2GZWA

Crystal structure of the e.coli crp-camp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
200
structure length
200
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of activated CRP protein from E coli
rcsb
molecule keywords Catabolite gene activator
molecule tags Transcription
source organism Escherichia coli
total genus 63
structure length 200
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gzwA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gzwA01
4P9FA 1SD7A 4GGGA 2VT3A 2ISYA 3C1DA 1VP6A 5JSRA 1TQIA 2B0LA 2GAUA 3UKVA 4RB2C 3EYYA 2C0ZA 2O8XA 4MGIE 4R8HA 3FMRA 5CVJA 1NXMA 2HWVA 3I53A 3PVBB 4B09A 2A68F 1LRHA 1J3QA 2XLGA 2FQ3A 1J2XA 5BMZA 4LTAA 3HHGA 3IWZA 4PIXA 1KQ0A 3MYXA 1HW1A 6PAXA 4QMAA 2RV8A 3DEUA 1XE8A 2H94A 1EP0A 5TRDA 5I8YA 3KP2A 3KE2A 1CF7A 1PDNC 2IXJA 2UXXA 3GWZA 1B1BA 4Q0QA 2CG4A 2BEOA 2GZWA 3M70A 3C3WA 2Y0OA 3UKTA 4A6EA 5D5XB 3ZPLA 1I27A 5E1XA 2ZMEA 3MZYA 3TQNA 1HBXG 1UB9A 2K7LA 3F23A 1ZRRA 2RQPA 1H1MA 3V8LA 4FAGA 2OAZA 3CO6C 4A6DA 1L3JA 3OGJA 1YLFA 2W24A 1IAWA 3V8KA 4I3PA 2QQBA 2A61A 2FE3A 1Y3TA 2OZUA 3CUOA 4HLXA 3ZMZA 1OI6A 5HLGA 5F1RA 1EH6A 3S7IA 5DCFA 4PDKA 2P5LC 4KT5C 1FYLA 2MC3A 4BNCA 1EH7A 1T6SA 4KDPA 1ODDA 1XGSA 3GZ6A 4L0ZB 3RYKA 5J3UA 4K2EA 1IUYA 2M8EA 4G7HF 2A07F 3H3ZA 1J0RA 3LA7A 5LRSA 1UD1A 3TO9A 3F72A 1RI7A 1FBUA 2EFNA 3OOPA 5JR3A 5ILUA 2O8QA 5FLHA 2MBFA 4HSJA 1CX4A 3I64A 4WZCA 4OIPF 2V1UA 1O3SA 2V1XA 2MH9A 1ZZBA 3SZPA 5FLXK 3IRQA 4UV9A 5LBQA 2DFIA 4AD9A 3ZQ7A 1YW9A 2MHFA 1XB4A 4UNOA 5I8SA 4HYEA 2Z99A 1CAUB 2Z33A 3U9GA 3O2PE 1XN7A 5JVTA 1YHFA 2M1BA 1B4AA 2MLKA 5L3DA 1BBYA 3U10A 2M30A 2QNKA 4KN4X 3PQJA 3QPHA 3RIRA 3HOSA 1Z91A 1UHWA 1NE4A 1U5TA 4KIFA 1UHMA 5HS7A 3IDBB 4HMZA 2WWYA 1ONVA 3O14A 1R5HA 5K5RA 5KHKA 4DNCA 3ZDSA 2E7XA 1VTNC 1J5YA 2CYYA 1REPC 4RGUA 3WTXC 2QBYA 3NEUA 1H0MA 4TV7A 3GVAA 3BY6A 3CO2A 2IC1A 2H09A 2VONA 2FBHA 1IN8A 3H8UA 4WK8F 4P9GA 1S8NA 2NYXA 4ESFA 1SD6A 2ZFWA 2LSOA 3FM5A 2IVMA 4EM1A 1IW7F 3FE5A 3UKNA 3HHHA 2GC0A 4FHTA 2OZ6A 1MKMA 5E17F 5ED4A 3L9FA 5JHUA 5IT9K 1DZRA 2HS5A 4EJTA 5C8WA 4TLFA 3RKYA 2QQAA 1CAVB 3MCZA 1ZAOA 4JBAA 4AIKA 2DW4A 4MZUA 2COMA 4BQAA 5LEKA 4K8FA 5H20A 4FX4A 3K9TA 4Q47A 2KIMA 4IEUA 1YG2A 1D5VA 3RI4A 4ORFA 3CLPA 2HJIA 5D8LB 1MZBA 5K1YA 3OD0A 4XF9A 1V70A 1BJAA 4PGHA 2O6GE 3IDCB 2D5FA 1XCVA 2FOKA 2Q8KA 2OPKA 4BAYA 4LA3A 2UWMA 4RB0A 1MD0A 1UW8A 1CAXA 2AS5F 2MPFA 3KFWX 3GFLA 5EEHA 4I09A 3L7WA 1IN5A 4N9IA 4MX3A 1QXRA 4J1XA 3HT2A 2JTVA 3BPXA 3MPBA 4HV5A 1XCBA 4XLPF 4CDGA 4AQ6A 1OYIA 4O3MA 1ZLJA 4HOBA 3FM3A 1RNLA 5CVUA 2P5KA 2B8MA 1CGPA 4DQ2A 3P9KA 2OU2A 4M9SA 4HX8A 3KMHA 1BIAA 1HXDA 4RAZA 2YR2A 2BNNA 3EQEA 2XAFA 3E5QA 2GIVA 1J7KA 1RZ4A 4HX4A 2PHLA 2D40A 3BB6A 2EFOA 2O0YA 1FY7A 3KLOA 3WODF 1KYZA 4HVOA 5DD4A 4G8XA 4U88A 1KYWA 3FHZA 1T0FA 2GA2A 1LDJA 4ON0A 4WCGA 1LB2A 2BBYA 2HDCA 2YU3A 1KU9A 3TO6A 2IP2A 1ZZ7A 3LQRA 2DT5A 4KU7A 2BYVE 2EV0A 1B9NA 3Q9SA 2L4AA 2LNBA 5A2QZ 5CVRA 3NRVA 5LGTA 3VFZA 2D1HA 2D1VA 1Z7UA 1B6AA 3CDHA 4UHTA 3V7RA 5I93A 3GEZA 1U78A 2K9ZA 4F8AA 1D8JA 4ZZDA 2PHDA 3ECHA 3M8FA 3D0JA 5FDBA 4L9TA 2EFWA 1HKSA 3BOQA 2PQ8A 4OFGA 3DP7A 1BIBA 4EJOA 5FPXA 3KP7A 3J81K 1B59A 2BGCA 2PBIA 3C7JA 2F5FA 4EGYA 2VBWA 2FNAA 3NL1A 1RUNA 2QLZA 3R6SA 3TNQA 2OQGA 3GW2A 1LDDA 2HQRA 1IRGA 3R0JA 2VT2A 5D4SA 3I58A 1IXRC 4XFCA 2CV6A 3I59A 2D45A 2ZXJA 2PQQA 1LEBA 3L00A 4ZYGA 1W7PD 2YX7A 2DQLA 3T5XA 2F2EA 2EA2A 3KP5A 4JV4A 4CHUA 4XF1A 5DUKA 3T8RA 3NSTA 4KYWA 3H1YA 3WE2A 1YW8A 2VE8A 4HLTA 4EWAA 4LGWA 3ELKA 1BOAA 3QRFF 3EDPA 2IXHA 2XUBA 4IEPA 3KZZA 1XSVA 3MZHA 1YYVA 1TBXA 4LG0B 3ZMVA 4M74A 5AIPA 1DP7P 2P7CB 2Y0MA 2DTRA 4MH0E 1MDMB 1F5TA 1UIJA 3FMQA 2IJLA 1CAWB 4Q0SA 4YRDA 4X6QB 5FO5A 1FXZA 4KU8A 3TO7A 3CUQA 2V79A 2LF8A 2H0VA 5JSPA 3COAC 2DO7A 5A2QK 1JUHA 1S29A 4RAYA 5LHHA 3U11A 2F5EA 4KA4A 1ZH5A 2WC2A 2PMHA 2Q4SA 3HRTA 3GYDA 1HKQA 2VN2A 4A5NA 3W6JB 1IRFA 5BY5A 4MTEA 3P9IA 3GX4X 4A0YA 4JTOA 5ILVA 2J5PA 2HR3A 2KRFA 1UIKA 2EFPA 3BALA 2XKPA 1I1GA 3IWFA 2STWA 1I1SA 2KIUA 4AVBA 1Z6TA 1LDKB 2PI0A 1ZX5A 2E7WA 1OFNA 4HVRA 3J80Z 3R0AA 1LEAA 2PAEA 1TQPA 5HI0A 2PFBA 4IPAA 1W7PA 4OMYA 4LB6B 4IHSA 1RIOH 1PP7U 2ESNA 3J7AO 2QENA 2EV6A 4BHCA 1TNSA 2P6TA 2MD5A 3ZMUA 5K5QA 5H6QA 3EETA 1L0OC 4O9GA 1ZGJA 4OMZA 4A12A 3ES1A 4YG2F 1IZ1A 1EYBA 4ETSA 4QGMA 4G6QA 2EV5A 1WA4A 4JVAA 2VQAA 4AVCA 4UVBA 1J58A 1R22A 4M71A 3KETA 5BUVA 1ON2A 1TLHB 3L2HA 3FHIB 4MUVA 2QJVA 2X0LA 4ZU7A 2CWEA 2D93A 5HDGA 2ZKZA 4DINB 4P5OA 3I7DA 4HQMA 1O5LA 1Y0UA 3IHUA 2RC4A 2JPCA 2XHKA 3FWEA 5D1IA 4I2OA 2HYFA 3VHRA 4CGZA 1D8KA 4AQ2A 1ZZCA 3F6VA 1YLLA 4N9HA 5E18F 2P5VA 1FSHA 2DBBA 5KHGA 4Q48A 1J75A 2ZCWA 3RYPA 3E97A 2Z3YA 3EYIA 2XAJA 2IA1A 3RJPA 3HUGA 5LHGA 4EJVA 2R3SA 1IN7A 4M6XA 1FLIA 1QQIA 5FB2A 5KHHA 1LR5A 1PMIA 3V4GA 3KGLA 1X8EA 2YX4A 1DGRA 3NJZA 4ZH4F 1Q1HA 1SFNA 2Q1ZB 3H7YA 3CL1A 1J1LA 1SD5A 3ZMSA 2XLFA 3QPTA 2KKOA 3CUQC 3SMHA 5ICEA 2DPUA 1B9MA 5JFRA 4WWCA 1X7NA 4EQQA 3GXOA 4IEYA 4MHGA 4IXAA 4Q0PA 3B02A 4FAHA 3ERED 5L3EA 3IL2A 3IRRA 4A2UA 4KWKA 2IXCA 1ZZ8A 5DCMB 3LA2A 4WX9A 1MJAA 2OZJA 2FA5A 4Q0VA 3DL3A 1R1UA 2DLLA 5LRRA 3SXYA 2ZMEB 4XSXF 5HOOA 1X8MA 2FEZA 1O5UA 1DUXC 4P55A 3M9AA 3KSCA 5ERIA 4ENKA 1R00A 3CLOA 3ULQB 3HYIA 3Q5FA 4XFGA 2VBXA 1K7AA 1NHAA 3LOIA 4CYDA 5FLIA 4WVZA 3ABUA 1XRUA 4M6YA 4IESA 2OA4A 4IVNA 4I01A 1YFXA 1YFYA 2FRHA 2F5DA 3H3UA 2IXLA 2ZKLA 4ZU5A 5E1RA 2BNOA 4CXFA 1KU7A 4YNIA 4L18B 4L9JA 4LLOA 4R52A 1ZLKA 4JK1X 4OIQF 5FFZA 5FD6A 2FBKA 5BOXA 4OU0A 3E6DA 2IXIA 2EK5A 2ACJA 1CAUA 1S7AA 2ATFA 2KXLA 4ONUA 1STZA 1XD7A 4LD5A 4ESJA 1WQ2A 3LSTA 5ILSA 4UBGA 3GFJA 5DEQA 1XE7A 5I91A 4YIIA 5L3FA 3RTRA 3REOA 4KN7X 4PGGA 1YTYA 3C3VA 4ENJA 3TDZC 3GYHX 4G9YA 3F8FA 1IF1A 3FJSA 4PIZA 1ZNPA 2NNYA 5D6FA 4Y17A 2W57A 3QU3A 5I0TA 3KLNA 5JSOA 5FQ0B 3ROUA 4ZZLA 5D5WB 2IA0A 3F8MA 1ZARA 3BROA 1R36A 1LQ1A 2DCTA 5E20A 2FBIA 2ISZA 2UYAA 4G7OF 3SXWA 4IF4A 4IRHA 1ZRDA 3P7NA 3JAMZ 2NNNA 5BS6A 3QOPA 4FX0A 2DI3A 3GBFA 4HN0A 2IPQX 3CF6E 3WW2A 4XFBA 3ZN0A 1CAVA 2FNPA 3NVCA 2E9QA 2VPVA 2W84A 3LQQA 5LLQA 3JTGA 1X3UA 4IEXA 4OOIA 1Z05A 1W5SA 3QP6A 3EJKA 2EJRA 3FF5A 1G4DA 3RNSA 3D0SA 1BC7C 2CSOA 3OV8A 4O5VA 3O6BB 5D5VB 2FF4A 5J7MA 1S7OA 5JI6A 4H0EA 2NS0A 1XMAA 2PJPA 2YSRA 2LF7A 3OTFA 3MWMA 1O4TA 3S7EA 3DN7A 2VC0A 3F21A 1Z9CA 1JHFA 4HW0A 3SHRA 2HKOA 4LK0F 2Y48A 4OIRF 2G7HA 3M1EA 1UPIA 2B9UA 4R79A 4HQEA 3USSA 4FBFA 1U8RA 1NE6A 4XEZA 3ECOA 2XAHA 1C0WA 3F8BA 4LFUA 4E70A 1FYKA 2ESHA 5I0SA 2V1DA 4ENMA 5DDGA 3PQKA 2ET7A 4Y15A 4HV6A 3S2WA 2UYBA 2VECA 1USTA 4XFHA 1U2WA 2NAZA 2ZNZA 1DGWA 1FP2A 1J3RA 5BXXA 3K1PA 4ZYDA 4WF2A 3EQLF 4YSFA 1JHHA 3SCGA 2UY9A 3MEXA 4L5JA 4IERA 3S0MA 1XSDA 4BHBA 2ZBKA 3K1MA 3MFKA 4LB5A 1F9NA 1USSA 3ABTA 4LEJA 2K27A 1DPRA 1HSTA 3IBMA 3IIAA 2UY8A 1FYMA 2EB7A 1FBQA 4EWDA 3WTUC 4EV0A 2PLYA 1QBJA 1YWKA 3JAMK 2FQPA 3E5UA 4QWQA 2OQRA 1GQGA 1FPQA 1I5ZA 1HW2A 1G6NA 2VXZA 4AIHA 1U5TC 1FBSA 1F1ZA 4AIJA 4HZFA 2JRTA 2WV0A 1UFMA 4EJUA 2TDXA 3SCFA 1U12A 2C6YA 1TTYA 4BXUA 2WTEA 4RGXA 3T1BA 1O7FA 3TOAA 1KGSA 4RGSA 1G3WA 2EFQA 2NRAC 1XMKA 2XAQA 4UXNA 1F4KA 4WXDA 3FFQA 3ML6A 3QACA 3T8TA 3WW3A 3L2CA 1J59A 3G73A 3M7GA 4ENNA 3FZ3A 1WWXA 4QXKA 2AXLA 2DQRA 4IRIA 1EV7A 1W4MA 4MGRA 5F64A 1XSXA 3F8NA 4UVCA 5FLJA 4CO8A 4M9XA 1DPUA 3N4MA 2PYTA 3KEQA 4D0PA 1ZHFA 4RGRA 2XGXA 4WXCA 2RDPA 5HLIA 4MV2A 2PTMA 5I8TA 4KWLA 2ETHA 3KP4A 5LGNA 3RPUA 2GU9A 4ESBA 2OYZA 1MGTA 1QY4A 2ELHA 3HOTA 3E6CC 3E3VA 1FX7A 3IKTA 2Q0OA 3FX3A 4QGNA 4XETA 2Z2SB 3R61A 4NQWA 2J5OA 2P7VB 4E2QA 4EWEA 3M3IA 3CEWA 3FXRA 5ICGA 4QX5A 4LG0A 3BP8A 3JZVA 4UBHA 3V7CA 1MDMA 3E5XA 4U0WA 2L4MA 4NHJA 4GCVA 2PA7A 1J9IA 1YUDA 2XIGA 1OPCA 5KHIA 4J1WA 3H7JA 5JAXA 2YPRA 1CAWA 4Q29A 1IN4A 2RVCA 4MGYE 4IEWA 3ZMTA 3WTTC 4KIBA 2P4WA 1P92A 4LLLA 4BH9A 4Z2YA 3LAJA 4E2SA 3F6OA 5HDNA 3MDPA 1P4WA 2P17A 4YFNF 2P8TA 1XGNA 2QDRA 2MA3A 2RKHA 2XAGA 1Q43A 4L0YB 3HSFA 5K5OA 4I02A 1XDSA 4M9ZA 2STTA 2W85A 1IPKA 2G7UA 1O57A 4GULA 1X82A 3TGNA 3KGZA 5E1WA 4Z82A 3D5LA 2ZJ2A 3CUQB 4ASNA 1EH8A 3H9AA 4Z07A 2QM3A 4EMSA 1MJBA 4XF4A 3WTWC 5HS8A 2Y75A 1PM7A 1TQMA 2Z5UA 1GQHA 2CO5A 3HRUA 2K0GA 3GO5A 1G3TA 2L3DA 1OR7A 4EROA 3I54A 5CLSA 3SHFA 2L01A 3IKVA 3K2ZA 4IJAA 4EJWA 2WFPA 3HRMA 5E1ZB 3LZZA 2VODA 4I98B 5LHIA 1OYYA 4A0ZA 3B73A 4AVPA 1K78A 1SEFA 1GHCA 2RNJA 1R5GA 2HZTA 2GC1A 3HRSA 3SFZA 1DZTA 1EY2A 3HQXA 3G7DA 1FT9A 1WKMA 1BI3A 1DDNA 5L3BA 1K79A 1XGOA 3U2RA 3KZYA 2UZKA 1VR3A 5DV5A 4YFKF 4XFFA 1T38A 1U3EM 3U1DA 5C6CA 2K4BA 3NKTA 4YARA 1HSJA 3LA3A 1T2KA 3VODA 5F6FA 2FSWA 1QWRA 4MTDA 5ICFA 3RPQA 1G3YA 4ZU4A 2CAUA 3W6KB 2D5HA 4IEQA 5L3GA 1QZYA 2Q30A 3EHKA 2E1CA 3WTSC 5BV6A 2A6HF 3U0ZA 3WGGA 4IEOA 4HVQA 2E1NA 4LUKA 3I5UA 2V09A 4HBLA 2OD5A 3AAFA 4MQVA 1YFUA 3R60A 3RKWA 3HSRA 3H1WA 5FLXZ 4GO1A 1BI2A 4M73A 4G7ZF 1YIOA 3HIFA 5BQTA 3RKXA 2P6SA 4LLGF 3ST7A 3H1MA 4QM8A 1Q3EA 4KMUX 4XSZF 4UVAA 3KP6A 3KP3A 1ZG1A 1SQ4A 5I0UA 2HTSA 3J80K 1RL3A 2Q2EA 2O1QA 2Z69A 1CF7B 4XRFA 5JR7B 2PAKA 1LKNA 4Q0UA 3GFIA 3RYRA 4LLNA 4KIGA 1EPZA 4YFXF 1SFUA 2GA1A 2MLGA 1TW2A 3V8JA 4MGKE 3GF2A 4XLNF 2HFHA 5DCMA 3D82A 2BNMA 5AVPA 4LUMA 2EWNA 3FZVA 5D4RA 1QZZA 1VJ2A 2GXGA 2PMUA 4R1HA 4HAMA 4Q4ZF 2G9WA 1QNTA 2OA2A 3QP5A 5EFUA 5D5UB 3BJOA 2JPBA 3H92A 1R1TA 3LAPA 3TDUC 3T0YA 3BU7A 5E8GA 1D3YA 5BPIA 1GXPA 5IT9Z 1FWZA 4U0VA 2VC1A 5J8FA 5HLHA 1IN6A 1AOYA 4GYGA 1ZYRF 2GC2A 2GH2A 5CJ9A 4HN1A 1WRJA 2PFWA 2KJCA 4N0BA 2W25A 2HGCA 4D7SA 1XGMA 5HVQC 1R58A 1IXSB 1SMYF 3BWGA 4AVAA 4KMFA 3E6MA 2QZ8A 1BC8C 1WLTA 3DV8A 4HBNA 4XBFA 2LKPA 1TW3A 3BCWA 4JTNA 5AONA 3RZZA 2MH2A 5HS9A 4ZYEA 3WTVC 3VOEA 1E2XA 3OCPA 1I6XA 4G6DA 4UV8A 1JXSA 1Q5OA 1Y9QA 2XROA 5D6EA 4HDUA 2PEXA 5LEJA 3WU0A 3BPVA 1SFEA 5I0RA 2FMLA 2DAOA 3HTUA 1YS6A 3EUHA 4KL1A 2O3FA 1JE8A 5J6XA 2F4PA 1H9GA 1GXQA 1S6LA 3K1NA 1R23A 2DPDA 5DUIA 4MEXF 2ETEA 2XL7A 5EZWA 4YIFA 2IT0A 2FMYA 2QYOA 1RUOA 3PNAA 1S3JA 1KU2A 5FQ0A 3QAHA 4PZJA 1U5TB 3ETQA 3WTZA 4U0YA 2ZNYA 2QQ9A 3PFIA 2PAMA 5CADA 4YYOA 1UCRA 5CVIA 4NVPA 4U7BA 2QBYB 1Z6RA 4RS8A 2CW0F 1ZG5A 3EO6A 4QLCU 3ACLA 4XFIA 1OYWA 2XKOA 5E16A 5K8SA 3Q9VA 1R7JA 2IXKA 4EGZA 2VE9A 3CJXA 3I71A 2OBPA 1BI0A 2M5WA 4P96A 2LDUA 1FC3A 4PIYA 1KU3A 3SCHA 4L5IA 2L54A 2RGVA 3ZMDA 1YS7A 4G94A 4BIFA 4IETA 2DK8A 5D8KB 1QGPA 4AXOA 1KA8A 2M45A 3K0LA 5CU1A 3TOBA 4L11A 3N97A 4MEYF 1LNWA 2XLAA 1ULYA 1JGSA 3BZ6A 1HKTA 4XF0A 1BI1A 3WW1A 2A6EF 1RTVA 4HDVA 4META 2M87A 1ZVFA 2H27A 2V9VA 3BPZA 3WW4A 4QM9A 3ZP5A 3J81Z 2QVOA 2PG4A 1YFWA 3BJ6A 1WSUA 4XFAA 2K02A 3DXJF 1CAXB 4MQ9F 3DPLC 4IEZA 2QCSB 4L2NA 5DYMA 3C18A 4GXOA 4OIOF 5TJJA 5EEGA 5AIQA 4BHPA 1SD4A 3TKYA 2K4JA 3KEOA 2EA7A 4M72A 5HDKA 5T3NA 1L3LA 3MQ0A 2V6CA 4UUVA 2X4HA 1WI9A 4S05A 2VBYA 2CAVA 4I0BA 4D7TA 4X6RB 4HF1A 1FSEA 5KBFA 5FCCA 2QVSB 2XVCA 3MAJA 1LVAA 2JSCA 3WGHA 3O3KA 4KICA 2D2WA 2VOPA 4KNYA 1ZG3A 3ZN1A 3DKWA 2PN6A 2HYGD 2H6CA 4ZYHA 1OMIA 3JSOA 4EM2A 2GQQA 1KQ8A 2XV4S 3CO7C 3WU1B 1HW5A 2IA2A 4KFCA 2EAAA 3ISPA 2K86A 3HTSB 1TNTA 2GC3A 4LMYA 3V7SA 1W5TA 4L9NA 1P6RA 5FFXA 4HX7A 4LA2A 5FPZA 4LJZF 2O03A 4CZZA 1XDUA 3NQOA 4EM0B 1ZZ9A 3L09A 5KVRA 2BE5F 1FOKA 1FNNA 1PUEE 1NYWA 3IC7A 1Z1DA 4B29A 4LK1F 1FP1D 2GWRA 2XRNA 2Z9OA 3JTHA 2EVXA 4NB5A 1TQ5A 3BJAA 4PJYA 4RB1A 3BDDA 3HT1A 1PP8F 2KJBA 5FD5A 2R7FA 1K6OA 2XL9A 1V3FA 1ZN2A 3M8EA 1T98A 3ELNA 1G3SA 2A3SA 3F8CA 3WGIA 4JQFA 2A69F 3H50A 3GFMA 3I59B 2RN7A 4RD7A 5LGUA 3RDIA 1MJ9A 1O3TA 1UCXA 4Y13A 1QO0D 3F3XA 2MNGA 5KHJA 1FZPB 4BYYA 1P4AA 3HSEA 3DFGA 1LJ9A 3E6BA 2HTJA 5BPXA 4S04A 4KUMA 1WGPA 4A5MA 3VEPA 3K69A 3LFKA 4L9VA 4KWJA 2DK5A 3NW4A 2ET1A 2VBZA 2FU4A 2BV6A 2HQNA 3P9CA 5ICCA 2HKXA 4I0AA 4HF2A 4UXAA 4RB3C 4AWXB 2GXBA 4CICA 4I7HA 4WXHA 4Q5SF 3CJNA 5CYVA 1R1VA 3KCCA 2HOEA 1NZCA 4QGLA 1QPMA 1ZREA 5E8IA 1V4RA 3LWFA 4EVIA 2IW5A 1YW7A 2XASA 3GUDA 4LULA 3I4PA 3SZTA 1T39A 2FXAA 3QU6A 1RGSA 2QUFA 2ADUA 2QWWA 3VB2A 3FXUA 2HEOA 1O3RA 3R4KA 4HA8A 5H6RA 4OLLA 2KIFA 4HSLA 4IEVA 1U6GA 1P2FA 1OKRA 4IRGA 2ZO4A 4HLYA 1QXJA 4WBBA 3OF1A 5IT3A 4O9EA 1J3PA 1H1IA 2H6BA 4GYIA 1BN5A 2CQKA 1AWCA 5DD8A 2Q0AA 4XF3A 4PCQA 1YFHA 5KK1A 3ES4A 3FMSA 2VOOA 2DU9A 4A0XA 4HF0A 4P9UA 4F7ZA 1O3QA 4FT8A 3CTAA 1RC6A 2O61A 2JT1A 1A04A 1SMTA 5BPDA 4H7LA 1GVJA 1O7LA 3G3ZA 2UXNA 3PLQA 3JW4A 1P4XA 3SQNA 2CFXA 4OINF 2L02A 3DF8A 1KQ9A 1W7PB 1H9TA 5JCTA 5CVVA 1HQCA 1ZRCA 1SFXA 1YO5C 1K78B 4IHTA 3WE3A 3EBRA 4O6JA 3F22A 2JZYA 1ZZ6A 5FGMA 4U7DA 1IPJA 1OD5A 2N7GA 2CGPA 1IXCA 5J48A 2EA4A 3LAGA 3WTYC 1ZRFA 3LWCA 1SAXA 3GZ5A 4E2GA 1YQAA 1ON1A 1BM9A 3DQVC 3JSPA 4MGZE 5L3CA 4MNUA 2R7DA 3FXQA 5J8CA 3GLXA 2B5HA 1ZGAA 3DPTA 2IRFG 3TNPB 1E17A 4B8XA 2F5CA 2A5YB 1FI2A 2I45A 3I0TA 3WG9A
chains in the Genus database with same CATH superfamily
4N43C 1IDYA 1C8M3 2VT3A 1YC61 5LK5A 1BBT3 5FTTC 2GAUA 5JLWA 3EYYA 1UG0A 2JA6J 2HWVA 2ZGRA 3B94A 2HBTA 3DEEA 5T5PA 1W2NA 1LRHA 2WNUA 1J3QA 2VLAA 3K70C 2ME6A 4DXSA 2FQ4A 2FQ3A 2QQPA 4CRQA 5BMZA 1US3A 1AR83 3CHXA 1DQUA 4BQOA 3I3DA 3MYXA 1HW1A 4KWUA 2RV8A 4GH4C 3RGBA 3NAPB 1ZKGA 3KE2A 1AR63 1PDNC 2UXXA 4Q0QA 4UB6C 2CG4A 1KXGA 4JAAA 2GZWA 2KPMA 3M70A 1PVC2 2Y0OA 1F4HA 2QFEA 1K5MA 1ULGA 4P9XA 2J1VA 1VNDA 3OBRA 2K9NA 2D6LX 3M4OJ 5GM0A 4MXWA 1KFXL 2C1FA 3KT1A 3OOXA 5FYBA 5D5XB 3T08A 1I27A 1KDKA 2AXTC 3MZYA 4AFAA 1H1MA 2ZX0A 2EXJA 5A7WA 3PIJA 1JTYA 1YLFA 1W8OA 4I3PA 3AZZA 1AYN2 1RHI1 1Z7S1 2HWC3 2TCTA 4CUAA 4JGZC 2JENA 4XMIA 5F1RA 3HQUA 2Q8OA 3RFRA 5DCFA 5FRMA 3O1PA 4BISA 4KT5C 1FYLA 3HR9A 3K2OA 1SFYA 2MC3A 2QBXA 3LIGA 5J3UA 1ODDA 2A5WA 3MV01 2PJRB 2OTLI 2JXAA 3H3ZA 1CVNA 3DEMA 5LRSA 1A8DA 1CIWA 3OYBA 1JODA 2MBFA 4HSJA 1IQDC 2QQOA 2V1UA 2V1XA 3Q3SA 1SLBA 5JIAA 1UELB 2E7TA 1C8M2 3A0KA 4IV3C 1BQPA 1BBT2 3IRQA 5LBQA 2L5QA 3LFIA 4AD9A 2JDKA 2WZR1 5T5JA 4WM8A 3Q0UA 2HDDA 5I8SA 4HYEA 5F0CA 4BE2A 2K3FA 1XN7A 4CCDA 3MFCA 1B4AA 5L3DA 3U4SA 1XB9A 2YZ4A 2QNKA 4YGBA 1H8TB 4AHWA 2OX0A 3ZFFB 1AR82 1QJFA 1DQ4A 3HOSA 2DUPA 2JE9A 1UZZA 2D6NA 5A7QA 2BQPA 2IGKA 5JVGF 3JRGA 2OPWA 1UHMA 4JX6A 3IDBB 4CYCB 2WWYA 1UY1A 2VOXA 1AR62 4I0WB 4XOTA 1REPC 1W9TA 2GALA 2QBYA 4RM3A 3B5LB 4TV7A 1W8WA 2BJSA 2DMNA 3BR1A 3CO2A 2H09A 3KWVA 3HBKA 4WK8F 2VVFA 4P9GA 4XOGA 4OI1A 4ESFA 1HQWA 2CWMA 5JZGB 3RZKA 2LSOA 2R7OA 1NCRB 4IL7A 3RSJA 2W1OA 3UKNA 4BCUA 2DJIA 2RVAA 2WZEA 3EXUA 2MGQA 1UXXX 1MKMA 5JHUA 1DZRA 1U5YA 5C8WA 5HLTA 2QQAA 2HWC2 4YW5A 3AMMA 2RR13 4BQAA 2BZTA 5LEKA 3HGYA 4QX8A 2E1OA 1T6BX 4FX4A 1QOTA 4AYBN 2Y60A 3RI4A 4ORFA 5T50A 5L36A 3CLPA 1MZBA 2E33A 1HA8A 4PGHA 1ZBE1 5DZEA 3IDCB 2D5VA 1DF0A 1RUH1 1SBFA 1XCVA 2Q8KA 5EGOA 5J3LA 3HGGA 1VAMA 1MD0A 2DMUA 3OUJA 3K7AJ 2AS5F 4CU8A 3KFWX 3GFLA 3K75B 3L7WA 4N9IA 1SCRA 1SAUA 2Q8EA 1ALYA 4AQ6A 2Y0SN 1OYIA 2PHWA 2QZ3A 5L19A 1ZLJA 4MIMA 3WD5A 4Y26A 2WZPP 3FM3A 1RNLA 4QDRA 1YOVB 2Y69H 2WT1A 4CDWC 4BQXA 2B8MA 3HNMA 4N90A 1XU2A 3U07A 1YQ6A 5IVYA 2V4VA 3KMHA 5GPCA 1Y9GA 4RAZA 3VZKA 1KJRA 2XAFA 4Q1PA 3E5QA 4MHUA 2DWRA 1J7KA 3NMBA 4JRAA 4D94A 3AYAA 1W8UA 3KLOA 5DD4A 2WFF1 4G8XA 3J7AY 2ZGUA 1KYWA 1COV1 3VBOA 4AI2A 2DOFA 3A23A 1T0FA 2VXDA 1MQTC 4ON0A 2PLV3 4CDXB 4GIQA 1FIPA 1KU9A 3TO6A 2DT5A 2WSVA 2BYVE 2EV0A 1VPHA 4BEHB 4GFBA 2JDZA 2I74A 3Q8CA 2EIBA 4L8QA 5A2QZ 5KR7A 1ND3A 4XKBA 3VFZA 4NR1A 3CDHA 1QRYA 2FMDA 3J7NA 3V7RA 2XBO1 2RR12 1JH5A 4F8AA 4YFWA 1U9OA 1UOBA 5FDBA 2EFWA 3FN9A 1TWGJ 5F9TA 4OFGA 3HZJA 3N35A 3KP7A 1B59A 2PBIA 3OIPA 3NL1A 1O8PA 1JZ4A 2LW8A 3TNQA 1JKOC 4RYDA 1CESA 1IO2A 4A3BJ 4J25A 4UFKA 5D4SA 3CF2A 1Q56A 4P1WA 2D45A 2IFRA 1LEBA 3L00A 5GTIC 1RC9A 1W7PD 2YX7A 4JV4A 4CHUA 2VXRA 4HG2A 2EAKA 4CP9B 4KYWA 5CFCB 3OYCA 3WE2A 4PJLA 4EWAA 4N43B 3ELKA 4B4PA 5IHRA 1IKQA 5FJ8J 3OJBA 2IXHA 4DBRA 5FPBA 5JOXA 3KZZA 2ERFA 1BMV1 4LG0B 4XC9A 3RZLA 3QH6A 1V9U1 2DTRA 3H0DA 1CPMA 4GRIA 1VQ5I 3FMQA 5J1YA 3MD2A 4YRDA 1WUVA 2PLV2 3JRAA 2P6HA 1V6LA 4KU8A 2LF8A 1LECA 3MEPA 2D6PA 5JSPA 4GH4B 1JJ6C 3OYWB 2R30A 3JQXA 1W6NB 5FMCA 3NJXA 1MBJA 4XKVA 5LHHA 2F5EA 4XLEA 2ECBA 4CU9A 1HKQA 4M3CF 3W6JB 3EUAA 4UWDA 4MTEA 3VBUC 4A0YA 2YC0A 2DUOA 3U37A 2HVSA 5ILVA 1IG7A 2KRFA 2EFPA 1UWWA 3BALA 4N7IA 4BQNA 3IWFA 2VZSA 2STWA 1NH3A 3U4XA 1QHHD 2HYKA 2RHPA 5FBJA 2R7QA 1Z6TA 2HI3A 1CPNA 2VO5A 3OB8A 5GKAC 1OFNA 1DQ0A 4Q27A 2PFBA 3SJMA 4IPAA 1BW6A 2VR4A 4OMYA 1YRNB 3HOYJ 4JGZB 4LB6B 5FY0A 2ESNA 1QH6A 3J7AO 3MN2A 5F7UA 4Y3OA 3EETA 1DCSA 3BTZA 4DYQA 3MPPG 3I49A 1GKBA 2PHUA 5C4WA 4AI3A 1O4XA 4QGMA 2NXNB 4G6QA 3CCEI 5FYIA 5HXMA 3PL0A 3NV3A 2VQAA 4UVBA 2WNVA 4QKNA 2QJVA 2X0LA 3OYJA 3N9PA 1Z0HA 1LUJB 2CWEA 4U87A 5C9AA 4BMBA 4IV3B 2GOXB 2RC4A 2XHKA 3FWEA 5D1IA 4I2OA 2E31A 3VHRA 1XPWA 2RS51 1D8KA 2IS6A 3WNPA 2X9DA 2XJSA 5JXJA 3BG5A 3RYPA 1R091 4B3NA 4NOTA 4XUPA 3RJPA 4QPOA 5LHGA 3CCLI 4EJVA 1IS3A 2IXSA 1IN7A 2CWSA 1BW5A 3PVEA 1QQIA 3UGGA 5KHHA 3W3CA 1STMA 4COVA 3ZYRA 3SQOA 1B09A 1AXYA 5EJ3A 4FOWA 5DM6F 3NJZA 4N7UA 3NQHA 3CL1A 3HM5A 2XLFA 4N4OB 5FYZA 1HOMA 2KKOA 5FYTA 4QQLA 3OYIA 5JFRA 2UU8A 2LKXA 3B93A 5JPMB 3OGRA 4HK8A 1RUI3 5FK8A 1CJDA 3FBYA 3OYDA 1ZA4A 1V55H 5L3EA 4OMDA 2VUJA 3ZYHA 4A2UA 4CCMA 2ZXQA 4AWDA 1CJPA 3LA2A 2OZJA 2AHQA 4Q0VA 3AKPA 1HB1A 2DLLA 4OI0A 3HNBM 3BC8A 5FMBA 4GMP1 1WVRA 1ST8A 3PNYA 1C1FA 2TBVA 1RUE1 3GTJJ 4XFGA 5FZ0A 5ERIA 2BOIA 1R00A 3CLOA 3Q5FA 5A7WB 5IVVA 1AYM1 3BR3A 2K3PA 2MABA 4CYDA 4E7HA 3SH4A 2E51A 5FLIA 1PGSA 1XG1A 3JRFA 4WVZA 4A3LJ 5FKCA 2CQXA 1XRUA 1GSLA 4UUTA 2IGNA 4I01A 1X1BA 4RGGA 1YFYA 2AH2A 1SDWA 3F9KA 1V54H 1VBA1 2BNOA 2ZJQF 1IDZA 2WY7Q 1KU7A 4ZDPA 1WMEA 3MI8A 4CDWB 3ZN5A 3AFKA 4LLOA 1XQNA 4R52A 3WY6A 1ZLKA 1Y1WJ 2FBKA 5GJ6A 4Z2AA 3T2QA 4FTBA 1CAUA 2WY8Q 4LBLA 4HFSA 5AFBA 1H4GA 4ASMB 4D5FA 4FCAA 3BT9A 4Y33A 1STZA 1FOXA 3ASIA 3R4SA 3ZFEA 1MNEA 1BKZA 5ILSA 5I91A 1AL23 5FKOA 2NS8A 5EV7A 2R5YB 1WBFA 1N3QA 5IAXA 3RRDA 1PGL1 3NNMA 4OUEA 4G9YA 3F8FA 4AW7A 1MQTB 1IF1A 1ODNA 2WS91 5CYYA 4PIZA 3T09A 2NNYA 3K2AA 2VM9A 3QU3A 2Y6GA 3KLNA 2E35A 4JYKA 1H1AA 2NN8A 5FQ0B 1PZ7A 5BNNA 1BXHA 2EILH 4PSWA 4IE0A 1MEC3 2OW4A 2IA0A 2VJ4A 3HJEA 2YMZA 1ZARA 3BROA 1R36A 1RUI2 5E20A 2A75A 3ZSKA 3L2WA 2CFOA 3ILFA 4NIDA 4G7OF 1CWPA 3JAMZ 3QOPA 2BWCA 3AVRA 2DI3A 3GBFA 2IPQX 3CF6E 2VC9A 4XFBA 3ZN0A 2K46A 2FNPA 4IO9F 5F3IA 1YHQI 5TSWA 1S9HA 1VF9A 3JTGA 2Y38A 4OOIA 1Z05A 1W5SA 2JJ6A 3G6JB 1LHVA 1R1ZA 2D3SA 4EJRA 2A6VA 3A2KA 3D0SA 2XGCA 2WAOA 3AP6A 2HOTA 2IVIB 2Q1MA 4CVUA 4Q4W1 4NRQA 3MMYB 5BNOA 4QAWA 2HKOA 4C2UA 3WQ0A 4OZXA 3M1EA 4UFJA 2Q5TA 4XAEA 3USSA 1AA7A 1NE6A 1N78A 5EWSA 2YU9J 1S1AA 4LFUA 2EH3A 4OZOA 2I5UA 2V1DA 2ET7A 1AL22 4RGAA 4OMCA 2VECA 4XFHA 2ZNZA 2BERA 1FP2A 4LBOA 4EN0A 5BXXA 5GAEJ 3O1TA 3F0CA 3SCGA 1G7YA 4IW3A 2RS33 2RE9A 5JXGA 1ORKA 4IERA 3S0MA 1XSDA 2ZBKA 1GBGA 3K1MA 4DRRA 2Z16A 5LA0A 3U75A 3RI9A 1JN2P 3ABTA 1OH3A 2K27A 3ABZA 1I50J 2D3RA 5CG9A 1HJGA 4V19K 1PX3A 1MEC2 1YWKA 1CX1A 3E5UA 3FMGA 1GQGA 1I5ZA 2HOAA 3VBFA 2VXZA 3AP4A 5DPNA 4AIJA 3VBUB 3ILNA 2JRTA 4BL0B 2VKVA 2WV0A 3SCFA 4TN7A 1U12A 5EYRA 4BXUA 4RGXA 3ALQA 2ZXWH 1QMJA 4B7KA 2EZLA 1MMDA 4B1LA 2NRAC 2MC4A 4A3FJ 5GZCA 2XAQA 3CQZJ 1DYPA 4HPKA 1F4KA 4FI9A 4WZFA 3VDDC 3QACA 3I2HA 5HCHA 3L2CA 1K83J 1HN1A 3UETA 4RA2A 1TP4A 3M7GA 3THCA 1REDA 3HAGA 4XMAA 1W3XA 2DQRA 2P5BA 1AX0A 1GT0C 1W03A 3MKWB 1MVQA 4LLFA 3TAYA 2BWAA 2J1EA 1LFPA 4LR4A 1ZHFA 3S5QA 2RDPA 3L2UA 4C1WA 5FOBB 4KT6A 2EZIA 3KP4A 1VIWB 4LO8A 2GU9A 4ESBA 3WVJA 5IK5A 2PMWB 5B5EC 3HN1A 2ELHA 4FQ4A 3SEPA 3E3VA 1FX7A 4QGNA 4BXFA 3R61A 3M8JA 4NQWA 4G9SB 4F93B 2P7VB 3RQ4A 1YIPA 2KR2A 3CEWA 3JZVA 4Y7NJ 3V7CA 3HBLA 2RS32 3E5XA 1MBHA 3W5NA 5JAXA 2YPRA 3PNVA 4MGYE 3POEA 4MGTA 3ZKYA 3MVPA 3ILRA 4QPGA 3MHZA 4KIBA 5A32A 2GNMA 4LLLA 2K40A 1UMIA 4GXLA 3OYNA 4YFNF 1XGNA 2QDRA 4QD2A 3UNPA 5FYMA 4M3CE 4L0YB 3HSFA 2YPDA 4M9ZA 1JTZX 2DFFA 2G7UA 1O57A 2YUSA 1N25A 2R92J 1TZOA 2X10A 4AI8A 2Y34A 3D5LA 2ZJ2A 3BCAA 1YITI 2QM3A 4XUTA 5DG1A 3WTWC 3G1LA 4D6RA 2HWB1 2CO5A 2K0GA 2WB1A 4JDNA 4EROA 3NWKA 4C3HJ 3AL6A 3OEAA 3EUKL 3H5NA 4LHNA 3AG2H 2WFPA 1BK1A 2AACA 5E1ZB 3LZZA 1L7QA 2M4GA 4M0NA 1DGRM 4I98B 3ZM8A 4DXRA 5LHIA 5JMOA 5FUPA 4G6TB 1EKEA 1D7PM 1GHCA 2RG4A 1NK3P 2BUKA 2RM23 4W1UA 4FE7A 4JQRA 5DDJ1 5FWJA 4XN3A 4XIDA 1D0XA 3SFZA 1DZTA 1A31A 2VW1A 1GUUA 1H2NA 1DDNA 2E6VA 2W48A 4FOQA 3B3QE 1XGOA 3AG3H 5GLZA 2UZKA 1VR3A 1WW7A 4B47A 1T38A 3TL4X 1U3EM 1A3KA 3ZSEA 1QVTA 2GMMA 2K4BA 1SEUA 1JHJA 3LA3A 5JXHA 1T2KA 3CMGA 5F6FA 2R7EB 3WCSA 4A3XA 1X3ZB 2VGDA 3ZFGC 4Q4Y3 3RPQA 5C3EJ 2VUAA 3PVOA 2IEKA 1M06G 3W6KB 2Y26A 1JHNA 3BG7A 4S2DA 3VD3A 3UESA 2E1CA 4QQ2A 3KHCA 4HVQA 2EPFA 3POJA 4WVWA 5EEAA 4MQVA 4AFCA 5LY1A 5IFTA 5IP9J 1A36A 3HSRA 3C7HA 2YGLA 5EIYB 4GO1A 1XMXA 2VW2A 4G7ZF 3BTYA 1A6QA 1YIOA 1ZA7A 2ARXA 3KCXA 2RREA 3U21A 5LWBA 3M4FA 2X1DA 3CCRI 2YHJA 4D6SA 5K7PA 3G71I 5LA9A 3KP3A 2OPTA 1ZG1A 5I0UA 2BGPA 1RL3A 2NPIA 3J26N 1PYVA 1UO9A 1PZ9A 3IAQA 5JR7B 1LKNA 4FXKB 3UNGC 4LLNA 4KIGA 4YFXF 1UF2C 3NJYA 4A44A 1TW2A 3GF2A 3UL2A 4XLNF 2ARCA 3D82A 5DAWA 4AHXA 4LUMA 1QZZA 2GXGA 1YEWA 2RM22 4HAMA 1UX6A 3EYPA 4OYUA 3AKZA 2CV1A 2F48A 3M1CA 1TE1B 2LRDA 3H92A 2I10A 4NJ4A 2M34A 4IV1A 3KM5A 1IN6A 3OS2A 1AOYA 1AXKA 4A6SA 4IHYA 5GLWA 2HWF3 5FO7B 4Q4Y2 4HN1A 4OHWA 5FZMA 2PFWA 2CS3A 2KJCA 4N0BA 2E26A 5FUNA 1PNFA 1R58A 4ZDOA 2I07B 1SMYF 3E6MA 1UOGA 3CLQA 3UJOA 1TW3A 4FISA 5FZIA 3CMMA 5FP8A 3RZZA 5HS9A 3DKYA 3N9OA 3JRHA 1F31A 1E2XA 4UV8A 1JXSA 5HNFA 1Q5OA 4BK5A 2XROA 4HDUA 5KXBA 4BZ4A 2LMDA 4W6YA 2V6EA 1SFEA 2DAOA 3HTUA 1YS6A 2EXIA 2RS13 3EUHA 2O3FA 5BNGA 5J6XA 2F4PA 3ZXDA 2ZB9A 1POQA 3NV4A 2M7AA 2R7SA 1H6YA 3K1NA 2DU0A 1R23A 3MUY1 2DPDA 5DUIA 5A3WA 4MEXF 4CU7A 5SV8A 2IT0A 2FMYA 3DPRA 3QD6A 2OUJA 5EXOA 3BTXA 3LEKA 4DYRA 2B9VA 3J8F1 4GKXA 1T8IA 2DVBA 1GP4A 5GLVA 2D98A 2R7WA 1RUC1 3CD6I 5J4VA 3S3NA 5GALA 4ANJA 2ZNYA 2QQ9A 2PAMA 1W6QB 2W5FA 4NVPA 2ZX2A 3A4CA 4CEWC 2XB0X 1GV5A 1BHGA 1Z6RA 4RS8A 2CW0F 4RBOA 2LS6A 2VZQA 4CA9A 4QLCU 3ACLA 5L7OA 3VDDB 5E16A 1R5ID 4UW6A 3PMSA 1WGXA 5A6XA 2EIDA 3I71A 5IUQA 3PUFA 1H8AC 2WLPA 2M5WA 3WF1A 2VOWA 2ZABA 2LDUA 1FC3A 3GZTB 5IATA 1TL8A 4Y1UA 4L5IA 1YS7A 1VB2A 4G94A 4IETA 3LSGA 2NVUB 3K0LA 4XABA 2JUGA 1BVP1 1CN1A 1LNWA 3NKGA 1F5FA 2XUMA 1X9TA 1A35A 2LR8A 3BZ6A 4AM3A 2V5YA 2HWF2 1XC5A 2FBEA 2DYRH 1IZ3A 1ZVFA 3C2UA 5AC91 3WW4A 1D4M1 2PG4A 1ULFA 1YFWA 2YBSA 3MKYB 1MS8A 3DPLC 1TNFA 1S7EA 3C18A 3AP5A 4OIOF 2YG0A 4C0HA 4HONA 2EA7A 1VQ4I 2RS12 1QJU3 5FJHA 5HDKA 1RVF3 3SKVA 3HDDA 4XCBA 2V6CA 4UUVA 3OGSA 3ZSLA 4S05A 2CAVA 4I0BA 1AJKA 2R0QC 4IE6A 1OOPA 1FSEA 5KBFA 2D7FA 2V1NA 5FIXA 3JXSA 5L9VA 2P0WA 2W95A 2LH9A 4KICA 2D2WA 3NV1A 4KNYA 4FFGA 5FZFA 3CP2A 3T4HB 2PN6A 3USUA 3N9QA 1H9PA 2H6CA 3S5AA 1C1LA 3ZXEA 4YZ3A 3UT0A 4EM2A 3AL0C 3TW6A 2NS7A 4HKWA 1D4VB 3WU1B 3DPRC 2IA2A 4JC1A 5FZ7A 1UZCA 1ULDA 2GC3A 4LMYA 1W5TA 4L9NA 3GBGA 3B6CA 3W58A 5JXIA 1ZR2A 4HX7A 4LA2A 5FPZA 2IS2A 4LJZF 1ZM1A 5FZCA 2DA2A 1FNNA 5KHDA 2ZX4A 3ZYIB 3IC7A 4UY8I 4LK1F 3WINE 4PJJA 2GWRA 5FZLA 5B66C 1GDTA 5HCAA 3HT1A 1XU1A 1EV11 2ID6A 2KJBA 1DG6A 2ZGTA 4YWAA 1K6OA 1OLRA 3FHQA 3WX5A 1ZN2A 2M9HA 1G3SA 2JEMA 1E5IA 4JQFA 4LG3A 1ETOA 2PXJA 1S2EA 2HVRA 2G19A 3I55I 3I59B 3ZFGB 5LGUA 3WQ7A 2XJPA 5KHJA 3LMMA 4BYYA 2I8DA 2WIIB 1QJU2 2WRAA 1RVF2 4S04A 5LBFA 5A3PA 2A5ZA 4A5MA 4PQ9A 2VBBA 3LFKA 4AEDC 3FKJA 3LEMA 4KWJA 1Y56A 5FP7A 3AMPA 3MICA 4KBZA 2HQNA 1O8SA 5K7HA 4UXAA 3S3MA 3AZXA 2MSYA 4E7LA 3Q8BA 2ZFUA 1NZCA 1ZRIA 1QPMA 3RZMA 1U0AA 2IW5A 2ENRA 4YGEA 2H8WA 3FXUA 4HA8A 1WJDA 4OLLA 5B4XA 2XPWA 4AVSA 1P2FA 1NLSA 1URXA 1OOPC 4IRGA 3SDBA 4HLYA 4MHRA 4WBBA 4GJYA 1LE8B 5FYHA 3LCPA 3S1RJ 1XYOA 3J7HA 1BLZA 3VDBA 4BLJA 2Y6KA 3MW2A 1OBNA 4OULA 3A1YA 2B7YA 3TEZA 2DFHA 1E57A 4XPVA 1YFHA 1RETA 3KZIC 1SACA 1U5ZA 2W08A 4P9UA 1O3QA 1VLNA 1SLCA 2O61A 4AZZA 1MW7A 2IGOA 5BPDA 1YIJI 5A70A 3SZGA 4KJZA 3TEDA 5DS9A 5C7GA 2ADDA 3K4JA 2CFXA 2W52A 2L02A 1W7PB 2RAEA 1VQ7I 1SDDB 1FATA 1HQCA 2BV4A 3QYFA 3ZSJA 2BPA2 2BY2A 1GV2A 4BE3A 2RMU1 1IS6A 1EUUA 1QZEA 1BK0A 2FDJA 1O4ZA 4XM3A 3HJRA 3HVDA 1R6RA 2LYCA 2N7GA 5KC5A 2CGPA 4KBBA 1QNYA 2EA4A 3LAGA 2QQKA 3AJYA 3HMYA 1SAXA 5IWFA 1YQAA 3BR0A 1ON1A 4Y52J 1BM9A 3J7ZI 4MGZE 5L3CA 5KAIC 4MNUA 3GLXA 5J8CA 3T0AA 1G9AA 3DPTA 3D4KA 3PIOF 2XJRA 4QPIA 3TNPB 4X0GA 2ZOEB 3CIHA 3ZQIA 1Q8SA 2JIGA 5M5XJ 2ISYA 4AF9A 3LB9A 4GALA 5FXVA 3CNAA 2O8XA 2R7RA 5IYDJ 1NXMA 3LDKA 2HH9A 3PVBB 1RUG3 1W3VA 2PHRA 1J2XA 1HQLA 3H8OA 2LY2A 4LK6A 3IWZA 2X6WA 4PIXA 1Q1VA 4QMAA 6PAXA 4LHLA 4CEWB 4PLNA 4INDA 2QA4I 5J98B 5TRDA 3VHNA 1JW6A 3CCVI 3FXOA 3KP2A 5JDBA 2BEOA 1I3AA 4QX2A 3C3WA 4XOPA 4AI9A 1LU1A 3GNEA 2VZUA 2KM2A 4CE8A 4WVMA 2VY0A 3CJQB 4P5YA 3FFZA 2KIQA 1VQ6I 1EPWA 1QHDA 1WMFA 2K7LA 3BG9A 3ZN4A 1YCIA 4LO5B 4FAGA 2OAZA 4F91B 1L3JA 2A6WA 3OGJA 1OR7C 2W24A 4NIGA 4QTRA 5C3SA 3V8KA 3KX2A 4BJTA 2ADEA 1RUJ1 2MFZA 3WF0A 1OC1A 2OZUA 2D3PA 3T1LA 1K4TA 4XJ8A 2MEV1 4PDWA 3O1MA 1VMHA 2QQIA 3IH4A 2W1WA 1HDPA 4XN0A 1WH5A 1TWHJ 4R9CA 1PX4A 1ND2A 1LOFA 2JX9A 3GZ6A 2HPMA 1QJY1 4IKFA 1N77A 2A07F 2A1XA 5CPRB 3G4SI 1XPXA 1FBUA 2EFNA 3TOJA 5ILUA 5LW9A 1CX4A 1P7JA 1J09A 4OIPF 3DBRB 1O3SA 2FD8A 4QPQA 1RUD1 1LGNA 4XACA 1ZZBA 3N9NA 2YGMA 5FP3A 1JYNA 2OJED 3KZ4C 2B4KA 1XB4A 4PCRA 3O2PE 1VBB3 5JVTA 4GB31 2M1BA 1D2SA 4CSWA 1RUG2 3PQJA 3AK0A 5C33A 3QPHA 4QPIC 3POWA 1Z91A 2DJNA 2XVLA 1NE4A 4KIFA 4AQSA 3ZXSA 4CPBA 2X5IC 3ZDSA 2E7XA 1VTNC 1H88C 1PK6C 1OCTC 3AL0B 3WTXC 1UZVA 1UY4A 2XVKA 2R7VA 3NEUA 3DPRB 4HT1T 9ANTA 1H0MA 2L9SA 4GKYA 4FPFA 3GJAA 2JK3A 4PFPA 2MG4A 2D6MA 2FBHA 3H8UA 1OUXA 2X1CA 3TN93 1NZIA 3A0BC 1UL9A 4Y5TA 3M8LA 1MBGA 5FWEA 1A6IA 1HV0A 3HHHA 5CFDC 4BQQA 1ZTRA 3RZOJ 5ED4A 3L9FA 4M00A 4DZGA 1CAVB 4R9DA 3GF6A 4JBAA 2BXYA 2C9AA 1YJ9I 4D7YA 2B42B 2KZVA 3KYDB 2X29A 2O8OA 2VKEA 1BCXA 4ET7A 2JA5J 2BGOA 4K8FA 5H20A 2B45X 1FPN3 5M5WJ 3EMRA 2KIMA 1H9WA 4CCNA 1YG2A 2QCOA 2CH0A 5F5IA 3TBDA 5D8LB 5K1YA 3OD0A 1V70A 1BJAA 4M4RA 2D5FA 2OPKA 2R7TA 4CP2A 2UWMA 2EZKA 1ENSA 1GNZA 3OEBA 3HKZN 3OYKA 1UW8A 2JB8A 5E3NA 2BY3A 3HNYM 5EEHA 1IN5A 2A05A 2VZ3A 4MX3A 2DDAA 3A02A 1QXRA 4WM7C 4J1XA 3VSLA 3WQBA 3MPBA 5L73A 1OPMA 1HN0A 4XLPF 1OKQA 2AGSA 4AEDB 3PUAA 3THDA 1LOFC 1V6KA 1VMFA 5EPAA 5CVUA 4AG4A 4QQHA 2P5KA 1VBB2 4XZUG 4Y1ZA 5FV3A 1PMHX 3O8HA 3ETPA 4XAAA 4M9SA 3J4UH 1T2XA 3FISA 1BIAA 1IG0A 2JE8A 5A3LA 5M0TA 1MBEA 3PJQA 2YR2A 4XXPA 2VG9A 5JIUA 3EQEA 4BJ0A 4PJMA 3HQRA 3C7FA 4AYBA 2D40A 3AG1H 2O0YA 1NCQC 3T4VA 1FY7A 3R05A 1HB4A 3LEGA 2DUQA 4IQJA 3VDXA 2ARAA 2VQUA 2GA2A 5H2FC 2ZAAA 2J1AA 1OOPB 4XE9A 4OI4A 4Y4YA 1VBE1 1HKDA 2R1BA 2YU3A 3TN92 2IP2A 1AR81 1P8JA 5IY5H 2W87A 3CDIA 3WP6A 5GAHJ 4QT6A 1BJQA 2W2IA 3VBHA 4E8CA 3NRVA 4K1ZA 2D1VA 2H1LA 1Z7UA 1B6AA 1S0EA 3GEZA 1RHI3 1Z7S3 4ZZDA 2N8GA 2RJ2A 4AGRA 4L9TA 1HKSA 2C26A 3GDBA 3BOQA 1FPN2 2ZMNA 1SFPA 4EJOA 2WBMA 3K4DA 2OF7A 3J81K 4DUWA 5ABJA 2VCAA 2XJTA 3R6SA 1PO11 4S2HA 3VZNA 2CRGA 1E0EA 5C44J 1LDDA 2RJKA 1IRGA 3R0JA 2VT2A 2RQQA 1PM4A 1C8NA 1UYXA 4M01A 2A6TA 2ZXJA 2WL1A 1BR4A 4IHXA 3KP5A 5H9SA 2E2JJ 2WZR3 3NSTA 3H1YA 1WW4A 3F2ZA 4OHYA 2VE8A 3MBWA 4ABZA 1KEXA 5FPVA 1S2BA 2WA4A 2WNOA 4CCKA 3QRFF 3VZOA 2R93J 3H0GJ 5CAZA 2WB1N 1VMJA 3MZHA 1TBXA 4LO6B 2Y0MA 4MH0E 1MDMB 4FSJA 5FZOA 1J1TA 2KRHA 1JKRC 3QPLA 1FOWA 1CAWB 4YG3A 4Q0SA 4X6QB 1ZBA1 4Q8KA 1OUSA 2CMPA 5FO5A 2P3IA 2XPVA 2V79A 3CUQA 1H6XA 4PBOA 2BVVA 5A2QK 2VTFA 3EPZA 2W39A 3O1VA 4UW3A 1S29A 2ZZJA 4RAYA 1P9QC 3U11A 5FYYA 2VQGA 4PUSA 4EQVA 4YVSC 3HRTA 2VN2A 1IRFA 5BY5A 4IGPA 2ZXIA 1FAYA 3GX4X 3KQ4B 1RHI2 1Z7S2 3PMEA 1UIKA 2HR3A 2OUMA 2ZHMA 5T54A 2PHXA 1I1GA 4Y5Z0 2KIUA 5BNPA 3LIHA 2KD7A 1LDKB 1W6MA 2ELJA 4W6XA 1LEAA 3TEWA 2UWAA 1ZBE3 2TNFA 1RUH3 3HC7A 3A01B 1POV0 3ZMUA 5H6QA 1DU6A 3S6PA 3DU5A 1IPSA 3IZOA 1X4OA 3WG7H 3ES1A 5A7PA 3PSIA 4DPNA 4URTA 1EYBA 3GTPJ 5CKNA 4XUNA 2EV5A 5ABJC 4XDPA 1WA4A 3M3YJ 4AFDA 3PM1A 2WZR2 2CGNA 3NRUA 1R22A 5BUVA 4P9YA 3FHIB 1OH4A 4C9YA 4ZU7A 3WNMA 2XC7A 2G9ZA 2V26A 4HK9A 1XNKA 3W2AA 5HBAA 1NY71 5FZDA 2HYFA 4CGZA 1GLHA 3VZJA 1YLLA 1MZEA 1XC6A 5KHGA 4YW2A 1J75A 1DLCA 2WFF3 3E97A 2E34A 1KJLA 2Z3YA 5J09A 2XAJA 4FVVA 4QPIB 2ES3A 2OQ7A 4AEKA 1LNSA 4LKSA 3GHNA 2E5ZA 2X5IB 5LK7B 3GTMJ 2JE7A 5FB2A 1DHKB 2VMFA 1PK6B 2K9MA 3PJRA 4YM0A 4YFZA 3R4DB 3BIEA 3V4GA 2FCUA 1LFUP 2RDNA 3KGLA 2GLOA 2LY1A 3ZMOA 2ZGSA 1AR91 3LL7A 5FMOL 1X8EA 5EG0B 4A4AA 2FDIA 4V1PA 3K77A 2JRMA 3VBRC 4V2GA 4DEVA 2XBO3 1Q1HA 5GLTA 4TSVA 2V4JC 2Q1ZB 5FK7A 2XF5A 5IYCJ 2W00A 3QPTA 1LOBA 4MVTA 1W99A 3CUQC 3SMHA 5CFDB 4AEJA 4DZPA 4Y1XA 2AO9A 3B02A 1AHDP 3ERED 1VQNI 1MS9A 3VD7A 3IL2A 4BBSJ 1ZBE2 2ZGPA 3TMOA 4CUCA 2IXCA 1RUH2 4LORA 2XH6A 4XVHA 3TEYA 1LULA 4WX9A 1MJAA 2R0FA 2Y6LA 2FA5A 4Z2WA 3DL3A 1R1UA 5LRRA 2BRTA 2HWD1 2ORZA 5HOOA 3UYJA 4JX4A 1V00A 2FEZA 2E2IJ 1IV6A 1QJX3 1DYOA 1JUSA 1DUXC 2PELA 3M9AA 4ENKA 1XYPA 2A73B 4XJ9A 5LY2A 4BQ3A 3L2VA 1MSFC 2VZTA 2L7MP 2PJRA 4X8PA 4KMQA 1RXFA 3ZGKA 3VL9A 4IESA 4A42A 5IOZA 4IVNA 3PL8A 4W65A 4WM7B 3A4UA 1OXCA 2FRHA 1OA2A 1KS4A 3H3UA 2IXLA 2ZKLA 4HXCA 2E36A 3H3LA 1WH7A 4YNIA 4L9JA 5FZ8A 1IRXA 3LSIA 1A8MA 1V9U3 3OR2C 2LTPA 1WKYA 1APLC 4JK1X 4OIQF 5FFZA 2WV1A 2VVEA 1QU0A 4U2AA 2JD9A 2WFF2 2ACJA 3WDYA 2ATFA 4FOVA 3O1SA 3I2IA 1OLTA 1RIRA 1JYWA 3ZYGA 3LSTA 2FD5A 1H8TA 4K1YA 4UBGA 3ZFFA 5C3RA 3GFJA 1XE7A 4AEMA 1Q8VA 1SG3A 1NCQB 1JZ3A 5F3CA 5EZGA 3TEXA 2IFWA 2SLIA 1D1AA 3OWTA 1YTYA 5C4XJ 4ENJA 4CYCA 3VWBA 3B00A 3GYHX 2E60A 1DYKA 2V4AA 1OISA 3CESA 2WQ4A 4UFHA 1ZNPA 1Y8QB 1HRI1 2XBO2 2W57A 2OS2A 3IMMA 2G9GA 3ACFA 1R71A 1BZWA 4ZZLA 3QH7A 4KGGA 3VZLA 3JCUC 5JZGA 3F8MA 5JMCA 3IV5A 1LQ1A 3HPHA 2XRLA 1R081 1W0PA 1XJAA 2ISZA 2UYAA 1ZRDA 1FMD1 2NNNA 2IGMA 2QZ2A 4BACA 4HN0A 3SITA 2F4MB 3DUIA 1DFQA 2WO3A 4A93J 2W84A 2CNAA 2GIZA 3JD73 2VMGA 4AI0A 3OS1A 1V6JA 1T33A 3LQQA 3QBQA 3NAUA 4COYA 4BY7J 3SNMA 1EAH1 3A21A 4P00B 2WQ8A 2DVAA 3EJKA 3FF5A 4OQ8A 1G4DA 1ETKA 4O5VA 5J7MA 3ZXAC 5JI6A 2NS0A 4M4PA 1OPOA 2OC6A 1TME3 3S7EA 1BMV2 4AOCA 1JHFA 1WHUA 4HW0A 3LSKA 2A6XA 1V9U2 1YQ2A 5F32A 2VZVA 4OIRF 2OTJI 1YI2I 5EF6A 2VPRA 4R79A 4FBFA 2BHZA 1R4MB 1U8RA 1GOHA 1R093 1PGW1 4XEZA 3LSRA 2XAHA 3IH2A 3A03A 4ENMA 3PQKA 2Q8CA 2W7NA 4Y15A 1AKHB 5GAGJ 2Y9YA 2TRTA 2WYFA 2WZ8A 1G8WA 3RPUD 4CEYC 4WF2A 2WN3A 1GUIA 3ZYJB 4YLZA 4YSFA 3MEXA 1W2OA 1IHMA 4JQTA 3MFKA 2EXHA 4LB5A 1USSA 4W97A 5HV4A 2VQTA 2L0KA 3IIAA 2UY8A 3AJZA 2CHHA 1VQOI 4L99A 3TP0A 1FBQA 3JAMK 1DQ6A 1UQXA 3BPSA 4QWQA 2VCMA 4YVSB 4BEHA 1G6NA 2ZEXA 1TZLA 2MYSA 3OPZA 1U5TC 4HZFA 1SLAA 1UFMA 4EJUA 1K3IA 2C6YA 5KXCA 1TTYA 2G4IA 3T1BA 3BTJA 2O7OA 1F36A 3JD72 3ZR8X 4Q26A 4LMFA 2EFQA 3E0JB 4GMP3 3ML6A 3O8GA 2JIJA 1W9WA 4Q2FA 5ACA1 4XRMA 1RUE3 2KMUA 3SEQA 3BU0A 2KHMA 1AYM3 1QVUA 3G73A 3DU6A 2AXLA 4IRIA 4BU2A 2DA1A 1W4MA 4RHV3 3F8NA 1RMU3 4UVCA 2H0BA 3ZN6B 2BZDA 5F3EA 2DFEA 5ABJB 1VBA3 3G1MA 4QXCA 3FXMA 4WXCA 4LOCA 5EZHA 4RFRB 4MV2A 2B46X 5I8TA 1NOVA 4CP9A 1UJ8A 2D43A 1R092 2YV8A 1MGTA 3H9GA 1NX9A 1NG0A 2ZS6B 3SEEA 3W2WA 2Z2SB 2GBYA 1DDLA 1M4WA 3RG0A 4EWEA 3L2QA 3FXRA 1R64A 5ICGA 4A3DJ 4LG0A 1OCPA 3EB7A 4UT5A 5DAPA 3ZKUA 3JRBA 1KONA 2CU5A 2R49A 5T5LA 3FUQA 4JKMA 4NHJA 2AUYA 4CDUC 2WS93 1OPCA 5KHIA 4J1WA 2HEWF 5F6LB 2P81A 1IN4A 3LOBA 4BH9A 4E2SA 3MW4A 4GH4A 3OYWA 1P4WA 2F5VA 3VYTB 5K5OA 3KF5A 5B4NA 3VBRB 4D0QA 2KISA 3KGZA 3CU7A 2LY9A 1RUF1 2QQMA 5FUIA 3CUQB 3K4NA 3AZWA 4P9JA 3JRDA 3WDUA 4XF4A 1W9FA 2V73A 4II3A 1V5FA 4HKOA 3T2TA 1PM7A 3W21A 1GQHA 3KT7A 2ZXHA 1RUE2 3HRUA 2LUWA 2L3DA 3GTLJ 3OMYA 3SH5A 1AYM2 3IKVA 4IJAA 2COBA 4LHSA 2DODA 3HRMA 1YRNA 4JGZA 2BBAA 3MIBA 4E7IA 3T0BA 4RHV2 1RMU2 3IPVB 1K78A 1ODMA 4JDOA 4FPOB 1VBA2 1I5PA 4Q4W3 2BW3B 2XPUA 4KQ7A 1EY2A 3HQXA 1JMUB 4R9BA 1FT9A 1WKMA 1BI3A 4FPGA 1RPWA 4BJ5C 5L3BA 5C5TA 4PSXA 1AR71 3U2RA 3KZYA 1UHSA 3VZMA 4C30A 1CQ9A 1HSJA 1X4PA 4IV3A 2BXZA 3U1KA 1RB8G 4UFIA 1W9SA 3IMNA 3OSFA 5F5QA 4QU2A 1PGL2 1G3YA 2CAUA 3VGIA 4RR3A 4LBQA 1QZYA 3EHKA 2WS92 3U0ZA 3WGGA 4BQYA 5FZAA 2HYXA 4N4NB 2HPIA 3I5UA 2M4KA 5IP7J 4RS5A 5E3LA 2OD5A 3H1CA 3R60A 4LIVA 1LOCA 5CNAA 1N1SA 4IHVA 5FY7A 4IZZA 5DAQA 1GZ9A 3DXUA 2RS31 2JKXA 1H89C 3HIFA 5BQTA 2GP3A 4XW3A 2NZ9A 3H1MA 4QM8A 4KMUX 3KP6A 4S0HB 3GM8A 4A3EJ 4AFMA 1ETWA 5DUXA 3VB9A 2LP0A 1W6OA 4LBKA 2VOKA 2Z69A 1CF7B 3WNXA 2PAKA 4FQGA 3KF3A 4KG8A 3GFIA 1XX5A 3SDGA 1SFUA 3MIDA 2JG9A 1H4HA 5A1LA 2EIJH 3AP9A 1N3OA 4DJAA 2BNMA 2LVSA 5IFPA 5FY5A 3VYRB 5D4RA 2X09A 4Q4W2 1QF3A 1ETYA 1RR8C 1Q8QA 4NMIA 4NHLA 3ZIXA 1QNTA 3MIHA 4V2VA 3QP5A 2LG4A 3ZPOA 5D5UB 2Q8DA 1R1TA 2DA7A 3LAPA 4ES8A 3WHCA 5E8GA 1OVPA 2JB4A 3RI8A 4U0VA 5J8FA 5JLVA 1P7IA 2EIKH 2YROA 1NTCA 4CDWA 4DQAA 2E71A 1RKWA 3SEZA 2HGCA 4NDLA 5HVQC 2BFUS 5HODA 3BWGA 5H9PA 2JVGA 2O8KA 2QZ8A 1BC8C 1WLTA 4HBNA 2LKPA 3BCWA 2VCBA 1O6UA 2JSPA 4YVWC 2MH2A 3LQCA 2P1BA 4ZYEA 3WTVC 5M5YJ 3I2FA 2YBPA 4CEYB 1Y9QA 5D6EA 1PMJX 1Z3XA 4Q4X1 3BPVA 3KV6A 1N1YA 5SV5A 5I0RA 2R5YA 2A3WA 2D97A 4TXWA 1S6LA 3VBSC 1MQTA 3O0XA 4RR3C 4CTEA 2FJ1A 3AFGA 4ZS2A 5EZWA 1UZ0A 2ZGKA 2WT0A 1DLLA 1FNZA 2DF7A 3OY8B 1S3JA 5FQ0A 2OT7A 3DYMA 4H14A 1U5TB 3ACHA 3LSEA 3ETQA 4RS5C 1H2LA 2HWB3 1MZFA 2GP5A 3K48A 2Y33A 5CADA 2TEPA 3OYGA 4EZHA 1CZSA 1GLNA 3LSPA 1ZG5A 3MIEA 1H2KA 4XFIA 5A7OA 5K8SA 3LD8A 3Q9VA 3Q0WA 3DECA 1E5SA 1BI0A 3C2HA 1KS5A 2WAFA 4Q4V1 5GZGA 4PIYA 4OVEA 3IKWA 2F6CA 1KU3A 2VTXJ 2RGVA 1I3QJ 3ZMDA 2W47A 3OSDA 1FOYA 1PO21 1JYIA 2JG9C 3BYWA 3N36A 4MEYF 2DTYA 3WP3A 1UY3A 1IOAA 1V6IA 4NHMA 1NA1C 4OCTA 3RS6A 1BI1A 4RFT0 2DCYA 2ME0A 3WW1A 3M3CA 4Y1VA 2R7ZJ 1FX5A 2EXKA 3K4MA 3J81Z 4ISQA 5ERLA 1K12A 1F15A 4DW6A 4XFAA 1CAXB 4MQ9F 2QCSB 2CQQA 5DYMA 1TMF1 4GXOA 1S0FA 5CQGA 1H0BA 5EEGA 1MMSA 3CJTB 3TKYA 2K4JA 3KEOA 3MO4A 4A7YA 2W46A 4Y20B 4CDUB 5T3NA 2L9LA 2JUCA 2X4HA 3NNJA 2WJSA 1VBC1 2HBUA 1AXZA 4RAGA 5KWRA 2JJ7A 3RKQA 2VKDA 3THTA 4PLOA 5FCCA 3A22A 2M0MA 5F3GA 1C3HA 4RL7A 2L7FP 2HWB2 3MAJA 3N3HA 4RQPA 2QSFX 3WGHA 2NOJB 1NUKA 3VBUA 3DKWA 1AVBA 1AL0G 2QQJA 3OY9A 4M3DA 4ZYHA 3JSOA 4J01A 2GQQA 3VKOA 1JU4A 1YI9A 3WP4A 1N3PA 3TB0A 2WSUA 5FKMA 2R7UA 3GMEA 4ZJZA 2EAAA 4ZPIA 3K6GA 1TNTA 5FPAA 3I3LA 5A80A 2DDUA 4XDQA 3FKIJ 1ZZ9A 3UJQA 1WJCA 3OPWA 5KVRA 2XSJC 1PUEE 4KG0A 1Z1DA 4B29A 3KS7A 2CQNA 4EN7B 4UW4A 2Z9OA 5IOYA 4UYBA 1XTAA 1UOJA 1WJEA 3BDDA 4YW4A 3HBZA 1PP8F 4UFLA 3ZO0B 3FHAA 3BTLA 5FD5A 3ASNH 1ULPA 1YIFA 4RSUA 4ARXA 2XL9A 1V3FA 1T98A 4BDYA 3AYEA 1GNHA 3KVBA 2TUNA 4IXLA 2A69F 3N7JA 4P9WA 2ZZQA 3RDIA 1O3TA 4CXXA 4Y13A 5CEHA 3F3XA 3POGA 1X2MA 1KZHA 1UX7A 3I3QA 3DFGA 4YW1A 1WGPA 2NOGA 3SLIA 2DK5A 3NW4A 4XLHA 1QQP3 3UGFA 2VBZA 3PIPF 2BW8A 2VBPA 2BV6A 3VSKA 3P9CA 2HKXA 2LALA 4AWXB 2GXBA 1VAKA 3J8F3 4E7KA 2LK2A 1R1VA 3KCCA 2HOEA 3POSA 1RUC3 3W6VA 3LWFA 2FZ2A 1YW7A 4LULA 3I4PA 3SZTA 1T39A 2QUFA 4FTEA 1D1BA 2KL4A 1O3RA 4YZ2A 5H6RA 3RZHA 3MGUA 1F2NA 2VJIA 2ZAHA 4HETA 4HSLA 1U6GA 3GZEA 4NHYA 5IT3A 1OJLA 4AU7A 2CQKA 1AWCA 1JYXA 5DD8A 1X33A 4RQPC 2BFUL 1C5IA 2B63J 4ARYA 2GDFA 4L0PA 3I2JA 3ZYFA 3FMSA 4XL9A 3IAM2 4A0XA 2VI6A 1WLDA 3NO8A 2KRCA 3PUIA 4FT8A 3CTAA 2O9LA 1A04A 3JB8A 2JWTA 1LU2A 1Y7BA 2GSYA 3GHMA 3ESWB 3G3ZA 1SPPB 3PLQA 4IOAF 2ZBJA 3JW4A 1LVKA 5JOZA 1P4XA 5AC93 4OINF 5C3QA 1W05A 2PQSA 5JCTA 1X58A 2ZX3A 1K78B 4B44A 1JJ8C 2VKHA 4O6JA 4NWVA 4RGKA 1GANA 1WLCA 1GU3A 1UU4A 2WO1A 1OD5A 4XBNA 2LBFA 2A71A 4NRPA 3CF5F 5LB6A 3ZRGA 3LFUA 4XLCA 1ZRFA 1OQDA 1GVDA 1V6OA 1UMQA 2R061 4YVWB 1QQP2 2IZWA 3LSJA 1MPXA 2R7DA 3PHMA 1JYVA 2B5HA 1ZGAA 1WZXA 2W0XA 2A5YB 3I0TA 3J8F2 4P9FA 1SD7A 2BBVA 3C1DA 3VBSB 3FBMA 1RUC2 3AX4A 4RR3B 5JSRA 1TQIA 4LBQB 2B0LA 3UKVA 1Z0XA 2X85A 4R8HA 3I53A 4B09A 1B8IA 3HUGB 1FOD1 2VOVA 3K10A 4CUGA 4A3IJ 2BY0A 3AVSA 2HVQA 2XLGA 4RS5B 4MGSA 3D6EA 2E63A 4QB1A 1KQ0A 4P08A 5BNQA 1LOGA 4CP1A 1POV1 4EZ4A 5I8YA 1LEMA 1W2AX 3GWZA 4YW7A 1B1BA 1W2UA 4A3MJ 3OL4A 3J7LA 1HXS1 1DQ2A 2FDFA 3UKTA 4QHZA 5DUUA 3V0AB 4B1RA 1B35C 3BTAA 3N9MA 1OHFA 3ZPLA 1W6OB 1UU5A 1UNBA 3TQNA 1UB9A 3PO3J 5JUVA 1EV13 1X1PA 2RQPA 3V8LA 3CO6C 3WQ1A 5AC92 1VRBA 1D4M2 2JG9B 1IAWA 2WUHA 4XIKA 2V7FA 1BR1A 4CCEA 2OXBA 2P6CA 2A61A 2FE3A 1YE9A 1Y3TA 1W28A 1NA1B 1HF0A 4HLXA 5KCMA 3ZMZA 2A3YA 2VBDA 4FFFA 4XRSG 3KIOA 3GCMA 1C4RA 4O65A 2P5LC 1KRIA 2UWCA 4XXAA 4QKDA 4KDPA 1JYCA 1XGSA 1H8VA 3CDZB 3RYKA 4K2EA 1IUYA 3OG2A 3E1F1 4L97A 3I3EA 2M8EA 4WVVA 1MMGA 3LA7A 1UD1A 2B39A 3X2QH 1DU0A 2ZMKA 5A7SA 5FLHA 4MXVA 2DOEA 2GM4A 5LA2A 5T52A 3BG6A 2DMTA 2MH9A 2EINH 3SZPA 5FLXK 2VZ1A 3HOZJ 3ZOIA 2DU1A 3OUHA 4ZXEA 2XR4A 3KCYA 4QXBA 2FDHA 3NNGA 4UNOA 2BOLA 2A6YA 4MLOA 3PUHA 1I3HA 2Z33A 4N53C 5EHDA 2MLKA 1BBYA 3U10A 2M30A 2QSGX 4GWNA 1WZ2A 1SHWB 1W0NA 1NK2P 4KI5M 3HOVJ 4QSHA 2IWGB 1LGCA 2PN5A 5HS7A 4HMZA 2CV2A 1ONVA 5KHKA 3L2RA 4DNCA 4FCYA 1W6QA 1SC7A 2CYYA 4RGUA 3WU2C 3O1RA 5FZEA 3KV5A 1HDKA 2UUZA 2DTWA 4B4CA 1IG3A 3BY6A 3P5BA 4OI2A 3BIWE 3VDDA 3ZQFA 3PURA 1ASJ1 1EV12 1ONAA 3AMNA 4I30A 2YB7A 2OZ6A 1YX3A 4ES9A 2DVDA 5EDNA 1D1CA 5IT9K 1WMDA 2XWBB 4EJTA 3RKYA 3S1MJ 3MCZA 4HRIA 3PO2J 1TEIA 3GTGJ 4MZUA 2RMU3 5E6HA 3WDTA 2ELKA 2XWJB 1FNYA 2R0HA 3K9TA 4Q47A 3INAA 3H9JA 4XF9A 4I99C 4IE7A 2FOKA 2YS9A 3JBG1 4QU1A 2DT7B 2DT6A 2HNHA 4D8MA 4OUSA 2BVBA 2LREA 2AQFA 3HT2A 3I2GA 2JTVA 3BPXA 4XBQA 3QODA 4CDGA 3T30A 3AMQA 1NG7A 1OF3A 5IW0A 4O3MA 2HXIA 3LF7A 3WNLA 1WCMJ 1I9RA 2NVYJ 5HCBA 3O1UA 1S0BA 3ME2A 2OQ6A 1CGPA 4JRLA 1O59A 1KFUL 4DQ2A 3P9KA 3N05A 4HX8A 1HXDA 5KXDA 3J7YJ 2BNNA 3HN3A 1LJ7A 2GIVA 4B1MA 1RZ4A 2B9SA 2OV7A 4HX4A 2PHLA 1SVMA 1APNA 3BB6A 3DYOA 3UKGA 2ARBA 2EFOA 5FFOC 3WODF 1KYZA 1CD3G 4U88A 5DABA 1LB2A 2XJVA 4QDSA 2BBYA 2JDPA 4NN0A 3HKZA 1ZGWA 2HDCA 2ZEZA 4Y5SA 1RJ8A 4RQPB 3DPUA 4RMNA 2LM3A 4LHKA 1B9NA 4DY3A 2NMOA 5CBLA 2XGEA 1Y6IA 5CVRA 2D1HA 1F9KA 3B9CA 3HD8B 3ZQCA 1H30A 5J37A 1RUJ3 1JGGA 2HXOA 4DUXA 2K9ZA 2RMU2 2FUG2 2MEV3 4LBJA 4HKLA 3M8FA 1WW6A 1SLTA 2PQ8A 3DP7A 1BIBA 4XQ4A 3PNTA 1FJLA 3DKQA 5KAFC 4LIUA 3C7JA 1LOAA 2FNAA 2ZSIB 3SFIA 3FDYA 3MV11 2DFBA 1RUNA 2MD0A 2QLZA 4OAZA 1QJY3 5F5CA 1U5XA 5FYUA 3GW2A 1T6GC 2VUCA 4HANA 1SLLA 2WQZC 3WOGA 1IGOA 3I58A 1F43A 4QPWA 4F92B 1AUYA 2CV6A 4EEFG 3I59A 3ZFGA 5GPAA 2PQQA 2RDSA 3WG4A 2DQLA 3T5XA 2EA2A 4IQPA 2K9QA 3C8XA 4XF1A 5DUKA 3ITQA 3DCFA 3T8RA 1A34A 1PNGA 4NC8A 1YW8A 4GB33 3S32A 4AI1A 2XONA 1BOAA 4PLMA 4IEPA 3ZMVA 4M74A 5AIPA 3BZCA 2P7CB 2WWUA 1Z78A 4ASKA 4XTPA 5EJZB 2GMEA 1QGLA 5I0DA 1HJFA 2CDPA 4UF0B 3V65A 1LHOA 1BR2A 2VVDA 3M7AA 1GOFA 2GXAA 3ENRA 2YC4A 3S57A 3COAC 3AM2A 4E4HA 3PJYA 1LE8A 3K51A 1Q8PA 1X2NA 4PHZA 4KA4A 1ZH5A 2WC2A 2VNGA 2PMHA 2Q4SA 3GYDA 2FCVA 4A5NA 4GD4A 4XJZA 5A1FA 5IAVA 1RUJ2 4JGYA 3P9IA 1BEV1 1B35B 4J00A 2QQLA 4CXYA 2MEV2 5IYBJ 2XUEA 1I1SA 2JG8C 3QYBA 3DLAA 4AVBA 2XGDA 4XJUA 2PI0A 3G6EI 2YYOA 2PHFA 1W36D 5A3UA 3DF0A 1R49A 1TQPA 3MIGA 3N7MA 4A3ZA 1QJY2 1W7PA 4CU6A 2CUFA 4BM8A 5DUVA 4IHSA 5H9QA 1PP7U 2QENA 2EV6A 5B1BH 2MD5A 3CC7I 2VASA 1REEA 3WNOA 1ZGJA 1OA3A 1GYKA 4IEJA 5FXZA 3A7QA 3CJRB 4ETSA 4BPZA 4HG6B 1FV3A 4JVAA 5L9BA 4AVCA 3SISA 1J58A 5DN2A 3ABMH 4M71A 1YRZA 3KETA 1IS5A 1TLHB 3L2HA 4GB32 3OYEA 3H42B 4MUVA 2D93A 5HDGA 4YW3A 2ZKZA 4P5OA 3I7DA 2LBFB 3IHUA 2Y6JA 1W5CC 3CKHA 2JPCA 2QEXI 3OYHA 1WCSA 1C28A 4O7XA 5A3MA 3F6VA 3ZQGA 4N53B 3LNQA 4N9HA 2W1SA 1FSHA 2P5VA 2DBBA 5F0HA 3AFHA 2EQRA 4YM3A 4NO4A 2ZCWA 3ZLIA 3EYIA 2KLOA 1JXNA 4ASLA 5FY8A 1TG7A 3OBTA 4M6XA 1VBE3 4W4ZA 1LR5A 1PMIA 5GZFA 5GZEA 2WLQA 3IP4B 4CEWA 4TYSA 5F27A 1B8IB 4P5HA 1DGRA 2CJJA 1ENHA 2NMNA 1DIWA 3H7YA 1J1LA 3ASOH 2Q2EB 3O0WA 3THPA 5A33B 1JT6A 1X1AA 1B9MA 2DPUA 1WCQA 1RKTA 4KGQA 2DBIA 4EQQA 4IEYA 3P3NA 4IXAA 4Q0PA 3ZXKA 2WINB 4HNVA 4F52A 1YQ8A 4KWKA 2ZX1A 1PO13 3KYCB 4LITA 1ZZ8A 5CA6A 4BK4A 5DCMB 5C8CC 2XXZA 4JGYC 2FHRA 3ZSMA 3SXYA 4XSXF 1X8MA 4P14A 4RLFA 4DB5A 5ISLA 1AJOA 1O5UA 2C9KA 2FZ1A 4XHBA 3D5SC 3ULQB 2R4GA 2CW7A 1K7AA 1NHAA 3KV4A 1GWLA 2XMLA 4LT5A 1VB4A 3ABUA 2K2SA 4XQFA 1KITA 5FMDA 4GWJA 4AHYA 2YXSA 1DQ1A 4FO9A 3WHUA 2F5DA 1U8BA 1OF4A 5E1RA 4Z1VA 2XHNA 4B7EA 3H8XA 4NIIA 1UYPA 1AU7A 2LOOA 5FYSA 3GCXA 4QX3A 1GNYA 4B4RA 2W1QA 3O1OA 3FK7A 1Z21A 4XR6A 5BOXA 1NT0A 1G9BA 1GQPA 1E3HA 3AKRA 1GR3A 2KXLA 4CXWA 1ZBA3 1XD7A 4LD5A 2HQAA 1WQ2A 2QKMB 1VBE2 1OURA 1PVXA 5DEQA 4YIIA 5EYYA 4Q8LA 4BBRJ 3V0BA 3ZOBA 2L7KA 3REOA 4KN7X 4M3CB 3C3VA 3W9AA 1KDMA 2M2EA 1K45A 1XNBA 2K9LA 2JN6A 4TLGA 3FJSA 3OGVA 4NBQA 4BS9A 1W6PB 5D6FA 4Y17A 3CMYA 2D6OX 3OL3A 1M1EB 1VRH1 2WNUC 5JSOA 5HCFA 5FKKA 1MSEC 3TP3A 5B2GB 5D5WB 4DMIA 4M6VA 2DCTA 1R1A3 3JB4C 1VZ0A 3SXWA 4IF4A 5IYYA 4IRHA 3FBNB 5BS6A 1PO12 4H7MA 1UG2A 1DBNA 1IJWC 3WW2A 1MZ5A 3DEWA 4LO7A 3V64A 1CAVA 5K4LA 1UMZA 1S72I 2E9QA 4BQWA 1K5MC 3RWNA 2IVJA 4LKEA 1HC8A 1DGWX 2P34A 5LLQA 3D1NI 4XRSA 1X3UA 4BOWA 5M3FJ 1UZWA 5HNHA 1S4CA 3RNSA 1BC7C 3WP5A 2CSOA 1VQMI 1LESA 3GBWA 2BHYA 3O6BB 2AREA 3ATGA 2VMIA 4H0EA 2YFUA 2C24A 1BOBA 5F2SA 4IGQA 3Q0VA 3DN7A 2VC0A 3F21A 2HDWA 4AEDA 3S17J 3FIWA 5M3MJ 3FL7A 5FZ3A 3X29B 1UPIA 4OWRB 2B9UA 3JRCA 1XNTA 3L2YA 4YGCA 4B3AA 4UFMA 3ECOA 1ZBA2 2ZGQA 4LKDA 5HXVA 1C0WA 3F8BA 1FYKA 3AZVA 4CCLA 2ESHA 5I0SA 3WG2A 5A6QA 2NYYA 2UYBA 1USTA 1J3RA 3M2MA 3K1PA 4ZYDA 3EQLF 1PZ8A 1AR93 2G9FA 2EICA 2WN2A 2Y6HA 1L7LA 4L5JA 4QWNA 2ORXA 2VUMJ 2DV9A 4BHBA 4K9SA 1LPQA 3QLQA 4WM8C 5LZ6A 2BU9A 1F9NA 4A45A 3CJIA 2WT2A 4LEJA 3JREA 1DPRA 3IBMA 3KV9A 3HPGA 1I1EA 4BQ5A 1W8FA 1FYMA 3E7LA 3VD9A 3WTUC 4EV0A 1QBJA 1WJBA 2IAIA