2GZWA

Crystal structure of the e.coli crp-camp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
200
structure length
200
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of activated CRP protein from E coli
rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 63
structure length 200
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gzwA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gzwA01
3NW4A 1NYWA 2IXKA 4IEVA 1OR7A 2MD5A 1Q5OA 3QACA 3V7SA 3KLOA 4KUMA 2GC2A 2YPRA 3H3UA 3VODA 4M9XA 4NVPA 5D6EA 4HLTA 3L2HA 5K5OA 2PN6A 4LMYA 4Q0UA 2QJVA 1G4DA 4AD9A 1XRUA 3SXYA 1IAWA 2K0GA 3IKTA 5FLXK 3SMHA 4P9UA 1YFUA 2E1CA 1ZGJA 4YNIA 1R36A 3TGNA 4R1HA 3QAHA 2XKOA 2JZYA 2F2EA 3J81Z 4UVBA 3F23A 1DPRA 1IXCA 4EM2A 4NHJA 5LGUA 1ZZCA 1I5ZA 4UVCA 1KU7A 1O7FA 3CLPA 4BH9A 2FA5A 2EJRA 3J80Z 4KDPA 4LLOA 3E6CC 3FXQA 3GFIA 5AIPA 1ZZBA 3RJPA 3O3KA 4GYGA 1XGMA 2NYXA 1X8MA 2OYZA 2Z99A 4FHTA 3FE5A 4RB0A 4KU8A 1J3QA 2ADUA 2M87A 4YIFA 1GVJA 1BIBA 2P7VB 4WX9A 1BI3A 2EAAA 2UY9A 1BJAA 4Q4ZF 4Q47A 4XETA 1O3QA 5CADA 2MNGA 3PFIA 5I8TA 3D0SA 5DEQA 3I53A 4O5VA 4Z07A 3FHIB 4IERA 1XGOA 5BQTA 2DO7A 3GW2A 2HZTA 4HV5A 1C0WA 5DDGA 3E6DA 4OIQF 4D7TA 4P96A 1OFNA 4JQFA 4ZU7A 1TQMA 1Z6RA 1X3UA 1K6OA 2VPVA 5IT3A 2DTRA 4EWAA 3ML6A 4I3PA 3H1YA 1LQ1A 5JAXA 2AS5F 4MTEA 1P2FA 4N9IA 1S29A 4ZZDA 2V9VA 3LWFA 2VECA 2EFNA 4QWQA 3NL1A 4IETA 4HF2A 2GA2A 1IN4A 4AWXB 1UHMA 1QZZA 3EDPA 4IEOA 2OZUA 1XSDA 2CSOA 5ICGA 1QXJA 5EEGA 1RTVA 2RNJA 1TNTA 5IT9Z 3TNPB 3H1WA 5J48A 1OKRA 4R8HA 1DZTA 1BI2A 3SQNA 1ZZ9A 3O2PE 4QXKA 1J9IA 2PHDA 2OPKA 4RAYA 3LOIA 1EYBA 3BU7A 3H3ZA 2XGXA 3SCGA 4YSFA 2WFPA 3FMQA 1BI1A 1D8KA 1SFNA 1MDMA 1GXQA 4PGGA 2XLFA 1R22A 5FPXA 1MD0A 2XHKA 3RI4A 3EETA 1LR5A 1Q1HA 3FHZA 4HLXA 4ENJA 5LHHA 5IT9K 5I0RA 4PIXA 3FXRA 4D0PA 4B09A 2BEOA 2K27A 1O57A 2VT3A 5J7MA 3MEXA 1IPKA 1KYWA 4K2EA 4CDGA 4IRGA 4L9VA 1IW7F 4XSZF 1DDNA 3WW4A 3HRMA 1H9TA 1ZRCA 1Z9CA 1FSEA 2VONA 2OA2A 2V79A 2H0VA 2K86A 3KE2A 1Q3EA 3LAGA 1RNLA 3V4GA 4G94A 3GEZA 3MFKA 1IRFA 4J1WA 2E9QA 5ILUA 4MGRA 1ZLKA 1GXPA 4AQ6A 4EJVA 4GO1A 1W7PB 5LEJA 3TNQA 1DGRA 1KQ8A 2BBYA 1YFXA 3ZN1A 4ZU5A 4IEYA 1R1TA 3H92A 2XL7A 1FBUA 4XRFA 3IRQA 2Y0OA 1SD5A 4TLFA 3KETA 1YUDA 4XFBA 2ZFWA 4P55A 2BNOA 1LEBA 5K5RA 2EWNA 3LFKA 4P9FA 2QENA 2EA4A 1K7AA 2OZ6A 1USSA 3MYXA 4BIFA 5J3UA 5FB2A 5HS7A 4A5NA 3FFQA 3E5QA 3HT1A 3WTZA 2UWMA 2F5EA 3T8TA 1OPCA 3BJOA 4XFGA 2XUBA 2IA2A 3RIRA 4I02A 5D6FA 1Z05A 4I0AA 3KSCA 2DW4A 2GC1A 2MBFA 3KP4A 4LUMA 4YFXF 2EA7A 1JXSA 1UFMA 3BPVA 5KHKA 1ODDA 4WZCA 3OGJA 2GC0A 5I8YA 1A04A 2ZBKA 1PUEE 1XGNA 5HDGA 1LB2A 2IXHA 3ECHA 4WVZA 3CJXA 1EH6A 3BJ6A 3DN7A 4XLNF 3K9TA 4RAZA 4Q0QA 1U12A 2V1XA 1SFUA 3HTSB 1IN7A 3SCFA 2QQ9A 3RKXA 3IRRA 3KGZA 3W6JB 5D5XB 5DCMA 4AXOA 1NE6A 4E2QA 1UW8A 3I64A 3HOSA 1T6SA 4HN0A 1QO0D 2DPUA 3HRSA 3SHRA 4H0EA 4AIHA 3KP3A 1O7LA 4EGZA 3E3VA 5K1YA 2ZCWA 5CYVA 3ZMTA 4LLLA 2A07F 2G7HA 2XAFA 3RYRA 3O6BB 2MLGA 2HKOA 1CF7B 2STTA 1XN7A 1R1VA 1I6XA 2RQPA 2V1DA 2DK8A 2QLZA 1HKQA 2JTVA 1TTYA 4M6YA 1ZH5A 1VR3A 1D3YA 4KA4A 4L2NA 2VC0A 4LGWA 4EMSA 2HS5A 2Q30A 3ZN0A 4KIFA 4IEUA 4MEYF 4M9SA 5JI6A 1BC7C 5H6RA 1NHAA 1W5SA 1HSTA 3AAFA 2FNPA 5FDBA 3EHKA 3KZZA 3WW2A 1RUNA 4CGZA 5DUIA 2QDRA 1QBJA 2L4MA 5HS9A 2A68F 4MQ9F 4DNCA 3GXOA 3WTWC 3G73A 1ZRFA 1GQHA 3TOAA 1XE7A 3EBRA 3S7IA 5JFRA 1QNTA 2HDCA 1XGSA 2D1VA 4OINF 1VJ2A 1LDKB 3J80K 4IEZA 4HMZA 2P7CB 3CTAA 2P5LC 2IXIA 2FQ3A 4MZUA 1YLFA 1CAWB 3S2WA 1YIOA 3CDHA 3JTGA 3KMHA 4BXUA 3M70A 2P6SA 3ABUA 2RKHA 4OIRF 1U5TA 2QWWA 1MGTA 2VXZA 5J8FA 3I59A 4Z2YA 1S6LA 1TQPA 1EH7A 4Z82A 1YO5C 2VQAA 1HW2A 5CVUA 4ZYHA 5JSOA 5FPZA 3K1PA 2PMHA 1ZAOA 4U0VA 2PHLA 1EP0A 2QZ8A 1JE8A 4A5MA 3H50A 4HVRA 2DI3A 1HQCA 3CUQA 5LHGA 1J2XA 2OA4A 1R5GA 4EM0B 3ELKA 3I5UA 2PAEA 1USTA 3EQLF 2UXNA 4PIYA 3GZ5A 4UBHA 4Y17A 2M5WA 4I0BA 2KIUA 2BE5F 1Y0UA 1W7PA 4LUKA 1S7OA 1RGSA 3I59B 2H27A 1Z6TA 3I0TA 2OQGA 4ZYDA 3P9CA 1PM7A 1YHFA 4UXNA 2RVCA 2KJCA 4N0BA 1XD7A 2EA2A 4CYDA 1Y3TA 4PIZA 2LSOA 3EQEA 3BJAA 2UYAA 5KK1A 1SD4A 4KNYA 4EJWA 2FMYA 3KP5A 5A2QZ 1G3TA 3R0JA 1DZRA 3I58A 2MLKA 3I71A 3CO7C 1ZG5A 1O3RA 1I27A 4MH0E 6PAXA 1S8NA 2XL9A 2G9WA 1XMAA 2KRFA 1L3JA 2RV8A 4NQWA 2MHFA 4YRDA 4UXAA 2CG4A 2DAOA 4KMUX 2ET1A 3IWZA 4WXCA 2CAUA 4HOBA 5DV5A 3TQNA 3C3VA 3FXUA 3ZMVA 4H7LA 1B4AA 1HKTA 4L18B 4LK0F 3K2ZA 3ZQ7A 3ZMZA 2ISZA 2GU9A 1H0MA 5BOXA 1Z91A 4AVPA 2RN7A 5BV6A 1ZG3A 4MGYE 4KWJA 1LRHA 4ZZLA 1UCXA 1SEFA 2EV0A 1DPUA 2PAKA 2FBIA 5HOOA 3K0LA 2GWRA 2P8TA 1CAUA 1T38A 4OIPF 5AONA 1UCRA 1XCVA 1YFWA 3Q9SA 2D93A 2GA1A 2COMA 1MDMB 2OQRA 3OF1A 4I09A 4RGXA 3CUQC 1HKSA 4IHTA 3DXJF 4Q5SF 3LA3A 4OMZA 3BY6A 2O3FA 4HA8A 2FSWA 3FMSA 2GZWA 3QPHA 3IIAA 4RB3C 3I7DA 3RTRA 5HVQC 4Q0SA 3ABTA 2E1NA 4L9TA 4QGNA 1F4KA 2J5OA 3OOPA 2P5KA 3V7RA 5HLHA 1D5VA 4EGYA 2A3SA 1EPZA 3PQKA 4XEZA 1U6GA 1YW7A 1XCBA 1OMIA 1X8EA 1UB9A 1OD5A 2ISYA 3ZPLA 1TW3A 4XFHA 2GXGA 4E2SA 3IKVA 1U5TB 4LA2A 3GX4X 1XSXA 5LRSA 2CYYA 4IEQA 4Y15A 3RPQA 4QX5A 3CL1A 1RC6A 3R0AA 5AVPA 3MAJA 2EFPA 5KHHA 2DPDA 4G7OF 4ENMA 1MJBA 2OZJA 2O0YA 5L3GA 3F8NA 2PEXA 2LF8A 2Y48A 5FFZA 3WW1A 2B0LA 1SD7A 5JCTA 2FNAA 4KICA 4RGUA 1WGPA 3G3ZA 5HDKA 3K1NA 4N9HA 3J81K 1V70A 2VBZA 1G3WA 4FX0A 3B02A 1ZZ7A 1LDDA 3L9FA 2NS0A 2HFHA 1WQ2A 2RGVA 5E1ZB 3USSA 4IEPA 4KN7X 5ERIA 2DCTA 2KJBA 4WK8F 3LQRA 1UPIA 2XKPA 5HI0A 1W7PD 4RB2C 1O4TA 3R4KA 1R7JA 3GO5A 4GGGA 3W6KB 1J59A 2F5CA 4TV7A 1NXMA 4YYOA 3BROA 3R60A 1G6NA 2Z5UA 1QPMA 4UNOA 2HGCA 1ZZ6A 5JSRA 3CEWA 2L01A 5FLXZ 2DQRA 2PA7A 2VOPA 5DUKA 2HOEA 1IXRC 3EJKA 5E17F 3WU0A 3FJSA 4PZJA 2QVSB 4XF1A 2IRFG 2CV6A 3KP2A 1CAVB 2W24A 2YSRA 4LB5A 3F21A 2IA0A 2JPBA 3HT2A 4P5OA 4LG0A 3NJZA 1Z7UA 3L2CA 5BY5A 5E8IA 3F8FA 3UKVA 3SFZA 2D45A 1X82A 4ZU4A 5E1XA 2PYTA 3PNAA 4EWDA 5KHGA 1WA4A 4MGZE 2Z3YA 3NRVA 2B5HA 3N4MA 4M72A 3WU1B 3CLOA 1OYIA 3SZTA 2Q2EA 1UD1A 5LGNA 1QZYA 5FLIA 2YX7A 1EH8A 1TQ5A 3JAMZ 4OIOF 2IXLA 1ZGAA 1OYYA 2BNNA 1TW2A 1P4WA 3UKNA 3DF8A 3SZPA 2TDXA 3GLXA 4FX4A 3LA7A 3DFGA 3E5UA 4EJOA 1R1UA 2GAUA 2XASA 2X4HA 2IXCA 2BGCA 5H6QA 1J58A 3OV8A 1HBXG 3SCHA 2XVCA 2KXLA 5D5WB 4HQMA 5BMZA 2R3SA 3VFZA 5D8LB 3F72A 5LGTA 1J0RA 2JSCA 3T0YA 2OD5A 2WTEA 1Y9QA 4OMYA 1KQ0A 4Q48A 3WGGA 3M7GA 4EQQA 1NZCA 4META 5TRDA 2ET7A 1GHCA 4AQ2A 1MKMA 1R23A 2Q0OA 1SQ4A 2E7WA 1U2WA 5D4SA 3F8MA 4HN1A 2XV4S 1LEAA 3COAC 2XLAA 5BXXA 2V09A 2ELHA 4XF3A 2CQKA 2FRHA 4A0ZA 2YR2A 2A6EF 3SXWA 1PMIA 5KHIA 1BC8C 2H6CA 1CGPA 1XDUA 4MHGA 1FYLA 3LWCA 2D5FA 2PG4A 3E6MA 2EFOA 5ICEA 3ZDSA 2PFWA 3U11A 3CO2A 3L09A 3LAPA 1QGPA 2PTMA 1IF1A 1HW1A 2IC1A 2DT5A 1P4XA 3P7NA 3KGLA 4A2UA 2O1QA 2NNYA 2R7DA 1WLTA 5EZWA 2HJIA 1FNNA 3KEQA 1KU9A 2Q4SA 1ON2A 2HYGD 3ERED 5FO5A 3GYDA 1YWKA 3IWFA 5CVRA 3RDIA 2E7XA 4L9NA 3RKYA 4E2GA 4KIGA 3BOQA 3C18A 4KFCA 2MH9A 1XMKA 3M3IA 3FWEA 5CVJA 2B9UA 3IBMA 4WF2A 3J7AO 3B73A 1T0FA 4L5IA 4LB6B 4HV6A 4QM8A 1ZLJA 3JSPA 3ECOA 1LDJA 1T2KA 5HLGA 3RNSA 2FU4A 5ED4A 3CJNA 2UY8A 2OU2A 2XIGA 1ZARA 2AXLA 3GFLA 3GFJA 1HW5A 4HZFA 3VHRA 3E5XA 1SD6A 3ISPA 1FT9A 2XAHA 2H6BA 3DL3A 1RI7A 3S0MA 4U7BA 1EY2A 5DCFA 1ONVA 5LHIA 1JUHA 4LJZF 5BS6A 2EV5A 4HBLA 3IDCB 2Y75A 1J1LA 2XROA 1IN8A 2HYFA 3PQJA 3BCWA 1SFXA 4NB5A 4L0YB 5EFUA 4L0ZB 4XF4A 3ELNA 4K8FA 3V8KA 5HS8A 4RGRA 3IDBB 3HQXA 3KFWX 3EYYA 5FQ0B 5KBFA 1KU2A 2X0LA 4KU7A 1R5HA 3CUQB 4HF0A 4ASNA 5C8WA 1G3SA 4B29A 2VBWA 2G7UA 4G6QA 4EV0A 3T1BA 3U9GA 5L3DA 1B9NA 4M9ZA 5ICCA 4ONUA 3GF2A 5DD4A 3DV8A 2OAZA 4YFKF 4LA3A 2HR3A 3F22A 4J1XA 3C1DA 3NQOA 1IN6A 1FYMA 4CZZA 4M6XA 2P4WA 1H9GA 5FD5A 1DP7P 3TOBA 5J6XA 3HRTA 1CAVA 4WXDA 1CX4A 2DBBA 2ZKLA 1RZ4A 3OTFA 1ZREA 2FF4A 1CAXB 4IJAA 1IN5A 2KKOA 1WSUA 1FI2A 3QP6A 2FQPA 2XLGA 1XB4A 3MWMA 1U3EM 1GQGA 3D82A 3BDDA 4ORFA 1DUXC 2VODA 2W84A 5LRRA 2DLLA 3WTXC 4BYYA 3F6VA 4LTAA 4LULA 1I1SA 3FX3A 4A0YA 4G6DA 4XF9A 3WE2A 4LLGF 4R52A 3FZ3A 1MJ9A 3HIFA 4ZH4F 4JVAA 5CU1A 3ES1A 3M9AA 1B6AA 5L3FA 1K78B 2D40A 2EB7A 2VC1A 4IPAA 3MZYA 4HVOA 2ZNZA 1D8JA 1E17A 3KEOA 4QGMA 2CAVA 1ZYRF 4YIIA 4E70A 2ACJA 3F8CA 3ZMUA 4PJYA 1B1BA 3HHGA 3D5LA 1OYWA 4BHCA 5ICFA 5LEKA 2I45A 3DKWA 2CGPA 2HKXA 3MQ0A 1YW9A 4QM9A 2Q8KA 4O3MA 2ESHA 3WTTC 2ZMEB 1ZZ8A 1ZNPA 4UVAA 5D5VB 4D7SA 4YG2F 3ULQB 2ZNYA 1VP6A 4CXFA 1YLLA 1AOYA 3F6OA 1REPC 1WKMA 4BNCA 1FBSA 3E6BA 3NEUA 4HX8A 3ES4A 1H1MA 3GZ6A 3HYIA 3FM5A 5E18F 2DFIA 4RGSA 2QBYB 1JGSA 2MA3A 1MZBA 2IP2A 1ZG1A 1RIOH 4M73A 2EFQA 4HW0A 3NKTA 3KCCA 3FZVA 2Y0MA 4AIJA 2V6CA 3TO9A 4ON0A 3IC7A 4UBGA 3MZHA 3ST7A 4IXAA 3RYPA 1YQAA 1SAXA 2K4JA 3GBFA 2JPCA 3LAJA 2JT1A 1S3JA 3I4PA 3VEPA 1IPJA 5BPXA 2GXBA 5I91A 2M45A 1J3PA 1U78A 4MGKE 1K79A 1ULYA 2LKPA 4U7DA 2L3DA 2QYOA 5AIQA 5HLIA 3TO6A 5FCCA 3KLNA 1FBQA 1CAUB 4L5JA 1U5TC 2NRAC 3OD0A 1JHFA 2LNBA 1J5YA 3V8JA 4X6RB 2P6TA 4GXOA 1J75A 4HSLA 4KWKA 5CVIA 1FYKA 2O61A 4G7HF 3K69A 2IW5A 2BV6A 3KP7A 4EWEA 4XFAA 3JSOA 3O14A 3NSTA 4ESJA 4XFFA 1T39A 4UUVA 4XFCA 2QVOA 3BALA 4AVBA 3T8RA 5A2QK 2EV6A 3HTUA 4Q0PA 2ZO4A 5E1WA 1R00A 2ZJ2A 5CJ9A 2NAZA 5E20A 4FAHA 2PMUA 4EJUA 1FXZA 1WI9A 1ZRRA 1KGSA 3CO6C 1K78A 5FLJA 5H20A 5I93A 4S04A 2IVMA 2L02A 4A0XA 2ZXJA 1G3YA 1YTYA 1DGWA 3PLQA 1KU3A 1FX7A 4BHPA 2FOKA 3NVCA 1RL3A 5EEHA 4ESFA 3G7DA 2KIFA 4RS8A 2K02A 2PBIA 4WWCA 1B9MA 1O3TA 3JTHA 3WG9A 4JTOA 5I0TA 4BQAA 1CAXA 3ZMDA 5J8CA 4JK1X 2Q0AA 4Q0VA 2B8MA 2K4BA 2F5FA 1P4AA 4U88A 3OCPA 2F5DA 4HDUA 4MQVA 4XFIA 4ETSA 5FQ0A 4M71A 3QRFF 3DQVC 4LEJA 4KL1A 2FBKA 3WW3A 3QU3A 3H8UA 3WTSC 3RYKA 2ATFA 5L3BA 3WTUC 3GYHX 4PGHA 2QNKA 1YYVA 4UV8A 3K1MA 1MJAA 2W85A 2K7LA 3M1EA 5F6FA 2YU3A 5T3NA 3FMRA 3KZYA 2CFXA 3HOTA 4DQ2A 2Q1ZB 4KT5C 1F5TA 1FP2A 2W57A 3BB6A 1YG2A 2FMLA 1LVAA 3QP5A 3RKWA 3ROUA 3GVAA 1UIKA 3ACLA 3TKYA 2QCSB 1FWZA 1W4MA 4KWLA 2FE3A 2DQLA 2M8EA 4I01A 3UKTA 1BM9A 1BOAA 2PI0A 1FSHA 4F8AA 4EROA 3F3XA 5ILSA 1BI0A 2VN2A 4FBFA 4M74A 2R7FA 4HSJA 3CUOA 4ESBA 2XAQA 3MDPA 2J5PA 4CO8A 4OU0A 4G8XA 2HQRA 5JHUA 4S05A 4Y13A 5F64A 3WE3A 5JR3A 5KHJA 3HHHA 4IRIA 2ESNA 3Q5FA 4AVAA 1SFEA 3P9IA 4LLNA 1XDSA 2ETHA 3S7EA 2OBPA 2ZMEA 4WCGA 1J7KA 2KIMA 2IXJA 5E8GA 4A12A 5KVRA 1QWRA 1V4RA 1LKNA 4BAYA 1FP1D 3D0JA 2HQNA 2V1UA 3WGIA 4MX3A 1WWXA 5D5UB 4KN4X 2PLYA 3R6SA 4PDKA 1IRGA 1EV7A 5I0SA 3REOA 1VTNC 1FPQA 2GQQA 5C6CA 5TJJA 2BYVE 2Z33A 4G7ZF 4HX4A 1Q43A 3ZMSA 1NE4A 4MV2A 2DK5A 1WRJA 5CLSA 2QUFA 3GUDA 2LDUA 1ZHFA 5FGMA 5I0UA 5DCMB 2HTJA 1J3RA 4XLPF 1YFHA 4OFGA 4LK1F 5D8KB 1UHWA 2VOOA 1HXDA 4O9EA 2XRNA 2D1HA 2VBYA 4XBFA 2D5HA 1F9NA 3BPXA 4KYWA 4JTNA 5JSPA 5FD6A 1BBYA 3EO6A 1O3SA 1P6RA 5FLHA 2QM3A 3LZZA 3DEUA 2IPQX 3U0ZA 3DPLC 2GIVA 1H1IA 1L0OC 2MH2A 3H1MA 4L9JA 1ZVFA 3WTVC 4KMFA 4RB1A 1E2XA 4UHTA 1QY4A 1LNWA 4HVQA 3SHFA 4IHSA 3Q9VA 4CHUA 2UYBA 2VT2A 3WTYC 1TLHB 3TDUC 3TDZC 2CO5A 1FC3A 1L3LA 4I2OA 2A69F 4HDVA 3LSTA 1KA8A 1ZRDA 2O03A 1O5LA 2VE8A 3DP7A 3FF5A 2A61A 4HQEA 4IESA 4RD7A 3M8EA 4XSXF 4CICA 1PP7U 3HSEA 5LLQA 2FXAA 3RZZA 1SMYF 1P92A 3JAMK 4A6EA 5K8SA 2O8QA 4HBNA 2IA1A 2WWYA 3TO7A 5FFXA 2D2WA 2EVXA 3VOEA 3EUHA 3IL2A 4UV9A 1TQIA 1XE8A 4GULA 1TBXA 5E16A 4ENKA 4AVCA 4PCQA 4MUVA 4YARA 2M1BA 4X6QB 1FY7A 5JR7B 1AWCA 5HDNA 4QMAA 4U0YA 5DD8A 5BUVA 4EM1A 4I7HA 2C6YA 5DYMA 4WBBA 1ZX5A 1XSVA 5ILVA 1OI6A 2JRTA 1U8RA 1RUOA 4R79A 1IUYA 2K9ZA 1KQ9A 2FBHA 1B59A 1QQIA 3IHUA 2PQQA 4IEWA 4QLCU 2HTSA 2YX4A 1CF7A 5I8SA 4LD5A 3FM3A 3V8LA 1I1GA 2QQBA 4XF0A 5E1RA 3R61A 1S7AA 1UIJA 5L3EA 2PQ8A 2STWA 3QPTA 3T5XA 2N7GA 1ZN2A 2VE9A 4LG0B 3ZP5A 2Z9OA 2MPFA 2NNNA 1BIAA 1STZA 2A6HF 4HLYA 4IEXA 2L4AA 1T98A 1KYZA 3U2RA 1FLIA 3WODF 4EVIA 3C7JA 2HWVA 3BZ6A 2DU9A 5BPDA 3GWZA 3KP6A 1IXSB 3V7CA 4YFNF 2LF7A 2WV0A 4AIKA 1JHHA 1O5UA 2C0ZA 2P5VA 3WGHA 1Z1DA 4EJTA 3I54A 5D1IA 4B8XA 2GC3A 1R58A 1IZ1A 4IRHA 4MEXF 3HUGA 4P9GA 1ON1A 3ETQA 4O9GA 1FZPB 2CW0F 3MPBA 2UXXA 2Z2SB 5F1RA 2HEOA 4Q29A 3BWGA 3GFMA 2QQAA 3L00A 4F7ZA 4MNUA 3JW4A 3PVBB 3RPUA 3C3WA 3H7YA 1HSJA 1LJ9A 3QOPA 3M8FA 3HSFA 2ZKZA 4IVNA 4HYEA 4U0WA 2FEZA 3HSRA 2IJLA 4KIBA 2ETEA 2H94A 3BPZA 2QBYA 3CF6E 4QGLA 4HAMA 2BNMA 3L7WA 1FOKA 1YFYA 2Z69A 2P17A 2IT0A 2H09A 2XAJA 2PFBA 4DINB 4HX7A 2VBXA 1YS6A 2RDPA 4IF4A 4BHBA 2M30A 4FT8A 2PJPA 2F4PA 3H7JA 2L54A 3DPTA 2A5YB 3HRUA 3E97A 5L3CA 4L11A 1QXRA 4ENNA 4G9YA 1YW8A 2GH2A 4ZYEA 4OOIA 4MTDA 3F8BA 4FAGA 4MGIE 5LBQA 4JBAA 2UZKA 4GYIA 1YS7A 5CVVA 2XAGA 3EYIA 3LQQA 2W25A 4I98B 5K5QA 5BPIA 2O8XA 1SMTA 5JVTA 2WC2A 4ZYGA 4A6DA 3H9AA 2RC4A 1X7NA 3N97A 3JZVA 3MCZA 3U10A 2CWEA 3VB2A 1TNSA 2EK5A 5D4RA 4LFUA 1V3FA 3BP8A 3U1DA 3LA2A 4WXHA 2PAMA 4HF1A 2MC3A 2EFWA 1CAWA 1PDNC 4OLLA 2O6GE 1PP8F 1BN5A 4O6JA 1F1ZA 4GCVA 4JV4A 3P9KA 1W5TA 3QU6A
chains in the Genus database with same CATH superfamily
5BNOC 1OR7A 4ZC3A 4A3DJ 5FKNA 3VODA 4NVPA 5JMCA 5FP3A 2R043 4ZHNA 5FKKA 2ZGKA 2OW4A 4Y4YA 4F3QA 2EZIA 1SMVA 2QJVA 4BGDA 2R4GA 4AD9A 3K4NA 3SXYA 5ABJB 3IKTA 4LMFA 4P9UA 1WCMJ 1ZGJA 1R36A 3TGNA 4L8QA 4R1HA 3QAHA 2JZYA 2EALA 2AXTC 4UVBA 3RSJA 1DPRA 3FXKA 5FO7B 5LGUA 1P8JA 1ZZCA 4UVCA 1KU7A 5CBLA 1O7FA 5E89A 1RUD1 3MW2A 1MR5A 4OI2A 4NNJA 2BERA 4V1PA 5FZGA 5GAHJ 4LR4A 1ZZBA 1H8TB 1ORKA 4GRIA 1QU0A 4D0QA 1XGMA 1H2NA 4LK6A 2Z99A 4FHTA 3KD4A 4RB0A 4QXBA 2P7VB 4WX9A 1SVMA 4QX7A 2HVSA 3BIWE 4QPGA 1RUD2 2UY9A 1H30A 1GBGA 2X1EA 3PIPF 2MNGA 2XBO1 2Y2ZA 3D0SA 3I53A 3OIPA 2ELKA 1TNRA 3FLPA 4FP3A 2DVBA 1ENQA 2V4AA 4BK5A 1VBA3 1ND3A 2HWB2 1C0WA 5DDGA 4M6VA 4B4QA 4JQFA 3TRSB 4XR6A 2WKKA 2ZMNA 3J7LA 2HXOA 1TQMA 4JDOA 1K6OA 5IT3A 4PLNA 4OI0A 5JZGB 3H1YA 1UXXX 1LQ1A 5IP9J 1ZM1A 1S0BA 4N9IA 4EN7B 1OXCA 2CY6A 5FYUA 4IETA 4HF2A 3DF0A 5GADJ 2R7TA 1QZZA 3JD73 3RI8A 4IEOA 3WG2A 4J01A 1ST8A 1LFBA 1XSDA 3NJXA 3AYEA 3TN92 4A7YA 5EEGA 2CW7A 3GTPJ 4H7MA 1X19A 5JWPA 4PF5A 2JKXA 5IT9Z 3C8XA 3H1WA 1GZWB 1DZTA 1GLNA 1R1A1 1W36D 4QXKA 4HL0A 4PHZA 4RAYA 5L9RA 3LOIA 1EYBA 2VNGA 3W5NA 3V0BB 3FMQA 1R6RA 1HN0A 1GXQA 2XUEA 2PLV1 2A3YA 3JRDA 1MD0A 5C4WA 2XHKA 2WYFA 2P4EA 4HLXA 1FV2A 4B44A 2B9SA 1UY4A 1OA2A 2Y64A 3M2MA 5FYTA 4UFMA 1C5IA 4B09A 3MKZA 2BEOA 2W00A 1O57A 1E3PA 2JDAA 2VVFA 3T2QA 1WPKA 3HRMA 2TRTA 1FJLA 4DGWB 2EAKA 2OA2A 5EGOA 3A01A 1MS1A 2G0EA 4A3MJ 1VBD2 2FJ1A 3ZFEB 2RREA 1S0CA 5ILUA 2QSGX 2K3PA 1XB9A 1MACA 2DMTA 2KL4A 1ULDA 3O1PA 3VKMA 1LE8A 1NQDA 5FZ6A 3V65A 3TEDA 2DYSH 2XL7A 1FBUA 5FMDA 2R061 5FO9B 5FYCA 4DXSA 3AKZA 2BVVA 3L2VA 2HWC2 4P9FA 2VY0A 1E5SA 2EA4A 1WH5A 3A0BC 3OYGA 1PVC1 4F92B 3MYXA 3LSKA 4BIFA 3FFQA 1OVSA 2DWRA 5LA1A 5FTTC 3P5JA 2F5EA 2QQUA 1GANA 2ECBA 2DJIA 1G59A 4Z2AA 4I02A 4XCAA 1Z05A 3RZHA 4OMDA 2XVGA 2KISA 3MVPA 1Q56A 3KSCA 2DW4A 2MBFA 4I0WB 4YFZA 3QQAA 2HWD3 1GNHA 3SEQA 5IOYA 1IO2A 1DGRN 3DKYA 1WH7A 2BVBA 1PUEE 5HDGA 4CXWA 3ECHA 4NRMA 1ND3B 2ME6A 3OPTA 4LNVA 4DEVA 1QJU2 3T2PA 1LEMA 4Q0QA 2V1XA 1U5YA 1SFUA 3S5QA 2QQ9A 3RKXA 3IRRA 3KGZA 3OL3A 5D5XB 3HBLA 5DCMA 4WM7B 1LVKA 4AXOA 2HVRA 2VQUA 4YZ2A 3WF1A 4D9JA 1T6SA 2W52A 1W1WE 2A6WA 1YJ9I 2HWE3 3SHRA 4AIHA 3L2RA 4EGZA 3E3VA 5K1YA 4LBMA 5FPUA 2DMQA 1IKPA 3S1QJ 4YVSC 3O6BB 4M3DA 5J36A 3MIDA 3IAPA 1VRH2 5FWJA 2Y0SN 2R0HA 2RQPA 3J7YJ 5KAFC 1Y39A 1HKQA 1MBKA 1ZH5A 4OHYA 3WHCA 2VC0A 4LGWA 5HXVA 2ARAA 4KIFA 4IEUA 4MEYF 4M9SA 4IXLA 5JI6A 1XXNA 2A75A 2EF6A 2ZB9A 5FDBA 3KZZA 3DU6A 1YE9A 5JPMB 5FMOL 1QBJA 2L4MA 3BR2A 5EZHA 4DNCA 1RC9A 2VQGA 3B9IA 1UY0A 3TP3A 3TOAA 4G12A 3EBRA 5JFRA 2ZHLA 4MG2A 3G1MA 1H9PA 1XGSA 1FV3A 3QCWA 1D2SA 2WB1A 4TZDA 5CFCA 4LBKA 1PUFA 1LDKB 2AC1A 2P7CB 3LSEA 1UAIA 4MZUA 1YJWI 2XSJC 4NIGA 3KF3A 1OUXA 2LG4A 4UFHA 5AVAA 4CEWC 2I8DA 4BXUA 1QGLA 1D0XA 2E5ZA 3ZN6A 5FZDA 4OIRF 1OCRH 2QWWA 2K3FA 4CP9B 5J8FA 1UMIA 1S6LA 5D8AC 1YO5C 4H14A 2BTVC 5LWBA 2XC7A 5FZHA 2RJ2A 4NHXA 1MEC1 4U0VA 2EXIA 1GSLA 3QYFA 3WOGA 4N43A 5A7OA 3RVHA 1C1FA 4OVEA 1ETWA 1JUMA 1YJKA 1R5GA 2QZ2A 3ILRA 3GZEA 2CNAA 4DYCA 3HG9A 2M0CA 1NKGA 2PELA 3ABKH 4FTSA 2VVEA 4HKLA 5HNFA 2FDIA 2ZSHB 4GQ7A 1W8TA 4NMIA 3I59B 5GAEJ 5J1UA 4LBQB 4FOQA 1GYKA 4Q4X3 3MFCA 2RVCA 2KJCA 1ND2A 1S1AA 1XD7A 2ZEYA 4CYDA 1HRV2 3J8F3 1JKPC 2UYAA 1LECA 3ZYFA 1K12A 1N1VA 3WNNA 3POEA 3KLSA 2M34A 4WV8A 5GLTA 3I71A 3CO7C 4HEA2 1PGSA 2XL9A 2ID3A 5KC5A 4K20A 1GP4A 2DAOA 2ET1A 4COWA 4WXCA 2DFFA 5EJCA 3C3VA 3FXUA 5GZEA 4H7LA 1IG3A 4RL7A 3UYJA 4BPZA 2PN5A 3ZMZA 2ISZA 1Z0HA 3CJIA 3PIJA 1H0MA 1Z91A 5A32B 3SZGA 4PUSA 1RUE3 1UWWA 4KG8A 1GDTA 2JX9A 1XCVA 3OY9A 2RS31 1C4RA 3AKQA 5EZGA 3OYDA 2V5YA 4Y26A 4OAZA 4I09A 4N43C 1DQUA 4IHTA 4Q5SF 1AU7A 3DUIA 3LA3A 3JRGA 2DUQA 3K4LA 2A6TA 3IIAA 2R7QA 4RB3C 5CFDC 4Q0SA 4AI2A 1OKOA 1F4KA 2J5OA 3OOPA 2P5KA 5FFOC 3EUHC 1U6GA 1UB9A 1S0JA 3JD72 5KWRA 2CUZA 1IOAA 4ARXA 4PJMA 3IKVA 4QDSA 2GLOA 5DUWA 3K7AJ 4QX5A 3CL1A 3THTA 5LK7B 3M3YJ 4DOZA 4GFBA 5FKMA 1PO22 5DAQA 4HSRA 4G7OF 4PCRA 4P5YA 3IAS2 3NKGA 1RUI1 1R083 2C9KA 3WW1A 1VQ8I 2OUJA 4RGUA 3VBSA 3A2KA 5HDKA 1UX7A 3VBFC 2VBZA 1AL0G 1XSQA 1LHOA 2E1OA 1LDDA 2LTPA 1QPIA 3L9FA 2O5RA 4TXWA 1K4SA 1BEV3 4KN7X 3B01A 1C8M2 1HV0A 3JRHA 2WT1A 4DEQA 1W7PD 1F4AA 5FZLA 2EH3A 3POIA 4NIAA 1S55A 2Y6FA 3PIGA 1OA3A 3VZJA 4BKXA 4C8DA 3B5LB 2TUNA 3T0BA 3JB4C 3KM5A 1G6NA 4PJJA 2Z5UA 2R7UA 3ZYPA 1X1DA 4XRSG 2HPMA 5FLXZ 1DQ6A 2PA7A 2VXRA 4Q4Y3 2OPWA 3HPHA 4AEDC 4QHOA 4WM7C 2DA7A 5K0UB 5T54A 2UWAA 2JE7A 4BMEA 1UYXA 3RS6A 4JHTA 2CV6A 3K4CA 5FJKA 3KP2A 2WNVA 3PUHA 2VJ4A 3F2ZA 4LB5A 2IGKA 2PHWA 3JQWA 3HT2A 1ULCA 5BY5A 1WW4A 3F8FA 4QX2A 5FP9A 2ARCA 1PIV3 1R64A 3V0BA 1X82A 2DBNA 3C2HA 5GZCA 3M3EA 4YW4A 2JA5J 1JYXA 4EWDA 1ZBE1 3MO4A 2HWD2 2YG0A 5DG2A 4Y4RA 4UW4A 3WU1B 5HODA 2DBIA 4L92A 3SZTA 1JHJA 5FRMA 3JAMZ 4GA9A 1RKTA 1ZTRA 4MXWA 3CQOA 2QA4I 3OGSA 5BNPC 1PGW2 4MFDA 2M9HA 5C71A 1P4WA 2QF7A 3DF8A 3SZPA 5J4YA 1MH4A 3THPA 1R1UA 2GAUA 2XASA 3CLQA 1KS4A 4PSXA 5H6QA 1MNMC 3G6JB 3LDBA 1LU2A 2XVCA 1MSFC 1AL22 1L7LA 4KQ7A 5SV5A 3F72A 4DZJA 2XJTA 5LGTA 2B7YA 1RJ8A 5IYBJ 2JSCA 4PQ9A 3VBRB 4COZA 2R93J 4BA6A 4EE2A 3WT3A 4YM1A 1SVOA 3OYWA 1JODA 2ZZQA 5GKAC 4A69C 1NZCA 1PHMA 5TRDA 2RM23 3JXSA 3HVDA 3O12A 2NYYA 1W03A 3KCXA 2L7FP 3OBRA 1OQ1A 2WZR3 5IK7A 2XLAA 4CEWA 1FOWA 1RKWA 3I8TA 1OQYA 4XF3A 1EKEA 2CQKA 1IS4A 3GDBA 3OUHA 2M7BA 1GZTA 3ZFFB 2GP3A 4XL9A 3K2AA 1A6QA 1BC8C 4IOAF 2WY7Q 3AM2A 3LWCA 1R1ZA 3GTKJ 1MS3A 2Y69H 4XBNA 2PFWA 4E7KA 4NROA 1Z7S2 3ZR8X 3P7NA 1JUPA 2NNYA 1N1SA 2HJIA 3LNQA 2DA5A 1MEC3 4D6QA 1FNNA 4YGDA 1JT0A 4DYRA 1IDYA 4LIVA 3GYDA 2OQ6A 4UB6C 1FMD1 3EUKL 3JBG1 5K4LA 3KQRA 3C18A 2MH9A 1XMKA 1IGNA 1OBNA 4GXLA 5IVCA 5CVJA 4RA2A 1UZCA 4A3LJ 1H88C 3GMEA 1W6QA 5GPAA 3BLYA 3ESWB 4XORA 1T0FA 4HV6A 3JSPA 4M00A 3OY8A 3HNMA 1PZ8A 1OF4A 4OAYA 4H55A 3RNSA 3CJNA 5FLMJ 1ZARA 2VOXA 3LSDA 5JMOA 3GFLA 3GFJA 1NA1C 4HZFA 4LBNA 1A78A 3CU7A 3HAGA 4Q8LA 4XMAA 2WWSA 1IG0A 2VUAA 5F8PA 1SBFA 5DPNA 4YM3A 4HBLA 1J1LA 2XROA 2ZX2A 1IN8A 2W68A 2V1NA 5B66C 1U8BA 2C4XA 1CJPA 1IS3A 3BCWA 3M1CA 3BTZA 1XNTA 1CPNA 2YMZA 2R5YA 2L9VA 5EFUA 1JI8A 4ATEA 4RAGA 3IDBB 5FQ0B 2JENA 3N9QA 1KU2A 2R7OA 1JJ6C 4N43B 2WZR2 1RUG3 2VCCA 4LORA 1B72B 4B29A 1WCKA 5LA0A 4EV0A 3U9GA 2D6NA 4M3EA 3HUGB 1CR7A 2A73B 3GF2A 2OAZA 4YFKF 1MQTB 3J7ZI 4J1XA 3RJ2X 3VBUC 1UNBA 4M6XA 3X29B 2VMGA 1HJFA 4A41A 1U0AA 4B1MA 4LT5A 2C1FA 1KRIA 1RZ4A 3OTFA 2FF4A 3VBUB 2KKOA 2XPWA 5JLWA 5LFAA 3QP6A 1IRZA 3K4MA 1XB4A 3D82A 3WDXA 1OCCH 2W84A 4A3XA 4LTAA 4LULA 1I1SA 4A0YA 3ZYBA 2E63A 4XF9A 1GVDA 4HONA 1HIXA 2MG4A 1SHWB 4HVOA 3VDCA 3CJIB 4YIIA 2FD5A 4E70A 4K40A 3ZMUA 3VYSB 4JX0A 2LK2A 4RQPB 1WCUA 1F36A 1YX3A 1PGW1 2VLAA 1NA1A 2JDPA 3J7NA 4YVWB 5C70A 5ICFA 2I45A 1NG6A 3DKWA 1DHKB 3VHPA 2ESHA 3MD2A 2ZMEB 4IOCF 2P3JA 1ZNPA 4D7SA 1VP6A 4MOAA 2ZGQA 1K4TA 1RESA 4YELA 1HB4A 1NCQA 4CEYA 1REPC 3VZKA 1WKMA 1H9WA 1ZBE2 4BNCA 1HQWA 3AMHA 4RS5A 3ES4A 1H1MA 3I2DA 4B4PA 3HYIA 4XK4A 4X6AJ 3D3AA 4RGSA 1JGSA 5IT6A 4A3KJ 1OCOH 1U9OA 2XQXA 4M73A 2EFQA 3NKTA 4YGCA 5LB6A 4RSUA 1HX6A 2D97A 4C30A 3MZHA 3ST7A 1SAXA 2K4JA 3L2YA 2VW0A 3LAJA 2OCEA 1MNEA 1KDKA 5JZGA 5BPXA 4CTEA 1W06A 2EIMH 2EQRA 4PSWA 3ABZA 4MGKE 3WUDA 5C9AA 3RQIA 5IP6A 4Q4W3 1H1AA 3O1SA 2LKPA 1Z77A 1R1A3 1SG3A 2L3DA 2QYOA 1LOFC 2Y9ZA 2EXJA 5HLIA 3TP0A 1J09A 3KLNA 5FCCA 2BUKA 1FBQA 3KQ4B 2YPJA 3PUIA 1XTAA 3BTIA 4E4ZA 4IGPA 4PDWB 4KWKA 1FYKA 3RWKX 4G7HF 3K69A 2CJJA 1ZQ3P 1HRI3 4YG3A 2BV6A 5CQGA 4EWEA 4CU6A 2W39A 4RFRB 4Y5TA 4LG3A 3VSLA 3BTLA 3CD6I 1S0DA 3NSTA 4FPGA 4ESJA 2DTWA 4YG0A 3FXMA 1RUI2 3PUFA 1U0JA 2WT0A 4P02B 2QZ3A 3BALA 4AVBA 1RVF1 2PHFA 1UX6A 3RRDA 4CDWA 1S2BA 2J1RA 5E1WA 1NH3A 5E20A 2B45X 4E9KA 4EJUA 1WI9A 3BOPA 4JZRA 4CRQA 4XDQA 4HOOA 3SEZA 4RAFA 4GKYA 1ASJ2 1W0TA 3AC0A 2E2JJ 5FLJA 5H20A 2CMPA 3NAUA 2P0WA 2MFZA 2IVMA 2ZXJA 2M4GA 3NVCA 5CKQA 1PMJX 1YQCA 2RV9A 3B9CA 4HPKA 3H9JA 1QNWA 2K5CA 2KIFA 1I39A 5C9AB 3PJRA 4KI5M 1BR1A 3JTHA 3WG9A 1CAXA 2IAIA 1WKYA 2RR11 5F04A 4B47A 2B8MA 2K4BA 3WHBA 3BTCA 2FMDA 4U88A 3OCPA 4MQVA 3O1OA 3DCFA 4ETSA 5FQ0A 4IW3A 2RS32 2F6CA 4M71A 4YW1A 2WWUA 4C3IJ 3QU3A 3ZR5A 1I3QJ 2ATFA 5L3BA 4S2HA 2Y38A 4PGHA 1ZKGA 4UV8A 4ARYA 3K1MA 4ITCA 2W85A 2K7LA 4YW6A 5T3NA 2CFXA 3GCWA 2CFOA 2Q1ZB 3BB6A 4FOVA 3VDDC 3GVAA 3H8XA 3TKYA 2CU7A 2QCSB 1FWZA 3PTRB 2JDUA 3SEPA 5KAIC 4MLOA 2DQLA 2I10A 3HC7A 1JUSA 3S2DJ 1BM9A 1BOAA 1H0BA 3B94A 5IVFA 2MD0A 4TN7A 5C3RA 4MVTA 2Z4FA 3J7HA 3CUOA 2D3SA 4HSJA 3CZUA 3MDPA 5JXJA 4G8XA 4XJ9A 3AXDA 1YIJI 2RJLA 3WE3A 4CUAA 1SLTA 1V55H 2XWJB 3VBHA 1IZ3A 1W6NB 4AC0A 1SC7A 4BDVB 1LE8B 3POFA 4AVAA 3P9IA 4WVVA 2WB1N 3UL2A 2ETHA 4WCGA 1J7KA 3JREA 1ASJ3 1ODMA 4FOYA 4AW7A 4A12A 1PJRA 5FBZA 4BAYA 1FP1D 3D0JA 4AFBA 4MX3A 1EF4A 4PDKA 1ENRA 4QWNA 3FBIB 3TN93 3H0OA 1FPQA 5C6CA 2Z33A 1PGL2 3FHQA 1NE4A 2KRCA 1MEC2 2BWCA 1ZHFA 3O5SA 5GZGA 1A8MA 4LK1F 1SLAA 2P3YA 4IUGA 3FBNB 3ACIA 1F9NA 2LR8A 4KYWA 5JSPA 5FD6A 2HWF1 4JRLA 3CKHA 2ID6A 3LZZA 3DEUA 3U0ZA 4YVWC 2GIVA 1KZHA 4QPIB 5JUVA 1TWAJ 5CIRA 1ZVFA 4KMFA 1ERDA 1QY4A 1LNWA 4IKFA 4HVQA 1BOBA 2VMIA 4QU1A 3EPZA 3WTYC 4FE4A 1TLHB 5FXZA 2CO5A 2ZACA 1OLRA 3LD8A 1KA8A 4URTA 2VE8A 2A61A 2BXZA 5KC6A 5DABA 3HL2A 2VL8A 3Q8BA 5KXCA 3HSEA 2FXAA 3RZZA 3BR6A 2BGOA 5A7QA 1F8VA 1X1CA 3WHUA 3LL7A 2JXAA 1PUFB 4ITVA 4M4PA 2IA1A 3BT9A 1DG6A 1IG7A 3OMYA 2RM21 3TO7A 5FFXA 2D2WA 1ETKA 1LHWA 3IL2A 3PDQA 1JKQC 2LOOA 1CONA 1BKZA 4EQVA 2OJED 5E16A 4MUVA 2H1LA 1FY7A 5JR7B 4P00B 3MICA 5DDJ3 3CF5F 1BJQA 2NOJB 3CCJI 2X9DA 3UT0A 4WBBA 2O7OA 1VIWB 3HKZA 1R092 2JRTA 1LJ7A 2Y30A 2R16A 2P81A 4FI9A 2PMZA 3ZSMA 1KQ9A 2WFF1 4IEWA 2HTSA 2BY1A 3FM3A 1AR71 3W2WA 4C3HJ 2VBPA 1I1GA 1OF3A 2O8OA 1S7AA 5L3EA 1JYVA 4YVSA 1K83J 3EYPA 1Y4WA 1HJGA 3T5XA 2VE9A 4LKDA 1N75A 2Z9OA 2NNNA 1QMJA 2LFBA 2W3JA 3RQ0A 4IEXA 4HFSA 3WQ0A 2WNVB 5A70A 3CCEI 1KYZA 3GALA 4AYBA 3K4BA 1W9WA 3OSFA 3FXOA 4N8MA 3VDAA 1Y7BA 3GWZA 1HRI1 5B4NA 4YM2A 2LF7A 1W9FA 1JHHA 2C0ZA 1Z1DA 1WJBA 2WO2A 4XURA 2F48A 4DQAA 3BR5A 4AHWA 2X1DA 5FZ4A 1Q8VA 4LO5B 3ETQA 1FNZA 2HEOA 3GFMA 2QQAA 4Q4Y1 5EJZB 5HCBA 1UF2C 1DQ5A 4FFFA 1B35A 2W1QA 3RZGA 3C3WA 5E3LA 4RGKA 1C8NA 3ZLIA 2PHRA 1HDPA 4U0WA 2KP6A 3ECQA 4K21A 3K77A 4KIBA 2H94A 1OQDA 2ZOEB 1XE0A 4CP0A 1YS6A 3MF9A 2RDPA 4R9BA 1REDA 4MXWB 2ZXIA 3HD8B 2L54A 2FZ1A 4L11A 1CQTA 4ASMB 3FISA 3HN1A 1YIPA 1UG2A 2HDWA 1QDOA 3WDUA 1HB2A 2ZX4A 2PLV2 2B9VA 3PNVA 5LBQA 4ZZ5A 4GYIA 2XJRA 3BOWA 5CVVA 3MHZA 2XAGA 5IK5A 3BG3A 2ZJQF 3FHAA 2BW3B 5K5QA 1TMF3 4B8EA 1OURA 4IQ4A 3WDYA 1OQEA 4ZJZA 3N97A 2ADEA 3OYHA 2JVGA 2CWEA 1QJY2 2F4MB 2DYCA 3BQZA 2P34A 1TNSA 2EK5A 1UY1A 2M2EA 1A31A 1W2AX 4ATFA 3BP8A 4AOCA 1O59A 4WXHA 4HF1A 3FLRA 2XG3A 2EFWA 1CAWA 1BN5A 1F1ZA 4GCVA 4Q4V1 4JV4A 3G71I 3P3NA 5E6HA 5FZFA 2IXKA 4C91A 2BOIA 3S15J 4K9SA 3BI3A 3C7GA 1G9BA 3V7SA 3KLOA 2CQ7A 4M9XA 2AHQA 2JA2A 5K5OA 4LMYA 4CCNA 2NM1A 3BYWA 1XRUA 4M3CA 5FLXK 4NO4A 3S30A 1AR82 4CEYC 3HWJA 5FKBA 1QDCA 2XKOA 3AMQA 2LY9A 1J1TA 4IL7A 1V6LA 4OUSA 4EM2A 2XBO2 1YRNB 1RUH1 4BH9A 2J1SA 2J7MA 3CC2I 2FA5A 2EJRA 3J80Z 5B5EC 3GFIA 1UMZA 3KVBA 5AIPA 4XRSA 4LHNA 3RJPA 3O3KA 3AMPA 4V2FA 3JRIA 4Q2FA 1N77A 1J3QA 1PMHX 2L7ZA 1GVJA 3WU2C 1BI3A 1S2EA 4F83A 3H9GA 1REFA 1P7IA 4KBZA 1W36C 2KIQA 3CC4I 5FRNA 4XETA 1O3QA 5I8TA 1JOBA 2GIZA 4O5VA 2NVXJ 5F39A 3TOJA 4HV5A 3J8F1 3E6DA 1BR2A 3THDA 5BNPB 4OQ8A 4D7TA 2W0XA 4ZU7A 5F5IA 2XF5A 2I07B 1Z6RA 1X3UA 2VPVA 2VPLA 3URFA 1DYKA 2QSHX 3AVSA 5JAXA 1P2FA 1S29A 3LWFA 2VVDA 4A4AA 4QWQA 4DOUA 3NAPC 1IN4A 1DYOA 2R1DA 3NNMA 1K5MB 4IE6A 2Q2EB 2R6QA 3PNTA 3NAPA 4BJ6C 3O2PE 1WD3A 2R042 1I1EA 5CKMA 2PHDA 2C5DA 4BDYA 4N7IA 3H3ZA 1MNDA 4YSFA 2WFPA 1BI1A 3L2UA 1ALYA 2DT7B 2LMDA 4PGGA 1R22A 3AP9A 5F5AA 4QPQA 3K4DA 1LR5A 3MI8A 5LHHA 5IT9K 1IQAA 2VAUA 2WNOA 4CCCA 1G8XA 4D0PA 4ZDPA 5FZIA 3MEXA 1IPKA 3VYUB 4XYXA 2WNUA 4IRGA 4L9VA 1IW7F 2VBDA 2WNUC 4FISA 2YYOA 4WZFA 4CYCB 3GTQJ 1ZRCA 2AQEA 1Z9CA 3V0AA 3LSMA 3S2HJ 1GQPA 5DM6F 4BWOA 2H0VA 5FKCA 3OYEA 1RNLA 1VMHA 2PJRA 4J1WA 2IGMA 3LFIA 4LOTA 2R0QC 2A3XA 3BU0A 4FQ4A 4MGRA 1ZLKA 1GXPA 2OTJI 3AL5A 4AQ6A 4EJVA 3VV1A 1W7PB 2LREA 2KMUA 5IVYA 1KQ8A 2DTYA 1KGYA 4ZU5A 4IEYA 3LE0A 4NBQA 3CMEI 4B4CA 1SD5A 4TLFA 4D1QA 3HN3A 4TSVA 2ZFWA 3CZ6A 5K5RA 2EWNA 2QENA 2F5VA 1AJOA 1GT0C 5J3UA 4DMIA 3HT1A 4FPFA 3M8JA 4QKFA 3H35A 1U5IA 3T8TA 1UZZA 3HMYA 3BJOA 3ZQFA 2DDAA 4O7XA 4XFGA 2IA2A 3B3QE 1NAEA 1NG7A 3CQZJ 2HPIA 2RMU2 4I0AA 3ZSLA 1OLQA 3KP4A 1DFQA 3NWTA 2WO1A 2EA7A 4WZCA 3OGJA 2GC0A 1SDWA 5C8CA 1ULEA 1Y43B 5ABJC 2GM4A 4RLQA 3DN7A 4RAZA 2Y6HA 1NTCA 5F27A 3SCFA 4Q4W2 1D4M2 3PTYA 3VYRB 1QJX1 3GTGJ 4A6SA 1SPPA 2X6WA 3K4KA 2BZTA 2ZHNA 1YCIA 3ON7A 4M3CE 1X50A 4PK4A 2JDMA 3I64A 1Z7LA 1K42A 1EUTA 5F3GA 4FP2A 3KP3A 1Y1WJ 5I0DA 2ZCWA 2OC6A 5CYVA 4DY3A 1VFCA 4HPKB 3J8F2 3W5MA 3CP2A 2XAFA 3RYRA 2JMWA 5C4JJ 2STTA 3AB0A 1XN7A 4YGEA 4K6BA 4XJAA 3A4CA 5IVEA 1AX0A 1TMF1 2AYHA 1TTYA 1WCDJ 4XW3A 2YB7A 1VR3A 3G2BA 4AL9A 1DU0A 1GNZA 4XZPA 2NN8A 1BC7C 1JHNA 2YPDA 1W5SA 2DVAA 5LY1A 3AAFA 2L5QA 3EHKA 2MABA 3H8OA 1RUNA 3C7HA 4GAZA 2D6PA 3K3OA 1O8SA 4FVVA 2QQOA 2RE9A 2LH9A 3WTWC 1ZRFA 1YQ5A 2HWC3 4BZ4A 2QQIA 4QKDA 4B1LA 4Y24A 1JTYA 2HDCA 4AR2A 2D1VA 3ZYGA 3VL9A 2DV9A 4Q5OA 4OINF 1AX1A 3T0DA 1RUH2 1UY2A 1H2KA 5GJ6A 4PJ0C 4JGYB 2P5LC 3I2IA 4BLIA 1YLFA 1JMUB 3S2WA 3KMHA 2GDFA 3M70A 1SPPB 2NLRA 2R49A 3ABUA 2RKHA 1U5TA 2JG9B 4L5EA 4LITA 1R081 1MQTC 5F0HA 3I59A 3CJTB 4BS9A 1SVLA 1EH7A 2RR13 3DLLF 1UY3A 1RMU2 3H5NA 4IO9F 4C3JJ 4BISA 1QOSA 5A80A 5FPZA 2PMHA 1UOGA 5F5QA 3H50A 4HVRA 1UMHA 2H0BA 2DI3A 4JDNA 4NIDA 1VF9A 3LOBA 2ZZJA 3ZXDA 2DOEA 1OLMA 4YZ5A 1U5XA 1VBB1 4EM0B 2DFCA 5FAXA 1WJCA 1D0HA 1MS0A 1CWPA 2YBPA 4W50A 1USTA 3EQLF 2R5YB 5LD2C 2M5WA 4RMNA 5JR2A 1W7PA 4LUKA 5CQEA 1S7OA 4CE8A 2H27A 1H6YA 4XJZA 5IK4A 4BXFA 2OQGA 3P9CA 1PZ7A 3I4IA 2VM9A 1ONAA 4P1WA 3LGRA 2XHNA 2BY2A 2E71A 4PIZA 3AL0C 3FFZA 4KNYA 3DKQA 2J1AA 2DYRH 3DYPA 1G9FA 2XBO3 2XJUA 1BXHA 2ZEXA 1Y1VJ 1DZRA 3I58A 4RR3B 4A3CJ 3QWLA 1ZG5A 5A3TA 4MH0E 4OUMA 2G9WA 2XPUA 2KRFA 3BODA 4M3GA 2RV8A 4NQWA 1MMAA 1A6CA 1HN1A 2CG4A 1XYOA 3IWZA 1VB4A 1B4AA 4OULA 4CU7A 2P2KA 1H2LA 1W9SA 4LK0F 2A6XA 2W46A 5BOXA 1NXD1 5BV6A 1AR62 4LHLA 1LRHA 4XKWA 3R4SA 1UCXA 4P9IA 5HOOA 3DBHB 3K0LA 2GWRA 3CJRB 4LE4A 5EG0B 4OIPF 5AONA 1BVVA 2D93A 4AI1A 3GM8A 2GA1A 1RUJ3 3AKTA 1RJ7A 1VBA2 2OQRA 3OF1A 1UELB 3CUQC 1HKSA 2LKXA 4YVSB 4OMZA 2O3FA 4HA8A 2FSWA 1XNKA 2GZWA 3I7DA 3KYLA 3RTRA 4KISA 2ZJRF 2E1NA 4QGNA 3BTXA 2WZPP 5HLHA 1D5VA 2DF7A 1CQ9A 1EPZA 4XEZA 3NNFA 1OMIA 1X8EA 2ISYA 3ZPLA 2CGOA 5L9BA 2GXGA 1GNYA 4P14A 4NR1A 1W90A 1FMWA 4XE9A 1XSXA 4QAWA 5LRSA 2CRGA 1A8DA 4IEQA 1WBFA 3HOXJ 4E7ZA 3W6VA 3MEPA 5GTHC 2HWF3 3N9PA 4ENMA 1MJBA 2XGEA 4PF1A 2O0YA 3AFGA 2PEXA 2D6LX 2LF8A 2Y48A 2LLKA 1M4WA 1NCQB 1JZ5A 2FDFA 5JCTA 1HDDC 2FNAA 5IWFA 3W58A 4NHKA 3G3ZA 4DY5A 4XHBA 3N7LA 2RJKA 1G3WA 3R0RA 4IGQA 3ZFFC 4I99C 2D6OX 2OX0A 2NS0A 2P5BA 3DEMA 3USSA 2WLQA 2CQNA 4WK8F 1F35A 1YX5A 5FP4A 1AR63 4IHYA 5HI0A 5CNAA 3VBRC 1O4TA 1VBE2 1IKQA 3IP4B 3Q0UA 4Y52J 4KNCA 5FREA 4AYBN 5A7WA 4RM3A 3GO5A 3NV3A 1J59A 2F5CA 4AAXA 4TV7A 4IV3A 2KA3A 1D0YA 5GLZA 4CCMA 3R60A 1AKHA 5FZ8A 4EEFG 1UKGA 5K7PA 4UNOA 4X0GA 1T33A 3K10A 1ZZ6A 2DUPA 3AKSA 5FYIA 3CEWA 2L01A 1LHUA 3NV4A 3DCQA 4OUEA 2DQRA 5LASA 2HOEA 1IXRC 2BZDA 3EJKA 1RUJ2 1UQXA 1VQ6I 4KMQA 3FJSA 2Z16A 5K0UA 3P6BA 1CAVB 3O1VA 5A32A 3F21A 3J4UH 5J1YA 4PI2A 3KPHA 3DTKA 2X10A 1SFPA 2IA0A 3ZGKA 2JPBA 1S0EA 4LG0A 3K46A 3L2CA 1VQ7I 4OHVA 2GALA 4E7JA 3SFZA 3ZFGB 2Y26A 3VKLA 3VGIA 1CIYA 3OBTA 1HQNA 3MBWA 3E1SA 1L7RA 2GMPA 2Z3YA 1T8IA 3N4MA 5IVBA 1R4NB 2LKSA 3KS7A 3W9AA 4RR3C 3CLOA 1OYIA 2Q2EA 4XN3A 4TYSA 1UD1A 5LGNA 1QZYA 2WINB 3IH4A 5FLIA 2VKVA 2YX7A 3F95A 2JG8B 4OIOF 4SBVA 1ZBA2 2BW3A 4FQZA 2F4OB 2EIEA 2BNNA 3UKNA 2FZ2A 4B3AA 2ZHMA 1W6PA 3LA7A 1GUUA 4V2WA 1NQJA 3INAA 1RUC3 1I3AA 3VDDA 1AXKA 2JJ7A 5GZDA 4RHV1 3ZXLA 3SCHA 1GZ9A 2KXLA 4HQMA 5A3UA 2R3SA 4ZPIA 1ZRIA 1J0RA 3T0YA 1EPWA 2GN3A 1WI3A 1H4HA 2WTEA 2ARXA 4J19A 4OMYA 1Y9QA 3ONQA 4XNFA 3JCUC 4N4NB 4B3NA 4META 1MW7A 2JA7J 4OMCA 2V9KA 3Q0VA 1MKMA 2DA3A 1IHMA 4G9SB 2Q0OA 2RG4A 2VQ0A 1U2WA 3CHXA 2ZA9A 3F8MA 1DU6A 3USUA 1TNFA 2NZ9A 2RQQA 4J25A 1HCRA 2ELHA 4BQYA 1HLCA 2FRHA 1CN1A 5DTDA 1TC3C 1OISA 3S5AA 4UOJA 2YC0A 1PMIA 2WAFA 1JUIA 2H6CA 1I9RA 3PO3J 3FK7A 1FYLA 4II3A 3A4UA 2D5FA 3E6MA 2VMDA 4AU7A 2DFBA 2AUYA 2EFOA 1X1BA 5ICEA 3L09A 3PJYA 1VBB3 1X9PA 2DOAA 2IC1A 1ND2C 5BNNB 1P4XA 2EXHA 4IDZA 3KGLA 1NK2P 2ADDA 2XOMA 3TBIA 5EJ1B 3KEQA 3S3NA 1DGWY 3CCMI 2Q4SA 1ON2A 3ERED 1KFUL 1JGGA 1YWKA 2KM2A 3RDIA 4L9NA 3GBWA 3OWTA 4E2GA 4KFCA 2HWE1 2MEV2 3M3IA 1D1CA 3S1MJ 5IHRA 2Q8EA 3QPSA 2E7AA 3B73A 2VQTA 4L5IA 4QM8A 2NVTJ 4C1XA 4YW3A 1ZLJA 2R32A 3ECOA 3VUOA 1KITA 2FBEA 2OU2A 2XIGA 4LO8A 1MZEA 4CH7A 5FROA 2I2SA 2LUWA 3C7OA 1HW5A 3VHRA 4FPKA 3UNPA 3WDTA 1FT9A 2VTXJ 2J1TA 2JECA 1W6PB 2GSYA 3DL3A 2ZC2A 3DGTA 1RI7A 4U7BA 2DODA 3ZXJA 1ONVA 1RVF2 2QSFX 3ASIA 2R7WA 4CP1A 2A5ZA 5D21A 4UI9L 1Z78A 3CP8A 5BS6A 2EV5A 4D6RA 4JP0A 4QQ2A 1R5ID 1W2OA 5EWSA 3PQJA 2JSPA 3R4UA 4L0ZB 4XF4A 5JLVA 1MH3A 1GICA 3KFWX 4V2VA 3I3DA 3VYTB 2X0LA 2WN2A 2DXIA 1FPN1 4HF0A 5C8WA 4BQQA 2VBWA 5FZBA 2VUMJ 1CVNA 4M9ZA 2A70A 3DV8A 3F22A 3NQOA 2VR4A 2E36A 3AK0A 5EYXA 4EATA 3S93A 1IN6A 2EZKA 3O1TA 2OUMA 2P4WA 4N7UA 3AZVA 5FD5A 1QXPA 1OCTC 2RDRA 2DMPA 2ZKLA 4JKMA 4CDUC 4IJAA 2XXZA 1PVEA 1N25A 1FI2A 2FQPA 3SKJE 3MWMA 1U3EM 5ANQA 1QH6A 1DUXC 5FKLA 2ZGOA 4A3EJ 5LRRA 3ZFFA 5EG0A 3F6VA 3FX3A 5AFEA 4JGZB 2VMFA 2OF7A 4ZH4F 3IPVB 4JVAA 3ES1A 5L3FA 4A45A 2D40A 3K3NA 2EB7A 2E7QA 3CBNA 2ZNZA 3KYCB 3QYEA 1PX3A 2ACJA 2FDGA 1RUG1 2FQ4A 1TG7A 2WQ4A 3HHGA 4XN0A 3I2HA 5LEKA 5CB7A 2HKXA 1UN1A 4GH4B 4QM9A 2Q8KA 4O3MA 5J4VA 5C44J 3WTTC 3D8CA 1ZZ8A 3MKLA 4BB3A 3OYAA 5D5VB 3WNOA 4YG2F 4AFCA 3OOUA 1NK3P 1BHGA 1YLLA 1AYN3 4QB6A 1IJWC 2ZX0A 4NIHA 3FDYA 2EZHA 2WS92 2CV1A 3NEUA 3FM5A 3QH7A 3MGUA 3FBYA 2QBYB 2PMWB 1PO11 2E60A 1MZBA 2IP2A 1DP0A 1S7EA 1ZG1A 1YRZA 4AIDA 3DEEA 4AF9A 1C3HA 4HW0A 1O4XA 2DU0A 3KCCA 2HBTA 1BW6A 1KQRA 5FY7A 3IC7A 4UBGA 4QT6A 2ZHKA 3M8LA 5FUIA 5T5OA 3ILNA 3ACFA 1G7YA 1MBGA 1IRXA 3IIIA 2EPFA 1YNAA 3HM5A 1TWFJ 3AKRA 1WWYA 4AEMA 1S3JA 3VEPA 2GXBA 4JGYA 5I91A 1X3ZB 3BC8A 2DCJA 1QU3A 1BVP1 1ULYA 1LHVA 3M7AA 4E8DA 4U7DA 5AIQA 2VE1A 1MMNA 4Z1VA 5DMYA 4N4OB 4QPIA 3TBDA 2ORXA 3KYDB 1OT5A 4L5JA 2NRAC 1AF9A 1QHDA 4GWIA 3B00A 3MKWB 4JGZC 2P6TA 1WHUA 2CV0A 2VCMA 1FPN2 2O61A 3AFKA 2ZBJA 1WD4A 2VTXA 1IPSA 4XFAA 1XYNA 4ANJA 3JSOA 3TWIA 5F1JA 5FR3A 2G9FA 1DCSA 4YVWA 5E3OA 4UUVA 3CMGA 2VTFA 5LA9A 4E4HA 1OOPA 3RMYA 3GCXA 3OOXA 2ZO4A 4XQDA 2XF7A 2NAZA 4FAHA 2E51A 3ZMNA 1OR7C 1HLVA 5A33A 1VAMA 3CO6C 1QA6A 3KIOA 1V00A 2UWCA 1FOXA 1DLCA 3W3CA 5M3FJ 5I93A 3N36A 4S04A 2EBIA 4QPWA 5CEHA 4K7JA 3N7KA 3BCBA 2I74A 2FCUA 1QJFA 4BHPA 1K3IA 5E88A 5EEHA 3RKQA 1W05A 1NCQC 1H8TC 5IFPA 2QCOA 2YROA 3OYBA 3DECA 4WWCA 1O3TA 2LW8A 3AL0B 5J8CA 2K46A 4ISQA 4JK1X 1POV1 1ETVA 5IPAA 2B46X 1W3VA 5FBJA 2XRLA 2BV4A 2F5DA 4OCTA 4DJAA 2G1MA 2G19A 1YI2I 1W39A 4NHMA 3M4FA 1REEA 2GNBA 4COVA 4WVMB 2DOFA 1QKQA 4KL1A 4QD2A 3WTSC 3RYKA 2VZQA 1Z7S1 2QNKA 3I3EA 2A5WA 1MJAA 2YU3A 3FMRA 2KD7A 1UPSA 4A6OA 2X8KA 5H2FC 3VBRA 5JHFA 5HNHA 1YG2A 1LVAA 3RKWA 3ROUA 3APBA 2EINH 1W4MA 3ZO0B 5EYYA 1B8IB 3HZJA 1CZTA 3PL0A 4LHKA 1SBEA 3UKTA 2BOJA 3OY8B 1R9TJ 1FSHA 3LF7A 3FXJA 2D6MA 3F3XA 2P6CA 4EROA 1H2MA 2DA4A 2ENRA 1BL0A 1RPWA 1OOPC 4ZDLA 2EIJH 2J5PA 2CL2A 5EQUA 4XLAA 2ZKNA 4Y13A 1RRJA 5F64A 1HB3A 5IAXA 1QVTA 2QQMA 3HHHA 1AXZA 4LLFA 4IRIA 1WJEA 4CDUB 5B4XA 2ZJPF 1SFEA 4DXZA 4LLNA 4AVVA 3W2AA 2NXNB 2ZMEA 3RZKA 5DZFA 5LA2A 3U78A 2IXJA 5TSWA 2WL1A 5A3PA 1V6IA 3MFAA 4N53B 5DUVA 2YC2A 1V4RA 1LKNA 2ZABA 3ZXFA 1HOMA 2V1UA 3A0KA 3IT8A 5C3OA 5D5UB 4KN4X 2PLYA 4BE0A 3PURA 5FMCA 1IRGA 3RPUD 5JXGA 1EV7A 5I0SA 2E33A 3REOA 3SEEA 5TJJA 5G05L 5FUPA 1DGRM 3PVNA 3ZMSA 1BBT3 1UOFA 3WNKA 5GPCA 3GUDA 2LDUA 1U9NA 5FGMA 2GOMA 4B3XA 4XLPF 1PVXA 4INDA 2CW8A 1UHWA 2VOOA 4E7SA 3LB9A 1YJNI 2HWD1 1JU3A 4MO3M 4NDLA 3BPXA 1BBYA 4CDQA 3HGGA 5FLHA 2WDBA 5FYYA 5A1FA 3POGA 2IPQX 3DPLC 1JN2P 1RUF1 5FMBA 1L0OC 1VB2A 1W8UA 4L9JA 3ITQA 3WTVC 4M3CF 2QTWB 4WM8C 4QHZA 4RB1A 5CZKA 2RAEA 4OWRB 1NLRA 4M0NA 2V6EA 3SHFA 2W95A 4IHSA 1QOOA 5A3LA 3TDZC 2R063 1XU2A 2IBDA 1ULFA 2BWAA 4I2OA 2LALA 3Q3SA 2E53A 5AC93 5BNOB 4RD7A 1MS9A 4CXYA 3A21A 3BR0A 1PK6A 3ZQQA 2XB6C 1FIAA 4UUSA 3I56I 3Q8AA 3SH4A 2RS33 5CFCB 1TT5B 4HXCA 2XWBB 4UAPA 1JTXA 4HG6B 3L2WA 5APAA 3TAYA 1MZ6A 1LENA 2AO9A 1VBE1 3N9OA 1TBXA 1IGOA 2A6VA 5KNLA 4ENKA 1AHSA 3HOWJ 4YARA 2M1BA 1TWHJ 1N3OA 1AWCA 5HDNA 2PJRB 4A3GJ 4QMAA 4U0YA 5DD8A 3S16J 4EM1A 2JDZA 1T6BX 3TW7A 3ZKUA 1OI6A 1RUC1 3ZIXA 1S2KA 2H8RA 1U8RA 1RUOA 1FMVA 1XC6A 2GNDA 5EV7A 5LW9A 3H5RA 3HBZA 2FBHA 1O6UA 2K9LA 2L9SA 3WG3A 1QQIA 4FE7A 1CF7A 2ELJA 4XF0A 2PHXA 4HANA 3I2JA 1PO21 1UIJA 1S4CA 3WG4A 2N7GA 3JCIA 3WNXA 2RDQA 1ZN2A 1VNDA 3ZP5A 1DLLA 1LGBA 1ULGA 4LKEA 1BIAA 3CCSI 1STZA 2A6HF 3CDLA 3UGHA 1T98A 3JD71 4ZYAA 3U2RA 4QHBA 4EVIA 3C7JA 4HNVA 4EYUA 4AIKA 4YFNF 2WV0A 2Q8CA 1AXYA 4F91B 4B1RA 3ORJA 4QU2A 3WGHA 4EJTA 3Q9OA 5D1IA 1Z0XA 2VJIA 2ZGNA 4GD4A 1R58A 4ZXEA 4KJZA 1IZ1A 4GMP3 1ON1A 4HETA 3OIQA 4O9GA 1VBA1 2WAAA 3MPBA 2UXXA 3NAPB 2Z2SB 2L9NA 5F1RA 2WBMA 1NCRA 1UAAA 3OPZA 2BU9A 5IVJA 4MXVA 3J26N 3JW4A 4AK3A 3RPUA 2ZEZA 2WSVA 3DYMA 1BQPA 2YY1A 3H7YA 1HSJA 2HNHA 2BW8A 2ZKZA 3D6EA 4IE0A 1Q8PA 1XBFA 4HYEA 4FPEA 4EN0A 2QQPA 4C2TA 2IJLA 2ETEA 3BPZA 4HAMA 2Z69A 4NUBA 2BGPA 2VD7A 2H09A 1JYNA 3BZCA 2PFBA 4HX7A 2GOXB 2VBXA 5FXVA 3N7JA 2IEKA 1QJX3 1FATA 4BHBA 3QH6A 2DA6A 1FAYA 1MBEA 4URAA 1JYWA 3K51A 3E97A 1QXRA 4ENNA 4G9YA 1YW8A 4A93J 4A3BJ 3HGYA 2GH2A 4ZYEA 1Y0NA 4M01A 4MGIE 2UZKA 1YS7A 4CCDA 3WF4A 1GOGA 5FYBA 3TL4X 3EYIA 5JVVA 3LQQA 2W25A 4I98B 4V2GA 5BPIA 3AJZA 2O8XA 2OIIA 1SMTA 5JVTA 4L99A 4A6DA 4G3YC 2RC4A 1OPMA 3JZVA 3IH3A 2F6BA 4CP9A 3MCZA 3A0HC 4RYDA 2JVHA 2X5IA 3U1DA 3VBFA 2VIXA 4OLLA 1NUKA 3DXUA 4O6JA 2DU1A 1VBB2 3QU6A 3NW4A 3I3BA 5LBBA 5ERLA 4Y3OA 3L2QA 1D1BA 4D6SA 3DEWA 3QACA 2GC2A 4KUMA 4LBJA 3H3UA 4IE5A 3VD5A 5D6EA 1ODNA 2PN6A 2SLIA 4Y33A 2J22A 3KZ4C 3EXUA 1G4DA 1NOVA 5FJ8J 1V6OA 3SMHA 1R082 2E1CA 3GZAA 2DFHA 2HLEA 2X48A 1H4GA 2F2EA 3F23A 4MGQA 4LIUA 3OG2A 1OVPA 1IXCA 4OI4A 4LOCA 4FPLA 2D7FA 3BG9A 3CLPA 3S57A 3PSFA 1UJ8A 3E6CC 1UZYA 2IFRA 3OYWB 4XJ8A 3SFIA 4BXXJ 1HKDA 1XNCA 1W8OA 5C7GA 4BQNA 1X8MA 4PLMA 1F9KA 2OYZA 2W08A 3FE5A 1E5HA 2M87A 4YIFA 1VQMI 1AX2A 1BIBA 2D3PA 2QFEA 2JRMA 4QDQA 3NQHA 1WCSA 2JWPA 3WF3A 1VQ9I 1TL8A 2ZTNA 1FOYA 4JX5A 4Q47A 3ZSKA 4LO6B 3FHIB 5KR7A 3U14A 4IERA 1VRH1 5BQTA 2ZXHA 4B4RA 2GH8A 2IZWA 2HZTA 1V6JA 4XLFA 3OEAA 2W87A 3ZQCA 4OZXA 5L9VA 4ASLA 1JZ7A 3POWA 1UZWA 2O8KA 4JGYC 1Z3YA 5FMOS 3AX4A 3SNMA 3TYJA 3B7MA 2DTRA 3U4SA 4B7EA 4EWAA 3ML6A 3I55I 3K70D 5GLUA 1LOCA 4AGGA 2QGUA 3JRCA 1EUUA 2RNGA 4CDQC 5CAZA 4DZPA 4XRMA 1UHMA 3EDPA 2LTNA 4JC1A 1LPQA 1HV1A 1ITYA 3JUUA 3ZYRA 1RHI2 2CSOA 4JQRA 5ICGA 5F32A 4EJRA 3EMRA 2QBXA 1RTVA 2ERFA 3TNPB 2R5ZA 5DZEA 1VMJA 5J48A 1DIWA 3SQNA 3N35A 1ZZ9A 3P5BA 1J9IA 3U1XA 3BU7A 4FSJA 2L2OA 3SISA 1MDMA 5FPXA 2P3IA 2RMU1 4A3ZA 3RI4A 3EETA 3T4HB 3FHZA 5G04L 1B09A 4PIXA 1TWCJ 3VD9A 4OHWA 2K27A 2VT3A 5J7MA 2GBYA 3O0WA 3JRBA 3WR0A 4CDGA 1DDNA 1VBE3 3WW4A 2HWC1 1OCPA 2QKLB 4QPGC 5CKNA 2R062 3AZYA 3MPPG 1FSEA 5C3PA 2VKEA 1GU3A 2CWSA 2K86A 3KE2A 1Q3EA 3LAGA 3ZQLA 3V4GA 2JG9C 5FK7A 1US2A 1WJAA 2KFDA 1OFCX 1YXWA 4KH9A 1V6MA 1DGRA 1YFXA 1VBD1 3A02A 1R1TA 3OYKA 3UKGA 4FPOB 2IS1A 1N3QA 4XRFA 3IRQA 4XIOA 3KETA 4HNTA 4XFBA 2BNOA 4P55A 3LFKA 1JZ6A 2B4KA 1K7AA 4NHYA 2ZGUA 4MIMA 4GWNA 4XILA 3RGBA 3E5QA 4FPCA 4CPBD 3S32A 1UZVA 4JYKA 1A36A 1XPWA 5CISA 4IEJA 3HDDA 2HOTA 4E7LA 4CUGA 4CCEA 4CDXC 2GC1A 3AMMA 3WXPA 4QKBA 4OHXA 4YFXF 1XNAA 2V26A 3POJA 1UFMA 3BPVA 5KHKA 1A5JA 3T09A 5F3EA 5BNOA 4Q27A 1HRV3 2HYJA 3UV9A 1A04A 2ZBKA 1JJ8C 1E3HA 2YHJA 5JOXA 4RA0A 1R1A2 1FEXA 3KWVA 4HPQA 1XGNA 2WA0A 1DQ2A 2IXHA 1DQ4A 4X8NA 2IWGB 4WVZA 4GIQA 1EH6A 1X1AA 4XLEA 3BJ6A 4XLNF 1OFSA 3K9TA 1MSEC 4M3FA 1U12A 2ZMEC 4UY8I 1NY72 4P08A 1IN7A 2D98A 2AGSA 3ZRGA 4RFT0 3FUOA 4FTEA 1BZWA 2EIGA 1IQDC 4XBLA 1K5MC 1RUC2 2KPMA 4LKSA 4QPGB 5JIUA 1UU4A 2BY0A 1QO0D 2DPUA 4H0EA 1O7LA 5FZOA 2WNUB 3MMYB 1QJZA 3ZX7A 4KWUA 5B1BH 3ZMTA 2M0MA 3NMBA 2ARBA 2A07F 3MZ8A 4NRQA 2HWB1 1WZ2A 1E0EA 4HNUA 2MLGA 2HKOA 2WSUA 1CF7B 1R1VA 2L9RA 2VW2A 4RQPA 2N8GA 2V1DA 2BPA2 2ZMLA 1AJKA 1SLCA 2YXSA 2JTVA 4GZ9A 4CDUA 3T1LA 4L2NA 4EMSA 2Q30A 5FV3A 1T6GC 2ID4A 4JAAA 5H6RA 1NHAA 1HSTA 3D5OA 2E31A 1RYYA 3WW2A 5DUIA 2JA8J 4M3CB 5EHDA 2A68F 4MQ9F 3GXOA 3G73A 3N9LA 1V5FA 1V6KA 3VBSB 1XE7A 3S7IA 3QOEA 2V73A 1DBNA 1VJ2A 1RXGA 2VZPA 1SANA 4HMZA 3CTAA 2A3WA 2IXIA 4X8PA 2FQ3A 2ZXWH 1ETQA 1PK6B 1CAWB 3POSA 3CDHA 1YIOA 3JTGA 1ND2B 5JOWA 3IAM2 5SV8A 4NWWA 4NAMA 2P3KA 2P6SA 4HT1T 2VB6A 2XPJA 1MGTA 1AR81 4YW2A 4NPMA 3FKJA 4PQQA 4IE7A 4Z82A 2X53S 2VQAA 1POV3 1JOJA 1HW2A 4W8JA 5CVUA 4ZYHA 3K1PA 1YEWA 1ZAOA 1QJEA 1K5JA 3I49A 1JE8A 1XX5A 4GMP0 1HQCA 1JYTA 5JLXA 2XAUA 3CCQI 4GMP1 4A7ZA 4DUVA 2W1OA 2YBSA 2PAEA 4AM3A 5A7SA 4QX3A 4PIYA 5IYCJ 3LFMA 4UBHA 3A22A 4Y17A 3JRFA 3M3CA 3T3YA 4I0BA 3AYDA 5ANNA 1QJY1 4COYA 5JDBA 1Y0UA 4Y20B 4BOWA 5ACA1 3KZIC 4DUWA 5IATA 3AP7A 3I0TA 1BLZA 3M4OJ 4XMYA 4ZYDA 1FTZA 5EEAA 3BIEA 1X2NA 4UXNA 3OGRA 4N0BA 2HEYF 4COUA 2TCTA 2EA2A 4RLFA 1VALA 4R9AA 3BJAA 2V9PA 4I3GA 3PIOF 1SD4A 4EJWA 3U4XA 1ETOA 1YI7A 1F5FA 2FMYA 3KP5A 4E6KG 5A2QZ 4UF0A 1J83A 3WP3A 3R0JA 3IPVA 4HK9A 2OT7A 4XIDA 2MLKA 3VBSC 5B3SH 3OSGA 6PAXA 2VZ1A 1XMAA 2D5VA 1L3JA 1UO9A 2WNEA 5F2SA 4C2MJ 4CUCA 2MHFA 4UXAA 4EN9B 4QXHA 2MC4A 2DCKA 3MLLA 4KMUX 4HOBA 5DV5A 3TQNA 1W28A 3ZMVA 4AGVA 2QQLA 4FCYA 1U5ZA 5BNQA 3HPNA 2NS7A 5F3CA 3RJRA 1HKTA 2Y6JA 3ZQ7A 1F5JA 2GU9A 1F43A 1ZG3A 2WYSA 2VGDA 3G4SI 4BJTA 1SEFA 3HOVJ 4UT5A 2FBIA 4GDFA 4AEJA 2BHZA 2FX0A 1DZQA 1UCRA 1YFWA 1RR7A 3Q9SA 5GP9A 3E0JB 5J98B 1B8IA 2WRAA 2COMA 1MDMB 3VWBA 3ZPYA 3POYA 1R71A 2KQRA 3VBUA 1LEDA 1VQ4I 5AC91 1CX1A 3FMSA 2VH9A 2E2IJ 5HVQC 4NPLA 4LPLA 1HRI2 4E4SA 5JPNB 2FHRA 5GM0A 4EGYA 2R7VA 1YW7A 3ILFA 4C9YA 4Q8KA 1T56A 3VBOA 3LKJA 4BACA 3DYOA 2NS8A 3DWLE 2VNVA 4E2SA 2WAQA 1U5TB 1NT0A 2JG9A 1RHI3 4LA2A 3ZXKA 3OYJA 2IFWA 5HCHA 1W9TA 2W82A 2UU8A 5EXOA 1VBC1 1IUFA 1RC6A 3MAJA 4A42A 2EFPA 1OD3A 4PJNA 2DVDA 5L7OC 1G9CA 2OZJA 1D4VB 1AR72 2HWB3 4Z92B 5KCMA 5A3WA 3H1CA 4AI0A 2WFF2 4Y7NJ 3T30A 3VZMA 3GHMA 2B0LA 1SD7A 1WGPA 3C2GA 1S9HA 1TZLA 5HBAA 1V70A 1K61A 1BBT1 3B69A 4WM8A 1R091 3B02A 1ZZ7A 3PMEA 2HFHA 2EXKA 1QHHD 1WQ2A 2BOLA 2E5NA 2IS2A 2RGVA 5E1ZB 1O91A 3KV4A 5ERIA 2IGOA 2VOWA 4XLCA 1C28A 3LQRA 3RWNA 1RUE2 3H42B 3VKOA 2XKPA 1BEV1 4W4ZA 3QODA 4RB2C 1EA3A 3JRAA 5F0CA 4P9YA 3DLAA 2L7MP 4D5FA 2RS11 1H6XA 3AYAA 2ICWG 2COBA 2XSDC 4AUXA 4BY1J 1X36A 1GMMA 4M3BA 1QPMA 3CCRI 3HOBA 3ZFGA 1O8PA 2HGCA 1YOVB 5JSRA 2XQRA 5E8AA 3POBA 4BEHB 2VOPA 1JZ4A 4AAPA 1W99A 2FUG2 4Z8BA 5E17F 1JOPA 1AYM1 4PZJA 4L97A 2QVSB 4IV3B 2LROA 3MW3A 4XF1A 4HKOA 3ZXAC 1DYPA 1HC8A 5A1LA 2W24A 2YSRA 4KG0A 1FPN3 3SKVA 3ZVXA 5L19A 3AJYA 2OCCH 1KONA 1CPMA 4P5OA 4GJYA 1Z7UA 1BMV2 1PO12 3SQOA 3UKVA 2KRHA 2XR4A 2D45A 2VZUA 1AKHB 5E1XA 1VBD3 2HWF2 3PNAA 1XNBA 4N53A 4BDZA 5KHGA 2DVGA 3UR3C 1RVF3 2WS91 4MGZE 2B5HA 5J1XA 2XB5A 3THCA 5LBFA 4M72A 3D5RC 4L9BA 1PYVA 5BNNC 3OD4A 5IK8A 3OEBA 4F52A 3MIBA 2E34A 3MN2A 4NAOA 2WN3A 2DA2A 1EH8A 1TQ5A 1AZDA 4MFEA 1ZA7A 2VXJA 4NJ4A 1N78A 3DBRB 3BPSA 1ZGAA 3QLQA 1OYYA 1TW2A 1RUG2 2HEVF 1D4M3 4NN0A 4Y22A 1V9U2 3GBGA 3E5UA 4EJOA 2Y31A 3NJYA 3FMGA 2X4HA 3K4ZA 2BGCA 1J58A 3OV8A 2C24A 1HBXG 5A6XA 2CU5A 4Y1ZA 5D5WB 4EN6B 3WUCA 3CJIC 3VFZA 2VZVA 4FO9A 3E1F1 1LFUP 4AZZA 3HXLA 5CFDB 3OUIA 4IV3C 1KQ0A 2LVSA 3WGGA 3LSHA 3M7GA 4U36A 5FXWA 2ZXQA 4IV1B 1KXGA 2ET7A 4AQ2A 1R23A 3I3MA 1WGXA 4E7IA 3RG0A 4HN1A 2XV4S 1QQP1 3KHCA 4J6GA 1S0GA 3A7QA 3UJQA 3LEIA 2Y9YA 2YR2A 2OPTA 5D8AA 4FFGA 2YGLA 4BUPA 3SXWA 1XSRA 5KHIA 5C4WB 1CGPA 4MHGA 3AG4H 2G9GA 1W8ZA 2PG4A 5HCAA 5EP9A 4FASD 5FP7A 1SLBA 5A3NA 3LAPA 1QGPA 2PTMA 1IF1A 3AL6A 1HW1A 1N1YA 2YDEA 1DU3D 4A2UA 4XUOA 1SFYA 2W2IA 1JBCA 1W2UA 1WLTA 5EZWA 3GLLA 1DGWX 1KU9A 3F0CA 4ZS2A 2ES3A 2WO7A 5FYMA 2HYGD 5FO5A 4IGOA 4XQFA 3BN6A 4SLIA 2AEYA 3DKXA 1A6IA 2PXJA 4BQ4A 3NRUA 2B9UA 4WF2A 3V42A 3UK9A 3J7AO 3PL8A 4JX4A 4LB6B 2WABA 1LDJA 5BNGA 4CZSA 2FU4A 3GJBA 1X1PA 3CIHA 3ZCOA