2HEYF

Crystal structure of murine ox40l bound to human ox40
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
135
structure length
135
Chain Sequence
b'DPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 4
publication title The Crystal Structure of the Costimulatory OX40-OX40L Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine
total genus 25
structure length 135
sequence length 135
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2heyF00
2WNUB 4RSUA 3FC0A 1O91A 4QQPA 2AZ5A 1D2QA 2TUNA 2JG8A 4OUSA 5TSWA 2JG9C 4NN0A 3WD5A 1DU3D 4DB5A 3V56A 4DOUA 1D0GA 2HEYF 5KC5A 5CIRA 1D4VB 5BNQA 4QQHA 2HEWF 2RJLA 4G3YC 3ME2A 2WNUC 3B9IA 4QPYA 1JTZX 1U5YA 1C28A 1A8MA 4F3JA 1WCKA 1XU1A 5KWRA 4OUMA 4TSVA 3AB0A 2HEVF 4MXVA 3MI8A 4E4SA 2R30A 1XU2A 1GR3A 1PK6A 2WNVA 4EN0A 2JG8B 3B93A 1TNFA 3TWIA 2QE3A 1PK6B 2OIIA 1I9RA 2QDNA 2KA3A 2JG9A 2TNFA 4MSVA 1JH5A 3QD6A 1RJ7A 2X29A 4QQLA 2RJKA 2JG8C 2E7AA 4KG8A 1OSGA 1KXGA 3L9JT 1U5ZA 4E4DX 1S55A 2R32A 2WNUA 5L36A 1IQAA 1ALYA 4D7YA 4HT1T 1PK6C 4QQ2A 3URFA 1DG6A 3TYJA 3K48A 5HBAA 1OQDA 5KC6A 3ALQA 2WNVB 1U5XA 4QQOA 5L19A 1OQEA 4TWTA 2Q1MA 4J6GA 3IT8A 2R6QA 4MXWA 3K51A 2JG9B 3B94A 4G4FA 4OULA 2O0OA 4N90A 1KD7A 2WNVC 2ZJCA 2ZPXA 4GIQA 1RJ8A 3QBQA 4KGQA 1C3HA 2Q8OA 4KGGA 3LKJA 4MXWB 2RE9A 1TNRA 2Z5WA
chains in the Genus database with same CATH superfamily
2CHHA 1K5MA 4X6RB 1UMZA 5F7UA 1D2QA 5BXXA 1VBB3 2DURA 3SH3A 2BNMA 4ARYA 1J1LA 2B7YA 3VLBB 5CEHA 2ZZQA 4YVSC 2W87A 3JCIA 1IG0A 1DLLA 1LOFA 3T2PA 3IKWA 2RJLA 4XIKA 3GXUA 2CV6A 5LA0A 4D8MA 5IVCA 4ZXKA 1YQCA 5KXCA 2YHJA 3EJKA 1FV3A 1YFUA 4QPGB 3T2QA 4KMQA 3VDAA 2A6ZA 4Q4X3 2BP6A 2NQYA 4K8RB 4OI1A 1MZ5A 1W6OB 2B45X 3PUHA 5EZWA 1V6JA 1ZNPA 3AVSA 1OOPC 4GMP3 3UJOA 4XBQA 1W8NA 4YVWC 1XSRA 2VZ3A 1FV2A 4RR3B 2QNKA 4O9EA 4OUMA 2GNDA 2IC1A 1IS6A 3C7HA 2PMWB 4ARXA 3PIJA 1RUJ2 1C8M1 1HKDA 2RR12 1PGW2 2VZ1A 1ULEA 2D7FA 3JD73 5IK7A 1PZ9A 3RMYA 2R072 3P1IA 3HQRA 2HWB2 4DINB 1QJEA 1REDA 2QZ2A 3RWNA 5J37A 1YFYA 4LKSA 1WA4A 4FQ4A 2J42A 3AKPA 1HDKA 3CJIA 3L2YA 3O7OA 5B2GB 2VH9A 1G7YA 2DBIA 3DKQA 1UYZA 3LEGA 1K45A 5K7PA 3DXTA 4CXWA 1LHVA 1R092 4HK9A 4LPLA 4XETA 4YW7A 5GKAC 3VHNA 2X29A 3PVEA 1ONAA 5FQ0A 2UY8A 1V70A 2VAUA 5LK5A 3FFQA 4NIHA 2Y6FA 1B35A 1H8TB 1NCQC 4YW4A 4AEKA 2G9GA 1BKZA 5I0DA 2QBXA 2XKPA 5BV6A 5JMCA 4RQPC 4DEQA 5BNOC 2P1BA 1S55A 2WQZC 2Y60A 3Q8FA 2WNUA 3CF6E 2PQSA 1CN1A 3CL1A 1W2OA 1BEV1 1QJU2 2YB7A 5ABJA 3TYJA 1JZ4A 4G9SB 4YG6A 3LFIA 3IDEA 1Y9MA 2GC2A 3SLIA 5ERLA 3E6CC 2WWUA 3K46A 2FHRA 1H30A 4Q4Y1 4XFFA 4LLOA 3ZDSA 2CTVA 5C4WA 1MS1A 3SEPA 5HCFA 1WWYA 4EJRA 4YM2A 2R0FA 2FDJA 3WQ1A 3RZLA 3GBWA 2OYZA 2C1FA 3UT0A 3N7LA 1RUD3 2VCMA 4LKEA 3AKQA 1ND2A 2LROA 3KQ4B 4TTGA 4HKOA 4CCLA 2DDUA 4URTA 1W6NA 2O0OA 2HBUA 2WNVC 4GD4A 3VD3A 5J1XA 1LTEA 4YGDA 1Z7S1 1LHOA 3UETA 3TNQA 1CAWB 3O1VA 2VUDA 2A6YA 3SH4A 3VD7A 1OLRA 5FV3A 1MZFA 3GCXA 2ZHNA 5DAPA 3TNPB 5DAWA 1O91A 4PDWB 1F5JA 4FPLA 4BLJA 4CDWC 1RUG2 2W68A 4MYEA 1YCIA 1S2EA 1AXZA 3AYDA 1WZXA 3DYOA 1AYM1 1UZZA 4IEOA 3SCGA 1AR81 2VD7A 3VHPA 1UAIA 2J22A 1QJX2 4Y24A 2HWC1 2RM21 2CDPA 5CFDA 2HEWF 2YFZA 2Z69A 4ET7A 2YPDA 3J8F1 4NHYA 1N47A 2WZR1 4JRAA 4XBLA 3ZN4A 1FMD3 4AI1A 2Z42A 4GWJA 1BJQA 3LDKA 4M3CA 1JYXA 5FY9A 5FYSA 1OH4A 3TEZA 1GSLA 4WVWA 4H2AA 1WLDA 4QM8A 5JOWA 3NVCA 4M4PA 1WBLA 3J7MA 3OEAA 2DBNA 1N3QA 4PF1A 2FZ1A 2VQ0A 2ZGRA 3POSA 4FTEA 4N43C 2WAOA 4LORA 3RI8A 5I0RA 1XNTA 3NRUA 4QGMA 1R64A 3O0XA 2Q1FA 5E88A 5FY8A 1RGSA 2AEZA 4LO8A 2QQNA 3JQWA 4ISRA 3VL8A 3IB3A 4HFSA 4WM8B 4UW5A 4YPJA 4LULA 5F5IA 2D5HA 2W9XA 5LA1A 1DQ6A 2Q30A 3BPSA 4Q4W2 4QB2A 1OA3A 4AVVA 3MIEA 5CFCC 4MGZE 4OI2A 4Y22B 5JWPA 2LS6A 2W1WA 5APAA 4GA9A 3OPWA 4LLFA 3DV8A 5FZ9A 4ZHNA 1FPN2 2XB6C 4AVSA 4XF4A 4HL0A 3DN7A 3VDBA 1JODA 3CMGA 2KA3A 4KNCA 1VRH3 1ZZCA 1TQ5A 3OOXA 3QD6A 3HQUA 3MF9A 4AVBA 5A32A 1OUXA 1W05A 2JWPA 3BODA 3INAA 5KR7A 3H8XA 1EV11 4P9XA 3MIHA 1PIV2 5ACA3 1PGL1 3OD4A 1X33A 1UYYA 4XOGA 5KHIA 3ILFA 2VPVA 4X8PA 2WYFA 3WW3A 1MS3A 4CRQA 1GNHA 1U12A 1ZBE1 4BHPA 4Q4V1 2P3YA 5K4LA 1L3JA 2GH2A 3FFZA 4QT6A 2WS93 3PTYA 4QGLA 1JU4A 3ALQA 3UL2A 4NMIA 2NZ9A 2P3IA 3MFAA 1JOBA 2EAAA 1HJGA 5LY2A 1Y4WA 2CSGA 1PVC1 2VR4A 1FNZA 1QQP2 1HXS3 2J1AA 4HONA 2WO2A 4C0HA 4AVTA 5D21A 3HQXA 3O14A 3IMMA 3VZNA 5A33B 1FNYA 4PIZA 4Y26A 1VAKA 1CAXB 1NQDA 2NMNA 4HPKA 2MEV3 3OY8A 2DF7A 5FYVA 1MVEA 1VBC3 1W6PB 3MF6A 3VBOA 1VP6A 4CCOA 2Y26A 4IE4A 1TME1 1H6YA 1KFUL 5CBLA 3ZFGB 1LB2A 2PAEA 5FZ8A 4AHYA 5CU1A 1WW4A 2E7QA 4AFAA 1UNBA 2YXSA 3I4IA 3BTZA 1QH7A 1Y43B 2F17A 2JG9C 2W1SA 4LNVA 3BB6A 2ZX3A 1LRHA 3ZXFA 1NCRC 2XUMA 1JZ8A 4XQ4A 1D0GA 3CLPA 2BZDA 5FPVA 3J8F2 1OI6A 5A6QA 1N3OA 4KG0A 4PBOA 4Q29A 5FCCA 2PELA 5T50A 3GBGA 1DZTA 4GKYA 2Y38A 4Y5Z0 1H2MA 1EPWA 1VIWB 1OQ1A 5DPNA 1CQ9A 3TBDA 3ZLIA 5FYCA 2YFUA 2WFF1 1UY3A 2VBPA 5F6LB 1ZZ8A 2DVAA 2WDBA 4YNIA 4NHXA 5A7PA 4Q5OA 5SV5A 3HD8B 2IXCA 3GF6A 4ONUA 4XZPA 1RUJ3 2VC9A 4C1XA 1AR61 4JKLA 2EIEA 5BYNA 1N1VA 2R073 2BFUL 1ENQA 2WSVA 1G9BA 2W91A 1VBB1 4KWLA 2KM2A 4AGVA 5HI0A 3ZYJB 3RDIA 5FOBB 2VQAA 5LCWL 3NV3A 1REEA 3QCWA 3WF2A 5KXBA 1MS5A 3MV11 2ARCA 3VBRB 3LOBA 1UQXA 2W47A 1F31A 2FBEA 2VZVA 1R093 2XQXA 3HNBM 3N36A 5JSPA 2TEPA 4FTSA 2PHXA 2H0VA 3P3NA 4LBKA 1QGLA 2UY9A 4CDUC 5A1AA 2VW0A 2GNTA 1XSQA 1UOGA 2TNFA 4Q4X1 2HLEA 4KL1A 1YIPA 2RS11 3M1HA 4M3CF 2DWRA 1O7FA 2VUJA 4GMP1 3UYJA 1H1AA 4MADA 1QJU3 3GZAA 3RZHA 3VBRA 4ATEA 1DGRN 4YZ3A 4O7XA 1YYNA 2C5DA 1H4GA 1PK6C 2IWGB 4HT1T 2VCAA 4P14A 3URFA 2D40A 5DMYA 2AEYA 3RZZA 4IE5A 3JD71 2IXIA 5C3SA 4FAHA 2XLGA 5LA2A 1QOOA 1FOD2 4XVHA 4BPZA 4M01A 2KR2A 2D6LX 4XHXA 3BU7A 1PNFA 3W5MA 1PO13 3Q8BA 1VALA 4QXBA 2JE7A 2VCCA 1U5XA 2ZX4A 4YG0A 5HCBA 2G1MA 5JPNB 4QKFA 4LK6A 1RXGA 4OHYA 3DKWA 3WDVA 1KS5A 3A22A 3DEMA 1NA1C 3PVBB 5EJZB 4XDOA 3WDWA 1W6OA 3AZYA 1YI9A 2ZGSA 4IGOA 2LW8A 4H3WA 2J1EA 3PNAA 5FJKA 3W20A 2A75A 1PHMA 4AG4A 2JIJA 1IKPA 1W8WA 2QQLA 1KD7A 4RR3A 4O9GA 4YW6A 4B8EA 1H2KA 4JQRA 5E1RA 3BTXA 5DABA 4FSJA 1MPXA 5J3UA 2RS32 3WNMA 1TNRA 5A3OA 3IN9A 1RUG3 1CZVA 2NPIA 2XLFA 1UZVA 2ZX2A 4AE2A 1NOVA 1BK1A 3A0KA 3FC0A 3SKJE 5IVBA 4OQ8A 3IBMA 3AMNA 2YDEA 5EFUA 1JN2P 1QJX3 1WMFA 2ARBA 3D4KA 2DVDA 1R1A3 3IAQA 1OC1A 4YZ2A 3ZXAC 5JDBA 3P5BA 1W6MB 4PQQA 1EP0A 2DV9A 2G9FA 3WG2A 4ZKTB 4A7ZA 5T5PA 2R7EB 4ES9A 1OVSA 3GYDA 3ACFA 4AI0A 3MZHA 1LESA 1DQ0A 4W6XA 5C71A 4S2HA 3OUHA 3MV01 5JCTA 2VZUA 4IUGA 1RUD1 2B8MA 2VZTA 4LIVA 4QXCA 5FYIA 2D6PA 1S4CA 3NNMA 1H8TA 4DUWA 2UWCA 4XJWA 1HV1A 1E5HA 1D2SA 5IVYA 1AYN2 1W3XA 3K4ZA 1ZRCA 1XQNA 3LA7A 3J4UH 4JRLA 5FZ6A 1J59A 2DCTA 2WJSA 3HT1A 4XJ9A 1YEWA 3E5QA 2O14A 3ITQA 1YI7A 4FFHA 1S1AA 4A42A 2BBAA 2ZAAA 4Q0QA 2W46A 4Q4W3 1XU2A 4SLIA 4X6QB 4HOOA 3ZSMA 4A44A 1HRI2 3I3QA 1W9YA 4CCNA 2FZ2A 3HBZA 4L9BA 1X50A 1QKQA 1UPIA 3FBYA 3T2OA 1FPN3 1R081 3J26N 3M8LA 4XABA 4MV2A 2K46A 5HPOA 5EPAA 1FMD1 4XTPA 3D0JA 1HB3A 2YBKA 5FYUA 4YGBA 1CJPA 4RS5B 4TYSA 5FLIA 3NV2A 1PIV3 4LJHA 4CXXA 1UOBA 3NL1A 5EJ3A 4GB33 3IZOA 4MX3A 4OMDA 3ORJA 1AJKA 2YC2A 1KXGA 5FP4A 3VZJA 5GZDA 5LB6A 3OEBA 2ADDA 3SXWA 4IETA 4LBJA 5FLHA 4IV1B 3RMXA 3AFKA 4OUEA 4CXYA 1BHGA 2XJPA 1LHNA 3AXDA 3E97A 3SNMA 3ZXDA 2C9AA 5A7QA 4FTBA 2ZMKA 5GLZA 5HBAA 1OQDA 3CJIC 4LMFA 1F2NA 3KGZA 4IE6A 5FIXA 3H8OA 1J58A 4LEJA 1QQP3 2PHWA 1JOPA 4QHOA 5BNPB 4K8FA 1V0AA 2I74A 2XXZA 4QQOA 2WQ4A 5A70A 1YQ5A 4MO3M 5A7WA 4WVMB 1UWWA 5DUUA 4A7YA 5EJ1B 4JKMA 1NY72 3RSJA 3KZ4C 4K7JA 3VBSA 3W21A 3QH6A 3W59A 4Q0VA 1B35C 5KHGA 1VRH1 2AYHA 1OLME 5HV4A 1NZCA 1OFNA 4QD2A 3GCWA 4HG6B 2VQTA 3I59A 4QKNA 4CYDA 4E8CA 3H8RA 2ZJCA 2X53S 3CKHA 5ACA1 2BV4A 1V00A 1X9TA 2UURA 2ZOEB 1W8ZA 1PNGA 1VPHA 1YO8A 2LRPA 1UY2A 4QPIB 4XCBA 3E6DA 3KB5A 3OF1A 1SZBA 4M0HA 1WW5A 2LM3A 2VMEA 3M4FA 2WS91 3PDQA 2VUCA 3ZYBA 1SQ4A 3POFA 5IUQA 3ZXLA 3N7JA 4E8DA 3ZYGA 3T09A 3ECQA 3ZFEB 4Y22A 4FPKA 3EMRA 3H3ZA 1PVXA 2WKKA 1H8VA 1F9KA 4KU7A 4M4RA 1OKOA 2PHFA 1ZZBA 1DYPA 2EIDA 1HXS1 5FY0A 4MGYE 2CU5A 1RUD2 2WINB 2JDUA 4PQ9A 1XBFA 2XVKA 4JTOA 1WGPA 4COUA 1JYIA 2ZGTA 3S6PA 1WLCA 5FO7B 1XNAA 2QQKA 2PTMA 2VW2A 2YC4A 3OGGA 4MVTA 3WNLA 1PZ7A 3ETPA 2IZWA 4OCTA 2YBPA 3UGFA 2MEV1 3ZYRA 4DEVA 1VJ2A 1VBC1 4IV3B 3VL9A 4B29A 4C90A 1KDMA 3M3QA 4LBLA 5C9AA 1EUTA 3FUOA 4FPCA 3KV6A 3ZSJA 3J7LA 4EN7B 3H7YA 4RFT0 3KMHA 2ZTNA 4XE9A 5JIUA 4Z82A 4JKKA 1JYCA 1PM7A 1FATA 4FPJA 1KQRA 1UU5A 1SMVA 5CFDC 1EUUA 3WF3A 1W03A 4JGZB 3UV9A 4AYUA 5T5LA 2RV9A 3WR0A 1T2XA 2P34A 4CUBA 1JYTA 3WUDA 2V72A 1GYKA 5A33A 1RITA 1TE1B 5C5UA 1AR72 3CIHA 1UZ0A 1S0CA 3B00A 3FLTA 5LBBA 5LRRA 5AVAA 3V65A 4U2AA 1DGWA 3H1YA 4QWNA 4FI9A 2RHPA 4PIYA 4UFIA 4YGEA 5FY7A 2WNEA 3I2DA 4YFZA 1ZVFA 4C91A 4DY3A 5JXIA 1ULDA 1GMMA 3KT4A 1POV3 2OPWA 5H9QA 3WNXA 3BGAA 4A2UA 3WG4A 1RUJ1 4W4ZA 3ZFGA 5IAXA 4E4DX 4EROA 1PGW1 2UWAA 3RZJA 1JYWA 4XILA 1QXRA 3WW4A 1IQAA 3PHMA 2VMFA 2BGPA 4FOQA 4BQXA 4D7YA 1FOD3 2R071 4UW6A 4FQZA 2WZEA 3T4HB 4FFGA 4DXZA 2BEOA 5F3IA 2PN5A 4MGIE 3K48A 5FYZA 2VBDA 3WY6A 5D8AB 3O1PA 1LKNA 3WINE 3NQHA 3NJXA 3WQ0A 3KV5A 2A1XA 2XKOA 1BVP1 4GWIA 4XUNA 4AEJA 3MPPG 3AZVA 2VNOA 1R091 3OGSA 2CGNA 3OYWB 3N9OA 4XJAA 2D98A 1HV0A 3WG1A 4TZDA 3O1UA 2ZACA 5I0TA 3T0BA 3S7IA 3R4DB 2BWCA 5IW0A 1XYNA 4J1WA 3HN3A 5A3PA 1TVGA 3EYPA 5CISA 2RS33 1H1MA 2VECA 4YVSB 3WDTA 5I0UA 3VBFA 5L7OB 4CUCA 1CZSA 4F7ZA 4COZA 1QJU1 2D44A 1U5IA 2WABA 3K4DA 4MXWB 3KHCA 4GJYA 2AREA 5IFTA 4YW2A 1SPPB 3MUY1 2A71A 1NZIA 1W8OA 4RSUA 2C0ZA 4F83A 2WA4A 5AC92 1HRV3 2VVFA 4X8NA 5C8CA 3VKFC 3S7EA 3WQ7A 2FDKA 5JR7B 3I54A 1W99A 2D6KA 2VMIA 1UF2C 3MEPA 4FPHA 4YVWB 5T5OA 1PO11 1OUSA 1DFQA 1D4VB 4MGQA 1HXS2 4TLGA 4HMZA 1DGLA 2QZ3A 3WV6A 2WWSA 3BALA 5D8AC 3RZGA 4AEDC 4QDQA 3ZSKA 1VMHA 4YRDA 3WEZA 3VD9A 1RMU3 3FHIB 5FYYA 1AYN3 3M3IA 3LIHA 3VBOC 3VDDB 2H0BA 2FDIA 2RS53 4PIXA 4IW3A 2NM1A 4AHXA 2OKXA 3ST7A 1F15A 1SLAA 1MR5A 3V0BB 1YRZA 1LGBA 1N1YA 4N8MA 5KWRA 1LENA 1WMDA 2DU0A 5K0UB 5BY5A 5FYTA 3LA3A 2FCVA 1RUG1 1OMIA 3LSEA 3ZDVA 3R6SA 3PVOA 3TB0A 4DQAA 1HRI3 1WLWA 5L7OC 2ZMLA 3J7HA 2P6CA 1CZTA 2ZA9A 4RGGA 1QJX1 4BIFA 5C3QA 5I0SA 4FXKB 2BOIA 1NCQB 1R1A1 3T08A 4DUXA 1S0DA 1HN1A 3C2UA 3WDXA 5F1RA 3EQEA 4RQPB 5BNOB 3HEIA 2QQJA 5FZ0A 4FPFA 4KU8A 3IAPA 2XHNA 5FZGA 1O4YA 1I3HA 4WM7C 5DAXA 2YPJA 3DPRC 1GZWB 4CDXA 4V2VA 1JBCA 3WHTA 3U10A 4Y5SA 3IIAA 2ZHKA 2SLIA 3LGRA 4K21A 1A34A 4B4RA 2O8OA 3R4UA 3UKNA 2OQ7A 2BQPA 3WXPA 4LBMA 5CB7A 4ASMB 5J36A 1QNWA 3AP6A 4NAMA 4OVEA 4XXAA 2Q0AA 3VDDC 4PI2A 3PL0A 2X09A 1W0NA 1US2A 3CHXA 4XIOA 2XL7A 4ZY9A 4HXCA 1HLCA 4QAWA 1N1TA 5FZIA 5FP7A 3KV9A 4GZ9A 2VNVA 2ZBJA 4Q4W1 5FK7A 2XOMA 1W6MA 5FYMA 2WNVB 4ZU5A 5K0UC 2ZX1A 1D4M2 2PAKA 1O4ZA 2ZEWA 3AC0A 4A4AA 2Y8KA 1W39A 1FPN1 3KS7A 3KCXA 1KDKA 2Q1MA 2W52A 3BI3A 3EHKA 4CUAA 4BMEA 1WCSA 2YC0A 2VUAA 3IWZA 3NJYA 3BOWA 4LBQA 2A3WA 4QX1A 4ZS3A 3RI9A 4CDWB 4QX7A 1OA2A 1IG3A 5LBCA 3LQCA 1SLBA 3ES4A 1PIV1 1SLCA 1CWPA 2WLPA 1LU2A 2QQPA 4GIQA 4XURA 3JB4C 1C3HA 1S0IA 1QOSA 1RUC2 2A7AA 2QQOA 4LIUA 4UOJA 1RHI2 2JKBA 1JYNA 2RE9A 1PMIA 2RDNA 2X8KA 3ZM8A 2WO1A 1LAJA 3FLRA 1IPSA 1JUIA 4RD7A 4AQ2A 5GALA 5EV7A 4P9LA 1FXZA 3LEMA 5JUVA 1GP4A 1XRUA 5TSWA 4I0WB 1PO12 3V56A 4JCKA 2HH9A 1QQP1 4N43B 3T30A 2HYXA 1I6XA 4LKFA 5A3WA 1KJLA 2JICA 2GNMA 1ND3A 4AVCA 2ZGLA 1VBE2 2E51A 2JB8A 4RS5A 3NAPA 2RJ2A 1W8HA 1QJFA 2V73A 5A3MA 5I8YA 4D6QA 4CCEA 2QQUA 3SC7X 4Y1ZA 5JIAA 1YFXA 2ZGQA 3H8UA 3NKGA 2HWD2 2Q8DA 2G19A 4MUVA 1G86A 3GZEA 4OHWA 1IPJA 2I2SA 3Q8CA 5CFCB 4EV0A 1AX1A 5GJ6A 1F4AA 4CP1A 3MO4A 2X10A 1YIFA 1LOBA 4IV1A 2J1UA 4LE3A 3U07A 4RGKA 1QIQA 2OX0A 3EO6A 1IS4A 1WD4A 3GDBA 2C9KA 1M06G 4ZONA 1AF9A 5JVVA 1OFSA 2Q1ZB 2RDRA 3CNAA 4GAZA 1HQLA 4LHSA 3ELNA 2WN2A 3OUIA 4PLNA 1SFPA 1R1A2 4BISA 2A3XA 3RPQA 3AKRA 5FZMA 5BNPA 1SLTA 1AXKA 5L9VA 2HBTA 1XE7A 3JZVA 1W9FA 2VOTA 1UY1A 3C7EA 3JU9A 2WYSA 4WVMA 5FAXA 1CAUA 3P3PA 2DUOA 1AR73 1O3QA 5G05L 3N9QA 1WBFA 3KWVA 2ZAHA 3LDBA 1SCSA 4BJ0A 4OZXA 4LHNA 5FZLA 1UZWA 2JKXA 1OPMA 3PUIA 3LEIA 1S2BA 1YQ6A 3WP3A 2HKXA 5JOZA 4RGAA 4DIQA 2AENA 3ILRA 1LCLA 3HNYM 2WWJA 2VE1A 3MW4A 4KG8A 3O12A 1TEIA 4JGYA 1JMUB 1ULPA 4LOSA 4BDVB 4CU6A 4QPIA 5FZEA 2B9VA 3ZIWA 1JZ7A 4AHZA 4XFCA 2WFPA 3FE5A 5CZKA 4BE3A 3AZXA 3IM0A 4L8QA 4R9AA 2DCZA 3ZMOA 3E5XA 1POQA 3ABZA 4ASLA 1XYOA 5A1FA 1RTVA 2JIGA 3VZKA 4FBFA 4NAOA 2JECA 3ZFEA 5BNNC 2LUWA 4GH4C 4XJZA 1JS9A 2VL4A 5LASA 4QX3A 5CADA 5F39A 2Y64A 3TAYA 3LDRA 5FZKA 2TBVA 3OJBA 2GN7A 2X5IA 2ZEYA 4HKWA 4N53A 5CG8A 4QDSA 4PCRA 1MS9A 2E26A 4DS0A 2XHKA 1UL9A 2JG9B 2DVBA 4HVRA 4GB32 3VHRA 1NCRB 4IV3A 2GC3A 1CX1A 5JZGC 1W28A 1O3RA 5FMOL 2ZPXA 1POV1 4KGQA 2VW1A 1PM4A 5FBJA 3SMHA 2BPA2 1V6OA 5AC93 2E7TA 2W95A 3VBUC 2DFBA 4BB3A 4I3PA 4QM9A 2WQ8A 1Q8QA 1FOD1 4CTEA 1XYPA 1Y3TA 2GAUA 4FXGB 4QQPA 1I5PA 1Y9QA 3JXSA 5A6XA 2W1UA 4FCAA 1VB4A 4JGZA 2QUOA 3VKOA 4DXRA 1DU3D 3ZFFB 1MACA 3L2HA 5LZ6A 4YZ4A 3VBHB 3VBSC 4Q0PA 4PLOA 3GZTB 5CIRA 5T3NA 1O5UA 1K5JA 4E2QA 3WNPA 4Q26A 1MQTC 5CYYA 2JD4A 4TLFA 4YZ1A 1UZYA 3H3LA 4S2GA 5IVJA 1NXD1 1L7QA 1NE6A 4IEYA 1F5FA 1VMJA 3KSCA 4I30A 2VTXJ 1Q5OA 1X8EA 1LEDA 2OPKA 5GLUA 2J1VA 2XLAA 4QX2A 4OHZA 1C28A 2QQIA 1C4RA 4K9SA 1GANA 4UF0A 2RS31 4XPVA 4YWAA 5FRAA 5FXVA 5LBFA 4RFRB 1XU1A 1DQ1A 4CZSA 4EQVA 4CEYC 1C8NA 1N1SA 4CDUB 4COVA 2QQMA 1VBD3 3AB0A 5DDJ2 2G9ZA 5IWFA 4XDPA 4ATFA 2W0XA 3E6BA 4UFLA 1WCUA 1EAH2 1VAMA 4EZHA 3FHAA 1BQPA 3M3OA 4N7UA 3B93A 4OI4A 2WZPP 4W65A 4NR1A 2BW8A 5LA9A 2P3KA 2XL9A 4PT6A 1W0OA 3KV4A 5EYXA 1PK6B 2WLQA 5DAVA 2YY1A 4LTAA 1URXA 3CU7A 3UJQA 1PMHX 3ZFFC 2JDKA 3KD4A 1SLIA 2VZQA 1RMU1 3D5OA 3VBHC 1AYN1 2W94A 1Y7BA 2BGCA 2BOJA 4ITCA 4H55A 2R16A 4YVSA 2JG8C 5GZGA 2A6XA 2BDRA 2XGXA 5HV0A 1MS0A 1O4TA 4I01A 5GLVA 5JI7A 1CVNA 4IE0A 4M0NA 4RYDA 5IK5A 3CO2A 4AHWA 2FCTA 3MYXA 5GM0A 5KBFA 4BQ1A 1NA1B 2ETEA 4Z2WA 1DQ5A 3M2MA 1HRI1 3NV1A 4Z92B 2PHRA 3WDYA 2I45A 2VOKA 1D4M3 1OOPA 4LR4A 4E2SA 5KC6A 4YVWA 1OPOA 3I3BA 2YGMA 4FP2A 4LOTA 3LA2A 2H6CA 2YBSA 3OSDA 4XF1A 4BQ5A 2CGOA 4HVQA 1QHDA 4FT8A 5HCHA 3RGBA 1OF4A 2PHDA 5E8AA 4Y1UA 1W6QB 2GMPA 3HJRA 3I3EA 4XZUG 2BVVA 1F4HA 2I07B 2P37A 4J6GA 4CDQC 3AJYA 2J1SA 2P5BA 3OD0A 3U75A 3GHNA 5FZAA 1HX6A 2R0HA 3NV4A 3ZN6A 3VZLA 5BUVA 3ZIXA 1ZRRA 1J3RA 3IPVB 4AW7A 3EBRA 4JTNA 3B94A 4G4FA 3PTRB 1GWKA 2K9ZA 1XOYA 1RUC3 2L9LA 1C1LA 1RHI3 1A6CA 2PFWA 4LHLA 1XXNA 3OBTA 4DY5A 4JDMA 1VBA2 4YYOA 3VKLA 3ACIA 5DN2A 4D7SA 4YM3A 3BU0A 3ZN5A 4UT5A 3NNFA 4BYYA 1M4WA 1OH3A 4GWNA 5LATA 1ZZ6A 3W5NA 2XJRA 2B4KA 1ZX5A 3I2GA 5EYYA 2E53A 1E57A 2Y6LA 4KQ7A 4AZZA 5I93A 2YU1A 5F32A 4IESA 3G6JB 1NCQA 1RUF2 4XBNA 1G9FA 4XF0A 1W2TA 1FI2A 2P3JA 1VBE3 4Q8LA 4QHBA 1SEFA 4QPGA 2YGLA 2OQ6A 4CCDA 1HQWA 5BNOA 4XC9A 3SCFA 1NY71 5ANNA 1K5MB 2C24A 5FPLA 4BXFA 3MLLA 3V0AB 5FPAA 4PF5A 3WNKA 4J25A 4BQWA 4XXPA 2Q4SA 2HWD3 1NUKA 2DTWA 1NLQA 3SKVA 3RZMA 1IOAA 3ILNA 4YARA 1UKGA 3RWKX 3UESA 2RMU2 4AAPA 1RUI3 2XQRA 2VZSA 5A6ZA 1WW7A 1JYVA 2XR4A 4LXLA 3HN1A 4BM8A 2QQWA 1EYBA 3ES1A 5C8CC 2PXJA 5KHJA 2O8QA 4UI9L 2W39A 4AQSA 1UN1A 2W08A 3AX4A 1HRV2 1N3PA 1RUE2 4JAAA 5FZ4A 4CA9A 4CEWC 1YWKA 2DU1A 1UD1A 3T0AA 2GP5A 1GR3A 2JX9A 2WNVA 3N35A 2OUJA 4Y1VA 5B4XA 5T5JA 5FK8A 4EYUA 1UMHA 1Q3EA 1TNFA 1KITA 2E33A 2F6BA 5FMOS 5T54A 1S0EA 1GFF2 4QB6A 5FBZA 1UX6A 3B3QE 3H1WA 2VOWA 2Z79A 1DQ2A 1UYXA 4YM1A 4CDWA 1RMU2 3MGUA 2XBO2 4AWDA 2ZGPA 1CR7A 5JPMB 1AVBA 2EAKA 1ZRIA 2WA3A 4FPYA 1X7NA 2RS52 4INDA 4NRQA 3T2TA 4CCKA 4CPBA 2QQVA 1K5MC 3CJIB 3RG0A 4CCCA 4DFSA 1UIKA 4BQYA 2YROA 4Y3OA 2DVGA 1GOHA 5FLJA 4JX0A 4BLIA 1YJLA 2K2SA 3LB9A 3LEKA 3MW2A 4QX8A 1CIYA 2R32A 1QDOA 5F8PA 1ALYA 3FX3A 3PUAA 2XVGA 1LOFC 1OD3A 4B7KA 5J48A 3ZR6A 5LEJA 1HW5A 4D6RA 4Z8BA 1B35B 3ACLA 3B5LB 3IDAA 1F35A 2VG9A 4RHV2 3MIBA 3KF5A 3WF0A 4N43A 1XPWA 2R042 3J7NA 3POYA 5FXZA 1CAVB 1VB2A 2JE9A 2ZMNA 4XEZA 3N4MA 5ABJB 2PHUA 3HAGA 4ZPIA 2OZ6A 1KS4A 5FZBA 2W5FA 3D3AA 1AR71 4ZXEA 2BERA 2ADEA 3SQOA 2CL2A 3UGHA 4ZU4A 3WW1A 3POIA 4AL9A 3WDUA 2O1QA 4JZRA 1CAWA 1CX4A 1ENRA 2BWAA 3N9MA 3AK0A 1SFYA 3O0VA 2VY0A 4XUQA 4MG2A 2LTNA 2DCYA 5LBEA 3BPZA 5CFCA 2XJVA 4HN1A 4N90A 2EF6A 1H2LA 4PDWA 3A23A 4I2OA 2QTWB 3S5QA 2JDZA 3OPZA 1ND2B 3O5SA 3TOJA 4UWDA 4LUMA 3ZYIB 4PJYA 3KQRA 5JOXA 4IEQA 3GJAA 3RJ2X 3TEWA 1KJRA 3CDZB 2W2IA 3KT1A 3OBZA 4M3CE 1QY4A 1SACA 4NHKA 2HWE2 2TUNA 2ZX0A 2RG4A 4MZUA 2R1BA 5A3TA 4NN0A 3C7GA 3T3YA 1T6BX 3ASIA 4ZS2A 3WCRA 4DB5A 5FZFA 1R1ZA 3RJRA 2BJSA 4UW4A 2PLV2 4TXWA 5FPBA 1ZBA2 3H42B 4P9WA 4GJZA 4QQHA 5EIYB 1W2AX 4QPWA 1QXPA 1XB9A 2WNUC 1RUOA 2JD9A 2R49A 3BIWE 4IGPA 3LFMA 5ABJC 4FOVA 5CFDB 1H4HA 1JHJA 1T6GC 2JXAA 4OZOA 1GU3A 2XONA 4DUVA 1GZ9A 1RVF2 2N7GA 2XJTA 3A21A 4WM8A 4CCMA 5DDJ3 1PO22 2PAMA 3AM2A 2WRAA 1DYKA 5C4WC 5AC91 4NHMA 2ET1A 4DPNA 1EAH3 5A6YA 1QXJA 4XJUA 1OLQA 5DUVA 4LO4B 1ST8A 5H9PA 3AKSA 4DO0A 5IAVA 1RUH2 4BQ3A 4OMCA 1JU3A 1ND2C 1NG0A 4LO5B 3RS6A 2FDGA 2VBBA 3PMEA 4WZCA 2V5DA 3NO8A 1GOGA 1LODA 2XUEA 2D3PA 2WT1A 4XHBA 4IQPA 1W2NA 4XQDA 2FCUA 3NJZA 2VOXA 3ZXKA 2P4EA 4ZZ8A 5A3LA 3LIGA 5FKCA 1AR83 2XVLA 2E63A 2OIIA 4FVVA 3C8XA 2RM23 4HSLA 5FWEA 2JG9A 1AHSA 3SEEA 1XE0A 1JH5A 4AQ6A 4QQLA 3WUCA 1NCRA 3ENRA 1S0JA 5L9RA 2XJQA 2RJKA 3J9SA 2XH6A 3DYPA 1GZCA 2IVIB 4K1ZA 3AMQA 2BUKA 1VE0A 2ZZJA 3POGA 1U5ZA 3FJSA 2XWJB 1I1EA 3MPBA 5L36A 3LWCA 2VMGA 2JDPA 4QQ2A 5CNAA 1VBD1 5IK4A 1Z0HA 1DG6A 3M3CA 3N7KA 4TN7A 5F2WA 4COYA 4BWOA 3VN4A 5DUXA 3O1SA 3JB8A 1RB8G 4Q0SA 4NROA 3R05A 4L0PA 1IKQA 4NO4A 3WVJA 2VVEA 3SISA 4E27A 3DGTA 1CAXA 1XE8A 3JBG2 1OHFA 4TWTA 5IYYA 1RIRA 1GWMA 2J1TA 1BZWA 1RL3A 5BPXA 4MGSA 2B5HA 2UYBA 1W6PA 5FZOB 1MEC2 2QKDA 3LPGA 3PURA 4LO6B 3H9AA 4NE9A 3K51A 2RVAA 3SCHA 1VBA3 2FDFA 3AMPA 1BMV2 1DP0A 3FN9A 4R9BA 1H2NA 3C7OA 1VMFA 2F4LA 2HWF2 3AL6A 4NRPA 4CUGA 2Y33A 3HWJA 1AL22 3F2ZA 4U36A 4LITA 3WP4A 1JZ3A 3S57A 3ACHA 4CDUA 2PA7A 4XACA 3UGGA 4NIIA 2AC1A 2ID4A 2JDMA 2PYTA 3SITA 4AEDB 1H9PA 2AR6A 2GC1A 1O6UA 1RUF3 2MHFA 2VMDA 1GWLA 5IVVA 1TMF2 5FZ3A 3V64A 4GWMA 1A78A 3VHOA 1MZ6A 1HJFA 3VBOB 4E2GA 1D4M1 1A8DA 4B7EA 4CCJA 1OD5A 2X5IC 3KHBA 4GMP0 2Q8EA 1APNA 5KC5A 3SHRA 3NW4A 3UKVA 2B42B 1JZ6A 4AXOA 5EXOA 3B7MA 5DXDA 4CVUA 2RMU3 2ET7A 1FAYA 3AL5A 2ILMA 3B9IA 3WQBA 5FPXA 3P6BA 4QPYA 3MDPA 5L9BA 2V4VA 1RUC1 2GH8A 1U5YA 1IS5A 1RHI1 5T52A 2J1RA 5ISLA 2Y6KA 2D3RA 3FWEA 1WCKA 3HR9A 3I2IA 2ZGUA 4UXAA 4YZ5A 1XNCA 1RUE3 1D0HA 1JOJA 1W0PA 3M3EA 1NA1A 3POEA 2C26A 4YSFA 4WM7B 4XMIA 1US3A 1W2UA 1XNDA 5F6KA 1RUNA 3NNLA 2ZXQA 3DPRB 4YM0A 1CIWA 4H14A 4E4SA 1SBDA 4J1XA 3NJVA 4EN0A 1BBT2 4L11A 2E32A 2HJIA 3ATGA 1HB4A 3AYAA 1VBE1 5FXWA 1W6QA 4FO9A 4NUBA 4N9IA 2XBO3 3X29B 3JUUA 1V9U2 2D6NA 3I3MA 3AFGA 3H7JA 5F5AA 4Q1PA 5FDBA 5FUPA 1AZDA 2CY6A 2OW4A 4UFMA 3WP5A 2HWD1 1I9RA 3IPVA 4Q8KA 2WC2A 2Y34A 3AP7A 3BN6A 2JDNA 1H0BA 5F2SA 3QLQA 3RZKA 1LGNA 3QOPA 1DYOA 5LWBA 1RUI1 2VO5A 3MICA 3U11A 4BK4A 1NXMA 3R0RA 1Q8OA 4WVZA 1YQ8A 3AJZA 4FOWA 4DRRA 3RFRA 1V6MA 1VBD2 4RHV3 4V1PA 2VTXA 4PHZA 1BLZA 3IDCB 2R043 1S2KA 4AFBA 4K6BA 3KM5A 4LBQD 2WNOA 3I2JA 4QDRA 3B02A 3H50A 1LOEA 3DCQA 4HKLA 2W92A 4D7TA 3HT2A 3UKTA 4B4QA 3MUZ1 1J84A 5T55A 4AEMA 5AFEA 1K3IA 4Y20B 3TN92 3V0AA 2R062 1YHFA 1LU1A 5DZGA 1ZRFA 4FPOB 1EY2A 3QACA 4P5YA 3I2FA 2EICA 3WF1A 3VZMA 4FFFA 1V6NA 2D93A 3ZXGA 1DLCA 1Q56A 2ZGOA 4OHVA 1AR92 5I8TA 2D97A 3CZJA 3O1RA 2JEMA 1OVPA 3AZWA 2R6QA 4YW3A 4IEXA 1LHUA 4P08A 4R4ZA 1UU4A 4UFHA 1ULGA 5IVFA 4XAAA 2MNGA 2XWBB 1V6LA 4Y33A 4UFJA 3IDBB 1GV9A 5F9TA 2RS13 1CPNA 4KWKA 3LKJA 2ZGKA 3WNOA 2D3SA 2HWE3 1QWRA 2Z5WA 3CEWA 3I7DA 4HN0A 3GJBA 5ANQA 4IDZA 1LECA 1OF3A 4H7LA 2GALA 1KFXL 3B01A 3WT3A 2YZ4A 4QX5A 5FMDA 5FTTC 4BCUA 1QOTA 4PLMA 5GLWA 2PLV3 5JSOA 1ZBA3 3NMBA 1X8MA 2BTVC 1ASJ2 2VNGA 1XJAA 2ZEZA 3IIIA 2ENRA 2K0GA 4QXKA 4R9DA 4XQWA 4DOUA 2CWMA 5IVEA 4BZ4A 5A3UA 4XAEA 3VUOA 5CG9A 4O65A 3RYPA 2DCJA 4LO7A 1GQHA 4XYXA 3KT7A 1E5RA 2ZS6B 3VBRC 1GZTA 1NAEA 3C3VA 4GB31 5FZ1A 1GBGA 1QF3A 1CJDA 4D3WA 2ZHLA 1AL0G 3KF3A 2JB4A 3MIFA 1A3KA 1BCXA 1RVF3 3OGRA 3BKZA 1COV3 4Q2FA 1PO23 4B1MA 4AFDA 3RYKA 2FQPA 3A4UA 3DL3A 4YW5A 2HYKA 2R1DA 5GLTA 3GGLA 4HK8A 3G7DA 5IFPA 1YNAA 1MVQA 1Q8SA 4ISQA 1QJY2 3LOIA 4BK5A 3OPTA 5AVPA 1RUH3 3N7MA 2QDRA 4HSJA 2ZEXA 2V5YA 5DUWA 4EWAA 4CP0A 3K77A 4MXVA 4KBBA 5J98B 1QJZA 4QPGC 1UO9A 1AUYA 1QH6A 4QKDA 1CAVA 3GHMA 3PIGA 4Q1RA 2E31A 1WLTA 4FFIA 4MH0E 1UX7A 4YW1A 1J3QA 2V09A 2NP0A 2V4AA 2ZKLA 2QE3A 4RR3C 4Y1XA 3PVNA 3OCPA 5FZCA 1HN0A 3WCSA 2OVUA 5EWSA 4IXLA 4RN5A 5FUIA 5C3OA 2W1QA 1O3TA 4H7MA 4MHRA 1NLRA 1C57A 2QDNA 4R4XA 1GOFA 3MIDA 4XF9A 1TZOA 1UCXA 1RJ7A 5BNNB 3APBA 4GH4B 1RUI2 4Y5TA 1GNYA 4EN9B 1QDCA 3WW2A 4I0AA 5DDJ1 1EPZA 3N3HA 5FXXA 4QXHA 3K2OA 1SLLA 4Y4RA 1REFA 4Q0UA 1EAH1 2UYAA 1WCQA 4HANA 1K42A 2EA7A 4DXTA 3E1F1 2NLRA 3ZYPA 4URAA 5H9SA 3JBG3 5GZEA 4JHZA 1ZA4A 1O5LA 4UAPA 5JZGB 1H8TC 1GNZA 5FFOC 1ULFA 3LD8A 3WG3A 2VOVA 4QB1A 1MEC3 4XMAA 3VBUB 1X82A 1LOAA 3ROUA 1W06A 3OTFA 4IERA 4XFGA 1VAVA 1R083 4Z07A 1IHMA 2AACA 2HWF3 4JC1A 3RNSA 3B69A 1AL23 1H6XA 2JDYA 2WUHA 3POWA 5A7WB 2VCBA 3BUCA 3RYRA 3VBSB 3A0NA 1PMJX 3AP4A 1S0BA 2ARAA 2VJXA 3PUSA 4S2DA 1TMF3 5FZ7A 5A80A 4BH9A 3E5UA 2XJUA 2WO7A 2BU9A 3KCCA 4E9KA 1MQTB 4NIDA 4HLTA 4B4PA 3I59B 5EHDA 3DUIA 1OLMA 1HQNA 3TEYA 2KD7A 3LE0A 1C8M2 2XMLA 3HBKA 5CVRA 3WSOA 4E4ZA 3PLQA 2WO3A 1MS8A 2VM9A 1U0AA 4IEZA 2GU9A 3D0SA 3ZVXA 2VZOA 1TG7A 4KWUA 5C6CA 3M7AA 4NIAA 5DQ0A 5J7MA 2Y6GA 2FD8A 4CEYB 4SBVA 3U78A 3LSDA 3GNEA 2VXRA 2ZGNA 3GALA 3K3NA 1CD3G 1W9TA 4P5HA 2GC0A 4PDWC 3HOBA 2YV8A 4ZZ5A 4BOWA 3FLPA 1AX2A 1VBA1 3CBNA 2OUHA 3USUB 1PX3A 4I3GA 4MHUA 4OI0A 4P9GA 1HIXA 4F3JA 1UXZA 1S0FA 3HNMA 3OB8A 3VGIA 4DZGA 5CAZA 4IEUA 4LT5A 2D43A 2DUQA 5I8SA 2Y6JA 3MIGA 5E89A 1RUF1 1BBT3 1J1TA 3OBRA 3LAGA 4OLLA 1BEV2 2JE8A 3VB9A 5JXHA 1DQ4A 3GBFA 4AOCA 2JG8B 4XFBA 4MGKE 5C9AB 1WD3A 1V9U3 5M0TA 1RYYA 5B4NA 3WOGA 1VLNA 1YFWA 3EB7A 4Q4Y2 5FUNA 1W3VA 5FWJA 5KXEA 3AVRA 5FZOA 2VGDA 3VD5A 4AQTA 2RMU1 3FMGA 2F4PA 3HVDA 4PI0A 5FREA 1LNSA 4WM8C 1DIWA 2XG3A 2X05A 3W58A 1ZZ9A 4HETA 1GKBA 2YUEA 1MZEA 1WMEA 1OBNA 1W9WA 1QU0A 5CA6A 4W6WA 3L9JT 1XNBA 3W9AA 4EWEA 5D8AA 1C1FA 4AEDA 5LW9A 3RVHA 2IXLA 1HRV1 1RUE1 2Z2SB 3ZXEA 4CU8A 3OGJA 1Z78A 1Z7S2 3PJYA 4AF9A 4CDQB 2GNBA 5E16A 2PQQA 3I2KA 5FKBA 2JDAA 4BU2A 3TN93 4K3UA 2R063 2ZGMA 3OYWA 2E9QA 3PJQA 1H9WA 1JW6A 2CDOA 5A1LA 2GP3A 4LA2A 2B39A 2YU2A 4P9JA 5C3PA 4C8DA 5FP8A 4YLZA 4A3XA 1AR93 5C8WA 1AYM2 2NMOA 3KCYA 2XBO1 5L19A 3I2OA 1AR82 1SFNA 4OFGA 3ZKYA 4DNYA 2RS51 2HWC2 2RM22 5C7GA 5L7OA 2DCKA 5C9AC 3NNGA 5EQUA 1ZM1A 2WZR2 3BVCA 3K4AA 4MXWA 4XUTA 1B09A 3N9PA 1JI6A 4D69A 3U0ZA 3T4VA 1C5HA 1NT0A 3AYEA 1SPPA 4ORFA 5E6HA 3A7QA 4A6OA 1Y9GA 5FO8B 5HXMA 4WVVA 1QMJA 2EXIA 4D94A 3GM8A 2WR9A 2Q8OA 4JVAA 4WM7A 5J09A 1RINA 4MGTA 3S0MA 3D6EA 3I8TA 1NKGA 4ASKA 3DPRA 4RHV1 3FHQA 5JOYA 4Y4YA 2VNRA 2MPFA 2R041 2ERFA 1ASJ3 2RR13 5F3EA 1ODNA 5A7SA 3VBFB 2WN3A 1VR3A 4CP9B 5FPUA 2BBVA 2XDVA 5FPZA 3NWKA 3VD4A 3M70A 1CPMA 1W8TA 3BTAA 4Q27A 2HWB3 2VZRA 4C0BA 3OUJA 4E4HA 4GULA 5K8SA 3S30A 2HEYF 1L7LA 1NYWA 2VTFA 1GP6A 3VDDA 1HB2A 1O3SA 2VZPA 5C8CB 4XF3A 1SBEA 3ZFGC 1YLLA 2OXBA 2VMCA 4R52A 1W8FA 3ME2A 3V0BA 3AZZA 2C6SA 4CEWB 3CQOA 3PU8A 2D5FA 3KGLA 5FZDA 3DYMA 5K0UA 4JDNA 4K40A 4D0QA 1KGYA 4D6SA 3QH7A 1JXNA 1QJY3 4LBNA 2C4XA 4LE4A 5GZFA 3FUQA 2NN8A 1EV12 2P6HA 1UW8A 1X9PA 1PGL2 2HWE1 4N9HA 1LULA 5C33A 3OG2A 3NKTA 4RQPA 2VU9A 4OHXA 2DTYA 4LQRA 1ZBE2 3KLSA 5FYHA 4BQ4A 4Q4V2 5KHHA 4CPBD 2PLV1 2WSUA 4Y20A 1ZBA1 1GZWA 4DXSA 3FBMA 3NNJA 4AI2A 2IVJA 1LEMA 3O0WA 3VBFC 5KHKA 1DGWX 2ZCWA 4AGRA 3H1MA 1PVC2 4JHTA 2YG0A 3KVAA 2A70A 3USSA 1ZYBA 5LEKA 4KI5M 1V6KA 4MSVA 4MLOA 1K12A 1AJOA 2BRTA 2DUPA 2LALA 3RRDA 4NVPA 2VXJA 1RVF1 1BVVA 1COV1 1PO21 4JQTA 4AAXA 3AMHA 1X36A 1WA6X 1G9CA 4FAGA 1ZREA 1UMIA 2EXKA 4CDXB 2JDHA 1AXYA 3TEXA 4Z1VA 5F37A 2WT0A 3HPNA 2WAAA 2B9UA 3AYCA 2P2KA 1RUH1 4IEWA 3TRSB 3ZPOA 4AI8A 4EWDA 1TME2 4RL7A 4A41A 5K9YA 4ES8A 4A3ZA 1BXHA 1SBFA 4AI9A 1Q8VA 2IXJA 3THDA 5D2AA 4DMIA 4ZU7A 5JLVA 1LJ7A 2OS2A 2KXLA 5FMCA 1WCDJ 4XDQA 5LRSA 4P02B 2A6VA 3I2HA 1BYHA 1ENXA 1SHWB 3ZXJA 5F3GA 1KRIA 4OYUA 3U4XA 2RDSA 3AP9A 3IT8A 3CJXA 3HMYA 4XJ8A 4OQ9A 2AH2A 3ZOIA 3ZPYA 1C5IA 4I0BA 3ZR5A 4HVOA 1HB1A 3K75B 4C1WA 1PGSA 1E5IA 4UYBA 4A45A 4AVAA 1W9SA 2PHLA 4QU1A 4LUKA 2IXHA 5FQ0B 2WFF2 2IFRA 4CE8A 1RJ8A 4LBQB 3QBQA 4XFAA 4KGGA 4NPLA 4BXSV 2FMDA 3WHUA 4XFIA 4W8JA 1ODMA 1UYPA 5JI9A 5GZCA 4FPGA 1C8M3 5LK7B 4XCAA 2ATFA 2W3JA 2WNUB 1AR62 4AR2A 3BCWA 2AZ5A 3WF4A 3ZYHA 2Y6HA 4OUSA 3UK9A 2NYYA 4M00A 1W04A 4CDXC 1GP5A 3JBG1 3BOPA 1ACCA 1VBB2 1XNKA 2B46X 3FZ3A 4JDOA 5F5CA 1JZ2A 4WBBA 1DDLA 1DF0A 1OT5A 4YGCA 5EP9A 5C4WB 1MEC1 4G3YC 3MLKA 4IEPA 1GUIA 4UBGA 5A7NA 1J83A 2A6WA 4QHZA 4CSWA 5DG2A 2Y0IA 5JXGA 5L73A 5A7OA 1JZ5A 2UWBA 3O1TA 4GQ7A 5BNNA 1BMV1 2HWF1 4GH4A 3BYWA 4KBZA 3C7FA 1SDDB 1AL21 1ND3B 4UFKA 2Z4FA 5FO9B 1Q8PA 2ES3A 4Q4X2 4AI3A 1A8MA 1ULOA 4L97A 2RS12 3NAPB 1QEXA 4JV4A 1W6NB 1YUDA 1TMF1 2ORZA 3N9LA 5FMBA 3WNNA 4QX0A 4Y1YA 2YYOA 1BEV3 4YG3A 3U1XA 4IEVA 1UU6A 1V6IA 2D6OX 5CKMA 5FJHA 5C5TA 5HXVA 1IGOA 2OT7A 2R30A 3DXUA 3U14A 2VULA 4CU9A 5JZGA 3MFCA 2Y0OA 4Q4Y3 1ZA7A 3JD72 4EE2A 2BVBA 1LOGA 3O1OA 3Q9OA 3VBUA 3S5AA 3TWIA 5DG1A 4YFWA 2E6VA 1POV0 3LCPA 5JXJA 1BK0A 1O59A 2DFCA 1DGRA 4B1LA 4GXLA 2ARXA 1ENSA 2EIGA 5G04L 1JHNA 4NWWA 2EXHA 3MHZA 3IMNA 1RXFA 5A3NA 4M3CB 3UNPA 4Z2AA 1COV2 2SBAA 3VV1A 1CAUB 3VZOA 1FX5A 2CNAA 2BFUS 2DVFA 3VKNA 1J3PA 1UXXX 3WP6A 1FT9A 2E7AA 4NRMA 3VDCA 3VKMA 2GMEA 1Z7S3 2ORXA 1IZ3A 5FY5A 1YC61 1MQTA 1FYUA 4GKXA 3WZ1A 3R4SA 2IUWA 2BYVE 3LZZA 5F3CA 4I09A 4O61A 1G8WA 4NPRA 4V2WA 1WW6A 3PUQA 1ND3C 4BMBA 3D8CA 4P9IA 1BBT1 2A73B 4QMAA 3ZO0B 2IFWA 3B9CA 4P00B 1NQJA 4RS5C 2AUYA 1DZRA 3NAPC 3O1MA 4JGYB 3ZX7A 4NHLA 1YXWA 1Q43A 2FMYA 2Q5TA 4GALA 1AYM3 2ZHMA 4UW3A 1O8PA 3I3DA 1DZQA 4AFCA 5F5QA 2VVDA 1V9U1 4BA6A 4CEYA 3T1MA 4LKDA 3ETQA 2HWC3 5D1IA 1JUHA 5FP9A 1ZZ7A 2J7MA 2A3YA 4BQ2A 1OQEA 3J8F3 1GQGA 2WZR3 4NOTA 3U4SA 1CGPA 4NWVA 4WZFA 2QVSB 4IV1C 4R9CA 4XUOA 3ZMNA 4PBPA 2QCSB 4LHKA 1GLHA 2XPJA 3USUA 3BIEA 1IQDC 4S2FA 1IPKA 4I02A 1G9DA 2FDHA 3N9NA 4FOYA 5CKNA 3NSTA 1G9AA 1NLSA 3MLJA 4K20A 5IT6A 3DECA 1LOCA 1UKRA 2X5IB 1P8JA 2QFEA 2YMZA 5A32B 4AFMA 4A7KA 4N53B 5BNPC 1STMA 4META 2WBKA 4AK3A 2BNOA 4N7IA 3SH5A 3POBA 3ZFFA 2VMHA 3VBHA 4IGQA 1ULCA 2CAUA 1SG3A 2JENA 4RA0A 5IATA 2VQUA 2JG8A 3TN91 2OA2A 2R061 3I97A 3BTYA 2UU8A 1KEXA 3MBWA 3T1LA 3WD5A 4A6SA 2JJ6A 1RC6A 1CONA 4QU2A 3ZKUA 3U37A 3EXUA 2RDQA 2XJSA 4AGGA 1AR91 5BNQA 1UY4A 1ZRDA 4R8HA 1YQ2A 3ACGA 4L92A 4JGYC 5CKQA 4FP3A 5HCAA 2CGPA 4QPIC 1R082 3CZUA 1NE4A 3ON7A 1OKQA 2BNNA 2CYFA 5AFBA 4LK7A 4IL7A 1UPSA 1FMD2 3LF7A 4XUPA 4LA3A 3ZYFA 4XTMA 5JAXA 3PMSA 4BIOA 5FP3A 3WLUA 1JTZX 2P17A 4HPKB 1EV13 4L99A 3ZFEC 5FR3A 2GN3A 1DHKB 3OY8B 1UOFA 5C70A 4CDQA 4NPMA 1DCSA 5IJRA 4L2NA 3DF0A 1ZBE3 2GSYA 5FY1A 4Q4V3 4TSVA 2WT2A 1L7RA 2HEVF 3RQ0A 4LBOA 3MI8A 4UF0B 1ASJ1 2RR11 1XC6A 5FYBA 1E5SA 4W50A 2EIBA 2EXJA 1LR5A 4KWJA 4N53C 5DZEA 1LHWA 1MS4A 1PK6A 3ZSLA 4CP2A 5I91A 1GQPA 5JMOA 4NIGA 4B3NA 1LGCA 2HWB1 2ZKNA 4K1YA 2BGOA 1SDWA 3KVBA 3PU3A 5FY4A 5FOJB 1PVC3 4IV3C 1I5ZA 3H3UA 3GZUC 2GZWA 3THTA 5DZFA 3MW3A 1W90A 4P9YA 2D6MA 5J96B 2G4IA 1DBNA 2GMMA 2ZABA 5JR2A 5LY1A 3JQXA 1OA4A 3THPA 3ZSEA 5IHRA 3I49A 1IS3A 3AKTA 4CU7A 1WUVA 1VRH2 3K3OA 4JGZC 3THCA 2DYCA 4NJ4A 1QJY1 1OSGA 5JSRA 3D82A 1OXCA 1TME3 3AP5A 1F8VA 5IK8A 4W6YA 5ACA2 2OZJA 1UY0A 4XFHA 4QGNA 4CP9A 2QJVA 1CESA 3WX5A 4EN6B 4F8AA 2GDFA 4EN8B 3OBAA 4COWA 4FPEA 1OURA 2WL1A 3AMMA 2IXKA 4KH9A 2EALA 4XW3A 5H9RA 2WS92 3Q8AA 3T0DA 1UIJA 3HIFA 3POJA 1W8UA 4HBNA 4UBHA 1S0GA 1OOPB 4DRVA 5C3RA 4CEWA 1SCRA 2EVXA 1WKYA 2AGSA 1YJKA 3H0OA 4MOAA 4QKBA 4EZ4A 2H6BA 2PHTA 1GICA 3LPFA 1D7PM 2WFF3 1G6NA 4WV8A 4IE7A 5FZHA 1WMXA 5KXDA 1PX4A 3AXEA 5DAQA 2CAVA 4OULA 2A5ZA 2CWSA 1VRBA 1O8SA 2WIIB 3OGVA 4HZFA 3ZN6B 1AR63 1NX9A 1PZ8A 3F95A 3FL7A 2MEV2 5SV8A 1UOJA 1H1IA 1QNYA 1VBC2 2WZ8A 2Q8CA 1AX0A 3Q8EA
chains in the Genus database with same CATH topology
1K5MA 4X6RB 1UMZA 1D2QA 5BXXA 1VBB3 2DURA 3SH3A 2BNMA 1J1LA 2B7YA 3VLBB 2ZZQA 4YVSC 3JCIA 1DLLA 1LOFA 3IKWA 2RJLA 4XIKA 2CV6A 4ZXKA 5KXCA 2YHJA 3EJKA 1FV3A 1YFUA 4QPGB 2A6ZA 4Q4X3 2NQYA 4OI1A 1MZ5A 1W6OB 2B45X 5EZWA 1V6JA 1ZNPA 1OOPC 4GMP3 3UJOA 4XBQA 4YVWC 1FV2A 4RR3B 2QNKA 4O9EA 4OUMA 2GNDA 2IC1A 1IS6A 1RUJ2 1C8M1 1HKDA 2RR12 1PGW2 1ULEA 2D7FA 3JD73 5IK7A 1PZ9A 3RMYA 2R072 2HWB2 4DINB 1REDA 2QZ2A 3RWNA 5J37A 1YFYA 1WA4A 4FQ4A 3AKPA 1HDKA 3CJIA 3L2YA 3O7OA 5B2GB 2VH9A 1G7YA 5K7PA 1LHVA 1R092 4HK9A 4XETA 5GKAC 3VHNA 2X29A 3PVEA 1ONAA 5FQ0A 2UY8A 1V70A 5LK5A 3FFQA 1B35A 1H8TB 1NCQC 4YW4A 4AEKA 2G9GA 1BKZA 2XKPA 5BV6A 5JMCA 4RQPC 5BNOC 1S55A 2WQZC 2WNUA 3CF6E 1CN1A 3CL1A 1BEV1 1QJU2 5ABJA 3TYJA 4G9SB 4YG6A 3IDEA 2GC2A 3SLIA 3E6CC 2FHRA 1H30A 4Q4Y1 4XFFA 4LLOA 3ZDSA 2CTVA 5C4WA 1MS1A 5HCFA 4EJRA 4YM2A 2R0FA 3WQ1A 3GBWA 2OYZA 2C1FA 3N7LA 1RUD3 3AKQA 1ND2A 4HKOA 4URTA 1W6NA 2O0OA 2WNVC 1LTEA 4YGDA 1Z7S1 1LHOA 3TNQA 1CAWB 2A6YA 3SH4A 1OLRA 1MZFA 2ZHNA 3TNPB 1O91A 4PDWB 1F5JA 4FPLA 4BLJA 4CDWC 1RUG2 2W68A 4MYEA 1YCIA 1AXZA 3AYDA 1AYM1 1UZZA 4IEOA 3SCGA 1AR81 3VHPA 1UAIA 1QJX2 4Y24A 2HWC1 2RM21 5CFDA 2HEWF 2Z69A 3J8F1 3ZN4A 1N47A 2WZR1 4JRAA 4XBLA 1FMD3 4AI1A 2Z42A 1BJQA 4M3CA 1GSLA 4WVWA 5JOWA 1WLDA 4QM8A 3NVCA 1WBLA 1N3QA 2FZ1A 2VQ0A 2ZGRA 3POSA 4FTEA 4N43C 3RI8A 5I0RA 4QGMA 3O0XA 5E88A 1RGSA 4LO8A 3JQWA 4ISRA 3VL8A 4HFSA 4WM8B 4UW5A 4LULA 2D5HA 1DQ6A 2Q30A 4Q4W2 1OA3A 4AVVA 3MIEA 5CFCC 4MGZE 4OI2A 4Y22B 5JWPA 4GA9A 4LLFA 3DV8A 1FPN2 2XB6C 4AVSA 4XF4A 4HL0A 3DN7A 2KA3A 4KNCA 1VRH3 1ZZCA 1TQ5A 3QD6A 3MF9A 4AVBA 5A32A 3BODA 3INAA 1EV11 4P9XA 3MIHA 1PIV2 5ACA3 1PGL1 3OD4A 1X33A 5KHIA 4XOGA 3ILFA 2VPVA 4X8PA 3WW3A 1MS3A 4CRQA 1GNHA 1U12A 1ZBE1 4BHPA 4Q4V1 1L3JA 2GH2A 3FFZA 4QT6A 2WS93 3PTYA 4QGLA 3ALQA 3UL2A 2NZ9A 2P3IA 3MFAA 2EAAA 1PVC1 1FNZA 1QQP2 1HXS3 4C0HA 4AVTA 3VZNA 3HQXA 3O14A 5A33B 1FNYA 4PIZA 4Y26A 1VAKA 1CAXB 1NQDA 2NMNA 4HPKA 2MEV3 3OY8A 2DF7A 1MVEA 1VBC3 1W6PB 3MF6A 3VBOA 1VP6A 2Y26A 1TME1 1KFUL 5CBLA 3ZFGB 1LB2A 2PAEA 4AHYA 5CU1A 1WW4A 2E7QA 4AFAA 2YXSA 3I4IA 1QH7A 1Y43B 2JG9C 4LNVA 3BB6A 2ZX3A 1LRHA 3ZXFA 1NCRC 2XUMA 4XQ4A 1D0GA 3CLPA 3J8F2 1OI6A 1N3OA 4KG0A 4PBOA 4Q29A 5FCCA 2PELA 5T50A 3GBGA 1DZTA 4GKYA 2Y38A 4Y5Z0 1H2MA 1EPWA 1VIWB 1OQ1A 3TBDA 1CQ9A 2WFF1 5F6LB 1ZZ8A 2DVAA 4YNIA 5SV5A 3HD8B 2IXCA 3GF6A 4ONUA 4XZPA 1RUJ3 4C1XA 1AR61 5BYNA 1N1VA 2R073 2BFUL 1ENQA 2WSVA 1G9BA 1VBB1 4KWLA 2KM2A 4AGVA 5HI0A 3ZYJB 3RDIA 5FOBB 2VQAA 3NV3A 1REEA 3QCWA 5KXBA 1MS5A 3VBRB 3LOBA 1F31A 2FBEA 3N36A 1R093 5JSPA 2TEPA 4FTSA 2PHXA 2H0VA 3P3NA 4LBKA 1QGLA 2UY9A 4CDUC 2VW0A 2GNTA 2TNFA 4Q4X1 4KL1A 1YIPA 2RS11 3M1HA 4M3CF 2DWRA 1O7FA 2VUJA 4GMP1 1H1AA 1QJU3 3GZAA 3VBRA 4ATEA 1DGRN 4YZ3A 1YYNA 2C5DA 1H4GA 1PK6C 2IWGB 4HT1T 4P14A 3URFA 2D40A 3RZZA 3JD71 2IXIA 4FAHA 2XLGA 1QOOA 1FOD2 4BPZA 4M01A 2D6LX 4XHXA 3BU7A 1PNFA 1PO13 1VALA 5HCBA 2JE7A 1U5XA 2ZX4A 4YG0A 5JPNB 4OHYA 3DKWA 3WDVA 1KS5A 3PVBB 1NA1C 3WDWA 1W6OA 3AZYA 1YI9A 2ZGSA 4H3WA 3PNAA 2A75A 1PHMA 4AG4A 1IKPA 1KD7A 4RR3A 4O9GA 4B8EA 1H2KA 4JQRA 5E1RA 4FSJA 5J3UA 2RS32 1TNRA 3IN9A 1RUG3 2XLFA 2NPIA 2ZX2A 4AE2A 1NOVA 1BK1A 3A0KA 3FC0A 3IBMA 3AMNA 2YDEA 5EFUA 1JN2P 1QJX3 1WMFA 2ARBA 3D4KA 2DVDA 1R1A3 4YZ2A 3ZXAC 5JDBA 1W6MB 1EP0A 2DV9A 2G9FA 3WG2A 4ZKTB 4A7ZA 5T5PA 4ES9A 3GYDA 4AI0A 3MZHA 1LESA 1DQ0A 4W6XA 4S2HA 5JCTA 1RUD1 2B8MA 2D6PA 1H8TA 2UWCA 4XJWA 1HV1A 1D2SA 1AYN2 1ZRCA 1XQNA 3LA7A 3J4UH 4JRLA 1J59A 2DCTA 2WJSA 3HT1A 4XJ9A 3E5QA 1YI7A 1S1AA 2ZAAA 4Q0QA 4Q4W3 1XU2A 4SLIA 4X6QB 3ZSMA 1HRI2 2FZ2A 3HBZA 4L9BA 1X50A 1QKQA 1UPIA 3FBYA 1FPN3 1R081 3J26N 3M8LA 4MV2A 1FMD1 4XTPA 3D0JA 4YGBA 1CJPA 4RS5B 4TYSA 5FLIA 3NV2A 1PIV3 3NL1A 5EJ3A 4GB33 4MX3A 1AJKA 3VZJA 1KXGA 5GZDA 3SXWA 4IETA 4LBJA 5FLHA 4IV1B 3RMXA 3AFKA 2XJPA 1LHNA 3AXDA 3E97A 3SNMA 3ZXDA 2C9AA 4FTBA 2ZMKA 5GLZA 5HBAA 1OQDA 3CJIC 1F2NA 3KGZA 1J58A 4LEJA 1QQP3 2PHWA 5BNPB 4K8FA 2I74A 4QQOA 2WQ4A 4WVMB 5DUUA 4A7YA 3RSJA 1NY72 3KZ4C 4K7JA 3VBSA 3QH6A 3W59A 4Q0VA 1B35C 5KHGA 1VRH1 2AYHA 1NZCA 1OFNA 4QD2A 4CYDA 3I59A 2ZJCA 2X53S 5ACA1 1V00A 2UURA 2ZOEB 1YO8A 1PNGA 4QPIB 3E6DA 3KB5A 3OF1A 4M0HA 1WW5A 2LM3A 3M4FA 2WS91 1SQ4A 5IUQA 3ZXLA 3N7JA 3ZYGA 3ECQA 3ZFEB 4Y22A 4FPKA 3H3ZA 1PVXA 2WKKA 1H8VA 1F9KA 4KU7A 2PHFA 1ZZBA 1DYPA 1HXS1 4MGYE 4PQ9A 1RUD2 2WINB 2XVKA 4JTOA 4COUA 1WGPA 1JYIA 2ZGTA 3S6PA 1WLCA 5FO7B 2PTMA 2VW2A 3OGGA 4MVTA 1PZ7A 2IZWA 2MEV1 3ZYRA 1VJ2A 1VBC1 4IV3B 3VL9A 4B29A 4C90A 1KDMA 3M3QA 4LBLA 5C9AA 3FUOA 4FPCA 3ZSJA 4EN7B 3H7YA 4RFT0 3KMHA 2ZTNA 4XE9A 5JIUA 4Z82A 1JYCA 1PM7A 1FATA 4FPJA 1KQRA 1UU5A 1SMVA 5CFDC 4JGZB 3UV9A 4AYUA 5T5LA 3WR0A 2P34A 3WUDA 1GYKA 5A33A 1RITA 1TE1B 1AR72 1S0CA 3B00A 3FLTA 5LRRA 5AVAA 3V65A 4U2AA 1DGWA 3H1YA 4YGEA 5JOXA 2RHPA 4PIYA 2WNEA 3I2DA 4YFZA 1ZVFA 4C91A 4DY3A 1ULDA 3KT4A 5H9QA 1POV3 3WNXA 4A2UA 3WG4A 1RUJ1 3ZFGA 4E4DX 4EROA 1PGW1 2UWAA 4XILA 1QXRA 3WW4A 1IQAA 3PHMA 4FOQA 4D7YA 1FOD3 2R071 4UW6A 4FQZA 4DXZA 2BEOA 2PN5A 4MGIE 3K48A 3WY6A 5D8AB 1LKNA 3WINE 3WQ0A 2XKOA 1BVP1 4AEJA 3MPPG 3AZVA 2VNOA 1R091 2CGNA 3OYWB 4XJAA 2D98A 1HV0A 3WG1A 4TZDA 2ZACA 5I0TA 3S7IA 3R4DB 2BWCA 1XYNA 4J1WA 2RS33 1H1MA 2VECA 4YVSB 3WDTA 5I0UA 3VBFA 5L7OB 4F7ZA 4COZA 1QJU1 2D44A 1U5IA 4MXWB 2AREA 4YW2A 2A71A 4RSUA 4F83A 2C0ZA 5AC92 2WA4A 1HRV3 2VVFA 4X8NA 5C8CA 3VKFC 3S7EA 3WQ7A 5JR7B 3I54A 2D6KA 2VMIA 1UF2C 3MEPA 4FPHA 4YVWB 5T5OA 1PO11 1DFQA 1D4VB 1HXS2 3WV6A 4HMZA 1DGLA 2QZ3A 2WWSA 3BALA 5D8AC 4AEDC 3ZSKA 4YRDA 1RMU3 3FHIB 1AYN3 3M3IA 3VBOC 3VDDB 2H0BA 2RS53 4PIXA 2NM1A 4AHXA 3ST7A 1SLAA 1MR5A 3V0BB 1YRZA 1LGBA 1N1YA 5KWRA 1LENA 1WMDA 2DU0A 5K0UB 5BY5A 3LA3A 1RUG1 1OMIA 3LSEA 3R6SA 3PVOA 1HRI3 1WLWA 5L7OC 2ZMLA 2ZA9A 4RGGA 4BIFA 1QJX1 5I0SA 4FXKB 1NCQB 1R1A1 1S0DA 3C2UA 3WDXA 5F1RA 3EQEA 4RQPB 5BNOB 4FPFA 4KU8A 1O4YA 1I3HA 4WM7C 2YPJA 3DPRC 1GZWB 4CDXA 1JBCA 3WHTA 3U10A 3IIAA 2ZHKA 2SLIA 3LGRA 4K21A 4B4RA 2O8OA 3R4UA 3UKNA 2BQPA 3WXPA 4LBMA 5CB7A 4ASMB 5J36A 1QNWA 3AP6A 4OVEA 4XXAA 2Q0AA 3VDDC 4XIOA 2XL7A 1HLCA 1N1TA 2ZBJA 4Q4W1 1W6MA 2WNVB 4ZU5A 5K0UC 2ZX1A 1D4M2 2PAKA 1O4ZA 1W39A 1FPN1 3KS7A 3KCXA 1KDKA 2Q1MA 2W52A 3EHKA 4BMEA 1WCSA 2YC0A 2VUAA 3IWZA 3BOWA 4LBQA 2A3WA 3RI9A 4CDWB 1OA2A 1SLBA 3ES4A 1PIV1 1SLCA 2WLPA 1LU2A 2QQPA 4GIQA 3JB4C 1C3HA 1S0IA 1QOSA 1RUC2 2A7AA 1RHI2 2JKBA 2RE9A 1PMIA 2X8KA 3FLRA 1JUIA 4RD7A 4AQ2A 5GALA 5EV7A 4P9LA 1FXZA 1XRUA 5TSWA 4I0WB 1PO12 3V56A 4JCKA 4N43B 1QQP1 1I6XA 1KJLA 2JICA 2GNMA 1ND3A 4AVCA 2ZGLA 1VBE2 2E51A 4RS5A 3NAPA 5A3MA 2V73A 5I8YA 4Y1ZA 5JIAA 1YFXA 2ZGQA 3H8UA 3NKGA 2HWD2 4MUVA 1G86A 4OHWA 1IPJA 2I2SA 5CFCB 4EV0A 1AX1A 5GJ6A 4CP1A 1YIFA 1LOBA 4IV1A 4LE3A 3U07A 3EO6A 1IS4A 1WD4A 1M06G 1AF9A 5JVVA 1OFSA 2Q1ZB 3CNAA 1HQLA 3ELNA 4PLNA 1R1A2 2A3XA 3RPQA 3AKRA 5BNPA 1SLTA 1AXKA 3JZVA 1XE7A 5FAXA 3JU9A 4WVMA 1CAUA 3P3PA 2DUOA 1AR73 1O3QA 1WBFA 2ZAHA 1SCSA 4OZXA 4LHNA 1OPMA 1S2BA 3WP3A 2HKXA 5JOZA 4RGAA 2AENA 3ILRA 1LCLA 3MW4A 4KG8A 3O12A 1TEIA 4JGYA 4QPIA 3ZIWA 4AHZA 4XFCA 2WFPA 3FE5A 4BE3A 3AZXA 3IM0A 4L8QA 4R9AA 2DCZA 3ZMOA 3E5XA 4ASLA 1XYOA 1RTVA 3VZKA 4FBFA 2JECA 3ZFEA 5BNNC 2LUWA 4GH4C 4XJZA 5CADA 3TAYA 2TBVA 3OJBA 2GN7A 2X5IA 4HKWA 4N53A 5CG8A 4PCRA 1MS9A 4DS0A 2XHKA 1UL9A 2JG9B 2DVBA 4HVRA 4GB32 3VHRA 1NCRB 4IV3A 2GC3A 5JZGC 1O3RA 5FMOL 2ZPXA 1POV1 4KGQA 2VW1A 3SMHA 2BPA2 1V6OA 5AC93 2E7TA 3VBUC 2DFBA 4I3PA 4QM9A 1Q8QA 1FOD1 4CTEA 1XYPA 1Y3TA 2GAUA 4FXGB 4QQPA 1Y9QA 4FCAA 1VB4A 4JGZA 2QUOA 3VKOA 1DU3D 3ZFFB 1MACA 3L2HA 4YZ4A 3VBHB 3VBSC 4Q0PA 4PLOA 3GZTB 5CIRA 5T3NA 1O5UA 4E2QA 4Q26A 1MQTC 2JD4A 4TLFA 4YZ1A 1UZYA 4S2GA 1NXD1 1NE6A 4IEYA 1F5FA 3KSCA 4I30A 4OHZA 1Q5OA 1X8EA 1LEDA 2OPKA 5GLUA 2XLAA 3TB0A 4DQAA 1C28A 1C4RA 4K9SA 1GANA 2RS31 4XPVA 5FRAA 1XU1A 1DQ1A 4CZSA 4CEYC 1C8NA 1N1SA 4CDUB 4COVA 1VBD3 3AB0A 5DDJ2 4ATFA 2W0XA 3E6BA 1EAH2 1VAMA 1BQPA 3M3OA 4N7UA 3B93A 4OI4A 2WZPP 4W65A 4NR1A 2BW8A 2P3KA 2XL9A 1W0OA 5EYXA 1PK6B 2WLQA 2YY1A 4LTAA 1URXA 3CU7A 3UJQA 3ZFFC 3KD4A 1SLIA 3D5OA 1RMU1 3VBHC 1AYN1 1Y7BA 2BGCA 4ITCA 4H55A 2R16A 4YVSA 2JG8C 5GZGA 2A6XA 2XGXA 1MS0A 1O4TA 4I01A 5GLVA 5JI7A 1CVNA 4M0NA 5IK5A 3CO2A 4AHWA 3MYXA 5GM0A 5KBFA 4BQ1A 1NA1B 2ETEA 4Z2WA 1DQ5A 3M2MA 1HRI1 3NV1A 4Z92B 2PHRA 3WDYA 2I45A 2VOKA 1D4M3 1OOPA 4LR4A 4E2SA 5KC6A 4YVWA 1OPOA 2YGMA 4FP2A 4XF1A 3LA2A 2H6CA 4HVQA 2CGOA 1QHDA 4FT8A 2PHDA 5E8AA 4Y1UA 1W6QB 2GMPA 2BVVA 2I07B 2P37A 4J6GA 4CDQC 3AJYA 3OD0A 3GHNA 2R0HA 1HX6A 3NV4A 3ZN6A 3VZLA 5BUVA 3ZIXA 1ZRRA 1J3RA 3IPVB 4AW7A 3EBRA 4JTNA 3B94A 4G4FA 2K9ZA 1RUC3 1C1LA 1RHI3 1A6CA 2PFWA 4LHLA 1XXNA 3OBTA 4DY5A 4JDMA 1VBA2 4YYOA 3VKLA 4YM3A 4D7SA 3ZN5A 4BYYA 1M4WA 4GWNA 1ZZ6A 2XJRA 1ZX5A 5EYYA 2E53A 1E57A 4KQ7A 5I93A 4IESA 3G6JB 1NCQA 1RUF2 4XBNA 1G9FA 4XF0A 1FI2A 2P3JA 1VBE3 4Q8LA 4QHBA 1SEFA 4QPGA 2YGLA 5BNOA 1HQWA 3SCFA 1NY71 1K5MB 3V0AB 3MLLA 4PF5A 4XXPA 2Q4SA 2HWD3 2DTWA 1IOAA 3ILNA 4YARA 1UKGA 2RMU2 1RUI3 1WW7A 3HN1A 4BM8A 1EYBA 3ES1A 5C8CC 5KHJA 2O8QA 2W39A 4AQSA 1UN1A 2W08A 3AX4A 1HRV2 1N3PA 1RUE2 4JAAA 4CEWC 1YWKA 2DU1A 1UD1A 1GR3A 2JX9A 2WNVA 3N35A 2OUJA 4Y1VA 5T5JA 1Q3EA 1TNFA 1KITA 2F6BA 5FMOS 5T54A 1S0EA 1GFF2 5FBZA 1UX6A 3B3QE 3H1WA 2VOWA 2Z79A 1DQ2A 4YM1A 4CDWA 1RMU2 3MGUA 2XBO2 4AWDA 2ZGPA 1CR7A 5JPMB 1AVBA 2EAKA 2WA3A 4FPYA 1X7NA 2RS52 4INDA 3T2TA 3CJIB 1K5MC 3RG0A 4DFSA 1UIKA 2YROA 2DVGA 5FLJA 4BLIA 1YJLA 2K2SA 3LB9A 3MW2A 2R32A 1QDOA 4B7KA 1ALYA 3FX3A 2XVGA 1LOFC 5J48A 5LEJA 1HW5A 4Z8BA 1B35B 3ACLA 3B5LB 2VG9A 4RHV2 3MIBA 4N43A 2R042 3POYA 1CAVB 1VB2A 2JE9A 2ZMNA 4XEZA 3N4MA 5ABJB 2PHUA 3HAGA 2OZ6A 1KS4A 1AR71 2CL2A 4ZU4A 3WW1A 3WDUA 2O1QA 1CAWA 1CX4A 1ENRA 2BWAA 3AK0A 1SFYA 3O0VA 2VY0A 2LTNA 2DCYA 5CFCA 3BPZA 2XJVA 4HN1A 4N90A 2EF6A 1H2LA 4PDWA 4I2OA 2JDZA 3OPZA 1ND2B 3O5SA 3TOJA 4LUMA 3ZYIB 4PJYA 3KQRA 4IEQA 3RJ2X 1KJRA 3KT1A 4M3CE 1QY4A 1SACA 4NHKA 2HWE2 2TUNA 2ZX0A 4MZUA 2R1BA 4NN0A 3ASIA 3WCRA 4DB5A 1R1ZA 3RJRA 4UW4A 2PLV2 1ZBA2 4QQHA 4P9WA 1QXPA 2WNUC 1RUOA 2R49A 3BIWE 5ABJC 4FOVA 5CFDB 1H4HA 2JXAA 1T6GC 1GZ9A 1RVF2 2N7GA 2XJTA 4WM8A 5DDJ3 1PO22 2PAMA 3AM2A 1DYKA 5C4WC 5AC91 4NHMA 2ET1A 4DPNA 1EAH3 1QXJA 4XJUA 1OLQA 5DUVA 4LO4B 5H9PA 3AKSA 1RUH2 1ND2C 1NG0A 4LO5B 3RS6A 3PMEA 4WZCA 3NO8A 4XHBA 1LODA 2D3PA 2WT1A 4IQPA 4XQDA 3NJZA 2VOXA 3ZXKA 5A3LA 1AR83 2XVLA 2E63A 2OIIA 4FVVA 4HSLA 2RM23 2JG9A 1AHSA 1JH5A 4AQ6A 4QQLA 3WUCA 1NCRA 3ENRA 1S0JA 2XJQA 2RJKA 3J9SA 2XH6A 1GZCA 4K1ZA 3AMQA 2BUKA 2ZZJA 1U5ZA 3FJSA 2XWJB 1I1EA 3MPBA 5L36A 3LWCA 2VMGA 4QQ2A 5CNAA 1VBD1 5IK4A 1Z0HA 1DG6A 3M3CA 3N7KA 4COYA 4BWOA 3VN4A 5DUXA 3JB8A 1RB8G 4Q0SA 3R05A 4NO4A 1IKQA 3WVJA 2VVEA 3SISA 4E27A 3DGTA 1CAXA 1XE8A 3JBG2 1OHFA 4TWTA 1RIRA 1BZWA 1RL3A 5BPXA 2B5HA 2UYBA 1W6PA 1MEC2 2QKDA 4LO6B 3H9AA 3K51A 3SCHA 1VBA3 3AMPA 1BMV2 4R9BA 1H2NA 2HWF2 3WP4A 3HWJA 1AL22 4U36A 4CDUA 2PA7A 4AEDB 3SITA 2PYTA 1H9PA 2AR6A 2GC1A 2MHFA 1RUF3 1TMF2 3V64A 4GWMA 1A78A 3VHOA 1MZ6A 3VBOB 4E2GA 1D4M1 1A8DA 4B7EA 1OD5A 2X5IC 4GMP0 1APNA 5KC5A 3SHRA 3NW4A 3UKVA 2B42B 4AXOA 5EXOA 3B7MA 5DXDA 2RMU3 2ET7A 1FAYA 5FPXA 2ILMA 3B9IA 4QPYA 3MDPA 1RUC1 2GH8A 1U5YA 1IS5A 1RHI1 5T52A 2D3RA 3FWEA 1WCKA 3HR9A 2ZGUA 4UXAA 4YZ5A 1XNCA 1RUE3 1D0HA 1JOJA 1W0PA 3M3EA 1NA1A 4YSFA 4WM7B 4XMIA 1W2UA 1XNDA 5F6KA 1RUNA 3DPRB 4YM0A 1CIWA 4H14A 4E4SA 1SBDA 4J1XA 4EN0A 1BBT2 4L11A 2HJIA 3ATGA 3AYAA 1VBE1 1W6QA 4FO9A 4N9IA 2XBO3 3X29B 3JUUA 1V9U2 2D6NA 3AFGA 3H7JA 4Q1PA 5FDBA 1AZDA 2CY6A 2OW4A 3WP5A 2HWD1 1I9RA 3IPVA 4Q8KA 2WC2A 3AP7A 1H0BA 3QLQA 1LGNA 3QOPA 1RUI1 3MICA 3U11A 1NXMA 3R0RA 1Q8OA 4WVZA 3AJZA 4FOWA 4DRRA 1V6MA 1VBD2 4RHV3 4V1PA 3IDCB 2R043 1S2KA 4AFBA 4K6BA 3KM5A 4LBQD 3B02A 3H50A 1LOEA 4HKLA 4D7TA 3HT2A 3UKTA 4B4QA 5T55A 5AFEA 4AEMA 3V0AA 4Y20B 3TN92 2R062 1YHFA 1LU1A 5DZGA 1ZRFA 4FPOB 1EY2A 3QACA 3VZMA 1V6NA 2D93A 3ZXGA 1Q56A 2ZGOA 4OHVA 1AR92 5I8TA 2D97A 2JEMA 3AZWA 2R6QA 4YW3A 4IEXA 1LHUA 4R4ZA 1UU4A 1ULGA 2MNGA 2XWBB 1V6LA 5F9TA 3IDBB 1GV9A 2RS13 1CPNA 4KWKA 3LKJA 2ZGKA 2D3SA 2HWE3 1QWRA 2Z5WA 3CEWA 3I7DA 4HN0A 1LECA 4H7LA 2GALA 1KFXL 3B01A 3WT3A 2YZ4A 4QX5A 5FTTC 4BCUA 1QOTA 4PLMA 5GLWA 2PLV3 5JSOA 1ZBA3 1X8MA 2BTVC 1ASJ2 2VNGA 4QXKA 4XQWA 2ENRA 2K0GA 4R9DA 4DOUA 2CWMA 4BZ4A 3VUOA 5CG9A 3RYPA 2DCJA 4LO7A 1GQHA 4XYXA 3KT7A 2ZS6B 3VBRC 3C3VA 4GB31 1GBGA 1QF3A 1CJDA 4D3WA 2ZHLA 1AL0G 3MIFA 1A3KA 1BCXA 1RVF3 1COV3 4Q2FA 1PO23 4AFDA 3RYKA 2FQPA 3A4UA 3DL3A 4YW5A 2HYKA 2R1DA 5GLTA 4HK8A 3G7DA 1YNAA 1MVQA 1Q8SA 4ISQA 1QJY2 3LOIA 5AVPA 1RUH3 3N7MA 2QDRA 4HSJA 5DUWA 2V5YA 4EWAA 4CP0A 4MXVA 4KBBA 5J98B 1QJZA 4QPGC 1AUYA 1QH6A 1CAVA 3GHMA 4Q1RA 1WLTA 4MH0E 4YW1A 1J3QA 2V09A 2NP0A 2ZKLA 2QE3A 4RR3C 4Y1XA 3PVNA 3OCPA 3WCSA 2OVUA 5EWSA 4IXLA 1O3TA 4H7MA 1NLRA 1C57A 2QDNA 4R4XA 3MIDA 4XF9A 1UCXA 1RJ7A 5BNNB 3APBA 4GH4B 1RUI2 4EN9B 1QDCA 3WW2A 4I0AA 5DDJ1 1EPZA 3N3HA 1SLLA 1REFA 4Q0UA 1EAH1 2UYAA 4HANA 2EA7A 2NLRA 3ZYPA 5H9SA 3JBG3 5GZEA 1ZA4A 1O5LA 5JZGB 1H8TC 1GNZA 5FFOC 1ULFA 3WG3A 2VOVA 4XMAA 1MEC3 3VBUB 1X82A 1LOAA 3ROUA 3OTFA 4IERA 4XFGA 1VAVA 1R083 4Z07A 1IHMA 2HWF3 4JC1A 3RNSA 3B69A 1AL23 3POW