2GZWA

Crystal structure of the e.coli crp-camp complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
200
structure length
200
Chain Sequence
b'TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Crystal structure of activated CRP protein from E coli
rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 63
structure length 200
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gzwA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gzwA01
4CDGA 3ELKA 2DBBA 3C7JA 5K5OA 1YUDA 3IHUA 3GO5A 3F8FA 4M6XA 5E20A 3WE3A 1MZBA 3RYRA 2AS5F 4LLLA 2ETEA 5LHIA 4S04A 5DEQA 3BY6A 2XKOA 5L3FA 2XAJA 4MTDA 3SMHA 4HVRA 3PQKA 1S3JA 4U0WA 2YR2A 1ODDA 1Y3TA 3EQEA 1YW8A 4QXKA 2HQRA 4DNCA 3W6JB 1ZREA 1PUEE 2W24A 4OFGA 4MGRA 3F8NA 5K8SA 1O4TA 5FLXZ 2UWMA 4XFBA 3R0AA 5KVRA 5HLGA 2BNNA 4IRIA 5J48A 4KT5C 1JHHA 2GA2A 2MD5A 1YFYA 4XLNF 2XHKA 1ZZCA 3Q9VA 2RVCA 2VBYA 2PJPA 3WE2A 2VT3A 1J1LA 1TW3A 1BN5A 4ZYDA 2MLKA 4EROA 4MEXF 3LQQA 4OINF 5D4SA 5LRRA 4FAHA 1U78A 4LFUA 3GUDA 4M9ZA 1I1SA 4ZU7A 1ON2A 4K2EA 2EFQA 3KFWX 1G6NA 3JW4A 3EQLF 4QLCU 4XLPF 3BALA 4MGIE 2QBYB 3FF5A 4P96A 2D2WA 4FHTA 1HSTA 1F5TA 4PCQA 1UHWA 1U5TB 4IEQA 3TDZC 2DT5A 1P6RA 4IHTA 5I0TA 1OKRA 2OAZA 4HDUA 1H9TA 1R00A 4IRGA 3VOEA 3BROA 3VEPA 2J5PA 3UKTA 2VECA 5JFRA 4LB5A 1IXRC 1T98A 5FGMA 2IXHA 4L9TA 1IAWA 3K69A 4HOBA 2B8MA 3HRTA 1UB9A 4HQEA 2OZ6A 3LAGA 1FSEA 3J81Z 4G6DA 1IXCA 2VPVA 1CAVA 4O9GA 2CV6A 5AIQA 1U12A 4XF1A 2V09A 1IN7A 3OTFA 3C1DA 3F72A 4Q0UA 3H7YA 4PGHA 2D1HA 4MV2A 4ZU5A 1DGRA 3TNQA 1FBUA 3FWEA 2BEOA 2NNNA 4G6QA 1QBJA 2LF8A 3EHKA 1LDDA 4FBFA 3GZ6A 2GA1A 4QMAA 3LA7A 3PQJA 3NEUA 5D6EA 4KL1A 4EM2A 4M71A 2IA1A 4WF2A 2K0GA 2D45A 1SFEA 1B9NA 4IXAA 1PP8F 3ETQA 2Q8KA 3KEOA 4J1XA 2K27A 2VC1A 3LQRA 1ZGAA 2DAOA 2F5DA 1B1BA 1Z6RA 5BMZA 5BUVA 4MUVA 4ORFA 2O6GE 4KMFA 3R0JA 2OPKA 5CVJA 4KWLA 1WRJA 5KHGA 2IXJA 1YFXA 5LRSA 2W85A 3I59A 1UW8A 2Z99A 2A61A 2BNOA 1P2FA 1OYYA 3HT2A 2ISZA 5FLXK 5CVRA 2P8TA 3NVCA 2IA2A 1V4RA 3LA2A 1TW2A 1CGPA 1C0WA 1REPC 4OOIA 2HR3A 3H7JA 1J5YA 2IC1A 4MTEA 5C6CA 2FNPA 3GXOA 2F5CA 2W57A 4GO1A 4P9UA 1XCBA 3ZN0A 1RUOA 1ZH5A 3S7EA 4LTAA 4ENNA 1CAXA 4S05A 1TQIA 2C6YA 2JRTA 2CSOA 1QPMA 4Y15A 3MAJA 2NYXA 2ET7A 3I64A 1ZARA 3ZN1A 3U0ZA 3RJPA 4L2NA 2HTSA 1BIBA 2PHLA 3PLQA 3FFQA 2D93A 2FU4A 4B09A 4WBBA 3CO6C 5I91A 4AVCA 2OBPA 1DZTA 3NQOA 1ULYA 4LGWA 2R3SA 3QU6A 2EJRA 4HN1A 2PAEA 4G8XA 5ILUA 3DEUA 3M8EA 3MPBA 4RGSA 2M87A 3NL1A 3TNPB 3WU1B 4JBAA 3ZMVA 4U7BA 2CFXA 2QM3A 1VR3A 4XBFA 1KGSA 2X0LA 5BOXA 2XGXA 2A5YB 3DFGA 1ZRRA 2GC3A 3U9GA 3IRRA 5ED4A 2VBZA 3K1NA 1QQIA 4UNOA 3J81K 1S7AA 4TV7A 3W6KB 3IDCB 4D7SA 2HKXA 3TOBA 4KWJA 3EO6A 1YFHA 1FLIA 3N4MA 3EYIA 3CUQC 1QZYA 3Q9SA 4Y17A 3P9CA 1O3QA 2GH2A 1IN5A 2ZKLA 4LULA 2ZNYA 1T6SA 2DW4A 3TQNA 2EVXA 1KU3A 4PDKA 1Y9QA 1MJAA 1ZAOA 4L9VA 3I7DA 4JV4A 2Q30A 2COMA 4OIOF 2Q4SA 4ZZLA 4G9YA 3BPXA 3D5LA 2PQQA 5IT3A 2P5LC 5D4RA 5FLJA 4IEWA 4G7OF 1FY7A 2OU2A 3G73A 3BOQA 1DZRA 1T0FA 1TQMA 1XN7A 4BHBA 2VT2A 4Q5SF 4O3MA 3IBMA 4EJTA 2PAKA 2CGPA 4HQMA 4HSJA 4LG0A 1K6OA 2UZKA 1G3YA 1KU7A 4KIGA 3FJSA 4N0BA 2A07F 1G3TA 1R5HA 4CYDA 1CAVB 5ILSA 1Y0UA 3E6BA 5I0SA 5E1ZB 2GXBA 3TO9A 1YTYA 2ZMEA 4HW0A 1X7NA 2ZNZA 3RIRA 2YU3A 3P7NA 3MFKA 3EJKA 3HRMA 3KLOA 2Y0OA 5DCFA 1P92A 1FZPB 4PIZA 4XEZA 1XE8A 4WXDA 4R8HA 2JPCA 2HFHA 4MGKE 4ZU4A 5F64A 3GF2A 4UHTA 3QAHA 1H1MA 2QYOA 4BYYA 4RGXA 3OOPA 2QENA 4ETSA 3LAJA 2IXKA 3C3WA 4HX7A 4EGYA 4I09A 5E1WA 4KDPA 3F3XA 5D5VB 3ZP5A 2LDUA 1ZX5A 5JSPA 4LLNA 1LNWA 5J6XA 3KGLA 4G94A 1AOYA 1HW5A 4KN4X 1DDNA 1XB4A 1WA4A 3CUOA 3WW3A 2IXCA 4O6JA 2DLLA 3I59B 3T0YA 3WTZA 5J7MA 2V1DA 2FMLA 4XFHA 3WODF 3GYHX 2GQQA 4YIIA 3F22A 4IEVA 2QJVA 4KFCA 4Z2YA 3SXWA 4QGMA 1K78A 5TJJA 3GZ5A 3K1MA 1U6GA 3QP5A 1FPQA 3JAMK 2CWEA 4RAZA 5JR7B 1ZGJA 3SQNA 4GGGA 3CJNA 3K0LA 1QO0D 3JZVA 3F8CA 4UXNA 4LLOA 3QACA 1Q43A 3WGGA 4RB0A 1XSVA 1HKQA 3K9TA 2QQ9A 1KU2A 3ISPA 1UIJA 1USSA 4B29A 3VHRA 5E1XA 2H6CA 1UIKA 3ABUA 5BY5A 2PN6A 2KJCA 1ZYRF 2UY8A 1FXZA 1H0MA 2HYGD 4IJAA 1LR5A 5EEHA 1ZG1A 4WXCA 2C0ZA 2G9WA 4AIKA 1BC8C 4IESA 4EM0B 4MGYE 5DUKA 4AQ6A 4F8AA 4HVQA 3HYIA 4BAYA 1S7OA 1XGNA 4U0YA 4RB1A 4Q0SA 1X82A 3AAFA 2MHFA 1LDJA 1RI7A 2LKPA 1OR7A 3WTSC 2DQLA 3MEXA 2QQAA 1F9NA 1J3PA 4UV8A 3OD0A 2XLGA 3L7WA 5AIPA 4NB5A 2GAUA 4A0XA 1ZN2A 4OLLA 4I7HA 4CICA 1W5TA 1YYVA 4KICA 3CLPA 2EA4A 1KYZA 2KXLA 1K7AA 1FYKA 2FQPA 1E2XA 1XMAA 1SMYF 2DPDA 3BB6A 1SQ4A 3QPTA 1ONVA 3COAC 5HLIA 1CF7A 2FMYA 4XSZF 3WTXC 2V6CA 4U0VA 5K5RA 3JSOA 3MZHA 1YS6A 4JTNA 1WQ2A 4X6RB 2XASA 4Z07A 3FM5A 5HOOA 3BPVA 1OFNA 4EJUA 4LEJA 1B6AA 2RC4A 2V1UA 3DPLC 1PP7U 2ZBKA 5FQ0B 5LLQA 4MGZE 1J3QA 3RI4A 1J0RA 2K7LA 3BZ6A 3EBRA 2PFBA 1ZRDA 4M9SA 4HF1A 2JT1A 3OCPA 2FXAA 3GYDA 1R23A 3GEZA 3CDHA 2P5KA 2RNJA 4HX8A 1XGSA 5LGTA 1KQ0A 3DF8A 4IERA 4L0YB 3DKWA 1R1VA 3IWZA 3H1YA 1HW1A 5KHHA 3LSTA 2VBWA 1W5SA 3RKYA 4G7ZF 4LG0B 4QM9A 3RYKA 3GW2A 2Q0AA 2WV0A 5E8GA 4LA3A 1QZZA 3MCZA 2E1CA 1E17A 2GC2A 5IT9Z 1ZZ8A 3HQXA 2YX4A 4ZYHA 1JE8A 2ZMEB 3OGJA 2YPRA 3K2ZA 1I1GA 1W7PA 2RV8A 2VQAA 2XV4S 2E7XA 2TDXA 2QLZA 3FXQA 2B5HA 5KHKA 3I53A 1ZG5A 4I98B 1NE6A 3JSPA 4HDVA 4GXOA 1DPUA 2Q0OA 4QGNA 5I8SA 4I0AA 4HF2A 5FD6A 4AQ2A 1O5UA 2RGVA 2KIUA 4A0YA 4NQWA 3HT1A 4KA4A 3OV8A 3I54A 2MBFA 3E6CC 3KE2A 5L3DA 4R52A 3I58A 1SAXA 3R6SA 3WGHA 4L5IA 5FFXA 3E3VA 4BHPA 4L11A 1F4KA 1MD0A 1DP7P 4P55A 2HTJA 5FCCA 4P5OA 3CF6E 3M3IA 4UV9A 4LK0F 5D8LB 1CAWB 3KP3A 1J2XA 2HDCA 2FSWA 4PJYA 2XIGA 4EV0A 5DDGA 4QX5A 1YW9A 3KSCA 1L3JA 1QXJA 4M73A 5FDBA 2FF4A 2M5WA 3DQVC 1VTNC 2EB7A 2P6TA 4AWXB 5H6RA 1XDUA 2UXNA 2KKOA 3ZQ7A 1DUXC 3M1EA 1GVJA 2EV0A 2O1QA 4JVAA 3KP7A 2R7FA 4G7HF 2PI0A 1CX4A 3CL1A 5AONA 5JAXA 3I5UA 1IF1A 4NVPA 4YFXF 3H8UA 4CGZA 4YRDA 3P9IA 4L9JA 1KQ8A 4FX0A 4LA2A 1LRHA 4A6EA 3F8BA 1BI1A 5FLIA 2G7UA 5I8TA 3I71A 1FI2A 3GX4X 1RTVA 2XVCA 5L3EA 1OYWA 1OYIA 1FYMA 2OZUA 2VONA 3U1DA 3LWCA 3IRQA 1U3EM 4Q0PA 4IETA 1BIAA 1D8KA 4E2QA 4HLTA 1SD4A 1MGTA 1ZG3A 5D5WB 1EYBA 4UBGA 5JR3A 1HSJA 3RNSA 5BPIA 2GZWA 3SCHA 2D5HA 3RKWA 1WI9A 2DFIA 4MH0E 3I4PA 1TNTA 3J7AO 1Z1DA 4O5VA 3FZVA 2I45A 2H09A 5LGUA 2PFWA 4YARA 5IT9K 5E16A 3BP8A 3Q5FA 3P9KA 5JHUA 4BIFA 1EPZA 2IJLA 3FMQA 2UYAA 2BBYA 1YWKA 2F2EA 1I6XA 2ZKZA 1D3YA 2O8QA 3U10A 4LLGF 5DD8A 1QWRA 4HZFA 2XUBA 1LEBA 3B73A 3I0TA 5HDGA 1O57A 4MNUA 2VN2A 1DPRA 4NHJA 1J58A 2L01A 2NAZA 1OPCA 1CAUA 5T3NA 3NRVA 4E2SA 4IF4A 4HA8A 1ZRCA 4Q4ZF 4FX4A 3N97A 2N7GA 2CQKA 1RZ4A 1G3SA 3KGZA 3FXRA 3IL2A 2XAHA 1EP0A 2PEXA 1BJAA 2DK8A 3LFKA 2VOOA 4IEXA 3V7SA 4YNIA 5K5QA 4HVOA 1DGWA 1LJ9A 2PMUA 3VODA 2EK5A 1W7PB 4LMYA 2EFPA 4E70A 2LNBA 2MC3A 2JZYA 3LAPA 1U5TC 1XGMA 4RD7A 3SXYA 3MWMA 4KU8A 1R7JA 3O6BB 1XD7A 1IRGA 5E8IA 1YO5C 2XAQA 3E6MA 3SCFA 5CU1A 1UCXA 2IXIA 5BXXA 5LBQA 3CO2A 3DV8A 1TBXA 2EAAA 1O5LA 3C18A 3WTTC 4PIXA 2VOPA 3HOSA 2IXLA 3H50A 3F6OA 5J8FA 2MH2A 4GYGA 1MJBA 3CTAA 1AWCA 3C3VA 3ML6A 3WW1A 3FMRA 2K86A 5EEGA 1H1IA 3BU7A 1ON1A 5LEKA 4CHUA 3HTUA 5BPDA 4AXOA 4YIFA 2DO7A 1SEFA 3CJXA 3T8RA 5BPXA 4IEOA 5LEJA 1D8JA 4IEZA 2DI3A 3WW2A 2P7CB 1R22A 5FO5A 1TTYA 3TGNA 1XE7A 2H27A 2LF7A 5ERIA 2BE5F 1UFMA 2XKPA 3R4KA 2CW0F 2M30A 2Q2EA 5JSRA 5D1IA 1OMIA 1IPKA 4PZJA 2FE3A 3PVBB 5JVTA 1UHMA 5KHIA 3R61A 5J8CA 1UD1A 2OD5A 3HSFA 3V8KA 4IVNA 3F21A 4KWKA 2QVSB 1A04A 3CLOA 3USSA 2MA3A 2KJBA 3KP5A 4QGLA 4HLYA 2QWWA 2XAFA 4D0PA 3NW4A 2BV6A 1IXSB 5KK1A 3H3UA 1SFXA 2Y48A 1GQGA 1PMIA 1BC7C 1Q5OA 3VB2A 3E5XA 2FBHA 1NYWA 1UPIA 3GBFA 4YYOA 4Q48A 3ROUA 4XFIA 4KU7A 3L00A 4LUKA 5JI6A 3O2PE 3TO7A 2PTMA 3E5QA 2K9ZA 5L3GA 4RB2C 1R5GA 5DYMA 2IPQX 3G3ZA 4MQ9F 5I8YA 1OD5A 4ESBA 2ACJA 3UKVA 3HHHA 4HN0A 1JXSA 3S0MA 4OU0A 1RNLA 4YFKF 1ZZ6A 1IZ1A 2PG4A 2XLAA 2E7WA 4KIFA 1WWXA 2F5EA 3REOA 4BHCA 1B4AA 4N9IA 3IKTA 4I0BA 3E97A 1RC6A 5K1YA 4R79A 4Q29A 1HW2A 1S8NA 2ATFA 1B59A 3RPQA 1I5ZA 1CAUB 1CAXB 1B9MA 1GXQA 3GLXA 3ECOA 1R1TA 2MH9A 4P9FA 1FYLA 3ZMDA 2VODA 2D40A 2VXZA 3D0JA 3ULQB 1BI3A 4MEYF 5TRDA 3F23A 2QCSB 4A0ZA 5AVPA 4HF0A 4AD9A 2ZXJA 1XMKA 4ZYEA 3MZYA 1YG2A 1O3SA 2XAGA 5FFZA 5HI0A 3H1MA 3CUQA 1IN8A 2HOEA 1ZHFA 3H1WA 5CJ9A 1R58A 4L18B 2GXGA 4U7DA 1EH7A 4AVAA 5FPZA 2FBIA 4KN7X 1L0OC 2YSRA 1WLTA 4BH9A 4ESJA 1RIOH 2HQNA 1FNNA 3SHFA 3OF1A 1P4WA 2EWNA 2FEZA 3V8LA 3HHGA 4HSLA 2WTEA 3EYYA 3KZZA 4JQFA 2QVOA 2O61A 2O3FA 4UVAA 1V70A 4U88A 4UVCA 3FXUA 3E5UA 1Q3EA 1EH8A 3V8JA 3DL3A 3WTVC 4KYWA 5CADA 4EWEA 4ASNA 1LQ1A 4A2UA 3RZZA 2NNYA 2LSOA 2R7DA 2VC0A 1ZNPA 2OYZA 2P17A 2DU9A 4EMSA 2IVMA 4I3PA 4YFNF 2Y0MA 1WGPA 2STWA 4BNCA 2PHDA 4AIHA 5I0UA 1LEAA 3WTYC 2PYTA 1HXDA 2FA5A 4YG2F 1X8MA 5A2QZ 3SZTA 4CZZA 2PQ8A 1J75A 3QP6A 2O0YA 2KRFA 5KHJA 1Z91A 1O3RA 4AVPA 4WK8F 4A6DA 1X8EA 2QDRA 3J80Z 4M74A 4EGZA 4X6QB 4TLFA 1WKMA 5HVQC 1IUYA 4YSFA 5HS7A 1TNSA 2WWYA 3RPUA 2GC1A 3E6DA 1J7KA 2IA0A 1BM9A 3ZMZA 2CG4A 4F7ZA 2P7VB 1RGSA 4I2OA 1R1UA 2EFWA 2FNAA 2QQBA 2L02A 4MQVA 5HDKA 5I0RA 2Z2SB 3HIFA 4FT8A 2OA4A 3ZDSA 5H6QA 2H0VA 4Q0VA 1STZA 3ES4A 4M6YA 3LOIA 5D8KB 2MPFA 2W84A 4WXHA 4META 4LJZF 4OMYA 2GU9A 2PA7A 4ENMA 2Z5UA 3V7RA 3HSEA 4EJOA 4ZH4F 4ZYGA 4L0ZB 3IC7A 3KCCA 2XL9A 1ZLKA 3VFZA 1IPJA 1FP2A 2B9UA 2RKHA 3UKNA 1BBYA 5F1RA 4RS8A 1F1ZA 4GCVA 1PM7A 2XL7A 2VBXA 5FLHA 5BV6A 2A6EF 2WFPA 1K78B 1QNTA 4PIYA 5KBFA 2Z33A 2GC0A 1FX7A 2KIMA 1YFWA 2Z69A 4M72A 4OIQF 4XRFA 4XFFA 4LUMA 5ICCA 1YLLA 2G7HA 2CAUA 5ILVA 4WVZA 4M9XA 3JTGA 3FHZA 5JCTA 4QWQA 4Z82A 4KMUX 4HLXA 3HRUA 3RTRA 2L4MA 2Y75A 3ST7A 5C8WA 3T1BA 1FBSA 5H20A 1TLHB 3L2CA 4P9GA 3IDBB 4A12A 1S29A 1R36A 2FRHA 1YFUA 5EZWA 5ICFA 1ZZ7A 2MLGA 1T39A 2V9VA 2QNKA 3BPZA 2XLFA 3CUQB 4HYEA 5FD5A 2L4AA 3RKXA 4JTOA 5BS6A 4J1WA 1P4AA 1VJ2A 3LWFA 1KQ9A 4AIJA 1MKMA 2ZCWA 5A2QK 2O03A 3CEWA 2QUFA 4BQAA 2HEOA 4HAMA 2KIFA 3KP4A 2P5VA 4K8FA 1RUNA 1NXMA 2BGCA 5DCMA 2K4BA 3J80K 2CO5A 1PDNC 1YW7A 4AVBA 3IIAA 3L2HA 1CF7B 1VP6A 2FQ3A 2ZFWA 5FB2A 2IP2A 3QOPA 2A69F 1H9GA 4R1HA 1IN4A 2OA2A 1ZZ9A 3G7DA 3IWFA 2WC2A 2IW5A 4A5NA 2JPBA 1ZVFA 1FC3A 3T8TA 3ZMSA 2ELHA 1X3UA 2P6SA 4ENKA 2GWRA 2UXXA 4HV5A 2K02A 2EFOA 1NZCA 4UUVA 2DPUA 2EV6A 3HOTA 5BQTA 3R60A 5CVUA 3GVAA 4L5JA 4UXAA 2PMHA 5F6FA 3ACLA 1J9IA 3GFLA 1KYWA 3LZZA 3DP7A 2YX7A 4IRHA 3TDUC 1TQPA 2OQGA 3S2WA 3DXJF 2ESHA 1GXPA 1T2KA 2JSCA 4I01A 3F6VA 4RAYA 5EFUA 3PNAA 5LGNA 4CXFA 1BI0A 2H94A 4N9HA 4RGRA 1WSUA 4IEPA 1O3TA 1FT9A 1UCRA 1NE4A 3U11A 1P4XA 1I27A 4XSXF 3IKVA 2NRAC 3RYPA 3NKTA 2XRNA 4EJVA 4XF3A 1KA8A 1TQ5A 2UYBA 1FSHA 4MHGA 1MDMA 2Q1ZB 2B0LA 1ZLJA 5D6FA 3M8FA 1W7PD 2EV5A 2HGCA 1SFUA 4GULA 3SFZA 4I02A 4Y13A 3V4GA 2FBKA 1YHFA 2ET1A 1U2WA 5FPXA 3GFMA 2NS0A 4IHSA 3M70A 5JSOA 3NSTA 3SHRA 1D5VA 1SMTA 3L09A 1O7LA 3EUHA 3GFJA 1ZZBA 3K1PA 3MYXA 2ESNA 3D82A 1K79A 3WTWC 4QM8A 4PGGA 1FOKA 4KNYA 3NJZA 3O14A 3QU3A 3JAMZ 4HBNA 3DN7A 4KUMA 3CO7C 4HBLA 3WGIA 4MZUA 1EY2A 1FBQA 3KP6A 5L3CA 2CAVA 2HWVA 3HUGA 3WW4A 3TO6A 2M45A 1Q1HA 1RL3A 3T5XA 3EDPA 3U2RA 2DTRA 1J59A 5FQ0A 1QGPA 5LHHA 4ENJA 3ECHA 3JTHA 2ISYA 2K4JA 3BDDA 4ONUA 2DCTA 2HYFA 4Q0QA 4EWDA 1XGOA 3FHIB 3MDPA 2P4WA 3RDIA 3BWGA 2ADUA 3M7GA 4KIBA 3KETA 3FZ3A 2EA2A 4Q47A 1HQCA 4LB6B 1YIOA 2A6HF 4IEUA 5E18F 2A3SA 1LB2A 1ZRFA 3FMSA 5CLSA 2J5OA 2STTA 1GQHA 2M1BA 4XFAA 1FWZA 6PAXA 2L3DA 3LA3A 5LHGA 1HKSA 3QRFF 2HKOA 1Z6TA 3V7CA 4OIRF 3B02A 4EWAA 1IN6A 2VE9A 1YLFA 2M8EA 1Z05A 1QXRA 4IEYA 1W4MA 4EVIA 2PBIA 1IRFA 4CO8A 4E2GA 1JHFA 3FE5A 4XFGA 2DK5A 3S7IA 5DCMB 1S6LA 4EJWA 3MQ0A 4LK1F 1NHAA 4BXUA 2RN7A 4WZCA 4L9NA 4A5MA 1J3RA 3ZMUA 1JGSA 4XFCA 5HS9A 2HS5A 3WG9A 2XROA 3KZYA 1LDKB 4HMZA 2BNMA 1XSDA 2EA7A 1L3LA 4RGUA 2L54A 2Z9OA 1MJ9A 4ZZDA 3ERED 1SD7A 1Z9CA 2OZJA 3KEQA 2UY9A 5D5UB 2A68F 4HX4A 3H92A 1XDSA 2VE8A 5HDNA 2IT0A 4OIPF 4H0EA 3H3ZA 2H6BA 1OI6A 2QBYA 2D5FA 1CAWA 5E1RA 2JTVA 3KP2A 2PLYA 1U5TA 4OMZA 4D7TA 4DQ2A 3FX3A 2Z3YA 5HLHA 4FAGA 5HS8A 3FM3A 2GIVA 1XRUA 5CYVA 2PAMA 2X4HA 2BYVE 3H9AA 5ICGA 1G3WA 4ON0A 2AXLA 2W25A 1XSXA 4UVBA 5L3BA 2F4PA 3GFIA 4ESFA 2RQPA 3QPHA 3KMHA 1FP1D 3BCWA 2V79A 4HV6A 1O7FA 4JK1X 1G4DA 2O8XA 3TOAA 1BI2A 3ELNA 1LKNA 3BJOA 4EQQA 3SCGA 4IPAA 5DV5A 4DINB 5DD4A 3F8MA 4B8XA 1SD6A 3GWZA 4XF0A 5I93A 2ZO4A 3EETA 5DUIA 5D5XB 1MDMB 3ZPLA 3M9AA 5E17F 4XF4A 4EM1A 1YQAA 3TKYA 3WU0A 2HZTA 1LVAA 1KU9A 2RDPA 3HTSB 5CVVA 2ETHA 2OQRA 3L9FA 3PFIA 2E9QA 4O9EA 3HRSA 2V1XA 3KLNA 4WCGA 1EH6A 1XCVA 1YS7A 1EV7A 2D1VA 1JUHA 4UBHA 2HJIA 2DQRA 4H7LA 5CVIA 1U8RA 4WWCA 1V3FA 3HSRA 2MNGA 1Z7UA 2QZ8A 4LD5A 4WX9A 4MX3A 3WTUC 1HBXG 3ZMTA 3BJ6A 3DPTA 2IRFG 2ZJ2A 1GHCA 1SD5A 2E1NA 3ES1A 5ICEA 5J3UA 1USTA 4XETA 1HKTA 3SZPA 1T38A 2F5FA 3D0SA 1IW7F 1BOAA 3O3KA 4RB3C 4GYIA 2FOKA 1SFNA 2EFNA 1QY4A 2CYYA 3ABTA 3BJAA 4XF9A
chains in the Genus database with same CATH superfamily
2BHZA 3ELKA 4M4RA 2VW0A 5LBBA 2JKXA 1OCZH 5K5OA 4DXZA 3IHUA 4DNYA 3F8FA 4PDWC 1DFQA 3WX5A 1WLWA 4M6XA 5FZ4A 3THCA 4V1PA 2WS93 2VJIA 2RVAA 4ZXEA 3KCYA 1TVGA 4D5FA 2JN6A 1Y9MA 2QQOA 4ZONA 1AYM1 4C90A 4A41A 1R093 2XKOA 2XAJA 3SMHA 1H2KA 2DFHA 3PQKA 2NOGA 1V00A 1HLVA 3AYCA 5FY9A 1ODDA 4N43A 2PHUA 3L2RA 5FWEA 2P6HA 3CZUA 4DNCA 3IKWA 3SLIA 4XHXA 4ZXKA 4MGRA 2R7RA 1O4TA 5DUXA 1SC7A 3SH3A 3ECQA 2Y6HA 3I49A 4C1WA 3FLRA 2XRLA 4GWJA 2X1CA 2YDEA 2JRMA 2EINH 3ZXSA 1ZZCA 3O12A 3J7LA 2PJPA 4A3XA 1FNYA 2OCEA 2VT3A 1TW3A 3F2ZA 4MEXF 3LQQA 3ZKYA 2CQXA 4OINF 5D4SA 3UKGA 1OXCA 2XUMA 2WN2A 1AHSA 1KGYA 3NRUA 3S3MA 1MS3A 3S16J 2E53A 1JZ5A 1TME1 3BALA 3RSNA 2R5YB 3FF5A 3M3OA 2D2WA 1QVUA 2A6ZA 4PCQA 3WP3A 1AR83 2XBO1 1U5TB 4IEQA 4IQPA 2DT5A 2HOSA 4UFLA 3HJEA 4HNUA 1GZCA 1R00A 3VOEA 3BROA 2NN8A 4CEYC 3O0WA 1T98A 4D6SA 4HOBA 4CXWA 3DTKA 3HRTA 5M5XJ 4HQEA 3J81Z 1LGBA 4G3YC 2RS51 4E4SA 1XB9A 5IAVA 3CMAI 3GHMA 4O9GA 2CV6A 3QH7A 1B35C 1H8TA 5FTTC 4QDQA 1U12A 1UAAA 2V09A 2M0MA 3MGUA 3QYEA 1ULCA 3ZOIA 4AK3A 4Q0UA 3H7YA 5JOWA 4PGHA 5L19A 5DS9A 4MV2A 2Y6FA 5TSWA 1UMQA 2NNNA 4G6QA 2Z1DA 4DW6A 2R49A 5FP4A 3EHKA 2GA1A 1W1WE 1SBFA 1D4VB 3BTXA 1PVC1 3NEUA 2IS1A 2VOXA 2VQLA 1VBD3 2K0GA 4LR4A 2P3IA 4M3EA 2RS12 3ZXEA 2JG9C 4J1XA 3NV3A 3OYEA 2HLEA 3LQRA 4NMIA 5F5QA 3RJ2X 2F5DA 2WAFA 1VNDA 3POFA 1UZVA 1AHDP 4KMFA 2CDPA 2OPKA 3K51A 4C2UA 1F35A 1WRJA 5GLZA 5SV5A 1XE0A 1YJ9I 1QQP3 2IXJA 2W85A 3I59A 1UW8A 2Z99A 2Y6LA 2Y31A 2BNOA 1P2FA 3VDCA 4GFBA 1SFPA 2ISZA 2HQ5A 2EIMH 5FV3A 5IYYA 1TW2A 3HOVJ 1JYTA 4UFJA 1C0WA 1REPC 2I07B 4B3XA 3QCWA 5C6CA 3NWSA 2ELKA 4GO1A 4GB33 5TGTA 4BJ6C 3S7EA 4ENNA 2MGQA 1CAXA 3WF3A 5LFAA 4AHXA 3H9JA 2XJQA 1Y9GA 4E7KA 1BZWA 2JRTA 2V6EA 5GALA 3I64A 3ZN1A 2B63J 4L2NA 4KT6A 4MGQA 2W3JA 2O9LA 2WWUA 2E19A 1Y4WA 1RMU3 3AKQA 1MMSA 2OBPA 5IP7J 4ZS3A 3S5AA 1DU6A 3GZNB 1ULYA 5IK7A 3ACHA 2ZSHB 4ABZA 2EJRA 2D7FA 2PAEA 5FMCA 2KR2A 1JUSA 3D5RC 3WU1B 1NTCA 1VBB1 5A3TA 1SPPA 2AQEA 2LLKA 4XL9A 3H36A 5DZEA 4E7ZA 4PFPA 2XPUA 5FZDA 4UB8C 2VASA 3IRRA 4GMP1 4PSXA 4UNOA 4CDUA 3N9LA 4Q4Y1 4TV7A 3PVNA 3PIGA 3W6KB 3VD4A 2RJ2A 2DFBA 2VR4A 3EO6A 1FLIA 2WA3A 1QZYA 4Y17A 3GHNA 2JE8A 2ZKLA 3CCEI 4D6RA 4JV4A 4MXVA 3HMYA 2VVFA 2VZ3A 3VKOA 2WO1A 2P5LC 4COZA 5FLJA 1YOVB 2JX9A 1FY7A 1TZLA 3ZIXA 4ZPIA 4M3CB 3G73A 4COVA 4O3MA 2DFFA 4EJTA 4QDSA 4BE3A 5GZCA 2AH2A 3MIGA 1V55H 1K6OA 1AA7A 2E60A 1AR91 1W05A 1G3YA 5JI9A 4KIGA 3VPRA 2DOFA 2BBVA 1JYIA 4RS5A 4TN7A 2R043 5BNGA 2YC0A 4Z2AA 4HW0A 1FEXA 2L9SA 2CV0A 2PHRA 2YU3A 1POV1 3MFKA 3A23A 3EJKA 4OZOA 3KLOA 5DCFA 4A3MJ 3LDKA 4LHSA 2VOKA 4Q4X2 4X1EA 3KF3A 4YW7A 4WXDA 2W08A 4R8HA 4ZZ5A 1LE8B 2QGUA 4YW6A 3A03A 3GF2A 4UHTA 4R9CA 1VQPI 4RGXA 2E5ZA 3RS6A 4ETSA 2QENA 3F3XA 2X51A 4W8JA 2BFUS 2LDUA 2ID3A 3PMSA 5JZGA 2VIXA 4LLNA 1W8HA 3KD4A 1GP4A 4HK8A 1Z7S1 4ANJA 1EV11 4AC0A 3RZLA 1PVXA 3TEWA 1AOYA 3Q8CA 1HW5A 2GN3A 3J9SA 2IZWA 2JDYA 5C4WC 1XB4A 5KAFC 2NYYA 3W5MA 1ENRA 1VRH3 2IXCA 3I59B 4P9WA 2QSHX 2FMLA 3GYHX 4H55A 4YIIA 5CKNA 1ZYBA 4KFCA 4Z2YA 1JBCA 3N9OA 4W6XA 3GZ5A 5A7OA 1U6GA 1OQEA 3JD73 4QXHA 3IIIA 3T4VA 3LEIA 1PHMA 4LKEA 1QO0D 2HXOA 1JKQC 1MSEC 1YX5A 2M0CA 4B7EA 2MEV2 3ENRA 2GMPA 1MS4A 3K9TA 2QQ9A 4COWA 2HWD1 3MKZA 2WIIB 5E1XA 2H6CA 2QQWA 5FXVA 3ABUA 2UY8A 2W0XA 3UGHA 4OMDA 3ZN4A 3OIOA 1LR5A 5JLVA 1ZG1A 2VCAA 4AQ6A 4HVQA 3HYIA 2LM3A 3N3HA 2XF5A 3DEMA 1X82A 3ILNA 4Q0SA 2MHFA 1LDJA 1AJOA 1GUUA 4JQTA 2DQLA 2V4JC 1F9NA 3HNMA 2XLGA 5AIPA 3CNAA 2YGLA 1SPPB 3OYBA 3VKNA 1X2MA 2P34A 1W5TA 1YYVA 3BLYA 1K7AA 5FXWA 4CDUB 1D0GA 2YU1A 2WINB 2WT0A 3OGSA 2V6CA 4LPLA 2JE9A 3MF9A 1ETOA 2HVSA 3PUFA 1EUTA 5HOOA 1XNBA 4LEJA 4XMAA 2RC4A 1VBD1 2QQKA 2V1UA 3C7GA 3DPLC 2QQJA 2W00A 1R082 1VBE3 3VBUB 1ENXA 4MGZE 1NCRC 3DU5A 2K7LA 1O91A 3BZ6A 2W39A 3EBRA 5FBZA 1ZRDA 1B72B 2BPA2 5JXIA 3GYDA 4QU2A 3VB9A 5FKOA 5ISLA 2RNJA 1FOXA 1VQOI 2R1DA 4E6KG 1B8IA 5DABA 4L0YB 3ILRA 1R1VA 3IWZA 3RRDA 2Y33A 4BE2A 5GZFA 2MD0A 1JH5A 2VBWA 4NIIA 2VNGA 1W5SA 2A6YA 4FPHA 1A36A 1X3ZB 5E8GA 2WNVC 5JR2A 2F48A 1H6YA 2EIDA 4PT6A 4OI1A 4H2AA 2YX4A 2P3KA 2ZJCA 1S0DA 3K3NA 5HNFA 3OGJA 1VQ9I 3ORJA 4AEJA 4LKSA 4CCKA 2E6VA 4E7LA 4LE4A 2EZHA 1W7PA 2VQAA 4BQ4A 3G4SI 1V6NA 2E7XA 1S2BA 2TDXA 2QLZA 2BRTA 2FMDA 1Y8QB 3H8RA 3RI9A 1ZG5A 2DMPA 4HDVA 4GXOA 3TBIA 1MNEA 1WW5A 4AQ2A 2EXIA 5FRAA 2KIUA 3CF5F 3LNQA 2EIKH 3KEYA 5FBJA 5JZGB 1BCXA 2RQQA 2JG8C 1WFXA 3HT1A 4KA4A 1MZ5A 2JDKA 1LHWA 2DODA 4XLCA 2MBFA 3E6CC 4C9YA 2YG0A 4MG2A 2V1NA 5E79C 3BR2A 2M4KA 4L5IA 3N9NA 2XDVA 5M3FJ 2A6VA 3IPVB 3VN4A 2BW3B 1V9U3 1Z3XA 1J2XA 4MLOA 3CD6I 3VDXA 5E3LA 4XBQA 3B94A 2M4GA 3WG1A 3KV5A 2IGOA 4M73A 4OHYA 3OR1C 4B48A 1R1A1 3DQVC 3ETPA 3AL6A 1AX0A 4YRVA 5FZBA 2P6TA 5HODA 2KPMA 4XIKA 2ORZA 2UXNA 5EJZB 1DUXC 4JDMA 1XX5A 1ETXA 2DVBA 2O1QA 2P4EA 2OS2A 4G7HF 2HWB1 4JHTA 4YFXF 1GOHA 4PJ0C 4L9JA 1KQ8A 2HYJA 2OQ7A 1NOVA 5FLIA 3I71A 4JGYB 2JWPA 3GX4X 2IFWA 1LFPA 2D6NA 1VMFA 3ME2A 2DA3A 3AP9A 3B7MA 1NY71 1BIAA 2WAQN 4IETA 4E2QA 5HBAA 1LUJB 4HETA 4M3CF 4P5HA 4P9IA 1U0JA 4W1UA 3MHZA 5JR3A 5J1XA 4WZFA 1HSJA 4CDQB 1WI9A 2D3PA 4B4QA 3WNKA 3J7AO 4O5VA 3I4IA 3FZVA 2I45A 2PFWA 5IT9K 3I9V2 1OQDA 4BIFA 1QVTA 1WJAA 2ZX2A 5ANNA 1EPZA 4WM8B 2PMWB 2UYAA 5IK5A 4J6GA 2KFDA 1YWKA 1AVBA 1I6XA 2ZKZA 1JJ8C 4HNTA 1W5CC 2EF6A 2VMCA 1QWRA 2XUBA 2ZXWH 1WCDJ 3B73A 4D6QA 4FFGA 2VN2A 1SCSA 5J98B 4HFSA 4DRRA 1J58A 2L01A 1RUG2 4U87A 3P1IA 4J25A 4NRMA 4QQLA 4FTSA 3WHCA 4HA8A 4Q4ZF 1QHGA 2VXDA 3N97A 4V2VA 5FXXA 4UW4A 4Q2FA 1LHOA 2XAHA 1EP0A 2UWCA 3H3VK 1BJAA 1WA6X 4OI4A 4AHZA 1VBC3 5HXMA 4B1RA 3RPUD 4YNIA 5T54A 1NK3P 2LUWA 3VODA 2R7TA 1W7PB 4LJHA 4E70A 1BR4A 2RR12 4FQGA 4ARXA 4EATA 2Q8EA 4FCYA 3U1XA 3LAPA 1U5TC 3UJQA 1QRYA 3A4UA 1OURA 1K5MA 4MADA 1CZTA 5K7HA 1UCXA 3DV8A 3LSHA 4PJMA 4I76A 2N8GA 4GD4A 3SKJE 1O5LA 3C18A 3DEEA 2VOPA 5DAXA 3HOSA 2IXLA 3F6OA 4NC6A 4DZGA 4GYGA 1MJBA 5G04L 5C3QA 3ML6A 1JZ7A 3AKTA 3OD4A 2AENA 4HANA 4MO7A 2LP0A 1OH4A 4E8DA 3FMRA 4AI2A 1MW7A 2K86A 1AR61 4K40A 5EEGA 1H1IA 2WFF1 1C8M3 5J36A 3L2UA 3PU3A 1ULFA 1ON1A 5LEKA 3CCUI 2W2IA 5FYYA 3CJXA 3WQBA 5BPXA 1W0NA 1D8JA 5LWBA 1W6PB 3JBG3 2P7CB 5DQ0A 1R22A 1HC8A 5FO5A 1XE7A 3WNPA 3VL8A 1YRNA 4PJJA 3T0AA 1R4NB 3Q9OA 4KGQA 4IV3A 2M30A 1LVKA 5D1IA 1OMIA 1IPKA 5JVTA 4BEHB 4IOCF 2E7AA 4IUGA 2DXIA 4SLIA 1IOAA 1O4YA 3M4OJ 1N1TA 3JRFA 3V8KA 4A3KJ 1SFKA 2QVSB 1U5YA 3O1SA 4UFHA 3CJIA 2KJBA 4HLYA 1X4OA 4D0PA 1MBKA 3H3UA 1SFXA 2R30A 2LRDA 2WB1A 1Q5OA 2A3YA 4GWNA 1UPIA 2QQPA 1UZYA 4C3IJ 2XH6A 1ZBE2 3JB8A 4Q48A 5F08A 1MNMC 4YVSB 4XFIA 1FATA 4A69C 2BUKA 2VKEA 2VULA 3O2PE 2PTMA 2R7QA 4YPJA 4BUPA 3MV01 4P9JA 4UF0B 2QZ2A 5BNOA 1QGLA 5I8YA 2VJXA 3QOEA 3CMYA 1OD5A 1VQ8I 1FJLA 4M6VA 5IVCA 1WH5A 1RNLA 1WBLA 4LIUA 5IY5H 3ZXJA 4XOPA 4KIFA 3S8PA 3REOA 4N9IA 4I0BA 4FPKA 1JHNA 5K1YA 4R79A 1HW2A 1Z3YA 2XB6C 2HWF1 4Q4V3 5K0UA 3PUBA 3RPQA 1I5ZA 3U4SA 5GAHJ 1BK1A 1RUC3 4EYUA 1UL9A 1ZR4A 1R1TA 2LD5A 2K40A 3PJQA 4QQ2A 4LBLA 3SDGA 2VXZA 3DTIA 4FSJA 2Z16A 4EN6B 5LASA 2DT7B 1BI3A 3IT8A 2DBIA 1F36A 4MEYF 2AQFA 4ZTJA 2XPWA 3H9GA 4XRSG 1HCRA 3AFGA 2Q1FA 1ASJ2 5HI0A 3CU7A 3I3QA 5GPCA 3I8TA 1W9FA 3HBLA 3QPSA 5FLVA 2VQUA 5CJ9A 3R4UA 4OZXA 1U9NA 1ACIA 4PBOA 5FPZA 4Y22B 5KCMA 1L0OC 5FYMA 3HL2A 4BH9A 2HQNA 3T1LA 2JDMA 4BE0A 2QQVA 1P4WA 3PNVA 2K9QA 1DLCA 1REEA 3OL4A 3VBOA 4XPVA 5FO8B 2O61A 1T95A 2YPJA 3WDTA 3M3EA 5F32A 4JYKA 1UZ0A 1Q3EA 3I2OA 1EH8A 3OG2A 4ASNA 2L9NA 4A2UA 2WT2A 2LSOA 3BGAA 3E0JB 1GV2A 4XKBA 5KXDA 4EQVA 1PIV3 3JCUC 5H9RA 2P17A 4A7ZA 4EZHA 4J00A 4W65A 1QJU3 4YFNF 2R073 2JUCA 1UNBA 2PHDA 3K4DA 4AIHA 3MIEA 5I0UA 1MZFA 4G6TB 1FPN3 2BZTA 1Q8QA 4XUTA 2PQ8A 4OHXA 2KRFA 5KHJA 1Z91A 2G9FA 4WK8F 1AYN3 1PO21 1RITA 2W4SA 4M74A 1LOFA 1WKMA 4JKKA 4AYUA 2P37A 2IAIA 4CP9B 4YSFA 4NIDA 1BQPA 3CJIB 2LREA 1FOD1 3IDEA 5LCWL 1UAIA 3FIWA 3C7OA 5F04A 3O8GA 3UNPA 4NROA 5IWFA 2L7KA 1YCIA 1RR7A 2XB0X 2EFWA 3BCBA 4MQVA 2XOMA 5F2WA 3HIFA 3AZZA 5IVVA 4NRPA 2JA7J 5DDJ2 3ES4A 1MVEA 4OI0A 2HWC2 2W84A 3AK0A 4LJZF 4OMYA 2Z5UA 2L9RA 4EJOA 4ZH4F 3RQ0A 2VC9A 2XL9A 1ZLKA 3D6EA 1FP2A 2B9UA 4CZSA 1IUFA 2CHHA 1BBYA 1W0UA 3KS7A 1F1ZA 3AKSA 3HGYA 3GM8A 4QU1A 5FLHA 1NG6A 3I4MJ 1A5JA 5A3UA 2DCKA 4AG4A 2BZDA 4XC9A 1K78B 4AI8A 1X9PA 3KQ4B 1E5HA 1YFWA 2Z69A 5K0UB 3BODA 1BW5A 3ILFA 1AUYA 4Y1UA 4LUMA 1YLLA 1RUC2 1O4XA 2G7HA 2CAUA 4WVZA 5JCTA 3JTGA 2JWTA 1A6IA 2RS31 4QX3A 4QWQA 4CDWB 4HLXA 4CDUC 2L4MA 4I6ZA 3QODA 1ULGA 1FBSA 2WJSA 1K3IA 1GWLA 3CDZB 5FZOA 2OUJA 1TLHB 3L2CA 4P9GA 3J26N 3U07A 1R36A 3DWLE 4H4KC 1I9RA 2FDIA 4WVMB 3HOWJ 2R0QC 2XLFA 3I3BA 5A3OA 1HLCA 4HYEA 3VBUC 1UQXA 2D6OX 1D5YA 3LWFA 2XJVA 4HPQA 5K9YA 4AIJA 5C3OA 1MKMA 2DCJA 5A1LA 2WNOA 1EPWA 2O03A 1D4M3 3HNYM 2QUFA 3MV11 1OUSA 3JCIA 1PUFA 5JI7A 1GWMA 2EXKA 3ESWB 3ASOH 3G1OA 1E3OC 1RUNA 3LL7A 2GP3A 3BVCA 2K4BA 3J80K 3DCQA 2ZGSA 4QAWA 5FY7A 1YW7A 4UY8I 5HCBA 1SCRA 3L2HA 4XOGA 1VFCA 3O0XA 3K70D 4R1HA 1B09A 2OA2A 1ZZ9A 3G7DA 3OR2C 2IW5A 2CWMA 2JPBA 5A70A 5DM6F 1RUJ2 1X3UA 2P6SA 2GWRA 5EJ1B 1BEV3 3WUDA 3VKMA 1LODA 3JRHA 1JYXA 1J1TA 2EFOA 1COV3 4YELA 5F0HA 2Z4FA 5CVUA 5E3MA 3IV5A 1VMJA 5LD2C 1IV6A 4L5JA 3VBHA 1HJFA 2DA1A 2PMHA 2ID6A 2ADEA 5F6FA 4Y7NJ 1XJAA 1MS1A 2YC4A 2FCTA 3WCSA 1TQPA 2OQGA 3LOCA 2KRHA 2VTXJ 2ESHA 4QQPA 4I01A 5LK7B 5B3SH 5JZGC 4RMNA 4FTBA 3PNAA 1G9AA 4MYEA 1AKHB 2H94A 4N9HA 4RGRA 1A3KA 5E3NA 4IV1B 1FT9A 3ZXKA 3F95A 2LTPA 3ZPYA 4Y5TA 2R7EB 4GH4B 3LSPA 5J40A 3BTYA 1PM4A 3ZQQA 2ZGPA 2NRAC 2XRNA 3B9CA 4EJVA 2LBFA 3HOUJ 3DXTA 1KA8A 4D94A 4MHGA 1ND3A 1LPQA 1ERDA 2F4MB 1JT0A 3A4CA 3K4KA 2BJSA 4K7JA 2EV5A 1JYNA 4URAA 4Y13A 2BV4A 3V4GA 2FBKA 2ZBJA 1DHKB 2NS0A 2K9NA 5CQGA 3GLLA 1X9TA 5FKMA 1D5VA 1SMTA 4XILA 4OUEA 3L09A 3GFJA 3K1PA 2ESNA 2CW7A 1APLC 1JOJA 1K79A 4QIWN 4JX5A 2EZLA 1GOGA 5GM0A 2RS11 4MZUA 3N7LA 1EY2A 4CP2A 4BISA 3HUGA 2ZXIA 1UELB 2A5WA 3SITA 2M45A 1Q1HA 1RL3A 2J1RA 2J22A 1GV9A 3RI8A 3AP4A 2GNMA 5FQ0A 1JT6A 1BVVA 2XGEA 2Z5WA 1L7LA 2J1EA 1AJKA 4ONUA 4IL6C 1PX4A 3V0AA 2JDAA 2FQ4A 2RMU2 3BWGA 1XTAA 3NQHA 3M7GA 5M5WJ 4YVWB 5E88A 3TOJA 2BVLA 2D5VA 3FZ3A 5FZOB 3ZN5A 4Q47A 1K4SA 2RDRA 1HQCA 1YIOA 2KLOA 2A6HF 4HKWA 3ZFFB 5FKNA 5FPUA 2A3SA 4WM8C 1LB2A 5B2GB 2J5OA 1Z21A 2STTA 1GQHA 4O61A 3FKIJ 5T5OA 3O0VA 5LHGA 1IS3A 5GPAA 2A71A 1HKSA 4PHZA 4AQSA 4AI9A 1FYUA 4OIRF 4XABA 4GWIA 1YLFA 1QXRA 1GV5A 4CO8A 3SC7X 5LA0A 4FP3A 2CW8A 5GP9A 1SG3A 1S6LA 3MQ0A 4LK1F 1Z77A 1J09A 1OQ1A 1NCQB 3VGIA 1GICA 1WD4A 2LRPA 1HRI2 4XFCA 2HS5A 2XROA 5FY0A 2DT6A 1BBT2 1BJQA 2C1FA 3SEQA 4HMZA 3PIJA 2XQXA 1XSDA 2EA7A 1L3LA 2WQ4A 2O14A 2HH9A 5GAGJ 1CPMA 2L54A 5JMCA 4H7MA 3HNBM 2V73A 4AGVA 2OZJA 2K46A 3S5QA 2A68F 1S5LC 3H92A 4RR3B 1N77A 4OIPF 5HDNA 1CQ9A 2H6BA 2YV8A 3KP2A 1XS9A 2PLYA 4D7TA 1UF2C 1X2NA 2JDPA 3THDA 1A8MA 2Z3YA 5HLHA 4FAGA 5HS8A 2VJ5A 1RUE2 5AVAA 3URFA 4AL9A 1MVQA 4FISA 4Q4W2 4PBPA 3TEXA 3LSMA 3GFIA 3AMQA 3MVPA 1FP1D 2V79A 5H9SA 4HV6A 1X33A 4OULA 5M0TA 4EQQA 3U14A 1J83A 2CMPA 5LA9A 4AVVA 1RUH2 2BWAA 1D0HA 3WU2C 5DD4A 2P5BA 3F8MA 2V5YA 2XXZA 4XF0A 1K42A 5DUIA 1ND3B 2ZS6B 3M9AA 4XF4A 5LATA 4EM1A 3LDRA 1IG7A 5F7UA 3WU0A 1LVAA 3GTMJ 3WNNA 5CVVA 2OQRA 5FUIA 3CQZJ 5K7ZA 4Q4X1 3HOZJ 4DB5A 4QHBA 4II2A 5GTHC 1AXZA 2D1VA 3H0GJ 1MEC3 5KR7A 1J84A 5C44J 1T2XA 1Z7UA 1D0YA 3K2AA 3VZMA 1GT0C 1XSRA 4JAAA 3LB9A 3OEAA 3HUGB 3UGFA 2Y0SN 2E1NA 3ES1A 1F15A 1USTA 4A3JJ 4WM7A 2WKKA 1HDDC 4HSRA 2ZB9A 1VLNA 4RB3C 1MBEA 2DU0A 1CPNA 1MBJA 2VUAA 5C4XJ 4D69A 2R4GA 3ABTA 2Q2EB 1I3QJ 2WAOA 1AXKA 4LKDA 2NXNB 4XF9A 4CDGA 2HDDA 2DBBA 3C7JA 5FZ9A 2VZ1A 5BNPB 4A3GJ 3GJBA 3GO5A 3TAYA 4ZDLA 2MEV1 1XMXA 1YQ2A 3OS0A 3VSKA 2AS5F 2KZGA 3I55I 5EG0B 3BQYA 4LLLA 1ODMA 2ETEA 2KA3A 4S04A 1RC9A 4XQDA 3BY6A 2ZZQA 2X8KA 1G2HA 2CGOA 1S3JA 3MN2A 3R05A 1UY0A 3I2DA 1Y3TA 4BK5A 1ZREA 2W24A 3NAPB 5LZ6A 1A8DA 5FLXZ 2NMOA 3SDBA 1GP6A 3OYWB 4ZKTB 4XRMA 2JJ7A 4KT5C 3HAGA 4LO4B 1LECA 2MD5A 3RZKA 4XORA 2RVCA 4BJ5C 1U5XA 1JHJA 2Y69H 5FYZA 3WE2A 2MLKA 1QPIA 1VB4A 4RAFA 5A3NA 2Z79A 4DUWA 5CG9A 1REDA 4ES9A 1W99A 3O1VA 4K2EA 2VTFA 5EQUA 1L7RA 3JW4A 3TRSB 4XLPF 1JZ6A 4MGIE 1R081 5JXGA 3UYJA 1PGW1 1C4RA 4ZY9A 5FKCA 1K5MC 3MICA 4L8QA 4Q5OA 3TDZC 1P6RA 4GALA 4IHTA 5I0TA 1OKRA 3J7ZI 1DG6A 1WMXA 5GADJ 3VEPA 3UKTA 5JFRA 4LB5A 1IXRC 3PO2J 3KWVA 4LNVA 2LKXA 3VZOA 1OCTC 4L9TA 3K69A 2B8MA 2JVGA 1OISA 2E34A 3WHBA 3LAGA 4UT5A 1SLLA 4QKDA 5HCAA 4C1XA 4JP0A 4LO8A 5HCFA 3WG4A 1CAVA 1QXPA 3LSJA 4CXYA 2WT1A 2KISA 2R93J 1LOEA 1VBA3 1FIAA 1IN7A 3OTFA 4LOTA 4A42A 3C1DA 3F72A 5FMOS 3G1LA 3BR3A 4CCNA 1DGRA 5EIYB 4KMQA 2BEOA 1QJY2 1SFOJ 3I2JA 2BOLA 3MO4A 1SACA 2PJRB 3PQJA 4DBRA 1VQLI 5D6EA 1QOSA 3POBA 4WF2A 5F1JA 1SFEA 1B9NA 1PP8F 4XHBA 2XJSA 4Q1PA 2FCUA 3KEOA 2LR8A 1TWAJ 4A44A 4DEQA 4JOMA 2YGMA 2R7XA 1B1BA 4YG0A 2WNUA 4A3CJ 1Z6RA 3PDQA 3K2OA 4PDWA 3FXOA 3CJIC 5DZFA 4KWLA 5FYIA 3WV6A 2P6CA 4CCCA 2A61A 3UL2A 4M4PA 3PNYA 3HT2A 3WP5A 1ULOA 2P8TA 3ZSLA 3LA2A 4XJZA 4XLEA 2WBKA 2FNPA 3GXOA 3GJAA 2F5CA 1XCBA 1OBNA 4PF1A 1PNGA 3H5AA 4II3A 4UUSB 1RVF2 3AXDA 1DP3A 4OQ9A 1RHI3 3W58A 4E4HA 1BIBA 1SHWB 2PHLA 1ZRIA 2UURA 2FU4A 5I91A 4AHWA 4NHXA 1K6YA 3K4CA 2R3SA 2GXAA 2ZJRF 1JGGA 1UY2A 4HN1A 2DCZA 1V5GA 2CU7A 2HWE2 1ZKGA 4G8XA 3DEUA 2E7QA 1W2UA 1HXS3 1OT5A 1R64A 4RGSA 3CDLA 4HL0A 1G9DA 5C5UA 2PMZA 5K0UC 3QLQA 5ANQA 3CCRI 3EB7A 2GMEA 1XYOA 3SQOA 4WV8A 4U7BA 2CFXA 2QM3A 4XBFA 2E1OA 2X0LA 3WDVA 4BQOA 5B4NA 4AIDA 1XOYA 3DECA 2XGXA 2A5YB 2XQRA 3IUOA 4CDWC 2MG4A 1WZXA 3K1NA 3KT1A 2QQUA 1RIRA 3J81K 3BIEA 1Q8OA 3RGBA 1HJGA 5A3MA 1GYKA 3TYJA 4RM3A 1SMVA 3WDUA 4KWJA 3KHCA 1YFHA 1DQ4A 4LXLA 3EPZA 2F6BA 4NIHA 1O3QA 1IN5A 2DW4A 2EVXA 1Y9QA 2CUJA 3I7DA 5B1AH 1C8NA 4AEKA 3DUIA 3BPXA 3D5LA 5J4VA 5IT3A 3ZYGA 4UWDA 4E7SA 5LY1A 3BOQA 1ZELA 1DZRA 1C1LA 1T0FA 1WJFA 3DYOA 4XMYA 3WXPA 1RUG1 1TMF2 2G9ZA 3WOGA 2PAKA 4KBZA 5EGOA 4GQ7A 3FK7A 2ZEZA 3OYAA 1DQ5A 2IFRA 2VO5A 2R7ZJ 2JUGA 1D1BA 1K12A 3WDWA 4CCDA 1G3TA 1S2KA 3D4KA 1CAVB 2WZPP 3VZLA 5FZEA 5D8AB 4QHOA 3ZM8A 3P7NA 2Y0OA 1Y7BA 1LFBA 1FZPB 4XEZA 5F39A 4OWRB 4Y5SA 1MIJA 4LOCA 4DYQA 1QDCA 1KJRA 2JPCA 2RR11 2HFHA 3JRIA 4ZU4A 3V65A 1VZ0A 2QYOA 1DDLA 2X53S 1VQ4I 1U0AA 3KCXA 3LAJA 4PQQA 4XJAA 3C3WA 3J8F3 4I09A 5E1WA 4E27A 5D5VB 4F52A 3ZP5A 3GNEA 1HKDA 4Z2WA 3KM5A 2O7OA 5JSPA 2GSYA 4UW3A 2EZIA 4B3NA 1YITI 4IV1C 4G94A 3X29B 1SLAA 2WNUB 4BA6A 4GH4C 1DDNA 1WA4A 2NMNA 3POIA 3CUOA 2BQPA 3LFMA 4O6JA 3BTAA 4AHYA 5FYUA 2PLV3 3WDYA 2V1DA 4FPYA 4XFHA 3WODF 3GMEA 2CV2A 2JECA 5TISC 4QGMA 1H6XA 1UU5A 4Y1XA 2CWEA 1WGXA 3CJNA 2LMDA 3JZVA 4UXNA 1KS5A 4DEVA 2R5ZA 4LK6A 3HEIA 1RPWA 4CYCA 3ON7A 3WGGA 2DU1A 4DY3A 1GZWA 2B42B 1TWCJ 1UIJA 4H14A 4V2WA 3VHRA 2HEVF 4YW3A 3NV2A 4L5EA 1JMUB 5DN2A 2EBIA 2KJCA 1ZYRF 4K9SA 4HNVA 4BWOA 4WXCA 3QYFA 1S0JA 2FCVA 3KYCB 4IESA 4MGYE 4COUA 2Q5TA 3V0BA 1S7OA 1XGNA 5ACA2 2K5CA 4RGAA 1W8ZA 3WR0A 3WTSC 3MEXA 2FDJA 1CQTA 1J3PA 1VPHA 2FDKA 3ZSEA 2DJIA 1A78A 4I7HA 5JLWA 4KICA 1KYZA 2KXLA 1G7YA 1ZBE1 1FYKA 1W3VA 5DG2A 4YVWC 3O1RA 1JYVA 1XMAA 1UOGA 1JTYA 1SQ4A 3BB6A 1JJ6C 2VNVA 1OA4A 3W2VA 2VBDA 3COAC 1VAMA 5KC5A 2FMYA 4MGTA 4FP2A 3WTXC 2CS3A 5CFCA 3C7EA 2NVYJ 3W2WA 1OFNA 4EJUA 1N1VA 1X36A 1B6AA 2DTZA 1PP7U 3ZFEA 4P9YA 1ZGWA 4E8CA 4V2GA 2YHJA 1IKPA 3UJOA 1Q8PA 5A32A 4M9SA 3U37A 3OCPA 1MS8A 3B6CA 3OPZA 2LVSA 3IH3A 3BU0A 3CDHA 1W03A 1XGSA 2Y34A 2X29A 4TTGA 3JRCA 3HC7A 2FJ1A 2WAAA 2HXIA 5JVVA 3TN93 3H1YA 4XKVA 1HW1A 5EGOB 5KHHA 3K4JA 1QU0A 4G7ZF 2PELA 1QU3A 2J1AA 3RYKA 3HPHA 3D8CA 2WV0A 4LIVA 3DTEA 1QZZA 3MCZA 2BDRA 5C8CB 1XYPA 1ZZ8A 4DZPA 4RR3C 2YFZA 3HBKA 1AR72 1ASJ1 5K7FA 1I1GA 2VCBA 1YEWA 3UK9A 2XV4S 2AEYA 3FXQA 4M01A 2B5HA 3S57A 3GTLJ 5JVGF 1NLQA 3MIBA 1HN0A 2EIGA 1BR2A 1RUI2 1NE6A 1QDOA 1DPUA 2AXTC 4FFFA 4QHZA 4I0AA 4HF2A 4HT1T 5KXEA 2IWGB 4DJAA 3H9QA 1O5UA 3PUSA 4Y1YA 4NQWA 5FZFA 3T2OA 4XLFA 3K4NA 2F4LA 2CYFA 3IDAA 2K85A 2VKDA 3POJA 3IZOA 1LAJA 3I58A 1UX6A 3R0RA 3S6PA 1TNRA 3ABKH 3CKHA 2AC1A 2NZ9A 5FCCA 4FE7A 4JQRA 2AZ5A 3MKYB 1H2LA 4XUQA 1QJZA 4V2FA 2JDZA 1NLRA 3M3IA 1Q56A 4LK0F 4IGPA 3OWTA 4C3JJ 1CAWB 1W8FA 2H1KA 2FSWA 1ND3C 2ARXA 2XUEA 3U4XA 5M3MJ 3ZXLA 4RDUA 1SVMA 3ASNH 5SV8A 4FE4A 1A6QA 2XPJA 1H2MA 2FF4A 2M5WA 4FFHA 4MGSA 4RHV3 4A7KA 2WQZC 5FYHA 2B45X 3N7MA 2QKDA 2VU9A 1W6OB 2BXZA 4I3GA 3PO3J 2DOAA 5H6RA 4M0NA 4JKMA 1SAUA 1RUF2 3ZQ7A 1GVJA 1GZWB 3TP0A 5CA6A 3KV6A 1ITYA 1EAH3 1PX3A 2R7FA 2PI0A 1CX4A 1HRV2 2OV7A 2TNFA 4BCUA 4XBLA 5A7WA 4PK4A 1LRHA 4A6EA 4LO5B 3V0BB 2KMUA 1PMHX 1NQDA 2XJRA 2VBPA 1FYMA 5IVBA 3CMEI 4YG3A 1NCRA 1VMHA 4BKXA 3LWCA 1U3EM 5FIXA 1YIFA 1HF0A 4BIOA 4HLTA 1ZG3A 5D5WB 4BQNA 2VUJA 1UZWA 4LBNA 1V6IA 5BPIA 2GZWA 2ZZJA 4FO9A 3BTLA 3RKWA 1O6UA 1E5RA 4L9BA 5DDJ1 3CESA 2VOVA 2H09A 5LGUA 4YARA 2HWC1 3BTJA 4HOOA 3K4ZA 1W36C 3BP8A 3Q5FA 3P9KA 3OUIA 4R4XA 5CQEA 5CFCB 1OVPA 2IJLA 3FMQA 3ZN6A 2BBYA 4XKWA 2NM1A 3ZFEB 4A3LJ 5B5EC 3I0TA 2A7AA 1QJFA 3AYEA 2WY8Q 1G59A 1QJX2 2XVKA 3S93A 3WF1A 4XKCA 3HZJA 3MW4A 5T3NA 3NRVA 4HRIA 3P5JA 1R71A 4IF4A 1QNYA 2J1VA 3AKPA 1T6BX 3VBRA 4BQWA 4FX4A 4ASLA 2CQKA 1RZ4A 2PHXA 5HV0A 1AYM3 3IAQA 3FXRA 2ZX3A 3CCYA 3IL2A 2B9VA 2DK8A 3CMGA 1LOAA 2BGOA 4XE9A 3VDDB 3S32A 1NH3A 2JG8A 2IS4A 3AKRA 3T0BA 3V7SA 5K5QA 2E26A 5F3EA 3PUAA 3CZJA 3FUQA 2ZHKA 2EK5A 2EFPA 5DMYA 3V42A 5F3GA 2MC3A 3K48A 4YIRX 1XGMA 2D6KA 4RD7A 1M4WA 2A70A 1XD7A 5E8IA 5JPNB 2WZR2 4XDOA 5CU1A 2ZABA 2IXIA 1WCQA 5BXXA 2KIQA 3CO2A 3TBDA 1UYPA 3PMEA 1PO12 4K1ZA 3JQXA 3CTAA 1AWCA 1TME3 3C3VA 3WW1A 2VUCA 5FRMA 2DJNA 4LT5A 3G6JB 2XBO3 3BU7A 4P9LA 3G1MA 1HV0A 3HTUA 5BPDA 2YXSA 4AXOA 2R7OA 4CDXA 1POQA 4BM8A 1MZ6A 1UY1A 4DFSA 4IEZA 2DI3A 1YI2I 2TUNA 4WVWA 3UGGA 2H27A 4C3HJ 4Y1ZA 1W8NA 2XKPA 4Y20A 2RS53 1IS6A 2FE3A 1H1AA 4PJLA 5JWPA 2OUHA 3R61A 1SANA 4OAYA 2C4XA 2OD5A 3HSFA 2LK2A 3OOUA 4X6AJ 4JHZA 3F21A 4AVSA 4KWKA 3FUOA 3MIHA 1A04A 3CLOA 2YPDA 4IE7A 3QBQA 3KP5A 2CH0A 3N7JA 2QWWA 2XAFA 1YJWI 5GZGA 1MH3A 1GQGA 1PVC3 3LSEA 3T08A 1UU4A 2DWRA 2VQTA 3WNLA 4OUMA 3GBFA 2FBHA 1NYWA 2W7NA 4AWDA 3ROUA 2ZJQF 5FJHA 4XR6A 4KU7A 5JI6A 1HDPA 4AAPA 1T33A 2W1QA 2VQHA 1VQ6I 1UMHA 3G3ZA 3WNMA 4ZTFA 2P3YA 4Z1VA 4U2AA 3UKVA 3ZRGA 1PK6A 4LLFA 3S0MA 4AUXA 3NARA 4FTEA 4NOTA 4BOWA 1XYNA 3FDYA 3HB9A 1WWXA 2F5EA 1G9CA 5IK4A 3DPRB 3IKTA 1XXNA 3FL7A 3H3LA 2FOWA 2FZ1A 1DGWY 5JLXA 2NVUB 5EPAA 2R5YA 3PIOF 4QPIB 4J19A 3CCJI 1B9MA 1C3HA 3GLXA 2DUOA 1RKWA 1OLRA 2B7YA 1FYLA 1AYM2 3ZMDA 3PTYA 2VODA 4RN5A 2D40A 4HG6B 5IK8A 1OQYA 2RMU1 3H5NA 3ULQB 1OKOA 1JYCA 5FK7A 3WF4A 5TRDA 3OYHA 3F23A 4A0ZA 1MSFC 4AD9A 1QH6A 3ZYRA 2ZXJA 1ZBA2 3MZYA 1YG2A 3CF2A 5FFZA 3H1MA 1VBB3 3VBSB 5C3PA 3H1WA 1M1EB 2GXGA 3U75A 5C71A 1EH7A 1C5IA 3WUCA 4AVAA 2FBIA 4GMP3 2A05A 2YSRA 1WLTA 4ESJA 4Q4Y3 3AZVA 3SHFA 3OF1A 2OIIA 1MS9A 2FEZA 1TT5B 2EIBA 2ARBA 5EZHA 2O3FA 3UT0A 1V70A 3VKLA 3LSRA 4UVCA 4MOAA 4P5YA 2WSVA 4AEDB 1W2OA 1HRI1 3DL3A 3WNXA 1N1YA 1BBT1 3NV4A 1KITA 2VMDA 1XNTA 2NNYA 4M00A 1ZNPA 2DU9A 4EMSA 3W21A 2IVMA 3BTCA 1QNWA 3E1SA 2G1MA 2Y0MA 1WGPA 2STWA 4F3JA 1IGOA 4O7XA 1WJCA 2D6LX 1AR93 1H0BA 1HXDA 2FA5A 4YG2F 2GN7A 5A2QZ 4YFZA 3CP8A 3P3PA 1AL22 1D2QA 5CFDB 5L9BA 4AVPA 4A6DA 2LW8A 5AC92 1RUD2 3BC8A 4YGCA 5F37A 4CUAA 2WNUC 1RUE1 5HVQC 3GTKJ 1POV3 2E35A 1V6JA 5HS7A 1DYPA 4Q4W1 2WWYA 1KDMA 2NOJB 3S1MJ 1KFUL 3GZEA 4U36A 2GC1A 4BZ4A 2IA0A 4BQ1A 5FKLA 3ZMZA 3N35A 2XVLA 2CG4A 2VZVA 4LBMA 4F7ZA 2P7VB 3RMYA 4I2OA 3WZ1A 4G12A 5FYCA 1WD3A 1RUH1 1PZ7A 1WMEA 4FT8A 4AYBN 2OA4A 4ATFA 1QZEA 4LBOA 2X1DA 1GMMA 5F3IA 1STZA 4M6YA 4PQ9A 4BDYA 1Z7S3 1FMD2 1EV13 3WD5A 2I74A 2MPFA 5DTDA 4META 3OEBA 1LKXA 5C3EJ 4IDZA 2GU9A 4MFDA 1SFYA 3BG7A 5J37A 2DYRH 3AC0A 5FUPA 4EN8B 4A3BJ 5FZHA 4XCAA 4L0ZB 3LQCA 1PK6B 1IPJA 2D97A 3VSLA 4AU7A 5F1RA 5C9AB 3AZWA 2XL7A 2VBXA 2KHMA 2A6EF 2WFPA 3CJTB 1FNZA 1JU4A 1QNTA 4PIYA 2Z33A 2GC0A 5E89A 1FX7A 4INDA 2KIMA 3ABMH 5IP9J 2QQMA 2HWD3 3EUHC 3K4LA 1QHDA 4KMUX 4M3CA 4YLZA 1WZ2A 1Z0XA 5T55A 1OLMA 3I4NJ 3ST7A 1TNFA 2WBMA 3ZGKA 3VYSB 3OOXA 2JJ6A 4FQZA 4AGGA 2AHQA 4R9BA 3OSDA 5AFEA 5CKQA 5F9TA 3UR3C 5K4LA 5EJ3A 2ARAA 3NMBA 4BQAA 2KIFA 4XJ9A 3OBTA 4K8FA 1NXMA 2DA6A 3AVSA 1T0FC 5DCMA 4NHMA 1RJ7A 5KWRA 3GBGA 2CO5A 3D5OA 5C7GA 1LE8A 1CF7B 1W9YA 2FQ3A 2ZFWA 2KDZA 4OMCA 2A69F 1IN4A 2R062 3RG0A 4LKFA 3IWFA 2WC2A 3WQ1A 4A5NA 4BACA 1VQNI 1H30A 5C8CC 1TEIA 4GMP0 4IGQA 2E51A 4UUVA 2RM22 2JDNA 1SLIA 2HYKA 5FY5A 1ST8A 1IZ3A 5LA1A 3ASIA 3LEMA 3ZYIB 3VDAA 2W47A 1JKRC 1EJ9A 3ACLA 4FPLA 1J9IA 3LZZA 1FMWA 4FTHA 3S15J 4X8PA 3TDUC 4XIOA 5APAA 4JZRA 1QOTA 2JSCA 4OAZA 5A7PA 2NS7A 4RAYA 4PUSA 3C8XA 3M7AA 5DPNA 5FYVA 2DA7A 1WSUA 1O3TA 3PSIA 1NE4A 2WS92 4QKBA 3KQRA 1UXXX 2HQAA 4KI5M 1R092 4NUBA 2V4AA 4XF3A 4FETA 1MDMA 2Q1ZB 2B0LA 1ZLJA 2B39A 3M8FA 2HGCA 1SFUA 4I02A 5FPXA 3GFMA 4YW2A 4IHSA 4JKLA 1QJY1 1POV0 1D7PM 2DVGA 3NSTA 3SHRA 3Q3SA 5J96B 3D82A 1MBHA 4KNYA 3NJZA 2F6CA 4O65A 4FOWA 4HBLA 3WGIA 4PI0A 3RZGA 1FBQA 5L3CA 1OSGA 2HWVA 1R49A 2RG4A 1TT0A 1GSLA 4Y5Z0 4JDNA 2W9XA 3VWBA 1R1A3 3U2RA 1UWWA 2DTRA 1BYHA 1J59A 3VBUA 4V19K 3ZO0B 3TWIA 1MH4A 4CP1A 2ISYA 2K4JA 3BDDA 5LY2A 3I3LA 1B72A 4S2DA 3DKYA 1WW6A 1XGOA 3X2QH 3O5SA 1FMVA 3HKZA 4X0GA 2L7FP 2P4WA 1AR82 2K2SA 4JC1A 2HWB3 2J1UA 2VQGA 1DQ0A 1Q8SA 1LEDA 5FPLA 4LB6B 4IEUA 4W6WA 1RVF1 5CFCC 4QX1A 5FZIA 4XACA 4HPKB 1VRBA 2VZQA 3ATGA 2Y26A 4XFAA 1FWZA 6PAXA 2JICA 2ES3A 2RNGA 1GANA 2RAEA 3ZFEC 4NAMA 2D98A 5FZ0A 2DURA 3V7CA 2RV9A 3AKZA 3A0BC 3UNGC 5IOZA 1Z05A 1W4MA 4K3UA 2HWE1 5GLTA 4XFGA 1GWKA 3S7IA 4N7UA 5FYSA 5DCMB 3GALA 4EJWA 3H1CA 3MZ8A 3WT3A 4A5MA 3ZMUA 3IH2A 1JGSA 2EIEA 1VBD2 5HXVA 1LDKB 1K45A 4MFEA 2LY1A 4RGUA 1YHQI 5IFTA 4QXCA 1UY4A 1V5FA 2VUMJ 1MJ9A 3VLBB 4HX4A 1XDSA 1QQP2 3IPVA 1C5HA 2M7AA 2MW8A 2VE8A 2BW3A 2IT0A 1NG0A 3NNLA 5CZKA 2QBYA 2D5FA 3HXLA 3LPGA 1I6HJ 3FLPA 1RINA 2WLPA 1Y1WJ 4DQ2A 1S0EA 1F31A 2M8GX 4NR1A 1ULDA 4GB32 3Q0WA 3AMMA 1G3WA 1TMF1 2AXLA 2W25A 2R7VA 5L3BA 2I5UA 3LSDA 1STMA 3WHTA 4JK1X 1O7FA 1RMU2 2O8XA 1BI2A 1LKNA 3BJOA 3IMNA 3ALQA 3OBZA 4JX0A 3GWZA 1LENA 4CCOA 2LROA 2D3RA 1W0PA 2ZO4A 1Z67A 3EETA 5D5XB 1K4TA 1MDMB 3OYNA 4OCTA 4JGYA 2TEPA 3MF6A 5CYYA 3HTSB 2ETHA 5IVFA 3L9FA 2E9QA 4O9EA 2V1XA 3WQ0A 3KT4A 4XJUA 1TL8A 1JUHA 1VAKA 1Y56A 2XGCA 1AR63 4CDQA 2DQRA 4H7LA 5CVIA 2JSPA 2WFF3 3WNOA 2FD8A 1P9QC 4GZ9A 2VNRA 4IO9F 4NO4A 4XM3A 2QZ8A 4LD5A 3CC4I 3WG2A 3BJ6A 2IRFG 1QH7A 4XYXA 3BYWA 4WM8A 5FZKA 4DBQA 3S1NJ 4AFCA 1GNZA 1HKTA 3AZXA 4YGEA 3SZPA 1JTZX 4A3IJ 1BOAA 1KS4A 2EAKA 2W1WA 4CZCA 3NKGA 3THPA 4F55A 3BJAA 4CCLA 3MI8A 4UW6A 2GOXB 5L9VA 3KPHA 1W8WA 3ACFA 4IE5A 3WP6A 1QJEA 4FVVA 4YG6A 4IL7A 5A6XA 1MZBA 3RYRA 3GCMA 1W8TA 3PU8A 5LHIA 5DEQA 2I10A 1UY3A 4MTDA 5L3FA 4R9AA 3QH6A 1NY72 4HVRA 1JOPA 3AFHA 1DQUA 4U0WA 2R042 3G71I 3H0DA 3EQEA 4MXWB 1YW8A 1U5ZA 5FP7A 3W6JB 1PUEE 1BMV2 4BJ0A 4OFGA 5LK5A 5ACA1 5K8SA 1GZTA 2VY0A 3VBRC 4XFBA 3R0AA 3ZR5A 4C0HA 1T6GC 4BMBA 4OI2A 3EUKL 1LFUP 5J48A 1AU7A 2CUEA 5IYCJ 5FXZA 2GA2A 3SJMA 5A6YA 1YFYA 4XLNF 3KVBA 3Q9VA 2VBYA 3IN9A 1V5EA 3SH4A 5EJCA 4ZYDA 3CZ6A 4EROA 5IHRA 1O59A 4B44A 1U78A 2HWF3 3GXUA 4LFUA 1AXYA 3WEZA 3GUDA 1I1SA 1JW6A 5FP3A 1WJEA 4ZU7A 1WJ5A 2EFQA 1VRH2 1G6NA 1XU1A 2DCYA 2ZGLA 3S30A 2MFZA 2QBYB 1QOOA 2JQ7A 4P96A 3RVHA 5FWJA 4FHTA 2VPLA 2VZTA 1VE0A 1F5TA 4Q27A 3ABZA 1H88C 4YGBA 2X6XA 2V72A 5EWSA 3JD72 1W6PA 1LHVA 2OAZA 4B4CA 1H9TA 1NQJA 2VKHA 3W2AA 2J5PA 2VECA 1WUVA 1UOJA 3PHMA 2ZFUA 3FXMA 3DCFA 2A73B 1W2NA 4CPBA 1UB9A 4BEHA 2D6MA 2Y9YA 1XPXA 1IXCA 2VPVA 3SZGA 1ACCA 4XF1A 3FISA 5L7OB 1S0GA 2EIJH 2D1HA 4ZU5A 4CDXC 4FPEA 5L9RA 1FBUA 3FWEA 1QBJA 1AR71 3TEZA 4FBFA 3PUIA 3GZ6A 2WA4A 3LA7A 3U78A 2W91A 1WBFA 4KL1A 4DQAA 4EM2A 4M71A 4YVSA 2IA1A 2VE1A 3E1F1 3FMGA 1RUI1 3ETQA 3VHPA 4N53B 2Q8KA 1DLLA 4UF0A 3LSIA 1XSQA 1ZGAA 2E33A 5JPMB 2DVFA 1WHUA 4F93B 3AB0A 1LJ7A 2QQNA 4ORFA 3R0JA 1X50A 2YZ4A 3G6EI 4QD2A 3ERMA 1YFXA 5LRSA 2JA6J 1FV2A 2WZ8A 1KZHA 3OUJA 1T8IA 1VBE2 5FLXK 2R16A 3BI3A 2IA2A 3OGRA 1XU2A 3RSJA 2AREA 3PFYA 1IRZA 1F8VA 2EILH 1V54H 3M3CA 1PO23 2W57A 1CZVA 3ZN0A 4IQJA 4LTAA 3PTRB 1ZQ3P 1W9SA 2C6YA 2CSOA 2ET7A 2NYXA 1ZARA 3VBFB 3NV1A 1GUIA 3BR6A 3RJPA 4L92A 1FOD3 1CESA 3BIWE 4KITB 3PLQA 3WG7H 2D93A 2HI3A 1PK6C 1ENHA 2GIZA 4B09A 4GKXA 4WBBA 3CO6C 4AVCA 1RUF1 3AMPA 1DZTA 3NQOA 1ZA4A 1A6CA 4LGWA 3ZQGA 1LCLA 1S0FA 1HRV1 4S2HA 3QU6A 5G05L 5ILUA 2M87A 5FPAA 3LGRA 4BXFA 4JBAA 2RHPA 2ZHLA 1S0CA 3PUHA 3WF2A 1XPWA 1VR3A 1KGSA 5JIUA 3AJYA 4Y22A 3OL3A 4JCKA 4UOJA 2OQ6A 4QKFA 5ED4A 2VBZA 2DOEA 1CJPA 2JIGA 4CRQA 5BNNB 2P1BA 3BPSA 3KVAA 5GAEJ 3IDCB 4D7SA 3PVEA 4XTMA 4XUOA 1VQKI 3AMHA 1A35A 3N4MA 1W2TA 3M8LA 4Y52J 4XNFA 2GH2A 3RWKX 1T6SA 2M2EA 1TC3C 3TQNA 1KU3A 1NA1A 2RDNA 4PDKA 4L9VA 2VBBA 3I2IA 4RA0A 1RRJA 1V9U2 2RS33 2COMA 1G8XA 4G9YA 4LG3A 4K20A 1Y6IA 3FHQA 5D4RA 1LNSA 3OPWA 5J4YA 2OU2A 1QJX1 1TQMA 2HOAA 1XN7A 4GA9A 4LOSA 2VT2A 2AYHA 3JREA 1XC6A 1TP4A 3TEDA 4HQMA 2GNBA 2NLRA 2UZKA 3M4FA 4M3DA 2ZACA 4OUSA 2W94A 3JQWA 3PURA 4N0BA 4CYDA 1OCPA 2W5FA 3FHNA 5GLVA 2JA5J 3RZOJ 4CP9A 5I0SA 3KLSA 5E1ZB 2GXBA 1P7IA 1TWHJ 4M3GA 2ZGTA 1NT0A 1ULPA 3HRMA 1YYNA 4XQWA 1P92A 1AL0G 2EH3A 1H9PA 4MGKE 4CEWB 3QAHA 3OOPA 2IXKA 1UYYA 4BQYA 5T5JA 4KDPA 1JN2P 1ZX5A 2WZR1 2E1MB 1LNWA 2WNVB 5J6XA 5J1UA 4D7NA 2PX9A 3DKXA 1K61A 2BP6A 3ZOBA 3HDDA 1PO11 3WW3A 3DBRB 3T0YA 3CHXA 3BOPA 1N75A 3MMYB 2GQQA 1YC61 2RDQA 3F22A 1HB4A 2QJVA 1GQPA 3SXWA 2JB8A 1K78A 3K1MA 4HEA2 2R6QA 1FPQA 3JRDA 3CCVI 5GJ6A 5GLWA 1IJWC 3AXEA 2VZPA 5JR7B 1OOPB 3SQNA 4GGGA 3O1MA 2K3PA 3OYCA 4P9XA 1IG0A 5ABJA 1Q43A 2D6PA 4CDWA 1HKQA 1S55A 2RJKA 1KU2A 2JA2A 1GKBA 3ISPA 1XQNA 1JKOC 1UIKA 2PN6A 3S2DJ 1S9HA 2HYGD 5F27A 1VBC2 2DMQA 3DLLF 4GAZA 1HV1A 5GZEA 4WVMA 4AIKA 1BC8C 4KWUA 4C8DA 4G4FA 4PLMA 2E71A 1UO9A 2LKPA 2XAUA 3HVDA 5A3WA 3AG4H 4BXXJ 4UV8A 2CGNA 3OD0A 1Y1VJ 4NB5A 2GAUA 4A0XA 4P14A 5A7QA 3RZHA 4OLLA 2C6SA 5BNQA 1DU0A 3T4HB 2OVUA 3FBNB 3CLPA 2EA4A 2BHYA 3BG3A 2RS13 3F0CA 4BXSV 5A1FA 1E2XA 1A34A 3SYTA 1ONVA 5HLIA 4XSZF 5FMOL 1GNYA 4X6RB 2XASA 1IS4A 4Z07A 3LIGA 4F92B 1VALA 2IGMA 4D8MA 3HOYJ 5DUWA 3AMNA 4MHRA 1OUXA 2ZBKA 4EN7B 4NHYA 4RL7A 4CA9A 1NA1B 3KYDB 1VQ5I 2VVEA 5FP9A 3HOBA 2PFBA 1C8M2 2GNTA 4CVUA 5IOYA 2BY2A 2FXAA 4FPJA 1R23A 3K4AA 3GEZA 2NP0A 2HBUA 4Y1VA 2P5KA 1G9BA 4HX8A 1KQ0A 5IATA 3JBG2 3DKWA 3ZPOA 1F5JA 4K21A 3FBYA 2WRAA 3DKQA 2BU9A 3MPPG 3ZYBA 3RKYA 1SVOA 1ENSA 3GW2A 5KNLA 4IGOA 4BY1J 1AKHA 1YO8A 3TW6A 1WLCA 5IAXA 1PVEA 4X8NA 2QEXI 4IV1A 3LKJA 3HQXA 1FAYA 3HR9A 2ZOEB 1JE8A 4GH4A 1ZBA1 3GCWA 2YPRA 3K2ZA 2RV8A 5IVEA 2ZKNA 1BKZA 4I99C 1HOMA 5KHKA 1X3WB 3S3OA 4I98B 2DBNA 2HPMA 3BQZA 5I8SA 1ENQA 4CCMA 3DBLB 5FD6A 1OJLA 5FUNA 2X5IB 5IYBJ 3AVRA 2LTNA 3OV8A 5E8AA 3I54A 5FPVA 3AZYA 3RMXA 2X48A 1U8BA 4ZZ8A 3B93A 1KEXA 3KE2A 2A6TA 5FZMA 4CU9A 4R52A 1SAXA 4D7YA 3R6SA 3WGHA 2KRCA 4L11A 2YU9J 3W5NA 4DO0A 1DP7P 1WWYA 1NLSA 4P55A 4SBVA 2WYSA 3VHNA 3LMMA 4UI9L 1JYWA 3CF6E 5D8LB 2JB4A 1X1CA 3A0KA 1CX1A 5IJRA 2HDCA 2XIGA 4EV0A 5DDGA 1RR8C 9ANTA 3GBWA 1TWGJ 4QX5A 1S7EA 3KSCA 1L3JA 4Q4V2 1ETQA 5FDBA 4IEJA 1LGCA 4QX2A 1VTNC 2VMHA 2CL2A 2MSYA 4DIQA 2EB7A 2W46A 4DXRA 1F4AA 1OCOH 5ABJB 3AP6A 1XDUA 1URXA 2F17A 4P00B 2EALA 2KZVA 1AL21 4YVWA 3OYMA 4JVAA 2QZ3A 3CL1A 5AONA 3AG2H 3GZAA 3I5UA 2ZMKA 4JRAA 3ZFFA 5JXHA 5AC91 1RUD1 3AJZA 2AACA 3OJBA 1XNKA 5GKAC 2WAQA 4LA2A 3CBNA 2QF7A 3F8BA 1BI1A 2G7UA 2ERFA 4YM3A 4Q4X3 5L3EA 1OYIA 3I56I 2OZUA 3U1DA 3IRQA 4Q0PA 2L7ZA 1D8KA 4KQ7A 4RA2A 1F43A 3IAPA 1SD4A 1MGTA 1BHGA 4UBGA 2X05A 3RNSA 1HB2A 3SCHA 2D5HA 2DFIA 3VD3A 1TNTA 1FX5A 1Z1DA 1H8VA 2ID4A 1FMD1 1NCQA 1SBEA 5DUVA 3NAUA 4AEMA 4BK4A 3H42B 1OHFA 1CJDA 3P5BA 2C26A 3USUB 2OTJI 2XC7A 4ES8A 2O8QA 3U10A 4LLGF 4HZFA 4Y26A 4AF9A 1LEBA 5KAIC 3FBMA 3W6VA 2E36A 1RXFA 1PIV2 4NPLA 1US3A 4RR3A 5FY8A 4NHJA 2O0OA 3C2HA 4DYRA 4KG0A 3T2TA 1QJU2 1CAUA 2CDOA 2R072 5H9PA 3BR1A 1ZRCA 1OA3A 2MEV3 2Q1MA 3MD2A 1WCSA 1FPN2 1JODA 2P2KA 5EP9A 1D2SA 2A75A 3VZNA 2YFUA 4Y3OA 1AYN2 3BUCA 1XC5A 3ZYPA 3OY8A 2VOOA 3QQAA 4NHLA 4IEXA 2FHRA 4QXBA 4HVOA 4D0QA 1MMAA 4N43B 3N9MA 1LJ9A 2DDAA 3K6GA 1YQCA 4GRIA 4CUBA 3SXYA 3V56A 1R7JA 5B66C 3OYKA 3O6BB 1IRGA 1YO5C 2XAQA 3E6MA 3SCFA 4IQ4A 1WVRA 2X09A 4Y4RA 5LBQA 2ADDA 1TBXA 1RJ8A 2NPIA 5CISA 5CKMA 3WTTC 4HKOA 1W06A 3H50A 3ZQHA 2JVHA 2MH2A 3BTIA 3RQ4A 1YJLA 2R061 1R083 2QKMB 1DZQA 2OTLI 4XRSA 2XF7A 5L7OC 1OVSA 1HB3A 1ORKA 2Y6JA 3I3EA 2DN0A 3MLLA 5IVJA 2LG4A 4YIFA 4RBOA 2DO7A 2KT0A 4N4NB 2RM21 4JGYC 3T8RA 5HLTA 5LEJA