2GZWA

Crystal structure of the e.coli crp-camp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
200
structure length
200
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of activated CRP protein from E coli
rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 63
structure length 200
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gzwA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gzwA01
3KFWX 2XLFA 2VN2A 3JSPA 1Y0UA 4XF0A 1TLHB 1ZLJA 3FF5A 4HX4A 5JR7B 1IRFA 2D5HA 1UCXA 3WTYC 1RZ4A 2YX7A 2DPUA 3MDPA 4PDKA 2A5YB 4CDGA 3UKTA 2DQRA 1I1SA 1S29A 1DDNA 1FYKA 2A61A 1YFWA 1NZCA 1V3FA 5L3GA 3OF1A 4KWJA 2FE3A 3ZMDA 1G3YA 1EH8A 1KYWA 2V79A 2QZ8A 2FXAA 1ZAOA 2K0GA 3D0JA 3SXWA 3COAC 2FMLA 2D45A 3GXOA 2EV0A 1BN5A 5E17F 3KP4A 1ZLKA 1JHHA 1EYBA 2VE9A 2FRHA 3MAJA 2MH2A 1U5TC 1HKTA 5FFZA 4XFIA 2BEOA 4HA8A 3T8TA 3HQXA 5KVRA 4ZYEA 2NNNA 2GAUA 4HF2A 5K1YA 3I7DA 4MGKE 1ZX5A 3U11A 4LGWA 2IJLA 4N9IA 4LUMA 1KQ0A 5JSOA 2KIMA 3RZZA 3TO7A 1TNSA 4JTNA 5CLSA 4K2EA 3BP8A 3EDPA 2UY9A 1XE8A 4A0YA 2BYVE 5CVIA 4YFNF 3CO7C 5HI0A 2DO7A 5DUIA 2GIVA 3I71A 3TQNA 5CVUA 3M3IA 3RKYA 2I45A 2HS5A 3BJOA 4O9GA 1U12A 3AAFA 4CGZA 3E3VA 2IT0A 1MDMA 1Z1DA 2CW0F 3ES4A 3HTSB 1U78A 2M1BA 1IAWA 4Z07A 5DCMA 2QCSB 1UHWA 1TQIA 4AIHA 2F5EA 5J3UA 4IEQA 4BXUA 3S7EA 2EFQA 1B1BA 2ZCWA 1YFHA 2GQQA 2CV6A 3RDIA 5LHHA 3DKWA 1ZRRA 2LF7A 3GFMA 3KE2A 2OQGA 4IRGA 2ADUA 3HSRA 3M8FA 2P5KA 4I02A 1OPCA 2F2EA 4M9SA 4LLGF 3EYIA 1CAWA 1AOYA 4HV5A 1J2XA 5BPIA 4A2UA 3DEUA 1T39A 3TO9A 2PN6A 2IRFG 5J8CA 1WRJA 2H94A 1STZA 4BHPA 1H9GA 2VBYA 4I3PA 5DUKA 1FBQA 1DZTA 1GVJA 3RYKA 2K9ZA 1WA4A 4I09A 2ZNYA 5I0UA 2L4MA 3LQQA 1XSDA 2VPVA 4IXAA 4KU8A 2HEOA 5KHGA 3E5XA 3J81K 1U5TA 3H8UA 1NE6A 3OV8A 5HS8A 4FT8A 2OBPA 3WW2A 1S8NA 4IESA 2NAZA 3M9AA 4KIBA 4EM2A 1IN6A 4LJZF 1HW5A 2QQ9A 2H09A 2W84A 3QP5A 1FYLA 1YLLA 4KWLA 2FEZA 3GZ5A 1ZRFA 3CO6C 3BJAA 1PMIA 2DK5A 1W7PD 4LTAA 5HDNA 2CO5A 1R5GA 3F8FA 4CICA 5I0RA 4AVAA 4WXDA 1FZPB 4IF4A 4TLFA 1HW2A 3WU1B 1XSXA 1EPZA 2IXJA 1RIOH 4ZH4F 3CO2A 1HQCA 2WTEA 4LB6B 1FBSA 5K5QA 1SMTA 1XMKA 1ZYRF 3VOEA 2QM3A 2EA7A 4EMSA 3BY6A 4FAGA 1U8RA 4EWAA 4PIXA 3MEXA 4O5VA 3V4GA 4HX7A 4QGLA 2Q4SA 2V1XA 2LDUA 3E6CC 4GO1A 4RB0A 1WWXA 1GQHA 4WCGA 3KGZA 1Y3TA 1R1UA 2FF4A 3NW4A 2R7DA 4XSXF 3OTFA 4DNCA 1DGWA 1SEFA 1KYZA 3KP5A 4LLNA 2D5FA 2XLGA 1GXPA 2IXHA 5JCTA 4R79A 1IRGA 1Y9QA 5E20A 5BMZA 4ESJA 1BI3A 1IPKA 1SFNA 4OFGA 2RQPA 1D3YA 3Q5FA 1G3SA 3NRVA 2C0ZA 2V9VA 2BBYA 2ISZA 3C18A 4G6DA 2OD5A 4MGRA 5HVQC 1MKMA 5EFUA 1E2XA 4LLLA 4B09A 1BM9A 3SCGA 2VQAA 1ZG1A 1X8MA 5I93A 1EH6A 2ZBKA 4X6RB 4KL1A 3TGNA 4IHSA 4YG2F 5FD5A 4ENMA 3LAGA 4Q4ZF 4HLXA 2RGVA 3F8CA 3IRRA 4IEYA 4YIIA 1USTA 1IN5A 3HOSA 4U0YA 1B9NA 1QBJA 5HLIA 1ZZ7A 1MZBA 4A5MA 2LKPA 4ONUA 1MDMB 4LB5A 4M6YA 3WU0A 1GQGA 4KNYA 2FQPA 5KHJA 3WTZA 4HF1A 1JXSA 3WGIA 2JSCA 1I1GA 5IT3A 5L3DA 2O03A 1YS7A 1HSJA 2XIGA 3C7JA 2A69F 3R6SA 2F4PA 3LSTA 4NB5A 4AVBA 4EJTA 4N0BA 1L3LA 2EJRA 4EJVA 2LF8A 2Z3YA 2HGCA 3MYXA 4KN4X 4A0XA 4L9NA 1RC6A 3EUHA 2XROA 1FYMA 2G7HA 2BNNA 3R61A 4LUKA 3FM5A 5L3FA 1TQ5A 4RGSA 4HW0A 4MV2A 2QDRA 1UFMA 4IRHA 2ZNZA 4Y17A 5E18F 4KT5C 2OZJA 4GULA 2Y0OA 1XRUA 1SD4A 3D0SA 1S6LA 4TV7A 4EM1A 4XEZA 1XE7A 2LSOA 5ERIA 3GLXA 5D4SA 1UHMA 1BIBA 4AD9A 1J3QA 2O1QA 4XFAA 3E6DA 2DPDA 3JAMK 4JV4A 3ZP5A 2PAEA 4Y15A 4G7ZF 2IA2A 1B59A 3PFIA 1IXCA 5LEJA 1P92A 2K27A 5FQ0A 3ABUA 2Q30A 1YQAA 5JFRA 5JI6A 1QZZA 5E16A 2YSRA 1CAWB 3EBRA 2KJBA 4XF3A 2O0YA 5ICEA 1O3TA 2D1HA 1V70A 2HTSA 1DGRA 2ACJA 2IXKA 1G3TA 4I0BA 2BE5F 4IEVA 5HDKA 4IEXA 3E6MA 4MGYE 3GFJA 2Q2EA 5CU1A 2GC3A 1IXRC 1J0RA 4QM8A 1HW1A 2NS0A 2L54A 2GC0A 2X4HA 1ZGJA 1K7AA 1U5TB 2PEXA 1BBYA 1ZHFA 2FBIA 3LA2A 5C8WA 2XV4S 2RN7A 3N4MA 1DP7P 1Q5OA 1G6NA 5D8KB 1FC3A 3MQ0A 3QRFF 1OI6A 3WTUC 1H9TA 5KHIA 4BH9A 4J1XA 2OPKA 1PUEE 1ON1A 4WXCA 4G8XA 2GZWA 3DN7A 2C6YA 5AIQA 4L0ZB 4Q47A 3CJXA 3GW2A 5C6CA 5D4RA 3PQKA 3B02A 2ZMEA 4Q0VA 1BI1A 3TO6A 4EQQA 3SHRA 3DL3A 4M73A 2HZTA 1FY7A 2UYBA 2PMHA 4XLPF 3ELNA 3HT2A 4ZYDA 5IT9Z 1KGSA 1X7NA 4XFBA 4I0AA 3L09A 3U10A 3FX3A 4D0PA 1LB2A 1CAXB 4AIJA 4MQ9F 4ZU5A 3U2RA 4I98B 5AONA 1XCBA 1T98A 4OLLA 3IKVA 3TDUC 1QO0D 3L7WA 3NJZA 2VE8A 3WTTC 1ZZ9A 4UHTA 1IUYA 3J81Z 5D1IA 3CUOA 1ZZCA 4O9EA 4KMFA 3WTSC 3MZHA 3IC7A 5AIPA 2M5WA 1TTYA 4RGUA 4YFXF 3H1YA 3HRUA 1USSA 1ULYA 2XKPA 1R1VA 4HQEA 3LA7A 3P7NA 2K7LA 2XRNA 4WX9A 4UBHA 1I6XA 5BPDA 3M8EA 3E6BA 2HQRA 1DUXC 1K78B 2ZKZA 3PQJA 1FSEA 2XLAA 2DK8A 5ILSA 2FOKA 5K5OA 1FBUA 1Z6RA 3KEQA 1QGPA 4G7OF 1YYVA 5E8GA 1LJ9A 3F8NA 2PBIA 4J1WA 4U7DA 2Q0OA 2CQKA 3DPLC 2B9UA 3DP7A 1OYYA 4D7TA 3IRQA 4CO8A 3HYIA 1SFEA 4HOBA 4PIZA 5FDBA 4EWDA 5FD6A 4HLYA 1Q3EA 4L5IA 1NYWA 5DV5A 1S7OA 3S7IA 2L01A 3BDDA 1LR5A 3V8KA 2MH9A 2CAVA 2A3SA 1RUOA 2F5DA 4HSLA 3SXYA 3CL1A 5CVJA 1EV7A 5JSRA 4QM9A 1YW9A 5FPXA 4I7HA 1B6AA 1UD1A 5FLIA 4NHJA 1J9IA 3IDBB 4MGZE 2KRFA 3FXUA 4O6JA 3F21A 2DU9A 3F6OA 1ZN2A 3RTRA 5EZWA 3K2ZA 1NHAA 3FMSA 4KN7X 2STTA 1TQPA 4WXHA 4UBGA 5BQTA 3J7AO 3GYDA 1ODDA 4OMZA 3L2HA 4PZJA 4WWCA 4Z82A 4XF4A 2OZUA 2VECA 1XDSA 1DZRA 4P5OA 4L0YB 2XAJA 3QOPA 5HS9A 2CGPA 2FNPA 1TW3A 4FX4A 2UXNA 5FLJA 2VXZA 3LQRA 4ESBA 3RKWA 5ILUA 2KIUA 2QBYB 5JR3A 4ZYGA 5D6EA 2VOPA 4META 3ERED 3K1MA 1SD7A 3QPTA 5JHUA 4MTDA 2K86A 3CUQC 3QU3A 4EJWA 2D93A 1VP6A 5DD8A 1YW7A 4IPAA 2JT1A 3ZQ7A 1Z6TA 4UVAA 4HQMA 1LEAA 3LZZA 3PNAA 3NKTA 3QP6A 3WG9A 2ET1A 5DDGA 4Z2YA 4D7SA 4BQAA 1ZZBA 1IF1A 3KP7A 3L2CA 4R8HA 3GEZA 2B8MA 2JZYA 1PDNC 4YFKF 5ED4A 2ET7A 3M70A 2FSWA 2MBFA 4JQFA 3ACLA 1YW8A 2DLLA 4DINB 3CLPA 3VHRA 1D8KA 3I4PA 2EFPA 3CUQA 4ENJA 2V1UA 2V6CA 4IEWA 3FHZA 4Y13A 4KIFA 1YS6A 4XFCA 4DQ2A 3ZMVA 3E5QA 1X82A 1SFUA 4S05A 1CX4A 3JW4A 4HDVA 1BOAA 1HXDA 1BC8C 2PYTA 1LRHA 3BZ6A 3FXRA 3CTAA 1YFYA 1IN7A 3REOA 4LK0F 3FE5A 4OMYA 4HZFA 4P9FA 4L18B 1O3RA 2UXXA 3L00A 4EGZA 1PM7A 2MD5A 3G73A 3LAJA 4LA3A 1Z05A 1Z91A 5HLHA 5JAXA 4XF1A 3B73A 5FQ0B 1HKSA 5F6FA 3ES1A 5LEKA 4Q5SF 2XAHA 1ZRDA 4Q48A 4KIGA 4BYYA 4A5NA 1K6OA 2HTJA 5FLHA 1TNTA 4M71A 3CF6E 3FWEA 3FXQA 3WODF 5BUVA 1YUDA 3BCWA 1FNNA 1UPIA 2PAMA 2GC1A 3G7DA 2EVXA 4A0ZA 4WVZA 1O4TA 3WGGA 2VBZA 1W7PB 3GF2A 2B5HA 4LD5A 5F64A 3KMHA 4RAYA 1H1MA 1EH7A 1Q1HA 3K1PA 5I0SA 1W5SA 2IXIA 2Q8KA 2Z69A 4OIPF 3GYHX 4I2OA 2PJPA 5A2QK 4L5JA 1LDKB 3V7SA 1J58A 3G3ZA 1H0MA 3NEUA 2IPQX 3ZMUA 2OAZA 4XFGA 3F72A 5LGTA 2QENA 1EY2A 3F3XA 3VB2A 3D5LA 5KBFA 5F1RA 1DPRA 2CAUA 4UVCA 1KQ9A 2UYAA 5I91A 3R60A 1SD6A 1P4AA 3KLOA 3VEPA 5LLQA 3ZN0A 5BV6A 3KETA 5FPZA 2KKOA 3GFLA 2PI0A 5FB2A 2HOEA 1XN7A 3GX4X 3H50A 1G4DA 1J7KA 3FFQA 3MFKA 3NQOA 2P6SA 2JTVA 3E97A 3T1BA 2D40A 2F5FA 4S04A 1OR7A 4E2GA 1EP0A 4A12A 4XBFA 2VODA 4L9TA 2FU4A 1YFUA 2Z5UA 4RS8A 4EGYA 1CGPA 1R58A 2V09A 2DQLA 3N97A 1J75A 4BNCA 1LDDA 3ZPLA 2Q1ZB 4BIFA 4M6XA 1D5VA 3V7CA 2DBBA 3VODA 1TBXA 4GYIA 4L9JA 4HX8A 4U88A 1S7AA 4A6EA 2OZ6A 4IRIA 2XKOA 5E8IA 4E70A 3MPBA 3KSCA 3KCCA 1QWRA 2JRTA 3BU7A 3WW1A 4EROA 1F5TA 3RJPA 2VT2A 4RB1A 3IBMA 4OIQF 2JPBA 3UKVA 3LFKA 1FT9A 2CYYA 2FNAA 4HBNA 5IT9K 4MX3A 4YARA 4UUVA 4K8FA 4KA4A 5BOXA 3BALA 5L3EA 2UWMA 3M7GA 1ZZ6A 5H6QA 4WBBA 1CAVB 5JSPA 3FM3A 4WZCA 4HVQA 2DTRA 2ESNA 4G7HF 3EHKA 2CSOA 3EQEA 2EFWA 4YRDA 1F9NA 1FP2A 4ENNA 2MPFA 3T0YA 3O2PE 3HSFA 4RB2C 3H9AA 2MA3A 2OQRA 4QX5A 1S3JA 1KU3A 2YPRA 1ZARA 3I5UA 4ZYHA 3KEOA 5EEHA 3KP6A 3O3KA 2GA2A 5BY5A 2R3SA 1ZREA 1O5UA 1FI2A 3ZMSA 1YWKA 3T5XA 3HT1A 2A68F 1XGNA 1UIKA 3BROA 4QXKA 3SCFA 2DAOA 1WQ2A 4HF0A 4QWQA 5EEGA 4OINF 2L02A 3RYPA 4QGMA 1YG2A 3K1NA 4BHCA 1IW7F 2O6GE 3WW3A 1W5TA 1X3UA 3RPUA 1ONVA 2EV6A 4F7ZA 4P9UA 2Z9OA 5H6RA 3W6JB 3BOQA 3LA3A 5ICGA 3CEWA 1W7PA 1V4RA 2VBXA 4G9YA 1YIOA 4XFFA 4ENKA 3ULQB 4LLOA 3ECOA 1T2KA 2HYGD 4M74A 2P5LC 4AWXB 4CYDA 1TQMA 5BPXA 1OKRA 4QLCU 1FP1D 3I58A 4CXFA 2HJIA 1KA8A 1ON2A 3FMRA 2IXCA 2DW4A 1NXMA 3EETA 4UNOA 5HLGA 4AIKA 1QXRA 3EJKA 3H7JA 3NVCA 3JTHA 3J80K 2VC1A 3I59A 2CG4A 1MJ9A 3H1MA 4CZZA 2XL7A 5K8SA 4HBLA 4KWKA 1UIJA 2ETHA 4RAZA 1J3PA 5CVRA 4IVNA 1RGSA 1FOKA 2H6CA 1VJ2A 1R1TA 4YNIA 2P7VB 1XGSA 3ZDSA 4PCQA 5J7MA 5J8FA 3D82A 4HYEA 4JTOA 2OU2A 3HRTA 4OOIA 2W85A 5K5RA 3R0JA 4E2QA 4AQ2A 4M9XA 4RGRA 2GH2A 3H3ZA 2A6HF 4R1HA 2EK5A 4M72A 4G6QA 2CFXA 3IDCB 2XAFA 2HWVA 2QJVA 2QYOA 2GU9A 3ZMZA 5DYMA 1F1ZA 4ZZDA 3P9KA 3WE2A 4ESFA 2O61A 2XAGA 1Q43A 3HUGA 2ETEA 3RKXA 2IVMA 4KICA 4IJAA 2K4JA 3HHHA 3U1DA 5D8LB 3GBFA 3BJ6A 3DF8A 2L4AA 4Q0SA 5HOOA 2B0LA 2PA7A 4JVAA 5JVTA 1FX7A 4MNUA 5E1XA 2P5VA 3DPTA 1CAUA 3DFGA 3ZMTA 1BJAA 2WFPA 4ZU7A 2HKOA 3GFIA 2JPCA 5D5VB 3ML6A 1U3EM 1D8JA 2YX4A 2H6BA 2XHKA 4WF2A 3U9GA 2K4BA 2PHDA 1JHFA 2NYXA 3OCPA 1A04A 4HDUA 2IW5A 3TOBA 1ZZ8A 5FLXZ 1XD7A 2A07F 5ICCA 3ECHA 2VOOA 2XUBA 1O5LA 1ZRCA 3I0TA 2PHLA 1SMYF 5CYVA 2ZMEB 4WK8F 3GUDA 3ETQA 1UB9A 3R0AA 2ELHA 4XSZF 2VC0A 2GA1A 3WTXC 5CVVA 4EVIA 2ZKLA 5BS6A 4OIRF 3F6VA 2J5PA 2AXLA 3WE3A 3I53A 1OD5A 2O8QA 2RVCA 1CAXA 3JZVA 2PTMA 5KK1A 4IEUA 1XCVA 4RGXA 3WGHA 1QXJA 1LKNA 4AQ6A 1I5ZA 5DCFA 1LQ1A 1WLTA 4ZU4A 5HDGA 4ORFA 2QBYA 3USSA 3JAMZ 5I0TA 1PP8F 3W6KB 2HR3A 5D5WB 4XF9A 2EAAA 1O3SA 1RUNA 3PVBB 1MJBA 3FMQA 4BAYA 4B29A 2Z2SB 3QPHA 2IP2A 4IERA 1QNTA 4ETSA 2GXGA 1IPJA 1RI7A 1YFXA 1YHFA 1J59A 1LEBA 5LRSA 1QY4A 1CAVA 1JGSA 4Q29A 4KUMA 2DFIA 4UV8A 1XMAA 5I8SA 3R4KA 4MEYF 2IC1A 1R36A 4AVCA 1MJAA 1MGTA 2KXLA 1G3WA 4AVPA 2QNKA 3H1WA 2XVCA 1BI0A 1K78A 1O57A 4UV9A 3O6BB 2QQBA 5DCMB 3RIRA 1WI9A 4FHTA 3CUQB 2STWA 2GXBA 4LFUA 3FHIB 1FXZA 1HBXG 5D5UB 3TOAA 2HFHA 1R23A 4KMUX 1P2FA 2N7GA 4KYWA 4IEOA 4ASNA 3CLOA 3E5UA 5FGMA 3IIAA 2O3FA 3RNSA 4LK1F 3VFZA 3LOIA 3GO5A 1XDUA 1FWZA 1BIAA 3I59B 1J3RA 2FBKA 2VONA 3SMHA 2ISYA 5FFXA 5ILVA 1YTYA 1E17A 1T0FA 2D2WA 2XL9A 3TNPB 4UXAA 4H7LA 2UZKA 3TDZC 4XFHA 3RPQA 5ICFA 4OU0A 3PLQA 4U7BA 1T6SA 1J1LA 3FZ3A 2RKHA 3WTWC 5FLXK 1T38A 3S2WA 4HN0A 2R7FA 3HOTA 4MUVA 2G7UA 4ZZLA 1OMIA 3HRSA 3DV8A 1RTVA 3Q9VA 2Q0AA 1Z7UA 2A6EF 4M9ZA 4MTEA 5L3BA 3J80Z 2PQ8A 5CJ9A 5LGNA 2H27A 5LRRA 3K9TA 2P17A 4BHBA 2ZFWA 4FAHA 1MD0A 2EFNA 5AVPA 1QPMA 3F23A 3HSEA 4IEPA 3Q9SA 3UKNA 3NL1A 3HRMA 1DPUA 1J5YA 1BC7C 1LNWA 2BV6A 4KDPA 2ZXJA 3GZ6A 1FSHA 1SQ4A 3FJSA 2GC2A 3C1DA 1RL3A 4MZUA 1X8EA 2Y48A 4I01A 5I8TA 2QQAA 1CAUB 2EA2A 3TKYA 4XRFA 1ZNPA 1U6GA 2W57A 2F5CA 1ZVFA 2QVOA 4GGGA 1W4MA 4JK1X 3P9IA 4PJYA 3LWFA 4LEJA 4QGNA 1TW2A 1R00A 4O3MA 3V8JA 2XASA 2P7CB 2Z33A 2V1DA 3NSTA 4G94A 2MLKA 3CDHA 1JE8A 4OIOF 1CF7A 3ELKA 5TJJA 2E9QA 4MH0E 1O3QA 2PFBA 4Q0UA 1YO5C 5L3CA 3S0MA 3BPZA 3P9CA 1L0OC 4MGIE 1K79A 4HMZA 2ESHA 1O7LA 3QAHA 4PGHA 3BWGA 3I54A 4R52A 4ON0A 4PGGA 4GCVA 3WW4A 4L2NA 4MQVA 4P96A 2W24A 1HSTA 1P4XA 3SCHA 2UY8A 4GYGA 4L9VA 3BPVA 1R5HA 2QVSB 5J6XA 2LNBA 2EWNA 1SFXA 1QQIA 1CF7B 1VTNC 4EWEA 3WTVC 1LVAA 3GWZA 4YSFA 2NRAC 4FBFA 2M30A 3HTUA 3SFZA 3ZN1A 3ROUA 4RD7A 1HKQA 3QACA 3DQVC 2FMYA 3C3WA 2P4WA 3O14A 1F4KA 3MCZA 3DXJF 1KU7A 2BNMA 3BPXA 4X6QB 5T3NA 3MZYA 2DCTA 2OYZA 3SZPA 2TDXA 4NQWA 2Y75A 2PFWA 5LGUA 1BI2A 5J48A 2OA4A 1P6RA 5H20A 3JSOA 2HDCA 3RYRA 3MWMA 3SHFA 3LWCA 4U0VA 3IKTA 3KZYA 2YR2A 3K69A 1B9MA 1SD5A 1GHCA 4HV6A 3LAPA 1FLIA 1LDJA 1OFNA 1O7FA 2Z99A 4MHGA 2MC3A 1U2WA 4AXOA 2VBWA 1QZYA 3ST7A 3HIFA 3F8BA 2QUFA 2O8XA 3H3UA 2L3DA 3RI4A 1NE4A 4QMAA 3TNQA 4P9GA 5LHIA 2M45A 4YYOA 2QWWA 2IA0A 1IN4A 4F8AA 1XB4A 1ZH5A 3OOPA 3GVAA 2FA5A 4EM0B 3KP2A 2Y0MA 3F22A 1GXQA 2EFOA 2VT3A 3I64A 3H7YA 1VR3A 1I27A 2PAKA 3V8LA 3OD0A 1P4WA 1UCRA 2M8EA 1JUHA 2OA2A 2E7WA 4U0WA 1R22A 1FPQA 2PMUA 2MNGA 3C3VA 3KGLA 2RC4A 2ZO4A 5D5XB 4XETA 2XAQA 3L9FA 4FX0A 2X0LA 4IETA 4EJOA 2FQ3A 2MLGA 3M1EA 2E7XA 2E1NA 4KU7A 3ABTA 4H0EA 3ISPA 3SQNA 2EB7A 4L11A 4Q0QA 5TRDA 2RDPA 4GXOA 5LHGA 2ATFA 4LULA 4Q0PA 1H1IA 3T8RA 2H0VA 2PQQA 2WWYA 6PAXA 5LBQA 3H92A 2RNJA 4LG0A 5FCCA 4UVBA 1UW8A 2COMA 2EA4A 1REPC 5BXXA 5CADA 3KP3A 2K02A 2WC2A 3KZZA 4NVPA 2CWEA 5KHHA 2HKXA 4RB3C 2D1VA 1WSUA 3EYYA 2IA1A 4A6DA 3IL2A 2W25A 2J5OA 2BGCA 3EO6A 3CJNA 3HHGA 4B8XA 1XSVA 1Z9CA 3K0LA 4KFCA 4IHTA 3V7RA 3U0ZA 2DI3A 1KU9A 2NNYA 2E1CA 4E2SA 1L3JA 1OYWA 3IWFA 4YIFA 2HYFA 4LG0B 4P55A 1IZ1A 5E1RA 4LA2A 2BNOA 2AS5F 2DT5A 2G9WA 1ZG3A 1OYIA 5D6FA 2KJCA 2GWRA 4HSJA 3F8MA 2P6TA 4HLTA 1PP7U 3IWZA 4EV0A 1XGOA 3SZTA 4HN1A 4CHUA 5A2QZ 2PLYA 4HVOA 2HQNA 5FO5A 1C0WA 4HVRA 4JBAA 1KU2A 1KQ8A 4PIYA 1IXSB 1IN8A 3EQLF 1ZG5A 2KIFA 2WV0A 1WGPA 5KHKA 5DEQA 3JTGA 4XLNF 2XGXA 3QU6A 1XGMA 1RNLA 4LMYA 4EJUA 3KLNA 2RV8A 4MEXF 5I8YA 1SAXA 1WKMA 4N9HA 3OGJA 2P8TA 2M87A 4HAMA 2MHFA 5E1WA 4IEZA 2FBHA 2ZJ2A 2QLZA 2EV5A 3BB6A 2YU3A 1AWCA 5HS7A 3IHUA 1B4AA 1R7JA 2PG4A 4UXNA 1ZGAA 2IXLA 5E1ZB 5DD4A 3FZVA 1YLFA
chains in the Genus database with same CATH superfamily
3LQCA 1DGRN 1TLHB 5A1AA 3FF5A 5JR7B 4W1UA 3BQYA 3ZO0B 5L7OA 3SYTA 1T56A 4ZDLA 1CJPA 2A5YB 4XK4A 2Q8EA 4ZS3A 4K8RB 3RJRA 2ZXIA 1XNKA 4LQRA 2C9AA 3P5BA 1SLTA 2PHTA 1JZ8A 1UMZA 2A61A 3LSHA 4AF9A 4A7KA 2ZJPF 4TZDA 1YNAA 2V79A 2QZ8A 5J98B 1ASJ2 5ERLA 2FXAA 3D0JA 4FQGA 3COAC 2G9FA 1QJX3 3KP4A 1ZLKA 5F27A 1EYBA 1K45A 4XL9A 3SH5A 2X05A 2R071 1HKTA 5FFZA 1OF4A 4OI2A 4GMP1 1MBHA 3HQXA 1NCQB 4ARYA 4ZYEA 2NNNA 2GAUA 4HF2A 5K1YA 3VKOA 1ZX5A 3FK6A 2R073 3HN1A 1KQ0A 4CDWB 4LT5A 1AF9A 4MADA 1TVGA 1TNSA 4JTNA 4K2EA 3EDPA 1GBGA 1XE8A 2NVYJ 2DCEA 5CVUA 2EXKA 3TYJA 1AHSA 3BJOA 2EXJA 2MSYA 4QQ2A 3PMEA 2JUCA 4LG3A 2CW0F 4V2GA 4LKSA 2QCSB 2ARAA 1UHWA 5TGTA 3VL9A 1ZRIA 3D3AA 3BTLA 1KS4A 2WL1A 2EFQA 1VMJA 3TAYA 3RDIA 4IEJA 3DKWA 4KITB 2QQMA 4TYSA 2DFHA 2OQGA 4JRAA 3WVJA 1MW7A 1PUFB 2BP6A 1X4OA 5FMCA 4LO4B 4M9SA 1Q8PA 4E4SA 1H8TB 1BHGA 2WFF1 1TWHJ 3KYLA 1J2XA 5BPIA 4A2UA 3GBWA 2WFF2 3DEUA 3TO9A 1D4M2 3CESA 1ZBA2 3MV01 4BHPA 4FOVA 2GSYA 3RYKA 2M7BA 1WA4A 2ZNYA 5I0UA 5DAXA 4LBMA 1CJDA 3OPWA 4AYBN 1DLLA 5KHGA 3K4AA 5GLZA 4Y22A 3H8UA 3WDUA 1IS3A 3WNMA 1SACA 4XMAA 2IWGB 4LBLA 2OBPA 2BOLA 1ZR2A 4R9AA 4UFJA 3A03A 3WW2A 3D5SC 4XUNA 1U9OA 2W84A 2JG9B 2H09A 1FYLA 3UNGC 2ADEA 2YU9J 1GWKA 1O8SA 3GZ5A 2VOVA 4S2FA 3LMMA 3CO6C 3BJAA 3JCUC 1FMD2 4FPGA 2DK5A 1W7PD 4F55A 4LTAA 3ZIXA 1R5GA 3F8FA 4CICA 5I0RA 2GOMA 1BR4A 4NQWB 1FZPB 2BZTA 1HW2A 3K4CA 1VBB1 2BHZA 4BQQA 4M3DA 2IXJA 5BNOA 5F08A 5F39A 1HQCA 4CDUA 1SMTA 3VOEA 3Q8EA 4G9SB 5A80A 4EWAA 4XUTA 3VL8A 3I3MA 3V4GA 4FOQA 1WW6A 3N9LA 4XABA 4N53B 3E6CC 3FBYA 4RB0A 2JN6A 1GQHA 4WVVA 2R7DA 1WMEA 3DCQA 5JIAA 1GT0C 2XB0X 4XSXF 4K40A 3OTFA 4DNCA 4NC7A 4YZ4A 1LOCA 1R081 1RUG2 2IXHA 2VJXA 1OA2A 4A3JJ 4DUXA 1IRGA 4AU7A 2NVTJ 5E20A 1Y9QA 2R0HA 5BMZA 2GNTA 1A36A 3LSRA 4Y4YA 1IPKA 3CJTB 4OFGA 1NZIA 5A1FA 2RQPA 4HKLA 3Q5FA 4UT5A 1STMA 5F8PA 2V9VA 2X6WA 5J40A 2CDPA 1HC8A 3V65A 4GZ9A 1G9AA 5T52A 4XJWA 4G6DA 4GMP0 4L9BA 4OCTA 1BM9A 2JA8J 2D43A 4YW4A 2DVFA 1ZG1A 3J4UH 1X8MA 2QQVA 4QPIA 5I93A 1E3PA 2R7EB 5C4WA 4YG2F 4QDQA 4IGOA 4HSRA 4ENMA 2ORZA 3HJRA 1QQP3 2RGVA 5FRAA 5HV4A 4YIIA 1GICA 1MEC1 1SBDA 4NHYA 1MZBA 3DTKA 2LKPA 4FETA 4HK8A 3S5QA 1MDMB 4LB5A 3ZXDA 2GOXB 1AXZA 4HG6B 3I4MJ 1GKBA 1GQGA 2R49A 4TSVA 1FATA 4QX8A 4RAFA 1F35A 4AI8A 4R9DA 4XKVA 4X8PA 2XPWA 5CFDA 1LFBA 1HSJA 2XIGA 1T8IA 1PYVA 2F4PA 4QX0A 1BW5A 2HOSA 5IY5H 2CDOA 4E4HA 5IYCJ 4EJTA 2HWF1 3AFKA 4NPRA 2LF8A 2Z3YA 1FMVA 2QF7A 1DP0A 4LMFA 4Z6YA 4L9NA 1F8VA 1ALYA 4QB1A 2BNNA 3OUIA 3FM5A 5AC91 2YMZA 1VAMA 2ZNZA 2KM2A 1HX6A 2Y0OA 1SD4A 3D0SA 4EM1A 2LSOA 2YHJA 3GLXA 1QU0A 4IV3A 3NKGA 4HK9A 5F0HA 4PQ9A 4BJ0A 4GALA 1MBGA 1BBT3 3FHQA 5A7NA 2RDNA 2ME0A 5FPAA 4H55A 5IP9J 2YV8A 1S0IA 1UWWA 4AM3A 1YQAA 5JFRA 1IJWC 1CAWB 2KJBA 1YXWA 4AAPA 2O0YA 1O3TA 4AWDA 5F5QA 1VBC3 1RC9A 4GJYA 2IXKA 1OBNA 4BM8A 1CQ9A 3U14A 2BE5F 5G05L 1QJX2 3KHCA 2ME6A 1F5FA 4E4ZA 3NWKA 4RYDA 1MSFC 1HW1A 2P3JA 2L54A 2DTZA 3ZVXA 1ZGJA 2WA0A 5J1UA 4L8QA 5CKNA 3WNPA 2ZPXA 3ASIA 3GJBA 5T55A 2FBIA 2GIZA 1VBE1 3R4SA 2XV4S 1QJFA 3DECA 5C8WA 3N4MA 1DP7P 5LA0A 1G6NA 4Y5Z0 4W6XA 5KHIA 3MPPG 2Y6KA 4CCCA 4J1XA 2IS2A 5A7OA 1A6IA 4G8XA 5JLXA 1MS0A 2C6YA 4QKNA 2Q2EB 1MZ6A 1Z78A 2X1DA 5C33A 5AIQA 2ZGNA 1PX4A 1AR73 5C6CA 3SHRA 3DL3A 1AL22 4M73A 2UYBA 3S2DJ 5ACA3 2QCOA 4ZYDA 3CC7I 1P7IA 1E57A 4XFBA 5T54A 5FYSA 3U10A 4RN5A 3ZOBA 3IAQA 4PLMA 1HLVA 5JMOA 2ZAAA 2ZEYA 3U2RA 4I98B 3OBZA 4QPQA 1B8IA 2JWPA 3RRDA 1XBFA 4CEWC 1PK6A 2VJ4A 2VIXA 1F9KA 4LJHA 2XR4A 2LTPA 4QKDA 1TWFJ 3CUOA 5EYRA 3LEKA 4AHZA 3SEQA 1X3ZB 2R7ZJ 3P1IA 5FZAA 5DG1A 3H1YA 1Q56A 2Y30A 2W1UA 3T0AA 1ULYA 2J1VA 4YW7A 4XRSA 3HQRA 4BEHA 2JE7A 3P7NA 3AK0A 5BPDA 1DUXC 2VPLA 5K5OA 1MPXA 4CPBD 4F3JA 4G7OF 2WT0A 3T2QA 5E8GA 3OG2A 3WT3A 4W4ZA 2NOJB 3VV1A 3DPLC 2CQKA 3V0AA 2QQKA 1OYYA 2NMNA 5J96B 3FMGA 5FZBA 1OUXA 2OW4A 4EWDA 4AI3A 4HLYA 5HODA 5EQUA 3A02A 4XKBA 3CMEI 3BDDA 3V8KA 5IAVA 2A3SA 2PX9A 3WINE 1RUOA 4H14A 1GWMA 1QJU2 5CVJA 5FKOA 1JT0A 1B35A 1EV7A 4B1LA 3FIWA 1OLTA 5FPXA 4JGZB 4I7HA 4SLIA 1ENQA 1VQNI 3POJA 2ZGTA 1DF0A 2JE9A 2FDHA 3FXUA 1GZTA 4IHYA 1RUE2 3IMNA 4OZOA 2ZBJA 3K2ZA 1Y1VJ 2QZ2A 1JUIA 2A6TA 2P6CA 1H4HA 4OI0A 5EYXA 4WWCA 1E3HA 4D8MA 4AUXA 1ETVA 3QOEA 2WZR3 4UF0A 4XF4A 1H1AA 2VECA 3FXJA 1JGGA 4UW3A 5FJHA 4L0YB 5D21A 3QOPA 2FNPA 2UXNA 2DA5A 5C4WC 3FUQA 3LQRA 4ESBA 3RKWA 1RUH3 5FZCA 1RYYA 1MS9A 5M0TA 1SD7A 1R71A 3CUQC 2EF6A 3QU3A 2YU2A 4EJWA 3BC8A 1K42A 1VP6A 1DU3D 1YW7A 2XPVA 1VRBA 3NNLA 2HWF2 3ZN4A 2NQYA 1GP6A 1ND2C 1UQXA 1FYUA 1Z6TA 1JU4A 1TME2 3KT1A 4RL7A 1SBFA 3WG9A 3VKFC 5A3UA 1ZZBA 4CZSA 2YC2A 2C5DA 4GD4A 1X58A 4PT6A 3L2RA 3GEZA 1RMU2 2BOJA 3I3BA 4BE3A 1PDNC 1V5EA 3OYHA 2PN5A 1HV0A 3M70A 3BTXA 1A8MA 2L5QA 3UR3C 1V0AA 3WG2A 3CLPA 2M8GX 1UX7A 1OH4A 4KISA 2E1MC 3I4PA 1XU1A 2V6CA 4Y20A 3ZN5A 4DYRA 1WA6X 2VJ5A 3OSDA 1JJ8C 4FPCA 4FPYA 3AMMA 3ZMVA 1PO13 1D2QA 4D0QA 5GLTA 3RPUD 4S05A 4JGYB 2EICA 4HDVA 1HXDA 3C7GA 1BC8C 2HWE3 2PYTA 3WHTA 3CTAA 2DOEA 3HOBA 4HXCA 3BODA 1GNZA 4LK0F 1VQLI 3FE5A 4HZFA 4L18B 1O3RA 3L00A 4EGZA 1I50J 1PM7A 2BY2A 1OCTC 2XGCA 1DQ6A 3LAJA 1UYXA 4LA3A 1MBKA 2H1LA 1JN2P 4FE4A 2FMDA 1UZZA 2LW8A 5HLHA 1VBA1 4QPOA 1VRH1 3JR9A 4Q48A 4KIGA 5A7WA 4BYYA 2XUMA 4B43A 2HTJA 5IVBA 1W9TA 2RJLA 3WOGA 3BU0A 1WFXA 3NJYA 1G8WA 4XRSG 2ZHLA 2EVXA 1TE1B 2XAUA 2AYHA 4W8JA 1O4TA 4ZPIA 1AR62 3WGGA 3OYKA 1W7PB 1VIWB 4KJZA 1JZ5A 1PZ9A 5DAQA 4LD5A 1JS9A 1W9SA 4BE1A 3OS1A 3MUZ1 3OYMA 4C0HA 3E7LA 1Q1HA 5A7WB 3AYCA 5I0SA 2Z69A 1VI0A 4BISA 2QE3A 3VKMA 1J58A 1H0MA 2Y34A 3VKLA 5J36A 1FAYA 2ZGSA 4XFGA 4BQ1A 1H8AC 3W21A 3F3XA 4XQ4A 3INAA 5C4JJ 1KQ9A 1W2TA 4BBSJ 1Y43B 4ZJZA 2EIEA 2XBO2 5LLQA 3ZN0A 3ORJA 5FPZA 2KKOA 5DTDA 3GFLA 2FDFA 1YJKA 3SEPA 3BCAA 3FFQA 3MFKA 1XNCA 2QQIA 3NQOA 1ODMA 4AEDB 2EXHA 4FXGB 2F5FA 4S04A 1OR7A 4XJ9A 3HNBM 1EP0A 4Q4V3 4A3LJ 4C0BA 2EZLA 4XBFA 5F7UA 2A5ZA 4I99C 1R58A 2KP6A 1S0BA 2B7YA 2DQLA 5CZKA 1UJ8A 2B4KA 3HN3A 1RUC2 3TN91 3ABKH 3O1UA 3H42B 2XDVA 1VMFA 2DBBA 5FZ6A 4GYIA 2JA6J 4U88A 1UG0A 4MHUA 4A6EA 1WZXA 3HL2A 3KSCA 3VPRA 1MS1A 1QWRA 3BU7A 1RUH2 3WW1A 2HWB1 1QMJA 5JIUA 2VXRA 3IBMA 1UY1A 2RM21 2WNOA 4SBVA 2JRMA 2DV9A 1UXZA 3U75A 1FT9A 3DPRC 1YJLA 4MX3A 2M0MA 2LS6A 1ND3A 5BOXA 3BALA 1AUYA 2DJNA 2UWMA 1OCRH 5IVJA 2BERA 3FM3A 3CP8A 1W06A 4YM0A 4HVQA 2DTRA 1HJGA 1PIV2 3DXUA 1RVF3 2ESNA 2V1NA 3EHKA 3LSEA 2K5CA 1K5MB 2EFWA 4YRDA 4CEYA 2HBUA 1FP2A 3LKJA 1D1BA 5F6LB 3O2PE 1LE8B 3JREA 4RB2C 4QX5A 4ES8A 5EG0A 4B3XA 1KU3A 4XIDA 1ODNA 4YGEA 1MS5A 1BBT2 2VTXJ 5FY8A 2E32A 5BY5A 3K4ZA 4XICA 3N9PA 1YWKA 3T5XA 4XMYA 2E7AA 2YZ4A 5FZKA 2FDKA 3DU6A 2JDPA 2VXJA 3SCFA 2Y6JA 1ORKA 5C44J 1LCLA 3WDXA 1QPIA 3K1NA 1FOD2 5EIYB 5TSWA 1XU2A 5LZ6A 3GLLA 1DLCA 2Z9OA 5H6RA 5DUXA 3HBZA 2D6MA 2OKXA 3H0OA 1UOJA 2JD9A 4FO9A 3B93A 1Z3XA 4G9YA 5FMOS 3JD71 1D0GA 3ULQB 2EPFA 3ECOA 1T2KA 2HYGD 2NMOA 4AWXB 2LY1A 4AQSA 4CYDA 1C1FA 2KIQA 3GHNA 1FP1D 3I58A 3A01A 1RUE1 4CXFA 2RJKA 1ON2A 4BY1J 1UO9A 1NXMA 3V42A 3EETA 2NOGA 1B72A 3EJKA 4RFRB 1MJ9A 3BKZA 5LA1A 3CLQA 3H1MA 2DVAA 5K8SA 4HBLA 4UB6C 4KWKA 1ETQA 4II3A 1J3PA 5CVRA 1QQP2 3PTYA 1AYM1 2DVGA 3JRGA 4ASKA 2P7VB 3K4JA 3ZDSA 1AX1A 5J8FA 3M2MA 4JTOA 4GWMA 2OU2A 3HRTA 4OOIA 4NHXA 5K5RA 1X19A 2VD7A 3R0JA 3NO8A 1WUVA 1PMHX 4RGAA 1XXNA 5EPAA 4M72A 1IG0A 2OCEA 3AYEA 3B00A 2X9DA 4YM1A 3ZQLA 4AAXA 3CCQI 3GZAA 3ZMZA 5FO7B 1JYTA 1Z7S2 1F1ZA 4ZZDA 3ILRA 3FK7A 1QOTA 4ESFA 2O61A 1OD3A 3VGIA 1V6IA 2WO2A 1GUUA 4RLQA 1X36A 2AQFA 4HKOA 1G2HA 4ZTFA 3JUUA 1YIFA 3POFA 5GLUA 2MYSA 4X6AJ 1C8M2 3ZQHA 2R7XA 3DF8A 2DCKA 2DF7A 4Q0SA 1S5LC 2B0LA 2DU1A 5JVTA 2RMU3 3DPTA 5D8AA 3KYDB 3NNGA 5JLWA 1BJAA 2Y0SN 4YEJA 4ZU7A 3GFIA 5A7PA 1GLNA 5KHDA 4JGZA 3VBHC 2YX4A 5FTTC 2H6BA 1S2EA 1E5HA 2CWMA 2K4BA 3MI8A 4U2AA 2AHQA 4AVZA 3W2AA 3H5NA 2KL4A 2IW5A 1ZZ8A 5FLXZ 3BTIA 2TBVA 3N9OA 2TRTA 3UV9A 2ZA9A 1W6NA 1OPMA 1ZRCA 5CYVA 4M3EA 2ZMEB 3GUDA 3R0AA 3JRFA 2IVIB 2RREA 5BS6A 2C9KA 2IS1A 2R041 4QPIC 2W1WA 2WA3A 3JBG1 3CJIC 2AXLA 1F15A 3I53A 5IVVA 1GUIA 3S6PA 2PTMA 2BW3A 1LKNA 1MS8A 4AQ6A 3HAGA 2JSPA 2VUJA 5B66C 5KC6A 1LQ1A 5A3PA 2F4MB 5HDGA 1BL0A 4ORFA 3JAMZ 2ZHMA 4LKDA 4XBLA 3RI9A 1PP8F 1YO8A 4Y52J 3URFA 4LORA 4FPHA 3T0BA 1K4TA 1UELB 2R5YB 5CFDC 1YFXA 4AW7A 2IS6A 1QY4A 1JGSA 2JK3A 1GR3A 2C24A 5ABJC 3BIEA 4GRIA 1OXCA 5FUIA 5LW9A 3DU5A 2EALA 2QSFX 4MEYF 3MEPA 1MMAA 2KFDA 5C71A 4RQPB 4WM7C 3VDDC 5C9AA 2CV2A 1QJU3 4LBNA 5IYBJ 1LHOA 2VBBA 3RIRA 2RE9A 2ILMA 2STWA 3THCA 4LFUA 3WCSA 1FXZA 2GN3A 1W6OA 4N43C 1AR82 4IV1A 2HFHA 3AKTA 1R23A 2N7GA 2V6EA 3TEZA 3CLOA 2VUAA 2O3FA 3DKQA 4ZTJA 3GO5A 1W8OA 5DUWA 5FZ1A 3TW6A 1OKQA 3HPHA 2ISYA 1NQJA 1XYOA 5M5XJ 4V2FA 1T0FA 3OYFA 1UZ0A 3ZN6A 2XL9A 4CUBA 1NKGA 2UZKA 3TDZC 4INDA 4XFHA 5SV5A 1IRZA 5FYUA 5FKKA 5FUPA 1T6SA 2HVRA 1NA1A 2DUOA 2ZEZA 4A42A 1LECA 3S2WA 2XWJB 4PUSA 2R32A 2OIIA 4MUVA 4ZZLA 4YG6A 3DV8A 1S0CA 1RTVA 3Q9VA 1O59A 2IZWA 4MTEA 1SVLA 3QBQA 5AC93 1H0BA 5A3TA 2OXBA 3K9TA 3MFCA 4IDZA 1CZVA 1MD0A 2EFNA 4PDWC 2BWCA 3AKQA 1QIQA 1Z67A 5JI9A 3K4KA 1DPUA 2VM9A 1BC7C 1LNWA 3VHNA 3PJQA 1FSHA 3MV11 4MZUA 3AJYA 1X8EA 1H4GA 1XYPA 4I01A 5FKCA 1XB9A 2L0KA 1KJRA 3TKYA 1ZVFA 2RAEA 3GTOJ 2A6VA 4XC9A 4GGGA 2EILH 2O14A 3P9IA 3LWFA 4OYUA 3ZSKA 3CP2A 5FPVA 2XBO3 1XPXA 4RM2A 4O3MA 4LHSA 3V8JA 2XASA 5JOWA 2P7CB 2WJSA 1UKRA 3NSTA 1FPN2 1OC1A 3D4KA 2WZEA 4NR1A 4NIAA 3ELKA 2H8RA 2E9QA 5L3CA 5J1RA 3P9CA 2MG4A 4DXZA 1PGW1 1WJFA 1JH5A 2PLV2 1QOSA 4AC0A 4P96A 2DT6A 1HSTA 3AZWA 3SCHA 5IOZA 1W1WE 4HPQA 1D4M1 2EWNA 1OOPA 3A4CA 5AFEA 1ETWA 1NY71 4S0HB 3VZOA 2J22A 4CE8A 4IKFA 3DCFA 5HXMA 2AZ5A 1A6QA 2M30A 2CSGA 1TP4A 2KRHA 3QCWA 3U37A 2H0BA 3ROUA 4H2AA 4RD7A 1TWCJ 1HKQA 1BEV3 3CCEI 2VPRA 3QACA 2VUDA 3DQVC 3C3WA 3FL7A 1F4KA 5GAEJ 3ZR5A 1KU7A 3A0NA 3BPXA 4NWWA 4TLGA 3IZOA 3VKNA 2R93J 2R7VA 5LGUA 1BI2A 4LHKA 1P6RA 5CFCB 3G1LA 4FOYA 3JSOA 1YQ2A 5GZDA 2XJTA 1BMV2 2WAQN 4IW3A 2P81A 5IW0A 2LG4A 2YR2A 4N4OB 1SD5A 4KMQA 3OSGA 5LB6A 3K70D 1XPWA 5JVGF 1FLIA 4CU8A 1OFNA 4HPKB 2Z99A 4MHGA 2XXZA 1T08B 4AXOA 4C9YA 1PNGA 3U1XA 3ST7A 1UMQA 5B1AH 3TEDA 2VXDA 2DWRA 4BQ3A 1UZWA 2R30A 2JA2A 1NE4A 3KT7A 2D5VA 4ASLA 3VBFB 4YIRX 1WJAA 3PUHA 3NRUA 4F8AA 4XUOA 3WG7H 2Y0MA 4NUBA 1GXQA 2EFOA 2ZABA 2VBPA 2RDRA 2M8EA 1JUHA 2OA2A 2E7WA 4IV3B 1FPQA 3AG1H 1IUFA 3KGLA 2W2IA 4BQYA 2VJIA 5C3OA 2ZO4A 2XAQA 2Y6FA 4AGRA 1LOFA 2X0LA 4R9CA 2CW8A 4BA6A 2FQ3A 3W2WA 3ABTA 2ZX1A 3B69A 4V19K 4FCAA 4Q0QA 4GXOA 2GNMA 5LHGA 1WKYA 2VULA 4ZZ5A 4Q0PA 4XHXA 4ET7A 1A5JA 3T8RA 1VBE3 3KX2A 1YQ8A 3N7LA 2H0VA 2PQQA 2WWYA 4K1ZA 3EUHC 1REPC 5HCFA 4NPMA 1IKPA 1GV9A 4LK7A 4XJ8A 2HKXA 1WSUA 3CMGA 3UL2A 3USUB 3KF3A 1LULA 2OX0A 2MFZA 3RZDJ 2LREA 4XE9A 1UYPA 1Z9CA 3K0LA 4UAPA 4IHTA 1APLC 4QX3A 3UT0A 1T6GC 3ACGA 1UNBA 4LG0B 3K2OA 1JT6A 3GGLA 3JB4C 4D5FA 5A3OA 5GZGA 4LOCA 1G86A 2KJCA 4HSJA 4DOZA 4HLTA 1EAH3 1PP7U 4L97A 4Y4RA 3WDYA 3SZTA 1NG6A 1W3VA 3AMQA 1VAVA 3GCMA 2Z79A 1C0WA 2HPIA 5FYBA 4HVRA 4BZ4A 1KQ8A 1KU2A 2HBTA 5L73A 3EQLF 2D7FA 4K21A 5L19A 4XLNF 1HRV2 4OHZA 4KGQA 4BQOA 4LMYA 2XF7A 2RR12 2RV8A 3H36A 5D8AB 4N9HA 1E5IA 2MHFA 5E1WA 1KEXA 4IEZA 2EV5A 1POGA 3BB6A 1XSQA 4IE0A 4OAZA 3M3EA 4ISRA 1B4AA 2SLIA 2VB6A 1W90A 5FY7A 3CD6I 1S0FA 1ZGAA 2OUMA 5GADJ 3U21A 2JICA 3APBA 2XLFA 2VN2A 4Q1RA 4QPIB 4NAOA 1IS6A 4RR3A 2D5HA 1UCXA 2DPUA 2YX7A 4FPJA 2Y2ZA 1XNBA 1N75A 1V6JA 1BW6A 4WZFA 1NZCA 1REEA 3W5MA 3ZMDA 2VTFA 3AVSA 1TNRA 5J37A 1EH8A 5CFCC 3ZIWA 5LK7B 1HN0A 5JMCA 2VZ3A 3B9IA 2FMLA 1QXPA 2D45A 2VH9A 1PO23 2EV0A 1BN5A 5E17F 1JHHA 3SJMA 4XACA 3MAJA 1OURA 2MABA 3HNYM 1Y6IA 4C30A 4W97A 4A6OA 4XFIA 3AG4H 2RS11 2EQRA 2JJ6A 2HYXA 3JRCA 5IP7J 4PF5A 5KVRA 4GWIA 4MGKE 1RB8G 1ZBA1 3U11A 4LGWA 4N4NB 4LUMA 4R9BA 3CZUA 2EZHA 2CJJA 2KIMA 1QEXA 2W3JA 3NAPC 2DUPA 1ZBA3 3VZNA 1AR93 2UY9A 3D8CA 3N7KA 4YFNF 5H9PA 3W3CA 4NE9A 2GIVA 3AMPA 2LKXA 4CUGA 5A6QA 3M3IA 2CV0A 2HS5A 3MZ8A 1FV2A 2VZ1A 3ZQIA 1R092 2EBIA 5A6ZA 1PX3A 3E3VA 2HWD3 4Q4Y1 1XNTA 4BPZA 3NNJA 4UW5A 2J1EA 4Z07A 3RQIA 3ACFA 3IN9A 4PJ0C 3RWKX 1CX1A 2WN2A 5J3UA 1RINA 3HBKA 4BXUA 2KDZA 5HBAA 3S7EA 5BNNC 1B1BA 1YFHA 1ZRRA 3K46A 1DG6A 3GFMA 5A3NA 4C2UA 3M8FA 1RRJA 4I02A 1CAWA 3PUSA 4YZ3A 1TMF1 4JRLA 3I55I 1MR5A 1TMF2 4GJZA 3ZPYA 1ND3C 4Q4W1 1STZA 2I8DA 4LKEA 2VBYA 4B4CA 5DUKA 4B1MA 1FBQA 1GVJA 1I3AA 3BR5A 3ONQA 1T2XA 2WS92 4MOAA 1RJ7A 3M07A 1HB1A 1LVKA 3KPHA 1AXYA 4IESA 3EUAA 3M9AA 4KIBA 3LF7A 5FROA 4EM2A 2JVGA 1UY0A 2CGOA 3BR0A 1HW5A 4M00A 3CIHA 2GALA 4QQLA 2M7AA 1YLLA 5FZ4A 3MKZA 3BLYA 2K9SA 1KRIA 2VZPA 1YJ9I 4H3WA 1NXD1 1UU4A 2CO5A 2HQAA 4AVAA 2E33A 3ILNA 4IF4A 3K51A 3VZJA 4D3WA 1XSXA 4GKXA 1HCRA 2HXIA 2X48A 1EPZA 4Y1ZA 2BVLA 3MICA 1RIOH 3CO2A 1W3XA 5K5QA 1S0EA 1ZYRF 2CS3A 4RGKA 4Z1VA 3SQOA 3MEXA 2X1EA 2P2KA 4GO1A 4RGGA 1WWXA 1QNWA 1GSLA 2DFCA 3NW4A 3DEMA 3K2AA 1RUI2 3T1LA 3G1OA 5LFAA 4TTGA 3X29B 1KYZA 1AL21 2Y8KA 4LLNA 2XLGA 2Q8DA 1GP5A 3CMYA 5FKNA 2GM4A 1GXPA 3TL4X 4QX2A 3LGRA 4K3UA 3PJYA 4OQ8A 2ES3A 5JOXA 2I5UA 4AYUA 4UOJA 4FTEA 2CUEA 2KPMA 2E6VA 1LGBA 4FFIA 3NRVA 2C0ZA 2VNRA 5DDJ2 2BBYA 3DTIA 3C18A 2E5ZA 1LE8A 2OD5A 4LLLA 3KT4A 3TEXA 4QHOA 4IO9F 1YRNA 1V6KA 2XJSA 1IG3A 2VQAA 4P5YA 1YI2I 3KQRA 5A3MA 4RMNA 5FD5A 1SCRA 3CDLA 4HL0A 4HLXA 4RA0A 4CDXC 4COWA 3IRRA 4IEYA 1USTA 3VDDB 4CYCB 1W2NA 3HOSA 1B9NA 2WNEA 5HLIA 3S1RJ 4LOTA 1ZZ7A 3ZYGA 1HRV1 3KZIC 4CUCA 4ONUA 1ENHA 1R5ID 4YFWA 1F31A 2HH9A 2DA7A 2R7SA 2FQPA 3WTZA 4YLZA 3VDBA 3BG5A 3WGIA 3M8JA 3ZXGA 3LSGA 3HDDA 5L3DA 2O03A 1Z7S3 4Q8LA 1NTCA 3CBNA 3M4FA 2CNAA 4C8DA 5JUVA 3C7JA 3BR1A 4NHMA 4S2GA 2L2OA 4NB5A 1Z7S1 3ZXEA 1L3LA 4EJVA 4YW5A 3MYXA 4KN4X 4Q26A 4BDVB 1W8ZA 5FUNA 2XROA 1DGWX 1D1CA 4LUKA 3AZXA 4RGSA 4MV2A 1UFMA 4IRHA 3WD5A 4Y17A 2X09A 3TWIA 1WMDA 2E1MB 1XRUA 4EZ4A 5IK4A 5IP6A 1D2SA 2XSJC 4XEZA 4MO3M 5ERIA 2D6LX 2QQWA 3ZX7A 5D4SA 2FHRA 1QVTA 1J3QA 4XLAA 1O4XA 2O1QA 2VTXA 3PU3A 3E6DA 4DQAA 1HJFA 1RITA 5FIXA 2IA2A 2R7QA 5LEJA 1HOMA 1P92A 2JG9A 3ABUA 2VCAA 5DMYA 4FP3A 4AEKA 2A1XA 3KV6A 1JI6A 4YM3A 2EIJH 4XF3A 2D1HA 4DEQA 2KDOA 2NVXJ 1W99A 1V70A 3DF0A 1REFA 2ACJA 1V9U2 4PDWB 1WD4A 1ZBE1 1W9YA 4I0BA 1FOD3 3PNTA 3CCJI 3J7HA 4IEVA 4IEXA 1UXXX 3GFJA 5CEHA 2Q2EA 5CU1A 2V26A 3HKZA 1J0RA 4ASMB 2NS0A 5FZ3A 3TOJA 1L7RA 4B4QA 1K7AA 1R6RA 1U5TB 3LA2A 1YI9A 1U5IA 2RN7A 2VW1A 1FC3A 3MQ0A 1VQPI 1OI6A 2AC1A 1H9TA 4BH9A 2R7TA 1JKPC 1GZWA 1W6PA 2OPKA 1G9FA 3RWNA 1ON1A 4WXCA 3DBHB 3RVHA 2L9SA 2QQJA 2I2SA 4N43A 3JD73 2VMDA 4CSWA 1E5RA 4XOGA 3CJXA 5FOBB 3O1OA 3VN4A 4Q0VA 3VBUB 4BQ2A 2HZTA 4XLPF 1HXS1 3ELNA 3W6VA 3HT2A 5FMBA 2ARCA 5FZHA 4A7ZA 4MQ9F 5IT6A 1ZGWA 2WB1A 1Q8OA 3UESA 2V7FA 5DG2A 1XCBA 3IKVA 4CXYA 2TNFA 4Q4X1 4KI5M 3RG0A 5IATA 2VE8A 3THTA 3LSIA 5A3WA 4UHTA 1IUYA 1LNSA 4UFLA 2X29A 1BJZA 2P37A 3LNQA 5FRMA 3EYPA 1FTTA 4KMFA 3IC7A 5AIPA 2WRAA 4MHRA 1U0JA 3MLLA 3VYTB 4PDWA 2XKPA 3B5LB 2LVSA 2QQLA 2VC9A 3NV4A 4NNJA 3A0BC 1NUKA 5IVYA 4WX9A 3G6EI 2JVHA 2Q1MA 4EE2A 5FZMA 2Y9ZA 4N53C 2HQRA 4CCNA 3PQJA 3MN2A 5FZ9A 2IS4A 2FOKA 3ACIA 3VBHB 2OTJI 3KEQA 4WM8B 4DNYA 4CU7A 2JECA 2B9VA 3OY9A 3OB8A 2RR13 1FMWA 4J1WA 4MXWA 4CU9A 2Q0OA 5T50A 2R063 5GM0A 4D7TA 4D7NA 3HYIA 1ACIA 4WVWA 1ULDA 5FD6A 4FXKB 1RUG1 1WH7A 1X2NA 5DV5A 1S7OA 2FOWA 5EDNA 3O1SA 3CNAA 2MH9A 2CAVA 5D8AC 2WYSA 3PIOF 4CUAA 2CUJA 2WNUA 3SXYA 1R093 5JSRA 5BNPC 1YW9A 2BBVA 4C90A 3HOVJ 3TRSB 3VD3A 1H2LA 1RMU1 4KQ7A 3U1KA 1ZN2A 5JXJA 2WO1A 1NHAA 3FMSA 4KN7X 2F6CA 2V5DA 1TQPA 2JMWA 1RMU3 2EIKH 3H1CA 3J7AO 3GYDA 4OMCA 3VBUC 4OMZA 1R1A3 4GB32 3T2OA 3THPA 1H6XA 2WWJA 4C1XA 4BDYA 3AYDA 5DDJ3 1XDSA 2UWAA 1LENA 4M0NA 2QQUA 1JUMA 3VD7A 3BZCA 1MZ5A 4YZ5A 3HGGA 3ZYHA 2DMUA 1WPKA 2CQQA 1UG2A 3HMYA 3ILFA 5IVCA 5FLJA 4N53A 2VXZA 2C4XA 2KIUA 4IGPA 2VOPA 1YQCA 5D6EA 4AYBA 4META 3K1MA 4EN6B 1P7JA 3WF4A 2DFEA 5C3SA 4DYCA 2JG8B 4L99A 2KR2A 4IPAA 2ID6A 1X4PA 4URAA 4F3QA 1IPSA 3H8OA 2JT1A 4YW2A 3ZQ7A 4IHXA 4UVAA 1I9RA 3HC7A 4L0PA 4ZONA 3NKTA 2ET1A 5DDGA 1VQ9I 5ABJA 1OA3A 4BQAA 3VYRB 2FUG2 1IF1A 1AYN2 3B01A 4FCYA 5FR3A 1VLNA 1QNYA 5LBBA 1SLAA 2VG9A 1BMV1 4YFKF 1W04A 5ED4A 3I4IA 4ISQA 2L9RA 4JQFA 4EQVA 1YW8A 3JD72 4JYKA 3VZLA 4XZUG 2RS53 4OQ9A 2VZQA 4DFSA 3BG7A 4ENJA 5F2WA 4IV1B 2LC2A 2R061 4IEWA 4E7KA 4KIFA 1EPWA 3FXKA 3WG4A 3BVCA 2C6SA 3ZOIA 3E5QA 1CX4A 2L7MP 1W05A 3BZ6A 3FXRA 2DOAA 5KXEA 1YFYA 2LBFB 4CDQA 1J09A 2W91A 4P9FA 3QWLA 1MQTC 2MD5A 3G73A 3GTGJ 3HEIA 4QQPA 3ZKYA 1NCRB 3O0VA 1Z91A 2I74A 2VNVA 3D5RC 5JAXA 4XF1A 2X6XA 5F6FA 3ES1A 5LEKA 4Q5SF 2LLKA 3MIBA 1R1A2 4GB33 2VO5A 2DBNA 4A5NA 1W6QA 2LK2A 5LA9A 2R072 3FWEA 4A7YA 1AJOA 3FXQA 3WODF 5FXZA 2O5RA 3BCWA 2PAMA 5EZHA 4HFSA 1OJLA 2DBIA 2VBZA 5FKBA 4PJNA 3I2JA 1RETA 2CYFA 3ACHA 5JR2A 5F64A 1VBD1 3OUHA 1W5SA 1V6MA 2ERFA 1SHWB 4ATFA 3GYHX 5T5PA 2UUZA 2PJPA 4L5JA 3V7SA 2MD0A 2CMPA 5I0DA 2VMFA 1YC61 3ME2A 2IPQX 1JZ3A 3OEAA 4U87A 5A7SA 2R5ZB 2WWSA 4P9XA 5FPUA 1MH3A 3R0RA 3FKIJ 2D44A 5FP4A 4AVSA 2DDUA 4XQFA 3D5LA 5KBFA 4FFHA 3R60A 2G0EA 1COV2 2VCMA 4XM3A 4M3GA 1YCIA 5BV6A 4YVWC 3OIQA 1JHNA 3I2DA 1YHQI 5FB2A 1XN7A 2GN7A 1G4DA 1P8JA 1XX5A 2VL8A 1IKQA 2HLEA 2JA5J 3H8RA 1W9WA 2WBKA 3MF6A 2VQLA 4E2GA 1JKRC 1UOFA 2EIDA 1OOPB 1BOBA 2VVEA 3PIPF 4M01A 2BU9A 1ULPA 4W65A 3S2HJ 2ZMLA 1BYHA 2XJUA 4RS8A 5E3MA 2RG4A 3HUGB 2V09A 5KC5A 5FPLA 3N97A 2E2IJ 1NG7A 4BNCA 2W1SA 2VQHA 3ZPLA 2EAKA 4ZY9A 2Q1ZB 3ZYBA 4BIFA 4M6XA 1D5VA 4PLNA 3HBLA 2A5WA 1H30A 2QFEA 5JPMB 4L9JA 3IAPA 1YITI 2Y69H 3SC7X 2OF7A 4E70A 3PIJA 3MPBA 3KCCA 2JRTA 1F5TA 3S5AA 2BVVA 4RB1A 1UHSA 2NVUB 3JQXA 4OIQF 1RHI3 4YVWB 3LFKA 2CYYA 2FNAA 2M9HA 1OQEA 1S0GA 4BJTA 2O0OA 4UUVA 2PJRA 3SITA 5L3EA 5H6QA 1GFF2 2P3KA 1WCDJ 1W0OA 3T0DA 4JDMA 2A6YA 1XMXA 3HZJA 2CSOA 3OYGA 4ENNA 2MPFA 3T0YA 2A70A 2D98A 2MA3A 1S3JA 3I5UA 5CYYA 1JTYA 2A6XA 2RS32 1C4RA 2ZXHA 1CPNA 3UYJA 2R3SA 5FZOA 2LRDA 4LXLA 5FZ7A 3DLAA 4U36A 1XG1A 1NAEA 4QDSA 3BROA 1EV13 1NY72 2HWE2 4UI9L 1SPPB 1S2BA 1AL23 4QGMA 4AOCA 1LOFC 1W5TA 4HRIA 3D6EA 3J8F1 1DP3A 4A4AA 3VBUA 1K3IA 3OGVA 1VQ8I 2O8OA 1NOVA 5FYHA 1I5PA 1VBA3 4DOUA 3LA3A 5GTIC 2LFBA 2D6KA 5GPAA 2X1CA 2VBXA 5K7FA 3PVEA 4ENKA 1N3PA 4HNTA 1WLCA 1E3OC 3OBAA 2HVSA 2LKSA 2DCZA 2R1DA 1KA8A 1HDKA 4DUWA 2P34A 2IXCA 3FXLA 2DW4A 4E7JA 4UNOA 1UZVA 5JOZA 3H7JA 3NVCA 2R16A 3J80K 2VC1A 1JZ6A 2VASA 3GM8A 4B8EA 1GOHA 3HG9A 5EP9A 3JQWA 5DXDA 1ZKGA 1ZM1A 2E51A 4IVNA 1SLLA 4D1QA 2H6CA 4YNIA 1XGSA 5J7MA 2DA6A 1QJEA 3D82A 3RZOJ 2W85A 3WP5A 1GU3A 2PLV1 4RGRA 1Q1VA 3CF5F 3DEWA 4G6QA 3TP0A 5IFTA 3ZXLA 1BVP1 4P9LA 3HEFA 3VBHA 4A6SA 1FEXA 2RS33 3I49A 5GLVA 2WZR2 3WE2A 3N36A 3W58A 5CKMA 3QODA 4BE0A 2XAGA 4XRMA 1Q43A 2ETEA 3ALQA 3RKXA 2VZTA 4BB3A 1V55H 2K4JA 5D8LB 3BJ6A 1EJ9A 4TN7A 1Z21A 1SPPA 3PJRA 4RHV2 1O91A 2CV1A 1V6LA 4B1RA 2P5VA 4XLEA 2CWSA 1CAUA 3RQ4A 1FOXA 4IHVA 4RS5A 3PM1A 3ML6A 1WWYA 2BTVC 2EIGA 3S93A 5LD2C 1LHVA 2XHKA 2PHDA 2H1KA 4EN7B 5C4XJ 3OCPA 3Q0VA 1JYVA 1XD7A 3N05A 2A07F 2VOOA 1SMYF 4RR3C 3OWTA 1UB9A 2ELHA 3BTCA 3IDEA 2VC0A 1DQ5A 2GA1A 4EVIA 5CVVA 3U4XA 3NAPB 5EGOB 2ZFUA 2W46A 2MW8A 1YJWI 4OHWA 1X1AA 1U5ZA 2O8QA 2RVCA 3FHAA 1CAXA 2OVUA 1NA1B 1K61A 2XG3A 2QDNA 2XVGA 4IEUA 2LD5A 5GZFA 4RGXA 1X2MA 3CHXA 3DYOA 5DCFA 1WLTA 4ZU4A 5K0UC 3USSA 1MVQA 3MIFA 2HR3A 5D5WB 3C7OA 3GCWA 5DUVA 1O3SA 1QH7A 1APNA 1RUNA 3FMQA 1QHHD 3CJIB 4B29A 4G4FA 4LK6A 3QPHA 2OT7A 2X6OA 4BIOA 4QXHA 4WVMB 4Q29A 3L9JT 3ZSLA 2DFIA 4LE4A 5KWRA 4XKCA 5E3NA 1XMAA 3ZYPA 2O9LA 1FMD3 1GWLA 4AVCA 1MJAA 2AR6A 3OPTA 4NO4A 1C5IA 2KXLA 2XVCA 1BI0A 5JHFA 1ULFA 3S8PA 2YB7A 3JRIA 1O57A 1K78A 3O6BB 4RAGA 5SV8A 3GTQJ 1CZSA 5A6YA 4FHTA 2GXBA 3T30A 2CGNA 3IH3A 2BBAA 1ERDA 3BR6A 5D5UB 2V4VA 4PQQA 2WQ4A 3OSFA 3E1F1 2Y60A 2HOTA 3UGFA 2Y6LA 5K0UB 4E7LA 3RNSA 2R7RA 3VFZA 1DFQA 1RUF1 4CCDA 3R4DB 1FWZA 1BIAA 4GMP3 3AVRA 1HB3A 2FBKA 1W8FA 5CBLA 2VCBA 3SMHA 5FFXA 1YTYA 4LOSA 3QYEA 2DCYA 2GMEA 3FISA 5FXWA 1IZ3A 3TNPB 2IAIA 4UXAA 3LSPA 4OHVA 5ICFA 3PLQA 1PO11 3OYNA 4ZYAA 4GQ7A 1LOGA 2JDZA 3RSNA 5IYDJ 5K0UA 3VWBA 1MS3A 1OMIA 1OQYA 2PJRB 1GNHA 2E7TA 2A6EF 4M9ZA 2BWAA 4CDWA 5L3BA 1EV12 4BBRJ 2PQ8A 5CJ9A 1LOBA 2JDYA 5LRRA 1BZWA 2M34A 3F23A 3Q0WA 5DN2A 3HSEA 3K10A 2K40A 2RS13 1MEC2 3UKNA 1KGYA 1WLWA 3NL1A 1BQPA 1XOYA 2EH3A 2R0FA 5CKTA 2ZOEB 2JDHA 3HPGA 2BV6A 2ZXJA 3PVNA 2CUFA 5DAPA 3ZFFC 3EXUA 2QQAA 2EA2A 1O4YA 3OIOA 4FASD 1U6GA 2W57A 2F5CA 1W4MA 3GTPJ 4JK1X 3GXUA 4PJYA 5B3SH 1EAH1 4QGNA 1YIPA 2QSGX 4Y7NJ 1H8TC 4LPLA 2FDGA 4BK5A 2V1DA 2MLKA 1HN1A 2AXTC 1FX5A 1UYYA 2VCCA 4HKWA 1XTAA 2PFBA 4Q0UA 1LESA 1LOAA 1SDDB 3GTLJ 1AHDP 3BPZA 1X33A 4MGIE 3S32A 1DQUA 1NX9A 4ON0A 1SC7A 2DVDA 2RMU1 3WW4A 4UUSA 4MQVA 1BBT1 4AFDA 5B2GB 2UY8A 4GYGA 2YY1A 4YGCA 4BUPA 5C8CC 2QVSB 5J6XA 1IS4A 1PVC2 4DYQA 3I3LA 1QQIA 3OS0A 3ZFFB 3T1MA 1VTNC 1R49A 3K3NA 1JKOC 2WKKA 3ESWB 3WTVC 1LVAA 2WNVB 4YSFA 1OH3A 4I6ZA 2DCJA 4LO5B 3ECQA 4CDWC 3HTUA 2A6ZA 3IKWA 1VNDA 5AFBA 1A6CA 3OYDA 4M3CA 2XONA 4X6QB 3EPZA 5T3NA 5DM6F 2DCTA 1Z77A 1KITA 1NCRC 4NQWA 5F3EA 5FWJA 1SLCA 2OA4A 5H20A 2ZX3A 3NQHA 1Q8SA 2KLOA 3RYRA 3O8HA 3LWCA 3KM5A 3WSOA 2DXIA 3FLPA 4MFEA 1JW6A 1YQ6A 3CCLI 3JRAA 1B9MA 1OQDA 3A01B 4F93B 4E7SA 2X6YA 2VMIA 3DGTA 4HV6A 5KXDA 3LAPA 3AZYA 1LDJA 2WZ8A 1O7FA 2QQ8A 3R4UA 1U2WA 4JOMA 1QZYA 3NAUA 3SZGA 2DURA 1UY2A 3KQ4B 1ZBE2 1AYM2 4AGGA 5BNPA 2QUFA 2O8XA 4M3FA 2A3XA 2L3DA 3BN6A 2V4JC 3DWLE 3RI4A 3BZKA 4LITA 4QMAA 4P9GA 2M45A 4YYOA 2QWWA 2LOOA 1XB4A 3OOPA 3PVOA 3PIGA 2FA5A 3VZMA 3EB7A 1EUUA 3O1TA 2B42B 4QPGB 2RV9A 1MEC3 3AYAA 4AE2A 3V8LA 3OD0A 1UCRA 4KG0A 2QSHX 4U0WA 2HYKA 3C3VA 3NV1A 5HLTA 3AG3H 5T5JA 4XLHA 4XETA 4W6WA 4K9SA 1XQNA 2VNOA 5IVEA 1REDA 4JQTA 2MLGA 3M1EA 2E7XA 2E1NA 2GMPA 2SBAA 2WAEA 1XSRA 4AI9A 1ST8A 3PUFA 4L11A 5IAXA 3HGYA 2ATFA 3Q8FA 1RESA 1VFCA 1H1IA 2RHPA 3IP4B 6PAXA 5LBQA 3H92A 2RNJA 4LG0A 2Q1FA 1BEV2 2EA4A 5EYYA 5CADA 5J3LA 3H8XA 2WC2A 4NVPA 1K6YA 3N9QA 5KHHA 1U5YA 3EYYA 2IA1A 3A22A 4MXVA 5DAVA 3KD4A 1O4ZA 3CMAI 2P6HA 4X8NA 3AL5A 2J5OA 2BGCA 2W87A 3EO6A 3HHGA 3CCYA 1XSVA 1ZK8A 4RM3A 4UWDA 5KNLA 2DI3A 2NNYA 4E2SA 2A71A 1OLMA 4RLFA 2BVBA 2WAAA 4RQPA 5CAZA 2ZTNA 1AX0A 4XBNA 1FNYA 2BNOA 2QKDA 2G9WA 3IPVB 1R1A1 3KV9A 2GWRA 4NRQA 3F8MA 4IOCF 3OIPA 3IWZA 1XGOA 4HN1A 1GV5A 4H7MA 4CHUA 4MGQA 1PO12 4BWOA 1TZLA 3WQ1A 4X1EA 4UB8C 5F5CA 1IXSB 2V9PA 5KHKA 5DEQA 1OCCH 2XGXA 3QU6A 3S3NA 1XGMA 1RNLA 4EJUA 3KLNA 2WA4A 3ZN6B 1WKMA 4OULA 1WJEA 3OGJA 2M87A 4P9IA 1TC3C 1MH4A 2QLZA 2HOAA 5IVFA 5C9AB 1AWCA 4BQ5A 1JZ7A 2VAUA 5HS7A 3IHUA 1MMNA 1JBCA 3CF2A 2UWCA 4PI0A 1ETOA 4FQZA 2CU5A 3T2PA 1N25A 3FZVA 1YLFA 3KFWX 2LROA 3JSPA 1Y0UA 4XF0A 4DBQA 4FSJA 1DU0A 2WIIB 1IRFA 1HV1A 4D7MA 1RZ4A 3WTYC 5LBEA 1N3OA 1VBE2 1UF2C 3UGGA 3HQUA 9ANTA 3NWSA 1DDNA 5CKQA 3NAPA 1FYKA 4IX7A 3IM0A 4PI2A 3WNLA 2BFUL 4LHNA 2K9MA 4KT6A 3S1QJ 3OF1A 2FE3A 4MIMA 2XH6A 3ZFGB 4C3HJ 2K0GA 1ZAOA 3LDBA 3WQBA 2VL4A 3ZSEA 1IS5A 4BCUA 3AX4A 4IL6C 1B09A 1MACA 3ZRGA 4NJ4A 3AP9A 2G9GA 3T8TA 4IE7A 3ZYIB 5F37A 1CZTA 4N9IA 5BNNA 5JSOA 2HWC3 3VBSB 4XIOA 3RS6A 2ELJA 3RZZA 3TO7A 1XC6A 4A0YA 4S2DA 3CO7C 5HI0A 5IWFA 1TT5B 5DUIA 1ETKA 3I71A 3TQNA 4MFDA 2JG9C 4O9GA 2DMPA 1U12A 2F6BA 2DYSH 4CGZA 2W52A 2DU0A 3OJBA 2K9LA 1Z1DA 4LHLA 2WABA 3HTSB 1U78A 2M1BA 5F0CA 2X5IA 5DCMA 2ZMEC 4B4RA 4MYEA 5C3RA 4QDRA 4QXBA 1S2KA 5BNNB 3WP6A 2F5EA 3J7LA 3NMBA 2ZCWA 2GQQA 2CV6A 5LHHA 3KVAA 5FYVA 2L7FP 3KE2A 4NN0A 1D0XA 3RZKA 2ADUA 3ENRA 5M5WJ 2E36A 2P5KA 2W82A 4BY7J 3EYIA 2F2EA 4V2WA 4BJ6C 1JYIA 4CCMA 4DY5A 2HWC2 2N8GA 1Y4WA 2PQSA 3D1NI 2MEV3 1QVUA 4XORA 5J8CA 2IRFG 1PVC1 2H94A 2ZX2A 4DJAA 1H9GA 3ZCOA 4I3PA 4MGSA 2A75A 1UMHA 4MVTA 2K9ZA 2B9SA 4FTHA 2L4MA 3LQQA 2VPVA 4IXAA 3POEA 1A34A 1UOBA 5DABA 3E5XA 3W59A 5HS8A 2A05A 2AH2A 2BQPA 2GNDA 1S8NA 2JJ7A 4AEDA 2PHRA 1IN6A 1RUG3 3S57A 4BDZA 2WLQA 4A3DJ 1BR2A 4KWLA 1IDZA 2Y9YA 1GMMA 1ZRFA 2KA3A 4XVHA 5CPRB 4XTMA 1COV1 4OHXA 3LPFA 2RNGA 3WU1B 3L2YA 3AKRA 3MW3A 1Y1WJ 3IH2A 2J1AA 4ZH4F 4NMIA 2VMHA 2KZGA 1FBSA 4FTSA 1I3HA 1HB2A 4GA9A 2QM3A 2EZKA 1ZQ3P 2EA7A 3ZYRA 2K9NA 1Y8QB 3BY6A 4ZC3A 1S4CA 4FAGA 4P14A 4PIXA 3AJZA 4O5VA 1TME3 3A4UA 4HX7A 4QGLA 2Q4SA 3JBG2 2V1XA 1WJBA 2LDUA 3ZXSA 1GOGA 3WF1A 1ND2B 2OPWA 3KCYA 4MSVA 3WDVA 3H3VK 1Y3TA 3VHOA 2FF4A 3AKZA 1EKEA 5J1YA 4V1PA 4QU1A 4YVSB 3DBLB 5FZEA 1DGWA 1SEFA 3LSKA 5C5TA 1W36C 3WHBA 2ZEXA 3A2KA 3MHZA 5E8AA 1QGLA 2R4GA 1BI3A 1SFNA 1D3YA 1G3SA 2WO3A 3LEGA 2FX0A 3RMYA 3LFIA 3T08A 4MGRA 2E60A 1RPWA 1MKMA 5HVQC 5EFUA 1E2XA 2AGSA 1WD3A 1C8M1 3PHMA 1X50A 2VQ0A 1U9NA 1AXKA 1B8IB 5IK5A 1OUSA 1EH6A 1W8WA 4WM7A 4X6RB 5L7OB 3TGNA 4IHSA 1PK6B 3LAGA 3VD9A 2OV7A 2ZGMA 1QRYA 3F8CA 3W5NA 4LO6B 4COYA 5A3LA 4RQPC 2HVQA 2RS51 4A5MA 3WP4A 3N7JA 4E8CA 2M0CA 1E5SA 4CVUA 4CEWB 4BQWA 4LBKA 1I39A 4A3FJ 2ZXWH 5KHJA 4L5EA 4HF1A 2EXIA 1JXSA 2JSCA 1I1GA 5FKMA 2E26A 4WM7B 2WQ8A 1T6BX 5B4NA 2A69F 2LY9A 3C8XA 3R6SA 4J01A 4XUPA 3CC4I 3LSTA 1GP4A 3ZXFA 1DGWY 2IUWA 4F91B 3P6BA 4BXFA 4A3EJ 4N0BA 5EWSA 1JYNA 2EJRA 3G1MA 3CDIA 3I2FA 4A0XA 3H0GJ 1RC6A 2I10A 2ZX4A 4NHKA 5L9RA 4QWNA 4QX1A 1F5JA 4KG8A 4UY8I 1DQ2A 1OT5A 5L3FA 1TQ5A 4CPBA 1RR8C 4DXTA 4C3JJ 4KT5C 2OZJA 4GULA 1H9WA 2LH9A 3M3OA 3MD2A 1TME1 2K46A 1UHMA 3GZTB 4CCLA 1VMHA 1Z7LA 3ZR8X 4XFAA 5CISA 2DPDA 3JAMK 5A32A 4D7YA 2BRTA 4Y15A 4G7ZF 2C1FA 4AR2A 2VQCA 3PFIA 1IXCA 5FQ0A 3M3CA 1DHKB 2RDQA 4CH7A 4GH4B 5IOYA 5JI6A 2R0QC 4E9KA 1QZZA 2YSRA 5EV7A 3DLLF 5F0FA 5ICEA 3I4NJ 2HTSA 4DRVA 1DGRA 1KDMA 4N43B 5HDKA 3TW7A 2FCVA 3Q8CA 4IUGA 2LALA 2HNHA 1IXRC 3JRDA 2V73A 5EJ3A 2DDAA 2R7WA 2GC0A 4UFIA 2DA1A 3J7YJ 2A6WA 3S15J 4XUQA 4CU6A 3JRBA 2PEXA 1OA4A 5LASA 4ZKTB 2ZGPA 4RS5B 3PUQA 1MMSA 4ZZ8A 4QQOA 1H2KA 5D8KB 4HONA 5GZCA 3WTUC 2E53A 2AQEA 1A31A 1VQ5I 4MXWB 1EA3A 3ZM8A 5HNFA 3DN7A 5DQ0A 4IZZA 1N1SA 3DPRA 1FOWA 5HV0A 1UMIA 2IVJA 1X9PA 4L0ZB 4Q47A 4AFCA 1W6NB 3WY6A 3DYPA 5D4RA 3PQKA 5EZGA 2AUYA 3B02A 2LYCA 2ZMEA 5LY2A 1FY7A 3LFUA 1PJRA 2VUMJ 3O7OA 4P1WA 2L9VA 1KGSA 2F17A 1X7NA 3L09A 2W9XA 1NK2P 3FX3A 4D0PA 2Q8CA 1LB2A 2D6PA 2WZR1 4AIJA 3AXEA 1D0ZA 3QD6A 2HWF3 3POGA 1ULCA 4IQPA 4PBOA 1BVVA 5F6KA 4ZU5A 5LA2A 2RM22 1T98A 4OLLA 1WCSA 3L2VA 3TDUC 5A32B 1QO0D 5T5OA 4NIHA 3L7WA 3NJZA 2M2EA 1AYN1 5FO8B 3WTTC 1ZZ9A 4QAWA 3DYMA 3GNEA 1JI8A 1IGNA 2OQ6A 2Z4FA 1ZZCA 2R042 4O9EA 3PURA 4K20A 3WTSC 1C3HA 1MZEA 1IHMA 1OHFA 1TTYA 2E7QA 3A1YA 2W94A 2VZVA 5H9QA 4GB31 3HRUA 1USSA 1X1PA 1N1YA 2ZHKA 4MGTA 4GFBA 1OKOA 2CW7A 5A6XA 2HU9A 1ZYBA 4HQEA 2XBO1 1C5HA 4PJJA 5FMDA 4UBHA 3OBTA 1U0AA 3KCXA 1I6XA 4QPWA 1WZ2A 4HT1T 4XKWA 3ZKUA 3M8EA 2R6QA 2G9ZA 1L7QA 4XDQA 2ZKZA 3WUCA 1FSEA 2RS12 2DK8A 5ILSA 3ZGKA 2Y6GA 2JDUA 1FBUA 2VVDA 1Z6RA 2V72A 1QGPA 4Q4W2 2WY8Q 2FBEA 2QEXI 2PBIA 4U7DA 3DP7A 4QKFA 4P5HA 4FPFA 1NT0A 2ENRA 3QYFA 4YW1A 5FDBA 5F3GA 1FPN3 3IAM2 3W9AA 1Q3EA 1NYWA 4DRRA 2HDDA 2PHWA 4RFT0 4LLFA 2VMEA 4Q4Y2 3J8F3 2F5DA 1LU1A 3S17J 4QM9A 5E88A 4COVA 1B6AA 2NVQJ 3WZ1A 1UD1A 5FREA 1QF3A 3BT9A 5C7GA 1J9IA 4YVSA 2KRFA 4O6JA 3F21A 2DU9A 3F6OA 3RTRA 5EZWA 3NNFA 4ZDOA 2STTA 4D94A 1NH3A 2ZXQA 1ODDA 4PZJA 4FPLA 3VYSB 1DQ1A 1JODA 2J1RA 1SAUA 2DJIA 2VQGA 2OZUA 3PO3J 1DZRA 4YZ1A 2VMCA 4P5OA 5FBZA 2XAJA 4DY3A 5HS9A 1GDTA 3LFMA 3O0WA 4B47A 5E89A 3TMOA 1F4AA 2JENA 4ABZA 2QBYB 3GALA 1COV3 4ZYGA 2KRCA 2B63J 2D6NA 4ZXKA 5JHUA 4MTDA 4DGWB 4J6GA 1K83J 3SEZA 2JEMA 4CP0A 2D93A 1VQMI 4LBJA 4AHXA 3A7QA 4HNVA 2VZUA 4HQMA 1LEAA 4AI0A 3LZZA 3RFRA 5EG0B 1IQDC 2B46X 2JB8A 4Z2YA 4D7SA 3L2CA 4R8HA 2JZYA 4I30A 4COZA 3OYEA 4CDQC 3AC0A 2ET7A 3UKGA 3ACLA 1MQTA 2DLLA 4DINB 4NWVA 3MBWA 1D8KA 2EFPA 4IHWA 1N78A 1ND3B 5EJCA 4LO7A 3HR9A 1VF9A 3RZLA 1ZR4A 3ZSJA 3ETPA 4XFCA 4CYCA 1D5YA 2VKHA 4XJAA 4JHTA 1SFUA 1S0DA 2MC4A 3SH3A 1S7EA 1OCZH 4QQHA 2VZOA 5KCMA 2W47A 2OC6A 3A0KA 2IFRA 2OQ7A 3O8GA 3REOA 1V9U1 4XIKA 1PVEA 3CCMI 5CB7A 3MLKA 1HF0A 2ZZJA 2OS2A 2CQNA 2W4SA 5CFCA 4NBQA 3B73A 1OVPA 2WINB 2XAHA 2UURA 2CRGA 4S2HA 4IE4A 3P5JA 2RDSA 3WXPA 1W03A 1TNTA 1C8M3 2XB5A 4A3GJ 5JZGA 4GWNA 1IV6A 2QBXA 2QQOA 1YUDA 1FNNA 1UPIA 3CCRI 1QJY1 4CCJA 4F52A 1ASJ1 3WP3A 2I07B 2XGDA 4B7EA 2JX9A 2BY1A 3GF2A 2X10A 4YVWA 3K4NA 1Q8VA 3KMHA 3GBGA 1H1MA 1EH7A 2TEPA 4Q2FA 1NLQA 5FZLA 2Q8KA 4CXXA 3E1SA 3K4BA 3RQ0A 1QJZA 1VALA 1SFYA 1LDKB 4QPGA 3D5OA 3OY8A 3G3ZA 5H2FC 3NEUA 4XAAA 3KEYA 1U5XA 2ZJQF 2F5VA 4YGDA 4ANJA 5BNQA 5F5IA 1MBFA 5IYYA 5LGTA 1EY2A 4XW3A 1QA6A 5F1RA 1DPRA 4W50A 4UVCA 2UYAA 5FMOL 4IXLA 3AG2H 3KETA 1VBC2 5C3EJ 2BXYA 2QGUA 2HOEA 3GX4X 2PXJA 3H50A 2LY2A 2P6SA 4FE7A 2JTVA