2HEYF

Crystal structure of murine ox40l bound to human ox40
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
135
structure length
135
Chain Sequence
DPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Tumor necrosis factor ligand superfamily member 4
publication title The Crystal Structure of the Costimulatory OX40-OX40L Complex.
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 135
sequence length 135
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2heyF00
1C28A 3K51A 4MXWA 1PK6C 4KGGA 2R30A 4RSUA 2RE9A 4MSVA 2TNFA 3TYJA 2R32A 4TSVA 2WNVC 1A8MA 4OULA 2WNVA 5HBAA 2JG9B 4MXVA 2WNUA 2OIIA 3WD5A 1KXGA 1IQAA 1DG6A 5BNQA 3LKJA 4NN0A 1U5ZA 4HT1T 4QQ2A 5KWRA 1WCKA 3IT8A 3B93A 1U5XA 2QDNA 3ME2A 1ALYA 5CIRA 1D0GA 2HEWF 1PK6A 3V56A 4F3JA 2TUNA 5KC5A 3FC0A 2QE3A 2JG9C 4E4DX 3K48A 4D7YA 2E7AA 3B9IA 4QPYA 1I9RA 2RJLA 4G3YC 1OQDA 2HEYF 2KA3A 4KGQA 1KD7A 2ZJCA 1TNRA 2RJKA 3QBQA 2R6QA 3URFA 3QD6A 4EN0A 1TNFA 4QQHA 4N90A 1JH5A 3MI8A 1RJ8A 1D4VB 2AZ5A 2WNUB 1D2QA 1DU3D 1JTZX 2Z5WA 2X29A 1S55A 1XU1A 2JG9A 4G4FA 3L9JT 5KC6A 2Q8OA 3B94A 4DOUA 2JG8B 4QQOA 4E4SA 5TSWA 4J6GA 2O0OA 4MXWB 4OUMA 1XU2A 1PK6B 2HEVF 3TWIA 5L19A 1O91A 2Q1MA 4GIQA 1OQEA 2WNUC 2WNVB 1OSGA 4TWTA 1GR3A 1C3HA 4KG8A 3AB0A 4QQPA 5L36A 4QQLA 4DB5A 1U5YA 1RJ7A 4OUSA 2JG8C 2ZPXA 2JG8A 3ALQA
chains in the Genus database with same CATH superfamily
5BNOB 1TG7A 3ZFFA 2RS31 5FY7A 1MS0A 4ITCA 4MXWA 1Y7BA 1ACCA 1CN1A 3FWEA 1APNA 4CEWC 3CU7A 2C9KA 4QKBA 3I54A 4GKYA 2GALA 1BKZA 4QB6A 1RUG1 5F2WA 5G04L 1WZXA 1F8VA 4COWA 2RS12 3CZJA 3ZXLA 3DUIA 5JMCA 3ZXJA 2O8OA 5FYYA 1BHGA 1V9U2 2ZEXA 2WL1A 4I3PA 1S4CA 2MEV2 2VQ0A 5DQ0A 3TNQA 3WF3A 1T6BX 1F15A 4IE7A 4MLOA 4OFGA 4ES9A 1UOJA 2CYFA 2Z79A 2DVFA 1JZ7A 3WEZA 2HWE2 4CDXB 1F4HA 3VBSC 1VRH3 3ZSMA 1RUI1 4CCLA 2ZGTA 2ZGRA 4QX0A 2HEWF 5FUPA 4Z2AA 1V6IA 3TEZA 4CDWB 1UKGA 1QXPA 2JDMA 4DIQA 1S0DA 1RUD2 1RXGA 3OEAA 1QJU1 1LNSA 2VMGA 2Y6JA 4W8JA 1TMF3 1YQ5A 4CA9A 4D0QA 5FREA 3NNMA 4WM8A 1XQNA 1RGSA 1DQ6A 3GJAA 4BLJA 1OT5A 2XBO3 1LGBA 4XF3A 4IE6A 2HEYF 1EPZA 3I7DA 3A22A 3CJIC 1W8FA 2QQVA 2WQ8A 2ERFA 4XVHA 5FXZA 5LW9A 4Q0SA 2R072 3QBQA 3VBRC 2PHXA 4RD7A 4QXCA 1UZVA 3SLIA 1JU4A 2VMFA 1YEWA 1IOAA 3FJSA 2IXIA 2IXKA 4W4ZA 2FZ1A 1RUE2 3ZXKA 2AZ5A 4JZRA 3WNNA 4BXSV 4D6SA 3WQ1A 3RS6A 1W2OA 3T09A 1AR83 5FPVA 4PJYA 1NA1C 1QH6A 5LBEA 4IV3C 4H3WA 5F5IA 3B9CA 1KS5A 3I2DA 4AFAA 1KDKA 1UZ0A 1G9BA 1G9CA 3V0BB 4UI9L 4XBLA 5CU1A 4CDUC 4CUBA 1XB9A 3ZX7A 3PUSA 2AYHA 1SBDA 1MS4A 2J1UA 5FXXA 4QQOA 5KXDA 2ZHNA 4IEWA 4A44A 4RR3A 1GICA 3VKMA 4GB31 1W39A 1LR5A 4XF1A 4XZPA 3H9AA 1EAH2 4LBNA 2QQJA 4L0PA 4MO3M 4BPZA 1QDOA 1PX3A 3NNFA 1OSGA 1OH3A 2YGMA 1LCLA 3U1XA 3ACLA 1BBT2 1W2UA 2HWC3 2WDBA 4RQPA 5AFBA 4JGYB 1F35A 1MZEA 1UO9A 3M4FA 3POBA 3S5AA 1PGL1 1HRI1 2WT0A 3AJYA 1XBFA 2VCBA 1V6KA 1W9SA 4GQ7A 5L36A 5K0UA 3ZM8A 2GC0A 2KR2A 1YRZA 5K7PA 4MGYE 1XSRA 3ZMOA 1R082 1GFF2 2CV6A 2R49A 2ZPXA 3KF3A 4Q26A 3B02A 1W8TA 1RUF1 3OEBA 5A32A 2JKBA 2D93A 3UKNA 5BUVA 1NYWA 1I1EA 1QHDA 3PHMA 2ZX4A 3ES4A 3SHRA 3KHBA 1YJKA 5M0TA 5FY5A 4K1ZA 3HT2A 1IZ3A 5C9AC 1NAEA 1Q8OA 1XNAA 1SPPB 3F95A 3ILNA 5FZCA 2ILMA 4XEZA 4ISRA 4PDWB 1G9AA 1GYKA 3MF9A 1OVPA 1HRV2 4Q4W3 4LHLA 2RS32 3BB6A 3INAA 2WFPA 5CZKA 5CBLA 1US3A 1RTVA 5IVYA 4HZFA 1H8TC 4ZPIA 4YVSB 4F8AA 5LWBA 4JDOA 2WO7A 4LMFA 5HCBA 5F3EA 2PQSA 3ZFEA 5KHGA 3MIBA 1AYM1 1RUG2 2E6VA 4XTPA 5FPBA 2AENA 3PUIA 5L7OC 1Z7S3 5LK5A 1LHOA 2ORZA 3POWA 3ZLIA 1WW6A 5FMOS 4ATEA 1VB2A 3VL8A 3LIGA 3KQRA 5B2GB 4CEWA 5EIYB 3V64A 3KCYA 1A3KA 1ENQA 1XNTA 2Q5TA 3FC0A 2PLV3 1NQDA 4HVOA 3NJVA 4Q4V3 4D7YA 1A34A 1ULPA 3PUAA 4R9DA 2AC1A 1RUI2 2JDPA 3AXEA 4G3YC 5GALA 5BY5A 5GZCA 1ZNPA 3AMMA 5FP3A 3FN9A 5H9QA 2WWSA 2V73A 4UBHA 1WCUA 4FQ4A 2OW4A 4QKFA 4AOCA 5JWPA 2BVVA 4HMZA 4RS5B 2VQUA 1QJU2 3LSEA 2VW0A 4EN0A 3ITQA 5FPXA 2KXLA 2XJUA 1XYNA 3JB4C 5GLVA 4OQ9A 4ORFA 3IDAA 5BV6A 4YFWA 4LA2A 5FZDA 3Q9OA 2GC1A 2J1RA 2XHKA 1RJ8A 1D4VB 1GZCA 1YC61 2IFRA 5T5LA 2ZBJA 5DDJ3 2DCJA 1MPXA 5C5TA 4NIHA 2CDPA 3ZXEA 4EWEA 1ZRIA 3PDQA 2CL2A 1VPHA 4J25A 2P2KA 5FZMA 1ZREA 3L9JT 2O8QA 1ND2C 2I45A 1GOFA 3PLQA 5JI7A 1RUOA 2VECA 3Q8AA 2J7MA 2PHLA 3UGFA 4QAWA 5FY0A 3MIEA 1DLCA 2OUJA 1OVSA 1KQRA 1S0JA 3VBRA 2VUDA 3N9QA 1SLBA 2Y6GA 1J3PA 2VW1A 3RI8A 3OD4A 4V1PA 1GNHA 4XE9A 5FK7A 2P3YA 3EYPA 2QQLA 3I49A 1LTEA 3AJZA 5FUNA 3WDVA 4BM8A 3ON7A 2QDRA 2Y33A 1H9PA 5FYVA 4GB32 5JI9A 1W99A 3ACGA 4CXWA 1NLSA 4IV3A 1SBEA 2RVAA 4XPVA 1CZVA 2YPDA 4XXAA 2R061 1L3JA 5HCHA 4HKOA 5JR7B 4NRMA 2CGOA 1UMIA 3SCFA 4AVCA 3HBKA 3QACA 4WVWA 4QXKA 3GBGA 2C5DA 1K5JA 1PGL2 4FTSA 1HRI2 3WP3A 1CESA 3VBUA 4GJYA 5F7UA 1VBC3 2Y6FA 3D0JA 1G7YA 4TXWA 3TYJA 3VBOB 3B01A 3PVOA 3U10A 4A2UA 1RUF2 2B7YA 2JG9B 3KV4A 4EYUA 3BTXA 2YHJA 4OZOA 3I2GA 1EPWA 1FT9A 1KXGA 3EBRA 4I01A 1HB2A 2WSUA 4BZ4A 3VV1A 4IE5A 4FSJA 3LOIA 3PTYA 3LKJA 2D5HA 1O4YA 2BNOA 2EIDA 3M3OA 3Q8EA 3RPQA 4CDQC 2NM1A 3IDEA 4E2SA 3P5BA 3WF2A 3ZSEA 3H8OA 3JQXA 2C26A 4JX0A 4GKXA 1U12A 2QBXA 5FZ4A 5A3WA 3ME2A 4P08A 2VUCA 2WZR3 1NZCA 3ZN6A 1RHI3 5JSPA 2FDIA 5JOWA 1AR61 2RR11 1L7LA 4JTOA 1GQPA 4FPEA 4XABA 4JQRA 2TUNA 2D6OX 5J48A 4NR1A 1VALA 3DYPA 1NCQC 1QJZA 1AYM2 2BOIA 2V5YA 1Q8PA 1PIV1 2V09A 1PVC3 3MPPG 1STMA 4PLNA 2NMNA 4AI9A 3AYDA 1I5PA 1UAIA 4JHTA 3AKRA 4YNIA 3E5QA 4XQ4A 1DYPA 4HPKA 4LQRA 5G05L 2IXLA 5CKNA 5F37A 1SLLA 1KD7A 2UY9A 3W5MA 5DMYA 4P5YA 2JE9A 2FBEA 2D7FA 2ZTNA 4N7IA 5FZGA 3T30A 2GC3A 4IV1C 4QM9A 4LJHA 4QXBA 4CE8A 2UYAA 1XRUA 1Z0HA 4QGNA 2HWB1 1H8VA 4Y1ZA 1M06G 5LA2A 4XETA 5C6CA 5H9PA 1VBE3 5A7OA 5EYYA 4LK7A 4JV4A 1F2NA 1NE6A 1O3TA 1REEA 2FDKA 4EWDA 1OC1A 2Z5WA 1YFYA 4UF0A 3KT4A 3AM2A 1UU5A 4OVEA 4OZXA 4B1LA 1OLQA 1H0BA 2LM3A 3H1YA 3N7KA 3GCWA 3MPBA 2WAAA 4FPOB 3DYMA 5FZAA 2P5BA 4NROA 3O14A 4SLIA 3ABZA 3I59B 1QOTA 4QDQA 4LORA 5DN2A 2ZGLA 5JUVA 2EXIA 2XHNA 5FO9B 3LE0A 1XU2A 2HEVF 3R05A 4NIAA 1O91A 1XE8A 2ZHMA 5T5PA 5B4XA 3DN7A 3PL0A 4QB1A 2X09A 4M3CB 4XJZA 2GH2A 5FZ3A 4R4XA 2EICA 5I8YA 5L9BA 5EQUA 2CY6A 4ZU7A 1VRH1 2E7QA 3E6DA 3OUJA 2VCAA 3OGRA 3WOGA 5JXJA 3TEXA 1K45A 4COYA 4OHWA 3E97A 3Q8BA 2JIGA 5A1AA 4OUSA 4AHZA 3AC0A 3VGIA 3KMHA 1U5IA 4HOOA 3O0WA 4QMAA 4FOYA 4XFIA 1MZFA 1TMF1 2XKOA 4AGGA 3AMNA 4HK8A 1BYHA 2WO3A 1AJKA 3WW3A 2D98A 1PK6C 2JDZA 2XBO1 2VPVA 4YRDA 2R062 3I2KA 3JBG3 3WCRA 4H7LA 4LNVA 3ZXDA 4EJRA 1OUXA 3NJZA 1O7FA 4IEPA 4GZ9A 3SISA 2BGPA 3KLSA 2YROA 3HQXA 4A6OA 4XCBA 1VLNA 2P3KA 1W03A 1JYIA 2D6MA 5HCFA 1VBB3 3IPVA 4NIIA 3SNMA 4Y1UA 1W0NA 1RXFA 4P14A 2GU9A 3ZYIB 2VOKA 4AAXA 3H3UA 1W2NA 2EXHA 4P9GA 3OBAA 5LBCA 4JGZB 4QM8A 5FQ0B 5FP4A 1AX1A 3VDDB 4BIFA 4ZKTB 5IYYA 4AZZA 3THDA 4UT5A 3HOBA 4IEYA 4WV8A 3RNSA 1AR81 1GMMA 4E8CA 2XMLA 1DGWA 5FKCA 4QDSA 4XAEA 1WLDA 4PLMA 3HMYA 3CNAA 4NUBA 4YGCA 3U0ZA 5CIRA 4FOWA 4WVMB 4JVAA 4F83A 2A3YA 4TLFA 3V56A 1HB1A 2WT2A 4R4ZA 3EO6A 3MV11 3RVHA 1LU1A 5FZOB 2HBTA 3VBFC 1OOPC 1WMEA 1YIPA 1BJQA 4XF0A 1HKDA 1PVXA 2XVLA 3FLRA 2AEYA 3WXPA 2D6KA 5GJ6A 4HFSA 2W2IA 4AGVA 1XPWA 4QU2A 1QJEA 2B46X 1OQDA 2RR12 1AR62 4AVAA 1MQTA 4DXSA 2D5FA 4GH4A 1WMFA 3POGA 3WDUA 4XF4A 2A73B 2PHWA 3HR9A 2J1EA 5FY9A 1QQP3 2HWC1 1PIV2 3ENRA 3PU3A 3POYA 4JDMA 3OF1A 2GP5A 3LA2A 1GOGA 1XNBA 2W9XA 1URXA 4MGZE 3SQOA 2P3JA 3NKGA 3I3EA 1SCSA 3UGGA 2YG0A 2H6BA 5CFCC 1D2QA 3MIDA 4CCCA 1LENA 5K8SA 5J36A 5C4WC 4YVWA 1LHVA 3E5UA 2IZWA 4UW3A 2QQOA 1UPSA 1CAUB 2BFUS 2RDRA 1S1AA 2UWBA 4LBMA 4LKFA 2P34A 2QQMA 4ZU4A 1LKNA 5KC6A 4COUA 2HWB2 4NPMA 1W9YA 1RC6A 3DL3A 2AACA 3ZSJA 3ES1A 1GP5A 4QPGB 3O1UA 3LQCA 5L7OB 2JDKA 5C3SA 5IATA 4UW5A 2ZX2A 4Q1RA 1LB2A 1TME3 4CCMA 2QZ2A 5FY1A 3RZMA 2WZPP 5C8CC 4Y5Z0 1CIWA 3AX4A 4NPRA 4MOAA 4D8MA 5D8AA 3TWIA 1MR5A 1T2XA 1WA6X 2CNAA 5E1RA 3OPTA 4YG0A 2ZEYA 1UXXX 4LUMA 1N3OA 2P1BA 2VTXA 4MGIE 1L7RA 1Z7S1 2W39A 1PGW1 3NAPB 2I07B 5APAA 4NVPA 4AFCA 1T6GC 1LOFC 3I2IA 4IEOA 3S6PA 2YPJA 1YNAA 1HQLA 5DUWA 3DKQA 3EXUA 4MV2A 2W52A 4HSLA 3TRSB 5IK7A 4AI3A 2JG8C 3UETA 1ULGA 2PLV1 3VZJA 1C1FA 2SBAA 4N7UA 4S2GA 3TB0A 4Q4V1 1XNKA 2BERA 3ZFFC 1DQ1A 1VRH2 4GWMA 4DXRA 2DV9A 4MGKE 5ACA3 2VOTA 2R30A 3FLPA 2HYXA 5EXOA 3RZGA 1JMUB 5FLHA 1QIQA 1I5ZA 5EJZB 4ZXKA 1FV3A 4UFHA 5FMDA 1MZ5A 3UL2A 2C0ZA 1XYPA 1Y43B 4ZU5A 3WQ0A 2WNVA 4LTAA 4A7YA 2DUQA 4I0BA 1VMJA 1TMF2 3WD5A 3CIHA 1JU3A 4GMP3 2VQAA 2PMWB 4QPIC 4XBQA 2WSVA 4IQPA 2XBO2 2O14A 4LO6B 1IG0A 1WBLA 1UD1A 1WCSA 2WO1A 4HL0A 5DDJ1 2VNOA 4OMCA 1RL3A 1HX6A 5BXXA 1CAVA 1WCKA 4LT5A 4LITA 3IMMA 4LO8A 4LOTA 4J1WA 5JLVA 1UQXA 5EJ3A 1W8ZA 3JD73 3LWCA 5C7GA 3OGVA 4JQTA 5JZGB 4MGQA 1PK6A 4F3JA 2WAOA 1QF3A 3AFGA 2VR4A 1ULOA 2V72A 3NJYA 4KNCA 5JDBA 1DFQA 1AR82 3OPZA 4R9CA 3LEGA 3AP9A 4YGDA 2XJTA 4E4DX 3GHNA 1WW5A 1PM4A 3KV9A 4LBQD 4WM8C 5DABA 5FWEA 3USUB 2D43A 3AZWA 3LOBA 1LRHA 2PELA 1BK0A 3M2MA 4KGQA 3GBWA 1ZRRA 2NPIA 4CEYB 1YUDA 3BODA 1S2EA 4LK6A 2WBKA 1OKQA 3N36A 4RYDA 4Y20B 1L7QA 4PIZA 2X5IB 5JCTA 5CKMA 3O1OA 4ISQA 3POEA 4QQHA 2VC9A 4ZHNA 1RUNA 1WLCA 1K5MA 4XJ9A 1SBFA 1I3HA 1RINA 2RS53 3HT1A 3HNMA 2PQQA 2I74A 2WNUB 3GF6A 1DU3D 1W6PB 1WMXA 2K2SA 2HWC2 1OA3A 2PHFA 3VBFA 2B4KA 1XNCA 4KI5M 4S2FA 3ZSLA 3T0BA 3WZ1A 2EVXA 4YW5A 1WCDJ 4BB3A 2Y6HA 4GALA 1PO23 1VBC1 4AE2A 1TQ5A 4BK5A 2VU9A 4LHNA 3D0SA 4MG2A 4LOSA 3ZKYA 3J9SA 1Y4WA 2ZMNA 2D40A 1AL23 4J6GA 4GWNA 2WYSA 4IGQA 1UZYA 3J7NA 4XURA 1NY71 3OBZA 4O7XA 4FFGA 3RZZA 3K75B 3ZYHA 3JUUA 5L9VA 4HXCA 2Z69A 2W68A 3KB5A 5FZHA 3BOPA 1NE4A 4ARXA 2YMZA 1DLLA 5D2AA 5KHJA 4FQZA 4RQPC 3ACIA 4Q4W2 2WZR1 3LDBA 1RHI1 3I3DA 1GP4A 1S2KA 5C4WA 2DWRA 3LEMA 4LBJA 4P9LA 4YLZA 5K0UC 1MS1A 3E5XA 3W9AA 3V0BA 2JICA 1GP6A 1V6JA 4L8QA 3T2PA 4NE9A 2XL9A 5FMBA 1YYNA 3WDWA 4XC9A 3G6JB 4C1XA 2K9ZA 2FCVA 1S0BA 4KU7A 1Z7S2 1PVC1 3VDCA 1PGW2 4B4QA 5A7WB 1UXZA 4KU8A 4Q5OA 5FYMA 3ZIWA 1ENRA 4GJZA 4OMDA 2QCSB 1PZ7A 1AXZA 4M4PA 4IGPA 2UU8A 2R7EB 1IKPA 4PBOA 2PLV2 5A3NA 4BIOA 1IS5A 2ES3A 2WN2A 2FHRA 4Y33A 3ZMNA 3CZUA 4Q4V2 4DEVA 5C3OA 1SZBA 1ZBE3 1G8WA 3TEWA 3GYDA 1EUUA 3J7MA 3VD3A 4C0HA 1VBE1 5FP9A 3ZFEC 3IBMA 3NL1A 4K3UA 4KQ7A 4M3CF 1UYXA 5KWRA 1GANA 3ZSKA 1OLRA 2AGSA 1GWKA 1UY0A 3N7LA 3MYXA 2XUMA 3A23A 4AEJA 2VJXA 3FFQA 3GGLA 4UW6A 4MADA 2DTYA 1FX5A 2JENA 4OCTA 4R52A 4IEVA 3FX3A 4AFBA 5BYNA 5LCWL 2G9FA 2XJPA 5J3UA 1H2LA 3DPRB 3GBFA 5LBFA 3VHPA 5DDJ2 1VR3A 4OHVA 4OUEA 2QUOA 4Q29A 5LRSA 3OUIA 1UMHA 4NHMA 1AXYA 3D3AA 2JD9A 2WFF3 3IDCB 3K4DA 3CBNA 4PDWA 5EZWA 4IGOA 3P3PA 3SKVA 4Q4X3 3BGAA 4QPIA 2ZA9A 1W6QB 1W05A 5FV3A 4FI9A 5FP7A 1RUH3 1NUKA 3HPNA 3NQHA 3WNOA 2OPWA 3MFAA 3I3QA 1UNBA 1DCSA 4IW3A 4JKMA 1JODA 3FBYA 4CCDA 4QGMA 3R6SA 5HV0A 3CEWA 3MO4A 4QX2A 1WUVA 3DF0A 2BZDA 3RMXA 5KHHA 4DZGA 2E63A 3O1RA 2OVUA 2OUHA 3L2YA 3BALA 2ADEA 3NRUA 3LPFA 3RYPA 4I09A 3T1MA 2X29A 4XZUG 1VBA3 4FBFA 1MZ6A 5CFDB 1YXWA 1FI2A 2AH2A 5IK4A 1W6OB 5FCCA 3JBG1 5C70A 1W0OA 4P9IA 2GAUA 2YB7A 3FHAA 3B94A 1E5RA 1UZZA 3W5NA 1RUJ3 1X8MA 2BU9A 1VBB1 5FJHA 5IUQA 5BNNB 2VD7A 3AP4A 4I2OA 4C1WA 2JDYA 4H55A 4HSJA 2RDNA 2VOWA 4ARYA 4YARA 1ASJ3 1VBC2 1S0IA 5DZGA 1UF2C 5FZ0A 3W20A 1NG0A 4H14A 1D0HA 1OOPB 2YZ4A 4FAGA 1YCIA 3OTFA 1O3QA 2FDJA 5IT6A 3VKFC 5BNPB 1W8HA 2Q4SA 2EF6A 1FAYA 4NHLA 1CX1A 1LOCA 4QD2A 3M7AA 4HBNA 4CPBA 2DTWA 2LTNA 1NY72 1YQ2A 3H3LA 3BTAA 3PUQA 4GMP0 4TLGA 4O9EA 2ZABA 1HW5A 1COV3 1BK1A 2BOJA 4D94A 3ETPA 3VD4A 1RVF3 2A6YA 4NRPA 4Y1YA 5FZ9A 4BQ4A 3PIGA 5F5AA 2XGXA 4QT6A 3VBHC 2WZR2 1Q3EA 1RHI2 4JKLA 4Z2WA 2ET1A 3VBUC 1CJPA 2UURA 4INDA 2FQPA 4NAMA 2YU1A 4N9HA 4FOVA 3WDYA 2B42B 2E51A 1QQP1 1ST8A 3POSA 1F9KA 1PVC2 2OIIA 3BPSA 4AEDA 1IQAA 2XQRA 3WCSA 2XDVA 2J1VA 3B00A 3I3BA 2D3RA 3D6EA 4XOGA 1PZ8A 2WA3A 5H9RA 1CZTA 2X05A 3V0AB 3BIEA 5DAPA 4D6RA 1C5IA 1OPMA 4W6WA 1GZWA 1ND3C 2BEOA 2ZHKA 5JR2A 1BXHA 5GLWA 5I8TA 3B69A 2RDSA 4W6YA 4AEMA 2RG4A 1B35B 3U4SA 3VLBB 1CPMA 4YW1A 2VTFA 5EJ1B 4XFGA 2XJRA 1VBE2 4JKKA 3IIIA 3ETQA 1GZ9A 4K20A 1CPNA 2WS93 1TME1 1VAVA 4DUXA 2KD7A 4LKDA 4IERA 1J58A 2RM23 3M70A 5GZGA 2XLAA 4YM0A 4FAHA 4N53A 4YM2A 3PVNA 1N1SA 1NCRB 4LBQB 2ZJCA 2QFEA 4Z92B 4YW2A 3ZFFB 2WWJA 3GZTB 1DGWX 4E2QA 1JZ3A 4XFBA 5CKQA 4OHXA 2R16A 2DVGA 3N9NA 3FZ3A 5FZ6A 2Y0OA 2JD4A 4FXGB 3MI8A 5DAXA 2WUHA 2EIBA 4JCKA 2JE7A 4RGAA 2WQ4A 3M3EA 5JOYA 3E6CC 1JTZX 2JIJA 4LKSA 3MLJA 3AZXA 1XU1A 5FZIA 2ZGQA 2QQPA 5ACA1 3N9LA 3D5OA 3BUCA 2Q8EA 4OI0A 1IS6A 2VAUA 3WQ7A 5JOXA 4A41A 4FTBA 2GN3A 3LFIA 1YHFA 5CB7A 2DCTA 1CAXB 4GMP1 3UV9A 5E16A 5A6XA 5ABJC 3HWJA 4DFSA 1OA4A 2O0OA 2VH9A 1WLWA 2WIIB 4LO5B 2ADDA 2ARAA 3JBG2 1E5IA 1QU0A 2GH8A 2R0FA 1CAWA 1SFPA 4KG0A 3T2TA 4URAA 5IVEA 3TOJA 3ZYFA 2YGLA 2ZMLA 1ENXA 1JI6A 1NOVA 1B09A 2DUPA 3ILFA 3OGGA 4LA3A 4MZUA 1VBB2 3LAGA 3AXDA 4L97A 4UFLA 3PVEA 3MW4A 4LE4A 3VDAA 2HWF3 3JD71 4XJ8A 2ZZJA 4GAZA 2OS2A 1SQ4A 2Z42A 4R8HA 2VGDA 4LBOA 4NHYA 2P17A 4NPLA 3MBWA 2XVKA 3J26N 4LIVA 1JXNA 2Y6LA 4XFHA 3RZJA 1X9TA 2D3PA 1N3PA 5GZEA 1J1TA 3I97A 1CR7A 1VMHA 1SLCA 5HXVA 3QOPA 3WF1A 4N43B 4Q4Y3 1JZ8A 2B39A 2RE9A 3AZZA 1V0AA 1VBD3 2GC2A 2Y60A 1DHKB 2XR4A 4AWDA 2FZ2A 3GALA 1OPOA 4OULA 3CKHA 4MXVA 4AVBA 3RJ2X 3WVJA 2PAKA 3GNEA 3IDBB 4K21A 5JXIA 1ZRDA 1QXRA 3DGTA 4BLIA 2LW8A 4IEQA 1KRIA 2RS51 3BPZA 4LO4B 4NN0A 1U5ZA 4RR3B 3UK9A 1QQP2 1R093 4XBNA 4B3NA 2A1XA 3QH6A 5A7PA 4KL1A 3VBHA 3MUY1 1PO21 1XNDA 3RZLA 1IG3A 4XFAA 4AFDA 5I0RA 2D44A 1SFNA 3BCWA 2EXJA 3GZAA 4OI2A 1W04A 3VDBA 3KSCA 2YFZA 4XAAA 4CU9A 1D4M3 4YGBA 1H30A 3RYRA 1UY2A 5FZKA 1AL21 2JWPA 2G4IA 2QJVA 4FT8A 4QU1A 1ULCA 4XIKA 4OLLA 3OSDA 1HJFA 2W94A 3PMSA 1MQTC 4DRRA 4WZFA 1FPN3 5KHIA 3C7FA 4GH4C 4E9KA 3T2QA 1XSQA 2Y0IA 4XTMA 1JBCA 1GKBA 2RV9A 3VDDA 5IVFA 5DAVA 3O5SA 5A32B 1ODMA 2YUEA 3CQOA 1ND3A 1TME2 5FJKA 2ZS6B 5IK8A 4E4HA 5FPUA 4JDNA 3ZDVA 1UMZA 2C1FA 4N90A 2LUWA 4WVMA 3FBMA 4CU7A 4YW6A 1LESA 2BP6A 2VMCA 5LA0A 2CTVA 1W28A 1OA2A 4C90A 5IWFA 3A21A 2WZ8A 4XMAA 3MLKA 4YVWC 4E27A 5JAXA 2DU1A 4I0AA 1YI9A 4A7ZA 5T5JA 5JSOA 4YW4A 2YC2A 4QGLA 2DFBA 2J22A 2YU2A 4CYDA 1CGPA 3WW2A 1O5UA 4N8MA 2OZJA 1OFSA 1ZBE1 3VKLA 1VP6A 3IAQA 3CDZB 3GZEA 3HN1A 3NO8A 5D8AC 5ACA2 3D82A 3TN93 4CEWB 2WKKA 1DGLA 4YZ4A 3THCA 1E57A 3SH5A 1WGPA 3QH7A 5FLJA 5FZLA 1SDWA 5HV4A 2PTMA 4PQ9A 3I2OA 1ONAA 5ANNA 4PBPA 5IAVA 2DVAA 1JZ6A 3K2OA 2VBBA 3RYKA 4IE4A 4NMIA 1CAUA 4F7ZA 1KDMA 5EFUA 1AYN3 4E4ZA 1S0FA 3HD8B 2A7AA 4FPFA 4SBVA 5A3OA 1JN2P 5DPNA 2W91A 2VXJA 1ZZ9A 3N35A 2WFF1 4QPGA 4HVRA 4EV0A 4EQVA 5IVCA 4BCUA 2GP3A 3NV4A 2NN8A 4UFKA 3QCWA 4YFZA 5JOZA 2VMHA 3VBSB 3JD72 5ABJA 4YG3A 4Q4X1 1J59A 1GU3A 1V6NA 2YFUA 2CGPA 1RUH1 4AYUA 5DAWA 3RSJA 2TNFA 5GZDA 1UW8A 2WNVC 5J37A 2ZGOA 2ZACA 3HEIA 2E7TA 2IXHA 4A3ZA 5HI0A 5E6HA 4BMBA 1AX2A 1YWKA 5AVPA 3O0XA 1H6XA 1PO13 3NAPA 5LA9A 2B8MA 2FCUA 5LEKA 1S0GA 3ZFGA 3ZN4A 1HV1A 3PNAA 2PFWA 2VVFA 3CJIB 1QY4A 1NZIA 3WUDA 3CF6E 5HXMA 3H7JA 2Y34A 5DZEA 3DXUA 3N7JA 3VBRB 4M0HA 3BYWA 3DCQA 2BPA2 3H8UA 1VBA1 5BNOC 1YQCA 3FLTA 4ASMB 1O59A 3F2ZA 3HQRA 1DQ2A 5ANQA 2RS52 1PMHX 4LHKA 3WP5A 1RUJ1 5CG9A 1US2A 4XUNA 4ZZ5A 1WLTA 5FZ1A 2E53A 1F5FA 4XQDA 1OMIA 1G86A 1NA1B 3ST7A 4IV3B 1OXCA 3C2UA 4LR4A 1X8EA 5KR7A 1I9RA 1MACA 1ASJ1 1PO22 4CDUB 4BQ3A 3S0MA 2X10A 1DZQA 2W3JA 1TE1B 5F39A 1HXS3 1FYUA 3WV6A 1WBFA 2D6LX 1LULA 2Z4FA 4C8DA 1TNRA 3V65A 1AL22 4HN1A 1VE0A 4OHYA 4CDXC 1MS8A 4ZY9A 1KITA 1K5MC 5JZGA 1COV1 5D1IA 1MVQA 1QH7A 3WNLA 3M3IA 4BJ0A 2Q30A 1RVF1 2Z2SB 1EYBA 1IGOA 1GNYA 5T5OA 4BQ1A 1QJY3 3PIJA 3GZUC 2ZGPA 1FOD3 3LFMA 4I02A 5F5CA 2ORXA 4UFIA 4URTA 3USUA 2C24A 1EV13 5EHDA 1W2AX 4V2WA 1HV0A 1UIJA 3OGSA 3MW3A 2VNRA 3EB7A 1DYOA 1GQHA 2VTXJ 4AF9A 3RZKA 1W0PA 1AR93 1W6NB 1W8OA 3K3OA 4E4SA 3KQ4B 3FMGA 4Y20A 5FOBB 4XYXA 2W1QA 2W95A 2X5IA 2MHFA 3OY8A 5C33A 5FZ7A 3P3NA 5C9AB 4G9SB 4CCNA 3WNXA 5H9SA 3H50A 5LY2A 4YM3A 4MHUA 3FHQA 1IQDC 4IDZA 2R043 3B5LB 2GNTA 4L92A 2WC2A 5D21A 4HANA 1UCXA 4YPJA 4AEKA 1QXJA 3C7EA 4ZONA 2DU0A 1ZBE2 1G9FA 2VBDA 3BKZA 1QNWA 4QHOA 4RA0A 1BEV3 3WQBA 2UYBA 3GJBA 4FFFA 3M8LA 1H8TB 5FP8A 1JYCA 4AFMA 2VNVA 2QQIA 3R4DB 4DB5A 1LODA 2D97A 4CUGA 2JDHA 5FLIA 3VZMA 4HLTA 3DECA 2WS91 3QLQA 3MGUA 4WM7A 1H6YA 5FFOC 3MZHA 2BV4A 2DF7A 2JX9A 4FP2A 3AYAA 2RM21 1AHSA 1OFNA 4YW3A 3NNJA 1H1AA 1XOYA 4HKWA 1FATA 3NSTA 4MSVA 3KT7A 4M0NA 5EV7A 5A33B 2NMOA 2MPFA 3PTRB 4U36A 2WFF2 2TBVA 1RUC3 4MYEA 2QNKA 4JGYC 4NJ4A 3WX5A 4Q4X2 2V4AA 4P9WA 4NRQA 5BNQA 1X7NA 4AVSA 2YDEA 5JPNB 1RUH2 1ZRFA 3S7EA 1K42A 1AF9A 3OYWA 4B29A 4GD4A 4W65A 5J1XA 4L9BA 4EN6B 4NIGA 1JYNA 2OQ6A 2W0XA 2VG9A 2V5DA 1QWRA 4Y22A 5A7WA 1PNFA 4MGSA 2Q1ZB 4XDQA 4CP0A 2VNGA 1SLAA 1HN0A 1W2TA 4K9SA 5KC5A 1Y9GA 3ZOIA 2CSGA 5FPZA 5GLUA 3VKOA 4DY3A 1PMIA 4PDWC 1VBA2 1D2SA 3LGRA 1Q43A 3U37A 2FCTA 5K9YA 4RN5A 1O8SA 2H0BA 1ND2B 1JW6A 2W1SA 2VL4A 4UFJA 1ZYBA 1QJX3 2HLEA 3LEKA 4JRLA 4CCEA 5KHKA 1RUJ2 1ULEA 4IETA 1J83A 3UYJA 1U0AA 5IJRA 2HWF1 1ENSA 4Z1VA 1ASJ2 1O3SA 1OH4A 5BNOA 1JH5A 3TNPB 1JUHA 3CHXA 5FXVA 2B9VA 2OYZA 4AW7A 4Y4YA 1KJLA 2UWAA 4PI2A 3S30A 1UOBA 4Y4RA 2ET7A 2D3SA 2BQPA 2CU5A 3ACFA 3GCXA 1ZBA3 2WZEA 4Q4Y1 1C8M3 3SCHA 1A78A 3KT1A 4LPLA 2F17A 1COV2 1HDKA 2PAMA 1VBD1 4FO9A 1J84A 3MIHA 1RVF2 3LB9A 4FPHA 3JQWA 3VHOA 3ZYRA 3T1LA 4DUVA 1TZOA 1NXMA 2DCYA 3LSDA 1IPJA 5DUUA 3WG3A 2E32A 4LEJA 5TSWA 4BOWA 3RG0A 4FPJA 2R1DA 3N3HA 3WG1A 3HQUA 5EYXA 4CDXA 5FYIA 4AI0A 3M3QA 1R1A3 4ASKA 1MEC3 1UIKA 2VMIA 3PJYA 4BQ5A 4BH9A 2FD8A 3OPWA 4P00B 2OKXA 1FMD3 3CLPA 4CDWA 3H3ZA 4XFCA 1R091 5F3CA 5L9RA 3AMHA 1XE7A 4LUKA 1MQTB 3NVCA 5CFDA 2YC4A 1MVEA 4GH4B 3WUCA 3VZKA 4HVQA 3DKWA 3CL1A 1JOBA 4CDQB 1D4M1 3E6BA 1BMV1 2VO5A 1KFUL 2IXJA 3OBRA 2XL7A 3WP4A 5BNNA 4CP2A 3O1VA 4CP9B 2L9LA 2PHRA 3EMRA 3GXUA 2N7GA 3ZYPA 4TZDA 3RZHA 3J8F3 5LASA 1FPN1 2PN5A 3HJRA 4RSUA 5E89A 4AVTA 1AZDA 4UBGA 1NCQB 2EALA 2R32A 3VB9A 4TSVA 2B5HA 1YFWA 1YO8A 5HBAA 4MX3A 2WS92 5IVJA 3LPGA 2IWGB 5F3IA 4S2HA 5T50A 5BNPA 1WCQA 2P3IA 1GV9A 2G9GA 5FYSA 4AEDC 1JZ5A 1RB8G 5KBFA 2RM22 2YBKA 3WDTA 3ZYJB 1JYWA 1Q8VA 1AUYA 1OF3A 3RRDA 5A80A 3MUZ1 3POIA 5FYTA 3H8XA 4X6RB 1PMJX 1NLRA 3KHCA 3MW2A 1UL9A 2VZOA 4FFHA 5DUXA 5FO8B 3IAPA 4FTEA 3IT8A 1CJDA 2RMU3 4B1MA 1R64A 1YQ8A 4IV1B 1AX0A 2VCCA 2G9ZA 2XONA 3JZVA 3NNGA 5JVVA 5KXEA 1W90A 4CPBD 3AKSA 5T54A 5AC93 5FBZA 3O1SA 3ZVXA 3JB8A 2QE3A 4YWAA 4BA6A 2JG9C 4Y3OA 3VHRA 2HH9A 1NXD1 5K4LA 4ZXEA 1JHJA 1GLHA 1FNYA 3K48A 4RFRB 4XIOA 5FBJA 3TN91 4YZ2A 2ZHLA 3AYCA 4JGYA 3U11A 4N53C 4OHZA 2WO2A 1XE0A 2WQZC 4LIUA 3V0AA 1IS3A 1DIWA 1WKYA 4HKLA 1SFYA 1REFA 4XJWA 4PLOA 2DFCA 1E5HA 3RQ0A 2FMDA 2R6QA 4AR2A 1K3IA 4B8EA 1W6MB 4KBZA 2FDGA 1N1YA 4XUTA 4QWNA 2OQ7A 3EHKA 5CVRA 3NJXA 3SEEA 1AYN1 1B35A 3VHNA 1OD5A 4LBKA 3O0VA 2DDUA 1RMU3 3PVBB 4H2AA 4RGKA 4WVZA 4QKDA 4W6XA 1LU2A 1NLQA 1ULFA 2XQXA 1X82A 3BIWE 4GWIA 1ZZBA 4Q0VA 4QX5A 3RGBA 1SPPA 4DPNA 1C8NA 3N9PA 4IEUA 1AXKA 3J7HA 2XLGA 4XQWA 1MS3A 3E1F1 2HWF2 1UX7A 4XHBA 2AUYA 4G4FA 3O7OA 4BISA 4ZS3A 4CP1A 4KWUA 5A6YA 4P5HA 4PI0A 2Q8OA 4CVUA 3CMGA 1CAVB 2WT1A 4YVSA 2ZEWA 3H1WA 3PURA 5HPOA 1BVVA 2Y6KA 2VVEA 2RDQA 3Q8CA 3PJQA 1HQWA 4YGEA 1PO11 4AQ2A 1JYTA 4KMQA 3KV5A 1PZ9A 3NMBA 1LHWA 4Q4Y2 1PK6B 4V2VA 5DG1A 4RHV3 1NKGA 2QZ3A 3H1MA 3MIGA 1QJFA 3LEIA 1VBD2 2VZUA 1SHWB 1JUIA 3BTYA 2K0GA 4ZZ8A 4L2NA 4LO7A 1NQJA 3AMPA 4TWTA 5FZ8A 1GR3A 3UNPA 1SLTA 3AK0A 2XJQA 3IZOA 5F1RA 3P6BA 1CIYA 4NOTA 5C3RA 1FXZA 1V70A 2A6WA 3IN9A 1EY2A 4RL7A 4DY5A 4BWOA 4DINB 5FAXA 1YIFA 2EA7A 4WZCA 3WNKA 2OA2A 5IFTA 1R092 2WWUA 2XH6A 1RYYA 3N4MA 1REDA 3N9OA 4NWWA 3AZYA 4R9AA 5I0UA 5GM0A 3ZKUA 1CAXA 2B9UA 4LKEA 4RS5A 4ZS2A 3M3CA 2VMEA 1C28A 5A3TA 3K51A 1K5MB 1V6OA 1LEMA 5JIAA 1OI6A 1DZRA 1HXS1 3ZDSA 1WD3A 3I2FA 1BQPA 4FVVA 4NWVA 4XW3A 5GLTA 3UT0A 1D4M2 3VBFB 4JAAA 1BMV2 1A8DA 3ZYGA 3NWKA 3NKTA 3I2HA 4JTNA 3C8XA 3ELNA 3I2JA 4BU2A 3MV01 2ZOEB 1RITA 2IFWA 1V6MA 3H7YA 4UW4A 4WVVA 1CONA 1WD4A 3IMNA 4QDRA 1FPN2 5GKAC 3WF0A 3O1PA 1W8WA 2XJSA 1ZZCA 5BPXA 4DMIA 3M1HA 5JXHA 4JRAA 4AQSA 2A6XA 4QHBA 1AR73 1O5LA 1QJY1 2EIGA 2Y26A 2YBSA 2XPJA 4XDPA 2PHTA 1ODNA 5ERLA 1FOD1 2CWSA 2QDNA 3DYOA 3KCCA 4PCRA 1UY3A 4MH0E 1V6LA 2VZPA 4C0BA 1EV11 1ZX5A 4N43A 3U4XA 2K46A 1POV3 1OLMA 4IXLA 5SV8A 4WBBA 3U78A 3S57A 4CZSA 5CFCB 4K40A 4FP3A 4IESA 1ZM1A 1BCXA 1AR91 1GNZA 5FYZA 1W3VA 4M00A 3HBZA 5C4WB 3I4IA 1EP0A 2X53S 1P8JA 2GNMA 2RJLA 5FYUA 1FV2A 4H7MA 4AVVA 4D6QA 4Q8KA 5FR3A 1PGSA 2ZX1A 3J7LA 4JGZC 2VM9A 4NHKA 5ISLA 2R041 3VDDC 3K4ZA 5DG2A 1DGRA 3OG2A 4RGGA 3CJXA 3WNPA 4QX3A 2ZX0A 2WRAA 1OBNA 1BEV1 3B3QE 4D7TA 5C8CB 3TN92 2TEPA 2FDFA 2BYVE 4E2GA 5A70A 3OD0A 4S2DA 2ZCWA 3U14A 1SG3A 4AI2A 3SCGA 4P9YA 2GMPA 2A6VA 3VBOA 4B7KA 2VY0A 5FMOL 1GSLA 1HQNA 2XWBB 2YC0A 2JG9A 3J4UH 5CG8A 2HBUA 1AYN2 2C6SA 2BBAA 3KVBA 1H1MA 4M4RA 4DRVA 2G1MA 2E9QA 3AKPA 4MHRA 5JXGA 2EIEA 1UZWA 1HIXA 3MDPA 2JG8B 3LA3A 2BVBA 2BNMA 3ASIA 4HONA 1RUC1 2ARXA 4Z82A 1X9PA 5FZBA 3THTA 4EN8B 4YW7A 5A3LA 3ACHA 2FDHA 4L11A 1TEIA 1UX6A 3ZXGA 3KCXA 2VOVA 1GBGA 4MXWB 4OUMA 4QX7A 1OQ1A 2Q1MA 3HNBM 2DCKA 1HB3A 4Y5TA 2QQWA 2QQNA 1NX9A 3OJBA 3RWNA 1VIWB 2X8KA 1PO12 1N1VA 1X33A 2WR9A 4QPIB 3D4KA 1X36A 2PHUA 3T3YA 3ZIXA 4BDVB 5A7NA 3AB0A 2OPKA 4I0WB 4QQPA 4ATFA 1XYOA 5EP9A 5FO7B 3UKTA 2W87A 4AQ6A 3A7QA 3BI3A 3PMEA 4QPGC 1BVP1 2W47A 3ALQA 2A70A 1O3RA 4A4AA 3VD5A 2XVGA 4DO0A 1LOEA 4A3XA 1QJX1 1WMDA 1UOGA 3TBDA 4OQ8A 4XCAA 4CU8A 2D6NA 2XLFA 2NP0A 3OCPA 4W50A 2EAAA 2DVDA 2IXCA 2XG3A 5FRAA 1DBNA 4QKNA 2W5FA 2ZAAA 3NAPC 1CZSA 2HWD3 4WM8B 5CNAA 1W9FA 5A1LA 1DF0A 3ZFGC 2QQKA 2F4LA 2QKDA 3I8TA 3KD4A 1VJ2A 4Q0UA 4AXOA 2JECA 1HXS2 3C3VA 2WYFA 5A3PA 4DEQA 2BWCA 4HT1T 4XILA 5FYHA 2OZ6A 4LLFA 2Q8DA 3IM0A 3AVRA 4Y1XA 2Q0AA 5JPMB 3KV6A 2PXJA 3I59A 5C8WA 1ZBA1 2F4PA 1C8M1 1JYVA 4CXYA 2WLQA 3VBSA 3IIAA 2BWAA 4HETA 1CWPA 3NV3A 1H4GA 3Q8FA 4FPLA 4Q0QA 1D7PM 2W46A 2OT7A 1LEDA 1SMVA 1QJY2 4OI4A 4M3CA 2RHPA 4MUVA 1WW7A 5CAZA 2Y64A 1ZZ8A 2LS6A 2RS13 3WLUA 3NV1A 1FOD2 4X8NA 4BQYA 2BDRA 2VVDA 4LHSA 1GQGA 4AAPA 1EV12 4ES8A 5IAXA 1R1A1 1MEC1 1KFXL 1V9U3 3KWVA 2IUWA 3AP6A 4MGTA 2MEV3 1FMD1 2KA3A 3T4VA 3CJIA 1K12A 2ZXQA 3FE5A 3BVCA 3ZPYA 1HJGA 2RJKA 1AR92 2J42A 3KM5A 3URFA 5FPAA 2DBIA 2RJ2A 2HWE3 4A7KA 3PU8A 5LBBA 1TNFA 1GWMA 5C5UA 3AVSA 1Z78A 1OLME 5LATA 5JZGC 4CRQA 1KJRA 1UYPA 2R042 4AG4A 4BMEA 1H2NA 2W1UA 5I0DA 3MLLA 4RQPB 1RUD3 4AEDB 2E33A 1ZA4A 2C9AA 2F6BA 3OB8A 3FUQA 1BEV2 1NA1A 2IC1A 4A6SA 3J8F1 4Y24A 2ZGSA 5FXWA 2DURA 1J1LA 3G7DA 3D8CA 3WNMA 5K0UB 4DXZA 4UFMA 5E8AA 4CDUA 5CEHA 5J98B 4P9XA 1GZWB 1VAMA 2LRPA 2ZAHA 4JGZA 5A3UA 1W8UA 5FQ0A 1Y9QA 4CEYC 3LF7A 4DQAA 3LDKA 2R073 1JZ2A 1JS9A 4IE0A 2DCZA 2X5IC 1POQA 2A75A 3IWZA 1KGYA 4IEZA 1GWLA 3DXTA 3NW4A 4LULA 3TAYA 4I30A 2VQTA 2H6CA 2JDUA 4PT6A 1LHUA 1RUE3 3KGZA 3O12A 4AL9A 2WNUC 3HN3A 2EXKA 1CD3G 1RUC2 2RMU1 4L99A 3WF4A 5FZOA 4BYYA 2WABA 5A7QA 2HKXA 2EAKA 2VZ3A 2VZTA 2YBPA 3MICA 5E88A 3VD9A 1MS5A 2HJIA 3LCPA 3OOXA 3ORJA 4N53B 2DYCA 4XUQA 2UY8A 5AC91 3T4HB 1QDCA 5SV5A 2ZEZA 4B4RA 3ZFEB 3WP6A 2YYOA 1N1TA 4WM7C 4XFFA 1W6NA 2C4XA 2XKPA 3GDBA 3OUHA 1QOSA 2D6PA 1ZA7A 4K7JA 1GUIA 4KGGA 4NAOA 4BE3A 1EAH3 4P02B 2FMYA 1YFXA 4Q27A 5C9AA 4UYBA 5J96B 1WWYA 5F2SA 3LD8A 3S7IA 5IHRA 5L73A 1O4ZA 1POV0 1LJ7A 3VKNA 4QX1A 4YM1A 1BBT3 1Y3TA 3MFCA 4XHXA 1H2KA 2WLPA 1RMU1 2DUOA 1QJX2 2ZGNA 4UXAA 1H8TA 2QQUA 3FFZA 1UN1A 2J1TA 3ILRA 1R083 5FZFA 3B93A 5JMOA 3SXWA 3W58A 3K46A 1VRBA 2Q8CA 4Z07A 1BLZA 5F32A 5IVBA 3AZVA 5L7OA 1PM7A 1LECA 2E31A 3ZXAC 1CAWB 3A0KA 2NYYA 5EPAA 3TEYA 1JYXA 4XJAA 4B4PA 1G9DA 3VZNA 5FY8A 4UOJA 1QOOA 2CWMA 4KWKA 5A33A 3UJQA 1C5HA 1F5JA 5DAQA 3OBTA 1LGNA 5F6LB 1DQ4A 1AJOA 4X8PA 1YFUA 1ZBA2 1HRV3 1JOJA 1C8M2 2GZWA 2JXAA 3DEMA 1Q5OA 2RS33 3HAGA 3POJA 3R4UA 4RHV1 5IVVA 4YG6A 5LY1A 4BQWA 4R9BA 3JXSA 3POFA 4EE2A 1W06A 4HN0A 1BZWA 5FIXA 5FK8A 5AVAA 2LALA 4YZ1A 2A3XA 2VZSA 1YJLA 1RIRA 1RUG3 1VB4A 2W08A 3NV2A 4K8RB 1F4AA 1H4HA 3QD6A 3R4SA 4GULA 5F5QA 5KXCA 5F8PA 3UGHA 4X6QB 3O1MA 2E26A 1R1A2 1MEC2 1ZZ6A 5I91A 1GZTA 4OYUA 2P4EA 3DPRC 3WW1A 1FMD2 2YXSA 2ZKNA 1NT0A 4D3WA 2ZZQA 1H2MA 1ULDA 3KF5A 4TYSA 4AGRA 4M3CE 4Q0PA 1UYYA 4QX8A 3IB3A 2JB8A 5A7SA 5IFPA 3EJKA 3WG2A 3ZYBA 3A0NA 1IPSA 4PIYA 1RUI3 4META 1ND2A 3JU9A 5FUIA 3HIFA 1M4WA 4M01A 3RMYA 2P6HA 3WR0A 4AHXA 5LK7B 2UWCA 2BW8A 3P1IA 2ATFA 1SACA 4XACA 4CSWA 1QJU3 3VBHB 3J8F2 3SMHA 4AI1A 2VOXA 2CDOA 2ARBA 4XUPA 3VBUB 5EWSA 3AL6A 4HG6B 3WSOA 2BGOA 5A1FA 5FMCA 1OQEA 2VE1A 1AR71 2IVJA 4FFIA 4CDWC 2WINB 1OURA 1LOAA 3ZR5A 1PHMA 2NZ9A 1DDLA 2Q1FA 2JE8A 4LLOA 4QXHA 2W92A 1H9WA 1OUSA 2GMEA 2JJ6A 5CFDC 1IHMA 1E5SA 1TVGA 2BTVC 4COZA 1POV1 4YSFA 1Y9MA 2WN3A 3EQEA 4Q1PA 2WNEA 5FOJB 1ND3B 1O4TA 2RMU2 2NLRA 4YYOA 2BFUL 3SITA 1QEXA 3HVDA 4Y26A 4CEYA 5BNNC 3ZN6B 3K77A 4QHZA 1FNZA 5CISA 4AHYA 2PHDA 5A3MA 2P37A 3WINE 2VMDA 4CCKA 4YZ5A 2CHHA 5AC92 4XUOA 2GNDA 1DQ5A 1J3RA 2J1SA 3S5QA 2CAUA 4KWJA 5T52A 3T2OA 2PA7A 3N7MA 2WNUA 1KEXA 2BRTA 4PF1A 3KS7A 5BNPC 1W6PA 3GM8A 3BU0A 3K3NA 1V00A 4GB33 2XXZA 2Y8KA 2ZGUA 1ZVFA 4A45A 1C1LA 4EROA 4Z8BA 4JHZA 5C3PA 4JC1A 4HPKB 3AKTA 5I0SA 1A6CA 2ZMKA 2VUAA 3VL9A 1UU6A 2O1QA 4MVTA 1UU4A 4PQQA 4CDQA 4EZ4A 2XOMA 2GN7A 1U5XA 1X50A 3APBA 1W3XA 4C91A 5LEJA 3MF6A 4CP9A 2VZ1A 1HRI3 1YLLA 1RMU2 2JKXA 3MHZA 2ZKLA 4FPCA 3FHIB 5GZFA 5J09A 3K4AA 3ATGA 3LDRA 2VBPA 2CGNA 5GLZA 4CXXA 3VD7A 5I93A 1ZZ7A 1NCQA 4UAPA 5CYYA 3RWKX 1UY4A 3IKWA 4UF0B 1RUF3 3RJRA 5I8SA 3UESA 4DS0A 3B9IA 5A6ZA 1O8PA 2XJVA 3ZXFA 3T0DA 2ENRA 2XB6C 1S0EA 5FYBA 2WJSA 3AMQA 3BN6A 3LZZA 1OD3A 1LHNA 4TN7A 4XJUA 3OGJA 5I0TA 1LOGA 2ARCA 1UOFA 3T0AA 4FPGA 4LBLA 4LXLA 4Q4W1 4RFT0 5ABJB 2OXBA 3C7HA 1S0CA 1AL0G 2WNOA 4IV1A 1F31A 1UKRA 2BNNA 4RHV2 1B35C 1C4RA 3AYEA 5T55A 5FTTC 4PF5A 4BQXA 4GXLA 5F9TA 2NQYA 2BBVA 2Y38A 2ZGKA 1AYM3 4I3GA 5C71A 4BK4A 2PAEA 5JIUA 1HB4A 2VW2A 3L2HA 2R0HA 2VXRA 3ECQA 3ZFGB 4QPWA 3BOWA 1N47A 2YY1A 4CUCA 2CAVA 2DBNA 2OX0A 2R1BA 4NHXA 1I6XA 4XDOA 2GNBA 2VULA 3AP5A 4YVSC 3X29B 4DOUA 4AK3A 1SCRA 1NCRC 3WHUA 3ZN5A 1J3QA 4PIXA 4AHWA 2HWD1 2BJSA 4FXKB 1W6MA 3N9MA 1JHNA 4D7SA 1CVNA 2MNGA 3UKVA 4K6BA 1DGRN 1R1ZA 3ZO0B 5DXDA 5F3GA 1CQ9A 4GIQA 5FKBA 2ZX3A 4IUGA 5FDBA 5LA1A 3DPRA 1WW4A 5AFEA 4AQTA 5FWJA 4EN7B 3IPVB 5F6KA 3I3MA 1W9WA 2G19A 3SH3A 4DNYA 4ET7A 3T08A 2SLIA 4KBBA 3THPA 3AKQA 4FPYA 4FOQA 4QQLA 3MIFA 1U5YA 1AR72 1SLIA 1W6QA 3C7GA 1UY1A 5FYCA 3WHTA 3ZR6A 2ETEA 4EN9B 4Y1VA 4AI8A 2RS11 4ONUA 5DZFA 4RS5C 1LOBA 3HNYM 5C3QA 1YQ6A 5KXBA 1JOPA 4ASLA 2ID4A 4IL7A 3SC7X 1HLCA 2VZQA 1HN1A 1V9U1 3H8RA 4D69A 2MEV1 3WW4A 3RFRA 4J1XA 2JEMA 3USSA 4XMIA 3WG4A 3AL5A 3MEPA 2B45X 1A8MA 2GSYA 3CO2A 2V4VA 4XXPA 3U75A 2HWE1 3C7OA 3AP7A 1DG6A 3A4UA 1S2BA 4GA9A 2AR6A 4BXFA 1W6OA 4TTGA 2XUEA 3BTZA 4FPKA 1DYKA 1XJAA 2VZVA 5CA6A 4QQ2A 3VUOA 1N3QA 3PUHA 4Q8LA 1RUD1 1G6NA 5IK5A 3H0OA 3LIHA 1W8NA 2QTWB 3OY8B 3JCIA 1QGLA 4DUWA 2JDNA 4FCAA 1ALYA 1DZTA 1IS4A 1D0GA 4N43C 3WDXA 1Q8QA 1SEFA 2AEZA 2R063 2ZGMA 4GWJA 4EZHA 1Q56A 2BGCA 1XXNA 4BHPA 4K1YA 2R071 5LB6A 3KGLA 1OOPA 1QMJA 5CADA 1OHFA 1O6UA 2J1AA 5IW0A 4PHZA 4YVWB 1OF4A 4BQ2A 2A3WA 1QKQA 2E7AA 2VCMA 4QPYA 5J7MA 2W1WA 1IPKA 5T3NA 3R0RA 2GMMA 3VZOA 4CCJA 3O1TA 1RUE1 3SKJE 3LA7A 2VZRA 2A5ZA 1SDDB 4WM7B 5FZEA 4RR3C 1LAJA 1MS9A 1Q8SA 3FL7A 2QVSB 4LE3A 2HYKA 4Q2FA 3SH4A 3WY6A 5JSRA 4KH9A 5D8AB 4U2AA 3WT3A 4CUAA 1KS4A 3BU7A 2BUKA 3UJOA 4HK9A 4O9GA 1PNGA 3VZLA 1UWWA 2GDFA 2VUJA 3KVAA 5DUVA 1AVBA 3VBOC 5CFCA 1WA4A 1JZ4A 2I2SA 2LROA 4N9IA 4YZ3A 1S55A 1LGCA 1PX4A 2DVBA 2H0VA 3KZ4C 4E8DA 4OI1A 1EAH1 1UPIA 1AR63 1OKOA 2KM2A 2RR13 1DQ0A 2WA4A 3OYWB 4XF9A 4Y5SA 4CU6A 5A6QA 5LZ6A 4DXTA 1IKQA 1H1IA 1UYZA 1YI7A 3GHMA 2A6ZA 3H42B 4K8FA 3RDIA 3AFKA 2A71A 1BBT1 3DV8A 4Y22B 2JDAA 1PIV3 4IEXA 4O65A 1GOHA 3NNLA 5C8CA 5L19A 5FPLA 4COVA 3B7MA 5LRRA 4KWLA 1R081 3W59A 2WNVB 1W9TA 4P9JA 3VN4A 1EUTA 3FUOA 3ROUA 1C3HA 4EWAA 1VMFA 2HWD2 4NO4A 3ZPOA 3U07A 1DP0A 4UWDA 1C57A 2AREA 2P6CA 4KG8A 4CCOA 1LOFA 1VAKA 1QNYA 2XWJB 4NIDA 2YV8A 4QB2A 2HWB3 4B7EA 5FY4A 5HCAA 4CTEA 1RJ7A 3SEPA 4A42A 1CX4A 2IVIB 2JG8A 2PYTA 3RI9A 1ZRCA 1NCRA 4LBQA 3W21A 4O61A 1XC6A 2JB4A 5B4NA 1HRV1
chains in the Genus database with same CATH topology
5BNOB 3ZFFA 2RS31 1MS0A 4ITCA 4MXWA 1Y7BA 1CN1A 3FWEA 4CEWC 1APNA 3CU7A 3I54A 4GKYA 2GALA 1BKZA 1RUG1 1F8VA 4COWA 2RS12 3ZXLA 3DUIA 5JMCA 3ZXJA 2O8OA 1V9U2 2WL1A 4I3PA 2MEV2 2VQ0A 3TNQA 4MLOA 4OFGA 4ES9A 2CYFA 2Z79A 2DVFA 2HWE2 4CDXB 3VBSC 1VRH3 3ZSMA 1RUI1 2ZGTA 2ZGRA 2HEWF 1V6IA 4CDWB 1UKGA 1QXPA 1S0DA 1RUD2 1QJU1 2VMGA 1TMF3 5FREA 4WM8A 1XQNA 1RGSA 1DQ6A 4BLJA 2XBO3 1LGBA 4XF3A 2HEYF 1EPZA 3I7DA 3CJIC 2ERFA 4Q0SA 2R072 3QBQA 3VBRC 2PHXA 4RD7A 3SLIA 1IOAA 3FJSA 2IXIA 2IXKA 2FZ1A 1RUE2 3ZXKA 2AZ5A 3WQ1A 3RS6A 1AR83 4PJYA 1NA1C 1QH6A 4IV3C 4H3WA 3B9CA 1KS5A 3I2DA 4AFAA 1KDKA 1G9BA 1G9CA 3V0BB 4XBLA 5CU1A 4CDUC 3ZX7A 2AYHA 1SBDA 1MS4A 4QQOA 5KXDA 2ZHNA 4IEWA 4RR3A 1GICA 3VKMA 4GB31 1W39A 1LR5A 4XF1A 4XZPA 3H9AA 1EAH2 4LBNA 4BPZA 1QDOA 1OSGA 2YGMA 1LCLA 3ACLA 1BBT2 1W2UA 2HWC3 4RQPA 5AFBA 4JGYB 1MZEA 3M4FA 1PGL1 1HRI1 2WT0A 3AJYA 1V6KA 4GQ7A 5L36A 5K0UA 2GC0A 1YRZA 5K7PA 4MGYE 3ZMOA 1R082 1GFF2 2CV6A 2R49A 2ZPXA 4Q26A 3B02A 1RUF1 5A32A 2JKBA 2D93A 3UKNA 5BUVA 1NYWA 1I1EA 1QHDA 3PHMA 2ZX4A 3ES4A 3SHRA 1YJKA 4K1ZA 3HT2A 1IZ3A 5C9AC 1Q8OA 3ILNA 2ILMA 4XEZA 4ISRA 4PDWB 1G9AA 1GYKA 3MF9A 1HRV2 4Q4W3 4LHLA 2RS32 3BB6A 3INAA 2WFPA 5CBLA 1RTVA 4HZFA 1H8TC 4YVSB 4F8AA 4JDOA 5HCBA 3ZFEA 5KHGA 3MIBA 1AYM1 1RUG2 2E6VA 4XTPA 2AENA 5L7OC 1Z7S3 5LK5A 1LHOA 3POWA 1WW6A 5FMOS 4ATEA 1VB2A 3VL8A 3KQRA 5B2GB 4CEWA 3V64A 3KCYA 1A3KA 1ENQA 2Q5TA 3FC0A 2PLV3 1NQDA 4HVOA 4Q4V3 4D7YA 4R9DA 5BY5A 1RUI2 3AXEA 4G3YC 5GALA 5GZCA 1ZNPA 3AMMA 5H9QA 2WWSA 2V73A 4UBHA 4FQ4A 2OW4A 5JWPA 2BVVA 4HMZA 4RS5B 1QJU2 3LSEA 2VW0A 4EN0A 5FPXA 2KXLA 2XJUA 1XYNA 3JB4C 5GLVA 4ORFA 5BV6A 4YFWA 4LA2A 3Q9OA 2GC1A 2XHKA 1RJ8A 1D4VB 1GZCA 2IFRA 5T5LA 2ZBJA 5DDJ3 2DCJA 3ZXEA 4EWEA 2CL2A 2P2KA 1ZREA 3L9JT 2O8QA 1ND2C 2I45A 3PLQA 5JI7A 1RUOA 2VECA 2PHLA 3MIEA 2OUJA 1KQRA 1S0JA 3VBRA 1SLBA 1J3PA 2VW1A 3RI8A 3OD4A 4V1PA 1GNHA 4XE9A 1LTEA 3AJZA 3WDVA 4BM8A 2QDRA 1H9PA 4GB32 5JI9A 1NLSA 4IV3A 1SBEA 4XPVA 4XXAA 2R061 1L3JA 4HKOA 5JR7B 3SCFA 2CGOA 4AVCA 3QACA 4WVWA 4QXKA 3GBGA 2C5DA 1PGL2 4FTSA 1HRI2 3WP3A 1CESA 3VBUA 1VBC3 3D0JA 1G7YA 3TYJA 3VBOB 3B01A 3PVOA 3U10A 4A2UA 1RUF2 2B7YA 2JG9B 2YHJA 1EPWA 1FT9A 1KXGA 3EBRA 4I01A 2WSUA 4BZ4A 3VV1A 4FSJA 3LOIA 3PTYA 3LKJA 2D5HA 1O4YA 2BNOA 3M3OA 3RPQA 4CDQC 2NM1A 3IDEA 4E2SA 3ZSEA 3JQXA 4GKXA 1U12A 3U4XA 3ZN6A 5JSPA 3ME2A 2WZR3 1NZCA 1RHI3 5JOWA 1AR61 2RR11 4JTOA 4FPEA 4JQRA 2TUNA 2D6OX 5J48A 4NR1A 1VALA 1NCQC 1QJZA 1AYM2 2V5YA 1Q8PA 1PIV1 2V09A 1PVC3 3MPPG 4PLNA 2NMNA 3AYDA 1UAIA 3AKRA 4YNIA 3E5QA 4XQ4A 1DYPA 4HPKA 2IXLA 1SLLA 1KD7A 2UY9A 2JE9A 2FBEA 2D7FA 2ZTNA 4N7IA 2GC3A 4IV1C 4QM9A 2UYAA 1XRUA 1Z0HA 4QGNA 2HWB1 1H8VA 4Y1ZA 1M06G 5C6CA 4XETA 5H9PA 1VBE3 5EYYA 4JV4A 1F2NA 1NE6A 1O3TA 1REEA 4EWDA 2Z5WA 1YFYA 3KT4A 3AM2A 1UU5A 4OVEA 4OZXA 1OLQA 1H0BA 2LM3A 3H1YA 3N7KA 3MPBA 4FPOB 3O14A 4SLIA 3I59B 1QOTA 2ZGLA 2EXIA 1XU2A 2HEVF 3R05A 1O91A 1XE8A 2ZHMA 5T5PA 3DN7A 4M3CB 4XJZA 2GH2A 4R4XA 5I8YA 2CY6A 4ZU7A 1VRH1 2E7QA 3E6DA 3WOGA 4COYA 4OHWA 3E97A 4OUSA 4AHZA 3VGIA 3KMHA 1U5IA 4QMAA 3O0WA 4FOYA 4XFIA 1MZFA 1TMF1 2XKOA 4AGGA 3AMNA 4HK8A 1BYHA 1AJKA 3WW3A 2D98A 1PK6C 2JDZA 2XBO1 2VPVA 4YRDA 2R062 3WCRA 3JBG3 3ZXDA 4H7LA 4LNVA 4EJRA 5FO9B 3NJZA 1O7FA 4IEPA 3SISA 3KLSA 2YROA 3HQXA 1VLNA 2P3KA 1JYIA 2D6MA 5HCFA 1VBB3 3IPVA 3SNMA 4Y1UA 4P14A 2GU9A 3ZYIB 2VOKA 3H3UA 2EXHA 4P9GA 4JGZB 4QM8A 5FQ0B 1AX1A 3VDDB 4BIFA 4ZKTB 4IEYA 4WV8A 3RNSA 1AR81 1DGWA 4YGCA 1WLDA 4PLMA 3HMYA 3CNAA 3U0ZA 5CIRA 4FOWA 4WVMB 4JVAA 4F83A 2A3YA 4TLFA 3V56A 2WT2A 4R4ZA 3EO6A 1LU1A 3VBFC 1OOPC 1WMEA 1YIPA 1BJQA 4XF0A 1HKDA 1PVXA 2XVLA 3FLRA 3WXPA 2D6KA 5GJ6A 4HFSA 4QU2A 2B46X 1AR62 1OQDA 2RR12 4AVAA 1MQTA 2D5FA 4GH4A 1WMFA 3WDUA 4XF4A 2A73B 2PHWA 3HR9A 1QQP3 2HWC1 1PIV2 3ENRA 3POYA 4JDMA 3OF1A 3LA2A 1XNBA 4MGZE 1URXA 2P3JA 3NKGA 1SCSA 2H6BA 5CFCC 1D2QA 3MIDA 1LENA 5K8SA 5J36A 5C4WC 4YVWA 1LHVA 3E5UA 2IZWA 4UW3A 1UPSA 1CAUB 2BFUS 2UWBA 1S1AA 4LBMA 2P34A 4ZU4A 5KC6A 1LKNA 4COUA 2HWB2 1RC6A 3DL3A 3ZSJA 3ES1A 4QPGB 5L7OB 4UW5A 2ZX2A 4Q1RA 1LB2A 1TME3 2QZ2A 2WZPP 5C8CC 4Y5Z0 1CIWA 3AX4A 4NPRA 5D8AA 3TWIA 1MR5A 2CNAA 5E1RA 4YG0A 4LUMA 1N3OA 4MGIE 1Z7S1 2W39A 1PGW1 3NAPB 2I07B 4AFCA 4NVPA 1T6GC 1LOFC 4IEOA 3S6PA 2YPJA 1YNAA 1HQLA 5DUWA 3EXUA 4MV2A 3TRSB 2W52A 4HSLA 5IK7A 4AI3A 2JG8C 1ULGA 2PLV1 3VZJA 1C1FA 2SBAA 4N7UA 4S2GA 3TB0A 4Q4V1 1XNKA 3ZFFC 1DQ1A 1VRH2 4GWMA 2DV9A 4MGKE 5ACA3 2R30A 3FLPA 5EXOA 5FLHA 1I5ZA 4ZXKA 1FV3A 1MZ5A 3UL2A 2C0ZA 1XYPA 1Y43B 4ZU5A 3WQ0A 2WNVA 4LTAA 4A7YA 2DUQA 4I0BA 1TMF2 3WD5A 4GMP3 2VQAA 4QPIC 4XBQA 2WSVA 4IQPA 2XBO2 4LO6B 1WBLA 4HL0A 1UD1A 1WCSA 5DDJ1 2VNOA 1RL3A 1HX6A 5BXXA 1CAVA 1WCKA 4LT5A 4LO8A 4J1WA 5JLVA 5EJ3A 3JD73 3LWCA 5JZGB 1PK6A 4F3JA 1QF3A 3AFGA 4KNCA 5JDBA 1DFQA 1AR82 3OPZA 4R9CA 3AP9A 4YGDA 2XJTA 4E4DX 3GHNA 1WW5A 4LBQD 4WM8C 3USUB 2D43A 3AZWA 3LOBA 1LRHA 2PELA 3M2MA 4KGQA 3GBWA 1ZRRA 2NPIA 4CEYB 1YUDA 3BODA 1OKQA 3N36A 4Y20B 4PIZA 2X5IB 5JCTA 4ISQA 4QQHA 1RUNA 1WLCA 1K5MA 4XJ9A 1SBFA 1I3HA 1RINA 2RS53 3HT1A 2PQQA 2I74A 2WNUB 3GF6A 1DU3D 1W6PB 2K2SA 2HWC2 1OA3A 2PHFA 3VBFA 1XNCA 4S2FA 3ZSLA 3WZ1A 2EVXA 4YW5A 1WCDJ 4GALA 1PO23 1VBC1 4AE2A 1TQ5A 2VU9A 4LHNA 3D0SA 3J9SA 2ZMNA 2D40A 1AL23 4J6GA 4GWNA 1UZYA 1NY71 3RZZA 3JUUA 2Z69A 2W68A 3KB5A 3BOPA 1NE4A 2YMZA 1DLLA 5KHJA 4FQZA 4RQPC 4Q4W2 2WZR1 1RHI1 1S2KA 5C4WA 2DWRA 4LBJA 4P9LA 4YLZA 5K0UC 1MS1A 3E5XA 3W9AA 3V0BA 2JICA 1V6JA 4L8QA 2XL9A 1YYNA 3WDWA 3G6JB 4C1XA 2K9ZA 1S0BA 4KU7A 1Z7S2 1PVC1 1PGW2 4B4QA 4KU8A 3ZIWA 1ENRA 2QCSB 1PZ7A 1AXZA 2UU8A 1IKPA 4PBOA 2PLV2 4BIOA 1IS5A 2ES3A 2FHRA 3ZMNA 4Q4V2 1ZBE3 1G8WA 3GYDA 4C0HA 1VBE1 3ZFEC 3IBMA 3NL1A 4K3UA 4KQ7A 4M3CF 5KWRA 1GANA 3ZSKA 1OLRA 2AGSA 3N7LA 3MYXA 2XUMA 4AEJA 3FFQA 4UW6A 2DTYA 1FX5A 2JENA 4R52A 4IEVA 3FX3A 4AFBA 5BYNA 2G9FA 2XJPA 5J3UA 1H2LA 3DPRB 3GBFA 3VHPA 5DDJ2 1VR3A 4OHVA 4Q29A 2QUOA 5LRSA 4NHMA 1AXYA 2WFF3 3IDCB 4PDWA 5EZWA 3P3PA 4Q4X3 4QPIA 2ZA9A 1W6QB 1RUH3 3MFAA 3FBYA 4QGMA 3R6SA 3CEWA 1WUVA 3DF0A 3RMXA 4DZGA 5KHHA 2E63A 2OVUA 2OUHA 3L2YA 3BALA 3RYPA 4I09A 3T1MA 2X29A 1VBA3 4FBFA 1MZ6A 5CFDB 1YXWA 1FI2A 2AH2A 5IK4A 1W6OB 5FCCA 3JBG1 1W0OA 4P9IA 2GAUA 3B94A 1UZZA 1RUJ3 1X8MA 1VBB1 5IUQA 5BNNB 3AP4A 4I2OA 4C1WA 4H55A 4HSJA 2VOWA 1ASJ3 1VBC2 1S0IA 5DZGA 1UF2C 1NG0A 4H14A 1D0HA 1OOPB 2YZ4A 4FAGA 1YCIA 3OTFA 1O3QA 5IT6A 3VKFC 5BNPB 4NHLA 2Q4SA 2EF6A 1FAYA 1LOCA 4QD2A 3M7AA 4HBNA 2DTWA 2LTNA 1NY72 3BTAA 4GMP0 4O9EA 2ZABA 1HW5A 1COV3 1BK1A 4D94A 1RVF3 2A6YA 4Y1YA 2XGXA 4QT6A 3VBHC 2WZR2 1Q3EA 1RHI2 4Z2WA 2ET1A 3VBUC 1CJPA 2UURA 4INDA 2FQPA 4N9HA 4FOVA 3WDYA 2B42B 2E51A 1QQP1 3POSA 1F9KA 1PVC2 2OIIA 4AEDA 1IQAA 3WCSA 3B00A 5H9RA 2D3RA 3D6EA 4XOGA 1PZ8A 2WA3A 3V0AB 1C5IA 1OPMA 4W6WA 1GZWA 1ND3C 2BEOA 2ZHKA 1BXHA 5GLWA 5I8TA 3B69A 4W6YA 4AEMA 1B35B 3VLBB 1CPMA 4YW1A 4XFGA 2XJRA 1VBE2 3ETQA 1GZ9A 4K20A 1CPNA 2WS93 1TME1 1VAVA 4IERA 1J58A 2RM23 3M70A 5GZGA 2XLAA 4YM0A 4FAHA 4N53A 4YM2A 3PVNA 1N1SA 1NCRB 4LBQB 2ZJCA 2QFEA 4Z92B 4YW2A 3ZFFB 3GZTB 1DGWX 4E2QA 4XFBA 4OHXA 2R16A 2DVGA 3FZ3A 2Y0OA 2JD4A 4FXGB 3MI8A 4JCKA 2JE7A 4RGAA 2WQ4A 3M3EA 5JOYA 3E6CC 1JTZX 3MLJA 3AZXA 1XU1A 2QQPA 2ZGQA 5ACA1 3D5OA 4OI0A 1IS6A 3WQ7A 5JOXA 4FTBA 2GN3A 1YHFA 5CB7A 2DCTA 1CAXB 4GMP1 3UV9A 5E16A 5ABJC 3HWJA 4DFSA 1OA4A 2O0OA 2VH9A 1WLWA 2WIIB 4LO5B 3T2TA 3JBG2 1QU0A 2GH8A 2R0FA 1CAWA 4KG0A 3TOJA 2YGLA 2ZMLA 1ENXA 1NOVA 3OGGA 1B09A 2DUPA 3ILFA 4LA3A 4MZUA 3WLUA 1VBB2 3LAGA 3AXDA 4L97A 3PVEA 3MW4A 4LE4A 2HWF3 3JD71 4XJ8A 2ZZJA 1SQ4A 2Z42A 4R8HA 2VGDA 4LBOA 2P17A 2XVKA 3J26N 1JXNA 4XFHA 2D3PA 1N3PA 5GZEA 1J1TA 1CR7A 1SLCA 5HXVA 3QOPA 4N43B 4Q4Y3 2B39A 2RE9A 3AZZA 1VBD3 2GC2A 4AWDA 1DHKB 2FZ2A 3GALA 1OPOA 4OULA 4MXVA 4AVBA 3RJ2X 3WVJA 2PAKA 3GNEA 3IDBB 4K21A 1ZRDA 1QXRA 3DGTA 4BLIA 4IEQA 1KRIA 2RS51 3BPZA 4LO4B 4NN0A 1U5ZA 4RR3B 3UK9A 1QQP2 1R093 4XBNA 4B3NA 3QH6A 4KL1A 3VBHA 1PO21 1XNDA 4XFAA 4AFDA 5I0RA 2D44A 1SFNA 3BCWA 2EXJA 3GZAA 4OI2A 3KSCA 1D4M3 4YGBA 1H30A 3RYRA 1AL21 4FT8A 2G4IA 2QJVA 4XIKA 1ULCA 4OLLA 3PMSA 1MQTC 4DRRA 4WZFA 1FPN3 5KHIA 4E9KA 4GH4C 2Y0IA 4XTMA 1JBCA 1GKBA 3VDDA 5A32B 3O5SA 2YUEA 1ND3A 1TME2 2ZS6B 5IK8A 4JDNA 1UMZA 2C1FA 4N90A 2LUWA 4WVMA 3FBMA 1LESA 2CTVA 1OA2A 4C90A 4XMAA 3MLKA 4YVWC 4E27A 5JAXA 2DU1A 4I0AA 1YI9A 4A7ZA 5T5JA 5JSOA 4YW4A 4QGLA 2DFBA 4CYDA 1CGPA 3WW2A 1O5UA 2OZJA 1OFSA 1ZBE1 3VKLA 1VP6A 3HN1A 3NO8A 5ACA2 5D8AC 3D82A 3TN93 4CEWB 2WKKA 1DGLA 4YZ4A 1E57A 3SH5A 1WGPA 3QH7A 5FLJA 1SDWA 2PTMA 4PQ9A 1ONAA 4PBPA 2DVAA 3RYKA 1CAUA 4F7ZA 1KDMA 5EFUA 1AYN3 4E4ZA 1S0FA 3HD8B 2A7AA 4FPFA 4SBVA 1JN2P 1ZZ9A 3N35A 2WFF1 4QPGA 4HVRA 4EV0A 4BCUA 3NV4A 2NN8A 3QCWA 4YFZA 5JOZA 2VMHA 3VBSB 3JD72 5ABJA 4YG3A 4Q4X1 1J59A 1V6NA 2CGPA 1RUH1 4AYUA 3RSJA 2TNFA 5GZDA 1UW8A 2WNVC 5J37A 2ZGOA 2ZACA 2E7TA 2IXHA 5HI0A 4BMBA 1AX2A 1YWKA 5AVPA 3O0XA 1PO13 3NAPA 2B8MA 5LEKA 1S0GA 3ZFGA 3ZN4A 1HV1A 3PNAA 2PFWA 2VVFA 3CJIB 1QY4A 3WUDA 3CF6E 3H7JA 5DZEA 3N7JA 3VBRB 4M0HA 2BPA2 3H8UA 1VBA1 5BNOC 3FLTA 4ASMB 1DQ2A 2RS52 4LHKA 3WP5A 1RUJ1 5CG9A 1WLTA 2E53A 1F5FA 4XQDA 1OMIA 1G86A 1NA1B 3ST7A 4IV3B 3C2UA 4LR4A 1X8EA 1I9RA 1MACA 1ASJ1 1PO22 4CDUB 3S0MA 1DZQA 1TE1B 1HXS3 1FYUA 3WV6A 1WBFA 2D6LX 1LULA 1TNRA 3V65A 1AL22 4HN1A 4OHYA 4CDXC 1MS8A 1KITA 1K5MC 5JZGA 1COV1 5D1IA 1MVQA 1QH7A 3M3IA 2Q30A 1RVF1 2Z2SB 1EYBA 1IGOA 5T5OA 4BQ1A 1QJY3 3GZUC 2ZGPA 1FOD3 4I02A 4URTA 3USUA 1EV13 1HV0A 1UIJA 3MW3A 2VNRA 1GQHA 4AF9A 1W0PA 1AR93 1W6NB 4E4SA 4Y20A 3FMGA 5FOBB 4XYXA 2X5IA 2MHFA 3OY8A 5C33A 3P3NA 5C9AB 4G9SB 4YM3A 3WNXA 5H9SA 3H50A 2R043 3B5LB 2GNTA 4L92A 2WC2A 4HANA 1UCXA 4AEKA 1QXJA 2DU0A 1ZBE2 1G9FA 1QNWA 4RA0A 1BEV3 2UYBA 3M8LA 1H8TB 1JYCA 4AFMA 3R4DB 4DB5A 1LODA 2D97A 5FLIA 3VZMA 4HLTA 2WS91 3QLQA 3MGUA 4WM7A 5FFOC 3MZHA 2DF7A 2JX9A 4FP2A 3AYAA 2RM21 1AHSA 1OFNA 4YW3A 1H1AA 4HKWA 4MSVA 1FATA 3NSTA 3KT7A 4M0NA 5EV7A 5A33B 2NMOA 2MPFA 4U36A 2WFF2 2TBVA 1RUC3 4MYEA 2QNKA 4JGYC 3WX5A 4Q4X2 5BNQA 4P9WA 1X7NA 4AVSA 2YDEA 5JPNB 1RUH2 1ZRFA 3S7EA 1AF9A 3OYWA 4B29A 4W65A 4L9BA 4EN6B 2W0XA 2VG9A 4Y22A 1QWRA 1PNFA 2Q1ZB 4XDQA 4CP0A 2VNGA 1SLAA 4K9SA 5KC5A 5FPZA 5GLUA 3VKOA 4DY3A 1PMIA 4PDWC 1VBA2 1D2SA 3LGRA 1Q43A 5K9YA 2H0BA 1ND2B 1JW6A 1ZYBA 1QJX3 4JRLA 5KHKA 1RUJ2 1ULEA 4IETA 1U0AA 2HWF1 1ENSA 4Z1VA 1ASJ2 1O3SA 5BNOA 1JH5A 3TNPB 1JUHA 2OYZA 4AW7A 4Y4YA 1KJLA 2UWAA 3S30A 2ET7A 2D3SA 2BQPA 1ZBA3 4Q4Y1 1C8M3 3SCHA 1A78A 3KT1A 1COV2 1HDKA 2PAMA 1VBD1 4FO9A 3MIHA 1RVF2 3LB9A 4FPHA 3JQWA 3VHOA 3ZYRA 3T1LA 1NXMA 2DCYA 3LSDA 1IPJA 5DUUA 3WG3A 4LEJA 5TSWA 4BOWA 3RG0A 4FPJA 2R1DA 3N3HA 3WG1A 5EYXA 4CDXA 4AI0A 3M3QA 1R1A3 1MEC3 1UIKA 2VMIA 3PJYA 4BH9A 1FMD3 3CLPA 4CDWA 3H3ZA 4XFCA 1R091 3AMHA 1XE7A 4LUKA 1MQTB 3NVCA 5CFDA 1MVEA 4GH4B 3WUCA 3VZKA 4HVQA 3DKWA 3CL1A 4CDQB 1D4M1 3E6BA 1BMV1 1KFUL 2IXJA 3OBRA 2XL7A 3WP4A 5BNNA 4CP2A 2PHRA 2N7GA 3ZYPA 4TZDA 3J8F3 1FPN1 2PN5A 4RSUA 5E89A 4AVTA 1AZDA 4UBGA 1NCQB 2EALA 2R32A 4TSVA 2B5HA 1YFWA 1YO8A 5HBAA 4MX3A 2WS92 2IWGB 5T50A 4S2HA 5BNPA 2P3IA 4AEDC 1GV9A 2G9GA 1RB8G 5KBFA 2RM22 3WDTA 3ZYJB 1Q8VA 1AUYA 3RRDA 4X6RB 1NLRA 3MW2A 1UL9A 5DUXA 5FO8B 4FTEA 3IT8A 1CJDA 2RMU3 4IV1B 1AX0A 3JZVA 5JVVA 5KXEA 3AKSA 5T54A 5AC93 5FBZA 3ZVXA 3JB8A 2QE3A 4BA6A 2JG9C 3VHRA 1NXD1 1GLHA 1FNYA 3K48A 4XIOA 3TN91 4YZ2A 2ZHLA 3AYCA 4JGYA 3U11A 4N53C 4OHZA 2WQZC 3V0AA 1IS3A 1DIWA 4HKLA 1SFYA 1REFA 4XJWA 4PLOA 2DFCA 3RQ0A 2FMDA 2R6QA 4B8EA 1W6MB 1N1YA 4AGVA 3EHKA 5CVRA 1AYN1 1B35A 3VHNA 1OD5A 4LBKA 3O0VA 4WVZA 1RMU3 3PVBB 4W6XA 1LU2A 1ULFA 3BIWE 1X82A 4QX5A 1ZZBA 4Q0VA 4DPNA 1C8NA 4XQWA 4IEUA 1AXKA 2XLGA 1MS3A 2HWF2 4XHBA 2AUYA 4G4FA 3O7OA 4CP1A 4P5HA 2Q8OA 1CAVB 2WT1A 4YVSA 3H1WA 1BVVA 2VVEA 3PJQA 1HQWA 4YGEA 1PO11 4AQ2A 1PZ9A 1LHWA 4Q4Y2 1PK6B 5DG1A 4RHV3 2QZ3A 3H1MA 3MIGA 1VBD2 1JUIA 2K0GA 4L2NA 4LO7A 1NQJA 3AMPA 4TWTA 1GR3A 1SLTA 3AK0A 2XJQA 5F1RA 4NOTA 1FXZA 1V70A 2A6WA 3IN9A 1EY2A 4RL7A 4DY5A 4BWOA 4DINB 5FAXA 1YIFA 2EA7A 4WZCA 2OA2A 1R092 2XH6A 3N4MA 1REDA 4NWWA 3AZYA 4R9AA 5I0UA 5GM0A 4YARA 1CAXA 2B9UA 4RS5A 3M3CA 1C28A 3K51A 1K5MB 1V6OA 1LEMA 5JIAA 1OI6A 1DZRA 1HXS1 3ZDSA 1WD3A 4NWVA 1BQPA 4FVVA 4XW3A 5GLTA 3VBFB 1D4M2 1BMV2 4JAAA 1A8DA 3ZYGA 3NWKA 3NKTA 4JTNA 3ELNA 2ZOEB 1RITA 2IFWA 1V6MA 3H7YA 4UW4A 4WVVA 1CONA 1WD4A 3IMNA 5GKAC 1FPN2 2XJSA 1ZZCA 5BPXA 4DMIA 3M1HA 4JRAA 4AQSA 2A6XA 4QHBA 1AR73 1O5LA 1QJY1 2EIGA 2Y26A 2XPJA 2PHTA 1FOD1 2CWSA 2QDNA 3KCCA 4PCRA 4MH0E 1V6LA 4C0BA 1EV11 1ZX5A 4N43A 1POV3 4IXLA 5SV8A 4WBBA 4CZSA 5CFCB 4K40A 4FP3A 4IESA 1ZM1A 1BCXA 1AR91 1GNZA 4M00A 3HBZA 5C4WB 3I4IA 1EP0A 2X53S 2RJLA 2GNMA 1FV2A 4H7MA 4AVVA 4Q8KA 1PGSA 2ZX1A 4JGZC 4NHKA 2R041 3VDDC 5DG2A 1DGRA 4RGGA 3CJXA 2ZX0A 1BEV1 3B3QE 4D7TA 5C8CB 3TN92 2TEPA 2BYVE 4E2GA 3OD0A 4S2DA 2ZCWA 4AI2A 3SCGA 4P9YA 2GMPA 2A6VA 3VBOA 4B7KA 2VY0A 5FMOL 1GSLA 1HQNA 2XWBB 2YC0A 2JG9A 3J4UH 5CG8A 1AYN2 1H1MA 4DRVA 2E9QA 3AKPA 1HIXA 3MDPA 2JG8B 3LA3A 2BVBA 2BNMA 3ASIA 4Z82A 1RUC1 2ARXA 4EN8B 3THTA 5A3LA 4L11A 1TEIA 1UX6A 3ZXGA 3KCXA 2VOVA 1GBGA 4MXWB 4OUMA 1OQ1A 2Q1MA 2DCKA 3OJBA 3RWNA 1VIWB 2X8KA 1PO