN A;  2YPJ A;  4KBB A;  2DUP A;  2PHF A;  3KM5 A;  4XJ8 A;  1UNB A;  3LSD A;  3VHP A;  1AR9 3;  1HW5 A;  3R4U A;  2WNO A;  2EIG A;  4BQY A;  1IG0 A;  1Z78 A;  2EXH A;  5LEK A;  1QJX 3;  4NOT A;  5KC6 A;  1PX4 A;  3ZR6 A;  2QZ2 A;  2ZAH A;  2ORZ A;  3R4D B;  2R1D A;  2X10 A;  2X5I C;  3AP9 A;  4QPW A;  2A6X A;  1Y4W A;  5IVV A;  2D40 A;  4LUL A;  4JGY A;  3I97 A;  4ORF A;  4XAC A;  4BIO A;  3O1T A;  2DFB A;  1IS4 A;  2QQJ A;  2RR1 1;  4DB5 A;  1FAT A;  5GLU A;  1NT0 A;  2ET1 A;  4GKY A;  1S0E A;  1YQ2 A;  2R06 1;  3ETP A;  1VB2 A;  4OI2 A;  3OG2 A;  4QAW A;  3SH5 A;  1EAH 1;  1JOD A;  1M4W A;  1RUI 3;  2DCK A;  2GH2 A;  2WWS A;  4PLN A;  3VKO A;  1BK0 A;  4BQX A;  3ZFF C;  2DCY A;  2GMP A;  3NNL A;  1H2K A;  3VBS B;  2QQP A;  2OQ7 A;  1TMF 2;  2XXZ A;  1OA3 A;  3BUC A;  1WMX A;  2RJL A;  4ZKT B;  4MXW A;  3WQ7 A;  1DU3 D;  2F4P A;  1HRI 2;  3CQO A;  4JQT A;  4IW3 A;  1LOF A;  3W20 A;  4QPI B;  4BE3 A;  1ZRF A;  5AVA A;  3KZ4 C;  3WCS A;  4DUX A;  1CD3 G;  2QQN A;  1ND3 B;  5M0T A;  1URX A;  2CYF A;  2VOX A;  2HWB 1;  1WME A;  5BV6 A;  3IZO A;  4K9S A;  2K46 A;  4BIF A;  1OC1 A;  1F4A A;  4PIZ A;  2VTF A;  1TNF A;  1RUG 3;  1C3H A;  5E6H A;  1KJL A;  3RJR A;  1HRI 3;  3EBR A;  1VBE 2;  2A6W A;  5JSO A;  2FBE A;  5LY1 A;  1XYP A;  2WNV C;  4IER A;  1W0N A;  1W2O A;  2E9Q A;  3CHX A;  3NMB A;  4FPK A;  4LK7 A;  4AED B;  5IUQ A;  4WBB A;  3WDY A;  3ZDV A;  2YG0 A;  3C7H A;  1JYI A;  3NNJ A;  1HB1 A;  4URT A;  5L7O A;  3VDA A;  5F5A A;  1WBL A;  3VBO B;  2J42 A;  2ZS6 B;  3IN9 A;  4XIK A;  2RM2 2;  2K9Z A;  5JCT A;  4D6S A;  4B8E A;  4I2O A;  3FL7 A;  1NCR A;  3UJQ A;  2UYB A;  4KG0 A;  5LBC A;  3VBF C;  3J4U H;  4AVB A;  3UNP A;  4AI0 A;  5TSW A;  1YUD A;  4LKS A;  2MHF A;  4DXR A;  3VZM A;  1DYK A;  2WS9 1;  1FNZ A;  1S0I A;  3ZVX A;  3MIH A;  3WOG A;  5I0D A;  2WNV B;  2HEV F;  1JBC A;  3LAG A;  2AUY A;  5IK4 A;  1PGL 2;  2GAU A;  1BXH A;  2E51 A;  1R1Z A;  4NPM A;  4XE9 A;  1AYN 3;  4ATE A;  2RS1 3;  2A3W A;  3CNA A;  4XIL A;  4YZ3 A;  2AEY A;  4YRD A;  5FQ0 A;  5JZG C;  1YEW A;  3N7L A;  5E88 A;  2RMU 2;  2ZHK A;  1EUT A;  2EA7 A;  2ORX A;  3WF1 A;  1YLL A;  1V6I A;  2FQP A;  1UW8 A;  1ODM A;  1OQD A;  4S2H A;  5EYX A;  2RS3 1;  3ZXD A;  1FV3 A;  5ISL A;  4QPI C;  5EXO A;  3S57 A;  1NA1 C;  1HJG A;  2PHT A;  4Y4Y A;  4OI1 A;  2YZ4 A;  4XDQ A;  1AZD A;  2WQ8 A;  4YWA A;  5A32 A;  1MQT B;  3POJ A;  1D4V B;  2WZR 1;  5FZG A;  2QZ3 A;  3VBS C;  3E5Q A;  1HB4 A;  3JUU A;  4ZU4 A;  4LO7 A;  2ZMN A;  2VW1 A;  2WA4 A;  5DG2 A;  1OA4 A;  4D6R A;  5JOZ A;  4MYE A;  4NRQ A;  2E63 A;  3I7D A;  3RG0 A;  2E53 A;  1OOP A;  4OHX A;  2VBB A;  4TLF A;  1VBB 1;  5KBF A;  3WF0 A;  1FPN 1;  1RED A;  4FPC A;  1EPW A;  1AHS A;  3K75 B;  3AP5 A;  4P9Y A;  1XC6 A;  4M3C E;  5DAV A;  3UES A;  1TE1 B;  2AEZ A;  4HKO A;  1HRI 1;  1OXC A;  5L9R A;  3VBH A;  2P3K A;  1SMV A;  3SH3 A;  4QX1 A;  5D1I A;  3I3Q A;  3ZKY A;  4ZU7 A;  1SPP B;  1RUH 2;  4Q4Y 1;  4GXL A;  3T30 A;  5A3T A;  3DEM A;  1D4M 1;  2XJR A;  3WQ1 A;  4QT6 A;  3ZFE C;  3M1H A;  2E26 A;  5FLI A;  4N43 B;  5KXE A;  4L97 A;  3S6P A;  1G9D A;  1PO1 2;  1CR7 A;  5ABJ A;  2Z79 A;  3JXS A;  3WIN E;  2AH2 A;  5C9A C;  2B45 X;  3A0K A;  5JI9 A;  4QB1 A;  1C57 A;  1GNY A;  1W2N A;  4OHW A;  3PJQ A;  5T5O A;  5BNO C;  2EIE A;  4EN0 A;  4KL1 A;  4AXO A;  2NYY A;  1V9U 2;  3GDB A;  1R09 1;  3VZJ A;  1U0A A;  2JDY A;  2UWC A;  2XJS A;  4W50 A;  4UBH A;  5FJK A;  3WDT A;  4LA3 A;  1BHG A;  1DQ0 A;  1AXK A;  3M8L A;  2PHD A;  1PVC 2;  1XE0 A;  2CDO A;  3TYJ A;  4EZH A;  3HNM A;  5IAT A;  1RUJ 3;  2YB7 A;  4O7X A;  3MLK A;  4UWD A;  1OPO A;  1ACC A;  2VG9 A;  3BKZ A;  1D4M 2;  1QQP 3;  1B35 C;  5DDJ 1;  1NZC A;  3NVC A;  5EQU A;  1IGO A;  1FMD 2;  2DDU A;  3AZV A;  2IFR A;  4ISR A;  5CKM A;  5FZH A;  3IIA A;  3WT3 A;  4MET A;  3LDB A;  2VCA A;  2VH9 A;  1WUV A;  4RS5 C;  4CA9 A;  2R30 A;  3O14 A;  2X5I A;  4UOJ A;  4Y24 A;  1V6J A;  2CDP A;  2ZHM A;  4OCT A;  1W6Q B;  4F8A A;  1C4R A;  2RV9 A;  1GOF A;  1NOV A;  3WSO A;  2OW4 A;  3GBW A;  3W59 A;  4Y1X A;  3EXU A;  5KC5 A;  1PGW 1;  1RUH 3;  1YHF A;  1UY0 A;  4BQ3 A;  2WZR 3;  1QH7 A;  3U07 A;  5JSR A;  5A6Z A;  4P14 A;  3TNQ A;  3I2G A;  2XJP A;  2X29 A;  5CNA A;  1JZ5 A;  1DBN A;  1C8N A;  1LHU A;  3Q8E A;  5AVP A;  4CCM A;  3KF5 A;  4LO5 B;  2ARE A;  1RUO A;  5CA6 A;  4KWL A;  1OUX A;  3VBR C;  2OPK A;  2PHW A;  5E16 A;  4C0B A;  3FJS A;  2WFF 3;  3LOI A;  4Q5O A;  2Q5T A;  5HBA A;  1O59 A;  4QQH A;  1E57 A;  4JDN A;  4BDV B;  3GM8 A;  4XMI A;  1NLR A;  1KDM A;  2EF6 A;  1PZ8 A;  2QE3 A;  2RDS A;  4Q4Y 3;  3H9A A;  1KFX L;  3HIF A;  1UF2 C;  3AZZ A;  2P3I A;  4Y20 A;  2RE9 A;  2C4X A;  2GU9 A;  4Z2A A;  1WA4 A;  2DCZ A;  3D3A A;  4NWW A;  1GFF 2;  4JTN A;  3O1O A;  5K0U C;  1IKQ A;  4AQ6 A;  5AC9 3;  5DG1 A;  3PNA A;  2A6Z A;  2DCT A;  3UGH A;  1RJ7 A;  4A7Z A;  3OBR A;  4D3W A;  2WFF 1;  4BU2 A;  1J3P A;  5F6L B;  3AYC A;  1T2X A;  2P37 A;  4LHS A;  2VJX A;  4UFH A;  2OA2 A;  2QVS B;  4Q4Y 2;  4QX8 A;  4QX3 A;  2P3Y A;  3NST A;  4QWN A;  2HBT A;  5DAW A;  1DIW A;  1W99 A;  3MUZ 1;  1UOB A;  3WUC A;  3WXP A;  1DQ1 A;  2AR6 A;  3UK9 A;  2PTM A;  4QU1 A;  2R07 1;  3SKV A;  3KT4 A;  1W6Q A;  1XOY A;  4MGY E;  2RS5 3;  4CDW C;  3IDB B;  3A4U A;  2D6M A;  5IFT A;  3W5N A;  3NAP B;  3B00 A;  4LBQ D;  3AFK A;  1QXJ A;  1Y9G A;  4QXC A;  3IAQ A;  3PVB B;  1DQ2 A;  1LED A;  3ZN6 A;  3ZYR A;  4W4Z A;  5EIY B;  1FYU A;  1LEC A;  5I0U A;  2Q0A A;  3WNL A;  4HN1 A;  5BNN C;  2ARX A;  2VME A;  2Y0O A;  4UW3 A;  4ZXE A;  3LGR A;  3ILR A;  1R1A 2;  4E4Z A;  4E8C A;  5C5T A;  1X33 A;  4RGK A;  4ES9 A;  3PUR A;  1SZB A;  4IV3 C;  4IV1 C;  1MZE A;  2VZP A;  2BRT A;  3HD8 B;  4MSV A;  5FZL A;  2Y34 A;  3EHK A;  1OFS A;  1PMI A;  4BB3 A;  1UL9 A;  1X9T A;  3U37 A;  2V73 A;  1JUI A;  1ZRD A;  3F2Z A;  4LTA A;  1KFU L;  2ZML A;  3FUO A;  2WO2 A;  3MIG A;  5JOX A;  4IEU A;  3MYX A;  3ZMN A;  2FDK A;  3FZ3 A;  3SIS A;  3SNM A;  3VBH B;  3JD7 3;  1CAV A;  3FUQ A;  4ZS2 A;  5LRR A;  1Q43 A;  1KD7 A;  1ZBA 2;  4H2A A;  4NHK A;  2CY6 A;  2Q8O A;  4CUC A;  1CAX A;  1FPN 3;  1S2B A;  3VV1 A;  5C8C B;  1SLA A;  4LUK A;  4HMZ A;  3B7M A;  4CCL A;  3ZSJ A;  4YG3 A;  1WW7 A;  4KGG A;  1GP4 A;  2BV4 A;  2VGD A;  3GZU C;  3HN1 A;  3E6C C;  4P5H A;  3WP3 A;  2FCU A;  3H3U A;  1AX2 A;  4EN9 B;  1JYV A;  1LB2 A;  1AR9 1;  1UU5 A;  2XBO 2;  3RSJ A;  4AG4 A;  1PVX A;  1NY7 2;  3IKW A;  5FK8 A;  1MQT A;  2X05 A;  4GA9 A;  2A71 A;  4IGP A;  1YFW A;  1ULO A;  1X8M A;  1O91 A;  5K4L A;  5HPO A;  4Q4V 1;  5FPL A;  5A7W B;  3VDC A;  1XYO A;  1RHI 2;  2VQT A;  5I0R A;  1JOJ A;  2JEN A;  1HRV 3;  1ZA4 A;  1DYP A;  5FXV A;  4KG8 A;  5C3O A;  2R32 A;  1UO9 A;  2WZR 2;  4LO6 B;  4FPF A;  5EP9 A;  4YW1 A;  3UGF A;  5FQ0 B;  4MGS A;  1UOF A;  1DCS A;  3D6E A;  3NJZ A;  4KH9 A;  4PIY A;  4PHZ A;  5G04 L;  4I0B A;  2B42 B;  1S4C A;  3M3C A;  3SHR A;  1VBE 1;  3JB4 C;  2WNV A;  4LK6 A;  1OQE A;  1B35 A;  4IEQ A;  1OUR A;  1SLI A;  4CXY A;  3PUH A;  3CBN A;  1UOG A;  2EVX A;  4W6W A;  2WS9 3;  4WM8 A;  4JKM A;  5L7O C;  1MEC 1;  1FMD 3;  1YQC A;  5FBJ A;  5A7O A;  3B93 A;  4NHM A;  4YFW A;  4DS0 A;  1I1E A;  5FY4 A;  5FZM A;  4CDX B;  1VBE 3;  4QPG A;  5IHR A;  1CWP A;  4Q0P A;  5BYN A;  3WR0 A;  2OQ6 A;  4HLT A;  4NAO A;  5FY8 A;  1QJX 2;  4IEX A;  3IAP A;  3OUH A;  4XFI A;  2HWF 2;  3AP4 A;  4PI2 A;  1POV 0;  1V6N A;  2QQK A;  3A7Q A;  4IUG A;  1S2K A;  2VNV A;  4NVP A;  4XDP A;  3RFR A;  3D0J A;  2ZGS A;  2FDF A;  4HT1 T;  1UX7 A;  5FZE A;  5T50 A;  3NW4 A;  4W6X A;  3ZFG A;  2JDA A;  1UYY A;  1ZZ7 A;  2JDM A;  2RMU 1;  2VMI A;  2WAB A;  2W08 A;  4XQ4 A;  1U5Z A;  1G7Y A;  4K7J A;  5JPM B;  2V09 A;  3AMN A;  3VBU B;  2ZXQ A;  4RA0 A;  1F5J A;  5ACA 2;  3TBD A;  1UZZ A;  3BGA A;  2KD7 A;  1UZ0 A;  5FMO L;  5L36 A;  5JIA A;  1WLT A;  1FOD 1;  2W5F A;  1I6X A;  4G4F A;  1ZZC A;  1LRH A;  2HWE 2;  2CSG A;  3I2H A;  3NNG A;  5FZA A;  5HV0 A;  2I07 B;  2NMO A;  3I59 A;  2BGP A;  4JVA A;  2HWC 2;  1LOD A;  2CV6 A;  3BOD A;  4WM7 B;  5LW9 A;  5FP3 A;  4WM7 A;  1BEV 3;  1OFN A;  2RG4 A;  2UU8 A;  4Q4W 1;  4Q0S A;  1UZV A;  2WT0 A;  1BMV 2;  2GH8 A;  1DQ5 A;  2H0B A;  4GH4 A;  2XLF A;  1GZW A;  5FRA A;  5CFC B;  3LA2 A;  3VHN A;  2QQU A;  4CRQ A;  4L2N A;  2DBN A;  4B3N A;  1W0P A;  2FDG A;  2VXR A;  4JX0 A;  1TG7 A;  3KF3 A;  1CQ9 A;  2DVD A;  3KV6 A;  3WG3 A;  2Q8D A;  5F9T A;  1UOJ A;  2E33 A;  2G19 A;  1S0D A;  1N1S A;  1L7L A;  2XVL A;  3HQR A;  2NP0 A;  1QY4 A;  4BK5 A;  4EWD A;  1W8W A;  1MEC 3;  2WT1 A;  2QUO A;  3DL3 A;  4P9J A;  3DYP A;  3VDD C;  1OF3 A;  4K21 A;  1S55 A;  2G4I A;  1DF0 A;  4KNC A;  3ZPO A;  5FR3 A;  4Q4X 2;  3S0M A;  3WDV A;  1FV2 A;  5E1R A;  4AHW A;  2Y38 A;  4OLL A;  4R9D A;  1ZM1 A;  5FYV A;  3ZXA C;  1OKQ A;  4LJH A;  3GHN A;  3OPZ A;  2WQZ C;  3ZX7 A;  1F35 A;  2RVA A;  5J1X A;  2VC9 A;  4XTM A;  1ZX5 A;  1CX1 A;  3H0O A;  4KU8 A;  2B39 A;  1LOE A;  3MF6 A;  4FFF A;  1FT9 A;  5DDJ 2;  1VAK A;  2QQL A;  3HNY M;  3ILN A;  5A70 A;  1W3X A;  3H8U A;  2WJS A;  1ODN A;  5FZ1 A;  3WNP A;  4NIG A;  1S1A A;  5FKC A;  4WVM A;  1IHM A;  5LA9 A;  2WO1 A;  2BGC A;  5DXD A;  4CCN A;  3LEK A;  2BFU S;  3OUI A;  1JOB A;  2XVK A;  3GAL A;  2WNU A;  3WVJ A;  4BXS V;  1KJR A;  3H8O A;  3AL6 A;  4G3Y C;  3WNO A;  4MXV A;  1ZZ6 A;  1W9S A;  1OF4 A;  4QMA A;  4V1P A;  1SHW B;  1ZBE 3;  4GB3 3;  4XYX A;  4DFS A;  4E2G A;  1VB4 A;  4X8P A;  3TAY A;  5JMO A;  2VZT A;  1CN1 A;  4Z82 A;  3A23 A;  4PT6 A;  3ENR A;  1Q8S A;  1QWR A;  1PGW 2;  3HBK A;  1Z7S 3;  1RIT A;  3L9J T;  2ZZJ A;  2D44 A;  3ZR5 A;  3RPQ A;  3I2J A;  4LIU A;  1NA1 B;  3BCW A;  2ZBJ A;  1QJU 3;  3DCQ A;  3VHR A;  4JGZ C;  5GKA C;  2D97 A;  1O4T A;  2DU1 A;  2YRO A;  5DAX A;  5A33 B;  2CWM A;  4XAE A;  5FFO C;  2WAO A;  4JKK A;  4YZ4 A;  3ZSE A;  1AUY A;  2W95 A;  3GCX A;  2P6H A;  1CJD A;  3INA A;  2IXH A;  1CAV B;  1UMI A;  1GAN A;  4N9H A;  3LEG A;  5FP9 A;  1QJU 1;  4Q2F A;  2G9Z A;  5FY7 A;  1OOP C;  3N7K A;  4XZU G;  3DN7 A;  3EYP A;  3RZM A;  3J8F 3;  3M3I A;  2DFC A;  3FLT A;  2YMZ A;  2GDF A;  3TEY A;  5FZO B;  2WZP P;  3VBF B;  2BJS A;  2CHH A;  1UZW A;  4BLJ A;  4XCA A;  3IPV A;  4OYU A;  2R07 2;  4NR1 A;  4LLF A;  4XFC A;  1J3Q A;  2ZEY A;  1JZ8 A;  1HJF A;  2C26 A;  3BVC A;  2A7A A;  4TZD A;  1HX6 A;  2CGP A;  5ANN A;  3POG A;  3K3O A;  4E4S A;  1CX4 A;  5I91 A;  5LK5 A;  2B7Y A;  3MPP G;  1MS1 A;  1Y43 B;  1NCR B;  3B02 A;  1ZZB A;  2XVG A;  3BOP A;  3TNP B;  3ZYB A;  4GMP 1;  1VIW B;  4C90 A;  2VEC A;  2C9K A;  1VAM A;  1PK6 A;  1QOT A;  4LEJ A;  4M00 A;  3WDU A;  2JB4 A;  1ND2 A;  4AEJ A;  3VZN A;  4J1X A;  1LGC A;  1ZBE 2;  4GB3 2;  3WP4 A;  3DKQ A;  4N7I A;  2BPA 2;  1ND3 C;  2VZR A;  4XJW A;  4YW5 A;  2F4L A;  2IUW A;  5FV3 A;  4XMA A;  4LR4 A;  4M4R A;  4GWI A;  4H14 A;  4YW3 A;  4LOT A;  2WFP A;  2BNO A;  4ATF A;  3RZK A;  5LEJ A;  2VCB A;  4KMQ A;  1MS5 A;  2A1X A;  1ZVF A;  3P3N A;  3IM0 A;  1OD5 A;  5FZ4 A;  4CE8 A;  4NRO A;  1UCX A;  5IWF A;  5JOY A;  2UWA A;  3URF A;  5IVE A;  1EP0 A;  1H30 A;  1W0O A;  3Q8A A;  3TRS B;  4YG6 A;  4YZ5 A;  4JDM A;  3T1L A;  4GZ9 A;  1UKG A;  4AF9 A;  3AB0 A;  1I3H A;  1W6P B;  4EQV A;  1WCK A;  2Z2S B;  4FCA A;  2VMC A;  1ASJ 3;  5JIU A;  3CEW A;  4B1L A;  3WDW A;  1UN1 A;  2VOK A;  3WNK A;  1S0G A;  4YVW B;  5JXI A;  1GV9 A;  2R7E B;  1AYM 3;  1TNR A;  4K40 A;  1ENX A;  3B01 A;  1QNY A;  5C4W C;  1V6O A;  3T0B A;  2R0F A;  1JYC A;  2ET7 A;  4LKE A;  1C8M 2;  2RJK A;  4NUB A;  4BA6 A;  2Q30 A;  3I59 B;  2GNB A;  1ULC A;  4XQW A;  1FI2 A;  2D43 A;  2ZPX A;  1JYX A;  5A7P A;  3KSC A;  2ADD A;  2VZ1 A;  1IG3 A;  4TYS A;  4AEK A;  1LUL A;  1O4Z A;  1AVB A;  5FPZ A;  3KV9 A;  1DGL A;  2P17 A;  3PIG A;  1NY7 1;  4DUW A;  2I74 A;  4PDW A;  2EXK A;  4FOW A;  4NPR A;  3SEP A;  1NLS A;  1ENQ A;  1QH6 A;  1WGP A;  4R52 A;  2VUJ A;  4RHV 1;  5EZW A;  4QQO A;  2JX9 A;  5BNP A;  4IEO A;  2ZHN A;  3ZYF A;  2PAK A;  4PF5 A;  4AFM A;  2WO3 A;  1GWM A;  4F3J A;  3BTY A;  3DUI A;  1FAY A;  2EIC A;  1W8T A;  4XF0 A;  4ARX A;  1RMU 1;  5JI7 A;  1SBE A;  2Z69 A;  5DAQ A;  3I2O A;  1RUG 2;  2R1B A;  3VL9 A;  2Q8C A;  3X29 B;  3POY A;  4Y22 A;  3MGU A;  1XND A;  3DF0 A;  4PBP A;  4YVS C;  5H9S A;  4A44 A;  3D8C A;  3VZL A;  5GJ6 A;  2O8Q A;  1AR8 3;  1YQ6 A;  2PN5 A;  1VR3 A;  2PLV 2;  4FPO B;  4M3C F;  4YGE A;  1VBB 2;  3RQ0 A;  4BXF A;  4FOY A;  3LFM A;  1P8J A;  4FTB A;  5DAP A;  2IXC A;  2VUC A;  4CXX A;  4E8D A;  5F5C A;  3C7F A;  4DZG A;  1CAW B;  1NE6 A;  4FPH A;  3JCI A;  3VBF A;  1COV 2;  4OHY A;  3WW1 A;  5JOW A;  4OUL A;  1QJX 1;  1XSR A;  3MHZ A;  1N3P A;  2WQ4 A;  2HKX A;  5A1A A;  5A3N A;  3D82 A;  4IET A;  4UFL A;  3ZYI B;  1UPI A;  1OLM A;  2JIJ A;  5AC9 1;  4MO3 M;  1GZC A;  4XBQ A;  3I3M A;  4DRV A;  4URA A;  1W9T A;  1LGB A;  1ZZ9 A;  3WP5 A;  1ENR A;  1RIR A;  2WAA A;  5GZG A;  1X8E A;  2GNT A;  3PIJ A;  1SFN A;  3LZZ A;  5FZF A;  2A3X A;  5IK7 A;  1Q8Q A;  1W6O B;  3VBR A;  1X50 A;  1PO1 1;  4LBM A;  1EAH 3;  1RUE 1;  4XUP A;  2NM1 A;  2HWC 1;  2FHR A;  5FXW A;  4XAA A;  1GQH A;  3CJI C;  1UMH A;  1E5I A;  5A1F A;  1NA1 A;  4HET A;  3OEA A;  3I2K A;  5JXH A;  1BVV A;  1CIW A;  5FLH A;  1LHN A;  2XL7 A;  2YPD A;  2C6S A;  5A32 B;  2BNM A;  5F5I A;  5IK5 A;  2JDP A;  4XF3 A;  4D94 A;  3AFG A;  3WZ1 A;  1MZ5 A;  4JAA A;  4O9E A;  4PCR A;  4XEZ A;  1FOD 3;  2BYV E;  3RNS A;  3VD5 A;  4A7K A;  3ACH A;  4JZR A;  5DPN A;  5FYZ A;  4YNI A;  4QKN A;  5FYU A;  4B4P A;  4AFA A;  1FNY A;  1PM4 A;  1QJY 1;  4FXK B;  1AR7 1;  4LE4 A;  4AQT A;  5I8T A;  1RVF 2;  4WVZ A;  4XUT A;  3GNE A;  2V5Y A;  3KGZ A;  4N7U A;  2WNU B;  2L9L A;  4QHZ A;  2RHP A;  1FX5 A;  1NKG A;  4OQ8 A;  2HWE 3;  1JN2 P;  1QEX A;  3LCP A;  3T2Q A;  2CWS A;  4GWM A;  2VL4 A;  1LOB A;  4AK3 A;  1PK6 C;  3N35 A;  2BER A;  1GYK A;  2YBP A;  4RQP C;  1EV1 1;  2OX0 A;  1US3 A;  1W2T A;  5JVV A;  5CFD B;  4DIN B;  4CP0 A;  4TTG A;  2KA3 A;  3WF4 A;  2Y8K A;  1DZT A;  3VB9 A;  1D7P M;  1PZ7 A;  2W92 A;  5DZE A;  4NMI A;  1RUJ 1;  3KS7 A;  4XUO A;  1KRI A;  1VRH 1;  3H42 B;  1QJU 2;  2P1B A;  2BGO A;  3GBF A;  1QJE A;  2P34 A;  4RSU A;  2XKP A;  4NIA A;  5IVC A;  1LHW A;  3VD9 A;  5C71 A;  3VL8 A;  3NNF A;  1UYX A;  3ZFE A;  5J96 B;  2JE7 A;  2YC0 A;  2C24 A;  3DPR C;  1HLC A;  4LBQ A;  3RZZ A;  3U4S A;  5CIR A;  4QKF A;  4XW3 A;  4HSJ A;  1JH5 A;  5FZK A;  3ALQ A;  2YU2 A;  3WD5 A;  2P3J A;  2BU9 A;  3NV1 A;  4UT5 A;  5FP8 A;  4AE2 A;  1WKY A;  1EV1 2;  1TVG A;  2J1V A;  1HB2 A;  4LOS A;  1IPK A;  4HVQ A;  1F31 A;  2RDQ A;  2RJ2 A;  4Q4W 3;  3AC0 A;  1VRB A;  4Q0Q A;  4PDW B;  5KXD A;  2WZ8 A;  1PZ9 A;  2IFW A;  2ZEX A;  4K3U A;  1RUE 3;  5FZ7 A;  2JEC A;  4C0H A;  2VVD A;  5I0T A;  4H3W A;  3FHA A;  4Q4V 3;  3JZV A;  3VDB A;  2TBV A;  4XET A;  2BBV A;  2BTV C;  4U2A A;  4GUL A;  4LUM A;  1YI9 A;  3E6D A;  3IBM A;  4J1W A;  1GP6 A;  3ROU A;  5CFC A;  4QD2 A;  2O0O A;  3EMR A;  3GJA A;  4AWD A;  1S0C A;  1JZ6 A;  3K51 A;  4XXP A;  1GMM A;  4SLI A;  3RYK A;  2HWD 2;  1MS9 A;  2OZ6 A;  1AL2 1;  2I45 A;  2JE8 A;  2Q1Z B;  3LD8 A;  4P9I A;  4IE7 A;  3FBY A;  2IXL A;  1BCX A;  1ZBA 1;  4C91 A;  4HOO A;  1K45 A;  4V2W A;  3SCG A;  5JR2 A;  2DWR A;  2Y0I A;  4C1W A;  3LPF A;  5CVR A;  3RJ2 X;  2MPF A;  4CDU C;  2WDB A;  4AI8 A;  2XBO 3;  4H55 A;  5T5L A;  4GD4 A;  2YV8 A;  4Q4X 3;  1PM7 A;  1SCR A;  3N9O A;  4R9C A;  3I8T A;  3ZPY A;  5K8S A;  3RZG A;  1JZ2 A;  3AL5 A;  2R0H A;  4Q27 A;  4P08 A;  1JYN A;  1PO2 1;  3ZYJ B;  5L9V A;  3KVB A;  3OD4 A;  4JHT A;  3B9C A;  1Z0H A;  3AXE A;  1SLL A;  1HIX A;  4CDU A;  4E2S A;  2W91 A;  1R08 2;  2MNG A;  5A80 A;  2KR2 A;  4BZ4 A;  2GC2 A;  3ME2 A;  4OMC A;  3DXU A;  4GKX A;  2B9V A;  1L3J A;  4L8Q A;  4LBQ B;  3T2T A;  1QOO A;  1PIV 3;  2BOJ A;  1ND2 B;  2WO7 A;  1W2U A;  2WN2 A;  4QPG B;  4Y1U A;  4KBZ A;  3BTA A;  5FY0 A;  4CDX A;  3O5S A;  4ES8 A;  4D0Q A;  2QDR A;  1O8P A;  1QQP 1;  1W90 A;  1G6N A;  5FDB A;  4ONU A;  5F37 A;  1BQP A;  2G1M A;  3ACG A;  5BNQ A;  2ZGN A;  5KHK A;  1NZI A;  2PA7 A;  2RM2 3;  1VBD 2;  3I3B A;  4EYU A;  1RGS A;  3GGL A;  1QKQ A;  4IEW A;  1J84 A;  3N3H A;  1TEI A;  1O8S A;  1KS4 A;  1UU4 A;  5CFD C;  3N9P A;  2VQA A;  3W5M A;  2P5B A;  1MR5 A;  2ZCW A;  4LBN A;  2BWC A;  1ULD A;  1AYN 2;  2XKO A;  4ASM B;  4ZS3 A;  2SBA A;  2ZX3 A;  1OT5 A;  3VGI A;  2Y6J A;  2H0V A;  3EJK A;  1H2M A;  2BUK A;  1RUD 2;  3VUO A;  1JU3 A;  4Y5T A;  3TB0 A;  1F8V A;  3GBG A;  1COV 3;  4LQR A;  5FP4 A;  4Q29 A;  3U75 A;  4MVT A;  1U5I A;  3WV6 A;  4BPZ A;  3K4D A;  4XFB A;  1VE0 A;  1V9U 3;  5LA2 A;  5HXV A;  2VOV A;  4K1Z A;  4NPL A;  1ALY A;  1K3I A;  3HT2 A;  1LTE A;  4JGY C;  3TOJ A;  5FOJ B;  2QJV A;  1TZO A;  4FVV A; 
#chains in the Genus database with same CATH homology
 1UYY A;  2E31 A;  2LW8 A;  2WAB A;  1GU3 A;  3WNP A;  4A42 A;  5C71 A;  4D8M A;  4L0P A;  2DCJ A;  4JKL A;  2ZXQ A;  3P1I A;  2HLE A;  3BGA A;  2KD7 A;  1UZ0 A;  5DQ0 A;  3GXU A;  4XUR A;  4QX2 A;  3MBW A;  1JU4 A;  4ARY A;  2W5F A;  1NAE A;  3I2F A;  4OZO A;  5LA1 A;  3I2H A;  3NNG A;  4QB2 A;  2W1S A;  3OB8 A;  3CKH A;  1JZ4 A;  2XON A;  2BGP A;  3MV0 1;  1UY4 A;  3T0A A;  3WNM A;  2V5D A;  4HG6 B;  2BBA A;  4A41 A;  3WF2 A;  1RYY A;  1KEX A;  1UY1 A;  3HJR A;  3LPG A;  2Z4F A;  2W1Q A;  3NJX A;  1F4H A;  3WF3 A;  3OGS A;  4JX0 A;  3SKJ E;  3EB7 A;  2VO5 A;  1TG7 A;  5I0D A;  1L7R A;  2E33 A;  4MAD A;  4XUQ A;  4BK5 A;  2JKX A;  1W8O A;  3DYP A;  5LCW L;  1OF3 A;  3MV1 1;  2WUH A;  3DYM A;  2PQS A;  4OMD A;  1W8N A;  2VMF A;  2VR4 A;  1UXZ A;  2RVA A;  5J1X A;  1US2 A;  2VC9 A;  3ACI A;  2W94 A;  1CX1 A;  3I3E A;  1PMH X;  3MO4 A;  2QQL A;  3HNY M;  4W8J A;  3CZJ A;  3T0D A;  4PQQ A;  2EID A;  2WO1 A;  4BJ0 A;  2B4K A;  2J22 A;  3OGR A;  5C7G A;  3LEK A;  2WBK A;  4QB6 A;  3C8X A;  4BXS V;  1HN1 A;  1W9W A;  3WNO A;  4ET7 A;  1W9S A;  1OF4 A;  1SHW B;  2LS6 A;  1SDD B;  3ZM8 A;  5JXG A;  5JMO A;  2X09 A;  2VZT A;  2XHN A;  3A23 A;  4PT6 A;  4A3Z A;  3III A;  4DEV A;  3UET A;  3I2J A;  2VOT A;  3CDZ B;  5EJZ B;  3VD4 A;  3CZU A;  3FHQ A;  5CYY A;  3HPN A;  1JI6 A;  4YPJ A;  5B4X A;  1UY2 A;  2WAO A;  2WZE A;  4JKK A;  2W95 A;  1PX4 A;  4A6O A;  2ORZ A;  1UMI A;  2X10 A;  3LEG A;  4DEQ A;  4QPW A;  3I97 A;  4XZU G;  2J1T A;  3EYP A;  3VD3 A;  5IYY A;  2QQJ A;  3C7E A;  1YQ2 A;  3ETP A;  4CVU A;  3OG2 A;  3HNB M;  4QAW A;  1JZ3 A;  2DCK A;  4OYU A;  4QDR A;  2W87 A;  1K42 A;  3MUY 1;  2Y6K A;  1PMJ X;  2ZEY A;  1JZ8 A;  2C26 A;  1JYW A;  4DXT A;  2WYS A;  3CQO A;  2JD9 A;  4RYD A;  3SEE A;  4DUX A;  2C9K A;  2J1E A;  2QQN A;  5CZK A;  1F4A A;  3WEZ A;  1MPX A;  3THD A;  1ULP A;  2VTF A;  2YC4 A;  3WQB A;  5C70 A;  1UY3 A;  2VZR A;  4CU9 A;  4M4R A;  4GWI A;  4QX0 A;  1W0N A;  2YG0 A;  3C7H A;  2VCB A;  4KMQ A;  4AAX A;  1WCQ A;  3VDA A;  4A4A A;  4CU7 A;  3K77 A;  1KGY A;  3FL7 A;  3UNP A;  3BN6 A;  4GZ9 A;  5G05 L;  4LKS A;  4DXR A;  2VMC A;  3A22 A;  2YC2 A;  3WNK A;  5JXI A;  2R7E B;  3FN9 A;  4RN5 A;  3K4A A;  2V72 A;  3T0B A;  2VQU A;  3DYO A;  5JUV A;  4LPL A;  2VMD A;  1EUT A;  2ORX A;  4MOA A;  3WF1 A;  4DUV A;  1JZ7 A;  1CIY A;  2QQM A;  1JYX A;  2VZ1 A;  4KI5 M;  2XQX A;  4ZY9 A;  2WQ8 A;  4DUW A;  2J1S A;  3SEP A;  3VD7 A;  4TXW A;  1GUI A;  1GOH A;  4BK4 A;  2VZU A;  3LE0 A;  3HOB A;  4CUA A;  2WO3 A;  3OGV A;  2W3J A;  3WF0 A;  2W46 A;  2EIC A;  3K75 B;  1XC6 A;  2J1U A;  4ARX A;  3UES A;  3T08 A;  2Y6G A;  4QX1 A;  3T2O A;  4A44 A;  4CU6 A;  1DP0 A;  2QBX A;  4DXS A;  4GWJ A;  3OBA A;  3P6B A;  1CZS A;  2E26 A;  1NUK A;  1P8J A;  2YFZ A;  4E8D A;  3JXS A;  3C7F A;  1CZV A;  4P00 B;  4QB1 A;  1GNY A;  3C7O A;  2EIE A;  5A1A A;  3GDB A;  2ZEZ A;  4P02 B;  3IB3 A;  4W50 A;  2Y6L A;  1BHG A;  4JHZ A;  4MO3 M;  2CDO A;  3I2I A;  3HNM A;  2YB7 A;  2Y64 A;  1W9T A;  2WAA A;  1SG3 A;  5FUI A;  1GQP A;  2W9X A;  2VZS A;  2W1U A;  3E1F 1;  2DDU A;  2QQO A;  3NQH A;  1H6Y A;  4CU8 A;  2VCA A;  3J7H A;  4XUP A;  4UOJ A;  2CDP A;  1UMH A;  2RV9 A;  3OEA A;  1GOF A;  2WN3 A;  3I2K A;  3WSO A;  5JXH A;  4UI9 L;  1UY0 A;  1DLC A;  2ZEW A;  1NX9 A;  1I5P A;  3I2G A;  3VD5 A;  3C7G A;  3ACH A;  1UYZ A;  5DPN A;  4M4P A;  1JZ5 A;  1IQD C;  3DEC A;  4QDQ A;  5LA0 A;  4XUT A;  2L9L A;  1NKG A;  1OH4 A;  3T2Q A;  1O59 A;  3HEI A;  1EUU A;  3GM8 A;  4BDV B;  2VL4 A;  5DMY A;  1XPW A;  2BER A;  1UXX X;  3CMG A;  2Y6H A;  4CUB A;  2J1A A;  2C4X A;  4Z2A A;  1US3 A;  3D3A A;  3K46 A;  4TTG A;  2YFU A;  3WF4 A;  2Y8K A;  1D7P M;  2W92 A;  4QDS A;  2J1R A;  4XUO A;  2BGO A;  1T2X A;  1UWW A;  2VZV A;  4LHS A;  2VJX A;  3WNN A;  4QX3 A;  3VD9 A;  2VZQ A;  1UYX A;  5HXM A;  1W99 A;  3MUZ 1;  5DN2 A;  1PX3 A;  5IJR A;  3SKV A;  5JXJ A;  4XUN A;  1K12 A;  3A21 A;  1WKY A;  1TVG A;  2J1V A;  3OEB A;  5EJ1 B;  2RJ2 A;  5IFT A;  3AC0 A;  3W5N A;  2WZ8 A;  2ZEX A;  4ZZ5 A;  3IAQ A;  3FHA A;  3VDB A;  3CIH A;  1L7Q A;  3I3D A;  3NRU A;  3LQC A;  4W4Z A;  5EIY B;  5B4N A;  4ZZ8 A;  3WNL A;  2E32 A;  2VME A;  4ZXE A;  4E8C A;  1GOG A;  1DYO A;  1LNS A;  2J7M A;  1JZ6 A;  1XNA A;  1GMM A;  2VZP A;  2JE8 A;  3U37 A;  2XOM A;  4FI9 A;  1K45 A;  5JR2 A;  3T09 A;  3F2Z A;  3PUI A;  3LPF A;  5F7U A;  2WO2 A;  2V4V A;  4OUE A;  2WDB A;  4MGQ A;  4PF1 A;  2VCC A;  3THC A;  1JHJ A;  4CUC A;  1JZ2 A;  4P08 A;  5IFP A;  1JYN A;  2QQI A;  3ECQ A;  2W91 A;  4XVH A;  1JYV A;  4OMC A;  4P5Y A;  2B9V A;  3LEI A;  4AG4 A;  2BZD A;  2X05 A;  3NJV A;  1ULO A;  2WN2 A;  5HPO A;  1OD3 A;  4D0Q A;  3VDC A;  1R64 A;  1O8P A;  2VQT A;  2W47 A;  1H6X A;  3ACG A;  4KWU A;  3HN3 A;  3I3B A;  4MGS A;  5G04 L;  1CZT A;  3GGL A;  2W1W A;  1J83 A;  2EIB A;  1XNT A;  1J84 A;  1O8S A;  3ACF A;  3PUH A;  2VZ3 A;  3IDA A;  3W5M A;  4JKM A;  3T2P A;  3ABZ A;  1OT5 A;  2Y6J A;  2HYX A;  2VZO A;  5IHR A;  4UAP A;  1JU3 A;  2VM9 A;  3IAP A;  4A45 A;  4LQR A;  2QQK A;  3A7Q A;  4IUG A;  2ID4 A;  3K4D A;  2OKX A;  5LA2 A;  1UX7 A;  1K3I A;  2JDA A;  3K4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...