3WXPA

Structure of hyperthermophilic family 12 endocellulase (e197a) from pyrococcus furiosus in complex with cellobiose
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQAVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of hyperthermophilic family 12 endocellulase mutant (E197A) from Pyrococcus furiosus in complex with cellobiose
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Endoglucanase A
total genus 72
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wxpA00
3MFAA 1NLRA 2BW8A 2DCJA 1ENXA 3B7MA 4HKLA 1UU6A 2B45X 1HV0A 3AKSA 1C5HA 4XQWA 2B42B 5K7PA 3VZJA 3WP3A 1XNDA 2B46X 2BWCA 3WQ1A 2VG9A 2DCYA 1H1AA 3WP4A 1AXKA 3VZKA 3AMNA 2VGDA 1TE1B 3M4FA 3VGIA 1BK1A 3AKRA 1HIXA 1PVXA 3O7OA 2C1FA 4S2HA 3VHNA 3RI8A 4H7MA 3MF6A 2VULA 3VL8A 4XPVA 4XQ4A 3VHPA 1XYPA 1UU5A 3AKPA 2VUJA 1HV1A 3MFCA 1REFA 4HK8A 3VZOA 3VZNA 3WX5A 3WR0A 1REEA 1W2UA 3RI9A 3AMMA 3VZLA 1T6GC 3AKTA 1C5IA 1XNKA 2JENA 1M4WA 1H4HA 1QH7A 2D97A 3WQ7A 3WY6A 2DFBA 2JEMA 3B5LB 1H8VA 4S2DA 1OA2A 1XNCA 1H0BA 3EXUA 3VHOA 3AMQA 4NPRA 4HK9A 4HKOA 3LB9A 4IXLA 2D98A 2NQYA 1XXNA 2BWAA 3ZSEA 1BVVA 3VL9A 1F5JA 3VZMA 2Z79A 1YNAA 3AMPA 3MF9A 5HXVA 1OA3A 3WT3A 2DCKA 3HD8B 3WXPA 1UU4A 1QH6A 1UKRA 1IGOA 3LGRA 2DFCA 1OLRA 4HKWA 2JICA 5K9YA 5EJ3A 1OA4A 3WQ0A 1KS4A 1BCXA 1REDA 1OLQA 2DCZA 3WP5A 1XYOA 2QZ3A 3AKQA 4S2FA 2NLRA 4S2GA 3VLBB 2F6BA 3WP6A 1XYNA 1XNBA 2QZ2A 4XQDA 3AMHA 1H4GA 2BVVA 1KS5A
chains in the Genus database with same CATH superfamily
1LHVA 2VECA 2VVFA 4QQLA 1K5MA 3IDEA 2BJSA 1SPPA 3L9JT 5FY7A 1VBA1 1GFF2 1H1MA 1GNZA 1OQEA 2KA3A 4ASKA 4EQVA 5J96B 3RSJA 1RMU2 2PLV2 3H1YA 3K77A 3V65A 2FMDA 2LALA 1W9WA 3OSDA 4OMDA 1LOEA 2WS93 1NA1B 4WV8A 5F32A 1ND3A 5IATA 3ZYPA 2VOKA 1LOCA 5T3NA 2FMYA 3BODA 1W8WA 4CDUC 4KWKA 4UXAA 4Z92B 2RR13 2HEYF 1AHSA 5CFDC 4LNVA 1YFWA 1BK1A 4KG8A 1CAUB 1MR5A 1W6MA 4MXWB 1LECA 1PGSA 3FLRA 4AQTA 1YWKA 4N43C 5FZ4A 1N1TA 3KM5A 3LIHA 1EAH1 2GP5A 1MZFA 4CXYA 1R1A3 1B35C 1J3RA 1JYCA 3WG3A 1FI2A 2ES3A 4GWJA 4AI0A 3ZSLA 2E53A 1JN2P 3ZYBA 3M3QA 4QD2A 4L99A 2ZHLA 4DY5A 2BUKA 3B93A 4XFGA 2OZJA 3GF6A 3GDBA 4X8NA 2R32A 2HWE1 2ARAA 1VBC2 4KQ7A 1O4TA 1F5FA 3H9AA 4Q1RA 5AC92 4XC9A 4FPEA 4QHBA 4AQ2A 1LGNA 2Y0IA 2XWBB 3I7DA 4R52A 5LA2A 4QKDA 3VN4A 2J42A 3I3QA 4MADA 5IK7A 2D97A 3CIHA 4ISRA 2VMEA 1GQHA 2ADDA 3WY6A 3ETQA 2XJSA 1FATA 1LU1A 1TME3 5CAZA 3JBG3 4DIQA 4NIHA 3POWA 4AVAA 2X10A 4HN0A 2RG4A 2D5HA 4HSLA 4XFCA 4CDWB 1C3HA 2JG8C 2ZGLA 3BIWE 4JTOA 4YVWA 3THPA 2RR11 2VQTA 4LEJA 3ZIXA 3AZZA 3MLKA 4HBNA 1F5JA 1CAUA 4A44A 1CZTA 4X8PA 3TEZA 4WM7A 1X36A 3BPSA 3N9OA 5F9TA 3EQEA 4GH4B 1LHUA 5JI7A 5F6LB 3LCPA 2YG0A 3OY8B 2G19A 4UYBA 5C8CC 4HSJA 4HONA 3LGRA 4DFSA 2SBAA 4ITCA 1OLRA 3CJIA 4EROA 4IE4A 4Y24A 2Z69A 5GALA 4BIFA 1DCSA 1W2NA 4XCAA 5I0UA 4YVWB 1LENA 2ZGKA 4XF0A 2YHJA 3OUHA 1RYYA 2EXHA 4QXBA 1WMXA 4JDNA 4OHVA 4YW3A 4K8FA 5DQ0A 3UGGA 2GNMA 1PNFA 4BQ2A 3GBWA 4XUPA 1ZBE1 3CNAA 4ZXKA 1UMHA 4DS0A 4LO6B 2WFF2 4O7XA 3WP6A 1RUH2 5A32A 1V9U2 2XPJA 2W9XA 4JQRA 3S7IA 4F7ZA 1FAYA 1ZVFA 4EN0A 3I2HA 1EV11 1PO12 3Q8CA 4YFZA 4TWTA 1UQXA 1GZWA 4BLIA 3WF0A 5IAXA 3WNPA 1L3JA 1SEFA 5IK8A 1BK0A 1OD5A 4CCJA 2OUHA 2Q0AA 2WQ4A 5IVVA 3DN7A 3GBGA 1IQAA 4H3WA 2ZX2A 1W8HA 3POGA 4LBQA 3SQOA 1WLCA 3ZSMA 4AHWA 4BQXA 4IETA 3WCRA 1VAKA 3MUZ1 1W6NA 1FX5A 3OBTA 1IHMA 2RS53 4FXGB 4R9BA 4OI1A 1JH5A 2J22A 1WCQA 5GZCA 2ZGTA 3OBAA 1ASJ3 3NNLA 4OI0A 1W8TA 3A7QA 3HVDA 4E9KA 3VB9A 3O7OA 5J7MA 4MSVA 3P5BA 3ZN6A 2ZZQA 1ZRDA 1WGPA 1RITA 5FREA 2VULA 2WA3A 2EIDA 3KS7A 4QHOA 2CNAA 4K1ZA 5FUNA 2WWUA 1YIFA 2JG9B 4Q0VA 3HPNA 1XE8A 5FMDA 1FPN1 2IFRA 3WG2A 4AFBA 3BUCA 4KWUA 4QX0A 3X29B 1IPKA 5FZIA 2CDOA 1BVP1 3KV5A 1CAWB 4GB32 5A7WB 3ZSKA 1EV13 5FMOL 1WCSA 2Q8DA 5EZWA 3T4VA 4TXWA 2RDQA 1IQDC 2NMNA 4R8HA 4M00A 4N53A 4OCTA 4UFHA 3RZKA 1L7LA 4D69A 2FDHA 5FQ0A 4HANA 1H8VA 1SDWA 3WNXA 1CN1A 2Y8KA 4BIOA 1X8EA 3EXUA 3VHOA 5BNOB 4Y26A 1BMV2 1PGL1 5BNNC 1JI6A 3HJRA 3W21A 1BQPA 4UI9L 3OPTA 1ODNA 2X5IC 2KM2A 2V73A 1KJRA 4Q0UA 5HPOA 4IEZA 1HB2A 3MV11 3AMPA 1HQNA 5SV8A 1MS8A 5IVYA 5A1FA 1G9CA 2JB8A 1RC6A 4CU6A 4CDQB 4BJ0A 4QDQA 4A41A 1DGRA 1UD1A 2YXSA 1O59A 2GH8A 3CKHA 3LOIA 1H30A 2G4IA 2YC0A 5FYZA 4UW3A 3SCGA 5A3WA 2VL4A 1NLQA 1TEIA 2HEVF 4X6RB 5J48A 1MS5A 4IEUA 5FCCA 3VKLA 5FO9B 2NZ9A 1RUG3 1Y3TA 4EYUA 4IE7A 3SEPA 2QDNA 1AR73 2DF7A 1UY0A 5FYIA 2BFUS 3I2KA 4NVPA 2OQ7A 4Q4V3 1RL3A 5JIAA 4YG0A 4BYYA 4UW6A 4EZHA 2O1QA 3HQUA 4DUVA 4IV3A 4WVVA 3RFRA 1OVPA 4NHYA 1COV1 5K4LA 4UFMA 4BM8A 1UZYA 3P6BA 4UF0A 4OVEA 1ACCA 2DCJA 2HEWF 3A22A 1U5XA 1UOJA 2UYAA 4KL1A 4XQWA 1HJGA 1NCRC 4YGDA 1J3PA 1X33A 3FFQA 5DPNA 2TNFA 1DQ6A 1R64A 1XBFA 4K7JA 3VZJA 2FBEA 2B46X 2HLEA 4P9GA 1D4M2 1K5MC 5GZEA 1WW6A 2WJSA 2PQSA 2Z4FA 5L7OA 1UX7A 3WUDA 3U07A 5A3TA 1W2OA 4RR3C 1E5SA 4IQPA 4FTSA 2JD9A 4QXCA 4YGCA 4QX1A 4IESA 3QOPA 4A7YA 2OA2A 2G1MA 2VM9A 1OLME 3J9SA 4RGGA 5A3LA 5H9RA 5JR2A 2OVUA 3CU7A 3C3VA 2ZHMA 5EWSA 1HRV2 3VBOB 1VBB2 2D6KA 1XQNA 5FZ8A 5FBZA 1NOVA 2R042 1R1A2 5HCAA 4Q4V1 5JPMB 5IHRA 2JE9A 3AXDA 4GMP0 3IAPA 5GJ6A 1AXZA 3MGUA 2QQIA 1MPXA 5JSRA 2R1DA 3MFCA 3TYJA 3VZOA 3ZXJA 4WM8C 1FNYA 3UL2A 2WQ8A 3K4AA 5JMOA 2V5YA 1UY4A 5KC6A 3BCWA 1VBC1 3GHMA 1FYUA 1JHNA 5FZ1A 3AVSA 2VU9A 5SV5A 5IVFA 2TUNA 5FK7A 2VPVA 3T4HB 1V00A 2FCVA 3DL3A 3NSTA 5F8PA 4NUBA 1A78A 3GYDA 3LFMA 5T55A 2ZKNA 3PUAA 3CHXA 5FP8A 5CB7A 4BB3A 5KWRA 4OULA 1F8VA 1C8M2 3AK0A 2C4XA 5FYCA 1LOFC 1W6QA 4AI3A 4UFIA 2A1XA 1VBB1 2ZAAA 2FHRA 5EFUA 5FXVA 1ASJ2 1JOBA 4EN7B 5HCFA 1BVVA 4JVAA 2CAVA 1MS1A 3VL9A 5FOJB 2QQMA 2Z79A 3UGHA 5A1LA 3WHUA 5JDBA 2YC4A 4AFCA 2VZSA 4CCMA 3D0JA 3OGSA 4EZ4A 2IXLA 1ZX5A 2YFZA 3EJKA 2QQUA 3UNPA 2EF6A 3O1PA 3KSCA 4OYUA 2VOTA 1CQ9A 5T54A 4CEYB 1XU2A 2RS32 3VKMA 2PLV1 4QPGB 5BNPC 3NW4A 2WT0A 1HRV3 3MW3A 1CVNA 3AYCA 3LE0A 4KBBA 1VBA2 3UYJA 4BH9A 4M3CA 4GMP3 1GQGA 5CZKA 4QU1A 5FLJA 3ILNA 3O14A 4A3ZA 1D4M1 3T2OA 2FZ1A 3FJSA 4LBJA 2WL1A 3P1IA 1BCXA 1DQ2A 2DUPA 3TN93 5A3PA 4WVMA 3NAPC 4QQHA 5FZ7A 3RZJA 4QKNA 4XJAA 1YFXA 4IEPA 5FZAA 2C24A 3SKJE 3WINE 3ZYGA 1VBE3 1BJQA 3ZMOA 4WZCA 3CQOA 3FHIB 5FYMA 3ZYHA 4LTAA 4CYDA 2E31A 4Y3OA 1ENXA 2A6YA 4LBMA 3ZVXA 2JDNA 3MUY1 3MIGA 4NIGA 3PIGA 4Y20A 1VMFA 3GNEA 2UY9A 3H7YA 4XETA 5FPBA 3SNMA 2J1RA 2Q1MA 1AR92 2WN3A 3WZ1A 2WR9A 4IW3A 1UXXX 5FPLA 4C0BA 1UF2C 5FOBB 3R0RA 5F5CA 4CEYA 3O1RA 4UF0B 4CU8A 1JYWA 4K9SA 1AVBA 2RMU3 4LUMA 2O0OA 2AC1A 3FX3A 3O0WA 3ORJA 4AFAA 4CCCA 4PQ9A 5JXJA 1OMIA 2ID4A 3CZJA 3ZN6B 4D7SA 1LAJA 5A80A 5J37A 2PELA 3B01A 1ENQA 1H2KA 4ZY9A 2QQWA 2G9GA 3KMHA 3NNJA 4ZS3A 5FP7A 1UOBA 3VD5A 1CR7A 3R4SA 2NM1A 5FMCA 5K0UA 4NR1A 2EIGA 1K5JA 4XPVA 4LKEA 4XUTA 3VL8A 3FLTA 1UU5A 2YPJA 3DF0A 4WVWA 2OYZA 2YMZA 2OZ6A 1WA6X 3O1UA 2VUJA 1S2BA 2DV9A 2BVBA 5JOXA 4CCNA 5LWBA 3MW2A 1G9AA 1ZYBA 4QXHA 1QGLA 3S5QA 5FZGA 4QKFA 1W2UA 2WNUC 2OXBA 1WKYA 5D8AA 4I30A 3N35A 4LE3A 1YUDA 3J8F1 3RNSA 5JUVA 1LESA 3RGBA 1RUI1 5FZ9A 3FBMA 1M4WA 3UESA 5APAA 1IS5A 2GNDA 3IMNA 4BQ3A 4JQTA 3DKQA 4IEVA 1JOPA 4Q27A 1Z7S2 5ISLA 1PK6C 3IDBB 3I2IA 2WO3A 2P3KA 3AMQA 4NPRA 3AZVA 2X53S 2WNOA 3FN9A 3IWZA 4HKOA 4CXXA 2AUYA 4RR3A 5M0TA 1ZBA1 5BNOA 1RUC3 4Y4YA 5F1RA 5CFDB 1BEV2 1QJEA 2HWC2 3NV4A 3VD3A 5JSOA 2Q30A 5LZ6A 3TEWA 2WNUA 2ZGUA 1LB2A 3WDYA 1YNAA 3MF9A 3N36A 4Q5OA 2CU5A 2J1TA 4NOTA 5I0RA 4PLMA 3ZSJA 5JI9A 1D0GA 4BA6A 1RGSA 2AACA 5JZGB 1VBE2 1A8DA 4FPOB 3AP5A 2JX9A 2W91A 4NWWA 3IDAA 5JXIA 2VD7A 1VBE1 1QJX3 1Z0HA 4YG6A 3WF1A 5K0UC 2D6PA 3HNMA 4RR3B 2MPFA 1V70A 3HT1A 5I0DA 1T2XA 3ABZA 1IOAA 5F6KA 1V6MA 1XRUA 3RZHA 1EAH3 3C7FA 1AUYA 3JUUA 1AX0A 1VALA 4HETA 4M3CE 1OHFA 3PUQA 3AJZA 1PIV3 1XB9A 4QB6A 4HZFA 3LDKA 4MHRA 2IUWA 3SMHA 2V09A 5KR7A 1YQCA 2OPKA 1O8SA 1OOPB 2CAUA 3OJBA 2WFF1 3AMHA 1GP6A 2EXJA 3NKTA 2BVVA 2V72A 3ZM8A 4JHZA 1OI6A 3LSEA 4PF1A 1G6NA 4WM8B 3JXSA 1G9BA 1EPZA 1UWWA 3E6CC 1NT0A 1SACA 1XC6A 3DYPA 2GU9A 1RUC1 1YLLA 4CDWA 1J1TA 1C5HA 4I02A 3GM8A 4NJ4A 3ECQA 4Q4W1 4AWDA 1VAVA 1QMJA 1E57A 2VCBA 2VNGA 3JD72 4K8RB 1SCSA 3EB7A 4ZS2A 5KHGA 4LO4B 4DINB 1ZBE2 2RM23 2WDBA 4R9DA 1WW4A 5B4XA 1ZRIA 2LM3A 2DCYA 1ZZBA 1XJAA 1UZZA 4AHXA 4QGNA 3VZKA 1SFYA 3PDQA 4CE8A 5FY1A 4QM8A 4CDWC 5I8YA 1I1EA 1QXPA 4Y20B 3LFIA 1CJPA 5FJKA 1PVXA 2JB4A 1J58A 1UYPA 2C1FA 4RHV1 3H0OA 2E7QA 3VHNA 1DG6A 5FKBA 3ME2A 5F5IA 2A5ZA 2ZX4A 4R4ZA 2P34A 4XQ4A 1NQJA 1YCIA 4KBZA 3VHPA 2W3JA 2R043 4GQ7A 4U2AA 2VY0A 2Y26A 5I0TA 1IS4A 1ENSA 5FYVA 1RUOA 5C33A 1OC1A 1AR91 4Y1YA 5A7QA 3VBSB 3U10A 3VZNA 5JXGA 2VZRA 4JCKA 4MGSA 2I2SA 3LIGA 3FWEA 1OUSA 2VW0A 1F31A 5I8SA 4RGKA 1W39A 4LT5A 3VBHA 4YZ1A 1JZ8A 3O1OA 3AZXA 3LKJA 2ZA9A 1C5IA 2NPIA 5A7PA 5FBJA 3J26N 1O3QA 4CCOA 5BNNB 4C8DA 1O3RA 4QWNA 4XUNA 3FUOA 1QH7A 1AX1A 3G7DA 3LSDA 5CFCC 1H6XA 5DAWA 4LKFA 4JC1A 5FPZA 5EQUA 4ZHNA 3TBDA 3ETPA 3VKFC 4EJRA 1X82A 2HYKA 1QJX1 1Q56A 5EV7A 2VUCA 5LY2A 1VR3A 1F15A 2VW2A 2VZ1A 1XPWA 4MXVA 4P9LA 1AYN3 3OGGA 5T52A 2BOJA 5DUVA 2MEV2 5FZOA 4LMFA 1S2KA 3J7MA 1EAH2 4YZ4A 1AXYA 3I97A 2DDUA 4NHLA 5D8AB 5C3QA 5C3RA 1FV2A 3TNQA 2XONA 4H55A 1BLZA 1F4HA 5KHIA 2ZCWA 1OA3A 3IPVA 1GUIA 3ZKUA 3R05A 3D8CA 4XVHA 3ACFA 3PVOA 5KXEA 2WZR3 3POSA 2ADEA 4XJ9A 3ZFFB 1AL0G 4RSUA 3I59B 2YBPA 1O5UA 1A3KA 4Q4Y3 2YU2A 2HWE3 3LDRA 4QQPA 4BZ4A 4IGOA 3O1MA 1O4ZA 2VC9A 2HWB2 4I09A 2QUOA 1S1AA 1WCKA 4OZXA 3EO6A 3NV2A 5T5JA 3WLUA 3U14A 1O7FA 2HWD3 3WQ0A 5DZGA 3ZYFA 3RDIA 3T3YA 2VJXA 4P08A 4LPLA 4Q4Y2 2GNTA 4S2GA 4CPBD 1SZBA 1J83A 5FZLA 1QDOA 2F6BA 5FIXA 2IZWA 3VBRA 4DRVA 2B8MA 5A6YA 1N1SA 3WP3A 1UZWA 4CTEA 2OX0A 3GCWA 1HW5A 2MNGA 1GICA 1NCRA 4JZRA 2GC3A 2YUEA 3QACA 4LBQD 1GBGA 1MEC1 4YRDA 5DG1A 3VUOA 1V6IA 3N7KA 3L2HA 5EXOA 1RUH3 3FMGA 5FP4A 4AQSA 3KV6A 3VBHC 5I0SA 1KRIA 3ZDSA 4HG6B 5C5TA 3OBRA 1JMUB 2W87A 3U75A 3HN3A 1RUF2 3TWIA 1CONA 3N9PA 4QDRA 1NA1A 5DZFA 4WVMB 1TME2 3U11A 3AVRA 2P37A 2WZR1 1YQ8A 3AP7A 2OT7A 4GALA 3VDBA 1SBDA 5DXDA 5LBFA 1OT5A 3J7HA 3CBNA 2WUHA 1LODA 1PMHX 3ALQA 4U36A 4CUBA 3LEMA 5A6XA 4XUOA 2CYFA 3BU0A 5GLWA 1UY2A 1YHFA 4GXLA 1EP0A 1WCDJ 5GZGA 3QH7A 4NPMA 5BY5A 4OHXA 2VOVA 1SCRA 4CUAA 1BBT1 4XBQA 1HQLA 4GH4C 1W0NA 1N47A 2BTVC 3WG4A 5CNAA 3EYPA 1OUXA 4Y1UA 1AR81 2FDGA 4FTBA 2ORXA 4W4ZA 3T2PA 1LTEA 1O91A 5ERLA 1W06A 5K0UB 4LO8A 4AGVA 4X6QB 2LRPA 1XE0A 3J7LA 4JGZB 4YM0A 1ZRRA 5IW0A 3OEBA 3A23A 4I01A 4XXAA 2W46A 1QOSA 4HVQA 2K9ZA 3W9AA 5FY4A 4DEQA 2P1BA 2PHRA 3POYA 2LTNA 4XURA 2IVJA 4XE9A 1GNYA 1CIWA 1YQ5A 2K46A 1C1FA 1OH3A 4INDA 3ZFGB 4QPIC 5A3MA 1F35A 1OQDA 4QXKA 4EE2A 2C9AA 1V9U1 5GZDA 1PIV2 4LOSA 3HN1A 3B5LB 1LEDA 1ENRA 2XHNA 1RHI3 1IG3A 1Z7S3 2VR4A 2ZGRA 1YEWA 1PZ8A 2EXIA 1WW7A 3O12A 5FZOB 4JKMA 4RQPC 2OKXA 1QOTA 3AX4A 3V0AB 4I2OA 1PVC2 4FQZA 2MEV1 2DURA 2XKOA 3DXTA 3C7EA 2R062 1VRBA 1VBC3 3O0VA 4XFFA 3MYXA 1H9WA 3POIA 4W6YA 4XFBA 5A6QA 5JIUA 2AENA 1S0IA 4XDQA 4DQAA 4RQPB 1HLCA 4FSJA 3UKNA 4E4ZA 3BALA 1MS0A 3OYWA 2Y6HA 2YBKA 4G4FA 4UFKA 3VBRC 4BPZA 2C9KA 3ZMNA 1NE6A 4HKWA 2XOMA 5FMOS 1ALYA 3RVHA 3PVBB 4B7EA 3AL6A 4RS5C 3QD6A 1NE4A 1OSGA 4YG3A 2Q4SA 4JV4A 3RS6A 2ZGPA 3PTRB 5F2WA 3KCYA 5FYHA 2XKPA 3KT1A 3HBKA 3USUB 3ACLA 1OPOA 4XACA 2AREA 1UZ0A 1DIWA 1TMF1 2B4KA 1W8OA 3QH6A 4MV2A 4AK3A 1DYPA 2JG9C 3J4UH 1GOGA 5BV6A 1QQP1 1YI7A 2K0GA 2RVAA 5EJ1B 1RMU3 5FZFA 1AF9A 3IM0A 1YJKA 2D98A 3OPWA 4DRRA 4LOTA 4TLGA 2JDMA 3LOBA 1JBCA 4Z07A 4GMP1 3N9NA 3WF2A 5JPNB 2XWJB 4N9HA 2YGMA 5L9RA 2ARXA 2J1VA 4TLFA 1DGLA 1N3PA 1XU1A 2XB6C 4XZUG 4OQ9A 3U78A 3WF4A 4CP1A 3TN91 2RV9A 4NPLA 1DYOA 1BBT3 2PAEA 2Q1ZB 2VMCA 3FFZA 3WW1A 3JD71 4BXFA 1VJ2A 2VW1A 3MIDA 4A2UA 2GNBA 1RVF2 2ZGQA 3R6SA 1GU3A 4RA0A 1RTVA 4CZSA 2WWSA 1JYIA 3KCCA 1WMFA 2DU1A 3MI8A 3BKZA 4JGZC 4QPGA 2BFUL 1PO21 4ZONA 2H6CA 2ZHNA 3PU3A 5ACA1 4OZOA 4P00B 4Q4X3 1S0EA 3ZFEA 3DGTA 3A4UA 3LA3A 4JGYB 4PF5A 2ZAHA 3I2OA 4Q4V2 4PT6A 1AR71 4CUGA 1RHI2 3ZIWA 1G8WA 2WNVA 3NMBA 3AKPA 4OUSA 3OUIA 1RHI1 3M3IA 2WKKA 3NV1A 4CEYC 1V6LA 4CEWA 2QVSB 1OFSA 1RUE2 2ILMA 2N7GA 2IXIA 2SLIA 3WSOA 1SQ4A 1J1LA 2YROA 3LA7A 2UWAA 5FYSA 1REEA 4TYSA 5DDJ3 5H9PA 3RI9A 1UO9A 1QJU3 1PO22 2CDPA 3BTXA 4GB33 4N7IA 3KGLA 3IPVB 2CY6A 4Y22B 1EV12 1PO11 4YVWC 1GWLA 1OLMA 1YJLA 4C91A 1V0AA 5T5LA 4XW3A 4AI2A 1H4HA 1W2AX 1BYHA 1LGCA 2WYSA 2BGPA 4GWIA 4LIUA 4ARYA 4EWDA 1OA2A 1W90A 2ZXQA 4H14A 1LHOA 1NYWA 4YM3A 3OB8A 5FO7B 5AVPA 2WINB 3LZZA 2LW8A 4YVSA 1D2SA 4E2GA 2A71A 2VBPA 3NAPA 4XZPA 5GM0A 5JZGC 1VE0A 1Y9MA 2VO5A 3H8UA 3MIHA 1DGRN 4LK6A 3EBRA 3D0SA 3TEXA 2W94A 3SH4A 1COV2 4XF9A 2JECA 3MPPG 5ANNA 4GZ9A 3B00A 4RGAA 3BTAA 4YGEA 3OD0A 3K4ZA 3WNLA 4QX7A 4JDMA 4BHPA 2D3PA 4JTNA 4DXZA 1COV3 3B02A 2W5FA 5D1IA 1UN1A 4BWOA 3IT8A 3JZVA 3C7OA 2VE1A 4OI4A 3E97A 2DTYA 2WZPP 3SH3A 5IVJA 4PIYA 5E1RA 5T5OA 1I9RA 3BPZA 4M4PA 5FYBA 4QMAA 4XFAA 4LHLA 4JX0A 2J1SA 1UPSA 1SHWB 2YV8A 1REDA 5DAPA 2DCZA 4B4QA 3D4KA 4CDUA 3W5NA 1XYOA 2A3XA 2QZ3A 1XSRA 1UNBA 4OUEA 4P5YA 1LOBA 2VVDA 5TSWA 3ZKYA 2BV4A 1C28A 1XYNA 2XVLA 4FPKA 5FRAA 2WLQA 2W1WA 2VMHA 3SCFA 3URFA 2VUAA 3H8RA 2JE7A 2HBUA 3WNMA 1HRI3 1T6BX 3LD8A 4FCAA 2B45X 1HKDA 2NMOA 4UBGA 5ABJA 4WVZA 4YW2A 4E4DX 1PVC1 5J36A 1QJZA 2QQJA 4KGQA 1G7YA 3FBYA 3GBFA 2HWE2 4IUGA 4OI2A 3I2DA 3VBUB 2F4LA 4Z8BA 5K7PA 4FPCA 4YARA 5FZ3A 5FR3A 3S0MA 2VCCA 2Z42A 3NRUA 1ULFA 4OUMA 3VBOA 5I93A 2V4AA 2ENRA 5FDBA 1PK6B 5IYYA 1KQRA 1POV0 1H1AA 1UMIA 1S4CA 4M01A 4RL7A 4TN7A 2FZ2A 5G05L 4DPNA 2VGDA 1JZ4A 1QKQA 3NNFA 1ZZ6A 4ZKTB 1WBFA 2PLV3 5I8TA 1ULEA 2BNNA 4P9XA 4I3GA 1QJU1 3MHZA 2EICA 1QEXA 2AYHA 1OBNA 4GWNA 3SH5A 5FPUA 3ZOIA 2WNUB 1YFUA 5K8SA 4Y1ZA 4GAZA 3HMYA 3A21A 2BP6A 4C1XA 3ON7A 4QB1A 4PBPA 5FKCA 4PDWB 2W1SA 4DNYA 2OW4A 2H0VA 3QCWA 1JYXA 3WVJA 1RUF3 5FZHA 2Q5TA 3KVAA 1REFA 1SDDB 2C26A 2R49A 4CCEA 4R9AA 1SLTA 1GV9A 5ANQA 4E8CA 5HCHA 4Y5Z0 2IXJA 4MGZE 2KR2A 1D2QA 1DQ4A 1AR61 4MGIE 3U0ZA 5IUQA 3AKTA 4FP3A 1XNKA 4RQPA 4AVVA 2PHWA 2CTVA 4YW6A 5EYYA 1GLHA 4P9IA 1U0AA 2JD4A 1SBEA 2W1QA 3WW3A 4AXOA 1AR72 3Q8AA 4LBQB 3KZ4C 1RVF3 2JG8A 2WSUA 1AYM3 2FD8A 1XE7A 4NRPA 4Y4RA 4Z82A 1FOD1 1KJLA 2DUOA 2TBVA 3AP4A 5E16A 5FP9A 4F3JA 4D3WA 1TVGA 2WBKA 3UV9A 2HWF2 5F5QA 3THDA 2BWAA 2BDRA 3L2YA 2ZX3A 3WF3A 2QNKA 2DVBA 2YB7A 2D3SA 4PBOA 3J8F2 5JVVA 1W8UA 3RZLA 2Y64A 3MICA 2OIIA 2XMLA 4M3CF 3WT3A 1JUHA 4D6QA 1AZDA 2BBAA 4BOWA 2RJKA 1RXGA 3ZDVA 1SLCA 3WNKA 5FTTC 1W03A 4CU7A 1KGYA 3PNAA 3GCXA 1GQPA 2JDKA 3OGVA 5BYNA 5F5AA 1UIJA 3JBG1 5A1AA 1C1LA 3T0DA 4ZU5A 1APNA 1H8TC 4OHWA 4MOAA 2JXAA 1I6XA 2HJIA 1J84A 2E7AA 2JICA 1HB1A 2ZABA 4LBOA 3O1SA 1UOFA 3AYDA 3INAA 5FY5A 1JOJA 5BNPA 4F83A 3HAGA 2D6MA 4E2QA 2XJTA 1Q5OA 3SHRA 4XJWA 4H7LA 1R1A1 1QQP2 5CVRA 1RUD3 1DQ1A 3MW4A 5LW9A 1RUI3 1X9PA 4IV1A 2GP3A 5DAXA 4AEJA 1QWRA 1S55A 1B35A 2BNOA 3DUIA 3WCSA 5BNNA 2E9QA 4Y5SA 1X50A 3OCPA 2JG8B 4L8QA 3JCIA 3N9LA 4N43A 3PUSA 3GZAA 4SBVA 3MFAA 1AYM1 4UFJA 4EN8B 2D3RA 1WCUA 3M3CA 4G3YC 1PZ9A 3TB0A 1SLLA 3LEGA 4LIVA 3B7MA 4N53C 1LKNA 3AKSA 1UY3A 5IAVA 4AYUA 1Y7BA 2B42B 1S0CA 1W3XA 2DBNA 2PA7A 2ARBA 1ND3C 1CPMA 3RYPA 2C5DA 3OOXA 4XF4A 1XNDA 1LOAA 4C90A 3ZLIA 1KEXA 3J7NA 1Q8OA 1UOGA 2QFEA 4XF3A 4P9JA 3IMMA 1JU3A 1AXKA 4AHYA 4BQ5A 4D6RA 3U37A 2UWCA 5FPAA 4LITA 4QDSA 3RZGA 1N3QA 1UX6A 2R061 2GSYA 3AP9A 1GNHA 1NQDA 2DUQA 4YSFA 2A6VA 1UZVA 1O4YA 2NP0A 3PVEA 5KXBA 1DGWA 1MEC3 1K5MB 4IL7A 4QM9A 1JZ3A 3S5AA 3E6BA 3NNMA 1ULCA 1UAIA 1W9SA 3KQ4B 2QJVA 1AYM2 2RS31 2H0BA 4CDQC 3MLLA 4OMCA 2WN2A 4DY3A 2ET7A 2X09A 3NQHA 5DMYA 5EPAA 3E5XA 1JZ6A 4M0NA 1W6NB 1LNSA 3RPQA 1Y4WA 2RS13 2VTXJ 3GJBA 3NL1A 4MHUA 4NHKA 5BPXA 3TAYA 2DYCA 1GSLA 4YM1A 3VBOC 2ORZA 3ZFFC 2WO7A 3THTA 2VQAA 3ILFA 5JOWA 3HQXA 3F95A 4BXSV 1VBA3 5BNOC 4HFSA 2J1EA 1OXCA 2X8KA 4Q4W3 2Z2SB 1WMEA 3I3MA 1HQWA 5CKNA 3V0BA 5H9SA 1AR82 4B3NA 2Y6LA 3PL0A 4HVRA 1PX4A 3ZPYA 1H0BA 4BLJA 1FPN3 4B4RA 3OTFA 3DPRC 2PHLA 4LBNA 2ETEA 4N90A 2P5BA 1O3SA 4UW5A 4Q4W2 3G6JB 3MLJA 1YFYA 4ZU4A 3GHNA 5A6ZA 5C8WA 3BI3A 3S57A 2RDNA 1VBD2 3CDZB 3AYEA 4E2SA 1RINA 1PGL2 3M3OA 4JGYC 1GANA 2R072 4NHMA 1NZCA 1OFNA 2G9FA 1EYBA 4GA9A 4PIZA 3VZMA 5HXVA 3VDCA 3ZXFA 3N4MA 1RUNA 2WRAA 1W8FA 3KQRA 1VMJA 1RUD1 1QY4A 1JU4A 1WW5A 2VMFA 1QNYA 1QU0A 4QX5A 4PQQA 1RB8G 2OS2A 4MYEA 2ZMNA 1IGOA 2R041 4B4PA 2DFCA 2XL7A 2YBSA 5DN2A 1R092 2RS11 2ZPXA 1DFQA 1RJ8A 2DVDA 5JAXA 3UETA 1JZ5A 3O1VA 4RFRB 5C9AA 1BEV3 5FMBA 2E7TA 1OLQA 4BDVB 2J1UA 1R093 2WFPA 2XVKA 4S2FA 3ZXAC 4D7YA 2LUWA 5CBLA 4GH4A 5DZEA 4AHZA 1CX1A 4LO5B 3DECA 4XUQA 4AI1A 1RUJ1 1NY72 5E6HA 2ARCA 3MIFA 1NX9A 1ND2C 2R16A 1NLRA 4J1XA 3N9QA 2VZVA 3I3BA 4HT1T 2GAUA 1JTZX 2XJVA 4CUCA 3MDPA 1W2TA 4D6SA 4LHNA 4XJ8A 1JYTA 1KDKA 4FO9A 4ARXA 3UKVA 1OKQA 4JKKA 4QX3A 4XBLA 2CL2A 3NWKA 3POEA 5ABJB 3W5MA 1UW8A 1ODMA 4DMIA 3K4DA 1UY1A 3FHQA 2EAKA 3WQ1A 3OBZA 4NWVA 2QBXA 4UAPA 2RHPA 1NCQA 4SLIA 4YLZA 3ZXLA 2WNVC 4XFIA 2EIEA 3WDTA 2HWF3 3VGIA 1LR5A 4B1MA 3RQ0A 1MACA 3UKTA 4Y33A 4C1WA 1FXZA 1XNTA 2WO1A 3GZUC 2A75A 4P9WA 3RI8A 3AYAA 4FFFA 1ZRCA 5LBCA 3JQWA 5C9AC 3Q8EA 1DBNA 2VNRA 2JKBA 3JD73 1TNRA 1CAVA 5A70A 1E5RA 4GKXA 2UYBA 1OF4A 4Q0QA 1BZWA 4CP0A 1WBLA 4YGBA 2GC2A 2KXLA 3BVCA 5FZCA 1JODA 2DVFA 1UYXA 2R073 3JB4C 4OFGA 3T08A 1WUVA 4GJYA 4N53B 2XQRA 1CAXB 1DQ0A 4D8MA 1QJFA 4CPBA 1W9TA 3H8OA 4LJHA 4HLTA 3JU9A 4DZGA 1A34A 3KV4A 5IK4A 4C0HA 1YQ2A 5A7OA 1PK6A 2D7FA 3VDAA 1XOYA 5IFTA 4PDWA 4PLOA 5GLUA 1X9TA 1YQ6A 2P3IA 3LB9A 3Q8FA 2JG9A 1FMD3 4FFHA 3I54A 2BQPA 1OF3A 2VVEA 1STMA 4L11A 4XILA 3WDXA 3ZN5A 3A0NA 4FXKB 4YZ5A 5C71A 4Q8KA 2Y0OA 2PFWA 1A8MA 3KCXA 3SC7X 4MO3M 4AG4A 3KB5A 1PO13 1XNAA 3HOBA 4LA2A 4XTPA 3K46A 5L36A 1IS6A 2XDVA 3K48A 2X05A 4CSWA 1C4RA 4KU7A 3P3PA 2PXJA 5D8AC 1B35B 2WA4A 4IV3B 1V6NA 3D3AA 4AVBA 4CP2A 5GZFA 1UMZA 4XDPA 1UU4A 3ZN4A 1JS9A 2BGCA 5FZBA 3IN9A 5D21A 1RUJ3 1YXWA 1JZ2A 3UGFA 3CEWA 2RE9A 4MVTA 1U5ZA 2DWRA 5EJ3A 3PURA 4M3CB 1OA4A 4I3PA 2VZUA 1R1ZA 1UCXA 3ZFGC 3CJIC 4DO0A 2ZTNA 1K3IA 2Y6GA 4KNCA 5DUWA 4NO4A 3HNYM 4K1YA 4BQYA 1PM7A 3PMSA 2UURA 1CX4A 3SISA 2DCTA 5LBEA 3GJAA 4FPYA 4ISQA 1QJY2 1N1YA 3D82A 3WV6A 4WM7C 4AI9A 3AC0A 1RJ7A 2W52A 3MZHA 1LHNA 3CJXA 5CU1A 1KS5A 3SCHA 5DDJ1 2FDIA 2RS51 1FMD1 2ZEXA 1NXMA 2D6LX 3KVBA 5LB6A 4B7KA 5LA0A 1CJDA 1W28A 3HEIA 2WABA 4HOOA 2F17A 5ACA2 3ACHA 2ZHKA 3NJVA 4AF9A 5FWEA 2O8OA 3RJRA 1CWPA 2RJ2A 3GALA 4Z1VA 5JZGA 1ZZ8A 2R1BA 3DXUA 4QPIB 4CU9A 2JWPA 3GZTB 4HN1A 4QPYA 5F3GA 1AR83 4LBKA 2BWCA 4YYOA 1NAEA 3UK9A 3POFA 3T0BA 4YFWA 5C8CB 3TRSB 4IGQA 1PHMA 1RUD2 2VAUA 4L0PA 2JIGA 2W68A 3SITA 3WP4A 4CCLA 2JE8A 2HYXA 3KT7A 3LWCA 5FLIA 2XJPA 2A7AA 4LE4A 4KU8A 4XXPA 3ZPOA 1E5IA 1HRI1 3B69A 3VBSC 1CZVA 3ZXKA 1AL23 1NLSA 2GZWA 2DTWA 4XJZA 2ZEZA 4BK4A 4COYA 3CL1A 2E32A 1QJX2 3N9MA 4EWAA 3I2GA 4K21A 1M06G 1RUG1 4YPJA 2Y38A 3DCQA 4XHBA 1LEMA 1SBFA 1US2A 4XTMA 1PMIA 4K3UA 5FQ0B 2X29A 4E4SA 3VD7A 4J1WA 4L92A 5KHJA 5IFPA 5GLZA 1H8TA 2GALA 2LROA 3VHRA 2XLAA 5FY9A 3VBFB 5F3CA 1MQTA 2Y34A 3IBMA 4XMAA 4N7UA 1IKQA 4FPGA 1QIQA 3H8XA 2D6OX 2DU0A 1Q8PA 4NIDA 2JDUA 3VZLA 1W8NA 5C3SA 3T2TA 4Q26A 4MGKE 2W1UA 3DV8A 5LA9A 1HN1A 1TMF2 4Q29A 2WNEA 2ZEWA 4B29A 4JGYA 5LA1A 5HV0A 2ZBJA 2Q8CA 1QNWA 4BISA 4CDUB 2BEOA 4G9SB 2ZOEB 1BHGA 1OVSA 3AL5A 4S2DA 4AQ6A 5J09A 2VZPA 2QQVA 2W92A 4HK9A 3BU7A 1G9FA 1NXD1 2A70A 1TQ5A 2ZGOA 4AAPA 1HXS1 4FBFA 2VQ0A 4LQRA 2K2SA 1ZZCA 4GWMA 3APBA 4BK5A 2WSVA 1AR63 5C7GA 1AL21 1JHJA 4MLOA 2E26A 3FLPA 3OG2A 4AEKA 2AEYA 5I91A 3JBG2 1S0BA 2FDKA 3KWVA 3BTZA 2B5HA 1PNGA 3GGLA 5CISA 4PI2A 1AJKA 4J25A 1B09A 1QQP3 1SFNA 1LGBA 4L9BA 5IK5A 2RMU1 4URTA 3T0AA 4GD4A 1ULDA 2I74A 2XGXA 1W6OB 3ZR5A 4IDZA 4IEWA 3ASIA 1JW6A 5K9YA 4META 4FOYA 3ZYJB 1BKZA 1KITA 3MIBA 2BGOA 5FWJA 2R7EB 2XBO1 3NVCA 2VNOA 1W3VA 4O65A 4XIOA 1CAWA 1O8PA 4ZZ5A 5LY1A 3RZZA 1H2MA 2XQXA 2RJLA 2UY8A 2A3WA 1EPWA 5C9AB 2PAKA 3D5OA 4LLFA 1SG3A 3PUHA 3MV01 3OEAA 3JQXA 3MPBA 1W6PA 4XQDA 4BQWA 1QJY1 1S0GA 1CPNA 2BW8A 2IC1A 5BXXA 4LKDA 1W6OA 5DDJ2 2PTMA 2P3JA 3BGAA 3LAGA 3SXWA 1PZ7A 1HV0A 4IERA 2EVXA 2WIIB 5T50A 4V2WA 1VP6A 1Y9QA 2G9ZA 3C8XA 1FNZA 2VUDA 2J7MA 3BOWA 3D6EA 2JDPA 3O0XA 1RVF1 2PMWB 1UYYA 4KG0A 4XYXA 5FJHA 4XIKA 4AVCA 1UXZA 1GZTA 4XAAA 1GP4A 2ZX0A 2QTWB 1J59A 1GWKA 2CWSA 2VQUA 5LASA 3UJOA 3V0AA 1I3HA 1KFUL 1TE1B 5AFBA 3M4FA 5L9VA 2QQNA 1W05A 3DYOA 3AKRA 1R082 1UYZA 4IGPA 3ST7A 1VRH3 3RMYA 5FFOC 1VBD3 1I5PA 1MVQA 1FOD2 2WO2A 3ZFEB 5F3IA 1DZTA 3KT4A 5FPVA 1AYN2 4F8AA 1VAMA 3U1XA 1HN0A 1W04A 3AM2A 5FO8B 1MEC2 2QKDA 3M1HA 3ZXDA 1MQTC 4BE3A 4DUXA 3MEPA 5HBAA 1AX2A 5F7UA 3WX5A 1AR62 1W9FA 4DOUA 1W6QB 1W6MB 1POV3 4PCRA 4XFHA 2D43A 4NRMA 2JJ6A 3AMMA 5KXDA 5A33A 5HI0A 1T6GC 1PX3A 1ULOA 1ZZ9A 4RHV3 1EUTA 2VMDA 4JDOA 3VKNA 4XABA 2GN7A 4MUVA 3LPGA 3ITQA 2X5IA 3H7JA 4ES8A 5FY8A 4LO7A 4AGGA 2B9VA 2VCMA 3OGJA 1KXGA 4UFLA 5FZEA 2HWB1 5EIYB 4YVSC 1LJ7A 3M2MA 2Z5WA 2FCUA 4O61A 5FXXA 5LCWL 1HDKA 4P9YA 3LA2A 4GULA 2W47A 3AZYA 1GZCA 1ND2A 3KHBA 2E63A 2PHXA 2VZQA 1CZSA 4ASMB 3E1F1 3USUA 1KFXL 1PGW2 3TEYA 4QGMA 2P6CA 1ZREA 2W95A 4MH0E 3I3DA 4IEQA 4A3XA 1ND3B 2Y60A 1S0JA 1UKRA 2B7YA 2KD7A 5L19A 2VOWA 4WBBA 5FYTA 3T30A 2P6HA 2YU1A 1DYKA 1L7QA 5EP9A 3H3ZA 3HQRA 3KGZA 3H50A 3Q8BA 3FZ3A 3H3UA 3NJXA 4V2VA 1OD3A 1MS3A 4WM7B 4XAEA 4KGGA 5EJZB 5A33B 4OHZA 1URXA 2DBIA 4QX2A 4AFMA 5JR7B 1KS4A 4NHXA 1DHKB 2JDAA 4YWAA 5CADA 2CGNA 3RJ2X 4AEDB 1QXRA 4COUA 1EUUA 1LHWA 3H1WA 3RRDA 4N43B 4DXSA 2ZGMA 4YW4A 1CESA 2C0ZA 3V64A 1WLTA 1O5LA 1JXNA 2CWMA 3ZXGA 4H2AA 3IDCB 4FPJA 3AP6A 2HWB3 1YYNA 3C7HA 3VBFC 3WNOA 1FOD3 4A7KA 1GZWB 5CG9A 4ZPIA 3V56A 5FUPA 1ZBA3 4UOJA 3IIAA 4MXWA 5H9QA 3T09A 3ZR6A 2Y6FA 1VB4A 5L7OC 2BYVE 2WZEA 1RUE1 3HIFA 4TSVA 4XDOA 1ZBE3 2RM22 2JDZA 1R091 2RS12 4XOGA 3LQCA 3E6DA 2ZGNA 3A0KA 4PI0A 1TME1 5L73A 5KHHA 3M7AA 4RN5A 3V0BB 4LR4A 2VXRA 2OUJA 1MZ6A 3FE5A 2VG9A 1RUF1 4O9EA 4MX3A 3IAQA 3SEEA 2EA7A 2HBTA 1WWYA 1UKGA 2VOXA 2JIJA 5FP3A 1R081 3OF1A 1POV1 3N7LA 4FFGA 5FZKA 1WD4A 5CKMA 1JYNA 3J8F3 1HIXA 1RUC2 1HRI2 3M8LA 5F2SA 4URAA 5LATA 1Q8SA 3R4DB 4QKBA 4FOQA 5CYYA 3UJQA 3WEZA 2GMPA 4H7MA 3MF6A 4ASLA 5LEJA 4YZ3A 2ZMLA 4RYDA 5FYYA 2UWBA 3RWKX 1LU2A 2XL9A 2D6NA 1GMMA 2ZJCA 3OPZA 4HMZA 4Q0SA 2P3YA 2IXKA 3ZO0B 1H9PA 3K51A 3IZOA 3WHTA 3TN92 2DVAA 4Q4Y1 4W65A 4HK8A 3T1MA 5C8CA 4KWLA 4O9GA 4CRQA 4A6SA 3WR0A 3F2ZA 1V6JA 2HWF1 2PQQA 1F9KA 1E5HA 1IZ3A 3FUQA 4YW5A 4N8MA 2BU9A 1FMD2 1V6KA 3PJQA 1RXFA 4K6BA 5KXCA 4JHTA 5C4WB 2JENA 4XEZA 2VTFA 5E8AA 4JRLA 4L2NA 2DFBA 4FPLA 3SKVA 2RM21 1XNCA 1SMVA 3WD5A 3ZYIB 1WZXA 4CDXC 1GOHA 3DEMA 4CP9B 1F4AA 5D2AA 2WT1A 5FZMA 4CCDA 2XBO2 5CA6A 2CGOA 1Q43A 1R083 4NAOA 3KLSA 2PAMA 2XXZA 4QPIA 4QQOA 5T5PA 1C8M3 5J3UA 3WNNA 1HB4A 2RMU2 5J98B 1W8ZA 4M4RA 4A7ZA 4IV1B 2E51A 3POBA 2A6ZA 1Z7S1 4MZUA 3N3HA 4W50A 2V5DA 2R30A 1BXHA 4YW1A 1NKGA 2WWJA 3CLPA 4QHZA 4XBNA 5FYUA 4CEWB 1P8JA 1TNFA 2WAAA 1QOOA 1ZBA2 4AVSA 2W39A 3I2JA 3ILRA 3THCA 4CXWA 1HX6A 1OQ1A 3W59A 1QF3A 2MEV3 1W9YA 4NIAA 1GOFA 2XVGA 4XCBA 3ES4A 5CG8A 3LDBA 3ZFEC 2A73B 2XJUA 4AEDA 5DAQA 3K3OA 4FOWA 2BPA2 1RUI2 2ZS6B 4Z2AA 3VLBB 3IB3A 1KD7A 4QPWA 3U4SA 4CDXA 3AJYA 4K40A 4NE9A 1PGW1 4BU2A 4LLOA 1ZA7A 2D5FA 3OUJA 3VBHB 1VMHA 4OQ8A 1YRZA 1SLBA 2R063 4W8JA 2EAAA 3OD4A 5LK5A 4IEXA 3TNPB 4Z2WA 5IT6A 1DQ5A 1ZRFA 2A6XA 1UU6A 3IKWA 1U12A 4AR2A 1DLCA 2HH9A 1Z78A 2VMGA 3NKGA 2PN5A 3VD9A 3BYWA 1O6UA 3KHCA 3LEKA 4CVUA 2IXCA 3NJZA 2WYFA 3R4UA 4IEYA 1TMF3 2BNMA 2XR4A 5FZ6A 3W58A 3FHAA 2GC1A 5IVEA 1VLNA 3BTYA 2ZEYA 2E33A 1Y9GA 1XSQA 4AAXA 3H3LA 4L97A 4FOVA 4D7TA 2NN8A 3VDDC 3RZMA 1Q3EA 2A6WA 4K20A 4RD7A 5B2GB 2BRTA 4ET7A 1W99A 1IKPA 2YGLA 2IFWA 3ACGA 3MIEA 4QB2A 2W2IA 4ES9A 1H2LA 1BMV1 4S2HA 1WMDA 2X5IB 4AGRA 5HV4A 3EHKA 4A6OA 1ULGA 3VV1A 5JSPA 2CSGA 3O5SA 1Y43B 4HPKA 3MBWA 3I4IA 2YYOA 5E89A 4BCUA 4TZDA 2Q8OA 4Y5TA 4A45A 1ND2B 2I45A 1OURA 2PHTA 4Q1PA 5AC91 1IS3A 5FXWA 5BNPB 2AH2A 1US3A 3B94A 4FQ4A 1GZ9A 1A6CA 5GLTA 2RS52 3WDWA 5A3NA 5LK7B 3BIEA 1MS4A 2VXJA 3B3QE 4ORFA 3VDDA 4AVTA 1MZ5A 1RUJ2 2IWGB 3C2UA 2WC2A 3C7GA 3ZXEA 2H6BA 4FFIA 3WDVA 1JUIA 4YZ2A 2R0HA 3RMXA 3I2FA 2OPWA 4HPKB 4IV3C 4BMEA 4IXLA 1NCQB 2B39A 1OOPA 1LOGA 4MGQA 2HKXA 2VNVA 1MZEA 1N3OA 2C6SA 3PVNA 4B8EA 3I59A 3RYKA 3ZSEA 4E8DA 3WW2A 2XHKA 1U5YA 4PHZA 2PYTA 5C70A 5EHDA 2ET1A 1D4VB 1BEV1 1DZQA 1KDMA 1ASJ1 1ONAA 4UBHA 2VBDA 5C4WA 1C8NA 1C57A 5L9BA 2DCKA 2HWD1 3LPFA 3Q9OA 3M3EA 3S30A 3WDUA 5JCTA 2CHHA 4UT5A 2WLPA 3HD8B 5C3PA 5JOZA 2XJRA 3TOJA 4MGYE 3WXPA 1YC61 4J6GA 5DG2A 2WZ8A 1V6OA 4LKSA 2EIBA 2ATFA 3E5UA 3JB8A 1WD3A 1SPPB 1QJU2 1SFPA 2AGSA 3VD4A 3PUIA 3BB6A 4AEDC 5FZ0A 1GKBA 1QXJA 2O8QA 2BOIA 2A3YA 4DEVA 2R071 5A7NA 3RG0A 2VZTA 1O3TA 1GR3A 1UPIA 5E88A 4AL9A 3HBZA 4CCKA 3N7MA 4IV1C 1HJFA 1RUH1 2D40A 2P17A 5A3UA 3AKQA 3OGRA 4B1LA 4I0AA 3WOGA 4NRQA 1D7PM 3KF5A 4R4XA 5DUXA 3IIIA 3B9IA 5L7OB 5C3OA 1H4GA 1AL22 3LF7A 4V1PA 3LEIA 1HRV1 5IVBA 3VBSA 1VB2A 1X7NA 5CFDA 2YPDA 4AW7A 3NJYA 4LK7A 2JDYA 4JRAA 2PHDA 1HXS2 3HR9A 3BOPA 4BMBA 2FCTA 2GDFA 2RDRA 2WT2A 1DF0A 3KF3A 1EY2A 3VBUA 2WNVB 3K75B 2W08A 2BBVA 1IG0A 4AOCA 3O1TA 2L9LA 1RIRA 5JXHA 1VRH2 1HXS3 3ES1A 4R9CA 2OQ6A 4FT8A 2GMEA 1S0DA 4ONUA 3I49A 1JZ7A 4P14A 2IXHA 5AC93 4A42A 2WQZC 4P02B 4NAMA 3E5QA 4BQ4A 5HXMA 2J1AA 1YIPA 2R0FA 2VBBA 4KWJA 1PVC3 4EV0A 4HXCA 4COWA 1LULA 1I5ZA 2FDJA 4A4AA 5JOYA 3T2QA 1WLDA 5BUVA 2GH2A 1V9U3 1NZIA 4CP9A 1AJOA 4ZXEA 1RUG2 1YI9A 3MO4A 1CIYA 2E6VA 4QU2A 2JKXA 2W0XA 2Q8EA 5KHKA 4JGZA 3NV3A 4QPGC 2DVGA 2HWC3 3S7EA 4EN6B 5CFCB 5F37A 1S0FA 3DPRB 4LBLA 1ST8A 3AZWA 5CIRA 1CD3G 4ATEA 3FL7A 5AVAA 1Q8QA 3M70A 4QX8A 5B4NA 1SLIA 2I07B 2LS6A 5A7SA 3CMGA 3K3NA 4TTGA 5DUUA 3WQ7A 2Y6KA 2JEMA 2P2KA 1QJY3 3PTYA 4EWEA 3NAPB 3OYWB 5A32B 1DGWX 4RHV2 5KBFA 5DABA 2XUEA 4JKLA 1ZNPA 3CO2A 5DAVA 2QQPA 1XXNA 3VBFA 2QQKA 4LA3A 4Q0PA 1H8TB 5C6CA 5CFCA 3H1MA 2YFUA 4AZZA 3GZEA 1WA4A 2AEZA 3N7JA 4UW4A 4BQ1A 1PMJX 1PO23 5FPXA 4PDWC 1GP5A 3PIJA 4IE0A 4AFDA 5LEKA 4Q8LA 4W6XA 1VIWB 3WW4A 4I0BA 4XF1A 3WG1A 4CDXB 3PJYA 3CJIB 4NN0A 1BBT2 5JLVA 4XMIA 5ABJC 2D44A 4WZFA 4YW7A 3AFKA 1RMU1 3WQBA 1L7RA 1ZM1A 1D0HA 5GLVA 3OY8A 1TG7A 3VKOA 4RS5A 3KD4A 4ATFA 2HWC1 1H1IA 4YNIA 2D93A 5HCBA 4XJUA 4P5HA 3K2OA 1VBD1 3DYMA 1X8MA 1W0OA 4GB31 1DZRA 5FLHA 3WP5A 1UL9A 1FV3A 4LORA 2R6QA 5A3OA 4MGTA 4D94A 1CAVB 2ZMKA 4FTEA 2QZ2A 3PLQA 4DXRA 3USSA 1F2NA 1NCQC 4E4HA 4LXLA 2HWD2 2XLFA 4RFT0 3VBUC 4DXTA 1GWMA 5F39A 3GXUA 2MHFA 2ERFA 2XUMA 4HKLA 3AXEA 4JAAA 4PIXA 2YZ4A 3ATGA 4DB5A 3CZUA 1JYVA 1MS9A 4LHSA 1IPJA 1OH4A 3HWJA 4Q4X1 3NNGA 1TZOA 3WUCA 1QHDA 2PHUA 2GMMA 5ACA3 3EMRA 2O14A 2IVIB 1IPSA 4IEOA 2QDRA 3ACIA 2BZDA 3QLQA 3UT0A 1POQA 2XG3A 2Q1FA 1DLLA 2VMIA 2WS92 1OKOA 1H6YA 3HT2A 4FAHA 3ELNA 2QQLA 4NMIA 1HB3A 2V4VA 4E27A 3NO8A 3AMNA 1K42A 4KH9A 1W6PB 3RYRA 3S6PA 2AR6A 5IJRA 4EN9B 4PLNA 1CAXA 1Q8VA 1MQTB 2XH6A 5FK8A 4IE5A 1FT9A 4Y1XA 2VCAA 2GC0A 2ZGSA 4FAGA 2XBO3 4MG2A 1GYKA 1NG0A 2CV6A 4KI5M 3BN6A 3CF6E 4CA9A 4ZU7A 2FDFA 4FPHA 1D4M3 4UWDA 3ZX7A 3DKWA 4ZZ8A 1ULPA 2YDEA 4LULA 1XYPA 2ZX1A 5FUIA 3VBRB 5F3EA 1HV1A 4QAWA 1SLAA 2VZOA 2QE3A 3ENRA 5A7WA 4LHKA 4M0HA 2YC2A 5C4WC 4PJYA 1N1VA 1LRHA 1NUKA 4AE2A 1VBB3 1NCRB 4W6WA 4CEWC 2TEPA 4YVSB 5LBBA 2QCSB 4COVA 3I8TA 3AFGA 5FXZA 1DU3D 1S2EA 4Y22A 3ROUA 1NA1C 4GIQA 5G04L 1WLWA 2CGPA 1PIV1 1K45A 1VPHA 4FPFA 4I0WB 3AB0A 1LCLA 2YY1A 4GJZA 2P4EA 2ZKLA 5GKAC 5AFEA 2JDHA 2ZACA 3B9CA 3U4XA 2WFF3 2XLGA 3VDDB 5FZDA 1OOPC 4FI9A 4Y1VA 1LOFA 1UIKA 2Y33A 2UU8A 1AR93 2EXKA 4FVVA 4D0QA 2RDSA 5J1XA 5BNQA 1J3QA 3DPRA 2NQYA 2XJQA 1PM4A 3T1LA 5C5UA 4QT6A 5JWPA 3FC0A 1ZA4A 4HL0A 1RUE3 3PU8A 1YO8A 1G86A 1NY71 2RR12 4GKYA 2FQPA 5FV3A 4YM2A 1VRH1 5FY0A 3ZFGA 2BERA 2WS91 5IWFA 4IE6A 4DUWA 3KV9A 4NROA 4XHXA 4AI8A 3SLIA 2WZR2 4Q2FA 1U5IA 3ZFFA 2ZZJA 1QH6A 1QDCA 4WM8A 2F4PA 5KC5A 4Q4X2 2VH9A 1AYN1 3P3NA 4OLLA 4FP2A 4QGLA 3RWNA 1MVEA 2B9UA 5LRSA 4HVOA 5IVCA 4N9IA 5JMCA 2PHFA 5CKQA 5FAXA 1G9DA 3QBQA 1H2NA 1ZZ7A 2VTXA 3ZYRA 3W20A 4COZA 1C8M1 3PMEA 2RS33 2AZ5A 3HNBM 2QQOA 2NYYA 3H42B 3POJA 2Y6JA 2VZ3A 2NLRA 1FPN2 1W0PA 4CDQA 1DDLA 1CGPA 2EALA 2GN3A 2WAOA 5EYXA 4AEMA 5CEHA 3I3EA 5LRRA 1K12A 4QQ2A 1XNBA 3PHMA 4RS5B 4NIIA 1OPMA 4OHYA 4KMQA 4LUKA 1DP0A
chains in the Genus database with same CATH topology
1LHVA 2VECA 2VVFA 4QQLA 1K5MA 3IDEA 3L9JT 1VBA1 1GFF2 1H1MA 1GNZA 1OQEA 2KA3A 5J96B 3RSJA 1RMU2 2PLV2 3H1YA 3V65A 2FMDA 2LALA 1LOEA 2WS93 1NA1B 4WV8A 1ND3A 3ZYPA 2VOKA 1LOCA 5T3NA 2FMYA 3BODA 4CDUC 4KWKA 4UXAA 4Z92B 2RR13 2HEYF 1AHSA 5CFDC 4LNVA 1YFWA 1BK1A 4KG8A 1CAUB 1MR5A 1W6MA 4MXWB 1LECA 1PGSA 3FLRA 4AQTA 1YWKA 4N43C 1N1TA 3KM5A 1EAH1 1MZFA 1R1A3 1B35C 1J3RA 1JYCA 3WG3A 1FI2A 2ES3A 4AI0A 3ZSLA 2E53A 1JN2P 3M3QA 4QD2A 4L99A 2ZHLA 4DY5A 2BUKA 3B93A 4XFGA 2OZJA 3GF6A 4X8NA 2R32A 2HWE1 1VBC2 4KQ7A 1O4TA 1F5FA 3H9AA 4Q1RA 5AC92 4FPEA 4QHBA 4AQ2A 1LGNA 2Y0IA 2XWBB 3I7DA 4R52A 3VN4A 5IK7A 2D97A 4ISRA 1GQHA 3WY6A 3ETQA 2XJSA 1FATA 1LU1A 1TME3 5CAZA 3JBG3 3POWA 4AVAA 4HN0A 2D5HA 4HSLA 4XFCA 4CDWB 1C3HA 2JG8C 2ZGLA 3BIWE 4JTOA 4YVWA 3THPA 2RR11 4LEJA 3ZIXA 3AZZA 3MLKA 4HBNA 1F5JA 1CAUA 4X8PA 4WM7A 1X36A 5F9TA 3EQEA 4GH4B 1LHUA 5JI7A 5F6LB 3LCPA 3OY8B 5C8CC 4HSJA 3LGRA 4DFSA 2SBAA 4ITCA 1OLRA 3CJIA 4EROA 4Y24A 5GALA 2Z69A 4BIFA 5I0UA 4YVWB 1LENA 2ZGKA 4XF0A 2YHJA 2EXHA 4YW3A 1G9AA 4JDNA 4OHVA 4K8FA 2GNMA 1PNFA 3GBWA 1ZBE1 3CNAA 4ZXKA 4DS0A 4LO6B 2WFF2 3WP6A 1RUH2 5A32A 1V9U2 2XPJA 4JQRA 4F7ZA 1FAYA 1ZVFA 4EN0A 1EV11 1PO12 4YFZA 4TWTA 1GZWA 4BLIA 1L3JA 1SEFA 5IK8A 1OD5A 2OUHA 2Q0AA 2WQ4A 3DN7A 3GBGA 1IQAA 4H3WA 2ZX2A 4LBQA 1WLCA 3ZSMA 4AHWA 4IETA 3WCRA 1VAKA 1W6NA 1FX5A 3OBTA 1IHMA 2RS53 4FXGB 4R9BA 4OI1A 1JH5A 5GZCA 2ZGTA 1ASJ3 4OI0A 4E9KA 5J7MA 3O7OA 4MSVA 3ZN6A 1ZRDA 2ZZQA 1WGPA 1RITA 5FREA 2VULA 2WA3A 3KS7A 2CNAA 4K1ZA 1YIFA 2JG9B 4Q0VA 1XE8A 1FPN1 2IFRA 3WG2A 4AFBA 3X29B 1IPKA 1BVP1 4GB32 1CAWB 3ZSKA 1EV13 5FMOL 1WCSA 5EZWA 2NMNA 4R8HA 4M00A 4N53A 4D69A 5FQ0A 4HANA 1H8VA 1SDWA 3WNXA 1CN1A 4BIOA 1X8EA 3EXUA 3VHOA 5BNOB 4Y26A 1BMV2 1PGL1 5BNNC 1BQPA 2X5IC 2KM2A 2V73A 1KJRA 4Q0UA 4IEZA 3AMPA 1HQNA 5SV8A 1MS8A 1G9CA 1RC6A 4CDQB 1DGRA 1UD1A 2YXSA 2GH8A 3LOIA 1H30A 2G4IA 2YC0A 4UW3A 3SCGA 1TEIA 2HEVF 4X6RB 5J48A 1MS5A 4IEUA 5FCCA 3VKLA 5FO9B 2NZ9A 1RUG3 1Y3TA 2QDNA 1AR73 2DF7A 2BFUS 4NVPA 4Q4V3 1RL3A 5JIAA 4YG0A 4BYYA 4UW6A 2O1QA 4IV3A 4WVVA 1COV1 4BM8A 1UZYA 4OVEA 2DCJA 2HEWF 1U5XA 2UYAA 4KL1A 4XQWA 1NCRC 4YGDA 1J3PA 1X33A 3FFQA 2TNFA 1DQ6A 4K7JA 3VZJA 2FBEA 2B46X 4P9GA 1D4M2 1K5MC 5GZEA 1WW6A 2WJSA 5L7OA 3WUDA 3U07A 4RR3C 4IQPA 4FTSA 4YGCA 4IESA 3QOPA 4A7YA 2OA2A 3J9SA 4RGGA 5A3LA 5JPMB 5H9RA 2OVUA 3CU7A 3C3VA 2ZHMA 5EWSA 1HRV2 3VBOB 1VBB2 2D6KA 1XQNA 5FBZA 1NOVA 2R042 1R1A2 5HCAA 4Q4V1 2JE9A 3AXDA 4GMP0 5GJ6A 5JSRA 1AXZA 3MGUA 2R1DA 3MFCA 3TYJA 3VZOA 3ZXJA 4WM8C 1FNYA 3UL2A 2V5YA 5KC6A 3BCWA 1VBC1 3GHMA 1FYUA 1JHNA 2VU9A 5SV5A 2TUNA 2VPVA 1V00A 3DL3A 3NSTA 1A78A 3GYDA 5T55A 2ZKNA 5CB7A 5KWRA 4OULA 1F8VA 1C8M2 3AK0A 1LOFC 1W6QA 4AI3A 1VBB1 2ZAAA 2FHRA 5EFUA 1ASJ2 4EN7B 5HCFA 1BVVA 4JVAA 2CAVA 1MS1A 3VL9A 5FOJB 2Z79A 3WHUA 5JDBA 4AFCA 3D0JA 2IXLA 1ZX5A 3EJKA 2EF6A 3KSCA 5T54A 4CEYB 1CQ9A 1XU2A 2RS32 3VKMA 2PLV1 4QPGB 5BNPC 3NW4A 2WT0A 1HRV3 3MW3A 1CVNA 3AYCA 4KBBA 1VBA2 4BH9A 4M3CA 4GMP3 1GQGA 5FLJA 3ILNA 3O14A 1D4M1 2FZ1A 3FJSA 4LBJA 2WL1A 3TN93 1BCXA 1DQ2A 2DUPA 4WVMA 3NAPC 4QQHA 4XJAA 1YFXA 4IEPA 3WINE 3ZYGA 1VBE3 1BJQA 3ZMOA 4WZCA 3FHIB 4LTAA 4CYDA 1ENXA 2A6YA 4LBMA 3ZVXA 3MIGA 4Y20A 3GNEA 2UY9A 3H7YA 4XETA 3SNMA 2Q1MA 1AR92 3WZ1A 5FOBB 4C0BA 1UF2C 3R0RA 4CEYA 4K9SA 1AVBA 2RMU3 4LUMA 2O0OA 3FX3A 3O0WA 4AFAA 4PQ9A 1OMIA 3ZN6B 4D7SA 5J37A 2PELA 3B01A 1ENQA 1H2KA 2G9GA 3KMHA 1CR7A 3R4SA 2NM1A 5K0UA 4NR1A 2EIGA 3VL8A 4XPVA 3FLTA 1UU5A 2YPJA 3DF0A 4WVWA 2OYZA 2YMZA 2OZ6A 2VUJA 1S2BA 2DV9A 2BVBA 5JOXA 3MW2A 1ZYBA 1QGLA 1W2UA 2WNUC 5D8AA 4I30A 3N35A 4LE3A 1YUDA 3J8F1 3RNSA 1LESA 1RUI1 3FBMA 1M4WA 1IS5A 2GNDA 3IMNA 4IEVA 4Q27A 1Z7S2 1PK6C 3IDBB 3AMQA 2P3KA 4NPRA 3AZVA 2X53S 4HKOA 3IWZA 2AUYA 4RR3A 1ZBA1 5BNOA 1RUC3 4Y4YA 5F1RA 5CFDB 1BEV2 3NV4A 2HWC2 5JSOA 2Q30A 2WNUA 2ZGUA 1LB2A 3WDYA 1YNAA 3MF9A 3N36A 4NOTA 5I0RA 4PLMA 3ZSJA 5JI9A 1D0GA 4BA6A 1RGSA 5JZGB 1VBE2 1A8DA 4FPOB 3AP5A 2JX9A 4NWWA 1VBE1 1QJX3 1Z0HA 4YG6A 5K0UC 2D6PA 4RR3B 2MPFA 1V70A 3HT1A 1IOAA 5F6KA 1V6MA 1XRUA 1EAH3 3JUUA 1AUYA 1AX0A 1VALA 4HETA 4M3CE 1OHFA 3AJZA 1PIV3 4HZFA 3SMHA 2V09A 2OPKA 1OOPB 2CAUA 3OJBA 2WFF1 3AMHA 3NKTA 2EXJA 2BVVA 1OI6A 3LSEA 1G6NA 4WM8B 1G9BA 1EPZA 3E6CC 1SACA 2GU9A 1RUC1 1YLLA 4CDWA 1J1TA 1C5HA 4I02A 4Q4W1 3ECQA 4AWDA 1VAVA 1QMJA 1E57A 2VNGA 3JD72 1SCSA 5KHGA 4LO4B 4DINB 1ZBE2 2RM23 4R9DA 1WW4A 2LM3A 2DCYA 1ZZBA 1UZZA 4AHXA 4QGNA 3VZKA 1SFYA 4QM8A 4CDWC 5I8YA 1I1EA 1QXPA 4Y20B 1CJPA 1PVXA 1J58A 2C1FA 4RHV1 3H0OA 2E7QA 3VHNA 1DG6A 3ME2A 2A5ZA 2ZX4A 4R4ZA 2P34A 4XQ4A 1NQJA 1YCIA 3VHPA 2R043 4GQ7A 4U2AA 2VY0A 2Y26A 5I0TA 1IS4A 1ENSA 1RUOA 5C33A 1AR91 4Y1YA 3VBSB 3VZNA 3U10A 4JCKA 2I2SA 5I8SA 3FWEA 2VW0A 1F31A 4LT5A 1W39A 3VBHA 4YZ1A 3AZXA 3LKJA 2ZA9A 1C5IA 2NPIA 1O3RA 3J26N 1O3QA 5BNNB 3FUOA 1QH7A 1AX1A 3G7DA 3LSDA 5CFCC 5FPZA 4JC1A 3TBDA 3VKFC 4EJRA 1X82A 2HYKA 1QJX1 1Q56A 5EV7A 3S7IA 1VR3A 2VW2A 4MXVA 4P9LA 1AYN3 3OGGA 5T52A 5DUVA 2MEV2 1S2KA 1EAH2 4YZ4A 1AXYA 5D8AB 4NHLA 1FV2A 3TNQA 4H55A 5KHIA 2ZCWA 1OA3A 3IPVA 3R05A 3D8CA 3PVOA 5KXEA 2WZR3 3POSA 4XJ9A 3ZFFB 1AL0G 4RSUA 3I59B 1O5UA 1A3KA 4Q4Y3 2HWE3 4QQPA 4BZ4A 1O4ZA 2HWB2 4I09A 2QUOA 1S1AA 1WCKA 4OZXA 3EO6A 3NV2A 5T5JA 3WLUA 1O7FA 2HWD3 3WQ0A 5DZGA 3RDIA 4Q4Y2 2GNTA 4S2GA 1QDOA 2F6BA 2IZWA 3VBRA 4DRVA 2B8MA 1N1SA 4CTEA 1HW5A 2MNGA 1GICA 1NCRA 2GC3A 2YUEA 3QACA 4LBQD 1GBGA 1MEC1 4YRDA 5DG1A 3VUOA 1V6IA 3N7KA 3L2HA 5EXOA 1RUH3 3FMGA 5I0SA 4AQSA 3VBHC 1KRIA 3ZDSA 3OBRA 1RUF2 3TWIA 1CONA 5DZFA 1NA1A 4WVMB 1TME2 3U11A 2P37A 2WZR1 3AP7A 4GALA 1SBDA 5DXDA 4U36A 1LODA 3ALQA 2CYFA 5GLWA 1YHFA 4GXLA 1EP0A 1WCDJ 5GZGA 3QH7A 5BY5A 4OHXA 2VOVA 1SCRA 1BBT1 4XBQA 1HQLA 4GH4C 1N47A 2BTVC 3WG4A 5CNAA 4FTBA 4Y1UA 1AR81 1LTEA 1O91A 5K0UB 4LO8A 4AGVA 4X6QB 4JGZB 4YM0A 1ZRRA 4I01A 4XXAA 1QOSA 4HVQA 2K9ZA 3W9AA 2PHRA 3POYA 2LTNA 4XE9A 1CIWA 3ZFGB 1C1FA 4INDA 4QPIC 5A3MA 1OQDA 4QXKA 2C9AA 1V9U1 5GZDA 1PIV2 3HN1A 3B5LB 1LEDA 1ENRA 1RHI3 1Z7S3 2ZGRA 1PZ8A 2EXIA 1WW7A 3O12A 4RQPC 1QOTA 3AX4A 3V0AB 4I2OA 1PVC2 4FQZA 2MEV1 2DURA 2XKOA 2R062 3O0VA 1VBC3 4XFFA 3MYXA 1H9WA 4W6YA 4XFBA 5JIUA 2AENA 1S0IA 4XDQA 4DQAA 4RQPB 1HLCA 4FSJA 3UKNA 4E4ZA 3BALA 1MS0A 3OYWA 4G4FA 3VBRC 4BPZA 3ZMNA 1NE6A 4HKWA 5FMOS 1ALYA 3PVBB 4B7EA 4RS5C 3QD6A 1NE4A 1OSGA 4YG3A 2Q4SA 4JV4A 3RS6A 2ZGPA 3KCYA 2XKPA 3KT1A 3USUB 3ACLA 1OPOA 2AREA 1DIWA 1TMF1 3QH6A 4MV2A 4AK3A 1DYPA 2JG9C 3J4UH 5BV6A 5KXDA 1QQP1 1YI7A 2K0GA 1RMU3 1AF9A 3IM0A 1YJKA 2D98A 4DRRA 3LOBA 1JBCA 4Z07A 4GMP1 5JPNB 2XWJB 4N9HA 2YGMA 2ARXA 4TLFA 1DGLA 1N3PA 1XU1A 2XB6C 4CP1A 3TN91 2PAEA 1BBT3 2Q1ZB 3FFZA 3WW1A 3JD71 1VJ2A 2VW1A 3MIDA 4A2UA 2GNBA 1RVF2 2ZGQA 3R6SA 4RA0A 1RTVA 4CZSA 2WWSA 1JYIA 3KCCA 1WMFA 2DU1A 3MI8A 4JGZC 4QPGA 2BFUL 1PO21 2H6CA 2ZHNA 5ACA1 4Q4X3 1S0EA 3ZFEA 3DGTA 3A4UA 3LA3A 4JGYB 4PF5A 2ZAHA 4Q4V2 1AR71 1RHI2 3ZIWA 1G8WA 2WNVA 3AKPA 4OUSA 1RHI1 3M3IA 2WKKA 3NV1A 4CEYC 1V6LA 4CEWA 2QVSB 1OFSA 1RUE2 2ILMA 2N7GA 2IXIA 2SLIA 1SQ4A 1J1LA 2YROA 3LA7A 2UWAA 1REEA 4TYSA 5DDJ3 5H9PA 3RI9A 1QJU3 1PO22 4GB33 4N7IA 3KGLA 3IPVB 2CY6A 4Y22B 1EV12 1PO11 4YVWC 1YJLA 4C91A 5T5LA 4XW3A 4AI2A 1H4HA 1BYHA 1LGCA 4EWDA 1OA2A 4H14A 4YM3A 1LHOA 1NYWA 5FO7B 5AVPA 2WINB 3LZZA 4YVSA 1D2SA 4E2GA 2A71A 3NAPA 4XZPA 5GM0A 5JZGC 3H8UA 3MIHA 1DGRN 3EBRA 3D0SA 3SH4A 1COV2 4XF9A 2JECA 3MPPG 3B00A 4RGAA 3BTAA 4YGEA 3OD0A 4JDMA 4BHPA 2D3PA 4JTNA 4DXZA 1COV3 3B02A 5D1IA 1UN1A 4BWOA 3IT8A 3JZVA 3SH3A 2WZPP 4OI4A 3E97A 2DTYA 4PIYA 5E1RA 5T5OA 1I9RA 3BPZA 4QMAA 4XFAA 4LHLA 2YV8A 1UPSA 4B4QA 1REDA 2DCZA 3D4KA 4CDUA 1XYOA 2A3XA 2QZ3A 1LOBA 2VVDA 5TSWA 1C28A 1XYNA 2XVLA 4FPKA 5FRAA 2WLQA 2VMHA 3SCFA 3URFA 2VUAA 2JE7A 1HRI3 4FCAA 2B45X 1HKDA 2NMOA 4UBGA 5ABJA 4WVZA 4YW2A 4E4DX 1PVC1 5J36A 1QJZA 4KGQA 1G7YA 3FBYA 3GBFA 2HWE2 4OI2A 3I2DA 3VBUB 4Z8BA 5K7PA 4FPCA 4YARA 3S0MA 2Z42A 5I93A 1ULFA 4OUMA 3VBOA 2ENRA 5FDBA 1PK6B 1KQRA 1POV0 1H1AA 4M01A 4RL7A 2FZ2A 4DPNA 2VGDA 1QKQA 1ZZ6A 4ZKTB 1WBFA 2PLV3 5I8TA 1ULEA 2BNNA 4P9XA 4I3GA 1QJU1 2AYHA 4GWNA 3SH5A 2WNUB 1YFUA 5K8SA 4Y1ZA 3HMYA 4C1XA 4PBPA 4PDWB 4DNYA 2OW4A 2H0VA 3QCWA 3WVJA 1RUF3 2Q5TA 1REFA 2R49A 4R9AA 1SLTA 1GV9A 4Y5Z0 2IXJA 4MGZE 1D2QA 1DQ4A 1AR61 4MGIE 3U0ZA 5IUQA 3AKTA 4FP3A 1XNKA 4RQPA 4AVVA 2PHWA 2CTVA 5EYYA 1GLHA 4P9IA 1U0AA 2JD4A 1SBEA 3WW3A 4AXOA 1AR72 4LBQB 3KZ4C 1RVF3 2JG8A 2WSUA 1AYM3 1XE7A 4Z82A 3AP4A 1FOD1 1KJLA 2DUOA 2TBVA 5E16A 4F3JA 4D3WA 3UV9A 2HWF2 5F5QA 2BWAA 3L2YA 2ZX3A 2QNKA 2DVBA 4PBOA 2D3SA 5JVVA 3J8F2 3MICA 2OIIA 4M3CF 3WT3A 1JUHA 1AZDA 4BOWA 2RJKA 1SLCA 5FTTC 3PNAA 5BYNA 1UIJA 3JBG1 1C1LA 4ZU5A 1APNA 1H8TC 4OHWA 2JXAA 1I6XA 2HJIA 2E7AA 2JICA 4LBOA 2ZABA 3AYDA 3INAA 1JOJA 5BNPA 4F83A 3HAGA 2D6MA 4E2QA 2XJTA 1Q5OA 3SHRA 4XJWA 4H7LA 1R1A1 1QQP2 5CVRA 1RUD3 1DQ1A 3MW4A 1RUI3 4IV1A 4AEJA 1QWRA 1S55A 1B35A 2BNOA 3DUIA 3WCSA 5BNNA 2E9QA 1X50A 3OCPA 2JG8B 4L8QA 3JCIA 4N43A 3GZAA 4SBVA 3MFAA 1AYM1 4EN8B 2D3RA 3M3CA 4G3YC 3TB0A 1PZ9A 1SLLA 3B7MA 4N53C 1LKNA 3AKSA 4AYUA 1Y7BA 2B42B 1S0CA 2PA7A 2ARBA 1ND3C 1CPMA 3RYPA 2C5DA 4XF4A 1XNDA 1LOAA 4C90A 1Q8OA 2QFEA 4XF3A 4P9JA 4AHYA 1AXKA 2UWCA 1N3QA 1UX6A 2R061 2GSYA 3AP9A 1GNHA 1NQDA 2DUQA 4YSFA 2A6VA 1O4YA 2NP0A 3PVEA 5KXBA 1DGWA 1MEC3 1K5MB 4IL7A 4QM9A 3E6BA 1ULCA 1UAIA 2QJVA 1AYM2 2RS31 2H0BA 4CDQC 3MLLA 4DY3A 2ET7A 3E5XA 4M0NA 1W6NB 3RPQA 2RS13 3TAYA 3NL1A 5BPXA 4NHKA 2DYCA 1GSLA 4YM1A 3VBOC 3ZFFC 3THTA 2VQAA 3ILFA 5JOWA 3HQXA 1VBA3 4HFSA 2X8KA 4Q4W3 2Z2SB 1WMEA 1HQWA 3V0BA 5H9SA 1AR82 4B3NA 4HVRA 3ZPYA 1H0BA 4BLJA 1FPN3 4B4RA 3OTFA 3DPRC 2PHLA 4LBNA 2ETEA 4N90A 1O3SA 4UW5A 4Q4W2 3G6JB 3MLJA 1YFYA 4ZU4A 3GHNA 5C8WA 1PGL2 1VBD2 4E2SA 3AYEA 1RINA 3M3OA 4JGYC 1GANA 2R072 4NHMA 1NZCA 1OFNA 2G9FA 1EYBA 4GA9A 4PIZA 3VZMA 5HXVA 3ZXFA 3N4MA 1RUNA 3KQRA 1RUD1 1QY4A 1WW5A 1QNYA 1QU0A 4QX5A 1RB8G 4MYEA 2ZMNA 1IGOA 2R041 4B4PA 2DFCA 2XL7A 1R092 2RS11 2ZPXA 1DFQA 1RJ8A 2DVDA 5JAXA 5C9AA 1BEV3 2E7TA 1OLQA 4D7YA 1R093 2WFPA 2XVKA 4S2FA 3ZXAC 2LUWA 5CBLA 4GH4A 5DZEA 4AHZA 4LO5B 4AI1A 1RUJ1 1NY72 3MIFA 1ND2C 2R16A 1NLRA 4J1XA 4HT1T 2GAUA 1JTZX 2XJVA 3MDPA 4LHNA 4XJ8A 1KDKA 4FO9A 3UKVA 1OKQA 4XBLA 2CL2A 3NWKA 5ABJB 1UW8A 4DMIA 2EAKA 3WQ1A 4NWVA 2RHPA 1NCQA 4SLIA 4YLZA 3ZXLA 2WNVC 4XFIA 3WDTA 2HWF3 3VGIA 1LR5A 3RQ0A 1MACA 3UKTA 4C1WA 1FXZA 3GZUC 2A75A 4P9WA 3RI8A 3AYAA 1ZRCA 3JQWA 5C9AC 1DBNA 2VNRA 2JKBA 3JD73 1TNRA 1CAVA 4GKXA 2UYBA 4Q0QA 1BZWA 4CP0A 1WBLA 4YGBA 2GC2A 2KXLA 2DVFA 2R073 3JB4C 4OFGA 1WUVA 4N53B 1CAXB 1DQ0A 4HLTA 3JU9A 4DZGA 5IK4A 4C0HA 1PK6A 2D7FA 4PDWA 4PLOA 5GLUA 2P3IA 3LB9A 2JG9A 1FMD3 3I54A 2BQPA 2VVEA 4L11A 4XILA 3WDXA 3ZN5A 3A0NA 4FXKB 4YZ5A 4Q8KA 2Y0OA 2PFWA 1A8MA 3KCXA 4AG4A 3KB5A 1PO13 4LA2A 4XTPA 5L36A 1IS6A 3K48A 1C4RA 4KU7A 3P3PA 5D8AC 1B35B 2WA4A 4IV3B 1V6NA 4AVBA 4CP2A 5GZFA 1UMZA 1UU4A 3ZN4A 2BGCA 3IN9A 1RUJ3 1YXWA 3CEWA 2RE9A 4MVTA 1U5ZA 2DWRA 5EJ3A 4M3CB 1OA4A 4I3PA 1R1ZA 1UCXA 3ZFGC 3CJIC 2ZTNA 4KNCA 5DUWA 4NO4A 4K1YA 1PM7A 3PMSA 2UURA 1CX4A 3SISA 2DCTA 4FPYA 4ISQA 1QJY2 1N1YA 3D82A 3WV6A 4WM7C 1RJ7A 2W52A 3MZHA 1LHNA 3CJXA 5CU1A 1KS5A 3SCHA 5DDJ1 2RS51 1FMD1 1NXMA 2D6LX 4B7KA 1CJDA 5ACA2 2ZHKA 4AF9A 2O8OA 3RJRA 3GALA 4Z1VA 5JZGA 1ZZ8A 2R1BA 4QPIB 3GZTB 4HN1A 4QPYA 1AR83 4LBKA 2BWCA 4YYOA 3UK9A 4YFWA 5C8CB 3TRSB 1PHMA 1RUD2 3WP4A 2W68A 3SITA 3KT7A 3LWCA 5FLIA 2XJPA 2A7AA 4LE4A 4KU8A 4XXPA 1HRI1 3B69A 3VBSC 3ZXKA 4COYA 1AL23 1NLSA 2GZWA 2DTWA 4XJZA 3CL1A 1QJX2 4EWAA 4K21A 1M06G 1RUG1 2Y38A 4XHBA 1LEMA 1SBFA 4XTMA 1PMIA 4K3UA 5FQ0B 2X29A 4E4SA 5KHJA 4J1WA 4L92A 5GLZA 1H8TA 2GALA 3VHRA 2XLAA 3VBFB 1MQTA 3IBMA 4XMAA 4N7UA 1IKQA 4FPGA 2D6OX 2DU0A 1Q8PA 3VZLA 3T2TA 4Q26A 4MGKE 3DV8A 1TMF2 4Q29A 2WNEA 4B29A 4JGYA 2ZBJA 1QNWA 4CDUB 2BEOA 4G9SB 2ZOEB 4S2DA 4AQ6A 5J09A 4HK9A 3BU7A 1G9FA 1NXD1 2A70A 1TQ5A 2ZGOA 4FBFA 1HXS1 2VQ0A 2K2SA 1ZZCA 4GWMA 3APBA 2WSVA 1AR63 1AL21 4MLOA 3FLPA 4AEKA 5I91A 3JBG2 1S0BA 2B5HA 1PNGA 1AJKA 1B09A 1QQP3 1SFNA 1LGBA 4L9BA 5IK5A 2RMU1 4URTA 1ULDA 2I74A 2XGXA 1W6OB 4IEWA 3ASIA 1JW6A 5K9YA 4META 4FOYA 3ZYJB 1BKZA 1KITA 3MIBA 2XBO1 3NVCA 2VNOA 4XIOA 1CAWA 3RZZA 1H2MA 2RJLA 2UY8A 2A3WA 1EPWA 5C9AB 2PAKA 3D5OA 4LLFA 3JQXA 3MPBA 1W6PA 4XQDA 1QJY1 1S0GA 1CPNA 2BW8A 2IC1A 5BXXA 1W6OA 5DDJ2 2PTMA 2P3JA 3LAGA 3SXWA 1PZ7A 1HV0A 4IERA 2EVXA 2WIIB 5T50A 1VP6A 1Y9QA 1FNZA 3BOWA 3D6EA 3O0XA 1RVF1 4AVCA 4KG0A 4XYXA 4XIKA 2ZX0A 1J59A 2CWSA 3UJOA 3V0AA 1I3HA 1KFUL 1TE1B 5AFBA 3M4FA 3AKRA 1R082 3ST7A 1VRH3 3RMYA 5FFOC 1VBD3 1MVQA 3ZFEB 1FOD2 1DZTA 3KT4A 1AYN2 4F8AA 1VAMA 3AM2A 5FO8B 1MEC2 2QKDA 3M1HA 3ZXDA 1MQTC 4BE3A 3MEPA 5HBAA 1AX2A 3WX5A 1AR62 4DOUA 1W6QB 1W6MB 1POV3 4PCRA 4XFHA 2D43A 2JJ6A 3AMMA 5A33A 5HI0A 1T6GC 1ZZ9A 4RHV3 4JDOA 3VKNA 2GN7A 4MUVA 2X5IA 3H7JA 4ES8A 4LO7A 4AGGA 3OGJA 1KXGA 2HWB1 4YVSC 1LJ7A 3M2MA 2Z5WA 1HDKA 4P9YA 3LA2A 4GULA 3AZYA 1GZCA 1ND2A 2E63A 2PHXA 4ASMB 3USUA 1KFXL 1PGW2 4QGMA 1ZREA 4MH0E 4A3XA 4IEQA 1ND3B 1S0JA 1UKRA 2B7YA 5L19A 2VOWA 4WBBA 1DYKA 3H3ZA