3WXPA

Structure of hyperthermophilic family 12 endocellulase (e197a) from pyrococcus furiosus in complex with cellobiose
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
270
Chain Sequence
b'KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQAVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase A
publication title Structure of hyperthermophilic family 12 endocellulase mutant (E197A) from Pyrococcus furiosus in complex with cellobiose
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 72
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wxpA00
3LGRA 3B7MA 3RI9A 3WP3A 3WQ7A 3VHOA 3AKTA 3AMPA 1T6GC 2VG9A 3WP4A 4S2DA 1XYOA 1XXNA 1W2UA 1UKRA 2JEMA 4HKLA 1UU5A 3WP6A 3EXUA 3AMNA 3VZJA 1XYPA 3AKSA 2NQYA 3AMMA 1C5IA 3VL9A 1OLQA 1XNDA 1F5JA 1H1AA 1OLRA 4XQDA 1UU6A 3WXPA 1YNAA 2QZ2A 4HK9A 2NLRA 2DCZA 1XYNA 5EJ3A 1PVXA 2DCJA 2VUJA 3RI8A 1H0BA 2BW8A 1OA2A 1KS4A 3MFCA 1HV1A 2DFBA 4XQ4A 2BWCA 1BCXA 1IGOA 1XNBA 1H8VA 2D97A 3VZLA 1H4GA 3MFAA 1BVVA 1REDA 2DCKA 1REEA 2B46X 3VZNA 1NLRA 2DFCA 4S2GA 2B42B 2C1FA 2VGDA 1M4WA 2VULA 3AKPA 3VL8A 2D98A 2BWAA 2BVVA 4HK8A 3O7OA 3WR0A 4H7MA 4IXLA 1C5HA 1XNKA 3MF6A 3AMQA 3VGIA 1BK1A 3VZMA 4HKWA 1OA3A 3VLBB 3HD8B 3WT3A 3WP5A 2JICA 1TE1B 3LB9A 4HKOA 1HIXA 3VZKA 3AKQA 3VHNA 3AKRA 2Z79A 3ZSEA 1ENXA 3AMHA 4NPRA 1OA4A 3WX5A 4XQWA 4XPVA 4S2FA 4S2HA 3VHPA 1H4HA 1QH6A 2B45X 2QZ3A 2JENA 1KS5A 5K7PA 1UU4A 1XNCA 3VZOA 3MF9A 2DCYA 5HXVA 3B5LB 3WY6A 3WQ0A 2F6BA 1AXKA 3M4FA 1HV0A 5K9YA 3WQ1A 1REFA 1QH7A
chains in the Genus database with same CATH superfamily
1LU2A 4MGQA 2YFUA 4A42A 4BQ4A 4CSWA 5BV6A 3FWEA 1Z7S3 4LHNA 5IK7A 1QOTA 2EXJA 1XU2A 4GAZA 2R7EB 4QD2A 3WNXA 2WL1A 4QB1A 1CZVA 1QOOA 1H8TC 2BZDA 2PLV1 5FZBA 2ZZQA 2K46A 2JIJA 1ENQA 1U5XA 1RUF2 1TNFA 2WNUA 2SLIA 1AR71 3VBRC 4XZUG 5FZ8A 2IXCA 2BYVE 1GQHA 5DAXA 1XE0A 4B1MA 3DV8A 3BCWA 4HFSA 5DQ0A 2BGPA 3IDBB 4COVA 1OFSA 4AI9A 4CP0A 1DHKB 1NT0A 1ZA7A 2WNVC 3ATGA 4Z92B 3KVBA 4AVVA 3Q9OA 1GNZA 5J98B 4Q4W2 2DU1A 1HX6A 1H1AA 2WZR1 4UFIA 4DXZA 5E16A 2EF6A 1PIV2 3JBG2 4HK9A 3NJYA 4IE0A 5AC93 1YEWA 4IEVA 2KM2A 4HZFA 3WHUA 2EXKA 2VUJA 4FFGA 3N4MA 1R1A1 2JG8C 3BN6A 5DG1A 1N1YA 1V6MA 2LS6A 5H9RA 4E4HA 1AX1A 2H6BA 3OPTA 1VBB1 2I2SA 1QY4A 2XLAA 1UYZA 3ALQA 3VD3A 1BVVA 4N7UA 4YVSC 1VBD1 1NAEA 5K4LA 1CX1A 2J42A 5A70A 2FCVA 3V0AA 2GNMA 1CJPA 4K8RB 2QDNA 4P9JA 3ZYBA 4LOSA 4QU1A 1W6QB 3V0AB 1W9SA 4QPGA 2GC2A 1OKOA 4BQ5A 1VB2A 4XFCA 3D82A 3U37A 4QQOA 2XGXA 4QPGB 2BOIA 4E2QA 5KXDA 5JVVA 5L36A 4H7MA 4ZHNA 1JYWA 3M2MA 2JDYA 4HMZA 3J7HA 4RR3C 3GHNA 5FZKA 1VP6A 5FO8B 2JDHA 1JTZX 4Z07A 2ZGOA 1GU3A 1X33A 3F95A 4N90A 1NUKA 4BA6A 1ZRIA 1UMHA 4XFFA 1PMJX 2B4KA 3AX4A 3AYAA 3I59A 5DAVA 5FZ9A 2Y26A 2A6YA 5SV5A 1YCIA 4TZDA 2ZGQA 4LO5B 1SDDB 3NJXA 2BFUL 5I91A 3I59B 1QJY2 2HBTA 2JE7A 1ZRCA 1UIKA 4N7IA 1VMFA 2ZGKA 5DAQA 3SH4A 3VZKA 5E88A 2R16A 4AYUA 4Z1VA 2YU1A 2TUNA 3KM5A 2XQXA 3ES1A 4QB6A 3MLLA 4QKBA 1JYCA 2PHFA 1ULGA 1W9WA 4COZA 2QZ3A 3RG0A 3T0DA 2JENA 4PHZA 1NCQC 5IJRA 4E4DX 1VBE2 4CP9A 4AK3A 1LOBA 1WMEA 4MH0E 4OCTA 4PQQA 1SLTA 4QWNA 3VN4A 4FP2A 3WDYA 4XEZA 5FUPA 1W28A 1AYN1 2FCUA 2JKXA 5FKBA 1PM7A 4M3CB 3E6BA 1RXGA 1DG6A 2HWD1 4DO0A 2ILMA 3SCGA 2W92A 3RI9A 1W90A 5FZGA 4UOJA 1OQDA 4KH9A 4LT5A 4UBHA 4AEJA 4J1XA 4I0BA 4P9XA 2QQVA 1MACA 1W8ZA 5A3WA 4IQPA 3AMPA 1BMV1 2ZGMA 2RJLA 2X53S 2RDSA 4CP1A 1VAMA 3K2OA 2UWCA 5GZEA 2JD9A 3VBHC 2HYXA 1XYOA 3RQ0A 2VW1A 1LEMA 4UW5A 4HKLA 4B29A 2JD4A 1S0GA 2Y6FA 1FOD1 1QDOA 4B8EA 4FPYA 4W8JA 4Q5OA 3TN93 4W6YA 1GZWA 5FUNA 4K20A 4LO7A 1XBFA 3AMMA 4Q8LA 4WM7B 5F5QA 4BK5A 4ATFA 4MGSA 1UIJA 2XUEA 1GZWB 3I3BA 3KF3A 4HL0A 3OSDA 2OA2A 4ZKTB 4MADA 2NMOA 3MW2A 2DDUA 2KXLA 4Z82A 2EICA 4ZS3A 3UKNA 4CDUA 3O0WA 1XNTA 4CXYA 3I4IA 2WINB 1Y9QA 2VBDA 3K75B 3SITA 5DN2A 3O5SA 4RQPA 2XKPA 2ZHKA 4XQ4A 3F2ZA 5A3NA 4RQPB 2EAKA 3HN3A 3S5QA 4AWDA 4LUKA 1O3RA 2R061 4OHZA 2VO5A 1MS9A 4W6WA 1IPJA 2RM23 2WWUA 2Y6GA 3ZFFA 1YYNA 3CU7A 4GZ9A 5EV7A 2XUMA 1WMXA 3NL1A 5LA9A 3ZFFB 1W8FA 3M3EA 1POV1 1LOCA 1VB4A 4NR1A 1K5MB 5T55A 2ZKLA 1GV9A 4NIGA 3JQXA 3DYPA 4O61A 4PT6A 4QGLA 4BISA 2VCCA 1GWLA 2PAMA 4LXLA 1PZ7A 1WCSA 2VZPA 2RR11 4DUXA 3FZ3A 5L9RA 2WFF2 1HN1A 2CU5A 2OX0A 4QPWA 3ZM8A 4EWDA 2C24A 4YPJA 2VZ3A 5FMDA 2N7GA 4ASMB 1UZZA 3OD4A 1HRV2 1ZX5A 4YSFA 1IS6A 2ZHMA 4J25A 2QUOA 1DYOA 1NXMA 3KWVA 4A45A 2VXJA 5K8SA 2ET1A 1N1SA 3GJBA 4LLFA 3POIA 4Q4Y3 2VAUA 4DY5A 2X8KA 3LB9A 3PJYA 3WW1A 5IVBA 5L7OA 1C8M2 4XTMA 3C7OA 3CNAA 1OMIA 3PUHA 5BNPA 1VBC2 3DPRB 2VBBA 4KGGA 5BNPB 3RZZA 1LOEA 1ZNPA 1VR3A 5C8WA 2F17A 1SACA 3AZYA 4XQWA 3ZN6A 1IPSA 1PX3A 2ARXA 3KV6A 5CAZA 1DQ6A 3VBSC 1UY2A 4GXLA 1AVBA 4LHLA 1RUG1 1JW6A 1JYXA 1FI2A 1WBLA 1QQP2 3M8LA 3ZXDA 1EV11 4DY3A 4OMDA 1H8TB 3B94A 5CFDC 1AJOA 2JKBA 5BUVA 2MPFA 1C1FA 1JMUB 2R042 3SISA 4DRVA 5FRAA 2MEV1 1CIYA 2RHPA 1HB4A 5LEKA 4IGQA 2Q8OA 3VBRB 3N9MA 1HV0A 2E9QA 4HANA 2LUWA 1MQTA 4A4AA 3SH3A 2LTNA 3M3CA 3W5NA 4OFGA 1AR82 3Q8EA 1Q8VA 3B7MA 3NV1A 4V2VA 2WNVB 5JXHA 1WLWA 2ZEWA 5K0UC 3ZO0B 4JDOA 1MEC1 1AX2A 1UYYA 1WW7A 3FUQA 5EP9A 5F3GA 1ULFA 4E2GA 4FAHA 4IL7A 1IZ3A 1RJ7A 4N8MA 1FPN1 4Q4W3 5F3CA 3EBRA 3OBZA 3RJ2X 2PA7A 5CA6A 1ULPA 4TLGA 3AXEA 4E8DA 2HWC1 1Y4WA 1NZCA 4CDWA 5JZGC 2JG8B 2B9UA 3FLTA 5T54A 2JEMA 2VVFA 1DZQA 4Q1PA 4CDQA 4CDWB 4YLZA 3RYKA 1LB2A 1SBFA 2W87A 3FFZA 1NOVA 2R073 1G9AA 2VH9A 1GP5A 2ZXQA 3I2JA 4YVSB 2NQYA 2WQ4A 4J6GA 2JIGA 5FZLA 1HJFA 5JIUA 1O8SA 2Y38A 3ACHA 1ND2C 1DGWA 1OLQA 1VRH1 1Y7BA 4D7YA 4PI2A 1J1LA 1H2MA 1UU6A 2DVBA 3WXPA 4TSVA 5EFUA 1JOPA 2WQ8A 5FP8A 1HN0A 1F2NA 2NLRA 2WLPA 3RPQA 5FY8A 4OQ9A 2XJQA 2AGSA 4YW3A 1YRZA 4K40A 4LPLA 4YYOA 4R9BA 3LAGA 1WLCA 1ND3C 1PO11 5ERLA 3RGBA 1XNBA 1JHJA 4MO3M 1GUIA 4XMAA 3ZOIA 5JDBA 3MFAA 4QKFA 1U0AA 5F2SA 3AP4A 1J59A 1QXJA 4CTEA 4UBGA 5J96B 1OD3A 4W50A 4HN0A 3RWNA 5D2AA 1SEFA 5FZ7A 3UKTA 2D98A 2P3IA 3AVRA 3JZVA 4GWIA 4YARA 2CY6A 1I9RA 3PU8A 4EN7B 3ITQA 3N9QA 1K42A 1GOHA 1QDCA 3JB8A 2ZX1A 3H9AA 3VBOC 4AAPA 5BNNC 1F31A 4DQAA 2WS91 1CR7A 1D2QA 2ZGNA 5T5JA 1NCQB 4QKDA 4MSVA 5FYBA 5FK7A 1XPWA 1LHOA 1TE1B 2AEZA 3LIGA 1CAUA 2W46A 3QBQA 1CGPA 3IZOA 4HKOA 5F32A 1UD1A 5CKQA 1LR5A 3BOWA 1K5JA 1LGNA 1ASJ1 2A5ZA 1JZ3A 5A7SA 5FDBA 4YM1A 3G7DA 2E33A 3KT1A 4ZZ8A 3WUDA 4BMBA 3B9IA 1J1TA 1ZBA1 1S0JA 1RITA 3C8XA 1R092 4K8FA 3DUIA 3GCWA 3IMNA 4Y1UA 2YXSA 1W2OA 2PHLA 3AXDA 2W9XA 1LHVA 3H50A 1WW6A 2FMYA 1LNSA 5SV8A 2GC1A 3ZFEA 4LA3A 2XJVA 4TYSA 2D43A 5F2WA 2FZ2A 2R063 5JXGA 1ZZCA 1WWYA 4LBJA 1YQ6A 1J84A 1ZBE1 4IV1C 5F5AA 4LBNA 3ZXKA 4OHWA 4HVRA 4BHPA 4JC1A 2RJKA 1MZ6A 1RUI3 4BYYA 3LSDA 3WQ1A 3L9JT 1REFA 1SLAA 1I5PA 4GMP1 4AHYA 1CX4A 4CPBA 1Q8PA 1OUSA 5A1FA 1WD3A 2VMHA 5KWRA 5A6ZA 2YDEA 2SBAA 3ABZA 4XUOA 3WDWA 3M1HA 4A7YA 2QKDA 4LOTA 5FPLA 4F83A 2XL9A 1GP4A 2IXKA 2QQJA 3AP6A 2DUQA 2XQRA 2R1BA 3FMGA 5FXWA 3WP4A 1ZZBA 2RDQA 4YWAA 2VCMA 3MGUA 1WLDA 1NCRC 4MGKE 3H8RA 3KCYA 1XQNA 1RHI1 4H55A 4WZFA 4F8AA 3U78A 2R1DA 4P5YA 4AGRA 5IAXA 3POWA 4M3CE 2FDHA 3PVNA 2WO3A 3B9CA 4E4SA 1OQ1A 3AMNA 2R0FA 1Z78A 2D6NA 3S30A 2GC0A 1E5IA 1AYM2 3MZHA 3J9SA 3EQEA 4LORA 1COV1 4HVQA 1OLRA 1NQDA 2XLFA 1HRI2 4OUMA 4XQDA 1BKZA 2RV9A 3RSJA 3TBDA 2FHRA 1EAH2 2WRAA 3D5OA 3NRUA 4MYEA 4GWJA 4BQ2A 1AR91 4JHZA 3H8XA 1YFXA 3LCPA 2YPDA 2RS51 2VCBA 2GDFA 1Q43A 5FXXA 4L92A 5C9AC 5IATA 1A8MA 1G8WA 1JODA 5J48A 2WFF3 1REEA 2E7QA 2NN8A 4HBNA 4BQ3A 1V9U2 1W0PA 1W9TA 1UX7A 4L8QA 5ANQA 5FR3A 1G7YA 1XNAA 1Z7S2 2DVGA 2A6ZA 1RVF1 1FMD1 1PVC3 2E7TA 3AP5A 4M01A 3VDCA 4AGVA 1QKQA 1W2TA 2ZX2A 3VD4A 2PMWB 3WCSA 1C8M3 1ZZ6A 5FREA 4Q0VA 4AHXA 5F1RA 4MGTA 1FPN3 1R082 2W1UA 4Q27A 1W8WA 4OQ8A 1H6YA 1TMF1 1YLLA 3ON7A 1E5HA 3MUZ1 4Q8KA 3VDDA 1W04A 3GZUC 3VBSB 1OXCA 1UN1A 2WNUC 3HQUA 4GH4A 4XAAA 1PZ8A 3PUSA 4OI2A 2VMCA 3KCCA 5CFDB 2JICA 5AFEA 3GXUA 2W47A 1Q5OA 4I0WB 4PLOA 3O0VA 4B7EA 4B4QA 2DVDA 3I3DA 5CKNA 1UX6A 2D5FA 4IEYA 3FE5A 5F9TA 3PUAA 1BZWA 1L3JA 3G6JB 5AC92 1VRH3 1H9PA 5I0TA 5FPBA 4W65A 3IBMA 2G9GA 1W6NB 3I2KA 3LDRA 3LPGA 3NNLA 4L11A 4BIOA 5C6CA 5K0UB 1ENSA 1HQLA 2NPIA 1AZDA 2IVIB 1H2NA 2QBXA 3BODA 1DZRA 1VAVA 3OPZA 2XB6C 4IETA 3WDTA 2VNOA 3AFGA 3CMGA 3HJRA 4META 4P9LA 3ZR6A 4CUBA 4Q0PA 3HNBM 1VIWB 2ERFA 1PK6A 4QX0A 4AI1A 3LOIA 3QOPA 4XFHA 3WY6A 4AGGA 3OYWB 2YBSA 1PK6B 4XVHA 4FI9A 3OB8A 5JZGB 1S0IA 1OSGA 5A33A 4YGDA 1WGPA 1NX9A 2W39A 3TEYA 1O4TA 4FCAA 1JZ6A 2ARBA 4I30A 1O6UA 4LNVA 2KR2A 4QPGC 3I3EA 4LQRA 1PM4A 1IS3A 4E2SA 1ND2B 4K9SA 2PHWA 5LBCA 4AFBA 3ILFA 4XF3A 3T30A 4HSJA 2QTWB 3T2QA 5JPNB 4NHYA 1E57A 5AFBA 4ZPIA 3CQOA 5JCTA 2R0HA 2WYFA 1T2XA 3W9AA 5LRSA 1CAXB 1W6MB 2YBPA 1WA6X 4WM8C 5BPXA 3O0XA 1F4HA 1UU5A 1ND3B 3IAQA 1UOFA 4FOWA 1RINA 4W4ZA 1RUE1 4HPKA 5DDJ3 2YFZA 2ARAA 4HLTA 4COUA 3N9PA 3PVEA 2E6VA 4NIDA 2VR4A 4Z2WA 4HPKB 4ZU7A 3PTYA 4MLOA 2UY8A 3PHMA 1UZ0A 5FXVA 2FQPA 5JOWA 4KWUA 1W9FA 3N3HA 1ZBA3 5GZFA 1D7PM 1VBA3 2OPKA 3KV9A 5HCAA 4QPIA 3IT8A 1HLCA 3MIDA 3MDPA 5EJ3A 2Y34A 2DCJA 3MEPA 4P02B 4Q4X1 4CU7A 2BPA2 4E8CA 1RMU1 2JWPA 1W6OB 1AX0A 2QQMA 4JQTA 3UESA 2BWCA 1RIRA 3SLIA 3VBOB 4I3PA 2QFEA 3VBFC 4AEDA 5BNNB 1AR62 4RHV3 3MICA 1REDA 4IEXA 3Q8AA 5FZ4A 3AP7A 3E97A 1C28A 3THPA 2H0VA 3OF1A 2BBAA 2YZ4A 2ZX0A 2G19A 2C6SA 1DQ5A 1S1AA 3RYRA 4LEJA 3J8F1 3RZGA 1UY4A 4URAA 4CP2A 1IG0A 2GP5A 4BQXA 5FQ0A 2J7MA 1FV2A 2QQKA 1PGW2 1EPWA 2W5FA 4FPLA 1PGL2 2GNTA 1TG7A 4WVVA 1N1TA 4K3UA 4AEMA 4XW3A 1QHDA 3LA7A 1F15A 3I54A 1RUD3 4PIXA 3ZYGA 1RHI3 4UW3A 2DUOA 1WW4A 4MHRA 4A44A 4AVBA 3HWJA 5GLTA 1YWKA 3MLKA 3S0MA 2A1XA 3OD0A 3TN92 4FPHA 4F3JA 4CU8A 1LGCA 1GYKA 1GNYA 5IFPA 3N9LA 4NRMA 4GIQA 4IV1A 3ZIXA 1DU3D 3LOBA 5DUXA 5GLVA 4IV1B 4M0NA 2XKOA 4OYUA 5T5PA 4H14A 1OQEA 1IPKA 1GZ9A 1XJAA 1XRUA 1LESA 2VZRA 4CDUC 5FZMA 2CWSA 1MR5A 5JOXA 2XJPA 4LO8A 2ET7A 4RGAA 5FZ0A 1KS5A 1FT9A 4RQPC 4L0PA 4BU2A 1Q56A 4M4RA 5FLIA 1SFPA 2WR9A 4QHOA 4P9YA 3IIAA 2DCYA 1MS5A 2Z5WA 5IK5A 2R6QA 3D0SA 3ZLIA 3NJZA 1W06A 5C8CA 4XFIA 1GLHA 2E7AA 3I2FA 5CFCA 3D4KA 4Y5TA 1NA1C 2O8QA 3POGA 2GC3A 2YBKA 1BEV3 2FDIA 4YFWA 5CFCB 2IVJA 3RDIA 2YYOA 3VHOA 5CG8A 3NWKA 4FAGA 1V6KA 3E5XA 3T09A 3I3QA 2V5YA 3K4AA 1OF4A 3TEZA 1KFUL 2JDNA 3VBUA 1EYBA 2A6XA 3K4ZA 4AFMA 1HRI3 2P6CA 1EUUA 3JCIA 4XC9A 3VBUB 4Q4Y2 2E51A 1O59A 1LEDA 5I8TA 1UKRA 4FSJA 5CYYA 4DOUA 4CEYC 4P14A 3WVJA 4OHVA 1RYYA 2BFUS 3M3OA 4BXSV 5JAXA 3WDUA 1PGSA 1VMJA 3DYMA 4Y5SA 4C8DA 5CADA 3HOBA 4CCOA 4XCAA 5L7OC 1GANA 2ENRA 5BY5A 1PO21 1V70A 3LFMA 2C4XA 2A3WA 1C5IA 1KXGA 2AYHA 1BJQA 2JDMA 2OUJA 4PLNA 3TNPB 4R9CA 3W59A 1V9U3 2VTFA 1M06G 2ES3A 4KU8A 3LE0A 1UY0A 5T52A 1DQ2A 1IOAA 3PNAA 4RS5A 3WNNA 2HWB1 1VBB2 3URFA 4JKMA 2Q1ZB 5DXDA 1SLLA 1S2EA 1VBD2 3MFCA 3U4SA 4QX8A 2XL7A 2P17A 5CG9A 1R083 1AF9A 3SNMA 3VZLA 4CXWA 2Q5TA 3U11A 2EIBA 1CAVA 3V0BA 2WNUB 4AHZA 2AZ5A 4BDVB 4XHXA 5M0TA 4GMP0 1MQTC 2D6PA 2HKXA 3ZN5A 4F7ZA 5FYUA 3S5AA 1AL21 2RS33 2O8OA 3MW3A 5I8SA 5DAPA 2JDZA 2YB7A 4M4PA 2W52A 1U12A 2Y6HA 3I49A 4EN6B 5JIAA 3AC0A 4EROA 1ZZ7A 2EIDA 1JU3A 1O5LA 4IV3A 4IW3A 4LBMA 4LITA 4U2AA 5FZ3A 2WZ8A 1FXZA 4RA0A 4D6QA 1W0OA 1HDKA 2CYFA 1LHWA 3MF6A 3LWCA 4NHKA 5EPAA 5FLHA 1RUC3 2R072 3B3QE 2AEYA 2VNRA 4XDOA 3I2DA 4CDWC 1GZCA 4CDQC 3O1OA 4GD4A 1S0DA 5GZCA 4RGKA 2HWE1 5DUUA 4XMIA 1SLBA 4QGMA 5FMOS 5LBFA 2J1TA 2VZTA 4MVTA 4NE9A 1UNBA 3VD7A 2J1UA 4DEVA 3VKFC 2IC1A 5FMBA 1X36A 5CBLA 5JLVA 2EAAA 3BGAA 1DCSA 5JWPA 3WX5A 5C3SA 2OW4A 5B4NA 2B45X 2ATFA 1H1MA 1V6OA 4XFGA 2OPWA 3CJIC 4ZU5A 5FXZA 1RMU3 3ZXGA 4BLJA 1DLLA 4L97A 4MOAA 5LBBA 4XE9A 3HBKA 4GB33 3MYXA 2IXHA 3OEBA 1LU1A 4O9EA 4WM8A 3TNQA 3V56A 5JSPA 4JGZA 1RUF1 3AFKA 1XU1A 4DFSA 1HKDA 1SPPA 4WM8B 1GWMA 2KA3A 4FVVA 4NIIA 4C0BA 4JGZB 1OUXA 1BMV2 3FJSA 4COWA 2WSUA 2ZMNA 4LBQA 3BI3A 3FBMA 3WNMA 4Q0SA 2D6KA 2RS13 5C3RA 1D4M3 2CDOA 3SEEA 1E5RA 3WF4A 4LBQB 4A2UA 4AF9A 1G9CA 1KRIA 1Y9GA 4XUTA 2HBUA 3NSTA 5L9BA 2FCTA 1YXWA 3POJA 3O1SA 2BERA 4QXKA 4WV8A 1IQAA 1PIV1 1CN1A 1GOFA 1WA4A 4J1WA 4LLOA 4O9GA 4IGOA 3LEKA 1ZYBA 4NAOA 4QT6A 4GJZA 4GQ7A 1BQPA 4MUVA 3VBFA 4CP9B 1UXZA 4IEWA 2YU2A 4QX1A 1L7LA 2WZEA 3NV4A 5DABA 2PN5A 3VBFB 2VNGA 3LZZA 2XDVA 3E5UA 5LB6A 3UJQA 3UGFA 5FY9A 2Z69A 4QX2A 4XXPA 1AR63 5FOJB 4YW4A 4MG2A 2PQSA 4P00B 1NG0A 2V4AA 2ADDA 3VL9A 3NVCA 4BPZA 1O5UA 2YUEA 4FOYA 2BDRA 2VXRA 2ZGSA 5FMCA 1HXS3 4AVTA 4LTAA 5FY5A 2QQPA 4FT8A 2HLEA 2R062 4Q2FA 2VVDA 2DTYA 2XOMA 1SZBA 1PZ9A 2UURA 5FP4A 3ZFEC 1IGOA 4YGCA 1QNYA 2XJUA 1JXNA 1RUI2 2WA4A 3HEIA 5EJ1B 4XTPA 1IKPA 2XWJB 2MHFA 5FLJA 3VHRA 1YQ2A 4B7KA 4KMQA 1NLQA 1TME3 3VV1A 5A1AA 2D6OX 5FAXA 5I93A 3RMXA 3ES4A 3ZYRA 4PBOA 3AB0A 4INDA 5FMOL 5FO9B 3THCA 2X05A 2D93A 5ANNA 1QJY1 1S0FA 3EJKA 4NPLA 3LA2A 5JXJA 1VLNA 4K7JA 2BVVA 4PDWA 3LEIA 1CIWA 1UCXA 2VTXA 5FZIA 5T5LA 3T2TA 4YZ2A 4FTEA 1ODMA 3M70A 4NHMA 5APAA 1SQ4A 3JD71 5FPAA 4CDUB 2HJIA 3VGIA 4D69A 5ACA1 2DCTA 4ASKA 1TNRA 1OKQA 1VBE1 5A32A 4QX5A 3N35A 1JYVA 4OI0A 4XBNA 3Q8FA 5C7GA 4FBFA 1X7NA 3LF7A 4KI5M 5A7WA 1NA1A 2LALA 2ZEYA 3CZUA 4Q4V1 2RDNA 3AKQA 1ENXA 1OD5A 2DU0A 1NA1B 2XG3A 3AMHA 5ISLA 1D2SA 1DGRN 4PJYA 4NMIA 4EYUA 2IXIA 5HCHA 1RUOA 4AFDA 4Z2AA 1GNHA 4UYBA 2DWRA 3WF2A 1GFF2 2PLV3 2VZUA 4BMEA 3O1UA 2OZJA 3SHRA 3CF6E 3WQBA 1G9BA 1MZFA 3MF9A 1APNA 3RFRA 1F35A 5FPVA 3I8TA 1AR73 5GZDA 3UKVA 3OGGA 1O7FA 4CEYA 2F6BA 1PVC2 4PCRA 1WKYA 2R30A 1QJFA 2ORXA 2WNEA 3M4FA 4CEYB 3OCPA 4BCUA 5IYYA 5J3UA 1QJU1 4U36A 3Q8BA 5FQ0B 2Z2SB 1FPN2 4GKXA 3WQ7A 2FDJA 5L7OB 1O4ZA 1A34A 2WZR3 3U10A 1A8DA 3OBRA 3U07A 1NY71 2BQPA 4ET7A 1NE4A 5JUVA 2VG9A 3ZN6B 1FNYA 1R1A3 3FHIB 4UW6A 3WINE 3VDDC 2ZX4A 1J83A 1JN2P 2RMU1 3GALA 4JRLA 2PHTA 2IWGB 3UGGA 1W2UA 4GH4C 3P3NA 3H1MA 1VBB3 1XE8A 4PIYA 4MV2A 1JZ4A 2D7FA 4A6SA 3WW3A 2F4PA 2JX9A 4B3NA 4DPNA 1OHFA 1H6XA 1VBD3 1VRH2 3ZYPA 5BNOA 3POSA 4EV0A 3NJVA 3H8OA 3B00A 2P34A 2K2SA 3WD5A 4QQHA 3MIFA 3WG2A 4UF0A 3ILRA 5H9PA 1XNDA 1MQTB 1SLIA 2QNKA 5IVVA 1J3QA 5JXIA 1W2NA 4UF0B 3AJYA 3ZFGA 3S7EA 2VE1A 5LRRA 4I01A 4MZUA 1PO12 3SEPA 5JR2A 1LECA 3TRSB 5FK8A 3RYPA 2R49A 3NNGA 4AEKA 1OA2A 1UXXX 4QDRA 3BTYA 2DFBA 2PTMA 4YNIA 1BCXA 2X09A 2W1SA 1PK6C 1FX5A 1VPHA 2AACA 5GLZA 3SCHA 5EYXA 1WMDA 4XUQA 1CD3G 5FZCA 1HRV1 4CDQB 2Y0OA 1H2LA 4AQ6A 3THTA 3WG1A 3SXWA 2VM9A 4LUMA 4NWWA 3BKZA 4QM9A 1L7QA 2R32A 5FZEA 3USUA 3ZYIB 3WNPA 5IK8A 4OUSA 2D3SA 3USUB 1VBC1 2WS92 3HVDA 4JRAA 5FPZA 4HVOA 5J1XA 1WUVA 5C71A 3ZXLA 2BRTA 4YGBA 2ZKNA 2DYCA 1XNKA 5FBZA 3CJIA 5FY1A 1W99A 3WOGA 4JTOA 4QXCA 5A7PA 2GAUA 2EIGA 1LODA 3BB6A 4XBQA 3C7EA 4HKWA 3CJIB 5DDJ2 3OJBA 2Y6KA 4WBBA 3T2PA 3WSOA 4EWAA 3WP5A 2C5DA 1AYN3 1UOGA 1ULDA 1UMIA 1XSQA 5E6HA 2Q4SA 3VDAA 1OLMA 3FFQA 2HWF1 2R041 4NJ4A 4TXWA 5LCWL 1ZBA2 2OXBA 4GA9A 1VBA2 2HWD3 3RS6A 1X50A 1O3QA 3OUHA 3OGSA 4QHBA 3UGHA 1GWKA 1LHUA 1WCDJ 3DYOA 1F9KA 1VRBA 1KD7A 3I2HA 5A7NA 3HQRA 5JOZA 3BTZA 3BUCA 1AR81 2J1EA 4QPIC 3VHPA 1QH6A 4MGZE 3RWKX 1W8OA 1OPMA 3WG4A 5F3IA 4RHV2 5K7PA 2VTXJ 5KHIA 3W58A 4DIQA 3O1PA 2RE9A 3DKQA 1KJLA 1MS8A 4LHKA 5JSOA 2UWAA 3AM2A 3CDZB 2VJXA 4AEDC 2A71A 1EUTA 3QCWA 3ILNA 2HEVF 3VKMA 1GICA 2GALA 3H1WA 3H8UA 3B93A 1FOD3 5EJZB 4DUWA 3JQWA 3RMYA 2BVBA 2WA3A 4I3GA 4CVUA 5B4XA 1SCSA 5FZOA 3VKOA 1RUJ1 4BB3A 5CNAA 1CZSA 1CAUB 3AZZA 4XJ8A 4CUAA 4JHTA 2J1VA 1SFNA 2JB8A 3AYEA 4FPKA 2D44A 2VZSA 3EB7A 1RUD2 2QJVA 3HT2A 4YG6A 3I2OA 3IN9A 1RHI2 3MV11 2W2IA 4AW7A 3LEMA 5J36A 1UAIA 4Y26A 1UZWA 5ACA3 2IZWA 1E5SA 3TWIA 3CL1A 1UZYA 3ZYFA 4CYDA 3KHCA 3J7LA 3KQ4B 4I0AA 1KDKA 3J7MA 3MLJA 5A7OA 3ZSJA 1IKQA 2PQQA 1QJX1 3ZFEB 1AUYA 1YQ5A 5LA2A 5EZWA 4KU7A 5CISA 3RRDA 3N7KA 5FO7B 3AKSA 1RUH1 5FYYA 4Q4V3 4YW7A 4AOCA 2BNOA 1POV3 3BPSA 3KD4A 4AR2A 1F5JA 1AR92 1LGBA 3KT4A 4IEPA 2BP6A 4JVAA 2RS52 3H3LA 4A3XA 2RR13 5L19A 5DUWA 3H0OA 3JU9A 5IUQA 3ZKUA 5FZDA 1DYKA 4CE8A 1I3HA 1POQA 1RVF2 3IB3A 1FMD2 3LFIA 1BEV2 2DCKA 3QH7A 4GJYA 3S6PA 5C8CC 2IFWA 3MV01 1K12A 1B09A 3PUIA 4YW2A 1VJ2A 5CFCC 2BBVA 1QJU3 4XUPA 1NXD1 1VMHA 4PLMA 3RZHA 1CZTA 3MHZA 4JAAA 1M4WA 1TMF2 3CZJA 1ULOA 1WCKA 1CAWA 2VW2A 3MO4A 4BIFA 1CAWB 1FV3A 3VBUC 2E63A 5LZ6A 3JXSA 1RUG3 3OGRA 3CJXA 1OFNA 4GULA 1EV13 2QE3A 1R091 4Y22A 1V6JA 2TEPA 1W39A 4BH9A 3LEGA 3WEZA 1BBT1 3GBWA 2MEV3 2OQ6A 2ZMKA 1YI9A 2G9ZA 1JBCA 3T08A 3WNKA 2VQAA 4UFHA 4LR4A 3NV3A 4B4PA 2VQUA 1JZ8A 5IWFA 3UYJA 1SCRA 3PDQA 4CCKA 3EHKA 4DZGA 4D8MA 4YZ1A 4XF0A 5HCBA 2VUCA 5BNQA 5FYVA 3HN1A 1MEC3 2AREA 2GMEA 5IW0A 3NKTA 1ULCA 4NROA 4RS5C 4SBVA 2Q8DA 1QMJA 2YPJA 3WF1A 5JMOA 3APBA 3O12A 3MUY1 4XAEA 4QM8A 4SLIA 4IESA 2L9LA 4N53A 1Y3TA 1W6PA 4QXHA 5A3MA 2HWC3 4FPEA 4D3WA 1L7RA 4CU9A 4WVMA 4AFAA 3VDDB 1RXFA 2YMZA 3T0AA 4AXOA 1GZTA 5FPUA 2FDKA 2V73A 1S2KA 2OUHA 2RS32 2BJSA 4GH4B 4UT5A 1MS0A 1OC1A 1A78A 2V09A 3WZ1A 1DP0A 2GZWA 1O3SA 3WP3A 5ABJA 1I5ZA 3ECQA 5AVPA 1AYM1 1NLSA 2BGCA 1D0GA 2JXAA 4IV3C 1RUC2 3ZDSA 3O14A 5KHHA 4AVCA 3CBNA 4I02A 1WLTA 3OY8A 1VALA 4JQRA 2E32A 1EAH1 1DFQA 1YJKA 1DYPA 2P3KA 2PAKA 3ZVXA 4QXBA 2NYYA 4HSLA 1PO13 5HV4A 2NP0A 4CA9A 3T4VA 4AI3A 4FPFA 1F8VA 4XF9A 2PXJA 1ULEA 2HWF3 2VUDA 5CVRA 4YG3A 4UXAA 1X8EA 3GZAA 1GKBA 5A33B 2VZ1A 1SBDA 1C8NA 2W1QA 1Z7S1 3E5QA 3UT0A 5C3PA 4BOWA 5KXCA 1JI6A 5T50A 1RMU2 3UETA 2XHKA 3KMHA 3MPPG 2WC2A 2VPVA 3IWZA 2VZVA 3FBYA 3NAPA 4GB32 1R1ZA 1S2BA 2DVFA 2Q30A 4DRRA 2VZOA 2BW8A 5FOBB 1CPNA 3N7MA 1P8JA 5GKAC 1HV1A 5E1RA 2WS93 1UY3A 5FWJA 4LK7A 2WN2A 1PMIA 2C0ZA 4TWTA 3RVHA 1MPXA 4CDXA 4LKFA 1CVNA 4JGZC 4LKEA 4D7TA 2FDFA 3VDBA 5E8AA 4A7ZA 2WLQA 4DEQA 2P2KA 3VZNA 2RS12 3N7LA 1D4M2 3E6DA 4S2GA 5LK7B 3FLRA 3LSEA 4FO9A 1ASJ3 4AE2A 4WVZA 2YGLA 3S57A 1URXA 4KG8A 5LK5A 3BALA 3H3ZA 3ZPOA 1GP6A 5AC91 5KC5A 4N43C 1PHMA 2H6CA 1UF2C 1UL9A 1H2KA 2Z42A 4A3ZA 3U0ZA 4QPIB 1U5ZA 3GCXA 3GYDA 4NO4A 4OMCA 5HPOA 1AXZA 2B9VA 3HD8B 1AXYA 1SHWB 2WYSA 2D5HA 2G4IA 4FQ4A 4AEDB 1ZBE3 1WW5A 4C1WA 1C3HA 2XBO1 4ISQA 5KHKA 1FAYA 1RUH3 1GQPA 4GMP3 4DMIA 1HXS2 4RN5A 2B39A 1W3VA 3ENRA 4NVPA 2I45A 2YROA 5CB7A 2CAUA 5L73A 4CPBD 1XC6A 1JU4A 3WNLA 4FTSA 5HI0A 2J1AA 1YC61 4A7KA 4LBLA 4EN8B 2HYKA 1TME2 3M3QA 1N47A 2W1WA 1TVGA 1YFWA 3VUOA 2AC1A 2ZAHA 4YG0A 4OULA 2IFRA 5K9YA 2W3JA 2QQNA 1FNZA 1OLME 1GR3A 1COV3 2W95A 4JGYA 4V1PA 5IVYA 4CCDA 3KCXA 4PDWC 2XMLA 5FIXA 3DCQA 2BUKA 3QACA 3OUIA 2VW0A 5GALA 4QDSA 4Y3OA 5A3LA 3MBWA 3IKWA 3L2YA 1G86A 2ZX3A 4B1LA 1X9TA 1AR93 1KFXL 4LULA 3P5BA 4P5HA 2RS53 1DBNA 1UOBA 2CHHA 4IE7A 4Y4RA 1RTVA 2DTWA 3RNSA 3RZMA 2Y0IA 1W05A 5LATA 3E1F1 4ZU4A 1NQJA 3EXUA 3KB5A 3PIGA 3VZJA 3K3OA 4RYDA 3FX3A 5C8CB 4CCJA 2HWB2 1OURA 1RVF3 4LE4A 1FMD3 1HQNA 4ZS2A 5I0RA 2VECA 4ORFA 2DUPA 2PLV2 1V0AA 4NAMA 1YNAA 1SFYA 1HB3A 2YGMA 4QU2A 4UW4A 5A6YA 5KXEA 3PU3A 1XYNA 1QIQA 2QQOA 2ZGUA 3RI8A 1AR72 3TEXA 1H0BA 1TMF3 3POFA 4Q1RA 4DB5A 4EJRA 4KWLA 1N3QA 1HQWA 2J22A 3HQXA 1PGL1 3K3NA 1AJKA 2XJRA 3K77A 1ZZ8A 2ZGRA 1CWPA 3RZLA 1YUDA 2G1MA 2DV9A 4XOGA 1O3TA 1KEXA 5AVAA 2O14A 1OF3A 3TN91 1ZZ9A 2WZR2 1NLRA 2X5IC 3EMRA 3WCRA 4QX7A 5KHGA 3NMBA 5C4WA 5IVJA 3PTRB 4GWMA 4H7LA 1X82A 5FJKA 1S0BA 5A3OA 2BWAA 2GMMA 2WAOA 5CKMA 1TQ5A 3O1VA 1R1A2 1W03A 3JB4C 3FN9A 1DGRA 2D3RA 1MZ5A 4YW1A 2GN7A 4DXTA 4IXLA 5C3QA 5D8AC 1YHFA 3ZKYA 2PELA 1JOBA 4RS5B 3C7GA 4QQLA 1US3A 3MIGA 4IDZA 4YW6A 4EZHA 2VOXA 3AVSA 1JH5A 3AZVA 4CEWA 3AL5A 2HEYF 2TBVA 2RM21 1XE7A 4XETA 4BK4A 4IGPA 2ZHNA 5BNOC 3QD6A 1QJZA 1T6BX 2GH2A 4N9IA 4OI1A 3RJRA 3O1MA 3BIEA 4ITCA 5D1IA 1HIXA 1JHNA 1CAVB 3ZSKA 3V0BB 1W2AX 4JKLA 3N9OA 4ARYA 1LENA 2CDPA 2UWBA 4NPRA 3WUCA 5GLUA 5FUIA 3ZFGC 3DGTA 5KR7A 3K51A 3UK9A 3ZXFA 5JMCA 4ISRA 4UAPA 1Y9MA 4GWNA 4R4XA 5IT6A 4FXGB 5F8PA 2DBNA 4IV3B 1W9YA 3A0KA 3OOXA 2WWSA 3D6EA 3EO6A 3OG2A 3B5LB 3R4UA 2RJ2A 1MZEA 4OLLA 4KNCA 3FHQA 4Q4Y1 2QQUA 4XDPA 2OKXA 4YFZA 5B2GB 1AXKA 2XH6A 1RUE3 4GKYA 2AH2A 2ORZA 4LMFA 2UY9A 3ASIA 3EYPA 5JI9A 2Q8EA 3LGRA 5FYMA 3N7JA 4LIVA 1RC6A 2J1RA 3ZN4A 4LBKA 2W94A 4QQ2A 3ZMOA 1V6NA 1S55A 4Q4X3 1GOGA 2WDBA 5FYHA 3W5MA 5DPNA 3LKJA 5GM0A 1AYN2 2ZOEB 2VMFA 4OZXA 3OPWA 4ASLA 4P9IA 1A3KA 5DZGA 5G05L 5JI7A 2KD7A 4X8PA 2HWD2 4QMAA 3VKNA 4AQTA 3MPBA 5FP9A 1W6QA 3WP6A 5C5TA 3ORJA 5L9VA 4CRQA 2H0BA 4Y5Z0 2JG9C 2XBO3 2VL4A 1UPSA 4XJAA 2O0OA 2I74A 5A6QA 2QQIA 3WHTA 1UOJA 1SPPB 1HB2A 4LE3A 4A6OA 5A1LA 2WN3A 1US2A 3J8F3 2A6VA 3BIWE 4PQ9A 3TEWA 5GZGA 2AENA 4CZSA 3DF0A 4Q4W1 3CIHA 4N43A 1PVXA 2WQZC 2G9FA 3OBTA 2JE9A 3GHMA 3POEA 5KXBA 4N43B 3JBG1 3FC0A 1FOD2 4HONA 5I0UA 2VZQA 5H9QA 1SG3A 4Y1XA 4BLIA 1DZTA 1C1LA 2R071 3ACLA 3ZMNA 1IS5A 2EVXA 1RB8G 2ZABA 5FYIA 4Y33A 1MVQA 4HOOA 2DURA 5FV3A 2VBPA 3JD72 5G04L 3BTAA 3C7HA 3M3IA 1U5IA 1O91A 2WT2A 2FMDA 4E9KA 5ACA2 5HXMA 1UO9A 4TN7A 1DF0A 4MX3A 3H42B 3U1XA 4K1ZA 3R05A 1KDMA 2ZEZA 1RUNA 3SH5A 3MW4A 4M3CA 3KZ4C 3IDEA 4M00A 5IVCA 5EIYB 4JV4A 4LO6B 3PMSA 1O8PA 4Q4V2 1BYHA 4ATEA 1VAKA 1W8NA 2ZS6B 4XILA 1OPOA 2K9ZA 2FBEA 3ROUA 5J7MA 3GBGA 3U75A 1X9PA 3KF5A 1CJDA 2RR12 5FBJA 2WT0A 2WABA 4RFT0 2WBKA 2FDGA 4MXVA 1V00A 3P6BA 2V72A 4PDWB 3TAYA 3WLUA 4ES8A 1OH3A 3FHAA 2OT7A 1JS9A 2VMGA 3A7QA 3NW4A 5F5IA 3PVOA 1H1IA 3PUQA 4BE3A 3IPVA 1QJU2 4KGQA 3N9NA 2WO2A 1LOFA 3WV6A 3U4XA 2C9KA 4WM7A 1S0CA 3IPVB 4CXXA 3ZSMA 2DVAA 2GNBA 4XIKA 4NOTA 5A32B 4FFFA 4L9BA 4E4ZA 2WAAA 2BNMA 3KV5A 3PIJA 4Q26A 5A80A 1PO23 3HNMA 1NY72 1Z0HA 4LIUA 1RGSA 2ZHLA 4C91A 1G9DA 3LD8A 2JE8A 1RJ8A 2XWBB 3I2IA 2CGOA 5A7WB 1RUG2 2VOTA 1DQ0A 4FFHA 4K21A 1AHSA 5F37A 2RMU2 1EV12 4LKDA 4XF1A 4AAXA 2HWB3 4UFKA 3KV4A 1JZ5A 4XJZA 1T6GC 4FPOB 4OI4A 2MEV2 1OBNA 4LJHA 3INAA 3BYWA 2HEWF 2IXLA 1HB1A 1CPMA 2GSYA 4BJ0A 3DECA 3GF6A 3T4HB 1EP0A 1DIWA 4Q0UA 1OI6A 2V4VA 5EYYA 2P3JA 4PI0A 4XYXA 1QOSA 3OEAA 1RUI1 1XYPA 1K5MA 4ZXKA 4AI0A 1MEC2 2FD8A 1D0HA 2X5IA 3ETQA 4XURA 5DMYA 3C3VA 3KSCA 3R0RA 3AZWA 1AL23 2X5IB 3AZXA 4K6BA 3K4DA 4MGIE 3MI8A 1Q8QA 1LHNA 1JOJA 3N36A 1OVSA 2EXHA 4XABA 4YVWC 3CKHA 4YW5A 5KBFA 1CESA 3JUUA 4UWDA 3WF0A 2HWC2 1PNGA 1YI7A 4HETA 5FP3A 4FTBA 2XONA 4JX0A 5D8AA 3WDXA 4ONUA 3ACGA 1C57A 2A6WA 3NQHA 4XXAA 1OOPA 5D8AB 4N53C 2WT1A 4BWOA 2WUHA 5IVEA 4DNYA 1OOPB 3KGLA 2C26A 1PMHX 2XVGA 3P1IA 1JYTA 1IG3A 5A7QA 3KQRA 4EZ4A 1QEXA 4YZ3A 3DPRA 2HWE3 1QJEA 5I0SA 2A70A 1Q3EA 3ZDVA 5KHJA 1ZRRA 2XVLA 5BNOB 2VQTA 4FQZA 4AFCA 3POBA 1VE0A 4IE4A 4QQPA 1WMFA 4V2WA 1TEIA 2YC4A 5ABJC 1CONA 1SBEA 1UQXA 2EA7A 3ETPA 2VCAA 4HK8A 4CU6A 3ELNA 3PL0A 4EWEA 2A7AA 3I3MA 3FLPA 4WZCA 3ZFGB 1H8TA 1UYXA 2X29A 2B7YA 3AMQA 5CU1A 5I8YA 1LKNA 1UPIA 1W8UA 3VZMA 2ZACA 3V65A 4NWVA 2HWF2 4B4RA 3VBRA 2GP3A 3SQOA 3H7JA 2WFF1 3ZPYA 2YC0A 1CQ9A 5FY7A 1RUF3 2RG4A 5FFOC 1UKGA 4X6RB 1OVPA 1SDWA 5LEJA 2WNVA 5HBAA 2DF7A 5F3EA 3VB9A 4AQ2A 1PVC1 4LO4B 1QXPA 2W08A 3BU7A 3GGLA 1JZ2A 4IEUA 5LY2A 5J09A 3D0JA 5FZFA 1OA4A 1C8M1 2VOKA 3LQCA 3HNYM 2IXJA 3NAPC 2P4EA 4RGGA 4LBQD 3LA3A 2NZ9A 3POYA 4XJ9A 4ZXEA 2JG8A 1PIV3 2YY1A 3JBG3 2NM1A 5KC6A 2AUYA 4Y4YA 1G6NA 1QWRA 1R64A 4R52A 1B35C 1DGLA 1W3XA 2VMDA 1RUJ2 4CDXC 4YVSA 5JPMB 1QQP1 3DKWA 2ETEA 1ASJ2 4RSUA 4A41A 2E26A 2LROA 2QVSB 4I2OA 3USSA 2EXIA 2JG9A 2BGOA 3ACIA 2VD7A 1WBFA 2JG9B 5F5CA 3T3YA 1X8MA 1H9WA 2ZGLA 3RZJA 2UU8A 4AVAA 4Y20A 1ONAA 3UNPA 5F39A 2Y6LA 2D3PA 2XR4A 4Y20B 4RR3A 1S0EA 4QAWA 3IIIA 1KJRA 4QX3A 2A73B 1QJX2 4RR3B 1C4RA 3THDA 2WSVA 1ZBE2 2BOJA 1TZOA 1XXNA 3V64A 3J4UH 3AL6A 2UYAA 3AYCA 3ZYJB 3CO2A 5EXOA 1RUH2 2VNVA 4QDQA 1H30A 3NNFA 5CZKA 1V6LA 2VVEA 1QNWA 1SMVA 1HW5A 4R9AA 2OS2A 3OUJA 3CHXA 1QJY3 3C2UA 1ODNA 5FZOB 2F4LA 1BK0A 1LTEA 4IE5A 2W0XA 3PJQA 2C9AA 2I07B 5GLWA 4FP3A 1V6IA 2E53A 5JR7B 4DINB 1IHMA 2P6HA 1F5FA 4LK6A 5T5OA 3JD73 4XHBA 2GN3A 1NCQA 4AI8A 2ADEA 1K3IA 3GJAA 4KQ7A 4BQYA 3H7YA 4XFAA 1ZVFA 2QQWA 4BXFA 2CGNA 3J7NA 1JZ7A 5FP7A 1H8VA 2D97A 3SKVA 4NHXA 4CCLA 1MS4A 5CIRA 4AQSA 3T1MA 3HPNA 5H9SA 3OGJA 1VBE3 2CTVA 1JUIA 4FFIA 1COV2 1N1VA 5FTTC 1LULA 2QCSB 5DDJ1 5F6LB 4PF1A 2RVAA 4CCMA 2C1FA 4QHZA 3SCFA 2ZMLA 1D4VB 3T0BA 1UMZA 1ZA4A 1SLCA 3R4SA 4QGNA 2VULA 4FXKB 4JGYC 1YFUA 5LASA 5TSWA 4OUEA 1Y43B 1VBA1 3H1YA 4L2NA 1NZIA 3IM0A 3ZX7A 4C90A 3WR0A 2RDRA 5EHDA 3U14A 3HIFA 3KHBA 4Y1VA 4URTA 1HJGA 4IEZA 5FWEA 1BBT2 3VBHA 2XHNA 3A4UA 3Q8CA 4IUGA 5FZAA 1BK1A 5CEHA 3PVBB 1OA3A 2WO1A 4QPYA 2D40A 1AL0G 4RL7A 4RHV1 3VBHB 4M3CF 4QKNA 3R4DB 5LA1A 1UY1A 4IERA 3HR9A 2MNGA 4UFMA 4JCKA 2FZ1A 2P37A 3P3PA 1LOAA 4PBPA 2XXZA 1LCLA 3VHNA 4IEOA 3AKRA 4XBLA 3VKLA 2CV6A 3KT7A 3NNJA 1BHGA 2Q1MA 1DLCA 2VC9A 1STMA 2XLGA 4MXWA 4S2FA 1H4HA 2A3XA 3HMYA 3MIEA 4NRPA 5A6XA 4GALA 4MXWB 4X8NA 1GBGA 2A3YA 2YHJA 1RUD1 4Z8BA 2WFPA 2WJSA 1I6XA 3CEWA 4BZ4A 3L2HA 3VZOA 2RMU3 3T1LA 3TB0A 3OTFA 5IK4A 3A23A 2Q8CA 2ZAAA 4Y22B 5E89A 2Z4FA 3DEMA 1OH4A 1DQ1A 3T2OA 3BU0A 4D6RA 5C4WC 2BNNA 4FPCA 5HCFA 3WNOA 1UZVA 4JDMA 3PURA 4YZ5A 1YO8A 3GDBA 3OBAA 4O7XA 2ID4A 4TLFA 5FZ1A 3SKJE 4DXSA 4N9HA 4ES9A 5C33A 4P9WA 4YVWA 5DZFA 4QB2A 2JB4A 4YVWB 1W8HA 1MS1A 3ME2A 2DBIA 4HT1T 5T3NA 5IAVA 3UL2A 2ZCWA 4CEWC 1ST8A 4N53B 4WVWA 1W6PB 1K45A 3C7FA 3LPFA 4D0QA 3I7DA 3PMEA 4G9SB 4K1YA 4LHSA 4UFJA 4WVMB 3VD5A 1HRV3 3SC7X 3VD9A 1KITA 2GH8A 1KQRA 3HAGA 4AL9A 5C70A 1BEV1 2BV4A 1EPZA 4XDQA 2CNAA 4LKSA 4DS0A 5GJ6A 2K0GA 2BU9A 5F6KA 2ZPXA 3BOPA 1ZREA 2JDUA 4M0HA 1YIPA 1NE6A 2A75A 2LW8A 1VBC3 4NIHA 2IUWA 2ZEXA 2DCZA 4YZ4A 5ABJB 4W6XA 3VBSA 4KBZA 4AHWA 1JYNA 1LAJA 1QGLA 1J58A 1HRI1 2GU9A 1UW8A 4OHXA 4I09A 1KS4A 4EQVA 3MIBA 2ZA9A 2CSGA 2EALA 5CFDA 1S4CA 3OY8B 4YM2A 4CCNA 1OT5A 2LRPA 1RUE2 3AJZA 1ZRDA 2WZPP 3NKGA 5LA0A 1QQP3 2QQLA 1I1EA 4R4ZA 3SMHA 2B46X 1DQ4A 5FYTA 3KLSA 1XSRA 2BTVC 2Q1FA 3D8CA 2JJ6A 2R043 3GZTB 4XJUA 3GBFA 4NIAA 3WW2A 2Q0AA 1W6NA 2OYZA 1W8TA 3ZIWA 4X6QB 2PHRA 1ZM1A 3I97A 3DL3A 3AKPA 1V9U1 5K0UA 3VL8A 4Q4X2 4Q29A 4NPMA 1GSLA 1BVP1 1AR83 4AI2A 5C3OA 3BTXA 1C5HA 1Q8OA 4D94A 4ZONA 1QF3A 2HH9A 5EWSA 2E31A 3NAPB 3OYWA 2WKKA 2WIIB 3B69A 4OZOA 5JZGA 1R081 1ACCA 2XBO2 4NUBA 1B35A 2CGPA 2D6LX 3WT3A 1G9FA 3O1RA 5I0DA 4H3WA 1B35B 2VOVA 2XJSA 2OIIA 3TYJA 4L99A 2GNDA 1POV0 3J8F2 4Y1ZA 3WDVA 4CDXB 1NKGA 1PNFA 3ZXEA 3A21A 1RUJ3 2ZGPA 2RS31 2XJTA 2XPJA 4BQ1A 1IQDC 1ND2A 3J26N 3ZSEA 4O65A 5FYZA 5DUVA 1BXHA 1FATA 4XF4A 4XACA 1N3OA 2JDPA 4XPVA 2JDAA 5FZ6A 2ZBJA 4S2HA 5BYNA 3QH6A 1UWWA 4TTGA 3E6CC 1CAXA 3NNMA 1W6MA 5D21A 5FCCA 2VOWA 4UI9L 3CLPA 1MVEA 1XNCA 3UJOA 3VLBB 3M7AA 5FYSA 1RUC1 1ND3A 2JDKA 2J1SA 4P9GA 4RFRB 5FYCA 5HXVA 2GMPA 1BLZA 3R6SA 4OVEA 4XIOA 3A0NA 3WQ0A 1LJ7A 4IE6A 4C0HA 4KWJA 4COYA 3UV9A 2Y8KA 4FPGA 5LY1A 1QJX3 4Q0QA 5FKCA 2ZZJA 3ACFA 4JDNA 4C1XA 4ARXA 4KG0A 4CUGA 2WO7A 4FOVA 2P5BA 4KL1A 3H3UA 2VUAA 1O4YA 2CL2A 2W68A 3HT1A 2Y60A 4R9DA 2X10A 1ENRA 2VQ0A 1GMMA 3W20A 2O1QA 3AKTA 3AK0A 3ZXAC 1MS3A 1QXRA 1W6OA 4YRDA 4FOQA 2WWJA 3VBOA 5IFTA 1YQCA 5BNNA 2PFWA 3GNEA 3K48A 2JECA 3KS7A 4S2DA 3KVAA 4GB31 4DUVA 4HXCA 2ARCA 4MHUA 2V5DA 4JKKA 1RL3A 3LDKA 5A3PA 1U5YA 1PX4A 2YV8A 3AYDA 4D6SA 4CCEA 1XOYA 1IS4A 4XFBA 1FYUA 2Y33A 1DGWX 4HN1A 1JYIA 3HBZA 2YG0A 1YQ8A 1KGYA 2VU9A 4JZRA 4XUNA 1F4AA 4RD7A 4LA2A 2RS11 1D4M1 2PHXA 3IAPA 4MGYE 4YM0A 2QZ2A 1Q8SA 3IDCB 3QLQA 4YGEA 4JGYB 5DG2A 3ZYHA 3DXUA 1ALYA 1UYPA 3BVCA 4ZZ5A 2CWMA 1WD4A 2PHDA 1GQGA 3NV2A 3WG3A 2ZJCA 1A6CA 1R093 2PAEA 4R8HA 1H4GA 5A3UA 1LOFC 3X29B 1PO22 1BBT3 4KWKA 4WM7C 3IMMA 3TOJA 3KGZA 5DAWA 4DXRA 1LOGA 3O1TA 4G4FA 1WCQA 2CAVA 1AR61 2DFCA 4LBOA 4Y1YA 2B42B 2ZGTA 2P1BA 4EN0A 3GZEA 5LW9A 5JOYA 2W91A 2EIEA 4JTNA 2VGDA 1J3RA 1N3PA 2OQ7A 1JUHA 2PHUA 4D7SA 5F7UA 5HV0A 2WNOA 4P08A 3O7OA 5FY0A 4NRQA 4KBBA 1HXS1 3B01A 4AVSA 4NN0A 4XZPA 3RZKA 5J37A 4H2AA 3FL7A 3WF3A 3ZR5A 2OZ6A 4EN9B 1W0NA 2NMNA 2RM22 3I2GA 5C5UA 3FUOA 1NCRA 3LIHA 4NHLA 5FJHA 4CCCA 3IDAA 1PGW1 4EE2A 2AR6A 4Y24A 1LRHA 1NCRB 4AZZA 1J3PA 1NYWA 3PLQA 3S7IA 1WZXA 2LM3A 3DN7A 2P3YA 5JSRA 3OGVA 3LDBA 3ZFFC 1YFYA 1AL22 1TME1 2XVKA 5EQUA 2YC2A 1K5MC 1YJLA 3BPZA 2Y6JA 3WW4A 4IEQA 2B5HA 5DZEA 5LBEA 3MIHA 4HG6B 4ZY9A 2Z79A 5LWBA 2QDRA 2UYBA 5A3TA 3B02A 5FZHA 5C4WB 5FPXA 3ZSLA 1AYM3 2BEOA 5BXXA 1EY2A 2ZTNA 4YM3A 5IVFA 4BM8A 4E27A 1WCUA 4XJWA 2PYTA 2VMEA 3ST7A 3NO8A 2TNFA 3D3AA 4FPJA 1UU4A 2OVUA 1OOPC 1EAH3 4AG4A 3AP9A 1YIFA 4PF5A 2HWE2 3GM8A 4UFLA 4XCBA 5C9AA 2B8MA 2Y64A 1QU0A 2VY0A 4PIZA 4G3YC 1DDLA 4CUCA 2VMIA 5C9AB 5FY4A 3DPRC 3ZXJA 4BQWA 4CEWB 2D6MA 3DXTA 5IHRA 5BNPC 3A22A 1ZRFA 3W21A 1XB9A 1QH7A 4OHYA 3K46A
chains in the Genus database with same CATH topology
1LU2A 5BV6A 3FWEA 1Z7S3 4LHNA 5IK7A 1QOTA 2EXJA 1XU2A 4QD2A 3WNXA 2WL1A 1QOOA 1H8TC 2PLV1 2ZZQA 1ENQA 1U5XA 1RUF2 1TNFA 2WNUA 2SLIA 1AR71 3VBRC 2IXCA 2BYVE 1GQHA 3DV8A 3BCWA 4HFSA 3IDBB 4COVA 1OFSA 4CP0A 1DHKB 3ATGA 2WNVC 4Z92B 4AVVA 3Q9OA 1GNZA 5J98B 4Q4W2 2DU1A 1HX6A 1H1AA 2WZR1 4DXZA 5E16A 2EF6A 1PIV2 3JBG2 4HK9A 5AC93 4IEVA 2KM2A 4HZFA 3WHUA 2EXKA 2VUJA 3N4MA 1R1A1 2JG8C 5DG1A 5H9RA 1N1YA 1V6MA 1AX1A 2H6BA 1VBB1 2I2SA 1QY4A 2XLAA 3ALQA 1BVVA 4N7UA 4YVSC 1VBD1 3V0AA 2GNMA 1CJPA 2QDNA 4P9JA 1W6QB 3V0AB 4QPGA 2GC2A 1VB2A 4XFCA 3D82A 4QQOA 2XGXA 4QPGB 4E2QA 5KXDA 5JVVA 5L36A 4H7MA 3M2MA 4RR3C 4HMZA 3GHNA 1VP6A 5FO8B 4Z07A 1JTZX 2ZGOA 1X33A 4N90A 4BA6A 4XFFA 3AYAA 5SV5A 3AX4A 3VLBB 3I59A 4TZDA 2Y26A 2A6YA 1YCIA 2ZGQA 4LO5B 2BFUL 5I91A 3I59B 1QJY2 2JE7A 1ZRCA 1UIKA 4N7IA 2ZGKA 3SH4A 3VZKA 5E88A 2R16A 4AYUA 4Z1VA 2TUNA 3KM5A 3ES1A 3MLLA 1JYCA 2PHFA 1ULGA 4COZA 2QZ3A 3RG0A 2JENA 1NCQC 4E4DX 1VBE2 4AK3A 1LOBA 1WMEA 4MH0E 1SLTA 3VN4A 4FP2A 3WDYA 4XEZA 1AYN1 1PM7A 4M3CB 3E6BA 1DG6A 2HWD1 2ILMA 3SCGA 3RI9A 1OQDA 4KH9A 4LT5A 4UBHA 4AEJA 4J1XA 4I0BA 4P9XA 1MACA 4IQPA 3AMPA 1BMV1 2ZGMA 2RJLA 2X53S 4CP1A 1VAMA 2UWCA 5GZEA 3VBHC 1XYOA 3RQ0A 2VW1A 1LEMA 4UW5A 4HKLA 4B29A 2JD4A 1S0GA 4B8EA 1FOD1 1QDOA 4FPYA 3TN93 4W6YA 1GZWA 4K20A 4LO7A 3AMMA 4Q8LA 4WM7B 5F5QA 4ATFA 1UIJA 1GZWB 4HL0A 4ZKTB 2OA2A 2NMOA 3MW2A 4Z82A 2KXLA 3UKNA 4CDUA 3O0WA 3I4IA 2WINB 1Y9QA 3SITA 3O5SA 4RQPA 2XKPA 2ZHKA 4XQ4A 4RQPB 2EAKA 4AWDA 4LUKA 1O3RA 2R061 4OHZA 1MS9A 4W6WA 1IPJA 2RM23 3ZFFA 1YYNA 3CU7A 5EV7A 2XUMA 3NL1A 3ZFFB 3M3EA 1POV1 1LOCA 1VB4A 4NR1A 1K5MB 5T55A 2ZKLA 1GV9A 3JQXA 4QGLA 2PAMA 1PZ7A 1WCSA 2RR11 3FZ3A 2WFF2 4EWDA 2N7GA 4ASMB 1UZZA 3OD4A 1HRV2 1ZX5A 4YSFA 1IS6A 2ZHMA 2QUOA 1NXMA 2ET1A 1N1SA 4LLFA 4Q4Y3 4DY5A 5FQ0A 2X8KA 3LB9A 3PJYA 3WW1A 5L7OA 1C8M2 4XTMA 3CNAA 1OMIA 5BNPA 1VBC2 3DPRB 4KGGA 5BNPB 3RZZA 1LOEA 1ZNPA 1VR3A 5C8WA 1SACA 3AZYA 4XQWA 3ZN6A 2ARXA 5CAZA 1DQ6A 3VBSC 4GXLA 1AVBA 4LHLA 1RUG1 1JW6A 1FI2A 1WBLA 1QQP2 3M8LA 3ZXDA 1EV11 4DY3A 1H8TB 3B94A 5CFDC 1AJOA 2JKBA 5BUVA 2MPFA 1C1FA 2R042 3SISA 4DRVA 5FRAA 2MEV1 2RHPA 5LEKA 2Q8OA 3VBRB 1HV0A 2E9QA 4HANA 2LUWA 1MQTA 3SH3A 2LTNA 3M3CA 4OFGA 1AR82 1Q8VA 3B7MA 3NV1A 2WNVB 1WLWA 5K0UC 3ZO0B 4JDOA 1MEC1 1AX2A 1WW7A 3FUQA 1ULFA 4E2GA 4FAHA 4IL7A 1IZ3A 1RJ7A 1FPN1 4Q4W3 3EBRA 3RJ2X 2PA7A 5CA6A 3AXEA 2HWC1 1NZCA 4CDWA 5JZGC 2JG8B 2B9UA 3FLTA 5T54A 2JEMA 2VVFA 1DZQA 4Q1PA 4CDQA 4CDWB 4YLZA 3RYKA 1LB2A 1SBFA 3FFZA 1NOVA 2R073 1G9AA 2VH9A 4YVSB 2NQYA 2WQ4A 4J6GA 5JIUA 2Y38A 4D7YA 1ND2C 1DGWA 1OLQA 1VRH1 1Y7BA 1J1LA 1H2MA 1UU6A 2DVBA 3WXPA 4TSVA 5EFUA 2WLPA 1F2NA 2NLRA 3RPQA 2XJQA 2AGSA 4YW3A 1YRZA 4K40A 4YYOA 4R9BA 3LAGA 1WLCA 1ND3C 1PO11 1XNBA 4XMAA 5JDBA 3MFAA 1U0AA 3AP4A 1J59A 1QXJA 4CTEA 4UBGA 5J96B 4HN0A 3RWNA 1SEFA 3UKTA 2D98A 2P3IA 3JZVA 4YARA 2CY6A 1I9RA 4EN7B 1QDCA 3JB8A 2ZX1A 3H9AA 3VBOC 5BNNC 1F31A 4DQAA 2WS91 1CR7A 1D2QA 2ZGNA 5T5JA 1NCQB 4MSVA 1LHOA 1TE1B 3QBQA 1CAUA 1CGPA 4HKOA 1UD1A 1LR5A 3BOWA 1LGNA 1ASJ1 2A5ZA 5FDBA 4YM1A 3G7DA 3KT1A 3WUDA 4BMBA 3B9IA 1J1TA 1ZBA1 1S0JA 1RITA 1R092 4K8FA 3DUIA 3IMNA 4Y1UA 2YXSA 2PHLA 3AXDA 1LHVA 3H50A 1WW6A 2FMYA 5SV8A 2GC1A 3ZFEA 4LA3A 2XJVA 4TYSA 2D43A 2FZ2A 2R063 1ZZCA 4LBJA 1ZBE1 4IV1C 3ZXKA 4LBNA 4OHWA 4HVRA 4BHPA 4JC1A 2RJKA 1MZ6A 1RUI3 4BYYA 3LSDA 3WQ1A 3L9JT 1REFA 1SLAA 4GMP1 4AHYA 1CX4A 1Q8PA 1WD3A 2VMHA 5KWRA 2YDEA 2SBAA 3WDWA 3M1HA 4A7YA 2QKDA 4F83A 2XL9A 2IXKA 3AP6A 3FMGA 2DUQA 2R1BA 3WP4A 1ZZBA 3MGUA 1WLDA 1NCRC 4MGKE 3KCYA 1XQNA 1RHI1 4H55A 4WZFA 4F8AA 2R1DA 4AGRA 3POWA 4M3CE 3PVNA 3B9CA 4E4SA 1OQ1A 3AMNA 2R0FA 1Z78A 2D6NA 3S30A 2GC0A 1AYM2 3MZHA 3J9SA 3EQEA 1COV1 4HVQA 1OLRA 1NQDA 2XLFA 1HRI2 4OUMA 4XQDA 1BKZA 3RSJA 3TBDA 2FHRA 1EAH2 3D5OA 4MYEA 1AR91 1YFXA 3LCPA 2RS51 2GDFA 1Q43A 4L92A 5C9AC 1A8MA 1G8WA 5J48A 2WFF3 1REEA 2E7QA 2NN8A 4HBNA 1V9U2 1W0PA 4L8QA 1G7YA 1Z7S2 2DVGA 2A6ZA 1RVF1 1FMD1 1PVC3 2E7TA 3AP5A 4M01A 4AGVA 1QKQA 2ZX2A 3WCSA 1C8M3 1ZZ6A 5FREA 4Q0VA 4AHXA 5F1RA 1FPN3 1R082 4Q27A 1TMF1 1YLLA 4Q8KA 3VDDA 3GZUC 3VBSB 1UN1A 2WNUC 4GH4A 1PZ8A 4OI2A 3KCCA 5CFDB 2JICA 5AFEA 4I0WB 1Q5OA 4PLOA 3O0VA 4B7EA 4B4QA 2DVDA 1UX6A 2D5FA 4IEYA 3FE5A 5F9TA 1BZWA 1L3JA 3G6JB 5AC92 1VRH3 1H9PA 5I0TA 4W65A 3IBMA 2G9GA 1W6NB 4BIOA 4L11A 5C6CA 5K0UB 1ENSA 1HQLA 2NPIA 1AZDA 3BODA 1H2NA 3OPZA 4IETA 1DZRA 1VAVA 3WDTA 2XB6C 2VNOA 3AFGA 4META 4P9LA 4Q0PA 1VIWB 2ERFA 1PK6A 4AI1A 3LOIA 3QOPA 4XFHA 3WY6A 4AGGA 3OYWB 1PK6B 5JZGB 1S0IA 1OSGA 5A33A 4YGDA 1WGPA 2W39A 1O4TA 4FCAA 2ARBA 4I30A 4LNVA 4QPGC 1IS3A 4E2SA 1ND2B 4K9SA 2PHWA 4AFBA 3ILFA 4XF3A 5JPNB 4HSJA 1E57A 5AFBA 5JCTA 2R0HA 5LRSA 3W9AA 1CAXB 1W6MB 4WM8C 5BPXA 3O0XA 1UU5A 1ND3B 4FOWA 1RINA 1RUE1 4HPKA 5DDJ3 4HLTA 4COUA 3PVEA 2E6VA 4Z2WA 4HPKB 4ZU7A 3PTYA 4MLOA 2UY8A 3PHMA 5JOWA 2FQPA 3N3HA 1ZBA3 5GZFA 1VBA3 2OPKA 5HCAA 4QPIA 3IT8A 1HLCA 3MIDA 3MDPA 5EJ3A 2DCJA 3MEPA 2BPA2 4Q4X1 1RMU1 1W6OB 1AX0A 2BWCA 1RIRA 3SLIA 3VBOB 4I3PA 2QFEA 3VBFC 4AEDA 5BNNB 1AR62 4RHV3 3MICA 1REDA 4IEXA 3AP7A 3E97A 1C28A 3THPA 2H0VA 3OF1A 2ZX0A 2YZ4A 1DQ5A 1S1AA 3RYRA 4LEJA 3J8F1 4CP2A 1FV2A 1PGW2 1EPWA 4FPLA 1PGL2 2GNTA 4WVVA 1N1TA 4K3UA 4AEMA 4XW3A 1QHDA 3LA7A 3I54A 1RUD3 4PIXA 3ZYGA 1RHI3 4UW3A 2DUOA 1WW4A 4AVBA 3HWJA 5GLTA 1YWKA 3MLKA 3S0MA 3OD0A 3TN92 4FPHA 4F3JA 1LGCA 1GYKA 4GIQA 4IV1A 3ZIXA 1DU3D 3LOBA 5DUXA 5GLVA 4IV1B 4M0NA 2XKOA 5T5PA 4H14A 1OQEA 1IPKA 1GZ9A 1XRUA 1LESA 4CDUC 2CWSA 1MR5A 5JOXA 2XJPA 4LO8A 2ET7A 4RGAA 1KS5A 1FT9A 4RQPC 1Q56A 5FLIA 4P9YA 3IIAA 2DCYA 1MS5A 2Z5WA 5IK5A 2R6QA 3D0SA 3NJZA 5C8CA 4XFIA 1GLHA 2E7AA 5CFCA 3D4KA 1NA1C 2O8QA 2GC3A 1BEV3 4YFWA 5CFCB 3RDIA 2YYOA 3VHOA 5CG8A 3NWKA 4FAGA 1V6KA 3E5XA 2V5YA 1KFUL 3VBUA 1EYBA 2A6XA 4AFMA 1HRI3 3JCIA 3VBUB 4Q4Y2 2E51A 1LEDA 5I8TA 1UKRA 4FSJA 4DOUA 4CEYC 4P14A 3WVJA 4OHVA 3M3OA 2BFUS 5JAXA 3WDUA 1PGSA 5CADA 5L7OC 1GANA 2ENRA 5BY5A 1PO21 1V70A 2A3WA 1C5IA 1KXGA 2AYHA 1BJQA 2OUJA 4PLNA 3TNPB 3W59A 4R9CA 1V9U3 1M06G 2ES3A 4KU8A 5T52A 1DQ2A 1IOAA 3PNAA 4RS5A 2HWB1 1VBB2 3URFA 2Q1ZB 5DXDA 1SLLA 1VBD2 3MFCA 2XL7A 2P17A 5CG9A 1R083 1AF9A 3SNMA 3VZLA 2Q5TA 3U11A 1CAVA 3V0BA 2WNUB 4AHZA 2AZ5A 4XHXA 4GMP0 1MQTC 2D6PA 2HKXA 3ZN5A 4F7ZA 1AL21 2RS33 2O8OA 3MW3A 5I8SA 2JDZA 2W52A 1U12A 4EN6B 5JIAA 4EROA 1ZZ7A 1O5LA 4IV3A 4LBMA 4U2AA 4RA0A 1FXZA 1W0OA 1HDKA 2CYFA 1LHWA 3MF6A 3LWCA 4NHKA 5FLHA 1RUC3 2R072 3B3QE 2VNRA 4CDWC 3I2DA 1GZCA 4CDQC 1S0DA 5GZCA 2HWE1 5DUUA 4XMIA 1SLBA 4QGMA 5FMOS 4MVTA 3VKFC 2IC1A 1X36A 5CBLA 5JLVA 2EAAA 5JWPA 3WX5A 2OW4A 2B45X 2ATFA 1H1MA 1V6OA 4XFGA 4ZU5A 3CJIC 3ZXGA 1RMU3 4BLJA 1DLLA 4L97A 4XE9A 4GB33 3MYXA 2IXHA 1LU1A 4O9EA 4WM8A 3TNQA 3V56A 5JSPA 4JGZA 1RUF1 3AFKA 1XU1A 4DFSA 1HKDA 4WM8B 2KA3A 4C0BA 4FVVA 4JGZB 1BMV2 3FJSA 4COWA 2WSUA 2ZMNA 4LBQA 3FBMA 4Q0SA 2D6KA 2RS13 1D4M3 4AF9A 1KRIA 4A2UA 1G9CA 4LBQB 3NSTA 1YXWA 4QXKA 4WV8A 1IQAA 1PIV1 1CN1A 4LLOA 1WA4A 4J1WA 4O9GA 1ZYBA 4QT6A 4GQ7A 1BQPA 4MUVA 3VBFA 4IEWA 3NV4A 2PN5A 3VBFB 2VNGA 3LZZA 3E5UA 3UJQA 2Z69A 4XXPA 1AR63 5FOJB 4YW4A 1NG0A 3VL9A 3NVCA 4BPZA 1O5UA 2YUEA 4FOYA 2VXRA 2ZGSA 1HXS3 4AVTA 4LTAA 2QQPA 4FT8A 2R062 4Q2FA 2VVDA 2DTYA 1PZ9A 2UURA 3ZFEC 1IGOA 4YGCA 1QNYA 2XJUA 1JXNA 1RUI2 2WA4A 5FLJA 4XTPA 1IKPA 2XWJB 2MHFA 3VHRA 4B7KA 1TME3 3VV1A 2D6OX 5FAXA 5I93A 3RMXA 3ES4A 3ZYRA 4PBOA 3AB0A 4INDA 5FMOL 5FO9B 2D93A 1QJY1 1S0FA 3EJKA 3LA2A 1VLNA 4K7JA 2BVVA 4PDWA 5T5LA 1CIWA 1UCXA 3T2TA 4YZ2A 4FTEA 4NHMA 3M70A 1SQ4A 3JD71 4CDUB 2HJIA 3VGIA 4D69A 5ACA1 2DCTA 1TNRA 1OKQA 1VBE1 5A32A 4QX5A 3N35A 4OI0A 4XBNA 4FBFA 1X7NA 1NA1A 2LALA 4Q4V1 3AKQA 1ENXA 1OD5A 2DU0A 1NA1B 2XG3A 3AMHA 1D2SA 1DGRN 4PJYA 2IXIA 1RUOA 4AFDA 1GNHA 2DWRA 1GFF2 2PLV3 4BMEA 2OZJA 3SHRA 3CF6E 1G9BA 1MZFA 3MF9A 1APNA 3I8TA 1AR73 5GZDA 3UKVA 3OGGA 1O7FA 4CEYA 2F6BA 1PVC2 4PCRA 2R30A 2WNEA 3M4FA 4CEYB 3OCPA 4BCUA 5J3UA 1QJU1 4U36A 5FQ0B 2Z2SB 1FPN2 4GKXA 3WQ7A 5L7OB 1O4ZA 2WZR3 3U10A 1A8DA 3OBRA 3U07A 1NY71 2BQPA 1NE4A 2VG9A 3ZN6B 1FNYA 1R1A3 3FHIB 4UW6A 3WINE 3VDDC 2ZX4A 1JN2P 3GALA 2RMU1 4JRLA 2PHTA 2IWGB 1W2UA 4GH4C 3P3NA 3H1MA 1VBB3 1XE8A 4PIYA 4MV2A 2D7FA 3WW3A 2F4PA 2JX9A 4B3NA 4DPNA 1OHFA 1VBD3 3ZYPA 1VRH2 5BNOA 3POSA 4EV0A 3B00A 2P34A 2K2SA 3WD5A 4QQHA 3MIFA 3WG2A 3ILRA 5H9PA 1XNDA 1MQTB 1SLIA 2QNKA 1J3QA 3AJYA 3ZFGA 3S7EA 5LRRA 4I01A 4MZUA 1PO12 1LECA 3TRSB 3RYPA 2R49A 4AEKA 1OA2A 2DFBA 2PTMA 4YNIA 1BCXA 1PK6C 1FX5A 5GLZA 3SCHA 5EYXA 1WMDA 1CD3G 1HRV1 4CDQB 2Y0OA 1H2LA 4AQ6A 3THTA 3WG1A 3SXWA 4LUMA 4NWWA 4QM9A 2R32A 3USUA 3ZYIB 5IK8A 4OUSA 2D3SA 3USUB 1VBC1 2WS92 5FPZA 4JRAA 4HVOA 1WUVA 3ZXLA 4YGBA 2ZKNA 2DYCA 1XNKA 5FBZA 3CJIA 3WOGA 4JTOA 2GAUA 2EIGA 1LODA 3BB6A 4XBQA 4HKWA 3CJIB 5DDJ2 3OJBA 4WBBA 4EWAA 3WP5A 2C5DA 1AYN3 1ULDA 2Q4SA 3FFQA 2HWF1 2R041 1ZBA2 4GA9A 1VBA2 2HWD3 3RS6A 1X50A 1O3QA 4QHBA 1LHUA 1WCDJ 5JOZA 1F9KA 1KD7A 1AR81 3VHPA 4QPIC 1QH6A 4MGZE 1OPMA 3WG4A 4RHV2 5K7PA 5KHIA 3W58A 2RE9A 4LHKA 1KJLA 1MS8A 5JSOA 2UWAA 3AM2A 4AEDC 2A71A 3QCWA 3ILNA 2HEVF 3VKMA 1GICA 2GALA 3H1WA 3H8UA 3B93A 1FOD3 3JQWA 3RMYA 2BVBA 2WA3A 4I3GA 1SCSA 3VKOA 1RUJ1 5CNAA 3AZZA 1CAUB 4XJ8A 1SFNA 3AYEA 4FPKA 2D44A 1RUD2 2QJVA 3HT2A 4YG6A 3IN9A 1RHI2 4AW7A 5J36A 1UAIA 4Y26A 5ACA3 2IZWA 3TWIA 3CL1A 1UZYA 4CYDA 4I0AA 1KDKA 3ZSJA 3MLJA 1IKQA 2PQQA 1QJX1 3ZFEB 1AUYA 5EZWA 4KU7A 3RRDA 3N7KA 5FO7B 3AKSA 1RUH1 4Q4V3 2BNOA 1POV3 3KD4A 1F5JA 1AR92 1LGBA 3KT4A 4IEPA 4JVAA 2RS52 4A3XA 2RR13 5L19A 5DUWA 3H0OA 3JU9A 5IUQA 1DYKA 1I3HA 1RVF2 1FMD2 3QH7A 1BEV2 2DCKA 3S6PA 5C8CC 2IFWA 4YW2A 1B09A 2BBVA 1VJ2A 5CFCC 1QJU3 1NXD1 4PLMA 4JAAA 1M4WA 1TMF2 1WCKA 1CAWA 2VW2A 4BIFA 1CAWB 1FV3A 3VBUC 2E63A 1RUG3 3CJXA 1OFNA 4GULA 1EV13 2QE3A 1R091 4Y22A 1V6JA 2TEPA 1W39A 4BH9A 1BBT1 3GBWA 2MEV3 2ZMKA 1YI9A 1JBCA 2VQAA 4LR4A 3NV3A 4DZGA 1SCRA 3EHKA 4YZ1A 4XF0A 5HCBA 5BNQA 3HN1A 1MEC3 2AREA 2GMEA 3NKTA 1ULCA 4RS5C 4SBVA 1QMJA 2YPJA 3APBA 3O12A 4QM8A 4SLIA 4IESA 4N53A 1Y3TA 1W6PA 5A3MA 2HWC3 4FPEA 4D3WA 4WVMA 4AFAA 3VDDB 2YMZA 4AXOA 2V73A 1S2KA 2OUHA 2RS32 4GH4B 1MS0A 1A78A 2V09A 3WZ1A 2GZWA 1O3SA 3WP3A 5ABJA 1I5ZA 3ECQA 5AVPA 1AYM1 1NLSA 2BGCA 1D0GA 2JXAA 4IV3C 1RUC2 3ZDSA 3O14A 5KHHA 4AVCA 4I02A 1WLTA 3OY8A 1VALA 4JQRA 1EAH1 1DFQA 1YJKA 1DYPA 2P3KA 2PAKA 3ZVXA 2NYYA 4HSLA 1PO13 2NP0A 4AI3A 4FPFA 1F8VA 4XF9A 1ULEA 2HWF3 5CVRA 4YG3A 4UXAA 1X8EA 3GZAA 1GKBA 5A33B 1SBDA 1C8NA 5KXCA 1Z7S1 3E5QA 4BOWA 5T50A 1RMU2 2XHKA 3KMHA 3MPPG 2WC2A 2VPVA 3IWZA 3FBYA 3NAPA 4GB32 1R1ZA 1S2BA 2DVFA 2Q30A 4DRRA 5FOBB 2BW8A 1CPNA 3N7MA 5GKAC 1HV1A 5E1RA 2WS93 1PMIA 2C0ZA 4TWTA 4CDXA 1CVNA 4JGZC 4D7TA 5E8AA 4A7ZA 2WLQA 2P2KA 3VZNA 2RS12 3N7LA 1D4M2 3E6DA 4S2GA 5LK7B 3FLRA 3LSEA 4FO9A 1ASJ3 4AE2A 4WVZA 2YGLA 1URXA 4KG8A 5LK5A 3BALA 3H3ZA 5AC91 5KC5A 4N43C 1PHMA 2H6CA 1UF2C 1UL9A 1H2KA 2Z42A 3U0ZA 4QPIB 1U5ZA 3GYDA 4NO4A 1AXZA 3HD8B 1AXYA 2D5HA 2G4IA 4FQ4A 4AEDB 1ZBE3 1WW5A 4C1WA 1C3HA 2XBO1 4ISQA 5KHKA 1FAYA 1RUH3 4GMP3 4DMIA 1HXS2 2B39A 3ENRA 4NVPA 2I45A 2YROA 5CB7A 2CAUA 5L73A 4FTSA 5HI0A 4A7KA 4LBLA 4EN8B 2HYKA 1TME2 3M3QA 1N47A 1YFWA 3VUOA 2ZAHA 4YG0A 4OULA 2IFRA 5K9YA 1FNZA 1GR3A 1COV3 4V1PA 4JGYA 3KCXA 4PDWC 2BUKA 3QACA 2VW0A 5GALA 5A3LA 3IKWA 3L2YA 1G86A 2ZX3A 1AR93 1KFXL 4LULA 4P5HA 2RS53 1DBNA 1RTVA 2DTWA 3RNSA 2Y0IA 4ZU4A 1NQJA 3EXUA 3KB5A 3VZJA 3FX3A 5C8CB 2HWB2 1RVF3 4LE4A 1FMD3 1HQNA 5I0RA 2VECA 4ORFA 2DUPA 2PLV2 1YNAA 1SFYA 2YGMA 4QU2A 4UW4A 5KXEA 1XYNA 2ZGUA 3RI8A 1AR72 1H0BA 1TMF3 4Q1RA 4DB5A 4EJRA 4KWLA 1N3QA 1HQWA 3HQXA 1PGL1 1AJKA 2XJRA 1ZZ8A 2ZGRA 1YUDA 2DV9A 4XOGA 1O3TA 5AVAA 3TN91 1ZZ9A 2WZR2 1NLRA 2X5IC 5KHGA 3WCRA 5C4WA 4GWMA 4H7LA 1X82A 1S0BA 2BWAA 2GMMA 1TQ5A 1R1A2 3JB4C 1DGRA 2D3RA 1MZ5A 4YW1A 2GN7A 4IXLA 5D8AC 1YHFA 2PELA 4RS5B 4QQLA 3MIGA 2VOXA 4CEWA 1JH5A 3AZVA 2HEYF 2TBVA 2RM21 1XE7A 4XETA 2ZHNA 5BNOC 3QD6A 1QJZA 2GH2A 4N9IA 4OI1A 3RJRA 4ITCA 5D1IA 1HIXA 1JHNA 1CAVB 3ZSKA 3V0BB 1LENA 2UWBA 4NPRA 3WUCA 5GLUA 3ZFGC 3DGTA 3K51A 3UK9A 3ZXFA 5JMCA 4ISRA 5IT6A 4GWNA 4R4XA 4FXGB 4IV3B 3A0KA 2WWSA 3D6EA 3EO6A 3B5LB 3R4UA 1MZEA 4OLLA 4KNCA 4Q4Y1 4YFZA 5B2GB 1AXKA 2XH6A 1RUE3 4GKYA 2AH2A 2UY9A 3ASIA 5JI9A 3LGRA 3N7JA 1RC6A 3ZN4A 4LBKA 4QQ2A 3ZMOA 1V6NA 1S55A 4Q4X3 3LKJA 5GM0A 1AYN2 2ZOEB 4OZXA 4ASLA 4P9IA 1A3KA 5DZGA 5JI7A 4X8PA 2HWD2 4QMAA 3VKNA 4AQTA 3MPBA 3WP6A 1W6QA 4CRQA 2H0BA 4Y5Z0 2JG9C 2XBO3 4XJAA 1UPSA 2O0OA 2I74A 3WHTA 4LE3A 3J8F3 2A6VA 3BIWE 4PQ9A 5GZGA 2AENA 4CZSA 3DF0A 4Q4W1 4N43A 1PVXA 2WQZC 2G9FA 3OBTA 2JE9A 3GHMA 5KXBA 4N43B 3JBG1 3FC0A 1FOD2 5I0UA 5H9QA 4Y1XA 4BLIA 1DZTA 1C1LA 2R071 3ACLA 3ZMNA 1IS5A 2EVXA 1RB8G 2ZABA 1MVQA 2DURA 3JD72 3BTAA 3M3IA 1U5IA 1O91A 2WT2A 2FMDA 4E9KA 5ACA2 1DF0A 4MX3A 4K1ZA 3R05A 1KDMA 1RUNA 3SH5A 3MW4A 4M3CA 3KZ4C 3IDEA 4M00A 4JV4A 4LO6B 3PMSA 4Q4V2 1BYHA 4ATEA 1VAKA 2ZS6B 4XILA 1OPOA 2K9ZA 2FBEA 3ROUA 5J7MA 3GBGA 1CJDA 2RR12 2WT0A 4RFT0 4MXVA 1V00A 4PDWB 3TAYA 3WLUA 4ES8A 2VMGA 3NW4A 3PVOA 1H1IA 4BE3A 3IPVA 1QJU2 4KGQA 3U4XA