3WXPA

Structure of hyperthermophilic family 12 endocellulase (e197a) from pyrococcus furiosus in complex with cellobiose
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQAVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase A
publication title Structure of hyperthermophilic family 12 endocellulase mutant (E197A) from Pyrococcus furiosus in complex with cellobiose
rcsb
source organism Pyrococcus furiosus
total genus 72
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wxpA00
3HD8B 4HKWA 3LB9A 2VUJA 1OLRA 1OLQA 2BVVA 1YNAA 4HKOA 3WY6A 1F5JA 3WXPA 2BW8A 3WT3A 3AMQA 1BK1A 1UU5A 3VHPA 3VL9A 3WR0A 3AKQA 1PVXA 3MFAA 1XYOA 3VGIA 1KS5A 1BVVA 4S2HA 2C1FA 1XNDA 1OA4A 1C5HA 1XYNA 2JEMA 1H4GA 3WP3A 2DCJA 2QZ3A 3WQ0A 4XQDA 3VZOA 2JICA 3AMHA 3LGRA 2BWAA 2DFBA 3VZMA 2QZ2A 2VG9A 4IXLA 3VZLA 3VZNA 4XQWA 2DCKA 1HIXA 3B7MA 1XNCA 1OA3A 4S2FA 1XYPA 4XPVA 4H7MA 2NQYA 1IGOA 2VULA 3RI8A 1H0BA 1W2UA 1NLRA 2F6BA 3MF9A 1REEA 1TE1B 1AXKA 3AKTA 2NLRA 5EJ3A 3AKSA 3RI9A 5K7PA 1XXNA 2JENA 4S2DA 2B45X 1H1AA 1QH6A 1QH7A 4HKLA 1OA2A 1T6GC 1BCXA 3B5LB 2Z79A 2BWCA 3AKPA 3VZJA 2DCZA 3VHOA 1REDA 3WP4A 3MFCA 1XNBA 2VGDA 5HXVA 2DCYA 1H8VA 3AKRA 1UKRA 1UU4A 3O7OA 3AMPA 3EXUA 1C5IA 2D97A 2DFCA 2B42B 2D98A 3AMNA 3VL8A 3VZKA 3M4FA 1HV0A 4XQ4A 3AMMA 1UU6A 3WP5A 3WQ1A 3WX5A 1HV1A 1M4WA 3VHNA 4HK8A 1REFA 1ENXA 3WQ7A 3MF6A 2B46X 1KS4A 4HK9A 3ZSEA 3VLBB 5K9YA 1H4HA 4NPRA 1XNKA 4S2GA 3WP6A
chains in the Genus database with same CATH superfamily
2XBO3 4BU2A 5LA9A 1TZOA 3ES1A 3IBMA 4NHMA 3WDVA 2RDQA 3AK0A 3HNMA 3K77A 3NNMA 4ZXEA 1ZZ8A 3VBUA 3LFIA 3NV1A 2ORZA 1FMD2 1IZ3A 2A6WA 2WABA 1JOBA 4DY3A 4GXLA 3AKQA 1Q5OA 3IM0A 2EA7A 4JVAA 1RIRA 4MGKE 3TNPB 2OUHA 2VZVA 1XOYA 2OA2A 3ZXDA 4LTAA 3HNYM 1DHKB 1Z78A 4WZCA 4CDWC 2Q8DA 1V9U3 2WRAA 3V0BB 2G9GA 3RWNA 2JICA 4PDWB 4BMEA 3QCWA 4DPNA 4TLFA 2O0OA 2GNMA 4IL7A 4QGNA 4CP9B 4E27A 3KWVA 2WUHA 3PTYA 4XEZA 5LA1A 5A33A 2WS92 2ZGPA 2PLV3 3VDAA 3N9LA 3CQOA 5A6QA 1WCUA 4BXSV 2IVIB 2MHFA 1FYUA 3BVCA 4PLNA 4ZXKA 1SLBA 1CAVA 3S30A 4YFZA 3BKZA 4QQLA 3H1WA 3WF4A 3I3BA 1AR83 1RJ8A 4LMFA 2ZKNA 2QFEA 4W8JA 4AI3A 4E2SA 5KXCA 1QJY2 1SZBA 4YRDA 3LEIA 2A5ZA 2CL2A 4ASMB 4BE3A 4DY5A 5A3NA 4XFHA 3S57A 2JDPA 2UURA 2OT7A 1H2KA 4PT6A 1ULPA 5C7GA 2WFF2 2WO7A 4HETA 4MOAA 4AQSA 2UWBA 4N9IA 4EWEA 1JYTA 5JPMB 1R093 5I91A 4A6SA 4EJRA 1VALA 2NLRA 1WCQA 3OG2A 1CZTA 1QJU1 2Q30A 4ASKA 1N1TA 1O5LA 5IAXA 1WGPA 2DV9A 1XXNA 4R52A 5A80A 4LHSA 1KJRA 1H1AA 4NVPA 4AEDB 1QH6A 4B7KA 2FHRA 2C5DA 1OH4A 4LBJA 1WKYA 3ZYHA 2JE7A 2VOKA 4HFSA 4Z2WA 5E88A 4LHNA 1LECA 4NIAA 4UW3A 4QPGA 2CV6A 2VCBA 3A22A 1Q8SA 4QAWA 1TME1 1EPWA 1WWYA 3MGUA 2B4KA 5C8CA 4X8PA 3EJKA 1S0BA 5HXVA 1S55A 1Z7S1 3PHMA 2YGLA 2VMDA 1I3HA 4GD4A 5FLJA 3I3MA 1W9FA 5G04L 4MGQA 1UKRA 4JKKA 2HWE3 1JUHA 4GH4C 4N43A 1ODMA 2VBDA 3KM5A 2A71A 1QJEA 3VV1A 4CEWA 1H8TB 4FFFA 3GGLA 3ZSLA 1EPZA 5FOJB 1ND3C 4RR3B 1GQPA 2N7GA 1NY71 3AMMA 3FHQA 2VVEA 3H42B 4KL1A 3U10A 2WSVA 3WX5A 1S4CA 4I2OA 3A4UA 5FKBA 5A7QA 4AI2A 2GNTA 3MLLA 2VY0A 3N35A 3TB0A 1CQ9A 3M3CA 5FIXA 1YUDA 3A23A 4LBOA 3LB9A 1QEXA 2R062 3HOBA 4LOTA 5FZAA 4G4FA 4PI2A 2ZACA 5EWSA 3ZN4A 5GLTA 4IERA 2OS2A 4FP2A 2VZTA 1FMD3 1ACCA 4IQPA 4XF3A 3WDYA 2L9LA 5JI9A 4WM7B 5KXBA 1UYZA 3ILNA 1CPNA 2P37A 3NVCA 1BK1A 3L2YA 1MEC1 4AHXA 3PVNA 3KMHA 4A3XA 2XGXA 3RJ2X 1E5IA 1W6PB 4BXFA 2KR2A 3AB0A 3I49A 2IFRA 5FYMA 3PDQA 2WDBA 3HN1A 5C3QA 1PK6B 4BCUA 5SV5A 5ACA2 2O8QA 2XHNA 1OUSA 4DOUA 3TYJA 2HWD3 3NJXA 5GALA 1RUD1 3ZIWA 3WNOA 1WCKA 1X8MA 1SACA 1G7YA 2KA3A 3PUSA 4IE6A 4AYUA 3FMGA 2G9FA 1R1A2 2AREA 1CX4A 3PVEA 1FOD1 1OOPC 1ZRRA 4IXLA 4JC1A 2B39A 4JGYC 5FZ6A 5F7UA 2FCTA 5KHGA 1RB8G 3MW2A 2Y6JA 1MZ6A 5L9BA 4KU8A 4R8HA 2XQXA 3MUZ1 1YXWA 4XDPA 4DO0A 4GB32 5J96B 4QWNA 1POV3 2HWB1 5A3TA 2AACA 4OUSA 1QJY3 1W06A 5CFDB 4L8QA 1LOAA 4XOGA 4AFCA 1X7NA 4QX7A 4YVWB 1H2LA 5A32B 3PUAA 5CKNA 2NM1A 2EIEA 4IV1A 2DUOA 1LR5A 5FFOC 4E8DA 1H6YA 1LRHA 2WNEA 1CWPA 1IKPA 5CYYA 4IEPA 4D7YA 1F15A 2DWRA 2FZ1A 4MZUA 5BUVA 5HBAA 4QKBA 2RMU1 3JXSA 3AKTA 2RHPA 3P3NA 2DYCA 2Z2SB 5DZEA 4Q5OA 4GJYA 5F2SA 1RVF1 2GSYA 2WQ4A 2IFWA 3LPGA 4ZS3A 4BOWA 2AR6A 4NHXA 4Y24A 3RMYA 3MO4A 1ND2A 4PF5A 3H0OA 2D5HA 2V72A 3LEKA 5HCFA 3NAPB 1GP6A 2Z79A 4YVSB 1QQP1 2Q4SA 3VZJA 1A6CA 1OT5A 1BHGA 2JG9B 2XJQA 3DF0A 3PU3A 4RQPC 2QDRA 4NHKA 5JXGA 2VOXA 5C9AA 5A3PA 3GJBA 3U14A 3AFKA 3CL1A 1W6QB 2W91A 4FPGA 5FV3A 1O3QA 3AFGA 3K51A 4JRLA 3FFZA 1HQLA 3AMNA 2YPJA 1O91A 3C7GA 3OY8B 4FPKA 4LK7A 1UKGA 1JZ7A 4C1XA 4LO5B 5J7MA 1F9KA 1FV3A 4ES9A 1OLMA 4HK8A 5L73A 4CEYC 3DPRC 3RFRA 1CD3G 2HWC2 4DXZA 2DVDA 2J1EA 1H4HA 4CCJA 3O1PA 1D4M1 3RZLA 4BIOA 2BBAA 3O1OA 1OQDA 3IDAA 4PLMA 3UV9A 2EXJA 3SLIA 2J1SA 3HBKA 1NCRB 1ENQA 2X5IA 4YG0A 3N9MA 3WZ1A 2SBAA 3MIFA 3B01A 3VD7A 2ZGLA 1BJQA 5BNNC 2VXRA 3K75B 2ZGSA 4P9XA 1XU2A 5KHHA 3VL9A 4ZZ8A 5F1RA 2WSUA 5ERLA 4AG4A 4IDZA 1O3TA 4N53A 1VBE3 3MFAA 1S0EA 4CU9A 1XQNA 2CDPA 3KT1A 2QQJA 5FWJA 1XNDA 4FTSA 3U0ZA 5ACA3 1G9AA 5D21A 2JECA 3ZXEA 2GMEA 2ZOEB 5C6CA 4MH0E 1H4GA 1GQGA 3UK9A 3K4AA 2QZ3A 3VBOB 2SLIA 3ETQA 5FUPA 5C4WB 1IS4A 2FDKA 5EFUA 1HRI2 4YGBA 4A7KA 2PFWA 1ZREA 2QZ2A 1GBGA 1S0IA 4OHWA 4B1MA 4NHYA 4XXPA 5J37A 1NT0A 1IOAA 2OW4A 2Y33A 4MGZE 2WZPP 2HYKA 3HT1A 4YSFA 4COZA 5C3RA 1YJKA 3QH7A 4XBLA 4DRRA 1D2QA 3NV2A 1AJOA 2J42A 2GN7A 4DMIA 2JDYA 1MPXA 1UY2A 1W04A 3ZDVA 1PNFA 3I2DA 3JD71 1TMF3 1CIYA 3NO8A 1QDCA 1RUE1 1VRH2 5HXMA 1J3RA 5EPAA 3DECA 1JU3A 3ECQA 4XPVA 3BTXA 2YC2A 3V0BA 4BQ3A 3H7YA 3NKTA 4PDWA 1H0BA 1VBB2 1S0GA 1W28A 1SLIA 4FFHA 2F6BA 1AYN3 3P6BA 4A42A 4CP9A 5IK8A 1EUUA 2RS33 4XETA 2DVAA 4FAHA 5DMYA 1LHNA 2JG8B 4INDA 2X53S 1PZ8A 3AKSA 3FHAA 4MXWA 4YWAA 4QGMA 4D7SA 2RVAA 1FV2A 4AFAA 1UZYA 2VTXA 4SLIA 3WEZA 3FC0A 3BIWE 4XUQA 5HCHA 1YQ8A 1J58A 2V09A 5L7OC 2AENA 4I09A 4LKDA 5SV8A 2Y8KA 4MGTA 5FXXA 1AR72 3D0SA 2GNDA 4B3NA 2P3IA 5AVAA 1GLHA 3H9AA 2HEYF 1OQ1A 2BJSA 4R9AA 5FP9A 3RZJA 1H8VA 4PQ9A 1CZSA 4WV8A 1JOJA 5FMCA 1X82A 3IN9A 1V6MA 4Q4Y2 1PMHX 3U07A 2HEVF 1POV0 5J36A 4CCDA 2KM2A 5JDBA 3ZFGA 4AEDA 2VZRA 1UOGA 3MW3A 4CUBA 5FZFA 5H9RA 2D5FA 3USUB 4CCNA 2XLFA 3M1HA 2HKXA 1SFNA 3VHNA 1Q8QA 5IK4A 2BYVE 5KHJA 3QH6A 3ZXGA 2H6BA 3M3OA 2NPIA 2AZ5A 3GALA 4Q2FA 4TWTA 5FP7A 5FZOB 4R9CA 1BZWA 2RE9A 3DYMA 2WA4A 4HBNA 3T0BA 2P2KA 1W9TA 4XABA 4JHZA 4ASLA 2WZR3 3WF1A 2XBO1 2JDKA 5D2AA 1MQTC 4B4PA 1OLRA 1OPOA 4BQ2A 1I5PA 4WVMA 1AL21 1EP0A 5KWRA 4OCTA 2A3XA 4HKOA 1F5JA 2BW8A 4YARA 1QDOA 1H8TA 3EMRA 1RVF2 2A7AA 1IQAA 1GQHA 2BQPA 3AL5A 1NYWA 4EQVA 4CXYA 3IZOA 2BGCA 3LDBA 4XW3A 3T1MA 4K3UA 3H8XA 4QDSA 3A0KA 5AFBA 4BK5A 1DFQA 1SMVA 4Q1PA 3IKWA 4MGIE 3N7MA 1RUJ2 4YZ5A 5F37A 2JEMA 2PHXA 2VUCA 2W0XA 2XR4A 3HAGA 4HG6B 1JW6A 3B02A 2UWAA 3OPTA 4YW1A 3T2PA 4CZSA 3BOWA 5F8PA 1SLTA 3K4ZA 1HRI3 2GC0A 2E32A 1YC61 2BNMA 2XJPA 4XJ8A 3HJRA 4HOOA 3JB8A 2PAKA 3VD4A 2DU1A 2ZKLA 5F5QA 1URXA 4WM7A 4HANA 3FLPA 2YB7A 1E57A 4IW3A 4AI0A 4EWDA 4Z2AA 5JSRA 2YU1A 2VG9A 3NJVA 4CUAA 3WNXA 2PLV1 1AXZA 5A6YA 1JZ3A 1RUC3 1W6PA 1ZA4A 4OFGA 4CPBD 3LA7A 4YG3A 4RGGA 1HJGA 3IPVA 5FPBA 3ZXLA 2ET1A 1PK6A 4AQTA 2HH9A 3V0AA 1AR81 4LLFA 1D4M2 5HCBA 2W92A 4EV0A 1EY2A 3MHZA 4YM3A 1GU3A 4KWLA 1FPN3 1RUG3 2IXCA 2F4PA 4AOCA 1KGYA 1BK0A 1PGW2 2VL4A 2WNVC 2EXHA 2BRTA 4ZONA 3RZZA 3U1XA 4FPOB 2Q1ZB 3WNNA 1QXPA 5JSPA 4AVVA 3FUOA 2F4LA 4YPJA 1R091 2BNOA 1IPJA 4Q4V3 2J1VA 2XUMA 4XVHA 3S5AA 4FSJA 5HCAA 4JTNA 5FLIA 4A7YA 2XQRA 3H3UA 3H8RA 1AUYA 3BODA 5GLZA 3UYJA 3HWJA 1OMIA 2VNGA 4IV3C 4N7UA 5FMDA 3WLUA 1QOTA 4Y22A 5JXIA 4FO9A 4GMP3 4NE9A 4FXGB 4P9JA 2XOMA 4QU1A 1MS5A 1VAKA 1W9WA 5K0UA 4H3WA 2ORXA 3NKGA 4BLJA 2R0HA 4AEJA 2AC1A 2JE9A 2OX0A 4FCAA 3RJRA 3TNQA 1XNBA 4MLOA 5I8YA 3GHNA 5J48A 3AXEA 3O12A 1RC6A 1RUNA 5C8CB 2VMEA 4Q4Y3 3GNEA 3GM8A 2WO2A 4XC9A 1WW5A 3QD6A 3AMPA 4FOYA 4Q4W1 3CBNA 1WA6X 4QB2A 4XJ9A 2QQLA 2WWJA 3J8F3 1TEIA 2OIIA 2ES3A 5JIUA 2A3YA 4ES8A 2DF7A 2YXSA 3ME2A 1NZCA 3AZXA 3N9NA 2YC0A 4HZFA 4CDWB 3J4UH 1MZEA 1KS4A 3WDXA 1DLLA 1RHI3 4YVSA 1K3IA 3IDEA 3HIFA 2JG9A 2W46A 3KCXA 4OULA 3POEA 3BIEA 3ACFA 4JGZC 2VO5A 3Q8FA 1W6QA 5DDJ3 1PO13 1PO23 4MSVA 1E5SA 3AP4A 1KD7A 1WA4A 5IK5A 1MVEA 3MW4A 4Y4RA 5DUXA 2NN8A 2Z4FA 1JHJA 3RG0A 5FK7A 5FYSA 3OY8A 2VM9A 5LY2A 4XF9A 4O65A 4DFSA 5LCWL 4RN5A 4XTMA 1NLQA 4QT6A 1VMFA 4FPHA 2A1XA 3AYDA 5J3UA 3ZFFC 3O0XA 5F39A 4Q0UA 3AZVA 4PJYA 4XFCA 3H1YA 4JV4A 2VCAA 2ZAAA 2UU8A 5FUNA 3OGGA 3ZSJA 4A44A 5FOBB 3J7NA 4DEVA 2AGSA 4RS5A 1ZZ6A 2Q5TA 1W3XA 1PZ7A 3A7QA 3T2TA 2ET7A 3MPPG 2HWD1 2CGPA 3AMHA 5A1AA 3BOPA 2CTVA 3KV9A 4I0BA 1LOCA 2WNUC 4NR1A 2JXAA 2C9KA 1OURA 2E51A 3VBSC 4OUEA 3PJYA 4DNYA 1CJDA 5FWEA 3WCSA 4F83A 3ZFEA 2FDIA 1KXGA 3O0WA 4LEJA 1VRBA 3IIIA 4B7EA 3DL3A 1JYNA 1RUF3 3B7MA 4Q0SA 2QQKA 3WW3A 3MICA 3C7EA 1F5FA 4K1ZA 3H7JA 3T0AA 4M4RA 4UI9L 4TSVA 4YM2A 1X9PA 3VBOA 1BBT3 5DUWA 4X6RB 5C4WA 4NIIA 1WD3A 5FPVA 3RDIA 1NG0A 3WF2A 5E1RA 1AL22 1U5XA 3E6BA 3I3EA 4MUVA 4PF1A 5GLWA 1XBFA 4LXLA 3EBRA 5F6LB 4AVCA 1NA1C 4IV1B 4AFDA 2ATFA 4ZHNA 5JZGC 4E4SA 2R043 5ANQA 5T55A 1HB3A 2R073 4UWDA 2ZMLA 1DF0A 2J22A 5E89A 3ZO0B 2GU9A 3KHCA 4BIFA 5IVYA 3LFMA 2GMPA 2ZEZA 2BTVC 1QU0A 2EICA 3AM2A 4DXRA 4FPLA 1ULEA 5EQUA 4UFJA 2ETEA 4QX1A 1ND2B 4GAZA 3OB8A 3B5LB 3D8CA 1VB4A 1GR3A 3CJIA 5FDBA 4K9SA 1L7QA 5IVVA 3MBWA 4YLZA 5IWFA 1ZBE3 1K5MA 1PIV2 3SKVA 1X8EA 3EO6A 2XH6A 2VGDA 1RMU2 3I2HA 4LPLA 1PGSA 1GNYA 3O7OA 4X8NA 3TWIA 4J1WA 5FZEA 3VDDC 4DB5A 4GALA 1V6IA 2DFCA 4LOSA 4CDXB 2VNOA 2WKKA 5DUVA 3VBUC 5D8AC 2YBPA 3JUUA 4QPIC 2DURA 4BQ1A 1PMIA 4QPWA 1IKQA 1GFF2 4XJUA 2WINB 4X6QB 1WLDA 2QQWA 1HX6A 4ISRA 3IMNA 3OPZA 3ZYBA 4SBVA 5IVBA 2XPJA 3DKWA 3CF6E 5CIRA 4NPRA 5C5UA 3M70A 2D44A 1GZWA 1YLLA 4D6QA 2W39A 4CXWA 5C5TA 5C70A 3KCCA 2C4XA 4HKWA 2LRPA 2TUNA 2PXJA 2R1DA 1K45A 2VUJA 3POFA 4GWIA 5FYIA 3JU9A 2BVVA 1OOPB 4HL0A 3PIGA 1U5YA 3WY6A 2X5IB 4PHZA 1QXRA 2ZGKA 5IUQA 3CMGA 5LK7B 4Q27A 4CDUA 5FYHA 1RTVA 4XMIA 2QKDA 4P00B 4Y1XA 1AR91 1Q3EA 1VBE1 4JDNA 3UKTA 1KS5A 3LOIA 4N53B 3GCXA 2DUPA 4FPYA 3RZKA 2YROA 5FZOA 4ZS2A 4DUVA 2A6XA 1ASJ3 1IPSA 3POGA 2QQUA 5FZ3A 1FATA 3ZMNA 4QQHA 5FLHA 3IMMA 3RYRA 3TRSB 3BPZA 3TAYA 4PI0A 2PHUA 4LA2A 1DGWX 3WF0A 4OHYA 1SHWB 5JAXA 5FQ0A 1QGLA 1COV3 3B9CA 3LSDA 2Q0AA 3TN92 2Z42A 1XSQA 4AGVA 3U4SA 4XILA 1N3PA 5KXDA 1HB2A 1N3OA 4C1WA 2BGPA 4XQWA 4W65A 1CAWA 4TYSA 3J7MA 1PHMA 2D40A 2YBSA 3LWCA 1QIQA 2OZJA 3VBRA 1V6OA 4CU6A 3ILRA 1HIXA 2MNGA 1W8NA 5KBFA 2XJRA 3AZZA 5A1FA 1DDLA 5A7OA 3WNMA 3KV5A 4BHPA 1TMF1 4BPZA 4RQPB 1UN1A 1GNZA 3ZR5A 3ILFA 4QPGC 3VBHC 1W2UA 4N9HA 3RNSA 1LB2A 2A73B 5A3WA 2ENRA 4PBOA 1AYN1 3T4HB 3U37A 4F7ZA 3GZAA 1NZIA 1O5UA 2X05A 2WN3A 4LBKA 2RS31 3DXUA 1JOPA 1ULDA 4UYBA 5EJ3A 4LLOA 1C3HA 1PVC2 1BKZA 1CAUA 4MXWB 4P9LA 1UXXX 2YU2A 2B45X 4CEWC 4CEYB 4CDQA 4XCBA 1LEMA 5GZEA 2RS12 3SCGA 4Y1VA 3DV8A 4Q4X1 4UFLA 1Q43A 3E1F1 5JI7A 1HRV3 4Z8BA 4DUXA 2GALA 1QWRA 1O4TA 2QDNA 1I1EA 1AHSA 4ET7A 1ENRA 2X10A 4D6RA 5CADA 1KDMA 2OQ6A 2UYAA 2E7TA 5CKMA 1REDA 2WYFA 3OUIA 4LE3A 4LORA 3JB4C 1RMU3 4A45A 4BB3A 5BNPC 5DG1A 3O1UA 3GBGA 3VHRA 2IVJA 5FRAA 1GP4A 4RHV3 3CIHA 3I2FA 2R32A 4NAMA 1RUI2 1DQ5A 1C8NA 2DUQA 4RGAA 2ZBJA 3POSA 4QKNA 3UNPA 5FZBA 2IXLA 4GWJA 2D98A 2HWF3 4QM9A 1VBD1 3VL8A 3I3DA 4L9BA 1LOFA 2EALA 5FZ7A 3SXWA 2I07B 2EIDA 3W9AA 2H0BA 3ACHA 2RM23 3KVBA 4MHRA 1VP6A 4LIUA 4NOTA 4BLIA 3ZFGB 2Y6FA 3FBMA 1LGCA 1REFA 1LGBA 1RUH3 5FTTC 4JQTA 1JYVA 1JMUB 1MR5A 1DQ6A 2ZHNA 5FAXA 1AYM3 4FAGA 3N9OA 2YFUA 2RR12 3HD8B 1C8M3 2VBBA 3U75A 1WMFA 3D3AA 2VNVA 5FZHA 2WQZC 4CE8A 2O1QA 4L11A 1O7FA 1AX0A 4IEXA 4WVMB 1NE4A 1NXMA 2MEV2 2R0FA 1W8TA 5C3SA 1QJX3 4L99A 2ZEYA 5FXWA 1FX5A 3SH5A 2YDEA 5FZ4A 1M06G 2D6LX 4QX2A 4AI9A 4B8EA 1VBC1 3N7JA 4EN0A 4CDWA 1QJFA 3WQBA 4M4PA 4KNCA 1C5HA 3K3NA 4O9GA 4OHVA 2P6CA 1J83A 2QTWB 3WP3A 2DCJA 3J26N 1AJKA 2C6SA 4XUTA 2PAMA 5F3EA 5A3LA 1AR62 3S0MA 3I97A 4M3CA 5FO8B 5AC92 3LGRA 3KF3A 5J98B 2I45A 1UMZA 4FTBA 1XE0A 1ZBA2 1V6NA 4CRQA 1O4YA 5I0SA 3WUCA 1HXS2 1D0GA 4J25A 3HQXA 3VZLA 4ONUA 4XF1A 3ON7A 4K20A 5GLVA 4EN8B 2GH8A 1UZVA 2VOWA 2I74A 2WAOA 4UF0A 1RUC1 2AEYA 1ZRDA 2NP0A 1PMJX 4H2AA 3HN3A 2JJ6A 4QX8A 5H9QA 5I8SA 2RG4A 3IPVB 5DQ0A 1F35A 4Y20A 5A3OA 1W8UA 5FZKA 1XYPA 2H6CA 2VCCA 4LBQA 3THCA 4H7MA 3V0AB 1FAYA 3MPBA 4PQQA 1FPN1 1RUG1 1U12A 4NRQA 2Y6KA 5DAXA 1UX6A 4PIYA 3W58A 4QHBA 3LDRA 2PHTA 1TNRA 3I54A 3APBA 4Q29A 1JZ8A 2WC2A 1AXKA 1BXHA 2QVSB 2WS93 3MYXA 1XNTA 3ORJA 1EV11 4XURA 2WR9A 4Q4V1 5LBBA 3UETA 3ZSMA 3ST7A 2RS13 4XHXA 5CG8A 1TVGA 2BUKA 3W5MA 4FVVA 2HBUA 2YBKA 5FYVA 2CGOA 4GMP1 4Y22B 5L9VA 2W1WA 1OVPA 3KVAA 1WMEA 4AHYA 4OQ8A 5GZFA 3Q9OA 2ZEWA 4CU7A 1SBEA 2WFF3 4L2NA 4LBQD 1OHFA 4GH4A 5K0UB 1RUI3 3KZ4C 1R081 4N7IA 1IPKA 3N9PA 1UU4A 3E6CC 4E4DX 4D69A 2P5BA 3W5NA 3I2JA 3LIGA 4V1PA 4KGQA 1DQ1A 2VC9A 1AL0G 1VMHA 2O8OA 3ELNA 1ULGA 4DUWA 1GZCA 2YC4A 3R4DB 3J8F1 4BQ4A 3WP5A 1GWKA 5FJKA 5FY1A 5JXJA 2AUYA 5BNOC 1LTEA 5JOXA 3WQ7A 1ZZCA 3NJZA 1UO9A 1WW6A 3HQUA 5LA0A 4Z07A 3TBDA 3DUIA 1TG7A 4FOVA 4G9SB 3RRDA 3KCYA 3OGVA 1RHI1 1V6LA 4UFHA 5EXOA 2RV9A 5B4XA 2NMNA 1OSGA 2ZHKA 5GZCA 3ZYIB 1SG3A 4HN1A 4O9EA 4KWUA 4WVZA 5DDJ1 1JH5A 1LHUA 1PO11 2VVFA 1H6XA 1PO21 2K0GA 4V2WA 5DAQA 1MS1A 4WM8C 2XJSA 4M01A 1O8SA 4CDXA 4R9DA 2J1UA 3WVJA 3T2OA 3U78A 3WR0A 4FBFA 3CZJA 2PQQA 5H9SA 1CONA 2GN3A 4FOWA 4QPYA 4Q4X2 3NNJA 1WBFA 3LAGA 4AK3A 1YJLA 3MV01 3O0VA 1OA4A 4MX3A 3N36A 4K40A 2Y0IA 3VD3A 3NSTA 2R063 4LQRA 3OBTA 5AC93 2YGMA 2ZX3A 3ZYJB 4QHZA 1X36A 2A3WA 1NAEA 4RS5B 1ZBA3 1OOPA 2MPFA 4JGYA 4IEOA 3SHRA 4AVSA 4E9KA 4XUNA 3WG4A 1ZRCA 1HXS3 1OI6A 3KS7A 2I2SA 3H1MA 4AAPA 1ALYA 2XWBB 4BQ5A 3MIBA 1Y43B 1CIWA 1WMDA 1QJU2 2J1RA 3VZNA 2IUWA 1AX1A 2CDOA 3IDBB 3BUCA 4H14A 4IV3B 1V6KA 1QF3A 1J1TA 1Y9GA 4XJAA 5I93A 3ZFEB 2FCUA 1GYKA 1RUF1 1NE6A 4K7JA 4WBBA 5CFCC 2DU0A 4ARYA 1OA3A 1W39A 5FY5A 3JBG1 4LHKA 4XDQA 3ATGA 1UY0A 4W6YA 1PGL1 1WW7A 2P1BA 1TME2 1HQNA 3DYOA 3QOPA 1RITA 2CAUA 2R16A 1LHVA 1BBT1 5FP4A 1EYBA 1XU1A 1JBCA 3S6PA 1KEXA 1C4RA 1Y3TA 2GZWA 2PTMA 3MIDA 3SH3A 2IZWA 1Z7S2 5DAWA 1REEA 4BYYA 3PVBB 2VMGA 1R1A3 1IS5A 4PIXA 4Y33A 1AXYA 4AEMA 3WNKA 2R041 1DG6A 5AFEA 2GC2A 2OPKA 3KV4A 1G9FA 3DKQA 5JPNB 3WOGA 4KG8A 2PYTA 2JENA 1NY72 4GB33 1UPSA 2JD4A 3LCPA 3OSDA 1VBC2 3MIGA 3EYPA 2VZ3A 3FWEA 5KHKA 3WHTA 1BMV1 3UESA 1XC6A 5FY9A 2OKXA 4KQ7A 4RQPA 1EAH1 1UOBA 2G19A 1G8WA 1BCXA 4JGZB 1IQDC 3C7HA 3IIAA 4Y1UA 4ZKTB 1Q8OA 2HEWF 4XUPA 2PN5A 1F4HA 3U11A 4OI0A 1H1MA 3CJIB 1GOGA 1ZBE1 2VQAA 5JVVA 2W94A 3RZMA 1I9RA 5FZ0A 1K5MB 3VDBA 4XDOA 3BU7A 1SEFA 3FLRA 4LT5A 1KQRA 2XMLA 2VE1A 4MV2A 1J84A 2PHLA 4CCLA 1PM4A 2FQPA 3ITQA 4E8CA 3GHMA 1SBDA 1CESA 4XIKA 4CTEA 4EYUA 5KC6A 1MZFA 1HV0A 3M4FA 3DPRA 4CEYA 1MEC2 5FYCA 3KGZA 4RR3C 1N3QA 5EJ1B 2OPWA 2FCVA 5JUVA 1GUIA 2Y34A 4LBNA 3MF6A 4ATEA 3ZLIA 1S1AA 2VTFA 4A4AA 4LKSA 4GQ7A 5FZGA 3ASIA 4DXTA 2QNKA 4RFT0 1OD3A 3SKJE 3WDWA 1RJ7A 2X29A 1GZWB 3UKNA 1RUD2 4LKEA 5IHRA 1XPWA 3SNMA 2WNUB 2LROA 3KQRA 2ERFA 1Y9QA 2DBNA 3N4MA 1O3SA 3NRUA 5JLVA 3UJQA 1EV12 1GMMA 2E26A 2JIJA 5C33A 4XTPA 4MGYE 4QDQA 2E31A 1X9TA 4AVTA 1FOD2 1CAXB 3VKMA 4WM7C 4LBMA 4XUOA 1W0OA 4LUMA 1WD4A 4JQRA 4YZ4A 4CDUB 1WLCA 5K4LA 1VBA1 1FNZA 2PQSA 2VW2A 2WN2A 4W50A 1DCSA 1STMA 3RYKA 1J3PA 1OFNA 1UL9A 1BEV1 2C1FA 2HWB2 2HWC3 2RS51 2YYOA 3OOXA 3WW1A 4ZZ5A 3TEZA 4K21A 1JODA 1QXJA 4AI1A 4A6OA 1PK6C 1T2XA 1ASJ1 1ULCA 2DDUA 5G05L 1A8MA 1NA1B 5FP3A 5JZGB 3OGRA 1ONAA 1I6XA 1US3A 1Z0HA 4FP3A 5IFTA 1GP5A 2DFBA 3VZMA 4QGLA 1JZ6A 2RJ2A 2RMU2 4UOJA 3WD5A 4AGRA 1COV1 1XB9A 5FQ0B 4JHTA 4OMDA 1UIKA 5FR3A 1LU1A 3HR9A 4CPBA 1HW5A 4ARXA 1UCXA 1CAWB 3A0NA 1OUXA 4HLTA 1A3KA 3VBRB 4FTEA 1W8HA 4KBBA 5CFDC 4RFRB 1QQP2 4KG0A 2VULA 1F2NA 2VNRA 1Z7S3 3E97A 4YVWC 1PNGA 3VDDB 1V9U1 3UKVA 2AH2A 3CO2A 2OYZA 4JAAA 4MHUA 2OZ6A 1JU4A 2XWJB 2P34A 5T5OA 5DG2A 4KH9A 4BA6A 3KSCA 5D8AB 5DN2A 3ZXJA 1ODNA 2VR4A 4LKFA 3RI9A 1GZTA 4OZXA 3I4IA 4R4XA 4TLGA 4BJ0A 4A7ZA 4HSLA 2VZUA 5E8AA 3LIHA 1CAUB 4NO4A 1WCSA 1HJFA 3M2MA 1OA2A 4J1XA 4CUCA 4CDQB 1VRH3 1UX7A 3E5QA 4A41A 1HRV1 3LD8A 3P1IA 3PMEA 4HVOA 3WUDA 5FZ1A 2LALA 3I2KA 1NX9A 4Y1ZA 3DYPA 1VBB3 1SCRA 3NAPC 4ZY9A 1C28A 4I02A 2ZGTA 2JG9C 5KC5A 3ES4A 1OKOA 1GOHA 2JX9A 3ZIXA 4YGEA 2F17A 4RHV1 5C8WA 3POJA 2D3SA 2Y60A 4C8DA 1IS3A 1LOGA 4YW7A 1MEC3 2D43A 3UGHA 4Q0VA 5C3PA 2HWF1 4L92A 5DZFA 1ZX5A 2DBIA 4C91A 4YW4A 5FZIA 4FPCA 5BPXA 2WFPA 4UT5A 1LESA 3NNGA 4XAAA 5EV7A 2GDFA 3VLBB 3WW4A 1MQTA 1AR73 1XNKA 2RDNA 4P9IA 4S2GA 2FMDA 3BGAA 5IW0A 1AYM1 4QHOA 2WZEA 5EJZB 5F5IA 3O1VA 2JKXA 1C8M1 1A78A 1LOEA 2YHJA 4BMBA 5ABJC 3S7IA 4AF9A 4HPKB 2J1TA 4XZUG 3PNAA 1NCRC 4BISA 3MI8A 4LHLA 2EXKA 4U2AA 2XLAA 4GJZA 2W2IA 1B35C 2HWE1 2RDSA 3M3IA 1OFSA 2OUJA 4AXOA 4NPLA 4U36A 3JQXA 4XCAA 5FKCA 4P02B 3B94A 4XFGA 1G9BA 3AYAA 1PX3A 1BMV2 2J1AA 1DZTA 1ST8A 4QQ2A 1GZ9A 2GMMA 4DINB 3JD72 1KFXL 2D6OX 3TEWA 1RUE2 3TEYA 4NIDA 1ULFA 4KU7A 2ARBA 1NOVA 2IXJA 2VOVA 2WBKA 3VBFC 3GCWA 1CVNA 4JZRA 2E7QA 3M7AA 3BPSA 2CWSA 3H8UA 1R64A 4AAXA 4IE7A 5LRSA 4M00A 2D6PA 3RGBA 5CNAA 4D94A 4M3CB 5CA6A 2P3JA 4ITCA 4LO4B 4UW6A 3WHUA 1VIWB 4BK4A 1FMD1 1YFWA 5FK8A 2ZZJA 3UGGA 1RVF3 3TOJA 3OGSA 2P17A 3V56A 5JSOA 1OQEA 5J09A 1C1FA 1CJPA 4UF0B 1W8OA 4E2GA 1RUJ3 4NRMA 4S2FA 2VBPA 4MADA 2CAVA 5LA2A 4CCMA 2VCMA 3G7DA 4K1YA 4Y20B 4UXAA 3SEPA 4LBQB 2KXLA 5JMOA 2VMCA 4ISQA 4AHZA 1YQ2A 1OXCA 3AP6A 1DIWA 1NQDA 1TE1B 4HXCA 3E5UA 3E6DA 1DZQA 5LEJA 1RL3A 2UWCA 1W6NB 2JG8C 3EQEA 4IV3A 3ZMOA 3RZHA 4AEKA 2XKPA 1W2AX 4W6XA 1VBA2 5FZMA 4YNIA 3H3ZA 4HKLA 2EIGA 4AL9A 2WNOA 3K46A 1D4M3 1POV1 3NV3A 4NAOA 2WT0A 4BQYA 1QJY1 3POBA 2W87A 5GM0A 1UQXA 2QQMA 3ZN5A 2W3JA 2UY9A 1G86A 3U4XA 5A6XA 4PCRA 3AVRA 2JE8A 4QM8A 5CKQA 1NQJA 5M0TA 3ZXKA 1QMJA 2CSGA 2XBO2 2WFF1 5EYXA 1SLAA 2XDVA 4GH4B 5C71A 1UIJA 2Y38A 2A70A 4EROA 3EHKA 2YUEA 3BYWA 1IG0A 1ND3B 5KR7A 1C5IA 1WZXA 1ENSA 3WDTA 1GV9A 1YQCA 3K3OA 1WLTA 2PMWB 1UU6A 4QMAA 5F2WA 1MS8A 1HV1A 2IXHA 4IUGA 4XYXA 1N47A 4JGZA 5T54A 1NCQC 1OH3A 2P4EA 1JHNA 4OHXA 3VB9A 2LUWA 5FZLA 3RMXA 1I5ZA 1YIPA 4H55A 5IVFA 3ENRA 5IJRA 4OLLA 1UY4A 3OTFA 3RYPA 1OBNA 2E33A 3IAPA 4FPJA 2R6QA 2WT2A 4HONA 4XJZA 5A7PA 3WXPA 2D6KA 2VAUA 3X29B 3WT3A 2ZX4A 2VD7A 3NNLA 3LKJA 2ZHLA 2C9AA 3K4DA 2PLV2 4LIVA 1WCDJ 3ZFFA 5DXDA 2TEPA 3N7LA 4JX0A 1DP0A 1PVXA 1VE0A 3LPFA 5FZDA 5I0UA 1MVQA 5ISLA 1POQA 1DQ4A 1SDDB 5C9AB 4K6BA 4XFAA 4QX3A 3IDCB 3MLJA 5GKAC 1APNA 4W6WA 2PHFA 1AR82 2B7YA 2WZ8A 2RJKA 3FFQA 4IEVA 3DXTA 4P14A 4LUKA 2AYHA 5FUIA 3WINE 1ZM1A 5JOWA 2ZGRA 1U0AA 1ZZ7A 2R061 1O6UA 2WNUA 1UAIA 3Q8CA 4Z82A 4Y3OA 5FREA 1W99A 4QQPA 3VBSA 1ZYBA 4QDRA 4JGYB 1G9DA 1KDKA 1CAXA 1P8JA 1R092 4IETA 3W20A 1UY1A 1CN1A 3NMBA 4K8RB 2BNNA 4IEYA 1UNBA 4OQ9A 4D8MA 3H8OA 1OLME 1YCIA 3LOBA 1W2TA 1GICA 2OVUA 3MEPA 1DGLA 4XF4A 5J1XA 3ZXAC 2JB4A 1XNAA 4IEUA 4COUA 4LO7A 5HV0A 4P9YA 1SLCA 4CP1A 2G1MA 5ACA1 2BPA2 3I59A 4AR2A 2ZGOA 4CP0A 3GF6A 1NA1A 4IGOA 2VXJA 5JZGA 1RUOA 1NLRA 2BOJA 2QUOA 1O59A 2BU9A 4XHBA 5TSWA 3WG2A 1OVSA 4HVRA 2XG3A 5F5AA 1D4VB 3AP7A 5FMOL 4CUGA 1R1A1 2QJVA 5B2GB 2HWE2 3D82A 4Q4W2 5IVJA 1S2EA 5LB6A 3D5OA 3ZX7A 1ULOA 4ZU4A 2G9ZA 2D93A 5GZDA 1ZZ9A 3O5SA 4GB31 2WL1A 5F6KA 5BYNA 2E6VA 2W95A 5JMCA 1KRIA 3ROUA 1W8FA 3EB7A 3T30A 2VUAA 5LK5A 1QKQA 2BWCA 3AKPA 4RSUA 2UYBA 5I0DA 1CZVA 3VDDA 4UBGA 3WP4A 1AL23 2BEOA 3J7HA 3FJSA 4WM8B 4OI1A 2R1BA 3NWKA 2WYSA 3LEMA 5KXEA 4YM1A 1YI9A 4C90A 3T2QA 1SFPA 2A6YA 4MXVA 1N1YA 1YEWA 2K9ZA 4QPIA 2PHRA 3B69A 5D8AA 3ZVXA 5C8CC 1ZVFA 1L3JA 1PM7A 2DCTA 1RINA 2YPDA 1CPMA 3AC0A 3VZKA 3POWA 2ZS6B 2W9XA 5CBLA 4N43C 4GULA 3DPRB 3DCQA 2VQUA 4NWVA 4XFFA 2ZJCA 5A7WA 1Y9MA 2P3YA 3O1MA 3O1RA 3HBZA 1ZA7A 4HK9A 5F3IA 3AZYA 4BQXA 5K9YA 3UJOA 3ZYPA 3OF1A 3O14A 3OEAA 3TEXA 1XE8A 3WNLA 1WLWA 3BB6A 1GNHA 4FOQA 4PBPA 3UGFA 1PIV3 5FPZA 5C3OA 3VD9A 4I3PA 3QLQA 3OUJA 3VKOA 2HWD2 4CVUA 5JOYA 2VZSA 3WV6A 5LWBA 3O1TA 1LHWA 1QOSA 5BNNB 2YY1A 2PHWA 5T50A 4RA0A 1BLZA 1UW8A 3BTYA 4KMQA 2JDUA 2XJTA 1GOFA 4TTGA 4M0HA 5DPNA 1DQ2A 2ZAHA 4UFMA 2Z69A 4MO3M 4QB6A 2ID4A 5T3NA 5FO7B 4COVA 2E63A 5CFCB 4D6SA 2ZHMA 1HB4A 4EWAA 4S2HA 4JCKA 4Y5Z0 2HWC1 1JN2P 1HN1A 2R49A 2BV4A 4FQ4A 1DZRA 2EIBA 3D4KA 4UFIA 4Z1VA 3LA2A 2BVBA 3OEBA 1DGRN 2YMZA 3HQRA 4JKMA 3QACA 3VZOA 3WQ0A 1DBNA 4HPKA 3R6SA 2WZR1 2VH9A 2YV8A 3AYEA 3N3HA 3GZEA 1AF9A 4EN6B 3PUHA 4MGSA 5FZ8A 4L97A 5IT6A 4JDMA 3WW2A 1HQWA 2XJUA 4COWA 3NV4A 5FMOS 1W6OA 1JZ5A 3T4VA 1VB2A 3OPWA 1S0CA 4OI2A 4QKDA 1ZRFA 3HEIA 2Y26A 3M8LA 4I0WB 5FZ9A 4IEZA 3OJBA 5CEHA 3FLTA 4M0NA 2HYXA 5F3CA 3VBHA 4XJWA 2ZA9A 5JXHA 3NL1A 1UMIA 4NMIA 2Y0OA 3KLSA 3W59A 3SH4A 4B4QA 1H9WA 1YI7A 4GWMA 4XZPA 1C1LA 4XMAA 4A3ZA 1HRI1 5APAA 4XAEA 4AFMA 3TN93 2W68A 4Q4W3 1X50A 4AE2A 4OVEA 4IV1C 1JYCA 2XKOA 3H3LA 4FFGA 1S2KA 2XVGA 2GH2A 2XLGA 1UD1A 4F8AA 3L2HA 3CKHA 5L7OB 4P08A 3VDCA 3AP5A 1TNFA 3NW4A 2PAEA 5IFPA 4GIQA 1VRH1 1DYPA 4XXAA 1CGPA 5BNPA 4HVQA 4YW5A 4YM0A 5IK7A 1RGSA 4Y5SA 1N1SA 2W08A 1ND2C 5FPUA 5FYYA 4G3YC 1VBB1 2K2SA 3FZ3A 1VJ2A 1W6MA 2DVBA 4ZPIA 3WF3A 3K48A 4MYEA 4R9BA 2DCYA 1QNYA 1IG3A 4JKLA 4N8MA 2ZGQA 5EHDA 1W6NA 1GSLA 4JRAA 4Y1YA 3THDA 1PVC3 4YFWA 5C9AC 3EXUA 5FPXA 5JR7B 4QQOA 1DYKA 2B42B 4URAA 2WIIB 4QX0A 4MG2A 3ZYRA 4CDXC 4NN0A 5CISA 4I01A 1K12A 1AR92 1VBE2 5FYBA 2FD8A 4H7LA 1M4WA 5A7NA 2B46X 2IC1A 4XBNA 4GA9A 3BTZA 4XIOA 5CAZA 1AR71 1J3QA 3BI3A 5CG9A 1OPMA 3DN7A 1MQTB 1O4ZA 1QNWA 2VZQA 2PA7A 3KF5A 4D0QA 4AQ6A 1OLQA 3AZWA 3SC7X 2VTXJ 3T1LA 3KD4A 3LA3A 2BDRA 1ND3A 2XJVA 1V0AA 2WQ8A 3JZVA 4Q4Y1 2ARCA 2ADDA 2X5IC 3JCIA 1JYXA 5LATA 1NLSA 3P5BA 3ZPYA 4D3WA 2CY6A 1XYOA 1LCLA 1MACA 4UW4A 1CX1A 1N1VA 1V00A 1ZZBA 3I8TA 4F3JA 2XB6C 4N53C 3AP9A 3I2GA 1W3VA 3N9QA 1TMF2 1AVBA 1UWWA 1SPPB 3NQHA 1GANA 1Q8PA 3B00A 3AJZA 2RR13 3F95A 3POIA 3KB5A 2BBVA 2D6NA 5ANNA 5GJ6A 1J1LA 5FPLA 4AGGA 1K5JA 3C8XA 4GZ9A 2ZX1A 5JIAA 3KGLA 4COYA 2QQIA 5FCCA 4NRPA 5LRRA 4EN7B 2BWAA 1AYN2 1Q8VA 4YW2A 2PHDA 2VZ1A 3E5XA 4OUMA 4QXKA 2RS32 2MEV3 4LE4A 3WSOA 4CA9A 2A75A 2WO1A 3GJAA 5KHIA 3PL0A 4QKFA 1OF3A 1UOFA 3B93A 1X33A 3OD4A 5EIYB 3CLPA 1HLCA 2CHHA 4FQZA 4OHZA 4LA3A 3ZYFA 2GC1A 5DAPA 4AFBA 1RUJ1 3AX4A 2NZ9A 4DEQA 5GLUA 4ATFA 3CNAA 2WNVB 3ZM8A 4OZOA 2NQYA 4YG6A 3M3QA 5HPOA 1AR63 3FL7A 3VN4A 2BFUL 5A6ZA 3CHXA 1PGL2 3VGIA 4AVAA 3GZUC 3GBFA 4BWOA 2ZMNA 2J7MA 3INAA 3I2OA 2C26A 3T08A 4BM8A 4EZ4A 4PDWC 4Q8LA 1UYYA 4EZHA 1LGNA 1GWMA 2JIGA 2ZTNA 3AYCA 2D6MA 3FHIB 1VBD2 3FUQA 4S2DA 1YFXA 2PELA 3THTA 1VMJA 5FPAA 2DVGA 2B8MA 4P9WA 2HBTA 3PVOA 1DYOA 2VVDA 3HMYA 4OMCA 1T6GC 4BDVB 4NJ4A 5BV6A 4O7XA 3R4SA 3CZUA 1W05A 3BALA 5FXVA 2VUDA 5CVRA 5ABJB 1PGW1 5IVCA 3FE5A 3SCFA 4C0HA 1Q56A 1QJZA 2VZOA 2WZR2 1OF4A 1LJ7A 4AQ2A 4CXXA 4IE5A 1B35B 4LBLA 4P5YA 4NUBA 1W90A 1LOBA 1QOOA 3I2IA 4QU2A 5FY0A 4UFKA 2VECA 1J59A 2D97A 4W4ZA 2FDFA 3HNBM 1AR93 3POYA 5BNOA 1RXGA 2R071 4XACA 1H30A 4AZZA 5DZGA 5LASA 1D7PM 5I0RA 1UZZA 4Q0QA 1WBLA 2Q1MA 2ARXA 3RS6A 3ZFGC 1SCSA 5BNQA 4AEDC 5LBCA 1JZ2A 2P6HA 1JI6A 3VBFB 3CDZB 2R7EB 1DLCA 1H1IA 2WO3A 4GWNA 5HV4A 4Q26A 3AL6A 3FX3A 3QBQA 3OBAA 4Q1RA 4QXBA 4FI9A 4WM8A 4C0BA 1SFYA 1MS0A 1VR3A 2Z5WA 3SITA 3MDPA 1LODA 2GP5A 1JYWA 1DGWA 3OD0A 4I3GA 2D3RA 3AMQA 3ZKUA 2VW0A 1UU5A 2H0VA 4IGQA 4PLOA 4Y5TA 4DS0A 5IYYA 3THPA 1LAJA 3KT4A 4AWDA 3MIEA 1JS9A 1QHDA 4Y4YA 5EZWA 2K46A 4BH9A 2TNFA 1H8TC 1RUC2 2WWUA 3LQCA 3ZFFB 4RL7A 2XVLA 3RSJA 5DAVA 1GWLA 1XYNA 3B3QE 5H9PA 1A8DA 1OKQA 3PLQA 1FPN2 1RUG2 2JDMA 3VKNA 1VPHA 1W8WA 4XQDA 4TZDA 3N7KA 3G6JB 4YZ1A 2BFUS 1O8PA 2JDNA 5BNNA 1S2BA 3D0JA 3A21A 5F5CA 2GP3A 2G4IA 3VBSB 2ILMA 4M3CF 1DU3D 3C7FA 1S0JA 1UPIA 4K8FA 4Q4V2 5IATA 1SLLA 2Q1FA 5CFCA 3R05A 3OYWB 2DCKA 1W0NA 4LK6A 4META 2CWMA 4Q4X3 3UT0A 3ZOIA 2WAAA 3ZN6B 2FBEA 1RYYA 4KWKA 1XNCA 2CU5A 1W9YA 3KHBA 5BXXA 1U5ZA 2C0ZA 4QX5A 4FXKB 3WG3A 1GKBA 5IVEA 3O1SA 1D0HA 3BTAA 3I59B 4E2QA 2LM3A 4QD2A 1K42A 4CP2A 2XXZA 1WMXA 1CR7A 2CGNA 1R082 4GKXA 1LEDA 5F32A 3AVSA 2ZX2A 3ACIA 1OD5A 1QJU3 1VBD3 1PZ9A 5LW9A 2LS6A 1MS9A 1WUVA 2TBVA 4NROA 4PIZA 2EVXA 1L7LA 1YQ6A 2ADEA 3J8F2 2VQTA 3MUY1 3RQ0A 5T5LA 5DUUA 2UY8A 1D2SA 2Q8OA 2GAUA 3SQOA 1NCQB 2VOTA 1JZ4A 1F4AA 2RDRA 5HI0A 2JKBA 1WW4A 4DIQA 4E4ZA 1RHI2 1TME3 1L7RA 2W52A 2DCZA 5BY5A 1LULA 1HB1A 5LY1A 2QQPA 3VHOA 4FPFA 4ZU5A 3ABZA 4YGCA 1SDWA 2WJSA 4AVBA 4RGKA 2IXIA 5DDJ2 1NKGA 4CCCA 1PO12 3AKRA 5K0UC 1PO22 3GYDA 4YGDA 3MIHA 4DRVA 1VAMA 4NPMA 3I3QA 2VZPA 4RR3A 3VBUB 5FBJA 4LR4A 4QPIB 4CCEA 4GKYA 3RWKX 2XL7A 5A3UA 3LF7A 1VBC3 2A6ZA 1H2NA 3SCHA 5L36A 5L7OA 3C3VA 1E5HA 1HKDA 3B9IA 1YHFA 4XBQA 5FXZA 2FZ2A 3WNPA 1A34A 1W9SA 2GC3A 3K2OA 2W1SA 4ZU7A 2E7AA 5A7WB 3T09A 4AHWA 4QXHA 4JDOA 3C7OA 5T5PA 2Q8EA 2ZABA 3OGJA 5T5JA 1PIV1 1XE7A 4YVSC 4LO6B 4A2UA 1UOJA 2C24A 3PJQA 1UF2C 1RMU1 2B9VA 2V4VA 2VPVA 2ZGMA 3HT2A 4KBZA 4KI5M 2P3KA 4B1LA 4XFBA 2BERA 2ZMKA 2ZGNA 5FY4A 5A33B 4HSJA 1H2MA 1YFYA 3VHPA 2VMHA 4IGPA 2E9QA 3BCWA 2W1QA 2YZ4A 2X8KA 3LE0A 2CNAA 4RYDA 2HLEA 4YZ2A 1CAVB 1XJAA 1RUF2 1YWKA 1ZNPA 1FNYA 2BZDA 2RM21 4V2VA 4QXCA 1G6NA 1LENA 3JBG2 3VD5A 2B9UA 1C57A 1RUH1 3LSEA 4NIHA 4IEQA 2XHKA 3USSA 1KJLA 1RUD3 4I0AA 3VKLA 1BBT2 1UYXA 1JUIA 1U5IA 1Y7BA 2BGOA 2GNBA 2O14A 4YZ3A 3F2ZA 1EV13 4RS5C 4IEWA 4I30A 1E5RA 1FOD3 2WWSA 2R042 5FYUA 2EF6A 2RJLA 5CB7A 2WA3A 3RZGA 2QQNA 2R072 3L9JT 1FT9A 4FT8A 5A70A 1VAVA 1W6OB 2JDHA 1QJX1 3GBWA 5FY7A 2HWB3 2IXKA 4LNVA 3GXUA 5CFDA 3WDUA 3ZPOA 2FDGA 1QY4A 2X09A 3PU8A 3ZFEC 5L19A 1AX2A 1SPPA 4YVWA 3IAQA 1EAH2 5A7SA 4URTA 5A32A 5LEKA 2ZXQA 4UBHA 3P3PA 1S0FA 4LITA 4QPGB 3VBHB 1IHMA 2Q8CA 3RVHA 1R083 1KFUL 2D7FA 5FMBA 1ZBE2 2XONA 3VBOC 4YW6A 4RD7A 5FJHA 5FY8A 2RMU3 5C4WC 3ZYGA 3TN91 3R0RA 5A3MA 1H9PA 2ZCWA 4KGGA 4N43B 5K7PA 4CEWB 1FI2A 1LNSA 5CU1A 3WG1A 3BU0A 4J6GA 4OI4A 2V5YA 5FYZA 4Q8KA 3GDBA 5T52A 4HMZA 2Y6GA 1KITA 2AEZA 4FFIA 5LBEA 2OQ7A 3I7DA 4JTOA 4MVTA 2D3PA 3BN6A 2NMOA 3NAPA 1JTZX 1UY3A 2YFZA 5E16A 3VKFC 3ZKYA 4IE4A 5EYYA 3ZR6A 2WNVA 3Q8AA 3V64A 4CCOA 1QQP3 1NUKA 2V5DA 4HN0A 3D6EA 4M3CE 2Y6HA 2ZX0A 5I0TA 4DQAA 2WLPA 5JWPA 5BNPB 2EAAA 1YIFA 2JDZA 4P9GA 3URFA 4LO8A 3CJIC 1W6MB 2QBXA 3J9SA 3PUQA 2QQVA 1Y4WA 3OCPA 1K5MC 1PX4A 5EP9A 1SQ4A 3SISA 2WS91 2ZZQA 1PVC1 2HJIA 1TQ5A 1XRUA 4XQ4A 5FZCA 2WLQA 1W2OA 4O61A 2W5FA 3PTRB 4B4RA 2RS11 1OC1A 3JQWA 3OBRA 1UZ0A 3WQ1A 5A1LA 5LZ6A 3MLKA 1BEV2 2RS52 1ENXA 1V70A 1BVP1 2DTYA 5JCTA 4ORFA 2XUEA 3ZSEA 2JD9A 4WVWA 2VJXA 1HDKA 1RXFA 3DEMA 3WP6A 1MS4A 5E6HA 5ABJA 1ASJ2 1G9CA 4LJHA 1NCRA 2EAKA 1MZ5A 4XFIA 2V73A 3CU7A 3C2UA 5K8SA 4E4HA 4BZ4A 1B35A 1YNAA 4NIGA 2EXIA 1BQPA 1RUI1 3T0DA 3CJXA 1COV2 3LDKA 5JOZA 5DABA 1UYPA 4B29A 1UXZA 3R4UA 2QE3A 5JR2A 4NHLA 2DTWA 2E53A 4CCKA 3SMHA 1BVVA 3KQ4B 3Q8EA 2ZGUA 1B09A 3JBG3 4WZFA 5IAVA 3T3YA 4CDUC 4TN7A 3VUOA 3VBFA 3NNFA 2FDJA 1R1ZA 3H50A 2FMYA 5FBZA 4YW3A 4CSWA 4CYDA 1FXZA 1DGRA 2XL9A 3HVDA 3ZXFA 4AW7A 4QB1A 2JB8A 2RR11 3W21A 4Z92B 2YG0A 3UL2A 1V9U2 2QQOA 4TXWA 2ARAA 2A6VA 3LEGA 4KWJA 4L0PA 4UW5A 5B4NA 3NJYA 2JDAA 1HN0A 4EN9B 2MEV1 3IB3A 4EE2A 1VLNA 3J7LA 2VQ0A 2BOIA 2OXBA 3S7EA 1W0PA 4Q0PA 4UAPA 2B5HA 4XE9A 4HT1T 3KT7A 1EUTA 2NYYA 5AVPA 4AI8A 1JYIA 2LW8A 3RPQA 1YQ5A 4P5HA 1UZWA 3JD73 3Q8BA 1EAH3 4Y26A 4CU8A 1RUE3 2WT1A 3ALQA 1HRV2 3VBRC 3KV6A 2IWGB 1IGOA 3ZSKA 1MS3A 3FN9A 3RI8A 2JWPA 1AR61 2VW1A 3ETPA 3MV11 1V6JA 3GZTB 3MF9A 2VU9A 2JG8A 1JXNA 4WVVA 1YFUA 5FP8A 3LZZA 2ZEXA 5FYTA 4DXSA 5AC91 1ZBA1 4RHV2 1S0DA 1US2A 4YYOA 4OYUA 1HXS1 5D1IA 5L9RA 1T6BX 2CYFA 3DGTA 3PIJA 2XVKA 3IT8A 1W8ZA 3OYWA 1O3RA 3HPNA 1XSRA 2HWF2 3ZDSA 3ZN6A 3IWZA 3OBZA 1AZDA 1IS6A 2KD7A 3SEEA 5F9TA 1LU2A 3FBYA 1QH7A 2RM22 3M3EA 4D7TA 3ACLA 3AJYA 4CDQC 1YRZA 1RUH2 2R30A 2LTNA 2DVFA 1W2NA 1ZRIA 3MZHA 1NXD1 2VMIA 4LULA 1AYM2 1F31A 2ZPXA 4N90A 1LHOA 3MFCA 1C8M2 2V4AA 4IESA 3WCRA 2QCSB 2VMFA 4IE0A 5LBFA 1BYHA 3CEWA 1W03A 1UMHA 3ACGA 5FO9B 3PMSA 3AXDA 4FPEA 2Y64A 1F8VA 4GMP0 3PUIA 1VBA3 4BQWA 1QJX2 3USUA 5GZGA 4R4ZA 1YO8A 1BEV3 2RS53 5BNOB 2W47A 5CZKA 3V65A 1NCQA 1YYNA 2W1UA 3S5QA 5F3GA 2BP6A 1LOFC 3OUHA 4XF0A 3PURA 4DZGA 2Y6LA 1LKNA 5I8TA 2FDHA 4NWWA 1SBFA 1DQ0A
chains in the Genus database with same CATH topology
2XBO3 3ES1A 3IBMA 4NHMA 3WDVA 3AK0A 1ZZ8A 3VBUA 3NV1A 1FMD2 1IZ3A 2A6WA 4DY3A 4GXLA 3AKQA 1Q5OA 3IM0A 2EA7A 4JVAA 1RIRA 4MGKE 3TNPB 2OUHA 2OA2A 3ZXDA 4LTAA 1DHKB 1Z78A 4WZCA 4CDWC 1V9U3 3V0BB 2G9GA 3RWNA 2JICA 4PDWB 4BMEA 3QCWA 4DPNA 4TLFA 2O0OA 2GNMA 4IL7A 4QGNA 4E27A 3PTYA 4XEZA 5A33A 2WS92 2ZGPA 2PLV3 2MHFA 1FYUA 4PLNA 4ZXKA 1SLBA 1CAVA 3S30A 4YFZA 4QQLA 3H1WA 1AR83 1RJ8A 4AI3A 2ZKNA 2QFEA 4E2SA 5KXCA 1QJY2 4YRDA 4ASMB 2A5ZA 2CL2A 4BE3A 4DY5A 4XFHA 2UURA 1H2KA 2WFF2 4HETA 4AQSA 2UWBA 4N9IA 4EWEA 5JPMB 1R093 5I91A 4EJRA 1VALA 2NLRA 2Q30A 1QJU1 1N1TA 1O5LA 1WGPA 2DV9A 1XXNA 4R52A 4NVPA 1KJRA 1H1AA 4AEDB 1QH6A 4B7KA 2FHRA 2C5DA 4LBJA 2JE7A 2VOKA 4HFSA 4Z2WA 5E88A 4LHNA 1LECA 4UW3A 4QPGA 2CV6A 1Q8SA 1TME1 1EPWA 3MGUA 5C8CA 4X8PA 3EJKA 1S0BA 5HXVA 1S55A 1Z7S1 3PHMA 2YGLA 1I3HA 5FLJA 1UKRA 2HWE3 1JUHA 4GH4C 4N43A 3KM5A 2A71A 3VV1A 4CEWA 1H8TB 3ZSLA 5FOJB 1EPZA 1ND3C 4RR3B 2N7GA 1NY71 3AMMA 2VVEA 4KL1A 3U10A 2WSVA 3WX5A 4I2OA 3A4UA 4AI2A 2GNTA 3MLLA 2VY0A 3N35A 3TB0A 1CQ9A 3M3CA 1YUDA 4LBOA 3LB9A 2R062 3ZN4A 4G4FA 5EWSA 2ZACA 5GLTA 4IERA 4FP2A 4IQPA 1FMD3 3WDYA 4XF3A 5JI9A 4WM7B 5KXBA 3ILNA 1CPNA 2P37A 3NVCA 1BK1A 3L2YA 1MEC1 4AHXA 3PVNA 3KMHA 4A3XA 2XGXA 3RJ2X 1W6PB 3AB0A 2IFRA 3HN1A 1PK6B 4BCUA 5SV5A 5ACA2 2O8QA 4DOUA 3TYJA 2HWD3 5GALA 1RUD1 3ZIWA 1WCKA 1X8MA 1SACA 1G7YA 2KA3A 4AYUA 3FMGA 2G9FA 1R1A2 2AREA 1CX4A 3PVEA 1FOD1 1OOPC 1ZRRA 4IXLA 4JC1A 2B39A 4JGYC 5KHGA 3MW2A 1MZ6A 4KU8A 4R8HA 5J96B 1YXWA 4GB32 1POV3 2HWB1 4OUSA 1QJY3 5CFDB 4L8QA 1LOAA 4XOGA 4AFCA 1X7NA 4YVWB 1H2LA 5A32B 2NM1A 4IV1A 2DUOA 1LR5A 5FFOC 2WNEA 1LRHA 1IKPA 4IEPA 4D7YA 4MZUA 2DWRA 2FZ1A 5BUVA 5HBAA 2RMU1 3AKTA 2RHPA 3P3NA 2DYCA 2Z2SB 5DZEA 1RVF1 2GSYA 2WQ4A 2IFWA 4BOWA 2AR6A 4Y24A 3RMYA 1ND2A 4PF5A 3H0OA 2D5HA 5HCFA 3NAPB 2Z79A 4YVSB 1QQP1 2Q4SA 3VZJA 1A6CA 2JG9B 2XJQA 3DF0A 4RQPC 2QDRA 4NHKA 2VOXA 5C9AA 3AFKA 3CL1A 1W6QB 4FPGA 1O3QA 3AFGA 3K51A 4JRLA 3FFZA 1HQLA 3AMNA 2YPJA 1O91A 3OY8B 4FPKA 1UKGA 4C1XA 4LO5B 5J7MA 1F9KA 1FV3A 4ES9A 4HK8A 5L73A 4CEYC 3DPRC 1CD3G 2HWC2 4DXZA 2DVDA 1H4HA 1D4M1 4BIOA 1OQDA 4PLMA 3UV9A 2EXJA 3SLIA 1NCRB 1ENQA 2X5IA 4YG0A 3WZ1A 2SBAA 3MIFA 3B01A 2ZGLA 1BJQA 5BNNC 2VXRA 2ZGSA 4P9XA 1XU2A 5KHHA 3VL9A 5F1RA 2WSUA 4AG4A 1O3TA 4N53A 1VBE3 3MFAA 1S0EA 1XQNA 3KT1A 1XNDA 4FTSA 3U0ZA 5ACA3 1G9AA 2JECA 3ZXEA 2GMEA 2ZOEB 5C6CA 4MH0E 1H4GA 1GQGA 3UK9A 2QZ3A 3VBOB 2SLIA 3ETQA 5C4WB 1IS4A 5EFUA 1HRI2 4YGBA 4A7KA 2PFWA 1ZREA 2QZ2A 1GBGA 1S0IA 4OHWA 4XXPA 5J37A 2OW4A 1IOAA 2WZPP 4MGZE 2HYKA 3HT1A 4YSFA 4COZA 1YJKA 3QH7A 4XBLA 4DRRA 1D2QA 3NV2A 1AJOA 2GN7A 4DMIA 1PNFA 3I2DA 3JD71 1TMF3 3NO8A 1QDCA 1RUE1 1VRH2 1J3RA 3ECQA 4XPVA 3V0BA 3H7YA 3NKTA 4PDWA 1H0BA 1VBB2 1S0GA 1SLIA 2F6BA 1AYN3 5IK8A 2RS33 4XETA 2DVAA 4FAHA 1LHNA 2JG8B 4INDA 2X53S 1PZ8A 3AKSA 4MXWA 4QGMA 4D7SA 1FV2A 4AFAA 1UZYA 4SLIA 3FC0A 3BIWE 1J58A 2V09A 5L7OC 2AENA 4I09A 5SV8A 1AR72 3D0SA 2GNDA 4B3NA 2P3IA 5AVAA 1GLHA 3H9AA 2HEYF 1OQ1A 4R9AA 1H8VA 4PQ9A 4WV8A 1JOJA 1X82A 3IN9A 1V6MA 4Q4Y2 3U07A 2HEVF 1POV0 5J36A 5JDBA 2KM2A 3ZFGA 4AEDA 3MW3A 5H9RA 2D5FA 3USUB 2XLFA 3M1HA 2HKXA 1SFNA 3VHNA 1Q8QA 5IK4A 2BYVE 5KHJA 3QH6A 3ZXGA 2H6BA 3M3OA 2NPIA 2AZ5A 3GALA 4Q2FA 4TWTA 4R9CA 1BZWA 2RE9A 2WA4A 4HBNA 2P2KA 4ASLA 2WZR3 2XBO1 1MQTC 4B4PA 1OLRA 1OPOA 4WVMA 1AL21 1EP0A 5KWRA 2A3XA 4HKOA 1F5JA 2BW8A 1QDOA 1H8TA 1RVF2 2A7AA 1IQAA 1GQHA 2BQPA 1NYWA 2BGCA 4XW3A 3T1MA 4K3UA 3A0KA 5AFBA 1DFQA 1SMVA 4Q1PA 3IKWA 4MGIE 3N7MA 1RUJ2 4YZ5A 2JEMA 2PHXA 3HAGA 2W0XA 4YW1A 1JW6A 3B02A 2UWAA 4CZSA 3BOWA 1SLTA 1HRI3 2GC0A 4XJ8A 2BNMA 2XJPA 3JB8A 2PAKA 2DU1A 2ZKLA 5F5QA 1URXA 4WM7A 4HANA 3FLPA 4AI0A 1E57A 4EWDA 2VG9A 3WNXA 2PLV1 1AXZA 1RUC3 1W6PA 1ZA4A 4OFGA 3LA7A 4YG3A 4RGGA 3IPVA 3ZXLA 2ET1A 1PK6A 4AQTA 3V0AA 1AR81 4LLFA 1D4M2 5HCBA 4EV0A 1EY2A 4YM3A 4KWLA 1FPN3 1RUG3 2IXCA 2F4PA 1PGW2 2WNVC 2EXHA 3RZZA 4FPOB 2Q1ZB 1QXPA 5JSPA 4AVVA 3FUOA 1R091 2BNOA 1IPJA 4Q4V3 2XUMA 4FSJA 5HCAA 4JTNA 5FLIA 4A7YA 3H3UA 1AUYA 3BODA 5GLZA 3HWJA 1OMIA 2VNGA 4IV3C 4N7UA 3WLUA 1QOTA 4Y22A 4FO9A 4GMP3 4FXGB 4P9JA 1MS5A 1VAKA 5K0UA 4H3WA 3NKGA 4BLJA 2R0HA 4AEJA 2JE9A 4FCAA 3RJRA 3TNQA 5I8YA 1XNBA 4MLOA 5J48A 3GHNA 3AXEA 3O12A 1RC6A 1RUNA 5C8CB 4Q4Y3 3GNEA 1WW5A 3QD6A 3AMPA 4FOYA 4Q4W1 4XJ9A 3J8F3 1TEIA 2OIIA 2ES3A 5JIUA 2A3YA 4ES8A 2DF7A 2YXSA 3ME2A 1NZCA 3AZXA 2YC0A 4HZFA 4CDWB 3J4UH 1MZEA 1KS4A 3WDXA 1DLLA 1RHI3 4YVSA 3IDEA 3HIFA 2JG9A 3KCXA 4OULA 4JGZC 1W6QA 5DDJ3 1PO13 1PO23 4MSVA 3AP4A 1KD7A 1WA4A 5IK5A 1MVEA 3MW4A 5DUXA 2NN8A 3RG0A 3OY8A 4XF9A 4DFSA 4XTMA 4QT6A 4FPHA 3AYDA 5J3UA 3ZFFC 3O0XA 4Q0UA 3AZVA 4PJYA 4XFCA 3H1YA 4JV4A 2ZAAA 2UU8A 3OGGA 3ZSJA 5FOBB 2AGSA 4RS5A 1ZZ6A 2Q5TA 1PZ7A 3T2TA 2ET7A 3MPPG 2HWD1 2CGPA 3AMHA 3BOPA 2CTVA 4I0BA 1LOCA 2WNUC 4NR1A 2JXAA 2E51A 3VBSC 3PJYA 4DNYA 1CJDA 4F83A 3WCSA 3ZFEA 1KXGA 3O0WA 4LEJA 4B7EA 3DL3A 1RUF3 3B7MA 4Q0SA 3WW3A 3MICA 4K1ZA 1F5FA 3H7JA 4TSVA 4YM2A 3VBOA 1BBT3 5DUWA 4X6RB 5C4WA 1WD3A 3RDIA 1NG0A 5E1RA 1AL22 1U5XA 3E6BA 4MUVA 4AVCA 5GLWA 3EBRA 5F6LB 1NA1C 4IV1B 4AFDA 2ATFA 5JZGC 4E4SA 2R043 5T55A 2R073 2ZMLA 1DF0A 3ZO0B 5E89A 2GU9A 4BIFA 2GMPA 2BTVC 1QU0A 3AM2A 4FPLA 1ULEA 2ETEA 1ND2B 3B5LB 3D8CA 1VB4A 1GR3A 3CJIA 5FDBA 4K9SA 4YLZA 1ZBE3 1K5MA 1PIV2 1X8EA 3EO6A 2XH6A 2VGDA 1RMU2 3VDDC 1PGSA 3TWIA 3O7OA 4X8NA 4J1WA 4DB5A 4GALA 1V6IA 2DFCA 4CDXB 2VNOA 2WKKA 5DUVA 3VBUC 5D8AC 3JUUA 4QPIC 2DURA 4BQ1A 1PMIA 1IKQA 1GFF2 4XJUA 2WINB 4X6QB 1WLDA 1HX6A 4ISRA 3IMNA 3OPZA 4SBVA 2XPJA 3DKWA 3CF6E 5CIRA 4NPRA 3M70A 2D44A 1GZWA 1YLLA 2W39A 3KCCA 4HKWA 2TUNA 2R1DA 2VUJA 3JU9A 2BVVA 1OOPB 4HL0A 1U5YA 3WY6A 2X5IB 1QXRA 2ZGKA 5IUQA 5LK7B 4Q27A 4CDUA 1RTVA 4XMIA 2QKDA 4Y1XA 1AR91 1Q3EA 1VBE1 4JDNA 3UKTA 1KS5A 3LOIA 4N53B 2DUPA 4FPYA 2YROA 2A6XA 1ASJ3 1FATA 3ZMNA 4QQHA 5FLHA 3RYRA 3TRSB 3BPZA 3TAYA 2PHUA 4LA2A 1DGWX 4OHYA 5JAXA 5FQ0A 1QGLA 1COV3 3B9CA 3LSDA 2Q0AA 3TN92 2Z42A 4AGVA 4XILA 1N3PA 5KXDA 1N3OA 4C1WA 4XQWA 4W65A 1CAWA 4TYSA 1PHMA 2D40A 3LWCA 2OZJA 3VBRA 1V6OA 3ILRA 1HIXA 2MNGA 5KBFA 2XJRA 3AZZA 1DDLA 4BHPA 1TMF1 4BPZA 4RQPB 1UN1A 1GNZA 3ILFA 4QPGC 3VBHC 1W2UA 4N9HA 3RNSA 1LB2A 2A73B 2ENRA 4PBOA 1AYN1 3GZAA 1O5UA 4LBKA 2RS31 1ULDA 5EJ3A 4LLOA 1C3HA 1PVC2 1BKZA 1CAUA 4MXWB 4P9LA 2B45X 4CEWC 4CEYB 4CDQA 5GZEA 1LEMA 3SCGA 2RS12 4Y1VA 3DV8A 4Q4X1 4Z8BA 1Q43A 5JI7A 1HRV3 2GALA 1QWRA 1O4TA 2QDNA 1I1EA 1AHSA 1ENRA 5CADA 1KDMA 2UYAA 2E7TA 1REDA 4LE3A 1PGL1 3JB4C 1RMU3 5BNPC 5DG1A 3GBGA 3VHRA 5FRAA 4RHV3 2R32A 1RUI2 1DQ5A 1C8NA 2DUQA 4RGAA 2ZBJA 3POSA 2IXLA 2D98A 2HWF3 4QM9A 1VBD1 3VL8A 4A2UA 4L9BA 1LOFA 2EALA 3SXWA 3W9AA 2I07B 4YARA 4BLIA 2H0BA 4NOTA 2RM23 1VP6A 3ZFGB 3FBMA 1LGCA 1REFA 1LGBA 1RUH3 5FTTC 1MR5A 1DQ6A 2ZHNA 5FAXA 1AYM3 4FAGA 2RR12 3HD8B 1C8M3 1WMFA 2WQZC 2O1QA 4L11A 1O7FA 1AX0A 4IEXA 4WVMB 1NE4A 1NXMA 2MEV2 2R0FA 1QJX3 4L99A 1FX5A 3SH5A 2YDEA 1M06G 2D6LX 4B8EA 1VBC1 3N7JA 4EN0A 4CDWA 4KNCA 1C5HA 4O9GA 4OHVA 3WP3A 2DCJA 3J26N 1AJKA 2PAMA 5A3LA 1AR62 3S0MA 4M3CA 5FO8B 5AC92 3LGRA 5J98B 2I45A 1UMZA 4FTBA 1ZBA2 1V6NA 4CRQA 1O4YA 5I0SA 3WUCA 1HXS2 1D0GA 3HQXA 3VZLA 4ONUA 4XF1A 4EN8B 4K20A 5GLVA 2GH8A 2VOWA 2I74A 1RUC1 1ZRDA 2NP0A 2JJ6A 5H9QA 5I8SA 3IPVB 4Y20A 1XYPA 2H6CA 4LBQA 4H7MA 3V0AB 1FAYA 3MPBA 1FPN1 1RUG1 1U12A 1UX6A 4PIYA 3W58A 4QHBA 2PHTA 1TNRA 3I54A 3APBA 4Q29A 2WC2A 1AXKA 1BXHA 2QVSB 2WS93 3MYXA 1EV11 4Q4V1 3ZSMA 3ST7A 2RS13 4XHXA 5CG8A 2BUKA 4FVVA 2CGOA 4GMP1 4Y22B 4AHYA 1WMEA 5GZFA 3Q9OA 1SBEA 2WFF3 4L2NA 4LBQD 1OHFA 4GH4A 5K0UB 1RUI3 3KZ4C 1R081 4N7IA 1IPKA 1UU4A 3E6CC 4E4DX 4D69A 4V1PA 4KGQA 1DQ1A 1AL0G 2O8OA 3ELNA 1ULGA 1GZCA 3R4DB 3J8F1 3WP5A 2AUYA 5BNOC 1LTEA 5JOXA 3WQ7A 1ZZCA 3NJZA 1WW6A 4Z07A 3TBDA 3DUIA 4G9SB 4FOVA 3RRDA 3KCYA 1RHI1 1V6LA 5EXOA 2NMNA 1OSGA 2ZHKA 5GZCA 3ZYIB 4HN1A 4O9EA 4WVZA 5DDJ1 1JH5A 1LHUA 1PO11 2VVFA 1PO21 2K0GA 1MS1A 4WM8C 2XJSA 4M01A 4CDXA 4R9DA 3WVJA 3WR0A 4FBFA 2PQQA 5H9SA 1CONA 2GN3A 4FOWA 4QPYA 4Q4X2 4AK3A 1WBFA 3LAGA 1YJLA 3O0VA 1OA4A 4MX3A 3N36A 4K40A 2Y0IA 3NSTA 2R063 3OBTA 5AC93 2YGMA 2ZX3A 3ZYJB 1X36A 2A3WA 4RS5B 3SHRA 1ZBA3 1OOPA 2MPFA 4JGYA 4IEOA 4AVSA 4E9KA 1ZRCA 3WG4A 1HXS3 1OI6A 3KS7A 2I2SA 3H1MA 1ALYA 2XWBB 3MIBA 1Y43B 1CIWA 1WMDA 1QJU2 3VZNA 3IDBB 1AX1A 4H14A 4IV3B 1V6KA 1QF3A 1J1TA 4XJAA 5I93A 3ZFEB 4WBBA 1GYKA 1RUF1 1NE6A 4K7JA 5CFCC 2DU0A 1OA3A 1W39A 3JBG1 4LHKA 4XDQA 3ATGA 4W6YA 1WW7A 1TME2 1HQNA 3QOPA 1RITA 2CAUA 2R16A 1LHVA 1BBT1 1EYBA 1XU1A 1JBCA 3S6PA 1C4RA 1Y3TA 2GZWA 2PTMA 3MIDA 3SH3A 2IZWA 1Z7S2 1REEA 4BYYA 3PVBB 2VMGA 1R1A3 1IS5A 4PIXA 4AEMA 1AXYA 2R041 1DG6A 5AFEA 2GC2A 2OPKA 1G9FA 5JPNB 3WOGA 4KG8A 2PYTA 2JENA 1NY72 4GB33 1UPSA 2JD4A 3LCPA 1VBC2 3MIGA 3FWEA 5KHKA 3WHTA 1BMV1 4KQ7A 4RQPA 1EAH1 1G8WA 1BCXA 4JGZB 4Y1UA 3IIAA 4ZKTB 1Q8OA 2HEWF 2PN5A 3U11A 4OI0A 1H1MA 3CJIB 1ZBE1 5JVVA 2VQAA 1I9RA 1K5MB 3BU7A 1SEFA 3FLRA 4LT5A 1KQRA 4MV2A 2PHLA 2FQPA 3GHMA 1SBDA 1CESA 4XIKA 4CTEA 5KC6A 1MZFA 1HV0A 3M4FA 3DPRA 4CEYA 1MEC2 3KGZA 4RR3C 1N3QA 4LBNA 4ATEA 3MF6A 1S1AA 4GQ7A 3ASIA 2QNKA 4RFT0 3WDWA 1RJ7A 2X29A 1GZWB 3UKNA 1RUD2 3SNMA 2WNUB 3KQRA 2ERFA 1Y9QA 3N4MA 1O3SA 5JLVA 3UJQA 1EV12 5C33A 4XTPA 4MGYE 4AVTA 1FOD2 1CAXB 3VKMA 4WM7C 4LBMA 1W0OA 4LUMA 1WD4A 4JQRA 4YZ4A 4CDUB 1WLCA 1VBA1 1FNZA 2VW2A 3VGIA 4F7ZA 3RYKA 1J3PA 1OFNA 1UL9A 1BEV1 2C1FA 2HWB2 2HWC3 2RS51 2YYOA 3WW1A 4K21A 1QXJA 4AI1A 1PK6C 1ASJ1 1ULCA 1A8MA 1NA1B 5JZGB 1ONAA 1I6XA 1Z0HA 4FP3A 2DFBA 3VZMA 4QGLA 2RMU2 3WD5A 4AGRA 1COV1 5FQ0B 1UIKA 1LU1A 3HR9A 1HW5A 1UCXA 1CAWB 3A0NA 4HLTA 1A3KA 3VBRB 4FTEA 4KBBA 5CFDC 1QQP2 4KG0A 2VULA 1F2NA 2VNRA 1Z7S3 3E97A 4YVWC 1PNGA 3VDDB 1V9U1 3UKVA 2AH2A 3CO2A 2OYZA 4JAAA 2OZ6A 2XWJB 2P34A 5T5OA 5DG2A 4KH9A 4BA6A 3KSCA 5D8AB 3ZXJA 3RI9A 4OZXA 4R4XA 3I4IA 4A7ZA 4HSLA 5E8AA 1CAUB 4NO4A 1WCSA 3M2MA 1OA2A 4J1XA 4CDQB 1VRH3 3E5QA 1HRV1 3PMEA 4HVOA 3WUDA 2LALA 4Y1ZA 1VBB3 1SCRA 3NAPC 1C28A 4I02A 2ZGTA 2JG9C 5KC5A 3ES4A 2JX9A 3ZIXA 4YGEA 4RHV1 5C8WA 2D3SA 1IS3A 1LOGA 1MEC3 2D43A 4Q0VA 2HWF1 4L92A 5DZFA 1ZX5A 4C91A 4YW4A 4FPCA 5BPXA 2WFPA 1LESA 5EV7A 2GDFA 3VLBB 3WW4A 1MQTA 1AR73 1XNKA 4P9IA 4S2GA 2FMDA 1AYM1 1C8M1 1A78A 1LOEA 2YHJA 4BMBA 5ABJC 3S7IA 4AF9A 4HPKB 3PNAA 1NCRC 3MI8A 4LHLA 2EXKA 4U2AA 2XLAA 1B35C 2HWE1 3M3IA 1OFSA 2OUJA 4AXOA 4U36A 3JQXA 3B94A 4XFGA 3AYAA 1BMV2 1DZTA 4QQ2A 1GZ9A 2GMMA 4DINB 3JD72 1KFXL 2D6OX 1RUE2 1ULFA 4KU7A 2ARBA 1NOVA 2IXJA 2VOVA 3VBFC 1CVNA 2E7QA 3M7AA 2CWSA 3H8UA 5LRSA 4M00A 2D6PA 5CNAA 4D94A 4M3CB 5CA6A 2P3JA 4ITCA 4LO4B 4UW6A 3WHUA 1VIWB 1FMD1 1YFWA 2ZZJA 1RVF3 3TOJA 2P17A 3V56A 5JSOA 1OQEA 5J09A 1C1FA 1CJPA 4E2GA 1RUJ3 4S2FA 2CAVA 3G7DA 4K1YA 4Y20B 4UXAA 4LBQB 2KXLA 4ISQA 4AHZA 3AP6A 1DIWA 1NQDA 1TE1B 3E5UA 3E6DA 1DZQA 5LEJA 1RL3A 2UWCA 1W6NB 2JG8C 3EQEA 4IV3A 3ZMOA 4AEKA 2XKPA 4W6XA 1VBA2 4YNIA 3H3ZA 4HKLA 2EIGA 3NV3A 1D4M3 1POV1 2WT0A 1QJY1 5GM0A 3ZN5A 2UY9A 1G86A 3U4XA 4PCRA 4QM8A 1NQJA 3ZXKA 1QMJA 2XBO2 2WFF1 5EYXA 1SLAA 4GH4B 1UIJA 2Y38A 2A70A 4EROA 3EHKA 2YUEA 1ND3B 1C5IA 1ENSA 3WDTA 1GV9A 1WLTA 1UU6A 4QMAA 1MS8A 1HV1A 2IXHA 4XYXA 1N47A 4JGZA 5T54A 1NCQC 4OHXA 1JHNA 2LUWA 3RMXA 1I5ZA 1YIPA 4H55A 3ENRA 4OLLA 3OTFA 3RYPA 4FPJA 2R6QA 2WT2A 4XJZA 3WXPA 2D6KA 3X29B 3WT3A 2ZX4A 3LKJA 2ZHLA 2C9AA 3ZFFA 2PLV2 1WCDJ 5DXDA 2TEPA 3N7LA 1PVXA 5I0UA 1MVQA 1DQ4A 4K6BA 4XFAA 3IDCB 3MLJA 5GKAC 1APNA 4W6WA 2PHFA 1AR82 2B7YA 2RJKA 3FFQA 4IEVA 4P14A 3WINE 4LUKA 2AYHA 1ZM1A 5JOWA 2ZGRA 1U0AA 1ZZ7A 2R061 2WNUA 1UAIA 4Z82A 5FREA 3VBSA 4QQPA 1ZYBA 4JGYB 1G9DA 1KDKA 1CAXA 1R092 4IETA 1CN1A 2BNNA 4IEYA 1YCIA 3LOBA 1GICA 2OVUA 3MEPA 1DGLA 4XF4A 3ZXAC 4IEUA 4COUA 4LO7A 4P9YA 1SLCA 4CP1A 2BPA2 5ACA1 3I59A 2ZGOA 4CP0A 3GF6A 1NA1A 5JZGA 1RUOA 1NLRA 2QUOA 4XHBA 5TSWA 3WG2A 4HVRA 2XG3A 1D4VB 3AP7A 5FMOL 1R1A1 2QJVA 5B2GB 2HWE2 3D82A 4Q4W2 3D5OA 3ZX7A 4ZU4A 2D93A 5GZDA 1ZZ9A 3O5SA 4GB31 2WL1A 5F6KA 5BYNA 2E6VA 5JMCA 1KRIA 3ROUA 2VUAA 5LK5A 1QKQA 2BWCA 3AKPA 4RSUA 2UYBA 3VDDA 4UBGA 3WP4A 1AL23 2BEOA 4OI1A 3FJSA 4WM8B 2R1BA 3NWKA 5KXEA 4YM1A 1YI9A 4C90A 2A6YA 4MXVA 5D8AA 1N1YA 2K9ZA 4QPIA 2PHRA 3B69A 3ZVXA 5C8CC 1ZVFA 1L3JA 1PM7A 2DCTA 1RINA 1CPMA 3VZKA 3POWA 2ZS6B 5CBLA 4N43C 4GULA 3DPRB 4NWVA 4XFFA 2ZJCA 3HBZA 4HK9A 5K9YA 3AZYA 3UJOA 3ZYPA 3OF1A 3O14A 1XE8A 1WLWA 3BB6A 1GNHA 4FOQA 4PBPA 1PIV3 5FPZA 4I3PA 3QLQA 3VKOA 2HWD2 5JOYA 3WV6A 1LHWA 1QOSA 5BNNB 2YY1A 2PHWA 5T50A 4RA0A 1UW8A 2XJTA 4M0HA 1DQ2A 2ZAHA 2Z69A 5T3NA 4COVA 5FO7B 5CFCB 2E63A 2ZHMA 4EWAA 4S2HA 4JCKA 4Y5Z0 2HWC1 1JN2P 2R49A 4FQ4A 1DZRA 3D4KA 4Z1VA 3LA2A 2BVBA 1DGRN 2YMZA 3WQ0A 3QACA 3VZOA 1DBNA 4HPKA 3R6SA 2WZR1 2VH9A 2YV8A 3AYEA 3N3HA 1AF9A 4EN6B 4L97A 5IT6A 4JDMA 3WW2A 1HQWA 2XJUA 4COWA 3NV4A 5FMOS 1W6OA 1VB2A 4OI2A 1S0CA 1ZRFA 2Y26A 3M8LA 4I0WB 4IEZA 3OJBA 3FLTA 4M0NA 3VBHA 4XJWA 2ZA9A 3NL1A 2Y0OA 3KLSA 3W59A 3SH4A 4B4QA 1H9WA 1YI7A 4GWMA 4XZPA 1C1LA 4XMAA 1HRI1 4AFMA 3TN93 2W68A 4Q4W3 1X50A 4AE2A 4OVEA 4IV1C 1JYCA 2XKOA 1S2KA 2XVGA 2GH2A 2XLGA 1UD1A 4F8AA 3L2HA