3WXPA

Structure of hyperthermophilic family 12 endocellulase (e197a) from pyrococcus furiosus in complex with cellobiose
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQAVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of hyperthermophilic family 12 endocellulase mutant (E197A) from Pyrococcus furiosus in complex with cellobiose
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Endoglucanase A
total genus 72
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wxpA00
1XNDA 2Z79A 3WP4A 1KS5A 1UU4A 2DCJA 1C5HA 1OA3A 2BW8A 1YNAA 2VG9A 1IGOA 3AMHA 1OLQA 1XYPA 3WQ7A 2NLRA 2BWCA 3HD8B 1XXNA 1H4HA 1H0BA 3VZNA 1ENXA 1OA4A 1T6GC 1QH7A 2JENA 3WY6A 1XYNA 5K7PA 3WX5A 1XNBA 3WP3A 3AKPA 4S2GA 1XNCA 3LGRA 4NPRA 2B46X 2F6BA 3VGIA 1HIXA 4S2HA 1REEA 2DFCA 2B45X 4S2DA 3M4FA 1M4WA 1HV0A 2DCZA 3VZOA 3VZKA 4HKOA 1BCXA 4HK9A 2VUJA 1UKRA 4XQDA 5K9YA 3MF6A 3WXPA 2QZ2A 3VZLA 2VULA 3WR0A 3WP6A 2QZ3A 2VGDA 2B42B 1BVVA 1PVXA 3MFCA 3WT3A 1KS4A 4XQWA 2DCYA 1REDA 3AMPA 2D98A 3WQ0A 2DFBA 3VLBB 3AKSA 3LB9A 3VHNA 1REFA 3AMQA 3WP5A 2D97A 4HKWA 4XQ4A 3VHPA 3VZMA 1QH6A 3AKQA 1BK1A 1C5IA 5HXVA 3ZSEA 3WQ1A 2BWAA 1XNKA 3AMMA 1H1AA 1H4GA 1OA2A 3EXUA 4HKLA 1NLRA 4HK8A 2BVVA 3VHOA 1UU5A 1UU6A 3O7OA 1TE1B 1W2UA 3B7MA 3MFAA 3RI9A 4IXLA 3VL9A 3VZJA 3MF9A 1XYOA 1HV1A 4S2FA 3RI8A 2DCKA 3VL8A 3B5LB 3AKTA 1OLRA 4H7MA 2JICA 1AXKA 1F5JA 4XPVA 3AKRA 2NQYA 1H8VA 2JEMA 2C1FA 3AMNA 5EJ3A
chains in the Genus database with same CATH superfamily
4IEXA 4P14A 3CHXA 1PIV1 4M3CE 4AYUA 1XNDA 1WW6A 4CU7A 3LOIA 1RXFA 2EIBA 1QQP3 1SLTA 3SNMA 3IPVA 1OLME 2P3IA 1C5HA 2IFWA 1LGBA 5LW9A 1RUJ1 4MV2A 1DZQA 1BMV2 3BODA 4NHLA 1HRV2 4K1YA 5FYTA 4ZU7A 3VN4A 5DAWA 2RM22 4QB6A 1EV13 1SBDA 1YJLA 4LPLA 2ZGLA 1DGWX 1VBD2 2BERA 4N7IA 5LA1A 4XDOA 5LEKA 2HWB3 5GZGA 2VO5A 4FPKA 3ZFEA 3KWVA 3ZSKA 2W2IA 4WM8B 3S7IA 1BK0A 3CLPA 4WVMA 2P6HA 1ZBE3 2E51A 4FFIA 4P9WA 5K7PA 1AR71 4BXSV 2A5ZA 1JU3A 2FBEA 1SLAA 1EV12 1OPMA 1GOGA 4GJZA 4JGYA 1QWRA 1ENSA 2JE7A 3U75A 1COV2 3OYWA 5FV3A 2QCSB 2R32A 3RQ0A 4U36A 3CJXA 2VD7A 1IKPA 2LS6A 1PK6A 4XFIA 3H8OA 4OI2A 5E16A 1QOTA 2C4XA 1UY4A 4CCNA 2ZAHA 3CL1A 3ZDSA 5FK7A 3MUZ1 1DYKA 4OHWA 4RS5A 4ZXEA 3NJZA 3T09A 4MOAA 2J1SA 4WVZA 3JU9A 1A3KA 4CUCA 2AEZA 2K46A 5FZCA 1JYWA 4A42A 5L7OC 4SBVA 2VULA 1XSRA 2WLPA 1OH4A 1RUF1 3ZSJA 5GALA 1OUXA 2XMLA 1DQ0A 1OFSA 2DWRA 3CZUA 2PAEA 2W1SA 2W47A 1VBB3 1L7RA 5C3PA 1YHFA 3VLBB 5A3TA 2A3YA 2MEV2 4AHYA 4XBLA 1Z0HA 4CCKA 4N90A 1YQ8A 4MXVA 4HXCA 4OI1A 4R9CA 2QQOA 1A6CA 5FZBA 4V1PA 4GALA 4E27A 2WZR2 1MR5A 3GZEA 4CDWB 5FPLA 1GP5A 3OGJA 4Q4X2 4XJWA 3TBDA 4KNCA 2CAUA 2E53A 2Y6JA 1PO22 2WYFA 3H1WA 1UAIA 5FLJA 2VAUA 4RS5C 5HCFA 2JG8C 4YVWA 5T5PA 2W1QA 4KG0A 2Q1FA 2ARAA 4JQRA 5K0UA 3VHOA 1OD3A 1TG7A 5FWEA 2R1BA 3ZXEA 2GDFA 4K7JA 2ORZA 3AJZA 5IVFA 3VD9A 3K51A 4IQPA 1ENRA 1Y3TA 4YVSA 5KHHA 3T0AA 3VD5A 3VZJA 2X5IC 4Q0SA 3KD4A 5FIXA 4OYUA 5IHRA 4S2FA 4GWNA 2SBAA 4UFMA 2E33A 2PYTA 2A3XA 3P6BA 2ZA9A 1F5JA 1WCDJ 1VBC2 4XPVA 4EZ4A 1EP0A 2P3JA 1H8TC 3BOWA 2R061 4IE0A 2GMPA 2QJVA 5JVVA 1DYPA 4FPEA 5APAA 4CDUA 3POFA 3HQRA 5C9AB 2C1FA 1CJDA 4AI3A 5A7WB 1FMD1 3S30A 2IXJA 2JD9A 2ET7A 4FFHA 3M3EA 1OH3A 1POV0 1S2BA 2EF6A 4RGAA 5CKQA 2BEOA 2DDUA 5FOBB 3UJOA 2WLQA 1AJKA 5CU1A 3GJAA 4FT8A 5GLZA 4IGQA 1OKQA 1VBA1 1NCRB 1LGNA 2P3YA 2GN3A 1LOFC 4X6QB 3EQEA 2E9QA 5D8AA 4LK7A 4AQ2A 1EPZA 2BFUS 3U0ZA 3NJXA 4QX3A 5GKAC 3O0VA 1SPPA 1OLQA 1PK6B 4RQPB 2Q8EA 1MEC3 4NIAA 2GMEA 3AP4A 3VBUB 4BB3A 4BQWA 4AGVA 1NCQC 1CR7A 2J1VA 3C3VA 3PJQA 4OUSA 4QGLA 4QHBA 5DXDA 5FP7A 2A6YA 4UFIA 5FZKA 2VM9A 2GC0A 3U37A 3O0WA 3O1UA 3RFRA 5A7OA 2J1UA 4GH4C 4TSVA 5CADA 4NIGA 4QX0A 2VQTA 2Z42A 1SHWB 1Y4WA 2D6MA 3PUHA 1APNA 2E7TA 2W0XA 3I2DA 4XJ8A 3VBRA 1KFXL 1CQ9A 3ORJA 2YB7A 5I0SA 3M8LA 2ZABA 3THCA 5FPZA 1NY72 2BP6A 3Q8EA 4YZ5A 3MIFA 1NX9A 2RDQA 2VZPA 4CVUA 5AC91 1SLIA 2WN2A 3VZKA 4HN1A 4JRLA 4QKBA 1OT5A 2ZGRA 2E63A 1GZWB 4WVVA 4K8FA 1BEV2 2X10A 1UX6A 3J7NA 1RUH1 4HL0A 2AEYA 1W28A 1N47A 2RE9A 3UV9A 4KWLA 4YNIA 3PIJA 2RS53 4RHV3 4NR1A 3FFZA 3BN6A 5ABJB 2DBIA 4Z92B 3D6EA 1QJY2 2ZX2A 3M2MA 4OHZA 4A44A 5GLWA 3WW2A 1AX1A 1G9BA 3BI3A 2WJSA 5FYBA 4W65A 1SZBA 1UIJA 3ACLA 4Y26A 1ZM1A 4XQ4A 3E6CC 3J8F3 1GV9A 1GWKA 2WNUC 4K3UA 5ERLA 2CGOA 3WDWA 5BY5A 5IK5A 3OUHA 4DPNA 4LIUA 5H9QA 4P00B 3L2HA 2ZGTA 3MW3A 1C8NA 5KXEA 3AXDA 4X8PA 2FMYA 1LHWA 3NVCA 5JXGA 2XJSA 4AEDB 3IIIA 5IYYA 1W8NA 3LQCA 5FAXA 4AVVA 1UXXX 3LDBA 4IV3B 1PM4A 3TN92 3KSCA 3DPRA 3A22A 4WZFA 3SKVA 1K5MA 1TQ5A 4QX7A 4CPBA 4GJYA 3JD71 1VRH2 1ZVFA 1HRI1 5IVVA 5FWJA 1OQ1A 2WUHA 3FBYA 3LCPA 1JZ3A 5JIAA 1ODNA 1A8DA 1LOGA 2RS32 1OLRA 2R7EB 3Q9OA 4H7MA 3H7YA 2WWSA 1KITA 4FSJA 1AR81 4W8JA 2N7GA 1COV3 2QBXA 2ZBJA 2ZCWA 4NPMA 5LB6A 1RUE3 1NLQA 1O8PA 4HVRA 5CG9A 1UW8A 1POV3 4XJ9A 4JDMA 2VZUA 1K42A 1SACA 4Q4Y2 1HB2A 2CSGA 3NSTA 4QWNA 3K4DA 1ND3C 3C2UA 3R6SA 5CFCA 4LE4A 4NOTA 2IVJA 3CQOA 4XZUG 3UGFA 2BBVA 1SBEA 2FHRA 2OPKA 2A71A 3LEIA 4PBOA 2ZGSA 3RZKA 5FP9A 4CDXA 2AREA 3AZWA 5DDJ1 5DZFA 1HXS3 3VBFC 4WVWA 4WZCA 5JSOA 4YSFA 1ASJ2 4LUMA 1XXNA 3V64A 5JZGB 4YG0A 1T6GC 4YG3A 1X33A 2NMNA 4CP9A 1ZYBA 4RA0A 4A41A 4ZONA 2VBDA 1CAUB 4G4FA 3UL2A 4E2SA 1IKQA 3LPFA 1S0CA 4IV1C 3MBWA 3WD5A 4S2GA 3CDZB 5T54A 2DUOA 5FZAA 1GZTA 4UW3A 1LESA 2F4LA 4GD4A 4ZKTB 1HIXA 4XURA 1GQHA 1Q43A 1VBD1 2WBKA 3KGLA 3ZMOA 5DQ0A 4DB5A 3CZJA 5FYMA 1W9SA 2GNMA 1DHKB 1SEFA 1M4WA 1HV0A 5E89A 2WT0A 5JZGC 1Q56A 3UESA 2PHXA 1L7QA 1ONAA 1WMEA 3MLKA 1PO23 1UKRA 3DPRC 1CN1A 3VDDB 4XILA 2FDJA 2K9ZA 3OBZA 4KGGA 1ZA4A 4HBNA 1W3VA 5CBLA 4JGZA 1RB8G 1MZ6A 4UFJA 1H2MA 3WT3A 1Q8QA 5LASA 4XQWA 3GM8A 2BRTA 1C57A 2XBO3 1IG0A 4QDSA 3IB3A 4LMFA 2Q8CA 5FZLA 1X9PA 4BZ4A 2DURA 2C6SA 4CCJA 2JXAA 2D93A 4FQZA 4UW6A 3S5AA 1GP6A 5FO7B 1F9KA 2Y6GA 3JQXA 3KQ4B 2A70A 2ZAAA 1R083 1WCUA 3JD72 5CA6A 3AZVA 1F2NA 2XJRA 4IGPA 4NRMA 2D44A 4RQPC 5FP8A 3VBHA 2ZX0A 5K4LA 3WDVA 3WOGA 4EN9B 2MEV1 4EROA 1V70A 3FC0A 2E6VA 1TMF2 1LEMA 2VH9A 5FLIA 2AZ5A 1B35A 5FZ3A 4N53B 1RUG3 2FCUA 2XHNA 2D43A 2OQ7A 3SC7X 3ZKYA 5KXCA 5FUPA 3I4IA 1OLMA 5D2AA 3N9LA 1IS5A 1RMU3 1POV1 5GLTA 5C9AC 3FWEA 1J3PA 4Y1UA 1MZEA 4YFWA 2JG9B 1I5ZA 3FHAA 1OMIA 3T1MA 1H8TB 2CWSA 2JDZA 1YYNA 1A8MA 2V72A 4XJZA 4MGKE 4LT5A 3VL8A 1RUF3 1T2XA 1MS8A 2ATFA 3B5LB 4OQ9A 4MG2A 3RWNA 1DZTA 2JKXA 2VZVA 2VMIA 4AAXA 1EAH1 3RYRA 3INAA 4Q1PA 2QVSB 4LA3A 1XU2A 5EYYA 4DEQA 5IVEA 2RS11 2NYYA 1W0NA 3RS6A 4ARYA 1WZXA 1NA1A 2HJIA 1W6MA 4XUTA 1RUC1 4N43B 3VKFC 4ZHNA 1O5UA 2E7AA 2ZGPA 2D3SA 4MYEA 1C8M2 2WT2A 5EZWA 5ABJC 3FLPA 4M0HA 5FZHA 1OC1A 5JIUA 2WZR1 3T08A 3LPGA 1ZZ7A 2DCTA 5FZMA 1S2EA 3K77A 1PO11 4LNVA 5I93A 1IHMA 1G86A 4ZU5A 2WO1A 4FP2A 4CEYA 4E2QA 1MQTC 3BU7A 3I2HA 3C8XA 4JKKA 4HSJA 1PGL1 1K5MC 2RDSA 2XWJB 1AJOA 1JXNA 5EIYB 1DCSA 1QH7A 4UF0B 2EXKA 4UBHA 4XHBA 3F2ZA 4I3PA 5A1LA 4QB2A 1H1IA 5GZDA 2IFRA 1CZVA 1D4M2 3OBRA 1JODA 1ZBA1 3BIEA 2VUAA 3OBAA 3WG4A 3AC0A 4AI0A 2X05A 5KXBA 2QKDA 4F83A 1JYVA 4DY3A 1QJU2 4CCDA 3U78A 1CZTA 2LTNA 4DNYA 3J8F2 2QFEA 4R52A 2WFF1 3VBUC 5JXHA 1WGPA 2Z5WA 2VOWA 5C70A 1BCXA 1PK6C 1SDWA 3AB0A 1W2TA 1DBNA 4Y1ZA 2KM2A 4QXBA 4W6XA 4NIHA 2RMU3 3NKGA 3MW2A 4XF4A 3GCXA 1W9TA 3FE5A 2XKOA 3AYCA 5A3WA 2HWF1 2WS93 4IEQA 2KXLA 1HJFA 3WQ0A 3N36A 3J8F1 4COWA 3I2KA 1AL21 1W8TA 3TEXA 1W6PB 2VNVA 1LEDA 3AMQA 4IESA 4AXOA 4AF9A 2GALA 5LK7B 4EN0A 1ZBA2 3BB6A 4ET7A 4IUGA 3ZPOA 4D6QA 3QACA 1C5IA 2WFPA 2D6PA 3ASIA 1ZZ9A 3PUAA 2QQWA 2OKXA 3WEZA 4D69A 2ZHMA 5FMOS 1OVSA 4YARA 5C5TA 5F5CA 1G6NA 4OHVA 2X5IB 4LK6A 2HBUA 3LA2A 4AW7A 5T55A 2RS31 3FBMA 1O4ZA 3ZYBA 4FAGA 2DVFA 3I59B 1GOHA 2IUWA 2XONA 5F2WA 4EJRA 4A45A 1JOBA 2JIGA 3O14A 5FYIA 4AGRA 5IWFA 2ZPXA 3M3QA 1RJ7A 2EIEA 3A7QA 2Z69A 4GWMA 2JB8A 3EBRA 4YM3A 2Y38A 5IW0A 3KMHA 2R6QA 1H9WA 1PO13 4DS0A 5L9BA 4GZ9A 5EJ1B 2R072 3ST7A 2LALA 2OVUA 4D6RA 4Y24A 3RMYA 3V0BA 1ACCA 4PBPA 4FPGA 1XRUA 2D6NA 2JB4A 3O1RA 3U07A 3IKWA 4CP2A 5J1XA 2SLIA 3DXTA 1HJGA 2VZSA 4CEWA 3I3BA 2VCCA 3ZSLA 4WM8A 3RPQA 5A6YA 5GZFA 1Z78A 2Z79A 3H3LA 2J1RA 5JOYA 4CDUC 4XFAA 5DAQA 4OMDA 2TBVA 3DXUA 4C8DA 5FZ7A 1ASJ3 1X50A 4HANA 4MO3M 4ZU4A 3BTAA 3M7AA 2VG9A 3OB8A 5DUXA 3O12A 3G6JB 3ON7A 5A1AA 4Q4Y1 5GZCA 1RHI3 1U5ZA 1VB4A 4KL1A 1LGCA 2IXIA 3KCXA 3ZXFA 1H4HA 1WLCA 1LNSA 5D1IA 3VDDA 1UNBA 1LOBA 3POJA 4ZZ8A 3BTXA 5L9RA 4UFLA 1CIYA 3C7GA 5C6CA 4D0QA 2FDHA 1FOD2 5IUQA 4IE6A 2PHWA 3VD4A 1YFWA 2WIIB 1MZ5A 3UK9A 3VB9A 4Q29A 5B2GB 3N9OA 3VBFA 4XZPA 1N3PA 3FUQA 2F6BA 4LKEA 3CO2A 5EFUA 5H9RA 4BMEA 1ZZCA 4WM7C 5TSWA 1W90A 3ZKUA 2IXCA 4MHUA 5LWBA 1RUJ2 1SCSA 3WDYA 1UY3A 3WG1A 2O8OA 3GBGA 1QEXA 2VTFA 4R9AA 5FPUA 4NVPA 1CVNA 3BALA 4MZUA 4JKMA 1QGLA 1AXZA 1X36A 1ALYA 3AFKA 2R16A 4KWKA 1LHVA 1S0BA 5GLVA 3NRUA 1FYUA 1W6NB 3AP6A 3ACHA 2J7MA 1N1SA 4LJHA 4AFDA 5DUUA 4XETA 5DUVA 1XU1A 1PVXA 1QOSA 5FBJA 5DPNA 2DCYA 1FX5A 1HRI3 2R071 3K4ZA 3KV6A 1Q8SA 4Q4W3 2WA3A 1VRH3 4XJAA 5I0TA 2OYZA 3W21A 1VMFA 1WLTA 2WFF3 3PUIA 3WNMA 3ZYGA 3AKSA 5A33A 1US2A 3RYPA 1DIWA 3TOJA 1HB4A 1ZRRA 2RS33 2HLEA 4ONUA 4P9GA 5CKNA 3LEGA 4NHKA 2HWC3 1ULDA 3H1MA 4HKWA 2VQUA 3GJBA 4JGZC 1QXPA 2V09A 1ULPA 2E26A 5HXVA 1FMD2 2VZTA 2HH9A 2HWF3 2CAVA 2X29A 3M3IA 4KU7A 4LULA 1PGW2 1JH5A 4QPYA 2ZEWA 5I8SA 3TN93 3TNQA 3WF1A 4BYYA 2YBSA 3O1TA 1Y7BA 1FI2A 1VBC1 2BV4A 2GSYA 2PTMA 4COYA 4D3WA 2NN8A 3KVBA 4IL7A 4LHLA 1QDCA 4CCLA 1BZWA 1W0OA 2X8KA 4RD7A 4Y4RA 4XAAA 4JDOA 4AHZA 2ZZQA 1ZRIA 5JOXA 4Q4V3 4I01A 1UZWA 1Q3EA 1K45A 4CCMA 2WQ8A 4QPGA 2RS13 1W2AX 1FT9A 2OXBA 3TEWA 4BOWA 1FNYA 3K3OA 1QIQA 1S4CA 3OGSA 1V6JA 3H8UA 3OBTA 5C8CC 1TEIA 4CXXA 3AM2A 3WZ1A 5BNPC 4N53A 3U4XA 4QPIA 4AFAA 1WBFA 2YGLA 4LLOA 1C28A 4Q4V2 1BXHA 1AYN3 1I5PA 1WMDA 1LHOA 2G19A 2OT7A 2XJTA 2JEMA 4FQ4A 4HPKA 1JI6A 1X82A 2ZJCA 4FOWA 3VBUA 1AR62 5FYYA 5SV8A 1ZZBA 1HQLA 2XQXA 5BNNC 1N1VA 2HWD1 1JYNA 2PELA 4OUMA 4AGGA 3C7OA 4Z82A 4TZDA 4IDZA 5A32B 4MH0E 1Z7S1 3N4MA 1PMHX 1H1MA 1UL9A 5IJRA 2FZ1A 1AYN2 2W87A 3DEMA 5LY2A 1D0GA 2A75A 1E5SA 4QKNA 1UPSA 1IGOA 3POYA 3RZMA 1B35B 1B09A 1W6MB 5DUWA 1UO9A 3WF3A 2R062 1UIKA 2ADEA 1AYM2 5FXVA 3UKTA 1U5IA 4JZRA 5FY8A 2O1QA 4YW1A 2AYHA 2V4AA 1MQTA 5FY9A 2ZXQA 3WW4A 5AC93 2QTWB 4HSLA 5FYCA 3ZLIA 2WR9A 2B8MA 3SH3A 4AE2A 3OSDA 5LEJA 2IXKA 3D8CA 3LAGA 4Q4Y3 1PX3A 1WD4A 2WQZC 3N7MA 4QT6A 4OQ8A 1DGRN 1OOPB 2VJXA 4LIVA 2RJ2A 2OA2A 3O5SA 4UF0A 1NA1B 5M0TA 2BUKA 1X8MA 3VBSA 2CDOA 2Y6LA 2W52A 4XCAA 4LBQD 1U5XA 4A4AA 3MF6A 3WXPA 1NOVA 2DUPA 2JE9A 4LO7A 5D21A 5IVBA 4B4PA 3GALA 5ISLA 3Q8BA 1RUNA 1AR61 2YYOA 5FP3A 3LD8A 4Y5Z0 3WP6A 4TLFA 4URTA 2ETEA 1EUUA 3O1OA 1W8FA 3QH6A 2DTWA 1EAH2 1REDA 3D3AA 4E2GA 1UOGA 3SISA 2GN7A 1SLBA 2OZ6A 3IN9A 4A3XA 4RSUA 5C9AA 3AL5A 3WNPA 1R64A 5A7NA 1VIWB 3D5OA 1YFUA 4ZS2A 1Q5OA 4LBNA 1CAWA 1MACA 2WC2A 3N9NA 4Y5SA 5CYYA 1AZDA 5IVYA 3A23A 1H6YA 2IVIB 3E97A 2GU9A 1AL0G 1BBT3 5LA0A 5FMOL 1LODA 2DF7A 3WQ1A 5DAPA 3T0DA 1VE0A 2QQLA 4NUBA 2GH8A 4PI0A 1H1AA 4LO4B 4HZFA 4HETA 3WUCA 4CP0A 4BK4A 4HLTA 4RQPA 3IAQA 3KZ4C 1OPOA 1W8UA 3HNYM 4BK5A 4Q8KA 3B3QE 1XE7A 4IEOA 1W6PA 1AYN1 4HPKB 5JAXA 1SLCA 2Y0OA 3B7MA 2XUEA 2C5DA 5J3UA 1W06A 3I49A 4I02A 2RVAA 1VBB1 3USSA 1HRI2 4W50A 1SCRA 2WL1A 3H0OA 3KCYA 1COV1 1FPN3 1IS6A 2XVGA 4PIXA 5HI0A 5HBAA 4M3CF 4CCCA 1V6IA 2LUWA 3RZGA 1N3OA 1OUSA 2ADDA 2EA7A 3LFIA 4FO9A 3ZFFB 3LA7A 4C90A 4CZSA 4QX2A 1UY0A 5A6ZA 4D7TA 3SH4A 4Z1VA 4H55A 3J9SA 4NWVA 1GZWA 3I59A 5GJ6A 1OF4A 2J1EA 1LHNA 4QX5A 1AYM1 4CU8A 4P9YA 1V6LA 2RM21 2ZMKA 4XFGA 5FYZA 1D2QA 1GANA 4FFGA 5FXXA 3RSJA 4KMQA 4UBGA 1BMV1 2D3PA 1TME3 3C7HA 4IEUA 4BQYA 1GFF2 3MPPG 1FNZA 1GYKA 3AP9A 2Y0IA 2X5IA 1Z7S2 2VCBA 3E5XA 3HD8B 4YW7A 3THTA 4B29A 4YVWB 1V6KA 2B9UA 4CYDA 1TMF3 2XLFA 4DXSA 4XABA 2V4VA 2VUCA 3VBSB 4FPFA 4QQPA 5F5AA 3ZXGA 1US3A 1E5RA 1O3QA 3P1IA 1VBD3 4D7YA 3NWKA 1GBGA 4JRAA 3TYJA 2OUHA 3THDA 4COZA 1QF3A 1XNCA 2W92A 5IFPA 3DKQA 3OY8B 3PUSA 4MGYE 2VY0A 2PXJA 2YZ4A 4ES9A 4AQSA 2BPA2 2B45X 1QQP2 2LW8A 1Y9MA 2QQMA 3I8TA 3MGUA 4BMBA 3RVHA 2P4EA 4E8CA 1FPN2 1XOYA 4Y4YA 1J1TA 5KR7A 4P9JA 1W9WA 3JCIA 3WSOA 2G9ZA 1K5MB 2ZHKA 5FKBA 1D2SA 1RC6A 1WA4A 2DVAA 2VCAA 3NAPA 5A7WA 3BUCA 2AUYA 1RGSA 2A3WA 4L0PA 4N9IA 2D3RA 2JDYA 3QH7A 3DCQA 3WR0A 3OOXA 4BLIA 4ZS3A 2B4KA 1TME1 2PHLA 1NCRA 1VPHA 2D6OX 3MFCA 5CZKA 4AVCA 2XB6C 1PO21 4AEMA 4FPHA 2ZGOA 2ARXA 5I0DA 5SV5A 1MVQA 1NZIA 1FPN1 1QJX3 3ZPYA 3ZDVA 4X8NA 4QM9A 2QQUA 3N9QA 2RMU2 5LA2A 2FDFA 1XPWA 4I30A 3HEIA 5EYXA 4JVAA 2WSVA 2VTXA 2VC9A 4AFBA 1VBC3 2W1UA 3AKQA 1XC6A 1GP4A 5DG1A 5EPAA 2ZMLA 3BGAA 3ZSMA 1J3QA 4OHXA 2BTVC 1KEXA 2VQ0A 3WF0A 3LZZA 3VBFB 3A0NA 2JG9C 2HEYF 4Q0UA 4YM2A 5AVPA 1CX4A 4Q4V1 1A34A 4XIOA 5FRAA 1PVC1 1W39A 4NE9A 4Y20B 2VMGA 1FV3A 5FPXA 1H2LA 1QXJA 4GULA 4B7KA 2EIGA 5IATA 3KVAA 1E5IA 3MIGA 5F5QA 5FK8A 3VL9A 1BKZA 1VRBA 2VCMA 3MF9A 4YZ2A 2BOJA 5F2SA 2I07B 2UURA 2Q8OA 1ND2B 3WF4A 3LIGA 3RI8A 5BNPB 5LBBA 2EXHA 3AZXA 2Q4SA 4K9SA 3E5UA 3KV5A 3BU0A 2C0ZA 2H6BA 3JZVA 5T52A 2ILMA 5FY0A 1QOOA 5BV6A 1MS4A 5CNAA 4JV4A 4RN5A 1RJ8A 5HXMA 4GAZA 1S1AA 1LOCA 1QHDA 3HMYA 1PGW1 3R4UA 3AMNA 3B02A 1EAH3 1BEV1 4IV3C 2ZMNA 5FP4A 1YI9A 5IT6A 1MS9A 1ZX5A 1E57A 2WWJA 3W5NA 1GKBA 1OA3A 1AUYA 1IQDC 4CXYA 1ZRFA 4BWOA 3V0AB 1PM7A 4K20A 4CDQC 2FDIA 1C8M1 5JR2A 5LRRA 5LBCA 2YFZA 5BNQA 4OULA 4N7UA 4Q2FA 3T2TA 4E4DX 4AI9A 4DQAA 2XOMA 1RUD3 1OA4A 3VZNA 4FI9A 2LRPA 5I8TA 1GZ9A 3WNXA 2BQPA 2UYAA 4QQ2A 1PIV2 2PHUA 1HX6A 1OOPC 3EJKA 4O9EA 4A2UA 3ZN6B 2UY9A 2VBBA 2ZHLA 2RDRA 3NV2A 3WX5A 1GU3A 4XBQA 4LO5B 5A32A 3DYOA 5J09A 1MEC1 4DOUA 5JI9A 4NPRA 5H9SA 1HDKA 4PF5A 3POWA 4UW5A 4YWAA 1AR92 4O9GA 2ENRA 2VNRA 4AWDA 4TLGA 2NPIA 1LU1A 3FZ3A 3MDPA 4AVSA 1OURA 1I9RA 5EJZB 4AI8A 2XXZA 1PO12 5FKCA 3PU8A 4PJYA 2QNKA 3VDDC 4J25A 3CU7A 5J96B 1NYWA 4HKOA 5A1FA 1W3XA 5L19A 5LZ6A 1V00A 1UXZA 2Y6KA 2WZ8A 5G05L 1H8TA 1RHI2 4CRQA 3IDCB 5FXWA 3VZLA 1F8VA 2I2SA 1Z7S3 2Q30A 5CFCB 3IWZA 4L2NA 1BHGA 1UYZA 2WNUA 3MV01 4XF0A 1ULEA 1XB9A 1AR83 2RJLA 1KS4A 3OPWA 1CIWA 3CJIC 3AVRA 4GH4B 4KGQA 5J7MA 2GNBA 4YVSC 5AC92 2ZEZA 3BIWE 1RL3A 3OUIA 3ALQA 4RHV2 2WNVB 3ZFGA 1HB3A 1SQ4A 1W9YA 3RZHA 2GP3A 4C0BA 3ZX7A 1CAUA 4CP1A 5FY4A 1D4M1 1S2KA 4EN6B 1BK1A 3AP7A 3RJRA 2FCVA 2XJQA 5DMYA 5J98B 5KHJA 1YI7A 3BOPA 5DZEA 1VMJA 3KHBA 4BXFA 4CEYB 4COUA 2ZGUA 3CMGA 2UY8A 4B8EA 1NCRC 2YV8A 3PJYA 3V0BB 2W94A 1O3TA 3K46A 3ZXLA 1DFQA 4HK8A 4MVTA 4CU9A 5BNOA 4M4PA 4CDUB 4XW3A 1TE1B 4CPBD 3TAYA 3S5QA 1F5FA 2VOXA 3RI9A 1FMD3 3K4AA 4L92A 4AEDC 2Q8DA 5T5LA 2UWBA 4QAWA 2XBO2 2YBKA 2WSUA 4GB31 4Y22B 4MUVA 5JOZA 5FYVA 1D7PM 4FPYA 4AHXA 1W05A 2VECA 3E5QA 3LFMA 4P9XA 1C1FA 3U11A 5FFOC 1NLSA 3AX4A 5GM0A 4XXPA 2W9XA 4JGZB 1AR91 2OIIA 4B4RA 5JSPA 2ZEXA 4AI2A 1S0DA 3MUY1 4V2WA 4LBQA 1GNHA 2J42A 3MW4A 2H0VA 5C3OA 2C24A 3MYXA 3CIHA 4NHMA 4AAPA 2YROA 3GZAA 3LE0A 3L9JT 2P6CA 4I0AA 4CDQA 2RHPA 3W58A 3IZOA 4QDQA 1X9TA 1RTVA 3EYPA 1TVGA 3H3UA 3E6DA 1WCSA 4QPIC 4PIYA 3VBHB 2PMWB 1MS5A 2CWMA 2E7QA 3OCPA 3W20A 4LLFA 2DVBA 3WNLA 4ASKA 2ZACA 3OPTA 3ACIA 2P2KA 2EAAA 4OI0A 3W9AA 3OUJA 1WUVA 1HQWA 2H6CA 3KV4A 3WQ7A 1G9AA 1KDMA 3AFGA 2TEPA 3MEPA 4R4XA 2Q1ZB 4LKDA 4HT1T 2K2SA 4KBBA 3UGGA 1UKGA 1QY4A 3ZFEC 3I3QA 1XYNA 4YPJA 1CD3G 4BU2A 4FOVA 3WV6A 4CEWC 2BFUL 2DU1A 4UT5A 1BYHA 2JDHA 4GIQA 4IEZA 1YCIA 1LECA 1FATA 2BDRA 1GQPA 3AZZA 4AR2A 2OS2A 1LJ7A 3K2OA 1TNFA 2MNGA 3B01A 4IETA 5FMBA 1VALA 4IE5A 3T4HB 2YGMA 4DXRA 4Z2WA 1S0JA 3N9MA 4LO8A 1C8M3 1REEA 1ZBE2 1WA6X 3WNNA 5C4WB 4PLOA 5FCCA 1D4M3 1SFPA 2A1XA 4QU1A 4FCAA 2D6LX 4KH9A 4Y5TA 5DN2A 4C0HA 4DFSA 1NCQB 5BPXA 2W5FA 3CEWA 4XUPA 1GQGA 3RJ2X 1ZA7A 4I0BA 4M4RA 4GA9A 5IAXA 1DGWA 3R0RA 4HK9A 4ZY9A 2HWE1 3Q8AA 4YZ3A 3UNPA 4D7SA 5FZEA 5T3NA 2UWCA 1Y9GA 3NV1A 1RUE2 5F9TA 1RMU2 3TRSB 1O3RA 1QNWA 1DQ1A 3UJQA 4F7ZA 2ZKNA 2P5BA 3LB9A 5FPBA 1QJY1 3KGZA 3AK0A 2WNOA 3ILNA 4N8MA 3ZFEB 2YC2A 3NAPB 1OKOA 4CA9A 2FDKA 5F6LB 1OXCA 1VRH1 3DECA 4WVMB 5CG8A 5J36A 4RR3B 5IK8A 4ARXA 2HWB2 4Q26A 3SCHA 3B00A 2VMDA 4QKDA 2XVKA 4WM7A 4CUAA 1RUH2 4OFGA 5D8AB 1S0IA 3OD0A 1ENQA 3IDAA 1JYTA 1R1A1 2XLAA 5HPOA 1W04A 1SPPB 3WF2A 5A3OA 3BPZA 4QPIB 3TEYA 2YXSA 2CGNA 2XL9A 4NRPA 2VMHA 2W95A 3I2FA 4Q1RA 5KWRA 2W08A 3ZN4A 4AQ6A 1C1LA 2HEWF 4FTBA 2JG8B 4XYXA 1NY71 1QKQA 3B93A 3ITQA 1PZ7A 4GQ7A 4RS5B 1EPWA 2GZWA 2YY1A 4RHV1 4FXGB 3SEEA 3JUUA 5FZ6A 2CL2A 1UD1A 2FQPA 1O5LA 1AL22 3HOBA 4EWEA 2KD7A 1V6MA 3J7HA 1RUD2 4LUKA 4M01A 3WQBA 4CXWA 4DRVA 3PNAA 2NM1A 2PAKA 1W8WA 2Y60A 4FPLA 4E4SA 5FUIA 4PCRA 3WG2A 2V73A 3NKTA 4XFCA 3QD6A 5T50A 4YG6A 3UYJA 4H3WA 3T0BA 3POGA 3VD3A 2IZWA 3BCWA 1KS5A 4JKLA 3ZN5A 4N9HA 1ND2A 2WFF2 2VUDA 3OTFA 4LKFA 1UMIA 2BNNA 1CPMA 3OGRA 3VHRA 1PZ8A 3T2QA 2WZR3 5F3EA 4BLJA 2HWC2 2JIJA 3FN9A 5L7OA 1GR3A 3H3ZA 1NCQA 1NKGA 2XJUA 2BGOA 3Q8CA 1YIPA 3IMMA 3PMEA 1DZRA 4QXHA 2BOIA 1TME2 4HFSA 3WDXA 1C3HA 1P8JA 1Y9QA 4AK3A 2VZOA 3VKNA 3KT4A 4YVSB 2L9LA 1XNBA 4RFT0 5F1RA 1MPXA 3W59A 2VZ1A 3ES4A 4CSWA 4LO6B 1JN2P 4Y3OA 3WW3A 1LOFA 3HNBM 4BQ2A 4GMP1 5HV4A 4QX1A 1URXA 2WN3A 5CB7A 2XLGA 3IIAA 2XG3A 3OD4A 4MLOA 3ME2A 2C26A 3NO8A 4QXKA 4XUNA 3DGTA 1ST8A 4XTPA 2DCZA 1YXWA 4XDQA 2A7AA 4JDNA 3S57A 3DPRB 1OSGA 5F3GA 1W2NA 1YWKA 5GLUA 5LATA 1GWMA 1R092 1GUIA 3T2PA 2FCTA 1FOD1 5EQUA 1V0AA 4ATEA 5KXDA 1YIFA 1IPKA 1LRHA 2G1MA 2VNOA 4P9IA 2WO7A 5IK4A 2CY6A 3X29B 5C8WA 4GMP0 5LBEA 4LBOA 1KJLA 5KC6A 4OUEA 3ZIXA 5FDBA 2OQ6A 4NWWA 4YLZA 3EMRA 3NV3A 4EN8B 3A4UA 1O8SA 3VBOC 1BBT1 1VBE2 4N43C 4RL7A 3R4SA 1F4HA 3VDCA 4F3JA 1AX2A 3KF5A 5FPAA 4EWDA 1QJFA 1WWYA 2WA4A 1RMU1 4MGQA 3SKJE 1G9CA 3HT2A 1VLNA 1V9U1 2BVBA 3VKMA 5KHIA 1PNFA 2WWUA 4INDA 3ZVXA 5IVJA 1ND3A 1OI6A 3DV8A 1HXS1 2RJKA 3MHZA 4LHNA 4HKLA 4DMIA 4FPOB 4BQ5A 3ZYIB 4L9BA 3NL1A 2VL4A 2GP5A 3VDAA 2VVFA 2IWGB 2RDNA 3SITA 4QM8A 1VB2A 2WS92 3SCFA 4XVHA 3DL3A 3PVNA 1V6OA 5FZFA 5LRSA 1YQCA 1VBB2 3I7DA 3LIHA 4ORFA 4CEYC 5HV0A 2VMEA 1PMIA 2WQ4A 3O1SA 1MS0A 5LCWL 3HQUA 1SDDB 1J84A 3IBMA 4GKXA 4QGMA 5KC5A 3CF6E 3CKHA 3POSA 1SFYA 2JICA 2A6XA 1ULFA 2BJSA 2RS51 1R081 1UQXA 4P5HA 1HLCA 1GOFA 2AACA 3AYDA 2RS12 2ZX1A 3UT0A 4DUXA 4RYDA 5T5JA 4ZXKA 4AFCA 4B3NA 1XSQA 5FJKA 2PHFA 3GZTB 3SCGA 2Y26A 3WP4A 5C5UA 1ZZ8A 2WNVA 4UFKA 5CFDA 4XE9A 4AEKA 1H30A 1QJEA 5A80A 2DCJA 3HVDA 3RNSA 3CJIA 4LEJA 4V2VA 3RZJA 1PNGA 5LY1A 3FLTA 1NQDA 3HAGA 1VAVA 2ZOEB 4OZOA 1JUIA 1BBT2 4XCBA 3O1VA 2RR11 1FXZA 4M0NA 5BNOB 2KR2A 2Y33A 1XE8A 3ZO0B 3OGVA 4UI9L 4HN0A 2CNAA 1RHI1 3ACGA 3RWKX 5C8CA 2E32A 3POIA 2AC1A 2YG0A 3H50A 4FPCA 4ISQA 3VBOB 2EXIA 2OPWA 2V5YA 4GKYA 1WLDA 2DYCA 4PQ9A 1UPIA 1JZ6A 2DFCA 4AOCA 1CWPA 2YDEA 3PHMA 2JDMA 3NNMA 4Q0VA 3FJSA 4QPWA 4Q0PA 5JR7B 1NE6A 2JDNA 3KB5A 5L73A 1CAVB 3N35A 4BDVB 2HYXA 3L2YA 3JB8A 1RUE1 5F8PA 3A21A 2J1TA 2AR6A 5DAXA 4CDQB 4XQDA 4FPJA 4GXLA 1SMVA 5K9YA 1X8EA 3U4SA 3BKZA 1ULGA 2EXJA 4GMP3 4LBMA 4C1WA 2VQAA 2BNMA 3P3NA 4TTGA 1MZFA 1ND3B 5FTTC 4IEWA 1DF0A 4L99A 4CDXB 4GB33 5L36A 3WNOA 2D98A 1ULCA 4FVVA 3JB4C 4LORA 1AXYA 5FZ9A 3JBG1 1REFA 4YW5A 1LOAA 2O14A 2PHRA 3SH5A 3URFA 2IXLA 4EWAA 1O3SA 4FOYA 4H7LA 3WDUA 3ZYFA 3VHPA 2XVLA 4L11A 1KD7A 3O0XA 2CGPA 1I3HA 2Q1MA 3POEA 4YFZA 2C9KA 4P08A 4XUOA 2YFUA 1ND2C 4DY5A 1RUI1 3IDBB 3T1LA 5T5OA 2J1AA 5F39A 1JS9A 1NXD1 1UYXA 1CAXB 4JGYC 4YW2A 1RUF2 1VJ2A 3PDQA 3H1YA 1F15A 2BVVA 1UOJA 1KJRA 1UU5A 1VR3A 5DDJ2 3RZZA 4FFFA 4IERA 1DP0A 2FDGA 2JECA 2HWE3 4EQVA 3FFQA 4P5YA 4QX8A 3SQOA 1U0AA 3R05A 3THPA 4CCEA 2MHFA 1QDOA 1ZRDA 2DCKA 1YC61 2VTXJ 1XNTA 1WCKA 3AKTA 4MXWA 2EICA 1ZBE1 5FO9B 1DU3D 3PTYA 3BPSA 4G9SB 4PIZA 2JD4A 1IS3A 4K40A 4QKFA 5JZGA 4I2OA 1WLWA 1T6BX 2A73B 2UWAA 2Z2SB 5FYUA 5KBFA 2HBTA 2YMZA 4MGTA 5K0UC 2VXJA 1O59A 3KCCA 1JHJA 4NAMA 1MVEA 4HOOA 5EJ3A 3M70A 4AG4A 1G9DA 2QUOA 2ZX4A 1JBCA 2D6KA 2IXHA 1W03A 4R9BA 4BCUA 4XMIA 3HBKA 1W9FA 4DUVA 3F95A 4R9DA 3B9CA 3CBNA 3WUDA 3NQHA 3I2OA 5LBFA 3UETA 4RR3A 2XPJA 2BBAA 5J37A 1JMUB 3MIBA 4QB1A 1L3JA 3AXEA 1BEV3 3N7KA 4A3ZA 2WS91 4GWIA 2AGSA 3RRDA 4W4ZA 5FR3A 2HWD3 4CU6A 3GHMA 3ZXJA 5FQ0A 1POQA 2FMDA 5AVAA 4CDWC 1AL23 2WO3A 1N3QA 3NJVA 4R8HA 3GNEA 1JW6A 4DUWA 1PX4A 2P3KA 4XFFA 4FP3A 4YW3A 4BHPA 2PA7A 4YGEA 1SG3A 1WKYA 4E4ZA 2ZGMA 3U10A 2P17A 2B46X 5A7PA 3FLRA 3VGIA 4S2HA 5B4XA 3WG3A 4RFRB 3WHTA 1AVBA 2FZ2A 1IS4A 1YFYA 2D5HA 4XMAA 2YC0A 1UMHA 3AL6A 3RGBA 5FYHA 5L7OB 1WMXA 3ENRA 1S55A 1VBA2 2ZGNA 5A33B 1XE0A 2CU5A 2NZ9A 1YEWA 5J48A 1RUC3 3OEAA 4H2AA 3JBG3 4N43A 3UKVA 4ES8A 2GC2A 3ZFGB 1LAJA 4QQLA 1BQPA 1HQNA 5BNPA 1JYIA 1DYOA 4XF3A 1YFXA 5ANNA 4Y1YA 2OUJA 3RMXA 2PN5A 3J7MA 3WDTA 5JDBA 2ZS6B 4IV1A 4KQ7A 1R091 3JQWA 5F6KA 1HB1A 4AVTA 3PVBB 1CAXA 4LE3A 5FXZA 3Q8FA 3VKOA 1RINA 1W99A 4Q4X3 4CEWB 1UY1A 5A7SA 4OMCA 2DUQA 2WYSA 3H7JA 5CKMA 4FOQA 4YRDA 4MGSA 1UZ0A 1ZZ6A 4XBNA 1CGPA 4NRQA 4Y22A 1B35C 4UFHA 3V0AA 1LB2A 4D6SA 2F4PA 4BA6A 4QD2A 4ISRA 1NUKA 3OYWB 2R1DA 3GXUA 4DO0A 1JZ2A 2CTVA 1YJKA 2R042 4AEJA 2ID4A 4Q5OA 1RUI2 2W68A 1CONA 4LA2A 4NMIA 3W5MA 3ACFA 4XIKA 1OBNA 3ZN6A 5A3UA 4TYSA 3I2IA 4HMZA 1AR93 1I1EA 1IZ3A 1STMA 2ES3A 2B7YA 3GHNA 3RG0A 4JAAA 4GB32 1A78A 4UAPA 1XYOA 4XXAA 4CUBA 5I8YA 5D8AC 3VBRB 1UOFA 3HWJA 4LR4A 4IE7A 3TN91 5F37A 1RUOA 2JDPA 3BTYA 4RR3C 1ODMA 5LK5A 1PIV3 2WINB 2XKPA 4A7YA 2VXRA 3C7FA 5FZOB 3NAPC 3K75B 3DYPA 4META 3GZUC 3AKRA 2VU9A 4BQ1A 1DG6A 3MFAA 1O4TA 4OCTA 3H9AA 4QHOA 5HCBA 4Q0QA 2BGCA 4LQRA 1QXRA 1R1ZA 3USUA 1Q8PA 1W6NA 3T2OA 2BZDA 4NJ4A 3ZMNA 4ASMB 2YU1A 4BE3A 4FTSA 1PGL2 4HONA 3ZR6A 4YM1A 3NMBA 4LBLA 2OW4A 2W1WA 5JSRA 3SEPA 1GNYA 5FMDA 4UYBA 3C7EA 1CPNA 1QQP1 1D0HA 5LA9A 3AMHA 1OQDA 2NLRA 4PLMA 3KHCA 2FD8A 1NA1C 1UX7A 1H0BA 2UYBA 2EALA 2A6VA 5JCTA 3HN3A 2WNVC 2AENA 2JENA 5C71A 3WY6A 2RS52 5FZ0A 1AR82 1H9PA 4KWJA 5C4WC 4Q4X1 4A7ZA 1WD3A 4XJUA 2HWB1 3CJIB 2JX9A 1GLHA 4O7XA 3LGRA 3PLQA 4QPGC 4O61A 4BQ4A 3ZOIA 1EYBA 3VUOA 2UU8A 2PHDA 4CCOA 3B94A 3T4VA 3OGGA 3HR9A 4RGKA 3PUQA 4WM8C 1LULA 1UCXA 3TNPB 3ZIWA 3K48A 3PVOA 5I0UA 2WDBA 3WNKA 1QMJA 3HNMA 4PDWB 2JDUA 2Z4FA 3R4DB 4TXWA 4TN7A 1FV2A 1CAWB 2D5FA 2VUJA 3KQRA 1RYYA 3H42B 4K8RB 4PDWC 4PT6A 5F32A 4ZZ5A 3AJYA 1J58A 2QZ2A 4URAA 5FZ4A 3HN1A 4WM7B 3QOPA 5ACA2 2XDVA 2RV9A 3VBHC 2PQSA 2HWE2 3LDKA 2ZEYA 1CJPA 3EO6A 5DDJ3 4UOJA 3HIFA 2D7FA 1XQNA 1W6QB 4Z8BA 1XBFA 5JUVA 4BIFA 5A6XA 1EY2A 5BYNA 1GNZA 1H6XA 5FY1A 3VHNA 1QNYA 4CE8A 5JMCA 1XNAA 3HT1A 3OEBA 3T30A 1W2OA 3OPZA 4D8MA 3EB7A 3PIGA 5CISA 3PL0A 3LKJA 4ASLA 2DV9A 2HKXA 2PLV1 2I45A 3UGHA 4XACA 4CUGA 4XHXA 4EV0A 1C4RA 4OI4A 4W6YA 3NNGA 1UOBA 4LTAA 4DRRA 4DXZA 3MI8A 5A70A 2B9VA 3G7DA 4NHYA 3WVJA 2ZGKA 4BISA 3IT8A 1DQ5A 4Q27A 3PTRB 1JUHA 5GZEA 2VNGA 3ES1A 4QQHA 2LROA 2QQIA 2RG4A 2VW2A 4JCKA 4CP9B 5FOJB 4G3YC 2GC1A 3O7OA 4WV8A 5C3QA 3N3HA 3BTZA 5BUVA 4MSVA 3QCWA 4BJ0A 5A3MA 1X7NA 5DAVA 4OHYA 2QE3A 3OJBA 1UYYA 3FHQA 4XC9A 3D82A 2ZKLA 5A3LA 5A6QA 4IEVA 3J7LA 1W6OA 2B5HA 5C4WA 2XUMA 4LITA 3ETPA 2HEVF 2XGXA 4BPZA 2XHKA 3MZHA 1CX1A 5I0RA 4YZ4A 1Q8OA 3VBRC 1LCLA 1PHMA 4NO4A 4HVQA 3JXSA 2Y64A 4WBBA 2NQYA 1H8VA 2EIDA 2NMOA 1VP6A 2PFWA 2XJPA 4GH4A 1K12A 2EVXA 3N7JA 1O7FA 1RIRA 1TMF1 2Q5TA 3O1PA 2XH6A 1HN1A 2DTYA 2VZ3A 4OVEA 1RUG2 3ZXAC 2R063 4NAOA 5DG2A 4AZZA 2P1BA 2CDPA 2F17A 2MEV3 1GWLA 3GCWA 3V65A 5CFCC 1GSLA 1YNAA 4UW4A 3QBQA 1RUI3 5CFDC 1U5YA 1QJU1 5JI7A 2XJVA 3ZM8A 5E1RA 4E9KA 4QXCA 2A6WA 3DF0A 5KHKA 1WW5A 1SLLA 2BWCA 3LEMA 5C3SA 1NXMA 3DUIA 3IAPA 4JTOA 3BYWA 1ENXA 5CIRA 2ZGQA 3WINE 2GAUA 3RZLA 1OVPA 2DVGA 4Q4W1 2RM23 2VMCA 2R043 3I3EA 3MIEA 4CTEA 3VDBA 3WP3A 2VOTA 3AKPA 4M3CA 4QPGB 2EAKA 5FPVA 5EXOA 2C9AA 2DVDA 5IVCA 1JYCA 2YPJA 4EZHA 2R49A 2G4IA 3EHKA 4MXWB 3U1XA 2PLV3 1IPSA 1AYM3 1DQ4A 1FOD3 3HJRA 1VBE1 4S2DA 5FQ0B 1WBLA 3M4FA 2VW0A 1YQ5A 2ZHNA 1DDLA 3AVSA 2HYKA 4NPLA 1O6UA 4HG6B 5E8AA 4QU2A 1RUG1 3ZYHA 5FUNA 4KG8A 3AZYA 3LOBA 3FUOA 1PGSA 1Y43B 4QDRA 2JDAA 1QJX2 2ARBA 3E1F1 4UWDA 1RXGA 4DEVA 2GNTA 3QLQA 3H8XA 2B42B 4JHTA 1BVVA 1W8ZA 3GBWA 4XF1A 4B1MA 4AVAA 3AMPA 4P9LA 5KHGA 2IC1A 5HCAA 1DQ2A 1QJZA 1RUH3 5C7GA 2PHTA 4J1XA 1MS3A 2WT1A 4Y20A 4QGNA 1V9U3 1HRV1 3OG2A 1KQRA 4GWJA 2VVEA 3VBSC 4ITCA 5L9VA 4KWUA 3ATGA 3WW1A 4LOTA 4YGBA 3M3CA 4YVWC 3RYKA 2K0GA 3NV4A 4I09A 1MEC2 1YQ2A 3I2GA 4YW4A 1OD5A 2GC3A 1MQTB 1YLLA 4XF9A 1J3RA 5F3IA 5FZIA 1W6OB 3LDRA 1H4GA 1OA2A 1TZOA 2VVDA 3FMGA 4B7EA 4KBZA 4FXKB 2VPVA 2W46A 2TNFA 1QJX1 4JHZA 5F5IA 1DGLA 1NE4A 1R082 4YZ1A 1G9FA 2OX0A 1NG0A 4BQ3A 1O4YA 1KGYA 4Q8LA 1UU6A 1W2UA 4J1WA 3ZYRA 1HW5A 1YO8A 2PAMA 3RDIA 3P5BA 1ZREA 5HCHA 5FO8B 1CZSA 2G9FA 1JZ5A 5DZGA 4C1XA 1UZZA 4Y1XA 2RMU1 1K3IA 1JOJA 3IPVB 1WW4A 2XL7A 3ZFFC 1LKNA 5FZ8A 4H14A 2WZEA 1LR5A 1WW7A 1ZRCA 3TEZA 1AR72 5FMCA 1R093 1TNRA 4AI1A 4AEDA 3TWIA 1ZBA3 5JPMB 1BJQA 2GMMA 2VOKA 5BNNA 2JWPA 1RVF2 4K1ZA 5A3PA 3I3MA 2YPDA 1RUD1 4Q4W2 3NNJA 2WZPP 1NZCA 1DLLA 1F31A 1R1A3 1UWWA 1UYPA 1VBE3 4TWTA 3H8RA 4OLLA 2CHHA 5EV7A 3S0MA 2B39A 1M06G 4MGIE 1PVC3 4JGYB 4M3CB 2BW8A 2JDKA 4LBKA 4XFBA 3I3DA 3VKLA 4K6BA 1KRIA 3KT1A 3S7EA 1ZNPA 3IDEA 1OF3A 1IQAA 2XWBB 3MIDA 5FZOA 5JLVA 3ZFGC 3D4KA 1FAYA 5A7QA 1IPJA 2AH2A 1YRZA 3FX3A 4E4HA 2YUEA 4FAHA 1DLCA 1PVC2 5CVRA 4IEYA 1HN0A 2XQRA 2WAOA 3K3NA 3NNFA 4Y1VA 4BIOA 3I54A 2JG8A 4EYUA 3USUB 2WNEA 5K8SA 4QHZA 3AYAA 1PZ9A 3WCRA 3ROUA 3KLSA 2RR12 3S6PA 5IFTA 4MGZE 3GF6A 1MS1A 1Q8VA 3GGLA 4I0WB 1JZ7A 1PMJX 3SXWA 1LU2A 1W0PA 5AFBA 2JE8A 1S0GA 2BNOA 2YHJA 4J6GA 4NN0A 1QU0A 2PQQA 3J26N 3DYMA 2VOVA 3ILFA 1DGRA 2O8QA 3B9IA 3M3OA 4MADA 4XOGA 5E6HA 5ACA3 1J83A 4PHZA 4DINB 1UF2C 1DQ6A 3UKNA 2XR4A 2D40A 4I3GA 5EWSA 5JWPA 5JOWA 4IGOA 1RVF1 5E88A 3LF7A 4PQQA 3DKWA 3N9PA 4BQXA 2VE1A 1R1A2 5C3RA 4F8AA 1F4AA 2LM3A 2E31A 3O1MA 4FTEA 4A7KA 4COVA 1VAMA 2BYVE 3KS7A 4P02B 3U14A 1GZCA 4Z2AA 2HWC1 4XAEA 4DXTA 4NROA 1JHNA 1S0FA 2A6ZA 4XDPA 4JTNA 1LENA 4JC1A 5FJHA 1AF9A 5K0UB 3LSDA 4PDWA 1UY2A 4JQTA 3ABZA 2VBPA 3MICA 3WCSA 4BM8A 2ARCA 4W6WA 5BNOC 3WP5A 5CAZA 2XBO1 2YC4A 1N1TA 1V6NA 3ZYPA 1QH6A 2W91A 2HWD2 3LWCA 1I6XA 1VBA3 3HPNA 4LHSA 1QJY3 3ZSEA 5JPNB 2QQKA 1RUC2 1W8OA 1E5HA 4L97A 1BVP1 2BWAA 4BH9A 3E6BA 1KXGA 3SMHA 3EXUA 2GH2A 2ZX3A 3ZXKA 2W39A 1LHUA 1GICA 3SHRA 1UZYA 5FLHA 1NLRA 1KDKA 1GMMA 4LBQB 4B4QA 3IMNA 2J22A 5BNNB 2WRAA 3APBA 3T3YA 1CESA 5FY7A 2GNDA 2KA3A 3NJYA 4IXLA 3I97A 4N53C 3GDBA 4ZPIA 1OFNA 4AL9A 2R0FA 2H0BA 5EHDA 1H2NA 2BGPA 4RGGA 3VBOA 5FZGA 3ELNA 4M00A 3KM5A 3A0KA 2CV6A 1KFUL 2JJ6A 1AXKA 1W8HA 4CDWA 2G9GA 4PLNA 4HVOA 3PU3A 4YW6A 3TB0A 3MLLA 5DABA 1NAEA 1W6QA 2Q0AA 3CNAA 5EP9A 2WABA 5FREA 1OHFA 2X09A 1HKDA 3ETQA 3PVEA 4XEZA 1G7YA 1U12A 2JG9A 4CDXC 3POBA 3V56A 1SBFA 2PLV2 4LXLA 3HBZA 1UU4A 5F3CA 4FBFA 5F7UA 2YBPA 2DU0A 2QQVA 5IAVA 4K21A 5I91A 4YGCA 5A3NA 4Z07A 2WKKA 1K5JA 3ZFFA 3ECQA 3ZYJB 2MPFA 3HQXA 2R041 4XTMA 1XYPA 5G04L 5AFEA 1D4VB 1SFNA 2QDNA 2Y8KA 2Y34A 2JKBA 2R073 4NIIA 1NQJA 4B1LA 1HXS2 5ACA1 5JXJA 1AHSA 1V9U2 1XJAA 2TUNA 3NW4A 3M1HA 1L7LA 4R4ZA 2QQNA 3LEKA 1YUDA 2ZZJA 3MPBA 4C91A 4PF1A 4DZGA 1S0EA 4IV1B 1YQ6A 1J1LA 4IE4A 3NNLA 3B69A 2ORXA 2YU2A 4IW3A 4LBJA 5ABJA 1F35A 3I2JA 4IV3A 3KF3A 3AYEA 3VZOA 2HWF2 2O0OA 1JZ4A 1H2KA 1O91A 2ZTNA 4IEPA 4AFMA 2VR4A 3D0SA 1UN1A 4A6OA 1EV11 5CFDB 3J4UH 3AP5A 1N1YA 5FY5A 2P37A 4XUQA 3MO4A 4LHKA 1VMHA 2QZ3A 2VGDA 3OF1A 4KU8A 3OY8A 2QQJA 1OQEA 3KV9A 2NP0A 2R0HA 5IK7A 2QDRA 4U2AA 4NIDA 3MLJA 3WLUA 2DFBA 1LOEA 2Y6HA 2I74A 2CYFA 1IOAA 4LOSA 5FBZA 2V5DA 4OZXA 3BVCA 3KT7A 2QQPA 2BU9A 3FHIB 3SLIA 3ZR5A 4YYOA 2X53S 2D97A 3PURA 2VZQA 3VZMA 4AHWA 4E8DA 1RVF3 1ULOA 5BXXA 3VD7A 1RUJ3 4AVBA 5C8CB 1EUTA 1LTEA 5JXIA 3ZXDA 3ILRA 1BLZA 1RITA 2OZJA 1XNKA 1WMFA 3AMMA 2WAAA 3GYDA 4MX3A 4NHXA 5CEHA 4JX0A 1WCQA 5H9PA 4DIQA 1JU4A 1AX0A 2ERFA 4EE2A 2RR13 2R30A 4O65A 1UMZA 5C33A 2ET1A 3IM0A 4ATFA 2DBNA 1CAVA 4Y33A 1QJU3 4SLIA 3WHUA 3FL7A 2W3JA 4MHRA 1IG3A 2VMFA 4LKSA 1AR73 4L8QA 4YGDA 5FYSA 1VAKA 3DN7A 3N7LA 4A6SA 1JOPA 4KI5M 4D94A 4QMAA 2Y6FA 3VV1A 3D0JA 2P34A 1HV1A 5B4NA 4YM0A 1JYXA 3JBG2 4XFHA 2WO2A 1AR63 1G8WA 5FZDA 4EN7B 1J59A 1UZVA 3LA3A 2WNUB 1JTZX 3JD73 2VZRA 4QQOA 1OOPA 4AQTA 5ANQA 4PI2A 1JZ8A 3P3PA 4X6RB 3GBFA 5FZ1A 3MIHA 3MV11 2VW1A 4UXAA 5JMOA 1ASJ1 1NT0A 1HRV3 3LSEA 3PMSA
chains in the Genus database with same CATH topology
4IEXA 4P14A 4M3CE 1PIV1 4AYUA 1XNDA 1WW6A 3LOIA 1QQP3 1SLTA 3SNMA 3IPVA 2P3IA 1C5HA 2IFWA 1LGBA 1RUJ1 4MV2A 1DZQA 1BMV2 3BODA 4NHLA 1HRV2 4K1YA 4ZU7A 3VN4A 2RM22 1EV13 1SBDA 1YJLA 2ZGLA 1DGWX 1VBD2 4N7IA 5LEKA 2HWB3 5GZGA 4FPKA 3ZFEA 3ZSKA 4WM8B 3S7IA 3CLPA 4WVMA 1ZBE3 2E51A 4P9WA 5K7PA 1AR71 2A5ZA 2FBEA 1SLAA 1EV12 1OPMA 4JGYA 1QWRA 1ENSA 2JE7A 1COV2 3OYWA 2QCSB 2R32A 3RQ0A 4U36A 3CJXA 4XFIA 1IKPA 1PK6A 4OI2A 5E16A 1QOTA 2ZAHA 3CL1A 3ZDSA 1DYKA 4OHWA 4RS5A 3NJZA 4WVZA 3JU9A 1A3KA 5L7OC 4SBVA 2VULA 2WLPA 1RUF1 3ZSJA 5GALA 1DQ0A 1OFSA 2DWRA 2PAEA 1VBB3 1YHFA 3VLBB 2A3YA 2MEV2 4AHYA 4XBLA 1Z0HA 4N90A 4MXVA 4OI1A 4R9CA 1A6CA 4V1PA 4GALA 4E27A 2WZR2 1MR5A 4CDWB 3OGJA 4Q4X2 4XJWA 3TBDA 4KNCA 2CAUA 2E53A 1PO22 3H1WA 1UAIA 5FLJA 4RS5C 5HCFA 2JG8C 4YVWA 5T5PA 4KG0A 4JQRA 5K0UA 3VHOA 3ZXEA 2R1BA 2GDFA 4K7JA 3AJZA 3K51A 4IQPA 1ENRA 1Y3TA 4YVSA 5KHHA 3VZJA 2X5IC 4Q0SA 3KD4A 4S2FA 4GWNA 2SBAA 2PYTA 2A3XA 2ZA9A 1F5JA 1WCDJ 1VBC2 4XPVA 1EP0A 2P3JA 1H8TC 3BOWA 2R061 2GMPA 2QJVA 5JVVA 1DYPA 4FPEA 4CDUA 5C9AB 2C1FA 1CJDA 4AI3A 1FMD1 3S30A 2IXJA 2ET7A 3M3EA 1POV0 1S2BA 4RGAA 2EF6A 2BEOA 5FOBB 3UJOA 2WLQA 1AJKA 5CU1A 4FT8A 5GLZA 1OKQA 1VBA1 1NCRB 1LGNA 2GN3A 1LOFC 4X6QB 3EQEA 2E9QA 5D8AA 4AQ2A 1EPZA 2BFUS 3U0ZA 5GKAC 3O0VA 1OLQA 1PK6B 4RQPB 1MEC3 2GMEA 3AP4A 3VBUB 4AGVA 1NCQC 1CR7A 3PJQA 3C3VA 4OUSA 4QGLA 4QHBA 5DXDA 2A6YA 2GC0A 3O0WA 4GH4C 4TSVA 5CADA 5JOZA 2Z42A 2D6MA 1APNA 2E7TA 2W0XA 3I2DA 4XJ8A 3VBRA 1KFXL 1CQ9A 5I0SA 3M8LA 2ZABA 5FPZA 1NY72 4YZ5A 3MIFA 5AC91 1SLIA 3VZKA 4HN1A 4JRLA 2ZGRA 2E63A 1GZWB 4WVVA 4K8FA 1BEV2 1UX6A 1RUH1 4HL0A 1N47A 2RE9A 3UV9A 4KWLA 4YNIA 2RS53 4RHV3 4NR1A 3FFZA 5ABJB 4Z92B 3D6EA 1QJY2 2ZX2A 3M2MA 4OHZA 5GLWA 3WW2A 1AX1A 1G9BA 2WJSA 4W65A 1UIJA 3ACLA 4Y26A 1ZM1A 4XQ4A 3E6CC 3J8F3 1GV9A 2WNUC 4K3UA 2CGOA 3WDWA 5BY5A 5IK5A 4DPNA 5H9QA 3L2HA 2ZGTA 3MW3A 1C8NA 5KXEA 3AXDA 4X8PA 2FMYA 1LHWA 3NVCA 2XJSA 4AEDB 5FAXA 4AVVA 4IV3B 3TN92 3KSCA 3DPRA 4WZFA 1K5MA 1TQ5A 3JD71 1VRH2 1ZVFA 1HRI1 1OQ1A 3LCPA 3FBYA 5JIAA 1A8DA 1LOGA 2RS32 1OLRA 3Q9OA 4H7MA 3H7YA 2WWSA 1KITA 4FSJA 1AR81 2N7GA 1COV3 2ZBJA 2ZCWA 1RUE3 4HVRA 5CG9A 1UW8A 1POV3 4XJ9A 4JDMA 1SACA 4Q4Y2 3NSTA 1ND3C 3C2UA 3R6SA 5CFCA 4LE4A 4NOTA 2BBVA 1SBEA 2FHRA 2OPKA 2A71A 4PBOA 2ZGSA 4CDXA 2AREA 3AZWA 5DDJ1 5DZFA 1HXS3 3VBFC 4WVWA 4WZCA 5JSOA 4YSFA 1ASJ2 4LUMA 1XXNA 3V64A 5JZGB 4YG0A 1T6GC 4YG3A 1X33A 2NMNA 1ZYBA 4RA0A 3UL2A 1CAUB 4G4FA 4E2SA 1IKQA 1S0CA 4IV1C 3WD5A 4S2GA 5T54A 2DUOA 4UW3A 1LESA 4ZKTB 1HIXA 1GQHA 1Q43A 1VBD1 3KGLA 3ZMOA 4DB5A 2GNMA 1DHKB 1SEFA 1M4WA 1HV0A 5E89A 2WT0A 5JZGC 1Q56A 2PHXA 1ONAA 1WMEA 3MLKA 1PO23 1UKRA 3DPRC 1CN1A 4XILA 2K9ZA 4KGGA 1ZA4A 4HBNA 5CBLA 4JGZA 1RB8G 1MZ6A 1H2MA 3WT3A 1Q8QA 4XQWA 1C57A 2XBO3 4BZ4A 2DURA 2JXAA 2D93A 4FQZA 4UW6A 5FO7B 1F9KA 3JQXA 2A70A 2ZAAA 1R083 3JD72 5CA6A 3AZVA 1F2NA 2XJRA 4RQPC 2D44A 3VBHA 3WDVA 4EN9B 2ZX0A 3WOGA 2MEV1 4EROA 1V70A 3FC0A 2E6VA 1TMF2 1LEMA 2VH9A 5FLIA 2AZ5A 1B35A 4N53B 1RUG3 2D43A 5KXCA 3I4IA 1IS5A 1RMU3 1POV1 5GLTA 5C9AC 3FWEA 1J3PA 4Y1UA 1MZEA 4YFWA 2JG9B 1I5ZA 1OMIA 3T1MA 1H8TB 2CWSA 2JDZA 1YYNA 1A8MA 4XJZA 4LT5A 4MGKE 3VL8A 1RUF3 3B5LB 1MS8A 2ATFA 3RWNA 1DZTA 2VMIA 1EAH1 3RYRA 3INAA 4Q1PA 2QVSB 4LA3A 1XU2A 5EYYA 2RS11 2NYYA 3RS6A 1NA1A 2HJIA 1W6MA 1RUC1 4N43B 3VKFC 1O5UA 2E7AA 2ZGPA 2D3SA 4MYEA 1C8M2 2WT2A 5EZWA 5ABJC 3FLPA 4M0HA 5JIUA 2WZR1 1ZZ7A 2DCTA 1PO11 4LNVA 5I93A 1IHMA 1G86A 4ZU5A 4FP2A 4CEYA 4E2QA 1MQTC 3BU7A 1PGL1 4HSJA 1K5MC 2XWJB 1AJOA 1JXNA 1QH7A 4XHBA 2EXKA 4UBHA 4I3PA 1H1IA 5GZDA 2IFRA 3OBRA 1D4M2 1ZBA1 2VUAA 3WG4A 4AI0A 5KXBA 2QKDA 4F83A 4DY3A 1QJU2 2LTNA 4DNYA 3J8F2 2QFEA 4R52A 2WFF1 3VBUC 1WGPA 2Z5WA 2VOWA 1BCXA 1PK6C 1SDWA 3AB0A 1DBNA 4Y1ZA 2KM2A 4W6XA 2RMU3 3NKGA 3MW2A 4XF4A 3FE5A 2XKOA 3AYCA 2HWF1 2WS93 4IEQA 2KXLA 3WQ0A 3N36A 3J8F1 4COWA 1AL21 1W6PB 3AMQA 1LEDA 4IESA 4AXOA 4AF9A 2GALA 5LK7B 4EN0A 1ZBA2 3BB6A 3QACA 1C5IA 2WFPA 2D6PA 3ASIA 1ZZ9A 4D69A 2ZHMA 5FMOS 4YARA 1G6NA 4OHVA 2X5IB 3LA2A 4AW7A 5T55A 2RS31 3FBMA 1O4ZA 4FAGA 2DVFA 3I59B 4EJRA 3O14A 4AGRA 2ZPXA 3M3QA 1RJ7A 2Z69A 4GWMA 3EBRA 4YM3A 2Y38A 3KMHA 2R6QA 1H9WA 1PO13 4DS0A 2R072 3ST7A 2LALA 2OVUA 4Y24A 3RMYA 3V0BA 4PBPA 4FPGA 1XRUA 2D6NA 3U07A 3IKWA 4CP2A 2SLIA 4CEWA 3ZSLA 4WM8A 3RPQA 5GZFA 1Z78A 2Z79A 5JOYA 4CDUC 4XFAA 2TBVA 1ASJ3 1X50A 4HANA 4ZU4A 3BTAA 3M7AA 2VG9A 5DUXA 3O12A 3G6JB 4Q4Y1 5GZCA 1RHI3 1U5ZA 1VB4A 4KL1A 1LGCA 2IXIA 3KCXA 3ZXFA 1H4HA 1WLCA 5D1IA 1LOBA 5C6CA 1FOD2 5IUQA 2PHWA 1YFWA 2WIIB 1MZ5A 3UK9A 4Q29A 5B2GB 3VBFA 4XZPA 1N3PA 3FUQA 2F6BA 3CO2A 5EFUA 5H9RA 4BMEA 1ZZCA 4WM7C 5TSWA 2IXCA 1RUJ2 1SCSA 3WDYA 3WG1A 2O8OA 3GBGA 4R9AA 4NVPA 1CVNA 3BALA 4MZUA 1QGLA 1AXZA 1X36A 1ALYA 3AFKA 2R16A 4KWKA 1LHVA 1S0BA 5GLVA 4CDWA 1FYUA 1W6NB 3AP6A 4AFDA 1N1SA 5DUUA 4XETA 5DUVA 1XU1A 1PVXA 1QOSA 2DCYA 1FX5A 1HRI3 2R071 4Q4W3 4XJAA 1Q8SA 2WA3A 1VRH3 2OYZA 5I0TA 1WLTA 3ZYGA 2WFF3 3AKSA 5A33A 3RYPA 1DIWA 3TOJA 2RS33 1ZRRA 4ONUA 4P9GA 4NHKA 2HWC3 1ULDA 3H1MA 4HKWA 4JGZC 1QXPA 2V09A 5HXVA 1FMD2 2HWF3 2CAVA 2X29A 3M3IA 4KU7A 4LULA 1PGW2 1JH5A 4QPYA 3TN93 5I8SA 3TNQA 4BYYA 4OI0A 1Y7BA 1FI2A 1VBC1 2GSYA 2PTMA 4COYA 4D3WA 2NN8A 4IL7A 4LHLA 1QDCA 1BZWA 1W0OA 2X8KA 4RD7A 4JDOA 4AHZA 2ZZQA 5JOXA 4Q4V3 4I01A 1Q3EA 4QPGA 2RS13 1FT9A 4BOWA 1FNYA 1V6JA 3H8UA 3OBTA 5C8CC 1TEIA 3AM2A 3WZ1A 5BNPC 4N53A 3U4XA 4QPIA 4AFAA 1WBFA 2YGLA 4LLOA 1C28A 4Q4V2 1BXHA 1AYN3 4AVCA 1WMDA 1LHOA 2XJTA 4FQ4A 4HPKA 2JEMA 1AR62 3VBUA 1X82A 2ZJCA 4FOWA 5SV8A 1ZZBA 1HQLA 5BNNC 1N1VA 2HWD1 2PELA 4OUMA 4AGGA 4Z82A 4TZDA 5A32B 4MH0E 1Z7S1 3N4MA 1H1MA 1UL9A 2FZ1A 1AYN2 1D0GA 2A75A 1UPSA 1IGOA 3POYA 1B35B 1B09A 1W6MB 5DUWA 2R062 1UIKA 1AYM2 3UKTA 1U5IA 2O1QA 4YW1A 2AYHA 1MQTA 3WW4A 5AC93 4HSLA 3SH3A 2B8MA 4AE2A 5LEJA 2IXKA 3D8CA 3LAGA 4Q4Y3 1WD4A 2WQZC 3N7MA 4QT6A 1DGRN 1OOPB 2OA2A 3O5SA 1NA1B 2BUKA 1X8MA 3VBSA 2W52A 4LBQD 1U5XA 3MF6A 3WXPA 1NOVA 2DUPA 2JE9A 4LO7A 4B4PA 3GALA 1RUNA 1AR61 2YYOA 3WP6A 4Y5Z0 4TLFA 4URTA 2ETEA 3QH6A 2DTWA 1EAH2 1REDA 4E2GA 3SISA 2GN7A 1SLBA 2OZ6A 3IN9A 4A3XA 4RSUA 5C9AA 1VIWB 3D5OA 1YFUA 1Q5OA 4LBNA 1CAWA 1MACA 2WC2A 3VDDA 1AZDA 3E97A 2GU9A 1AL0G 1BBT3 5FMOL 1LODA 2DF7A 3WQ1A 2GH8A 1H1AA 4LO4B 4HZFA 4HETA 3WUCA 4CP0A 4HLTA 4RQPA 3KZ4C 1OPOA 4Q8KA 3B3QE 1XE7A 4IEOA 1W6PA 1AYN1 4HPKB 5JAXA 1SLCA 2Y0OA 3B7MA 2C5DA 5J3UA 4I02A 1VBB1 3USSA 1HRI2 1SCRA 2WL1A 3H0OA 3KCYA 1COV1 1FPN3 1IS6A 2XVGA 4PIXA 5HI0A 5HBAA 4M3CF 1V6IA 2LUWA 1N3OA 4FO9A 2EA7A 3ZFFB 3LA7A 4C90A 4CZSA 4D7TA 3SH4A 4Z1VA 4H55A 3J9SA 4NWVA 1GZWA 3I59A 5GJ6A 1LHNA 4QX5A 1AYM1 4P9YA 1V6LA 2RM21 2ZMKA 4XFGA 1D2QA 1GANA 3RSJA 4UBGA 1BMV1 2D3PA 1TME3 4IEUA 1GFF2 3MPPG 1FNZA 1GYKA 3AP9A 2Y0IA 2X5IA 1Z7S2 3E5XA 3HD8B 3THTA 4B29A 4YVWB 1V6KA 2B9UA 4CYDA 1TMF3 2XLFA 3VBSB 3ZXGA 4FPFA 4QQPA 1O3QA 1VBD3 4D7YA 3NWKA 1GBGA 4JRAA 3TYJA 2OUHA 4COZA 1QF3A 1XNCA 3OY8B 4MGYE 2VY0A 4ES9A 2YZ4A 4AQSA 2BPA2 2B45X 1QQP2 3MGUA 3I8TA 4BMBA 1FPN2 4Y4YA 1J1TA 4P9JA 3JCIA 2ZHKA 1K5MB 1D2SA 1RC6A 1WA4A 2DVAA 3NAPA 2AUYA 1RGSA 2A3WA 4N9IA 2D3RA 3QH7A 3WR0A 4BLIA 1TME1 2PHLA 1NCRA 2D6OX 3MFCA 2XB6C 1PO21 4AEMA 4FPHA 2ZGOA 2ARXA 5SV5A 1MVQA 1FPN1 1QJX3 3ZPYA 4X8NA 4QM9A 2RMU2 4I30A 5EYXA 4JVAA 2WSVA 4AFBA 1VBC3 3AKQA 5DG1A 3ZSMA 2ZMLA 1J3QA 4OHXA 2BTVC 2VQ0A 3LZZA 3VBFB 3A0NA 2JG9C 2HEYF 4Q0UA 4YM2A 5AVPA 1CX4A 4Q4V1 4XIOA 5FRAA 1PVC1 1W39A 4Y20B 5FPXA 2VMGA 1FV3A 1H2LA 1QXJA 4GULA 4B7KA 2EIGA 3MIGA 5F5QA 3VL9A 1BKZA 3MF9A 4YZ2A 2I07B 2UURA 2Q8OA 1ND2B 5BNPB 3RI8A 2EXHA 3AZXA 2Q4SA 4K9SA 3E5UA 2C0ZA 2H6BA 3JZVA 5T52A 2ILMA 1QOOA 5BV6A 1MS4A 5CNAA 4JV4A 1RJ8A 1LOCA 1QHDA 1S1AA 3HMYA 1PGW1 3R4UA 3B02A 3AMNA 1EAH3 1BEV1 4IV3C 2ZMNA 1YI9A 5IT6A 1MS9A 1ZX5A 1E57A 1GKBA 1OA3A 1AUYA 1ZRFA 4BWOA 3V0AB 1PM7A 4K20A 4CDQC 1C8M1 5LRRA 5BNQA 4OULA 4N7UA 4Q2FA 3T2TA 4E4DX 4DQAA 3VZNA 1RUD3 1OA4A 5I8TA 1GZ9A 3WNXA 2BQPA 2UYAA 4QQ2A 1PIV2 2PHUA 1HX6A 1OOPC 3EJKA 4O9EA 4A2UA 3ZN6B 2UY9A 2ZHLA 3NV2A 3WX5A 4XBQA 4LO5B 5A32A 5J09A 1MEC1 4DOUA 5JI9A 4NPRA 5H9SA 1HDKA 4PF5A 3POWA 4UW5A 1AR92 4O9GA 2ENRA 2VNRA 4AWDA 2NPIA 1LU1A 3FZ3A 3MDPA 4AVSA 1I9RA 4AI8A 1PO12 4PJYA 2QNKA 3VDDC 5J96B 3CU7A 5L19A 1NYWA 4HKOA 1V00A 4CRQA 1H8TA 1RHI2 3IDCB 3VZLA 1F8VA 2I2SA 1Z7S3 2Q30A 5CFCB 3IWZA 4L2NA 2WNUA 4XF0A 1ULEA 2RJLA 1AR83 1KS4A 1CIWA 3CJIC 4KGQA 4GH4B 5J7MA 2GNBA 4YVSC 5AC92 3BIWE 1RL3A 3ALQA 4RHV2 2WNVB 3ZFGA 1SQ4A 4C0BA 3ZX7A 1CAUA 4CP1A 1D4M1 1S2KA 4EN6B 1BK1A 3AP7A 3RJRA 2XJQA 5KHJA 5J98B 1YI7A 3BOPA 5DZEA 4CEYB 4COUA 2ZGUA 2UY8A 4B8EA 1NCRC 2YV8A 3PJYA 3V0BB 1O3TA 3ZXLA 1DFQA 4HK8A 4MVTA 5BNOA 4CDUB 4XW3A 1TE1B 3TAYA 1F5FA 2VOXA 3RI9A 1FMD3 4AEDC 4L92A 5T5LA 2UWBA 2XBO2 2WSUA 4GB31 4Y22B 4MUVA 4FPYA 4AHXA 2VECA 3E5QA 4P9XA 1C1FA 3U11A 5FFOC 1NLSA 3AX4A 5GM0A 4XXPA 4JGZB 1AR91 2OIIA 4B4RA 5JSPA 4AI2A 1S0DA 4LBQA 1GNHA 3MW4A 2H0VA 3MYXA 4NHMA 2YROA 3GZAA 3L9JT 4I0AA 4CDQA 2RHPA 3W58A 1RTVA 3H3UA 3E6DA 1WCSA 4QPIC 4PIYA 3VBHB 1MS5A 2CWMA 2E7QA 3OCPA 4LLFA 2DVBA 2ZACA 2P2KA 2EAAA 3W9AA 1G9AA 1WUVA 1HQWA 2H6CA 3WQ7A 1KDMA 3AFGA 2TEPA 3MEPA 4R4XA 2Q1ZB 4HT1T 2K2SA 4KBBA 1UKGA 1QY4A 3ZFEC 1XYNA 1CD3G 4FOVA 3WV6A 4CEWC 2BFUL 2DU1A 1BYHA 4GIQA 4IEZA 1YCIA 1LECA 1FATA 3AZZA 4IETA 1LJ7A 1TNFA 2MNGA 3B01A 1VALA 4Z2WA 2YGMA 1S0JA 4LO8A 1C8M3 1REEA 1ZBE2 5C4WB 4PLOA 5FCCA 1D4M3 3LOBA 4FCAA 2D6LX 4KH9A 4C0HA 4DFSA 1NCQB 5BPXA 3CEWA 3RJ2X 1GQGA 4I0BA 4GA9A 1DGWA 3R0RA 4HK9A 2HWE1 4YZ3A 4D7SA 5T3NA 2UWCA 3NV1A 1RUE2 5F9TA 1RMU2 3TRSB 1O3RA 1QNWA 1DQ1A 3UJQA 4F7ZA 2ZKNA 3LB9A 1QJY1 3KGZA 3AK0A 3ILNA 3ZFEB 3NAPB 5F6LB 1VRH1 4WVMB 5CG8A 5J36A 4RR3B 5IK8A 2HWB2 4Q26A 3SCHA 3B00A 2XVKA 4WM7A 1RUH2 4OFGA 5D8AB 1S0IA 3OD0A 1ENQA 1R1A1 2XLAA 3BPZA 4QPIB 2YXSA 2CGNA 2XL9A 2VMHA 5KWRA 4Q1RA 2W08A 3ZN4A 4AQ6A 1C1LA 2HEWF 4FTBA 2JG8B 4XYXA 1NY71 1QKQA 3B93A 4GQ7A 1PZ7A 4RS5B 1EPWA 2GZWA 2YY1A 4RHV1 4FXGB 3JUUA 2CL2A 1UD1A 2FQPA 1O5LA 1AL22 4EWEA 1V6MA 1RUD2 4LUKA 4M01A 4DRVA 3PNAA 2NM1A 2PAKA 4FPLA 4E4SA 3WG2A 4PCRA 2V73A 3NKTA 4XFCA 3QD6A 5T50A 4YG6A 4H3WA 2IZWA 3BCWA 1KS5A 3ZN5A 4N9HA 1ND2A 2WFF2 3OTFA 2BNNA 1CPMA 3VHRA 1PZ8A 2WZR3 4BLJA 2HWC2 5L7OA 1GR3A 3H3ZA 1NCQA 2XJUA 1YIPA 3PMEA 1DZRA 1TME2 4HFSA 3WDXA 1C3HA 1Y9QA 4AK3A 3VKNA 3KT4A 4YVSB 1XNBA 4RFT0 5F1RA 3W59A 3ES4A 4LO6B 1JN2P 3WW3A 1LOFA 4GMP1 1URXA 5CB7A 2XLGA 3IIAA 2XG3A 3OD4A 4MLOA 3ME2A 3NO8A 4QXKA 3DGTA 4XTPA 2DCZA 1YXWA 4XDQA 2A7AA 4JDNA 3DPRB 1OSGA 1YWKA 5GLUA 1R092 1FOD1 4ATEA 5KXDA 1YIFA 1IPKA 1LRHA 2VNOA 4P9IA 5IK4A 2CY6A 3X29B 5C8WA 4GMP0 4LBOA 1KJLA 5KC6A 3ZIXA 5FDBA 4NWWA 4YLZA 3NV3A 4EN8B 3A4UA 3VBOC 1BBT1 1VBE2 4N43C 4RL7A 3R4SA 4F3JA 1AX2A 4EWDA 2WA4A 1RMU1 1G9CA 3HT2A 1VLNA 1V9U1 2BVBA 3VKMA 5KHIA 1PNFA 4INDA 3ZVXA 1ND3A 1OI6A 3DV8A 1HXS1 2RJKA 4LHNA 4HKLA 4DMIA 4FPOB 3ZYIB 4L9BA 3NL1A 2VVFA 2IWGB 3SITA 4QM8A 1VB2A 2WS92 3SCFA 3DL3A 3PVNA 1V6OA 5LRSA 1VBB2 3I7DA 4ORFA 4CEYC 1PMIA 2WQ4A 1MS0A 4GKXA 3IBMA 4QGMA 5KC5A 3CF6E 3POSA 1SFYA 2A6XA 2JICA 1ULFA 2RS51 1R081 4P5HA 1HLCA 3AYDA 2RS12 2ZX1A 5T5JA 4ZXKA 4AFCA 4B3NA 2PHFA 3GZTB 3SCGA 2Y26A 3WP4A 1ZZ8A 2WNVA 5CFDA 4XE9A 4AEKA 1H30A 2DCJA 3RNSA 3CJIA 4LEJA 1PNGA 3FLTA 1NQDA 3HAGA 1VAVA 2ZOEB 1JUIA 1BBT2 2RR11 1FXZA 4M0NA 5BNOB 1XE8A 3ZO0B 4HN0A 2CNAA 1RHI1 5C8CA 3H50A 4FPCA 4ISQA 3VBOB 2EXIA 2V5YA 4GKYA 1WLDA 2DYCA 4PQ9A 1UPIA 2DFCA 2YDEA 3PHMA 4Q0VA 3FJSA 4Q0PA 5JR7B 1NE6A 5L73A 3KB5A 1CAVB 3N35A 3L2YA 3JB8A 1RUE1 2AR6A 4CDQB 4XQDA 4FPJA 4GXLA 1SMVA 5K9YA 1X8EA 1ULGA 2EXJA 4GMP3 4LBMA 4C1WA 2VQAA 2BNMA 3P3NA 1MZFA 1ND3B 5FTTC 4IEWA 1DF0A 4L99A 4CDXB 4GB33 5L36A 2D98A 1ULCA 4FVVA 3JB4C 1AXYA 3JBG1 1REFA 4YW5A 1LOAA 2PHRA 3SH5A 3URFA 4EWAA 2IXLA 1O3SA 4FOYA 4H7LA 3WDUA 3VHPA 2XVLA 4L11A 1KD7A 3O0XA 2CGPA 1I3HA 2Q1MA 4YFZA 1ND2C 4DY5A 1RUI1 3IDBB 3T1LA 5T5OA 1NXD1 1CAXB 4JGYC 4YW2A 1RUF2 1VJ2A 3H1YA 2BVVA 1KJRA 1UU5A 1VR3A 5DDJ2 3RZZA 4IERA 2JECA 2HWE3 3FFQA 1U0AA 3R05A 3THPA 2MHFA 1QDOA 1ZRDA 2DCKA 1WCKA 3AKTA 4MXWA 1ZBE1 5FO9B 1DU3D 3PTYA 4G9SB 4PIZA 2JD4A 1IS3A 4K40A 4I2OA 5JZGA 1WLWA 2UWAA 2A73B 2Z2SB 5KBFA 2YMZA 5K0UC 3KCCA 1MVEA 1G9DA 5EJ3A 3M70A 4AG4A 2QUOA 2ZX4A 1JBCA 2D6KA 2IXHA 4R9BA 4BCUA 4XMIA 4R9DA 3B9CA 3WUDA 4RR3A 2XPJA 5J37A 3MIBA 1L3JA 3AXEA 1BEV3 3N7KA 2WS91 3RRDA 2AGSA 2HWD3 3GHMA 3ZXJA 5FQ0A 2FMDA 5AVAA 4CDWC 1AL23 1N3QA 4R8HA 3GNEA 1JW6A 2P3KA 4XFFA 4FP3A 4YW3A 4BHPA 2PA7A 4YGEA 4E4ZA 2ZGMA 3U10A 2P17A 2B46X 3FLRA 3VGIA 4S2HA 3WG3A 3WHTA 1AVBA 2FZ2A 1IS4A 1YFYA 2D5HA 4XMAA 2YC0A 5L7OB 3ENRA 1S55A 1VBA2 2ZGNA 5A33B 2NZ9A 5J48A 1RUC3 3JBG3 4N43A 3UKVA 4ES8A 2GC2A 3ZFGB 4QQLA 1BQPA 1HQNA 5BNPA 1JYIA 4XF3A 1YFXA 4Y1YA 2OUJA 3RMXA 2PN5A 3WDTA 5JDBA 2ZS6B 4IV1A 4KQ7A 1R091 3JQWA 5F6KA 4AVTA 3PVBB 1CAXA 4LE3A 3VKOA 1RINA 4Q4X3 4CEWB 2DUQA 3H7JA 4FOQA 4YRDA 1ZZ6A 4XBNA 1CGPA 4Y22A 1B35C 3V0AA 1LB2A 2F4PA 4BA6A 4QD2A 4ISRA 3OYWB 2R1DA 2CTVA 1YJKA 2R042 4AEJA 1RUI2 2W68A 1CONA 4LA2A 4XIKA 3ZN6A 4TYSA 4HMZA 1I1EA 1AR93