4OYUA

Crystal structure of the n-terminal domains of muskelin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
MECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNYPPQYLILKLERPAIVQNITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHKIDEQMFPCRFIKIVPLLSWGPSFNFSIWYVELSGIDDPDIVQPCLNWYSKYREQEAIRLCLKHFRQHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muskelin
publication title The LisH Motif of Muskelin Is Crucial for Oligomerization and Governs Intracellular Localization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 47
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4oyuA00
1SG3A 3OBAA 1HN1A 2J1VA 4BK4A 5EIYB 4M4PA 3P1IA 2BGOA 5IFTA 4CU7A 2VMDA 4ARXA 1T2XA 2YFZA 1UXXX 1JYNA 2VO5A 3HOBA 1UZ0A 3T2QA 2CDOA 3LEGA 3VDCA 5C7GA 2WAOA 1OD3A 2HYXA 2VZVA 2X05A 4QX0A 2BBAA 4XUNA 5J1XA 2RJ2A 2XQXA 3WNOA 4XZUG 1GOFA 2Y6GA 3CDZB 3C7HA 5JR2A 4JKLA 3I3BA 3NJVA 4OMDA 3I97A 4JKKA 4QB6A 2VZRA 3J7HA 4RN5A 4BXSV 1XNAA 3T2OA 1UYYA 2QQIA 1UY3A 4DUVA 1UYXA 1RYYA 3VD3A 1F4HA 2E33A 2JE8A 1L7RA 1XPWA 2J22A 2X09A 1JYVA 2L9LA 5JXHA 2PQSA 3PUHA 3FL7A 1PX3A 3MO4A 4A6OA 3HEIA 1OT5A 4XURA 2J1UA 3T2PA 1GMMA 2CDPA 2DCKA 5B4NA 1JHJA 2C9KA 2J1SA 3WF2A 2WO3A 3I2HA 3IDAA 3VDAA 1W9WA 2XONA 1H6XA 4KI5M 2YFUA 3DYPA 2VZSA 4ZZ5A 4P08A 2QQJA 4A45A 3W5MA 1J83A 3NRUA 2Y64A 3WSOA 4AG4A 4AAXA 5A1AA 4LPLA 3IB3A 3WEZA 4CU6A 1JZ3A 4DEVA 3OEAA 1YQ2A 3CQOA 2WABA 3EB7A 2VTFA 2DCJA 1F4AA 1UMHA 1MPXA 3F2ZA 4OMCA 4DUXA 2JDAA 5JXGA 2Y6HA 2OKXA 1K12A 1W9TA 3A21A 4CUBA 2W1WA 1W8OA 2VOTA 3WNNA 1US3A 3CZUA 2ORZA 3IAQA 3ACIA 1GOHA 5IFPA 4XUOA 5C70A 1PMHX 4UOJA 5F7UA 1P8JA 2YG0A 1KGYA 3DYOA 1OF3A 4JKMA 3ACFA 1K3IA 4MADA 4YPJA 4LHSA 1L7QA 3LPGA 2J1AA 3A23A 2EIBA 3DYMA 3SEPA 4QAWA 2B9VA 2VZ1A 2Y8KA 2WBKA 4UI9L 2J7MA 2WQ8A 1GNYA 3EYPA 4JHZA 1UXZA 3U37A 3HPNA 2WZEA 4D0QA 5DQ0A 4P02B 1CZVA 3A7QA 3FHQA 2V4VA 2RVAA 3ZM8A 3T09A 1GU3A 2W91A 4D8MA 2LS6A 3A22A 1JZ2A 3ECQA 3CKHA 4MGQA 2E31A 3K75B 3SKVA 3T08A 1D7PM 1JU4A 3GM8A 5EJZB 2HLEA 2BGPA 4JX0A 1JZ5A 2Y6LA 3WF1A 2W1UA 3GXUA 3HN3A 5JXJA 2QQNA 2V5DA 3K77A 3MUZ1 2ID4A 3OEBA 1KEXA 3CMGA 3P6BA 3GDBA 5LA2A 1CIYA 2BZDA 4UAPA 5JMOA 4E8CA 3T0BA 3VDBA 4LKSA 1EUTA 2XHNA 5FUIA 2WDBA 5B4XA 2WO2A 1NX9A 3E1F1 1W8NA 2J1EA 2VZTA 2EIDA 2R7EB 3LPFA 5CZKA 4PF1A 1DLCA 1DP0A 3THCA 4FI9A 3MV11 1JZ7A 3K4ZA 4L0PA 1GUIA 3OGRA 3C7FA 3IAPA 3WF3A 1JZ4A 2WN3A 4MGSA 1OF4A 1XC6A 4TTGA 3MBWA 1UMIA 1I5PA 2WO1A 3C8XA 4KWUA 4ZZ8A 1UY1A 5LCWL 4DXRA 1UY4A 1K42A 1NKGA 2WN2A 2ZEYA 3CIHA 2WZ8A 2W1QA 4QDRA 2VZUA 3MV01 1NAEA 2VQUA 2ZXQA 3VD9A 4ZXEA 2ZEXA 3UNPA 3DECA 3NNGA 4BDVB 1US2A 3OG2A 1CX1A 1J84A 2VZPA 1UYZA 2J1TA 5CYYA 3UETA 3PUIA 2W9XA 3W5NA 1JYWA 2VM9A 4QB1A 4DUWA 2VL4A 4QX1A 3WNKA 4W8JA 3I3EA 3BGAA 5IYYA 2VZ3A 3VD5A 3D3AA 4PQQA 4MO3M 1SHWB 2E26A 1K45A 1GOGA 2C4XA 3WF0A 2VQTA 1O8PA 3I2JA 4OYUA 3I2GA 4A3ZA 2XOMA 3I3DA 2ZEZA 4DEQA 4ET7A 1XNTA 1JZ8A 1ULPA 2BERA 2QQLA 3BN6A 3NQHA 4XUPA 1OH4A 2JKXA 2VCCA 3K4AA 2W3JA 5EJ1B 4M4RA 4QB2A 1TG7A 1BHGA 1WKYA 4BJ0A 2VCBA 3VD7A 3MUY1 3LQCA 2E32A 2V72A 2VR4A 3C7OA 4E8DA 5C71A 4CUAA 4GWIA 3C7EA 3SKJE 1PMJX 4LQRA 3I2KA 3K46A 4Z2AA 4XVHA 4QPWA 4TXWA 1LNSA 5HXMA 2B4KA 1EUUA 3WNPA 5IHRA 2JD9A 4CUCA 2ORXA 3HNBM 2VMEA 3WNLA 2QQOA 2W46A 2C26A 3AC0A 3I2IA 2W92A 4PT6A 1CZTA 4KMQA 2QBXA 5LA1A 2QQMA 3LEKA 3ETPA 4W4ZA 2X10A 5G05L 4MOAA 1CZSA 3ACGA 4GZ9A 3IIIA 4IUGA 3GGLA 3T0DA 4BK5A 3WNMA 4RYDA 5DN2A 4QX3A 2Z4FA 2VMFA 1UWWA 3C7GA 4OUEA 4A42A 2YB7A 2LW8A 2WYSA 3FHAA 5LA0A 2VJXA 3HJRA 1IQDC 1DYOA 3OGVA 2Y6JA 3I2FA 4XUQA 3WF4A 4ARYA 1W0NA 3HNMA 3LE0A 1O59A 4A41A 3LEIA 3THDA 3JXSA 2ZEWA 2W1SA 1H6YA 2J1RA 5IJRA 2YC2A 4CVUA 4ZY9A 3K4DA 4CU9A 3ABZA 2W5FA 1W9SA 1JZ6A 4P00B 5G04L 2W47A 1TVGA 4QDQA 1R64A 2W95A 4W50A 2VCAA 4A4AA 3OGSA 1JU3A 5DMYA 1UY0A 1UX7A 2WAAA 4OZOA 4P5YA 1WCQA 4DXTA 3CZJA 5JXIA 2VC9A 5JUVA 3HNYM 1ULOA 2W94A 3ACHA 5HPOA 2VMCA 3SEEA 2WUHA 4A44A 2EIEA 1W99A 5DPNA 4QDSA 3T0AA 2Y6KA 3WQBA 1JYXA 3OB8A 1UY2A 3FN9A 2QQKA 2VZQA 1NUKA 2W87A 1PX4A 3UESA 2YC4A 3NJXA 2RV9A 2VZOA 4GWJA 1JI6A 2EICA 4CU8A 4HG6B 1O8SA 4XUTA 5I0DA 2DDUA 2KD7A 1GQPA 4QX2A 3VD4A 4DXSA 1SDDB
chains in the Genus database with same CATH superfamily
2NPIA 2PTMA 5LRSA 2WNUA 3OBAA 4FP3A 2K2SA 1GZWA 4YLZA 1Y9MA 2VNOA 4NWWA 1RVF3 4Q4V3 4FAGA 1MACA 3B01A 3VUOA 4BK4A 5EIYB 3VBUA 4D3WA 1BKZA 4ZONA 2CL2A 3EXUA 5J3UA 3ILFA 2V5YA 4ZXKA 5FO7B 2VXJA 1ZBE3 4HPKB 4MZUA 4ARXA 4LBOA 4YVWB 4FFIA 1T2XA 2EAKA 1FX5A 1S0FA 1J3PA 5J96B 3ON7A 1HX6A 1JYNA 2CU5A 5A80A 2A6WA 4QM8A 2UYAA 3ZSJA 1XNKA 1UZ0A 2VBDA 1AR73 5FY8A 1VAKA 5FYTA 2VZVA 3M3OA 1PO12 1V9U1 5FZDA 3U0ZA 3ZXDA 3VV1A 1GWMA 4LTAA 1H2LA 2WZR3 3V0BB 2VECA 3E6BA 1AL21 3VZJA 2FMYA 2XLAA 4IEVA 1NLRA 4HBNA 3CDZB 1X36A 3HQXA 1PK6A 5A3NA 3I3BA 1DZRA 5A7OA 5C5TA 3I97A 1Y3TA 2C5DA 4QB6A 5J7MA 2G9GA 2BOJA 4PDWB 2QZ2A 3J7HA 4CCJA 2PHRA 3RS6A 2JDMA 3KCCA 1RMU1 1J1LA 5KHHA 1DGLA 1QY4A 1UF2C 2C24A 2R062 1RYYA 3LKJA 3VD3A 2OIIA 4FPHA 4IGPA 2E33A 3HVDA 1MS4A 5FAXA 5E8AA 3PVNA 4QPIC 3H8XA 1N3PA 3JCIA 4BIOA 1KD7A 2O8QA 1MQTB 1Q56A 1FPN3 3N9PA 1RB8G 3OCPA 4N7IA 5JOYA 3GF6A 3NW4A 3FL7A 3R4SA 3RDIA 4CEWB 4AYUA 3KV5A 3MO4A 1GKBA 2VQAA 1OPOA 2YHJA 1LOBA 5C9AC 4Y4RA 1OA2A 1PZ8A 1F9KA 2RR12 3NNMA 4Q8KA 4XURA 4E9KA 4JV4A 4RS5B 2FZ1A 4XC9A 4D6QA 4L11A 1DQ4A 3NWKA 5B4NA 1FOD3 3ZXAC 5F5AA 2P6HA 3ZIWA 1ZZ9A 2VUJA 3I2HA 3M8LA 4RHV1 3VDAA 1W9WA 4XDQA 4QKFA 4LLFA 4R4ZA 2ZA9A 1JMUB 2K46A 4EE2A 2OQ7A 3KGZA 1SACA 1QJY1 2H0VA 5FZKA 2R071 3LFMA 1PO13 2VBBA 4B7EA 1DQ5A 4GMP1 4Q4Y2 4JC1A 1S0CA 2XVLA 4LA3A 1LOFA 1YNAA 2XBO1 3AKPA 4RR3B 3WSOA 5JPMB 1HXS1 3N7MA 1OURA 3IZOA 4AAXA 5A1AA 1NCQB 1W2TA 2ZGPA 3H1YA 3OF1A 2UWCA 4LPLA 4DMIA 4CU6A 5A33B 1ENQA 2KR2A 4FFGA 4K8FA 1UNBA 2WS92 5FZLA 1MS1A 4B4PA 4EZ4A 1S1AA 3ZFFC 2G9ZA 1X50A 3RZMA 3WP4A 1IOAA 4LO7A 2WABA 4Y5SA 3SH4A 5CEHA 1UOJA 2FDFA 3EB7A 5HCBA 4HN1A 1KITA 1QF3A 3AB0A 4QHOA 1F4AA 4YFZA 1UMHA 1GSLA 3AMNA 4CP1A 4OMCA 4YGCA 2JG9B 2JDAA 2R063 4QGLA 2OKXA 1GWLA 4S2FA 3ZVXA 3I59A 2VUDA 1UOFA 2XKOA 3CJXA 4IW3A 3AP7A 5IVYA 3DEMA 3A21A 4LJHA 1OSGA 3ZXEA 5KXEA 3VBOA 2VNGA 1AR92 4NIGA 3VB9A 4M3CE 4DO0A 1GOHA 1R1A1 4XUOA 1PGL2 2HWF1 5F7UA 1I3HA 2YG0A 5FYYA 3VKFC 3KT1A 4AOCA 1OF3A 4XHBA 3WHTA 4URAA 3TRSB 3VGIA 5CKQA 2ET7A 5ACA1 3LIHA 1K3IA 4MADA 3T3YA 4CEYC 1SZBA 5CA6A 1LEDA 3U1XA 1L7QA 1O4YA 1OC1A 1XXNA 5EFUA 2WC2A 3LPGA 1W8FA 3WDXA 2BWAA 2R042 5CIRA 1QOSA 1VBD1 1D2QA 4FFHA 4JDOA 4QAWA 4AZZA 1MZFA 4LXLA 1KS5A 2WBKA 1RUD2 5FZHA 4YWAA 1HV0A 1QJU3 1WUVA 1L7LA 1YI9A 3OY8B 5BY5A 3N3HA 4DY5A 1GZCA 2WNUC 1LOCA 1RXFA 2ZHKA 1VRH3 2PLV2 4XCAA 1EAH2 3P3NA 1K5MA 3WQ0A 5BNPB 3U37A 2FMDA 3ZKUA 3BIWE 3E5XA 4Q4Y3 5FREA 2WZEA 2ZGLA 4D0QA 1YUDA 2VTXJ 1GBGA 1XU1A 5FPBA 3VBUC 3QD6A 4MG2A 3FHQA 1NE6A 3PMSA 4CCOA 3AMPA 2VMIA 2WS93 5BXXA 3ZM8A 1GU3A 2W91A 2LS6A 2XQRA 1JZ2A 2RR11 4HT1T 3ECQA 1W8WA 4JRLA 2XJUA 2BTVC 4MGQA 4Y20A 5L7OB 3K75B 2X8KA 5E6HA 2Y60A 3SKVA 3IWZA 1D0HA 5JSPA 3B69A 1JU4A 1RUI2 1OMIA 3IMMA 1YLLA 5D1IA 2B5HA 4MYEA 2BV4A 2NN8A 3JD72 2VOVA 1OFSA 3OD0A 2TNFA 4LKEA 3N7JA 4B1LA 3OBTA 1CWPA 3LCPA 3FZ3A 4QHZA 5FO8B 2OYZA 1FATA 3PLQA 2RS33 1NCRA 1AYM2 1EP0A 2D6LX 5IW0A 2EXIA 5CVRA 3M3QA 5IK7A 2V5DA 4N8MA 3CO2A 5T54A 4I3PA 4EJRA 1YO8A 3LSEA 4AI9A 2A5ZA 2OPWA 5FK8A 1KEXA 1U0AA 1S2BA 2GMPA 2DUPA 1W8UA 2NZ9A 5DDJ3 4Y1UA 3U07A 2NP0A 4F3JA 5IWFA 5FOBB 1CIYA 2FHRA 2BZDA 2X5IA 5FLJA 4LIUA 5JMOA 5FLHA 1EYBA 2VMGA 2ZOEB 3AMMA 3GALA 1W6PA 2R043 3VBRC 3M2MA 4FPLA 4CDUB 2VMHA 3BPZA 3IDEA 4U36A 2WLQA 1W8NA 3K2OA 1TMF2 1UZZA 3JQXA 4V1PA 5H9QA 4AGRA 2EIDA 2PLV3 4AEJA 2DVFA 1EAH3 1AX1A 5SV5A 3ZXKA 3WW4A 4COZA 3LPFA 1XNDA 3SC7X 1AR91 5FP7A 4NUBA 4PF1A 3ZSEA 3JUUA 4ZS3A 4AR2A 4CXYA 4N43A 5HV0A 3ZDSA 1D4M3 4COWA 4AFAA 4FSJA 1V6NA 2HYKA 4FI9A 3CHXA 4A3XA 5L19A 1X33A 1RUJ1 1R092 1ZNPA 4L0PA 4YVSA 2W39A 3C7FA 5LBFA 3MHZA 5F1RA 3IAPA 5DUVA 1ND2B 2WN3A 5FYSA 2WNOA 5JOWA 3D8CA 1XC6A 2OVUA 1RUI3 4QQHA 1U5XA 3MBWA 1TEIA 4XPVA 2GP5A 1EV12 4GJYA 4KWUA 5FMCA 3X29B 1LEMA 3B02A 3S6PA 3VDDC 1RUD1 2BFUL 2XLFA 5LCWL 1AYM3 4DRVA 1O5LA 2R32A 2I2SA 1LESA 1R1ZA 1DQ2A 3LEMA 4Q1RA 4AI2A 4ZU7A 1NKGA 4NPLA 4DB5A 5FTTC 2YGLA 1ZVFA 4PBOA 3C3VA 3ZKYA 2W1QA 2IUWA 3UKNA 1DGRA 2RS11 2XKPA 3H7YA 4IEOA 4EN8B 4FPOB 3H50A 1IQAA 3BIEA 1ZRFA 1NAEA 1PNFA 2VQUA 2WT0A 4NMIA 5A7WB 4ZXEA 5F3CA 2DFBA 1POV1 4P9JA 4AEDB 2G4IA 5C3SA 1FMD1 1ST8A 3NNGA 4MUVA 2HWD2 5FMOL 1I5ZA 1VIWB 3OG2A 1ZZBA 1TQ5A 5BNQA 3UETA 4AK3A 2WA3A 3B00A 3PUIA 2BRTA 4QXKA 3VBOC 4QXBA 3D4KA 2HWB2 4AHYA 4FQ4A 3JB8A 3JD71 3ZYHA 3WNKA 1CQ9A 4K21A 1VBC2 4FPGA 1EPWA 2VZ3A 3ZFEA 5I0SA 2IXCA 2BGCA 4MO3M 1QJX2 2RE9A 4TSVA 3BOPA 1BK1A 2C4XA 4CCNA 2RJKA 3V0AA 3HD8B 4Q1PA 1BEV2 2EA7A 4GJZA 3LA7A 4AHXA 4C0BA 1ULEA 2GMEA 3I2GA 1R093 3WP5A 1APNA 5IVCA 4Q5OA 2UWAA 1ZZ6A 2D3RA 3NQHA 4LK6A 2A73B 4ASLA 1K5MC 1BBT3 1BXHA 1HJGA 2XLGA 4XILA 2PFWA 4QU2A 1EV13 3KQRA 5EJ1B 5ABJC 1LHWA 3USUA 4XMIA 1RL3A 1TE1B 4K3UA 2DTYA 3BTAA 5LY2A 1ZBA2 1TMF1 1W6NB 5BUVA 2EXKA 5A6QA 3U14A 1HW5A 5J48A 4FTSA 4PIXA 2Q0AA 2P3YA 4Q4X1 5CKMA 1BYHA 3SKJE 3RG0A 1AUYA 2CGPA 4LQRA 4PHZA 3I2DA 1DGWA 2HWE2 3I2KA 4ATEA 1S0GA 1XBFA 5FYVA 3RGBA 4IV1B 4COUA 2VW1A 4Q8LA 1LNSA 3NNLA 1V70A 3LIGA 1NCRC 3TB0A 5KC5A 3O1VA 1SFNA 4IE4A 4IE0A 5FDBA 1NA1A 4INDA 3J7LA 1GICA 4XAEA 2VMEA 4LE3A 3WNLA 3I2IA 2W92A 4JRAA 4PT6A 4AFCA 1PNGA 1WCKA 2RMU2 3POJA 4S2GA 3LEKA 2HEVF 3H42B 2EIGA 3RI8A 3KVBA 2WR9A 1H1IA 4MOAA 3K3OA 1QJZA 3KD4A 1ASJ2 1QJX3 3A0KA 3DGTA 1H0BA 3GGLA 3ZYPA 1D2SA 4OQ8A 3LZZA 1BEV3 3RJ2X 5FUPA 2R1DA 1KDKA 2A70A 2Y38A 4RYDA 2P1BA 2VAUA 1LAJA 5K9YA 3INAA 1SFYA 5JPNB 3CJIA 4OUEA 4XDPA 1I6XA 4R9DA 2HWD1 2WYSA 1TNRA 3FHAA 3NV2A 4Y26A 3U4XA 1T6BX 4CP2A 5LA0A 1RINA 3CBNA 3ZXFA 3O14A 4Y22A 4D69A 3HJRA 2YXSA 4HVRA 3OGVA 3TEWA 5APAA 4F83A 4XIOA 4XUQA 5LZ6A 2HWB1 4JDMA 2MPFA 2VD7A 2ZJCA 4IQPA 3WDTA 1G9DA 4N43C 4IESA 1D0GA 2ARBA 2V73A 2J1RA 4X8PA 3N9LA 4YM1A 5ANNA 3UGFA 1VBC1 4YVSC 4NVPA 3WR0A 2XL7A 3AFKA 4PBPA 1JOJA 2WNVB 2D44A 3FBMA 4X8NA 2JXAA 1NY71 2EVXA 4XJWA 1W3XA 2GN7A 4N9HA 5A1FA 1ZX5A 5D8AB 4C1XA 2E51A 2WSVA 5EP9A 2Z5WA 1G7YA 2FZ2A 4XE9A 4J25A 4MV2A 4QDQA 1R64A 4RD7A 4NRPA 1AX2A 3SH3A 1N3OA 3S5AA 1UY0A 2QQPA 1HRV1 4YZ3A 4P5YA 2KA3A 4OLLA 3ZFGA 4NOTA 5AFEA 5C3OA 4IE6A 1GP6A 5JXIA 2VC9A 1G8WA 2FBEA 3I49A 3AMQA 4P9LA 3LD8A 1AZDA 5SV8A 5FYUA 2PHFA 3SEEA 3QBQA 1QWRA 4PJYA 1CAUB 2XDVA 1ZBA1 4A7ZA 3OOXA 2A71A 3H8RA 4AQSA 3RZLA 1ASJ3 4AW7A 5DPNA 3AKQA 4QDSA 3T0AA 3KGLA 3WQBA 4NRQA 5T5JA 1OUXA 3OB8A 4CDWB 4OHVA 4CPBA 3RNSA 5C4WB 4B4QA 3J7MA 5FJKA 5EYYA 4GULA 1ND3B 1NUKA 2YC4A 1COV3 3CF6E 4BQ3A 1DLLA 3RYRA 1Y9GA 3VKLA 2IC1A 3ZFEC 4WM8B 4CU8A 2OUJA 4LEJA 4OZXA 5DAPA 5T52A 1AXZA 1LKNA 1H4GA 3GZAA 2KD7A 1HB4A 2EXJA 5LW9A 4QX2A 3NV3A 3VD4A 2XPJA 3E5UA 4LMFA 2RMU1 4NAMA 3I3QA 4QKDA 3DKQA 1HB1A 1SG3A 1OOPB 4EROA 5JI9A 3WG3A 4LITA 1RUNA 2HEWF 5DZEA 1GQHA 3LDBA 2AYHA 5IUQA 1WA6X 2FDKA 1H30A 3UT0A 2GH8A 5IFTA 4CRQA 2RDQA 3ZN6B 4CXXA 5L73A 3TNQA 2VMDA 3RZKA 1YIPA 1V6LA 1QEXA 4EQVA 3HAGA 5BNNB 2ZMKA 3J4UH 3LFIA 1REDA 2YFZA 2NMOA 5J36A 1MS8A 5IK8A 2VGDA 2VO5A 3THTA 3WDUA 2CDOA 3O1MA 2ZACA 2XJRA 1CD3G 5F5CA 4BZ4A 2WFPA 1OA4A 1UZWA 2BOIA 4CDQB 2WQ4A 2BBAA 4QGMA 4FFFA 3JBG1 4WM7B 5FQ0A 2ADDA 2XQXA 1GANA 2X53S 1UAIA 1W6OA 3VHRA 2ZAHA 3WNOA 5K0UB 2E7QA 3WW1A 2EAAA 1STMA 1GOFA 1DQ6A 3C7HA 4JKLA 1RUH2 1CJPA 2D3SA 1Y7BA 1NA1C 3HBZA 4JGZA 4OMDA 2PA7A 1CAWB 2VZRA 1IZ3A 1XU2A 3AFGA 2YROA 1QMJA 5JR7B 3T4HB 2OA2A 3KWVA 3TNPB 3T2OA 2AUYA 4URTA 4BWOA 5HCHA 2XVKA 2QQIA 1RHI1 1UY3A 2CHHA 3NNFA 5CFDA 1O3SA 3LWCA 1J58A 4K40A 1R081 2JE8A 2FDHA 4ZPIA 1L7RA 4JQTA 3VBSC 5JAXA 2J22A 1JXNA 2WNEA 5C9AA 1JYVA 3NL1A 3U11A 2L9LA 1G86A 1ULGA 5JXHA 4GAZA 3ZDVA 2WT2A 5ISLA 2VE1A 4JTNA 4M3CA 3VZKA 2ZKNA 1ZZ8A 5I91A 5HCFA 4UFIA 2VQ0A 4Q29A 3ZYRA 1LRHA 1PIV3 2BVBA 2OQ6A 3GCXA 4HETA 1W90A 5EYXA 5LK7B 2RS51 4CDXA 1YI7A 2DCKA 3AJZA 2NMNA 1ENRA 3J7NA 1VJ2A 2ET1A 2C9KA 3WOGA 5T50A 4UFMA 2BUKA 3KQ4B 1LCLA 2XONA 4YG3A 2R0FA 5KHKA 4S2DA 4XTMA 2E63A 3ATGA 1CIWA 2YFUA 2W52A 1VBA3 4P08A 3BU0A 4XHXA 3LOBA 3AVSA 3MI8A 4Z8BA 3NRUA 1NE4A 2JIJA 2CGNA 2JE9A 4HLTA 2Z2SB 4OULA 3WNXA 4AG4A 3H7JA 3IPVB 3RZZA 3D0JA 3WEZA 3O1UA 1LOEA 1X9PA 4XABA 3ZXLA 3KV9A 1RUH3 4GH4A 2XUMA 1B09A 1SCRA 2WZR2 3LA3A 4MXWB 3BTZA 4FPCA 1RUE1 4LULA 1KS4A 3BI3A 3NKGA 1W2OA 3MIGA 3MFCA 5A32A 3QACA 3BU7A 4OUSA 4Q0PA 2E7TA 2WL1A 2Y6HA 4FOWA 1K12A 4K9SA 1OLRA 2PMWB 4B1MA 3RZHA 1KJLA 4B4RA 2BW8A 3O1RA 5GZCA 2D98A 4QPGB 3RPQA 1H4HA 1HRI2 1RJ8A 4H3WA 5IAXA 3CZUA 2OW4A 2ZBJA 2ZMLA 4EV0A 2FD8A 4COYA 3KT7A 4UOJA 5FBJA 2ZGKA 1P8JA 3EHKA 1W8ZA 4MLOA 5K0UC 1AR63 3LA2A 2VOWA 5AC92 3DF0A 1PM7A 4Y33A 5KXDA 5L9BA 4TN7A 4YPJA 1V6MA 4XDOA 3IN9A 1UIKA 4AQ2A 4IL7A 4SBVA 1FXZA 5A6XA 3WCRA 1NT0A 1X8EA 3AZXA 2EIBA 2Q1MA 3DYMA 1ZYBA 3SEPA 3NAPA 2ZX2A 1MQTC 2Y8KA 2A6XA 2N7GA 2ZGUA 3S7EA 1SDWA 2NLRA 2GU9A 4ORFA 2DTWA 4Q0VA 1U5IA 4IDZA 1EY2A 1QQP3 4CEWC 2HWC2 4E27A 1ENSA 3I3MA 1FOD2 1F5FA 1ZRDA 3RVHA 3WDWA 3KV6A 5JZGA 1W6MA 2DWRA 1ZZ7A 4FPKA 4GB33 4OFGA 1S55A 3ZR6A 3ZMOA 4LBKA 1N1SA 5DQ0A 3RYKA 2D5FA 1AYN2 1POQA 2RHPA 3DPRA 3O0XA 5FXZA 5JWPA 5A70A 3T09A 4D8MA 4WZFA 1LJ7A 4ZS2A 4XFGA 1F31A 1B35B 2XJSA 4XW3A 5HBAA 3BALA 3KHBA 2GNMA 3WG1A 2QQUA 3OUJA 5F37A 3BTYA 5EJZB 2BGPA 4S2HA 5L36A 3HQUA 1REEA 4MX3A 3MLJA 1RVF1 2BNMA 4Q4V1 2W1UA 5LA9A 4NIHA 1G9AA 3OUIA 1ALYA 2AACA 3OPZA 3WCSA 3ZN5A 1HRI3 4AQTA 1AR81 3AVRA 3H1MA 1AL0G 5E1RA 4JGYB 2QQNA 2BJSA 3K77A 4JGZC 3KM5A 5FZGA 1ZBE1 5JXJA 2YGMA 4BISA 5FY9A 5FYBA 2XXZA 1MEC3 4XJ9A 3CEWA 4PI2A 4CCLA 4O7XA 5AC93 4NR1A 4NHMA 3L2YA 3VBRA 5F6KA 2OZJA 4NIIA 1AR71 5CFDC 2DCTA 5LA2A 3ZYGA 4I0AA 4UAPA 4Y4YA 1WW7A 3W9AA 4XZPA 3O1SA 1PVC2 4XJZA 2MEV2 4DINB 4YSFA 3VDBA 2XG3A 1VBB3 2WZR1 1EUTA 3GCWA 1OQDA 4BXFA 4CP9B 4XIKA 4F8AA 2BBVA 5C33A 4DY3A 5B4XA 5L9VA 4IV3A 3PIGA 3E1F1 3VBHB 2ZX1A 1W2AX 4AGVA 1PZ9A 2J1EA 4LHKA 1VP6A 1QU0A 5FZ0A 1LULA 2HWC3 1OD5A 2WKKA 2Y26A 5TSWA 5IT6A 4XCBA 3SLIA 4W6YA 4RQPA 1QJU2 4CDXC 2B7YA 3OPWA 1I9RA 2JJ6A 2DVGA 4P14A 2IXIA 1DP0A 1AYN3 2DV9A 1VRH2 2A7AA 3MV11 1W2NA 1DDLA 3K4ZA 1IHMA 3ACLA 1GUIA 1FPN1 4IEZA 5FPZA 1E5HA 5CBLA 5FZFA 3VDDA 5LBEA 4MGSA 1OF4A 5I8SA 3PMEA 2XL9A 4TTGA 5A7QA 2IFWA 4TZDA 2QFEA 1I5PA 2WO1A 2WWJA 4XF4A 1UY1A 2XVGA 5FXVA 3ST7A 5C8CA 1PGW2 5HV4A 1E5RA 4WVMA 2I07B 5IVBA 2E6VA 3POFA 1UKRA 3WP3A 5FRAA 1YQ5A 1OQEA 3K3NA 4GH4C 1FOD1 4QMAA 2WZ8A 2FCVA 1JTZX 2Y33A 1IS5A 5A3WA 2VZUA 2RS32 2V4AA 4YW2A 5FKBA 3RYPA 3J8F3 4QQLA 5A3PA 4BMEA 2ZXQA 4AVTA 4XFBA 4K1ZA 3VD9A 1RJ7A 3GHNA 2HEYF 1UZVA 4AGGA 1Y4WA 2ZX4A 1W6QB 1CX1A 1SLLA 1JW6A 1PO11 1PVC3 1RUF3 1UYZA 2J1TA 2WYFA 2MEV3 3PTYA 4L9BA 5LATA 1ENXA 2HJIA 3M1HA 4QPIB 4RSUA 5E89A 3WW3A 4EWAA 2ADEA 3S0MA 2VG9A 4CCMA 3E97A 5DDJ2 4BQXA 1YFYA 2VM9A 5FYCA 4P9GA 3RQ0A 2QDNA 2XB6C 4QX1A 3GBFA 3FE5A 4XJUA 3I3EA 5KWRA 2H6CA 4IEPA 5IYYA 4KGQA 3VD5A 1RGSA 4NJ4A 5C9AB 4QX5A 1SHWB 3OYWA 3IDBB 5FZMA 4MSVA 5FZ1A 2ZGOA 2MHFA 3LDRA 2Y34A 2R061 3N9MA 4Q26A 4L8QA 3WF0A 2PYTA 4N90A 1YC61 5H9PA 3NAPC 4OVEA 5FKCA 2YMZA 5BPXA 1VMFA 4XFIA 5FZOB 3B3QE 2XOMA 3I3DA 3H8UA 5GM0A 4CDUC 1W2UA 2K0GA 3AZWA 3FHIB 4FXKB 1AJKA 1BJQA 4DEQA 4H2AA 4FPFA 4OHXA 5ABJA 4CZSA 3TN93 1CONA 4E4DX 3D6EA 3FMGA 2YU2A 2BU9A 4L97A 1D4M2 2BWCA 1IGOA 2VNVA 5JZGC 4P9XA 4Y3OA 2VCCA 4QD2A 1DHKB 2W3JA 2DFCA 5HXVA 2AGSA 3R6SA 4QB2A 1TG7A 4NWVA 4UF0B 4UFLA 3DPRC 1WKYA 3PUAA 3CLPA 3ENRA 3MUY1 2WSUA 1IKPA 3NNJA 3POIA 1VBE2 3LQCA 1V6JA 2E32A 2V72A 1L3JA 3DXUA 4LBQB 5A6YA 3ZYIB 2GDFA 3ZFFB 1LHUA 2F4PA 4KG0A 4QT6A 3HQRA 4RGKA 4Z82A 1V6OA 1QJU1 1Q8PA 1X9TA 2VUCA 2ZGQA 3ASIA 4GWNA 4EWEA 4Z2AA 4GWMA 5GLZA 1H2KA 1LGBA 4TXWA 1VRH1 1CR7A 3U78A 3AL5A 5DUXA 3UJOA 4CUCA 5DUWA 2D40A 4Q4Y1 3RMXA 5DAXA 2VVEA 1TME3 1OI6A 2W46A 3MW2A 2C26A 2WS91 5I0UA 1CZTA 2QNKA 5LA1A 1CAXA 3FFZA 2QQMA 3WZ1A 3QOPA 5JOXA 3SCGA 1YQ6A 2JG8A 5K7PA 1PGW1 4YZ4A 1X82A 3ACGA 1YIFA 3IIIA 4CEYB 4JHTA 4Y1ZA 3MLKA 1UD1A 2FQPA 2XHKA 4KU7A 1H8TA 4BK5A 1IS6A 1PO23 3FBYA 2RS31 4W6XA 3ZR5A 4YW6A 5DN2A 4QX3A 3SITA 3WLUA 3KT4A 5FP3A 4FBFA 4GD4A 3EBRA 3WW2A 5KR7A 4IV3C 3PVEA 4LKFA 5J09A 3KS7A 3C7GA 2LW8A 1PGL1 4BA6A 4I0BA 4JCKA 2WNUB 3MEPA 1DYOA 3NMBA 4IE5A 1GZWB 2Y6JA 2JWPA 1AHSA 1QJFA 3B93A 3HN1A 3K51A 3I2FA 3DUIA 4J1XA 4RQPC 1SPPA 4BQ2A 5IK4A 4MH0E 5DDJ1 2LALA 5AVPA 1WBFA 3VBUB 1XE8A 3LEIA 4GQ7A 3THDA 3KLSA 2CV6A 1H6YA 1ZA7A 2YC2A 5JI7A 1BBT2 1VBE3 2ZX0A 2R041 1Q5OA 3MGUA 5FY4A 4CVUA 5KXBA 3K4DA 1OXCA 1OKOA 3FC0A 3LB9A 1W0OA 4RGGA 1X7NA 3FLTA 5I93A 1CAVA 2KM2A 1XYOA 1LODA 2XJQA 2PLV1 5G04L 1EAH1 3UKVA 1CX4A 2LUWA 3OTFA 2ZHNA 3W58A 3POYA 4LO6B 1MS9A 2W95A 5C8CC 2JE7A 4W50A 1JU3A 5DMYA 4G9SB 1WMEA 3PL0A 2BPA2 1D4M1 4DXTA 2GSYA 1PK6B 5JIAA 2LROA 3CZJA 4OHYA 3OSDA 4AVVA 3KCXA 4D7YA 2DBIA 2ES3A 5CFCA 2W94A 4JTOA 4W65A 5FYZA 5HPOA 1C1LA 1UU5A 2ARCA 5FP8A 3SMHA 4RGAA 2YBSA 1H1MA 1RUI1 3EO6A 3N7KA 3AYCA 4IV1C 1HQNA 2EIEA 3BPSA 3MYXA 4HKOA 1W99A 3ORJA 2RM23 4DPNA 2D6NA 1JYXA 3WINE 1UY2A 2HKXA 3FUOA 1AYM1 3U4SA 3V56A 1LU2A 3WXPA 4YGDA 5BNOA 4YZ5A 3DV8A 1PX4A 2RV9A 4B3NA 4GWJA 3ZPOA 5GZGA 1LR5A 1OVSA 1FAYA 2W08A 2YPJA 4H7MA 3THPA 4HG6B 1O8SA 2ZGMA 4YW7A 2GP3A 3WT3A 4NHYA 2GC3A 1N3QA 2I45A 2G9FA 2UWBA 4QX7A 5H9RA 4AFMA 5KBFA 1DBNA 4Q0SA 4AEKA 1OBNA 2A6YA 1LECA 3VBFA 5C5UA 5FIXA 3PU8A 4FAHA 1HN1A 4RA0A 5GLWA 2PAEA 5J37A 1QH7A 2LM3A 1MVEA 2CAUA 3OGGA 5EXOA 4WV8A 3P1IA 1UPIA 2IXHA 3T1MA 1U5YA 1SEFA 5F9TA 1XB9A 4HVQA 1NLSA 3M3EA 1C8M3 2P17A 4LO8A 1TNFA 3FLPA 3PUQA 5FMBA 1IPSA 1W3VA 5EPAA 4NHKA 4YARA 2Y0IA 3HOBA 3T2QA 4C0HA 1SMVA 3LEGA 3WY6A 2YDEA 3BKZA 1OD3A 1C5IA 2HYXA 1URXA 4IEUA 4GMP0 2X05A 1R091 1MR5A 4UFHA 4XFFA 4LORA 4XUNA 5A7PA 1Y9QA 5CB7A 1ZREA 2Z79A 4MGIE 2RJ2A 3ZSKA 4MHRA 5KHGA 4XZUG 1W06A 1HLCA 2VVFA 5T3NA 1OQ1A 1BBT1 2Y6GA 5JR2A 2GNDA 3BCWA 1VRBA 3I59B 3NJVA 1EV11 4GKXA 4BPZA 2P37A 4PI0A 4NIDA 5FMDA 2GN3A 3VBOB 4UW6A 3ZYFA 2PHLA 4BXSV 1O4TA 5T5PA 1UYYA 3KZ4C 3VBSA 4DUVA 2UY8A 2CWMA 2A75A 4J1WA 3ZSMA 3H1WA 1WA4A 1ONAA 2JG8C 5LRRA 2VY0A 4NROA 2WFF2 1OLME 1XPWA 2LTNA 4N53A 3V65A 1MS5A 1WCDJ 3KF3A 4FPEA 2X09A 4AI1A 4Z1VA 1MS3A 3W21A 2NQYA 1ZM1A 1SBDA 3N35A 3U10A 1COV2 1H8TC 1RUG3 1XNCA 2RDRA 5IVJA 5M0TA 4OHWA 1HKDA 2PQSA 3PUHA 4BLJA 4CCKA 4YZ2A 2RDSA 2YYOA 5C4WC 5FPVA 1PX3A 2JX9A 4A6OA 1QH6A 1GZ9A 2PAKA 5ERLA 1UL9A 4TLGA 4A6SA 3HEIA 5FFOC 3I4IA 3R4DB 2W68A 1VALA 1H2NA 4YG6A 2AZ5A 2J1UA 1GMMA 3GZTB 4LLOA 4RL7A 3T2PA 2OXBA 3ALQA 3T1LA 1YHFA 1K5MB 3AX4A 2J1SA 4G3YC 3WF2A 2WO3A 2IZWA 5FZ6A 5JMCA 4H7LA 3EJKA 1QJX1 3Q9OA 5DAVA 1OHFA 2DVBA 3DYPA 4ZZ5A 4LUKA 2QTWB 1AX0A 1BEV1 4YGBA 5FZ3A 5FPLA 2VVDA 3N7LA 2HBUA 4A7YA 4NHXA 4EYUA 3W5MA 4HPKA 4ATFA 2VNRA 1W8HA 1BZWA 2Y64A 4YVWA 1UOGA 2H0BA 4Y20B 2FDJA 3DCQA 2YV8A 1XRUA 3POEA 3PURA 5F2WA 4HONA 4P9IA 3AKSA 1HB2A 2D97A 4DEVA 5BNNC 3OEAA 2EXHA 3S7IA 2ZMNA 4BH9A 1VMJA 4GKYA 3IIAA 1NCRB 4HVOA 4UW3A 3IM0A 1S0DA 3CQOA 3MIEA 2ZCWA 3HT2A 2VTFA 5FPUA 3V0BA 4NO4A 2DCJA 1MPXA 1UW8A 1RUC3 4DUXA 5JXGA 4XOGA 4Z92B 1E5SA 5CFCC 4L92A 3RMYA 3SCHA 1W9TA 3AP6A 4NHLA 4CCEA 4CUBA 4HMZA 2WFF3 5DG1A 2HWE1 2VOTA 4PDWA 4AXOA 2BP6A 1MZ6A 1DIWA 5FZ8A 2ORZA 2X5IB 2XMLA 3ACIA 3I7DA 3IAQA 4HKWA 5IFPA 3O0VA 5C70A 1PMHX 1UOBA 4MHUA 1SCSA 3MPPG 1W6PB 1SBFA 4IEXA 3Q8FA 1A34A 1KGYA 2D6PA 3LSDA 5BNOC 4K20A 5F3EA 4I0WB 3OJBA 5A3UA 1DU3D 4JDNA 4UYBA 1MQTA 2GALA 2ZGSA 4WVWA 1O3TA 1IS4A 4C1WA 1SFPA 4L99A 3P5BA 4LHSA 3AZZA 4PQ9A 4Y5Z0 3DN7A 2J1AA 4V2VA 3A23A 4FOYA 4CEWA 2VW2A 5IATA 1YXWA 1KFXL 4KNCA 1FV3A 5EJ3A 5AVAA 5IVVA 2C9AA 3UL2A 4AVCA 1PIV2 1ASJ1 1A3KA 3UGHA 4N43B 4IXLA 4CCDA 2WQ8A 3VBFC 2JEMA 4RS5A 1QOOA 1UXZA 1H9PA 2ZHMA 4YVSB 2A6ZA 5F32A 3O1TA 4HANA 3HPNA 4BOWA 4LHLA 1BCXA 3MFAA 5FYHA 1COV1 1C57A 4P02B 4DZGA 1VBA2 2TEPA 1CZVA 4KG8A 4AL9A 1RC6A 3ZSLA 2RVAA 5F5IA 2AENA 3A22A 2VULA 4PLMA 3VLBB 3CKHA 2E31A 4FPJA 4RR3A 1WMDA 3T08A 1D7PM 4KGGA 2WLPA 1NCQA 3GM8A 5A33A 2HLEA 3RSJA 4JX0A 1XSQA 4HKLA 5LEJA 2DBNA 4BYYA 2O8OA 4UWDA 4M00A 4DXZA 1C1FA 1BQPA 3LF7A 2DU0A 5DABA 4YM0A 5A1LA 2ARAA 3SXWA 4GALA 5F5QA 3HN3A 5CKNA 1Z7S3 2D5HA 3I8TA 3BODA 2WRAA 1DZTA 2JG9A 1SQ4A 3APBA 4AVBA 4CP0A 1IPJA 3H9AA 2X29A 3V64A 3BTXA 2ID4A 4AHZA 3OEBA 4NRMA 1POV0 5FZ9A 1JS9A 4Z2WA 1FNYA 1GP4A 1W28A 1XOYA 3KF5A 1SLCA 2B45X 2PN5A 3VHNA 1DYKA 1QNYA 1YQCA 3FLRA 1J3QA 3D5OA 2ZTNA 4E8CA 1CPMA 2IVJA 1HQWA 2YPDA 1AR62 4N53C 3ZFEB 2ETEA 3N9NA 2XHNA 1S0JA 4LKSA 1W0PA 5FUIA 4QKNA 2WDBA 4AF9A 3M3IA 2QZ3A 4XETA 1UX6A 2WO2A 3V0AB 3S30A 1C4RA 5F39A 1XJAA 5CU1A 4DRRA 3HMYA 1WMFA 4BQWA 2DVAA 3G6JB 4BLIA 4E4SA 2VXRA 1VB4A 1ZRRA 4LBNA 1DLCA 2Q1FA 3JB4C 1GR3A 3OY8A 4AEMA 4PLOA 1QQP2 2R1BA 5DAWA 1V9U2 1Q43A 1JZ7A 4ZHNA 5FY0A 3PJQA 4WVVA 3USUB 3AL6A 3POGA 4GB32 2EALA 4D94A 5L9RA 5BNPA 4I01A 1AL22 1JZ4A 4UXAA 4AI8A 5CG8A 1ZA4A 2R49A 4BM8A 3M70A 3WD5A 4SLIA 1UMIA 1YFUA 4Q4W3 4YVWC 2D7FA 5FOJB 4HK9A 2Q8OA 2P3JA 4CDXB 3WQ1A 2BFUS 2IFRA 4K8RB 1PIV1 4OUMA 4DXRA 3WV6A 2XUEA 2Q1ZB 5L7OA 4LK7A 2YUEA 1K42A 4CUGA 2WN2A 5JDBA 3UK9A 1DG6A 3TBDA 2IXKA 3BUCA 5A6ZA 1B35C 2KXLA 4ZU5A 1NA1B 2ILMA 5C3QA 3MV01 2FCUA 3NJZA 3PUSA 3UNPA 3DECA 4O61A 4MVTA 4ES9A 3VL8A 1KFUL 1US2A 5FMOS 1WW5A 4EWDA 3RI9A 2A1XA 1J84A 4EN9B 2VZPA 1LB2A 4Q27A 5CYYA 1MEC2 1H9WA 4PDWC 4XF9A 2FDIA 2WO7A 4XBQA 3WUCA 2W9XA 4UW4A 3W5NA 5FZ7A 4XFAA 1UN1A 3PNAA 4QB1A 4V2WA 4DUWA 2VL4A 1RUH1 2A6VA 2AEZA 1KDMA 4W8JA 3WP6A 1VBB2 3BGAA 4Z07A 5FWJA 3VHPA 4RHV2 3D3AA 3CJIB 4KL1A 3WHUA 2E26A 3WVJA 1K45A 4LKDA 3PU3A 4CDUA 1GNZA 1X8MA 1NQDA 2SLIA 2YU1A 4TWTA 4Y22B 2BNOA 2VQTA 3VZLA 1O8PA 3POSA 5FK7A 4LBLA 3Q8CA 1PMIA 1V9U3 4QU1A 5KC6A 1QNWA 2IXLA 1O7FA 4WBBA 3R0RA 4HN0A 4ES8A 5A3LA 2XBO2 3LAGA 4ET7A 1JOPA 1U5ZA 1JZ8A 1AL23 2PAMA 3AK0A 4RS5C 2QQLA 1FV2A 1OFNA 1DGWX 1WD4A 5LASA 4E4ZA 3PVBB 1AR61 1OH4A 1OVPA 2JKXA 4P5HA 4YG0A 2RJLA 1GFF2 2GC2A 2PHTA 2R16A 3T30A 4AI0A 1BHGA 1DZQA 4BJ0A 3VD7A 1AR83 1MZ5A 1ND2A 2AH2A 1RMU3 2GAUA 1KXGA 4A7KA 1PGSA 3VKMA 4B7KA 3TEYA 1VPHA 4Y1XA 5KXCA 5C71A 5GALA 4HSLA 4FPYA 4XQDA 4IEQA 4GWIA 4RR3C 5EHDA 4CUAA 1SLTA 3WDVA 2DCZA 4BHPA 1NCQC 1OUSA 4E2SA 3K46A 4XVHA 4QPWA 3ZFGB 4NE9A 4YNIA 1QQP1 2QE3A 1R1A2 2CSGA 2RDNA 2DF7A 1FNZA 2HWF2 5HXMA 3WNPA 1LHVA 2JDUA 1UIJA 4GB31 2Q8EA 1CVNA 2B46X 3J8F2 2TUNA 2BYVE 3HNBM 5ACA2 5FO9B 2CNAA 3MDPA 5GLTA 5A7WA 3AJYA 5CG9A 2QQOA 5FP9A 4XBLA 4AEDA 3ZYJB 1JYTA 2JG9C 3AC0A 1WW6A 2ZPXA 4LBJA 1KQRA 2QBXA 1RUF2 2IXJA 4E4HA 1RIRA 1VBD2 2GC0A 2X10A 5G05L 4OCTA 5FZ4A 3W59A 4RHV3 4BE3A 1JYIA 4GZ9A 5GLVA 4MGZE 5FZBA 4QQ2A 2DU1A 3T0DA 3ZXJA 1QJY3 2H6BA 5D21A 2R073 1JHNA 1NZCA 3D82A 1H2MA 2A3YA 3G7DA 4YW5A 5GKAC 3F95A 2C1FA 5LBCA 3WDYA 1WBLA 4GMP3 1HRI1 1ACCA 2YBKA 1UWWA 2XBO3 4A42A 3OD4A 4QWNA 1HXS3 5D2AA 3AKTA 4W6WA 1S4CA 2VJXA 1H8VA 1O6UA 2XJPA 4QHBA 4K6BA 4R9AA 5E16A 1IQDC 1A8MA 1MEC1 2UYBA 2BNNA 5AC91 1M4WA 2CY6A 3WF4A 4KBBA 4ARYA 1WWYA 4Y1VA 4JZRA 1N47A 5J98B 4A41A 3TN92 2ZEWA 2W1SA 1Q8VA 2VUAA 5IJRA 5DUUA 3NSTA 4D6SA 3TOJA 4LO4B 2CTVA 1VBB1 5LY1A 1V0AA 2D3PA 2GMMA 4PCRA 4ZY9A 5BNPC 2P4EA 2A3XA 3ABZA 1E5IA 1NG0A 1OLQA 2WT1A 1A78A 2D6KA 4EN6B 3M7AA 1W9SA 1AXKA 1SLIA 1QGLA 4N7UA 2YBPA 4BCUA 1JZ6A 2Q5TA 4CXWA 4O65A 2HWC1 1R1A3 1W6NA 2MNGA 3RWNA 2FCTA 3RWKX 3ETQA 3GHMA 1SLBA 2HWF3 4AI3A 4YW4A 1G9CA 5FQ0B 1PHMA 2VCAA 4UFJA 5F6LB 5C3RA 3OGSA 5L7OC 1QXPA 1W6OB 1UKGA 5ACA3 3L9JT 2WAAA 1F35A 2QQWA 1QIQA 1WLCA 2YZ4A 2QKDA 3Q8AA 1AYN1 4GIQA 4OZOA 3UV9A 1JOBA 2R6QA 5CISA 4LOSA 4QM9A 4FVVA 4JGZB 4IV1A 1PZ7A 5DXDA 5K8SA 2XR4A 2UURA 3HNYM 4O9EA 1ULOA 1WLTA 1Z78A 3ACHA 1VBD3 1G6NA 2VMCA 3J26N 1TME2 3DKWA 3MPBA 3O1OA 1QJEA 1NXD1 4A44A 3IMNA 4PIZA 4FO9A 1C3HA 5CFDB 3POBA 1GYKA 3FN9A 3ZO0B 1LHNA 4U2AA 1Q8QA 2XJTA 2QQKA 3N4MA 3S57A 3MLLA 4I02A 1ZRCA 4H55A 1VAMA 4ZU4A 4JAAA 3NJXA 3PDQA 4ZKTB 3VZOA 2VZOA 4ISQA 3H3UA 5H9SA 4M3CB 4CPBD 1PO22 2JDZA 2GNBA 2P3KA 2EICA 1ULCA 4R8HA 3J8F1 1RUJ2 3M3CA 5I0DA 1U12A 2RR13 3TWIA 2DDUA 4I2OA 4TLFA 2QCSB 1OLMA 1GQPA 1TZOA 3AYAA 1YYNA 1WCSA 4IEYA 1NYWA 4ONUA 1LTEA 3UKTA 1SDDB 1PVC1 1RUF1 3VZNA 4DXSA 5JLVA 2MEV1 3W20A 4K1YA 2J1VA 4LNVA 4COVA 2JICA 3JQWA 1HQLA 3PHMA 5GLUA 1LGCA 2JDNA 4M4PA 4JQRA 2BGOA 3WX5A 3I54A 4YZ1A 2JD4A 4XYXA 1C5HA 3AYDA 4CU7A 1MS0A 1YFWA 3IKWA 1BVVA 2RS12 1MZEA 4GXLA 4KU8A 2WNVA 1UXXX 1ND2C 3URFA 3E6DA 4KBZA 1DYPA 1FMD2 1UU4A 4QXHA 3VDCA 5C7GA 5D8AA 2WAOA 2WIIB 2ZKLA 4GH4B 2PXJA 5DAQA 3GYDA 1YQ8A 2R0HA 1V00A 3HT1A 4QX0A 5LB6A 4XF1A 4AFDA 4BB3A 2E53A 5J1XA 3MIFA 1G9FA 5A32B 5LK5A 3TN91 4DQAA 4QKBA 4PF5A 1NQJA 2P2KA 4PIYA 2JDYA 1JUIA 2XH6A 1RXGA 1W9FA 4JKKA 5F2SA 4BQYA 1XSRA 5C6CA 1JH5A 2F17A 4OQ9A 1T6GC 1ODNA 1S0IA 4MGKE 1XNAA 4RN5A 1AR93 4AEDC 4BIFA 1CAUA 4I3GA 1O3QA 1PK6C 1JN2P 3QCWA 2J42A 2QJVA 1UYXA 4KWLA 4UFKA 4LO5B 1F4HA 2RM22 2XGXA 4GA9A 4QQOA 4FOVA 3CL1A 3GZUC 2D93A 4CDWA 1C8NA 1RUJ3 3QH6A 5C4WA 3VKOA 4FTBA 3NV1A 1UYPA 2PHWA 1CJDA 4IGQA 1ND3A 4IERA 3USSA 4J6GA 1DCSA 1XE7A 2CAVA 3WQ7A 3EQEA 1QDOA 3NAPB 2RG4A 4M0NA 1XNBA 3MZHA 5K4LA 4WM8A 1TME1 1O3RA 2ATFA 1D4VB 2G19A 4XJAA 4Y5TA 4ASMB 2DURA 1OT5A 1RUD3 1PM4A 3BB6A 1I1EA 3IBMA 3CNAA 5CADA 1WLWA 2CDPA 2ZZQA 1N1TA 5EWSA 1JUHA 2PHDA 4IETA 2SBAA 3A4UA 1W05A 2O14A 5JZGB 1JHJA 5IVFA 1W6MB 1OOPA 3HWJA 3KV4A 2GZWA 2RS13 2Z69A 3IDAA 4Q4X2 1H6XA 1FI2A 3NV4A 3HIFA 4KI5M 1POV3 3DPRB 3R4UA 2VZSA 2QQJA 1FMD3 1PO21 4A45A 2F4LA 3ZN6A 1A8DA 2OT7A 1J83A 3N9OA 4OI0A 1CPNA 1C8M2 5BNNA 2JENA 3AP4A 3O12A 4UT5A 4CE8A 3ZLIA 1XQNA 3IB3A 2CWSA 3OGJA 4LBQD 1JZ3A 1XE0A 4P9WA 5FYIA 3JD73 4BQ4A 1YQ2A 1LOAA 4B29A 5FLIA 1LOFC 1CN1A 5GZEA 4DS0A 3WUDA 4CDQA 4DIQA 3RFRA 4YGEA 4WM7A 5A7SA 4OI1A 1OH3A 5K0UA 3AYEA 3F2ZA 2PHXA 4YM3A 4UBHA 1VBE1 3AMHA 3M4FA 1GWKA 5EZWA 3ZIXA 4YW1A 1DQ0A 2JDHA 3BVCA 1LOGA 1CAWA 4N9IA 5FY5A 3HBKA 2W1WA 1DF0A 1REFA 1W8OA 3VBRB 3WNNA 5B2GB 4HL0A 1US3A 1DGRN 1GQGA 2AREA 3ES1A 3FWEA 3GBWA 4M3CF 5DZFA 1QHDA 5I0RA 3QH7A 3ME2A 4C91A 3PIJA 3DYOA 3H3LA 5IVEA 4E2GA 4JKMA 3VKNA 3ACFA 5C8WA 4XJ8A 3J9SA 4META 1AJOA 1ZRIA 3TAYA 4IV3B 3T4VA 2F6BA 3O0WA 3KSCA 1RUG2 1W04A 1TMF3 1AVBA 5ANQA 3NJYA 3MW3A 2NYYA 2B9VA 3B7MA 1NOVA 3SQOA 2IVIB 2VZ1A 4RQPB 4Q4X3 1NZIA 1RITA 3TEZA 5DZGA 4UI9L 1NY72 5F8PA 2A3WA 1VAVA 2DUOA 4YRDA 2J7MA 3ITQA 2RM21 1GNYA 1QXJA 4UW5A 3EYPA 4JHZA 4HXCA 3AKRA 1QKQA 4CSWA 3MIDA 2JB4A 3E5QA 2D43A 3QLQA 1Q8SA 4OI4A 4LUMA 3VDDB 4XFHA 1HRV2 3U75A 1DQ1A 5DG2A 1VLNA 3A7QA 4AHWA 1JODA 2V4VA 1VB2A 2P5BA 4O9GA 3E6CC 1JYCA 2WWSA 4EN7B 3GNEA 1FT9A 2WNVC 5C8CB 4A2UA 2BVVA 4Q0QA 4LBMA 4OI2A 5FZCA 2QDRA 4WVMB 3Q8EA 5FYMA 2VOKA 2FDGA 2C6SA 3IPVA 5D8AC 2Y6FA 3ROUA 2OX0A 3FX3A 1JZ5A 4WVZA 4I30A 3AZYA 1QXRA 4FQZA 1V6KA 1SLAA 3O7OA 2C0ZA 2Y6LA 2ERFA 4OHZA 3GXUA 2JECA 1Y43B 2P34A 2ZHLA 3WF1A 1ODMA 4MXWA 3MIHA 4HZFA 1F15A 4B8EA 3BYWA 5FBZA 1RUC2 2HWD3 2PHUA 1HJFA 1UMZA 1O5UA 2O0OA 2HH9A 3KMHA 1S0BA 4XACA 2R30A 4BQ5A 1RTVA 3MUZ1 3ZX7A 2ARXA 1C8M1 4IEWA 4H14A 3PJYA 1HDKA 4X6RB 4R9BA 3AXDA 2HWB3 4XF3A 4QPGA 5I0TA 2CYFA 3MF6A 3CMGA 5FPAA 3P6BA 1XYNA 3GDBA 3LDKA 3O1PA 4YFWA 3H0OA 3H3ZA 1H1AA 2DUQA 1CGPA 3T0BA 4CDWC 1HB3A 2JDKA 1VBC3 4KWJA 4LOTA 4M0HA 3B9CA 5BYNA 3C2UA 3OYWB 5A3TA 1ND3C 2X5IC 1K5JA 3WG2A 2Q30A 3JZVA 4XF0A 3BOWA 1AXYA 5FZIA 4Y24A 1NX9A 5T5OA 1BLZA 3ES4A 4XAAA 1XYPA 5FCCA 2VZTA 3IDCB 5I8TA 1YRZA 4WM8C 1HIXA 4P9YA 2R7EB 5FXWA 1RUOA 3VZMA 3I2OA 4QGNA 5CZKA 2DCYA 1C28A 3H8OA 2YC0A 5ABJB 1W39A 4XQWA 2WINB 3B94A 4C8DA 1HRV3 1IKQA 4F7ZA 3UJQA 3THCA 1BVP1 4D6RA 1OOPC 2WZPP 1S2KA 1W8TA 4XQ4A 3JBG2 4HSJA 4XXAA 3OGRA 3MIBA 3AP5A 1F8VA 4MGTA 1IG0A 1S0EA 2Z42A 2JB8A 1RUG1 3GJAA 2OPKA 4UBGA 3WF3A 4CA9A 3O5SA 1ZBA3 2UY9A 3OBZA 5BV6A 1WZXA 3DL3A 2PQQA 1YFXA 3K48A 4XBNA 3C8XA 1F2NA 4ISRA 4ZZ8A 5LBBA 3SNMA 1B35A 2V09A 5JSRA 1ULFA 2HWE3 1UQXA 1UY4A 2Q4SA 1Z0HA 1NXMA 2ZEYA 1RHI2 3CIHA 2OUHA 4CDQC 1F5JA 3OBRA 4AE2A 2VPVA 3AP9A 3GZEA 1R082 3FJSA 1GLHA 4QDRA 2K9ZA 4FXGB 4WM7C 1S2EA 5FY1A 5GJ6A 4AVAA 1YJKA 5FR3A 5JCTA 4LIVA 2ZGRA 2PELA 5T55A 1HN0A 1W9YA 1N1YA 1UZYA 2WWUA 2ZEXA 3KVAA 1LGNA 4HFSA 5KHIA 1KRIA 4FCAA 1Z7S2 3S5QA 4BDVB 1GP5A 4R4XA 4LHNA 4JGYA 1BMV2 1CAXB 1CESA 4NAOA 2RMU3 1IPKA 1WW4A 5GZFA 2WJSA 3TYJA 2JG8B 1YWKA 3UYJA 1YCIA 4BQ1A 1SBEA 5IAVA 1NLQA 4FT8A 1UPSA 4CYDA 5CAZA 2ZX3A 4Q0UA 1J1TA 1JYWA 1Q3EA 3SISA 1H8TB 2RS52 4NN0A 4RFT0 2JDPA 5EQUA 4LR4A 5AFBA 2DYCA 5A7NA 4E2QA 1MVQA 4PQQA 4Y1YA 4CP9A 1WMXA 1YEWA 3RZGA 4QXCA 1ZZCA 1RUC1 1GOGA 3PTRB 4TYSA 4DNYA 5LEKA 3VBHA 1M06G 2QUOA 4K7JA 2YY1A 4WZCA 1BK0A 2UU8A 1VMHA 3I2JA 4OYUA 1W03A 3SH5A 4G4FA 1SPPB 4A3ZA 2WFF1 4QX8A 3RRDA 5KHJA 1QOTA 3JBG3 2ZEZA 4I09A 1WLDA 1XNTA 3FUQA 3PVOA 2ZABA 1ULPA 2B42B 3LOIA 2BERA 3DXTA 4EZHA 1WCUA 1WD3A 3BN6A 3N9QA 3KCYA 4XUPA 4D7SA 4LA2A 3K4AA 1KJRA 1UU6A 1LU1A 2ZGTA 4FTEA 1O91A 3NO8A 1V6IA 4M4RA 1IG3A 3EMRA 3IT8A 2TBVA 1RUE2 4LT5A 2GH2A 1CAVB 2OZ6A 2W0XA 2VCBA 4MGYE 4NPMA 1O4ZA 5F3GA 4AWDA 3AM2A 5IK5A 1YJLA 2XWJB 1RHI3 5JSOA 4E8DA 2VR4A 3MICA 3C7OA 4XTPA 2D6MA 4Q4W2 4EN0A 2BEOA 3VN4A 1R083 3R05A 2JKBA 3C7EA 5JIUA 4RFRB 1PMJX 1IS3A 2ZGNA 2VH9A 4AVSA 1UCXA 2JIGA 3HR9A 5HI0A 1G9BA 4DOUA 4DFSA 5FZAA 2B4KA 1EUUA 2ENRA 5IHRA 2JD9A 1GV9A 3L2HA 5CFCB 4YM2A 5FPXA 4IGOA 2ORXA 4BU2A 1GNHA 2ZZJA 2D6OX 4IE7A 2GC1A 2CGOA 4XXPA 3NVCA 2RS53 4KMQA 3FFQA 5GZDA 1W6QA 5HCAA 2Q8CA 2Y0OA 4CCCA 3ETPA 4W4ZA 2QQVA 5BNOB 4QPGC 2ZAAA 4QPIA 4YW3A 5CNAA 3ZN4A 2WA4A 4XMAA 1CZSA 5EV7A 4IUGA 3AZVA 2ZS6B 3B9IA 4ASKA 3AXEA 1Q8OA 1GZTA 3ZOIA 1DFQA 5T5LA 3WNMA 3MF9A 3VL9A 5I8YA 1UO9A 2Z4FA 2VMFA 4ITCA 2B9UA 2AEYA 1HV1A 1Z7S1 2YB7A 3B5LB 2EF6A 1BMV1 3VBFB 2BDRA 4CTEA 4Q2FA 1EPZA 1JBCA 2E9QA 3UGGA 1PVXA 4MXVA 2AR6A 3CJIC 5FZOA 1W0NA 3HNMA 3P3PA 3LE0A 3MW4A 3NKTA 4AAPA 1O59A 3RZJA 1QDCA 1RUE3 4X6QB 3ZXGA 3JXSA 4BMBA 5F3IA 3T2TA 2Q8DA 2O1QA 2BQPA 1OKQA 5FJHA 3ZMNA 3OPTA 1RVF2 4Q4V2 2XWBB 4CU9A 2W5FA 1FYUA 3D0SA 3GBGA 1WGPA 3ILRA 5FWEA 4UF0A 3A0NA 1AR82 2GNTA 1OPMA 3POWA 1RMU2 4HK8A 4P00B 4XFCA 3ZYBA 2QVSB 1J3RA 2VU9A 1ZBE2 2I74A 4LBQA 5E88A 2W47A 3ILNA 5FY7A 1TVGA 5LWBA 3ZFFA 3VHOA 4A4AA 3OUHA 4L2NA 5FXXA 3RJRA 2HBTA 1UX7A 2WQZC 1VBA1 4YYOA 1LENA 5A3MA 2DVDA 3GJBA 1AR72 1WCQA 4FP2A 1AF9A 2VW0A 2IWGB 3CU7A 4LE4A 1N1VA 5C3PA 4R9CA 3WG4A 5JOZA 2VBPA 3LGRA 5JUVA 4PLNA 4HOOA 4C90A 1OA3A 2VOXA 2WUHA 4FOQA 3TEXA 3ZFGC 4AQ6A 3VBSB 3SHRA 5FP4A 5FUNA 4JGYC 2P6CA 4QQPA 4XEZA 4NIAA 2B8MA 3SCFA 2Y6KA 4Q4W1 2NM1A 4N53B 2VZQA 2B39A 2P3IA 3N36A 3JU9A 3Q8BA 4JVAA 4KWKA 1E57A 5JVVA 2W87A 3UESA 4KH9A 2OS2A 5FZEA 4CEYA 1A6CA 4D7TA 1JI6A 2VCMA 4R52A 4QPYA 2XJVA 3ELNA 1LHOA 1QJY2 2R072 2G1MA 2W2IA 4XUTA 2LRPA 5A3OA 1FPN2 1J59A 5FV3A 1ULDA 2VTXA 1VE0A 1VR3A 1HXS2 3KB5A 3VBHC 4NPRA 4KQ7A 4AFBA 2AC1A 3KHCA 4M01A 3ZPYA 2E7AA
chains in the Genus database with same CATH topology
1SG3A 3OBAA 1HN1A 2J1VA 4BK4A 5EIYB 4M4PA 3P1IA 2BGOA 5IFTA 4CU7A 2VMDA 4ARXA 1T2XA 2YFZA 1UXXX 1JYNA 2VO5A 3HOBA 1UZ0A 3T2QA 2CDOA 3LEGA 3VDCA 5C7GA 2WAOA 1OD3A 2HYXA 2VZVA 2X05A 4QX0A 2BBAA 4XUNA 5J1XA 2RJ2A 2XQXA 3WNOA 4XZUG 1GOFA 2Y6GA 3CDZB 3C7HA 5JR2A 4JKLA 3I3BA 3NJVA 4OMDA 3I97A 4JKKA 4QB6A 2VZRA 3J7HA 4RN5A 4BXSV 1XNAA 3T2OA 1UYYA 2QQIA 1UY3A 4DUVA 1UYXA 1RYYA 3VD3A 1F4HA 2E33A 2JE8A 1L7RA 1XPWA 2J22A 2X09A 1JYVA 2L9LA 5JXHA 2PQSA 3PUHA 3FL7A 1PX3A 3MO4A 4A6OA 3HEIA 1OT5A 4XURA 2J1UA 3T2PA 1GMMA 2CDPA 2DCKA 5B4NA 1JHJA 2C9KA 2J1SA 3WF2A 2WO3A 3I2HA 3IDAA 3VDAA 1W9WA 2XONA 1H6XA 4KI5M 2YFUA 3DYPA 2VZSA 4ZZ5A 4P08A 2QQJA 4A45A 3W5MA 1J83A 3NRUA 2Y64A 3WSOA 4AG4A 4AAXA 5A1AA 4LPLA 3IB3A 3WEZA 4CU6A 1JZ3A 4DEVA 3OEAA 1YQ2A 3CQOA 2WABA 3EB7A 2VTFA 2DCJA 1F4AA 1UMHA 1MPXA 3F2ZA 4OMCA 4DUXA 2JDAA 5JXGA 2Y6HA 2OKXA 1K12A 1W9TA 3A21A 4CUBA 2W1WA 1W8OA 2VOTA 3WNNA 1US3A 3CZUA 2ORZA 3IAQA 3ACIA 1GOHA 5IFPA 4XUOA 5C70A 1PMHX 4UOJA 5F7UA 1P8JA 2YG0A 1KGYA 3DYOA 1OF3A 4JKMA 3ACFA 1K3IA 4MADA 4YPJA 4LHSA 1L7QA 3LPGA 2J1AA 3A23A 2EIBA 3DYMA 3SEPA 4QAWA 2B9VA 2VZ1A 2Y8KA 2WBKA 4UI9L 2J7MA 2WQ8A 1GNYA 3EYPA 4JHZA 1UXZA 3U37A 3HPNA 2WZEA 4D0QA 5DQ0A 4P02B 1CZVA 3A7QA 3FHQA 2V4VA 2RVAA 3ZM8A 3T09A 1GU3A 2W91A 4D8MA 2LS6A 3A22A 1JZ2A 3ECQA 3CKHA 4MGQA 2E31A 3K75B 3SKVA 3T08A 1D7PM 1JU4A 3GM8A 5EJZB 2HLEA 2BGPA 4JX0A 1JZ5A 2Y6LA 3WF1A 2W1UA 3GXUA 3HN3A 5JXJA 2QQNA 2V5DA 3K77A 3MUZ1 2ID4A 3OEBA 1KEXA 3CMGA 3P6BA 3GDBA 5LA2A 1CIYA 2BZDA 4UAPA 5JMOA 4E8CA 3T0BA 3VDBA 4LKSA 1EUTA 2XHNA 5FUIA 2WDBA 5B4XA 2WO2A 1NX9A 3E1F1 1W8NA 2J1EA 2VZTA 2EIDA 2R7EB 3LPFA 5CZKA 4PF1A 1DLCA 1DP0A 3THCA 4FI9A 3MV11 1JZ7A 3K4ZA 4L0PA 1GUIA 3OGRA 3C7FA 3IAPA 3WF3A 1JZ4A 2WN3A 4MGSA 1OF4A 1XC6A 4TTGA 3MBWA 1UMIA 1I5PA 2WO1A 3C8XA 4KWUA 4ZZ8A 1UY1A 5LCWL 4DXRA 1UY4A 1K42A 1NKGA 2WN2A 2ZEYA 3CIHA 2WZ8A 2W1QA 4QDRA 2VZUA 3MV01 1NAEA 2VQUA 2ZXQA 3VD9A 4ZXEA 2ZEXA 3UNPA 3DECA 3NNGA 4BDVB 1US2A 3OG2A 1CX1A 1J84A 2VZPA 1UYZA 2J1TA 5CYYA 3UETA 3PUIA 2W9XA 3W5NA 1JYWA 2VM9A 4QB1A 4DUWA 2VL4A 4QX1A 3WNKA 4W8JA 3I3EA 3BGAA 5IYYA 2VZ3A 3VD5A 3D3AA 4PQQA 4MO3M 1SHWB 2E26A 1K45A 1GOGA 2C4XA 3WF0A 2VQTA 1O8PA 3I2JA 4OYUA 3I2GA 4A3ZA 2XOMA 3I3DA 2ZEZA 4DEQA 4ET7A 1XNTA 1JZ8A 1ULPA 2BERA 2QQLA 3BN6A 3NQHA 4XUPA 1OH4A 2JKXA 2VCCA 3K4AA 2W3JA 5EJ1B 4M4RA 4QB2A 1TG7A 1BHGA 1WKYA 4BJ0A 2VCBA 3VD7A 3MUY1 3LQCA 2E32A 2V72A 2VR4A 3C7OA 4E8DA 5C71A 4CUAA 4GWIA 3C7EA 3SKJE 1PMJX 4LQRA 3I2KA 3K46A 4Z2AA 4XVHA 4QPWA 4TXWA 1LNSA 5HXMA 2B4KA 1EUUA 3WNPA 5IHRA 2JD9A 4CUCA 2ORXA 3HNBM 2VMEA 3WNLA 2QQOA 2W46A 2C26A 3AC0A 3I2IA 2W92A 4PT6A 1CZTA 4KMQA 2QBXA 5LA1A 2QQMA 3LEKA 3ETPA 4W4ZA 2X10A 5G05L 4MOAA 1CZSA 3ACGA 4GZ9A 3IIIA 4IUGA 3GGLA 3T0DA 4BK5A 3WNMA 4RYDA 5DN2A 4QX3A 2Z4FA 2VMFA 1UWWA 3C7GA 4OUEA 4A42A 2YB7A 2LW8A 2WYSA 3FHAA 5LA0A 2VJXA 3HJRA 1IQDC 1DYOA 3OGVA 2Y6JA 3I2FA 4XUQA 3WF4A 4ARYA 1W0NA 3HNMA 3LE0A 1O59A 4A41A 3LEIA 3THDA 3JXSA 2ZEWA 2W1SA 1H6YA 2J1RA 5IJRA 2YC2A 4CVUA 4ZY9A 3K4DA 4CU9A 3ABZA 2W5FA 1W9SA 1JZ6A 4P00B 5G04L 2W47A 1TVGA 4QDQA 1R64A 2W95A 4W50A 2VCAA 4A4AA 3OGSA 1JU3A 5DMYA 1UY0A 1UX7A 2WAAA 4OZOA 4P5YA 1WCQA 4DXTA 3CZJA 5JXIA 2VC9A 5JUVA 3HNYM 1ULOA 2W94A 3ACHA 5HPOA 2VMCA 3SEEA 2WUHA 4A44A 2EIEA 1W99A 5DPNA 4QDSA 3T0AA 2Y6KA 3WQBA 1JYXA 3OB8A 1UY2A 3FN9A 2QQKA 2VZQA 1NUKA 2W87A 1PX4A 3UESA 2YC4A 3NJXA 2RV9A 2VZOA 4GWJA 1JI6A 2EICA 4CU8A 4HG6B 1O8SA 4XUTA 5I0DA 2DDUA 2KD7A 1GQPA 4QX2A 3VD4A 4DXSA 1SDDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SG3 A;  3OBA A;  1HN1 A;  2J1V A;  4BK4 A;  5EIY B;  4M4P A;  3P1I A;  2BGO A;  5IFT A;  4CU7 A;  2VMD A;  4ARX A;  1T2X A;  2YFZ A;  1UXX X;  1JYN A;  2VO5 A;  3HOB A;  1UZ0 A;  3T2Q A;  2CDO A;  3LEG A;  3VDC A;  5C7G A;  2WAO A;  1OD3 A;  2HYX A;  2VZV A;  2X05 A;  4QX0 A;  2BBA A;  4XUN A;  5J1X A;  2RJ2 A;  2XQX A;  3WNO A;  4XZU G;  1GOF A;  2Y6G A;  3CDZ B;  3C7H A;  5JR2 A;  4JKL A;  3I3B A;  3NJV A;  4OMD A;  3I97 A;  4JKK A;  4QB6 A;  2VZR A;  3J7H A;  4RN5 A;  4BXS V;  1XNA A;  3T2O A;  1UYY A;  2QQI A;  1UY3 A;  4DUV A;  1UYX A;  1RYY A;  3VD3 A;  1F4H A;  2E33 A;  2JE8 A;  1L7R A;  1XPW A;  2J22 A;  2X09 A;  1JYV A;  2L9L A;  5JXH A;  2PQS A;  3PUH A;  3FL7 A;  1PX3 A;  3MO4 A;  4A6O A;  3HEI A;  1OT5 A;  4XUR A;  2J1U A;  3T2P A;  1GMM A;  2CDP A;  2DCK A;  5B4N A;  1JHJ A;  2C9K A;  2J1S A;  3WF2 A;  2WO3 A;  3I2H A;  3IDA A;  3VDA A;  1W9W A;  2XON A;  1H6X A;  4KI5 M;  2YFU A;  3DYP A;  2VZS A;  4ZZ5 A;  4P08 A;  2QQJ A;  4A45 A;  3W5M A;  1J83 A;  3NRU A;  2Y64 A;  3WSO A;  4AG4 A;  4AAX A;  5A1A A;  4LPL A;  3IB3 A;  3WEZ A;  4CU6 A;  1JZ3 A;  4DEV A;  3OEA A;  1YQ2 A;  3CQO A;  2WAB A;  3EB7 A;  2VTF A;  2DCJ A;  1F4A A;  1UMH A;  1MPX A;  3F2Z A;  4OMC A;  4DUX A;  2JDA A;  5JXG A;  2Y6H A;  2OKX A;  1K12 A;  1W9T A;  3A21 A;  4CUB A;  2W1W A;  1W8O A;  2VOT A;  3WNN A;  1US3 A;  3CZU A;  2ORZ A;  3IAQ A;  3ACI A;  1GOH A;  5IFP A;  4XUO A;  5C70 A;  1PMH X;  4UOJ A;  5F7U A;  1P8J A;  2YG0 A;  1KGY A;  3DYO A;  1OF3 A;  4JKM A;  3ACF A;  1K3I A;  4MAD A;  4YPJ A;  4LHS A;  1L7Q A;  3LPG A;  2J1A A;  3A23 A;  2EIB A;  3DYM A;  3SEP A;  4QAW A;  2B9V A;  2VZ1 A;  2Y8K A;  2WBK A;  4UI9 L;  2J7M A;  2WQ8 A;  1GNY A;  3EYP A;  4JHZ A;  1UXZ A;  3U37 A;  3HPN A;  2WZE A;  4D0Q A;  5DQ0 A;  4P02 B;  1CZV A;  3A7Q A;  3FHQ A;  2V4V A;  2RVA A;  3ZM8 A;  3T09 A;  1GU3 A;  2W91 A;  4D8M A;  2LS6 A;  3A22 A;  1JZ2 A;  3ECQ A;  3CKH A;  4MGQ A;  2E31 A;  3K75 B;  3SKV A;  3T08 A;  1D7P M;  1JU4 A;  3GM8 A;  5EJZ B;  2HLE A;  2BGP A;  4JX0 A;  1JZ5 A;  2Y6L A;  3WF1 A;  2W1U A;  3GXU A;  3HN3 A;  5JXJ A;  2QQN A;  2V5D A;  3K77 A;  3MUZ 1;  2ID4 A;  3OEB A;  1KEX A;  3CMG A;  3P6B A;  3GDB A;  5LA2 A;  1CIY A;  2BZD A;  4UAP A;  5JMO A;  4E8C A;  3T0B A;  3VDB A;  4LKS A;  1EUT A;  2XHN A;  5FUI A;  2WDB A;  5B4X A;  2WO2 A;  1NX9 A;  3E1F 1;  1W8N A;  2J1E A;  2VZT A;  2EID A;  2R7E B;  3LPF A;  5CZK A;  4PF1 A;  1DLC A;  1DP0 A;  3THC A;  4FI9 A;  3MV1 1;  1JZ7 A;  3K4Z A;  4L0P A;  1GUI A;  3OGR A;  3C7F A;  3IAP A;  3WF3 A;  1JZ4 A;  2WN3 A;  4MGS A;  1OF4 A;  1XC6 A;  4TTG A;  3MBW A;  1UMI A;  1I5P A;  2WO1 A;  3C8X A;  4KWU A;  4ZZ8 A;  1UY1 A;  5LCW L;  4DXR A;  1UY4 A;  1K42 A;  1NKG A;  2WN2 A;  2ZEY A;  3CIH A;  2WZ8 A;  2W1Q A;  4QDR A;  2VZU A;  3MV0 1;  1NAE A;  2VQU A;  2ZXQ A;  3VD9 A;  4ZXE A;  2ZEX A;  3UNP A;  3DEC A;  3NNG A;  4BDV B;  1US2 A;  3OG2 A;  1CX1 A;  1J84 A;  2VZP A;  1UYZ A;  2J1T A;  5CYY A;  3UET A;  3PUI A;  2W9X A;  3W5N A;  1JYW A;  2VM9 A;  4QB1 A;  4DUW A;  2VL4 A;  4QX1 A;  3WNK A;  4W8J A;  3I3E A;  3BGA A;  5IYY A;  2VZ3 A;  3VD5 A;  3D3A A;  4PQQ A;  4MO3 M;  1SHW B;  2E26 A;  1K45 A;  1GOG A;  2C4X A;  3WF0 A;  2VQT A;  1O8P A;  3I2J A;  4OYU A;  3I2G A;  4A3Z A;  2XOM A;  3I3D A;  2ZEZ A;  4DEQ A;  4ET7 A;  1XNT A;  1JZ8 A;  1ULP A;  2BER A;  2QQL A;  3BN6 A;  3NQH A;  4XUP A;  1OH4 A;  2JKX A;  2VCC A;  3K4A A;  2W3J A;  5EJ1 B;  4M4R A;  4QB2 A;  1TG7 A;  1BHG A;  1WKY A;  4BJ0 A;  2VCB A;  3VD7 A;  3MUY 1;  3LQC A;  2E32 A;  2V72 A;  2VR4 A;  3C7O A;  4E8D A;  5C71 A;  4CUA A;  4GWI A;  3C7E A;  3SKJ E;  1PMJ X;  4LQR A;  3I2K A;  3K46 A;  4Z2A A;  4XVH A;  4QPW A;  4TXW A;  1LNS A;  5HXM A;  2B4K A;  1EUU A;  3WNP A;  5IHR A;  2JD9 A;  4CUC A;  2ORX A;  3HNB M;  2VME A;  3WNL A;  2QQO A;  2W46 A;  2C26 A;  3AC0 A;  3I2I A;  2W92 A;  4PT6 A;  1CZT A;  4KMQ A;  2QBX A;  5LA1 A;  2QQM A;  3LEK A;  3ETP A;  4W4Z A;  2X10 A;  5G05 L;  4MOA A;  1CZS A;  3ACG A;  4GZ9 A;  3III A;  4IUG A;  3GGL A;  3T0D A;  4BK5 A;  3WNM A;  4RYD A;  5DN2 A;  4QX3 A;  2Z4F A;  2VMF A;  1UWW A;  3C7G A;  4OUE A;  4A42 A;  2YB7 A;  2LW8 A;  2WYS A;  3FHA A;  5LA0 A;  2VJX A;  3HJR A;  1IQD C;  1DYO A;  3OGV A;  2Y6J A;  3I2F A;  4XUQ A;  3WF4 A;  4ARY A;  1W0N A;  3HNM A;  3LE0 A;  1O59 A;  4A41 A;  3LEI A;  3THD A;  3JXS A;  2ZEW A;  2W1S A;  1H6Y A;  2J1R A;  5IJR A;  2YC2 A;  4CVU A;  4ZY9 A;  3K4D A;  4CU9 A;  3ABZ A;  2W5F A;  1W9S A;  1JZ6 A;  4P00 B;  5G04 L;  2W47 A;  1TVG A;  4QDQ A;  1R64 A;  2W95 A;  4W50 A;  2VCA A;  4A4A A;  3OGS A;  1JU3 A;  5DMY A;  1UY0 A;  1UX7 A;  2WAA A;  4OZO A;  4P5Y A;  1WCQ A;  4DXT A;  3CZJ A;  5JXI A;  2VC9 A;  5JUV A;  3HNY M;  1ULO A;  2W94 A;  3ACH A;  5HPO A;  2VMC A;  3SEE A;  2WUH A;  4A44 A;  2EIE A;  1W99 A;  5DPN A;  4QDS A;  3T0A A;  2Y6K A;  3WQB A;  1JYX A;  3OB8 A;  1UY2 A;  3FN9 A;  2QQK A;  2VZQ A;  1NUK A;  2W87 A;  1PX4 A;  3UES A;  2YC4 A;  3NJX A;  2RV9 A;  2VZO A;  4GWJ A;  1JI6 A;  2EIC A;  4CU8 A;  4HG6 B;  1O8S A;  4XUT A;  5I0D A;  2DDU A;  2KD7 A;  1GQP A;  4QX2 A;  3VD4 A;  4DXS A;  1SDD B; 
#chains in the Genus database with same CATH topology
 2NPI A;  2PTM A;  5LRS A;  2WNU A;  3OBA A;  4FP3 A;  2K2S A;  1GZW A;  4YLZ A;  1Y9M A;  2VNO A;  4NWW A;  1RVF 3;  4Q4V 3;  4FAG A;  1MAC A;  3B01 A;  3VUO A;  4BK4 A;  5EIY B;  3VBU A;  4D3W A;  1BKZ A;  4ZON A;  2CL2 A;  3EXU A;  5J3U A;  3ILF A;  2V5Y A;  4ZXK A;  5FO7 B;  2VXJ A;  1ZBE 3;  4HPK B;  4MZU A;  4ARX A;  4LBO A;  4YVW B;  4FFI A;  1T2X A;  2EAK A;  1FX5 A;  1S0F A;  1J3P A;  5J96 B;  3ON7 A;  1HX6 A;  1JYN A;  2CU5 A;  5A80 A;  2A6W A;  4QM8 A;  2UYA A;  3ZSJ A;  1XNK A;  1UZ0 A;  2VBD A;  1AR7 3;  5FY8 A;  1VAK A;  5FYT A;  2VZV A;  3M3O A;  1PO1 2;  1V9U 1;  5FZD A;  3U0Z A;  3ZXD A;  3VV1 A;  1GWM A;  4LTA A;  1H2L A;  2WZR 3;  3V0B B;  2VEC A;  3E6B A;  1AL2 1;  3VZJ A;  2FMY A;  2XLA A;  4IEV A;  1NLR A;  4HBN A;  3CDZ B;  1X36 A;  3HQX A;  1PK6 A;  5A3N A;  3I3B A;  1DZR A;  5A7O A;  5C5T A;  3I97 A;  1Y3T A;  2C5D A;  4QB6 A;  5J7M A;  2G9G A;  2BOJ A;  4PDW B;  2QZ2 A;  3J7H A;  4CCJ A;  2PHR A;  3RS6 A;  2JDM A;  3KCC A;  1RMU 1;  1J1L A;  5KHH A;  1DGL A;  1QY4 A;  1UF2 C;  2C24 A;  2R06 2;  1RYY A;  3LKJ A;  3VD3 A;  2OII A;  4FPH A;  4IGP A;  2E33 A;  3HVD A;  1MS4 A;  5FAX A;  5E8A A;  3PVN A;  4QPI C;  3H8X A;  1N3P A;  3JCI A;  4BIO A;  1KD7 A;  2O8Q A;  1MQT B;  1Q56 A;  1FPN 3;  3N9P A;  1RB8 G;  3OCP A;  4N7I A;  5JOY A;  3GF6 A;  3NW4 A;  3FL7 A;  3R4S A;  3RDI A;  4CEW B;  4AYU A;  3KV5 A;  3MO4 A;  1GKB A;  2VQA A;  1OPO A;  2YHJ A;  1LOB A;  5C9A C;  4Y4R A;  1OA2 A;  1PZ8 A;  1F9K A;  2RR1 2;  3NNM A;  4Q8K A;  4XUR A;  4E9K A;  4JV4 A;  4RS5 B;  2FZ1 A;  4XC9 A;  4D6Q A;  4L11 A;  1DQ4 A;  3NWK A;  5B4N A;  1FOD 3;  3ZXA C;  5F5A A;  2P6H A;  3ZIW A;  1ZZ9 A;  2VUJ A;  3I2H A;  3M8L A;  4RHV 1;  3VDA A;  1W9W A;  4XDQ A;  4QKF A;  4LLF A;  4R4Z A;  2ZA9 A;  1JMU B;  2K46 A;  4EE2 A;  2OQ7 A;  3KGZ A;  1SAC A;  1QJY 1;  2H0V A;  5FZK A;  2R07 1;  3LFM A;  1PO1 3;  2VBB A;  4B7E A;  1DQ5 A;  4GMP 1;  4Q4Y 2;  4JC1 A;  1S0C A;  2XVL A;  4LA3 A;  1LOF A;  1YNA A;  2XBO 1;  3AKP A;  4RR3 B;  3WSO A;  5JPM B;  1HXS 1;  3N7M A;  1OUR A;  3IZO A;  4AAX A;  5A1A A;  1NCQ B;  1W2T A;  2ZGP A;  3H1Y A;  3OF1 A;  2UWC A;  4LPL A;  4DMI A;  4CU6 A;  5A33 B;  1ENQ A;  2KR2 A;  4FFG A;  4K8F A;  1UNB A;  2WS9 2;  5FZL A;  1MS1 A;  4B4P A;  4EZ4 A;  1S1A A;  3ZFF C;  2G9Z A;  1X50 A;  3RZM A;  3WP4 A;  1IOA A;  4LO7 A;  2WAB A;  4Y5S A;  3SH4 A;  5CEH A;  1UOJ A;  2FDF A;  3EB7 A;  5HCB A;  4HN1 A;  1KIT A;  1QF3 A;  3AB0 A;  4QHO A;  1F4A A;  4YFZ A;  1UMH A;  1GSL A;  3AMN A;  4CP1 A;  4OMC A;  4YGC A;  2JG9 B;  2JDA A;  2R06 3;  4QGL A;  2OKX A;  1GWL A;  4S2F A;  3ZVX A;  3I59 A;  2VUD A;  1UOF A;  2XKO A;  3CJX A;  4IW3 A;  3AP7 A;  5IVY A;  3DEM A;  3A21 A;  4LJH A;  1OSG A;  3ZXE A;  5KXE A;  3VBO A;  2VNG A;  1AR9 2;  4NIG A;  3VB9 A;  4M3C E;  4DO0 A;  1GOH A;  1R1A 1;  4XUO A;  1PGL 2;  2HWF 1;  5F7U A;  1I3H A;  2YG0 A;  5FYY A;  3VKF C;  3KT1 A;  4AOC A;  1OF3 A;  4XHB A;  3WHT A;  4URA A;  3TRS B;  3VGI A;  5CKQ A;  2ET7 A;  5ACA 1;  3LIH A;  1K3I A;  4MAD A;  3T3Y A;  4CEY C;  1SZB A;  5CA6 A;  1LED A;  3U1X A;  1L7Q A;  1O4Y A;  1OC1 A;  1XXN A;  5EFU A;  2WC2 A;  3LPG A;  1W8F A;  3WDX A;  2BWA A;  2R04 2;  5CIR A;  1QOS A;  1VBD 1;  1D2Q A;  4FFH A;  4JDO A;  4QAW A;  4AZZ A;  1MZF A;  4LXL A;  1KS5 A;  2WBK A;  1RUD 2;  5FZH A;  4YWA A;  1HV0 A;  1QJU 3;  1WUV A;  1L7L A;  1YI9 A;  3OY8 B;  5BY5 A;  3N3H A;  4DY5 A;  1GZC A;  2WNU C;  1LOC A;  1RXF A;  2ZHK A;  1VRH 3;  2PLV 2;  4XCA A;  1EAH 2;  3P3N A;  1K5M A;  3WQ0 A;  5BNP B;  3U37 A;  2FMD A;  3ZKU A;  3BIW E;  3E5X A;  4Q4Y 3;  5FRE A;  2WZE A;  2ZGL A;  4D0Q A;  1YUD A;  2VTX J;  1GBG A;  1XU1 A;  5FPB A;  3VBU C;  3QD6 A;  4MG2 A;  3FHQ A;  1NE6 A;  3PMS A;  4CCO A;  3AMP A;  2VMI A;  2WS9 3;  5BXX A;  3ZM8 A;  1GU3 A;  2W91 A;  2LS6 A;  2XQR A;  1JZ2 A;  2RR1 1;  4HT1 T;  3ECQ A;  1W8W A;  4JRL A;  2XJU A;  2BTV C;  4MGQ A;  4Y20 A;  5L7O B;  3K75 B;  2X8K A;  5E6H A;  2Y60 A;  3SKV A;  3IWZ A;  1D0H A;  5JSP A;  3B69 A;  1JU4 A;  1RUI 2;  1OMI A;  3IMM A;  1YLL A;  5D1I A;  2B5H A;  4MYE A;  2BV4 A;  2NN8 A;  3JD7 2;  2VOV A;  1OFS A;  3OD0 A;  2TNF A;  4LKE A;  3N7J A;  4B1L A;  3OBT A;  1CWP A;  3LCP A;  3FZ3 A;  4QHZ A;  5FO8 B;  2OYZ A;  1FAT A;  3PLQ A;  2RS3 3;  1NCR A;  1AYM 2;  1EP0 A;  2D6L X;  5IW0 A;  2EXI A;  5CVR A;  3M3Q A;  5IK7 A;  2V5D A;  4N8M A;  3CO2 A;  5T54 A;  4I3P A;  4EJR A;  1YO8 A;  3LSE A;  4AI9 A;  2A5Z A;  2OPW A;  5FK8 A;  1KEX A;  1U0A A;  1S2B A;  2GMP A;  2DUP A;  1W8U A;  2NZ9 A;  5DDJ 3;  4Y1U A;  3U07 A;  2NP0 A;  4F3J A;  5IWF A;  5FOB B;  1CIY A;  2FHR A;  2BZD A;  2X5I A;  5FLJ A;  4LIU A;  5JMO A;  5FLH A;  1EYB A;  2VMG A;  2ZOE B;  3AMM A;  3GAL A;  1W6P A;  2R04 3;  3VBR C;  3M2M A;  4FPL A;  4CDU B;  2VMH A;  3BPZ A;  3IDE A;  4U36 A;  2WLQ A;  1W8N A;  3K2O A;  1TMF 2;  1UZZ A;  3JQX A;  4V1P A;  5H9Q A;  4AGR A;  2EID A;  2PLV 3;  4AEJ A;  2DVF A;  1EAH 3;  1AX1 A;  5SV5 A;  3ZXK A;  3WW4 A;  4COZ A;  3LPF A;  1XND A;  3SC7 X;  1AR9 1;  5FP7 A;  4NUB A;  4PF1 A;  3ZSE A;  3JUU A;  4ZS3 A;  4AR2 A;  4CXY A;  4N43 A;  5HV0 A;  3ZDS A;  1D4M 3;  4COW A;  4AFA A;  4FSJ A;  1V6N A;  2HYK A;  4FI9 A;  3CHX A;  4A3X A;  5L19 A;  1X33 A;  1RUJ 1;  1R09 2;  1ZNP A;  4L0P A;  4YVS A;  2W39 A;  3C7F A;  5LBF A;  3MHZ A;  5F1R A;  3IAP A;  5DUV A;  1ND2 B;  2WN3 A;  5FYS A;  2WNO A;  5JOW A;  3D8C A;  1XC6 A;  2OVU A;  1RUI 3;  4QQH A;  1U5X A;  3MBW A;  1TEI A;  4XPV A;  2GP5 A;  1EV1 2;  4GJY A;  4KWU A;  5FMC A;  3X29 B;  1LEM A;  3B02 A;  3S6P A;  3VDD C;  1RUD 1;  2BFU L;  2XLF A;  5LCW L;  1AYM 3;  4DRV A;  1O5L A;  2R32 A;  2I2S A;  1LES A;  1R1Z A;  1DQ2 A;  3LEM A;  4Q1R A;  4AI2 A;  4ZU7 A;  1NKG A;  4NPL A;  4DB5 A;  5FTT C;  2YGL A;  1ZVF A;  4PBO A;  3C3V A;  3ZKY A;  2W1Q A;  2IUW A;  3UKN A;  1DGR A;  2RS1 1;  2XKP A;  3H7Y A;  4IEO A;  4EN8 B;  4FPO B;  3H50 A;  1IQA A;  3BIE A;  1ZRF A;  1NAE A;  1PNF A;  2VQU A;  2WT0 A;  4NMI A;  5A7W B;  4ZXE A;  5F3C A;  2DFB A;  1POV 1;  4P9J A;  4AED B;  2G4I A;  5C3S A;  1FMD 1;  1ST8 A;  3NNG A;  4MUV A;  2HWD 2;  5FMO L;  1I5Z A;  1VIW B;  3OG2 A;  1ZZB A;  1TQ5 A;  5BNQ A;  3UET A;  4AK3 A;  2WA3 A;  3B00 A;  3PUI A;  2BRT A;  4QXK A;  3VBO C;  4QXB A;  3D4K A;  2HWB 2;  4AHY A;  4FQ4 A;  3JB8 A;  3JD7 1;  3ZYH A;  3WNK A;  1CQ9 A;  4K21 A;  1VBC 2;  4FPG A;  1EPW A;  2VZ3 A;  3ZFE A;  5I0S A;  2IXC A;  2BGC A;  4MO3 M;  1QJX 2;  2RE9 A;  4TSV A;  3BOP A;  1BK1 A;  2C4X A;  4CCN A;  2RJK A;  3V0A A;  3HD8 B;  4Q1P A;  1BEV 2;  2EA7 A;  4GJZ A;  3LA7 A;  4AHX A;  4C0B A;  1ULE A;  2GME A;  3I2G A;  1R09 3;  3WP5 A;  1APN A;  5IVC A;  4Q5O A;  2UWA A;  1ZZ6 A;  2D3R A;  3NQH A;  4LK6 A;  2A73 B;  4ASL A;  1K5M C;  1BBT 3;  1BXH A;  1HJG A;  2XLG A;  4XIL A;  2PFW A;  4QU2 A;  1EV1 3;  3KQR A;  5EJ1 B;  5ABJ C;  1LHW A;  3USU A;  4XMI A;  1RL3 A;  1TE1 B;  4K3U A;  2DTY A;  3BTA A;  5LY2 A;  1ZBA 2;  1TMF 1;  1W6N B;  5BUV A;  2EXK A;  5A6Q A;  3U14 A;  1HW5 A;  5J48 A;  4FTS A;  4PIX A;  2Q0A A;  2P3Y A;  4Q4X 1;  5CKM A;  1BYH A;  3SKJ E;  3RG0 A;  1AUY A;  2CGP A;  4LQR A;  4PHZ A;  3I2D A;  1DGW A;  2HWE 2;  3I2K A;  4ATE A;  1S0G A;  1XBF A;  5FYV A;  3RGB A;  4IV1 B;  4COU A;  2VW1 A;  4Q8L A;  1LNS A;  3NNL A;  1V70 A;  3LIG A;  1NCR C;  3TB0 A;  5KC5 A;  3O1V A;  1SFN A;  4IE4 A;  4IE0 A;  5FDB A;  1NA1 A;  4IND A;  3J7L A;  1GIC A;  4XAE A;  2VME A;  4LE3 A;  3WNL A;  3I2I A;  2W92 A;  4JRA A;  4PT6 A;  4AFC A;  1PNG A;  1WCK A;  2RMU 2;  3POJ A;  4S2G A;  3LEK A;  2HEV F;  3H42 B;  2EIG A;  3RI8 A;  3KVB A;  2WR9 A;  1H1I A;  4MOA A;  3K3O A;  1QJZ A;  3KD4 A;  1ASJ 2;  1QJX 3;  3A0K A;  3DGT A;  1H0B A;  3GGL A;  3ZYP A;  1D2S A;  4OQ8 A;  3LZZ A;  1BEV 3;  3RJ2 X;  5FUP A;  2R1D A;  1KDK A;  2A70 A;  2Y38 A;  4RYD A;  2P1B A;  2VAU A;  1LAJ A;  5K9Y A;  3INA A;  1SFY A;  5JPN B;  3CJI A;  4OUE A;  4XDP A;  1I6X A;  4R9D A;  2HWD 1;  2WYS A;  1TNR A;  3FHA A;  3NV2 A;  4Y26 A;  3U4X A;  1T6B X;  4CP2 A;  5LA0 A;  1RIN A;  3CBN A;  3ZXF A;  3O14 A;  4Y22 A;  4D69 A;  3HJR A;  2YXS A;  4HVR A;  3OGV A;  3TEW A;  5APA A;  4F83 A;  4XIO A;  4XUQ A;  5LZ6 A;  2HWB 1;  4JDM A;  2MPF A;  2VD7 A;  2ZJC A;  4IQP A;  3WDT A;  1G9D A;  4N43 C;  4IES A;  1D0G A;  2ARB A;  2V73 A;  2J1R A;  4X8P A;  3N9L A;  4YM1 A;  5ANN A;  3UGF A;  1VBC 1;  4YVS C;  4NVP A;  3WR0 A;  2XL7 A;  3AFK A;  4PBP A;  1JOJ A;  2WNV B;  2D44 A;  3FBM A;  4X8N A;  2JXA A;  1NY7 1;  2EVX A;  4XJW A;  1W3X A;  2GN7 A;  4N9H A;  5A1F A;  1ZX5 A;  5D8A B;  4C1X A;  2E51 A;  2WSV A;  5EP9 A;  2Z5W A;  1G7Y A;  2FZ2 A;  4XE9 A;  4J25 A;  4MV2 A;  4QDQ A;  1R64 A;  4RD7 A;  4NRP A;  1AX2 A;  3SH3 A;  1N3O A;  3S5A A;  1UY0 A;  2QQP A;  1HRV 1;  4YZ3 A;  4P5Y A;  2KA3 A;  4OLL A;  3ZFG A;  4NOT A;  5AFE A;  5C3O A;  4IE6 A;  1GP6 A;  5JXI A;  2VC9 A;  1G8W A;  2FBE A;  3I49 A;  3AMQ A;  4P9L A;  3LD8 A;  1AZD A;  5SV8 A;  5FYU A;  2PHF A;  3SEE A;  3QBQ A;  1QWR A;  4PJY A;  1CAU B;  2XDV A;  1ZBA 1;  4A7Z A;  3OOX A;  2A71 A;  3H8R A;  4AQS A;  3RZL A;  1ASJ 3;  4AW7 A;  5DPN A;  3AKQ A;  4QDS A;  3T0A A;  3KGL A;  3WQB A;  4NRQ A;  5T5J A;  1OUX A;  3OB8 A;  4CDW B;  4OHV A;  4CPB A;  3RNS A;  5C4W B;  4B4Q A;  3J7M A;  5FJK A;  5EYY A;  4GUL A;  1ND3 B;  1NUK A;  2YC4 A;  1COV 3;  3CF6 E;  4BQ3 A;  1DLL A;  3RYR A;  1Y9G A;  3VKL A;  2IC1 A;  3ZFE C;  4WM8 B;  4CU8 A;  2OUJ A;  4LEJ A;  4OZX A;  5DAP A;  5T52 A;  1AXZ A;  1LKN A;  1H4G A;  3GZA A;  2KD7 A;  1HB4 A;  2EXJ A;  5LW9 A;  4QX2 A;  3NV3 A;  3VD4 A;  2XPJ A;  3E5U A;  4LMF A;  2RMU 1;  4NAM A;  3I3Q A;  4QKD A;  3DKQ A;  1HB1 A;  1SG3 A;  1OOP B;  4ERO A;  5JI9 A;  3WG3 A;  4LIT A;  1RUN A;  2HEW F;  5DZE A;  1GQH A;  3LDB A;  2AYH A;  5IUQ A;  1WA6 X;  2FDK A;  1H30 A;  3UT0 A;  2GH8 A;  5IFT A;  4CRQ A;  2RDQ A;  3ZN6 B;  4CXX A;  5L73 A;  3TNQ A;  2VMD A;  3RZK A;  1YIP A;  1V6L A;  1QEX A;  4EQV A;  3HAG A;  5BNN B;  2ZMK A;  3J4U H;  3LFI A;  1RED A;  2YFZ A;  2NMO A;  5J36 A;  1MS8 A;  5IK8 A;  2VGD A;  2VO5 A;  3THT A;  3WDU A;  2CDO A;  3O1M A;  2ZAC A;  2XJR A;  1CD3 G;  5F5C A;  4BZ4 A;  2WFP A;  1OA4 A;  1UZW A;  2BOI A;  4CDQ B;  2WQ4 A;  2BBA A;  4QGM A;  4FFF A;  3JBG 1;  4WM7 B;  5FQ0 A;  2ADD A;  2XQX A;  1GAN A;  2X53 S;  1UAI A;  1W6O A;  3VHR A;  2ZAH A;  3WNO A;  5K0U B;  2E7Q A;  3WW1 A;  2EAA A;  1STM A;  1GOF A;  1DQ6 A;  3C7H A;  4JKL A;  1RUH 2;  1CJP A;  2D3S A;  1Y7B A;  1NA1 C;  3HBZ A;  4JGZ A;  4OMD A;  2PA7 A;  1CAW B;  2VZR A;  1IZ3 A;  1XU2 A;  3AFG A;  2YRO A;  1QMJ A;  5JR7 B;  3T4H B;  2OA2 A;  3KWV A;  3TNP B;  3T2O A;  2AUY A;  4URT A;  4BWO A;  5HCH A;  2XVK A;  2QQI A;  1RHI 1;  1UY3 A;  2CHH A;  3NNF A;  5CFD A;  1O3S A;  3LWC A;  1J58 A;  4K40 A;  1R08 1;  2JE8 A;  2FDH A;  4ZPI A;  1L7R A;  4JQT A;  3VBS C;  5JAX A;  2J22 A;  1JXN A;  2WNE A;  5C9A A;  1JYV A;  3NL1 A;  3U11 A;  2L9L A;  1G86 A;  1ULG A;  5JXH A;  4GAZ A;  3ZDV A;  2WT2 A;  5ISL A;  2VE1 A;  4JTN A;  4M3C A;  3VZK A;  2ZKN A;  1ZZ8 A;  5I91 A;  5HCF A;  4UFI A;  2VQ0 A;  4Q29 A;  3ZYR A;  1LRH A;  1PIV 3;  2BVB A;  2OQ6 A;  3GCX A;  4HET A;  1W90 A;  5EYX A;  5LK7 B;  2RS5 1;  4CDX A;  1YI7 A;  2DCK A;  3AJZ A;  2NMN A;  1ENR A;  3J7N A;  1VJ2 A;  2ET1 A;  2C9K A;  3WOG A;  5T50 A;  4UFM A;  2BUK A;  3KQ4 B;  1LCL A;  2XON A;  4YG3 A;  2R0F A;  5KHK A;  4S2D A;  4XTM A;  2E63 A;  3ATG A;  1CIW A;  2YFU A;  2W52 A;  1VBA 3;  4P08 A;  3BU0 A;  4XHX A;  3LOB A;  3AVS A;  3MI8 A;  4Z8B A;  3NRU A;  1NE4 A;  2JIJ A;  2CGN A;  2JE9 A;  4HLT A;  2Z2S B;  4OUL A;  3WNX A;  4AG4 A;  3H7J A;  3IPV B;  3RZZ A;  3D0J A;  3WEZ A;  3O1U A;  1LOE A;  1X9P A;  4XAB A;  3ZXL A;  3KV9 A;  1RUH 3;  4GH4 A;  2XUM A;  1B09 A;  1SCR A;  2WZR 2;  3LA3 A;  4MXW B;  3BTZ A;  4FPC A;  1RUE 1;  4LUL A;  1KS4 A;  3BI3 A;  3NKG A;  1W2O A;  3MIG A;  3MFC A;  5A32 A;  3QAC A;  3BU7 A;  4OUS A;  4Q0P A;  2E7T A;  2WL1 A;  2Y6H A;  4FOW A;  1K12 A;  4K9S A;  1OLR A;  2PMW B;  4B1M A;  3RZH A;  1KJL A;  4B4R A;  2BW8 A;  3O1R A;  5GZC A;  2D98 A;  4QPG B;  3RPQ A;  1H4H A;  1HRI 2;  1RJ8 A;  4H3W A;  5IAX A;  3CZU A;  2OW4 A;  2ZBJ A;  2ZML A;  4EV0 A;  2FD8 A;  4COY A;  3KT7 A;  4UOJ A;  5FBJ A;  2ZGK A;  1P8J A;  3EHK A;  1W8Z A;  4MLO A;  5K0U C;  1AR6 3;  3LA2 A;  2VOW A;  5AC9 2;  3DF0 A;  1PM7 A;  4Y33 A;  5KXD A;  5L9B A;  4TN7 A;  4YPJ A;  1V6M A;  4XDO A;  3IN9 A;  1UIK A;  4AQ2 A;  4IL7 A;  4SBV A;  1FXZ A;  5A6X A;  3WCR A;  1NT0 A;  1X8E A;  3AZX A;  2EIB A;  2Q1M A;  3DYM A;  1ZYB A;  3SEP A;  3NAP A;  2ZX2 A;  1MQT C;  2Y8K A;  2A6X A;  2N7G A;  2ZGU A;  3S7E A;  1SDW A;  2NLR A;  2GU9 A;  4ORF A;  2DTW A;  4Q0V A;  1U5I A;  4IDZ A;  1EY2 A;  1QQP 3;  4CEW C;  2HWC 2;  4E27 A;  1ENS A;  3I3M A;  1FOD 2;  1F5F A;  1ZRD A;  3RVH A;  3WDW A;  3KV6 A;  5JZG A;  1W6M A;  2DWR A;  1ZZ7 A;  4FPK A;  4GB3 3;  4OFG A;  1S55 A;  3ZR6 A;  3ZMO A;  4LBK A;  1N1S A;  5DQ0 A;  3RYK A;  2D5F A;  1AYN 2;  1POQ A;  2RHP A;  3DPR A;  3O0X A;  5FXZ A;  5JWP A;  5A70 A;  3T09 A;  4D8M A;  4WZF A;  1LJ7 A;  4ZS2 A;  4XFG A;  1F31 A;  1B35 B;  2XJS A;  4XW3 A;  5HBA A;  3BAL A;  3KHB A;  2GNM A;  3WG1 A;  2QQU A;  3OUJ A;  5F37 A;  3BTY A;  5EJZ B;  2BGP A;  4S2H A;  5L36 A;  3HQU A;  1REE A;  4MX3 A;  3MLJ A;  1RVF 1;  2BNM A;  4Q4V 1;  2W1U A;  5LA9 A;  4NIH A;  1G9A A;  3OUI A;  1ALY A;  2AAC A;  3OPZ A;  3WCS A;  3ZN5 A;  1HRI 3;  4AQT A;  1AR8 1;  3AVR A;  3H1M A;  1AL0 G;  5E1R A;  4JGY B;  2QQN A;  2BJS A;  3K77 A;  4JGZ C;  3KM5 A;  5FZG A;  1ZBE 1;  5JXJ A;  2YGM A;  4BIS A;  5FY9 A;  5FYB A;  2XXZ A;  1MEC 3;  4XJ9 A;  3CEW A;  4PI2 A;  4CCL A;  4O7X A;  5AC9 3;  4NR1 A;  4NHM A;  3L2Y A;  3VBR A;  5F6K A;  2OZJ A;  4NII A;  1AR7 1;  5CFD C;  2DCT A;  5LA2 A;  3ZYG A;  4I0A A;  4UAP A;  4Y4Y A;  1WW7 A;  3W9A A;  4XZP A;  3O1S A;  1PVC 2;  4XJZ A;  2MEV 2;  4DIN B;  4YSF A;  3VDB A;  2XG3 A;  1VBB 3;  2WZR 1;  1EUT A;  3GCW A;  1OQD A;  4BXF A;  4CP9 B;  4XIK A;  4F8A A;  2BBV A;  5C33 A;  4DY3 A;  5B4X A;  5L9V A;  4IV3 A;  3PIG A;  3E1F 1;  3VBH B;  2ZX1 A;  1W2A X;  4AGV A;  1PZ9 A;  2J1E A;  4LHK A;  1VP6 A;  1QU0 A;  5FZ0 A;  1LUL A;  2HWC 3;  1OD5 A;  2WKK A;  2Y26 A;  5TSW A;  5IT6 A;  4XCB A;  3SLI A;  4W6Y A;  4RQP A;  1QJU 2;  4CDX C;  2B7Y A;  3OPW A;  1I9R A;  2JJ6 A;  2DVG A;  4P14 A;  2IXI A;  1DP0 A;  1AYN 3;  2DV9 A;  1VRH 2;  2A7A A;  3MV1 1;  1W2N A;  1DDL A;  3K4Z A;  1IHM A;  3ACL A;  1GUI A;  1FPN 1;  4IEZ A;  5FPZ A;  1E5H A;  5CBL A;  5FZF A;  3VDD A;  5LBE A;  4MGS A;  1OF4 A;  5I8S A;  3PME A;  2XL9 A;  4TTG A;  5A7Q A;  2IFW A;  4TZD A;  2QFE A;  1I5P A;  2WO1 A;  2WWJ A;  4XF4 A;  1UY1 A;  2XVG A;  5FXV A;  3ST7 A;  5C8C A;  1PGW 2;  5HV4 A;  1E5R A;  4WVM A;  2I07 B;  5IVB A;  2E6V A;  3POF A;  1UKR A;  3WP3 A;  5FRA A;  1YQ5 A;  1OQE A;  3K3N A;  4GH4 C;  1FOD 1;  4QMA A;  2WZ8 A;  2FCV A;  1JTZ X;  2Y33 A;  1IS5 A;  5A3W A;  2VZU A;  2RS3 2;  2V4A A;  4YW2 A;  5FKB A;  3RYP A;  3J8F 3;  4QQL A;  5A3P A;  4BME A;  2ZXQ A;  4AVT A;  4XFB A;  4K1Z A;  3VD9 A;  1RJ7 A;  3GHN A;  2HEY F;  1UZV A;  4AGG A;  1Y4W A;  2ZX4 A;  1W6Q B;  1CX1 A;  1SLL A;  1JW6 A;  1PO1 1;  1PVC 3;  1RUF 3;  1UYZ A;  2J1T A;  2WYF A;  2MEV 3;  3PTY A;  4L9B A;  5LAT A;  1ENX A;  2HJI A;  3M1H A;  4QPI B;  4RSU A;  5E89 A;  3WW3 A;  4EWA A;  2ADE A;  3S0M A;  2VG9 A;  4CCM A;  3E97 A;  5DDJ 2;  4BQX A;  1YFY A;  2VM9 A;  5FYC A;  4P9G A;  3RQ0 A;  2QDN A;  2XB6 C;  4QX1 A;  3GBF A;  3FE5 A;  4XJU A;  3I3E A;  5KWR A;  2H6C A;  4IEP A;  5IYY A;  4KGQ A;  3VD5 A;  1RGS A;  4NJ4 A;  5C9A B;  4QX5 A;  1SHW B;  3OYW A;  3IDB B;  5FZM A;  4MSV A;  5FZ1 A;  2ZGO A;  2MHF A;  3LDR A;  2Y34 A;  2R06 1;  3N9M A;  4Q26 A;  4L8Q A;  3WF0 A;  2PYT A;  4N90 A;  1YC6 1;  5H9P A;  3NAP C;  4OVE A;  5FKC A;  2YMZ A;  5BPX A;  1VMF A;  4XFI A;  5FZO B;  3B3Q E;  2XOM A;  3I3D A;  3H8U A;  5GM0 A;  4CDU C;  1W2U A;  2K0G A;  3AZW A;  3FHI B;  4FXK B;  1AJK A;  1BJQ A;  4DEQ A;  4H2A A;  4FPF A;  4OHX A;  5ABJ A;  4CZS A;  3TN9 3;  1CON A;  4E4D X;  3D6E A;  3FMG A;  2YU2 A;  2BU9 A;  4L97 A;  1D4M 2;  2BWC A;  1IGO A;  2VNV A;  5JZG C;  4P9X A;  4Y3O A;  2VCC A;  4QD2 A;  1DHK B;  2W3J A;  2DFC A;  5HXV A;  2AGS A;  3R6S A;  4QB2 A;  1TG7 A;  4NWV A;  4UF0 B;  4UFL A;  3DPR C;  1WKY A;  3PUA A;  3CLP A;  3ENR A;  3MUY 1;  2WSU A;  1IKP A;  3NNJ A;  3POI A;  1VBE 2;  3LQC A;  1V6J A;  2E32 A;  2V72 A;  1L3J A;  3DXU A;  4LBQ B;  5A6Y A;  3ZYI B;  2GDF A;  3ZFF B;  1LHU A;  2F4P A;  4KG0 A;  4QT6 A;  3HQR A;  4RGK A;  4Z82 A;  1V6O A;  1QJU 1;  1Q8P A;  1X9T A;  2VUC A;  2ZGQ A;  3ASI A;  4GWN A;  4EWE A;  4Z2A A;  4GWM A;  5GLZ A;  1H2K A;  1LGB A;  4TXW A;  1VRH 1;  1CR7 A;  3U78 A;  3AL5 A;  5DUX A;  3UJO A;  4CUC A;  5DUW A;  2D40 A;  4Q4Y 1;  3RMX A;  5DAX A;  2VVE A;  1TME 3;  1OI6 A;  2W46 A;  3MW2 A;  2C26 A;  2WS9 1;  5I0U A;  1CZT A;  2QNK A;  5LA1 A;  1CAX A;  3FFZ A;  2QQM A;  3WZ1 A;  3QOP A;  5JOX A;  3SCG A;  1YQ6 A;  2JG8 A;  5K7P A;  1PGW 1;  4YZ4 A;  1X82 A;  3ACG A;  1YIF A;  3III A;  4CEY B;  4JHT A;  4Y1Z A;  3MLK A;  1UD1 A;  2FQP A;  2XHK A;  4KU7 A;  1H8T A;  4BK5 A;  1IS6 A;  1PO2 3;  3FBY A;  2RS3 1;  4W6X A;  3ZR5 A;  4YW6 A;  5DN2 A;  4QX3 A;  3SIT A;  3WLU A;  3KT4 A;  5FP3 A;  4FBF A;  4GD4 A;  3EBR A;  3WW2 A;  5KR7 A;  4IV3 C;  3PVE A;  4LKF A;  5J09 A;  3KS7 A;  3C7G A;  2LW8 A;  1PGL 1;  4BA6 A;  4I0B A;  4JCK A;  2WNU B;  3MEP A;  1DYO A;  3NMB A;  4IE5 A;  1GZW B;  2Y6J A;  2JWP A;  1AHS A;  1QJF A;  3B93 A;  3HN1 A;  3K51 A;  3I2F A;  3DUI A;  4J1X A;  4RQP C;  1SPP A;  4BQ2 A;  5IK4 A;  4MH0 E;  5DDJ 1;  2LAL A;  5AVP A;  1WBF A;  3VBU B;  1XE8 A;  3LEI A;  4GQ7 A;  3THD A;  3KLS A;  2CV6 A;  1H6Y A;  1ZA7 A;  2YC2 A;  5JI7 A;  1BBT 2;  1VBE 3;  2ZX0 A;  2R04 1;  1Q5O A;  3MGU A;  5FY4 A;  4CVU A;  5KXB A;  3K4D A;  1OXC A;  1OKO A;  3FC0 A;  3LB9 A;  1W0O A;  4RGG A;  1X7N A;  3FLT A;  5I93 A;  1CAV A;  2KM2 A;  1XYO A;  1LOD A;  2XJQ A;  2PLV 1;  5G04 L;  1EAH 1;  3UKV A;  1CX4 A;  2LUW A;  3OTF A;  2ZHN A;  3W58 A;  3POY A;  4LO6 B;  1MS9 A;  2W95 A;  5C8C C;  2JE7 A;  4W50 A;  1JU3 A;  5DMY A;  4G9S B;  1WME A;  3PL0 A;  2BPA 2;  1D4M 1;  4DXT A;  2GSY A;  1PK6 B;  5JIA A;  2LRO A;  3CZJ A;  4OHY A;  3OSD A;  4AVV A;  3KCX A;  4D7Y A;  2DBI A;  2ES3 A;  5CFC A;  2W94 A;  4JTO A;  4W65 A;  5FYZ A;  5HPO A;  1C1L A;  1UU5 A;  2ARC A;  5FP8 A;  3SMH A;  4RGA A;  2YBS A;  1H1M A;  1RUI 1;  3EO6 A;  3N7K A;  3AYC A;  4IV1 C;  1HQN A;  2EIE A;  3BPS A;  3MYX A;  4HKO A;  1W99 A;  3ORJ A;  2RM2 3;  4DPN A;  2D6N A;  1JYX A;  3WIN E;  1UY2 A;  2HKX A;  3FUO A;  1AYM 1;  3U4S A;  3V56 A;  1LU2 A;  3WXP A;  4YGD A;  5BNO A;  4YZ5 A;  3DV8 A;  1PX4 A;  2RV9 A;  4B3N A;  4GWJ A;  3ZPO A;  5GZG A;  1LR5 A;  1OVS A;  1FAY A;  2W08 A;  2YPJ A;  4H7M A;  3THP A;  4HG6 B;  1O8S A;  2ZGM A;  4YW7 A;  2GP3 A;  3WT3 A;  4NHY A;  2GC3 A;  1N3Q A;  2I45 A;  2G9F A;  2UWB A;  4QX7 A;  5H9R A;  4AFM A;  5KBF A;  1DBN A;  4Q0S A;  4AEK A;  1OBN A;  2A6Y A;  1LEC A;  3VBF A;  5C5U A;  5FIX A;  3PU8 A;  4FAH A;  1HN1 A;  4RA0 A;  5GLW A;  2PAE A;  5J37 A;  1QH7 A;  2LM3 A;  1MVE A;  2CAU A;  3OGG A;  5EXO A;  4WV8 A;  3P1I A;  1UPI A;  2IXH A;  3T1M A;  1U5Y A;  1SEF A;  5F9T A;  1XB9 A;  4HVQ A;  1NLS A;  3M3E A;  1C8M 3;  2P17 A;  4LO8 A;  1TNF A;  3FLP A;  3PUQ A;  5FMB A;  1IPS A;  1W3V A;  5EPA A;  4NHK A;  4YAR A;  2Y0I A;  3HOB A;  3T2Q A;  4C0H A;  1SMV A;  3LEG A;  3WY6 A;  2YDE A;  3BKZ A;  1OD3 A;  1C5I A;  2HYX A;  1URX A;  4IEU A;  4GMP 0;  2X05 A;  1R09 1;  1MR5 A;  4UFH A;  4XFF A;  4LOR A;  4XUN A;  5A7P A;  1Y9Q A;  5CB7 A;  1ZRE A;  2Z79 A;  4MGI E;  2RJ2 A;  3ZSK A;  4MHR A;  5KHG A;  4XZU G;  1W06 A;  1HLC A;  2VVF A;  5T3N A;  1OQ1 A;  1BBT 1;  2Y6G A;  5JR2 A;  2GND A;  3BCW A;  1VRB A;  3I59 B;  3NJV A;  1EV1 1;  4GKX A;  4BPZ A;  2P37 A;  4PI0 A;  4NID A;  5FMD A;  2GN3 A;  3VBO B;  4UW6 A;  3ZYF A;  2PHL A;  4BXS V;  1O4T A;  5T5P A;  1UYY A;  3KZ4 C;  3VBS A;  4DUV A;  2UY8 A;  2CWM A;  2A75 A;  4J1W A;  3ZSM A;  3H1W A;  1WA4 A;  1ONA A;  2JG8 C;  5LRR A;  2VY0 A;  4NRO A;  2WFF 2;  1OLM E;  1XPW A;  2LTN A;  4N53 A;  3V65 A;  1MS5 A;  1WCD J;  3KF3 A;  4FPE A;  2X09 A;  4AI1 A;  4Z1V A;  1MS3 A;  3W21 A;  2NQY A;  1ZM1 A;  1SBD A;  3N35 A;  3U10 A;  1COV 2;  1H8T C;  1RUG 3;  1XNC A;  2RDR A;  5IVJ A;  5M0T A;  4OHW A;  1HKD A;  2PQS A;  3PUH A;  4BLJ A;  4CCK A;  4YZ2 A;  2RDS A;  2YYO A;  5C4W C;  5FPV A;  1PX3 A;  2JX9 A;  4A6O A;  1QH6 A;  1GZ9 A;  2PAK A;  5ERL A;  1UL9 A;  4TLG A;  4A6S A;  3HEI A;  5FFO C;  3I4I A;  3R4D B;  2W68 A;  1VAL A;  1H2N A;  4YG6 A;  2AZ5 A;  2J1U A;  1GMM A;  3GZT B;  4LLO A;  4RL7 A;  3T2P A;  2OXB A;  3ALQ A;  3T1L A;  1YHF A;  1K5M B;  3AX4 A;  2J1S A;  4G3Y C;  3WF2 A;  2WO3 A;  2IZW A;  5FZ6 A;  5JMC A;  4H7L A;  3EJK A;  1QJX 1;  3Q9O A;  5DAV A;  1OHF A;  2DVB A;  3DYP A;  4ZZ5 A;  4LUK A;  2QTW B;  1AX0 A;  1BEV 1;  4YGB A;  5FZ3 A;  5FPL A;  2VVD A;  3N7L A;  2HBU A;  4A7Y A;  4NHX A;  4EYU A;  3W5M A;  4HPK A;  4ATF A;  2VNR A;  1W8H A;  1BZW A;  2Y64 A;  4YVW A;  1UOG A;  2H0B A;  4Y20 B;  2FDJ A;  3DCQ A;  2YV8 A;  1XRU A;  3POE A;  3PUR A;  5F2W A;  4HON A;  4P9I A;  3AKS A;  1HB2 A;  2D97 A;  4DEV A;  5BNN C;  3OEA A;  2EXH A;  3S7I A;  2ZMN A;  4BH9 A;  1VMJ A;  4GKY A;  3IIA A;  1NCR B;  4HVO A;  4UW3 A;  3IM0 A;  1S0D A;  3CQO A;  3MIE A;  2ZCW A;  3HT2 A;  2VTF A;  5FPU A;  3V0B A;  4NO4 A;  2DCJ A;  1MPX A;  1UW8 A;  1RUC 3;  4DUX A;  5JXG A;  4XOG A;  4Z92 B;  1E5S A;  5CFC C;  4L92 A;  3RMY A;  3SCH A;  1W9T A;  3AP6 A;  4NHL A;  4CCE A;  4CUB A;  4HMZ A;  2WFF 3;  5DG1 A;  2HWE 1;  2VOT A;  4PDW A;  4AXO A;  2BP6 A;  1MZ6 A;  1DIW A;  5FZ8 A;  2ORZ A;  2X5I B;  2XML A;  3ACI A;  3I7D A;  3IAQ A;  4HKW A;  5IFP A;  3O0V A;  5C70 A;  1PMH X;  1UOB A;  4MHU A;  1SCS A;  3MPP G;  1W6P B;  1SBF A;  4IEX A;  3Q8F A;  1A34 A;  1KGY A;  2D6P A;  3LSD A;  5BNO C;  4K20 A;  5F3E A;  4I0W B;  3OJB A;  5A3U A;  1DU3 D;  4JDN A;  4UYB A;  1MQT A;  2GAL A;  2ZGS A;  4WVW A;  1O3T A;  1IS4 A;  4C1W A;  1SFP A;  4L99 A;  3P5B A;  4LHS A;  3AZZ A;  4PQ9 A;  4Y5Z 0;  3DN7 A;  2J1A A;  4V2V A;  3A23 A;  4FOY A;  4CEW A;  2VW2 A;  5IAT A;  1YXW A;  1KFX L;  4KNC A;  1FV3 A;  5EJ3 A;  5AVA A;  5IVV A;  2C9A A;  3UL2 A;  4AVC A;  1PIV 2;  1ASJ 1;  1A3K A;  3UGH A;  4N43 B;  4IXL A;  4CCD A;  2WQ8 A;  3VBF C;  2JEM A;  4RS5 A;  1QOO A;  1UXZ A;  1H9P A;  2ZHM A;  4YVS B;  2A6Z A;  5F32 A;  3O1T A;  4HAN A;  3HPN A;  4BOW A;  4LHL A;  1BCX A;  3MFA A;  5FYH A;  1COV 1;  1C57 A;  4P02 B;  4DZG A;  1VBA 2;  2TEP A;  1CZV A;  4KG8 A;  4AL9 A;  1RC6 A;  3ZSL A;  2RVA A;  5F5I A;  2AEN A;  3A22 A;  2VUL A;  4PLM A;  3VLB B;  3CKH A;  2E31 A;  4FPJ A;  4RR3 A;  1WMD A;  3T08 A;  1D7P M;  4KGG A;  2WLP A;  1NCQ A;  3GM8 A;  5A33 A;  2HLE A;  3RSJ A;  4JX0 A;  1XSQ A;  4HKL A;  5LEJ A;  2DBN A;  4BYY A;  2O8O A;  4UWD A;  4M00 A;  4DXZ A;  1C1F A;  1BQP A;  3LF7 A;  2DU0 A;  5DAB A;  4YM0 A;  5A1L A;  2ARA A;  3SXW A;  4GAL A;  5F5Q A;  3HN3 A;  5CKN A;  1Z7S 3;  2D5H A;  3I8T A;  3BOD A;  2WRA A;  1DZT A;  2JG9 A;  1SQ4 A;  3APB A;  4AVB A;  4CP0 A;  1IPJ A;  3H9A A;  2X29 A;  3V64 A;  3BTX A;  2ID4 A;  4AHZ A;  3OEB A;  4NRM A;  1POV 0;  5FZ9 A;  1JS9 A;  4Z2W A;  1FNY A;  1GP4 A;  1W28 A;  1XOY A;  3KF5 A;  1SLC A;  2B45 X;  2PN5 A;  3VHN A;  1DYK A;  1QNY A;  1YQC A;  3FLR A;  1J3Q A;  3D5O A;  2ZTN A;  4E8C A;  1CPM A;  2IVJ A;  1HQW A;  2YPD A;  1AR6 2;  4N53 C;  3ZFE B;  2ETE A;  3N9N A;  2XHN A;  1S0J A;  4LKS A;  1W0P A;  5FUI A;  4QKN A;  2WDB A;  4AF9 A;  3M3I A;  2QZ3 A;  4XET A;  1UX6 A;  2WO2 A;  3V0A B;  3S30 A;  1C4R A;  5F39 A;  1XJA A;  5CU1 A;  4DRR A;  3HMY A;  1WMF A;  4BQW A;  2DVA A;  3G6J B;  4BLI A;  4E4S A;  2VXR A;  1VB4 A;  1ZRR A;  4LBN A;  1DLC A;  2Q1F A;  3JB4 C;  1GR3 A;  3OY8 A;  4AEM A;  4PLO A;  1QQP 2;  2R1B A;  5DAW A;  1V9U 2;  1Q43 A;  1JZ7 A;  4ZHN A;  5FY0 A;  3PJQ A;  4WVV A;  3USU B;  3AL6 A;  3POG A;  4GB3 2;  2EAL A;  4D94 A;  5L9R A;  5BNP A;  4I01 A;  1AL2 2;  1JZ4 A;  4UXA A;  4AI8 A;  5CG8 A;  1ZA4 A;  2R49 A;  4BM8 A;  3M70 A;  3WD5 A;  4SLI A;  1UMI A;  1YFU A;  4Q4W 3;  4YVW C;  2D7F A;  5FOJ B;  4HK9 A;  2Q8O A;  2P3J A;  4CDX B;  3WQ1 A;  2BFU S;  2IFR A;  4K8R B;  1PIV 1;  4OUM A;  4DXR A;  3WV6 A;  2XUE A;  2Q1Z B;  5L7O A;  4LK7 A;  2YUE A;  1K42 A;  4CUG A;  2WN2 A;  5JDB A;  3UK9 A;  1DG6 A;  3TBD A;  2IXK A;  3BUC A;  5A6Z A;  1B35 C;  2KXL A;  4ZU5 A;  1NA1 B;  2ILM A;  5C3Q A;  3MV0 1;  2FCU A;  3NJZ A;  3PUS A;  3UNP A;  3DEC A;  4O61 A;  4MVT A;  4ES9 A;  3VL8 A;  1KFU L;  1US2 A;  5FMO S;  1WW5 A;  4EWD A;  3RI9 A;  2A1X A;  1J84 A;  4EN9 B;  2VZP A;  1LB2 A;  4Q27 A;  5CYY A;  1MEC 2;  1H9W A;  4PDW C;  4XF9 A;  2FDI A;  2WO7 A;  4XBQ A;  3WUC A;  2W9X A;  4UW4 A;  3W5N A;  5FZ7 A;  4XFA A;  1UN1 A;  3PNA A;  4QB1 A;  4V2W A;  4DUW A;  2VL4 A;  1RUH 1;  2A6V A;  2AEZ A;  1KDM A;  4W8J A;  3WP6 A;  1VBB 2;  3BGA A;  4Z07 A;  5FWJ A;  3VHP A;  4RHV 2;  3D3A A;  3CJI B;  4KL1 A;  3WHU A;  2E26 A;  3WVJ A;  1K45 A;  4LKD A;  3PU3 A;  4CDU A;  1GNZ A;  1X8M A;  1NQD A;  2SLI A;  2YU1 A;  4TWT A;  4Y22 B;  2BNO A;  2VQT A;  3VZL A;  1O8P A;  3POS A;  5FK7 A;  4LBL A;  3Q8C A;  1PMI A;  1V9U 3;  4QU1 A;  5KC6 A;  1QNW A;  2IXL A;  1O7F A;  4WBB A;  3R0R A;  4HN0 A;  4ES8 A;  5A3L A;  2XBO 2;  3LAG A;  4ET7 A;  1JOP A;  1U5Z A;  1JZ8 A;  1AL2 3;  2PAM A;  3AK0 A;  4RS5 C;  2QQL A;  1FV2 A;  1OFN A;  1DGW X;  1WD4 A;  5LAS A;  4E4Z A;  3PVB B;  1AR6 1;  1OH4 A;  1OVP A;  2JKX A;  4P5H A;  4YG0 A;  2RJL A;  1GFF 2;  2GC2 A;  2PHT A;  2R16 A;  3T30 A;  4AI0 A;  1BHG A;  1DZQ A;  4BJ0 A;  3VD7 A;  1AR8 3;  1MZ5 A;  1ND2 A;  2AH2 A;  1RMU 3;  2GAU A;  1KXG A;  4A7K A;  1PGS A;  3VKM A;  4B7K A;  3TEY A;  1VPH A;  4Y1X A;  5KXC A;  5C71 A;  5GAL A;  4HSL A;  4FPY A;  4XQD A;  4IEQ A;  4GWI A;  4RR3 C;  5EHD A;  4CUA A;  1SLT A;  3WDV A;  2DCZ A;  4BHP A;  1NCQ C;  1OUS A;  4E2S A;  3K46 A;  4XVH A;  4QPW A;  3ZFG B;  4NE9 A;  4YNI A;  1QQP 1;  2QE3 A;  1R1A 2;  2CSG A;  2RDN A;  2DF7 A;  1FNZ A;  2HWF 2;  5HXM A;  3WNP A;  1LHV A;  2JDU A;  1UIJ A;  4GB3 1;  2Q8E A;  1CVN A;  2B46 X;  3J8F 2;  2TUN A;  2BYV E;  3HNB M;  5ACA 2;  5FO9 B;  2CNA A;  3MDP A;  5GLT A;  5A7W A;  3AJY A;  5CG9 A;  2QQO A;  5FP9 A;  4XBL A;  4AED A;  3ZYJ B;  1JYT A;  2JG9 C;  3AC0 A;  1WW6 A;  2ZPX A;  4LBJ A;  1KQR A;  2QBX A;  1RUF 2;  2IXJ A;  4E4H A;  1RIR A;  1VBD 2;  2GC0 A;  2X10 A;  5G05 L;  4OCT A;  5FZ4 A;  3W59 A;  4RHV 3;  4BE3 A;  1JYI A;  4GZ9 A;  5GLV A;  4MGZ E;  5FZB A;  4QQ2 A;  2DU1 A;  3T0D A;  3ZXJ A;  1QJY 3;  2H6B A;  5D21 A;  2R07 3;  1JHN A;  1NZC A;  3D82 A;  1H2M A;  2A3Y A;  3G7D A;  4YW5 A;  5GKA C;  3F95 A;  2C1F A;  5LBC A;  3WDY A;  1WBL A;  4GMP 3;  1HRI 1;  1ACC A;  2YBK A;  1UWW A;  2XBO 3;  4A42 A;  3OD4 A;  4QWN A;  1HXS 3;  5D2A A;  3AKT A;  4W6W A;  1S4C A;  2VJX A;  1H8V A;  1O6U A;  2XJP A;  4QHB A;  4K6B A;  4R9A A;  5E16 A;  1IQD C;  1A8M A;  1MEC 1;  2UYB A;  2BNN A;  5AC9 1;  1M4W A;  2CY6 A;  3WF4 A;  4KBB A;  4ARY A;  1WWY A;  4Y1V A;  4JZR A;  1N47 A;  5J98 B;  4A41 A;  3TN9 2;  2ZEW A;  2W1S A;  1Q8V A;  2VUA A;  5IJR A;  5DUU A;  3NST A;  4D6S A;  3TOJ A;  4LO4 B;  2CTV A;  1VBB 1;  5LY1 A;  1V0A A;  2D3P A;  2GMM A;  4PCR A;  4ZY9 A;  5BNP C;  2P4E A;  2A3X A;  3ABZ A;  1E5I A;  1NG0 A;  1OLQ A;  2WT1 A;  1A78 A;  2D6K A;  4EN6 B;  3M7A A;  1W9S A;  1AXK A;  1SLI A;  1QGL A;  4N7U A;  2YBP A;  4BCU A;  1JZ6 A;  2Q5T A;  4CXW A;  4O65 A;  2HWC 1;  1R1A 3;  1W6N A;  2MNG A;  3RWN A;  2FCT A;  3RWK X;  3ETQ A;  3GHM A;  1SLB A;  2HWF 3;  4AI3 A;  4YW4 A;  1G9C A;  5FQ0 B;  1PHM A;  2VCA A;  4UFJ A;  5F6L B;  5C3R A;  3OGS A;  5L7O C;  1QXP A;  1W6O B;  1UKG A;  5ACA 3;  3L9J T;  2WAA A;  1F35 A;  2QQW A;  1QIQ A;  1WLC A;  2YZ4 A;  2QKD A;  3Q8A A;  1AYN 1;  4GIQ A;  4OZO A;  3UV9 A;  1JOB A;  2R6Q A;  5CIS A;  4LOS A;  4QM9 A;  4FVV A;  4JGZ B;  4IV1 A;  1PZ7 A;  5DXD A;  5K8S A;  2XR4 A;  2UUR A;  3HNY M;  4O9E A;  1ULO A;  1WLT A;  1Z78 A;  3ACH A;  1VBD 3;  1G6N A;  2VMC A;  3J26 N;  1TME 2;  3DKW A;  3MPB A;  3O1O A;  1QJE A;  1NXD 1;  4A44 A;  3IMN A;  4PIZ A;  4FO9 A;  1C3H A;  5CFD B;  3POB A;  1GYK A;  3FN9 A;  3ZO0 B;  1LHN A;  4U2A A;  1Q8Q A;  2XJT A;  2QQK A;  3N4M A;  3S57 A;  3MLL A;  4I02 A;  1ZRC A;  4H55 A;  1VAM A;  4ZU4 A;  4JAA A;  3NJX A;  3PDQ A;  4ZKT B;  3VZO A;  2VZO A;  4ISQ A;  3H3U A;  5H9S A;  4M3C B;  4CPB D;  1PO2 2;  2JDZ A;  2GNB A;  2P3K A;  2EIC A;  1ULC A;  4R8H A;  3J8F 1;  1RUJ 2;  3M3C A;  5I0D A;  1U12 A;  2RR1 3;  3TWI A;  2DDU A;  4I2O A;  4TLF A;  2QCS B;  1OLM A;  1GQP A;  1TZO A;  3AYA A;  1YYN A;  1WCS A;  4IEY A;  1NYW A;  4ONU A;  1LTE A;  3UKT A;  1SDD B;  1PVC 1;  1RUF 1;  3VZN A;  4DXS A;  5JLV A;  2MEV 1;  3W20 A;  4K1Y A;  2J1V A;  4LNV A;  4COV A;  2JIC A;  3JQW A;  1HQL A;  3PHM A;  5GLU A;  1LGC A;  2JDN A;  4M4P A;  4JQR A;  2BGO A;  3WX5 A;  3I54 A;  4YZ1 A;  2JD4 A;  4XYX A;  1C5H A;  3AYD A;  4CU7 A;  1MS0 A;  1YFW A;  3IKW A;  1BVV A;  2RS1 2;  1MZE A;  4GXL A;  4KU8 A;  2WNV A;  1UXX X;  1ND2 C;  3URF A;  3E6D A;  4KBZ A;  1DYP A;  1FMD 2;  1UU4 A;  4QXH A;  3VDC A;  5C7G A;  5D8A A;  2WAO A;  2WII B;  2ZKL A;  4GH4 B;  2PXJ A;  5DAQ A;  3GYD A;  1YQ8 A;  2R0H A;  1V00 A;  3HT1 A;  4QX0 A;  5LB6 A;  4XF1 A;  4AFD A;  4BB3 A;  2E53 A;  5J1X A;  3MIF A;  1G9F A;  5A32 B;  5LK5 A;  3TN9 1;  4DQA A;  4QKB A;  4PF5 A;  1NQJ A;  2P2K A;  4PIY A;  2JDY A;  1JUI A;  2XH6 A;  1RXG A;  1W9F A;  4JKK A;  5F2S A;  4BQY A;  1XSR A;  5C6C A;  1JH5 A;  2F17 A;  4OQ9 A;  1T6G C;  1ODN A;  1S0I A;  4MGK E;  1XNA A;  4RN5 A;  1AR9 3;  4AED C;  4BIF A;  1CAU A;  4I3G A;  1O3Q A;  1PK6 C;  1JN2 P;  3QCW A;  2J42 A;  2QJV A;  1UYX A;  4KWL A;  4UFK A;  4LO5 B;  1F4H A;  2RM2 2;  2XGX A;  4GA9 A;  4QQO A;  4FOV A;  3CL1 A;  3GZU C;  2D93 A;  4CDW A;  1C8N A;  1RUJ 3;  3QH6 A;  5C4W A;  3VKO A;  4FTB A;  3NV1 A;  1UYP A;  2PHW A;  1CJD A;  4IGQ A;  1ND3 A;  4IER A;  3USS A;  4J6G A;  1DCS A;  1XE7 A;  2CAV A;  3WQ7 A;  3EQE A;  1QDO A;  3NAP B;  2RG4 A;  4M0N A;  1XNB A;  3MZH A;  5K4L A;  4WM8 A;  1TME 1;  1O3R A;  2ATF A;  1D4V B;  2G19 A;  4XJA A;  4Y5T A;  4ASM B;  2DUR A;  1OT5 A;  1RUD 3;  1PM4 A;  3BB6 A;  1I1E A;  3IBM A;  3CNA A;  5CAD A;  1WLW A;  2CDP A;  2ZZQ A;  1N1T A;  5EWS A;  1JUH A;  2PHD A;  4IET A;  2SBA A;  3A4U A;  1W05 A;  2O14 A;  5JZG B;  1JHJ A;  5IVF A;  1W6M B;  1OOP A;  3HWJ A;  3KV4 A;  2GZW A;  2RS1 3;  2Z69 A;  3IDA A;  4Q4X 2;  1H6X A;  1FI2 A;  3NV4 A;  3HIF A;  4KI5 M;  1POV 3;  3DPR B;  3R4U A;  2VZS A;  2QQJ A;  1FMD 3;  1PO2 1;  4A45 A;  2F4L A;  3ZN6 A;  1A8D A;  2OT7 A;  1J83 A;  3N9O A;  4OI0 A;  1CPN A;  1C8M 2;  5BNN A;  2JEN A;  3AP4 A;  3O12 A;  4UT5 A;  4CE8 A;  3ZLI A;  1XQN A;  3IB3 A;  2CWS A;  3OGJ A;  4LBQ D;  1JZ3 A;  1XE0 A;  4P9W A;  5FYI A;  3JD7 3;  4BQ4 A;  1YQ2 A;  1LOA A;  4B29 A;  5FLI A;  1LOF C;  1CN1 A;  5GZE A;  4DS0 A;  3WUD A;  4CDQ A;  4DIQ A;  3RFR A;  4YGE A;  4WM7 A;  5A7S A;  4OI1 A;  1OH3 A;  5K0U A;  3AYE A;  3F2Z A;  2PHX A;  4YM3 A;  4UBH A;  1VBE 1;  3AMH A;  3M4F A;  1GWK A;  5EZW A;  3ZIX A;  4YW1 A;  1DQ0 A;  2JDH A;  3BVC A;  1LOG A;  1CAW A;  4N9I A;  5FY5 A;  3HBK A;  2W1W A;  1DF0 A;  1REF A;  1W8O A;  3VBR B;  3WNN A;  5B2G B;  4HL0 A;  1US3 A;  1DGR N;  1GQG A;  2ARE A;  3ES1 A;  3FWE A;  3GBW A;  4M3C F;  5DZF A;  1QHD A;  5I0R A;  3QH7 A;  3ME2 A;  4C91 A;  3PIJ A;  3DYO A;  3H3L A;  5IVE A;  4E2G A;  4JKM A;  3VKN A;  3ACF A;  5C8W A;  4XJ8 A;  3J9S A;  4MET A;  1AJO A;  1ZRI A;  3TAY A;  4IV3 B;  3T4V A;  2F6B A;  3O0W A;  3KSC A;  1RUG 2;  1W04 A;  1TMF 3;  1AVB A;  5ANQ A;  3NJY A;  3MW3 A;  2NYY A;  2B9V A;  3B7M A;  1NOV A;  3SQO A;  2IVI B;  2VZ1 A;  4RQP B;  4Q4X 3;  1NZI A;  1RIT A;  3TEZ A;  5DZG A;  4UI9 L;  1NY7 2;  5F8P A;  2A3W A;  1VAV A;  2DUO A;  4YRD A;  2J7M A;  3ITQ A;  2RM2 1;  1GNY A;  1QXJ A;  4UW5 A;  3EYP A;  4JHZ A;  4HXC A;  3AKR A;  1QKQ A;  4CSW A;  3MID A;  2JB4 A;  3E5Q A;  2D43 A;  3QLQ A;  1Q8S A;  4OI4 A;  4LUM A;  3VDD B;  4XFH A;  1HRV 2;  3U75 A;  1DQ1 A;  5DG2 A;  1VLN A;  3A7Q A;  4AHW A;  1JOD A;  2V4V A;  1VB2 A;  2P5B A;  4O9G A;  3E6C C;  1JYC A;  2WWS A;  4EN7 B;  3GNE A;  1FT9 A;  2WNV C;  5C8C B;  4A2U A;  2BVV A;  4Q0Q A;  4LBM A;  4OI2 A;  5FZC A;  2QDR A;  4WVM B;  3Q8E A;  5FYM A;  2VOK A;  2FDG A;  2C6S A;  3IPV A;  5D8A C;  2Y6F A;  3ROU A;  2OX0 A;  3FX3 A;  1JZ5 A;  4WVZ A;  4I30 A;  3AZY A;  1QXR A;  4FQZ A;  1V6K A;  1SLA A;  3O7O A;  2C0Z A;  2Y6L A;  2ERF A;  4OHZ A;  3GXU A;  2JEC A;  1Y43 B;  2P34 A;  2ZHL A;  3WF1 A;  1ODM A;  4MXW A;  3MIH A;  4HZF A;  1F15 A;  4B8E A;  3BYW A;  5FBZ A;  1RUC 2;  2HWD 3;  2PHU A;  1HJF A;  1UMZ A;  1O5U A;  2O0O A;  2HH9 A;  3KMH A;  1S0B A;  4XAC A;  2R30 A;  4BQ5 A;  1RTV A;  3MUZ 1;  3ZX7 A;  2ARX A;  1C8M 1;  4IEW A;  4H14 A;  3PJY A;  1HDK A;  4X6R B;  4R9B A;  3AXD A;  2HWB 3;  4XF3 A;  4QPG A;  5I0T A;  2CYF A;  3MF6 A;  3CMG A;  5FPA A;  3P6B A;  1XYN A;  3GDB A;  3LDK A;  3O1P A;  4YFW A;  3H0O A;  3H3Z A;  1H1A A;  2DUQ A;  1CGP A;  3T0B A;  4CDW C;  1HB3 A;  2JDK A;  1VBC 3;  4KWJ A;  4LOT A;  4M0H A;  3B9C A;  5BYN A;  3C2U A;  3OYW B;  5A3T A;  1ND3 C;  2X5I C;  1K5J A;  3WG2 A;  2Q30 A;  3JZV A;  4XF0 A;  3BOW A;  1AXY A;  5FZI A;  4Y24 A;  1NX9 A;  5T5O A;  1BLZ A;  3ES4 A;  4XAA A;  1XYP A;  5FCC A;  2VZT A;  3IDC B;  5I8T A;  1YRZ A;  4WM8 C;  1HIX A;  4P9Y A;  2R7E B;  5FXW A;  1RUO A;  3VZM A;  3I2O A;  4QGN A;  5CZK A;  2DCY A;  1C28 A;  3H8O A;  2YC0 A;  5ABJ B;  1W39 A;  4XQW A;  2WIN B;  3B94 A;  4C8D A;  1HRV 3;  1IKQ A;  4F7Z A;  3UJQ A;  3THC A;  1BVP 1;  4D6R A;  1OOP C;  2WZP P;  1S2K A;  1W8T A;  4XQ4 A;  3JBG 2;  4HSJ A;  4XXA A;  3OGR A;  3MIB A;  3AP5 A;  1F8V A;  4MGT A;  1IG0 A;  1S0E A;  2Z42 A;  2JB8 A;  1RUG 1;  3GJA A;  2OPK A;  4UBG A;  3WF3 A;  4CA9 A;  3O5S A;  1ZBA 3;  2UY9 A;  3OBZ A;  5BV6 A;  1WZX A;  3DL3 A;  2PQQ A;  1YFX A;  3K48 A;  4XBN A;  3C8X A;  1F2N A;  4ISR A;  4ZZ8 A;  5LBB A;  3SNM A;  1B35 A;  2V09 A;  5JSR A;  1ULF A;  2HWE 3;  1UQX A;  1UY4 A;  2Q4S A;  1Z0H A;  1NXM A;  2ZEY A;  1RHI 2;  3CIH A;  2OUH A;  4CDQ C;  1F5J A;  3OBR A;  4AE2 A;  2VPV A;  3AP9 A;  3GZE A;  1R08 2;  3FJS A;  1GLH A;  4QDR A;  2K9Z A;  4FXG B;  4WM7 C;  1S2E A;  5FY1 A;  5GJ6 A;  4AVA A;  1YJK A;  5FR3 A;  5JCT A;  4LIV A;  2ZGR A;  2PEL A;  5T55 A;  1HN0 A;  1W9Y A;  1N1Y A;  1UZY A;  2WWU A;  2ZEX A;  3KVA A;  1LGN A;  4HFS A;  5KHI A;  1KRI A;  4FCA A;  1Z7S 2;  3S5Q A;  4BDV B;  1GP5 A;  4R4X A;  4LHN A;  4JGY A;  1BMV 2;  1CAX B;  1CES A;  4NAO A;  2RMU 3;  1IPK A;  1WW4 A;  5GZF A;  2WJS A;  3TYJ A;  2JG8 B;  1YWK A;  3UYJ A;  1YCI A;  4BQ1 A;  1SBE A;  5IAV A;  1NLQ A;  4FT8 A;  1UPS A;  4CYD A;  5CAZ A;  2ZX3 A;  4Q0U A;  1J1T A;  1JYW A;  1Q3E A;  3SIS A;  1H8T B;  2RS5 2;  4NN0 A;  4RFT 0;  2JDP A;  5EQU A;  4LR4 A;  5AFB A;  2DYC A;  5A7N A;  4E2Q A;  1MVQ A;  4PQQ A;  4Y1Y A;  4CP9 A;  1WMX A;  1YEW A;  3RZG A;  4QXC A;  1ZZC A;  1RUC 1;  1GOG A;  3PTR B;  4TYS A;  4DNY A;  5LEK A;  3VBH A;  1M06 G;  2QUO A;  4K7J A;  2YY1 A;  4WZC A;  1BK0 A;  2UU8 A;  1VMH A;  3I2J A;  4OYU A;  1W03 A;  3SH5 A;  4G4F A;  1SPP B;  4A3Z A;  2WFF 1;  4QX8 A;  3RRD A;  5KHJ A;  1QOT A;  3JBG 3;  2ZEZ A;  4I09 A;  1WLD A;  1XNT A;  3FUQ A;  3PVO A;  2ZAB A;  1ULP A;  2B42 B;  3LOI A;  2BER A;  3DXT A;  4EZH A;  1WCU A;  1WD3 A;  3BN6 A;  3N9Q A;  3KCY A;  4XUP A;  4D7S A;  4LA2 A;  3K4A A;  1KJR A;  1UU6 A;  1LU1 A;  2ZGT A;  4FTE A;  1O91 A;  3NO8 A;  1V6I A;  4M4R A;  1IG3 A;  3EMR A;  3IT8 A;  2TBV A;  1RUE 2;  4LT5 A;  2GH2 A;  1CAV B;  2OZ6 A;  2W0X A;  2VCB A;  4MGY E;  4NPM A;  1O4Z A;  5F3G A;  4AWD A;  3AM2 A;  5IK5 A;  1YJL A;  2XWJ B;  1RHI 3;  5JSO A;  4E8D A;  2VR4 A;  3MIC A;  3C7O A;  4XTP A;  2D6M A;  4Q4W 2;  4EN0 A;  2BEO A;  3VN4 A;  1R08 3;  3R05 A;  2JKB A;  3C7E A;  5JIU A;  4RFR B;  1PMJ X;  1IS3 A;  2ZGN A;  2VH9 A;  4AVS A;  1UCX A;  2JIG A;  3HR9 A;  5HI0 A;  1G9B A;  4DOU A;  4DFS A;  5FZA A;  2B4K A;  1EUU A;  2ENR A;  5IHR A;  2JD9 A;  1GV9 A;  3L2H A;  5CFC B;  4YM2 A;  5FPX A;  4IGO A;  2ORX A;  4BU2 A;  1GNH A;  2ZZJ A;  2D6O X;  4IE7 A;  2GC1 A;  2CGO A;  4XXP A;  3NVC A;  2RS5 3;  4KMQ A;  3FFQ A;  5GZD A;  1W6Q A;  5HCA A;  2Q8C A;  2Y0O A;  4CCC A;  3ETP A;  4W4Z A;  2QQV A;  5BNO B;  4QPG C;  2ZAA A;  4QPI A;  4YW3 A;  5CNA A;  3ZN4 A;  2WA4 A;  4XMA A;  1CZS A;  5EV7 A;  4IUG A;  3AZV A;  2ZS6 B;  3B9I A;  4ASK A;  3AXE A;  1Q8O A;  1GZT A;  3ZOI A;  1DFQ A;  5T5L A;  3WNM A;  3MF9 A;  3VL9 A;  5I8Y A;  1UO9 A;  2Z4F A;  2VMF A;  4ITC A;  2B9U A;  2AEY A;  1HV1 A;  1Z7S 1;  2YB7 A;  3B5L B;  2EF6 A;  1BMV 1;  3VBF B;  2BDR A;  4CTE A;  4Q2F A;  1EPZ A;  1JBC A;  2E9Q A;  3UGG A;  1PVX A;  4MXV A;  2AR6 A;  3CJI C;  5FZO A;  1W0N A;  3HNM A;  3P3P A;  3LE0 A;  3MW4 A;  3NKT A;  4AAP A;  1O59 A;  3RZJ A;  1QDC A;  1RUE 3;  4X6Q B;  3ZXG A;  3JXS A;  4BMB A;  5F3I A;  3T2T A;  2Q8D A;  2O1Q A;  2BQP A;  1OKQ A;  5FJH A;  3ZMN A;  3OPT A;  1RVF 2;  4Q4V 2;  2XWB B;  4CU9 A;  2W5F A;  1FYU A;  3D0S A;  3GBG A;  1WGP A;  3ILR A;  5FWE A;  4UF0 A;  3A0N A;  1AR8 2;  2GNT A;  1OPM A;  3POW A;  1RMU 2;  4HK8 A;  4P00 B;  4XFC A;  3ZYB A;  2QVS B;  1J3R A;  2VU9 A;  1ZBE 2;  2I74 A;  4LBQ A;  5E88 A;  2W47 A;  3ILN A;  5FY7 A;  1TVG A;  5LWB A;  3ZFF A;  3VHO A;  4A4A A;  3OUH A;  4L2N A;  5FXX A;  3RJR A;  2HBT A;  1UX7 A;  2WQZ C;  1VBA 1;  4YYO A;  1LEN A;  5A3M A;  2DVD A;  3GJB A;  1AR7 2;  1WCQ A;  4FP2 A;  1AF9 A;  2VW0 A;  2IWG B;  3CU7 A;  4LE4 A;  1N1V A;  5C3P A;  4R9C A;  3WG4 A;  5JOZ A;  2VBP A;  3LGR A;  5JUV A;  4PLN A;  4HOO A;  4C90 A;  1OA3 A;  2VOX A;  2WUH A;  4FOQ A;  3TEX A;  3ZFG C;  4AQ6 A;  3VBS B;  3SHR A;  5FP4 A;  5FUN A;  4JGY C;  2P6C A;  4QQP A;  4XEZ A;  4NIA A;  2B8M A;  3SCF A;  2Y6K A;  4Q4W 1;  2NM1 A;  4N53 B;  2VZQ A;  2B39 A;  2P3I A;  3N36 A;  3JU9 A;  3Q8B A;  4JVA A;  4KWK A;  1E57 A;  5JVV A;  2W87 A;  3UES A;  4KH9 A;  2OS2 A;  5FZE A;  4CEY A;  1A6C A;  4D7T A;  1JI6 A;  2VCM A;  4R52 A;  4QPY A;  2XJV A;  3ELN A;  1LHO A;  1QJY 2;  2R07 2;  2G1M A;  2W2I A;  4XUT A;  2LRP A;  5A3O A;  1FPN 2;  1J59 A;  5FV3 A;  1ULD A;  2VTX A;  1VE0 A;  1VR3 A;  1HXS 2;  3KB5 A;  3VBH C;  4NPR A;  4KQ7 A;  4AFB A;  2AC1 A;  3KHC A;  4M01 A;  3ZPY A;  2E7A A; 
#chains in the Genus database with same CATH homology
 1SG3 A;  3OBA A;  1HN1 A;  2J1V A;  4BK4 A;  5EIY B;  4M4P A;  3P1I A;  2BGO A;  5IFT A;  4CU7 A;  2VMD A;  4ARX A;  1T2X A;  2YFZ A;  1UXX X;  1JYN A;  2VO5 A;  3HOB A;  1UZ0 A;  3T2Q A;  2CDO A;  3LEG A;  3VDC A;  5C7G A;  2WAO A;  1OD3 A;  2HYX A;  2VZV A;  2X05 A;  4QX0 A;  2BBA A;  4XUN A;  5J1X A;  2RJ2 A;  2XQX A;  3WNO A;  4XZU G;  1GOF A;  2Y6G A;  3CDZ B;  3C7H A;  5JR2 A;  4JKL A;  3I3B A;  3NJV A;  4OMD A;  3I97 A;  4JKK A;  4QB6 A;  2VZR A;  3J7H A;  4RN5 A;  4BXS V;  1XNA A;  3T2O A;  1UYY A;  2QQI A;  1UY3 A;  4DUV A;  1UYX A;  1RYY A;  3VD3 A;  1F4H A;  2E33 A;  2JE8 A;  1L7R A;  1XPW A;  2J22 A;  2X09 A;  1JYV A;  2L9L A;  5JXH A;  2PQS A;  3PUH A;  3FL7 A;  1PX3 A;  3MO4 A;  4A6O A;  3HEI A;  1OT5 A;  4XUR A;  2J1U A;  3T2P A;  1GMM A;  2CDP A;  2DCK A;  5B4N A;  1JHJ A;  2C9K A;  2J1S A;  3WF2 A;  2WO3 A;  3I2H A;  3IDA A;  3VDA A;  1W9W A;  2XON A;  1H6X A;  4KI5 M;  2YFU A;  3DYP A;  2VZS A;  4ZZ5 A;  4P08 A;  2QQJ A;  4A45 A;  3W5M A;  1J83 A;  3NRU A;  2Y64 A;  3WSO A;  4AG4 A;  4AAX A;  5A1A A;  4LPL A;  3IB3 A;  3WEZ A;  4CU6 A;  1JZ3 A;  4DEV A;  3OEA A;  1YQ2 A;  3CQO A;  2WAB A;  3EB7 A;  2VTF A;  2DCJ A;  1F4A A;  1UMH A;  1MPX A;  3F2Z A;  4OMC A;  4DUX A;  2JDA A;  5JXG A;  2Y6H A;  2OKX A;  1K12 A;  1W9T A;  3A21 A;  4CUB A;  2W1W A;  1W8O A;  2VOT A;  3WNN A;  1US3 A;  3CZU A;  2ORZ A;  3IAQ A;  3ACI A;  1GOH A;  5IFP A;  4XUO A;  5C70 A;  1PMH X;  4UOJ A;  5F7U A;  1P8J A;  2YG0 A;  1KGY A;  3DYO A;  1OF3 A;  4JKM A;  3ACF A;  1K3I A;  4MAD A;  4YPJ A;  4LHS A;  1L7Q A;  3LPG A;  2J1A A;  3A23 A;  2EIB A;  3DYM A;  3SEP A;  4QAW A;  2B9V A;  2VZ1 A;  2Y8K A;  2WBK A;  4UI9 L;  2J7M A;  2WQ8 A;  1GNY A;  3EYP A;  4JHZ A;  1UXZ A;  3U37 A;  3HPN A;  2WZE A;  4D0Q A;  5DQ0 A;  4P02 B;  1CZV A;  3A7Q A;  3FHQ A;  2V4V A;  2RVA A;  3ZM8 A;  3T09 A;  1GU3 A;  2W91 A;  4D8M A;  2LS6 A;  3A22 A;  1JZ2 A;  3ECQ A;  3CKH A;  4MGQ A;  2E31 A;  3K75 B;  3SKV A;  3T08 A;  1D7P M;  1JU4 A;  3GM8 A;  5EJZ B;  2HLE A;  2BGP A;  4JX0 A;  1JZ5 A;  2Y6L A;  3WF1 A;  2W1U A;  3GXU A;  3HN3 A;  5JXJ A;  2QQN A;  2V5D A;  3K77 A;  3MUZ 1;  2ID4 A;  3OEB A;  1KEX A;  3CMG A;  3P6B A;  3GDB A;  5LA2 A;  1CIY A;  2BZD A;  4UAP A;  5JMO A;  4E8C A;  3T0B A;  3VDB A;  4LKS A;  1EUT A;  2XHN A;  5FUI A;  2WDB A;  5B4X A;  2WO2 A;  1NX9 A;  3E1F 1;  1W8N A;  2J1E A;  2VZT A;  2EID A;  2R7E B;  3LPF A;  5CZK A;  4PF1 A;  1DLC A;  1DP0 A;  3THC A;  4FI9 A;  3MV1 1;  1JZ7 A;  3K4Z A;  4L0P A;  1GUI A;  3OGR A;  3C7F A;  3IAP A;  3WF3 A;  1JZ4 A;  2WN3 A;  4MGS A;  1OF4 A;  1XC6 A;  4TTG A;  3MBW A;  1UMI A;  1I5P A;  2WO1 A;  3C8X A;  4KWU A;  4ZZ8 A;  1UY1 A;  5LCW L;  4DXR A;  1UY4 A;  1K42 A;  1NKG A;  2WN2 A;  2ZEY A;  3CIH A;  2WZ8 A;  2W1Q A;  4QDR A;  2VZU A;  3MV0 1;  1NAE A;  2VQU A;  2ZXQ A;  3VD9 A;  4ZXE A;  2ZEX A;  3UNP A;  3DEC A;  3NNG A;  4BDV B;  1US2 A;  3OG2 A;  1CX1 A;  1J84 A;  2VZP A;  1UYZ A;  2J1T A;  5CYY A;  3UET A;  3PUI A;  2W9X A;  3W5N A;  1JYW A;  2VM9 A;  4QB1 A;  4DUW A;  2VL4 A;  4QX1 A;  3WNK A;  4W8J A;  3I3E A;  3BGA A;  5IYY A;  2VZ3 A;  3VD5 A;  3D3A A;  4PQQ A;  4MO3 M;  1SHW B;  2E26 A;  1K45 A;  1GOG A;  2C4X A;  3WF0 A;  2VQT A;  1O8P A;  3I2J A;  4OYU A;  3I2G A;  4A3Z A;  2XOM A;  3I3D A;  2ZEZ A;  4DEQ A;  4ET7 A;  1XNT A;  1JZ8 A;  1ULP A;  2BER A;  2QQL A;  3BN6 A;  3NQH A;  4XUP A;  1OH4 A;  2JKX A;  2VCC A;  3K4A A;  2W3J A;  5EJ1 B;  4M4R A;  4QB2 A;  1TG7 A;  1BHG A;  1WKY A;  4BJ0 A;  2VCB A;  3VD7 A;  3MUY 1;  3LQC A;  2E32 A;  2V72 A;  2VR4 A;  3C7O A;  4E8D A;  5C71 A;  4CUA A;  4GWI A;  3C7E A;  3SKJ E;  1PMJ X;  4LQR A;  3I2K A;  3K46 A;  4Z2A A;  4XVH A;  4QPW A;  4TXW A;  1LNS A;  5HXM A;  2B4K A;  1EUU A;  3WNP A;  5IHR A;  2JD9 A;  4CUC A;  2ORX A;  3HNB M;  2VME A;  3WNL A;  2QQO A;  2W46 A;  2C26 A;  3AC0 A;  3I2I A;  2W92 A;  4PT6 A;  1CZT A;  4KMQ A;  2QBX A;  5LA1 A;  2QQM A;  3LEK A;  3ETP A;  4W4Z A;  2X10 A;  5G05 L;  4MOA A;  1CZS A;  3ACG A;  4GZ9 A;  3III A;  4IUG A;  3GGL A;  3T0D A;  4BK5 A;  3WNM A;  4RYD A;  5DN2 A;  4QX3 A;  2Z4F A;  2VMF A;  1UWW A;  3C7G A;  4OUE A;  4A42 A;  2YB7 A;  2LW8 A;  2WYS A;  3FHA A;  5LA0 A;  2VJX A;  3HJR A;  1IQD C;  1DYO A;  3OGV A;  2Y6J A;  3I2F A;  4XUQ A;  3WF4 A;  4ARY A;  1W0N A;  3HNM A;  3LE0 A;  1O59 A;  4A41 A;  3LEI A;  3THD A;  3JXS A;  2ZEW A;  2W1S A;  1H6Y A;  2J1R A;  5IJR A;  2YC2 A;  4CVU A;  4ZY9 A;  3K4D A;  4CU9 A;  3ABZ A;  2W5F A;  1W9S A;  1JZ6 A;  4P00 B;  5G04 L;  2W47 A;  1TVG A;  4QDQ A;  1R64 A;  2W95 A;  4W50 A;  2VCA A;  4A4A A;  3OGS A;  1JU3 A;  5DMY A;  1UY0 A;  1UX7 A;  2WAA A;  4OZO A;  4P5Y A;  1WCQ A;  4DXT A;  3CZJ A;  5JXI A;  2VC9 A;  5JUV A;  3HNY M;  1ULO A;  2W94 A;  3ACH A;  5HPO A;  2VMC A;  3SEE A;  2WUH A;  4A44 A;  2EIE A;  1W99 A;  5DPN A;  4QDS A;  3T0A A;  2Y6K A;  3WQB A;  1JYX A;  3OB8 A;  1UY2 A;  3FN9 A;  2QQK A;  2VZQ A;  1NUK A;  2W87 A;  1PX4 A;  3UES A;  2YC4 A;  3NJX A;  2RV9 A;  2VZO A;  4GWJ A;  1JI6 A;  2EIC A;  4CU8 A;  4HG6 B;  1O8S A;  4XUT A;  5I0D A;  2DDU A;  2KD7 A;  1GQP A;  4QX2 A;  3VD4 A;  4DXS A;  1SDD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...