5IVBA

A high resolution structure of a linked kdm5a jmj domain with alpha-ketoglutarate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
317
structure length
293
Chain Sequence
EFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTEQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPVLEKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Lysine-specific demethylase 5A,Lysine-specific demethylase 5
publication title Structural Basis for KDM5A Histone Lysine Demethylase Inhibition by Diverse Compounds.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 293
sequence length 317
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5ivbA00
5IVCA 5A3PA 2XMLA 4URAA 5FZCA 5IVYA 5IVVA 3AL5A 3KV5A 4LITA 5FZHA 5IVBA 4QXCA 4QWNA 5F3GA 4EZ4A 5FJKA 5FYMA 4CCJA 5ISLA 3PDQA 4C8DA 5A1FA 4CCKA 2YPDA 3AVSA 3LD8A 4V2VA 3PU8A 3KV9A 3KVBA 3N9LA 5FYSA 5FYTA 4AAPA 2OQ7A 5FXVA 4HONA 5FZ6A 4CSWA 5FWEA 5FP8A 2OS2A 3KVAA 5F3EA 5F32A 4IGPA 5IVEA 5A3TA 4IGOA 2VD7A 2Q8EA 3AVRA 5FYZA 5FYIA 5FV3A 3KV4A 4HOOA 5CEHA 5FZ7A 3K2OA 5FZOA 5FP9A 5A1LA 5FYUA 4XDOA 5F2SA 3OPTA 5A7PA 5LY1A 4UF0A 5F5IA 4BU2A 2P5BA 3AL6A 5F3IA 2W2IA 5A7SA 5FZIA 5A7WB 2Q8DA 5IVFA 4Y3OA 4CCNA 5F5AA 5FXXA 2YBKA 5FZOB 4IGQA 5A3WA 3ZLIA 4CCMA 5IVJA 5FUNA 3PUQA 4UF0B 3PUSA 4GJZA 3PU3A 5LWBA 5FZ1A 5F3CA 3DXUA 4AI9A 5FYCA 2OX0A 2Q8CA 5FZBA 3N9NA 5FYYA 2GP3A 3KV6A 5A7WA 3RVHA 3N9QA 4Y33A 5FY0A 5FPUA 5FY7A 5FZMA 4ASKA 3U78A 5A3NA 3UYJA 5FP3A 5FWJA 4V2WA 5FXWA 5FPAA 2YBSA 5ANQA 5FYBA 5FY5A 4BXFA 5FZAA 5FZFA 2OT7A 5FPLA 5IWFA 5FZGA 3ZPOA 4GJYA 4LXLA 5FY1A 5KR7A 5FZLA 5FJHA 3U4SA 4E4HA 3N9PA 5FYHA 5FY8A 5FP4A 5LW9A 5FUPA 3K3OA 3PUAA 4QU1A 3DXTA 5FPVA 2XUEA 1VRBA 4DIQA 3OPWA 2XXZA 4D6QA 2YU2A 3NJYA 4GAZA 4CCLA 2GP5A 3N9OA 5FZ0A 4D6RA 5FZ4A 4DO0A 4NUBA 5K4LA 4LIUA 5FPBA 5FY9A 5FBJA 4LIVA 5F37A 4QXBA 5FYVA 4QXHA 5F5CA 4EZHA 3K3NA 2WWJA 3PURA 4XDPA 5FY4A 5FZEA 5FP7A 5FZ3A 4Y4RA 5FZDA 4QX7A 5FXZA 4GD4A 2XDVA 5A7QA 4QX8A 2WWUA 5E6HA 2PXJA 5A7OA 4TN7A 5F2WA 2YBPA 2YU1A 5F39A 2OQ6A 5FZ8A 5A7NA 5A80A 4D6SA 4EYUA 5LY2A 4BISA 3N9MA 4CUGA 5IW0A 5FZ9A 4CCOA 3LDBA 5FZKA 3PTRB
chains in the Genus database with same CATH superfamily
5I8TA 4URAA 1QQP1 2Z2SB 4ZPIA 5TSWA 1EV13 2TEPA 2VOXA 4FQZA 3KCXA 5IATA 4ES8A 3MIGA 3UT0A 1Q8SA 4JDNA 2HWF3 3WQ0A 5HI0A 5LEJA 2JWPA 5CKNA 4GH4B 3BN6A 4Z92B 1W90A 4JQTA 2DBNA 4YG3A 4BH9A 3MIDA 2BVBA 3WHUA 3VDDA 1UYPA 4CXWA 2PAMA 1JZ3A 1UX7A 1L7LA 1ZM1A 1I3HA 2OS2A 3AP4A 3ZFGA 3PL0A 3ZN6A 1BJQA 1OA2A 5C71A 3QBQA 2A3WA 4NRMA 3AMNA 3K75B 2JE7A 3WW1A 4U36A 1H2NA 1UKRA 3PVBB 2XLFA 1PO22 1E5HA 1N47A 4IV3B 2E7QA 3OTFA 3V64A 3ACGA 1QU0A 1KQRA 3RZJA 4RQPA 2Z4FA 3BGAA 4Y3OA 1PMIA 3CIHA 5ACA1 1YRZA 4A45A 4ZZ8A 2YBKA 1PVC2 4XF0A 4AHWA 4AW7A 4DOUA 5HCAA 1ULOA 5KXCA 2HBTA 3GHMA 2LS6A 1C1LA 2HKXA 4XBLA 3RPQA 3ZSEA 5C3OA 5I91A 1VBB2 1G9BA 2P6CA 2RS32 1LEDA 2R042 3S6PA 4HPKA 2ERFA 4BYYA 4CP2A 4LOTA 1G9DA 2CWSA 1FMD2 4QPGA 1OOPC 4DS0A 4LHKA 1RUJ2 4R4ZA 4Z07A 4UFLA 1OPMA 4E8CA 2G9GA 1X9PA 1HB2A 1AR93 3VDBA 2HWE3 1HRV2 1QY4A 1YXWA 1REDA 3WG3A 4QQPA 4HLTA 3WQ7A 4BQ4A 2C9KA 1F5FA 2C0ZA 4BQ2A 5JZGB 4NIAA 4NPRA 1UOJA 2HWE1 4PLOA 4A42A 1O8PA 2XQRA 4ZS3A 4PJYA 1NLQA 2ARXA 1W2OA 4LHNA 5FBZA 4CE8A 1AR63 5CFCC 5JUVA 5ERLA 3C8XA 4N7UA 3BPZA 2AEYA 5IYYA 1OH3A 1CX1A 1A78A 2EXJA 1AR61 4UYBA 2PHFA 2J1AA 4W6XA 4FPLA 2DVGA 1W2UA 1W9WA 2NM1A 3NJYA 5T54A 3NAPA 1ZRRA 4LBNA 3JB4C 3CEWA 4XJWA 3M1HA 2EVXA 3ASIA 3ZIXA 1VBE2 2VXJA 5FFOC 2QQUA 3HBKA 4QX0A 1OOPA 4M3CE 1AYN2 3CU7A 3WQ1A 4LOSA 5DAXA 1PMHX 4CEYB 3A0KA 5BYNA 2WWJA 4LKDA 4CP9B 2DTYA 4A4AA 5JMOA 3WUDA 2W1UA 2D6KA 2PHTA 1NG0A 3D3AA 2ZMNA 1OD3A 4TN7A 5CFDB 2VL4A 2XVLA 4GIQA 3JCIA 3M3QA 4LNVA 4XFFA 4C1WA 5JZGA 1RB8G 2XJRA 3NJZA 1DQ5A 1MS4A 1ND3C 4CUGA 5J48A 4L2NA 5FZKA 3CJIC 4MO3M 3VBFB 4KGQA 4BCUA 2JEMA 1NKGA 2GH2A 4N53A 2LM3A 3BOWA 5FZCA 2BBAA 1BK0A 5DUWA 4HXCA 2VMGA 4FTSA 3FLPA 3O14A 2PHXA 2GSYA 5FMCA 3AKPA 1R1A2 2R49A 2FZ2A 2QJVA 1FV3A 1SQ4A 3Q8EA 3DF0A 2JX9A 1NE6A 2A6XA 1M4WA 2WN2A 3HQRA 4V2VA 5E1RA 5A70A 3CHXA 4TTGA 1QQP2 5A6YA 4CSWA 1KFUL 3B02A 3O1UA 5FP8A 4XE9A 3KHCA 4NPMA 2JDZA 5DG2A 3IIAA 3I2KA 1XE7A 4A3ZA 3JBG3 4B4QA 2Y6LA 3I97A 3JBG1 1KDKA 4Q4Y3 3NNFA 4YGCA 5I93A 3K4AA 3ETPA 2JG8C 4W8JA 2GAUA 4XDOA 1F31A 2GMMA 4Q4Y1 5F3IA 2AR6A 2DCZA 5EHDA 3KGZA 3V56A 4NWVA 1ZZBA 2ORXA 4TXWA 3VHRA 2LW8A 2GNBA 1TEIA 5BNOB 2ZGLA 3I2OA 3OF1A 2O1QA 1LR5A 3WZ1A 1LOFA 2ZGKA 2X5IC 4QQ2A 1CAUB 4AI9A 2EAAA 2R0HA 3VDCA 4EE2A 3AMQA 2Z79A 3NWKA 4LLFA 3TRSB 4YZ4A 1NY71 1O8SA 2YV8A 4ARYA 1JW6A 5ACA2 3EO6A 3UJQA 5BNPA 5K0UB 2OPKA 2VZQA 1RMU3 3Q8BA 4CDQA 5D2AA 1IGOA 5EFUA 2DCKA 2IXHA 4IXLA 4P5HA 2ZZJA 3H42B 4XFIA 5DAQA 2FDHA 3AZYA 1IKPA 1YWKA 1JHJA 2P3KA 5LB6A 5IUQA 1PNFA 3VBRA 1CJPA 1E57A 3AYCA 4YARA 4QU1A 1VRBA 3MLKA 2ZABA 4PQQA 3HQXA 4WBBA 3GZEA 3ZSLA 1BEV1 1CQ9A 2DTWA 3U14A 5L7OA 3BU0A 5C6CA 2Q5TA 2HWE2 4LIUA 1BVP1 1POV0 3K77A 1RUC1 2Y8KA 4IQPA 2Y6KA 3I3QA 4P9JA 3GZUC 4YGDA 5HXMA 4Q0SA 3I3MA 2VZSA 1ULDA 1AR62 5IK4A 4K20A 4OI4A 1ASJ1 2HYXA 5I0TA 1LGNA 1DQ6A 2Y6FA 3WINE 4WM8C 2J1RA 4HG6B 4XJZA 3B9IA 4XHBA 1WW5A 5JI7A 1W9FA 1J1LA 1B35C 4AFMA 1EPZA 5JR2A 2YU1A 4BQWA 4D7TA 4FQ4A 4E27A 4H14A 1RXFA 4XUNA 2ZHKA 3DPRB 4KU7A 1SLIA 1QJZA 2AENA 4BIOA 1OFSA 4EN6B 5IK7A 5CG9A 4OVEA 2ZAAA 3MLLA 2E7AA 4FCAA 4JTOA 5E88A 3MUY1 4MGZE 3O7OA 3O1PA 1ND2B 4XFAA 3RZKA 3KSCA 4UFKA 2FMYA 5E89A 4C1XA 4ZZ5A 4J1WA 2VOVA 2IXLA 3RYPA 3OSDA 2E53A 5F9TA 3LEMA 3TN93 3I2IA 3I54A 3ZXAC 4WM7A 4IEPA 1S0IA 1H8TA 3KS7A 3AVSA 4URTA 3TN91 4CU9A 4LUKA 4I0BA 1ZRDA 2R0FA 4HONA 1AUYA 1ZZ9A 2HWB3 4HVQA 4XAAA 3URFA 1KFXL 4GMP3 2VCMA 2WO3A 2HWB1 2QQNA 4ATEA 2WNVB 1XNDA 4O7XA 2Q8EA 4IV1A 3WNLA 1REFA 2VW0A 3DYOA 4JV4A 1O3SA 4R8HA 4DB5A 4IUGA 4ISRA 4JQRA 1FATA 5CKMA 3UKTA 3ZYJB 1EUUA 1W0PA 2XL9A 3AYAA 2YG0A 5A1LA 3OPTA 3LGRA 4R9CA 1W8NA 2W2IA 2GU9A 2Q8DA 1RUG3 1LOGA 2HWC3 3UL2A 5AVAA 2Z69A 1H1MA 4CDXC 5FZOB 2HWC1 1C5IA 2K46A 4FTBA 3J26N 4AGGA 1N1TA 3AMPA 3I8TA 4X8NA 4DINB 3E6BA 3JBG2 3J7HA 1T6GC 4ES9A 4F3JA 5F5QA 1XRUA 5FK8A 5FOBB 3KHBA 2ATFA 2OX0A 2WQZC 4Q4Y2 2JG9A 1QJU3 1LJ7A 4RGKA 5F6KA 5FKCA 4MUVA 4LPLA 3RZZA 3E97A 4M01A 4FPFA 1YJKA 2ARBA 3ON7A 2ZKNA 5FY0A 2D98A 4AI0A 1WLTA 3I4IA 2HEYF 2ETEA 2E33A 2VG9A 1HDKA 2Q1ZB 1HXS3 4DMIA 3I59A 5FYBA 1EAH1 2BNOA 4DUVA 3PJQA 5J96B 1HV1A 5IK5A 3N4MA 5IWFA 2YZ4A 5FO8B 4DXSA 3UNPA 1NAEA 1NY72 3IKWA 4GJYA 5KR7A 3VBUC 3VZOA 4E4HA 3AC0A 5FYHA 3GHNA 1H4GA 1F35A 2P2KA 5J1XA 1UMIA 5D8AC 1IKQA 5K8SA 3H8XA 1XNTA 1CIYA 4R9AA 1OVSA 5C8CC 2YU2A 4D8MA 4YVWC 1W6NA 2GP5A 4JRAA 3POEA 1DCSA 1Q3EA 3MDPA 2JDMA 4DO0A 3IAQA 4GWMA 3JB8A 4QQOA 4DY3A 3EJKA 1MQTA 3BPSA 3FE5A 2DVAA 3GBGA 1OLRA 1HN0A 1WD3A 1Y7BA 3BTXA 1G7YA 1NLRA 2LTNA 5JIAA 2PHRA 3LOBA 3CZJA 2RM21 3MF6A 1BEV2 1ZBA3 3PURA 1RUE3 5D21A 5FP7A 3SCGA 3CL1A 3IAPA 4M0HA 4RR3B 4NJ4A 5E6HA 1ZBA1 1RUE1 1LCLA 1NA1B 4YYOA 1RUC2 3NSTA 1SACA 1WWYA 1ZX5A 4PDWA 2VC9A 4IEVA 1WCDJ 3OUJA 5GZFA 5FPZA 2FQPA 1ASJ2 1RUF1 2B8MA 2BFUL 2QQJA 3C3VA 5IVCA 1VRH1 1LOBA 2B46X 2JJ6A 2ENRA 1NCRB 2HWD3 5K9YA 2ZX3A 2XPJA 2R30A 3AKSA 4IE4A 4A44A 2CAVA 2X29A 4WVWA 1WZXA 2HWD1 3ZR5A 1W6PA 5BUVA 1Q8OA 1NQDA 5G05L 1VAMA 3H3ZA 4XEZA 3LD8A 4JGYA 4LBQB 2A7AA 1YQ2A 1PM7A 4RHV3 4Y26A 1APNA 1AR83 5CVRA 1U5XA 2DWRA 2JDAA 3Q8FA 4FOWA 2Q8OA 2A3YA 3PMEA 1AR81 1JU3A 2GN7A 3AVRA 3K48A 4Q27A 1US2A 4MYEA 2OKXA 3KV4A 1H1AA 5JAXA 4Q0UA 2W68A 1DBNA 1PNGA 4I09A 3ZXEA 2ZGRA 4C91A 3TN92 1R1ZA 1PM4A 3HT1A 4I3PA 3U10A 2VAUA 2W5FA 2XWJB 4HKWA 2IFRA 4AFCA 3P5BA 4AEMA 3PVEA 5CISA 3WF2A 4QGMA 5A32A 4LO8A 2WINB 4OMDA 1LTEA 2A6WA 1NLSA 1OF4A 2HWB2 4QPIA 1X7NA 4XIOA 4CCMA 2VW2A 4CUBA 4TZDA 2VCBA 3BIEA 4JDOA 5ABJA 3DEMA 2IFWA 3SCFA 2WNEA 1Y9GA 1YQ5A 3O5SA 1S0CA 1Z7S1 2VH9A 4NHMA 5IT6A 5JWPA 5AFBA 1H30A 4BJ0A 4X8PA 3RI9A 2D5FA 5CIRA 2OVUA 3LFMA 1HW5A 5SV8A 1W8HA 3OGSA 2HWC2 4H2AA 2WT0A 3AM2A 5FP3A 3V65A 5GLTA 4YNIA 2ZS6B 1WBFA 5B2GB 5ANQA 4QD2A 4AGVA 2EIEA 4XW3A 5FPLA 1VMJA 1R64A 3KLSA 3MPBA 5C4WA 1PIV3 3WVJA 3THCA 1Q8VA 5I8YA 1QJEA 2EA7A 1CESA 1PIV1 3KB5A 5LA9A 3B00A 4DXZA 4XFCA 1DZTA 3HOBA 5HCHA 1LULA 2WUHA 2YGMA 4XF9A 1SBEA 3BVCA 1SLAA 3FJSA 3WQBA 1EAH2 3LDRA 5FZ4A 4UOJA 2TUNA 5CA6A 1SZBA 1HXS2 2XL7A 5SV5A 4KWJA 4IESA 2VVFA 1POV3 1OT5A 3NKTA 1LU1A 2RS11 2QBXA 5FLHA 5HCBA 4OI0A 5F37A 1C3HA 4FPEA 1ZRIA 4IEOA 1POV1 3TNQA 3VBSA 4PQ9A 1QIQA 3AYDA 5FZ3A 1KGYA 3ST7A 1BMV1 4BLIA 4OZOA 1YFXA 3NNMA 4YVSA 1QXJA 2WC2A 4YW4A 3VDAA 1Q8PA 3D6EA 5A7NA 1GR3A 4YM0A 5DAWA 5DG1A 1IHMA 2VMHA 3H9AA 4RFT0 3RFRA 4F7ZA 4MGTA 2RR13 3N7LA 4K1YA 1MEC1 3BB6A 4IL7A 1UXZA 1JHNA 3BYWA 4QPWA 2NPIA 4XTMA 2RM22 2VMFA 3WW2A 2RR11 5EWSA 3B94A 3OBTA 4GB31 4FFHA 4KWKA 4GH4A 1ZBA2 1RUE2 4BB3A 3UESA 3T3YA 1OF3A 2IXCA 1YFWA 5APAA 1NCQC 3WNXA 5C9AC 2V5YA 3OY8B 1GOHA 4CU7A 5A1FA 3T0DA 3SMHA 4L97A 1RUF2 4JGZB 4JCKA 1AXZA 1W6MB 2G4IA 3QACA 1VRH2 3HWJA 2VBDA 3SQOA 4AAXA 1GNZA 5FXVA 5KHKA 4QT6A 5FZ6A 2RV9A 4IV3A 3R6SA 4FO9A 3QOPA 1QEXA 3ES1A 4YWAA 4IGPA 3W5MA 4MHRA 1EY2A 3W21A 1FX5A 3RMXA 1J3QA 1ENQA 1ZNPA 2HWD2 2VE1A 3APBA 4IGOA 1VMHA 1HX6A 5DZGA 4JKMA 5FYIA 4CDXB 1S2BA 2FDIA 1K45A 4AHYA 1V6KA 5FZ7A 5KHJA 4YGBA 4V1PA 3ZM8A 2LRPA 3B01A 5E16A 5LA1A 4O65A 2O8OA 1DGWX 4W50A 1GWMA 1SG3A 1FI2A 4Q8KA 4BM8A 1BCXA 3ECQA 4K6BA 4RA0A 3T1MA 1QWRA 2XG3A 1AR82 1V6LA 4IEXA 4E2GA 2W08A 5A3WA 4CYDA 2P17A 2JDUA 2GC0A 1SEFA 1DZQA 2YB7A 4GJZA 4N7IA 4NHXA 2W1QA 4YW3A 3T2PA 1SCSA 2O0OA 3ILNA 3LIGA 3DGTA 1VAVA 3VB9A 1DQ1A 3O1RA 1US3A 3JD73 1PVC3 1GQPA 4MGIE 4OFGA 3SC7X 2DDUA 4OUEA 2Q8CA 1CZSA 3JD71 4C0HA 4CXYA 2Y38A 2GP3A 1VBB3 2CTVA 4XUQA 3OCPA 3BU7A 5FZMA 1XPWA 1FPN3 1LODA 1FMD3 4XAEA 5D8AB 3TYJA 1TE1B 3FHIB 1RUJ3 2WZR1 3RJRA 1FPN1 1DQ2A 3L2HA 4CEWC 4YG0A 3MW3A 2WO2A 3IWZA 4P9WA 1Z7S2 5KHIA 5CB7A 2CSGA 4H55A 3WD5A 5DDJ3 1QNYA 3GBFA 3PNAA 2MNGA 3T30A 5JDBA 1TME1 3GCWA 1MS1A 2WKKA 2AZ5A 4XHXA 2QTWB 2E9QA 1MZ6A 3HN3A 5DDJ1 3D0JA 3DYPA 2C24A 4WVVA 1RJ8A 4D6QA 2A73B 2XQXA 1O91A 1LECA 1BHGA 5B4NA 3POFA 2C9AA 5C8WA 3AFKA 2D3RA 3PVOA 2TBVA 4ISQA 4NAOA 3B69A 4RSUA 4AG4A 4CP9A 4AEKA 1LENA 4OHVA 4P08A 4CPBA 2EXIA 1CPMA 3C7HA 1PIV2 2PHLA 4DPNA 2BERA 2RDSA 1K5MC 2VTXA 2VQUA 4QXHA 1W3VA 2Y0IA 5CFDA 2BGPA 2JKXA 5CAZA 5A6ZA 2D6PA 4RS5B 4XTPA 5FZEA 3FX3A 4AVSA 3FBYA 2BW8A 5FZDA 1ACCA 3K4DA 4I01A 1JYNA 1QOSA 1Q56A 5FXZA 1AYN3 3VBFA 2VUJA 2NMNA 2WFF1 1W8OA 4OZXA 1C28A 3VHOA 3M3IA 3LSEA 2RS12 4TWTA 1RUNA 3RDIA 4GWJA 4K7JA 1ODNA 4Q8LA 4QM9A 5A3LA 1W39A 2XBO3 4NHYA 3B3QE 3H8RA 3CNAA 4PBOA 4FPHA 1BMV2 1PZ9A 2XLAA 5C3PA 5IVVA 1JZ4A 4Q0VA 2XBO1 4AEDB 5JI9A 1W2TA 2Y6GA 4BWOA 3AKRA 3JXSA 1LGBA 2NYYA 2WAAA 4NROA 5I0SA 2VVEA 3DN7A 4UW5A 2P3IA 5FYMA 3VDDC 1MEC2 3NKGA 4AQ6A 3U0ZA 5A1AA 4LHLA 5LRRA 2R16A 2RR12 3N3HA 1W0NA 5FYSA 4L9BA 1GU3A 1LHWA 2D6MA 2P6HA 3E5QA 3H1YA 3OYWB 3RJ2X 3T09A 1WW7A 1XQNA 2R32A 2YC2A 2YY1A 3RMYA 2W87A 3LOIA 2Y64A 3O0VA 1AF9A 4GQ7A 5C5UA 2A70A 2WJSA 3AKTA 4S2HA 1U0AA 1JZ2A 5FYZA 3MICA 2WO1A 1VBD1 2FDKA 5BNOA 3LZZA 5BPXA 4RQPC 2D7FA 4NIHA 3I2DA 4YRDA 3AB0A 5ANNA 1AVBA 1RVF1 2L9LA 4HL0A 2GH8A 4A3XA 1CAUA 1UOGA 3MIHA 3POGA 5DUVA 1BQPA 3ZYHA 3KM5A 3ZXJA 4ET7A 2FCTA 2XVKA 3ZN4A 1DP0A 1JYIA 1O7FA 2YROA 3EXUA 1UOBA 4B8EA 1FNZA 2RJKA 2H0VA 1ZVFA 4QPGC 5K0UA 1Z0HA 2AEZA 2BUKA 2CV6A 2RHPA 3OBRA 4CU6A 4EN9B 3KD4A 2EICA 4PLNA 3LWCA 5FMDA 3KF5A 3U4XA 5BY5A 4YZ2A 3BKZA 4LE4A 4LLOA 5A7WA 4DXTA 2D6NA 3N9QA 5EIYB 1JZ8A 2NP0A 1W8UA 5HBAA 4N43B 4XUOA 4HN0A 2PN5A 5FKBA 4V2WA 4XJUA 1UYYA 4AQ2A 1DG6A 3ETQA 1SLBA 1LHUA 5ACA3 1XOYA 5A3MA 1XU1A 5KC6A 2QQVA 4KGGA 4BK5A 1U5ZA 5FMOS 2GC3A 3JD72 4FPYA 4AHXA 2DV9A 2Y33A 4G4FA 3VBHA 2CDOA 3S57A 3MV11 1GZTA 3UGGA 4AVAA 3NAPC 4DY5A 2ZKLA 2FD8A 3ELNA 5FREA 4YM3A 3SXWA 1UY2A 5BNNB 3ENRA 4B3NA 2W3JA 1A3KA 3T08A 4GAZA 1OUSA 2WZR2 1FPN2 3T4HB 2OUHA 1NYWA 3D5OA 4FAHA 5L9VA 4W4ZA 4JZRA 4I3GA 5FBJA 1UIJA 1JH5A 3FHQA 4BQ3A 2YC4A 5T5JA 4OHZA 3NO8A 3W5NA 5DDJ2 1RL3A 4META 2QZ2A 1EP0A 4OI2A 3LA3A 4EZHA 3WW3A 1UWWA 1PVXA 3AZVA 4LK7A 1UW8A 3DPRA 2WS93 3IDCB 4EROA 2HEVF 2YUEA 5JZGC 5A7QA 4QX8A 2MEV3 3QLQA 1F2NA 4RN5A 4AI2A 2OZ6A 2XUMA 1GLHA 2WS91 2HJIA 4CDWA 5GJ6A 1J3RA 2MEV1 1J83A 4HFSA 1QJFA 4N53C 1ND2A 4QKFA 3VHPA 4B7EA 2WYFA 2YYOA 4CP1A 1RUOA 2YDEA 2D44A 1EPWA 4Y20B 2WQ4A 4E2QA 1QXRA 4TLGA 3N7MA 3BTYA 1GANA 3FLTA 3J4UH 2BWCA 3FBMA 3MIFA 5DQ0A 2WFF2 4LITA 2XJUA 4AOCA 2VJXA 4MHUA 3NRUA 4ZXEA 4COWA 5BNQA 4ZU7A 1PK6B 4NO4A 5EJZB 2DBIA 4LO4B 1AL0G 4CCKA 5DPNA 3O1TA 1HIXA 3WUCA 2WNVA 5LCWL 2WN3A 3KVBA 1COV1 1CAVB 1ZZCA 3N7JA 4BLJA 1W28A 1LGCA 3RI8A 1W8WA 5CADA 5KC5A 2XBO2 3T1LA 4LTAA 3NV3A 3KVAA 4LK6A 1JOJA 2NMOA 1YFUA 4K9SA 4YFWA 3UETA 4HVRA 1JYTA 2JIJA 1C8M1 3IT8A 4XXPA 5JOZA 3ATGA 2UY9A 1XNKA 3AYEA 1OKOA 1UN1A 2FZ1A 4PCRA 4QKNA 5A6XA 1MS8A 5FZOA 5F2SA 5KHHA 3CO2A 2PAEA 3AP9A 4JRLA 2AYHA 2J1SA 3M3CA 5C7GA 2OZJA 2VZOA 2W94A 1LAJA 4G3YC 1RIRA 1OC1A 1LOFC 3F95A 4FPGA 4ZXKA 1FT9A 1P8JA 1X50A 3M70A 1IS5A 2KA3A 2BBVA 3GBWA 1VBD2 1NUKA 3DKWA 1OQEA 3SNMA 4LO6B 1JS9A 2PTMA 2CDPA 5BNPC 4YM2A 4CEWB 3T0BA 3TEYA 1HJFA 1RVF2 4I2OA 4CDQC 1YCIA 3IDEA 3WX5A 4B29A 3KGLA 5FLJA 2GNMA 3RZMA 5FY7A 1UO9A 2VUAA 3THPA 1RUI3 4CDUA 1D0GA 2H6CA 2RDNA 4EV0A 1WMFA 2H0BA 4BXSV 4E8DA 1UYXA 3ZN5A 1RUI1 3VHNA 2F17A 3AP6A 5FZFA 3WR0A 1HQWA 3VBRC 2LALA 5AFEA 5FJHA 2ZXQA 1WCKA 2HBUA 3R05A 1Q43A 4PLMA 1AL23 4EN8B 3J7NA 5L7OC 2XKOA 2OXBA 1O4ZA 2ZCWA 4MXWB 3WDWA 2VY0A 1XC6A 1C4RA 2ADEA 1AL21 3WG2A 1ZA7A 1RYYA 2WZEA 2E51A 4BPZA 4EN0A 2IZWA 3BOPA 4JAAA 3TEZA 3NV4A 2Q1FA 3S7EA 4RGAA 1V6JA 4RR3A 4UW3A 3TBDA 5FCCA 1V70A 1NA1A 3OG2A 3AK0A 2VVDA 1UZZA 2QFEA 4XDPA 4UFHA 5GM0A 1LRHA 5J36A 3A4UA 4EJRA 1FAYA 2ZGSA 4DUXA 1IQAA 2BYVE 4Q2FA 1CAWB 1XNAA 5A7OA 2VXRA 4ZONA 1BYHA 1D4VB 1ONAA 4MLOA 4R9BA 3VD9A 4QB1A 3KWVA 2TNFA 5FZ8A 1BEV3 4B1LA 1NCRA 3OPZA 3ZO0B 4EYUA 3VZKA 1E5IA 2FCUA 4BISA 3G6JB 5T3NA 3VDDB 1RUC3 3ZYGA 3I3DA 2UY8A 3WNMA 4KWLA 1OI6A 2E63A 4CTEA 3ZFGB 2DVDA 1YI9A 3KT4A 1V6OA 2Y0OA 1ASJ3 4LMFA 5C5TA 4LBQA 4WM7C 4XFHA 2WS92 3ZDSA 4QXCA 4CPBD 1H8TC 2UWBA 1R083 2MEV2 4KG0A 3RSJA 3ZFFB 5FAXA 3ZFEB 5T50A 1OQ1A 3PDQA 4OMCA 2EXKA 1SBDA 1NXMA 2WAOA 1R081 1I9RA 3ES4A 5FO9B 5F3CA 2C26A 2V5DA 3PU8A 3R4SA 4NOTA 2J1TA 2HH9A 2ZGOA 4RL7A 5IJRA 1VE0A 4IV1C 2ZZQA 2XGXA 2X09A 5A33B 4GALA 1NE4A 5I0RA 5A3TA 4QGNA 3VD4A 1UPIA 3M3OA 1J3PA 5I0DA 4XBQA 4C0BA 2N7GA 1PO11 2RE9A 4A6SA 4AHZA 2QQLA 4NRPA 4OLLA 5JIUA 1COV2 3MZHA 1F4AA 2C5DA 2P5BA 2CGNA 1X36A 1NXD1 4BOWA 2RDQA 4XBNA 3ZXDA 2NLRA 1CVNA 1UMHA 2W1SA 2FDJA 2VMEA 4FPKA 5CZKA 5FDBA 5GZGA 3BTAA 1UMZA 1C8M2 1S0EA 2UWCA 3POJA 4IGQA 5FUNA 4CCDA 2BZDA 2QQOA 4ATFA 5LWBA 2WA3A 2JG9C 5LK5A 2UYBA 1NZIA 4QHBA 4RYDA 5D1IA 1JI6A 4KWUA 1KEXA 5FQ0A 4GULA 3RS6A 2A6YA 1W9TA 3I7DA 2WDBA 1JZ5A 3T2OA 1G8WA 3POYA 4JC1A 3ZKYA 2R1BA 3LQCA 1KDMA 1JOBA 3JQXA 2QCSB 2Y60A 4QU2A 3MEPA 4XILA 4M3CF 3LSDA 3G7DA 1UU5A 3KMHA 3NAPB 3P1IA 3R4UA 4OYUA 2VGDA 5FXWA 3WT3A 2YFZA 1V00A 3OB8A 4X6RB 4XC9A 4DFSA 1W6QB 4XF1A 5KHGA 2HYKA 4LT5A 3JQWA 1HQLA 3ZPOA 4LA2A 4XUTA 3JUUA 4IEYA 1QDCA 1OOPB 1QOOA 3VL9A 3ZYIB 3FFQA 2ZGPA 5FTTC 2ZEZA 2RMU1 3PUAA 4DIQA 2XUEA 3IM0A 4M3CB 1OKQA 3OPWA 2KD7A 3AZZA 4AVVA 1CONA 1MQTC 4NR1A 1RUI2 1FOD1 4NUBA 2XKPA 2CNAA 2W46A 1TG7A 2BEOA 3EHKA 3MFCA 1U12A 3NJXA 4MVTA 5DAPA 4BQ1A 4NHLA 1N1YA 2JD4A 4FSJA 1EAH3 3KCYA 3TEXA 3ZMNA 4QXBA 4XVHA 2E26A 1NX9A 2V4VA 2VZVA 1AL22 3RWKX 1QOTA 3THDA 4D3WA 2V73A 3LF7A 4JVAA 4P00B 4PDWC 4AI8A 1I5ZA 4BQYA 4LE3A 1SFPA 3QCWA 2ZEXA 4LBLA 1OA4A 4XYXA 4GWNA 1IS4A 2W47A 3C2UA 3Q8CA 3WY6A 4XZPA 1HRI3 4MG2A 4MSVA 1XE0A 3ZXFA 1S4CA 3HIFA 3GYDA 4DXRA 1JUIA 3N9MA 2PHUA 4MGKE 1HRI1 4FI9A 4WVMA 5FZ9A 5C3RA 3DYMA 1TMF1 3M7AA 4BA6A 1F9KA 4EQVA 4LR4A 3OY8A 4FPCA 1DGRN 1WCUA 3AL5A 1XNCA 1ENXA 2B5HA 2GALA 4JGZA 4MXVA 3VKNA 3KV5A 2OIIA 2B4KA 1W6MA 2RG4A 1QH7A 5FZHA 2RM23 3BTZA 1VPHA 2FHRA 3J8F3 1N3PA 1EYBA 1OVPA 4JGYC 1WD4A 3VBOA 4R4XA 4AFDA 4CCJA 5JPNB 1ND3B 2WZ8A 1HB4A 3CJIB 2WQ8A 3J8F1 4QB2A 3E5XA 3HD8B 1IS6A 3MIEA 5LBFA 4CA9A 2OQ7A 1LB2A 2GC1A 4D94A 5I0UA 2ZGTA 3ME2A 1C57A 3A22A 1MVEA 1RUF3 3HBZA 3PUIA 4KMQA 2IXJA 4FVVA 1VRH3 4ONUA 4AVTA 4Y4YA 2DUQA 3PJYA 1H2LA 2Y26A 5CEHA 1R082 1VIWB 1MR5A 2JDYA 2YMZA 3K2OA 1UOFA 3NMBA 3VD3A 2P3YA 1GZWB 4QPIC 5F5IA 4M00A 4E4ZA 3AL6A 3J7LA 2IVJA 1RTVA 3O1MA 1KS5A 3ZKUA 2YPJA 1IPJA 5BNPB 5IAXA 4NHKA 2WLQA 3FUOA 2XH6A 5FUIA 5ABJC 1O3QA 1BBT1 4YW6A 3VKFC 5J3UA 1PGSA 1V6MA 1K12A 1PO12 2WLPA 1CD3G 1L7RA 1KD7A 2J42A 2JG8B 1OBNA 2DCJA 2A3XA 3N9NA 4HK9A 4NIGA 1AYM1 1O4TA 4PIYA 1AX0A 1RC6A 3KV6A 3M8LA 2EF6A 5LRSA 5KXEA 2P34A 3B7MA 5C4WC 2EIGA 3OUIA 1W2NA 2X5IB 4XFGA 1OSGA 2A6VA 4FPOB 3H3UA 2AGSA 4QX2A 5DZFA 1QGLA 4AI1A 2WNUA 1WLDA 3GDBA 4Z82A 1H2MA 5FY1A 2CWMA 5JR7B 3NNJA 4Y5Z0 5KBFA 3P3NA 4GWIA 4NWWA 3D0SA 2XJPA 1W6OB 2QVSB 2ZBJA 4E2SA 5FPVA 1Z7S3 1O3TA 2XXZA 2ZAHA 2XJTA 3I3EA 4L11A 4W6YA 4BIFA 4D6RA 3N9OA 1ZZ6A 3ZXGA 2PQQA 5DXDA 2ZX1A 4QHZA 1EUTA 1CAXB 2V72A 5GLZA 3DV8A 3VZMA 1UY3A 5KXDA 4K8RB 4RS5A 3VBSC 1OLMA 5JXJA 3WLUA 3LE0A 4Z8BA 2XWBB 4LIVA 1YQCA 4DUWA 3WDUA 1OXCA 1GNHA 5J09A 2RMU2 4YVSC 5FYVA 3RZHA 4YGEA 5T5PA 4OHYA 4Y4RA 4QX7A 1XE8A 1WKYA 1FOD2 3M2MA 3PUHA 4W6WA 4P9YA 5BV6A 5F2WA 1ZA4A 4IETA 3LEIA 3Q9OA 3SISA 2QKDA 4WM7B 4AEDA 3T0AA 5LY2A 5FPXA 4QM8A 3GALA 3LA7A 3ZVXA 4GH4C 2ES3A 5HXVA 3R4DB 5FRAA 3IBMA 2RS13 3A23A 2HLEA 4WM8B 4ASLA 1CZVA 1UU4A 2F4PA 2JICA 4LBKA 1YC61 2YC0A 3WP5A 5EPAA 3U1XA 1B35B 2WBKA 4GA9A 4QDSA 3IDBB 4XMIA 1A6CA 1N1SA 5DUXA 4KNCA 1J84A 5AVPA 5EQUA 4C8DA 4UT5A 1HRI2 3WHTA 3H8UA 1GUIA 4IV3C 5LBBA 4DEQA 1D0HA 1TMF2 2QQMA 4QAWA 3RQ0A 5JOYA 2YFUA 1ODMA 1VP6A 1DGRA 4LKFA 5LATA 3ZXKA 3O0XA 5L36A 1MEC3 1Q5OA 4JX0A 3SITA 4AE2A 3P6BA 4AQSA 4N9HA 1PX4A 1YLLA 3O1OA 4GB33 2J1UA 2D3SA 2W92A 4GZ9A 3RNSA 1UPSA 2AH2A 3J8F2 1XXNA 1UZ0A 3WF3A 3AJZA 4GXLA 1DGLA 5J7MA 5FYUA 2W91A 2JENA 3CKHA 3BIWE 2MHFA 1V0AA 1VLNA 2R061 1NZCA 4AGRA 4XQ4A 3FLRA 2XVGA 2LUWA 1V6IA 2JECA 2EIBA 3POSA 1KS4A 1WW6A 1F5JA 3WNPA 1RUD1 3B5LB 5C70A 4Y1YA 5IHRA 4AFBA 1ALYA 5FZ1A 2EIDA 4LHSA 2WA4A 3ZSMA 3EB7A 4YW1A 4N43A 1K42A 1K5JA 2B42B 4ARXA 1HN1A 2JDKA 1BLZA 4HBNA 2J1EA 5GLWA 3IPVB 5GLUA 2X53S 3TB0A 2WFPA 5M0TA 1VBC1 3LIHA 4A41A 1BBT2 2BRTA 5FWJA 3EQEA 3ZOIA 4AF9A 3INAA 2ARCA 4QX3A 5FMOL 1CIWA 3WCRA 3NL1A 3WW4A 5BNNA 4K1ZA 1UIKA 2ILMA 3OBAA 3VKLA 2ZEWA 4A2UA 5FOJB 1AYM2 3GNEA 2ORZA 3U4SA 4QGLA 3N9PA 3CJXA 3QD6A 4EWEA 1DF0A 3ZIWA 3BALA 3J7MA 2DUPA 2QDRA 2A1XA 4RFRB 2UU8A 5JOXA 4PI0A 2Q0AA 2VZ3A 4AZZA 3ALQA 4XACA 3LAGA 4ZU5A 2NN8A 3AXEA 4LUMA 3CLPA 2NQYA 4S2GA 4XJ9A 4PDWB 4COVA 3K51A 3FMGA 4FAGA 4LORA 2XONA 5CFDC 1UY4A 2PLV3 3VBUB 2VULA 3RRDA 1S0JA 2WZR3 2Z42A 1FXZA 2RJ2A 3F2ZA 4N8MA 3VN4A 2VTFA 4PIXA 4Z2WA 2PLV1 1Y9QA 4QDRA 3RYRA 1DZRA 3VBFC 5C8CB 5A3OA 5KWRA 5LBEA 1N3QA 1OLQA 1YYNA 4YVWB 1GSLA 4N90A 5FK7A 1TME3 5DAVA 5T5LA 4IEZA 1HV0A 1MACA 4Y20A 2XR4A 4NPLA 3I49A 5JLVA 5F39A 4LO7A 3SLIA 2R073 3KCCA 2ZHMA 2XB6C 5GKAC 2OYZA 2ZMKA 1SPPB 3IMMA 3ILRA 1JZ6A 2R071 4UW4A 3H7JA 4DRVA 1JYCA 1H9PA 1LOEA 1ULPA 2O14A 2XMLA 1PK6A 3HAGA 4CEYA 1U5YA 2FDFA 1AZDA 4HSLA 3VD7A 1SDWA 3D82A 3BCWA 1Y3TA 2BGCA 2UWAA 1CAVA 5F3GA 1S2EA 1GV9A 1SBFA 3WF4A 4A6OA 4PF1A 4I0WB 2BTVC 2JDNA 3AZWA 2WFF3 1G9CA 3IZOA 4AVCA 2V09A 2VU9A 3LDKA 4GKXA 2JB4A 4IW3A 2K9ZA 5FWEA 2GNTA 1J1TA 4XMAA 5BNOC 3SKJE 2D93A 4E4DX 4K21A 1B09A 5H9PA 3ZYRA 5C3SA 1YJLA 2PMWB 4UBGA 2ZX2A 4Q4V3 1CR7A 4XIKA 3WOGA 4L0PA 2ZGNA 4Q4V1 2G1MA 3GF6A 5FZIA 5A7SA 4DZGA 5IVFA 5DUUA 4HANA 4NN0A 2ZHNA 4KBBA 5F5AA 1WLWA 2R1DA 5K0UC 4WV8A 3ZLIA 5IVJA 5EYYA 2A75A 3PUSA 4UF0B 4S2FA 3ACFA 1VBA3 2XLGA 4P02B 4GB32 1XSQA 2BNNA 4LULA 2WR9A 4HN1A 1QHDA 1QJX1 2IVIB 4Q4X3 1VBA1 1UL9A 2R062 3NJVA 3HVDA 3WDTA 4Y22B 1VBD3 4KL1A 5FYYA 1PZ7A 4N9IA 4IE7A 4Q4X1 3OJBA 4Y5SA 4MH0E 1RUD2 2WL1A 5EV7A 4YFZA 5EP9A 3ITQA 1OPOA 1RVF3 1UY0A 3ZYPA 1FNYA 4CUCA 1HLCA 1ZYBA 2BOIA 1OA3A 2RS53 3E5UA 5FY5A 3VBHC 4MXWA 3RZGA 1AJKA 1GOFA 1OHFA 2RS51 2VNOA 2YHJA 1H2KA 2C6SA 4G9SB 5CNAA 3U75A 2VOKA 1VBC2 3SHRA 2X10A 2VNRA 1OMIA 1W04A 1YEWA 1GFF2 3OGVA 4NE9A 1H4HA 5DZEA 3WF0A 2E7TA 5EJ1B 4YG6A 3A0NA 4XUPA 5DN2A 4HKOA 2DFBA 2XJSA 1UX6A 1QJY1 4F83A 3OD4A 3EYPA 1V9U3 1CGPA 1CAWA 2B45X 3DPRC 5FLIA 5F5CA 1V9U1 1A8MA 1EV11 3MUZ1 1MZFA 3FZ3A 1UU6A 5FY4A 4CDWC 2HWF1 4PI2A 4HMZA 1UCXA 2XDVA 3WNNA 3ZPYA 1ND2C 2DFCA 2PXJA 4GMP0 4LA3A 1XYPA 2QZ3A 4HKLA 1TVGA 2YBPA 2OQ6A 1DHKB 5JXHA 4PF5A 4OUSA 3UGFA 1A8DA 2VUDA 2D40A 3MBWA 4CVUA 2PLV2 3MGUA 3I2FA 4HETA 3LDBA 3WG1A 4AFAA 3ZFFA 2VO5A 4UXAA 4LEJA 1MPXA 1WW4A 2VBBA 3L9JT 1JODA 1G86A 3ZFEA 4AL9A 1LNSA 4XCAA 1SDDB 1WA4A 1SLCA 5HCFA 3DECA 3VGIA 2WABA 1TME2 2OPWA 2WNVC 5B4XA 1FV2A 3WNKA 4MGQA 1DIWA 4FPJA 3L2YA 5A33A 4CXXA 1ULGA 1GQHA 1PGW1 1KJLA 2R072 3DKQA 1SHWB 3I3BA 5FYTA 3ZYBA 1DQ0A 1W9YA 4Q0PA 2V4AA 1TNRA 1LHNA 1TNFA 1YHFA 4YSFA 4FFIA 1LESA 2Q4SA 1DLCA 5IVEA 4QMAA 4A7KA 5L9RA 4MGSA 2CHHA 4NIIA 2VQ0A 5C9AB 1NCQB 3NNGA 4HOOA 1WMXA 2XJQA 3SEPA 4ASMB 5FP9A 2KR2A 1BVVA 3GGLA 1IOAA 3O1SA 4XF4A 1AR91 1RHI3 2UYAA 3S7IA 1LOCA 4AEJA 2JIGA 2O8QA 1W8FA 1UZWA 3Q8AA 1NOVA 1W2AX 2WIIB 2WZPP 1COV3 2FDGA 1RHI1 5JXIA 5GLVA 2VNVA 3PUQA 2J22A 4M4RA 3HPNA 4Q29A 1XYOA 2VPVA 3UV9A 1C8M3 1R093 2E31A 3GJAA 1HB1A 3T2TA 4YW7A 4X6QB 4EN7B 1GKBA 1X82A 4Q4V2 1A34A 1D2QA 2Q1MA 2ZJCA 4CDUC 3PHMA 1R091 5H9RA 1W6QA 5KXBA 2ZMLA 3WDXA 4OQ8A 4F8AA 3IMNA 4OQ9A 3WCSA 3CBNA 4HZFA 1CX4A 4QQHA 3U78A 5A3NA 5T52A 2BDRA 3ILFA 1GBGA 1UNBA 4CU8A 3I2GA 1HB3A 3HNBM 4P14A 4XF3A 1QJX2 2OT7A 4JTNA 5FZAA 2HEWF 1OUXA 1VBA2 4JKKA 4M3CA 5CU1A 1W03A 4I0AA 5AC93 4YPJA 3LFIA 3S30A 2OUJA 5C33A 3WNOA 2VZ1A 1NQJA 4Q4X2 3ABZA 1UF2C 1JXNA 3POBA 3V0AB 4D69A 5AC91 2VMIA 2OA2A 5CFCA 3MFAA 4P5YA 4L92A 3WF1A 2P1BA 4TLFA 2GMEA 1GQGA 4ITCA 1N3OA 1S0DA 2SLIA 4H7MA 4Q0QA 1MS3A 2QNKA 1L7QA 4RR3C 2GMPA 1QH6A 3O0WA 4Q5OA 1O4YA 1NA1C 2PELA 4CUAA 3MHZA 3MLJA 5LZ6A 2RS52 5JPMB 2VOWA 3ACIA 3MV01 4K8FA 1BZWA 3DCQA 3DL3A 4I02A 3USUB 2IWGB 5HPOA 1ZREA 4D0QA 3POIA 2WT2A 4J25A 4I30A 4XJ8A 1F4HA 5CYYA 4QQLA 5J37A 2DURA 1JUHA 1NCRC 2VZUA 3R0RA 4KG8A 2WWUA 3MW2A 4LBOA 1KJRA 4B1MA 5EZWA 1O59A 5FMBA 4FBFA 3VZJA 4LQRA 1QJY2 5IAVA 2P3JA 1JYVA 2ZEYA 3ZDVA 1H6YA 2GN3A 4FTEA 3DUIA 3A7QA 3FFZA 4ZS2A 1K5MB 5IW0A 4YZ3A 5FIXA 5L73A 1V9U2 1K3IA 1EV12 4BK4A 4CCOA 2R7EB 1DU3D 3NV2A 3PTRB 4A7ZA 5CKQA 1UD1A 2AREA 3MYXA 3W58A 1ND3A 2HWF2 3AJYA 4MOAA 5IVYA 1UZYA 3CJIA 3N35A 2WSUA 1AHSA 5IVBA 1AR73 3WXPA 3OGJA 4HK8A 1PZ8A 1DYPA 1YQ6A 4Y5TA 3X29B 2ARAA 1C1FA 3AXDA 2JDHA 1AR71 1IG3A 2VW1A 3N7KA 5GZCA 5DABA 3VV1A 1TZOA 2B9UA 2W1WA 4UFIA 3KV9A 3N9LA 3ZR6A 3GM8A 2H6BA 1WA6X 4GKYA 1GICA 4DQAA 3BUCA 2WO7A 2JXAA 1X8MA 2F4LA 2A71A 1GZWA 2RVAA 3OEAA 4P9XA 3OEBA 4COYA 2DU1A 1STMA 1KRIA 4ZU4A 4IDZA 3O12A 1PGW2 2GC2A 2VQTA 3LPGA 5DMYA 2BU9A 2A5ZA 4QX5A 2W39A 3ZN6B 1X8EA 5LY1A 2YXSA 1F15A 2I2SA 2JE9A 1RMU1 3HT2A 1KITA 5A7WB 2CGOA 2JG8A 4KU8A 5A3UA 2ZGUA 4P9LA 3S0MA 2OW4A 2D3PA 1VB2A 5FXXA 1ZZ8A 3W59A 4HSJA 3K4ZA 4D7YA 2FBEA 4LO5B 4YLZA 2RDRA 3W9AA 3THTA 3H8OA 3QH7A 2ZACA 4RQPB 5HV0A 2VTXJ 3KT1A 4DRRA 2JB8A 1IG0A 1YQ8A 4FXKB 5FZBA 2X5IA 3VBHB 1AR92 2ZGQA 3VUOA 1H6XA 2EXHA 1H0BA 4KQ7A 2GNDA 1PO13 1ZBE3 2W0XA 4MZUA 4SLIA 1QNWA 3RVHA 2WT1A 5FPUA 1RHI2 4RD7A 1UY1A 1ZBE1 4HPKB 5FR3A 1MS5A 2I07B 1W6OA 4QPGB 1BXHA 2FMDA 4JKLA 1QKQA 2C4XA 4BXFA 4AQTA 2VNGA 4YZ1A 1ST8A 1QXPA 3CQOA 4IE6A 4QPYA 4LJHA 1R092 3V0BB 4Q1PA 1CAXA 3WP6A 1XYNA 5FY8A 3RYKA 1NT0A 4OHWA 2K2SA 2QQIA 4E9KA 1S0BA 5L19A 3GZAA 1IZ3A 2FCVA 3FL7A 3OGRA 2BOJA 3HQUA 1JU4A 3NNLA 1XB9A 4FOQA 2BPA2 4XZUG 2PYTA 2Y6HA 1WCQA 4WZCA 4YM1A 4CDWB 3WEZA 1DYOA 3FC0A 5FY9A 3WP4A 4P9GA 3B9CA 3AX4A 2QQWA 2ZPXA 1D2SA 2G19A 4EWDA 5AC92 3FN9A 1QMJA 3LEGA 3GCXA 4R9DA 5JVVA 2G9ZA 2WRAA 1WUVA 4IEWA 4O61A 4QHOA 3C7FA 1AX2A 1UKGA 1VJ2A 2RMU3 5L9BA 2P4EA 4XPVA 4RGGA 2B7YA 3E6DA 2ZX0A 5A80A 4WM8A 4ZKTB 4MV2A 1I5PA 5EYXA 4XABA 1T2XA 1L3JA 1D7PM 1FOD3 1W3XA 1U5IA 1B35A 3IDAA 4GMP1 3JU9A 5JXGA 4JGZC 4BMEA 1TQ5A 4Q26A 1MS9A 3U07A 1AXKA 1HQNA 1D4M3 1V6NA 1GYKA 2P37A 5CBLA 3ZX7A 1WCSA 3VBOC 4IEUA 1REEA 4M4PA 5FUPA 1YO8A 1D4M1 5IK8A 3KF3A 3IB3A 4QWNA 4OCTA 1YIPA 5FJKA 3U11A 4N53B 1RJ7A 3NW4A 2QE3A 4Z1VA 5HV4A 1RUG1 1X33A 1C8NA 2VMDA 2VMCA 2BWAA 1G9FA 4AAPA 4XJAA 4NRQA 1ENSA 4H3WA 5GZDA 1RITA 1VALA 1Z78A 2G9FA 1LHVA 5F3EA 1C5HA 5IFPA 2DVBA 2DU0A 2BNMA 1TMF3 4Y1ZA 4CCCA 2PHWA 2VD7A 3ACLA 4A7YA 1QJU1 2SBAA 2QUOA 2CGPA 2JKBA 1AR72 4OHXA 3UKVA 1O6UA 3HR9A 2VOTA 4OUMA 4AI3A 4BMBA 1H8VA 1SFNA 1IQDC 4QKBA 5JCTA 1W9SA 1FYUA 2PFWA 3HN1A 4BQ5A 4O9GA 3RG0A 3V0BA 3LEKA 1JZ7A 2VZRA 1HXS1 1SFYA 3TWIA 3M4FA 4CCNA 1G9AA 4FOYA 4CDUB 1UZVA 4ZHNA 1MVQA 1GOGA 1ZZ7A 3NQHA 5J98B 4XFBA 2WSVA 3IPVA 4KH9A 1JN2P 4AVBA 3CMGA 1QF3A 1SLLA 1Y43B 4OULA 4YW2A 4CDXA 1XNBA 3DXUA 2BQPA 4H7LA 3AP5A 2GDFA 4HVOA 5H9SA 1RMU2 3AMMA 1H1IA 3CF6E 4IE5A 2BP6A 3AZXA 5EJ3A 4PT6A 3OOXA 2K0GA 3HMYA 2PA7A 2B9VA 3VD5A 4ASKA 2WNUC 3IN9A 4SBVA 1IS3A 1LEMA 5FPAA 3OUHA 4IEQA 2WYSA 4UFMA 1VMFA 1LHOA 2EAKA 3LB9A 3ZSJA 1YIFA 5G04L 3JZVA 4R52A 3ZSKA 2VR4A 1BBT3 3OD0A 1PX3A 2IUWA 5LA0A 2QQKA 4B4PA 2QQPA 1PGL1 4CDQB 4JHZA 2VQAA 3POWA 1ZRCA 3B93A 4KI5M 3LA2A 3S5QA 4Y24A 2I45A 3K3OA 1WMEA 1ZBE2 1LOAA 1Y4WA 2NZ9A 3DXTA 3VBUA 4AYUA 4RS5C 1AYM3 3SKVA 2YGLA 5K7PA 3T4VA 2VCAA 4XQWA 2B39A 5D8AA 4QXKA 3VZLA 3WSOA 3RZLA 5CG8A 2D5HA 5K4LA 5C8CA 3VBRB 3SEEA 3C7GA 1RGSA 4YVWA 3O1VA 5F7UA 2KXLA 3I2JA 4HT1T 4QX1A 5LASA 3H0OA 4TSVA 3TEWA 5L7OB 1RUH3 3CZUA 1WBLA 4FXGB 2J1VA 1DYKA 3OBZA 5LEKA 1RUH1 3GJBA 1SPPA 1HJGA 4GD4A 1O3RA 4AEDC 1YI7A 5BXXA 2DCYA 1JTZX 1ENRA 3MI8A 3ROUA 3P3PA 4TYSA 4D6SA 2GZWA 5E8AA 4RHV1 1DFQA 4JHTA 1WMDA 2QDNA 2W9XA 1OLME 5H9QA 4FOVA 2ZOEB 3NVCA 3K46A 4BDVB 1PMJX 2E6VA 4PHZA 4B7KA 4UW6A 4EZ4A 3S5AA 3LPFA 4PIZA 2A6ZA 2ADDA 2YPDA 1GWLA 4LKSA 4UWDA 3WV6A 1VAKA 3HNYM 3T2QA 2PHDA 1W06A 2Q30A 3KT7A 4UI9L 1D4M2 4LBMA 3KQ4B 3GXUA 1W0OA 5T55A 2D6OX 3SH5A 1H8TB 1UYZA 2E32A 5FV3A 3WP3A 1WGPA 1RUG2 2JE8A 5FQ0B 3OGGA 5GZEA 4COUA 4QKDA 4UAPA 1W8ZA 4UF0A 3VLBB 5T5OA 4DNYA 3CDZB 1M06G 3QH6A 2CU5A 4IV1B 1LU2A 4K3UA 3D4KA 1F8VA 3OYWA 4Q1RA 4XDQA 3C7OA 4D7SA 4N43C 4Y22A 1QJU2 2DVFA 2D97A 3IIIA 4M0NA 3PU3A 3ACHA 1J58A 4MX3A 4CRQA 3E6CC 4XOGA 4BZ4A 2CYFA 4Z2AA 5FYCA 1G6NA 4NVPA 1N1VA 3MF9A 1SMVA 2DF7A 4FP2A 2PQSA 1BK1A 2VZTA 3MIBA 3WG4A 2IXKA 1YNAA 2X8KA 3VKOA 3ORJA 2R063 2I74A 3PIJA 5BNNC 1OH4A 4FFGA 2JG9B 2Y34A 3M3EA 3FUQA 1X9TA 1J59A 2RJLA 2YBSA 4Q4W3 5C3QA 3UJOA 5LK7B 3FWEA 1RUD3 3TNPB 1T6BX 2CAUA 4UFJA 4J1XA 4LBQD 4Q4W1 5FZGA 3UGHA 3I2HA 4LXLA 2ID4A 5FZLA 5I8SA 1JBCA 3AKQA 3I59B 2AUYA 3LKJA 1VB4A 3PMSA 2W52A 2MPFA 4COZA 1CJDA 1KXGA 1VBC3 2CY6A 2IXIA 4IE0A 1MZEA 1UQXA 5FPBA 5LBCA 1HKDA 1QDOA 2BV4A 1GP6A 2VBPA 4UBHA 4NMIA 3SCHA 3TOJA 1XU2A 5A6QA 3BI3A 3EBRA 1PGL2 4WVMB 3KZ4C 1W6NB 5JOWA 1I6XA 3EMRA 1DLLA 4AR2A 1W99A 3SH4A 1LKNA 3ZXLA 1MQTB 4WVZA 4AK3A 1GZ9A 3AFGA 5IFTA 1E5RA 2BJSA 3AP7A 3VBOB 5FO7B 4L99A 4MGYE 3MPPG 3RGBA 4CEYC 1PK6C 2XHKA 4FT8A 1DQ4A 1XSRA 4W65A 3VL8A 3N36A 2X05A 1UAIA 1SCRA 4AWDA 4BHPA 4ZY9A 1S1AA 5A3PA 1GNYA 2XOMA 1RUH2 3VKMA 1S2KA 5F1RA 1AXYA 1I1EA 5JSRA 3H3LA 2BFUS 5F6LB 2VZPA 1IPKA 1POQA 1PO23 2VCCA 1RXGA 5CFCB 1S55A 4RHV2 1ULEA 2D43A 5ISLA 2LROA 2VECA 1GWKA 2CL2A 4J6GA 1JYWA 1PO21 5LA2A 3U37A 4S2DA 4MADA 3RWNA 5C9AA 1S0GA 1NCQA 1E5SA 1AJOA 1DDLA 3PTYA 1W6PB 4O9EA 4QB6A 5F32A 1JOPA 1PHMA 2C1FA 1PVC1 4XETA 5EXOA 2WNOA 4JGYB 5JSPA 1CPNA 1S0FA 2RS33 2R043 1JMUB 2UURA 3H50A 4XCBA 1DGWA 1GP4A 1OFNA 3PIGA 1VBB1 3VZNA 3WDVA 1CN1A 2RS31 2ZHLA 2R041 5A7PA 2VUCA 4BU2A 1ZRFA 2DCTA 1VR3A 1CWPA 1FMD1 2EALA 4DEVA 1URXA 1RUJ1 4JDMA 4Y1UA 1XBFA 2ZX4A 2XJVA 1HRV3 2J7MA 3BODA 3MO4A 1YFYA 2BGOA 2DUOA 3HNMA 2JD9A 3C7EA 1HRV1 1GMMA 2WNUB 5A32B 2BVVA 2R6QA 2WWSA 4KBZA 4QPIB 1BKZA 1ULCA 2W95A 3GZTB 4YZ5A 4BQXA 1XJAA 3NV1A 3J9SA 4PBPA 1GZCA 4XXAA 4Y33A 5ABJB 2ET7A 2ZGMA 1W8TA 2JDPA 3H7YA 2F6BA 1MZ5A 3UYJA 1CZTA 3W20A 3V0AA 1RINA 4AXOA 2IC1A 1MS0A 4Y1VA 2PAKA 3SH3A 3UKNA 1OD5A 5JMCA 1VBE3 2XHNA 5JSOA 4QDQA 3WDYA 1JYXA 4C90A 2ZA9A 4XQDA 4FFFA 4CCEA 4CEWA 1VBE1 5GALA 1SLTA 1W05A 4NAMA 2AACA 4LKEA 3ZMOA 1QJX3 5FP4A 1AYN1 5LW9A 4ORFA 4INDA 2ZTNA 3TAYA 5C4WB 3A21A 4IERA 4CCLA 5FZ0A 3USUA 4L8QA 1O5UA 4CZSA 1Q8QA 3FHAA 3H1WA 1WLCA 4B4RA 4Q4W2 4NIDA 4WZFA 1OQDA 3ZYFA 4E4SA 1GP5A 4EWAA 2VM9A 3E1F1 3K3NA 3PLQA 3HJRA 4FP3A 2DYCA 2ET1A 3H1MA 1K5MA 3ZFGC 1R1A3 2Y6JA 5F8PA 1UXXX 3MW4A 4CP0A 1YUDA 3LCPA 1ULFA 4XURA 3VBSB 4P9IA 4YW5A 1H9WA 1OURA 1R1A1 3KQRA 3PVNA 2AC1A 2D6LX 1IPSA 4K40A 4Y1XA 3ZFFC 4BE3A 3ZFEC 1O5LA 2Z5WA 1Y9MA 4LBJA 4U2AA 4YVSB 4OI1A 1QQP3 3AMHA 3D8CA 3HEIA 3UK9A 3USSA 2KM2A 1QJY3 1AX1A
chains in the Genus database with same CATH topology
5IVCA 5A3PA 2XMLA 4URAA 5FZCA 5IVYA 5IVVA 3AL5A 3KV5A 4LITA 5FZHA 5IVBA 4QXCA 4QWNA 5F3GA 4EZ4A 5FJKA 5FYMA 4CCJA 5ISLA 3PDQA 4C8DA 5A1FA 4CCKA 2YPDA 3AVSA 3LD8A 4V2VA 3PU8A 3KV9A 3KVBA 3N9LA 5FYSA 5FYTA 4AAPA 2OQ7A 5FXVA 4HONA 5FZ6A 4CSWA 5FWEA 5FP8A 2OS2A 3KVAA 5F3EA 5F32A 4IGPA 5IVEA 5A3TA 4IGOA 2VD7A 2Q8EA 3AVRA 5FYZA 5FYIA 5FV3A 3KV4A 4HOOA 5CEHA 5FZ7A 3K2OA 5FZOA 5FP9A 5A1LA 5FYUA 4XDOA 5F2SA 3OPTA 5A7PA 5LY1A 4UF0A 5F5IA 4BU2A 2P5BA 3AL6A 5F3IA 2W2IA 5A7SA 5FZIA 5A7WB 2Q8DA 5IVFA 4Y3OA 4CCNA 5F5AA 5FXXA 2YBKA 5FZOB 4IGQA 5A3WA 3ZLIA 4CCMA 5IVJA 5FUNA 3PUQA 4UF0B 3PUSA 4GJZA 3PU3A 5LWBA 5FZ1A 5F3CA 3DXUA 4AI9A 5FYCA 2OX0A 2Q8CA 5FZBA 3N9NA 5FYYA 2GP3A 3KV6A 5A7WA 3RVHA 3N9QA 4Y33A 5FY0A 5FPUA 5FY7A 5FZMA 4ASKA 3U78A 5A3NA 3UYJA 5FP3A 5FWJA 4V2WA 5FXWA 5FPAA 2YBSA 5ANQA 5FYBA 5FY5A 4BXFA 5FZAA 5FZFA 2OT7A 5FPLA 5IWFA 5FZGA 3ZPOA 4GJYA 4LXLA 5FY1A 5KR7A 5FZLA 5FJHA 3U4SA 4E4HA 3N9PA 5FYHA 5FY8A 5FP4A 5LW9A 5FUPA 3K3OA 3PUAA 4QU1A 3DXTA 5FPVA 2XUEA 1VRBA 4DIQA 3OPWA 2XXZA 4D6QA 2YU2A 3NJYA 4GAZA 4CCLA 2GP5A 3N9OA 5FZ0A 4D6RA 5FZ4A 4DO0A 4NUBA 5K4LA 4LIUA 5FPBA 5FY9A 5FBJA 4LIVA 5F37A 4QXBA 5FYVA 4QXHA 5F5CA 4EZHA 3K3NA 2WWJA 3PURA 4XDPA 5FY4A 5FZEA 5FP7A 5FZ3A 4Y4RA 5FZDA 4QX7A 5FXZA 4GD4A 2XDVA 5A7QA 4QX8A 2WWUA 5E6HA 2PXJA 5A7OA 4TN7A 5F2WA 2YBPA 2YU1A 5F39A 2OQ6A 5FZ8A 5A7NA 5A80A 4D6SA 4EYUA 5LY2A 4BISA 3N9MA 4CUGA 5IW0A 5FZ9A 4CCOA 3LDBA 5FZKA 3PTRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IVC A;  5A3P A;  2XML A;  4URA A;  5FZC A;  5IVY A;  5IVV A;  3AL5 A;  3KV5 A;  4LIT A;  5FZH A;  5IVB A;  4QXC A;  4QWN A;  5F3G A;  4EZ4 A;  5FJK A;  5FYM A;  4CCJ A;  5ISL A;  3PDQ A;  4C8D A;  5A1F A;  4CCK A;  2YPD A;  3AVS A;  3LD8 A;  4V2V A;  3PU8 A;  3KV9 A;  3KVB A;  3N9L A;  5FYS A;  5FYT A;  4AAP A;  2OQ7 A;  5FXV A;  4HON A;  5FZ6 A;  4CSW A;  5FWE A;  5FP8 A;  2OS2 A;  3KVA A;  5F3E A;  5F32 A;  4IGP A;  5IVE A;  5A3T A;  4IGO A;  2VD7 A;  2Q8E A;  3AVR A;  5FYZ A;  5FYI A;  5FV3 A;  3KV4 A;  4HOO A;  5CEH A;  5FZ7 A;  3K2O A;  5FZO A;  5FP9 A;  5A1L A;  5FYU A;  4XDO A;  5F2S A;  3OPT A;  5A7P A;  5LY1 A;  4UF0 A;  5F5I A;  4BU2 A;  2P5B A;  3AL6 A;  5F3I A;  2W2I A;  5A7S A;  5FZI A;  5A7W B;  2Q8D A;  5IVF A;  4Y3O A;  4CCN A;  5F5A A;  5FXX A;  2YBK A;  5FZO B;  4IGQ A;  5A3W A;  3ZLI A;  4CCM A;  5IVJ A;  5FUN A;  3PUQ A;  4UF0 B;  3PUS A;  4GJZ A;  3PU3 A;  5LWB A;  5FZ1 A;  5F3C A;  3DXU A;  4AI9 A;  5FYC A;  2OX0 A;  2Q8C A;  5FZB A;  3N9N A;  5FYY A;  2GP3 A;  3KV6 A;  5A7W A;  3RVH A;  3N9Q A;  4Y33 A;  5FY0 A;  5FPU A;  5FY7 A;  5FZM A;  4ASK A;  3U78 A;  5A3N A;  3UYJ A;  5FP3 A;  5FWJ A;  4V2W A;  5FXW A;  5FPA A;  2YBS A;  5ANQ A;  5FYB A;  5FY5 A;  4BXF A;  5FZA A;  5FZF A;  2OT7 A;  5FPL A;  5IWF A;  5FZG A;  3ZPO A;  4GJY A;  4LXL A;  5FY1 A;  5KR7 A;  5FZL A;  5FJH A;  3U4S A;  4E4H A;  3N9P A;  5FYH A;  5FY8 A;  5FP4 A;  5LW9 A;  5FUP A;  3K3O A;  3PUA A;  4QU1 A;  3DXT A;  5FPV A;  2XUE A;  1VRB A;  4DIQ A;  3OPW A;  2XXZ A;  4D6Q A;  2YU2 A;  3NJY A;  4GAZ A;  4CCL A;  2GP5 A;  3N9O A;  5FZ0 A;  4D6R A;  5FZ4 A;  4DO0 A;  4NUB A;  5K4L A;  4LIU A;  5FPB A;  5FY9 A;  5FBJ A;  4LIV A;  5F37 A;  4QXB A;  5FYV A;  4QXH A;  5F5C A;  4EZH A;  3K3N A;  2WWJ A;  3PUR A;  4XDP A;  5FY4 A;  5FZE A;  5FP7 A;  5FZ3 A;  4Y4R A;  5FZD A;  4QX7 A;  5FXZ A;  4GD4 A;  2XDV A;  5A7Q A;  4QX8 A;  2WWU A;  5E6H A;  2PXJ A;  5A7O A;  4TN7 A;  5F2W A;  2YBP A;  2YU1 A;  5F39 A;  2OQ6 A;  5FZ8 A;  5A7N A;  5A80 A;  4D6S A;  4EYU A;  5LY2 A;  4BIS A;  3N9M A;  4CUG A;  5IW0 A;  5FZ9 A;  4CCO A;  3LDB A;  5FZK A;  3PTR B; 
#chains in the Genus database with same CATH topology
 5I8T A;  4URA A;  1QQP 1;  2Z2S B;  4ZPI A;  5TSW A;  1EV1 3;  2TEP A;  2VOX A;  4FQZ A;  3KCX A;  5IAT A;  4ES8 A;  3MIG A;  3UT0 A;  1Q8S A;  4JDN A;  2HWF 3;  3WQ0 A;  5HI0 A;  5LEJ A;  2JWP A;  5CKN A;  4GH4 B;  3BN6 A;  4Z92 B;  1W90 A;  4JQT A;  2DBN A;  4YG3 A;  4BH9 A;  3MID A;  2BVB A;  3WHU A;  3VDD A;  1UYP A;  4CXW A;  2PAM A;  1JZ3 A;  1UX7 A;  1L7L A;  1ZM1 A;  1I3H A;  2OS2 A;  3AP4 A;  3ZFG A;  3PL0 A;  3ZN6 A;  1BJQ A;  1OA2 A;  5C71 A;  3QBQ A;  2A3W A;  4NRM A;  3AMN A;  3K75 B;  2JE7 A;  3WW1 A;  4U36 A;  1H2N A;  1UKR A;  3PVB B;  2XLF A;  1PO2 2;  1E5H A;  1N47 A;  4IV3 B;  2E7Q A;  3OTF A;  3V64 A;  3ACG A;  1QU0 A;  1KQR A;  3RZJ A;  4RQP A;  2Z4F A;  3BGA A;  4Y3O A;  1PMI A;  3CIH A;  5ACA 1;  1YRZ A;  4A45 A;  4ZZ8 A;  2YBK A;  1PVC 2;  4XF0 A;  4AHW A;  4AW7 A;  4DOU A;  5HCA A;  1ULO A;  5KXC A;  2HBT A;  3GHM A;  2LS6 A;  1C1L A;  2HKX A;  4XBL A;  3RPQ A;  3ZSE A;  5C3O A;  5I91 A;  1VBB 2;  1G9B A;  2P6C A;  2RS3 2;  1LED A;  2R04 2;  3S6P A;  4HPK A;  2ERF A;  4BYY A;  4CP2 A;  4LOT A;  1G9D A;  2CWS A;  1FMD 2;  4QPG A;  1OOP C;  4DS0 A;  4LHK A;  1RUJ 2;  4R4Z A;  4Z07 A;  4UFL A;  1OPM A;  4E8C A;  2G9G A;  1X9P A;  1HB2 A;  1AR9 3;  3VDB A;  2HWE 3;  1HRV 2;  1QY4 A;  1YXW A;  1RED A;  3WG3 A;  4QQP A;  4HLT A;  3WQ7 A;  4BQ4 A;  2C9K A;  1F5F A;  2C0Z A;  4BQ2 A;  5JZG B;  4NIA A;  4NPR A;  1UOJ A;  2HWE 1;  4PLO A;  4A42 A;  1O8P A;  2XQR A;  4ZS3 A;  4PJY A;  1NLQ A;  2ARX A;  1W2O A;  4LHN A;  5FBZ A;  4CE8 A;  1AR6 3;  5CFC C;  5JUV A;  5ERL A;  3C8X A;  4N7U A;  3BPZ A;  2AEY A;  5IYY A;  1OH3 A;  1CX1 A;  1A78 A;  2EXJ A;  1AR6 1;  4UYB A;  2PHF A;  2J1A A;  4W6X A;  4FPL A;  2DVG A;  1W2U A;  1W9W A;  2NM1 A;  3NJY A;  5T54 A;  3NAP A;  1ZRR A;  4LBN A;  3JB4 C;  3CEW A;  4XJW A;  3M1H A;  2EVX A;  3ASI A;  3ZIX A;  1VBE 2;  2VXJ A;  5FFO C;  2QQU A;  3HBK A;  4QX0 A;  1OOP A;  4M3C E;  1AYN 2;  3CU7 A;  3WQ1 A;  4LOS A;  5DAX A;  1PMH X;  4CEY B;  3A0K A;  5BYN A;  2WWJ A;  4LKD A;  4CP9 B;  2DTY A;  4A4A A;  5JMO A;  3WUD A;  2W1U A;  2D6K A;  2PHT A;  1NG0 A;  3D3A A;  2ZMN A;  1OD3 A;  4TN7 A;  5CFD B;  2VL4 A;  2XVL A;  4GIQ A;  3JCI A;  3M3Q A;  4LNV A;  4XFF A;  4C1W A;  5JZG A;  1RB8 G;  2XJR A;  3NJZ A;  1DQ5 A;  1MS4 A;  1ND3 C;  4CUG A;  5J48 A;  4L2N A;  5FZK A;  3CJI C;  4MO3 M;  3VBF B;  4KGQ A;  4BCU A;  2JEM A;  1NKG A;  2GH2 A;  4N53 A;  2LM3 A;  3BOW A;  5FZC A;  2BBA A;  1BK0 A;  5DUW A;  4HXC A;  2VMG A;  4FTS A;  3FLP A;  3O14 A;  2PHX A;  2GSY A;  5FMC A;  3AKP A;  1R1A 2;  2R49 A;  2FZ2 A;  2QJV A;  1FV3 A;  1SQ4 A;  3Q8E A;  3DF0 A;  2JX9 A;  1NE6 A;  2A6X A;  1M4W A;  2WN2 A;  3HQR A;  4V2V A;  5E1R A;  5A70 A;  3CHX A;  4TTG A;  1QQP 2;  5A6Y A;  4CSW A;  1KFU L;  3B02 A;  3O1U A;  5FP8 A;  4XE9 A;  3KHC A;  4NPM A;  2JDZ A;  5DG2 A;  3IIA A;  3I2K A;  1XE7 A;  4A3Z A;  3JBG 3;  4B4Q A;  2Y6L A;  3I97 A;  3JBG 1;  1KDK A;  4Q4Y 3;  3NNF A;  4YGC A;  5I93 A;  3K4A A;  3ETP A;  2JG8 C;  4W8J A;  2GAU A;  4XDO A;  1F31 A;  2GMM A;  4Q4Y 1;  5F3I A;  2AR6 A;  2DCZ A;  5EHD A;  3KGZ A;  3V56 A;  4NWV A;  1ZZB A;  2ORX A;  4TXW A;  3VHR A;  2LW8 A;  2GNB A;  1TEI A;  5BNO B;  2ZGL A;  3I2O A;  3OF1 A;  2O1Q A;  1LR5 A;  3WZ1 A;  1LOF A;  2ZGK A;  2X5I C;  4QQ2 A;  1CAU B;  4AI9 A;  2EAA A;  2R0H A;  3VDC A;  4EE2 A;  3AMQ A;  2Z79 A;  3NWK A;  4LLF A;  3TRS B;  4YZ4 A;  1NY7 1;  1O8S A;  2YV8 A;  4ARY A;  1JW6 A;  5ACA 2;  3EO6 A;  3UJQ A;  5BNP A;  5K0U B;  2OPK A;  2VZQ A;  1RMU 3;  3Q8B A;  4CDQ A;  5D2A A;  1IGO A;  5EFU A;  2DCK A;  2IXH A;  4IXL A;  4P5H A;  2ZZJ A;  3H42 B;  4XFI A;  5DAQ A;  2FDH A;  3AZY A;  1IKP A;  1YWK A;  1JHJ A;  2P3K A;  5LB6 A;  5IUQ A;  1PNF A;  3VBR A;  1CJP A;  1E57 A;  3AYC A;  4YAR A;  4QU1 A;  1VRB A;  3MLK A;  2ZAB A;  4PQQ A;  3HQX A;  4WBB A;  3GZE A;  3ZSL A;  1BEV 1;  1CQ9 A;  2DTW A;  3U14 A;  5L7O A;  3BU0 A;  5C6C A;  2Q5T A;  2HWE 2;  4LIU A;  1BVP 1;  1POV 0;  3K77 A;  1RUC 1;  2Y8K A;  4IQP A;  2Y6K A;  3I3Q A;  4P9J A;  3GZU C;  4YGD A;  5HXM A;  4Q0S A;  3I3M A;  2VZS A;  1ULD A;  1AR6 2;  5IK4 A;  4K20 A;  4OI4 A;  1ASJ 1;  2HYX A;  5I0T A;  1LGN A;  1DQ6 A;  2Y6F A;  3WIN E;  4WM8 C;  2J1R A;  4HG6 B;  4XJZ A;  3B9I A;  4XHB A;  1WW5 A;  5JI7 A;  1W9F A;  1J1L A;  1B35 C;  4AFM A;  1EPZ A;  5JR2 A;  2YU1 A;  4BQW A;  4D7T A;  4FQ4 A;  4E27 A;  4H14 A;  1RXF A;  4XUN A;  2ZHK A;  3DPR B;  4KU7 A;  1SLI A;  1QJZ A;  2AEN A;  4BIO A;  1OFS A;  4EN6 B;  5IK7 A;  5CG9 A;  4OVE A;  2ZAA A;  3MLL A;  2E7A A;  4FCA A;  4JTO A;  5E88 A;  3MUY 1;  4MGZ E;  3O7O A;  3O1P A;  1ND2 B;  4XFA A;  3RZK A;  3KSC A;  4UFK A;  2FMY A;  5E89 A;  4C1X A;  4ZZ5 A;  4J1W A;  2VOV A;  2IXL A;  3RYP A;  3OSD A;  2E53 A;  5F9T A;  3LEM A;  3TN9 3;  3I2I A;  3I54 A;  3ZXA C;  4WM7 A;  4IEP A;  1S0I A;  1H8T A;  3KS7 A;  3AVS A;  4URT A;  3TN9 1;  4CU9 A;  4LUK A;  4I0B A;  1ZRD A;  2R0F A;  4HON A;  1AUY A;  1ZZ9 A;  2HWB 3;  4HVQ A;  4XAA A;  3URF A;  1KFX L;  4GMP 3;  2VCM A;  2WO3 A;  2HWB 1;  2QQN A;  4ATE A;  2WNV B;  1XND A;  4O7X A;  2Q8E A;  4IV1 A;  3WNL A;  1REF A;  2VW0 A;  3DYO A;  4JV4 A;  1O3S A;  4R8H A;  4DB5 A;  4IUG A;  4ISR A;  4JQR A;  1FAT A;  5CKM A;  3UKT A;  3ZYJ B;  1EUU A;  1W0P A;  2XL9 A;  3AYA A;  2YG0 A;  5A1L A;  3OPT A;  3LGR A;  4R9C A;  1W8N A;  2W2I A;  2GU9 A;  2Q8D A;  1RUG 3;  1LOG A;  2HWC 3;  3UL2 A;  5AVA A;  2Z69 A;  1H1M A;  4CDX C;  5FZO B;  2HWC 1;  1C5I A;  2K46 A;  4FTB A;  3J26 N;  4AGG A;  1N1T A;  3AMP A;  3I8T A;  4X8N A;  4DIN B;  3E6B A;  3JBG 2;  3J7H A;  1T6G C;  4ES9 A;  4F3J A;  5F5Q A;  1XRU A;  5FK8 A;  5FOB B;  3KHB A;  2ATF A;  2OX0 A;  2WQZ C;  4Q4Y 2;  2JG9 A;  1QJU 3;  1LJ7 A;  4RGK A;  5F6K A;  5FKC A;  4MUV A;  4LPL A;  3RZZ A;  3E97 A;  4M01 A;  4FPF A;  1YJK A;  2ARB A;  3ON7 A;  2ZKN A;  5FY0 A;  2D98 A;  4AI0 A;  1WLT A;  3I4I A;  2HEY F;  2ETE A;  2E33 A;  2VG9 A;  1HDK A;  2Q1Z B;  1HXS 3;  4DMI A;  3I59 A;  5FYB A;  1EAH 1;  2BNO A;  4DUV A;  3PJQ A;  5J96 B;  1HV1 A;  5IK5 A;  3N4M A;  5IWF A;  2YZ4 A;  5FO8 B;  4DXS A;  3UNP A;  1NAE A;  1NY7 2;  3IKW A;  4GJY A;  5KR7 A;  3VBU C;  3VZO A;  4E4H A;  3AC0 A;  5FYH A;  3GHN A;  1H4G A;  1F35 A;  2P2K A;  5J1X A;  1UMI A;  5D8A C;  1IKQ A;  5K8S A;  3H8X A;  1XNT A;  1CIY A;  4R9A A;  1OVS A;  5C8C C;  2YU2 A;  4D8M A;  4YVW C;  1W6N A;  2GP5 A;  4JRA A;  3POE A;  1DCS A;  1Q3E A;  3MDP A;  2JDM A;  4DO0 A;  3IAQ A;  4GWM A;  3JB8 A;  4QQO A;  4DY3 A;  3EJK A;  1MQT A;  3BPS A;  3FE5 A;  2DVA A;  3GBG A;  1OLR A;  1HN0 A;  1WD3 A;  1Y7B A;  3BTX A;  1G7Y A;  1NLR A;  2LTN A;  5JIA A;  2PHR A;  3LOB A;  3CZJ A;  2RM2 1;  3MF6 A;  1BEV 2;  1ZBA 3;  3PUR A;  1RUE 3;  5D21 A;  5FP7 A;  3SCG A;  3CL1 A;  3IAP A;  4M0H A;  4RR3 B;  4NJ4 A;  5E6H A;  1ZBA 1;  1RUE 1;  1LCL A;  1NA1 B;  4YYO A;  1RUC 2;  3NST A;  1SAC A;  1WWY A;  1ZX5 A;  4PDW A;  2VC9 A;  4IEV A;  1WCD J;  3OUJ A;  5GZF A;  5FPZ A;  2FQP A;  1ASJ 2;  1RUF 1;  2B8M A;  2BFU L;  2QQJ A;  3C3V A;  5IVC A;  1VRH 1;  1LOB A;  2B46 X;  2JJ6 A;  2ENR A;  1NCR B;  2HWD 3;  5K9Y A;  2ZX3 A;  2XPJ A;  2R30 A;  3AKS A;  4IE4 A;  4A44 A;  2CAV A;  2X29 A;  4WVW A;  1WZX A;  2HWD 1;  3ZR5 A;  1W6P A;  5BUV A;  1Q8O A;  1NQD A;  5G05 L;  1VAM A;  3H3Z A;  4XEZ A;  3LD8 A;  4JGY A;  4LBQ B;  2A7A A;  1YQ2 A;  1PM7 A;  4RHV 3;  4Y26 A;  1APN A;  1AR8 3;  5CVR A;  1U5X A;  2DWR A;  2JDA A;  3Q8F A;  4FOW A;  2Q8O A;  2A3Y A;  3PME A;  1AR8 1;  1JU3 A;  2GN7 A;  3AVR A;  3K48 A;  4Q27 A;  1US2 A;  4MYE A;  2OKX A;  3KV4 A;  1H1A A;  5JAX A;  4Q0U A;  2W68 A;  1DBN A;  1PNG A;  4I09 A;  3ZXE A;  2ZGR A;  4C91 A;  3TN9 2;  1R1Z A;  1PM4 A;  3HT1 A;  4I3P A;  3U10 A;  2VAU A;  2W5F A;  2XWJ B;  4HKW A;  2IFR A;  4AFC A;  3P5B A;  4AEM A;  3PVE A;  5CIS A;  3WF2 A;  4QGM A;  5A32 A;  4LO8 A;  2WIN B;  4OMD A;  1LTE A;  2A6W A;  1NLS A;  1OF4 A;  2HWB 2;  4QPI A;  1X7N A;  4XIO A;  4CCM A;  2VW2 A;  4CUB A;  4TZD A;  2VCB A;  3BIE A;  4JDO A;  5ABJ A;  3DEM A;  2IFW A;  3SCF A;  2WNE A;  1Y9G A;  1YQ5 A;  3O5S A;  1S0C A;  1Z7S 1;  2VH9 A;  4NHM A;  5IT6 A;  5JWP A;  5AFB A;  1H30 A;  4BJ0 A;  4X8P A;  3RI9 A;  2D5F A;  5CIR A;  2OVU A;  3LFM A;  1HW5 A;  5SV8 A;  1W8H A;  3OGS A;  2HWC 2;  4H2A A;  2WT0 A;  3AM2 A;  5FP3 A;  3V65 A;  5GLT A;  4YNI A;  2ZS6 B;  1WBF A;  5B2G B;  5ANQ A;  4QD2 A;  4AGV A;  2EIE A;  4XW3 A;  5FPL A;  1VMJ A;  1R64 A;  3KLS A;  3MPB A;  5C4W A;  1PIV 3;  3WVJ A;  3THC A;  1Q8V A;  5I8Y A;  1QJE A;  2EA7 A;  1CES A;  1PIV 1;  3KB5 A;  5LA9 A;  3B00 A;  4DXZ A;  4XFC A;  1DZT A;  3HOB A;  5HCH A;  1LUL A;  2WUH A;  2YGM A;  4XF9 A;  1SBE A;  3BVC A;  1SLA A;  3FJS A;  3WQB A;  1EAH 2;  3LDR A;  5FZ4 A;  4UOJ A;  2TUN A;  5CA6 A;  1SZB A;  1HXS 2;  2XL7 A;  5SV5 A;  4KWJ A;  4IES A;  2VVF A;  1POV 3;  1OT5 A;  3NKT A;  1LU1 A;  2RS1 1;  2QBX A;  5FLH A;  5HCB A;  4OI0 A;  5F37 A;  1C3H A;  4FPE A;  1ZRI A;  4IEO A;  1POV 1;  3TNQ A;  3VBS A;  4PQ9 A;  1QIQ A;  3AYD A;  5FZ3 A;  1KGY A;  3ST7 A;  1BMV 1;  4BLI A;  4OZO A;  1YFX A;  3NNM A;  4YVS A;  1QXJ A;  2WC2 A;  4YW4 A;  3VDA A;  1Q8P A;  3D6E A;  5A7N A;  1GR3 A;  4YM0 A;  5DAW A;  5DG1 A;  1IHM A;  2VMH A;  3H9A A;  4RFT 0;  3RFR A;  4F7Z A;  4MGT A;  2RR1 3;  3N7L A;  4K1Y A;  1MEC 1;  3BB6 A;  4IL7 A;  1UXZ A;  1JHN A;  3BYW A;  4QPW A;  2NPI A;  4XTM A;  2RM2 2;  2VMF A;  3WW2 A;  2RR1 1;  5EWS A;  3B94 A;  3OBT A;  4GB3 1;  4FFH A;  4KWK A;  4GH4 A;  1ZBA 2;  1RUE 2;  4BB3 A;  3UES A;  3T3Y A;  1OF3 A;  2IXC A;  1YFW A;  5APA A;  1NCQ C;  3WNX A;  5C9A C;  2V5Y A;  3OY8 B;  1GOH A;  4CU7 A;  5A1F A;  3T0D A;  3SMH A;  4L97 A;  1RUF 2;  4JGZ B;  4JCK A;  1AXZ A;  1W6M B;  2G4I A;  3QAC A;  1VRH 2;  3HWJ A;  2VBD A;  3SQO A;  4AAX A;  1GNZ A;  5FXV A;  5KHK A;  4QT6 A;  5FZ6 A;  2RV9 A;  4IV3 A;  3R6S A;  4FO9 A;  3QOP A;  1QEX A;  3ES1 A;  4YWA A;  4IGP A;  3W5M A;  4MHR A;  1EY2 A;  3W21 A;  1FX5 A;  3RMX A;  1J3Q A;  1ENQ A;  1ZNP A;  2HWD 2;  2VE1 A;  3APB A;  4IGO A;  1VMH A;  1HX6 A;  5DZG A;  4JKM A;  5FYI A;  4CDX B;  1S2B A;  2FDI A;  1K45 A;  4AHY A;  1V6K A;  5FZ7 A;  5KHJ A;  4YGB A;  4V1P A;  3ZM8 A;  2LRP A;  3B01 A;  5E16 A;  5LA1 A;  4O65 A;  2O8O A;  1DGW X;  4W50 A;  1GWM A;  1SG3 A;  1FI2 A;  4Q8K A;  4BM8 A;  1BCX A;  3ECQ A;  4K6B A;  4RA0 A;  3T1M A;  1QWR A;  2XG3 A;  1AR8 2;  1V6L A;  4IEX A;  4E2G A;  2W08 A;  5A3W A;  4CYD A;  2P17 A;  2JDU A;  2GC0 A;  1SEF A;  1DZQ A;  2YB7 A;  4GJZ A;  4N7I A;  4NHX A;  2W1Q A;  4YW3 A;  3T2P A;  1SCS A;  2O0O A;  3ILN A;  3LIG A;  3DGT A;  1VAV A;  3VB9 A;  1DQ1 A;  3O1R A;  1US3 A;  3JD7 3;  1PVC 3;  1GQP A;  4MGI E;  4OFG A;  3SC7 X;  2DDU A;  4OUE A;  2Q8C A;  1CZS A;  3JD7 1;  4C0H A;  4CXY A;  2Y38 A;  2GP3 A;  1VBB 3;  2CTV A;  4XUQ A;  3OCP A;  3BU7 A;  5FZM A;  1XPW A;  1FPN 3;  1LOD A;  1FMD 3;  4XAE A;  5D8A B;  3TYJ A;  1TE1 B;  3FHI B;  1RUJ 3;  2WZR 1;  3RJR A;  1FPN 1;  1DQ2 A;  3L2H A;  4CEW C;  4YG0 A;  3MW3 A;  2WO2 A;  3IWZ A;  4P9W A;  1Z7S 2;  5KHI A;  5CB7 A;  2CSG A;  4H55 A;  3WD5 A;  5DDJ 3;  1QNY A;  3GBF A;  3PNA A;  2MNG A;  3T30 A;  5JDB A;  1TME 1;  3GCW A;  1MS1 A;  2WKK A;  2AZ5 A;  4XHX A;  2QTW B;  2E9Q A;  1MZ6 A;  3HN3 A;  5DDJ 1;  3D0J A;  3DYP A;  2C24 A;  4WVV A;  1RJ8 A;  4D6Q A;  2A73 B;  2XQX A;  1O91 A;  1LEC A;  1BHG A;  5B4N A;  3POF A;  2C9A A;  5C8W A;  3AFK A;  2D3R A;  3PVO A;  2TBV A;  4ISQ A;  4NAO A;  3B69 A;  4RSU A;  4AG4 A;  4CP9 A;  4AEK A;  1LEN A;  4OHV A;  4P08 A;  4CPB A;  2EXI A;  1CPM A;  3C7H A;  1PIV 2;  2PHL A;  4DPN A;  2BER A;  2RDS A;  1K5M C;  2VTX A;  2VQU A;  4QXH A;  1W3V A;  2Y0I A;  5CFD A;  2BGP A;  2JKX A;  5CAZ A;  5A6Z A;  2D6P A;  4RS5 B;  4XTP A;  5FZE A;  3FX3 A;  4AVS A;  3FBY A;  2BW8 A;  5FZD A;  1ACC A;  3K4D A;  4I01 A;  1JYN A;  1QOS A;  1Q56 A;  5FXZ A;  1AYN 3;  3VBF A;  2VUJ A;  2NMN A;  2WFF 1;  1W8O A;  4OZX A;  1C28 A;  3VHO A;  3M3I A;  3LSE A;  2RS1 2;  4TWT A;  1RUN A;  3RDI A;  4GWJ A;  4K7J A;  1ODN A;  4Q8L A;  4QM9 A;  5A3L A;  1W39 A;  2XBO 3;  4NHY A;  3B3Q E;  3H8R A;  3CNA A;  4PBO A;  4FPH A;  1BMV 2;  1PZ9 A;  2XLA A;  5C3P A;  5IVV A;  1JZ4 A;  4Q0V A;  2XBO 1;  4AED B;  5JI9 A;  1W2T A;  2Y6G A;  4BWO A;  3AKR A;  3JXS A;  1LGB A;  2NYY A;  2WAA A;  4NRO A;  5I0S A;  2VVE A;  3DN7 A;  4UW5 A;  2P3I A;  5FYM A;  3VDD C;  1MEC 2;  3NKG A;  4AQ6 A;  3U0Z A;  5A1A A;  4LHL A;  5LRR A;  2R16 A;  2RR1 2;  3N3H A;  1W0N A;  5FYS A;  4L9B A;  1GU3 A;  1LHW A;  2D6M A;  2P6H A;  3E5Q A;  3H1Y A;  3OYW B;  3RJ2 X;  3T09 A;  1WW7 A;  1XQN A;  2R32 A;  2YC2 A;  2YY1 A;  3RMY A;  2W87 A;  3LOI A;  2Y64 A;  3O0V A;  1AF9 A;  4GQ7 A;  5C5U A;  2A70 A;  2WJS A;  3AKT A;  4S2H A;  1U0A A;  1JZ2 A;  5FYZ A;  3MIC A;  2WO1 A;  1VBD 1;  2FDK A;  5BNO A;  3LZZ A;  5BPX A;  4RQP C;  2D7F A;  4NIH A;  3I2D A;  4YRD A;  3AB0 A;  5ANN A;  1AVB A;  1RVF 1;  2L9L A;  4HL0 A;  2GH8 A;  4A3X A;  1CAU A;  1UOG A;  3MIH A;  3POG A;  5DUV A;  1BQP A;  3ZYH A;  3KM5 A;  3ZXJ A;  4ET7 A;  2FCT A;  2XVK A;  3ZN4 A;  1DP0 A;  1JYI A;  1O7F A;  2YRO A;  3EXU A;  1UOB A;  4B8E A;  1FNZ A;  2RJK A;  2H0V A;  1ZVF A;  4QPG C;  5K0U A;  1Z0H A;  2AEZ A;  2BUK A;  2CV6 A;  2RHP A;  3OBR A;  4CU6 A;  4EN9 B;  3KD4 A;  2EIC A;  4PLN A;  3LWC A;  5FMD A;  3KF5 A;  3U4X A;  5BY5 A;  4YZ2 A;  3BKZ A;  4LE4 A;  4LLO A;  5A7W A;  4DXT A;  2D6N A;  3N9Q A;  5EIY B;  1JZ8 A;  2NP0 A;  1W8U A;  5HBA A;  4N43 B;  4XUO A;  4HN0 A;  2PN5 A;  5FKB A;  4V2W A;  4XJU A;  1UYY A;  4AQ2 A;  1DG6 A;  3ETQ A;  1SLB A;  1LHU A;  5ACA 3;  1XOY A;  5A3M A;  1XU1 A;  5KC6 A;  2QQV A;  4KGG A;  4BK5 A;  1U5Z A;  5FMO S;  2GC3 A;  3JD7 2;  4FPY A;  4AHX A;  2DV9 A;  2Y33 A;  4G4F A;  3VBH A;  2CDO A;  3S57 A;  3MV1 1;  1GZT A;  3UGG A;  4AVA A;  3NAP C;  4DY5 A;  2ZKL A;  2FD8 A;  3ELN A;  5FRE A;  4YM3 A;  3SXW A;  1UY2 A;  5BNN B;  3ENR A;  4B3N A;  2W3J A;  1A3K A;  3T08 A;  4GAZ A;  1OUS A;  2WZR 2;  1FPN 2;  3T4H B;  2OUH A;  1NYW A;  3D5O A;  4FAH A;  5L9V A;  4W4Z A;  4JZR A;  4I3G A;  5FBJ A;  1UIJ A;  1JH5 A;  3FHQ A;  4BQ3 A;  2YC4 A;  5T5J A;  4OHZ A;  3NO8 A;  3W5N A;  5DDJ 2;  1RL3 A;  4MET A;  2QZ2 A;  1EP0 A;  4OI2 A;  3LA3 A;  4EZH A;  3WW3 A;  1UWW A;  1PVX A;  3AZV A;  4LK7 A;  1UW8 A;  3DPR A;  2WS9 3;  3IDC B;  4ERO A;  2HEV F;  2YUE A;  5JZG C;  5A7Q A;  4QX8 A;  2MEV 3;  3QLQ A;  1F2N A;  4RN5 A;  4AI2 A;  2OZ6 A;  2XUM A;  1GLH A;  2WS9 1;  2HJI A;  4CDW A;  5GJ6 A;  1J3R A;  2MEV 1;  1J83 A;  4HFS A;  1QJF A;  4N53 C;  1ND2 A;  4QKF A;  3VHP A;  4B7E A;  2WYF A;  2YYO A;  4CP1 A;  1RUO A;  2YDE A;  2D44 A;  1EPW A;  4Y20 B;  2WQ4 A;  4E2Q A;  1QXR A;  4TLG A;  3N7M A;  3BTY A;  1GAN A;  3FLT A;  3J4U H;  2BWC A;  3FBM A;  3MIF A;  5DQ0 A;  2WFF 2;  4LIT A;  2XJU A;  4AOC A;  2VJX A;  4MHU A;  3NRU A;  4ZXE A;  4COW A;  5BNQ A;  4ZU7 A;  1PK6 B;  4NO4 A;  5EJZ B;  2DBI A;  4LO4 B;  1AL0 G;  4CCK A;  5DPN A;  3O1T A;  1HIX A;  3WUC A;  2WNV A;  5LCW L;  2WN3 A;  3KVB A;  1COV 1;  1CAV B;  1ZZC A;  3N7J A;  4BLJ A;  1W28 A;  1LGC A;  3RI8 A;  1W8W A;  5CAD A;  5KC5 A;  2XBO 2;  3T1L A;  4LTA A;  3NV3 A;  3KVA A;  4LK6 A;  1JOJ A;  2NMO A;  1YFU A;  4K9S A;  4YFW A;  3UET A;  4HVR A;  1JYT A;  2JIJ A;  1C8M 1;  3IT8 A;  4XXP A;  5JOZ A;  3ATG A;  2UY9 A;  1XNK A;  3AYE A;  1OKO A;  1UN1 A;  2FZ1 A;  4PCR A;  4QKN A;  5A6X A;  1MS8 A;  5FZO A;  5F2S A;  5KHH A;  3CO2 A;  2PAE A;  3AP9 A;  4JRL A;  2AYH A;  2J1S A;  3M3C A;  5C7G A;  2OZJ A;  2VZO A;  2W94 A;  1LAJ A;  4G3Y C;  1RIR A;  1OC1 A;  1LOF C;  3F95 A;  4FPG A;  4ZXK A;  1FT9 A;  1P8J A;  1X50 A;  3M70 A;  1IS5 A;  2KA3 A;  2BBV A;  3GBW A;  1VBD 2;  1NUK A;  3DKW A;  1OQE A;  3SNM A;  4LO6 B;  1JS9 A;  2PTM A;  2CDP A;  5BNP C;  4YM2 A;  4CEW B;  3T0B A;  3TEY A;  1HJF A;  1RVF 2;  4I2O A;  4CDQ C;  1YCI A;  3IDE A;  3WX5 A;  4B29 A;  3KGL A;  5FLJ A;  2GNM A;  3RZM A;  5FY7 A;  1UO9 A;  2VUA A;  3THP A;  1RUI 3;  4CDU A;  1D0G A;  2H6C A;  2RDN A;  4EV0 A;  1WMF A;  2H0B A;  4BXS V;  4E8D A;  1UYX A;  3ZN5 A;  1RUI 1;  3VHN A;  2F17 A;  3AP6 A;  5FZF A;  3WR0 A;  1HQW A;  3VBR C;  2LAL A;  5AFE A;  5FJH A;  2ZXQ A;  1WCK A;  2HBU A;  3R05 A;  1Q43 A;  4PLM A;  1AL2 3;  4EN8 B;  3J7N A;  5L7O C;  2XKO A;  2OXB A;  1O4Z A;  2ZCW A;  4MXW B;  3WDW A;  2VY0 A;  1XC6 A;  1C4R A;  2ADE A;  1AL2 1;  3WG2 A;  1ZA7 A;  1RYY A;  2WZE A;  2E51 A;  4BPZ A;  4EN0 A;  2IZW A;  3BOP A;  4JAA A;  3TEZ A;  3NV4 A;  2Q1F A;  3S7E A;  4RGA A;  1V6J A;  4RR3 A;  4UW3 A;  3TBD A;  5FCC A;  1V70 A;  1NA1 A;  3OG2 A;  3AK0 A;  2VVD A;  1UZZ A;  2QFE A;  4XDP A;  4UFH A;  5GM0 A;  1LRH A;  5J36 A;  3A4U A;  4EJR A;  1FAY A;  2ZGS A;  4DUX A;  1IQA A;  2BYV E;  4Q2F A;  1CAW B;  1XNA A;  5A7O A;  2VXR A;  4ZON A;  1BYH A;  1D4V B;  1ONA A;  4MLO A;  4R9B A;  3VD9 A;  4QB1 A;  3KWV A;  2TNF A;  5FZ8 A;  1BEV 3;  4B1L A;  1NCR A;  3OPZ A;  3ZO0 B;  4EYU A;  3VZK A;  1E5I A;  2FCU A;  4BIS A;  3G6J B;  5T3N A;  3VDD B;  1RUC 3;  3ZYG A;  3I3D A;  2UY8 A;  3WNM A;  4KWL A;  1OI6 A;  2E63 A;  4CTE A;  3ZFG B;  2DVD A;  1YI9 A;  3KT4 A;  1V6O A;  2Y0O A;  1ASJ 3;  4LMF A;  5C5T A;  4LBQ A;  4WM7 C;  4XFH A;  2WS9 2;  3ZDS A;  4QXC A;  4CPB D;  1H8T C;  2UWB A;  1R08 3;  2MEV 2;  4KG0 A;  3RSJ A;  3ZFF B;  5FAX A;  3ZFE B;  5T50 A;  1OQ1 A;  3PDQ A;  4OMC A;  2EXK A;  1SBD A;  1NXM A;  2WAO A;  1R08 1;  1I9R A;  3ES4 A;  5FO9 B;  5F3C A;  2C26 A;  2V5D A;  3PU8 A;  3R4S A;  4NOT A;  2J1T A;  2HH9 A;  2ZGO A;  4RL7 A;  5IJR A;  1VE0 A;  4IV1 C;  2ZZQ A;  2XGX A;  2X09 A;  5A33 B;  4GAL A;  1NE4 A;  5I0R A;  5A3T A;  4QGN A;  3VD4 A;  1UPI A;  3M3O A;  1J3P A;  5I0D A;  4XBQ A;  4C0B A;  2N7G A;  1PO1 1;  2RE9 A;  4A6S A;  4AHZ A;  2QQL A;  4NRP A;  4OLL A;  5JIU A;  1COV 2;  3MZH A;  1F4A A;  2C5D A;  2P5B A;  2CGN A;  1X36 A;  1NXD 1;  4BOW A;  2RDQ A;  4XBN A;  3ZXD A;  2NLR A;  1CVN A;  1UMH A;  2W1S A;  2FDJ A;  2VME A;  4FPK A;  5CZK A;  5FDB A;  5GZG A;  3BTA A;  1UMZ A;  1C8M 2;  1S0E A;  2UWC A;  3POJ A;  4IGQ A;  5FUN A;  4CCD A;  2BZD A;  2QQO A;  4ATF A;  5LWB A;  2WA3 A;  2JG9 C;  5LK5 A;  2UYB A;  1NZI A;  4QHB A;  4RYD A;  5D1I A;  1JI6 A;  4KWU A;  1KEX A;  5FQ0 A;  4GUL A;  3RS6 A;  2A6Y A;  1W9T A;  3I7D A;  2WDB A;  1JZ5 A;  3T2O A;  1G8W A;  3POY A;  4JC1 A;  3ZKY A;  2R1B A;  3LQC A;  1KDM A;  1JOB A;  3JQX A;  2QCS B;  2Y60 A;  4QU2 A;  3MEP A;  4XIL A;  4M3C F;  3LSD A;  3G7D A;  1UU5 A;  3KMH A;  3NAP B;  3P1I A;  3R4U A;  4OYU A;  2VGD A;  5FXW A;  3WT3 A;  2YFZ A;  1V00 A;  3OB8 A;  4X6R B;  4XC9 A;  4DFS A;  1W6Q B;  4XF1 A;  5KHG A;  2HYK A;  4LT5 A;  3JQW A;  1HQL A;  3ZPO A;  4LA2 A;  4XUT A;  3JUU A;  4IEY A;  1QDC A;  1OOP B;  1QOO A;  3VL9 A;  3ZYI B;  3FFQ A;  2ZGP A;  5FTT C;  2ZEZ A;  2RMU 1;  3PUA A;  4DIQ A;  2XUE A;  3IM0 A;  4M3C B;  1OKQ A;  3OPW A;  2KD7 A;  3AZZ A;  4AVV A;  1CON A;  1MQT C;  4NR1 A;  1RUI 2;  1FOD 1;  4NUB A;  2XKP A;  2CNA A;  2W46 A;  1TG7 A;  2BEO A;  3EHK A;  3MFC A;  1U12 A;  3NJX A;  4MVT A;  5DAP A;  4BQ1 A;  4NHL A;  1N1Y A;  2JD4 A;  4FSJ A;  1EAH 3;  3KCY A;  3TEX A;  3ZMN A;  4QXB A;  4XVH A;  2E26 A;  1NX9 A;  2V4V A;  2VZV A;  1AL2 2;  3RWK X;  1QOT A;  3THD A;  4D3W A;  2V73 A;  3LF7 A;  4JVA A;  4P00 B;  4PDW C;  4AI8 A;  1I5Z A;  4BQY A;  4LE3 A;  1SFP A;  3QCW A;  2ZEX A;  4LBL A;  1OA4 A;  4XYX A;  4GWN A;  1IS4 A;  2W47 A;  3C2U A;  3Q8C A;  3WY6 A;  4XZP A;  1HRI 3;  4MG2 A;  4MSV A;  1XE0 A;  3ZXF A;  1S4C A;  3HIF A;  3GYD A;  4DXR A;  1JUI A;  3N9M A;  2PHU A;  4MGK E;  1HRI 1;  4FI9 A;  4WVM A;  5FZ9 A;  5C3R A;  3DYM A;  1TMF 1;  3M7A A;  4BA6 A;  1F9K A;  4EQV A;  4LR4 A;  3OY8 A;  4FPC A;  1DGR N;  1WCU A;  3AL5 A;  1XNC A;  1ENX A;  2B5H A;  2GAL A;  4JGZ A;  4MXV A;  3VKN A;  3KV5 A;  2OII A;  2B4K A;  1W6M A;  2RG4 A;  1QH7 A;  5FZH A;  2RM2 3;  3BTZ A;  1VPH A;  2FHR A;  3J8F 3;  1N3P A;  1EYB A;  1OVP A;  4JGY C;  1WD4 A;  3VBO A;  4R4X A;  4AFD A;  4CCJ A;  5JPN B;  1ND3 B;  2WZ8 A;  1HB4 A;  3CJI B;  2WQ8 A;  3J8F 1;  4QB2 A;  3E5X A;  3HD8 B;  1IS6 A;  3MIE A;  5LBF A;  4CA9 A;  2OQ7 A;  1LB2 A;  2GC1 A;  4D94 A;  5I0U A;  2ZGT A;  3ME2 A;  1C57 A;  3A22 A;  1MVE A;  1RUF 3;  3HBZ A;  3PUI A;  4KMQ A;  2IXJ A;  4FVV A;  1VRH 3;  4ONU A;  4AVT A;  4Y4Y A;  2DUQ A;  3PJY A;  1H2L A;  2Y26 A;  5CEH A;  1R08 2;  1VIW B;  1MR5 A;  2JDY A;  2YMZ A;  3K2O A;  1UOF A;  3NMB A;  3VD3 A;  2P3Y A;  1GZW B;  4QPI C;  5F5I A;  4M00 A;  4E4Z A;  3AL6 A;  3J7L A;  2IVJ A;  1RTV A;  3O1M A;  1KS5 A;  3ZKU A;  2YPJ A;  1IPJ A;  5BNP B;  5IAX A;  4NHK A;  2WLQ A;  3FUO A;  2XH6 A;  5FUI A;  5ABJ C;  1O3Q A;  1BBT 1;  4YW6 A;  3VKF C;  5J3U A;  1PGS A;  1V6M A;  1K12 A;  1PO1 2;  2WLP A;  1CD3 G;  1L7R A;  1KD7 A;  2J42 A;  2JG8 B;  1OBN A;  2DCJ A;  2A3X A;  3N9N A;  4HK9 A;  4NIG A;  1AYM 1;  1O4T A;  4PIY A;  1AX0 A;  1RC6 A;  3KV6 A;  3M8L A;  2EF6 A;  5LRS A;  5KXE A;  2P34 A;  3B7M A;  5C4W C;  2EIG A;  3OUI A;  1W2N A;  2X5I B;  4XFG A;  1OSG A;  2A6V A;  4FPO B;  3H3U A;  2AGS A;  4QX2 A;  5DZF A;  1QGL A;  4AI1 A;  2WNU A;  1WLD A;  3GDB A;  4Z82 A;  1H2M A;  5FY1 A;  2CWM A;  5JR7 B;  3NNJ A;  4Y5Z 0;  5KBF A;  3P3N A;  4GWI A;  4NWW A;  3D0S A;  2XJP A;  1W6O B;  2QVS B;  2ZBJ A;  4E2S A;  5FPV A;  1Z7S 3;  1O3T A;  2XXZ A;  2ZAH A;  2XJT A;  3I3E A;  4L11 A;  4W6Y A;  4BIF A;  4D6R A;  3N9O A;  1ZZ6 A;  3ZXG A;  2PQQ A;  5DXD A;  2ZX1 A;  4QHZ A;  1EUT A;  1CAX B;  2V72 A;  5GLZ A;  3DV8 A;  3VZM A;  1UY3 A;  5KXD A;  4K8R B;  4RS5 A;  3VBS C;  1OLM A;  5JXJ A;  3WLU A;  3LE0 A;  4Z8B A;  2XWB B;  4LIV A;  1YQC A;  4DUW A;  3WDU A;  1OXC A;  1GNH A;  5J09 A;  2RMU 2;  4YVS C;  5FYV A;  3RZH A;  4YGE A;  5T5P A;  4OHY A;  4Y4R A;  4QX7 A;  1XE8 A;  1WKY A;  1FOD 2;  3M2M A;  3PUH A;  4W6W A;  4P9Y A;  5BV6 A;  5F2W A;  1ZA4 A;  4IET A;  3LEI A;  3Q9O A;  3SIS A;  2QKD A;  4WM7 B;  4AED A;  3T0A A;  5LY2 A;  5FPX A;  4QM8 A;  3GAL A;  3LA7 A;  3ZVX A;  4GH4 C;  2ES3 A;  5HXV A;  3R4D B;  5FRA A;  3IBM A;  2RS1 3;  3A23 A;  2HLE A;  4WM8 B;  4ASL A;  1CZV A;  1UU4 A;  2F4P A;  2JIC A;  4LBK A;  1YC6 1;  2YC0 A;  3WP5 A;  5EPA A;  3U1X A;  1B35 B;  2WBK A;  4GA9 A;  4QDS A;  3IDB B;  4XMI A;  1A6C A;  1N1S A;  5DUX A;  4KNC A;  1J84 A;  5AVP A;  5EQU A;  4C8D A;  4UT5 A;  1HRI 2;  3WHT A;  3H8U A;  1GUI A;  4IV3 C;  5LBB A;  4DEQ A;  1D0H A;  1TMF 2;  2QQM A;  4QAW A;  3RQ0 A;  5JOY A;  2YFU A;  1ODM A;  1VP6 A;  1DGR A;  4LKF A;  5LAT A;  3ZXK A;  3O0X A;  5L36 A;  1MEC 3;  1Q5O A;  4JX0 A;  3SIT A;  4AE2 A;  3P6B A;  4AQS A;  4N9H A;  1PX4 A;  1YLL A;  3O1O A;  4GB3 3;  2J1U A;  2D3S A;  2W92 A;  4GZ9 A;  3RNS A;  1UPS A;  2AH2 A;  3J8F 2;  1XXN A;  1UZ0 A;  3WF3 A;  3AJZ A;  4GXL A;  1DGL A;  5J7M A;  5FYU A;  2W91 A;  2JEN A;  3CKH A;  3BIW E;  2MHF A;  1V0A A;  1VLN A;  2R06 1;  1NZC A;  4AGR A;  4XQ4 A;  3FLR A;  2XVG A;  2LUW A;  1V6I A;  2JEC A;  2EIB A;  3POS A;  1KS4 A;  1WW6 A;  1F5J A;  3WNP A;  1RUD 1;  3B5L B;  5C70 A;  4Y1Y A;  5IHR A;  4AFB A;  1ALY A;  5FZ1 A;  2EID A;  4LHS A;  2WA4 A;  3ZSM A;  3EB7 A;  4YW1 A;  4N43 A;  1K42 A;  1K5J A;  2B42 B;  4ARX A;  1HN1 A;  2JDK A;  1BLZ A;  4HBN A;  2J1E A;  5GLW A;  3IPV B;  5GLU A;  2X53 S;  3TB0 A;  2WFP A;  5M0T A;  1VBC 1;  3LIH A;  4A41 A;  1BBT 2;  2BRT A;  5FWJ A;  3EQE A;  3ZOI A;  4AF9 A;  3INA A;  2ARC A;  4QX3 A;  5FMO L;  1CIW A;  3WCR A;  3NL1 A;  3WW4 A;  5BNN A;  4K1Z A;  1UIK A;  2ILM A;  3OBA A;  3VKL A;  2ZEW A;  4A2U A;  5FOJ B;  1AYM 2;  3GNE A;  2ORZ A;  3U4S A;  4QGL A;  3N9P A;  3CJX A;  3QD6 A;  4EWE A;  1DF0 A;  3ZIW A;  3BAL A;  3J7M A;  2DUP A;  2QDR A;  2A1X A;  4RFR B;  2UU8 A;  5JOX A;  4PI0 A;  2Q0A A;  2VZ3 A;  4AZZ A;  3ALQ A;  4XAC A;  3LAG A;  4ZU5 A;  2NN8 A;  3AXE A;  4LUM A;  3CLP A;  2NQY A;  4S2G A;  4XJ9 A;  4PDW B;  4COV A;  3K51 A;  3FMG A;  4FAG A;  4LOR A;  2XON A;  5CFD C;  1UY4 A;  2PLV 3;  3VBU B;  2VUL A;  3RRD A;  1S0J A;  2WZR 3;  2Z42 A;  1FXZ A;  2RJ2 A;  3F2Z A;  4N8M A;  3VN4 A;  2VTF A;  4PIX A;  4Z2W A;  2PLV 1;  1Y9Q A;  4QDR A;  3RYR A;  1DZR A;  3VBF C;  5C8C B;  5A3O A;  5KWR A;  5LBE A;  1N3Q A;  1OLQ A;  1YYN A;  4YVW B;  1GSL A;  4N90 A;  5FK7 A;  1TME 3;  5DAV A;  5T5L A;  4IEZ A;  1HV0 A;  1MAC A;  4Y20 A;  2XR4 A;  4NPL A;  3I49 A;  5JLV A;  5F39 A;  4LO7 A;  3SLI A;  2R07 3;  3KCC A;  2ZHM A;  2XB6 C;  5GKA C;  2OYZ A;  2ZMK A;  1SPP B;  3IMM A;  3ILR A;  1JZ6 A;  2R07 1;  4UW4 A;  3H7J A;  4DRV A;  1JYC A;  1H9P A;  1LOE A;  1ULP A;  2O14 A;  2XML A;  1PK6 A;  3HAG A;  4CEY A;  1U5Y A;  2FDF A;  1AZD A;  4HSL A;  3VD7 A;  1SDW A;  3D82 A;  3BCW A;  1Y3T A;  2BGC A;  2UWA A;  1CAV A;  5F3G A;  1S2E A;  1GV9 A;  1SBF A;  3WF4 A;  4A6O A;  4PF1 A;  4I0W B;  2BTV C;  2JDN A;  3AZW A;  2WFF 3;  1G9C A;  3IZO A;  4AVC A;  2V09 A;  2VU9 A;  3LDK A;  4GKX A;  2JB4 A;  4IW3 A;  2K9Z A;  5FWE A;  2GNT A;  1J1T A;  4XMA A;  5BNO C;  3SKJ E;  2D93 A;  4E4D X;  4K21 A;  1B09 A;  5H9P A;  3ZYR A;  5C3S A;  1YJL A;  2PMW B;  4UBG A;  2ZX2 A;  4Q4V 3;  1CR7 A;  4XIK A;  3WOG A;  4L0P A;  2ZGN A;  4Q4V 1;  2G1M A;  3GF6 A;  5FZI A;  5A7S A;  4DZG A;  5IVF A;  5DUU A;  4HAN A;  4NN0 A;  2ZHN A;  4KBB A;  5F5A A;  1WLW A;  2R1D A;  5K0U C;  4WV8 A;  3ZLI A;  5IVJ A;  5EYY A;  2A75 A;  3PUS A;  4UF0 B;  4S2F A;  3ACF A;  1VBA 3;  2XLG A;  4P02 B;  4GB3 2;  1XSQ A;  2BNN A;  4LUL A;  2WR9 A;  4HN1 A;  1QHD A;  1QJX 1;  2IVI B;  4Q4X 3;  1VBA 1;  1UL9 A;  2R06 2;  3NJV A;  3HVD A;  3WDT A;  4Y22 B;  1VBD 3;  4KL1 A;  5FYY A;  1PZ7 A;  4N9I A;  4IE7 A;  4Q4X 1;  3OJB A;  4Y5S A;  4MH0 E;  1RUD 2;  2WL1 A;  5EV7 A;  4YFZ A;  5EP9 A;  3ITQ A;  1OPO A;  1RVF 3;  1UY0 A;  3ZYP A;  1FNY A;  4CUC A;  1HLC A;  1ZYB A;  2BOI A;  1OA3 A;  2RS5 3;  3E5U A;  5FY5 A;  3VBH C;  4MXW A;  3RZG A;  1AJK A;  1GOF A;  1OHF A;  2RS5 1;  2VNO A;  2YHJ A;  1H2K A;  2C6S A;  4G9S B;  5CNA A;  3U75 A;  2VOK A;  1VBC 2;  3SHR A;  2X10 A;  2VNR A;  1OMI A;  1W04 A;  1YEW A;  1GFF 2;  3OGV A;  4NE9 A;  1H4H A;  5DZE A;  3WF0 A;  2E7T A;  5EJ1 B;  4YG6 A;  3A0N A;  4XUP A;  5DN2 A;  4HKO A;  2DFB A;  2XJS A;  1UX6 A;  1QJY 1;  4F83 A;  3OD4 A;  3EYP A;  1V9U 3;  1CGP A;  1CAW A;  2B45 X;  3DPR C;  5FLI A;  5F5C A;  1V9U 1;  1A8M A;  1EV1 1;  3MUZ 1;  1MZF A;  3FZ3 A;  1UU6 A;  5FY4 A;  4CDW C;  2HWF 1;  4PI2 A;  4HMZ A;  1UCX A;  2XDV A;  3WNN A;  3ZPY A;  1ND2 C;  2DFC A;  2PXJ A;  4GMP 0;  4LA3 A;  1XYP A;  2QZ3 A;  4HKL A;  1TVG A;  2YBP A;  2OQ6 A;  1DHK B;  5JXH A;  4PF5 A;  4OUS A;  3UGF A;  1A8D A;  2VUD A;  2D40 A;  3MBW A;  4CVU A;  2PLV 2;  3MGU A;  3I2F A;  4HET A;  3LDB A;  3WG1 A;  4AFA A;  3ZFF A;  2VO5 A;  4UXA A;  4LEJ A;  1MPX A;  1WW4 A;  2VBB A;  3L9J T;  1JOD A;  1G86 A;  3ZFE A;  4AL9 A;  1LNS A;  4XCA A;  1SDD B;  1WA4 A;  1SLC A;  5HCF A;  3DEC A;  3VGI A;  2WAB A;  1TME 2;  2OPW A;  2WNV C;  5B4X A;  1FV2 A;  3WNK A;  4MGQ A;  1DIW A;  4FPJ A;  3L2Y A;  5A33 A;  4CXX A;  1ULG A;  1GQH A;  1PGW 1;  1KJL A;  2R07 2;  3DKQ A;  1SHW B;  3I3B A;  5FYT A;  3ZYB A;  1DQ0 A;  1W9Y A;  4Q0P A;  2V4A A;  1TNR A;  1LHN A;  1TNF A;  1YHF A;  4YSF A;  4FFI A;  1LES A;  2Q4S A;  1DLC A;  5IVE A;  4QMA A;  4A7K A;  5L9R A;  4MGS A;  2CHH A;  4NII A;  2VQ0 A;  5C9A B;  1NCQ B;  3NNG A;  4HOO A;  1WMX A;  2XJQ A;  3SEP A;  4ASM B;  5FP9 A;  2KR2 A;  1BVV A;  3GGL A;  1IOA A;  3O1S A;  4XF4 A;  1AR9 1;  1RHI 3;  2UYA A;  3S7I A;  1LOC A;  4AEJ A;  2JIG A;  2O8Q A;  1W8F A;  1UZW A;  3Q8A A;  1NOV A;  1W2A X;  2WII B;  2WZP P;  1COV 3;  2FDG A;  1RHI 1;  5JXI A;  5GLV A;  2VNV A;  3PUQ A;  2J22 A;  4M4R A;  3HPN A;  4Q29 A;  1XYO A;  2VPV A;  3UV9 A;  1C8M 3;  1R09 3;  2E31 A;  3GJA A;  1HB1 A;  3T2T A;  4YW7 A;  4X6Q B;  4EN7 B;  1GKB A;  1X82 A;  4Q4V 2;  1A34 A;  1D2Q A;  2Q1M A;  2ZJC A;  4CDU C;  3PHM A;  1R09 1;  5H9R A;  1W6Q A;  5KXB A;  2ZML A;  3WDX A;  4OQ8 A;  4F8A A;  3IMN A;  4OQ9 A;  3WCS A;  3CBN A;  4HZF A;  1CX4 A;  4QQH A;  3U78 A;  5A3N A;  5T52 A;  2BDR A;  3ILF A;  1GBG A;  1UNB A;  4CU8 A;  3I2G A;  1HB3 A;  3HNB M;  4P14 A;  4XF3 A;  1QJX 2;  2OT7 A;  4JTN A;  5FZA A;  2HEW F;  1OUX A;  1VBA 2;  4JKK A;  4M3C A;  5CU1 A;  1W03 A;  4I0A A;  5AC9 3;  4YPJ A;  3LFI A;  3S30 A;  2OUJ A;  5C33 A;  3WNO A;  2VZ1 A;  1NQJ A;  4Q4X 2;  3ABZ A;  1UF2 C;  1JXN A;  3POB A;  3V0A B;  4D69 A;  5AC9 1;  2VMI A;  2OA2 A;  5CFC A;  3MFA A;  4P5Y A;  4L92 A;  3WF1 A;  2P1B A;  4TLF A;  2GME A;  1GQG A;  4ITC A;  1N3O A;  1S0D A;  2SLI A;  4H7M A;  4Q0Q A;  1MS3 A;  2QNK A;  1L7Q A;  4RR3 C;  2GMP A;  1QH6 A;  3O0W A;  4Q5O A;  1O4Y A;  1NA1 C;  2PEL A;  4CUA A;  3MHZ A;  3MLJ A;  5LZ6 A;  2RS5 2;  5JPM B;  2VOW A;  3ACI A;  3MV0 1;  4K8F A;  1BZW A;  3DCQ A;  3DL3 A;  4I02 A;  3USU B;  2IWG B;  5HPO A;  1ZRE A;  4D0Q A;  3POI A;  2WT2 A;  4J25 A;  4I30 A;  4XJ8 A;  1F4H A;  5CYY A;  4QQL A;  5J37 A;  2DUR A;  1JUH A;  1NCR C;  2VZU A;  3R0R A;  4KG8 A;  2WWU A;  3MW2 A;  4LBO A;  1KJR A;  4B1M A;  5EZW A;  1O59 A;  5FMB A;  4FBF A;  3VZJ A;  4LQR A;  1QJY 2;  5IAV A;  2P3J A;  1JYV A;  2ZEY A;  3ZDV A;  1H6Y A;  2GN3 A;  4FTE A;  3DUI A;  3A7Q A;  3FFZ A;  4ZS2 A;  1K5M B;  5IW0 A;  4YZ3 A;  5FIX A;  5L73 A;  1V9U 2;  1K3I A;  1EV1 2;  4BK4 A;  4CCO A;  2R7E B;  1DU3 D;  3NV2 A;  3PTR B;  4A7Z A;  5CKQ A;  1UD1 A;  2ARE A;  3MYX A;  3W58 A;  1ND3 A;  2HWF 2;  3AJY A;  4MOA A;  5IVY A;  1UZY A;  3CJI A;  3N35 A;  2WSU A;  1AHS A;  5IVB A;  1AR7 3;  3WXP A;  3OGJ A;  4HK8 A;  1PZ8 A;  1DYP A;  1YQ6 A;  4Y5T A;  3X29 B;  2ARA A;  1C1F A;  3AXD A;  2JDH A;  1AR7 1;  1IG3 A;  2VW1 A;  3N7K A;  5GZC A;  5DAB A;  3VV1 A;  1TZO A;  2B9U A;  2W1W A;  4UFI A;  3KV9 A;  3N9L A;  3ZR6 A;  3GM8 A;  2H6B A;  1WA6 X;  4GKY A;  1GIC A;  4DQA A;  3BUC A;  2WO7 A;  2JXA A;  1X8M A;  2F4L A;  2A71 A;  1GZW A;  2RVA A;  3OEA A;  4P9X A;  3OEB A;  4COY A;  2DU1 A;  1STM A;  1KRI A;  4ZU4 A;  4IDZ A;  3O12 A;  1PGW 2;  2GC2 A;  2VQT A;  3LPG A;  5DMY A;  2BU9 A;  2A5Z A;  4QX5 A;  2W39 A;  3ZN6 B;  1X8E A;  5LY1 A;  2YXS A;  1F15 A;  2I2S A;  2JE9 A;  1RMU 1;  3HT2 A;  1KIT A;  5A7W B;  2CGO A;  2JG8 A;  4KU8 A;  5A3U A;  2ZGU A;  4P9L A;  3S0M A;  2OW4 A;  2D3P A;  1VB2 A;  5FXX A;  1ZZ8 A;  3W59 A;  4HSJ A;  3K4Z A;  4D7Y A;  2FBE A;  4LO5 B;  4YLZ A;  2RDR A;  3W9A A;  3THT A;  3H8O A;  3QH7 A;  2ZAC A;  4RQP B;  5HV0 A;  2VTX J;  3KT1 A;  4DRR A;  2JB8 A;  1IG0 A;  1YQ8 A;  4FXK B;  5FZB A;  2X5I A;  3VBH B;  1AR9 2;  2ZGQ A;  3VUO A;  1H6X A;  2EXH A;  1H0B A;  4KQ7 A;  2GND A;  1PO1 3;  1ZBE 3;  2W0X A;  4MZU A;  4SLI A;  1QNW A;  3RVH A;  2WT1 A;  5FPU A;  1RHI 2;  4RD7 A;  1UY1 A;  1ZBE 1;  4HPK B;  5FR3 A;  1MS5 A;  2I07 B;  1W6O A;  4QPG B;  1BXH A;  2FMD A;  4JKL A;  1QKQ A;  2C4X A;  4BXF A;  4AQT A;  2VNG A;  4YZ1 A;  1ST8 A;  1QXP A;  3CQO A;  4IE6 A;  4QPY A;  4LJH A;  1R09 2;  3V0B B;  4Q1P A;  1CAX A;  3WP6 A;  1XYN A;  5FY8 A;  3RYK A;  1NT0 A;  4OHW A;  2K2S A;  2QQI A;  4E9K A;  1S0B A;  5L19 A;  3GZA A;  1IZ3 A;  2FCV A;  3FL7 A;  3OGR A;  2BOJ A;  3HQU A;  1JU4 A;  3NNL A;  1XB9 A;  4FOQ A;  2BPA 2;  4XZU G;  2PYT A;  2Y6H A;  1WCQ A;  4WZC A;  4YM1 A;  4CDW B;  3WEZ A;  1DYO A;  3FC0 A;  5FY9 A;  3WP4 A;  4P9G A;  3B9C A;  3AX4 A;  2QQW A;  2ZPX A;  1D2S A;  2G19 A;  4EWD A;  5AC9 2;  3FN9 A;  1QMJ A;  3LEG A;  3GCX A;  4R9D A;  5JVV A;  2G9Z A;  2WRA A;  1WUV A;  4IEW A;  4O61 A;  4QHO A;  3C7F A;  1AX2 A;  1UKG A;  1VJ2 A;  2RMU 3;  5L9B A;  2P4E A;  4XPV A;  4RGG A;  2B7Y A;  3E6D A;  2ZX0 A;  5A80 A;  4WM8 A;  4ZKT B;  4MV2 A;  1I5P A;  5EYX A;  4XAB A;  1T2X A;  1L3J A;  1D7P M;  1FOD 3;  1W3X A;  1U5I A;  1B35 A;  3IDA A;  4GMP 1;  3JU9 A;  5JXG A;  4JGZ C;  4BME A;  1TQ5 A;  4Q26 A;  1MS9 A;  3U07 A;  1AXK A;  1HQN A;  1D4M 3;  1V6N A;  1GYK A;  2P37 A;  5CBL A;  3ZX7 A;  1WCS A;  3VBO C;  4IEU A;  1REE A;  4M4P A;  5FUP A;  1YO8 A;  1D4M 1;  5IK8 A;  3KF3 A;  3IB3 A;  4QWN A;  4OCT A;  1YIP A;  5FJK A;  3U11 A;  4N53 B;  1RJ7 A;  3NW4 A;  2QE3 A;  4Z1V A;  5HV4 A;  1RUG 1;  1X33 A;  1C8N A;  2VMD A;  2VMC A;  2BWA A;  1G9F A;  4AAP A;  4XJA A;  4NRQ A;  1ENS A;  4H3W A;  5GZD A;  1RIT A;  1VAL A;  1Z78 A;  2G9F A;  1LHV A;  5F3E A;  1C5H A;  5IFP A;  2DVB A;  2DU0 A;  2BNM A;  1TMF 3;  4Y1Z A;  4CCC A;  2PHW A;  2VD7 A;  3ACL A;  4A7Y A;  1QJU 1;  2SBA A;  2QUO A;  2CGP A;  2JKB A;  1AR7 2;  4OHX A;  3UKV A;  1O6U A;  3HR9 A;  2VOT A;  4OUM A;  4AI3 A;  4BMB A;  1H8V A;  1SFN A;  1IQD C;  4QKB A;  5JCT A;  1W9S A;  1FYU A;  2PFW A;  3HN1 A;  4BQ5 A;  4O9G A;  3RG0 A;  3V0B A;  3LEK A;  1JZ7 A;  2VZR A;  1HXS 1;  1SFY A;  3TWI A;  3M4F A;  4CCN A;  1G9A A;  4FOY A;  4CDU B;  1UZV A;  4ZHN A;  1MVQ A;  1GOG A;  1ZZ7 A;  3NQH A;  5J98 B;  4XFB A;  2WSV A;  3IPV A;  4KH9 A;  1JN2 P;  4AVB A;  3CMG A;  1QF3 A;  1SLL A;  1Y43 B;  4OUL A;  4YW2 A;  4CDX A;  1XNB A;  3DXU A;  2BQP A;  4H7L A;  3AP5 A;  2GDF A;  4HVO A;  5H9S A;  1RMU 2;  3AMM A;  1H1I A;  3CF6 E;  4IE5 A;  2BP6 A;  3AZX A;  5EJ3 A;  4PT6 A;  3OOX A;  2K0G A;  3HMY A;  2PA7 A;  2B9V A;  3VD5 A;  4ASK A;  2WNU C;  3IN9 A;  4SBV A;  1IS3 A;  1LEM A;  5FPA A;  3OUH A;  4IEQ A;  2WYS A;  4UFM A;  1VMF A;  1LHO A;  2EAK A;  3LB9 A;  3ZSJ A;  1YIF A;  5G04 L;  3JZV A;  4R52 A;  3ZSK A;  2VR4 A;  1BBT 3;  3OD0 A;  1PX3 A;  2IUW A;  5LA0 A;  2QQK A;  4B4P A;  2QQP A;  1PGL 1;  4CDQ B;  4JHZ A;  2VQA A;  3POW A;  1ZRC A;  3B93 A;  4KI5 M;  3LA2 A;  3S5Q A;  4Y24 A;  2I45 A;  3K3O A;  1WME A;  1ZBE 2;  1LOA A;  1Y4W A;  2NZ9 A;  3DXT A;  3VBU A;  4AYU A;  4RS5 C;  1AYM 3;  3SKV A;  2YGL A;  5K7P A;  3T4V A;  2VCA A;  4XQW A;  2B39 A;  5D8A A;  4QXK A;  3VZL A;  3WSO A;  3RZL A;  5CG8 A;  2D5H A;  5K4L A;  5C8C A;  3VBR B;  3SEE A;  3C7G A;  1RGS A;  4YVW A;  3O1V A;  5F7U A;  2KXL A;  3I2J A;  4HT1 T;  4QX1 A;  5LAS A;  3H0O A;  4TSV A;  3TEW A;  5L7O B;  1RUH 3;  3CZU A;  1WBL A;  4FXG B;  2J1V A;  1DYK A;  3OBZ A;  5LEK A;  1RUH 1;  3GJB A;  1SPP A;  1HJG A;  4GD4 A;  1O3R A;  4AED C;  1YI7 A;  5BXX A;  2DCY A;  1JTZ X;  1ENR A;  3MI8 A;  3ROU A;  3P3P A;  4TYS A;  4D6S A;  2GZW A;  5E8A A;  4RHV 1;  1DFQ A;  4JHT A;  1WMD A;  2QDN A;  2W9X A;  1OLM E;  5H9Q A;  4FOV A;  2ZOE B;  3NVC A;  3K46 A;  4BDV B;  1PMJ X;  2E6V A;  4PHZ A;  4B7K A;  4UW6 A;  4EZ4 A;  3S5A A;  3LPF A;  4PIZ A;  2A6Z A;  2ADD A;  2YPD A;  1GWL A;  4LKS A;  4UWD A;  3WV6 A;  1VAK A;  3HNY M;  3T2Q A;  2PHD A;  1W06 A;  2Q30 A;  3KT7 A;  4UI9 L;  1D4M 2;  4LBM A;  3KQ4 B;  3GXU A;  1W0O A;  5T55 A;  2D6O X;  3SH5 A;  1H8T B;  1UYZ A;  2E32 A;  5FV3 A;  3WP3 A;  1WGP A;  1RUG 2;  2JE8 A;  5FQ0 B;  3OGG A;  5GZE A;  4COU A;  4QKD A;  4UAP A;  1W8Z A;  4UF0 A;  3VLB B;  5T5O A;  4DNY A;  3CDZ B;  1M06 G;  3QH6 A;  2CU5 A;  4IV1 B;  1LU2 A;  4K3U A;  3D4K A;  1F8V A;  3OYW A;  4Q1R A;  4XDQ A;  3C7O A;  4D7S A;  4N43 C;  4Y22 A;  1QJU 2;  2DVF A;  2D97 A;  3III A;  4M0N A;  3PU3 A;  3ACH A;  1J58 A;  4MX3 A;  4CRQ A;  3E6C C;  4XOG A;  4BZ4 A;  2CYF A;  4Z2A A;  5FYC A;  1G6N A;  4NVP A;  1N1V A;  3MF9 A;  1SMV A;  2DF7 A;  4FP2 A;  2PQS A;  1BK1 A;  2VZT A;  3MIB A;  3WG4 A;  2IXK A;  1YNA A;  2X8K A;  3VKO A;  3ORJ A;  2R06 3;  2I74 A;  3PIJ A;  5BNN C;  1OH4 A;  4FFG A;  2JG9 B;  2Y34 A;  3M3E A;  3FUQ A;  1X9T A;  1J59 A;  2RJL A;  2YBS A;  4Q4W 3;  5C3Q A;  3UJO A;  5LK7 B;  3FWE A;  1RUD 3;  3TNP B;  1T6B X;  2CAU A;  4UFJ A;  4J1X A;  4LBQ D;  4Q4W 1;  5FZG A;  3UGH A;  3I2H A;  4LXL A;  2ID4 A;  5FZL A;  5I8S A;  1JBC A;  3AKQ A;  3I59 B;  2AUY A;  3LKJ A;  1VB4 A;  3PMS A;  2W52 A;  2MPF A;  4COZ A;  1CJD A;  1KXG A;  1VBC 3;  2CY6 A;  2IXI A;  4IE0 A;  1MZE A;  1UQX A;  5FPB A;  5LBC A;  1HKD A;  1QDO A;  2BV4 A;  1GP6 A;  2VBP A;  4UBH A;  4NMI A;  3SCH A;  3TOJ A;  1XU2 A;  5A6Q A;  3BI3 A;  3EBR A;  1PGL 2;  4WVM B;  3KZ4 C;  1W6N B;  5JOW A;  1I6X A;  3EMR A;  1DLL A;  4AR2 A;  1W99 A;  3SH4 A;  1LKN A;  3ZXL A;  1MQT B;  4WVZ A;  4AK3 A;  1GZ9 A;  3AFG A;  5IFT A;  1E5R A;  2BJS A;  3AP7 A;  3VBO B;  5FO7 B;  4L99 A;  4MGY E;  3MPP G;  3RGB A;  4CEY C;  1PK6 C;  2XHK A;  4FT8 A;  1DQ4 A;  1XSR A;  4W65 A;  3VL8 A;  3N36 A;  2X05 A;  1UAI A;  1SCR A;  4AWD A;  4BHP A;  4ZY9 A;  1S1A A;  5A3P A;  1GNY A;  2XOM A;  1RUH 2;  3VKM A;  1S2K A;  5F1R A;  1AXY A;  1I1E A;  5JSR A;  3H3L A;  2BFU S;  5F6L B;  2VZP A;  1IPK A;  1POQ A;  1PO2 3;  2VCC A;  1RXG A;  5CFC B;  1S55 A;  4RHV 2;  1ULE A;  2D43 A;  5ISL A;  2LRO A;  2VEC A;  1GWK A;  2CL2 A;  4J6G A;  1JYW A;  1PO2 1;  5LA2 A;  3U37 A;  4S2D A;  4MAD A;  3RWN A;  5C9A A;  1S0G A;  1NCQ A;  1E5S A;  1AJO A;  1DDL A;  3PTY A;  1W6P B;  4O9E A;  4QB6 A;  5F32 A;  1JOP A;  1PHM A;  2C1F A;  1PVC 1;  4XET A;  5EXO A;  2WNO A;  4JGY B;  5JSP A;  1CPN A;  1S0F A;  2RS3 3;  2R04 3;  1JMU B;  2UUR A;  3H50 A;  4XCB A;  1DGW A;  1GP4 A;  1OFN A;  3PIG A;  1VBB 1;  3VZN A;  3WDV A;  1CN1 A;  2RS3 1;  2ZHL A;  2R04 1;  5A7P A;  2VUC A;  4BU2 A;  1ZRF A;  2DCT A;  1VR3 A;  1CWP A;  1FMD 1;  2EAL A;  4DEV A;  1URX A;  1RUJ 1;  4JDM A;  4Y1U A;  1XBF A;  2ZX4 A;  2XJV A;  1HRV 3;  2J7M A;  3BOD A;  3MO4 A;  1YFY A;  2BGO A;  2DUO A;  3HNM A;  2JD9 A;  3C7E A;  1HRV 1;  1GMM A;  2WNU B;  5A32 B;  2BVV A;  2R6Q A;  2WWS A;  4KBZ A;  4QPI B;  1BKZ A;  1ULC A;  2W95 A;  3GZT B;  4YZ5 A;  4BQX A;  1XJA A;  3NV1 A;  3J9S A;  4PBP A;  1GZC A;  4XXA A;  4Y33 A;  5ABJ B;  2ET7 A;  2ZGM A;  1W8T A;  2JDP A;  3H7Y A;  2F6B A;  1MZ5 A;  3UYJ A;  1CZT A;  3W20 A;  3V0A A;  1RIN A;  4AXO A;  2IC1 A;  1MS0 A;  4Y1V A;  2PAK A;  3SH3 A;  3UKN A;  1OD5 A;  5JMC A;  1VBE 3;  2XHN A;  5JSO A;  4QDQ A;  3WDY A;  1JYX A;  4C90 A;  2ZA9 A;  4XQD A;  4FFF A;  4CCE A;  4CEW A;  1VBE 1;  5GAL A;  1SLT A;  1W05 A;  4NAM A;  2AAC A;  4LKE A;  3ZMO A;  1QJX 3;  5FP4 A;  1AYN 1;  5LW9 A;  4ORF A;  4IND A;  2ZTN A;  3TAY A;  5C4W B;  3A21 A;  4IER A;  4CCL A;  5FZ0 A;  3USU A;  4L8Q A;  1O5U A;  4CZS A;  1Q8Q A;  3FHA A;  3H1W A;  1WLC A;  4B4R A;  4Q4W 2;  4NID A;  4WZF A;  1OQD A;  3ZYF A;  4E4S A;  1GP5 A;  4EWA A;  2VM9 A;  3E1F 1;  3K3N A;  3PLQ A;  3HJR A;  4FP3 A;  2DYC A;  2ET1 A;  3H1M A;  1K5M A;  3ZFG C;  1R1A 3;  2Y6J A;  5F8P A;  1UXX X;  3MW4 A;  4CP0 A;  1YUD A;  3LCP A;  1ULF A;  4XUR A;  3VBS B;  4P9I A;  4YW5 A;  1H9W A;  1OUR A;  1R1A 1;  3KQR A;  3PVN A;  2AC1 A;  2D6L X;  1IPS A;  4K40 A;  4Y1X A;  3ZFF C;  4BE3 A;  3ZFE C;  1O5L A;  2Z5W A;  1Y9M A;  4LBJ A;  4U2A A;  4YVS B;  4OI1 A;  1QQP 3;  3AMH A;  3D8C A;  3HEI A;  3UK9 A;  3USS A;  2KM2 A;  1QJY 3;  1AX1 A; 
#chains in the Genus database with same CATH homology
 5IVC A;  5A3P A;  2XML A;  4URA A;  5FZC A;  5IVY A;  5IVV A;  3AL5 A;  3KV5 A;  4LIT A;  5FZH A;  5IVB A;  4QXC A;  4QWN A;  5F3G A;  4EZ4 A;  5FJK A;  5FYM A;  4CCJ A;  5ISL A;  3PDQ A;  4C8D A;  5A1F A;  4CCK A;  2YPD A;  3AVS A;  3LD8 A;  4V2V A;  3PU8 A;  3KV9 A;  3KVB A;  3N9L A;  5FYS A;  5FYT A;  4AAP A;  2OQ7 A;  5FXV A;  4HON A;  5FZ6 A;  4CSW A;  5FWE A;  5FP8 A;  2OS2 A;  3KVA A;  5F3E A;  5F32 A;  4IGP A;  5IVE A;  5A3T A;  4IGO A;  2VD7 A;  2Q8E A;  3AVR A;  5FYZ A;  5FYI A;  5FV3 A;  3KV4 A;  4HOO A;  5CEH A;  5FZ7 A;  3K2O A;  5FZO A;  5FP9 A;  5A1L A;  5FYU A;  4XDO A;  5F2S A;  3OPT A;  5A7P A;  5LY1 A;  4UF0 A;  5F5I A;  4BU2 A;  2P5B A;  3AL6 A;  5F3I A;  2W2I A;  5A7S A;  5FZI A;  5A7W B;  2Q8D A;  5IVF A;  4Y3O A;  4CCN A;  5F5A A;  5FXX A;  2YBK A;  5FZO B;  4IGQ A;  5A3W A;  3ZLI A;  4CCM A;  5IVJ A;  5FUN A;  3PUQ A;  4UF0 B;  3PUS A;  4GJZ A;  3PU3 A;  5LWB A;  5FZ1 A;  5F3C A;  3DXU A;  4AI9 A;  5FYC A;  2OX0 A;  2Q8C A;  5FZB A;  3N9N A;  5FYY A;  2GP3 A;  3KV6 A;  5A7W A;  3RVH A;  3N9Q A;  4Y33 A;  5FY0 A;  5FPU A;  5FY7 A;  5FZM A;  4ASK A;  3U78 A;  5A3N A;  3UYJ A;  5FP3 A;  5FWJ A;  4V2W A;  5FXW A;  5FPA A;  2YBS A;  5ANQ A;  5FYB A;  5FY5 A;  4BXF A;  5FZA A;  5FZF A;  2OT7 A;  5FPL A;  5IWF A;  5FZG A;  3ZPO A;  4GJY A;  4LXL A;  5FY1 A;  5KR7 A;  5FZL A;  5FJH A;  3U4S A;  4E4H A;  3N9P A;  5FYH A;  5FY8 A;  5FP4 A;  5LW9 A;  5FUP A;  3K3O A;  3PUA A;  4QU1 A;  3DXT A;  5FPV A;  2XUE A;  1VRB A;  4DIQ A;  3OPW A;  2XXZ A;  4D6Q A;  2YU2 A;  3NJY A;  4GAZ A;  4CCL A;  2GP5 A;  3N9O A;  5FZ0 A;  4D6R A;  5FZ4 A;  4DO0 A;  4NUB A;  5K4L A;  4LIU A;  5FPB A;  5FY9 A;  5FBJ A;  4LIV A;  5F37 A;  4QXB A;  5FYV A;  4QXH A;  5F5C A;  4EZH A;  3K3N A;  2WWJ A;  3PUR A;  4XDP A;  5FY4 A;  5FZE A;  5FP7 A;  5FZ3 A;  4Y4R A;  5FZD A;  4QX7 A;  5FXZ A;  4GD4 A;  2XDV A;  5A7Q A;  4QX8 A;  2WWU A;  5E6H A;  2PXJ A;  5A7O A;  4TN7 A;  5F2W A;  2YBP A;  2YU1 A;  5F39 A;  2OQ6 A;  5FZ8 A;  5A7N A;  5A80 A;  4D6S A;  4EYU A;  5LY2 A;  4BIS A;  3N9M A;  4CUG A;  5IW0 A;  5FZ9 A;  4CCO A;  3LDB A;  5FZK A;  3PTR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...