2GZWA

Crystal structure of the e.coli crp-camp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
200
structure length
200
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Crystal structure of activated CRP protein from E coli
rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 63
structure length 200
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gzwA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gzwA01
3FXUA 4UXNA 1BM9A 4AQ6A 1HXDA 1UFMA 4ZYDA 2XL9A 1IN7A 1YS7A 3JW4A 1CGPA 3G3ZA 2IA1A 4O6JA 4LG0A 1E2XA 3V7CA 2R7FA 2VN2A 3PLQA 4QWQA 2HGCA 1UCXA 2JT1A 1ZHFA 1RL3A 4ZZDA 2VOPA 1SFNA 1XD7A 1PP7U 3F6VA 3S7EA 4CICA 4MGIE 2MH9A 5FCCA 5D8LB 3KEQA 2XLAA 1YHFA 4ZYGA 5AVPA 2OQGA 2BGCA 2A69F 4Z2YA 1OD5A 3KZYA 4IRHA 4E70A 4AVPA 3DQVC 3E6MA 3BPXA 3SCHA 4LLLA 2ZFWA 3I59B 1FSEA 3J80K 2A5YB 3H50A 5JSPA 1IZ1A 2CWEA 3VEPA 1UW8A 4OMYA 2CG4A 1UB9A 2QENA 2QVSB 3FXRA 4KICA 5ICEA 3HTSB 1OPCA 3RIRA 1EH8A 1CF7A 2V09A 2F5FA 1XSXA 4R79A 4OOIA 2W85A 1TQ5A 2CYYA 2VT2A 2X4HA 2ADUA 5ILSA 2CGPA 2V1UA 4ASNA 3H9AA 3GO5A 3S0MA 4HW0A 2O3FA 4LUKA 2J5OA 2FBKA 3MEXA 4BHPA 1FP2A 2EFOA 2UYAA 1LDDA 3HQXA 4LJZF 2QLZA 2PFWA 4HQMA 1CAVB 2K7LA 3JAMK 3I4PA 1U5TB 1TQMA 2IP2A 3VFZA 1MGTA 2EK5A 3F8FA 1J0RA 4UVAA 1XSVA 1EYBA 1O7FA 3KLOA 3FZVA 4META 3JAMZ 4XFIA 4MTEA 2EA2A 1K6OA 2RNJA 2UY8A 4IEXA 4M71A 2HWVA 3H7JA 1W4MA 2QZ8A 1Z91A 3QAHA 3ZMVA 4EWDA 1ZZCA 4MQVA 4EROA 1XGMA 4PCQA 1J1LA 4JQFA 3KLNA 2R7DA 1JHHA 4S04A 4IEWA 3BPVA 1ZX5A 1S7OA 2VBZA 3DF8A 3BOQA 2CFXA 2P4WA 5H20A 1DZRA 3M3IA 2YU3A 1XDUA 2ACJA 3KP6A 4HF2A 4MNUA 5L3GA 1BI1A 3ZDSA 3D5LA 4R1HA 5FDBA 5L3BA 2F4PA 4WX9A 3USSA 3F8MA 2DPUA 2D1VA 2RDPA 4KWJA 1MD0A 2ISYA 1YFHA 4HAMA 1CX4A 2FBHA 4AVCA 1KU2A 2ZXJA 1YW7A 1W5TA 2G7HA 4EGZA 3LQRA 4CO8A 4B8XA 4HQEA 4B29A 4L5IA 1EPZA 4EV0A 2FMLA 3WE2A 4LB6B 2QVOA 4UXAA 4RD7A 4WXDA 5HVQC 3MFKA 5I0RA 1X82A 3PQKA 4FAGA 3TDUC 4XF4A 1R7JA 5JCTA 1O3SA 1W7PA 3HHHA 2P7CB 3QU6A 2FBIA 1R22A 3MWMA 4ENMA 2BE5F 4HBNA 3RKWA 2B5HA 2EAAA 3DN7A 2XASA 4AQ2A 1PMIA 1MJBA 2WC2A 3LA7A 1R23A 4KU8A 4L9TA 4HVOA 3I5UA 3GFMA 2L4MA 1U12A 4GXOA 3O6BB 3WTXC 4XFBA 3OD0A 1XGNA 5E1ZB 2IXCA 3V7RA 3QACA 2PFBA 4IJAA 4G9YA 4ONUA 1BIBA 4RGRA 3RYRA 1D8JA 4EJVA 3LFKA 2HOEA 2PG4A 4JK1X 3C3WA 1P4AA 1LQ1A 3LSTA 4M9ZA 4PGHA 4NVPA 3TO9A 1LKNA 1ZZ6A 5E18F 4YSFA 4YYOA 4A2UA 2YR2A 3E6BA 4KU7A 1SFEA 3M7GA 2DK5A 3HOSA 1NE6A 1DZTA 4QM8A 5J8CA 3CF6E 2XUBA 1FZPB 5E20A 3GF2A 3L7WA 4ESFA 3SHFA 1LB2A 4MHGA 1X8EA 3K0LA 4PIZA 2QBYA 2O1QA 1ZZ7A 2PQ8A 5BUVA 3HHGA 2FOKA 5EEHA 2GIVA 3CO6C 1O7LA 4M6XA 1YFWA 2STTA 4U88A 3WU1B 1RGSA 4L18B 1ZG3A 2LF7A 3SMHA 5DCFA 1UPIA 4X6RB 2P7VB 5CADA 3WG9A 2KJBA 3FZ3A 5DUIA 2HS5A 1JXSA 5FLXK 2NNYA 5EZWA 3T5XA 2DAOA 4OIQF 1FT9A 3ZN0A 5LEKA 4AIKA 4IRGA 2FSWA 1ODDA 5CU1A 3BDDA 4ENKA 1EY2A 3WGIA 3EBRA 3RPUA 5FLXZ 3FM3A 1SD5A 3B73A 3JSPA 4RB1A 4L0ZB 3H7YA 5IT3A 3ML6A 1JUHA 3F23A 2Y75A 2MLKA 2RQPA 4U0YA 2GXBA 2D2WA 3PFIA 4CDGA 1G3YA 3WW1A 2A61A 3V7SA 4XFFA 2FXAA 3WW3A 4HYEA 2QNKA 1Z1DA 5FQ0A 3C1DA 4AD9A 1YQAA 2IXKA 2RC4A 1IPKA 3COAC 3FJSA 2D93A 1B9MA 1I1GA 3KSCA 5JFRA 2PJPA 4DINB 2FNAA 2CV6A 1YO5C 4P96A 1P4WA 4L9NA 4JVAA 1ZZBA 3HYIA 2XIGA 2Z2SB 3ELNA 1R1UA 2RVCA 5E17F 1J3RA 5BV6A 3HOTA 1FLIA 1R1VA 3J7AO 3K1NA 4EJWA 4MGKE 3BPZA 4NQWA 5FPZA 2UXNA 1ON2A 4AIJA 1QPMA 4IEZA 3GBFA 2JSCA 1BN5A 3I59A 3HIFA 2NNNA 2O8QA 2A07F 2HQNA 1UIKA 4MGYE 2B9UA 5K5QA 1BI0A 5JVTA 1WI9A 2R3SA 4WCGA 2GC3A 2NRAC 2ET7A 4IVNA 3TNQA 4MX3A 4GGGA 3H1WA 1MJAA 3P9IA 5F64A 4XLPF 1J58A 2GA2A 2HEOA 5DYMA 3BY6A 5JI6A 5D6EA 2WWYA 3EYIA 1S7AA 3V4GA 3K1MA 4HZFA 1DP7P 2XAQA 1ZZ8A 5HDNA 4HVRA 1WA4A 1XSDA 1IAWA 2OAZA 3FFQA 2J5PA 2CO5A 1G3SA 1BI2A 5I8SA 2BEOA 1DUXC 3R0JA 3GYDA 3UKVA 2STWA 1CAVA 1SFXA 2K86A 5D4RA 1U5TA 1XCBA 4EJOA 2XRNA 1HW1A 4A12A 4I0BA 3WTZA 2E7XA 3Q9SA 5D1IA 2ZKLA 3OTFA 1P2FA 2HQRA 4FT8A 3CO7C 3NKTA 3E97A 3GZ5A 4U0VA 5LHGA 3LAJA 5BXXA 4ZU7A 3R60A 2EFWA 1HW5A 2LNBA 3WW2A 3IKTA 3OCPA 1NHAA 2XKOA 2QDRA 3KP5A 1HKQA 4EMSA 4M74A 3NRVA 1U5TC 4ENJA 2L01A 3MZHA 4A0ZA 2OZUA 4J1WA 3VODA 4MV2A 3D0SA 4KA4A 1D5VA 3MQ0A 2Z33A 2EA4A 4P9UA 1AOYA 3BU7A 2F5EA 1YG2A 2O8XA 3ZPLA 2ZNZA 4I09A 1G3WA 1KQ8A 1OFNA 1TW2A 4S05A 5BS6A 5D5WB 1JE8A 5I91A 4LUMA 5J8FA 3F6OA 1LDJA 4HDVA 2BYVE 3HSEA 1IN5A 1W7PD 4Q5SF 5FLIA 3L00A 1Z9CA 2CAUA 4HLTA 1BI3A 2FEZA 2OZJA 4MUVA 1WGPA 4MH0E 3F3XA 4ORFA 3I71A 1FBQA 1UIJA 3LWFA 4A5NA 1HBXG 2FU4A 1TQPA 3NEUA 4ZU4A 2VC0A 1LJ9A 2IW5A 5FPXA 1TNTA 4KN7X 1E17A 4RAZA 1UHWA 4F7ZA 5E1WA 2QUFA 1MKMA 3LAGA 3SHRA 2BNNA 3AAFA 5I93A 1FBSA 2A6HF 3NJZA 1HKSA 2GC0A 3PVBB 4CYDA 1S6LA 2MC3A 1ZRDA 3SQNA 1XE7A 1B4AA 4B09A 3LA3A 5E8IA 4LLOA 1K78A 4CGZA 4HF1A 4RGXA 1J9IA 3IWZA 1GQGA 2C6YA 2HDCA 4OIRF 1DGRA 1O57A 4ETSA 2ETEA 1TNSA 5FGMA 3REOA 4OIOF 2PHDA 4G6DA 3WTTC 3RI4A 5CVIA 2Q8KA 1T98A 2OZ6A 4FBFA 3NW4A 2LKPA 1IN4A 1IXSB 1K79A 1UD1A 1J7KA 1YYVA 2I45A 3GYHX 4JTOA 5J7MA 5AIQA 2EVXA 2KRFA 1CAXB 1Q3EA 1KGSA 3ST7A 4GYIA 2V1XA 4U7BA 3J80Z 2XGXA 5K5OA 1XGSA 4XBFA 1EH7A 3OF1A 2L54A 2ISZA 5LEJA 5KK1A 3F21A 1T2KA 3E6DA 1ZZ9A 1SAXA 2EV6A 4HN0A 4HV5A 1NZCA 3HT2A 3F8NA 4D0PA 1ULYA 3FWEA 3GEZA 1X3UA 4Q0UA 2F5DA 1I6XA 3RTRA 1ZRCA 4EJUA 3C7JA 1RI7A 4HN1A 1QXRA 1HQCA 3H92A 2KXLA 3F8BA 2Q2EA 4N0BA 5LGNA 2JTVA 3FMRA 4YFNF 2E1CA 3N4MA 5ED4A 5DDGA 4YRDA 3HTUA 4QX5A 4HMZA 2D1HA 2VBXA 5LGTA 2Z69A 4RB2C 5ICCA 1I27A 1KU7A 3S2WA 2M8EA 2H0VA 4Q0SA 2L4AA 1VJ2A 2PN6A 2MHFA 1V3FA 3EQEA 5I0UA 4RGUA 4LGWA 4H0EA 1RIOH 2OYZA 4IPAA 2IA2A 4TV7A 2G9WA 4KYWA 1YLLA 1MDMB 1KYWA 1GVJA 2PMUA 2Q30A 1RNLA 4Q48A 1NE4A 4PZJA 2CAVA 2FQ3A 3MDPA 4HLXA 2WFPA 2G7UA 5DD4A 4WXHA 1QGPA 1R00A 3JSOA 3ABUA 3O2PE 1QO0D 1NXMA 3ABTA 1YLFA 5J48A 2QYOA 2WTEA 4U7DA 3RZZA 1T6SA 2Z3YA 2L3DA 1ZYRF 2MLGA 5TJJA 1FYMA 3TQNA 2M1BA 1JHFA 2K02A 2Y48A 4IRIA 1FP1D 4M9SA 5LLQA 3TDZC 5FD6A 2MH2A 4KMUX 1ZLKA 2Z99A 5BMZA 4LA2A 4XFAA 1L0OC 1YIOA 3HT1A 3F72A 2PYTA 2FNPA 3IHUA 3V8LA 5K5RA 3QP5A 3KE2A 1RUNA 2DT5A 1EV7A 2H94A 4UHTA 4AXOA 5FLHA 1HSTA 4KMFA 5L3FA 5KHIA 1WLTA 5LRSA 2QQBA 4PGGA 2PI0A 5D6FA 4M9XA 2XAJA 1D3YA 4UNOA 1Q5OA 1FSHA 5K8SA 1QQIA 3P9CA 4HLYA 3ZMTA 3SXYA 4HBLA 1RTVA 3LA2A 1FYKA 2VC1A 2VONA 1SMTA 5F1RA 4LG0B 4M73A 5J6XA 4BHCA 3MYXA 2YPRA 4IHSA 1OR7A 1BBYA 2RGVA 3RDIA 3CL1A 4BXUA 1LNWA 3IRRA 2PBIA 2H6BA 3WODF 3CDHA 2XKPA 2KIFA 3BROA 2GA1A 1O3TA 3F22A 2P17A 3HRMA 3ZMZA 3KCCA 2K27A 1ZGAA 4OIPF 2GH2A 3I0TA 2A6EF 2GWRA 2O03A 2VT3A 2V79A 4UV9A 4U0WA 1C0WA 3BALA 2V1DA 3HRTA 1LVAA 4Z82A 2YX7A 1WRJA 2HZTA 4EM1A 3Q9VA 5CVRA 4IEQA 3GWZA 1LDKB 4HA8A 4KIFA 2O6GE 2QCSB 4DQ2A 1PP8F 3BCWA 5E8GA 1TQIA 4WK8F 4X6QB 2IXHA 5K1YA 1CAWA 4Z07A 1MJ9A 1WQ2A 2F2EA 2HYFA 3QRFF 1YUDA 4R8HA 1QY4A 1FXZA 1WKMA 4UUVA 1SD7A 2VBYA 5KVRA 2FRHA 5HS9A 4ENNA 1FWZA 4WF2A 1BOAA 4XF0A 3LZZA 3RYKA 3M70A 4EWAA 4HX7A 1DDNA 2Q4SA 4L0YB 4YG2F 2UWMA 2DPDA 3ELKA 3WTYC 1U78A 3CUQB 4ZZLA 2DK8A 2AXLA 4I01A 4Q47A 4ZYEA 4KNYA 2ZMEA 3DP7A 5DCMB 4A5MA 3U2RA 2QWWA 1SEFA 4M6YA 2LDUA 2BV6A 1QZYA 3IKVA 2JZYA 3D0JA 2ZNYA 3L9FA 1I1SA 2CQKA 2AS5F 2K4JA 3L2CA 4ZYHA 4OU0A 2Y0MA 1B9NA 4O9GA 2DCTA 3EJKA 4I7HA 4JTNA 3DKWA 1TW3A 2PEXA 2DO7A 4PJYA 2UXXA 1AWCA 1Y3TA 2HTJA 4EJTA 2E1NA 5D5VB 3GX4X 1I5ZA 5BOXA 2XL7A 2DU9A 1Y0UA 2IA0A 3WE3A 1LRHA 3RPQA 3FX3A 2EFPA 4Y17A 5HLIA 3HUGA 3D82A 2D5HA 1T39A 4BIFA 2VQAA 2Z9OA 1J5YA 2ZJ2A 5HDKA 4XF3A 2PA7A 2H6CA 1Z7UA 4GCVA 2B8MA 4YIIA 1ZVFA 4HVQA 3FMSA 4HDUA 5C8WA 3WTWC 3R61A 3H1YA 4IEUA 2H09A 2TDXA 2NYXA 3KGZA 1CAXA 5CJ9A 1W7PB 2H27A 1J3QA 1RZ4A 1QNTA 4HX4A 4QM9A 1ZREA 1XMAA 4RGSA 1KU9A 1R5GA 2IC1A 3E3VA 2EB7A 3U0ZA 3BZ6A 2MD5A 2OA4A 3SXWA 4G6QA 1FC3A 1WSUA 2GXGA 2D5FA 3FHZA 2V6CA 2YSRA 2GC1A 2EA7A 3DPLC 2O0YA 2IRFG 1HW2A 3K1PA 4LTAA 1IXRC 2EJRA 3EETA 3I7DA 4N9IA 3HSFA 3QPTA 4IF4A 4MEYF 4RB0A 3WTUC 1LR5A 4I3PA 3H1MA 1V70A 2EV0A 2D45A 1B1BA 4EM0B 4HSJA 4A0YA 2A3SA 4ESBA 4XF1A 3NQOA 5JR3A 2XV4S 1REPC 4Q4ZF 5JHUA 3I58A 3DFGA 1Y9QA 2DI3A 5KHKA 3I64A 4MGZE 3T0YA 4YFXF 1K7AA 5HS8A 3KMHA 1U8RA 4HX8A 3KFWX 2XAHA 1GXQA 4YARA 4LK1F 2QBYB 1ON1A 4MZUA 4KUMA 3HRUA 1JGSA 1LEBA 1BC7C 1F1ZA 5KBFA 2QJVA 1F9NA 4I98B 3U9GA 4Y13A 1XDSA 5LBQA 3KETA 1L3JA 2M45A 4XRFA 2GC2A 3G7DA 2IXIA 1QBJA 5AIPA 4M72A 1QXJA 4AWXB 4D7TA 1SD6A 4BH9A 3M8FA 4JV4A 4P5OA 4IEPA 5D4SA 1J59A 4KT5C 1DGWA 3KP4A 3F8CA 2IJLA 2VOOA 3O3KA 2NS0A 2K4BA 5BPIA 1PM7A 1FOKA 4BHBA 2QM3A 1YWKA 3FE5A 1YW8A 4R52A 5L3EA 3WTSC 3IC7A 2Y0OA 3C18A 5JSOA 1RUOA 3TOAA 3M9AA 1BJAA 2ESNA 1FBUA 4L5JA 1TTYA 3DV8A 3FMQA 4IEVA 1B6AA 2P8TA 3BB6A 4I2OA 4E2GA 4MGRA 5D5XB 5I8YA 2XAGA 3GXOA 3N97A 4UVCA 3P9KA 3EQLF 5I0TA 1KYZA 1QWRA 2HFHA 2ESHA 3IRQA 4CZZA 1F4KA 3MZYA 4RAYA 4WBBA 1ONVA 2DW4A 1XCVA 4WVZA 4LLGF 5DV5A 4OINF 3SZTA 3S7IA 4QLCU 1GQHA 2W84A 1S29A 3M1EA 3ETQA 2VPVA 4O5VA 3H3ZA 1NYWA 1FYLA 2P6TA 1O3QA 5DD8A 2FE3A 1G3TA 2HR3A 3R0AA 5T3NA 1Z6RA 4I0AA 2M87A 1DPRA 3SCGA 1FY7A 2GQQA 2DLLA 2Q1ZB 4GYGA 1T0FA 4IEYA 2EV5A 4FAHA 4I02A 4WWCA 3GW2A 3W6JB 1S3JA 2IVMA 2XHKA 4HV6A 3PNAA 5ILVA 3BJOA 1O5LA 4GO1A 2E9QA 2KIMA 5ICFA 1SFUA 3K69A 1SQ4A 2PQQA 1YFYA 1P6RA 2RKHA 5C6CA 2DTRA 4QGNA 3VOEA 4NHJA 1XGOA 2NAZA 1QZZA 2VECA 1H1IA 3WGGA 5HLHA 1ZN2A 4GULA 4FX0A 4KDPA 3EDPA 1IN8A 1GHCA 4BNCA 1IXCA 2VODA 4P9GA 3HRSA 5DEQA 2VE9A 4RS8A 5DUKA 5E1XA 1ZRFA 5J3UA 1DPUA 4OLLA 3CJXA 3R4KA 5BQTA 1KQ0A 3O14A 3EHKA 3MAJA 3I53A 2UY9A 3SCFA 2OBPA 6PAXA 3KP3A 4MEXF 3UKTA 2JPBA 5BPDA 3KP7A 3U1DA 3NVCA 4XSXF 3R6SA 5CVJA 2UYBA 5CLSA 3TNPB 3CUQA 3EYYA 4IESA 3QPHA 1ZLJA 4XFGA 4Q0PA 4LA3A 4HOBA 2OPKA 3L09A 5DCMA 1FNNA 4YIFA 3ZMSA 5KHGA 5KHHA 1EH6A 1OYWA 1Q1HA 4A0XA 1P92A 1CAUB 1O4TA 4H7LA 2P6SA 4EGYA 4ZU5A 3IIAA 3VHRA 3JZVA 4IERA 2FF4A 2M5WA 3ECHA 3WW4A 4F8AA 5FFZA 3CUQC 4FHTA 4LLNA 1YFUA 2MA3A 3OV8A 4QGMA 1G6NA 4L9JA 1X8MA 4BAYA 1FX7A 1ZNPA 3TKYA 2K0GA 1H0MA 1PUEE 2GAUA 1ZG1A 3ES4A 2Z5UA 2P5KA 4CHUA 1H9GA 1Z6TA 1R1TA 4G7ZF 1HSJA 4KN4X 2FMYA 3GFLA 5E16A 2KJCA 5LHHA 5HS7A 1GXPA 1G4DA 3ZMUA 5IT9K 2QQ9A 1SD4A 1R58A 3PQJA 1STZA 3GLXA 5JR7B 5BY5A 5FO5A 3TO6A 1TBXA 5L3DA 3WTVC 3ACLA 2JRTA 4G7OF 5CYVA 5LHIA 5IT9Z 4IHTA 3MPBA 3KP2A 3QP6A 4D7SA 3IL2A 5AONA 5L3CA 5LRRA 3BP8A 2IXLA 1IRGA 4LFUA 4EWEA 1VTNC 1X7NA 3GFIA 1P4XA 2L02A 2PHLA 1YTYA 2P5LC 4G94A 1K78B 4ZH4F 3FXQA 2PMHA 2W25A 1IRFA 1J2XA 3VB2A 5ICGA 1H9TA 4N9HA 5HOOA 3ULQB 4AVAA 1LEAA 1KA8A 3HSRA 3LAPA 4O3MA 1ZRRA 2F5CA 2ZKZA 1IF1A 4MQ9F 4LK0F 1FPQA 3ERED 1FI2A 2O61A 1B59A 1YS6A 3E5UA 3CUOA 3IBMA 4PIXA 4KIGA 5HLGA 1CF7B 1ZH5A 3DPTA 1BIAA 1ZARA 5E1RA 3M8EA 2ELHA 3RJPA 4XFCA 3LWCA 3DEUA 1O3RA 4LB5A 3E5XA 2XLFA 5I0SA 3BJ6A 5LGUA 1YW9A 2C0ZA 1J75A 4IXAA 2E7WA 1VR3A 3V8KA 4FX4A 5KHJA 3ISPA 2Q0AA 1U3EM 3E5QA 3KZZA 4YNIA 4MTDA 1BC8C 2XLGA 5H6RA 4HF0A 4G8XA 4OMZA 4XSZF 4IETA 3GFJA 4JBAA 3IDBB 1SMYF 1XB4A 3TGNA 4OFGA 2MNGA 2OA2A 2BBYA 4NB5A 4UVBA 4WXCA 1KU3A 1OYYA 5BPXA 1D8KA 2D40A 5CVVA 4DNCA 2V9VA 2RN7A 2VE8A 2HJIA 3RKYA 2PAKA 5H6QA 2XVCA 4PDKA 4Q29A 2PLYA 1ZG5A 1F5TA 2DBBA 3ZQ7A 4KWLA 2WV0A 2A68F 5HDGA 1U6GA 4UBHA 1ZGJA 3WGHA 2ET1A 3ROUA 4ON0A 4KFCA 1J3PA 2YX4A 2HKXA 3G73A 2EFNA 4L11A 4YFKF 1USTA 2DQLA 4XFHA 2CW0F 1IW7F 3Q5FA 3QU3A 3RYPA 3KEOA 1U2WA 4CXFA 5D8KB 2P5VA 2QQAA 4E2SA 2B0LA 5JSRA 4QMAA 5ILUA 1OKRA 3I54A 3OGJA 4P55A 1O5UA 3ECOA 4A6EA 3FHIB 3LQQA 5EFUA 2IXJA 5ERIA 1Z05A 2IT0A 3SFZA 2Q0OA 5FD5A 3IWFA 3T1BA 1MZBA 2JPCA 4BYYA 2BNMA 2LF8A 3EO6A 1VP6A 4LULA 5F6FA 4J1XA 2COMA 5D5UB 1A04A 3JTGA 1XN7A 3CJNA 3MCZA 1H1MA 3ZP5A 3CLOA 3KGLA 3L2HA 3UKNA 5I8TA 1XE8A 1WWXA 1IN6A 4XEZA 3FM5A 1IPJA 3GUDA 4HSLA 5HI0A 3EUHA 3CEWA 3J81K 3LOIA 3GZ6A 4Q0VA 2X0LA 3ES1A 3B02A 3RKXA 2DFIA 4G7HF 1W5SA 2CSOA 4EQQA 3U10A 1RC6A 2VXZA 2K9ZA 1OI6A 1UCRA 3WU0A 4K8FA 1Q43A 3TO7A 3ZN1A 2OQRA 3J81Z 1XMKA 1R5HA 2FA5A 4EM2A 5A2QK 1T38A 2VBWA 4AVBA 2HYGD 2EWNA 4AIHA 3BJAA 1EP0A 2MPFA 2N7GA 4XF9A 3JTHA 1UHMA 5A2QZ 2OU2A 4BQAA 2XAFA 4L9VA 4LEJA 3CLPA 4QXKA 3IDCB 3T8TA 3DXJF 2IPQX 3NL1A 1MDMA 1HKTA 3TOBA 2EFQA 2GU9A 3BWGA 1USSA 2W57A 4L2NA 5FFXA 3DL3A 2PAEA 3OOPA 4KWKA 4TLFA 2M30A 4O9EA 3E6CC 4IEOA 2RV8A 2PTMA 5TRDA 1L3LA 4E2QA 2MBFA 1IUYA 3C3VA 5CVUA 2GZWA 5FB2A 2UZKA 2KKOA 3T8RA 4P9FA 4Y15A 2PAMA 3H8UA 4K2EA 1YFXA 1CAWB 2ZCWA 1PDNC 3FF5A 4UV8A 3CO2A 3SZPA 2XROA 2ZO4A 3ZMDA 1ZAOA 3P7NA 3QOPA 3V8JA 2ZBKA 1CAUA 3W6KB 3H3UA 4XETA 3NSTA 4UBGA 4XLNF 4PIYA 4EVIA 4WZCA 3K2ZA 3GVAA 2DQRA 1OYIA 3CTAA 4ESJA 2KIUA 4QGLA 2BNOA 1XRUA 2OD5A 1OMIA 4A6DA 4RB3C 3K9TA 1S8NA 1V4RA 3U11A 4LMYA 3RNSA 2ZMEB 5FLJA 2FQPA 4Q0QA 2W24A 2HKOA 2ETHA 1R36A 5EEGA 5JAXA 4LD5A 2HTSA 2ATFA 4KL1A 1TLHB 5FQ0B 2LSOA 1KQ9A 4KIBA
chains in the Genus database with same CATH superfamily
4AYBN 1BM9A 1YS7A 4BDYA 3DKQA 1AR73 2VOTA 2IA1A 2BXYA 4BBSJ 3V7CA 3JBG2 1IG7A 4Y20A 2VN2A 3WDVA 4QWQA 2HGCA 2JUGA 4W65A 1RL3A 2M34A 4ZZDA 4CDXA 3KT1A 3BIEA 5T54A 3S7EA 4CICA 4MGIE 1IRZA 1ULGA 5D8LB 2HVSA 1LE8A 2BGCA 3T2TA 3HUGB 1STMA 2R7ZJ 4NQWB 3KQRA 1OCZH 2VLAA 3BLYA 2PJRB 1O6UA 4QPWA 4E70A 4Y26A 1YQCA 1GVDA 4LLLA 3SCHA 5H2FC 3J80K 1FSEA 1IZ1A 3VEPA 1APLC 4OMYA 4DNYA 1H2LA 3ZGKA 5ICEA 1Y56A 3RIRA 1EH8A 3OB8A 4R79A 4OOIA 1TQ5A 2CYYA 2VT2A 4P5HA 2AH2A 3ZN5A 3OPZA 1SBDA 1DLCA 4BQ5A 5DM6F 2HWC2 3BR0A 4EN7B 4HW0A 4RA2A 3WHTA 1QDCA 2FBKA 4BHPA 4JKLA 2UYAA 1R71A 3HQXA 2QLZA 5GZCA 1NTCA 3HPHA 3TEZA 4EE2A 3V0AB 4N4OB 1S0DA 1MGTA 5FY1A 2EK5A 3PO2J 1W8NA 2VUJA 3KLOA 4PK4A 3JAMZ 4MTEA 2EA2A 2UY8A 3VDCA 3H7JA 4YW1A 4JX5A 1SEUA 1KGYA 1SLCA 3CLQA 3CDIA 1PZ8A 2R7DA 3DXTA 1JHHA 2H0BA 2Y9ZA 5DQ0A 3FLRA 1ZX5A 4HSTA 4Z92B 3ZXDA 5A7SA 2DDBA 3OYWB 1RUG1 1EJ9A 4IV3C 3BOQA 1OISA 3ZQGA 3ZPYA 1DZRA 3DCFA 3CESA 4NHMA 3KP6A 4MNUA 5L3GA 1JZ8A 2WN2A 2NVYJ 3D5LA 4UF0A 2XG3A 5FDBA 4WX9A 2X8KA 3PIJA 2DPUA 2D1VA 1VQ4I 1CQ9A 4ARYA 4LBLA 2ISYA 5GZDA 2RS32 1JTYA 1KU2A 2ZXJA 4UFIA 1UYPA 1LOFC 4CO8A 1QJY1 4P1WA 2E35A 1PUFA 1TNFA 1QMJA 1LHVA 3O8HA 4NHKA 5ANNA 3O1RA 4EV0A 1L7RA 1B35C 4UXAA 4RD7A 4F55A 2O5RA 1GU3A 1NUKA 3L1PA 3VGIA 4A3ZA 5KXEA 3VSLA 1X82A 3PQKA 1OA2A 4R9CA 4UUSB 2BVMA 1R7JA 1QIQA 2JE7A 1QDOA 5DUUA 5CISA 2P7CB 2FBIA 3MWMA 4HBNA 4H7MA 1VB4A 2QKMB 2OCEA 5FYMA 1PMIA 1MJBA 3AG4H 3K77A 1JOJA 4URAA 5IK8A 4YIRX 3VZKA 4KU8A 4L9TA 4I30A 2L4MA 3T2QA 4GXOA 3O6BB 2GLOA 1XGNA 3V7RA 3RSNA 3S3NA 4LBKA 4RGRA 3RYRA 2ZZJA 2NOGA 2WIIB 2PG4A 4JK1X 3BQZA 2B46X 2FD5A 1X1DA 4WVMB 4AYUA 5CKQA 4NVPA 1R1A3 1ZZ6A 3RSJA 4AHYA 1GOGA 4RR3B 1XPWA 1F5JA 1MH3A 1HDKA 4YYOA 5JZGA 4N43B 4A2UA 4V1PA 2YR2A 1LENA 1NCRA 3AJYA 1NE6A 4XN3A 3TL4X 1RUE2 4QM8A 5E20A 2VM9A 1HB4A 3K3OA 4A42A 5H9SA 1IGNA 5EZGA 3K0LA 1RHI3 2XQRA 3ALQA 1BEV2 3IPVB 2PQ8A 3TBDA 4ITVA 3T2PA 4M6XA 4U88A 3CF2A 5IAVA 4DOUA 1HN0A 2DU1A 1MMAA 2P7VB 2X09A 1VBD2 1FV2A 2HS5A 4J25A 1X50A 4FOQA 1JXSA 1MZ6A 1BW6A 1G9CA 4Q8LA 4IDZA 3OBZA 4IOCF 3T5XA 5H9RA 4F93B 1DU3D 2FSWA 4CUCA 1EY2A 4RHV1 5GLUA 3FXJA 5JOXA 2BY2A 4P9WA 4LBQB 4XKBA 4Y52J 5CFDC 5FKLA 5IT3A 1I1EA 4YW7A 3ML6A 3CNAA 2OUMA 2RQPA 4Y7NJ 2HU9A 2WNVA 1UZVA 3HKZA 4Q4Y2 3DKYA 3V7SA 4HL0A 2FXAA 3P3PA 3ZXKA 2V4AA 2QNKA 1Z1DA 2DVBA 3ZYIB 4AD9A 1EV12 3VUOA 3HM5A 1V6OA 2WZ8A 2IXKA 5T55A 2FDIA 3BTJA 2R7XA 5FZDA 1AL23 3KSCA 3S14J 2XJPA 2QQPA 3K4CA 3PDQA 1ZZBA 2YG0A 3WUDA 1ND2A 2XIGA 3WDWA 3IT8A 4BOWA 1R1UA 3GDBA 3OBTA 3B6CA 3HXLA 4PDWC 3HOTA 5J47A 1R092 4IE4A 3G1OA 3JD72 5DDJ1 4UW4A 2AQEA 2UXNA 1ON2A 4XACA 3ORJA 2LM3A 4XTMA 2ZB9A 3SLIA 2HYJA 2LMDA 4DUVA 3NV1A 3CCYA 3DEMA 4MGYE 2B9UA 5K5QA 1BI0A 4A7ZA 2VW1A 2R3SA 4IVNA 3TNQA 1FYUA 4GGGA 4G12A 1C1FA 1LGBA 4XLPF 1TG7A 3VKMA 2DA2A 2GA2A 3NAUA 5DYMA 3OYMA 1ND3C 5FJKA 2ZAHA 2A3XA 1W9TA 2RQQA 1GNHA 3V4GA 4HZFA 1DP7P 3W3CA 2WS92 4B43A 1BVVA 3U4SA 2XH6A 5HDNA 3OGRA 2LKSA 1IAWA 2OAZA 1G9BA 1PO22 4XDOA 2J5PA 2VIXA 1UY3A 3S3MA 2BEOA 1DUXC 1YEWA 3R0JA 4A3XA 3UKVA 1CAVA 4EJOA 1NA1A 3AL6A 3AC0A 2ZX3A 1UZCA 1X4PA 3WTZA 3PL0A 4FT8A 3CO7C 3NKTA 4GKYA 3JRHA 3ACIA 4F52A 3GZ5A 3MPPG 1D0GA 5FROA 5BXXA 3R60A 2JICA 2EFWA 3AG3H 2LNBA 1HV0A 4Q1PA 4E7JA 3ETPA 1NHAA 2BW3B 5A33B 4LQRA 3HR9A 3GTQJ 3DCQA 3KP5A 3CCLI 1AKHB 2X51A 4ENJA 5C70A 2GH8A 5F8PA 3LSPA 4A0ZA 2VGDA 4MV2A 3KEYA 4N53A 3GCWA 3MQ0A 1ONAA 3Q8EA 3VHOA 2G4IA 2IGMA 4DMIA 1PGW1 3BT9A 1Q8SA 3BU7A 1CESA 2D3SA 1YG2A 1ZA7A 3B9IA 2GIZA 2XXZA 1G3WA 5I91A 1TWGJ 4XORA 3POGA 2R6QA 5J8FA 2BYVE 1FTZA 1OCTC 4DXTA 4IQPA 2A3YA 4Q5SF 5FLIA 5DG1A 1WCMJ 4QPQA 3I2KA 1DQ5A 2FEZA 2OZJA 1WJDA 1CVNA 4H3WA 4K9SA 4H55A 1OOPA 2EF6A 3I71A 3HEIA 1PVC2 3K70D 1TWFJ 1FBQA 1UIJA 1GV2A 3O1SA 4HEA2 1TQPA 2CRGA 2VC0A 4A93J 3HD8B 4XR6A 4CDWC 4U2AA 4LT5A 1TNTA 4C2MJ 4XJWA 5E1WA 4XLEA 2L7FP 3GF6A 3AAFA 4M4RA 2OX0A 1RMU2 1AR91 1FBSA 2CGOA 1Q8VA 1ZYBA 1UZ0A 5L9BA 1Q1VA 1XE7A 3SQNA 1LOBA 3LA3A 2E60A 5CAZA 1K78A 1GDTA 3EUKL 1JOPA 4NO4A 1J9IA 3IWZA 4Q4W2 2C6YA 2AREA 4CZCA 3MUY1 2F48A 1O57A 4ETSA 4CCKA 2WZR1 2JDPA 4G6DA 2W92A 5CFCA 1EAH2 3WTTC 4MO7A 3ZYFA 4AEDC 3VBFB 3GMEA 1U5YA 4DXZA 5JHFA 5AIQA 1HA8A 2R1BA 4ZHNA 3ST7A 3LSJA 5K5OA 1LFBA 2VBBA 4IUGA 5LD2C 2ISZA 2R7WA 4R4ZA 1SAXA 4HN0A 3HT2A 1AA7A 3GM8A 2R072 1W2NA 1PJRA 1JUPA 1VBC3 3C7JA 1HDDC 4AAPA 2NVXJ 3W58A 1HQCA 1OBNA 2TUNA 3WHBA 2KXLA 2Q2EA 4Q27A 4C90A 2E1CA 4H4KC 1LNSA 3LPGA 5APAA 5FYHA 5LGTA 5ICCA 2VNGA 4PF1A 3AB0A 3V65A 3M3YJ 1C8M1 3HEFA 1V55H 5IK7A 2P2KA 3KVAA 2ZMLA 4H0EA 1UMHA 1FPN2 4TV7A 1W36C 1QOOA 1MDMB 1GVJA 5GPAA 4QD2A 2Q30A 1LULA 3OOXA 4A3FJ 1WCUA 3D5OA 3O0VA 4IV1B 4GJZA 2D3RA 1RJ8A 1IV6A 2ENRA 4Q4V3 3ABUA 1NXMA 4LK6A 3IM0A 4XONA 1GWMA 1DGRN 3ABTA 4CRQA 1VBA3 4UFLA 2WTEA 4PLOA 1T6SA 1FYMA 3TQNA 4YM3A 4BQXA 1HRV1 1JHFA 4JZRA 1W6PA 4M9SA 3SDBA 1TEIA 3AMNA 2CNAA 5DAXA 5LLQA 2M8GX 5FD6A 1VBE1 4JDMA 2WDBA 2A5WA 2R93J 1H8TB 2XJQA 2A6WA 1V5GA 3F72A 5BNOA 1NY72 3WQBA 2FNPA 5K5RA 3KE2A 5AC92 1RUNA 2DT5A 4RQPA 4RM3A 5D8AA 4QX1A 1W05A 2DT7B 2ORXA 3TWIA 1A6CA 1G59A 4KMFA 1TVGA 1WLTA 2WQ8A 5LRSA 1CIWA 2QQBA 3K4LA 2PI0A 3K4KA 2VTXJ 5TSWA 2JDAA 4RGKA 1Q5OA 5FZ6A 4DUWA 1S0JA 1JODA 3P9CA 4HLYA 3SXYA 5EGOA 3WHCA 5HXVA 4CCJA 2DA3A 2VONA 1SMTA 5F1RA 4LG0B 1GV5A 4M73A 5C4XJ 5J6XA 1PO11 4CEWC 4BHCA 1W8ZA 2VTFA 1X3ZB 1OR7A 1DHKB 1LNWA 3IRRA 4LBNA 2PBIA 1E5HA 1R64A 1A78A 2H6BA 3CDHA 3GJAA 2XKPA 3BROA 1DYPA 1OHFA 2JWPA 4YVSC 4RL7A 3WDXA 1JYXA 2K27A 2R041 2KMUA 5LA9A 3IZOA 2ZX2A 1ZGAA 3NWKA 4C3JJ 4OIPF 5DDJ3 4AU7A 5GLTA 4N7UA 4U0WA 1C0WA 4XQ4A 4BXSV 1MNMC 1AX0A 5IK5A 3L2YA 2FBEA 3J7ZI 4NJ4A 4QWNA 3AP7A 3WV6A 1LOEA 2QQUA 4P00B 4RLFA 5FZGA 2QCSB 4DQ2A 3DLLF 3V56A 5E8GA 5FZOB 1YOVB 4X6QB 1R1ZA 2GNBA 1CAWA 4Z07A 4ET7A 1MJ9A 3S1QJ 4XHXA 2F2EA 4QX2A 2CWMA 4LKFA 1YUDA 1QY4A 1AR62 1M1EB 2IZWA 2ZXHA 5HS9A 4K1ZA 3VPRA 4WF2A 3CMEI 2ARAA 1BOAA 3UK9A 4M3CF 4EWAA 5IOZA 3M4OJ 2K3FA 3Q0WA 4L0YB 2UWMA 3QH6A 1WJBA 2E71A 2XB6C 2ZSIB 4PQQA 2JUCA 1KDKA 3A03A 5DCMB 4IOAF 3LSHA 2QWWA 5L7OC 1JHNA 1QZYA 2TEPA 1HXS1 1YQ2A 3AKQA 1U0AA 4OYUA 1JU4A 2K4JA 3L2CA 1RUJ3 2W1QA 4YGBA 1AX2A 5IVFA 4ZDPA 1B9NA 3EJKA 4I7HA 1B09A 3SFIA 3V0BB 4X8PA 2ZMEC 2PEXA 2UXXA 3AZWA 1Y3TA 4EJTA 2Y6HA 2E1NA 2NVUB 1Z7S2 5BOXA 1CPNA 3WE3A 4M3BA 3CCQI 4PBPA 2K85A 4YZ2A 2B63J 3WDYA 3G1MA 1GP5A 1PK6B 3LE0A 4JKKA 5IP9J 4FPCA 3D82A 2D5HA 3C2BA 1EPWA 3OEBA 2WO2A 5HDKA 4YIIA 5A3TA 1WBFA 5FKBA 2KHMA 5J1RA 2FZ2A 1G86A 1RUF1 1CAXA 4KG0A 1R4NB 1ZR2A 1J3QA 5IJRA 1QNTA 4HX4A 1AR93 3BYWA 1KU9A 5CZKA 4PBOA 3ACGA 2ZX1A 4JP0A 2MD5A 3TW7A 4I6ZA 1XXNA 3S93A 5A70A 1OH4A 3OUJA 2V6CA 2EA7A 5FZCA 2ZMNA 5HPOA 2O0YA 2WZR3 1H2KA 4CZSA 2R5YA 1MMNA 1IXRC 2EJRA 4N9IA 1QKQA 1SPPA 3ZFGA 4ZZ8A 5F9TA 3QPTA 4IF4A 4RB0A 3WTUC 1LECA 4ASKA 5C3QA 5DAPA 3TEXA 4I3PA 1ULFA 4LE4A 2D45A 3WXPA 4XQDA 5FBJA 3SH3A 3D3AA 4ESBA 4J01A 4XF1A 3NQOA 2XWJB 2RS13 4BXXJ 2XV4S 3B94A 2IFRA 3T4HB 2ZZQA 2DT6A 1WPKA 3ECQA 3T0YA 1G2HA 4R9DA 5HS8A 1D4M1 2XAHA 1WJEA 1GXQA 3HOUJ 4YARA 2ZGKA 4LK1F 3POJA 4KUMA 5FRAA 5C44J 4XMYA 1BC7C 1H8VA 4IL6C 4AIDA 4IXLA 5KBFA 3ZQQA 5GALA 3S2DJ 3GZTB 2QJVA 5G04L 1F9NA 3BTAA 2IXIA 4DO0A 3VBRB 4TSVA 3DU6A 3S5QA 4IEPA 4PFPA 4PLNA 2IWGB 2Q8OA 4BPZA 2EIMH 5L73A 2VOOA 1DDLA 4IW3A 1N1VA 2NS0A 2K4BA 1HRI2 3FK7A 1FOKA 2QM3A 3M8JA 3OY8A 3BC8A 3UKGA 3WTSC 2WWJA 4XMAA 4DPNA 3C18A 3VDDC 2QZ2A 4ZDOA 3DF0A 5H9PA 4L5JA 4CUAA 5FZ1A 1TTYA 3DV8A 4CXWA 2P8TA 3FLTA 2CW8A 4A6SA 3THPA 2EZKA 1S4CA 4YRVA 3GXOA 3T3YA 3P9KA 2WL1A 2PXJA 1KYZA 3G4SI 4PQ9A 3ZOIA 2YUEA 3S1MJ 1ULOA 2DBNA 1UG2A 1ONVA 1HRV3 2DW4A 4GQ7A 4N90A 3S7IA 3OGGA 5AFBA 4B3NA 1VBE3 4A3BJ 2W84A 1F35A 4K21A 3M1EA 3LEMA 3U14A 4O5VA 1NYWA 1FYLA 3WG4A 2NMNA 2EILH 1O3QA 3RZJA 4E6KG 5T3NA 1RETA 5IVVA 3MHZA 4ZDLA 1V6NA 1OFCX 2AENA 2Q1ZB 4GYGA 4QU1A 4JX4A 2EV5A 2AEZA 3FC0A 1ND3B 3PURA 2OV7A 4WWCA 2E5ZA 1PNGA 3W6JB 4XUPA 2JA8J 4BA6A 1UY4A 3PNAA 3NQHA 3WVJA 2KIMA 5ICFA 2P3JA 2E7TA 3A22A 4NHXA 3HPGA 4D94A 4OULA 5GKAC 3A7QA 5C6CA 1PO13 1XGOA 1TME2 3JUUA 1NCQA 4C2UA 1IN8A 2C9AA 2BY3A 1GHCA 3DPRA 3KS7A 4CEYC 2M7BA 3HRSA 3JCIA 5DEQA 2VE9A 2DYRH 2KDOA 4RS8A 4JQRA 2Y0IA 5J3UA 2QQIA 2R043 4OLLA 2B7EA 2ZAAA 4GH4C 1RXFA 1VFCA 4MSVA 1YRNB 3VBUB 3CJIA 3KP3A 1VQNI 3H1CA 5EG0B 3NVCA 2JDNA 5CVJA 2VCMA 2W68A 2CYFA 1U0JA 4IESA 4OHYA 2A6XA 3WCRA 2JECA 2ZEZA 2WYFA 1RITA 1K83J 5KHHA 2BP6A 4HKOA 3MIEA 3HNMA 2QQJA 4JCKA 2BERA 1OCOH 5CKTA 4EGYA 2HWD2 2M5WA 1XG1A 1ULDA 4BY1J 1BQPA 3I55I 2X5IC 4Y5SA 1LHOA 1ZK8A 1G6NA 4EN6B 1FX7A 2BGOA 3TKYA 3BG7A 5A6YA 1H0MA 3KX2A 3M1HA 2QQOA 5T50A 1ZG1A 4CHUA 1GLNA 1Z6TA 3H0GJ 2W0XA 2VMFA 1ODNA 5E16A 4TN7A 2CJJA 2KJCA 1NK2P 3ZSMA 1SD4A 3GLXA 1H6YA 5EF6A 3TN91 4A44A 3DTKA 5LHIA 1X9TA 3WUCA 3MPBA 1Y4WA 3QP6A 2VXJA 5AONA 3ZPOA 4Z8BA 2YDEA 4Y20B 2YC4A 4C2TA 3L2WA 5FMDA 3GFIA 4AEDB 1ZKGA 1QRYA 4CDXB 4PT6A 3AP9A 2PMHA 2XOMA 1J2XA 1LE8B 2HWC3 5M5XJ 2K9MA 1Z0HA 3HWJA 5ERLA 4E4DX 1ZRRA 4UAPA 1IF1A 4MQ9F 2HEYF 4YG6A 3PUAA 1SLBA 1W04A 3LSIA 4K1YA 1SMVA 2JEMA 1BIAA 2ELHA 3U1KA 1YX3A 2JIGA 4DOZA 3DEUA 4LB5A 2XLFA 4YLZA 3BJ6A 5LGUA 1RUF3 1YW9A 1AYM1 2HBTA 4RS5C 5DUVA 1G8WA 5HODA 2E19A 5KHJA 3ISPA 2Q0AA 1REDA 1YCIA 1CQTA 3JRIA 4QPIB 2DCJA 4MTDA 1BC8C 1WD3A 1ZBA1 1H4HA 4XSZF 4IETA 1Y0NA 4BQYA 4EYUA 2WFF2 3TMOA 2OQ6A 3TGNA 2MNGA 2OA2A 4NB5A 2E1MC 4XQWA 4X0GA 4COYA 4CE8A 4P9JA 4HT1T 3ZQIA 2ICWG 4DNCA 1WMFA 5LA1A 4D9JA 2OUJA 5K0UA 2PAKA 4NRPA 3OSFA 1UXZA 1HJFA 4M3GA 3IAPA 2WWUA 2ZJCA 3OL4A 1W90A 4Q29A 5HNFA 4FOYA 5DUWA 1V9U2 4KWLA 2ZGPA 2A68F 2HH9A 1U9OA 4NC6A 4UBHA 4LXLA 4MFDA 4NBQA 3A2KA 4NHLA 1OLME 1RUH2 3ROUA 4ON0A 4JRLA 4ASLA 1J3PA 1D4M3 1W2AX 3WNKA 1OKOA 2PHTA 3VBSC 2V9KA 3G73A 3BR6A 3ZYRA 2X6YA 4UF0B 3JRCA 3O0XA 2DQLA 2VQTA 4XFHA 4BQWA 2YU9J 1W8OA 2WT0A 5FP8A 1U2WA 1XPXA 2B42B 4HK9A 4E2SA 1BVP1 5FZIA 3C7OA 1OKRA 3I54A 1Y1VJ 4XDQA 2VBDA 3OMYA 4A3JJ 5A1LA 1Z05A 4FO9A 2K46A 2XB5A 5FD5A 5E6HA 1QJU2 4BM8A 1MZBA 4FP2A 2MYSA 1K12A 3VN4A 2JPCA 4CU7A 2CL2A 3ZXGA 3HPNA 4BYYA 2CQQA 2EAKA 3EO6A 3UR3C 4LULA 4CDUA 2ZGUA 3H3VK 3S6PA 1U8BA 4J1XA 5LA0A 3OYDA 1A04A 1XN7A 4B8EA 4C0BA 2PHXA 3ZP5A 3ZYBA 3KGLA 1AUYA 2G9ZA 1R9TJ 5F7UA 3ZQLA 3PJYA 1IN6A 4XEZA 4YVSB 3SJMA 1D0XA 2X1EA 1CX1A 3WY6A 1GKBA 4AGVA 2DMQA 1KJRA 3CEWA 3J81K 3JR9A 3LOIA 4Q0VA 1OXCA 2HBUA 3NV2A 2P1BA 2VL4A 1W5SA 2VXZA 5JWPA 1OI6A 4LBQD 4K8FA 3A23A 3TO7A 3ZN1A 2OQRA 2FA5A 4EM2A 3K3NA 4PJ0C 2CGNA 5JZGB 3BJAA 3AYDA 3M07A 4TWTA 2P3KA 2R061 3JTHA 2VMEA 4BQAA 1JTXA 2XAFA 2VTXA 2BVVA 5FMOL 2P6HA 3BCBA 3T8TA 5FZ8A 2BOLA 3AZYA 2D98A 3NRUA 1HKTA 1LOCA 5CG9A 2B39A 5FFXA 1VBB3 2M30A 3E6CC 4NIGA 2Y64A 2JA6J 3I3DA 1DP3A 1HOMA 3WP3A 3M1CA 1QJFA 4NOTA 1MEC1 5FJHA 1BYHA 3C3VA 4CVUA 4AQTA 3ZXAC 3R4UA 1YFXA 4ISQA 2ZCWA 1PDNC 4F83A 1EKEA 3QOPA 3V8JA 1REFA 2W82A 3W6KB 2ZGSA 3KPHA 3GTGJ 4OCTA 4E27A 4MOAA 1S2BA 4WZCA 5L7OB 1MMDA 1AXYA 4QGLA 3WZ1A 2BNOA 5FK7A 4FVVA 2F4OB 1OMIA 2ZGRA 4BKXA 5K7ZA 1S8NA 2LBFA 1ZM1A 2Y34A 4LMYA 1X9PA 1W0TA 3ZFEA 2M9HA 1JI6A 4W4ZA 2OTJI 2ZMEB 4XCAA 2R49A 5JAXA 4AHWA 1V00A 4M3FA 4AZZA 1KQ9A 1FJLA 2A71A 4UXNA 2OIIA 1HXDA 1SHWB 2PMZA 2AUYA 2ZEWA 2KIQA 3A01A 1IN7A 3FUOA 3JW4A 3G3ZA 2BBAA 2OXBA 2XQXA 2KDZA 1PX4A 1E2XA 4B3XA 5D21A 1FOD2 1GWKA 1UCXA 3MFAA 3HBLA 1SFNA 2GP3A 3ZXLA 3F6VA 2GP5A 2MH9A 3LCPA 1YHFA 4GFBA 2XONA 1OLMA 2WS93 3I2GA 2OQGA 1OD5A 4IRHA 3T0DA 4AVPA 2YUSA 3BPXA 3MGUA 2CWEA 4D5FA 3ZR8X 1OCRH 1UB9A 2QVSB 5L9VA 3TN93 4WM7A 4KICA 3OS0A 1W03A 2B7YA 3JRFA 1XSXA 2F5FA 2BQPA 1WCDJ 3PUQA 2VKDA 4BK5A 4XM3A 3MW3A 2ADDA 3MICA 1VE0A 4Z2AA 2VZQA 2KD7A 2ZGQA 2ZXIA 4ASNA 2ZHKA 3H9AA 2OVUA 3OUHA 3FK6A 1WLDA 5A7PA 1X33A 4ZZ5A 4ZY9A 4BE3A 3MEXA 3F9KA 1KEXA 1FP2A 4QHOA 5DAQA 1MMSA 3E0JB 1YJLA 4XPVA 2PFWA 1CAVB 2K7LA 4XL9A 3JAMK 3OYHA 5DZFA 3LOBA 3OL3A 4HPQA 2WO7A 3VFZA 1NA1B 3P5BA 1PGL2 4R9BA 1EYBA 3IAQA 1VQ9I 1O7FA 3V64A 1H2MA 5FXXA 4Q1RA 3PTRB 4LOSA 5FZEA 4IHXA 4EWDA 3ZMVA 4BQ2A 4MQVA 3GLLA 4C9YA 4BQ4A 4PCQA 1J1LA 3AM2A 1WWYA 4IEWA 1LU2A 2NZ9A 1S0CA 1AYM3 3ZFFA 3LOCA 1A34A 2IVIB 4DYRA 2WV1A 5FP3A 1WKYA 1RHI2 2CFXA 4II2A 4NROA 3ZXEA 1SVOA 3M3IA 3OPWA 2YU3A 1XDUA 3K4ZA 1ZBA3 4QPGC 2XWBB 2CU7A 3TOJA 2F4PA 1RMU3 3USSA 2A6VA 2GNTA 3CDLA 3CF5F 3VD9A 1YQ5A 4KWJA 3AP6A 1MD0A 1YHQI 2HWB1 2FBHA 5FXWA 3GTOJ 2K5CA 1QJX2 4AVCA 3W5NA 1RR7A 1VPHA 1R081 2NMOA 1W5TA 2G7HA 1I39A 3LQRA 4B29A 1QOTA 4L5IA 5C3SA 3NV4A 3KV9A 4P9LA 1EAH3 5B1BH 2FMLA 5F5AA 1IS3A 4IE5A 5A3OA 4CTEA 2QVOA 5IAXA 3LSKA 2XC7A 1MVEA 1PZ7A 5HVQC 3MFKA 3VDBA 5I0RA 4FAGA 1GNZA 5DAVA 3TDUC 1NG6A 4XF4A 1GQPA 5L36A 1HIXA 4OQ9A 5JCTA 1O3SA 3HHHA 2H8WA 3OS1A 1HX6A 3CQOA 5F5QA 2HWE2 1BR2A 2VJ4A 3SQOA 2B5HA 3E1F1 4AQ2A 3HNYM 1R23A 3AFKA 1UF2C 2V26A 2E5NA 1KJLA 2D6NA 2PFBA 4G9YA 4MVTA 4WVWA 2VU9A 1AU7A 2CFOA 2V9PA 2XMLA 3C3WA 3RI8A 2LREA 1P4AA 1MS4A 4PGHA 2Z1DA 1KDMA 1IG3A 1XC6A 3VYTB 1IDYA 3OYNA 1IC8A 5F04A 1MBGA 4B48A 2WY7Q 2DK5A 3LSDA 4JHZA 1R5ID 2XUBA 3GF2A 1HLCA 5J1YA 4KH9A 1ETOA 4ESFA 1SZBA 1HQNA 1XNBA 4GH4B 4PIZA 4J6GA 4BL0B 2O1QA 3LIHA 5BUVA 2FOKA 1LGNA 3JBG1 5EEHA 2GIVA 4RGGA 1O7LA 3WU1B 4L18B 1ZG3A 2LF7A 3CBNA 3ASIA 3SMHA 4Q5OA 2WBKA 4X6RB 2C1FA 1LFPA 3WG9A 2KJBA 1VRH1 2ZHMA 5DUIA 5F0CA 2NYYA 1GBGA 2NNYA 3IDAA 5EZWA 4RLQA 1MQTA 2GALA 2JG9C 4OIQF 2R063 4AIKA 1JT0A 3BDDA 3WGIA 3EBRA 1FEXA 3OYKA 1SD5A 3B73A 5E3LA 3LEIA 4JHTA 4RB1A 3H7YA 1A36A 1JUHA 2MGQA 2MLKA 3T30A 2PELA 4CDGA 1SFYA 3I9V2 2LC2A 1G3YA 2OF7A 4CA0A 2BOIA 1K5MA 3WW3A 4ZXKA 2OTLI 2R7QA 3ZOBA 4AFAA 3ZN6B 1YQAA 4Y4RA 4LPLA 2Y9YA 3CJTB 2D93A 1B9MA 3DYOA 4DINB 2X6WA 1ETXA 4B47A 4P08A 1YO5C 4CDQC 4P96A 1P4WA 1W2TA 2NS7A 4N7IA 3SKVA 5BNOB 2HPMA 2RVCA 2HOAA 5E17F 1YITI 2X1DA 5D8AB 3ME2A 5FO7B 5C8CA 3K1NA 1BOBA 4EJWA 3BPZA 4AIJA 1MZ5A 1D1AA 3GBFA 3I59A 3TRSB 3H5AA 1A5JA 2QSFX 2RM21 2YV8A 1RUG2 4BUPA 4RGAA 4GIQA 2Q1FA 5JVTA 3AP5A 3B5LB 3QYFA 4WCGA 1JT6A 2ET7A 5EYYA 3FIWA 4K3UA 2IGKA 3OYLA 3P9IA 4LKSA 1J58A 3BY6A 2RDNA 5IOYA 3S2HJ 1YX5A 4TTGA 5J96B 1QGLA 2XAQA 4HVRA 1QVTA 1WA4A 3ZR5A 2MW8A 4OVEA 2WAEA 1B72B 1QNWA 3FFQA 1FAYA 4OUSA 4RS5B 2CO5A 3MO4A 1LOAA 5I8SA 1LVKA 5EHDA 1AR63 5FY4A 4QTRA 2STWA 2R92J 3CIHA 4FETA 2RMU1 4AI1A 1U5TA 3HL2A 3GZUC 4QKBA 4A12A 2H1KA 5KAFC 4I0BA 4BXFA 5DZEA 5FPVA 1QHHD 2Y6LA 2ZSHB 2HOSA 5LHGA 3LAJA 1UOFA 5ACA1 2E2IJ 2Y26A 1UQXA 3SDGA 3OCPA 4XKVA 1C57A 2CUEA 4AFMA 1LAJA 4M74A 1DCSA 1KFUL 4DXRA 2TCTA 3DTEA 4CU9A 3MZHA 2OZUA 5FZAA 1J1TA 1VBC2 2LR8A 1OQYA 2X05A 3KB5A 4OHXA 2NOJB 1AOYA 1W8HA 4AC0A 1TWAJ 4I09A 1OFNA 5BS6A 2NPIA 2L9RA 3F6OA 1LDJA 1IN5A 1Z7S3 4LO4B 3WINE 3VBSB 1Z9CA 2D6KA 4MIMA 1V0AA 2WNOA 5DS9A 4FCAA 5CIRA 3ZQHA 1VALA 3HDDA 3CMGA 1HBXG 3NEUA 4N8MA 4ZU4A 4E7KA 4F92B 2IW5A 5FPXA 1JZ6A 1RKWA 5GZEA 4KN7X 2HWF1 4RAZA 4RYDA 4F7ZA 1K4TA 3ZYHA 2BNNA 4W1UA 5I93A 3SKJE 5C3PA 2A6HF 2WB1N 1VBA2 1BR1A 1HKSA 4JQTA 1W28A 4NWWA 4PJMA 3GBGA 1ZRDA 3MKYB 4UOJA 1B4AA 3N7MA 2XJSA 4D0QA 3BR5A 5E8IA 4LLOA 1U5XA 5BNNA 4HF1A 4TYSA 3ACHA 1DG6A 1PZ9A 2HWB3 5LBEA 4ZKTB 3CP8A 2ETEA 2DVFA 1TNSA 3AZZA 3REOA 4OIOF 2WAOA 1R083 1WMDA 1RUC1 4JGZA 5CVIA 4IEJA 2Q8KA 1T98A 1MZFA 1Y9GA 1W8TA 2VW0A 4KI5M 3NAPA 2ZJQF 5LBBA 2LKPA 4RHV2 4QXCA 2VW2A 3H0OA 1K79A 4BLJA 2J1UA 2I45A 2W2IA 1CAXB 1Q3EA 1KGSA 4GYIA 1OJLA 4U7BA 3J80Z 1A8MA 2HQAA 2XGXA 4HFSA 4XBFA 2YC2A 1DU0A 3ZSKA 5CPRB 2Y6KA 3F21A 1T2KA 1BL0A 5JLVA 5C9AC 3F8NA 1ZTRA 3N05A 3LSRA 4OI1A 1X3UA 2K9NA 1UELB 3CMYA 2F5DA 2CUFA 1ZRCA 1BHGA 2I10A 4AUXA 1OKQA 2HLEA 2EZIA 4RR3C 1R6RA 2DFFA 3H92A 5CQEA 3I97A 5FZ4A 2JTVA 3FMRA 4YFNF 1SPPB 2ZOEB 5ED4A 1KZHA 1US3A 4YRDA 3HTUA 4QX5A 2VO5A 3WNMA 3H9QA 4HMZA 2D1HA 2H1LA 4L0PA 2Y2ZA 1KU7A 5JR2A 2XPVA 3S2WA 3OYBA 1XSRA 3M3EA 4XUNA 5DDJ2 2FX0A 3EQEA 1UOBA 5IW0A 4RGUA 4LGWA 2D6MA 3JD71 4G4FA 4IPAA 2HVQA 3MIHA 2ARXA 4GZ9A 2G9WA 2G1MA 3HJEA 1YLLA 2YBSA 1KYWA 1WJAA 1AJOA 1VF9A 2W5FA 3H8XA 5LZ6A 3PUBA 2ZGMA 4YVWC 2YPJA 4DB5A 4PZJA 2CAVA 2FQ3A 1GOHA 1WLCA 2WFPA 5HXMA 2IS1A 2RE9A 1QGPA 1R00A 2CMPA 4AGRA 5FZMA 1VQKI 1QO0D 1JH5A 1W6QA 4ASMB 1YLFA 3QPLA 4RBOA 5GAEJ 3ONQA 2QYOA 3AL5A 3A4UA 4AK3A 4C91A 1QU0A 1YXWA 2Z3YA 2L3DA 1ZYRF 3POFA 5C4WA 5J3LA 2M1BA 1ZA4A 4ZPIA 1O4YA 2ZS6B 1I50J 2Y48A 4MO3M 4IRIA 3WX5A 1FP1D 1XYOA 1WD4A 1VRH3 2ZC2A 3QWLA 4UFJA 2Z99A 5BMZA 3OY8B 3BZCA 5EYRA 4LA2A 4EQVA 1L0OC 1YIOA 5HCFA 2PYTA 4YM2A 3NMBA 1MBHA 1JI8A 1EV7A 4UHTA 2ZX0A 3SEPA 5FZ3A 2AQFA 5L3FA 3J9SA 2V73A 2WQZC 4LO8A 3SITA 4GWIA 3W21A 4UNOA 1FTTA 1FSHA 5K8SA 2PLV1 3PUSA 4BIOA 4P5YA 2VI6A 2AHQA 4HBLA 3J7YJ 1RTVA 1W0UA 3ZO0B 1APNA 1PGW2 5JOYA 3U75A 3BI3A 3TEDA 2W94A 5FZBA 1G7YA 4BISA 1XX5A 3MYXA 2W52A 1OCPA 4NAOA 5BNGA 3WODF 4FE7A 5JVGF 2KIFA 3SNMA 3OGSA 4OMDA 5FYYA 3KQ4B 3F22A 3FN9A 2P17A 3HRMA 3ZMZA 3KCCA 5FMOS 2BY0A 4YM0A 1MIJA 2GWRA 2O03A 5JOWA 2WZPP 2B9SA 5FKCA 1RUI1 5FMCA 4A3EJ 2RM23 3FBIB 5L9RA 3UJQA 2YX7A 2DMPA 2DJIA 3J26N 4IEQA 5JPMB 3KWVA 1AR92 4CXYA 5F39A 1BJQA 3ZYPA 1PP8F 1GT0C 1Z3YA 4V2VA 1UOGA 4BQ1A 1PMHX 2IXHA 5K1YA 3DPRB 3MN2A 3ZR6A 1WQ2A 1EUTA 2A6TA 1ACCA 2HYFA 2M4GA 3QRFF 1X2MA 2WZR2 2F4LA 5FIXA 2J1TA 1W1WE 3LFIA 2XPJA 3K4AA 1KD7A 3H5RA 3DYMA 3BR1A 3G2BA 4P9XA 2FUG2 3LZZA 4XF0A 5E88A 5B5EC 2RMU3 4HX7A 3CC2I 2G9FA 4YG2F 4QPGB 3WTYC 1U78A 2WNUA 1WUVA 3EB7A 4QB1A 1H0BA 1VMJA 3AZVA 2AXLA 4I01A 4Q47A 4L5EA 2XHNA 4A5MA 3U2RA 5ACA3 3OIQA 1ETYA 1SEFA 2GSYA 2LDUA 3D0JA 3POEA 2ZNYA 3L9FA 2Z5WA 1I1SA 2AS5F 3PSFA 4OU0A 5C3RA 1IZ3A 2DCTA 3F0CA 4LHLA 2ILMA 2J1VA 3CCJI 1FMD1 1POV1 2VJ5A 1AWCA 4AHXA 4QPYA 2XL7A 1Y0UA 4BK4A 1UYXA 3O1OA 3MD2A 5FWEA 5J09A 3LFMA 2EFPA 4Y17A 4O7XA 5HLIA 3HUGA 1CD3G 5IVYA 2PJRA 1WW5A 1OCCH 1DU6A 3A4CA 1T39A 5LK5A 2VQAA 2Z9OA 3VHNA 2PA7A 2B8MA 4GCVA 3OPTA 2D7FA 3FMSA 5CB7A 1RB8G 4IEUA 5A7QA 4B4RA 3GZEA 3VD5A 2TDXA 5K7FA 3ABMH 3KGZA 1VZ0A 2HWF3 2DDAA 5CJ9A 3NJYA 1W7PB 3DECA 2DUPA 5EPAA 2Z16A 4XUOA 2L9NA 1XMAA 4RGSA 1IKPA 1R5GA 3E3VA 3C7FA 4BACA 3VBFC 2OA4A 1ETWA 1HRV2 4G6QA 2LVSA 1WSUA 2DDUA 2WLQA 1VBE2 2C5DA 3CZ6A 3I2OA 4A3DJ 5A6ZA 1SANA 1HW2A 2WO1A 2KA3A 4CP0A 3FLPA 3I7DA 1RUC3 3V0AA 3HSFA 4JDOA 4NNJA 2Y0SN 2XVGA 2EV0A 4A0YA 2A3SA 1AYN1 5LW9A 2PHFA 4K8RB 4Q4ZF 2TNFA 3OOUA 3DEEA 2DI3A 4CP1A 2IS2A 3I64A 4MGZE 4YFXF 5E89A 2LK2A 4I0WB 1V9U3 3P6BA 1QQP1 3H0DA 1LHWA 2E33A 3KFWX 3S3OA 1PNFA 3ZKYA 3MIFA 1DIWA 2W00A 2QBYB 1PO12 2E31A 3L2RA 4JDNA 3MF9A 1RXGA 2XJVA 4HPKB 2DA4A 2WBMA 3VD4A 1C4RA 1WI3A 2JJ6A 3VZLA 1WHUA 1CZVA 3KETA 2M45A 2GC2A 1N77A 2VY0A 1FMWA 2HI3A 2IFWA 2KRHA 4LIVA 2P4EA 2OT7A 5K0UB 3PMSA 5JMCA 3F95A 4PSXA 2R042 1SAUA 4P5OA 3QPSA 4CYCA 2FD8A 5D4SA 2NM1A 3FISA 3KP4A 4M3CA 3F8CA 1JGGA 2YMZA 2VMDA 3O3KA 5T52A 1S9HA 1OA4A 5BPIA 2YYOA 3DEWA 2VZUA 2ZHNA 4BU2A 5L3EA 4Y1ZA 1K3IA 2CHHA 5FYZA 2Y0OA 1W9SA 3KZIC 3Q8AA 3TOAA 3ZMOA 3D5SC 4CDQB 2DUOA 3NNJA 1F31A 4NIDA 3BR3A 2V5DA 2WAQN 4K40A 4E2GA 3PNTA 1SLTA 3RZOJ 5F5IA 2ARBA 5A7WA 5D5XB 5EEAA 1XNKA 2XUMA 1BJZA 1H8TC 3IAS2 4CSWA 2EIDA 5GM0A 4XLHA 2ESHA 4CZZA 4GALA 5K7HA 4RFT0 1N25A 3B69A 4LLGF 2YC0A 5DV5A 4OINF 2FDHA 3WEZA 1KS5A 4NPRA 1MS3A 3ETQA 2P6TA 2H8RA 4NAMA 3KCXA 1Z6RA 1ENXA 3SCGA 2UWCA 1OVSA 1XNAA 1FY7A 3VZJA 2DLLA 2DN0A 1Q56A 4FAHA 4I02A 3RQ0A 2DCZA 2Q8EA 4N43A 3GW2A 4L92A 2M0CA 5DM7F 2IVMA 4W8JA 2XHKA 1WA6X 2JG8A 4GO1A 3QBQA 1NH3A 2PLV3 3APBA 3K69A 2PQQA 1ETKA 4HNUA 2W87A 4DZJA 1YFYA 4CCMA 1HLVA 2W1SA 1T0FC 2R16A 2RKHA 2DTRA 3VOEA 1OA3A 4NHJA 2Q8CA 5EJCA 4DY5A 1NG0A 1QZZA 4HG2A 4QQPA 3IPVA 2VECA 1H1IA 3HOYJ 5FZ9A 5HLHA 1SDWA 1ZN2A 2DF7A 4S2GA 2QA4I 3A0NA 4BQ3A 1IXCA 2VODA 5DUKA 1CR7A 4GXLA 3R0RA 3GCMA 5E1XA 5TISC 2RJLA 1DPUA 3CJXA 5FR3A 3R4KA 4ZS3A 4LORA 2KISA 3VYUB 2ZEYA 3I53A 4AOCA 2E7QA 5BPDA 3PM1A 4BMBA 3POYA 1LOGA 2UYBA 2OQ7A 1RUF2 1HQLA 3TNPB 2G9GA 3CUQA 4DFSA 4XN0A 1ZLJA 2ZGTA 2DMTA 1LUJB 4GD4A 4HOBA 2OPKA 1LEMA 3U4XA 1OYWA 1Q1HA 4AI3A 4HETA 3WT3A 4C0HA 3O1VA 3VHRA 2HXIA 2FF4A 2KZGA 3ECHA 3WW4A 4F8AA 3TEWA 4FHTA 1S55A 3VYSB 4CU8A 2MA3A 5GZGA 4L9JA 1FOD3 4YW5A 4LO6B 2ORZA 2LP0A 1PUEE 1P8JA 4MGTA 4RAGA 3USUB 3B3QE 4K6BA 2QQLA 1H9GA 3I3BA 5DABA 1R1TA 3RS6A 3ZFEB 4F91B 4WM8A 3C8XA 2OPTA 1S72I 2Y38A 4L9BA 3KT4A 4NPMA 1H89C 5GJ6A 3BG9A 3Q3SA 2EXIA 1WJ5A 1O59A 2ECCA 1OLQA 1GR3A 2D6OX 5FO5A 3TO6A 4A7YA 4YEJA 1ZR4A 1D4M2 1DGWX 2L5QA 5IT9Z 4IHTA 4XJZA 3A01B 4D7SA 3N7JA 3AG1H 2WA4A 1YC61 3HNBM 4DS0A 3RI9A 4DBQA 5LRRA 1I9RA 3BP8A 1ASJ1 4XKCA 2ID3A 1PK6C 1JJ6C 2IXLA 4LFUA 4EWEA 2P5LC 1POV3 4G94A 5FRNA 4ZH4F 1AXKA 3BODA 1IRFA 1JYCA 2EALA 2VUDA 4E8DA 5FTTC 4BDZA 3AKPA 4BJ6C 3HB9A 2VPRA 3GTLJ 2O8OA 3ULQB 4LG3A 2BU9A 2F5CA 2ZKZA 1L7QA 5C9AB 4D3WA 1C3HA 4XJ9A 1W9WA 2O61A 1B59A 1YS6A 3E5UA 2DVGA 1F15A 2JD4A 4HXCA 4WM7B 2HDWA 1N1TA 3IBMA 1HRI1 4PIXA 1US2A 5J98B 1V6IA 5HLGA 1ZH5A 3LQCA 1ZARA 2YU2A 3E5XA 5I0SA 2W47A 3GNEA 2FCUA 5FKNA 3I2JA 1J75A 4IXAA 2VJIA 2E7WA 3O1PA 4V19K 5A33A 3KV5A 1I5PA 4YNIA 2L9VA 1RR8C 2XLGA 3LDKA 1BCXA 4M0HA 2VUCA 2GMPA 2BUKA 4AVSA 4LITA 2DVAA 4D7NA 1SMYF 2XVKA 3VKOA 3I4MJ 4YVWB 4UVBA 4WXCA 3OIOA 1D2SA 3ZYGA 2VOVA 1UU5A 4M01A 2DA1A 3POIA 1OFSA 1QJX3 1SC7A 5SV8A 3O1TA 1AYN3 4QX3A 2LY9A 4BWOA 2I07B 1JS9A 2DBBA 3ZQ7A 4COWA 5B1AH 2DFEA 1VBB2 5HDGA 1ZGJA 3WGHA 3CKHA 4Q4X1 1X2NA 1UMQA 4HKWA 2ELJA 1U5ZA 3VBRC 4Y1VA 3POWA 3I3LA 1N47A 1QQP3 4QQHA 4L97A 1GZTA 3VBHC 2KFDA 2J1EA 2EFNA 3BOPA 2XRLA 2IUWA 2FHRA 1VB2A 3UGHA 3RRDA 4JGYC 1OH3A 4RDUA 5FKMA 1USTA 3CHXA 4W6WA 5BNPC 2YZ4A 3LNQA 1WCKA 3KIOA 1IW7F 1HB3A 3QU3A 2FDFA 2I8DA 5E79C 2V7FA 3KEOA 1BK1A 5D8KB 3B93A 2HWE3 5FY7A 3T08A 4PSWA 3RQ4A 5JSRA 3ZIXA 4Y5Z0 2D97A 1GUUA 3FHIB 3RJRA 1OPOA 3MLKA 2IT0A 3SFZA 4W6YA 4B4QA 2XB0X 4FOVA 3X29B 1IG0A 3PNYA 2DOAA 4QHZA 5ABJB 3CCVI 1LHUA 3K48A 1TMF3 3PVNA 2XGDA 5D5UB 1TT5B 3CJNA 3J7MA 4AEKA 5JUVA 2UWAA 2Y8KA 2XAUA 3C7HA 5HI0A 3EUHA 2E32A 3AKSA 3RMYA 4QX0A 2HWD1 2X0LA 3WU2C 3J8F1 4AYBA 4TXWA 3ES1A 4OUMA 2CUJA 2DFIA 4RA0A 4QX8A 5FPLA 4YFZA 2K9ZA 5HV4A 2QQNA 4C3IJ 2O14A 1UCRA 2WSUA 5E3NA 1Q43A 4IQ4A 4XAEA 5JDBA 1D0ZA 4B3AA 2O8KA 4OHWA 1XMKA 4UW6A 1IKQA 3CC4I 2VBWA 4NRMA 4QXBA 2DYCA 2EWNA 1EP0A 2A5ZA 2N7GA 4XF9A 5A2QZ 3TN92 2OU2A 3A21A 4LEJA 3N9QA 3CCUI 5A32B 1VMHA 5EZHA 3IDCB 4XBLA 3QODA 3DXJF 3K4JA 1MDMA 5A3UA 3PSIA 2W57A 1O8PA 2Z4FA 4L2NA 1WFXA 4KWKA 1UOJA 5JXHA 4CCOA 5IVJA 2RV8A 1L3LA 1RESA 4IV1A 4E2QA 4MXWA 2GBYA 3NKGA 4XOGA 4YPJA 1VAVA 1KRIA 2VZOA 2GZWA 3JU9A 3UJOA 3T8RA 4Y15A 1W6NA 3VBUC 3CO2A 3MW2A 2W95A 1ZAOA 3Q9OA 1SG3A 1SBEA 4YM1A 1LU1A 4BEHA 3WSOA 4UBGA 1OQEA 3THDA 1UKGA 2RDRA 4XIDA 4IE7A 1MQTB 1OYIA 3AMHA 4E7SA 4ESJA 4XURA 1R49A 1YJKA 3L2QA 1POV0 1GLHA 2XR4A 1Q8PA 1BMV1 1G9DA 5LFAA 4X6AJ 1DLLA 1V4RA 2VMCA 3VBOC 4Y3OA 3IV5A 3JRAA 1AYM2 4RFRB 1OF3A 2LALA 3NWSA 1K5MB 1QNYA 5AFEA 1RUD1 2HTSA 2ATFA 2WZEA 3FXKA 1TLHB 4KL1A 2LSOA 1GYKA 9ANTA 2E63A 4MHRA 4CUGA 3R4SA 4FPLA 1ZBA2 1RUG3 4PCRA 4RM2A 4ZYDA 3KVBA 2W48A 1CONA 5F3GA 2CV2A 4LG0A 2R7FA 3PLQA 2CQNA 1ZHFA 5KC5A 2VOPA 3VKNA 2ZGLA 5FCCA 2JX9A 1JUSA 2XLAA 4D6RA 2FJ1A 1VQLI 2A69F 4Z2YA 2R7UA 4CU6A 2YXSA 1JKQC 3DQVC 4M3DA 2ZFWA 3I59B 2GOMA 5JSPA 1QJY3 5CNAA 4QHBA 1UW8A 2R0HA 1T6BX 2JDMA 2CG4A 2QENA 4CDXC 2N8GA 1PIV1 1SFKA 3K10A 1KXGA 4KBBA 4AGGA 2V09A 3PJRA 1ASJ3 2WQ4A 2CGPA 2V1UA 3TAYA 3S0MA 2XF5A 4QQ2A 2X48A 1RKTA 1JYIA 3C2UA 1UAAA 5FZOA 2O3FA 2J5OA 1D4VB 4QB6A 1UHSA 4NMIA 1UU4A 1JZ4A 5IY5H 4OHVA 1LDDA 2GNMA 5KR7A 5FP7A 3PNVA 4HQMA 3C7EA 4EN0A 3I4PA 5F3EA 1WZXA 3VZMA 1U5TB 2IP2A 5F6KA 3F8FA 1J0RA 3ERMA 4UVAA 2ZGNA 3RZMA 1QJU1 1UZWA 4META 3IDEA 4IV3A 3PO3J 4QPIC 4XFIA 2RNJA 4M71A 3JB4C 3QOEA 4CPBD 2QZ8A 1Z91A 3QAHA 1CZSA 2NQYA 1ZZCA 4IL7A 3ZYJB 1XGMA 3BG6A 2VNOA 2E34A 3KLNA 1DBNA 4QSHA 4JOMA 2SBAA 3BVCA 4YFWA 4F3QA 5DN2A 1S7OA 4KT6A 3DF8A 1V5FA 2P4WA 5H20A 1AR71 2ACJA 3PJQA 4HF2A 1LOFA 5M5WJ 4XDPA 4F3JA 4COZA 2P6CA 4R1HA 5L3BA 1WW7A 1WW4A 2K2SA 2XVLA 1SVMA 3CJQB 1B35A 2RDPA 2IGNA 1ZQ3P 2VZ1A 4XQFA 2CY6A 1D7PM 1YFHA 4HAMA 4LOCA 4AW7A 3AKZA 2VMIA 4RSUA 3I4NJ 1YW7A 4R9AA 4QAWA 2D5VA 1F2NA 1ACIA 1LTEA 4EGZA 2R062 4B8XA 2Q5TA 3BR2A 1EPZA 3ZVXA 5FPAA 3WNPA 4LBMA 3JQWA 3WE2A 3ZCOA 4WXDA 4HONA 2LTNA 3R4DB 1YQ8A 4RHV3 4Q4X3 1ULCA 5KHDA 5B4NA 3WR0A 3WOGA 2DCYA 4FQGA 5IVEA 3U07A 4SBVA 5ANQA 2VCCA 2Z42A 4JAAA 3QU6A 1R22A 4FFHA 1AXZA 4XW3A 3RKWA 2EAAA 3DN7A 2XASA 3Q8FA 1PGSA 2WC2A 2J22A 3LA7A 5C3EJ 3KT7A 4HVOA 4BE0A 2QBXA 3FDYA 4X1EA 4QIWN 5E1ZB 4JGZB 2IXCA 2ZJRF 4S2DA 1KONA 3GHMA 3NAPB 4EJVA 4NE9A 4XABA 3LFKA 1IS4A 2LOOA 4UUTA 1LQ1A 3LSTA 2QKDA 3K4DA 3FXLA 4LMFA 2BTVC 5E18F 2W91A 4YSFA 4EATA 5FY5A 3HJRA 3E6BA 2CU5A 3DUIA 2JE9A 4KU7A 1SFEA 3M7GA 5J8CA 1FZPB 3F2ZA 5DPNA 4NPLA 1VQOI 3NO8A 5DTDA 3SHFA 1LB2A 2ZHLA 4MHGA 1X8EA 2R7EB 2VNVA 2DOEA 5JZGC 5FYUA 1X1PA 4B4PA 3IUOA 3J8F3 4GB31 3AL0C 3K2OA 1NCRC 1ULPA 2XF7A 1RGSA 2JK3A 2QQWA 3A0HC 2FZ1A 1BBT1 4B1LA 3CD6I 4NUBA 3K75B 5CFDA 2BW8A 4FFGA 2BGPA 5JIUA 2WADA 3UNGC 1FIAA 4C1WA 2R1DA 2HEVF 2RHPA 1FT9A 4LIUA 3DXUA 3ZN0A 4LHNA 1COV1 3JRDA 4JC1A 1ODDA 1XJAA 4ENKA 1JBCA 2OUHA 2A1XA 3OIPA 2BWCA 5FLXZ 2ZABA 3JB8A 2R30A 3JSPA 2GN7A 2A3WA 4L0ZB 2Y60A 5K4LA 3AG2H 1K4SA 4OAYA 1K61A 3F23A 2W3JA 3SEQA 4TLGA 4U0YA 1W6QB 2R7VA 3LF7A 3PFIA 4S0HB 3L2VA 4XFFA 4KQ7A 4HYEA 3AMQA 2YROA 2YFUA 5C4WB 5FQ0A 5LY1A 3C1DA 1DQ2A 4PDWA 4FTBA 2DFHA 3VL9A 2DOFA 2D6PA 2F4IA 3MKZA 3BU0A 1C28A 1OF4A 4L9NA 3MW4A 4GMP1 2EIJH 3HYIA 2WNVC 1D2QA 2M4KA 1RJ7A 2QE3A 2RV9A 1N3PA 1J3RA 4G9SB 4KWUA 1R1A1 3C2HA 1FLIA 1R1VA 3HQUA 2RAEA 3FXMA 3MEPA 2NVQJ 4FASD 3IP4B 4IEZA 2EIKH 1LFUP 1ND2C 1QPIA 1ND3A 3HIFA 5C5TA 2JVGA 2HQNA 1RUD3 1UIKA 3W59A 2DBIA 1UY0A 1QF3A 2ME0A 1WI9A 1CPMA 2LKXA 1MS0A 2CH0A 1EUUA 1URXA 1PHMA 1MJAA 5F64A 1WH5A 5FUIA 3A0KA 4XYXA 2WWYA 1S7AA 1YO8A 4NDLA 3HMYA 2ZKNA 2HWB2 2JDUA 2WLPA 1XSDA 4HSRA 5KXBA 1ITYA 4NC7A 5GP9A 1R082 3W2AA 3WP5A 3LSEA 4UYBA 5DUXA 3DLAA 1G3SA 1OD3A 1IOAA 3JQXA 3MFCA 3GYDA 3N9LA 5CKNA 3HZJA 1SFXA 1XSQA 2K86A 5D4RA 1ODMA 1XCBA 4FPKA 3BQYA 2VVFA 1IS5A 2XRNA 2HQ5A 5IYDJ 1UKRA 3VZNA 4Y1UA 5D1IA 1P2FA 1QH6A 5EJ1B 2VZRA 2HQRA 4MFEA 1PIV3 2Y30A 2X85A 3E97A 3S57A 1AL0G 5EG0A 2DCEA 4U0VA 4ZU7A 1HW5A 3WW2A 4XNFA 3IKTA 2XKOA 3T1LA 2XPUA 1JUMA 1HKQA 4EMSA 3NRVA 5E8AA 1NA1C 4MADA 5JI9A 3FKJA 1OUXA 3VODA 3D0SA 2JE8A 4KA4A 2R5ZA 1D5VA 3INAA 1AL21 4OZOA 2EA4A 4AVTA 2O0OA 3ITQA 3WLUA 3OYFA 2F5EA 4EZHA 1YJWI 1YI9A 3ZPLA 2ZNZA 5D5WB 2JA7J 4HDVA 1L7LA 1JU3A 4CDWA 1UY1A 1W7PD 4N53C 2WNUB 5G05L 3VBHB 2RG4A 1F9KA 2CAUA 2UU8A 4HLTA 1C8M3 4JGYB 1GZWB 1QH7A 5BNPB 2XSJC 2B45X 4MUVA 3FBYA 4MH0E 3F3XA 4ORFA 5FO8B 4A5NA 3I49A 3G1LA 1UXXX 5GADJ 1E17A 5FOJB 4XRSA 1MKMA 3LAGA 5F32A 1XU2A 5FYIA 3NJZA 4LJHA 1OOPC 1MZEA 4CYDA 2HNHA 2MC3A 4AEDA 1JYVA 4B09A 2JVHA 4CGZA 2VQCA 5JXJA 1GQGA 1VRH2 2BDRA 5C71A 2HDCA 1YIJI 1DGRA 1VQ6I 2E1OA 5M3MJ 5JIAA 1S0GA 5FGMA 2JD9A 4XOPA 3RI4A 2DWRA 2BVLA 1JUIA 4FBFA 4C1XA 3I3EA 1I3QJ 1IN4A 1IXSB 1UD1A 4AF9A 1YYVA 2KT0A 2EIBA 4JTOA 5J7MA 1CIYA 5IVCA 2V1XA 1XGSA 1EH7A 3PIGA 5CFCC 3VD3A 2L2OA 5IUQA 1JJ8C 4HV5A 1RINA 4D0PA 2X6XA 3FWEA 4Q0UA 1IPSA 5FYCA 1I6HJ 2UWBA 4QPIA 5GAGJ 2ZGOA 1RI7A 2P81A 2EXJA 3RPUD 1QXRA 4FXGB 3KF5A 3GZAA 4N0BA 4KISA 1H9PA 2HDDA 3ZN4A 3N4MA 2HVRA 2BPA2 4E9KA 1H6XA 1IGOA 4G3YC 2VBXA 2Z69A 4RB2C 3AYCA 5K7PA 2H0VA 4Q0SA 2RR11 5KAIC 1VJ2A 2PN6A 1V3FA 1CZTA 5I0UA 4DZGA 1IRXA 1WH7A 3ACFA 2VCAA 1SLLA 4A3KJ 2RM22 4AI0A 1ST8A 1C5IA 4N4NB 2B4KA 1RNLA 4CCEA 4ZYAA 3TEYA 2VXDA 4PF5A 4EN9B 2M2EA 3MDPA 2G7UA 3O0WA 4UT5A 2ZFUA 3JSOA 2BVBA 2EXHA 4FE4A 1ENRA 4GB33 5J48A 4Y22B 3VBOB 5TJJA 4CYCB 1BBT3 1T08B 3QYEA 1VQ8I 4M3CB 3TDZC 2YBKA 4DXSA 1ZLKA 4GAZA 2RMU2 4YW4A 3J7AY 1F8VA 2MD0A 3T2OA 2RS51 1W6OB 1I3AA 3UT0A 3V8LA 1COV3 1JOBA 1W8UA 3CMMA 4LE3A 2H94A 4L99A 4AXOA 5FLHA 3ZXSA 1HSTA 5ACA2 5FLVA 1H1AA 4AE2A 2JDYA 4CEWA 1Q8OA 1RRJA 4MYEA 5A7WB 4PGGA 5D6FA 2WUHA 4CCLA 2R32A 2L9LA 1QA6A 3DPUA 2IVJA 5BNOC 3ZMTA 1HXS3 2VZTA 2FQ4A 4YVSA 4C8DA 1FYKA 4RQPC 2VC1A 1JZ3A 3OYEA 3Q8BA 4EEFG 1VBC1 4XZUG 5D8AC 2FDKA 3C2GA 4IGPA 2ZA9A 2YPRA 1NAEA 4DEQA 1BBYA 3N9NA 3RDIA 3CL1A 4AQSA 4GMP3 3CU7A 3GTPJ 1JN2P 2F6BA 4ZTFA 2GA1A 3AYAA 4BJTA 4FI9A 4BZ4A 1Y43B 2P34A 1K45A 5F3IA 3W5MA 3RZDJ 1HB2A 2CQ7A 3LEKA 3GTKJ 2VQHA 4XBNA 1OR7C 4A4AA 5J4VA 1UN1A 2GH2A 4U36A 4UV9A 2JG8B 5FYVA 2UV1A 1JYWA 2V1DA 1PVXA 4Z82A 3NNLA 2HWF2 3DKXA 4IE6A 2NP0A 1WRJA 1WCQA 3Q9VA 4HANA 3FFZA 4D5CA 3D5RC 4Q4V1 5AVAA 2X6OA 3X2QH 4NR1A 4HA8A 1HV1A 4KIFA 1VQ7I 2WWSA 2O6GE 2IS6A