2DVGA

Crystal structure of peanut lectin gal-alpha-1,6-glc complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galactose-binding lectin
publication title Structural studies on peanut lectin complexed with disaccharides involving different linkages: further insights into the structure and interactions of the lectin
pubmed doi rcsb
total genus 53
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dvgA00
2Z42A 1QMJA 1QNWA 3ZYRA 2P34A 4TYSA 1UX6A 3PVNA 1GZCA 4JRAA 3VKFC 1GSLA 1JBCA 4ISQA 1AX2A 4R9CA 4FPEA 2VW0A 4M3CF 1AJOA 2BQPA 3PMEA 2NMOA 1SLIA 4XBLA 2DYCA 3L2YA 1GYKA 3VUOA 2A71A 3N35A 4XOGA 1Q8PA 1YIFA 2WT1A 2C9AA 3ILRA 2GALA 4YFZA 5T5JA 4GWMA 1GANA 1IS3A 4BMBA 2ZBJA 1F5FA 1MS1A 2TEPA 2GDFA 1G8WA 2V5YA 2VW1A 3AP7A 1XQNA 1IKQA 3H0OA 4M01A 1TEIA 3W58A 4DRVA 2DUOA 1CVNA 4YFWA 5T5LA 1ULDA 1JN2P 2ZAAA 1QOSA 3NWKA 4UW4A 3ZXLA 5JOYA 1SBEA 1DQ2A 2WKKA 2DTYA 4Y1YA 5EXOA 1I1EA 3ZSLA 1WW6A 3AZZA 1DGLA 4PQ9A 4I30A 4FPJA 5DZGA 1MS9A 1V6MA 2ZGTA 4CZSA 4LBQD 4XMIA 4XZPA 4YW1A 2ZGSA 2E7TA 3RQ0A 3SH4A 4FPOB 2AREA 3M3OA 3SNMA 3N36A 1FV2A 1DQ6A 2YY1A 3ILNA 5IK5A 3AP9A 2R0HA 1IKPA 2UWCA 1LOAA 4Q2FA 2ZA9A 2GN3A 2NMNA 2PHXA 2ZKNA 1FATA 1AX0A 1C57A 1DBNA 3UK9A 5JOWA 1IS5A 5CAZA 1RIRA 4XDQA 4R9DA 2DVGA 1N3PA 4K1ZA 5GZCA 4GA9A 4K1YA 2UURA 1MACA 1KRIA 4ISRA 1LOCA 2YXSA 3T1LA 1KJRA 3NV4A 2AENA 1O4YA 2P3IA 3AZWA 4GKYA 1GLHA 4GXLA 4U2AA 3ZXEA 1DFQA 5IT6A 4AVVA 3DGTA 1V6LA 1LHOA 2LALA 3AK0A 1OQ1A 4NO4A 3PJQA 4BMEA 1MVQA 3WUDA 1Q56A 2DUQA 1CESA 1LOFC 4RL7A 1AXKA 1H30A 2OVUA 3FFZA 5DUUA 5FRAA 4YW5A 1RINA 1W0OA 3MW3A 3O0XA 2GMEA 5GLZA 4Q8KA 1D2SA 4YZ3A 4P9XA 1WLDA 3WG3A 1LECA 2SBAA 2ZABA 3VKLA 1Y7BA 3AZYA 1BQPA 1KJLA 4K21A 3WDVA 4FOVA 1HLCA 3IN9A 2Q5TA 2PHFA 4YGEA 4LBQA 1LEDA 1JW6A 2D44A 1N3QA 1SCRA 2ENRA 2JD4A 3LCPA 4YM0A 3OY8A 1G9DA 1LU2A 2NZ9A 2CWMA 2NP0A 4LBLA 4XE9A 1UL9A 4LBQB 3N7JA 1LOGA 3D4KA 4CRQA 2AGSA 2A3YA 3AYDA 4ATFA 1GNHA 1QDOA 3FLPA 5AVAA 4XBNA 1DHKB 3OBTA 1DLLA 3OY8B 3AXDA 3VKOA 1SACA 1KDMA 2B7YA 5H9QA 4LBMA 2ZHKA 3AXEA 1CPNA 4YZ1A 4P9YA 4AGRA 1MS3A 1BXHA 4UW6A 4YG6A 1U0AA 5SV8A 1WW5A 2VW2A 2EALA 1FX5A 1FYUA 1UZZA 2I2SA 2P3KA 3AP4A 3JUUA 4FPFA 4ZXKA 4IQPA 1ENQA 3POSA 4YM3A 4F83A 4AWDA 2NN8A 1KITA 1NLSA 1MZ5A 1QU0A 2A75A 4M3CE 5T54A 1WW7A 3LSDA 1RITA 2R1DA 3N7LA 5IUQA 1UKGA 2D3PA 2JE9A 4PCRA 2A6ZA 4FP3A 3NV3A 4Q26A 5GJ6A 4M3CA 1WD3A 3VKMA 3WCRA 3POWA 3UJOA 1HDKA 2CY6A 2ARXA 5CBLA 1DQ0A 1FNYA 2DU1A 4Y20A 3V0AA 4HANA 4FP2A 1IS6A 2W52A 1W6QA 4M3CB 3ZXKA 2OW4A 2A6XA 3DUIA 4XJWA 1V6KA 2DVAA 3NV1A 1AXYA 3M2MA 5JOZA 3ZSKA 5KXEA 3V0AB 4Y20B 2P37A 1V00A 3D5OA 1W6QB 4C1XA 3RS6A 1S1AA 2EAKA 4Q1RA 3Q9OA 2A6VA 3UJQA 1LHNA 1SLCA 1Z0HA 4FQZA 1SBFA 4Q27A 2ZGRA 2R16A 1N47A 2ZHMA 3O12A 1MS4A 4R9AA 4FVVA 1S0CA 2UWAA 1C1LA 2UU8A 4P14A 1NXD1 1J1TA 3OYWA 3SH5A 3WUCA 1W6MA 3SITA 4FQ4A 5CA6A 5IK8A 5DXDA 4Y22A 5JOXA 3AYEA 3AX4A 3WHUA 3FLTA 3KQRA 4PF5A 5GM0A 2CTVA 3OYWB 2DURA 1W6MB 5EYXA 1AZDA 3M3CA 1H9PA 3OJBA 2ZGUA 1ULCA 3AP5A 3LSEA 5DZFA 1SLAA 2D3SA 5EWSA 1JYCA 4FOWA 2D6NA 1MS0A 5GALA 5JVVA 2W68A 2ZGKA 5HCFA 1N1YA 2ZGMA 2ZACA 1LU1A 3FUOA 1HQLA 1QGLA 1QNYA 4XJ8A 5L73A 1V6IA 4Y24A 4LBJA 4DQAA 1G9CA 2GMPA 4RA0A 1S0JA 4ATEA 2JKBA 3O0VA 1A8DA 3ATGA 5GLTA 3R05A 5HCAA 2WNEA 1GZWA 4YM1A 1YI7A 2ES3A 1ONAA 2A6WA 1V6OA 1S0FA 4AGVA 5IK7A 2R0FA 2VH9A 1LGNA 1UN1A 1YXWA 1N3OA 1Z78A 2HYKA 2OUHA 3BOPA 3FUQA 3N7MA 4NOTA 4BQ1A 1GZWB 3HR9A 4TZDA 2CNAA 1YO8A 2DVDA 2FHRA 5T5PA 1LOBA 4C1WA 2VUAA 2XG3A 3M1HA 4XJUA 5T5OA 1VALA 1ULEA 5E88A 3WVJA 1IOAA 1PZ7A 1EPWA 2EXKA 4FPGA 1SLBA 4YG0A 2EIGA 5H9SA 1CPMA 1OKQA 2V73A 3ZPYA 2VY0A 3BODA 3O0WA 3IKWA 4XILA 1LGCA 1D0HA 2ZGOA 3N7KA 4YLZA 1QF3A 5JLVA 1CN1A 1W6NA 3AYCA 4XTMA 3AP6A 1JUIA 1W6PA 2AR6A 3R4SA 3KM5A 3RG0A 4JC1A 3B3QE 1O4ZA 4Y1VA 2NM1A 3I4IA 1BZWA 3AZXA 3N3HA 4YM2A 5CNAA 5DUVA 3QLQA 3OBRA 1W6NB 1SLLA 4FPYA 2ERFA 3WNXA 1W6PB 3SISA 5GLUA 4AVTA 1YYNA 2ZMLA 5DZEA 4YZ5A 2WT0A 1FNZA 5BYNA 2DTWA 1CR7A 3SLIA 1SLTA 4XMAA 4Y26A 2D6LX 3AFKA 3B01A 1X50A 4FOQA 4P9WA 1AVBA 3ZXFA 4AVSA 1BYHA 1LENA 2DVFA 1FAYA 5KXDA 2DV9A 1IS4A 3AYAA 1LTEA 3M3EA 4XIKA 2EXHA 2YROA 1UAIA 2YV8A 5GLWA 1YRZA 1A78A 2DUPA 3RSJA 3UL2A 3USUA 2GNDA 3CNAA 3MW4A 4XJZA 3MW2A 4JCKA 1JXNA 1LHVA 1B09A 5F5QA 3WV6A 1WD4A 3WZ1A 1GKBA 1LJ7A 1DQ1A 4Q8LA 1CIWA 5F9TA 3BIWE 3TAYA 3USUB 2ZMKA 5T55A 2RHPA 1A3KA 1C4RA 2A6YA 2ZGQA 1G86A 1ENRA 3AJYA 3M3QA 3WLUA 2D6MA 1BKZA 3ZSMA 2WLQA 2P3JA 3VV1A 4ASMB 2PELA 2JECA 1DQ5A 5H9RA 1G9AA 2E7QA 4U36A 2WQZC 2C5DA 3A0KA 4XJAA 5H9PA 4UW5A 5JDBA 5KXBA 4SLIA 2XB6C 3ASIA 3ZSJA 2PHWA 3OGGA 1Q8SA 4PBOA 5E89A 4W65A 1AF9A 3V64A 3FBYA 3WCSA 1GICA 4M00A 2ZGNA 2ZGLA 1JOJA 3RMXA 1V6NA 3WHTA 3VKNA 4DS0A 1AXZA 2A5ZA 2E53A 2PHUA 2ZGPA 1OFSA 2SLIA 3AJZA 1CONA 3GNEA 3WOGA 4WVVA 2AUYA 1WW4A 5GZDA 3V65A 2E6VA 3JU9A 2DWRA 1F9KA 1LCLA 2D7FA 1DZQA 1MR5A 1SCSA 2D6KA 3HN1A 4L8QA 2PHTA 4DFSA 3PVEA 1DYKA 3APBA 4YGBA 1JYIA 2AYHA 1GZ9A 1MVEA 2WSVA 2WJSA 3FLRA 4LBKA 3U4XA 4XXAA 1S0IA 3B9CA 1G7YA 2ARBA 2VU9A 1I3HA 3GALA 3POYA 1F31A 4PBPA 1PZ8A 4BOWA 2EXIA 2JJ6A 4Y1UA 5DG2A 1ZM1A 3T1MA 2D3RA 2YMZA 5GLVA 2ZZJA 1LOFA 4Y22B 4H55A 3OPZA 1ULFA 2E51A 4R9BA 3W59A 1LOEA 1GV9A 1H9WA 2CYFA 4Y1ZA 1G9BA 1QKQA 1W6OA 4FPHA 3WG1A 3IMNA 3ZVXA 1MS8A 2A70A 2A7AA 1CJPA 1DQ4A 1HKDA 1Q8OA 1SFYA 3IM0A 2D43A 1S0GA 2ZHNA 3INAA 5JMCA 2EF6A 4YGDA 3QCWA 4XXPA 1W6OB 2CWSA 1WLCA 4HL0A 3C2UA 4Q1PA 1JHNA 2ZMNA 1URXA 2W08A 1LHUA 1VLNA 2CL2A 4GALA 4OZXA 4YW4A 4KBBA 4BM8A 2P2KA 5GZFA 4XTPA 2A3XA 4MYEA 5E8AA 1BJQA 1UPSA 2GN7A 1FV3A 1Q8QA 2JE7A 2ZHLA 1N1TA 1KQRA 3R4UA 5DG1A 5EYYA 2JDZA 3WDYA 4XHBA 4CTEA 4DPNA 1AX1A 1WUVA 1APNA 1LGBA 1QOTA 4YGCA 3WDWA 1GNZA 4FPCA 2R49A 2A3WA 1WCSA 3D6EA 1V6JA 1S0DA 2KM2A 4ITCA 4XJ9A 2GNTA 5T50A 1G9FA 2G4IA 1UZYA 2PHRA 2WT2A 4YZ4A 5DUWA 5GZGA 3A4UA 2R1BA 3NV2A 1KDKA 1SBDA 3O5SA 3WG4A 4YZ2A 3WG2A 3B69A 4XBQA 2GNBA 1ENSA 4GWNA 5DUXA 1QDCA 5LK5A 5IK4A 2D6OX 1S0BA 3RMYA 2OUJA 2NYYA 3RRDA 2YZ4A 3A0NA 1HQWA 1N1VA 4LBOA 2H0BA 5HCBA 1LULA 4BLIA 1C1FA 5T52A 1Q8VA 4UW3A 2D6PA 2DU0A 4LBNA 1GBGA 1LEMA 3WDTA 3IPVA 3WDUA 4BPZA 1N1SA 1VAVA 1PZ9A 1ZA4A 3ZYPA 1VIWB 4XYXA 2FMDA 2DVBA 3ILFA 3PVOA 4D69A 4Z8BA 1S0EA 4YG3A 4AGGA 3MPPG 3IPVB 3SH3A 1LESA 1MZ6A 4FPLA 3B00A 1CQ9A 1WBFA 2GMMA 4WVWA 3I8TA 1WBLA 2VXRA 4K20A 4XHXA 3T2TA 1UMZA 1W0PA 4FPKA 5CB7A 1DYPA 4BLJA 3ENRA 1ULGA 4ZKTB 2WSUA 3MEPA 1LHWA 2AH2A 2GNMA 1WLWA 3AZVA 4WV8A 1DIWA 2LTNA 1QOOA 2W39A 3WDXA 3BTAA 3V0BA 4XIOA 1VAMA 4WZFA 4YW2A 5KXCA 4Y1XA 1AJKA 3HMYA 3TB0A 1R1ZA 2EXJA 3V0BB 2UWBA 4YW3A 1MS5A 1LODA 5FREA 4GKXA 5GZEA 3ZXJA 4AYUA 4DRRA 4FOYA
chains in the Genus database with same CATH superfamily
4CUAA 1US3A 2Y38A 2FMYA 2VUJA 4JZRA 1ND3C 5FUNA 4FXGB 4LIVA 1UX6A 3PVNA 3VKFC 1DGWA 1AX2A 4B4QA 5JVVA 4JDMA 4M3CF 1F4HA 4XBLA 3VD3A 5FWJA 2JG9C 3L2YA 2ZKLA 3S57A 3VUOA 4Y5TA 2MNGA 4CCJA 1NA1A 2Z69A 5FCCA 5DPNA 1W9WA 2GALA 4K7JA 4YFZA 4GWMA 2VOWA 1UU6A 2JXAA 1IS3A 4QX3A 2WIIB 2BU9A 5A33A 5LK7B 1QJY3 1YUDA 2VW1A 4DRVA 1X7NA 1NA1B 3CKHA 3OPWA 5FMOS 2OT7A 1CVNA 2JKXA 1W8NA 4QDRA 3E5QA 2ZAAA 5A33B 5JOYA 1QOSA 5JXJA 3O1PA 5FZAA 3ZSLA 3EB7A 3NAPA 1UZWA 1GWKA 5CZKA 1BMV1 2ZEXA 3K4AA 4XMIA 4FAHA 5CADA 1DP0A 4LO5B 2ZGSA 3IT8A 3NAPB 5JIUA 4LMFA 3ILNA 2Q4SA 4JTOA 1VBE1 3DCQA 3O1VA 2UWCA 1X33A 4Q2FA 1R1A1 5ACA1 3IDBB 5AFEA 2PHXA 2X5IC 2C9KA 2C26A 4Q5OA 3VL8A 3T2PA 2HWD2 4Q4Y3 2HWF3 3WNOA 5LBFA 1OT5A 1BVVA 5CAZA 2B9UA 3HNMA 4R9DA 4LORA 4ORFA 3U11A 2EIDA 3RWNA 4KG8A 5IVEA 4XW3A 1DYOA 3I3DA 3JQXA 2UURA 2VBBA 4CEYC 1CZVA 1KS4A 1SZBA 2YXSA 3KCYA 4G4FA 4QQPA 5BNOC 3HIFA 4UFIA 2RMU2 3KLSA 2VOTA 2WABA 4GKYA 2XJQA 1AR91 4AFDA 4IXLA 2PAKA 1LHOA 2VZPA 2IXJA 5FMBA 1O3RA 2R30A 3JB4C 2XUEA 3HN3A 4MGSA 5A3UA 1NCQC 2PLV3 2WS93 1MVQA 1KEXA 1UYPA 4RS5B 5FP4A 3MLJA 1S2EA 4QPWA 1LOFC 5LA1A 4RL7A 1UY0A 1UXXX 5JR7B 2ZEWA 3FFZA 3CL1A 4CDQB 4CDWC 2QQNA 1S2KA 3AKPA 4YW5A 5A7PA 4K40A 3AVSA 1W0OA 4OI0A 2GMEA 5GLZA 3T0BA 1H8VA 1QQP3 2VVDA 4HXCA 4P9XA 3M8LA 3C8XA 2SBAA 5F6LB 3JBG3 4BZ4A 1YI9A 5KWRA 4AAPA 3WX5A 1IZ3A 3CQOA 3GZUC 1AR83 3HAGA 2VG9A 2Q5TA 4FFIA 2XHKA 5KHGA 3GZEA 1R092 1W9TA 1N3QA 1SCRA 2ENRA 1ZVFA 2JD4A 1VBA2 1SEFA 3A21A 2VECA 5LY2A 2EAAA 5BUVA 5IYYA 2AZ5A 3MBWA 4PIZA 3ITQA 2V4AA 2ZX1A 3N9QA 5FPZA 1GWLA 4W8JA 4XE9A 3RZLA 1UL9A 2ZEZA 4E9KA 1GNHA 1QDOA 3FLPA 1DHKB 1E5HA 3OBTA 5KR7A 1LNSA 2B7YA 5H9QA 1QH6A 1WCQA 4L11A 4LBMA 1YFWA 4LHLA 4BHPA 4HKLA 3ZPOA 5FO8B 5IVFA 4BK5A 2Q0AA 1VRH3 3OUJA 1K3IA 4ARYA 3AKSA 4RR3C 5SV8A 3ZO0B 4I0AA 1UZZA 2JIGA 3F95A 3J7LA 4LULA 3N4MA 4NVPA 4WM8C 4LE3A 2OYZA 2NN8A 1KITA 4F83A 2F4PA 3KHCA 3LKJA 1PO22 1RITA 4IEXA 4AI2A 3N7LA 1H8TC 1YQCA 2PYTA 1NAEA 1WCKA 5C4WC 2FD8A 4C0HA 5ACA3 2I07B 4ES9A 1QXPA 1GOFA 1YQ5A 2QQJA 1U5ZA 3LFMA 4Q26A 5FV3A 5GJ6A 4E2GA 5FYVA 4HSJA 4M3CA 3NJYA 1WD3A 4XF0A 1PIV2 4I01A 3RWKX 2RM22 1COV1 1FNYA 2G9GA 2J1UA 4Y20A 3V0AA 3DYOA 4FP2A 5CKMA 5F1RA 2W52A 1W6QA 4M3CB 4XJWA 2RG4A 5IVYA 3EMRA 3B7MA 3H3LA 3MGUA 5KXEA 3V0AB 4Y20B 2ZX3A 2P37A 4W50A 1JH5A 3BPSA 1W6QB 1ZZ9A 2BPA2 1MQTC 1REDA 2JG8C 2VZOA 2A6VA 4KMQA 1GWMA 5J09A 1PO11 1SBFA 1UXZA 1OFNA 2UYAA 2VNGA 2VTXJ 1QY4A 3DECA 3K3OA 1YFUA 5KHKA 4ASKA 4LKDA 3EHKA 2W1UA 4FVVA 3UNPA 3FJSA 3ZYJB 5IVVA 3RZKA 4NPRA 3VZJA 1W6MA 2HLEA 4A4AA 3D0JA 5CA6A 4I0BA 1ENXA 3KQ4B 1RMU1 2BZDA 2K0GA 2VULA 1AR61 3TN91 3KQRA 4PF5A 3THTA 1F15A 1X82A 3O1OA 1W6MB 3CO2A 1RUH2 3IAPA 4XUNA 2JDKA 2Z2SB 1X8EA 2VCMA 1JYCA 2O1QA 2VVFA 4FOWA 5FUPA 4CCCA 4JVAA 1XYNA 4F7ZA 1JS9A 2LM3A 4LHNA 5TSWA 5FZ8A 1HXS1 1UU4A 1HQLA 1QNYA 4YSFA 4DXSA 1P8JA 1CJDA 1V0AA 1W2AX 2GMPA 1HRI3 3AKQA 5EPAA 1S0JA 4OI2A 4JGYB 1QJEA 2JKBA 1A8DA 1I6XA 1O5UA 3O0VA 5GLTA 4HETA 2CDPA 5A7NA 3PTRB 2ES3A 3LZZA 3ZFEA 1LRHA 1ONAA 2A6WA 1UD1A 2W46A 4AGVA 1ZA7A 1UN1A 1YXWA 2X29A 5ANNA 4EQVA 1QJU2 2YB7A 5K7PA 4EWAA 2CNAA 2FHRA 3ZFEB 4C1WA 3H8OA 3M1HA 5T5OA 1UZ0A 1ULEA 4BIFA 3A23A 3SMHA 1OPOA 3JD73 1W03A 3NMBA 5ISLA 2IXCA 4NRQA 1EP0A 1OKQA 4XUQA 3FN9A 3BN6A 4QQOA 3O0WA 1RJ7A 3IKWA 4QU2A 4XILA 5FPVA 3B5LB 1NYWA 3N7KA 1QF3A 2J1SA 3AYCA 4XTMA 1XSRA 2E32A 5A7QA 2HWB1 3B3QE 1JU4A 3G6JB 5CIRA 2AEZA 1K42A 1XXNA 5DUVA 3N3HA 4L99A 5CNAA 4OUSA 4UFJA 1K5MA 4OHYA 3SISA 5A1LA 3WF0A 1B35A 4AVTA 1YYNA 5FMDA 2FZ1A 2QDRA 4FFFA 4L97A 5FMOL 3I2JA 2DTWA 3SLIA 1SLTA 4XMAA 2D6LX 1K5MB 1YHFA 4AVSA 4QKFA 1B35B 3GHMA 3LEKA 5D8AA 4AI1A 4A7KA 5C70A 3J8F2 4NIGA 2DV9A 3FMGA 3I2KA 4IEYA 3ZR6A 1QJFA 3AYAA 1ZBA1 3HQUA 3M3EA 1NY71 1K12A 1UAIA 2WYSA 4OUMA 5A3NA 1FMD2 1W99A 4N9HA 4DNYA 5A3LA 3OF1A 5D8AB 4CXXA 3UL2A 3S7EA 2GNDA 3MW4A 4EV0A 4L2NA 5ABJC 4BQ5A 1WD4A 3VZLA 1IPSA 1LJ7A 4EWDA 5FLIA 3DPRC 3RJRA 1BBT1 3I3BA 3TAYA 1ODNA 5LY1A 1JUHA 2ZMKA 4QB6A 1OA3A 5T55A 2ZGQA 4D0QA 3RZMA 1RUD1 3OBAA 3KT4A 3ZYIB 3M7AA 3S30A 3ETPA 3ZN4A 3AMMA 4EROA 3VDBA 3A0KA 4FT8A 5JZGC 1GQPA 2ZZQA 4MHUA 1NLRA 5CFCC 5FZHA 1BEV1 3I3MA 1NX9A 3FBYA 1RUNA 2WNVC 1QIQA 4BQ3A 1RVF1 2FQPA 3ACLA 1V6NA 3SXWA 1TZOA 4JHZA 2E53A 4CP1A 4IGOA 2TNFA 5A6QA 1D7PM 2SLIA 3AJZA 3AKTA 3EXUA 1G6NA 2IWGB 3WOGA 4WVVA 3OGJA 2AUYA 4MLOA 4JV4A 4ARXA 1WCDJ 2E6VA 5EIYB 4AOCA 3E5XA 3JU9A 1HXS3 1XYPA 2JDPA 3BVCA 1O8SA 3I2DA 2CHHA 4OVEA 2RS13 1O3QA 1LCLA 1DZQA 2D6KA 3HN1A 2F17A 1SMVA 2RS53 4CU7A 4CUCA 5K8SA 4YGBA 1JYIA 1X36A 1NUKA 2AYHA 2PQSA 4IL7A 5FXZA 2FBEA 2WSVA 2B5HA 3FLRA 4LBKA 4YARA 1C28A 5L19A 1S0IA 3B9CA 4XDPA 3T08A 1F31A 5J36A 4Y1UA 3BALA 1HB3A 2YMZA 2YC2A 2RR12 4H55A 1S55A 3W59A 5A7OA 4MV2A 3S5QA 1ND2A 1CAVB 3AL6A 4BQXA 4AI9A 5IW0A 1TME1 4HFSA 3I49A 5I8SA 4CPBD 5C9AC 4QQHA 1VBE2 2A70A 1WCUA 2A7AA 3NKTA 4LEJA 1DQ4A 1HKDA 1SFYA 1SG3A 3CZUA 4NAOA 1VB4A 2D43A 3ES4A 4B1LA 2IXHA 3QCWA 2Q8EA 1FXZA 2G9FA 5C8CC 4EZ4A 1JZ8A 2QTWB 4YPJA 5JXHA 2GC0A 3BU7A 3POBA 5L7OA 4LOSA 2DCTA 3RDIA 1LHUA 1VLNA 1NZCA 3ON7A 4OZXA 1DGWX 1EAH1 3A7QA 3CJXA 4KBBA 3VB9A 1JZ7A 1JYWA 4XTPA 2A3XA 5L7OB 3AB0A 4Q4X2 1O91A 3U14A 4LUMA 4O9EA 4PIYA 2WWUA 2XBO2 2GN7A 4DUXA 1FV3A 2JE7A 3O7OA 2X05A 4AR2A 4CTEA 4XHBA 3WNLA 4JX0A 1UIKA 2Y64A 1WUVA 1QOTA 1LGBA 2GP3A 5JPNB 4FPCA 3O1RA 2C0ZA 1K45A 2KXLA 1WCSA 2R49A 2VZUA 4G3YC 4HN0A 4NRPA 4RN5A 4TXWA 4XJ9A 2FDJA 1ZBA3 2XVKA 2JIJA 2IXLA 2YG0A 1RUI2 2VMIA 2QJVA 2G4IA 2W5FA 5K0UA 2HWC1 2ZAHA 3UGHA 3PU8A 1WKYA 4KL1A 3O5SA 2G19A 5KBFA 5BNNA 4AFBA 5A1FA 3WW3A 5F5AA 5IK4A 1O7FA 3VBOC 4S2DA 2OUJA 3MFAA 1CAXA 5K4LA 2QDNA 2R043 3H7JA 4Q29A 5G04L 1OA2A 3LEIA 4DO0A 5BNNB 2WAOA 4CYDA 5HCBA 4R4ZA 3H42B 1CAXB 2DU0A 3BGAA 5HPOA 2HEVF 2W47A 3ZOIA 2Z5WA 3IPVA 3WDUA 4AAXA 5E1RA 1N1SA 4CEWA 5JI9A 3VD9A 1PZ9A 1ZA4A 2PXJA 3CDZB 3S0MA 1UOBA 4XYXA 4D69A 3VBUC 4CU6A 1FI2A 1TG7A 2NLRA 3IPVB 4CEWB 4NMIA 3N9LA 2FDHA 3B00A 1CQ9A 1WBFA 2GMMA 4WVWA 2WNOA 4XHXA 3BI3A 1FPN1 4FPKA 2WBKA 4HZFA 4BLJA 4LK7A 4XF1A 3ENRA 1ULGA 4D6QA 2QNKA 2GNMA 3OSDA 5EZWA 3AZVA 4OULA 4AW7A 2WZR1 5FPBA 3IDCB 3V0BA 4X8PA 4WM7C 1GFF2 2JEMA 3TBDA 4RHV1 3HNYM 4XF4A 5FP9A 1U5XA 2VO5A 4NUBA 2WR9A 1SHWB 2VNVA 3N9PA 3V0BB 5CG8A 4LO4B 3KT7A 4B1MA 5GZEA 2R061 5BNPA 5BV6A 4DRRA 4YRDA 4XOGA 2BERA 1H6YA 4ES8A 1VBD2 5DDJ1 1QMJA 4A44A 2K9ZA 3WQ7A 3UKNA 3ZYRA 1WWYA 1GZCA 1YFYA 4Q4V3 2HWE2 2IFRA 3CMGA 4ISQA 2P5BA 4QPYA 5BNPB 3KF5A 4MUVA 2FDIA 2O0OA 3CF6E 4YW7A 1C8M3 4AFCA 1AJOA 2BQPA 1ASJ2 4LHSA 2DYCA 2JDUA 3P3PA 1Z7S1 2A71A 1O59A 3N9NA 1Q8PA 4ZU4A 3VBFA 2HWD3 4COZA 4DUVA 3ILRA 4EYUA 4CP2A 1GANA 3MV01 3QH7A 1OURA 1MS1A 2TEPA 2GDFA 1G8WA 4BQ4A 3VBFB 3H0OA 5J96B 4P08A 1W28A 1TEIA 5FKCA 2WUHA 4QGLA 4GB31 4QAWA 3U78A 2JDHA 4YFWA 1JN2P 4QU1A 3ZXLA 1DQ2A 2WKKA 2DTYA 2VMGA 2K46A 4KG0A 4Y1YA 1I1EA 4J1XA 3VGIA 4AQSA 1WW6A 1OD5A 2BW8A 4PQ9A 4I30A 2RMU3 4FPJA 4AZZA 3R4DB 4CZSA 1COV2 1EUUA 4QM9A 1XU1A 1BCXA 5C3QA 4XC9A 3NNFA 3RQ0A 5F39A 1BK0A 1PGW2 1MZFA 2AREA 3M3OA 3SNMA 3TOJA 2X09A 4HVQA 4YVSA 4IEPA 1PGL1 5HBAA 4ZU5A 5FO7B 4RQPA 1LOAA 4OI1A 3WP5A 3P3NA 2NMNA 2YC0A 3IWZA 3VL9A 3URFA 1QJY1 2CGNA 4YVSB 1AX0A 1DBNA 4NHKA 2UY9A 2W1QA 3RFRA 4XDQA 2XR4A 4D7TA 1ZRFA 5CU1A 1RUF2 4NE9A 1N3PA 2OPWA 2HWC3 4HSLA 1HRV2 3HJRA 4GA9A 4K1ZA 4QHZA 1L7RA 1AR72 4K1YA 2YYOA 4BQ2A 3AFGA 4UBGA 1MACA 1RUJ2 4A2UA 1KRIA 3T1LA 3WW1A 3H50A 5FY8A 1AYM2 3OBZA 1KJRA 2XQRA 1YFXA 4KU8A 3RGBA 4COWA 5F3EA 3I2HA 2ZXQA 2WO2A 1IQAA 5FZDA 2W87A 2P3IA 5FZKA 1WGPA 3D82A 4NHMA 1DFQA 4QWNA 3ZXEA 4AVVA 1V6LA 2CAUA 4Q0QA 2RDQA 1IG0A 3OD0A 5FJHA 1PX3A 3AK0A 4Q4Y1 1OQ1A 2HWF1 4P5HA 4AHZA 2GH2A 4W6YA 1ALYA 1S4CA 4BMEA 4QPGA 2XJUA 4WZCA 5FXWA 1AHSA 3HVDA 3T0DA 2BOIA 2DUQA 4JDNA 1AXKA 1RHI2 3PUIA 2PAEA 1ZBE1 5EP9A 3POGA 4YW6A 2LS6A 5LATA 2OXBA 4MXWA 1D2SA 4YZ3A 2B46X 2WZR3 1WLDA 3GBGA 4GWIA 1LECA 2J22A 2DFBA 3H1YA 4JQRA 3UKTA 4R8HA 1OHFA 3TEXA 2ZABA 3TNQA 2BP6A 2VOKA 1BQPA 3BPZA 4MXWB 3ST7A 4QX1A 3LIHA 1MPXA 4JGZA 5FPAA 5F8PA 4HT1T 2IZWA 4K21A 3ZFFC 4CCDA 2W0XA 3J9SA 1HJGA 2OZJA 1C3HA 1H6XA 3HD8B 3IN9A 5FZLA 1E5RA 2PHFA 3NKGA 2KR2A 3ZLIA 1VE0A 2WC2A 3IAQA 4BA6A 2QCSB 5CISA 4QXCA 4LBQA 1JW6A 3LCPA 3LD8A 3DEMA 3WQBA 1OUXA 2MEV3 4IEZA 4MX3A 1G9DA 3GF6A 2NZ9A 4INDA 4MO3M 4Q4W1 4LBQB 3N7JA 1LOGA 3D4KA 1KGYA 2H6BA 2AGSA 4IE7A 1W8OA 4IESA 5AVAA 2GC2A 2XUMA 1W8FA 1DLLA 3WP4A 2QQKA 2ZJCA 4BCUA 2XVGA 2JG9A 3JBG1 1UY3A 1OVPA 1PIV3 3T09A 2YFUA 1T2XA 4BK4A 1H4GA 3CEWA 3BIEA 1CPNA 1SDDB 4AEDC 2BNMA 1AR81 1BXHA 1O4TA 2JG9B 4UW6A 2Q8OA 1UOFA 3N9MA 4QKNA 1UX7A 5FUIA 2VW2A 1YEWA 2EVXA 1UPIA 1FX5A 4FTBA 1W8HA 3AP4A 2CAVA 3H7YA 2VQUA 3L9JT 1R082 3TEZA 4G9SB 3ELNA 4NWVA 2VL4A 5FZEA 4EE2A 3H8UA 2J7MA 4AWDA 1NLSA 1MZ5A 1HN1A 1QU0A 2A75A 3B02A 2JB8A 2XGXA 2RDRA 3LSDA 2WAAA 1XOYA 2R1DA 1BBT2 3D0SA 5DAWA 4MXVA 5FMCA 3KSCA 5IUQA 2W91A 2JE9A 5J3UA 2FZ2A 2XXZA 5KHJA 1RUD2 1SFNA 1REEA 3NV3A 1NOVA 2Y8KA 1HIXA 1VRH1 3NSTA 4BE3A 1HDKA 1UYXA 2CY6A 4IE0A 3ZSEA 1RUH3 4MZUA 5CBLA 2DU1A 4HANA 1W8ZA 4TLGA 4HVOA 3LDRA 4Y4YA 2R32A 1POV1 2NQYA 3KV6A 4I09A 4Z2AA 1YLLA 3CIHA 3K75B 3MIBA 3NJVA 3NV1A 3KHBA 3ZIWA 1BEV2 3S5AA 1XPWA 3IDEA 5C71A 4LJHA 3VDDA 3ZFGA 1OA4A 1SPPA 5JOZA 2D40A 3Q8FA 4QQLA 3D5OA 5I8YA 4Q0PA 5FY0A 5KC5A 4HN1A 3RS6A 2EAKA 4N43A 5A3PA 3R0RA 2ORZA 3ALQA 3UJQA 5BNOA 1SLCA 3VDDB 4M01A 3ZFGB 4AF9A 1OLQA 1NQDA 3I54A 5A3OA 3AM2A 3O12A 3HPNA 4R9AA 4N43B 2FDKA 4L92A 5BNOB 2OPKA 2WFF2 3BB6A 1J1TA 1RUC2 3SH5A 1UZVA 3FC0A 3SITA 4FQ4A 2W95A 4A3ZA 2Y0OA 4AL9A 3K46A 1VBC3 3PUHA 3AX4A 3IB3A 2V4VA 1NA1C 1V9U2 5GM0A 3H8RA 2CTVA 5FP3A 3T3YA 2JDNA 4Z92B 1ZBE3 2BBVA 5J1XA 1ULCA 4SBVA 2XWJB 1QXJA 4XCAA 5DZFA 4FSJA 2D6NA 5GALA 4CDWA 1RUE1 5FBZA 2DCKA 5HCFA 5LBBA 1POQA 2ZGMA 4JTNA 4M0NA 5G05L 3C7OA 1IPKA 4F8AA 4Y24A 3PHMA 4LE4A 1BVP1 4CDWB 3NAPC 2HYXA 4LBJA 1G9CA 5IJRA 4RA0A 2HH9A 4ATEA 1PMHX 3ATGA 4CE8A 4XQWA 1AYN2 4UXAA 1GZWA 3ACGA 3PDQA 4META 3T2QA 3PUSA 5FYMA 1S0FA 5IK7A 2W94A 2VH9A 1LGNA 3BOPA 1N3OA 2HYKA 4BQ1A 3I3EA 4O9GA 1GZWB 1HB4A 2QBXA 4TZDA 1YO8A 2VBPA 1F4AA 4Q4W3 1LOBA 5T5PA 3SC7X 2XG3A 3Q8EA 3UGFA 4XJUA 1VALA 1W2OA 1A34A 3J8F3 2K2SA 2VAUA 5E88A 1YJLA 1I9RA 5KC6A 3LAGA 1VRBA 3ZDVA 2RV9A 4W6XA 1EPWA 2EXKA 3FBMA 4OHWA 1I5ZA 1FMD3 3JCIA 1CPMA 2V73A 3UETA 3ZPYA 3C7HA 3QOPA 4WVZA 4IEUA 2OX0A 4E8CA 4P02B 2ETEA 2F6BA 1D0HA 2R6QA 4YLZA 1HRI1 3O1UA 1CN1A 1XNAA 2FCUA 5FYIA 5J37A 1JUIA 2PMWB 1W6PA 3R4SA 1TQ5A 4XPVA 4JC1A 3RG0A 1GNYA 2C1FA 4R4XA 4Y1VA 4FTEA 4Y5SA 2NM1A 3KVBA 4RR3A 1S2BA 1SLLA 2ERFA 1W06A 1W6PB 4RS5C 4AEMA 1DDLA 5DZEA 1AL22 1XU2A 1JYVA 4HLTA 4RGKA 3LA3A 4RGAA 3B01A 4P9WA 1X50A 3ZXFA 4CDQC 1NCRA 3JD71 5IVJA 5AVPA 4AHWA 2P4EA 5EQUA 5AC93 1W0NA 1NZIA 2DVFA 2ATFA 1H8TA 1EY2A 5KXDA 1H2LA 5C4WA 2WZ8A 2QQPA 1NCRB 3WNMA 3SQOA 5C3SA 5GLWA 2DUPA 1CZTA 4P9IA 1H8TB 4H7LA 1EYBA 5CB7A 5CYYA 3MW2A 5C4WB 1B09A 4XF9A 2BOJA 2WA3A 1POV3 3WV6A 3WZ1A 1GKBA 5FY1A 4Q8LA 1CIWA 4UBHA 3H1MA 1W9FA 4BXSV 2GU9A 2QUOA 3T4VA 1UU5A 2BGCA 5F3IA 5FZ6A 2F4LA 4K8FA 2RHPA 2A6YA 1F35A 2E31A 3ZSMA 3RPQA 1BKZA 4MH0E 3LDBA 1QXRA 1UW8A 1NE6A 3GJBA 3PIGA 2PELA 2JDAA 2D97A 5IFPA 1G9AA 2QFEA 4RHV2 3VBRC 2BV4A 5JDBA 4KWKA 5H9PA 5FY7A 4PLNA 2YUEA 4XQDA 2PHWA 1OBNA 1Q8SA 4IV1A 4Z07A 2I45A 1ZZCA 2BDRA 2RR13 3PUQA 4L9BA 3WCSA 4Q0VA 1GICA 2VTFA 4CCLA 4B4PA 1JMUB 2XJVA 2ZGLA 4IV1B 2WN2A 5C33A 4KWLA 4DS0A 2A5ZA 3WF3A 3T2OA 1RUE3 3V65A 1Z7S2 4NAMA 5A32A 5FLHA 5FYYA 3U07A 1DG6A 1YIPA 1GMMA 4JAAA 4JKMA 3ROUA 3ZMOA 1SCSA 1GUIA 5FZIA 2PHTA 4DFSA 3APBA 3PU3A 1QH7A 4P9LA 2HEYF 5A32B 3T0AA 5FOJB 1OF3A 2Y60A 4GAZA 1MVEA 4C91A 1WLTA 3VHRA 4CCMA 3EQEA 3MZHA 4NWWA 2RE9A 4Q4X3 2VQ0A 3VBSA 3MHZA 3UKVA 2EXIA 2RS31 1VJ2A 3CZJA 2NPIA 5DG2A 5L9VA 3T1MA 2W1SA 2YGLA 2ZZJA 3ZR5A 4R9BA 3WR0A 4COYA 4GMP0 2Y0IA 3VBSB 5FYCA 2QZ2A 1GV9A 5FXXA 3IMMA 3CU7A 1H9WA 5EJ3A 4YVWC 2VE1A 2VQTA 3LE0A 1QKQA 4OMDA 5A3WA 4ZONA 1CX1A 1I5PA 2EA7A 4NIIA 1D4M1 1MS8A 3I2IA 4IV3A 2RS11 1CJPA 1Q8OA 2VTXA 4MGYE 2RS51 5CFDA 3INAA 3SHRA 4YGDA 1YNAA 4J25A 1D2QA 4HL0A 1W8TA 4LO6B 3OUHA 1URXA 3FFQA 3LEGA 4IV3B 3NNJA 4PDWA 3H3UA 5CFDB 2CL2A 3T30A 3I7DA 1QJX2 3X29B 4BB3A 1QHDA 4PDWB 3ZXDA 1BJQA 2JD9A 3HNBM 1UPSA 1CAUA 3VBHC 4N7UA 1RTVA 5CKNA 1Q8QA 2PHDA 3MICA 2WO1A 3R4UA 1KQRA 3H3ZA 4LUKA 3W5MA 3I59A 1CAUB 1GNZA 4OZOA 2RDNA 5C7GA 3RI9A 3D6EA 5E6HA 3VD5A 2L9LA 4QX7A 2GP5A 4ZXEA 1JZ4A 1G9FA 3I59B 1UZYA 4Q4Y2 5FZGA 2HWF2 5B4XA 1UWWA 3NV2A 5HI0A 1KDKA 1UYZA 2R072 2WNUC 3QBQA 4HPKA 2VMFA 3B69A 1ENSA 1L3JA 4GWNA 2PAMA 1H1MA 5DUXA 5FDBA 2D6OX 4XUPA 1S0BA 3RMYA 4JGYC 1CIYA 2NYYA 1XJAA 1PVC3 4HPKB 5F5CA 1VP6A 1N1VA 2VUCA 4BLIA 2H0BA 4CSWA 1LULA 2Z79A 1VMJA 4AHYA 1GBGA 1VBB2 2N7GA 1AL0G 4LOTA 2FMDA 3ILFA 2HWE3 1S0EA 4OHXA 5IAVA 5FFOC 4LTAA 1MZ6A 4NHYA 1MEC2 2WS92 2PLV2 1FOD3 1WBLA 4K20A 3ZN5A 5A70A 5JZGA 1UMZA 1W0PA 2IC1A 1NKGA 2XH6A 5CFCA 2WSUA 4NN0A 1LHWA 3DXTA 5FXVA 5JR2A 2YGMA 3WDXA 2WNVA 5JZGB 2ZX0A 4MVTA 3BTAA 2R041 2C24A 4AHXA 2YHJA 1EV11 4QX8A 4IEVA 3NJXA 5KXCA 5CFCB 4Y1XA 1E5SA 1AJKA 4UI9L 2BWAA 3IBMA 4ONUA 4CCEA 1TMF1 1QQP2 3JZVA 3TB0A 1ULPA 3V56A 3TRSB 5FREA 4BQYA 2GC3A 5AFBA 1J3RA 4XUTA 5DAXA 3ZXJA 4AI3A 1Q43A 4CDXA 5A3MA 1X9PA 1NQJA 4FOYA 4H2AA 4IE4A 4QHOA 1QNWA 4XF3A 1B35C 4TYSA 2BGOA 3M4FA 2WL1A 3LWCA 4CXYA 2LUWA 4JRAA 1GSLA 4CDXB 2ADDA 2XKOA 5M0TA 3IIAA 2RS33 1RUG3 2ZX4A 4CU8A 2VW0A 3LA7A 4B7EA 3ACHA 2NMOA 3PMEA 3U0ZA 2CGOA 2Y6KA 4Y4RA 5D8AC 2Q8CA 2IVIB 1X9TA 4UWDA 1OXCA 3UYJA 2IVJA 1J1LA 2V5YA 4J1WA 1D4M3 2YFZA 1XQNA 1IKQA 1HRV3 2XJTA 1HV1A 2BGPA 2DFCA 3KV4A 3POIA 3WW2A 4PHZA 4N8MA 3THCA 1NT0A 1RUJ3 2IXKA 1ULDA 5T5LA 4F3JA 4UW4A 1GOGA 3D3AA 1AYM3 5C9AA 1DF0A 3CLPA 1O8PA 1E5IA 4OQ9A 4HBNA 1YCIA 4NHLA 4YNIA 3AZZA 1DU3D 3FE5A 5DN2A 2W1WA 5F3CA 1MS9A 1W3XA 5C9AB 4LBQD 1YJKA 5C8CA 4Q4V1 4L0PA 3BOWA 4XZPA 3MF9A 4RYDA 1BK1A 1C8M1 1QEXA 4FPOB 1GU3A 2XLFA 3GBFA 1BMV2 3N9OA 5HV0A 3N36A 1FV2A 2ZEYA 4EN7B 5C8CB 1W9SA 2HWD1 3AP9A 5JMOA 4OYUA 2ZA9A 5EV7A 2GN3A 2ZKNA 3H8XA 2QQVA 4ZPIA 1C57A 1R64A 2D5HA 1ND2B 1IS5A 4K9SA 1R1A2 4PF1A 5F2WA 5FPLA 3PUAA 4UOJA 4QPIC 1RHI3 4QQ2A 4TWTA 3SCGA 1KXGA 3DKQA 2XPJA 5GKAC 2ZTNA 5GZCA 3WINE 4HKWA 4MADA 4AFAA 2Q1FA 3E1F1 1J3QA 2WO7A 2RMU1 2GC1A 2CDOA 4D6SA 3MIEA 2D5FA 3NV4A 5B2GB 1UY1A 4LKEA 2CV6A 3CJIA 5FO9B 3WQ1A 1O4YA 3RYKA 3VLBB 2E63A 3OD4A 4HVRA 3SCHA 3VBOA 4U2AA 4GXLA 2OKXA 2BEOA 5IT6A 5FZ1A 2FCVA 1CZSA 3DGTA 5FZOA 5A80A 3RJ2X 3CJIB 4TSVA 1AR92 5J48A 1UOGA 1WMXA 3VBOB 2BRTA 3GXUA 3MV11 5FZOB 3WUDA 1WMDA 2QKDA 1Q56A 3LEMA 1CESA 2RJLA 1ZRRA 4DMIA 5B4NA 1H30A 2LROA 3ECQA 4AI0A 4I2OA 4AK3A 1H4HA 3LOBA 5DUUA 3OOXA 3C3VA 5K0UB 3UV9A 5LRSA 4LLOA 3MW3A 3ZMNA 4D7SA 2VMEA 1OLME 3WG3A 2BFUS 1EV13 4C8DA 3OCPA 5F2SA 3J7MA 2VPVA 4X8NA 2TUNA 3KVAA 3BTZA 2BJSA 1GP4A 1Y43B 1TMF3 1Y7BA 2P1BA 3ABZA 3AZYA 3GDBA 2JICA 1DCSA 3USSA 4PLMA 4WM7A 4MHRA 3WDVA 1R091 4FOVA 5J98B 2VOXA 5I0DA 1R083 2XDVA 4IE5A 1VBA1 1WZXA 1DZTA 4K6BA 3AVRA 1J59A 4WM7B 1RC6A 3ACFA 1LEDA 2D44A 1HRI2 3O1SA 5LW9A 1RXFA 2CU5A 5DQ0A 4CDUC 1OSGA 4DINB 3OY8A 1GQHA 1LU2A 1UKRA 2WQ4A 4ZU7A 1EPZA 2ILMA 1XE0A 3PTYA 1OOPC 3POEA 2FDGA 3AYDA 1ZRCA 4PI0A 3E6CC 3OY8B 5I0TA 1SACA 2LRPA 3K48A 2DBIA 4KNCA 5I91A 3LQCA 4AXOA 3AXEA 3K4ZA 3I2OA 1JTZX 4FFGA 1MS3A 1UF2C 4YG6A 2BBAA 5BNNC 1U0AA 4EN8B 1WW5A 2FDFA 2XJPA 4ZXKA 4C90A 4FPFA 3JUUA 4IUGA 3RYRA 2D93A 5JWPA 3ES1A 2DCYA 4EN6B 4IQPA 1ENQA 2DCJA 4KQ7A 2MEV1 4YM3A 2J1VA 4TTGA 4GH4A 4CXWA 3ZXAC 5T54A 3SCFA 1ZZ6A 1TE1B 4JRLA 4CEWC 2DDUA 1UKGA 2D3PA 5C8WA 2WFF3 4GH4B 1RUC3 2A6ZA 1PIV1 2RM21 2B45X 5FY5A 5IVBA 1V9U3 4EN9B 3WCRA 2VZRA 4GULA 3I97A 3K77A 1ZREA 1W90A 1D0GA 1DQ0A 3WF2A 3G7DA 3ZXKA 1QJZA 1V6KA 4MSVA 4FTSA 4XFAA 5ACA2 1AXYA 2VZ1A 4B8EA 2QQIA 2VR4A 4LITA 1V00A 3C7FA 4LA3A 1PNFA 3MPBA 2PTMA 1LKNA 1JYXA 1CWPA 1S1AA 2Z4FA 4UFLA 3EO6A 4Q1RA 4QX2A 1HB1A 2HBUA 3Q9OA 4OLLA 4PLOA 4DB5A 4A7ZA 5BPXA 5BNPC 4KU7A 3OUIA 3J26N 4NIAA 1N47A 2ZHMA 4B7KA 4R52A 1AYN3 2X10A 3BCWA 4JDOA 3WW4A 1S0CA 2UWAA 4LHKA 1PO12 1C1LA 4XFHA 3O1MA 4LA2A 4RQPB 1JYTA 1US2A 4KWJA 3VHNA 4BDVB 5CVRA 5IK8A 4Y22A 1RUH1 3WP6A 5JOXA 4LT5A 5A6XA 3PJYA 3GZAA 2AACA 2DURA 3DYPA 3M3CA 1H9PA 4E4SA 1UCXA 1RMU2 3AP5A 3JXSA 3LSEA 3TN92 1IGOA 1SLAA 4H14A 2D3SA 5EWSA 3U4SA 4ZS3A 1AR62 5A6ZA 1MS0A 3DV8A 2PHLA 4GWJA 2ZGKA 1RB8G 1N1YA 3R6SA 5LEJA 1IHMA 1LU1A 2ZACA 3FWEA 1SQ4A 4HK8A 1QGLA 4XJ8A 4DOUA 1V6IA 1HW5A 1JOBA 1R093 1UYYA 2XJRA 5FYUA 1HXS2 3P6BA 3NVCA 4LNVA 2GSYA 5KHIA 4LKFA 1VBA3 4KGQA 3R05A 2WNEA 3ZFFA 4YM1A 1YI7A 4A45A 2XMLA 1VBC1 4DY3A 1JU3A 5LRRA 2ZX2A 1Z78A 4LBLA 3FUQA 2OUHA 3N7MA 4QPGB 4ZHNA 4CCNA 3GM8A 3D8CA 3ZFFB 1ZZ7A 2VUAA 4LPLA 2IFWA 2Q1MA 2BVBA 1XNDA 5A7WA 3VZMA 1W04A 1IOAA 1PZ7A 1JODA 3MF6A 4FPGA 5EJZB 3TEWA 2EIGA 3GYDA 1Y9MA 5A7WB 1PK6A 5HCHA 3BODA 2YBPA 4P00B 2J1RA 2ZGOA 3FHAA 5BY5A 4UFHA 4IERA 3WNNA 3J4UH 2AR6A 4AEDA 1PK6B 2UY8A 4JGZB 3E6DA 1J83A 2O8OA 5FZBA 2ZS6B 2XJSA 4N53A 1BZWA 1PO23 3AZXA 4QX0A 4YM2A 1TNFA 2VUDA 1DGRA 4FPYA 3VZNA 4LIUA 2HWB2 5GLUA 1ND3A 5APAA 2VZSA 2ID4A 3ZYGA 3E5UA 4YZ5A 4N53B 5BYNA 1CR7A 3LPGA 3MUY1 4QM8A 2W2IA 3H9AA 3J8F1 4B3NA 3AFKA 5JI7A 2E33A 2ADEA 1ND3B 1BYHA 4NIHA 4XEZA 4A6OA 2QZ3A 1FMD1 1LENA 1PHMA 2RM23 1FAYA 2CGPA 1OPMA 1IS4A 1UY2A 4GD4A 4XIKA 4H7MA 2VD7A 5LBCA 3LA2A 3DYMA 3RSJA 3USUA 3CNAA 4XJZA 4JCKA 1ZBA2 1LHVA 4N90A 1NY72 3SKJE 3THDA 1PVXA 4Y33A 2J1AA 1DQ1A 5F9TA 5IATA 2I74A 3USUB 1J3PA 4M0HA 1HX6A 3MDPA 4PI2A 2ORXA 2VOVA 1A3KA 1G86A 3AJYA 4BIOA 2D6MA 5HXVA 5C6CA 2WLQA 3KGZA 2P3JA 5JPMB 1U5IA 1PX4A 4QXBA 2JECA 1DQ5A 5H9RA 5AC91 2VMCA 2WQZC 3KGLA 2C5DA 5KXBA 3EYPA 3NNGA 4I0WB 2BUKA 4UW5A 5FYTA 2XB6C 3ASIA 3LIGA 5FTTC 5FYSA 3ZSJA 2X5IA 3OGGA 1WA4A 5E89A 2MPFA 3B94A 4QD2A 1AF9A 4V2VA 2J1EA 3V64A 3BU0A 3KB5A 4Z1VA 1VAKA 1XE8A 1JOJA 2X5IB 3WHTA 2VCAA 5EFUA 3VKNA 2TBVA 1AXZA 2FCTA 2YU1A 3AMHA 1OFSA 3EJKA 4CEYA 4TN7A 3TNPB 1CONA 1RVF2 5FK7A 3GNEA 4A6SA 5FYZA 1WW4A 3TYJA 3E6BA 4AVBA 1W8WA 4AVAA 4Q0UA 5LCWL 2DWRA 1F9KA 2YDEA 1SPPB 4CEYB 2WZEA 4A3XA 4FAGA 2D7FA 1MR5A 3VHPA 3POJA 3DF0A 3PVEA 1OH3A 1Y4WA 1XSQA 4IEOA 1U12A 1QJX3 2BNOA 2P6CA 5EJ1B 2OQ7A 3BUCA 1IG3A 1F5JA 1QJU3 2XHNA 2O14A 3C7GA 3U4XA 3FL7A 1XNKA 1G7YA 2ARBA 2RR11 2BFUL 4PBPA 1Q5OA 3POYA 1NCQA 4BOWA 3HQRA 2JJ6A 4E4HA 1OVSA 1C5HA 1UMHA 2D3RA 2BWCA 1L7QA 3KF3A 1YC61 5FY9A 1LOFA 4Q4V2 3OPZA 1ULFA 2E51A 1A8MA 1PM4A 4EJRA 1LOEA 2YC4A 3B93A 1NCQB 1T6GC 4HG6B 4RSUA 1C8M2 5DAQA 3WP3A 2V09A 3WSOA 4FPHA 5KHHA 3IMNA 3WG1A 3ZVXA 2RVAA 1OF4A 1Y9GA 3WY6A 3BYWA 4D8MA 1TME2 4LO8A 4DY5A 4A42A 2R073 3M70A 2CWSA 5FZ7A 3VZOA 3OGSA 3VDDC 2ZMNA 3ZFGC 5I0UA 3L2HA 4ET7A 4BYYA 4O61A 4Q4X1 4CUGA 5JIAA 1H0BA 1W9YA 4N43C 4CA9A 4BM8A 1H2KA 2P2KA 2XBO1 2Y6GA 4J6GA 5F32A 5GZFA 1JZ6A 2J1TA 5FZMA 4I02A 5HXMA 2B4KA 2PQQA 1EAH2 5JXGA 1VBB3 2QVSB 1AUYA 1UO9A 3PNAA 3ZM8A 4NHXA 1CGPA 4DPNA 5DG1A 4RS5A 2JDZA 5EYYA 4HMZA 1HB2A 1OC1A 1JOPA 1APNA 1RUI1 2VBDA 4XFCA 4DUWA 3O1TA 1KFUL 2JWPA 2A3WA 1MEC3 1V6JA 1S0DA 2KM2A 3K4DA 2VGDA 4CDQA 4FXKB 2GNTA 2VZTA 4N9IA 5T50A 3PMSA 3BKZA 2G9ZA 5JSRA 4D3WA 2PHRA 2QQUA 2WT2A 4GMP3 3A22A 4YZ4A 5DUWA 3A4UA 1OH4A 2R1BA 2VNRA 3BTXA 1SBDA 3WG4A 1J84A 1XNBA 2HWC2 4QB1A 4RD7A 1O6UA 2GNBA 4BU2A 1O3TA 1NXMA 5LK5A 5I8TA 1YQ2A 3ZN6A 1C8NA 4UFMA 3RRDA 5I93A 1XE7A 4LBOA 3DKWA 4RR3B 4WM8A 4DEQA 1OD3A 4BQWA 1C1FA 1JI6A 3ZN6B 1Q8VA 3OG2A 4LBNA 4UW3A 1WMFA 1LEMA 1NG0A 3QACA 4XFFA 5FY4A 3WDTA 2P6HA 4X6QB 3AMNA 1QWRA 1LAJA 2WWSA 1VIWB 2ZOEB 3DXUA 3NNMA 4WM8B 3ZYPA 2YBKA 1W2TA 3OPTA 4COVA 2ZCWA 1ST8A 3SH3A 3LDKA 3VBRA 3RZHA 5SV5A 3T2TA 4OI4A 3B9IA 4PQQA 4IGQA 4ZKTB 4E27A 3VBRB 3VD7A 3PVBB 4HK9A 1FPN2 1DIWA 4WV8A 1QOOA 4NJ4A 4BJ0A 1PVC1 4XIOA 1VAMA 2VM9A 1KD7A 2OZ6A 3HMYA 4W6WA 2GH8A 2JENA 2WZR2 4OHZA 1R1ZA 2EXJA 2XOMA 3KZ4C 2C6SA 1MS5A 1LODA 1O5LA 1VBD1 1MQTA 4YW3A 3ZDSA 2JG8A 4OFGA 1GP6A 4YYOA 3RYPA 1OLRA 1H1AA 2HWE1 5FLJA 1U5YA 2Z42A 3VN4A 2UYBA 4MGQA 4E4ZA 1MQTB 2P34A 2R062 1ASJ1 2JG8B 4AI8A 1RL3A 1JBCA 1FOD1 5LZ6A 2KD7A 5DDJ2 1D4VB 4FPEA 1NCRC 4R9CA 4N7IA 1SLIA 2GAUA 1GYKA 3N35A 2MEV2 1YIFA 2WT1A 1VBE3 1VMHA 2C9AA 2XQXA 3GBWA 4I3GA 1R1A3 5T5JA 1PMJX 4QDQA 4BMBA 2ZBJA 1F5FA 5T3NA 2QQWA 4MOAA 5C5TA 2WN3A 3AP7A 3W58A 3KMHA 2WA4A 2JDYA 2DUOA 4CUBA 4UYBA 4V2WA 1SDWA 4YVWA 2V5DA 5BXXA 3NWKA 1SBEA 2Y6LA 5FPUA 5EXOA 1DZRA 4GB32 2Y6HA 4D6RA 1WA6X 1DLCA 5FQ0A 1DGLA 3TEYA 4YVWB 3LPFA 5DZGA 1PGW1 1JZ2A 1V6MA 2ZGTA 2OA2A 4ZZ5A 2IUWA 2XBO3 4LR4A 5FP8A 1XNCA 4YW1A 4D94A 1RUG1 4FO9A 5FQ0B 1FT9A 2E7TA 2AC1A 4OMCA 3SH4A 1DQ6A 2YY1A 2QQOA 5IK5A 1AR93 3MIHA 2R0HA 1IKPA 4UAPA 3NL1A 3OEAA 1PGL2 3AC0A 4IV1C 3VBHA 1FATA 1RUI3 5DAPA 1RUF1 3FHIB 3UK9A 1HRV1 3FX3A 3K51A 4S2GA 5JOWA 1AR71 1RIRA 1PNGA 1RUJ1 2DVGA 1QJY2 5FZ3A 3VBHB 4LK6A 3UT0A 2JX9A 1XYOA 1AYM1 3HEIA 2W3JA 2XLGA 4AQ6A 1HQNA 5CEHA 4P9GA 2X53S 3AMPA 4K3UA 2ZPXA 3KV5A 1LOCA 4ISRA 2QQLA 5FWEA 2PN5A 3ME2A 1XB9A 4NPMA 2AENA 3PURA 4QT6A 2OQ6A 1H1IA 4OQ8A 2WNUA 3AZWA 3C7EA 2W92A 1GLHA 1OMIA 4JGYA 4QGNA 4COUA 1UIJA 4Y5Z0 5FP7A 2XWBB 2WNUB 3NRUA 5DAVA 2YPDA 2LALA 2Q8DA 4NO4A 3PJQA 4PJYA 2EICA 3VBSC 2GZWA 5EHDA 1RHI1 4IE6A 4OUEA 5HV4A 3DL3A 2Y26A 3K2OA 1REFA 3VDAA 3OTFA 1RJ8A 5FZCA 3THPA 2OVUA 1W3VA 2D98A 4KWUA 5FRAA 5LA9A 1RINA 5LB6A 4AEKA 1RYYA 1VBC2 4AEJA 3O0XA 4E8DA 4B4RA 2EIBA 3QH6A 4S2FA 4Q8KA 2VVEA 4IV3C 5ABJA 4NR1A 1ZBE2 1POV0 2DF7A 5CFDC 5FYHA 2E7AA 3DPRA 5FYBA 3MUZ1 5FIXA 3VKLA 3FHQA 3K3NA 4XAEA 3WNKA 2HBTA 3O14A 4PDWC 1KFXL 4UT5A 5LA2A 5ABJB 4AVCA 1KJLA 1VBD3 3ZFEC 3DPRB 1HLCA 5CKQA 1OKOA 1OLMA 3GGLA 4NROA 3ORJA 3MFCA 2B42B 4YGEA 5J7MA 4O7XA 1W2NA 2DBNA 4XETA 5F5IA 1ASJ3 5FJKA 4FI9A 1JZ3A 4YM0A 2ET1A 1RUOA 2CWMA 2NP0A 2V72A 4CU9A 5D2AA 5FKBA 3SEEA 4CRQA 2BTVC 2A3YA 3SEPA 4ATFA 2HKXA 1ZX5A 4XBNA 2C4XA 3AXDA 3MYXA 3VKOA 3VD4A 4Q4W2 1KDMA 2Y34A 5FZ0A 1Y3TA 4UF0A 2ZHKA 2WNVB 2YBSA 4YZ1A 4AGRA 3JBG2 3I2GA 3TWIA 4HONA 5IHRA 2KA3A 1R081 1COV3 4UF0B 1YQ6A 1O3SA 2EALA 1HV0A 1K5MC 2I2SA 1FYUA 2P3KA 4DIQA 3RZGA 2JE8A 1AR82 2VNOA 1JHJA 3HT2A 5JUVA 3M3IA 3POSA 4LLFA 3I3QA 1GP5A 2ARCA 4WVMA 2WO3A 2RJKA 3KCXA 4M3CE 3ZYHA 4QX5A 1WW7A 5A1AA 2BVVA 4XAAA 2WDBA 2XVLA 4YWAA 1PO13 4M4PA 4WVMB 3ZYBA 4XCBA 3P5BA 1MZEA 4PCRA 1VPHA 4FP3A 1RUF3 5C3PA 4XFBA 4PT6A 2VC9A 3KD4A 1AR73 1KS5A 1CX4A 1T6BX 3NJZA 5AC92 2Q1ZB 3POWA 3UJOA 2P3YA 2ARXA 4BWOA 1K5JA 1RMU3 1TVGA 3TN93 1AR63 3Q8BA 1IS6A 4QPIA 1E57A 3NW4A 1VRH2 2OW4A 2A6XA 3DUIA 2DVAA 3M2MA 1YQ8A 1IPJA 3ZSKA 4DXTA 4GZ9A 3LB9A 5FR3A 2W9XA 4QPIB 4C1XA 4JKKA 4QXHA 3J7HA 4KH9A 2XL9A 3WQ0A 2BYVE 1OUSA 1LHNA 1Z0HA 4FQZA 2XONA 1Y9QA 4Q27A 4CDXC 2ZGRA 5IWFA 5LA0A 2R16A 2WFF1 1IQDC 5FOBB 2VZ3A 1RUC1 3IZOA 1MS4A 3HBZA 3ACIA 1W39A 4Z2WA 2UU8A 3ZYFA 4P14A 2IXIA 1NXD1 1V9U1 3OYWA 1XRUA 4RFT0 3WUCA 3SKVA 1XNTA 2LW8A 2MHFA 5DXDA 4AQ2A 3AYEA 2VCBA 3WHUA 2WQ8A 4E4DX 3FLTA 1CAVA 4ZS2A 2XL7A 3OYWB 5F37A 4AFMA 2O8QA 3OGVA 5EYXA 1AZDA 2QQMA 2ET7A 3OJBA 4JKLA 2ZGUA 1VMFA 2ARAA 4QMAA 1BHGA 1L7LA 2RJ2A 3PL0A 3JB8A 2W68A 4XABA 1NLQA 1HJFA 4IDZA 4Z82A 3RZJA 3FUOA 3GCXA 4IETA 1RUE2 5L73A 2VQAA 3KWVA 1AYN1 4DXZA 5IAXA 1LR5A 4DQAA 2H0VA 2YU2A 5JCTA 4E2QA 4XVHA 3CBNA 1PM7A 1GOHA 1Q3EA 4JHTA 4XQ4A 3CHXA 4K8RB 5HCAA 5JAXA 2HWB3 3KCCA 4M4RA 1V6OA 4KI5M 2BNNA 2R0FA 1ND2C 3HBKA 3MIDA 4P9YA 3GJAA 4XUOA 3VBUA 4NOTA 1SFPA 3HR9A 3AL5A 2DVDA 3W20A 4CDUA 4FBFA 3LF7A 5C3RA 5A7SA 3VBUB 4FCAA 3WVJA 1DGRN 3WF4A 5JSOA 1OOPA 1SLBA 4YG0A 3MLKA 4CDUB 1ZZBA 5H9SA 2HEWF 5L7OC 2VY0A 4ZZ8A 3NO8A 5FBJA 3UESA 1LGCA 1ZYBA 1UY4A 1OOPB 5JLVA 1W6NA 3AP6A 1PMIA 3ETQA 3KM5A 2E26A 4HKOA 1O4ZA 3CJIC 2P17A 2E9QA 5E16A 1AL21 3I4IA 3VKMA 1H2NA 2G1MA 1BBT3 4GQ7A 3UGGA 3QLQA 3OBRA 1W6NB 4P9JA 3WNXA 1JZ5A 4NRMA 2H6CA 3W21A 3W9AA 5BNQA 3BTYA 2ZMLA 4CP0A 2XLAA 4KBZA 3MIGA 1RUD3 1UOJA 2Y6JA 2WT0A 1FNZA 3Q8CA 4A7YA 2JDMA 3WT3A 3LFIA 4Y26A 4ZY9A 3RZZA 5IFTA 4FOQA 1AVBA 4GJYA 4RGGA 5K0UC 4W4ZA 3RNSA 3ZX7A 2EIEA 3RI8A 3U75A 2A73B 2B9VA 4TLFA 1JYNA 4O65A 3JD72 2VCCA 1LTEA 2EXHA 2YROA 4Y3OA 3VHOA 2YV8A 1YRZA 1A78A 1BEV3 2WLPA 5F5QA 1UQXA 1JXNA 4MGKE 1RVF3 2Q30A 5L9BA 1ZZ8A 4MGTA 4GIQA 3OB8A 4BH9A 1PO21 3BIWE 5D1IA 2VZVA 4Q0SA 5I0RA 2VXJA 4QHBA 4XURA 4CCKA 1C4RA 1YWKA 3M3QA 4LXLA 1ENRA 4BISA 3WLUA 2Y6FA 5D21A 3VV1A 1ZRIA 5FZ9A 1PVC2 4ASMB 4ASLA 1C5IA 2E7QA 4U36A 1UNBA 5L36A 4XJAA 1VR3A 3U10A 2PA7A 4SLIA 2CSGA 1ODMA 3ZIXA 3OEBA 5FK8A 3WD5A 1XC6A 4PBOA 1OI6A 4W65A 5LWBA 3I2FA 4XFGA 4M00A 3J7NA 2ZGNA 5F6KA 3RMXA 5C5UA 2PHUA 2ZGPA 1FOD2 2OIIA 5FAXA 2B39A 4IEQA 1TME3 1W05A 5GZDA 1UMIA 4E2SA 2VZQA 3JQWA 3MLLA 4BXFA 4EWEA 2RDSA 3QD6A 2WZPP 1OQDA 1GR3A 4L8QA 1RGSA 1X8MA 5K9YA 2QE3A 1DYKA 3NQHA 4UFKA 5LASA 3KS7A 3VDCA 1GZ9A 3U37A 1ULOA 3S6PA 2WJSA 4GH4C 4XZUG 4CP9A 4XXAA 1EAH3 3MI8A 2WFPA 4OHVA 3VBFC 4A41A 5JXIA 2VU9A 1I3HA 3GALA 1M06G 1PZ8A 5FZFA 5JSPA 3E97A 4CVUA 1ZM1A 1RXGA 4XFIA 5GLVA 3ZKUA 4CP9B 1LB2A 5IVCA 2AEYA 4Y22B 1H2MA 3PIJA 1CAWA 2RS32 1RUG2 2X8KA 2XKPA 2CYFA 1BLZA 4Y1ZA 3AMQA 4NPLA 1G9BA 5A3TA 3Q8AA 1W6OA 4MG2A 4KGGA 3OGRA 1CAWB 3FZ3A 4AG4A 1CD3G 3IM0A 3IIIA 4XACA 1S0GA 2ZHNA 4URTA 5JMCA 2EF6A 4X6RB 1VB2A 4XXPA 1W6OB 1D4M2 4I3PA 1WLCA 3PLQA 3C2UA 2Y33A 2RS12 3KV9A 1JHNA 1QJX1 4LO7A 4Q1PA 4QKDA 2WRAA 5LBEA 1QJU1 1GQGA 2RS52 3VZKA 3LGRA 2W08A 3GZTB 4GALA 2DCZA 4YW4A 5ANQA 3MO4A 1AL23 1PGSA 2PFWA 4YVSC 3T4HB 3WXPA 2JB4A 2J42A 4RQPC 3P1IA 4GJZA 4MYEA 5E8AA 3WEZA 3W5NA 4EZHA 5F7UA 5A6YA 1WMEA 4AQTA 1OQEA 1HN0A 2ZHLA 4IEWA 1XBFA 4LQRA 1V70A 1N1TA 4CCOA 4QB2A 5FZ4A 1EUTA 3WDYA 1AX1A 3ZKYA 3POFA 4YGCA 4H3WA 1ACCA 2YPJA 4S2HA 3WDWA 3S7IA 3WNPA 4ITCA 2R071 4MGZE 3HT1A 4HOOA 4QGMA 4QDSA 5CG9A 5GZGA 4NIDA 1ZNPA 1STMA 1FPN3 4URAA 3GCWA 5LEKA 2VMDA 3MIFA 3WG2A 3EBRA 4YZ2A 3HWJA 4XBQA 1QDCA 4B29A 4FFHA 4IW3A 1NE4A 4AEDB 3GHNA 4WBBA 2YZ4A 1VBB1 1HQWA 3A0NA 5DMYA 4D7YA 4C0BA 4RHV3 3DN7A 4V1PA 4DZGA 1F8VA 5T52A 4QKBA 4QPGC 2D6PA 1F2NA 3AKRA 2A1XA 1M4WA 4BPZA 1VAVA 3NNLA 2R063 3ZXGA 1MEC1 3PVOA 2DVBA 2WS91 1W8UA 2PLV1 3F2ZA 3H1WA 4YG3A 4AGGA 4Z8BA 5DABA 5DDJ3 1ZRDA 3MPPG 5ERLA 5C3OA 2OS2A 1LESA 2VMHA 4FPLA 5I0SA 4GMP1 4P5YA 5F3GA 3I8TA 2HJIA 2VXRA 4XDOA 1W2UA 2WWJA 4IGPA 1DYPA 3HOBA 1GZTA 5L9RA 4OCTA 5FPXA 3MEPA 3IDAA 2AH2A 1Z7S3 1WLWA 2VJXA 4DEVA 3HQXA 2LTNA 2W39A 3LOIA 1QQP1 4JQTA 1PK6C 4JGZC 1J58A 1TNRA 4CPBA 4WZFA 4YW2A 3WF1A 2WYFA 4DXRA 2R7EB 3KT1A 4AE2A 2B8MA 2R042 3RVHA 4RFRB 1EV12 4GB33 1A6CA 2UWBA 4EN0A 4GKXA 3U1XA 4QXKA 4LKSA 1TMF2 2WINB 4MGIE 4N53C 4PIXA 4AYUA
chains in the Genus database with same CATH topology
2Y38A 2FMYA 2VUJA 1ND3C 4FXGB 1UX6A 3PVNA 3VKFC 1DGWA 1AX2A 4B4QA 5JVVA 4JDMA 4M3CF 4XBLA 2JG9C 3L2YA 2ZKLA 3VUOA 2MNGA 1NA1A 2Z69A 5FCCA 4K7JA 2GALA 4YFZA 4GWMA 2VOWA 1UU6A 2JXAA 1IS3A 5A33A 2WIIB 5LK7B 1QJY3 1YUDA 2VW1A 4DRVA 1X7NA 1NA1B 5FMOS 1CVNA 5JOYA 3E5QA 2ZAAA 5A33B 1QOSA 3ZSLA 3NAPA 1BMV1 4XMIA 4FAHA 5CADA 4LO5B 2ZGSA 3IT8A 3NAPB 5JIUA 3ILNA 2Q4SA 4JTOA 1VBE1 2UWCA 1X33A 4Q2FA 1R1A1 5ACA1 3IDBB 5AFEA 2PHXA 2X5IC 3VL8A 2HWD2 4Q4Y3 2HWF3 1BVVA 5CAZA 2B9UA 4R9DA 3U11A 4ORFA 3RWNA 4KG8A 4XW3A 3JQXA 2UURA 4CEYC 1KS4A 2YXSA 3KCYA 4G4FA 4QQPA 5BNOC 3HIFA 2RMU2 3KLSA 4GKYA 2XJQA 1AR91 4AFDA 4IXLA 2PAKA 1LHOA 2IXJA 1O3RA 2R30A 3JB4C 1NCQC 2PLV3 2WS93 1MVQA 4RS5B 3MLJA 1LOFC 4RL7A 5JR7B 3FFZA 3CL1A 4CDQB 4CDWC 3AKPA 1S2KA 4YW5A 4OI0A 4K40A 1W0OA 2GMEA 5GLZA 1H8VA 1QQP3 2VVDA 4P9XA 3M8LA 2SBAA 5F6LB 3JBG3 4BZ4A 1YI9A 5KWRA 3WX5A 1IZ3A 3GZUC 1AR83 3HAGA 2VG9A 2Q5TA 2XHKA 5KHGA 1R092 1N3QA 1SCRA 2ENRA 1ZVFA 2JD4A 1VBA2 1SEFA 2VECA 2EAAA 5BUVA 2AZ5A 5FPZA 4PIZA 2ZX1A 4XE9A 1UL9A 4E9KA 1GNHA 1QDOA 3FLPA 1DHKB 3OBTA 2B7YA 5H9QA 1QH6A 4L11A 4LBMA 4LHLA 1YFWA 4BHPA 5FO8B 4HKLA 2Q0AA 1VRH3 3AKSA 4RR3C 5SV8A 3ZO0B 4I0AA 1UZZA 4LULA 3N4MA 4NVPA 4WM8C 4LE3A 2OYZA 2NN8A 1KITA 4F83A 2F4PA 3LKJA 1PO22 1RITA 4IEXA 4AI2A 3N7LA 1H8TC 2PYTA 1WCKA 5C4WC 4C0HA 5ACA3 2I07B 4ES9A 1QXPA 1U5ZA 4Q26A 5GJ6A 4E2GA 4HSJA 4M3CA 1WD3A 4XF0A 1PIV2 4I01A 2RM22 1COV1 1FNYA 2G9GA 4Y20A 3V0AA 4FP2A 5F1RA 2W52A 1W6QA 4M3CB 4XJWA 3B7MA 3MGUA 5KXEA 3V0AB 4Y20B 2ZX3A 2P37A 1JH5A 1W6QB 1ZZ9A 2BPA2 1MQTC 1REDA 2JG8C 2A6VA 5J09A 1PO11 1SBFA 1OFNA 2UYAA 2VNGA 1QY4A 5KHKA 1YFUA 3EHKA 4FVVA 3FJSA 3ZYJB 4NPRA 3VZJA 1W6MA 3D0JA 5CA6A 4I0BA 1ENXA 1RMU1 2K0GA 2VULA 3TN91 1AR61 3KQRA 4PF5A 3THTA 1X82A 1W6MB 3CO2A 1RUH2 2Z2SB 1X8EA 1JYCA 2O1QA 2VVFA 4FOWA 4JVAA 1XYNA 4F7ZA 2LM3A 4LHNA 5TSWA 1HXS1 1UU4A 1HQLA 1QNYA 4YSFA 1CJDA 3ST7A 3AKQA 2GMPA 1HRI3 1S0JA 4OI2A 4JGYB 2JKBA 3O0VA 1I6XA 1A8DA 1O5UA 5GLTA 5GKAC 4HETA 2ES3A 3LZZA 3ZFEA 1LRHA 1ONAA 2A6WA 1UD1A 4AGVA 1UN1A 1YXWA 2X29A 5K7PA 1QJU2 4EWAA 2CNAA 2FHRA 3ZFEB 4C1WA 3M1HA 5T5OA 1ULEA 4BIFA 3SMHA 1OPOA 3JD73 2IXCA 1EP0A 1OKQA 4QQOA 3O0WA 1RJ7A 3IKWA 4QU2A 4XILA 3B5LB 1NYWA 3N7KA 1QF3A 3AYCA 4XTMA 2HWB1 3B3QE 3G6JB 5CIRA 1XXNA 5DUVA 3N3HA 4L99A 5CNAA 4OUSA 4OHYA 1K5MA 3SISA 1B35A 4AVTA 1YYNA 2FZ1A 2QDRA 4L97A 5FMOL 2DTWA 3SLIA 1SLTA 4XMAA 2D6LX 1K5MB 1YHFA 4AVSA 1B35B 3GHMA 5D8AA 4AI1A 4A7KA 3J8F2 2DV9A 3FMGA 4IEYA 3AYAA 3M3EA 1ZBA1 4OUMA 1NY71 1UAIA 1FMD2 4N9HA 5A3LA 4DNYA 3OF1A 5D8AB 3UL2A 3S7EA 2GNDA 3MW4A 4EV0A 4L2NA 5ABJC 1WD4A 3VZLA 1LJ7A 4EWDA 5FLIA 3DPRC 3RJRA 1BBT1 3TAYA 1JUHA 2ZMKA 1OA3A 5T55A 2ZGQA 1RUD1 3ZYIB 3KT4A 3M7AA 3S30A 3ZN4A 3AMMA 4EROA 3A0KA 4FT8A 5JZGC 2ZZQA 1NLRA 5CFCC 1BEV1 1RUNA 3FBYA 2WNVC 1RVF1 2FQPA 3ACLA 1V6NA 3SXWA 2E53A 4CP1A 2TNFA 3AKTA 2SLIA 3AJZA 3EXUA 1G6NA 2IWGB 3WOGA 4WVVA 3OGJA 2AUYA 4MLOA 4JV4A 1WCDJ 2E6VA 3E5XA 3JU9A 1HXS3 1XYPA 3I2DA 4OVEA 2RS13 1O3QA 1LCLA 1DZQA 2D6KA 3HN1A 1SMVA 2RS53 5K8SA 4YGBA 1JYIA 1X36A 2AYHA 4IL7A 2FBEA 2WSVA 2B5HA 3FLRA 4LBKA 4YARA 1C28A 5L19A 1S0IA 3B9CA 1F31A 5J36A 4Y1UA 3BALA 2YMZA 2RR12 4H55A 1S55A 3W59A 4MV2A 1ND2A 1CAVB 1TME1 4HFSA 5I8SA 5C9AC 4QQHA 1VBE2 2A70A 3NKTA 2A7AA 4LEJA 1DQ4A 1HKDA 1SFYA 1VB4A 2D43A 3ES4A 2IXHA 3QCWA 1FXZA 2G9FA 5C8CC 2GC0A 3BU7A 5L7OA 2DCTA 3RDIA 1LHUA 1VLNA 1NZCA 4OZXA 1DGWX 1EAH1 3CJXA 4KBBA 4XTPA 2A3XA 5L7OB 3AB0A 4Q4X2 1O91A 4LUMA 4O9EA 4PIYA 2XBO2 2GN7A 1FV3A 2JE7A 3O7OA 4CTEA 4XHBA 1UIKA 1WUVA 1QOTA 1LGBA 5JPNB 4FPCA 2C0ZA 2KXLA 2R49A 1WCSA 4G3YC 4HN0A 4XJ9A 2XVKA 1ZBA3 2IXLA 1RUI2 2VMIA 2QJVA 2G4IA 5K0UA 2HWC1 2ZAHA 4KL1A 3O5SA 5KBFA 5BNNA 4AFBA 3WW3A 5IK4A 1O7FA 3VBOC 4S2DA 2OUJA 3MFAA 1CAXA 2QDNA 2R043 3H7JA 4Q29A 1OA2A 5BNNB 4CYDA 5HCBA 4R4ZA 1CAXB 2DU0A 1ZREA 2HEVF 2Z5WA 3IPVA 3WDUA 4CEWA 5E1RA 1N1SA 5JI9A 1PZ9A 1ZA4A 3S0MA 4XYXA 4D69A 3VBUC 1FI2A 2NLRA 3IPVB 4CEWB 3B00A 1CQ9A 1WBFA 2GMMA 4WVWA 4XHXA 1FPN1 4FPKA 4HZFA 4BLJA 4XF1A 3ENRA 1ULGA 2QNKA 2GNMA 5EZWA 3AZVA 4OULA 4AW7A 2WZR1 3V0BA 3IDCB 4X8PA 4WM7C 1GFF2 2JEMA 3TBDA 4RHV1 4XF4A 1U5XA 3V0BB 5CG8A 4LO4B 3KT7A 5GZEA 2R061 5BNPA 5BV6A 4DRRA 4YRDA 4XOGA 4ES8A 1VBD2 5DDJ1 1QMJA 2K9ZA 3WQ7A 3UKNA 3ZYRA 1GZCA 1YFYA 4Q4V3 2HWE2 2IFRA 4ISQA 4QPYA 5BNPB 4MUVA 2O0OA 3CF6E 4AFCA 1C8M3 1AJOA 2BQPA 1ASJ2 2DYCA 3P3PA 1Z7S1 2A71A 3VBFA 4ZU4A 1Q8PA 2HWD3 4COZA 3ILRA 4CP2A 1GANA 3QH7A 1MS1A 2TEPA 2GDFA 1G8WA 3VBFB 3H0OA 5J96B 1TEIA 4QGLA 4GB31 4YFWA 1JN2P 3ZXLA 1DQ2A 2WKKA 2DTYA 2VMGA 4KG0A 4Y1YA 1I1EA 4J1XA 3VGIA 4AQSA 1WW6A 1OD5A 2BW8A 4PQ9A 4I30A 2RMU3 4FPJA 3R4DB 4CZSA 1COV2 4QM9A 1XU1A 1BCXA 3RQ0A 1PGW2 1MZFA 2AREA 3M3OA 3SNMA 3TOJA 4HVQA 1PGL1 4YVSA 4IEPA 5HBAA 4ZU5A 5FO7B 4RQPA 1LOAA 4OI1A 3WP5A 3P3NA 2NMNA 2YC0A 3IWZA 3VL9A 3URFA 1QJY1 2CGNA 4YVSB 1AX0A 1DBNA 4NHKA 2UY9A 4XDQA 4D7TA 1ZRFA 5CU1A 1RUF2 1N3PA 4HSLA 2HWC3 4K1ZA 1HRV2 4GA9A 4WBBA 4DB5A 1AR72 4K1YA 2YYOA 3AFGA 4UBGA 1MACA 1RUJ2 4A2UA 1KRIA 3T1LA 3WW1A 3H50A 1AYM2 1KJRA 1YFXA 4KU8A 4COWA 1IQAA 2P3IA 1WGPA 3D82A 4NHMA 1DFQA 3ZXEA 4AVVA 1V6LA 2CAUA 4Q0QA 3OD0A 3AK0A 4Q4Y1 1OQ1A 2HWF1 4P5HA 4AHZA 2GH2A 4W6YA 1ALYA 4BMEA 4QPGA 2XJUA 4WZCA 1AHSA 2DUQA 4JDNA 1AXKA 1RHI2 2PAEA 1ZBE1 4MXWA 1D2SA 4YZ3A 2B46X 2WZR3 1WLDA 3GBGA 1LECA 3UKTA 2DFBA 3H1YA 4JQRA 4R8HA 1OHFA 2ZABA 3TNQA 2VOKA 1BQPA 3BPZA 4MXWB 4JGZA 3ZFFC 4HT1T 2IZWA 4K21A 2W0XA 3J9SA 2OZJA 1C3HA 3HD8B 3IN9A 2PHFA 3NKGA 2WC2A 4BA6A 2QCSB 4LBQA 1JW6A 3LCPA 2MEV3 4IEZA 4MX3A 1G9DA 3GF6A 2NZ9A 4INDA 4Q4W1 4LBQB 3N7JA 1LOGA 3D4KA 2H6BA 2AGSA 4IESA 5AVAA 2GC2A 2XUMA 3WP4A 1DLLA 2ZJCA 4BCUA 2XVGA 2JG9A 3JBG1 1PIV3 1H4GA 3CEWA 1CPNA 4AEDC 2BNMA 1AR81 1BXHA 1O4TA 2JG9B 4UW6A 2Q8OA 2VW2A 2EVXA 1UPIA 1FX5A 4FTBA 3AP4A 2CAVA 3H7YA 3L9JT 1R082 4G9SB 3ELNA 4NWVA 3H8UA 4AWDA 1NLSA 1MZ5A 1QU0A 2A75A 3B02A 2XGXA 3LSDA 3D0SA 2R1DA 1BBT2 4MXVA 3KSCA 5IUQA 2JE9A 5J3UA 2FZ2A 5KHJA 1RUD2 1SFNA 1REEA 3NV3A 1NOVA 1HIXA 1VRH1 3NSTA 4BE3A 1HDKA 2CY6A 3ZSEA 1RUH3 4MZUA 5CBLA 2DU1A 4HANA 4Y4YA 4HVOA 2R32A 1POV1 2NQYA 4I09A 1YLLA 3MIBA 3NV1A 3ZIWA 1BEV2 3IDEA 5JOZA 3VDDA 3ZFGA 1OA4A 2D40A 4QQLA 3D5OA 5I8YA 4Q0PA 5KC5A 4HN1A 3RS6A 2EAKA 4N43A 3R0RA 3ALQA 3UJQA 5BNOA 1SLCA 3VDDB 3ZFGB 4AF9A 1OLQA 1NQDA 3I54A 3AM2A 3O12A 4R9AA 4N43B 4L92A 5BNOB 2OPKA 2WFF2 3BB6A 1J1TA 1RUC2 3SH5A 3FC0A 3SITA 4FQ4A 2Y0OA 1VBC3 3AX4A 1NA1C 1V9U2 5GM0A 2CTVA 4Z92B 1ZBE3 2BBVA 1ULCA 4SBVA 2XWJB 1QXJA 5DZFA 4FSJA 2D6NA 5GALA 4CDWA 1RUE1 5FBZA 2DCKA 5HCFA 2ZGMA 4JTNA 4M0NA 1IPKA 4F8AA 4Y24A 3PHMA 4LE4A 1BVP1 4CDWB 3NAPC 4LBJA 1G9CA 4RA0A 4ATEA 3ATGA 4XQWA 1AYN2 4UXAA 1GZWA 4META 1S0FA 5IK7A 2VH9A 1LGNA 3BOPA 1N3OA 2HYKA 4BQ1A 4O9GA 1GZWB 4TZDA 1YO8A 5T5PA 4Q4W3 1LOBA 2XG3A 4XJUA 1VALA 3J8F3 2K2SA 5KC6A 5E88A 1YJLA 1I9RA 3LAGA 4W6XA 1EPWA 2EXKA 3FBMA 4OHWA 1I5ZA 1FMD3 3JCIA 1CPMA 2V73A 3ZPYA 3QOPA 4WVZA 4IEUA 2ETEA 2F6BA 1D0HA 2R6QA 4YLZA 1HRI1 1CN1A 5J37A 1JUIA 1W6PA 3R4SA 1TQ5A 4XPVA 4JC1A 3RG0A 2C1FA 4R4XA 4Y1VA 4FTEA 2NM1A 4RR3A 1S2BA 1SLLA 2ERFA 1W6PB 4RS5C 4AEMA 1DDLA 5DZEA 1AL22 1XU2A 4HLTA 3LA3A 4RGAA 3B01A 4P9WA 1X50A 3ZXFA 4CDQC 1NCRA 3JD71 5AVPA 4AHWA 5AC93 2ATFA 2DVFA 1H8TA 1EY2A 5KXDA 1H2LA 5C4WA 2QQPA 1NCRB 5GLWA 2DUPA 4P9IA 1H8TB 4H7LA 1EYBA 5CB7A 3MW2A 5C4WB 1B09A 4XF9A 2WA3A 1POV3 3WV6A 3WZ1A 1GKBA 4Q8LA 1CIWA 4UBHA 3H1MA 2GU9A 2QUOA 1UU5A 2BGCA 4K8FA 2RHPA 2A6YA 3ZSMA 3RPQA 1BKZA 4MH0E 1QXRA 1UW8A 1NE6A 2PELA 2D97A 1G9AA 2QFEA 4RHV2 3VBRC 5JDBA 4KWKA 5H9PA 4PLNA 2YUEA 4XQDA 2PHWA 4IV1A 1Q8SA 4Z07A 2I45A 1ZZCA 2RR13 4L9BA 3WCSA 4Q0VA 1GICA 4B4PA 2XJVA 2ZGLA 4IV1B 5C33A 4KWLA 4DS0A 2A5ZA 1RUE3 3V65A 1Z7S2 5A32A 5FLHA 3U07A 1DG6A 1YIPA 4JAAA 3ROUA 3ZMOA 1SCSA 2PHTA 4DFSA 3APBA