3WXPA

Structure of hyperthermophilic family 12 endocellulase (e197a) from pyrococcus furiosus in complex with cellobiose
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQAVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase A
publication title Structure of hyperthermophilic family 12 endocellulase mutant (E197A) from Pyrococcus furiosus in complex with cellobiose
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 72
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wxpA00
3WT3A 4IXLA 1H4GA 3AKQA 4HKLA 1PVXA 3VZLA 3WR0A 3WY6A 2BWAA 2DFCA 1REFA 1H8VA 3WQ7A 1NLRA 1XNDA 4S2HA 2DCYA 2NLRA 2Z79A 3B5LB 1C5IA 4XQWA 3EXUA 1F5JA 4NPRA 3WP6A 1XYNA 2VUJA 1XNCA 5K9YA 3WQ0A 2BWCA 3MFAA 3AKPA 1H0BA 1TE1B 1OA2A 3AKRA 1T6GC 2DFBA 1REDA 1KS4A 1BK1A 2B42B 2VGDA 3B7MA 3VZKA 3WX5A 5HXVA 1W2UA 2QZ3A 4HKOA 3AMHA 2D97A 2NQYA 1UKRA 3LGRA 3AKSA 3MF9A 1XXNA 4XQDA 2BW8A 1OLRA 3VZMA 3VZNA 3VHNA 1QH6A 1REEA 5K7PA 2QZ2A 3AMNA 1HIXA 4H7MA 4HK9A 4XQ4A 2B46X 3VLBB 3RI8A 1H4HA 3VHPA 2B45X 3LB9A 1AXKA 3WQ1A 2JICA 3VHOA 4S2GA 1BVVA 3AMMA 3VGIA 1HV0A 4S2DA 4XPVA 1OLQA 1C5HA 2DCJA 3VZOA 3MFCA 3RI9A 3AMPA 5EJ3A 2BVVA 3MF6A 3AKTA 2JEMA 4HKWA 3M4FA 1ENXA 1XYPA 1XNBA 1H1AA 1XNKA 3WP3A 3VZJA 1XYOA 2VG9A 3WXPA 1HV1A 2JENA 3VL8A 2VULA 4S2FA 1UU4A 2DCKA 1OA4A 3AMQA 3WP5A 1QH7A 1UU6A 3O7OA 1BCXA 3HD8B 2D98A 3WP4A 3VL9A 1UU5A 1YNAA 1OA3A 1IGOA 2DCZA 1M4WA 4HK8A 1KS5A 3ZSEA 2C1FA 2F6BA
chains in the Genus database with same CATH superfamily
5A7WA 1ULEA 5C4WC 4YW6A 3WNMA 1PVXA 4LO5B 4N8MA 1HN1A 2VBDA 2XDVA 4QKFA 1GNHA 4R8HA 1FATA 1CZVA 3OGJA 4K9SA 1S0FA 3MV01 3URFA 4XDOA 1EV11 2RM23 1QMJA 2QQUA 4Q4X2 4D6SA 4NPLA 1RUE2 4QKBA 4JX0A 2Q5TA 3VDCA 4AVCA 2ZHLA 1O91A 3R4UA 4I0WB 1JU3A 4MZUA 4FTBA 5JCTA 3O1PA 1LJ7A 1JODA 3MV11 3P3NA 4CPBD 1WMXA 4K40A 1BK0A 2UU8A 3FBMA 4CUGA 3FE5A 1I5ZA 3J9SA 1AYN2 4ZZ5A 4JGZC 3LIHA 5JSPA 2ZMNA 3M3OA 4DXZA 4GWNA 2YC2A 2DF7A 4XABA 1MZ6A 5FY7A 3KT1A 1BKZA 3K4ZA 1W6OA 3ZSMA 1W05A 3JQWA 3CL1A 4CDWC 4FO9A 2QQMA 4QX3A 5DAWA 2JD4A 2HKXA 4DMIA 1WW5A 2V5DA 1FI2A 4ASMB 1MQTC 5CVRA 3BPSA 2IVJA 3FZ3A 3SCHA 4CDWA 1IPJA 1OF3A 5E89A 3KD4A 3VN4A 4BXFA 3D8CA 1OPOA 1IQDC 2BW8A 1P8JA 1WZXA 4ZXKA 4L99A 3ZIXA 4TLGA 4HOOA 1U12A 5HCHA 3AMNA 4Z82A 1MQTA 2VCMA 4RL7A 3NMBA 5T5PA 4ZKTB 2E7QA 3FLTA 3K51A 4Q0VA 3LPGA 2JXAA 2BFUL 4MX3A 3WDWA 5J36A 2QQPA 4QWNA 4Z1VA 1NKGA 2X10A 1UX6A 3ZIWA 1C3HA 1RHI2 2YHJA 2GC2A 4LHLA 3U4SA 3VBRB 2HWF1 1BEV2 4D3WA 3PURA 4Y1YA 3O1MA 1PMJX 2VNRA 4IEWA 4LIVA 5FY0A 4ET7A 5CAZA 5G05L 1URXA 3OTFA 4XFBA 2B7YA 4ZS3A 2ZJCA 1ZNPA 2XJSA 4IEZA 2RJLA 4N9HA 5EJ3A 3RJ2X 2DTYA 4META 1KXGA 2ZBJA 2VH9A 3OEAA 1HRV2 2D5FA 4L9BA 5GZEA 3N4MA 3FFQA 4B1LA 3DPRC 1EUTA 5GKAC 2R49A 4YVWB 2YXSA 4OMCA 3VUOA 2QVSB 4PHZA 3BN6A 3IN9A 3S6PA 4JTOA 4MO3M 2XWJB 4AVVA 3PIGA 5KHGA 5LY2A 1ZRRA 1LEMA 5ISLA 1S55A 4XUNA 3W5MA 1AR62 1OQDA 1Q8PA 5E88A 3WQBA 5J96B 3GZTB 2VZ1A 3VD9A 5C33A 2C4XA 4FPHA 3O12A 4RFT0 1L7RA 3C7HA 4GULA 5EHDA 2BGOA 3K3OA 3T0BA 1AJOA 2O8OA 2XWBB 3MIGA 2UURA 5H9RA 1GOGA 3EHKA 1WLDA 2CY6A 5KHIA 2HJIA 3A21A 1GWKA 3NAPC 3POBA 4K8RB 2K2SA 4COVA 1K42A 3RGBA 3RYPA 2JDAA 4A7YA 3HQUA 1WLWA 5CFDC 2DFCA 4LQRA 3PTYA 1MEC1 4IEPA 1HN0A 1DQ1A 4XJ8A 4AG4A 2NLRA 1JBCA 1YFWA 3W20A 4A45A 5AFBA 3C2UA 4ZS2A 3IKWA 3PMEA 5CFDA 5J48A 5BY5A 1T2XA 4OYUA 2VUJA 5FP3A 3IDEA 1RUC3 3MFAA 5GJ6A 5FY5A 3V0AB 4LBOA 2RM21 5JIAA 1GQGA 2HWD1 5CEHA 4EZHA 5LEJA 4AEMA 5C5UA 1O7FA 5FYCA 1LOEA 2JE8A 5HCFA 4YW7A 1DZRA 2SLIA 2ZGUA 2A70A 4J6GA 5FUNA 2J1TA 5JPNB 5CA6A 4CEYB 4FSJA 1PM7A 3B7MA 1OFNA 1SLTA 2G9GA 3AZZA 3ZYPA 3NNLA 4QQHA 3ZLIA 1ZRFA 1Z7S2 1HX6A 1FXZA 1Q3EA 2HWC1 4J1WA 4KNCA 4NHLA 1AXYA 1MZFA 4D0QA 1SLCA 4GH4B 3B93A 5FYBA 3AP6A 1LKNA 3VZNA 3ZN5A 1H2KA 1J83A 5FZBA 2WO3A 3T08A 4CDQB 5AC91 2IXJA 3E6CC 4NIGA 2XBO2 1EP0A 3I2KA 4B8EA 1W9WA 2H6BA 5C4WB 1Y9GA 5EV7A 2XQRA 4RHV1 3DKWA 1ZBE2 1CJPA 3RDIA 5FCCA 1ONAA 3LEIA 4AFDA 4JKMA 2Q8CA 3RZJA 5FZFA 2CWSA 3KV5A 3ZKUA 1JHNA 1XC6A 2C5DA 4NOTA 4YZ4A 3UKNA 2E63A 1MS9A 3E6DA 4QKDA 3VD7A 3ZYJB 1HXS1 4URAA 4QAWA 2VW1A 4KWJA 3ZN4A 2W5FA 1AF9A 1UL9A 3KGZA 2EAKA 2XH6A 4HLTA 4D8MA 4XBQA 1YCIA 2GU9A 3C8XA 4NUBA 4MHRA 4BZ4A 1W6OB 5ACA1 1PGL1 2E31A 4JGZB 3PUIA 2PHTA 4Y4RA 4AEJA 5C3OA 4AI1A 2W92A 1G9CA 2VU9A 4FQZA 1CPMA 1QOTA 5ANQA 3MI8A 1OFSA 1VBE1 3POJA 3Q9OA 1DLCA 3VD3A 4EN7B 4CDWB 1VALA 1Q8SA 4EWAA 4WV8A 4LPLA 2AUYA 3OGGA 5FJHA 2ZGMA 1Y7BA 3OG2A 4O9EA 4Y26A 1RL3A 2ZX0A 2VM9A 1HRI1 2JDUA 4E4DX 4Z8BA 1MQTB 1QQP2 3N7LA 3NO8A 1G7YA 3SMHA 3CEWA 3ETPA 5F5CA 2HYXA 5E6HA 3RJRA 1DQ6A 1FV2A 2JIJA 3DYOA 2BGCA 4BLIA 2DCZA 4KWUA 2DV9A 4F3JA 4NRPA 3AK0A 3WDTA 3SNMA 1T6BX 3RZGA 1W8ZA 3R4DB 2X05A 2VZRA 5H9PA 1SMVA 1XBFA 2GMPA 1W6QB 2ENRA 3M70A 1UYPA 4PQ9A 1OLMA 2QTWB 1LU1A 4UI9L 3RNSA 4AI3A 2XL7A 3ZYGA 2OQ7A 2VZQA 3AFGA 4AWDA 1UKGA 4MVTA 4UFMA 5H9SA 3FFZA 1JUIA 2HH9A 1NLRA 1WBLA 2Q30A 1KDMA 2WT1A 2XKPA 3LA7A 3P1IA 2ZEYA 2DVGA 3WDVA 3D0SA 4LT5A 1ZRCA 1DLLA 4J1XA 3U0ZA 2PLV3 3WDUA 1N1YA 1OUXA 3WQ0A 3TEWA 3HR9A 4EROA 3ZSKA 3DPRB 2RS12 2E32A 2VL4A 5ERLA 3S7IA 1HLCA 3SC7X 4JDNA 3CDZB 1YWKA 1PMHX 2P2KA 4UW4A 4JQTA 2RDRA 3PVEA 4XHBA 5FYSA 3UJOA 4HSLA 2J1VA 4FPOB 4A7KA 2JB8A 3OCPA 5DAXA 2TBVA 4JGYC 4MSVA 3HNBM 2SBAA 3CZJA 3LDBA 1SFYA 1LESA 5FTTC 3O1VA 4BHPA 2AENA 5FMOS 1X8MA 1S2EA 2XJUA 3J4UH 3IAQA 2WT0A 2BBAA 3DGTA 3VDAA 3ZXDA 5FZEA 3FBYA 4JGYA 4EYUA 4GAZA 4Q4V2 5FY4A 1JUHA 4D69A 1ZBA3 2ZA9A 3V65A 2WIIB 2VW2A 1ZZ8A 3WEZA 4YM0A 2BOIA 2P34A 2XONA 4BDVB 3NKGA 1Y4WA 2Q1ZB 2ZAAA 2WRAA 1AVBA 1ENSA 1OVPA 3RQ0A 1OQ1A 1N1SA 1V6JA 3NAPB 3THDA 1OXCA 3NJZA 3RI8A 3ZXLA 1GU3A 4H3WA 5CFDB 1OF4A 3I3EA 1QEXA 3DYPA 3G7DA 3AMMA 4GB31 2P5BA 5C3SA 5IK8A 4XMAA 4NIAA 2GZWA 2WFF3 3WZ1A 1A8MA 2E51A 3O5SA 4Q0QA 4X6RB 4FPGA 4XTPA 5IAVA 3ILFA 4HANA 1KJLA 3MF6A 3GJBA 4YVSC 3T0AA 3KF3A 2GNMA 4UW6A 4YG3A 4QB6A 4A42A 1LAJA 4RYDA 4Y1VA 1AR71 1XYPA 2FMYA 1WW7A 2ERFA 3GCXA 3L9JT 3W5NA 1IOAA 1EAH2 4JC1A 5FYTA 1G9FA 5GLTA 2AREA 4LR4A 5FIXA 2VXJA 4LEJA 4WM7A 2CGPA 2PYTA 2JDMA 3WXPA 1VBC1 4K6BA 1XJAA 1MZ5A 2GH8A 1MVQA 4XEZA 1O4ZA 5CYYA 4C0BA 4DEVA 1UN1A 3ABZA 3HQXA 4OUEA 5FMOL 1QGLA 2JG9C 2W68A 1KFUL 1PO21 3SCFA 1QH7A 1LHNA 1DGLA 3T0DA 3JXSA 3KHBA 1Q43A 2DBNA 3KSCA 1AZDA 3T1MA 3HVDA 3MHZA 2BNOA 5L73A 1JZ3A 3PU3A 4QU1A 4XF1A 1XE7A 1Y9MA 3RG0A 5CKMA 5L7OA 1FYUA 4XUPA 1W6NA 1YFUA 4JVAA 3EMRA 1W6MA 2LRPA 2FDFA 2BQPA 3OGVA 4P9XA 1GANA 2ZMLA 3TEXA 1Q5OA 3P3PA 4BXSV 3VZLA 4A7ZA 1Q8OA 5DDJ3 3WY6A 3ILRA 4EV0A 1OKOA 5FZ7A 4AEKA 3DKQA 1YLLA 4YYOA 5IUQA 2ZGOA 3WQ7A 3RSJA 5FPXA 5F5IA 4FT8A 1WBFA 2YFZA 4ISQA 1POV0 3GXUA 2Z79A 3A0NA 3TYJA 1C5IA 3AJYA 3JBG1 1S0IA 1D4M3 2ZX4A 3EXUA 3J7LA 3ACGA 3OPWA 5J1XA 1AR91 2DUQA 1KQRA 2AACA 5T55A 1QDOA 2BWCA 2H6CA 5FZOB 4EN8B 3KWVA 1VBA1 3GNEA 4CVUA 1SFPA 2A71A 5F7UA 5JAXA 2EALA 3PHMA 2GN3A 2DUPA 2W1QA 4MOAA 4QM8A 1PZ9A 2BNNA 2K9ZA 2A3XA 4I30A 2HBTA 2VZOA 1TMF3 1GOFA 1PO13 2D43A 3LZZA 2DYCA 3LA2A 4IV3B 1BK1A 2EXIA 3K48A 2FBEA 4ZXEA 5HXVA 4GMP1 2CNAA 2JD9A 5D8AC 3L2HA 4GWMA 2Z5WA 5BNNC 1TME3 4E4ZA 5CNAA 1UKRA 4HN0A 2XLFA 3JD71 5D8AA 1R1ZA 5A7SA 3VZMA 2ZAHA 3UGFA 1JZ8A 2D5HA 3IDBB 4ORFA 5JMOA 1K3IA 1LGBA 3RS6A 1HKDA 1PHMA 4E2SA 1RUH3 4P5HA 1X7NA 4DQAA 1W9YA 3N9OA 2WNUA 1H4HA 4FOWA 4JKKA 1ENRA 2BNMA 3KCYA 4AK3A 1CWPA 3DYMA 1F9KA 2MPFA 2OXBA 4XF9A 5IK7A 2UWBA 4ZZ8A 2GALA 1DGRN 3BCWA 3VGIA 1IS4A 3QH7A 1GWLA 1TEIA 2BTVC 2O1QA 4CSWA 3B9CA 2P3JA 4TSVA 1UOGA 4XFHA 2EIBA 2Q1MA 5JOZA 1FNYA 1NZCA 4DY3A 5A70A 5FUIA 3WUCA 2AH2A 4PLNA 2PMWB 1V6OA 1SPPA 3M3EA 4W6YA 1QXRA 2JEMA 5IHRA 5DABA 1UOJA 1F2NA 2CGOA 3RVHA 4E8DA 5JI7A 1H1AA 1XNKA 3MW2A 4EWDA 4JGYB 3W9AA 3D4KA 1UPIA 1R1A3 5A7NA 3OUIA 1SQ4A 2J1AA 4P5YA 4MADA 2BP6A 5FLJA 4AQ2A 4L8QA 3TB0A 4AI9A 5DQ0A 1KGYA 5GLUA 5IVYA 1JTZX 5FY8A 4BIOA 1WMDA 3WW2A 5IATA 5FPAA 5JWPA 3NNMA 5FZCA 2WJSA 4LXLA 3I7DA 4YNIA 4Q26A 1UU5A 3LDRA 1AL21 4GWIA 1IGOA 1PIV3 4QGLA 5FFOC 2VBPA 4ZONA 5K8SA 1X36A 1YJLA 3H0OA 3C7FA 1QJX3 4N7UA 1OLME 5JXGA 2CGNA 2WN2A 5F39A 4A3XA 4FFGA 4ONUA 2HLEA 4QX0A 4YM2A 5FPBA 1R081 1ENQA 3G6JB 1GWMA 1QF3A 1IQAA 5LA9A 5IVBA 5FZDA 1H2LA 4AHXA 1ZZCA 5KXEA 4MHUA 1C8M3 2JIGA 3SKVA 1F8VA 4B4QA 2VPVA 1VAKA 1RUC2 5F3EA 4DEQA 1XNAA 2B5HA 3WG2A 1NUKA 1IPKA 2YBPA 2GP3A 4YVSB 3UGHA 2EAAA 2W91A 4OUSA 4D7YA 4B4PA 3LOBA 4QMAA 2Y6LA 4XETA 5DDJ1 1PX4A 2XVKA 4OLLA 1D4VB 3H3ZA 1D0HA 5F3IA 1H6YA 1SCRA 2R1DA 1EV13 3J7HA 4YZ5A 4OZXA 4QPIC 2JE9A 4QT6A 3W58A 1DYKA 2YDEA 1ZZ9A 3M3QA 4G4FA 3KV6A 4YM1A 5BNPC 4QXCA 4AHZA 1YQCA 4LORA 2WLPA 2JG9B 2P3YA 4UW5A 5FYHA 3H42B 3T3YA 4QPIA 1JZ2A 1MPXA 1K5MC 1PZ8A 4Q4W1 2C24A 1W6NB 4MXVA 1DQ2A 1RYYA 4Q8LA 3ZMNA 1YHFA 1GOHA 5BNPA 3QLQA 3UYJA 1CAXA 1MZEA 4LJHA 5A7PA 3IWZA 2TUNA 3ZPYA 1ODMA 4DS0A 3FMGA 4HZFA 2VNVA 4OMDA 1W9TA 1PO11 2ADDA 5FKBA 3UETA 4CU7A 3VHNA 4IEVA 3SH4A 4OHZA 2IUWA 4XJWA 2WFPA 2LM3A 1IKPA 3TWIA 5HV0A 5KHKA 2GC3A 4H7MA 4MGTA 2WS93 2Q4SA 1PGW1 4CP1A 5FXZA 1D2QA 1LOBA 2NMOA 3ENRA 4NAMA 4LKDA 1N47A 3AVRA 4YZ1A 1H2MA 4DRRA 1LCLA 3HT1A 1IG0A 1R64A 2WSVA 3ORJA 1V6KA 4XDPA 4P9YA 1YUDA 4FXKB 3CLPA 4AL9A 4ASLA 1PVC1 1SCSA 3I3BA 1RVF2 1W0OA 1VAVA 2BVVA 3AJZA 3HT2A 3PUHA 5BNOB 5FR3A 1JZ7A 2W0XA 3UGGA 2HWF3 2ZABA 2Z4FA 1UYZA 2DU0A 3M4FA 5DZGA 1EUUA 2ZGNA 3GM8A 1RJ7A 1NLSA 4AXOA 2EF6A 4CXXA 2NMNA 3WF2A 2W52A 4XOGA 4YW4A 1TZOA 2QJVA 3R0RA 4LA2A 5FLIA 4BQ2A 1KEXA 1AX1A 4XFAA 1DP0A 2YG0A 4AGRA 4KQ7A 1W3VA 5JIUA 2WABA 3OBTA 5JXIA 3ROUA 2HEWF 5D8AB 1UU4A 1GSLA 2DCKA 1V9U1 1NCRC 1OA4A 2V73A 5BNNB 2WLQA 1CZSA 3WCSA 3WF1A 3RZMA 2WZR1 3B3QE 2FDKA 2XB6C 1Z78A 5C8CC 4BB3A 3WF3A 2XHNA 3ACFA 4UYBA 1FPN1 1C4RA 1I9RA 2XVLA 1NCRA 3BGAA 3N3HA 2ZEWA 5AVAA 4K1YA 4OI4A 4GKXA 1A78A 1EPWA 3VBHC 5C8CA 1G9BA 4QM9A 1UMHA 2OZ6A 1MS4A 1NYWA 2QKDA 2J42A 1LOCA 3KQ4B 2ZHKA 1NXD1 4R9CA 3AKQA 1QHDA 4RS5C 5I0UA 2Y38A 4HVOA 4JHTA 4TXWA 1CVNA 1HB1A 3VBHA 4C91A 5D2AA 1PM4A 4GXLA 2A73B 1ULCA 1GP5A 2PLV2 2YGLA 4DOUA 1W2OA 3IDCB 3LKJA 4RS5A 1CAUB 1ULOA 2C6SA 2OT7A 1O3SA 1NLQA 5EQUA 5SV5A 2JG8C 2VOKA 4CCDA 1POV1 5FY1A 1CAVA 2H0BA 4NIIA 1S0EA 1ZRIA 1RTVA 3HQRA 3WG3A 1TG7A 4YGCA 3RMXA 2ZX2A 3K4AA 2GDFA 4YGEA 4XW3A 4CP2A 2JG8A 5LRSA 5EIYB 4EN9B 2CU5A 3BKZA 3B69A 4LOTA 3B00A 1MEC3 2BZDA 4KMQA 3NV3A 5HI0A 2XHKA 4HFSA 3V64A 1QNYA 5CFCC 2ZZJA 1OA2A 3K3NA 4Q0PA 1LOFC 4XUOA 3AKRA 1VBB1 1Q8QA 2AEZA 4QQPA 2Y60A 4GH4A 3RWNA 5AFEA 1RB8G 1ZBA2 3H1WA 3NV2A 3J8F1 4ES8A 2QBXA 1W06A 4V2VA 4AE2A 4CDQA 2X5IC 3HIFA 5CFCA 1LOFA 5AVPA 3SEPA 2BERA 2HWD3 4NE9A 5C4WA 4N53C 4HKOA 5EYYA 3NVCA 1CGPA 1HJGA 2G9FA 2O14A 3K4DA 1EY2A 1W0PA 2BEOA 2X5IA 4NHKA 1W90A 3AL5A 3AKSA 5DG1A 5L19A 4I2OA 2R041 3THPA 4XILA 4N53A 5FMCA 1ZZ7A 3OPTA 4BJ0A 4RGGA 2UYBA 2VOWA 4OHXA 2HWC3 4YW5A 2V4AA 4LNVA 2B46X 4QDSA 2W1SA 1K45A 1BMV2 3OPZA 4GALA 2WFF2 4XJUA 1JYWA 1W9SA 1LHVA 4EE2A 1U5IA 2BGPA 2W1WA 4P02B 5AC93 3AP7A 4JGZA 1UPSA 4LBMA 3LFMA 5B4XA 3I97A 5A1LA 1RUJ2 3RZZA 3MFCA 2WS91 2Y6JA 4RHV3 4JDOA 4AOCA 1YRZA 1Y9QA 2LUWA 4KU7A 3RPQA 4E4SA 3V0BA 4A44A 3AKTA 4QU2A 4KWLA 4QPIB 1W6PB 1JI6A 1VPHA 3E5UA 4CCMA 4P9GA 4QPYA 2ZPXA 3LD8A 4UFIA 4YW1A 5FJKA 4CYDA 5BNPB 4IE5A 3WV6A 1H1IA 1HXS3 2VTXJ 4AZZA 4CP0A 4KH9A 4Q4Y2 1CAXB 1QDCA 3POYA 3POFA 4XAEA 1K5MB 2F4LA 2E9QA 2D7FA 2GH2A 2FDGA 4B1MA 2DCTA 3R05A 4OI0A 1OURA 2JKXA 3TBDA 3MYXA 5ACA3 4RR3C 5T3NA 1SBEA 1TQ5A 2I74A 4B3NA 3O7OA 4H55A 4LUMA 1VBD1 4D7SA 3MIBA 1UOBA 1W6QA 2EICA 1VBE3 4BIFA 2WWSA 3N35A 3I54A 3SLIA 5A80A 1RUNA 3Q8AA 1GICA 2O0OA 2XLGA 4OUMA 5FYMA 1CQ9A 5GLVA 3N9MA 5FZLA 4N43C 4COWA 3UV9A 3ZSEA 2VQAA 3LCPA 4H14A 3LDKA 5C8WA 1HRI3 2R062 5CBLA 1SZBA 1VMFA 3W21A 1PNFA 4M4RA 1H9WA 3ON7A 4XF3A 5CIRA 3EQEA 4XXAA 4CU9A 5EJZB 1D4M2 4LO6B 4QPGC 3NSTA 3DPRA 2EIDA 5DUXA 2OVUA 4SBVA 2FDHA 2QQNA 2K0GA 2XVGA 1ZYBA 4S2HA 2MEV1 3PDQA 4BH9A 4H7LA 2FZ1A 3J26N 3OD0A 4DPNA 2GMEA 2BV4A 5CZKA 4O61A 5T5OA 3WW1A 3WP6A 1XE8A 3ES1A 1J59A 3HNMA 2DWRA 1TMF2 4OHYA 3GZAA 1RUF1 1S2KA 2B9UA 3THTA 3LSDA 1H6XA 3KCCA 3PVBB 4XACA 3ZDSA 1ULFA 2V5YA 5I8YA 2D40A 1TME2 4XMIA 4IGPA 5J98B 1NCRB 2RMU1 2OW4A 4IEQA 2RS31 4LK6A 4IW3A 5C8CB 4XIOA 5FXXA 1VRH3 3NAPA 3POSA 1U5ZA 4L92A 1H30A 1QJZA 3U75A 5H9QA 5J3UA 1ZRDA 2GC0A 4UFHA 4DNYA 1RUH2 5DMYA 1E5IA 4A2UA 1UD1A 1W03A 1XXNA 2IXLA 3VBHB 5C5TA 1PX3A 3TNPB 3VKLA 1CJDA 5FUPA 1AYM1 1E5RA 4YZ3A 2Q1FA 5EYXA 4CUAA 4RS5B 3NNJA 3GALA 5IYYA 4UF0A 3BTZA 1CAVB 2Y34A 4R4ZA 4AI0A 2XKOA 1PK6C 4IEOA 3AP9A 1L3JA 5FXWA 1WLTA 2W9XA 3M2MA 4GQ7A 4NJ4A 5A3LA 2OKXA 2JG8B 3VHOA 2OYZA 1KRIA 3U14A 3TN91 4E27A 4C1WA 4GMP0 4E8CA 1KDKA 4LE3A 1PK6A 2PHFA 3A23A 4QGMA 3VZOA 5FO8B 2AGSA 4UFJA 3HBKA 1SHWB 4AFCA 3HPNA 3FWEA 4HONA 1R1A2 1WMFA 4URTA 2XJTA 4DO0A 3VBOC 3NL1A 3SISA 3O0XA 2CDOA 5CFCB 2R30A 4BQWA 1JHJA 4GB33 4Q1RA 1R091 4AFBA 3KVAA 4FOYA 1JU4A 4Q29A 5DAVA 5EJ1B 4HG6B 2WNVC 5J09A 3ZR5A 1X50A 2VQ0A 1H1MA 3O0VA 1HV1A 2X5IB 3DV8A 5LBCA 3I8TA 4B7EA 2FMDA 1PIV2 3VL8A 5I0DA 1RUD1 3POIA 1XQNA 5LRRA 4N53B 2WNVA 3IT8A 1AR73 3AMQA 4WZCA 2QQLA 2VQTA 1BLZA 1QJX2 1RMU1 1UU6A 1WCUA 4CDXC 4FTEA 4NRMA 4HL0A 5JDBA 4NMIA 3VL9A 1JYTA 4ZU4A 2Z42A 4KBBA 3FC0A 1VBC3 4GIQA 2NPIA 2E6VA 4WVVA 4RA0A 3VB9A 2I2SA 4CDXA 2PXJA 2BBVA 3WW4A 1O59A 3TEZA 1UF2C 4JCKA 5F9TA 1PGSA 2VOXA 1C8M2 2C1FA 1KFXL 1ASJ1 1PO23 1DQ0A 5KHJA 4ZY9A 1NAEA 1HB4A 1Q8VA 2NYYA 3ZYRA 5FV3A 2QQKA 4ASKA 2R071 3POWA 4G3YC 3SH3A 5LB6A 1J84A 2F17A 2Y6GA 3V0BB 4XUQA 1OSGA 1PNGA 2A3YA 1SDWA 4WM8C 5DUWA 3N7MA 5FZOA 2ARBA 3FJSA 3O1SA 2Y6HA 3N7JA 1RIRA 4IV3C 1ZX5A 1DU3D 1EV12 3BYWA 3IBMA 4XIKA 4BU2A 1GUIA 1SLLA 3IPVB 2P3KA 1V6NA 2WDBA 1WW4A 4HMZA 4WM8A 3O1UA 4YG0A 2QQIA 1LODA 1JOBA 1XNCA 1OQEA 3AVSA 4IV3A 4MGIE 5DUUA 3U37A 4OI2A 2D6NA 4M4PA 3S0MA 2RDQA 4HN1A 1FOD1 3BOPA 5F37A 3JBG3 4QXHA 1AR93 1V00A 3NW4A 2BU9A 3EO6A 1OHFA 1REDA 4RR3B 4M3CA 3ZDVA 2B42B 5GZCA 1VLNA 3CKHA 5CG8A 4IE0A 1VBA3 1WMEA 2A6ZA 2Y0OA 4KBZA 1O3TA 3KGLA 1HQLA 5KC6A 1KITA 2DTWA 3AL6A 5J37A 5K4LA 3DEMA 2RR11 4ZHNA 5EPAA 2XJRA 1GNZA 5T52A 4N43B 5F2SA 3PUSA 2BPA2 3P6BA 2Q8EA 3ZFEC 2ARAA 2ZTNA 4GMP3 2RVAA 1U5XA 2R0HA 1QKQA 4NHMA 1XPWA 1UY2A 2IVIB 4XDQA 5JXJA 1VRH1 2CYFA 1L7QA 3K2OA 3QH6A 3THCA 3HBZA 1ZVFA 1US3A 1BXHA 3AM2A 3FX3A 4IGQA 4MXWA 2YYOA 4QPGB 3JD73 3ZFFC 3ZFEA 2L9LA 3MEPA 3QACA 3PJQA 4AVTA 5FK7A 2HWF2 1S2BA 1QJY1 3U1XA 1O4TA 2ZS6B 4CCCA 3JZVA 4Q8KA 5C9AB 5A3UA 4JRLA 4HXCA 1NY71 3DECA 1GP6A 1WCKA 1FAYA 1CONA 4UFKA 5LZ6A 2RJKA 2ZX3A 2FDIA 3HAGA 3LWCA 1WCSA 4PDWC 4PIYA 2PAMA 5FZ9A 2AR6A 3N9PA 4AHWA 1ENXA 3WF4A 4V1PA 2Y64A 4ZPIA 2PTMA 3O1OA 2ZGTA 1XYOA 4AAXA 4AQSA 1I3HA 2A75A 2WO7A 1FMD1 4PDWA 1DZTA 1WA4A 3T1LA 3S5AA 2VUAA 5FP4A 4AGGA 3KLSA 2IXKA 1AR81 1MS1A 4M0NA 3RZLA 4LBQB 2CWMA 4IESA 3HJRA 4TN7A 3SHRA 4BM8A 2Z69A 1D0GA 1K5JA 4Q0UA 4UF0B 1WGPA 5KXBA 3I3QA 1O3QA 1APNA 2X8KA 1OOPC 1RUG1 4FTSA 2BRTA 5E1RA 3NJXA 1UCXA 3E5XA 2D3PA 1KJRA 2ZGKA 2DVFA 2VZVA 2J7MA 3LPFA 1PK6B 3IDAA 4XFCA 1OOPA 4YVSA 4QQOA 4AHYA 1ZREA 2ES3A 1UY3A 1AL23 2R0FA 3CJIC 5LA0A 1QXJA 5DXDA 4CXYA 1YYNA 4R9DA 3TAYA 3IZOA 2OIIA 3KQRA 5T5LA 4MUVA 5BXXA 3TN92 4CRQA 4P9LA 3ZYFA 5C3RA 2QUOA 4QDRA 3CJIA 1XNDA 3LEKA 5KBFA 1BBT1 1MEC2 3MICA 2DCYA 2HEYF 4XAAA 3ZOIA 2RS51 3VBOB 5M0TA 2P4EA 1R083 3L2YA 5IVEA 2JG9A 1UIJA 4Y1XA 1FX5A 4IE4A 4CXWA 4NHYA 4Y33A 1S0BA 5CU1A 2WR9A 3AKPA 5DG2A 1MS5A 4XTMA 2HWE1 3PL0A 2B4KA 4KI5M 3T2PA 2WNVB 5KHHA 5C6CA 3EB7A 1COV1 2RM22 3C3VA 3H7JA 2HWD2 1AX0A 4BOWA 1TNFA 4COUA 2UY8A 1X82A 3DUIA 5SV8A 5LA1A 2W94A 4D7TA 4W6XA 4K21A 1W04A 4YW2A 1ZA7A 2VGDA 3WX5A 4CDXB 4EJRA 5A3TA 3LSEA 1DDLA 1XU1A 2EXHA 3VBFC 2QZ3A 3EJKA 3ETQA 5BUVA 3M3CA 1F31A 5JZGB 1GZTA 1UMIA 3KV9A 2HWC2 2LS6A 4HVQA 4PI0A 5DPNA 1S0GA 3VBFA 1NT0A 3ZVXA 3I2GA 4P9JA 4XQDA 2B9VA 4BK5A 1QH6A 2OX0A 4TYSA 4YRDA 4Q4W3 1NA1C 3OB8A 5F5QA 2D6MA 1QJU1 5BNOC 1GMMA 4R9AA 5AC92 4AGVA 2VOTA 2OQ6A 4XQ4A 2WT2A 5JSOA 1O6UA 4X8NA 1K12A 4IE6A 5FZIA 5A1FA 4WM8B 5F3CA 1ZZ6A 1NA1A 4RHV2 5FDBA 4LIUA 5BNOA 1HDKA 2W39A 2BUKA 4UXAA 1AXKA 1SLBA 3WNPA 4OVEA 2FCVA 4S2GA 5A7OA 4FAGA 4Y20A 4FPLA 5FZGA 2VJXA 3DL3A 3X29B 2WQZC 4O9GA 1LTEA 4U36A 1HW5A 2ZGLA 4DUVA 5FYVA 1HXS2 2WNEA 2K46A 3UKVA 5HBAA 1JZ6A 3H8OA 1DQ5A 1NE4A 1DQ4A 3JU9A 1B09A 1SLIA 3MW4A 4M3CB 2GMMA 4HSJA 5BNNA 1O8SA 1WCDJ 4IEXA 1RITA 1PGL2 5FZMA 2X29A 5ACA2 1GKBA 4FP2A 5FOJB 5JPMB 2LALA 2WWUA 3BU7A 4G9SB 1PVC3 2KM2A 2VG9A 4A6OA 1UAIA 2VO5A 1VBE2 5ABJC 4CCJA 2PQQA 2YB7A 3PLQA 3WP5A 4P9WA 3LQCA 3UL2A 4OQ9A 2ZX1A 1HB2A 4C90A 1HRI2 5ABJA 1CAWA 1RUI1 2D6LX 4XE9A 2VZUA 5JSRA 5DN2A 1H2NA 2JWPA 3N9NA 4LLOA 4MXWB 3PUAA 4W65A 3ZFEB 4QXBA 3ZN6A 1CR7A 5BV6A 2HWB1 3UJQA 4JRAA 1CAUA 5LATA 2Z2SB 1V9U3 4WZFA 2Q0AA 1IKQA 1STMA 2JDYA 4PLMA 4SLIA 4EWEA 2WZR3 3C7OA 3HMYA 4IXLA 1H4GA 1MS0A 4LITA 1WUVA 5LA2A 2JDZA 3ZFFB 3A22A 1F4HA 1FPN3 3NV1A 3QD6A 3MW3A 4Q4X1 3T2OA 4I01A 1W2NA 2A6XA 4K7JA 1RUE1 5I91A 2QNKA 3A0KA 3S5QA 3VBUB 3WLUA 3NQHA 5I8TA 3AB0A 3PJYA 1DCSA 4Y24A 5F32A 4TWTA 2A6YA 1Y43B 4LK7A 4CPBA 1SACA 5I0RA 5JVVA 4CEWC 1UZ0A 4UT5A 1KD7A 1ZZBA 2Y6KA 1SLAA 4PDWB 4XJAA 2ZEXA 4NRQA 3J7NA 3TNQA 1B35C 3ST7A 5L9BA 3V56A 1XNTA 1AYN1 4XZUG 4WVMB 4CEWA 4OHVA 2ADEA 5CKQA 2VUDA 2IFWA 1YI7A 2W1UA 4M3CE 2YUEA 5HCBA 3ZSJA 1POV3 1UXXX 4CP9B 2GC1A 1LULA 1B35A 2CTVA 5B4NA 2XBO3 1DGWA 3ECQA 1O4YA 4UFLA 3AYEA 2ZGPA 4Z2WA 3BUCA 4K3UA 4GKYA 4PT6A 1DZQA 1G8WA 3U11A 1X9TA 1C1LA 3D5OA 3GZUC 1RGSA 5A33B 5FZ4A 3ASIA 4BQYA 1VBB3 3O0WA 1OOPB 4IETA 2GNTA 3BVCA 3WNKA 2CSGA 3AP4A 1LECA 3J8F3 2ZKNA 3FHAA 5DAPA 2P6HA 4XCAA 2VMHA 2B39A 4JTNA 1HIXA 1S0DA 3T30A 1RHI1 2VXRA 4HK9A 5JLVA 4N9IA 4DXSA 2VNGA 3CJIB 5FZAA 3NRUA 3N9QA 4H2AA 4F8AA 4MLOA 1BEV1 2VNOA 3D0JA 4L2NA 3WOGA 4AI2A 2R043 1J3QA 1W6PA 2UWAA 3WQ1A 1QY4A 3ZXFA 3SXWA 1OLQA 4BCUA 3AXDA 4GB32 4FP3A 1ULGA 2KXLA 4AQTA 2YV8A 2NN8A 4CCKA 4YGDA 1K5MA 1O5UA 1HRV1 5FQ0A 4IDZA 1YQ6A 1N1VA 4IUGA 3ZMOA 1XSQA 3VDDC 1W8OA 4HKWA 2VVDA 4HETA 4KGGA 3BIEA 1C28A 5JOWA 1LOAA 1OKQA 1C57A 2Y8KA 4YLZA 3WP3A 2DVBA 3I2IA 1US2A 3SCGA 3T2QA 1AR72 2QQVA 4UBGA 3ZXEA 3VDDA 1N3PA 1N3QA 4O7XA 2YPJA 4LO8A 4YG6A 3VBFB 1VBC2 4IV1C 1AL0G 1AR61 3LEGA 4AW7A 1W0NA 4KL1A 1PO22 3HOBA 4BE3A 1YNAA 4IV1A 3DXUA 2VMEA 3M1HA 2ATFA 2ZOEB 1NA1B 1M06G 5LWBA 2C9AA 2VC9A 1KS5A 2FCTA 2XR4A 5TSWA 5A6QA 2RJ2A 3DCQA 3CNAA 4QX5A 1SBFA 3ILNA 4QX7A 4BYYA 4KGQA 3TRSB 4Y20B 3M7AA 1VBD3 1G6NA 5GALA 3AZWA 1IPSA 3M3IA 2J22A 5G04L 2VECA 5CKNA 4DRVA 3U4XA 5FK8A 1LENA 3RWKX 1AHSA 2UY9A 2J1SA 4FOVA 2GSYA 2VTXA 3WHUA 4FPKA 1SEFA 1X33A 4A6SA 2J1UA 1WLCA 1I5PA 1F35A 5F6KA 3EYPA 1OH3A 1UW8A 3WDYA 2Y0IA 4P14A 1XYNA 5KR7A 3ME2A 2JB4A 5K9YA 4NIDA 3JBG2 4CU8A 3ALQA 1AR92 1F4AA 1GFF2 4JAAA 2OS2A 2WUHA 4CUBA 1X9PA 1GP4A 1VBA2 2X09A 1GBGA 2Y6FA 3FUOA 3P5BA 4KG8A 5FO7B 4AF9A 5GLZA 2MEV3 5K0UC 5ABJB 1JOPA 1T6GC 1CAWB 1EPZA 4KWKA 4LA3A 4FPJA 3MUZ1 1S1AA 3UNPA 3ZN6B 3KB5A 1Z7S1 3VZKA 3GDBA 2WN3A 4RN5A 5K0UA 3VHRA 2E7TA 1RUF3 2WO1A 4OZOA 4IE7A 1WWYA 4CTEA 1WA6X 4JZRA 3IM0A 4RQPC 4AEDC 1LGNA 3KT4A 4YZ2A 4RSUA 1F15A 1JMUB 1WKYA 3LGRA 3U78A 2XBO1 3BI3A 3IAPA 2W2IA 4QHZA 5A3WA 3I3MA 1REEA 4RGAA 2RMU3 3JD72 5K7PA 2RS33 4Q0SA 3ZM8A 2UWCA 3MPPG 4RQPA 4AEDA 3H8RA 1ZBE1 1RXGA 3I59A 1JS9A 1WCQA 3VLBB 3PMSA 5A6ZA 1QJFA 1DF0A 2W87A 3VHPA 3H1MA 3LFIA 5FRAA 4W50A 4ATFA 4QXKA 1EAH3 3Q8FA 2CAUA 3H1YA 1AYM3 3HN3A 1LHOA 1W8TA 4XPVA 3SH5A 1G9AA 4CEWB 2DCJA 2P3IA 5FPZA 4FOQA 3PVOA 3K46A 4DINB 3ELNA 2XJVA 5FYIA 3MIEA 1B35B 2IXIA 2YMZA 2A6VA 3VKOA 4AYUA 2Y26A 2WZPP 2IXCA 4Y3OA 5E8AA 5BNQA 3I2JA 4I09A 3WCRA 4K8FA 3TN93 2BFUS 5IW0A 2WBKA 4HPKB 3VZJA 4BK4A 5KXCA 3U07A 1ALYA 1HQNA 4AVAA 1PMIA 4GJYA 4Y1UA 3SEEA 4E2GA 5FO9B 3D82A 1CX4A 1LR5A 2YFUA 3I2FA 2N7GA 4XJZA 1ODNA 3MIHA 5JI9A 4FPEA 1IZ3A 3WVJA 1QQP1 1NG0A 3O14A 4BMEA 2DDUA 2D6PA 5DAQA 5FPUA 3K77A 1R093 2JJ6A 4MG2A 4LKFA 1UNBA 1NZIA 2VD7A 2OA2A 4NVPA 1OA3A 2XOMA 4CDUC 4COYA 3CHXA 2R32A 4XHXA 3ZPOA 1CZTA 1W8NA 4NIHA 1XRUA 1AL22 3ATGA 5FP9A 1ZM1A 1RUD3 3CBNA 4XVHA 3AP5A 1JZ4A 1JYVA 3GHMA 3GHNA 5LASA 4CDUA 4JHZA 1RMU3 3IPVA 1UYXA 1DG6A 2YC0A 2PQSA 1MS8A 1IS6A 4GJZA 4Y5SA 1YC61 4WVZA 4HBNA 1JYCA 3KVBA 5FZ0A 2R16A 1H9PA 5FQ0B 1R082 1V70A 5IVJA 4JV4A 1REFA 1DIWA 1H8VA 4NR1A 3RFRA 1ASJ3 2W46A 3QBQA 4AFAA 4LMFA 3TOJA 4YW3A 3U10A 1IS3A 4XQWA 2R073 2BOJA 3VDDB 4LULA 4OI1A 2RS11 4NPRA 3O1TA 2A3WA 2R6QA 3POEA 4RR3A 3APBA 4MH0E 1YEWA 1FT9A 4ZU7A 5DDJ2 5FYYA 2QQOA 2KD7A 1JW6A 3AZVA 2ORZA 2VZ3A 5EXOA 3VD4A 5LW9A 3RYRA 2G19A 3WNNA 4BA6A 3OUHA 5JOXA 2LW8A 3LEMA 3VKFC 1NCQC 2ID4A 4IV1B 4N43A 4M00A 4XBNA 3RYKA 1OD5A 2EXKA 2CAVA 4Q4V1 4YGBA 2VW0A 1NCQA 2JX9A 3AZXA 4Q4W2 2P17A 3PU8A 1FOD3 3WNOA 5FXVA 1OPMA 4BQ4A 1JH5A 4QPGA 3LOIA 4J25A 5C9AC 5F1RA 2WQ4A 1W39A 2WYFA 1AUYA 2WINB 4K20A 4Y4YA 2WSUA 4RD7A 1BHGA 4Z2AA 1PO12 4XZPA 2ZGSA 5E16A 5C9AA 2PA7A 5DUVA 5CG9A 3B02A 3OD4A 1CN1A 2RR13 4D6QA 1PGW2 2VVFA 3HN1A 2ZCWA 2JICA 2E53A 4BQ1A 5C71A 1BVVA 1O8PA 1CD3G 3A7QA 3NJVA 2WZEA 4W8JA 1DBNA 5LY1A 1RINA 3R6SA 4R9BA 3USSA 3H8XA 4Q2FA 5FZ3A 1PVC2 1GZ9A 2PHUA 1EAH1 3OEBA 3PUQA 4L11A 2QDRA 1XB9A 4XC9A 4X8PA 2ARXA 1XNBA 4XF4A 5FLHA 4JDMA 1MACA 2JECA 4LBQA 5GM0A 1QJY3 5IK4A 3BB6A 4AQ6A 3H8UA 5K0UB 1LGCA 1A34A 3FHIB 5CB7A 5F8PA 5EZWA 4ATEA 2WNOA 4Y5TA 3WDXA 4CCOA 2ZGQA 3MZHA 3NNFA 2WA4A 4LOSA 4L97A 2DU1A 4S2FA 2JDKA 3HWJA 2AYHA 1YFXA 2D3RA 2DVAA 2JDNA 3FLPA 3WINE 5EFUA 5HV4A 4TTGA 3MLKA 2R1BA 2WYSA 4HPKA 4MGZE 4RQPB 4AEDB 2GP5A 3HD8B 1V9U2 3I59B 3GYDA 4C0HA 4BQ5A 2EA7A 3IIIA 3KMHA 2XL9A 5LBEA 1FMD3 2WZR2 5FAXA 4IERA 5I93A 4LO4B 4Z92B 3A4UA 5C70A 1M4WA 1FPN2 3OY8B 3SKJE 3B01A 4EN0A 4PBOA 1SFNA 3CMGA 5FZ8A 1AR83 2VMFA 1FNZA 5F2WA 1UOFA 5I0SA 1W8FA 2QFEA 4AVBA 4RFRB 3CQOA 3VBOA 4MYEA 1JZ5A 2C26A 3LE0A 1DYPA 1RUG3 3B9IA 4XBLA 3Q8CA 1CIWA 4BPZA 4FPYA 1LRHA 1VMJA 2ZGRA 3VD5A 5A7WB 2YBSA 3F2ZA 3H7YA 3B5LB 5JR7B 3NJYA 2P37A 4WBBA 4GD4A 1F5JA 4NN0A 2XJQA 5JZGC 1BVP1 1YFYA 3LA3A 5IK5A 4YARA 1LB2A 4QDQA 1H0BA 1XU2A 2OUJA 2PHLA 3R4SA 5HPOA 5KWRA 2V72A 4Y22A 1J3PA 3E5QA 1BBT3 5JZGA 1YJKA 2RS53 1YIPA 3OGRA 3KM5A 1IS5A 1VBB2 3OOXA 4OCTA 5LK5A 2E26A 1W2UA 3WG4A 3J8F2 2HWE3 1ND3C 4OHWA 2VQUA 4I3GA 2AC1A 4UW3A 4LTAA 5FY9A 4INDA 1COV3 3RZHA 4CDUB 5I8SA 2C9KA 2KA3A 4FAHA 1L7LA 4M3CF 3EBRA 1E5HA 4QB2A 3T2TA 4BISA 1OMIA 2PHXA 1ND3A 4D94A 2BJSA 1OLRA 4Z07A 5FYZA 2VVEA 3MBWA 3KT7A 4PJYA 4QQLA 1NX9A 5HXMA 2R042 4LKEA 1J1LA 2W3JA 2Y33A 4QB1A 1RVF3 4UWDA 1ULPA 3INAA 2FD8A 1A8DA 2GNDA 2VY0A 4NWVA 4LE4A 2KR2A 3RZKA 5FP7A 3BALA 2R7EB 2X53S 2P1BA 1LHUA 1GLHA 1QNWA 2CHHA 2PHRA 1QJU3 1VRBA 2ET7A 4CCEA 3OUJA 2PHDA 1W3XA 1WD4A 4IL7A 2OPKA 2WQ8A 3FLRA 5FPLA 3LF7A 2WS92 4KU8A 2RDNA 4CA9A 2ZKLA 1DHKB 3I2DA 3H9AA 3ZSLA 3HNYM 4GZ9A 2JDPA 3MGUA 2FCUA 4LBKA 1MS3A 1UZZA 2AZ5A 2YU1A 5BPXA 1UZWA 1NCQB 4YFZA 4LHSA 1GR3A 3H3UA 2ZXQA 5T50A 1W8UA 2VTFA 2VULA 4FXGB 3MLJA 2VZPA 3KCXA 4Y5Z0 2MHFA 2XLAA 2F4PA 1WW6A 3VBUC 2JE7A 4ARYA 2PHWA 1V6IA 3ZFFA 5LEKA 4XFFA 3DN7A 4QKNA 2WL1A 3KF5A 1VBD2 4O65A 1LOGA 2C0ZA 3WG1A 4QD2A 2A1XA 4DUWA 3O1RA 3VBUA 4PF1A 4HK8A 2VCBA 5EWSA 1XOYA 4XUTA 3D6EA 4OQ8A 2F6BA 2VE1A 4EQVA 3BTYA 4MV2A 1RUI3 1YIFA 4KG0A 3WSOA 1RUC1 5KXDA 1S4CA 3PIJA 3C7GA 5FZ1A 2HWB3 4LHNA 4WVMA 5GZDA 5FREA 4AAPA 2ILMA 2WC2A 4MGQA 4CP9A 3NV4A 2YROA 4YSFA 2XUMA 1V0AA 2ZHMA 4B4RA 1D7PM 1XE0A 3GBWA 3AZYA 4P08A 3ZFGC 2MEV2 2EVXA 3ZO0B 1VJ2A 2JDHA 4HVRA 4Q4X3 1NOVA 5FMDA 1RUE3 1S0CA 3AXEA 3USUA 1QJEA 3WNXA 1UZYA 1CPNA 1VMHA 2FHRA 4K1ZA 2ZEZA 3UT0A 3WW3A 5A33A 4UBHA 3ZFGA 4GWJA 1RUF2 5B2GB 1V6LA 2I07B 3PTRB 2V09A 4AR2A 2VOVA 2ET1A 3RRDA 3ZXKA 5LK7B 2W95A 1KS4A 2YBKA 1AYN3 3BPZA 1X8EA 4LO7A 4XJ9A 3MO4A 2FDJA 2NZ9A 3AYAA 3OGSA 2RMU2 1W2TA 2RS32 2IFRA 1QIQA 3AMHA 2D6KA 2DUOA 3ACHA 4TLFA 3ACIA 1ULDA 2HYKA 5A3MA 4WM7C 1CIYA 3OJBA 5GLWA 1ND2C 4OFGA 4R52A 1RUJ3 4LBJA 5IFTA 2QZ2A 1GV9A 1W8WA 3Q8EA 2I45A 3MIDA 3LAGA 1AYM2 5GZFA 3I2OA 3AYCA 4LBQD 4DXTA 2D3SA 5LBBA 1ND2A 2WO2A 1UX7A 2A7AA 2B8MA 3W59A 3BTXA 4P00B 1XSRA 3FHQA 1Y3TA 3GCWA 4JKLA 4A41A 4BWOA 2WAAA 2BDRA 2YY1A 3FL7A 2DURA 2YZ4A 5HCAA 3UKTA 2TEPA 5L7OC 4Q4Y3 2XMLA 2VMIA 1OVSA 4IGOA 5FZHA 1JYIA 4E4HA 1AX2A 4JQRA 1RHI3 1RVF1 1GZWA 2A6WA 2CL2A 1H8TC 2JKBA 4Y22B 3AMPA 5IJRA 4CZSA 1BEV3 3WD5A 4LKSA 5EP9A 4CCLA 4YPJA 4CE8A 3AC0A 4NROA 2UYAA 4XCBA 1DYOA 1OUSA 2WKKA 1H8TA 1BJQA 1UY1A 1WD3A 5A7QA 4OULA 1LU2A 2QDNA 4E9KA 3S57A 2VR4A 3E97A 3N36A 3WUDA 3JUUA 1O3RA 1F5FA 3CZUA 4DB5A 1R092 4LBNA 2CDPA 5FBZA 1HRV3 1JXNA 4NWWA 4QPWA 2R063 1ND3B 4XXPA 2TNFA 4F83A 2DBIA 1RXFA 4CCNA 2RHPA 1DGWX 1RUD2 5IWFA 2D98A 2XGXA 4QGNA 3WP4A 3F95A 2IC1A 4EN6B 5F5AA 1RMU2 2RDSA 3VKMA 3GZEA 3NWKA 4UAPA 2A5ZA 3S30A 4DIQA 3KS7A 3VBSC 1AR63 1RC6A 3N9LA 5BYNA 3ZXAC 2VMCA 3WT3A 1DFQA 2CV6A 3JB4C 3OYWA 4A3ZA 1VR3A 4DFSA 4HKLA 1LNSA 1ASJ2 1C1FA 2O8QA 2VZSA 1MVEA 2PLV1 3VV1A 3VDBA 3WR0A 3VBSA 5LBFA 1OT5A 3PVNA 4D6RA 1J58A 2BWAA 2D44A 2R072 2XQXA 3CO2A 3POGA 1VE0A 4Q1PA 2WWJA 3IMMA 4ITCA 4C8DA 4FPFA 3AYDA 4AVSA 1TVGA 1YQ5A 2PN5A 2ARCA 3BOWA 3I3DA 2FZ2A 2VBBA 1NQDA 3AX4A 3CF6E 4GA9A 5FPVA 5FKCA 1TNRA 3IB3A 5FZ6A 4CU6A 1D2SA 2WNUC 4PI2A 3T4HB 2ZZQA 4RGKA 2VCCA 1MR5A 1UXZA 2IWGB 2XJPA 2YC4A 5A6XA 1W28A 1JN2P 1QU0A 3MUY1 4XURA 2LROA 4UOJA 5LCWL 1QOSA 1TE1B 4Q5OA 4DUXA 3GF6A 3DF0A 1ZBA1 2RE9A 5JOYA 4TZDA 1OC1A 3IMNA 2HEVF 1FOD2 5JR2A 1N1TA 3TEYA 2QCSB 2DVDA 2DFBA 1OD3A 3T4VA 5CISA 4FVVA 4N7IA 1YQ8A 2BVBA 1NXMA 5DZFA 4YWAA 5F3GA 3KZ4C 3ITQA 1OI6A 2NQYA 1LEDA 3OSDA 2XG3A 3MF9A 2RR12 3ZYIB 1NQJA 2YPDA 1Z7S3 5FP8A 2RV9A 5L9RA 5A32A 1GYKA 3GBFA 1UYYA 3ACLA 2OPWA 1I6XA 2VMDA 3UESA 4M0HA 1AJKA 1VP6A 1BMV1 2WFF1 5CADA 3T09A 2YGMA 1VAMA 2G4IA 4WVWA 2E7AA 1IHMA 4YM3A 1VRH2 5IT6A 2B45X 3B94A 2YU2A 5IAXA 5A3OA 1OH4A 1ST8A 1N3OA 4F7ZA 2HBUA 1RUJ1 1I1EA 3WF0A 4BLJA 3USUB 3ZYHA 1C5HA 1A3KA 1Q56A 1ZBE3 5J7MA 3ES4A 3JB8A 4FPCA 1QJY2 5F6LB 3RI9A 2PELA 3ZFGB 3MPBA 1EYBA 4Q27A 2ZMKA 3VKNA 3E6BA 4B7KA 4LBLA 3MIFA 5IVCA 1NY72 4M01A 1UIKA 2EIGA 4L0PA 3GGLA 4MGSA 1S0JA 1UO9A 4Q4Y1 4W6WA 4ES9A 3FUQA 2XXZA 5IVVA 1LHWA 1C8NA 3WHTA 4PIZA 4I02A 4PLOA 4DZGA 2J1RA 5APAA 1J1TA 1FMD2 2JENA 3CIHA 1A6CA 1GZCA 3WNLA 2Q8DA 2VUCA 4YFWA 4N90A 1UY4A 2VCAA 1OBNA 3M8LA 5D1IA 4E2QA 3K75B 4FCAA 1BZWA 2PAEA 1AR82 2D6OX 1SG3A 3E1F1 4WM7B 1UY0A 2IZWA 1J3RA 1ND2B 3GJAA 1JYXA 5A3PA 2WZ8A 5D21A 4LHKA 4CUCA 2R061 1SBDA 1QQP3 1ZA4A 2ORXA 2WAOA 3ZXJA 1RUG2 5FWEA 4FI9A 3ZXGA 5KC5A 4ARXA 4FFFA 1BYHA 2W08A 1D4M1 1GZWB 2VZTA 5IFPA 3I4IA 3SITA 3JQXA 2FQPA 1QOOA 1Z0HA 5L7OB 3C7EA 1AXZA 3VBRC 4AI8A 1IG3A 1W6MB 1G9DA 2MNGA 4XYXA 4PBPA 1H8TB 4Y1ZA 4XFIA 1YI9A 5L9VA 4NO4A 2J1EA 3S7EA 3IIAA 2GAUA 3D3AA 1FV3A 2NP0A 1BBT2 3VBRA 1TMF1 2EIEA 2VAUA 1UMZA 2RS52 2XUEA 3MDPA 5A6YA 1E5SA 4U2AA 3KHCA 3UK9A 1E57A 4HT1T 4NPMA 4QX2A 1O5LA 4PQQA 3ZR6A 5DZEA 1QXPA 3NNGA 1HQWA 1TME1 5A3NA 2HWE2 5A1AA 3BTAA 3I49A 2G1MA 1COV2 3KV4A 4YVWC 3NKTA 5L36A 4LLFA 3MLLA 4P9IA 4W4ZA 2ETEA 2RS13 2D93A 4FQ4A 1W2AX 2IXHA 3BODA 3BIWE 3CU7A 4X6QB 5T5JA 3AFKA 1YXWA 4EZ4A 1SDDB 1GNYA 4YVWA 1UQXA 1RUH1 3J7MA 1VB4A 3OF1A 5JUVA 2D97A 1W8HA 3OYWB 2XPJA 2G9ZA 3HEIA 1VB2A 4FFHA 2PFWA 1JYNA 5JMCA 1JOJA 2WA3A 4DXRA 3VBSB 2PAKA 3GBGA 4PF5A 2BYVE 5C7GA 4I3PA 3FN9A 4I0AA 4Q4V3 5FWJA 3QCWA 2NM1A 1HJFA 5FMBA 4IEYA 4PCRA 1QJU2 4MGYE 5FYUA 5I0TA 4C1XA 5FZKA 3OBAA 4A4AA 1U5YA 1BQPA 4PIXA 2QE3A 3JCIA 4COZA 2W47A 5IVFA 2ZACA 4XFGA 2GNBA 1YQ2A 3LB9A 3CJXA 1UZVA 4B29A 3H50A 4DY5A 1QWRA 1YO8A 4V2WA 4FFIA 3ZX7A 1HV0A 2ZHNA 1DGRA 4S2DA 4R4XA 1V6MA 3QOPA 1R1A1 4IEUA 2LTNA 4NHXA 4QX8A 5ANNA 4BMBA 2WNUB 2VMGA 3BU0A 1NE6A 3ZYBA 1W9FA 4QHBA 1U0AA 2AEYA 3Q8BA 1POQA 4ISRA 2E33A 5C3PA 1CX1A 4BQ3A 4I0BA 4QQ2A 1UWWA 4AFMA 3OBZA 3H3LA 4QX1A 3N7KA 4IQPA 1PIV1 1RJ8A 4BQXA 4ZU5A 3DXTA 3V0AA 1SPPB 5T54A 3LIGA 1GQHA 3OY8A 2OZJA 1QJX1 2GN7A 2V4VA 3RMYA 3PNAA 2QQJA 4CEYC 1ACCA 4XF0A 3I2HA 2P6CA 3OBRA 5A32B 3ZKYA 1W99A 5C3QA 1BCXA 5FBJA 2Q8OA 2OUHA 1HB3A 4QHOA 1CESA 4MGKE 3SQOA 1G86A 1PZ7A 1GQPA 4NAOA 4CEYA 1RUOA 2EXJA 1C8M1 1RUI2 1VIWB 4FBFA 5JXHA 4GH4C 2RG4A 5FOBB 2H0VA 4CDQC 5GZGA 2QQWA 4LUKA 2HWB2
chains in the Genus database with same CATH topology
1ULEA 5C4WC 1PVXA 4LO5B 4R8HA 1GNHA 1FATA 3OGJA 4K9SA 3URFA 1S0FA 1EV11 2RM23 1QMJA 4Q4X2 1RUE2 2Q5TA 4AVCA 2ZHLA 1O91A 3R4UA 4I0WB 4MZUA 4FTBA 5JCTA 1LJ7A 3P3NA 4K40A 2UU8A 3FBMA 3FE5A 1I5ZA 3J9SA 1AYN2 4JGZC 5JSPA 2ZMNA 3M3OA 4DXZA 4GWNA 2DF7A 1MZ6A 3KT1A 1BKZA 1W6OA 3ZSMA 3JQWA 3CL1A 4CDWC 4FO9A 2JD4A 2HKXA 4DMIA 1WW5A 1FI2A 4ASMB 1MQTC 5CVRA 3FZ3A 3SCHA 4CDWA 1IPJA 5E89A 3KD4A 3VN4A 3D8CA 1OPOA 2BW8A 4ZXKA 4L99A 3ZIXA 1U12A 3AMNA 4Z82A 1MQTA 4RL7A 5T5PA 4ZKTB 2E7QA 3FLTA 3K51A 4Q0VA 2QQPA 2JXAA 2BFUL 4MX3A 3WDWA 5J36A 4Z1VA 1UX6A 3ZIWA 1C3HA 1RHI2 2YHJA 2GC2A 4LHLA 3VBRB 2HWF1 1BEV2 4Y1YA 2VNRA 4IEWA 5CAZA 1URXA 3OTFA 4XFBA 2B7YA 2ZJCA 1ZNPA 2XJSA 4IEZA 2RJLA 4N9HA 5EJ3A 3RJ2X 2DTYA 4META 1KXGA 2ZBJA 2VH9A 1HRV2 2D5FA 4L9BA 5GZEA 3N4MA 3FFQA 3DPRC 5GKAC 2R49A 4YVWB 2YXSA 3VUOA 2QVSB 3IN9A 3S6PA 4JTOA 2XWJB 4AVVA 5KHGA 1ZRRA 1LEMA 1S55A 1AR62 1OQDA 1Q8PA 5E88A 5J96B 3GZTB 5C33A 4FPHA 3O12A 4RFT0 4GULA 1AJOA 2O8OA 2XWBB 3MIGA 2UURA 5H9RA 3EHKA 1WLDA 2CY6A 5KHIA 2HJIA 3NAPC 2K2SA 4COVA 3RYPA 4A7YA 1WLWA 5CFDC 2DFCA 3PTYA 1MEC1 4IEPA 1DQ1A 4XJ8A 4AG4A 2NLRA 1JBCA 1YFWA 5AFBA 3C2UA 5CFDA 3IKWA 3PMEA 5J48A 5BY5A 2VUJA 3IDEA 1RUC3 3MFAA 5GJ6A 3V0AB 4LBOA 2RM21 5JIAA 1GQGA 2HWD1 5LEJA 4AEMA 1O7FA 1LOEA 5HCFA 5JPNB 1DZRA 2SLIA 2ZGUA 2A70A 4J6GA 5CA6A 4CEYB 4FSJA 1PM7A 3B7MA 1OFNA 1SLTA 2G9GA 3AZZA 3ZYPA 4QQHA 1ZRFA 1Z7S2 1HX6A 1FXZA 1Q3EA 2HWC1 4J1WA 4KNCA 4NHLA 1AXYA 1MZFA 1SLCA 4GH4B 3B93A 3AP6A 1LKNA 3VZNA 3ZN5A 1H2KA 4CDQB 5AC91 2IXJA 3E6CC 2XBO2 1EP0A 4B8EA 2H6BA 5C4WB 5EV7A 4RHV1 3DKWA 1ZBE2 1CJPA 3RDIA 5FCCA 1ONAA 4AFDA 2CWSA 1JHNA 2C5DA 4NOTA 4YZ4A 3UKNA 2E63A 1MS9A 3E6DA 3ZYJB 1HXS1 2VW1A 4KWJA 3ZN4A 1AF9A 1UL9A 3KGZA 2EAKA 2XH6A 4HLTA 4XBQA 1YCIA 2GU9A 4BZ4A 1PGL1 1W6OB 5ACA1 4JGZB 2PHTA 4AEJA 1G9CA 4AI1A 2VU9A 4FQZA 1CPMA 1QOTA 3MI8A 1OFSA 1VBE1 3Q9OA 4EN7B 4CDWB 1VALA 1Q8SA 4EWAA 4WV8A 2AUYA 3OGGA 2ZGMA 1Y7BA 4Y26A 4O9EA 1RL3A 2ZX0A 1HRI1 4E4DX 4Z8BA 1MQTB 1QQP2 3N7LA 3NO8A 1G7YA 3SMHA 3CEWA 4D3WA 4BLIA 3RJRA 1DQ6A 1FV2A 2BGCA 2DCZA 2DV9A 4F3JA 3AK0A 3WDTA 3SNMA 3R4DB 1SMVA 2GMPA 1W6QB 2ENRA 3M70A 4PQ9A 1LU1A 3RNSA 4AI3A 2XL7A 3ZYGA 3AFGA 4AWDA 1UKGA 4MVTA 5H9SA 3FFZA 1JUIA 1NLRA 1WBLA 2Q30A 1KDMA 2WT1A 2XKPA 3LA7A 2DVGA 3WDVA 3D0SA 4LT5A 1ZRCA 1DLLA 4J1XA 3U0ZA 2PLV3 3WDUA 1N1YA 3WQ0A 3HR9A 4EROA 3ZSKA 3DPRB 2RS12 3S7IA 1HLCA 4JDNA 1YWKA 2P2KA 4UW4A 3PVEA 4XHBA 3UJOA 4HSLA 4A7KA 4FPOB 3OCPA 2TBVA 4JGYC 4MSVA 5H9PA 2SBAA 1SFYA 1LESA 5FTTC 4BHPA 2AENA 5FMOS 1X8MA 2XJUA 3J4UH 2WT0A 3DGTA 3ZXDA 3FBYA 4JGYA 4Q4V2 1JUHA 4D69A 1ZBA3 2ZA9A 3V65A 2WIIB 2VW2A 1ZZ8A 4YM0A 2P34A 3NKGA 2Q1ZB 2ZAAA 1AVBA 1ENSA 3RQ0A 1OQ1A 1N1SA 1V6JA 3NAPB 3NJZA 3RI8A 3ZXLA 4H3WA 5CFDB 3G7DA 3AMMA 4GB31 5IK8A 4XMAA 2GZWA 2WFF3 3WZ1A 1A8MA 2E51A 3O5SA 4Q0QA 4X6RB 4FPGA 4XTPA 3ILFA 4HANA 1KJLA 3MF6A 4YVSC 2GNMA 4UW6A 4YG3A 4Y1VA 1AR71 1XYPA 2FMYA 1WW7A 2ERFA 3L9JT 1IOAA 1EAH2 4JC1A 1G9FA 5GLTA 2AREA 4LR4A 2CGPA 4LEJA 4WM7A 2PYTA 3WXPA 1VBC1 4K6BA 1MZ5A 2GH8A 1MVQA 4XEZA 1O4ZA 4C0BA 1UN1A 3HQXA 5FMOL 1QGLA 2JG9C 2W68A 1KFUL 1PO21 3SCFA 1QH7A 1LHNA 1DGLA 3KSCA 1Q43A 3T1MA 1AZDA 2BNOA 5L73A 4XF1A 1XE7A 3RG0A 5L7OA 1FYUA 1W6NA 1YFUA 4JVAA 1W6MA 2BQPA 4P9XA 1GANA 2ZMLA 1Q5OA 3P3PA 3VZLA 4A7ZA 1Q8OA 5DDJ3 3WY6A 3ILRA 4EV0A 4AEKA 1YLLA 4YYOA 5IUQA 2ZGOA 3WQ7A 3RSJA 5FPXA 4FT8A 1WBFA 4ISQA 1POV0 2Z79A 3A0NA 3TYJA 1C5IA 3AJYA 3JBG1 1S0IA 1D4M3 2ZX4A 3EXUA 5JWPA 1AR91 2DUQA 1KQRA 5T55A 1QDOA 2BWCA 2H6CA 4EN8B 1VBA1 3GNEA 2A71A 5JAXA 2EALA 3PHMA 2GN3A 2DUPA 4QM8A 1PZ9A 2BNNA 2K9ZA 2A3XA 4I30A 1TMF3 1PO13 2D43A 3LZZA 2DYCA 3LA2A 4IV3B 1BK1A 2EXIA 3K48A 2FBEA 5HXVA 4GMP1 2CNAA 5D8AC 3L2HA 4GWMA 2Z5WA 5BNNC 1TME3 4E4ZA 5CNAA 1UKRA 4HN0A 2XLFA 3JD71 5D8AA 1R1ZA 3VZMA 2ZAHA 2D5HA 3IDBB 4ORFA 1LGBA 3RS6A 1HKDA 1PHMA 4E2SA 1RUH3 4P5HA 1X7NA 4DQAA 2WNUA 1H4HA 4FOWA 1ENRA 2BNMA 3KCYA 4AK3A 1F9KA 2MPFA 4XF9A 5IK7A 2UWBA 2GALA 1DGRN 3BCWA 3VGIA 1IS4A 3QH7A 1TEIA 2BTVC 2O1QA 3B9CA 2P3JA 4TSVA 4XFHA 5JOZA 2Q1MA 1FNYA 1NZCA 4DY3A 3WUCA 2AH2A 4PLNA 1V6OA 3M3EA 4W6YA 1QXRA 2JEMA 2CGOA 1F2NA 5JI7A 1H1AA 1XNKA 3MW2A 4EWDA 4JGYB 3W9AA 3D4KA 1UPIA 1R1A3 1SQ4A 5FLJA 4AQ2A 4L8QA 3TB0A 5GLUA 1JTZX 4BIOA 1WMDA 3WW2A 2WJSA 3I7DA 4YNIA 4Q26A 1UU5A 1AL21 1IGOA 1PIV3 4QGLA 5FFOC 5K8SA 1X36A 1YJLA 3H0OA 1QJX3 4N7UA 2CGNA 4A3XA 4ONUA 4YM2A 1R081 1ENQA 3G6JB 1QF3A 1IQAA 4AHXA 1H2LA 5KXEA 1ZZCA 1C8M3 1F8VA 4B4QA 2VPVA 1VAKA 1RUC2 2B5HA 3WG2A 1IPKA 4YVSB 2EAAA 4OUSA 4D7YA 4B4PA 3LOBA 4QMAA 4XETA 5DDJ1 2XVKA 4OLLA 1D4VB 3H3ZA 1D0HA 1SCRA 2R1DA 1EV13 4YZ5A 4OZXA 4QPIC 2JE9A 4QT6A 3W58A 1DYKA 2YDEA 1ZZ9A 3M3QA 4G4FA 4YM1A 5BNPC 4AHZA 2WLPA 2JG9B 4UW5A 4QPIA 1K5MC 1PZ8A 4Q4W1 1W6NB 4MXVA 1DQ2A 4Q8LA 3ZMNA 5BNPA 1YHFA 3QLQA 1CAXA 1MZEA 3IWZA 2TUNA 3ZPYA 4DS0A 3FMGA 4HZFA 1PO11 3VHNA 4IEVA 3SH4A 4OHZA 4XJWA 2WFPA 2LM3A 1IKPA 3TWIA 5KHKA 2GC3A 4H7MA 2WS93 2Q4SA 1PGW1 4CP1A 1D2QA 1LOBA 2NMOA 3ENRA 4YZ1A 1N47A 1H2MA 4DRRA 1LCLA 3HT1A 2WSVA 1V6KA 4P9YA 1YUDA 4FXKB 3CLPA 4ASLA 1PVC1 1SCSA 1RVF2 1W0OA 1VAVA 2BVVA 3AJZA 3HT2A 5BNOB 2W0XA 2HWF3 2ZABA 2DU0A 3M4FA 5DZGA 2ZGNA 1RJ7A 1NLSA 4AXOA 2EF6A 2NMNA 2W52A 4XOGA 4YW4A 2QJVA 3R0RA 4LA2A 5FLIA 1AX1A 4XFAA 4AGRA 4KQ7A 5JIUA 3OBTA 3ROUA 2HEWF 5D8AB 1UU4A 1GSLA 2DCKA 1V9U1 1NCRC 1OA4A 2V73A 5BNNB 2WLQA 3WCSA 2WZR1 3B3QE 2XB6C 1Z78A 5C8CC 1FPN1 1C4RA 1I9RA 2XVLA 1NCRA 3N3HA 5AVAA 4K1YA 4OI4A 4GKXA 1A78A 1EPWA 3VBHC 5C8CA 1G9BA 4QM9A 2OZ6A 1MS4A 1NYWA 2QKDA 1LOCA 4R9CA 2ZHKA 1NXD1 4RS5C 3AKQA 1QHDA 5I0UA 2Y38A 4HVOA 3VBHA 1CVNA 4C91A 4GXLA 2A73B 1ULCA 2YGLA 2PLV2 4DOUA 3LKJA 3IDCB 4RS5A 1CAUB 1O3SA 5SV5A 2JG8C 2VOKA 1POV1 1CAVA 2H0BA 1S0EA 3WG3A 1RTVA 4YGCA 3RMXA 2ZX2A 4YGEA 2GDFA 4CP2A 4XW3A 2JG8A 5LRSA 4EN9B 3B69A 3B00A 1MEC3 3NV3A 5HI0A 2XHKA 4HFSA 3V64A 1QNYA 5CFCC 2ZZJA 1OA2A 4Q0PA 1LOFC 3AKRA 1VBB1 1Q8QA 4QQPA 4GH4A 3RWNA 5AFEA 1RB8G 1ZBA2 3H1WA 3NV2A 3J8F1 4ES8A 4AE2A 4CDQA 5CFCA 2X5IC 3HIFA 1LOFA 5AVPA 2HWD3 5C4WA 4N53C 4HKOA 5EYYA 3NVCA 1CGPA 2G9FA 1EY2A 1W0PA 2BEOA 2X5IA 4NHKA 3AKSA 5DG1A 5L19A 4I2OA 2R041 3THPA 4XILA 4N53A 1ZZ7A 4RGGA 2UYBA 2VOWA 4OHXA 2HWC3 4YW5A 4LNVA 2B46X 1BMV2 3OPZA 4GALA 2WFF2 4XJUA 1LHVA 1U5IA 5AC93 3AP7A 4JGZA 1UPSA 4LBMA 1RUJ2 3RZZA 3MFCA 2WS91 4RHV3 4JDOA 4E4SA 1YRZA 1Y9QA 2LUWA 4KU7A 3RPQA 3V0BA 3AKTA 4QU2A 4KWLA 4QPIB 1W6PB 3E5UA 4P9GA 4QPYA 2ZPXA 4YW1A 4CYDA 5BNPB 3WV6A 1H1IA 1HXS3 4CP0A 4KH9A 4Q4Y2 1CAXB 1QDCA 3POYA 1K5MB 2E9QA 2D7FA 2GH2A 4OI0A 2DCTA 3R05A 3TBDA 3MYXA 5ACA3 4RR3C 5T3NA 1SBEA 1TQ5A 2I74A 4B3NA 3O7OA 4H55A 4LUMA 1VBD1 4D7SA 3MIBA 1W6QA 1VBE3 4BIFA 2WWSA 3N35A 3I54A 3SLIA 1RUNA 1GICA 2O0OA 2XLGA 4OUMA 1CQ9A 5GLVA 4COWA 4N43C 3UV9A 3ZSEA 2VQAA 3LCPA 4H14A 5C8WA 1HRI3 2R062 5CBLA 1PNFA 1H9WA 4XF3A 5CIRA 3EQEA 4XXAA 1D4M2 4LO6B 4QPGC 3NSTA 3DPRA 5DUXA 2OVUA 4SBVA 2K0GA 2XVGA 1ZYBA 4S2HA 2MEV1 4BH9A 4H7LA 2FZ1A 3J26N 3OD0A 4DPNA 2GMEA 5T5OA 3WW1A 3WP6A 1XE8A 3ES1A 1J59A 2DWRA 1TMF2 4OHYA 3GZAA 1RUF1 1S2KA 2B9UA 3THTA 3LSDA 3KCCA 3PVBB 3ZDSA 1ULFA 2V5YA 5I8YA 2D40A 1TME2 4XMIA 5J98B 1NCRB 2RMU1 2OW4A 4IEQA 2RS31 5C8CB 4XIOA 1VRH3 3NAPA 3POSA 1U5ZA 4L92A 1H30A 1QJZA 5H9QA 5J3UA 1ZRDA 2GC0A 4DNYA 1RUH2 4A2UA 1UD1A 1XXNA 2IXLA 3VBHB 3TNPB 3VKLA 1CJDA 1AYM1 4YZ3A 5EYXA 4RS5B 3GALA 1CAVB 4R4ZA 4AI0A 2XKOA 1PK6C 4IEOA 3AP9A 1L3JA 1WLTA 3M2MA 4GQ7A 5A3LA 2JG8B 3VHOA 2OYZA 1KRIA 3TN91 4E27A 4C1WA 4GMP0 1KDKA 4LE3A 1PK6A 2PHFA 4QGMA 3VZOA 5FO8B 2AGSA 4AFCA 3FWEA 1R1A2 1WMFA 4URTA 2XJTA 3VBOC 3NL1A 3SISA 3O0XA 5CFCB 2R30A 4GB33 4Q1RA 1R091 4AFBA 4FOYA 4Q29A 5J09A 2WNVC 1X50A 2VQ0A 1H1MA 3O0VA 1HV1A 2X5IB 3DV8A 3I8TA 4B7EA 2FMDA 1PIV2 3VL8A 1RUD1 1XQNA 5LRRA 4N53B 2WNVA 3IT8A 1AR73 3AMQA 4WZCA 1UU6A 1QJX2 1RMU1 4CDXC 4FTEA 4HL0A 5JDBA 3VL9A 4ZU4A 2Z42A 4KBBA 3FC0A 1VBC3 4GIQA 2NPIA 2E6VA 4WVVA 4RA0A 2I2SA 4CDXA 2BBVA 3WW4A 1UF2C 4JCKA 5F9TA 1PGSA 2VOXA 1C8M2 2C1FA 1KFXL 1ASJ1 1PO23 1DQ0A 5KHJA 1Q8VA 2NYYA 3ZYRA 2R071 3POWA 4G3YC 3SH3A 3V0BB 5DUWA 1OSGA 1PNGA 2A3YA 1SDWA 4WM8C 3N7MA 2ARBA 3FJSA 3N7JA 1RIRA 4IV3C 1ZX5A 1DU3D 1EV12 3IBMA 4XIKA 1SLLA 3IPVB 2P3KA 1V6NA 1WW4A 4HMZA 4WM8A 4YG0A 1LODA 4MGIE 1XNCA 1OQEA 4IV3A 5DUUA 4OI2A 2D6NA 3S0MA 4HN1A 1FOD1 3BOPA 3JBG3 1AR93 1V00A 3NW4A 3EO6A 1OHFA 1REDA 4RR3B 4M3CA 2B42B 5GZCA 1VLNA 5CG8A 1VBA3 1WMEA 2A6ZA 2Y0OA 1O3TA 3KGLA 1HQLA 5KC6A 1KITA 2DTWA 5J37A 2RR11 2XJRA 1GNZA 5T52A 4N43B 2BPA2 3ZFEC 2ZTNA 4NHMA 4GMP3 1U5XA 2R0HA 1QKQA 4XDQA 1VRH1 2CYFA 3QH6A 3HBZA 1ZVFA 3AM2A 1BXHA 3FX3A 4MXWA 4QPGB 3ZFFC 2YYOA 3ZFEA 3JD73 3MEPA 3QACA 3PJQA 4AVTA 1S2BA 2HWF2 1QJY1 1O4TA 2ZS6B 3JZVA 4Q8KA 5C9AB 4JRLA 1NY71 1WCKA 1FAYA 1CONA 2RJKA 2ZX3A 3HAGA 3LWCA 1WCSA 4PDWC 4PIYA 2PAMA 2AR6A 4AHWA 1ENXA 4V1PA 2PTMA 2ZGTA 1XYOA 4AQSA 1I3HA 2A75A 1FMD1 4PDWA 1DZTA 1WA4A 3T1LA 2VUAA 4AGGA 3KLSA 2IXKA 1AR81 1MS1A 4M0NA 4LBQB 2CWMA 4IESA 3SHRA 4BM8A 2Z69A 1D0GA 4Q0UA 1WGPA 5KXBA 1O3QA 1APNA 2X8KA 1OOPC 1RUG1 4FTSA 5E1RA 1UCXA 3E5XA 2D3PA 1KJRA 2ZGKA 2DVFA 4HPKB 4XFCA 5KHHA 1PK6B 1ZREA 1OOPA 4YVSA 4QQOA 4AHYA 2ES3A 1AL23 2R0FA 3CJIC 1QXJA 5DXDA 1YYNA 4R9DA 3TAYA 3KQRA 2OIIA 5T5LA 4MUVA 5BXXA 3TN92 4CRQA 4P9LA 2QUOA 5KBFA 3CJIA 1XNDA 1BBT1 1MEC2 3MICA 2DCYA 2HEYF 2RS51 3VBOB 1R083 3L2YA 2JG9A 1UIJA 4Y1XA 1FX5A 1S0BA 5CU1A 3AKPA 5DG2A 1MS5A 4XTMA 2HWE1 2WNVB 5C6CA 1COV1 2RM22 3C3VA 3H7JA 2HWD2 1AX0A 4BOWA 1TNFA 4COUA 2UY8A 1X82A 3DUIA 5SV8A 4D7TA 4W6XA 4K21A 4YW2A 3WX5A 2VGDA 4CDXB 4EJRA 3LSEA 1DDLA 1XU1A 2EXHA 3VBFC 2QZ3A 3EJKA 3ETQA 5BUVA 3M3CA 1F31A 5JZGB 2HWC2 4HVQA 1S0GA 3VBFA 3ZVXA 4XQDA 4P9JA 1QH6A 4TYSA 4YRDA 4Q4W3 1NA1C 5F5QA 2D6MA 1QJU1 5BNOC 4R9AA 5AC92 4AGVA 4XQ4A 2WT2A 5JSOA 4X8NA 4WM8B 1ZZ6A 1NA1A 4RHV2 5FDBA 5BNOA 1HDKA 2W39A 2BUKA 4UXAA 1AXKA 1SLBA 4OVEA 4S2GA 4FAGA 4Y20A 4FPLA 3DL3A 3X29B 2WQZC 4O9GA 1LTEA 4U36A 1HW5A 2ZGLA 1HXS2 2WNEA 3UKVA 5HBAA 1DQ5A 1NE4A 1DQ4A 3JU9A 1B09A 1SLIA 3MW4A 4M3CB 2GMMA 4HSJA 5BNNA 1WCDJ 4IEXA 1RITA 1PGL2 5ACA2 2X29A 1GKBA 4FP2A 5JPMB 2LALA 3BU7A 4G9SB 1PVC3 2KM2A 2VG9A 1UAIA 1VBE2 5ABJC 2PQQA 3PLQA 3WP5A 4P9WA 3UL2A 2ZX1A 4C90A 1HRI2 5ABJA 1CAWA 1RUI1 2D6LX 4XE9A 5JSRA 1H2NA 3ZN6A 4LLOA 4MXWB 3ZFEB 4W65A 5BV6A 1CR7A 2HWB1 3UJQA 4JRAA 1CAUA 2Z2SB 1V9U3 4WZFA 2Q0AA 1IKQA 4PLMA 4SLIA 4EWEA 2WZR3 3HMYA 4IXLA 1H4GA 1MS0A 3ZFFB 1WUVA 2JDZA 1FPN3 3NV1A 3QD6A 3MW3A 4Q4X1 4I01A 4K7JA 2A6XA 5I91A 1RUE1 2QNKA 3A0KA 3VBUB 3WLUA 5I8TA 3AB0A 3PJYA 4Y24A 4TWTA 2A6YA 1Y43B 1SACA 5I0RA 5JVVA 4CEWC 1KD7A 1ZZBA 1SLAA 4PDWB 4XJAA 3TNQA 1B35C 3ST7A 3V56A 1AYN1 4WVMB 4CEWA 4OHVA 2IFWA 1YI7A 4M3CE 2YUEA 5HCBA 3ZSJA 1POV3 2GC1A 1LULA 1B35A 2CTVA 2XBO3 1DGWA 3ECQA 1O4YA 3AYEA 2ZGPA 4Z2WA 4K3UA 4GKYA 1DZQA 1G8WA 3U11A 1C1LA 3D5OA 3GZUC 1RGSA 5A33B 3ASIA 1VBB3 3O0WA 1OOPB 4IETA 2GNTA 3AP4A 1LECA 3J8F3 2ZKNA 2VMHA 2B39A 4JTNA 1HIXA 1S0DA 5JLVA 1RHI1 2VXRA 4HK9A 4N9IA 2VNGA 3CJIB 4F8AA 4MLOA 1BEV1 2VNOA 3D0JA 4L2NA 3WOGA 4AI2A 2R043 1J3QA 1W6PA 2UWAA 3WQ1A 1QY4A 3ZXFA 3SXWA 1OLQA 4BCUA 3AXDA 4GB32 4FP3A 1ULGA 2KXLA 4AQTA 2YV8A 2NN8A 4YGDA 1K5MA 1O5UA 1HRV1 5FQ0A 1N1VA 3ZMOA 3VDDC 4HKWA 2VVDA 4HETA 4KGGA 1C28A 5JOWA 1LOAA 1OKQA 1C57A 4YLZA 3WP3A 2DVBA 3SCGA 1AR72 4UBGA 3ZXEA 3VDDA 1N3PA 1N3QA 2YPJA 4LO8A 4YG6A 3VBFB 1VBC2 4IV1C 1AL0G 1AR61 4AW7A 4KL1A 1PO22 4BE3A 1YNAA 4IV1A 3M1HA 2ATFA 2ZOEB 1NA1B 1M06G 2C9AA 5TSWA 1KS5A 4QX5A 3CNAA 4BYYA 1SBFA 3ILNA 5FOJB 4KGQA 3TRSB 4Y20B 3M7AA 1VBD3 1G6NA 5GALA 3AZWA 3M3IA 2VECA 4DRVA 3U4XA 1LENA 1AHSA 2UY9A 4FOVA 2GSYA 3WHUA 4FPKA 1SEFA 1X33A 1WLCA 5F6KA 1UW8A 3WDYA 2Y0IA 4P14A 1XYNA 3ME2A 5K9YA 3JBG2 3ALQA 1AR92 1GFF2 4JAAA 1VBA2 5FO7B 1GBGA 3FUOA 4KG8A 4AF9A 5GLZA 2MEV3 5K0UC 5ABJB 1T6GC 1CAWB 1EPZA 4KWKA 4LA3A 4FPJA 1S1AA 3ZN6B 3KB5A 1Z7S1 3VZKA 5K0UA 3VHRA 2E7TA 1RUF3 4CTEA 3IM0A 4RQPC 4AEDC 1LGNA 3KT4A 4YZ2A 4RSUA 3LGRA 2XBO1 1REEA 4RGAA 2RMU3 3JD72 5K7PA 2RS33 4Q0SA 2UWCA 3MPPG 4RQPA 4AEDA 1ZBE1 3I59A 3VLBB 3PMSA 1DF0A 3VHPA 3H1MA 5FRAA 4ATFA 4QXKA 1EAH3 2CAUA 3H1YA 1AYM3 1LHOA 4XPVA 3SH5A 1G9AA 4CEWB 2DCJA 2P3IA 5FPZA 4FOQA 3PVOA 4DINB 3ELNA 2XJVA 3MIEA 1B35B 2IXIA 2YMZA 2A6VA 3VKOA 4AYUA 2Y26A 2WZPP 2IXCA 5E8AA 5BNQA 4I09A 3WCRA 4K8FA 3TN93 2BFUS 3VZJA 5KXCA 3U07A 1ALYA 1HQNA 4AVAA 1PMIA 4Y1UA 5FO9B 4E2GA 3D82A 1CX4A 1LR5A 4XJZA 2N7GA 3MIHA 5JI9A 4FPEA 1IZ3A 3WVJA 1QQP1 1NG0A 3O14A 4BMEA 2D6PA 1R093 2JJ6A 2OA2A 4NVPA 1OA3A 4CDUC 4COYA 2R32A 4XHXA 1XRUA 1AL22 3ATGA 1ZM1A 1RUD3 3AP5A 3GHMA 3GHNA 4CDUA 1RMU3 3IPVA 1DG6A 2YC0A 1MS8A 1IS6A 4WVZA 4HBNA 1JYCA 2R16A 1H9PA 5FQ0B 1R082 1V70A 4JV4A 1REFA 1DIWA 1H8VA 4NR1A 1ASJ3 3QBQA 4AFAA 3TOJA 4YW3A 3U10A 1IS3A 4XQWA 2R073 3VDDB 4LULA 4OI1A 2RS11 4NPRA 2A3WA 2R6QA 4RR3A 3APBA 4MH0E 1FT9A 4ZU7A 5DDJ2 1JW6A 3AZVA 5EXOA 3RYRA 4BA6A 5JOXA 3VKFC 1NCQC 4IV1B 4N43A 4M00A 4XBNA 3RYKA 1OD5A 2EXKA 2CAVA 4Q4V1 4YGBA 2VW0A 1NCQA 2JX9A 3AZXA 4Q4W2 2P17A 1FOD3 1OPMA 1JH5A 4QPGA 3LOIA 5C9AC 5F1RA 2WQ4A 1W39A 1AUYA