1OFNA

Purification, crystallisation and preliminary structural studies of dtdp-4-keto-6-deoxy-glucose-5-epimerase (evad) from amycolatopsis orientalis; the fourth enzyme in the dtdp-l-epivancosamine biosynthetic pathway.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
202
structure length
202
Chain Sequence
MQARKLAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMSKRGVVRGIHYTVTPPGTAKYVYCARGKAMDIVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGHAFVALEDDTVMSYMLSRSYVTQDELALSALDPALGLPIDIGVEPIVSDRDRVAITLAEAQRQGLLPDYTTSQEIERRLTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PCZA361.16
publication title Purification, Crystallization and Preliminary Structural Studies of Dtdp-4-Keto-6-Deoxy-Glucose-5-Epimerase (Evad) from Amycolatopsis Orientalis, the Fourth Enzyme in the Dtdp-L-Epivancosamine Biosynthetic Pathway.
pubmed doi rcsb
source organism Amycolatopsis orientalis
total genus 51
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ofnA00
5C6CA 4QX5A 3RYPA 2GC2A 4KU7A 4XFAA 2UY9A 2BNOA 4N9IA 4MZUA 4FBFA 2QVSB 1IPJA 4ORFA 1VR3A 3GBFA 4J1WA 1CAVB 1J3RA 3MPBA 2CAVA 4IEQA 1CAXA 2XKPA 3KGZA 1SEFA 4L2NA 3NSTA 2D5FA 3I7DA 1RC6A 2PFWA 3I54A 4MGYE 5FCCA 4XFHA 4XFBA 2MNGA 4EWEA 2ET1A 4AXOA 1O7FA 5KHKA 4E2QA 4META 2B8MA 4AVAA 1O3RA 2CAUA 4ZU5A 5LRSA 5I8TA 3FHIB 3PNAA 4IEYA 4BIFA 2H6CA 4Q0VA 2V09A 1O3TA 3GYDA 3HT2A 1ZZBA 1J58A 3OF1A 2Y0OA 1DZTA 4PIXA 2BYVE 4IEXA 3QACA 1LKNA 5BXXA 4UBHA 5I8SA 5JR7B 3H50A 4MH0E 1HW5A 1YWKA 5FLJA 4EWDA 2QCSB 3RYRA 2XLGA 2XL7A 4I02A 4IEUA 5FLHA 3UKTA 5BV6A 1LRHA 2VPVA 1RTVA 3H9AA 5I0RA 2KXLA 1X7NA 1X8EA 3IWZA 4R8HA 4IEVA 5FQ0B 2UY8A 3KMHA 3ZDSA 4LUKA 4BH9A 4HZFA 1RGSA 3E6DA 5J48A 1H1MA 3H7JA 3NL1A 4XF9A 4J1XA 3QOPA 2Q30A 1ZZ8A 4AVBA 5CADA 3BCWA 4CYDA 3UKNA 5LEJA 4MGKE 3ELNA 2BNNA 1VJ2A 4X6QB 4Z07A 4HMZA 3G7DA 1UCXA 2BNMA 3IBMA 2B9UA 4X6RB 3LWCA 1Y3TA 2EVXA 3KSCA 1Q43A 5I0SA 3OGJA 2E9QA 5EFUA 3M70A 4F8AA 4LA3A 4PIYA 3D0JA 4Q29A 1NE6A 1ZZ9A 1UPIA 4IETA 4O9GA 1LB2A 1QXJA 2GAUA 5BY5A 4GULA 3C3VA 4BHPA 4QM9A 1EY2A 3LOIA 4EWAA 1GQHA 2GC1A 2C0ZA 1YFYA 5I8YA 1WGPA 1CAWB 2DCTA 1RUOA 3RDIA 2OA2A 1ZNPA 2F4PA 4E2GA 1I6XA 1YFXA 4Q0SA 3CF6E 4XF1A 4D7TA 1YHFA 1CGPA 4HSLA 3HQXA 4EV0A 1ZRFA 2VQAA 2WFPA 3B02A 1J1LA 4IEZA 4YARA 5KHJA 1ZRRA 5FDBA 1EPZA 4LLOA 3FZ3A 2BGCA 3KGLA 1OD5A 1YFWA 2BEOA 2IXKA 4L11A 1QY4A 2IXCA 5I0TA 4FAHA 4WZCA 1PMIA 2XGXA 2EA7A 2UYBA 5FPXA 4XF4A 3E5XA 4YSFA 2ATFA 5C8WA 4N9HA 3UKVA 1ZZCA 1NXMA 2PAEA 4MX3A 4JTOA 2ETEA 2D5HA 4EROA 5J3UA 1UIJA 4KU8A 4HSJA 5JSPA 4AVCA 1O3SA 2Q1ZB 3WW4A 4XF0A 4O9EA 3U0ZA 3FE5A 4R52A 4XFIA 3I59B 1O3QA 3OTFA 3NJZA 1CAUB 3LZZA 3BPZA 1EP0A 3L2HA 3BB6A 4HLTA 4I3PA 1DGRA 3EJKA 5T3NA 1I5ZA 1WA4A 4QGMA 1Y9QA 4QM8A 4QGLA 3FJSA 3DV8A 1UW8A 2IXIA 2Q4SA 3RZZA 5F1RA 5FLIA 1OI6A 2Q0AA 4HVRA 3S7IA 3NW4A 3E6CC 3IIAA 3DKWA 3HIFA 3S7EA 4IESA 1CAXB 3BU7A 4AQ6A 1O5UA 4OLLA 4D7SA 1CAVA 5HI0A 1ZVFA 2QNKA 1OMIA 1QXRA 4IEOA 2O1QA 3FFQA 3LA3A 1FXZA 1Q5OA 2CV6A 4PIZA 3CL1A 1YLLA 4AQ2A 1H1IA 3JZVA 3RYKA 2ZCWA 1ZZ7A 3H3ZA 4YYOA 4Q0PA 4DINB 3SXWA 2O8QA 3N4MA 1Q3EA 1J3PA 4XFGA 3D82A 3USSA 3E5UA 4I09A 4FT8A 2XLFA 2PHLA 3FX3A 5CVRA 5I0UA 5BPXA 5CU1A 4IEWA 3CEWA 3TNQA 1PM7A 3EQEA 3WW3A 4I01A 2XHKA 4I0AA 3ES1A 4IERA 4QMAA 2D40A 3DN7A 4A2UA 4HVQA 3LA7A 4LUMA 4LULA 2MPFA 3SMHA 3H1YA 2GH2A 2ZKLA 5EZWA 1ZRCA 2QJVA 2GC3A 3D0SA 1RUNA 1GQGA 3ST7A 5E1RA 2OYZA 3SCHA 3E5QA 4XEZA 1QWRA 1SQ4A 5LRRA 3LA2A 1NYWA 4RD7A 4XFFA 1NZCA 5J7MA 3MYXA 3EO6A 5FPZA 3SHRA 1VP6A 3MDPA 3VHRA 5KHGA 4LEJA 4YNIA 3R6SA 5LEKA 4PJYA 2IXLA 2QDRA 3E6BA 2GC0A 4UBGA 5FQ0A 1DZRA 3PLQA 2MHFA 4E2SA 3CLPA 4F7ZA 4KL1A 3CJXA 1TQ5A 1UIKA 2UYAA 3ROUA 1FT9A 3OD0A 2IXHA 2HKXA 3FWEA 2OZJA 1ZZ6A 2IXJA 4XETA 2PTMA 2K9ZA 2XL9A 1ZX5A 4MGIE 5I91A 2IC1A 3ES4A 1O5LA 4HN0A 2WC2A 3RPQA 3U10A 3LAGA 3SCGA 3ETQA 4Q0QA 1X8MA 1LR5A 1SFNA 2FQPA 2PAKA 5JCTA 4Q0UA 1UD1A 3DL3A 1XE8A 5JSOA 1L3JA 5JSRA 4HVOA 4HBNA 1IPKA 1YUDA 3NKTA 2XLAA 5I93A 1YFUA 5D1IA 1CX4A 2OZ6A 3EHKA 4MGZE 1J59A 4MUVA 3WW2A 2P17A 4H7LA 1WLTA 3NVCA 5K8SA 5JAXA 1CAWA 5E16A 3H8UA 1U12A 2CGPA 1NE4A 4LA2A 2FMYA 3EBRA 4KWKA 5AVPA 4KWLA 2XKOA 4HN1A 2PQQA 4P9GA 4XFCA 3H1MA 1XE7A 2I45A 4ZU4A 2GU9A 4I0BA 4K8FA 3TNPB 1DGWA 2GZWA 2H0VA 1X82A 1RL3A 4JVAA 3WW1A 1G6NA 4UXAA 3O14A 2OPKA 3H1WA 2EAAA 4XF3A 2B5HA 3ACLA 4QGNA 5KBFA 1ZREA 4IEPA 4I2OA 3H7YA 4NVPA 4BYYA 3H3UA 3OCPA 2D93A 3SCFA 5KHHA 1JUHA 3S0MA 1EYBA 2VECA 3M3IA 4JV4A 3E97A 3CO2A 4WBBA 4FAGA 2H6BA 3U11A 3HT1A 1J3QA 2PA7A 4JTNA 2PHDA 1ZRDA 5BUVA 3IDCB 1OFNA 1V70A 2PAMA 2Z2SB 2HJIA 2K0GA 3KCCA 4TLFA 4ONUA 4YRDA 3MZHA 5KHIA 3RNSA 3I59A 4Z82A 2Z69A 1XRUA 2N7GA 1CAUA 3PVBB 3BALA 1FI2A 4KWJA 4MV2A 1O4TA 4B29A 3IDBB 4OFGA 4QXKA 4LTAA 2PYTA 4WVZA 4ZU7A 2ET7A
chains in the Genus database with same CATH superfamily
1W6PA 1JZ8A 4QX5A 1SLBA 4KU7A 1LOFA 4EZ4A 1WUVA 1DIWA 1AR62 4Z8BA 2R063 2RVAA 1BXHA 4LO4B 5JXGA 1UYYA 2MEV1 4DS0A 5DZGA 1G9CA 3BVCA 3WF0A 1IPJA 4P9XA 4GIQA 4KWUA 1ODNA 1PZ8A 1XC6A 4GWIA 4ZZ8A 1BEV3 1PNFA 1R091 3NV3A 1Y43B 2R49A 3R4SA 4MHUA 4PHZA 4Y20B 4IEQA 5HPOA 4BLIA 3N35A 3MLKA 5F3CA 2BUKA 1E5RA 1MS8A 1NT0A 1BBT1 2GNTA 3BIWE 5FCCA 5HV4A 5FPAA 4XFBA 2ZJCA 2MNGA 2X5IC 1O91A 2AEZA 2DTYA 3JU9A 3MIHA 3LD8A 1LODA 1CX1A 1O7FA 1CZSA 4MYEA 3ZDVA 1JOBA 1MACA 2JG8B 4META 3T0AA 4BU2A 4DXSA 2B8MA 2ZGMA 4MXVA 3WG2A 2AACA 1C4RA 2CAUA 4PI2A 2P34A 3WNOA 4ZU5A 4DQAA 5J36A 3AKRA 4L92A 4XQ4A 1BMV1 2ZGOA 5CKQA 3T1MA 4OCTA 1PMHX 1XYNA 2H6CA 4YPJA 4XVHA 4L99A 2R32A 1AXYA 1CESA 1R1A1 2D6NA 4PT6A 3H3LA 4D6SA 4NAMA 4YG0A 1J58A 4RYDA 4BQ4A 1M4WA 3ZN6B 2Y0OA 4K20A 4CCOA 5DAWA 1X36A 2BQPA 4YLZA 3JBG2 2BYVE 3POWA 4XJZA 3QACA 5JI7A 3VBFC 1OPOA 4B4QA 3AM2A 3AXEA 5EJ3A 1QJY3 1WLWA 5I8SA 3EMRA 2DCYA 4LKSA 5JR7B 1AR93 1CJPA 1A6CA 1OUSA 1W9FA 5GJ6A 1DYOA 2YBKA 4NHLA 3GZUC 1S0GA 2ZZQA 3HR9A 3Q8AA 1YWKA 3KCYA 4Q4Y2 5FY8A 5DAXA 3U14A 2G19A 2GMPA 2W9XA 2XLGA 3WEZA 3T1LA 3WQBA 4ASKA 1NOVA 5IVBA 3MF9A 3W59A 4GH4C 5FLHA 1RUH3 1K12A 4Q4V2 1BVVA 1LRHA 2QQIA 2R043 2QQJA 4QPIC 1REEA 1WCSA 4M4PA 1UKRA 5I0RA 5C33A 2KXLA 1W6OA 2RR11 4W65A 3GZAA 2ZTNA 4Y1UA 1S1AA 3TWIA 3GZTB 1AR71 2NMOA 3NJVA 1R081 5BNPA 3J8F1 2DU0A 4XACA 3I49A 4Y4YA 4BH9A 2XBO3 1S55A 2HWD1 3BTXA 4MXWB 2Y6GA 3LIHA 4J1XA 3QOPA 2IVIB 1AVBA 3I3BA 2DF7A 4JGYB 1ZZ8A 1PVC3 3VD7A 1W6QB 1REDA 2K2SA 3UKNA 2JENA 1ND2B 2VE1A 4XC9A 3OPZA 1IS3A 4X6QB 1JMUB 3QCWA 2FD8A 2LS6A 3ZMOA 1GNZA 4HMZA 1AR61 4AEDC 1UCXA 2BNMA 4V1PA 5L9VA 5T5JA 2B9UA 1MS1A 5A33A 3A0KA 1JZ2A 2J1EA 2YBPA 3I97A 3OY8B 5FYVA 3WG4A 5ABJB 2EVXA 3ACIA 4LHNA 1VAKA 4XIKA 4A45A 4AEMA 5GZGA 1D4M2 3MBWA 3M70A 3GGLA 4ATEA 2BDRA 4UOJA 2F17A 5IWFA 4LKDA 3D0JA 3MUY1 1RUJ3 4RL7A 2DCKA 5LA2A 4K6BA 3VBFA 3AMHA 4CCDA 1RUG3 3KV4A 2R30A 4IE6A 1HXS3 1F2NA 3LFMA 5F39A 3ZR6A 1S0BA 3UGFA 4BQWA 3C3VA 1N3PA 4BHPA 3ZFFC 3T09A 1UN1A 1EY2A 1LOCA 3RJRA 3LOIA 1FPN2 4NHXA 5HBAA 1CJDA 2Y8KA 3ZN4A 2RS53 2R7EB 3ZVXA 4GH4A 1MS3A 3NAPB 1ONAA 1ZNPA 3JB4C 3SITA 3BGAA 1GZ9A 4CDQB 3CF6E 4LLFA 1GFF2 2WNEA 1S2KA 4TXWA 1YHFA 5SV8A 1CGPA 2JJ6A 4FPCA 4HKWA 3J9SA 1YQCA 5FZOA 3UNPA 4UYBA 4L0PA 2R6QA 3O12A 1W9TA 4IEZA 5JLVA 1NCQC 1MQTC 1CZTA 1JOJA 4FPJA 3TAYA 2ZX1A 1ZRRA 2CTVA 2AENA 3JBG1 2ZOEB 3UK9A 3LGRA 2YG0A 3AMNA 4EN9B 4AI3A 1UY1A 5FYTA 2W87A 2ZAHA 4FPKA 4XBNA 5I0DA 5JPNB 2VQ0A 4Q4Y1 2W1UA 4HFSA 4WZCA 2D3SA 5ANQA 1NQDA 5T50A 5C8WA 4DMIA 1ZZCA 5FO7B 3VZLA 4AEDA 4ZKTB 2P4EA 1ZA7A 4HL0A 4EYUA 1Q8SA 1ND3B 4Q4V1 2RS12 3U37A 5JIAA 5FZCA 3RMXA 1LECA 4QAWA 1RHI3 1F9KA 4RFT0 5F3EA 5J3UA 5EHDA 2BPA2 3AP5A 2WSUA 1DFQA 3NJYA 1COV2 5JSPA 2ID4A 3KT4A 1W99A 3INAA 2Q1ZB 1GYKA 2BU9A 2KA3A 1YJLA 2ZHLA 4NPRA 3WW4A 3WZ1A 5K7PA 1HB1A 1G9BA 3FE5A 4XFIA 3I59B 3UESA 3ZFFA 3BPZA 1YYNA 4Y5Z0 1VMHA 1JZ3A 3L2HA 4RHV2 3OGSA 4HLTA 5AC92 3VUOA 3BTZA 4XUQA 5T3NA 3TEYA 4QGMA 1NA1B 3UETA 4QX8A 2NMNA 1VBC3 2YPJA 4NOTA 3MIFA 4QM8A 4YFZA 3WR0A 1WD3A 3DXUA 3FJSA 3DV8A 4YZ3A 4DPNA 3HPNA 5C4WC 1HB2A 5FREA 1PO13 2JDNA 1UW8A 2IXIA 2Q4SA 5H9RA 1HKDA 2RG4A 3H42B 4LNVA 3X29B 2VAUA 4MLOA 1OI6A 3B01A 1QJX2 2B45X 2Q0AA 3ZFEC 1D4M1 3AZZA 4JGZC 3WLUA 1NCQA 1MQTA 3S7IA 1IKPA 1XSQA 3I2HA 5GLVA 4LO7A 1N1TA 2NQYA 2Y60A 1F35A 1GSLA 1VBD3 2D6KA 3V0BB 3HIFA 3DCQA 4LHSA 1CAXB 5DAPA 1QEXA 4CDWC 4OLLA 1CN1A 3LEIA 3ZIWA 1V6MA 3EXUA 2TEPA 2QNKA 1OMIA 5C5UA 1EUUA 2O1QA 1OH3A 3ZM8A 3PVOA 2DVAA 1A78A 1DQ4A 1W3VA 1FPN1 3ETPA 1AF9A 3C8XA 4DEVA 1S0EA 4C90A 5A7QA 2A73B 4CP2A 1C57A 1UKGA 1XE0A 3RGBA 5K4LA 2QFEA 3DYOA 2A6WA 3LEKA 3WNXA 5F3IA 4F83A 4AL9A 1H1IA 2PHFA 1PIV1 3ZSKA 4L8QA 3GXUA 4QPGB 4D3WA 3VV1A 2P2KA 3JCIA 2ARCA 2ZCWA 1XNBA 3H3ZA 1HV0A 1VBA2 3ZXGA 5CAZA 4E8DA 4XUTA 4Z2AA 3O1OA 4DINB 4M3CB 1N1SA 2O8QA 2JKBA 5FR3A 3OB8A 4NIDA 1W39A 1J3PA 1DQ2A 4C1WA 3V0AB 2XB6C 4LBNA 2TNFA 2VCCA 3BTAA 3IPVA 2P3KA 5CVRA 3JD72 5CU1A 1GLHA 3N3HA 2Z79A 4MGQA 1DU3D 1OBNA 5GZFA 4UW4A 3ECQA 4EZHA 1PM7A 3EQEA 3GCWA 2QQVA 1UL9A 1CVNA 4I01A 4YGDA 3WW3A 2XHKA 3J8F3 3MLLA 4Q8KA 5F5AA 2XHNA 5IFTA 4QDQA 1DCSA 2R062 1UZWA 4QMAA 1W03A 1YC61 4YM2A 4A2UA 5DMYA 3AZVA 2JX9A 2HWD3 3K77A 1FATA 4LULA 2MPFA 4XAEA 2GH2A 3QD6A 2VVFA 5GLUA 1WW5A 3RWNA 5C4WA 2QJVA 1UOFA 4I3GA 2RS11 1LU2A 1ZRIA 1GQGA 1BEV2 1U5ZA 3HN1A 5G05L 4YG6A 1PGSA 4AI9A 4XEZA 5FYMA 1HQWA 5LRRA 1UPSA 3ZFEA 3GZEA 2VMHA 3LA2A 3P5BA 4FFFA 4JGZA 3SISA 2D3PA 1X9TA 4MGSA 4PLNA 1COV1 3SHRA 3IAPA 1JH5A 2HBUA 3VHRA 2WR9A 4CDWA 1JYWA 4OI0A 3VD9A 1SG3A 4YNIA 3R6SA 5LEKA 2GMMA 2VTXJ 2IXLA 3LEMA 5DPNA 2G9ZA 4FQZA 5FY0A 4J25A 3VBUC 4PLOA 2MHFA 3CLPA 2WO3A 1BKZA 4B7KA 3FLRA 4RHV1 4XPVA 3ROUA 1K5MC 2ZHNA 5AC91 1WCUA 5FP7A 3OD0A 2FDHA 4CCLA 5C5TA 1QDOA 4AFMA 3AKSA 5FFOC 3C7EA 2PTMA 1V0AA 4ET7A 4MGIE 1JS9A 1UMHA 1LGCA 1DP0A 1O5LA 3ES4A 4HN0A 2JD4A 2GN7A 2YDEA 3RPQA 2ORXA 1F5JA 1W9YA 3BU0A 1QJX1 2LM3A 4M0HA 2WO1A 3ETQA 4CA9A 5GKAC 4IE4A 2Q8CA 5DUUA 1LR5A 1AR92 1JU4A 1WMEA 4Z1VA 5J96B 2QQLA 5FZ7A 2CL2A 4Q0UA 3DL3A 3VZNA 1RIRA 3MIDA 3MV01 3VKOA 2WQ8A 2QQUA 3MLJA 1L3JA 1LULA 4YZ5A 3GNEA 1WZXA 1UU5A 2BVBA 1IPKA 3NKTA 3ZSLA 1XYOA 5JIUA 2UWBA 2E53A 2R042 4JZRA 1POV1 1QJFA 3GF6A 5I93A 4ZZ5A 4K9SA 5HCBA 2ZGRA 1IS6A 2VZVA 2HWF2 4AGRA 3N7KA 1J59A 2P17A 3PL0A 1UZYA 2AYHA 2C9KA 2CDOA 1CD3G 4H7LA 1X9PA 4X8PA 1GWLA 5GLZA 4COVA 4NRPA 1GANA 5K8SA 4PBOA 1SBEA 4CDXC 2JXAA 3IIIA 3H8UA 1U12A 4QHZA 4RGAA 5LK7B 2JDUA 2GALA 2XBO2 5JZGB 3WF1A 1GZWB 4QX2A 2HBTA 1GNHA 4KMQA 1S2BA 3EBRA 4Q4W2 4YVWC 4HN1A 4OMCA 2WNVC 4XZPA 4E27A 1PVC2 5KR7A 3KD4A 2VULA 5FUPA 4I0BA 4P02B 3RS6A 1VBB3 3JD71 1C5HA 5FYHA 3VL9A 4IV3B 3VBUA 4NPLA 4DXRA 4QQOA 5J37A 4BLJA 1QKQA 1XU2A 1MEC3 2JIJA 1K5MA 1G6NA 2R061 2YC2A 3SEEA 2ZBJA 4Q1RA 3WHUA 2RE9A 2WLQA 2ZXQA 4GA9A 4CUBA 3BUCA 1ZREA 3F95A 3KS7A 1HB4A 3N9MA 2ZGTA 3BPSA 3LDBA 4ISRA 3SEPA 4CCKA 3H7YA 1BEV1 3VBRC 4BYYA 1J1TA 3H3UA 3OCPA 1LESA 1RUJ2 3HAGA 4WZFA 2ZGSA 5FP9A 1CIYA 4E8CA 5IFPA 2QQMA 4TLGA 1GWMA 1RUG2 5BNNB 4FTSA 3CJIC 1OPMA 1OVSA 3I3QA 4JV4A 3K4ZA 5FXWA 3VD3A 4CUCA 4HK8A 4N43B 3RZLA 2NM1A 4FAGA 3WDTA 5F5IA 5A1LA 1C8M3 2PA7A 1ZRDA 3JB8A 5BUVA 3IDCB 1LGNA 1V70A 2LROA 3KCCA 1AHSA 2HJIA 3POJA 1RUE3 2X53S 3POEA 4A6SA 3U4XA 2Y6KA 1JUIA 3ILFA 1CIWA 2BW8A 3PDQA 4JRLA 4YRDA 2C24A 5JR2A 3SQOA 3MZHA 3HJRA 3RNSA 4KH9A 2N7GA 3OYWB 1CAUA 3PVBB 4G9SB 4KWJA 5L73A 2VMFA 4GJYA 1O4TA 3RZMA 2XOMA 1LNSA 1BK0A 3RI8A 1HN1A 4RR3B 2RV9A 4YGEA 4V2WA 3PUIA 4CDXA 1XPWA 2ET7A 1V9U2 1OSGA 3RYPA 3B5LB 2GC2A 1H4HA 2UY9A 3AMQA 1UWWA 1W8FA 4N9IA 2WZR2 4U36A 4YVWA 3WDVA 2J1SA 4FBFA 1PIV3 2WNVA 4YW1A 1AR91 3POBA 5FZIA 1SZBA 1RMU3 3J7HA 1NXD1 3AP4A 2KR2A 5IK8A 2WYFA 2VZSA 3WP5A 3AFGA 1XOYA 1J3RA 2KD7A 3VBSC 3B69A 3GBGA 3MPBA 2CAVA 2WQ4A 1QH6A 4KGGA 3HNMA 4PDWB 2OW4A 1TZOA 4XXAA 2ADEA 3KGZA 1BZWA 1RUF3 2R041 4L2NA 2VG9A 2GDFA 3POIA 3ZLIA 3IMNA 2R073 3I7DA 1RC6A 2YHJA 4KNCA 4XOGA 4FTBA 4WM7C 4MGYE 2HWF1 4ZXEA 3WCSA 4EWEA 1POV0 4IGOA 3SH3A 4UF0A 5ANNA 1B35B 2RMU3 4AWDA 3VBRA 3Q8BA 2VZUA 3LSEA 5DDJ3 1O3RA 1T2XA 3K75B 1O6UA 2XBO1 4UFKA 5KXBA 4K1YA 1W6NB 3CJIA 2W94A 4C8DA 1W8TA 5I8TA 3FHIB 3CDZB 1YEWA 4A7ZA 4Q4W1 3J4UH 2PHWA 1YXWA 2Y26A 2P1BA 3PMEA 4LIVA 4UT5A 1PVC1 1YI9A 2SBAA 2VW2A 1ZZBA 1ALYA 4OI1A 3LIGA 4W6YA 1C8NA 4PIXA 4WVMB 3AJZA 1AYM3 1VBC2 3ALQA 4Q27A 1F8VA 3ZYBA 5JOZA 1L7QA 4IEXA 3RZHA 1V6NA 1CR7A 2JECA 2Q5TA 5EJZB 5CIRA 1PO12 4QKDA 1X33A 3H50A 3WDWA 3O1MA 4QHOA 2W92A 1XB9A 2NP0A 4LITA 3LPFA 1CQ9A 4QPWA 2HEVF 2QCSB 3RYRA 4QT6A 2XL7A 4I02A 1WBLA 1VBD2 1RUJ1 4LQRA 5BV6A 3TEWA 1MZEA 1W6PB 3CMGA 1AX1A 4P5YA 5F8PA 5IATA 5L7OC 1RUG1 4BWOA 3I2JA 1W3XA 1RTVA 2CNAA 4DO0A 5KXEA 5FBZA 5LA9A 4QU1A 3P3PA 1X8EA 5DN2A 3D3AA 3VBHB 4BK4A 3AZYA 5LWBA 3THCA 2UY8A 2VMIA 4LUKA 1XJAA 3H8RA 3I2KA 5CBLA 4HZFA 1SACA 2P37A 4LE3A 4FOYA 4DZGA 2DUQA 5DAQA 1SBFA 3H0OA 3ZKYA 3NL1A 4XF9A 3R0RA 3VKFC 3U75A 2A6YA 4LO6B 1YRZA 1H6YA 3NNMA 4JHTA 2FCUA 2ADDA 4CEYA 1G9AA 2A7AA 1UF2C 3E1F1 4MGKE 4BISA 1DZQA 1V9U1 5A32B 4N53C 5FY7A 1SPPB 3VDDC 4RQPC 5FOBB 1LTEA 1PX3A 4ARYA 1W9WA 3JQXA 2WZR1 1S0FA 3IBMA 4X6RB 4NJ4A 3HEIA 3IT8A 3MIBA 3ITQA 5JOWA 1Q43A 5T5PA 5A3UA 1SLCA 1D7PM 2TUNA 3C2UA 3A21A 5BNOB 1KFUL 3N7JA 4IXLA 4CXYA 1O4ZA 3ACGA 4Q29A 4YVSC 5E6HA 4TZDA 2V4AA 2UURA 1DGLA 2A3YA 1WW7A 4LOTA 1LB2A 1QXJA 5A6YA 5HV0A 1VAVA 1H2LA 5EQUA 1MZ5A 2Y6LA 4WM8C 2FZ1A 2PLV2 3K46A 1ZA4A 2XJUA 3IMMA 1UY3A 1S4CA 1JZ5A 2PELA 3AMPA 5I8YA 1VIWB 1WGPA 2DCTA 2OIIA 3PURA 4YZ4A 1LHNA 3NV1A 5L7OA 2I74A 2OA2A 2F4PA 4V2VA 3AKPA 4AEKA 3ZOIA 3AL6A 3D8CA 2Y34A 2J1UA 2OX0A 2YB7A 3PUHA 5HCFA 4COYA 3KB5A 2VW1A 1ULCA 1ZBE3 5DAVA 2DUPA 2ZGLA 5F5QA 5KXCA 2QUOA 4NMIA 4CU9A 3I4IA 2DYCA 5DQ0A 4JKLA 2VQAA 2WFPA 1QMJA 4INDA 3TN93 4YWAA 4GB33 1PK6B 1OA4A 1VBC1 4HPKA 5BNPB 2NYYA 1RUD3 3OBAA 4IUGA 1Y9MA 5FUIA 5EV7A 5FXVA 2X05A 1RUI2 3ATGA 1PO11 1S2EA 3QH6A 1STMA 2AREA 4L11A 4PF1A 2IXCA 3ZXDA 3PVEA 2ZMKA 1UX6A 3VBOB 4AEJA 4N53A 3MIGA 5FPXA 1JZ4A 1W28A 4XF4A 3E5XA 4Y1XA 3VDDA 2W46A 1AX0A 1VBD1 3ZKUA 3HD8B 4I0WB 1I9RA 3WP4A 2R0HA 1QHDA 4XILA 5DUWA 3Q8FA 2J22A 4MX3A 4M0NA 1HQLA 1YIFA 4JTOA 1PZ9A 1I5PA 1NLQA 2JG8C 1ENSA 2JDMA 2R1BA 4LO8A 4EROA 3K51A 4NWVA 1IHMA 2WO2A 4HSJA 4YVSA 4AVCA 1BQPA 4OUEA 1JYTA 3RSJA 3FLPA 1W6MB 1UY2A 4WVWA 2VOWA 4KQ7A 2XJRA 3S5QA 3OTFA 5CFCB 2DBIA 1KS4A 3ABZA 3LZZA 4KG0A 5FK7A 5FYBA 1GNYA 5B4XA 4C0BA 4UI9L 4IV1B 1YCIA 2Y6FA 4AYUA 4QXCA 4CCJA 1I5ZA 1Q56A 3VKNA 1EUTA 1EPWA 3J7MA 4MSVA 5FYCA 3OOXA 3RG0A 1SDDB 1OF3A 2HWF3 1VBB2 1F5FA 3ZN6A 2VZQA 3VZOA 4NRQA 2DURA 1MEC2 5LBCA 5F6KA 5FYIA 2FDKA 1WCDJ 2QKDA 1IQAA 2B42B 4XCBA 1W8NA 5A6ZA 5CFDB 3DF0A 3NW4A 3HOBA 5FZOB 3E6CC 1D0GA 4Q4X3 1SFPA 4UFLA 2ZMLA 4Q4W3 4XQDA 2ZZJA 5CG8A 2ZHKA 5H9PA 3BU7A 3AYAA 5FJKA 1NCRB 1O5UA 3THTA 2YV8A 3WDUA 4AQ6A 2X5IA 3MEPA 1OURA 2GNDA 2WZ8A 3Q9OA 4FPGA 4Y20A 3OD4A 4A41A 3T4VA 5LBBA 1IS5A 5FO9B 1VMFA 4DB5A 2EF6A 1OFSA 5C9AB 2PLV1 4C91A 3WF4A 1XNCA 2CV6A 1V6JA 5ACA3 2VTXA 1BVP1 3OUJA 2YPDA 3T08A 1Q8VA 5JPMB 4LBKA 4KGQA 5FP8A 4AQ2A 1CWPA 3LE0A 3PU3A 2FDGA 2ZKNA 2E32A 2OVUA 2WNOA 5E88A 4EE2A 4JGYC 1C8M2 4XMAA 2VZRA 5HXVA 3VL8A 3ZPOA 1ZM1A 3MPPG 1JHJA 1ND2C 3RYKA 1ZZ7A 1RUE2 1GOHA 2EXIA 2JG8A 4NHKA 2RJLA 1SLIA 3P1IA 4XJWA 2PMWB 1Q8PA 4AVTA 1W2OA 4G3YC 1Q3EA 2DWRA 3NNGA 3J7NA 3B7MA 3D82A 3POFA 5ABJC 3I8TA 5JDBA 3CZJA 1RJ7A 5I0UA 3U78A 3D6EA 2FDIA 2PHXA 3O1SA 5E89A 4IEWA 1RUI1 5A3NA 2FHRA 3IDEA 5FZLA 2H0BA 3MFCA 4I0AA 4XTMA 4LR4A 2WAOA 1MZ6A 4JDMA 1RXGA 2D40A 3AZXA 3DN7A 3FUQA 3O7OA 5F3GA 4A7YA 3HQUA 1PIV2 2VO5A 3LA7A 4QPIA 3VKLA 2X10A 3WY6A 5A80A 5A7WB 3H1YA 5FZEA 5EZWA 1RMU2 2UWAA 1RUNA 4YFWA 1UYPA 3H8OA 4JDOA 5E1RA 1V6OA 2GNBA 1QWRA 3ZYJB 3NAPC 2QZ2A 3T2PA 1V9U3 1A3KA 3MW2A 4RD7A 1RUF2 1W06A 1PHMA 4QX3A 4D6RA 4CDQC 3USUB 2R072 3O0WA 2OQ6A 5FOJB 1DBNA 1QJU3 2WZR3 1Z0HA 1VP6A 2R16A 4R9CA 3WVJA 3OGRA 1HLCA 2RMU2 4PJYA 2C4XA 2QDRA 3E6BA 1EV13 5DDJ2 1DZRA 4IGPA 4OQ8A 4F7ZA 3WQ0A 4AHYA 2GP5A 2XG3A 2YC4A 1DG6A 1TQ5A 4HETA 3ZSJA 4RS5B 4MXWA 2BWCA 1PM4A 3IB3A 4YW2A 4XHXA 4B1LA 3KVAA 1AR82 1K5JA 4JGYA 5FY1A 1D2SA 3FWEA 1W6QA 2W68A 2ARAA 4QKNA 1UNBA 1ND2A 3Q8EA 2K9ZA 1VBB1 2XL9A 4Y5TA 3SH4A 5LZ6A 2ZGKA 3NNJA 4K8RB 4P9WA 5F2WA 4LT5A 2AH2A 4OHYA 1AYM2 1MEC1 2WC2A 3ZFGB 4R4XA 3U10A 5A3LA 3IZOA 4L97A 1UXXX 1ND3C 3N9NA 3A22A 5FTTC 1PGW2 3WT3A 4DFSA 5ABJA 1QGLA 2BOIA 1YQ2A 1YNAA 5JCTA 1UY0A 2J7MA 2J1AA 5APAA 4Q26A 4EJRA 2FMDA 2VMDA 2WWJA 1LOGA 4CDUB 1KXGA 2EAKA 3OGGA 1TE1B 4XBLA 4Q2FA 4XTPA 4NIAA 1QJEA 4HVOA 2V73A 1YUDA 1RUC3 1KJLA 1JW6A 1CZVA 3MUZ1 2E7TA 1H2NA 1GV9A 2TBVA 2A71A 4MHRA 5C71A 4DIQA 1R1ZA 4MGZE 2QDNA 5FZ8A 4OHZA 5FYYA 2SLIA 4MUVA 4XUOA 1LGBA 4NE9A 1H0BA 3WXPA 2ZGUA 1C8M1 4CP0A 3AB0A 4CP9B 3NVCA 3MI8A 2P3IA 4XBQA 5EWSA 3WDXA 5JAXA 5E16A 3PUAA 4LXLA 1RUE1 1S0CA 1NE4A 3C7HA 1NA1C 3U4SA 4LA2A 4CDQA 5AVPA 4P00B 4JCKA 4JHZA 3U07A 1ST8A 4W6XA 2WZEA 3C7GA 1JTZX 3RVHA 2GU9A 2LALA 5CYYA 4FI9A 2VMGA 4NN0A 3UJOA 1HRV3 1YQ8A 4H7MA 4AFAA 2H0VA 1X82A 4BQ3A 3ZR5A 3KV5A 5FYZA 1US3A 3WW1A 3J26N 5KC5A 4A6OA 1KDMA 3KVBA 4OHVA 3O1RA 4XF3A 4Z2WA 1PGL2 4QGNA 3WUDA 1RMU1 4E9KA 3MIEA 4IEPA 1UU6A 3TEZA 3WSOA 3SCFA 2BTVC 2IWGB 4TSVA 4XXPA 2XDVA 1ND3A 5GLWA 1RUF1 5F5CA 4PQ9A 3MV11 4QPGC 4O65A 3W20A 2R071 1KD7A 2CYFA 1US2A 4DUVA 2H6BA 4Y1ZA 3U11A 4QQHA 5C3PA 4JAAA 4FOWA 2P5BA 2RMU1 3WINE 3PIJA 4XHBA 2A6ZA 4CU7A 3BIEA 5DDJ1 2WLPA 1JOPA 4FFIA 4AGGA 5IK7A 1LEDA 1L7LA 4ONUA 1MVQA 3I59A 1RJ8A 1ULFA 1NZIA 4LBQB 2Z69A 5T55A 4NO4A 2FZ2A 1ZBE2 3BALA 1AR81 4JKMA 4B29A 4OFGA 1WD4A 4I30A 1GOGA 2B9VA 2WRAA 1W2UA 3AMMA 2BP6A 3NV4A 2PLV3 3TN92 5IVJA 1OOPB 1W0NA 1UQXA 3VHNA 3UL2A 1NA1A 1UO9A 3CBNA 4XFAA 4GB32 1AYM1 2W3JA 1WMXA 1RUD2 1T6BX 1WWYA 3KHBA 1YO8A 3P6BA 4MZUA 4QXBA 4ZS3A 4W8JA 3AVRA 2Q8OA 3WP6A 4FSJA 1PGW1 4BQ1A 2QVSB 3WX5A 1VMJA 1P8JA 1TEIA 5J98B 4MADA 2OT7A 4ORFA 5A1FA 1VR3A 5IW0A 5C3OA 2JDYA 3GBFA 5JI9A 5D21A 1CAVB 3DPRB 1OKOA 1PMJX 3V56A 1AXZA 3KWVA 5K0UB 3V0BA 1QQP2 1CAXA 2WN2A 2XKPA 1SEFA 2EIBA 1F15A 1WW6A 2BFUS 2WS93 2D5FA 5LASA 2DV9A 4AI1A 3LQCA 2CGNA 4JC1A 2PFWA 5LW9A 4M3CE 3SC7X 2WL1A 2BWAA 5FWEA 5IVCA 4XFHA 1RUI3 2VNRA 2LW8A 1H30A 3O5SA 1GP4A 4FPYA 4HT1T 4COWA 1FOD3 2E51A 3VB9A 1IGOA 4Y22B 1YIPA 4YW3A 2EXHA 5FZKA 1DGWX 5KHKA 4E2QA 1HJFA 1QIQA 2D43A 3ZYRA 1SLTA 3B9CA 4QPGA 4BK5A 5C70A 5L19A 3IKWA 3PNAA 2OKXA 2RS33 4IEYA 1DDLA 4QDRA 4CXXA 5FV3A 1TME3 4BIFA 4YGCA 1YJKA 4PCRA 1REFA 5FZ4A 3POGA 3LDRA 3OF1A 3NNLA 2JIGA 4DUXA 1GQPA 4F3JA 2OUJA 4AK3A 2O14A 2WYSA 1LKNA 3WQ1A 5BXXA 4AQTA 4Y5SA 4UBHA 3UGHA 5DUXA 4XJ9A 4UFJA 4MH0E 2RHPA 1MS4A 5DABA 2Z5WA 1MPXA 4LKEA 1PGL1 4EWDA 4HONA 2YUEA 2OXBA 2CDPA 4GWJA 2C26A 2JICA 3AXDA 2Q1FA 2EIGA 2IUWA 5A70A 3WNPA 3B00A 2WNUB 4GZ9A 4Q4X2 4IEUA 4ES8A 3UKTA 2FCTA 1OLME 5C7GA 4UFIA 3ILNA 3NMBA 4AR2A 4ASLA 2VPVA 1KFXL 3H9AA 1VBE2 1OKQA 4AFCA 2RDNA 2XWBB 1X7NA 3GBWA 3VDBA 2XH6A 5A3PA 5JZGC 1KRIA 5ACA2 4HKLA 1BCXA 5FMBA 5DZFA 5FQ0B 3T30A 3KF5A 1N1VA 3KMHA 5FZ6A 1TVGA 3ZDSA 5A7SA 1I3HA 5FZHA 4FPHA 4QHBA 4K1ZA 1G9FA 4E4SA 1OQDA 3NO8A 4LOSA 2RDQA 4XQWA 2W39A 1OLMA 2HWE3 3SLIA 5J48A 4A7KA 4IV3C 1GR3A 4FP2A 1SHWB 1ZBE1 2WINB 2Q30A 1V00A 1H9WA 1HQNA 5CADA 4N90A 2W5FA 4AGVA 2DVFA 3WOGA 1QOTA 2X29A 1W8ZA 2VXJA 4GKXA 1LENA 4FP3A 2PQSA 2QZ3A 3TN91 1VJ2A 4CEWB 2CGOA 1DQ1A 4MOAA 4GB31 3G7DA 3LEGA 5FKCA 1RUD1 2VOXA 2W0XA 5J09A 3LWCA 4AHXA 3OBRA 1PNGA 4AQSA 3GM8A 1HX6A 3KV6A 3MW4A 3POSA 2R0FA 2AC1A 2JG9B 2P6CA 3W9AA 2GSYA 4W4ZA 2E9QA 5BNNC 2NPIA 4F8AA 5FUNA 5FZ1A 4FPOB 3K3NA 5DZEA 3K48A 1UXZA 4N43C 2A70A 4NHMA 1Y4WA 4PIYA 5L9RA 4A4AA 3N36A 4J6GA 1NE6A 2BGOA 2EICA 3VHOA 4IETA 1QQP1 1U5XA 4O9GA 2CWMA 2GAUA 1GZCA 2VZTA 5BY5A 1SCSA 5LBFA 4C1XA 3RZJA 2Y0IA 4QM9A 3RFRA 2ZABA 2DVDA 1GQHA 2HEYF 4EN6B 1YFYA 5G04L 3MHZA 1CAWB 1QU0A 2B46X 1RUOA 1RVF3 1IZ3A 2ILMA 1QJU2 1G9DA 3A23A 1XXNA 2WQZC 4E2GA 4CCCA 3B94A 4RR3C 4ARXA 1KEXA 4O7XA 2QQOA 1ZBA3 5AVAA 4W50A 1EV12 1YQ5A 4LE4A 4A44A 4LBLA 5LATA 2R1DA 5FWJA 4QXHA 5JZGA 1GZWA 4R9AA 5LA1A 2CWSA 4P9YA 3B02A 3SH5A 5AFBA 1PO23 3VN4A 5EPAA 4TYSA 5A7OA 4DRRA 3NNFA 4H55A 1ODMA 3WG1A 5FDBA 1EPZA 5FMOS 5B4NA 1H8TB 2E26A 2VD7A 3DEMA 4HANA 4CUAA 4DY5A 3FZ3A 2BGCA 2ORZA 4IV3A 4YM1A 3KGLA 3VD5A 1OD5A 1YFWA 2BEOA 1SCRA 2VUCA 4QQLA 3RMYA 5LK5A 1QY4A 5FIXA 2YC0A 5I0TA 3TEXA 1NKGA 1JHNA 2JDPA 4PDWC 1E5SA 1MR5A 4FAHA 1LOEA 3KM5A 2XVKA 3WCRA 2RJKA 1WMDA 1ZYBA 3OPTA 4CEYB 3PTYA 4IE5A 1H2MA 2X8KA 4N9HA 4CU6A 4Q4X1 3EYPA 4BIOA 1NXMA 2PAEA 1AR83 3A7QA 3VDCA 5D8AB 4TTGA 1CONA 1B35C 4UW6A 3AP7A 2IFWA 2VXRA 2ZGQA 1VBE1 4S2DA 2ETEA 1RUC2 2ZMNA 4B8EA 1BHGA 2XWJB 4GXLA 5BNNA 1UIJA 5ACA1 1JODA 3KT1A 2DCJA 3BKZA 4MGTA 4DUWA 4FOVA 4MVTA 1QJZA 4XIOA 4LBMA 2CSGA 1GOFA 3T3YA 5ISLA 2XQXA 5C8CB 1W2NA 5DUVA 2HWB3 4XF0A 3PMSA 4O9EA 4UWDA 3IN9A 4R52A 4S2GA 5LBEA 5CB7A 4LJHA 4CPBD 5LA0A 1O3QA 4NHYA 4YZ1A 4FTEA 4EN0A 4DRVA 3L9JT 1EP0A 2WWSA 3PHMA 2NZ9A 3ASIA 3AP9A 4BQ2A 4DXZA 3M3OA 2G9FA 1DGRA 2J1TA 1W04A 4LHLA 2PHTA 3OYWA 3EJKA 4KBZA 3NJXA 1LOBA 2D6LX 1V6KA 2XJQA 1FX5A 1BLZA 1EAH3 1Y9QA 5FRAA 4RR3A 4BB3A 3O1VA 2HYKA 3VKMA 2OS2A 4YW6A 1GU3A 1C1LA 1AL23 1HRV2 5EJ1B 1XNDA 5E8AA 3D4KA 5FLIA 3VBSA 2VZ1A 3EB7A 3QH7A 4AI0A 3M7AA 2HEWF 5JMOA 1RINA 1LOFC 2RDRA 1F4AA 2ZPXA 1S0JA 3PTRB 4XZUG 4N8MA 5GZDA 4YM0A 3DKWA 3M3CA 4HOOA 4WM7A 2W08A 4QPYA 4UFHA 1DQ5A 3DGTA 1OD3A 1ULDA 2A3XA 3DUIA 4FXGB 5A3OA 3VBHC 1BK1A 2JWPA 5HI0A 1ULOA 5IVVA 4IEOA 4PDWA 3LA3A 2W2IA 1FXZA 2VGDA 3P3NA 4JQRA 3SNMA 2HWC3 1VAMA 1YLLA 1DYPA 3W5NA 1UMIA 3OBTA 3DXTA 1A8MA 1QJU1 5FZAA 4IW3A 5FAXA 1C3HA 2XJVA 3JZVA 2JB8A 2KM2A 3FLTA 2WIIB 4YYOA 4AHWA 1NQJA 1EV11 4Q0PA 4BQYA 2FDFA 4QQPA 2JD9A 3CIHA 1HB3A 1W6NA 2Y33A 4QKBA 1YI7A 4XDPA 3SXWA 1QNYA 4DNYA 5FO8B 3ORJA 2CHHA 1H6XA 2DTWA 2EALA 3T0BA 2ZHMA 1W9SA 1URXA 3FMGA 4I09A 1GMMA 4FT8A 1UY4A 2XLFA 2PHLA 3FX3A 3HBZA 3JXSA 1TNFA 5KWRA 1UOGA 3O0VA 1RITA 1UYXA 4PLMA 4S2HA 1JU3A 1UU4A 3CEWA 1HDKA 2VVDA 2YU1A 4LHKA 4WVMA 1GWKA 3THPA 3TNQA 5BNOC 4JKKA 2BJSA 1LAJA 2CU5A 2EXKA 1SLLA 4FO9A 2E33A 5FP3A 3ZPYA 4XCAA 4QWNA 4HVQA 1DYKA 2DVGA 2JE7A 3KF3A 1ENQA 2VUDA 2D98A 4IDZA 4M00A 4Y1YA 3WNKA 2ZKLA 1C28A 2WZPP 4QB6A 4OYUA 5T54A 1UX7A 2GC3A 3HBKA 4CP1A 2YBSA 1C1FA 1GKBA 4PQQA 3SCHA 4NRMA 2AZ5A 1W6OB 1IPSA 1SQ4A 4JQTA 4Q1PA 4CPBA 1RUC1 4E4HA 1NYWA 3AFKA 5IUQA 1NZCA 2WS92 5J7MA 3MYXA 3EO6A 3FN9A 1W0OA 2VMEA 4P9JA 2DVBA 5FPZA 4CCEA 4A42A 1HIXA 2K46A 5IJRA 3MDPA 5KHGA 4LEJA 3VBHA 1WCKA 1FOD2 2C1FA 3W21A 3MW3A 1FMD2 2VH9A 3HN3A 4KBBA 4GMP3 4UBGA 1X50A 3R4DB 1W2AX 3PLQA 3AC0A 1KQRA 1POQA 1ASJ3 2X5IB 1PK6C 5BNPC 2UYAA 4RQPA 3H8XA 2RS32 4NR1A 3F2ZA 2A6VA 2OUHA 1QQP3 1TME2 2LUWA 2IXHA 1R64A 1WKYA 4N7UA 4NWWA 3DYPA 4CU8A 4NIIA 2F6BA 2CY6A 1ZZ6A 4LMFA 4OUMA 3ZXFA 2IXJA 3AKTA 4GALA 4EN7B 5JXJA 4XETA 4OQ9A 2E31A 1LCLA 1ZX5A 3VBOC 5I91A 5A33B 5A32A 2IC1A 1W8OA 1HRV1 1SDWA 1SPPA 4RA0A 3SCGA 2DFBA 2ZGPA 1UMZA 4ZS2A 1KDKA 2D7FA 2V5DA 4LKFA 3ZXLA 4SLIA 1S0DA 2JKXA 2VMCA 1G86A 2W95A 4OMDA 2PAKA 2WT2A 4M4RA 5GM0A 1UD1A 2E63A 4WM8A 3VBFB 5JWPA 5IYYA 4XDOA 4EN8B 5KXDA 5BNOA 4K3UA 5JSOA 4G4FA 2PHRA 2ZAAA 4XUNA 1A8DA 1H2KA 3VLBB 2BVVA 1JXNA 1SFYA 4X8NA 3N9LA 4COUA 1WMFA 4K7JA 1O4YA 5D1IA 1CX4A 2OZ6A 2DCZA 5BYNA 5CFCC 1WW4A 3OG2A 4GH4B 4OZOA 3CQOA 3WD5A 2G4IA 4AE2A 2ZEYA 4GKYA 1WLTA 2VNVA 4QPIB 4IV1C 4Z92B 3OEAA 3VHPA 1QOSA 4ZHNA 1XNTA 5ERLA 1LHOA 2EIEA 3I3DA 4AFBA 2CGPA 5T5OA 4P14A 2PN5A 3VD4A 3MO4A 2FMYA 1KS5A 1Z7S3 2WN3A 5AFEA 2HWE2 2WSVA 4KWLA 4BE3A 2XKOA 3GJBA 3T4HB 2GN3A 1JYNA 2P3JA 4XFCA 3UYJA 3T0DA 1XE7A 2I45A 2LRPA 1VBE3 2A3WA 1DLCA 3FBMA 4K8FA 2BFUL 3R4UA 4ZU4A 3K3OA 5JVVA 3ZYIB 5A3MA 5JMCA 1DGWA 5CFDC 1BYHA 3WHTA 2D97A 4Q5OA 3AYDA 1PK6A 1IG3A 1RL3A 2XJPA 4UAPA 2XPJA 1FV3A 2WO7A 5FY4A 4UXAA 2G1MA 5GZCA 5CEHA 1NCRC 3O14A 4IE0A 5H9QA 3H1WA 2AEYA 4YM3A 3ACLA 3ZYHA 4HXCA 4AEDB 5C9AC 4YW4A 5KBFA 3KHCA 4MO3M 3VBOA 1PZ7A 5F9TA 4OULA 3AL5A 4I2OA 2VCAA 4S2FA 4NIHA 1GBGA 3TRSB 2D93A 1AL0G 1OVPA 3GHMA 4W6WA 3WP3A 3I2DA 4RN5A 5LB6A 1JUHA 2DUOA 4B3NA 5C3RA 5HXMA 3GCXA 4BCUA 2AUYA 2VBDA 3M3IA 2WS91 4ZONA 1MVEA 2RDSA 2ZGNA 4OI4A 1K42A 3WF3A 1W05A 1XNAA 4WBBA 2QQKA 3TBDA 3JQWA 2AR6A 3ZXJA 3HT1A 1J3QA 3SKJE 4JTNA 5EIYB 2QQPA 4UW5A 4AI8A 5L36A 1FOD1 1O8SA 2Z2SB 1FMD1 1RVF2 5CISA 3ZFFB 5F6LB 1DQ0A 1AYN2 2VZPA 3BN6A 4FPLA 4XUPA 1PX4A 4QKFA 3AVSA 4IQPA 3SKVA 1W6MA 1FYUA 5KHIA 5FJHA 1ZBA2 2RS31 3J7LA 4BQXA 4PI0A 5CFCA 1XRUA 4AAPA 1TME1 1FI2A 4FPEA 4MV2A 3ZO0B 3IDBB 4QXKA 4LTAA 4IV1A 4R9BA 2G9GA 3G6JB 2D44A 1PO22 4ZU7A 4JRAA 5T5LA 3VDAA 2A5ZA 5C6CA 4FFHA 2BRTA 5FK8A 1M06G 1OQEA 3O1TA 1FNYA 1XSRA 1OA2A 2BNOA 1ENRA 5BNQA 3TOJA 5CZKA 1NCQB 1MQTB 1N47A 3BOWA 4LPLA 2VU9A 5T52A 4CVUA 2Z42A 3AK0A 2WBKA 3VZMA 4MG2A 3ACHA 4OZXA 3CNAA 4J1WA 4PBPA 5CFDA 3ME2A 4ZXKA 5IAXA 2WFF3 2XXZA 4YW7A 4FXKB 5TSWA 1W8UA 4E4DX 1JYCA 1UAIA 4OVEA 2I2SA 1NCRA 2GP3A 1L7RA 2VNGA 3NSTA 5GLTA 1WLDA 4JDNA 2VNOA 3I54A 4XABA 3OUIA 2PXJA 1FV2A 5C9AA 1TMF3 3W5MA 1VB4A 2ZX0A 4CTEA 2UWCA 3FC0A 1J83A 3HMYA 1YQ6A 2ZEZA 1VRH3 1JBCA 2ET1A 1DHKB 3C7FA 4B7EA 4RS5C 3BTYA 1E57A 2DU1A 4AXOA 4IE7A 4QX1A 4AVAA 3OY8A 4AF9A 5JXIA 2HWB2 2Y6JA 2YGLA 5FPVA 5LRSA 3TB0A 2OQ7A 2QBXA 5FZBA 3T2OA 2HWE1 3RJ2X 1NUKA 3OSDA 5IVFA 1ULEA 4Q0VA 2WWUA 2V09A 4K40A 4P5HA 3ZFGC 2GH8A 1O3TA 3FHAA 3IPVB 3GYDA 4BMEA 3HT2A 1QXPA 1DQ6A 5JOXA 5B2GB 2YROA 2XJTA 2L9LA 1DZTA 1GP6A 5LY1A 3MGUA 4URAA 3KZ4C 1EAH2 3FHQA 3M2MA 3LFIA 4LBJA 4AZZA 5HCHA 4CDUC 5J1XA 2MEV3 1AL22 1WBFA 5M0TA 1U5IA 2VL4A 2W91A 1HW5A 2PHUA 2WT1A 1QDCA 2W1WA 3M1HA 3ACFA 2O0OA 1QNWA 5FLJA 3LB9A 3WV6A 5JOYA 3NAPA 3AZWA 4AVVA 5C4WB 1JN2P 3ILRA 1R093 1UOBA 1Y9GA 3PUQA 3NQHA 3POYA 5A7WA 1H8VA 5FYSA 4AW7A 4D8MA 1S0IA 3U1XA 3PU8A 4EQVA 3ZFEB 5A7PA 4JGZB 2RM22 2ZX3A 1BBT3 2P3YA 3LDKA 4KG8A 3IDAA 1NX9A 1W2TA 5FMOL 5CG9A 4GJZA 3V65A 3IWZA 4CDWB 4D7YA 2HWC2 4R8HA 1XNKA 4IEVA 3USUA 5F7UA 1OF4A 5FZDA 4D69A 1RVF1 3D5OA 3S57A 2BV4A 2EIDA 1W0PA 4DEQA 1AYN1 5FYUA 3O1UA 5C3SA 3S5AA 1RGSA 3E6DA 2XJSA 2Z4FA 1H1MA 4P9IA 3H7JA 1ZBA1 2VUJA 4BOWA 4AVBA 3BCWA 1R1A3 1AJKA 5A7NA 4CYDA 3LKJA 3OPWA 4YG3A 4RS5A 4SBVA 5FBJA 5A6QA 1SBDA 3AYEA 5LEJA 1PO21 3ELNA 3ZXAC 2BNNA 1KITA 4URTA 4Z07A 3N7MA 1NAEA 5FZ9A 1OT5A 4BDVB 1VRBA 3I2FA 1U0AA 3NWKA 4D6QA 2DBNA 1VALA 3JUUA 4LORA 4OI2A 1Y3TA 5FXZA 3ZFGA 3KSCA 2D6PA 3ZSEA 3NRUA 3W58A 5FZ3A 5I0SA 4LBQD 3O0XA 1PVXA 2NLRA 3OGJA 5EFUA 4CZSA 2Q8EA 3QLQA 2ARXA 4LA3A 3URFA 3M3QA 3DECA 3ON7A 1IKQA 4BZ4A 1HRI2 1ZZ9A 4CUGA 1UPIA 3ZXKA 2XMLA 3GJAA 4CDUA 2J1VA 1OA3A 2WT0A 2FDJA 1K3IA 4GULA 3UGGA 1VB2A 4QDSA 2ARBA 3DKQA 2RR13 1UZ0A 1GP5A 1AZDA 4XDQA 1IG0A 1LHVA 4EWAA 4AG4A 1JI6A 1AR73 2GC1A 4ZPIA 1E5IA 2C0ZA 1R083 2XONA 1KJRA 3PIGA 5JXHA 3RDIA 2YU2A 4P9LA 1I6XA 1YFXA 2HWB1 4CP9A 3IAQA 4Q0SA 4BA6A 1QH7A 4DOUA 4XF1A 2W47A 4D7TA 1OOPC 3CHXA 4HSLA 3HQXA 2JB4A 1ASJ2 3M3EA 4EV0A 4RGGA 1ZRFA 2A6XA 5IK4A 2VTFA 4Y4RA 1GUIA 1J1LA 2IFRA 4YARA 3VBUB 1ULGA 5L9BA 1V6IA 1XU1A 5KHJA 1MS5A 3ENRA 2JE9A 4D94A 1OLQA 2V4VA 3LF7A 1EAH1 4LLOA 1AR63 3ZXEA 1K5MB 1RYYA 1E5HA 4GWNA 1AJOA 1UOJA 1AL21 2IXKA 3B9IA 3DPRC 3M4FA 2NN8A 5FPBA 4BXSV 1RXFA 1FMD3 5K0UC 4XW3A 3ZYPA 2WAAA 1PMIA 2X09A 1OUXA 1Q8QA 5DXDA 2XGXA 4R4ZA 3ZSMA 2EA7A 2UYBA 1AUYA 4YSFA 2ATFA 3L2YA 3AJYA 3UKVA 2VR4A 3M8LA 2V5YA 4BJ0A 4BQ5A 2FCVA 2RM21 2XUEA 5EYYA 2IZWA 4M3CA 4UW3A 1O8PA 3THDA 4N7IA 2Y38A 2YGMA 2VCBA 1LJ7A 5FY9A 2D5HA 1VPHA 4K21A 3V0AA 3GALA 2D6OX 2C9AA 5DG1A 3WG3A 4KU8A 1HN0A 2HWC1 1NLSA 3GHNA 5IHRA 1FNZA 5FMCA 3B93A 4Y26A 5C3QA 5KC6A 3FFZA 1O3SA 4GAZA 1QJY2 3N9QA 2QTWB 4R9DA 4QX0A 4YW5A 3U0ZA 1A34A 1Q8OA 3S30A 1F4HA 4RSUA 1D0HA 1WA6X 3NJZA 2QQNA 1CAUB 4YGBA 2HH9A 4ZY9A 1MZFA 3BB6A 2DFCA 1Z7S2 2BOJA 3R05A 3I3EA 4I3PA 4CDXB 4LBQA 1RUH2 5FZGA 2DDUA 2C5DA 1OLRA 2C6SA 4LK6A 1WA4A 3JBG3 2WABA 2GNMA 4QGLA 4YVWB 1OOPA 3MF6A 3RZZA 5F1RA 4XJ8A 2WNVB 4CE8A 3A0NA 3VZKA 5FZFA 2WNUC 5JUVA 2GMEA 4Q4Y3 3UJQA 2VBBA 3OGVA 3T2TA 4AOCA 2LTNA 1VBA1 4HVRA 3RZKA 1RB8G 1OC1A 2VZOA 4RFRB 3IIAA 3S7EA 2E6VA 4IESA 1HRI1 4Q4V3 3RQ0A 5CKMA 1F31A 2VM9A 3BI3A 1IQDC 3WDYA 4D7SA 1CAVA 1LHUA 1BJQA 3DPRA 3WNLA 4RGKA 2YFUA 1ZVFA 2A1XA 5CKNA 2D6MA 5K0UA 1QXRA 3ZIXA 2V72A 3FFQA 3WF2A 2VQUA 1Q5OA 3CKHA 3I2IA 4PIZA 4NIGA 3CL1A 4UF0B 2JDZA 3AYCA 4M3CF 4QX7A 3A4UA 2YMZA 3VBRB 4E4ZA 4B4PA 3FBYA 4C0HA 1FAYA 2FBEA 3WQ7A 5H9SA 4AVSA 3CJIB 1H4GA 5FY5A 4Y22A 2D3RA 3I3MA 4ATFA 5F32A 1W90A 3PJQA 2QQWA 3MICA 4GMP1 3RWKX 3N9PA 4CEWC 3UV9A 2VUAA 4QB2A 4FVVA 1ASJ1 3B3QE 4CRQA 4D0QA 3N4MA 1WCQA 1VLNA 4M01A 4XFGA 4AFDA 1LU1A 2J1RA 4B1MA 3USSA 3E5UA 4H14A 1HXS2 2OPWA 5IVYA 3LPGA 4CXWA 1O59A 1D2QA 2YY1A 2JG9C 5BPXA 3BOPA 5A1AA 4XE9A 1JZ6A 3RZGA 1NLRA 2VOKA 2J42A 1XQNA 2ZA9A 2YZ4A 3HNBM 1G8WA 5FZ0A 1NG0A 2VCMA 1MS0A 2A75A 2VQTA 2VOTA 4KI5M 4Y1VA 3ES1A 2RS52 4IERA 4QD2A 2YXSA 4FOQA 3RRDA 1N1YA 1D4M3 1AYN3 1GICA 1HV1A 3IM0A 3VZJA 4DXTA 4IGQA 4LUMA 1N3QA 4XAAA 2Q8DA 3SMHA 1G7YA 2BERA 2ENRA 3QBQA 5FXXA 1ZRCA 2XR4A 3NV2A 4LBOA 4XMIA 3BYWA 3D0SA 3OJBA 3AX4A 2WFF2 4HG6B 3ST7A 2OYZA 3I2GA 3E5QA 3FUOA 2WNUA 2BBVA 2VVEA 4NROA 4O61A 1TNRA 3LSDA 4Q8LA 4XFFA 1TG7A 1FPN3 2ZEXA 3NKGA 4HKOA 2WKKA 5EXOA 1UYZA 1VE0A 4WV8A 2XQRA 2EXJA 3VBSB 3WUCA 1K45A 4AAXA 1TMF2 3FL7A 2VC9A 4U2AA 4QQ2A 1QJY1 1AXKA 1LEMA 1MS9A 1SLAA 2VJXA 5SV5A 1JYIA 1VRH2 2VY0A 4XYXA 1ACCA 1D4VB 4H3WA 4H2AA 1NY72 4A3XA 1QF3A 5FQ0A 2GC0A 4QB1A 4WM7B 3WNNA 5FPUA 5LCWL 3V64A 3ZN5A 2JDAA 4A3ZA 2YYOA 4E2SA 4KL1A 3CJXA 2XVGA 1OXCA 1UIKA 5F37A 1H8TC 3T2QA 1Z7S1 4AHZA 2ES3A 4OUSA 2E7AA 1FT9A 1W8WA 1DLLA 1APNA 1RUH1 1UZVA 1XYPA 2B39A 2HKXA 3MFAA 4ITCA 5EP9A 5F2SA 1IS4A 2VW0A 2OZJA 5FP4A 2W1QA 1RHI2 3AKQA 3PUSA 4CEWA 3GDBA 4CEYC 4CSWA 4FQ4A 3DYMA 5IT6A 3C7OA 3LAGA 5GZEA 2B4KA 2WJSA 4N43A 1LHWA 2F4LA 4Q0QA 3OEBA 4XJAA 5D8AC 2MEV2 1ENXA 1X8MA 4UFMA 2XVLA 1SFNA 1CPNA 2FQPA 1GZTA 4GWMA 1JYXA 2BBAA 2JG9A 3HQRA 2Y64A 4OHWA 4IL7A 3HNYM 1XE8A 2O8OA 3AP6A 2RS13 4LO5B 4Y33A 4AI2A 1UZZA 2XUMA 1JYVA 2HYXA 3UT0A 1R092 1Z78A 2VOVA 2ZACA 4LK7A 5JSRA 2RJ2A 3KT7A 4XJUA 1C5IA 4HBNA 1H9PA 5C8CC 3ZYGA 2XLAA 3VGIA 5A3WA 1YFUA 4LIUA 5IVEA 2BGPA 1OH4A 1BBT2 5EYXA 3EHKA 1COV3 3ZYFA 4HK9A 4JX0A 3WW2A 3O1PA 3ZX7A 5L7OB 1DF0A 1SMVA 5FPLA 3RI9A 3OBZA 2IVJA 3BODA 4CCMA 5HCAA 4FPFA 1I1EA 2HLEA 3K2OA 1CAWA 2WUHA 1QOOA 1IOAA 5IK5A 4ISQA 4NUBA 2WDBA 5FMDA 1KGYA 4RHV3 3I2OA 3HVDA 4ES9A 3KQRA 1BMV2 4KWKA 2UU8A 5AC93 5FKBA 3ZMNA 4GMP0 2PQQA 3K4AA 2RM23 4P9GA 1HXS1 3H1MA 1OQ1A 1R1A2 2YFZA 4HPKB 4TWTA 4FCAA 4L9BA 1H1AA 1CPMA 2VBPA 2ZS6B 3TNPB 4CCNA 3KV9A 5A6XA 3TYJA 3N7LA 2GZWA 1XBFA 2AGSA 4YZ2A 2ZX2A 2W52A 4JVAA 1H8TA 1LOAA 2WA3A 1QJX3 2RS51 4BMBA 5IAVA 2W1SA 4GD4A 4BPZA 4N53B 4BXFA 2OPKA 4ASMB 2EAAA 1B35A 4BM8A 3VDDB 4RQPB 3CU7A 2B5HA 5K9YA 1V6LA 2BZDA 3S6PA 3APBA 2E7QA 5D2AA 1U5YA 2P6HA 4PF5A 2ZX4A 3KCXA 3LCPA 2WFF1 4NVPA 4P08A 3K4DA 2QE3A 4XURA 1JZ7A 3OUHA 1DGRN 5FZMA 1HJGA 1N3OA 4FFGA 3N9OA 5KHHA 5CNAA 3S0MA 1EYBA 1POV3 2VECA 3KLSA 4NAOA 4NPMA 4OHXA 5D8AA 2JDHA 4COZA 3HWJA 5GALA 4DY3A 2ZEWA 3E97A 3CO2A 5LY2A 4YVSB 2ERFA 2RR12 1T6GC 3Q8CA 1TMF1 2B7YA 2JDKA 2PHDA 1AR72 1J84A 1OFNA 1VRH1 1R082 2Q1MA 3J8F2 4WVVA 1NY71 2PAMA 2I07B 2K0GA 1WLCA 2Y6HA 4WM8B 3PJYA 3KQ4B 4Y24A 5DG2A 1AX2A 1VBA3 2JE8A 2VZ3A 4Y3OA 1Y7BA 4TLFA 5C8CA 1W8HA 3WNMA 2HWD2 5CA6A 3LOBA 4B4RA 1B09A 1HRI3 4Z82A 5A3TA 4GQ7A 4QU2A 1OHFA 2WA4A 4TN7A 2JEMA 2PYTA 3CZUA 3PVNA 4WVZA 1ULPA 3JD73 1RHI1
chains in the Genus database with same CATH topology
1W6PA 4QX5A 1SLBA 4KU7A 1LOFA 1WUVA 1DIWA 1AR62 4Z8BA 2R063 1BXHA 4LO4B 1G9CA 2MEV1 4DS0A 5DZGA 1IPJA 4P9XA 4GIQA 1PZ8A 1BEV3 1PNFA 1R091 3NV3A 1Y43B 2R49A 3R4SA 4Y20B 5T5OA 4IEQA 4BLIA 3N35A 3MLKA 2BUKA 1MS8A 1BBT1 2GNTA 3BIWE 5FCCA 4XFBA 2ZJCA 2MNGA 2X5IC 1O91A 2DTYA 3JU9A 3MIHA 1LODA 1O7FA 4MYEA 1MACA 2JG8B 4META 2B8MA 2ZGMA 4MXVA 3WG2A 1C4RA 2CAUA 2P34A 4DQAA 4ZU5A 5J36A 3AKRA 4L92A 4XQ4A 1BMV1 2ZGOA 3T1MA 1XYNA 2H6CA 4L99A 2R32A 1AXYA 1CESA 1R1A1 2D6NA 4YG0A 1J58A 1M4WA 3ZN6B 2Y0OA 4K20A 1X36A 2BQPA 4YLZA 3JBG2 2BYVE 3POWA 4XJZA 3QACA 5JI7A 3VBFC 1OPOA 4B4QA 3AM2A 3AXEA 5EJ3A 1QJY3 1WLWA 5I8SA 2DCYA 5JR7B 1AR93 1CJPA 1A6CA 5GJ6A 4NHLA 3GZUC 1S0GA 2ZZQA 3HR9A 4Q4Y2 1YWKA 3KCYA 2GMPA 2XLGA 3T1LA 1NOVA 3MF9A 3W59A 4GH4C 5FLHA 1RUH3 4Q4V2 1BVVA 1LRHA 2R043 4QPIC 1REEA 1WCSA 5I0RA 1UKRA 5C33A 2KXLA 1W6OA 2RR11 4W65A 3GZAA 2ZTNA 4Y1UA 1S1AA 3TWIA 3GZTB 1AR71 2NMOA 1R081 5BNPA 3J8F1 2DU0A 4Y4YA 4BH9A 2XBO3 1S55A 2HWD1 4MXWB 4J1XA 3QOPA 1AVBA 2DF7A 4JGYB 1ZZ8A 1PVC3 1W6QB 1REDA 2K2SA 3UKNA 2JENA 1ND2B 3OPZA 1IS3A 4X6QB 3QCWA 3ZMOA 1GNZA 4HMZA 1AR61 4AEDC 1UCXA 2BNMA 4V1PA 5T5JA 2B9UA 1MS1A 5A33A 3A0KA 5ABJB 3OY8B 3WG4A 2EVXA 4LHNA 4XIKA 1VAKA 4AEMA 5GZGA 1D4M2 3M70A 4ATEA 3D0JA 1RUJ3 4RL7A 2DCKA 4K6BA 3VBFA 3AMHA 1RUG3 2R30A 1HXS3 1F2NA 1S0BA 3C3VA 1N3PA 4BHPA 3ZFFC 1UN1A 1EY2A 1LOCA 3RJRA 3LOIA 1FPN2 5HBAA 1CJDA 3ZN4A 2RS53 3ZVXA 4GH4A 1MS3A 3NAPB 1ONAA 1ZNPA 3JB4C 3SITA 1GZ9A 4CDQB 3CF6E 4LLFA 1GFF2 2WNEA 1S2KA 1YHFA 5SV8A 1CGPA 2JJ6A 4FPCA 4HKWA 3J9SA 2R6QA 3O12A 4IEZA 5JLVA 1NCQC 1MQTC 1JOJA 4FPJA 3TAYA 2ZX1A 1ZRRA 2CTVA 2AENA 3JBG1 2ZOEB 3UK9A 3LGRA 3AMNA 4EN9B 4AI3A 2ZAHA 4FPKA 4XBNA 5JPNB 2VQ0A 4Q4Y1 4HFSA 4WZCA 2D3SA 1NQDA 5T50A 5C8WA 4DMIA 1ZZCA 5FO7B 3VZLA 4AEDA 4ZKTB 4HL0A 1Q8SA 1ND3B 4Q4V1 2RS12 5JIAA 3RMXA 1LECA 1RHI3 1F9KA 4RFT0 5J3UA 2BPA2 3AP5A 2WSUA 1DFQA 1COV2 5JSPA 3KT4A 3INAA 2Q1ZB 1GYKA 2KA3A 1YJLA 2ZHLA 4NPRA 3WW4A 3WZ1A 5K7PA 1G9BA 3FE5A 4XFIA 3I59B 3ZFFA 3BPZA 1YYNA 4Y5Z0 3L2HA 4RHV2 4HLTA 5AC92 3VUOA 5T3NA 4QGMA 1NA1B 2NMNA 1VBC3 2YPJA 4NOTA 3MIFA 4QM8A 4YFZA 3WR0A 1WD3A 3FJSA 3DV8A 4YZ3A 4DPNA 5C4WC 5FREA 1PO13 1UW8A 2IXIA 2Q4SA 5H9RA 1HKDA 4LNVA 3X29B 4MLOA 1OI6A 3B01A 1QJX2 2B45X 2Q0AA 3ZFEC 1D4M1 3AZZA 4JGZC 3WLUA 1NCQA 1MQTA 3S7IA 1IKPA 5GLVA 4LO7A 1N1TA 2NQYA 1GSLA 1VBD3 2D6KA 3V0BB 3HIFA 1CAXB 4CDWC 4OLLA 1CN1A 3ZIWA 1V6MA 3EXUA 2TEPA 2QNKA 1OMIA 2O1QA 3PVOA 2DVAA 1A78A 1DQ4A 1FPN1 1AF9A 1S0EA 4C90A 2A73B 4CP2A 1C57A 1UKGA 2QFEA 3WNXA 2A6WA 4F83A 1H1IA 2PHFA 1PIV1 3ZSKA 4L8QA 4QPGB 4D3WA 3VV1A 2P2KA 3JCIA 2ZCWA 1XNBA 3H3ZA 1HV0A 1VBA2 3ZXGA 5CAZA 4DINB 4M3CB 1N1SA 2O8QA 2JKBA 1W39A 1J3PA 1DQ2A 4C1WA 3V0AB 2XB6C 4LBNA 2TNFA 3BTAA 3IPVA 2P3KA 5CVRA 3JD72 5CU1A 1GLHA 3N3HA 2Z79A 5GZFA 1DU3D 4UW4A 3ECQA 1PM7A 3EQEA 3WW3A 1UL9A 1CVNA 4I01A 4YGDA 2XHKA 3J8F3 3MLLA 4Q8KA 2R062 4QMAA 4YM2A 4A2UA 3AZVA 2JX9A 2HWD3 1FATA 4LULA 2MPFA 2GH2A 3QD6A 2VVFA 5GLUA 1WW5A 3RWNA 5C4WA 2QJVA 4I3GA 2RS11 1LU2A 1GQGA 1BEV2 1U5ZA 3HN1A 4YG6A 1PGSA 4XEZA 1HQWA 5LRRA 1UPSA 3ZFEA 2VMHA 3LA2A 4JGZA 3SISA 2D3PA 4PLNA 1COV1 3SHRA 1JH5A 3VHRA 4CDWA 4OI0A 4YNIA 3R6SA 5LEKA 2GMMA 2IXLA 4FQZA 3VBUC 4PLOA 2MHFA 3CLPA 1BKZA 4B7KA 3FLRA 4RHV1 4XPVA 3ROUA 1K5MC 2ZHNA 5AC91 3OD0A 1QDOA 4AFMA 3AKSA 5FFOC 2PTMA 4MGIE 1LGCA 3ES4A 1O5LA 4HN0A 2JD4A 2GN7A 2YDEA 3RPQA 1F5JA 1QJX1 2LM3A 4M0HA 3ETQA 5GKAC 5DUUA 1LR5A 1AR92 4Z1VA 1WMEA 5J96B 2CL2A 4Q0UA 3DL3A 3VZNA 1RIRA 3MIDA 3VKOA 3MLJA 1L3JA 1LULA 4YZ5A 3GNEA 1UU5A 3ZSLA 2BVBA 1IPKA 3NKTA 1XYOA 5JIUA 2UWBA 2E53A 2R042 5I93A 1POV1 3GF6A 4K9SA 5HCBA 2ZGRA 1IS6A 4AGRA 2HWF2 1J59A 3N7KA 2P17A 1UZYA 2AYHA 1CD3G 4H7LA 4X8PA 4COVA 5GLZA 5K8SA 1GANA 4PBOA 1SBEA 4CDXC 2JXAA 4RGAA 3H8UA 1U12A 5LK7B 2GALA 2XBO2 5JZGB 1GZWB 1GNHA 1S2BA 3EBRA 4Q4W2 4YVWC 4HN1A 2WNVC 4XZPA 4E27A 1PVC2 3KD4A 2VULA 4I0BA 3RS6A 1VBB3 3JD71 1C5HA 3VL9A 4IV3B 3VBUA 5J37A 4QQOA 4BLJA 1QKQA 1XU2A 1MEC3 1K5MA 1G6NA 2R061 2ZBJA 4Q1RA 3WHUA 2RE9A 2WLQA 4GA9A 1ZREA 3KS7A 2ZGTA 4ISRA 3H7YA 1BEV1 3VBRC 4BYYA 1J1TA 3H3UA 3OCPA 1LESA 1RUJ2 3HAGA 4WZFA 2ZGSA 1RUG2 5BNNB 4FTSA 3CJIC 1OPMA 4JV4A 4HK8A 4N43B 2NM1A 4FAGA 3WDTA 1C8M3 2PA7A 1ZRDA 3JB8A 5BUVA 3IDCB 1LGNA 1V70A 3KCCA 1AHSA 2HJIA 1RUE3 2X53S 3U4XA 3ILFA 1JUIA 1CIWA 2BW8A 4JRLA 4YRDA 3MZHA 3RNSA 4KH9A 2N7GA 3OYWB 1CAUA 3PVBB 4G9SB 4KWJA 5L73A 1O4TA 3RI8A 4RR3B 4YGEA 4CDXA 2ET7A 1V9U2 1OSGA 3RYPA 3B5LB 2GC2A 1H4HA 2UY9A 3AMQA 4N9IA 2WZR2 4U36A 4YVWA 3WDVA 4FBFA 1PIV3 2WNVA 4YW1A 1AR91 1RMU3 1NXD1 3AP4A 5IK8A 3WP5A 3AFGA 1J3RA 3VBSC 3B69A 3GBGA 3MPBA 2CAVA 2WQ4A 1QH6A 4KGGA 4PDWB 2OW4A 4XXAA 3KGZA 1BZWA 1RUF3 2R041 4L2NA 2VG9A 2GDFA 3IMNA 2R073 3I7DA 1RC6A 2YHJA 4KNCA 4XOGA 4FTBA 4WM7C 4MGYE 2HWF1 3WCSA 4EWEA 1POV0 3SH3A 1B35B 2RMU3 4AWDA 3VBRA 3LSEA 5DDJ3 1O3RA 5KXBA 2XBO1 4K1YA 1W6NB 3CJIA 5I8TA 3FHIB 4A7ZA 4Q4W1 3J4UH 2PHWA 1YXWA 2Y26A 3PMEA 2SBAA 1PVC1 1YI9A 2VW2A 1ZZBA 1ALYA 4OI1A 4W6YA 1C8NA 4PIXA 4WVMB 3AJZA 1AYM3 1VBC2 3ALQA 4Q27A 1F8VA 5JOZA 4IEXA 1V6NA 1CR7A 2JECA 2Q5TA 5CIRA 1PO12 1X33A 3H50A 3WDWA 2NP0A 1CQ9A 2HEVF 2QCSB 3RYRA 4QT6A 2XL7A 4I02A 1WBLA 1VBD2 1RUJ1 5BV6A 1MZEA 1W6PB 5L7OC 1AX1A 1RUG1 4BWOA 1RTVA 2CNAA 5KXEA 5FBZA 3P3PA 1X8EA 3VBHB 3AZYA 2UY8A 2VMIA 4LUKA 5CBLA 4HZFA 1SACA 2P37A 4LE3A 4FOYA 4DZGA 2DUQA 1SBFA 3H0OA 3NL1A 4XF9A 3R0RA 3VKFC 2A6YA 4LO6B 1YRZA 4CEYA 1G9AA 2A7AA 1UF2C 4MGKE 1DZQA 1V9U1 5A32B 4N53C 3VDDC 4RQPC 5FOBB 1LTEA 3JQXA 2WZR1 1S0FA 3IBMA 4X6RB 3IT8A 3MIBA 5JOWA 1Q43A 5T5PA 1SLCA 3C2UA 2TUNA 5BNOB 1KFUL 3N7JA 4IXLA 1O4ZA 4Q29A 4YVSC 4TZDA 2UURA 1DGLA 2A3YA 1WW7A 1LB2A 1QXJA 1VAVA 1H2LA 1MZ5A 4WM8C 2FZ1A 2PLV2 1ZA4A 2XJUA 2PELA 3AMPA 5I8YA 1VIWB 1WGPA 2DCTA 2OIIA 4YZ4A 1LHNA 3NV1A 5L7OA 2I74A 2OA2A 2F4PA 3AKPA 4AEKA 3D8CA 5HCFA 4COYA 3KB5A 2VW1A 1ULCA 1ZBE3 5F5QA 2DUPA 2ZGLA 5KXCA 2QUOA 3I4IA 2DYCA 2VQAA 2WFPA 1QMJA 4INDA 3TN93 4GB33 1PK6B 1OA4A 1VBC1 4HPKA 5BNPB 2NYYA 1RUD3 5EV7A 1RUI2 3ATGA 1PO11 3QH6A 2AREA 4L11A 2IXCA 3ZXDA 3PVEA 2ZMKA 1UX6A 3VBOB 4AEJA 4N53A 3MIGA 5FPXA 4XF4A 3E5XA 4Y1XA 3VDDA 1AX0A 1VBD1 3HD8B 4I0WB 1I9RA 3WP4A 2R0HA 1QHDA 4XILA 5DUWA 4MX3A 4M0NA 1HQLA 1YIFA 4JTOA 1PZ9A 2JG8C 1ENSA 2R1BA 4LO8A 4EROA 3K51A 4NWVA 1IHMA 4HSJA 4YVSA 4AVCA 1BQPA 3RSJA 3FLPA 1W6MB 4WVWA 2VOWA 4KQ7A 2XJRA 3OTFA 5CFCB 1KS4A 3LZZA 4KG0A 4C0BA 4IV1B 1YCIA 4AYUA 1I5ZA 1Q56A 3VKNA 1EPWA 4MSVA 3RG0A 2HWF3 1VBB2 1F5FA 3ZN6A 3VZOA 2DURA 1MEC2 5F6KA 1WCDJ 2QKDA 1IQAA 2B42B 5CFDB 3DF0A 3NW4A 3E6CC 1D0GA 4Q4X3 2ZMLA 4Q4W3 4XQDA 2ZZJA 2ZHKA 5H9PA 3BU7A 3AYAA 3THTA 1NCRB 1O5UA 4AQ6A 2YV8A 3WDUA 2X5IA 3MEPA 2GNDA 3Q9OA 4FPGA 4Y20A 3OD4A 5FO9B 1G9DA 1IS5A 4DB5A 2EF6A 1OFSA 5C9AB 2PLV1 4C91A 1XNCA 2CV6A 1V6JA 5ACA3 1BVP1 1Q8VA 5JPMB 4LBKA 4KGQA 4AQ2A 2ZKNA 2OVUA 5E88A 4JGYC 1C8M2 4XMAA 5HXVA 3VL8A 1ZM1A 3MPPG 3RYKA 1ND2C 1ZZ7A 1RUE2 2EXIA 2JG8A 4NHKA 4XJWA 2RJLA 1SLIA 1Q8PA 4AVTA 4G3YC 1Q3EA 2DWRA 3B7MA 3D82A 5ABJC 5JDBA 3I8TA 1RJ7A 5I0UA 3D6EA 2PHXA 5E89A 4IEWA 1RUI1 2FHRA 3IDEA 2H0BA 3MFCA 4I0AA 4XTMA 4LR4A 1MZ6A 4JDMA 2D40A 3DN7A 3AZXA 3FUQA 3O7OA 4A7YA 1PIV2 3LA7A 3VKLA 4QPIA 3WY6A 3H1YA 5EZWA 1RMU2 2UWAA 1RUNA 4YFWA 4JDOA 5E1RA 1V6OA 2GNBA 1QWRA 3ZYJB 3NAPC 2QZ2A 1V9U3 1A3KA 3MW2A 4RD7A 1RUF2 1PHMA 4CDQC 3USUB 2R072 3O0WA 5FOJB 1DBNA 1QJU3 2WZR3 1Z0HA 1VP6A 2R16A 4R9CA 3WVJA 1HLCA 2RMU2 4PJYA 2QDRA 3E6BA 1EV13 5DDJ2 1DZRA 4F7ZA 3WQ0A 4AHYA 2XG3A 1DG6A 1TQ5A 4HETA 3ZSJA 4RS5B 4MXWA 2BWCA 4YW2A 4XHXA 1AR82 4JGYA 1D2SA 3FWEA 1W6QA 2W68A 1ND2A 2K9ZA 1VBB1 2XL9A 3SH4A 2ZGKA 4LT5A 4OHYA 4P9WA 2AH2A 1AYM2 1MEC1 2WC2A 3ZFGB 4R4XA 3U10A 5A3LA 4L97A 1ND3C 5FTTC 1PGW2 3WT3A 4DFSA 5ABJA 1QGLA 1YNAA 5JCTA 4Q26A 4EJRA 2FMDA 1LOGA 4CDUB 1KXGA 2EAKA 3OGGA 1TE1B 4XBLA 4Q2FA 4XTPA 4HVOA 2V73A 1YUDA 1RUC3 1KJLA 1JW6A 2E7TA 1H2NA 1GV9A 2TBVA 2A71A 1R1ZA 4MGZE 2QDNA 4OHZA 2SLIA 4MUVA 1LGBA 3WXPA 1H0BA 2ZGUA 1C8M1 4CP0A 3AB0A 3NVCA 3MI8A 2P3IA 4XBQA 5EWSA 3WDXA 5JAXA 5E16A 1RUE1 1S0CA 1NE4A 1NA1C 4LA2A 4CDQA 5AVPA 4JCKA 3U07A 4W6XA 1JTZX 2GU9A 2LALA 2VMGA 4NN0A 3UJOA 1HRV3 4H7MA 4AFAA 2H0VA 1X82A 3WW1A 3J26N 5KC5A 1KDMA 4OHVA 4XF3A 4Z2WA 1PGL2 4QGNA 3WUDA 1RMU1 4E9KA 3MIEA 4IEPA 1UU6A 3SCFA 2BTVC 2IWGB 4TSVA 4XXPA 1ND3A 5GLWA 1RUF1 4PQ9A 4QPGC 2R071 1KD7A 2CYFA 2H6BA 4Y1ZA 3U11A 4QQHA 4JAAA 4FOWA 2RMU1 3WINE 4XHBA 2A6ZA 5DDJ1 2WLPA 4AGGA 5IK7A 1LEDA 4ONUA 1MVQA 3I59A 1RJ8A 1ULFA 4LBQB 5T55A 2Z69A 2FZ2A 4NO4A 1ZBE2 3BALA 1AR81 4B29A 4OFGA 1WD4A 4I30A 1W2UA 3AMMA 3NV4A 2PLV3 3TN92 1OOPB 3VHNA 3UL2A 1NA1A 4XFAA 4GB32 1AYM1 1RUD2 1YO8A 4MZUA 2Q8OA 3WP6A 4FSJA 1PGW1 4BQ1A 2QVSB 3WX5A 1TEIA 5J98B 4ORFA 5JI9A 1VR3A 3GBFA 1CAVB 3DPRB 3V56A 1AXZA 5K0UB 3V0BA 1QQP2 1CAXA 2XKPA 1SEFA 1WW6A 2BFUS 2WS93 2D5FA 4AI1A 2DV9A 2CGNA 4JC1A 2PFWA 4M3CE 2WL1A 2BWAA 4XFHA 1RUI3 2VNRA 1H30A 3O5SA 4FPYA 4HT1T 4COWA 1FOD3 2E51A 1IGOA 4Y22B 1YIPA 4YW3A 2EXHA 1DGWX 5KHKA 4E2QA 2D43A 3ZYRA 1SLTA 3B9CA 4QPGA 5L19A 3IKWA 3PNAA 2RS33 4IEYA 1DDLA 1TME3 4BIFA 4YGCA 1YJKA 4PCRA 1REFA 3OF1A 4F3JA 2OUJA 4AK3A 1LKNA 3WQ1A 5BXXA 4AQTA 4UBHA 5DUXA 4XJ9A 4MH0E 2RHPA 1MS4A 2Z5WA 1PGL1 4EWDA 2YUEA 2JICA 3AXDA 2EIGA 3B00A 2WNUB 4Q4X2 4IEUA 4ES8A 3UKTA 4ASLA 3ILNA 2VPVA 1KFXL 3H9AA 1VBE2 1OKQA 4AFCA 2XWBB 1X7NA 3GBWA 2XH6A 5JZGC 1KRIA 5ACA2 4HKLA 1BCXA 5DZFA 5FQ0B 1N1VA 3KMHA 3ZDSA 1I3HA 4FPHA 4QHBA 4K1ZA 1G9FA 4E4SA 1OQDA 3NO8A 4XQWA 2W39A 2HWE3 3SLIA 5J48A 4A7KA 4IV3C 1GR3A 4FP2A 1ZBE1 2WINB 2Q30A 1V00A 1H9WA 1HQNA 5CADA 4N90A 4AGVA 2DVFA 3WOGA 1QOTA 2X29A 4GKXA 1LENA 4FP3A 2QZ3A 3TN91 1VJ2A 4CEWB 2CGOA 1DQ1A 4GB31 3G7DA 1RUD1 2VOXA 2W0XA 5J09A 3LWCA 4AHXA 3OBRA 1PNGA 4AQSA 1HX6A 3MW4A 3POSA 2R0FA 2JG9B 3W9AA 2GSYA 2E9QA 5BNNC 2NPIA 4F8AA 4FPOB 5DZEA 3K48A 4N43C 4NHMA 2A70A 4PIYA 3N36A 4J6GA 1NE6A 3VHOA 4IETA 1QQP1 1U5XA 4O9GA 2CWMA 2GAUA 1GZCA 5BY5A 1SCSA 4C1XA 2Y0IA 4QM9A 2ZABA 2DVDA 1GQHA 2HEYF 4EN6B 1YFYA 1CAWB 1QU0A 2B46X 1RUOA 1RVF3 1IZ3A 2ILMA 1QJU2 1XXNA 2WQZC 4E2GA 3B94A 4RR3C 1ZBA3 5AVAA 1EV12 4LE4A 4LBLA 5JZGA 2R1DA 1GZWA 4R9AA 2CWSA 4P9YA 3B02A 3SH5A 5AFBA 1PO23 3VN4A