2GZWA

Crystal structure of the e.coli crp-camp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
200
structure length
200
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of activated CRP protein from E coli
rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 63
structure length 200
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gzwA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gzwA01
2YSRA 3CLOA 1FP1D 3H92A 3UKTA 2L01A 5FQ0A 3ABUA 2EV6A 4K2EA 1HBXG 4BIFA 1T2KA 5JR7B 2IA0A 1QZZA 4YG2F 1TQ5A 2Z69A 2XAQA 1USTA 3EDPA 3VFZA 4CGZA 4G6QA 1G3YA 3CL1A 5E17F 2CFXA 2P5LC 1QBJA 5K5RA 3FX3A 1AOYA 2VT2A 1WGPA 3Q9SA 1R22A 3BB6A 5EZWA 3H3UA 3D0SA 3JTHA 2BYVE 4CICA 3F22A 4EGYA 5KHJA 2RGVA 1ZN2A 3O3KA 1S29A 3H1YA 3E5QA 4RGXA 3IRQA 3M7GA 1PM7A 3LWCA 1H0MA 3KFWX 3GFMA 3BOQA 3MDPA 3VOEA 4MX3A 5FLXZ 3CTAA 4LLGF 3G7DA 5FCCA 1QO0D 3RKWA 4QGLA 4LULA 4OMZA 5I0RA 2ACJA 1OI6A 3LSTA 1SQ4A 4O6JA 1XGSA 5D4RA 1EH6A 1Z1DA 1F5TA 5T3NA 2PQQA 3H7YA 4XETA 1ZGAA 3T5XA 3HOSA 2Z99A 3O6BB 2O61A 3J80Z 3E6CC 4I02A 4YRDA 2FRHA 3MEXA 4IVNA 4KWJA 1YQAA 2P17A 5LRRA 1I1GA 4U0WA 1ZAOA 5DCMA 4OMYA 1O3TA 2G7UA 2PG4A 3KP4A 1DUXC 1D5VA 2PHDA 3QP5A 3D82A 1HSJA 2O8XA 3M3IA 3WU0A 3S7IA 3KZYA 4LTAA 3VHRA 1P4AA 4KUMA 2EV0A 1UB9A 4PGHA 4PIYA 1X8MA 1NHAA 3J81Z 4LA3A 1OYYA 3V8JA 3GFIA 3RPUA 1W7PA 4LA2A 4FX0A 1WRJA 4G6DA 4EJTA 2BV6A 3I7DA 3NQOA 4BAYA 3N97A 4PIXA 1GXQA 3FXRA 3FFQA 4L2NA 3K9TA 4OIOF 1X7NA 4MQ9F 4LLOA 2D93A 3ST7A 2CQKA 1HW1A 4DNCA 1PP7U 3E6MA 1REPC 2PFWA 4P9GA 2QLZA 3I4PA 5DD4A 1V4RA 1IN5A 1L0OC 3F8MA 4EM1A 2M1BA 3H3ZA 4QMAA 1MDMA 1UIKA 5CLSA 5BPDA 4WZCA 4ZZDA 3OGJA 2DPDA 4KN7X 2XUBA 3WW1A 1I5ZA 1KQ0A 2STTA 3KP6A 2ZMEB 3J80K 5BY5A 4RGRA 3RPQA 2FQPA 1LR5A 2Z2SB 4A0XA 3SCGA 1XMKA 2PAKA 4MZUA 3IL2A 3DV8A 3COAC 4A0ZA 3KCCA 4EWEA 3KSCA 4KWKA 3I58A 3O2PE 2V9VA 1Z6RA 1R00A 2VE9A 2B5HA 3B02A 1BJAA 3MAJA 2Z3YA 1JE8A 4HYEA 1ON1A 1BC7C 3SMHA 4IRGA 4L9JA 1RGSA 1HSTA 3OCPA 3K0LA 2LKPA 3EETA 3V8LA 2UZKA 3LA7A 3IDCB 1DDNA 5DUKA 1SD6A 1OFNA 2DI3A 2KIFA 4WX9A 2CGPA 2EK5A 1I27A 3U9GA 5EFUA 3UKVA 2QWWA 2BNOA 5HLIA 1TW3A 2KJBA 3R4KA 3BCWA 4RD7A 2EFOA 1YYVA 2WC2A 4I0BA 1SEFA 2BNMA 4HF1A 2UY8A 2OAZA 5D5VB 4MV2A 1FPQA 2V79A 4XLNF 2MD5A 4ZH4F 2ZJ2A 3NVCA 2IA1A 3RJPA 1UW8A 1RTVA 3DEUA 4CYDA 1FYMA 2DU9A 5BMZA 2BNNA 4G7HF 1RC6A 2OPKA 1CAWB 3CO2A 5D5XB 5H20A 2KXLA 1TQMA 3KP3A 2K86A 1ZZ6A 4YIFA 4MGYE 3EQLF 1FBUA 2PN6A 2HWVA 4ENKA 4ZU7A 2VBWA 5HDNA 2LSOA 4L9NA 1B9MA 4LLNA 2K0GA 2H6BA 2FF4A 2O3FA 4RS8A 4LD5A 4D7TA 4KIBA 2ETEA 3MCZA 4M9SA 1O7FA 1FBQA 2YU3A 2IPQX 5J48A 2GWRA 2WWYA 2H09A 4ZU4A 1O5UA 2OBPA 2RVCA 3ETQA 3M8EA 4EGZA 2FXAA 2P6TA 1V3FA 3L9FA 1UPIA 2MBFA 1RIOH 3RI4A 1B9NA 1R36A 1S7AA 5H6RA 4UNOA 4EQQA 3GF2A 1D8KA 1Z7UA 4IXAA 2R3SA 1EV7A 5LBQA 2GIVA 4UXAA 4GCVA 1S7OA 3FMSA 2QDRA 3C3WA 4KT5C 2MLGA 1J75A 3BPVA 3GLXA 1IPJA 1A04A 3ZQ7A 3BU7A 2I45A 4LEJA 1LQ1A 1MDMB 1CGPA 1ZNPA 3FZ3A 1W5TA 4XSZF 1YLLA 3JZVA 2OA4A 5EEGA 2MPFA 3R60A 1FOKA 5DUIA 2R7FA 3BY6A 2Q8KA 1DGWA 2OU2A 2XLGA 4QGNA 4CO8A 3F8FA 1ZRCA 4XFFA 2L02A 2OQRA 1G4DA 4QX5A 1W4MA 3L09A 3EUHA 5I93A 4LG0B 1ZVFA 2B9UA 3NEUA 1S6LA 4OLLA 3BWGA 2COMA 1YO5C 2KRFA 4FBFA 4R52A 4P9FA 4MHGA 1KU7A 1J9IA 4AIKA 2YR2A 2F5EA 1J7KA 2Y48A 1F9NA 1QZYA 2K4JA 4GXOA 4KNYA 1T6SA 1W5SA 1USSA 5CADA 3ES1A 3LZZA 2JSCA 2PAMA 2A61A 5ERIA 3Q9VA 4M72A 1SAXA 2B8MA 4XF1A 3NKTA 5I0TA 3EJKA 3LAGA 3K1PA 3C1DA 3I59A 1S8NA 1H1MA 2XL9A 4TV7A 3F8BA 5DCFA 5HDGA 3GXOA 4RGSA 1ONVA 1XMAA 4LMYA 4XLPF 1D3YA 3BDDA 3E6DA 1J3QA 2O6GE 2HYFA 4ESJA 2DT5A 2HJIA 5D5UB 1K79A 3LQQA 2WFPA 1G3WA 4L5JA 2P5VA 4XFAA 4IPAA 1HQCA 4MTDA 4HN0A 1W7PD 3F23A 3F21A 3SXYA 5CU1A 2LDUA 1P4WA 2EFWA 4OINF 1BC8C 1GXPA 2F5DA 2V1XA 4KWLA 1JHHA 4R1HA 1ZYRF 3CUQB 1I1SA 2K4BA 2FSWA 4XFGA 5ILVA 4HDUA 1T39A 5LEJA 5LGTA 3ZN0A 2KIUA 3GBFA 2DK5A 1TW2A 3D0JA 3HUGA 1JHFA 4ORFA 5KHKA 4L18B 1WA4A 2IJLA 2UXNA 2IXLA 1VR3A 2PFBA 2Q1ZB 2BE5F 3HT2A 4Q0SA 1X8EA 4AVAA 1YUDA 2PHLA 2QQAA 2G7HA 2PAEA 2DCTA 1R23A 2F5CA 2O03A 3IKTA 1HKSA 3T8RA 1U5TC 4ONUA 2FEZA 3I59B 4EJWA 3WE2A 1BIAA 3BPZA 3IKVA 5KVRA 4KDPA 4QXKA 2CWEA 1R1TA 3L7WA 2ZMEA 3DQVC 4EM2A 3DL3A 5K5OA 5D6FA 2V1DA 3GFJA 4E2SA 1BI2A 3FMRA 2NNYA 4WCGA 4KMFA 1SD5A 1HW5A 2A6HF 1RI7A 4D0PA 1NYWA 2GXBA 1ON2A 4ZYEA 3GZ5A 1ZZ9A 1XGNA 4HVRA 5F6FA 3FHIB 3TOBA 1YLFA 4BHCA 3NL1A 4YYOA 1Y0UA 2HKOA 1XSDA 3LAPA 2GA1A 3WODF 2ATFA 2UYAA 3DF8A 1ZHFA 2XROA 3U2RA 2L54A 4KU8A 3WGGA 2XLFA 3I64A 4PZJA 3CJNA 1FNNA 1UHWA 4XRFA 4HV5A 2MH2A 1U5TA 5FFZA 5BPIA 2D40A 3FHZA 3MWMA 4UUVA 2D5FA 1EH8A 4H0EA 4A6DA 4Q48A 4IETA 4IEWA 2E1NA 4N0BA 3HOTA 3BROA 1HXDA 5HS9A 3ZMVA 3CLPA 2XKPA 5DEQA 4ENNA 3G3ZA 2JT1A 4LUMA 2DTRA 4EROA 2Z5UA 1SFXA 1KYWA 3KP5A 1RL3A 2LNBA 4Y13A 1Q5OA 2Z9OA 1GQGA 4E2GA 4M6XA 4NB5A 2A5YB 3P9KA 4UBGA 3ZP5A 2QM3A 5I0UA 2XV4S 4XF4A 3L2HA 1ZLKA 2QJVA 1JGSA 1XB4A 4EMSA 3KP7A 5HI0A 4LJZF 1R58A 3IIAA 3WW4A 1NE4A 5FFXA 3ZN1A 1CAUB 1CF7B 4KMUX 1FZPB 3CUQA 3WU1B 3E3VA 4L5IA 3DFGA 5BOXA 2HYGD 4EJUA 4ON0A 2VECA 1R7JA 4Q4ZF 4KA4A 3ML6A 2UY9A 1U78A 2M5WA 2HQRA 4RAYA 4BH9A 3HYIA 3RDIA 1Z91A 5ICCA 1LNWA 1T0FA 1OPCA 1BM9A 5JCTA 1PUEE 4M9XA 2VC1A 1X3UA 2IP2A 2YPRA 3HSRA 4I0AA 3QU3A 1LB2A 4IEXA 2A69F 3EYYA 1K78B 4BNCA 2GQQA 2F4PA 3JTGA 3DXJF 1CAWA 3TO9A 5L3CA 5FLXK 1O3RA 3HHGA 4YARA 2XAJA 3DPLC 1B6AA 4HOBA 3WGHA 5CVRA 3QOPA 2IC1A 2CSOA 3ZMDA 1Y9QA 5HDKA 5JFRA 4I09A 2EA7A 1J5YA 2IXJA 4TLFA 4N9HA 2CAVA 4U0YA 3OTFA 4RAZA 4P5OA 4XBFA 4I01A 3FM5A 1YFXA 1KU2A 1YW9A 1BI3A 2QUFA 2EFQA 1IPKA 2OYZA 2D45A 5FPZA 4MH0E 1STZA 4YIIA 3RNSA 2L4MA 3KGZA 4Y15A 5HVQC 1NXMA 4GO1A 4I7HA 3MZHA 4YFXF 1KQ9A 2ET7A 4Z2YA 4CZZA 3EO6A 4XF0A 1U5TB 4A5NA 2HOEA 4I3PA 2H94A 3ROUA 4LLLA 2V1UA 3Q5FA 3WG9A 1Q3EA 5L3DA 1H9TA 5ED4A 3F8NA 2MLKA 2XASA 1Z05A 3GEZA 2K02A 2W25A 3KEOA 5FQ0B 4IHTA 3QPTA 1J59A 2FE3A 5CVJA 2HGCA 4DINB 2YX7A 3BP8A 1HKQA 3LWFA 2STWA 2Z33A 5J8FA 2DAOA 2QENA 2QQ9A 4UHTA 3CEWA 2DQLA 1ZG5A 1J3PA 5D4SA 3KLNA 1BI1A 3SZTA 5C8WA 1ZZ8A 5IT9K 5JSRA 3MFKA 4IEUA 1SFEA 5FLHA 1XE7A 2JPBA 4ENMA 2Q0AA 5AIPA 1XRUA 4MEYF 3N4MA 1YG2A 1LDJA 3G73A 3I53A 4B8XA 5KHHA 1ZZBA 3KLOA 4MGIE 1IN6A 1Z6TA 2RDPA 2VBXA 5D8KB 2M45A 2A07F 3WTXC 1IXSB 5JHUA 1QXRA 4OFGA 2E7XA 3ERED 4FT8A 3V8KA 2W84A 4IF4A 4Z82A 4LK0F 5KBFA 3FE5A 1B59A 3LA3A 4NQWA 1K6OA 3TOAA 4AD9A 2FA5A 4NVPA 2N7GA 4FHTA 4HX8A 4A6EA 5LGUA 1ZREA 4U7BA 4CHUA 2BBYA 2RV8A 3WE3A 4F8AA 2E7WA 1YTYA 4AIHA 4OIRF 3BJOA 5JSPA 1ZG1A 5KHGA 2D5HA 3W6JB 3R0JA 2XVCA 3SZPA 1IXRC 3FZVA 1ZGJA 4LUKA 3HIFA 4I2OA 5ILSA 4CXFA 3DP7A 4JTNA 5LLQA 1XGMA 3ELNA 2W24A 4HLTA 3LOIA 3CUOA 5I91A 3V7CA 1G3TA 1U2WA 4PGGA 1EY2A 4QLCU 2KKOA 3SQNA 1XGOA 4GYGA 1GVJA 3LAJA 1J0RA 4L9VA 1TLHB 4WXDA 1U3EM 4FX4A 5L3GA 3WTTC 1H9GA 6PAXA 2BEOA 1D8JA 3RTRA 2Q0OA 2PA7A 2XAGA 3ECHA 4KN4X 4HN1A 2DBBA 2DLLA 2K27A 5HOOA 5HLHA 1WQ2A 4S05A 4LB6B 4HW0A 3I54A 2VE8A 4JQFA 4UVBA 2ZKZA 1WKMA 2JZYA 5E16A 2ELHA 2FBHA 3F6OA 3E97A 3RYPA 3MZYA 2QVOA 1OR7A 2PEXA 1CAXB 3VODA 1TQIA 4WVZA 1G3SA 2FBKA 2UWMA 2ZCWA 1UCXA 3WTSC 2D1HA 3MPBA 2G9WA 1KA8A 2NS0A 1YFWA 1QGPA 3GUDA 3CO7C 1Z9CA 2GXGA 2EAAA 2UXXA 1EYBA 1Q43A 1FBSA 3SHFA 5E8IA 3R6SA 1RNLA 4PCQA 4HLYA 5ILUA 4XFCA 2VONA 3RIRA 1L3LA 1S3JA 4HZFA 5E8GA 1ZARA 4QWQA 1O3SA 4IEOA 4A0YA 2EWNA 4O3MA 4K8FA 4HLXA 3T0YA 1XDSA 5TJJA 2GA2A 1UCRA 3ELKA 2OZJA 4MUVA 4UVCA 3WW3A 3LFKA 3D5LA 1B4AA 2XGXA 4R79A 4B29A 1BIBA 2QNKA 1QY4A 1GQHA 2FOKA 2P4WA 1RUNA 1IUYA 4HBLA 5BS6A 3UKNA 4Q0QA 4QM8A 4IEQA 2GZWA 4WF2A 2ISZA 3FF5A 4A5MA 3C18A 4GGGA 1MD0A 5F1RA 3P9CA 4KIGA 4KIFA 3AAFA 2P7CB 4BQAA 5HS8A 4M74A 5D6EA 1ZZ7A 4LK1F 3QAHA 4KFCA 3JAMK 1G6NA 2V09A 4XSXF 2H27A 4YFKF 4P9UA 3T1BA 1SMTA 2VC0A 1MZBA 1LDKB 3T8TA 3QPHA 4BHPA 5D8LB 1MJ9A 4ENJA 4E2QA 3HQXA 3WTWC 2L3DA 3SXWA 2NYXA 2P5KA 4WBBA 5ICEA 1TBXA 4JTOA 3U0ZA 4AQ6A 2KIMA 1IRFA 1FYLA 3U10A 4R8HA 2HR3A 5K8SA 4Y17A 2VT3A 2QQBA 1KU9A 4ESBA 2HDCA 2RC4A 4LB5A 1MJAA 3J7AO 1FX7A 5AONA 3H1MA 3BJAA 3P7NA 4XFHA 2PQ8A 4G9YA 3OV8A 1U12A 4D7SA 3HRMA 2RQPA 2HFHA 1XN7A 2DO7A 4L9TA 2GH2A 3B73A 3TNQA 4GULA 5AVPA 2NAZA 3M1EA 4ESFA 1YS7A 3ISPA 4BHBA 1IW7F 4LFUA 2XKOA 4KICA 3C3VA 1AWCA 4YNIA 1OD5A 2R7DA 3KETA 4GYIA 4IEYA 1TNTA 3TGNA 2E1CA 3PLQA 4AIJA 2Q2EA 4MGKE 1SMYF 5FD6A 2GAUA 1SD7A 4X6RB 2VODA 2EFNA 1BBYA 4PJYA 3MYXA 1ODDA 2DK8A 5KK1A 5FLJA 4ZZLA 2IVMA 3USSA 2TDXA 4HX4A 3E5XA 2VQAA 3FJSA 3WTUC 2Q4SA 4HAMA 2RN7A 2YX4A 2A6EF 4PDKA 1WWXA 4XFBA 1YW8A 1E17A 2PYTA 5KHIA 1XCBA 5E1ZB 1DPUA 3IRRA 5A2QZ 5I8YA 3ZMSA 2MC3A 2ISYA 1QPMA 2OZUA 1UHMA 3WTYC 4OIPF 1XDUA 3GX4X 2XIGA 3P9IA 4G8XA 4RB1A 2QZ8A 4G7OF 2PBIA 4HA8A 4IESA 2XL7A 2IXIA 3RKYA 2D2WA 4F7ZA 4ZYGA 4J1WA 5FDBA 2CG4A 4RB3C 3BALA 1ZLJA 4BYYA 3E6BA 5FPXA 1XD7A 2VXZA 1VJ2A 1EPZA 3QACA 3PNAA 1F4KA 2E9QA 2AXLA 1P4XA 3BPXA 2VOPA 3RKXA 4AQ2A 3GWZA 2CV6A 3H1WA 1ZZCA 4EJVA 4Q5SF 3ES4A 4RGUA 4P55A 4E70A 4OU0A 1FWZA 3C7JA 5E18F 2F5FA 2WV0A 3HSEA 2ZNZA 3ZDSA 2VOOA 3DPTA 3GYHX 2XHKA 1UIJA 3L2CA 3PQJA 1MJBA 1IN8A 2WTEA 2FBIA 3FM3A 4EM0B 4FAGA 2IXKA 5L3BA 4FAHA 3GZ6A 3ZPLA 4XF3A 1U6GA 3SHRA 3O14A 1LEAA 3W6KB 5JVTA 1CAXA 3S2WA 1XSXA 2GU9A 3NJZA 1K7AA 2A3SA 2ET1A 4KU7A 3ZMUA 5E20A 3JW4A 5LEKA 2X4HA 2W57A 1MGTA 4KL1A 3EYIA 4IEPA 1FYKA 1OYWA 5CYVA 3IDBB 4Q47A 4MGRA 4J1XA 4ASNA 4M9ZA 4XEZA 3HSFA 2QBYB 4HDVA 3ACLA 1UD1A 1LDDA 2JRTA 4H7LA 3TKYA 2EA4A 2HQNA 2ZO4A 1CF7A 2H0VA 3TDZC 1KU3A 1FP2A 5K5QA 4JV4A 5FGMA 4QGMA 3PVBB 2HEOA 4AVPA 3U1DA 3H50A 2J5OA 4MEXF 2IA2A 2ESHA 2QYOA 5K1YA 5I8TA 1WI9A 4ZYDA 1F1ZA 1BN5A 3GVAA 4ZU5A 3FMQA 2MH9A 4UV9A 3NRVA 5DDGA 3I0TA 2M8EA 3GFLA 5E1XA 1JXSA 2VBYA 2F2EA 2FMYA 4B09A 1PMIA 3KGLA 3HTUA 4IERA 4OIQF 4WXCA 5E1WA 3WTVC 5I8SA 5JAXA 4M71A 3TDUC 4G94A 1TNSA 4RB0A 3QP6A 1P6RA 4JVAA 5J8CA 4WWCA 1SFNA 3MQ0A 4YFNF 3TO7A 2XAHA 5L3FA 3I71A 4Q0VA 4HMZA 3K1MA 4I98B 4HX7A 2VPVA 1DP7P 1YFHA 2MA3A 3K2ZA 1ZG3A 1XCVA 3M9AA 5DD8A 3REOA 3RYRA 4U7DA 2QCSB 4S04A 1KQ8A 5TRDA 1LKNA 1R5GA 5ICGA 5J6XA 2RNJA 5J7MA 3BZ6A 2VN2A 3GW2A 4M6YA 3HHHA 2P7VB 3SCFA 5AIQA 2MNGA 2JPCA 3V7RA 1P92A 1IN4A 3QU6A 3HTSB 2M30A 5E1RA 2PJPA 2CYYA 4ZYHA 4IHSA 2LF8A 3K1NA 3K69A 2PI0A 2CAUA 2M87A 4MQVA 2K9ZA 1PDNC 3EQEA 2RKHA 3ZMZA 5I0SA 5CVVA 2GC3A 3ZMTA 2ADUA 2PLYA 1ZX5A 3HT1A 4UV8A 4Q29A 2IRFG 2W85A 2EA2A 4AVCA 1P2FA 4WK8F 5BV6A 1BI0A 2ZNYA 3WGIA 4HQEA 5FLIA 4HSJA 3OOPA 2HTJA 3V7SA 1RUOA 5J3UA 1VP6A 2QBYA 1I6XA 3HRUA 1YFYA 1R1UA 4Q0PA 4AXOA 1YWKA 5C6CA 1FSEA 1NZCA 2CO5A 5EEHA 4EWDA 5LHGA 4EVIA 3F72A 3FXQA 3ECOA 4LGWA 2IW5A 3FWEA 3JSOA 2NNNA 1R1VA 2L4AA 3L00A 1CAVA 1J2XA 2IXHA 1IAWA 2O0YA 1FXZA 3VB2A 1Y3TA 5DYMA 1DZTA 4IEVA 2X0LA 1DZRA 2DW4A 1KYZA 3ABTA 4L11A 5FB2A 4IRHA 5BXXA 1FT9A 5CVUA 4RB2C 3F6VA 5IT9Z 3S0MA 3H9AA 1YFUA 4IEZA 4JBAA 3NSTA 1IRGA 3TNPB 2FNAA 2LF7A 2P6SA 3QRFF 2Y75A 3EHKA 5F64A 3S7EA 3I5UA 2ZKLA 3R0AA 4O9EA 2AS5F 1FY7A 1SD4A 4P96A 4X6QB 3H8UA 1FI2A 1QQIA 5IT3A 1IF1A 2DQRA 4O9GA 2C0ZA 1O57A 4HV6A 4U88A 3CF6E 2HKXA 4G7ZF 1U8RA 2FQ3A 2EV5A 2DPUA 2H6CA 4HSLA 3SCHA 3ULQB 1J1LA 2XAFA 1CAUA 1ULYA 1LRHA 1XE8A 1JUHA 4M73A 5LGNA 1TTYA 4MTEA 2OA2A 2O1QA 4WXHA 4PIZA 2J5PA 1BOAA 2EFPA 3CUQC 4UVAA 2HS5A 3V4GA 1QNTA 1VTNC 4BXUA 5H6QA 2NRAC 2JTVA 5D5WB 4XF9A 2O8QA 5LHHA 3LQRA 2VBZA 2ZBKA 1O7LA 3KE2A 4O5VA 1NE6A 2UYBA 2KJCA 3R61A 3OD0A 4ETSA 3HRSA 4JK1X 2IT0A 4A2UA 1HKTA 2PMUA 1RZ4A 1ZRFA 2BGCA 4XFIA 2ESNA 5BPXA 3RZZA 5HS7A 3FXUA 2ETHA 1CX4A 4L0ZB 1O3QA 3CDHA 1TQPA 4CDGA 1L3JA 5JSOA 1OKRA 2FNPA 4KYWA 3F8CA 1FSHA 1QXJA 1FLIA 2XLAA 3H7JA 4L0YB 4EJOA 2GC1A 1HW2A 2D1VA 4AWXB 5HLGA 4MGZE 2GC0A 1WSUA 2PTMA 3CJXA 3J81K 1GHCA 1YW7A 4U0VA 4MNUA 4DQ2A 1LEBA 3VEPA 5DV5A 2Y0OA 4NHJA 1X82A 3TQNA 4LG0A 3EBRA 1CAVB 4EWAA 3PFIA 2CW0F 4META 3GO5A 1T98A 3F3XA 2EVXA 2PMHA 3IBMA 3M8FA 1H1IA 2OZ6A 3LA2A 4A12A 3IC7A 3OF1A 4IRIA 3WTZA 3KP2A 1SFUA 1YIOA 2B0LA 2FU4A 2P8TA 1OMIA 2A68F 4UXNA 4HQMA 1DPRA 1T38A 2FMLA 2OQGA 5FD5A 1QWRA 5D1IA 2OD5A 3PQKA 1EP0A 2ZXJA 4Z07A 1K78A 4OOIA 4AVBA 1WLTA 2GC2A 1ZH5A 2QVSB 1IN7A 3SFZA 4HBNA 5FO5A 3TO6A 5L3EA 3IWFA 5A2QK 1KGSA 5JI6A 3WW2A 2V6CA 1IZ1A 1XSVA 5DCMB 1C0WA 4QM9A 3E5UA 1IXCA 2XRNA 1OYIA 2EJRA 4HVQA 1PP8F 2ZFWA 4N9IA 3KEQA 2Q30A 1YHFA 1UFMA 4YSFA 4HF2A 1MKMA 3DKWA 3JSPA 4IJAA 1E2XA 1ZRRA 3BJ6A 3IWZA 1B1BA 4UBHA 3GYDA 1Q1HA 3HRTA 2HTSA 3IHUA 2C6YA 2K7LA 3RYKA 1W7PB 3JAMZ 3DN7A 2DFIA 3KMHA 2IXCA 5CVIA 1R5HA 5CJ9A 1V70A 1YS6A 4HF0A 4EV0A 5BQTA 4Q0UA 1EH7A 3U11A 1J58A 1LVAA 2MHFA 4HVOA 1O5LA 3KZZA 2HZTA 5LRSA 1DGRA 3M70A 1O4TA 5LHIA 5BUVA 5ICFA 1FC3A 2EB7A 1LJ9A 3CO6C 3NW4A 2Y0MA 1ZRDA 1J3RA 5JR3A
chains in the Genus database with same CATH superfamily
2Q8DA 2WZEA 4XUTA 1OD3A 2Q8CA 1BYHA 3RS6A 2KMUA 3CC7I 1QH6A 2L01A 3C7GA 1HBXG 4BIFA 1T2KA 2ZOEB 5JR7B 2IA0A 3IP4B 4X1EA 2J1VA 2XAQA 1OLRA 1FNZA 4FO9A 3VFZA 1BEV3 1G3YA 3GZAA 3V42A 3O8HA 1Y1VJ 3I56I 4IV3C 4I30A 1QBJA 1W03A 3FX3A 1WGPA 3VGIA 1R22A 3H3UA 1YQCA 3IB3A 5KHJA 3H1YA 4RGXA 4P9YA 1YOVB 3KFWX 3I2HA 1HLCA 5FXWA 2E71A 4M3BA 4LBQA 3QCWA 4G6TB 4QPYA 3VOEA 4MX3A 4AI8A 2HQAA 1RVF1 4PJJA 4G3YC 3G7DA 1UELB 3LEMA 4BJ0A 3VBFA 1MH3A 3UJOA 2CV0A 4LULA 5I0RA 5C70A 1RUD1 2ACJA 3LSTA 1SQ4A 4XRSG 4LR4A 1AU7A 1F5TA 5T3NA 2VMEA 4HANA 3BR3A 2Q1FA 4NAMA 5JOWA 4EZHA 1ZGAA 3T5XA 4QKFA 1QXPA 3J80Z 4JX5A 4IHWA 3B94A 3VBFC 3O7OA 5DN2A 4KWJA 1YQAA 5LRRA 2CV2A 1Z0HA 1WCSA 1ZAOA 2OCCH 5DCMA 4B7EA 2G7UA 4XQDA 3H5NA 3KP4A 2PHDA 1NH3A 2O8XA 3I2GA 1YNAA 1P4AA 4KUMA 2YGMA 2EV0A 1QHHD 3D5SC 3WLUA 1WJEA 3IAS2 4LA3A 5K7PA 5FZ8A 1FOYA 1TEIA 5D21A 4LLFA 2VE1A 2QQKA 3OS2A 4LA2A 4FX0A 2LOOA 2IEKA 5D8AC 3N97A 3LMMA 2YU9J 3FXRA 2C5DA 2WJSA 3ZFFB 4M3FA 4UUSB 3SNMA 2D93A 1HW1A 4BLJA 1PP7U 3MBWA 3FHNA 3I4PA 5DD4A 1BW5A 2M1BA 1MDMA 4WZCA 2ZKNA 2DPDA 3OGJA 3JREA 4LXLA 4OMCA 1I5ZA 1KQ0A 2STTA 1MBKA 2WAFA 4RGRA 3RPQA 3CCQI 4A0XA 3BVCA 1XMKA 4Q27A 2VZPA 4GWJA 2PX9A 2JJ7A 2Z79A 3COAC 4XC9A 5CQGA 1VRBA 3KSCA 2BY3A 3I58A 3GTKJ 3ZFGA 5FV3A 3GF6A 1XNKA 2V9VA 2WYFA 1LEMA 5GLZA 1Z6RA 1AKHB 4RAFA 5F5IA 2VZ1A 3AG4H 2Z3YA 5FZDA 4M0NA 3DEWA 1BC7C 4IRGA 1RGSA 5T54A 3VBOB 2LKPA 2XUEA 3V8LA 2UZKA 3IDCB 1J84A 4WX9A 2KIFA 2CGPA 1Y7BA 1W0OA 4BKXA 1JHJA 1PVC3 5HLIA 1TW3A 2KJBA 1O59A 2FDIA 4PBPA 3R4KA 3K75B 3IN9A 2VU9A 5FMBA 2IBDA 1YYVA 2WC2A 1UYZA 4I0BA 2CUFA 2XJUA 2OX0A 5JOZA 5H9RA 3WHUA 4PDWC 5D5VB 3RI8A 1FPQA 2HBUA 1O8PA 3Q3SA 2IA1A 3L2YA 2ZEZA 4NQWB 1RTVA 3JB4C 2DUPA 4CYDA 1ENSA 1H8TC 3TB0A 4URAA 3KEYA 3HJEA 2XF7A 3OYNA 1CAWB 3CO2A 2XDVA 1TQMA 2W82A 1WCMJ 4MGYE 3EQLF 2YFZA 2CQQA 5GZCA 5JLXA 2VR4A 2VBWA 4CEYC 3BT9A 2WABA 5IPAA 1NA1A 2H6BA 3P6BA 5EYRA 3WSOA 3IH2A 5HV0A 4M9SA 2IPQX 2J1TA 2WWYA 4E7LA 5C8CC 4ZU4A 3M8EA 4OHXA 4E7JA 2FXAA 2P6TA 2L9RA 3MUZ1 1UPIA 4FPJA 4F3JA 2QKLB 2NYYA 3M8JA 3RI4A 3N7LA 1B9NA 3N9QA 1RR7A 1R36A 3B69A 1S7AA 4LITA 1JJ8C 4QU2A 4J6GA 3OYHA 2R3SA 3AZWA 5LBQA 2D6PA 1C8M1 3BQZA 3I3MA 3FMSA 1VQ5I 5GZFA 3ZMOA 3A0NA 1VAMA 1VIWB 3RQ4A 4C3IJ 2BY1A 2TNFA 4M3GA 2TEPA 5M5WJ 4MGSA 1AR71 4OMDA 4QQPA 1CGPA 5FIXA 2ZGOA 4X8PA 3PTYA 1W2OA 3O8GA 2Q8KA 3PNVA 2XLGA 4A69C 1C3HA 1X1BA 2ZHNA 3BR0A 1GBGA 5ACA2 4CU6A 1B35B 4XFFA 4QX5A 3KF3A 1W4MA 3L09A 1YJ9I 3NEUA 1S6LA 4AVTA 3LSPA 1LOGA 1W39A 2HLEA 3M3OA 3TWIA 4BU2A 1ZRIA 4AIKA 1QJY3 3F9KA 3S16J 4JGYA 4FPYA 1AYN1 1QZYA 3HOBA 1RMU2 2ZS6B 3OYLA 4GXOA 4BXXJ 5CADA 2JSPA 2PAMA 3JU9A 4IHYA 2DOAA 1DP3A 3ZYHA 1SAXA 2QZ3A 3NKTA 5CPRB 3J7YJ 1SG3A 4GWNA 4TV7A 2XJSA 5DAXA 5FK7A 1BBT3 2ME6A 1JKRC 5DPNA 4LMYA 5C7GA 1XS9A 1MEC1 2G9ZA 3BTZA 2O6GE 1DU3D 2QKMB 3GCMA 2NVXJ 1BCXA 2HJIA 5D5UB 3LQQA 4BGDA 1G3WA 2W92A 2BU9A 3OBTA 1HQCA 3HOUJ 5FZBA 1Z3YA 3F21A 2D6NA 2LDUA 4N43B 5BNOA 1ASJ1 5CNAA 2EFWA 4OINF 1US2A 3R4SA 1SFPA 1JHHA 5DABA 4R1HA 4IOCF 5CBLA 1SVOA 1YE9A 2XQXA 1S9HA 3A03A 4XFGA 2JB4A 1E5IA 2RJLA 2I07B 2A6YA 1REFA 3VBOA 2R7QA 2BUKA 3CZUA 1WA4A 2IJLA 2NVTJ 4B1LA 3DCQA 1YJWI 1R1A3 2W3JA 1EUUA 3OYCA 4S0HB 2DMQA 2NMNA 4W6WA 5F2SA 2G7HA 4LHSA 5KNLA 1K5MB 4Y1XA 3IKTA 3T8RA 4A7KA 1WFXA 2FEZA 4YVWB 1BIAA 3HPNA 3VZNA 5KVRA 2ZTNA 5G04L 2LYCA 5HCBA 1R1TA 1GP4A 3L7WA 1GV2A 2FMDA 1EV13 3GFJA 1KITA 4Q4V1 3VD7A 3CMGA 1RUF3 1BI2A 3FMRA 2NNYA 3SITA 2HWE1 1SD5A 3FBIB 2V72A 4LOTA 3H3LA 2A6HF 2X6OA 2VUAA 4GH4A 3DKXA 1ON2A 4ZYEA 3GZ5A 4K7JA 3OUHA 3ACHA 1BJZA 2GNMA 4BHCA 2JDPA 1N77A 4CUCA 2FZ1A 2P37A 3WODF 2ATFA 1MMSA 2ZMNA 1BR1A 1XMXA 3ZYGA 1P8JA 1X1DA 4AOCA 1FNNA 3ASOH 4UFKA 2HWD1 4QPWA 5JMCA 1UHWA 5C9AC 1Z67A 3BOWA 2D40A 1ASJ2 1QDCA 1NG7A 2WO2A 4UFLA 3R0RA 4A6DA 2A75A 4IETA 1Q8OA 2Y33A 1PK6C 1HXDA 2R0HA 2VCMA 5DEQA 5DG1A 2HOAA 3KQ4B 3CMYA 4MSVA 4EROA 4PFOA 4Q1PA 1SFXA 1UY3A 4LKSA 4Y20A 3QQAA 3KP5A 2HEYF 3OR1C 1RL3A 4Y13A 3VDXA 3ILRA 5LY1A 1GQGA 1LCLA 2DWRA 3B7MA 3P9KA 1ZBA1 2EIDA 2XJRA 3OS1A 4IGQA 4ISRA 5HPOA 4XF4A 3L2HA 2QJVA 2QE3A 1MS8A 1D1AA 2PXJA 5IP7J 1I50J 3WW4A 1QOTA 4BQ5A 3N9NA 3GTMJ 3FXMA 1TME2 1PO12 4KMUX 4Q4W1 1JZ3A 4YM2A 4A41A 3CUQA 3JUUA 3JRGA 2ZJCA 3B9IA 3DFGA 5BOXA 2JENA 4A3KJ 2VECA 4H2AA 5JR2A 4KA4A 3BI3A 2RS11 5A80A 1MBFA 1OOPA 3RDIA 4CDXB 2GMEA 1LNWA 1BM9A 3PIGA 4M9XA 3IPVA 5TISC 4P02B 3W2VA 1MBEA 4ET7A 5LASA 2YB7A 3DKYA 2YPRA 2VW2A 4QQHA 2QQWA 4I0AA 3LFMA 2W94A 1Z7S2 3QU3A 1ZGWA 3KCXA 5JIUA 4BNCA 2F4PA 3T0DA 1NLSA 1AKHA 4QPOA 3HHGA 1FTZA 1N1YA 2HWF3 1COV1 3CBNA 2VJ4A 2W1UA 3O1VA 1V9U2 4HOBA 3S14J 5CVRA 2ZC2A 2IVJA 3ABKH 2CSOA 1PIV2 5LA0A 3ZMDA 1DF0A 1Y9QA 2EA7A 2J1UA 3SEZA 4Z2WA 1VI0A 1HB3A 1CIYA 3WQ7A 4C2MJ 3AKPA 3OTFA 4RAZA 3B9CA 3I3QA 2QQMA 3WF1A 4BK5A 3DPUA 4HKOA 4WM7A 5FYSA 1YW9A 2EFQA 4AYUA 2JDAA 4S2HA 4MH0E 3QLQA 4IV1B 4PHZA 3M8LA 4BIOA 2L4MA 1QJU2 4LBLA 2OXBA 4I7HA 3EB7A 4CZZA 3EO6A 3B01A 4XF0A 3POSA 5CKQA 3AYDA 3CJIC 4N4NB 5L3DA 2VVFA 3POGA 3OGGA 1GLHA 4QX7A 2MLKA 2X09A 3WOGA 3TEZA 4I99C 4FPEA 1OF3A 2W2IA 1GNYA 5H9PA 1TWHJ 1TNRA 2XJPA 1J59A 2X29A 4DUXA 2HGCA 1ULCA 3MFAA 4AFAA 2QKDA 3H0OA 2Z33A 2XGEA 4HK8A 3FISA 3JD71 4A3XA 2NPIA 5KC5A 3GJBA 5BNOB 1ZG5A 3KLNA 1UY0A 1ZZ8A 3AJYA 2ZMKA 4IE6A 2FDJA 4IEUA 3VL9A 3LE0A 5M3FJ 2F6BA 5C4WB 5AIPA 1XRUA 2RAEA 1NQDA 1UAIA 1YG2A 5GZEA 1TE1B 5LCWL 4YPJA 2A3XA 3I53A 4B8XA 5KHHA 3KLOA 1ND2A 3CP2A 4OHVA 5D8KB 2A07F 3WTXC 4FCYA 3AP6A 1DLLA 2VJXA 2DJNA 3V8KA 1DGLA 2CMPA 1HQWA 5J3LA 5FKCA 2LVSA 3TOAA 4AD9A 1RC9A 2N7GA 5FYBA 5ISLA 4FHTA 1KS4A 4COVA 5ACA3 2BBYA 3HPGA 4F8AA 4XKWA 4IQJA 4AIHA 4FP3A 4A45A 4EN0A 2D5HA 4KITB 2E7AA 3ALQA 2XVCA 1IXRC 4V2FA 2WA0A 2VNRA 2EIKH 4UYBA 1VQLI 5A3UA 2RG4A 4A3GJ 4I2OA 5ILSA 1JU3A 3DP7A 2XC7A 3HWJA 4EYUA 2W24A 3LOIA 3CUOA 4ASMB 3VZJA 1U2WA 3IKWA 1EY2A 1QH7A 2W1QA 2W46A 3S17J 3OWTA 2XSJC 4V2GA 3LAJA 2WBKA 4L9VA 4DEVA 1UO9A 1U3EM 1K83J 3VKOA 1H9GA 3ZYIB 2WFF1 3K4NA 1GZCA 2WNVB 1KONA 2Q0OA 2PA7A 1M1EB 2AZ5A 4HN1A 2DLLA 4LE4A 4CUAA 1BLZA 4PJMA 4LB6B 2QQIA 4HW0A 3I54A 2VE8A 2VJ5A 5FLVA 1H2MA 4CCEA 2B7YA 5C44J 3I8TA 3JQXA 1LHVA 1MS4A 2UWAA 2FBHA 2E6VA 3RYPA 1SFOJ 2MABA 4MO7A 1TME1 2DOEA 1QJU1 1UYYA 4RS5A 2G9WA 2M4KA 1VQKI 1YFWA 3I2JA 3CO7C 1Z9CA 2GXGA 2EAAA 5CFCC 3SHFA 3VDDB 5E8IA 2LKSA 3R6SA 1RNLA 3V64A 2EH3A 4KT6A 3VPRA 4CEYB 1P9QC 2VONA 3S1QJ 2R30A 3BUCA 3KHCA 3KM5A 2DFHA 1IUFA 1O3SA 2ZBJA 4O3MA 3JBG1 1NLRA 3WUCA 2HWB2 3O1SA 4MXVA 1U0AA 1BMV1 5FLMJ 5C5TA 4LBKA 2EIGA 2L9VA 2M7AA 5A6ZA 1UCRA 3T08A 2JD9A 2XBO1 3D5LA 5IAXA 4EN8B 4PDWB 4AI9A 4B29A 2O14A 2UUZA 2X6WA 2QNKA 2PLV3 3FK6A 2IS6A 3OIQA 3VBHC 1GQHA 3NRUA 2Y0SA 4YW7A 5L73A 1RUNA 4CU7A 4HBLA 5F3EA 4DY5A 2YUEA 2ISZA 4OULA 3FF5A 3U4SA 1ND3C 1JS9A 1SDDB 1S2BA 1JYCA 3HBKA 1MNDA 1QPIA 2R043 3L2RA 4XMYA 4A3DJ 3NAPC 1HX6A 2W68A 4LK1F 3WDUA 1XBFA 3AM2A 4C30A 2V09A 1W9SA 4XSXF 5K4LA 2Z1DA 5A1FA 3AZVA 4XAAA 1C28A 3RZKA 1WMDA 1SMTA 4JGYB 2VC0A 4R9CA 1J09A 3WEZA 4D0QA 1RUJ3 4BHPA 1C5IA 4FPHA 4P9IA 2BGOA 1K6YA 5A3NA 2L3DA 4BQWA 1V5FA 1ZR2A 2KIMA 1FYLA 3U10A 4DGWB 5FPVA 5K8SA 4Y17A 3CLQA 5IVBA 3AFHA 1KU9A 4ESBA 4FOQA 4FPCA 3O12A 2HDCA 4LB5A 3NAPB 1V9U1 4YGCA 3WUDA 2GP3A 2KDZA 3BJAA 3ZOBA 3FL7A 2KRHA 1VBA1 4RA0A 2R063 2QQVA 4L9TA 5DUUA 3B73A 4FETA 2NAZA 4ESFA 5A7QA 1X1PA 5A33A 1AWCA 2L5QA 1EUTA 2ZFUA 4CCLA 1BVVA 1Y8QB 2DMTA 4WVMA 4AIJA 4P9JA 1VBE1 4M6VA 5FD6A 4ANJA 5GM0A 2VW1A 3L2QA 1TVGA 2IVMA 2W0XA 3FJSA 1H1AA 3WTUC 2DV9A 4HAMA 5EIYB 4A7ZA 2R042 2A6EF 1WWXA 1UX6A 2W47A 4XFBA 4YW6A 1E17A 5KHIA 1WLDA 5FMDA 3MLLA 1V6OA 3BLYA 5E1ZB 3OIOA 1DPUA 3VSKA 5A2QZ 1DGWY 5I8YA 3ZMSA 4AHZA 1KS5A 1VQ6I 2ISYA 3T2OA 1QZEA 3HNYM 2VH9A 3T1MA 4YVWA 1UOGA 1OCOH 3ZCOA 1XDUA 4NO4A 2XIGA 2HWD3 4G7OF 2LC2A 2X85A 3W2WA 1XC6A 5IJRA 4CCDA 1HKDA 4E7SA 2GOMA 4F7ZA 4ZYGA 5DAVA 3T3YA 1R091 4Y1ZA 3BCBA 4R9DA 2VXZA 3MLJA 1H8TB 4A3JJ 4KQ7A 3RRDA 5GZGA 3QACA 3IM0A 5DDJ1 1OVSA 3GZTB 2AXLA 2LRDA 4IGPA 4ARXA 1CIWA 5DQ0A 1W6NB 2VOPA 3MIDA 2CV6A 5CFCA 3ES4A 4CP2A 5JPMB 1Z7S1 4D3WA 3BOPA 3VD9A 5E18F 5T52A 2ZNZA 3T2PA 3DPTA 3G1OA 1MZ6A 2DF7A 3N7KA 3O1MA 5GTIC 3NJYA 5FYIA 2C1FA 2FBIA 3PVEA 3FM3A 2D43A 4LBQD 3ZFFA 1F31A 5F3IA 2H8RA 1W5CC 4LBMA 4XHXA 4EM0B 1HV1A 3BC8A 1W9FA 2P6CA 4JX0A 3LF7A 4AF9A 1K4TA 5FPBA 1QJZA 5JVTA 2F4MB 2XONA 2J22A 1IQDC 2A5ZA 4OI2A 5GZDA 3JW4A 2MD0A 3WDWA 3RJ2X 2RM22 4D8MA 4ZKTB 2L7MP 1X9PA 2GALA 5CYVA 3IDBB 4Q47A 1D0ZA 3ZXEA 4M9ZA 4XEZA 2EALA 3VYSB 2CV1A 2QBYB 1HDPA 4F83A 5ACA1 3N9OA 4H7LA 1Z0XA 2FOWA 2JA8J 2CQ7A 3ZXLA 3TDZC 3O0XA 5K5QA 5CYYA 2W7NA 2LG4A 1FJLA 4RL7A 4CZSA 3WU2C 4AVPA 1G8WA 2CWMA 2HNHA 1WI9A 1WD3A 3GVAA 2ARXA 3FMQA 4QXBA 4AR2A 3NRVA 2IWGB 1JXSA 4FTHA 2Z16A 1PMIA 3KGLA 4IERA 4OIQF 4WXCA 1MMAA 2HEWF 3CDIA 1LE8B 1WPKA 1TNSA 4DZPA 4XKBA 2Q1MA 3DGTA 2XB0X 5ABJB 5FZ3A 2E33A 2M7BA 4MYEA 4WWCA 4U36A 4YFNF 1OF4A 2DU0A 1HCRA 3DEEA 2V5YA 2WZR2 2VPVA 1DP7P 5JHFA 3TBDA 4ZJZA 3FUOA 1XCVA 4C9YA 5DD8A 5IT6A 3LD8A 4U7DA 5B1AH 1R71A 3FC0A 3ZN5A 2XG3A 3K4CA 5ICGA 5J6XA 2RNJA 3BZ6A 4M6YA 4AIDA 5LK5A 2P7VB 3SCFA 1HV0A 2V7FA 2MNGA 4AZZA 4QT6A 4C0HA 3V7RA 1IN4A 2XRLA 5IYCJ 2VTXA 1RB8G 2WY7Q 2E53A 1V0AA 4IHSA 5AFEA 2LF8A 2M87A 2G1MA 1PDNC 4E7ZA 1B8IA 5FXZA 1ZA4A 5DXDA 2PLYA 1UZZA 5BNPA 2IRFG 2W85A 2EA2A 1JOJA 5A33B 5FY7A 2XBO3 4AAXA 1W6QB 1XSQA 2W08A 1HF0A 1YWKA 1DYPA 2R7OA 1OCRH 5LHGA 3F72A 2IW5A 3FWEA 3JSOA 4ZDOA 4YW3A 1R1VA 1A6CA 1PZ7A 4UFJA 3DBHB 1U8BA 1FXZA 3SQOA 4IEVA 3CJIA 5FMCA 2DW4A 4R9BA 4TYSA 2VKDA 3VBRB 2A73B 2WT2A 2YBSA 4XN0A 5FB2A 1JYWA 3SFIA 5BXXA 2OV7A 3DXTA 4CU9A 3EYPA 3POIA 2FNAA 2LF7A 3CCSI 1LU1A 4IKFA 1RUC2 4TSVA 1P7IA 1JOPA 5JOXA 2BGPA 2JDHA 3R0AA 4ZC3A 2AS5F 2AH2A 1FY7A 1SD4A 1PO13 3MF6A 3H8UA 2WLQA 3LSDA 1XNCA 1D0HA 4RQPA 5DDJ2 3ZQCA 2R0FA 1O57A 4M3CA 1EF4A 3CF6E 4M0HA 2FQ3A 4N53C 2AGSA 3EMRA 4FQ4A 3ULQB 4FPFA 2XAFA 1O4YA 1CAUA 1ULYA 1D7PM 1QJX3 4WXHA 2EFPA 3CUQC 1MMGA 1FTTA 2FHRA 3BU0A 4CCJA 2HS5A 1QNTA 3G6EI 1UMQA 3ILFA 2DVFA 1LGBA 4XABA 5LHHA 5GAHJ 2ZBKA 4CU8A 4PF5A 2UYBA 2R6QA 3OD0A 4ETSA 2IT0A 3ILNA 4HPKA 2B39A 5CIRA 4YVSA 3CMAI 1HKTA 2LD5A 2DOFA 2WL1A 5I0DA 4TN7A 3IPVB 3R4DB 3LEKA 3HEFA 2Y38A 3ZFGC 4IXLA 2ESNA 5BPXA 5HS7A 2VOKA 2HWE3 1RUI3 2R0QC 5JSOA 1IKQA 2J42A 3PU8A 1E57A 4FFHA 4Y22A 2YY1A 1QXJA 4LOCA 2B7EA 3I9V2 4EJOA 1GWKA 4NIIA 3LSJA 3S1MJ 3QH6A 1PHMA 3N7JA 4L99A 5IAVA 3J81K 1QNYA 1GHCA 1IG7A 3VBSA 3JRFA 4MNUA 5E3LA 1LEBA 2YBPA 3RWNA 2V6EA 1MNEA 1PK6A 1U5YA 2Y0OA 1ZQ3P 5GALA 3RI9A 1JYXA 5J4YA 4DZJA 1RUI2 2RVAA 4META 1ND3A 1T98A 4UI9L 4AEDA 3LA2A 1JYVA 3OF1A 1QGLA 4IRIA 3MKWB 3FXJA 5H9QA 2P8TA 1FMWA 1C57A 2KIQA 4DO0A 1ASJ3 1DPRA 3OEBA 2OQGA 2JA7J 3ACGA 1P7JA 1UX7A 2ZXJA 4XIOA 1K78A 4E7IA 4UWDA 4AVBA 3ME2A 2GMPA 1ZH5A 3K2AA 2VB6A 4HBNA 4NWVA 2X5IC 3IWFA 1LHOA 1GICA 4RLQA 4YGBA 1PO22 4HG6B 1RITA 2JKXA 1C0WA 1RRJA 2HXOA 2VJJA 4ZXEA 5F0CA 2VASA 4IL6C 1W90A 4BWOA 2ZFWA 1Y1WJ 3KB5A 2Q30A 1UFMA 4HF2A 1MKMA 1C5HA 3HL2A 2K9QA 4IJAA 2DVAA 3MIGA 1E2XA 1F5FA 1ZRRA 4TTGA 1DCSA 5DMYA 4CTEA 2O7OA 2O0OA 3GYDA 3HRTA 3IHUA 3RYKA 1GFF2 1IGOA 3JAMZ 3DN7A 5A3WA 3KMHA 1ZR4A 4FE7A 1V70A 1HC8A 4EV0A 1PYVA 3RZOJ 4BEHA 1LVAA 1S0FA 2HZTA 4URTA 1R4MB 1UZ0A 1JYTA 1WJCA 4DS0A 1JHNA 4CXWA 3P5JA 1J3RA 4D6QA 3C2UA 1HB2A 5JR3A 1DGWX 3WP5A 1X3WB 1RXFA 2D98A 4L9BA 5AC92 3H92A 3HR9A 3UKTA 5FQ0A 4XPVA 3ABUA 4QKDA 5C9AB 4NDLA 1TQ5A 2Z69A 1USTA 3AJZA 5FKBA 2EZHA 3FKJA 5IP9J 3LPFA 5E17F 2CFXA 2P5LC 2LY1A 2RS13 5KC6A 1FV2A 5K5RA 3A01B 4RS5B 3D0SA 4XACA 2BYVE 1LTEA 3F22A 1SACA 4EGYA 2JX9A 2DCYA 5H9SA 4HT1T 3E5QA 3LWCA 2X1DA 3H0DA 2L7KA 3GFMA 4CXXA 3BOQA 5FY0A 1LOCA 5FLXZ 3AP4A 1BK1A 1FV3A 2PJRA 4COUA 2VUDA 3RKWA 1D0GA 2EXHA 1IS3A 3TL4X 1G2HA 2WZ8A 1GLNA 2NXNB 1OI6A 1AYM3 1HQLA 2F48A 2B9SA 3DUIA 2ZMEC 4XETA 1ULFA 3BPSA 2Z99A 3M1CA 2O61A 1OBNA 3E6CC 2O9LA 4IVNA 1GDTA 2I10A 4U0WA 4HL0A 3AMPA 3RSNA 1O3TA 2PG4A 2W95A 3D82A 1HSJA 1OFSA 4LTAA 3VHRA 3OYWB 2WNEA 2XF5A 3IDAA 4PGHA 1OURA 4PIYA 4GXLA 2AR6A 4OI4A 1NHAA 1VBD3 1YI7A 1QA6A 1G9AA 1V6IA 2FX0A 2HU9A 3V8JA 4NHMA 3RPUA 2DFCA 5AC93 3I7DA 3ZXSA 5F04A 5SV5A 5JI9A 3AXDA 1LAJA 5CZKA 1WJBA 3ABMH 1MEC2 1GXQA 3OYEA 4L2NA 2YBKA 4MQ9F 4LLOA 3ST7A 1RESA 2CQKA 4EN7B 1B8IB 4DNCA 3TN92 3E6MA 1PGL2 4JP0A 2QLZA 4N8MA 2JG9C 1NLQA 1IN5A 1L0OC 1RPWA 4C1WA 3VBFB 4QMAA 4A6SA 5CLSA 5BPDA 1H4HA 3FUQA 4ZZDA 3AL0B 3VDDC 3KYDB 3IMMA 1U9NA 1D4M2 2ID6A 1LR5A 1A36A 1IQAA 2WYSA 3QPLA 2RNGA 3ATGA 4A0ZA 1B72B 5BNGA 2VXJA 2ME0A 3TEDA 4KWKA 3SKVA 4AHXA 2ERFA 1GT0C 3O2PE 5KAFC 1R00A 3PUSA 2B5HA 2KD7A 1S0CA 1BJAA 4FI9A 2HVRA 1FPN3 1Z77A 3P3NA 1XNDA 4XTMA 1U0JA 4UOJA 3SMHA 3NMBA 5EZHA 3OCPA 4PSXA 3K0LA 4GWMA 4UY8I 3LA7A 1DDNA 5DUKA 1JKPC 2EK5A 3ZFFC 2QWWA 1RUD2 1SPPA 3QBQA 4AEDB 3BCWA 3ZYBA 2EFOA 1ALYA 2EXKA 4OHYA 1QHGA 2Y6HA 2GDFA 2BNMA 2UY8A 4BXSV 1I39A 2OAZA 2DVDA 4P14A 1WLCA 1K61A 1YRZA 2ZJ2A 1NXD1 3NVCA 3RJPA 4NIGA 4P5HA 3DEUA 1HRI1 2CNAA 4XZPA 1FYMA 5F5CA 4FISA 2DU9A 2BNNA 1SHWB 2OPKA 2YG0A 3ZSLA 1S72I 1C8M2 2CU7A 2I8DA 2LM3A 1S0JA 2W1OA 4YIFA 1W6MA 2Y9ZA 4ZU7A 2LSOA 1GKBA 1TME3 4JKLA 4LD5A 4KIBA 5J36A 2R5ZA 4AI0A 1O7FA 1FBQA 2GNBA 3EPZA 1VLNA 4BL0B 2R7RA 3L9FA 2MBFA 1RIOH 1LHNA 3TOJA 5GAEJ 1VB4A 5GLVA 5APAA 3GF2A 3GLLA 3LEIA 1D8KA 4MOAA 1EV7A 2X5IB 4XRMA 4GCVA 1UOBA 1OCCH 4AU7A 3VZOA 4KT5C 4B43A 4YRVA 2MLGA 1R64A 4E4SA 1VBB3 1W3VA 3GLXA 1T6BX 1W6PA 4CCOA 3CZ6A 3BU7A 3C7FA 2I45A 5GLUA 4XNFA 1LQ1A 5GLWA 1MDMB 3ZKYA 2B9VA 3FZ3A 1W5TA 2OA4A 2VPLA 2MPFA 3R60A 4IEJA 2BVVA 4BQXA 5DUIA 3WT3A 2O8KA 1MBJA 3BKZA 3F8FA 1MPXA 5G05L 5FRAA 1ZRCA 1NY72 2L02A 1G4DA 3OYKA 3EUHA 4B1RA 2B9UA 1NQJA 2M8GX 4QTRA 1G9CA 4OLLA 1RUG3 4B44A 2W39A 3BWGA 1AXKA 2XAUA 2CY6A 1R5ID 2KRFA 1YO5C 2R16A 2RS33 2ARCA 4P9FA 1KU7A 4OYUA 1J9IA 4GJYA 3VD5A 5J1XA 3LSKA 4Q4V3 2F5EA 1J7KA 1ULEA 4YFZA 3MMYB 5FBZA 2Y48A 1F9NA 2YC2A 3POEA 3SDGA 4KNYA 4OZXA 3CJIB 3ES1A 2M34A 4JHZA 3ZFEB 1XJAA 4NRPA 2VMDA 4Y3OA 1BR2A 4M72A 1DHKB 1MH4A 2B8MA 5I0TA 4H4KC 3EJKA 2W48A 1ULOA 1DZQA 3ZPYA 1S8NA 2MSYA 4AAPA 3WG4A 3QWLA 3F8BA 4WZFA 4O61A 1WCDJ 2RE9A 4W6XA 4AQTA 2Y0IA 2XB6C 1XMAA 3VBUA 3BDDA 5JPNB 3SH3A 3RQ0A 2G0EA 4IV3A 2DA6A 5BNNA 2DT5A 1QU3A 1L7LA 3A21A 1YJKA 1WW7A 2WFPA 4W6YA 4NC8A 4L5JA 2E2IJ 4LQRA 2P5VA 4XFAA 1H8AC 4ATEA 4B48A 1W7PD 1XE0A 2ENRA 3W9AA 3F23A 4JQTA 3VKMA 3CQOA 5HCFA 2F5DA 4KWLA 1W8UA 2WBMA 2Q2EB 2K4BA 3BODA 4Q4V2 3S2DJ 3HPHA 5ILVA 1GOHA 1W2NA 4QKBA 3T4VA 1ZYBA 4QB6A 5LEJA 1W3XA 3ZN0A 4KBBA 3D0JA 3VYTB 3HUGA 2Y30A 2XGDA 1W2UA 5KHKA 3RMYA 3WDXA 4PQ9A 1VR3A 1ZTRA 2AEZA 1QMJA 2Q1ZB 1YUDA 4LO5B 3TAYA 1WVRA 2PAEA 4XLFA 3I2FA 1HKSA 4AVVA 3MW3A 4XR6A 4GD4A 2VZUA 3WE2A 3IKVA 5FKNA 4LOSA 4NE9A 4KDPA 1S2EA 2CWEA 3ZXDA 4XDQA 4KWUA 1OQDA 5BNPB 3DQVC 3LFIA 4E27A 4V2WA 5D6FA 2R7TA 4E2SA 3FFZA 3H42B 3CCYA 3Q0VA 4DRRA 5BNNB 4CYCA 1HW5A 2HYKA 1RI7A 2GXBA 3MW4A 1ZZ9A 3DLAA 4HVRA 5FYHA 5E88A 5ERLA 1NCQC 3MIEA 5F6FA 3FHIB 3TOBA 1YLFA 4XJ8A 3LSIA 4TZDA 2XPWA 2PJRB 1QQP2 1D0XA 1PZ8A 3T4HB 4AC0A 1MS9A 2L54A 3WGGA 3PFYA 1HJGA 4XRFA 2MH2A 1U5TA 2H8WA 2A5WA 1G7YA 1G8XA 5BPIA 2JE8A 2LK2A 4HPKB 4YVSB 1GP6A 2D5FA 4H0EA 1RUD3 4AK3A 1C8M3 3OYDA 4JYKA 5FRNA 1E0EA 3CLPA 2VMIA 4A3ZA 4ENNA 2DTRA 4P9WA 4DXSA 2PQSA 4C3JJ 1Q8SA 1VBE3 1KYWA 3U37A 3VDAA 1WW5A 1SLBA 2Z9OA 1N3QA 4E2GA 4M6XA 4NB5A 4UBGA 1UMIA 1X50A 2WNUA 2AREA 1XB4A 2WLPA 5HI0A 1RXGA 3ZPOA 3H1CA 1CAUB 3H3VK 1NA1C 3ZOIA 4DIQA 1YI9A 1UMHA 1FPN2 1H2LA 1AF9A 2A70A 4L5IA 1VBC3 1JTZX 1GOGA 2WAQN 2AC1A 5CFDA 1ENHA 1XXNA 1H6XA 1UZYA 3HMYA 2HQRA 4BH9A 4BK4A 4IV1A 5F0FA 3WINE 4BACA 3BQYA 5JCTA 3C8XA 4PDWA 2R041 2VMHA 4BEHB 2LROA 2E2JJ 1X3UA 5A3PA 1VQ4I 4XK4A 3OJBA 1GMMA 1KZHA 4QDQA 3LDKA 4OVEA 3HSRA 2WIIB 3CP8A 2A6ZA 2NOJB 5JOYA 5LFAA 1K78B 4PQQA 2JIGA 4QPIB 3JTGA 3AB0A 5T5JA 2JRMA 2IS4A 1CQ9A 1D4VB 1BKZA 2XAJA 5DZFA 3WGHA 3IUOA 2IC1A 1JU4A 1UZWA 1RUF1 1NOVA 1N1TA 4I09A 4CP0A 4DFSA 5T5OA 2JDZA 3GXUA 5FZGA 4P5OA 5A1AA 5FZIA 4M3CF 3CC2I 3HOWJ 5GJ6A 1YFXA 4LO6B 4D7YA 1NKGA 1BI3A 2BOIA 5DUVA 5A7OA 5B3SH 1Y43B 2DCZA 3BG7A 3Q0UA 2D45A 5FY9A 1NAEA 1STZA 1LOEA 4H3WA 3V65A 2WADA 1BOBA 1VQOI 3KGZA 1JT0A 2JQ7A 3LPGA 5HVQC 1NXMA 4GO1A 1O91A 4LHNA 5IW0A 4OZOA 1ACCA 4A5NA 2TBVA 3L2WA 4LLLA 4W65A 1ND2B 4XDPA 5FOJB 3WG9A 2CYFA 2EILH 2C26A 2R1DA 3WP4A 2CFOA 2MEV3 3AFGA 3QYBA 3F8NA 5B2GB 5F3GA 1VBC2 3EUKL 2VZRA 1Z05A 3H9GA 1ORKA 1T33A 2K02A 3GEZA 4QHOA 1OQYA 2ZX2A 4Z6YA 2ZSHB 1HXS1 2P1BA 1PO21 2STWA 1JJ6C 2WAQA 2K85A 5J8FA 2ZGNA 3WXPA 2DAOA 4UHTA 3KT1A 1ETXA 1MQTC 1COV3 2C4XA 2YGLA 3OGRA 4QSHA 2DFFA 2WSVA 1XE7A 3DTIA 2JPBA 3U21A 3AVSA 1R082 4MEYF 3N4MA 5J47A 4Y5Z0 4BQQA 2VZSA 1LDJA 1NCRB 4AHWA 2DMPA 4I76A 5L9RA 3ZLIA 1IN6A 2RDPA 5JVGF 2BW8A 2M45A 3SEQA 5JLVA 4NC6A 1IXSB 5L9BA 5A3LA 4XTPA 5JZGA 4OFGA 5FZEA 2EPFA 2HH9A 2E7XA 3ERED 3BTJA 1SLCA 4LT5A 4Z82A 2ELKA 1KJRA 5KBFA 3VZMA 1B59A 2LH9A 3A1YA 4NQWA 5FKMA 2R7WA 1DQ4A 1K6OA 2D6OX 1K3IA 4A6EA 3USUA 4U7BA 2OQ7A 4BZ4A 3AK0A 3WE3A 3KPHA 1ONAA 1YTYA 1AR82 1WCUA 4XJZA 2VXDA 2OUJA 5JSPA 5KHGA 3W6JB 4QU1A 3R0JA 3GALA 4FQZA 3OL3A 1UY2A 2WNVC 1A8DA 1SLLA 4RDUA 4PK4A 4XBNA 5LLQA 3B6AA 1XGMA 4HLTA 1ENQA 2RS32 3CD6I 1POV3 4W97A 4D7NA 4LJHA 4LG3A 3HNBM 2MW8A 1YJLA 1EKEA 2JN6A 4FX4A 1RUF2 3WTTC 1UOFA 4AWDA 4H14A 6PAXA 1BEV2 2K5CA 2BEOA 3WVJA 1D8JA 3ZXFA 4BDZA 2TRTA 1DU6A 4CDUC 3MKZA 1WQ2A 2R7XA 3ZMNA 4JQFA 4KJZA 3FXKA 4YG3A 4FXGB 1WKMA 2UWCA 4CCNA 4AI2A 4I6ZA 3F6OA 3E97A 3EUHC 3MZYA 4MXWB 1B72A 1OR7A 2M0CA 1CAXB 1G3SA 2BVLA 1EJ9A 3K4DA 5EQUA 3MPBA 1DBNA 1KA8A 4EZ4A 3MW2A 1QGPA 4CPBD 2VKHA 4DYCA 1Q43A 2VPRA 4PCQA 2L7FP 2VNOA 1S1AA 2VQ0A 4XFCA 2GXAA 3VD3A 2W1WA 2ARAA 1J83A 5E8GA 4CDXA 5LA9A 4E7HA 2MEV2 3NNMA 4IEOA 2CS3A 2EXJA 5JDBA 1JGGA 2EWNA 4K8FA 1W0NA 3ASIA 5K7FA 3MGUA 4JCKA 1YIJI 1LKXA 2MEV1 1AR62 1OA3A 3DU5A 3AMHA 5C4JJ 4MUVA 1PVC1 1LHWA 3PTRB 4A3BJ 4YIRX 2XGXA 4EN6B 4FOVA 2FOKA 5BS6A 4QM8A 4IEQA 5F3CA 2RR13 2GZWA 1LGCA 4BOWA 3NAPA 3C2HA 1AL22 1WBFA 1LGNA 2FDGA 1JW6A 4X0GA 3P9CA 4KIGA 4KIFA 2P7CB 4BQAA 2IGKA 1UXXX 5DZEA 3OYFA 3JAMK 3OR2C 1G6NA 3U4XA 4EATA 2YXSA 1DDLA 1OLTA 4YFKF 1F15A 4QHZA 4JKKA 2Z42A 3T1BA 1POQA 3M7AA 1RUG1 3QPHA 3TP0A 4Y5TA 3J7NA 1DQ0A 1NK3P 3J8F1 3LKJA 1WBLA 4E2QA 3PIPF 3HQXA 3WTWC 4Q4W3 2IVIB 1RUG2 2P5KA 5EWSA 5ICEA 3ZFEA 4E7KA 3B00A 4UW5A 2HVSA 4R8HA 2HR3A 3PJQA 1ULDA 1XU2A 3MD2A 5FKKA 2CW8A 3B5LB 3DCFA 4GRIA 4AYBN 3UNPA 3A0BC 3GTPJ 5AONA 2AQEA 1PGW1 1X33A 4K20A 4XFHA 2PQ8A 4ZDLA 3NV3A 4G9YA 1XPWA 4D7SA 3HRMA 1ETQA 2RQPA 3S3MA 1GQPA 4J00A 4XMIA 4JGZB 1XN7A 3URFA 4GULA 5AVPA 1W8ZA 1YS7A 3DECA 1HRV3 1F36A 1VQPI 2DDUA 4KICA 2R7DA 4BQ2A 1F4AA 1UQXA 4IEYA 4D6SA 2DVBA 3ZO0B 1L7QA 4Q26A 1DQ5A 1UNBA 4SLIA 5EYYA 4MGKE 5FY1A 2GAUA 1SD7A 1ZBE3 3VDDA 4X6RB 2EFNA 4PJYA 1ODDA 1WMEA 4YG6A 4WVVA 4IE4A 1YC61 2F5VA 3UL2A 2Q4SA 1MS5A 4AVZA 1DFQA 2GNDA 1XYPA 1A78A 3ZRGA 4CDWA 1OKQA 1AYM2 3VWBA 9ANTA 1T56A 2OZUA 1WUVA 3WTYC 2K3FA 1ETYA 4QAWA 4OIPF 4EEFG 1LENA 2YFUA 2QZ8A 1JZ4A 5FO8B 5FZ6A 2XVKA 4IESA 2IXIA 1NK2P 3RKYA 4C2TA 1OHFA 2XPVA 2ELJA 2SLIA 5E8AA 5J40A 3BALA 4BYYA 3GJAA 5FPXA 5HNFA 4WVWA 5FXXA 1YQ8A 3G6JB 2E9QA 3KYCB 2FBEA 2QA4I 4GB31 4BQ4A 4A3FJ 1DYKA 3BPXA 5LY2A 1ZZCA 4EJVA 4Q5SF 3H5RA 1OT5A 4E70A 4ZDPA 4WM7C 1FWZA 1JTXA 2HWD2 2F5FA 2NVQJ 2F4LA 4Q4Y3 2LRPA 4MVTA 2VOOA 3UR3C 2VZ3A 5FUIA 2ZJQF 2XHKA 3OG2A 4DYRA 1H88C 1UIJA 1ZBA3 2VQGA 3LFUA 3ZN6A 3ZQIA 3L2CA 3PHMA 4MGQA 4JDNA 1IN8A 3TN93 1LUJB 3S93A 4LKDA 4C1XA 1Z3XA 1UAAA 2DURA 3D5RC 3CMMA 4XF3A 1U6GA 2AYHA 3BZKA 1O8SA 1HJFA 1CAXA 4XXAA 1TT5B 5JXJA 4BJ6C 1VQMI 4L5EA 2E60A 1MZFA 1W28A 2EIEA 5LEKA 4B8EA 2X4HA 2MG4A 2BXZA 2BRTA 3WD5A 1MGTA 2V26A 3ZSEA 1G9BA 4N7UA 1FYKA 1OYWA 4IHXA 5IFTA 4ASNA 3PJRA 3SEPA 4HDVA 3ACLA 1LDDA 2JRTA 1YRNA 4Q4X2 4UFHA 4DY3A 3TKYA 2V73A 2R7UA 5KCMA 3VBSC 5JXHA 2JG9B 5JMOA 4RN5A 3ZIXA 1KU3A 1AR61 1CJPA 5IK5A 1MBHA 4QGMA 5ABJC 5B66C 2R7SA 3B6CA 4YZ4A 3W5MA 1ETKA 2E63A 3RKQA 4QX1A 2JDMA 2ZEWA 5F27A 4V2VA 1XNTA 5I8TA 1F1ZA 3HGYA 2KFDA 1QRYA 5IHRA 1F5JA 2A3YA 2XQRA 2HDDA 3TMOA 2KPMA 2VBYA 2F2EA 4D69A 2OPTA 4N43C 4RGKA 5EF6A 4CDQC 2BBAA 2CHHA 5C3EJ 5E1WA 2YU1A 5I8SA 1WW6A 1TZOA 4M71A 2R49A 2L9NA 4XJUA 4XKCA 2HWC1 5A3MA 2JDKA 1P6RA 4JVAA 4S2DA 5L7OC 5GPCA 3FLPA 2WO7A 2WO3A 3SKJE 2XAHA 4A42A 3VBSB 5EEAA 5T50A 4LO7A 1YFHA 1UN1A 5IYYA 3PIJA 2MA3A 3K2ZA 1ZG3A 2XB5A 2QQLA 4NHKA 2OKXA 2QCSB 4S04A 1KQ8A 2JUCA 5TRDA 2ZJRF 1IPSA 3RZMA 1JKQC 3GTLJ 1R5GA 1HDKA 3DF0A 5J7MA 2VN2A 4NHXA 1MQTA 3UK9A 2JPCA 3PM1A 2DDBA 3QU6A 3WF2A 2BFUL 5L36A 3HC7A 2CYYA 4AFMA 4S2GA 5FZ7A 1A6IA 3LIHA 4FTSA 2JMWA 4XBQA 3K69A 2HOSA 2YU2A 3WG1A 5IVEA 2J1AA 3VV1A 5K0UB 2RKHA 1DYOA 5A7WB 5CVVA 3ZMTA 1SBFA 2XJTA 2BERA 1P2FA 5DS9A 2BZTA 4BJTA 4E8DA 3NWKA 3WGIA 1KD7A 1EA3A 3OOPA 2HTJA 2R4GA 2QBYA 1I6XA 1R1UA 2K46A 1ZK8A 1PM4A 1NZCA 1PZ9A 1RUH3 3WDYA 4EWDA 1W6OA 4QKNA 1CPMA 1FMD3 1AX1A 4LGWA 4M3CB 2P2KA 3NV1A 1AYN3 3POBA 2ILMA 5FP3A 3O1RA 2L4AA 1CAVA 1J2XA 2IXHA 4A44A 5HV4A 2ZAAA 2DCJA 4F92B 4Q8KA 1Y3TA 3AC0A 3IDEA 4JDOA 4HOOA 4TXWA 1KYZA 5LA1A 2HYJA 3KQRA 1WMXA 4MO3M 4L11A 4IRHA 4GZ9A 1FT9A 1TMF1 2VOTA 1UKRA 2L9SA 1QDOA 3T1LA 3VKNA 5FO7B 3VBRA 4QX3A 4YGDA 3ZYPA 2OIIA 1YFUA 4IEZA 2E34A 3NWSA 4JBAA 1SPPB 3TNPB 3CCJI 4BXFA 2P6SA 3QRFF 3EHKA 1XG1A 1X1CA 1VBC1 4S2FA 2VQCA 3WG3A 4XILA 4GJZA 4RGAA 4FFGA 4X6QB 3DPRC 3ZR5A 3LEGA 5IT3A 3U14A 4PI2A 5FJ8J 3LCPA 3LSGA 2HKXA 1U8RA 2EV5A 2DPUA 2H6CA 1FX5A 3FXLA 1F2NA 1CZVA 3HAGA 2Z5WA 4B3NA 2DMUA 1DQ2A 1FEXA 3ZVXA 3X2QH 4BY1J 1O4ZA 1JUHA 5LGNA 1TTYA 4XW3A 2V5DA 3KVAA 4PIZA 1W6OB 1BOAA 4UVAA 3KF5A 3OYIA 4KBZA 1VTNC 3V4GA 4BXUA 1UY1A 3UYJA 4KISA 2NRAC 4XF9A 1PGSA 1XQNA 2M9HA 4EQVA 3A4CA 4JDMA 4O5VA 2VI6A 1GUIA 3HRSA 3DPRA 4GQ7A 4A2UA 2PMUA 1RZ4A 2DT6A 4H7MA 2EF6A 3DKQA 4XIDA 1EPWA 1E5HA 3FXUA 1WJFA 2AENA 4L0ZB 1O3QA 1TQPA 4HK9A 5FJHA 4CDGA 3OOUA 1ENXA 4K9SA 4KYWA 1FSHA 5CG9A 2LTPA 2V9KA 1EAH1 4QHBA 2DYSH 2ZA9A 2KLOA 1BZWA 5IYDJ 1S4CA 2LY9A 4L0YB 4QWNA 2GC1A 3KVBA 2WA4A 2D1VA 4MGZE 5HCHA 3CCRI 4NMIA 3CJXA 4FSJA 3WNKA 3ETPA 2Y6KA 1YW7A 2JXAA 1K12A 1VE0A 2PHUA 2NMOA 2ZAHA 5KWRA 2JDNA 4X6AJ 1Q8PA 4NHJA 4HNVA 1CX1A 1CAVB 3N05A 4EWAA 2PMHA 5E89A 5M5XJ 2FD8A 1UZVA 3IC7A 2P4EA 4UUTA 4NRQA 3TEXA 4NIHA 2FU4A 2R5YA 4C2UA 2D5VA 2A68F 4UXNA 4HQMA 4OI0A 5IK7A 1SEUA 1LE8A 3AG3H 1QWRA 5D1IA 2XR4A 5FYCA 4ABZA 3RJRA 3PIOF 5EPAA 5CA6A 1PX3A 2WQ4A 2GC2A 4CDXC 1IN7A 3FXOA 3PNYA 1Q1VA 4W8JA 1YI2I 5JI6A 1N78A 4Z92B 2V6CA 1IZ1A 2OW4A 1XSVA 3OYAA 3TW7A 2PLV1 1XNBA 4PF1A 1AHDP 2H1LA 2XRNA 4CA9A 4R4ZA 3Q8AA 3Q8BA 4N9IA 3KEQA 1HOMA 1YHFA 1JYIA 2XUMA 1FIAA 2XPJA 3JSPA 3CESA 3GM8A 2W00A 3IWZA 3JBG3 3ZFEC 3NO8A 4UBHA 4Y5SA 1Q1HA 1PO11 3J8F3 2HTSA 1FOD1 2DFIA 3WF4A 5CVIA 1FMVA 5CJ9A 4BM8A 1YS6A 4LHLA 4HF0A 2WT0A 4Q0UA 4UUSA 1G59A 1N47A 5GKAC 2V9PA 2VLAA 2DUQA 2OTJI 1DGRA 5LRSA 2VNGA 2VOWA 1O4TA 5LHIA 4GKXA 5B4NA 5ICFA 5M5YJ 2EB7A 4LORA 1PVC2 2WAEA 3MO4A 2Y0MA 2QQJA 4IV3B 1PGL1 5KHDA 3WNPA 2P0WA 5E3OA 2YSRA 4LIUA 3W2AA 1W99A 2DMNA 3CLOA 2Q8OA 3N35A 3SC7X 4RYDA 2EV6A 4K2EA 2JG8B 3DBLB 1QZZA 3L1PA 3JD72 4YG2F 2B42B 1R6RA 2RS51 4P08A 3U07A 3EDPA 1RINA 4G6QA 4XOGA 3CL1A 1T2XA 1HA8A 5C9AA 1K45A 1Q8VA 1AOYA 1CONA 2WFF3 4YW4A 5A32B 4UW4A 2DCKA 3JTHA 1ZKGA 4P1WA 3HD8B 2IUWA 4F3QA 3GNEA 2RGVA 1ZN2A 1S29A 4BQNA 1PM7A 1X2NA 1H0MA 3BR5A 1N3PA 3CCEI 3QOEA 3K51A 3J7ZI 1OKOA 4OUSA 3RWKX 4CH7A 3UKGA 2GN7A 1XOYA 3JRDA 1JTYA 5H2FC 3WQ0A 4K40A 4BE1A 4G4FA 4O6JA 2RREA 2QSFX 5D4RA 1WI3A 3TP3A 2AHQA 2K9LA 2PQQA 2VGDA 3H7YA 4LMFA 1IV6A 3O6BB 2GMMA 2KA3A 1IRXA 5TSWA 4YRDA 3MEXA 1U5IA 1BJQA 5IATA 3CCMI 2XHNA 3CU7A 4AFDA 3D8CA 4HRIA 1KXGA 1R4NB 1DUXC 1D5VA 2OF7A 3QP5A 3PDQA 5LD2C 2R93J 3WU0A 3M3YJ 3S7IA 4LO4B 5F5AA 1UB9A 5FYTA 2W1SA 5J96B 3H8RA 2L7ZA 2XPUA 2VULA 3J81Z 3I49A 3WF3A 4CDQA 3L2UA 1QKQA 1W7PA 3PL8A 1WRJA 4EJTA 2TUNA 2HQ5A 2R062 3DTKA 3FFQA 3K9TA 3TYJA 2ZEYA 1W8OA 2GIZA 2ZGMA 4QPGB 5FXVA 4XM3A 1REPC 2JE7A 3SEEA 5D8AA 4P9GA 1Y9MA 1X58A 4EM1A 3H3ZA 2D6KA 1UIKA 1LHUA 3I2OA 2JA6J 4KN7X 2XUBA 3WW1A 4XQ4A 2VUJA 5BY5A 2FQPA 1Y4WA 4AGVA 3SCGA 1XU1A 2RMU2 4XOTA 5AFBA 1QJX2 2HZDA 2BHYA 2LREA 5FYYA 3DV8A 5LATA 5FKLA 2HBTA 3Q9OA 4EWEA 1SFKA 2BDRA 4IZZA 3UNGC 3UV9A 1T8IA 2LUWA 3M3QA 1LPQA 2ZGSA 2VE9A 3B02A 4AEMA 1VBB2 1HRI2 3MAJA 2F17A 1ON1A 4L9JA 4QPGC 2LBFA 5LBBA 2DI3A 3K70C 4BE2A 2E36A 1OUXA 2C24A 3U9GA 5EFUA 3UKVA 5FUPA 1A35A 3OEAA 2OS2A 3WHCA 2ORXA 1OOPB 2QFEA 2XH6A 1SVMA 1RHI1 1SEFA 4HF1A 1I9RA 4MV2A 2R5YB 4RMNA 2V79A 4XLNF 2DXIA 5HNHA 4DOZA 2A1XA 3HN1A 1N3OA 1HLVA 5J37A 5BMZA 5FK8A 2BV4A 3LB9A 4FQGA 5D5XB 1H6YA 2GSYA 1V54H 4P9XA 3KP3A 1OCPA 1ZZ6A 2WINB 5FP4A 1FBUA 1QQP1 1N75A 2R32A 1JKOC 1UKGA 3D3AA 4AG4A 3U1XA 2K0GA 2O3FA 4RS8A 1HXS2 1PIV1 4D7TA 4JRAA 2ETEA 2FCVA 4JX4A 1ENRA 2H09A 3KHBA 2ZGKA 1U9OA 1O5UA 2PELA 1AUYA 1PVXA 2COBA 1V3FA 2JA5J 2JG9A 2G4IA 5H6RA 4UNOA 4L0PA 1FOXA 5GAGJ 1UWWA 3V0BA 1Z7UA 4BY7J 4NOTA 1W8WA 4IXAA 5C3QA 5EG0A 2GIVA 4UXAA 5D2AA 2QDRA 1K4SA 3FMGA 1W0TA 1DGRN 1K42A 1J75A 3BPVA 1YX5A 3ZQ7A 2WR9A 3Q8CA 4FASD 4LEJA 4XMAA 5JI7A 5JVVA 1JUMA 4HONA 2OVUA 4XSZF 3JZVA 3E1SA 3VZKA 5EEGA 1TMF2 2R7FA 3OSDA 2CW7A 1RUC1 2HWC2 4EE2A 2QQOA 4JGZC 3VHPA 4AUXA 1YHQI 2OQRA 1COV2 2WAAA 5FZFA 1JI8A 1ZVFA 1S0IA 1AR83 4SBVA 2COMA 2JKBA 4JRLA 2MGQA 4MHGA 2ZXHA 2BFUS 2YR2A 2Y9YA 4D1QA 2X05A 2NQYA 3OBAA 4Y24A 1ND2C 4IE7A 1T6SA 2WT1A 1W5SA 2X48A 3LZZA 1RUH1 2M4GA 2A61A 3Q9VA 3AP7A 4IQPA 3O1UA 3K1PA 2XOMA 3C1DA 1C1LA 3THPA 2M3AA 2XL9A 3EXUA 1W1WE 3PUIA 1IGNA 1HN1A 4ZONA 5J09A 3GXOA 4RGSA 1ONVA 2W4SA 3NV2A 1D3YA 2LP0A 4OQ8A 4B4PA 1J3QA 4QQOA 5FZMA 2HYFA 2F4OB 1K79A 1XNAA 4IGOA 3MV11 3DEMA 1IOAA 5LZ6A 2JDUA 4HN0A 2WO1A 2NP0A 1P4WA 4LKFA 1X4OA 3PO2J 1BC8C 2BWAA 1LECA 4ZPIA 5EJZB 1KRIA 5IUQA 1MVEA 2FSWA 1T6GC 1SLIA 2Y6FA 1UG2A 4HDUA 2DJIA 1C8NA 2WKKA 5B4XA 3GBFA 1TW2A 1LJ7A 5EJCA 2WQZC 4KH9A 1JYNA 1JHFA 4RLFA 3H8OA 2XWJB 2QQ8A 1SVLA 3KIOA 3FBNB 2IXLA 2PFBA 1Y0NA 3BG3A 2BE5F 2NS7A 4Q0SA 1FYUA 3S32A 2PHLA 4UB6C 2QQAA 2X5IA 4A3LJ 2DCTA 2O03A 3ZQFA 4UF0A 3CF2A 3BPZA 5FYVA 3ZQLA 4QXKA 4XJAA 3USUB 4EM2A 3DYPA 5K5OA 5C4XJ 5IOZA 3N9MA 4WCGA 4CXYA 1R081 1JZ7A 4UFMA 1BW6A 5FWEA 1Z78A 3BTLA 1U5ZA 1GYKA 5CQEA 1NYWA 4BJ5C 4BE3A 2PN5A 5C33A 4BMBA 4YYOA 2RQQA 1A34A 3LAPA 2GA1A 1PK6B 3ZXAC 3DF8A 2OQ6A 3AKQA 1ZHFA 2XROA 2DA4A 4TWTA 1Z21A 4KU8A 2A6TA 2XLFA 1D1CA 1ZBE1 2IFWA 3X29B 4XONA 1TNFA 3RQIA 1BK0A 2WNOA 1W8NA 1W36C 5FFZA 2VC9A 1GZTA 3V0BB 4UUVA 1QJY1 1EH8A 3UESA 4NAOA 5F6KA 5BNQA 4IEWA 2E1NA 4N0BA 2RDQA 1N1SA 2RMU1 3CJRB 4XDOA 5HS9A 3ZMVA 3S3NA 1LESA 3G3ZA 2JT1A 1MW7A 4BS9A 2CUZA 1N1VA 3LNQA 3V0AA 1RMU1 5FPAA 4D5FA 4Y1UA 1Q5OA 2GM4A 1APLC 1R9TJ 3ZP5A 3ERMA 3QD6A 4MHUA 5I0UA 2V4VA 3RPUD 4Q8LA 5FJKA 1DG6A 4PI0A 4EMSA 3ZKUA 3KP7A 2CSGA 3PVOA 1IDYA 4LJZF 3IIAA 2Z4FA 5FFXA 4MFDA 1FNYA 3ZDVA 1TL8A 1CF7B 1FZPB 4GMP3 2DA1A 1AR92 1OISA 3ASNH 3FKIJ 1YITI 4B3XA 1VNDA 3LSMA 2R073 2HYGD 1MR5A 3M3CA 4GIQA 4LBQB 1S0DA 5C4WA 1YRNB 4Q4ZF 2RHPA 3ML6A 2NVYJ 2UY9A 1Y8RB 1U78A 2M5WA 4N90A 4RAYA 3HYIA 5ICCA 4DEQA 3ZXGA 1PUEE 2VC1A 4F93B 2G19A 1RKTA 3MN2A 2VL8A 2A6WA 4RFT0 3P1IA 4E8CA 2D6MA 4CA0A 1JZ8A 2HDWA 4IEXA 3LDRA 2A69F 3EYYA 1PUFA 2GQQA 3HZJA 2HI3A 4JOMA 1CAWA 5FLXK 1O3RA 4QDSA 2EZIA 4YARA 5FWJA 2ES3A 3DPLC 1RUJ1 2C9AA 1FPN1 4QX8A 1WJDA 5F5QA 3QOPA 1OLQA 1JH5A 3K4KA 2Y6GA 2E2HJ 3VBOC 3I2KA 5HDKA 2KRCA 2W91A 3K4ZA 3WP6A 2IXJA 1J5YA 1TT0A 2WS92 4HXCA 3QH7A 1AXYA 4N9HA 1HXS3 3N9PA 3SH5A 5T5LA 2RR11 4CCCA 4XBFA 4I01A 3S5AA 5FZAA 5GADJ 3FM5A 3PJYA 3WQ1A 2X8KA 2OYZA 1IPKA 4PLMA 5FPZA 4IQ4A 3HOZJ 3RNSA 3P3PA 3J26N 4LBNA 1ETWA 1G9FA 1KQ9A 5FP8A 2KL4A 2ET7A 5FBJA 1U5TB 2XXZA 3KCYA 2HOEA 4I3PA 4AW7A 1PNGA 4CUGA 2V1UA 2P6HA 4XUPA 1S2KA 1ULPA 1Q3EA 3SDBA 5FREA 2JE9A 2CRGA 1H9TA 2NM1A 2XASA 3VKLA 1BA5A 1HQNA 1PX4A 1AL0G 3E7LA 2W5FA 5FQ0B 4IHTA 3W58A 2HXIA 3PURA 2FE3A 1RUE1 4DINB 4RFRB 3KT4A 4RR3C 4QX0A 2HWC3 3N36A 3BYWA 4Y33A 1TWGJ 3UJQA 3CEWA 2WS93 1Y56A 3HOYJ 2DQLA 1J3PA 2R7ZJ 3SZTA 1HDDC 5JSRA 3KV9A 3PMEA 1X36A 2CWSA 5EGOB 3LGRA 5FLHA 3AYCA 1Q8QA 2ICWG 4ENMA 4D7MA 1QNWA 4XXPA 1MZEA 4N53B 1FATA 1BHGA 1RUI1 3BR1A 3RZDJ 1H8VA 3ZQQA 2ZX3A 4XICA 3LOCA 4J19A 2Q5TA 2D3SA 1SZBA 3IMNA 2VAUA 4M3DA 2WUHA 4XORA 5JHUA 1QXRA 2C6SA 4RSUA 3HG9A 2FDKA 5FKOA 1T95A 4B47A 2W84A 1GU3A 4IF4A 3JQWA 1AVBA 3FE5A 1W9TA 3PVNA 1IS4A 2X53S