3AKTA

Crystal structure of xylanase from trichoderma longibrachiatum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords xylanase
publication title Packing Space Expansion of Protein Crystallization Screening with Synthetic Zeolite as a Heteroepitaxic Nucleant
doi rcsb
source organism Trichoderma longibrachiatum
total genus 56
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aktA00
3MFCA 2BWCA 3VZMA 1OA3A 1REEA 1XXNA 3AMPA 1HV0A 1TE1B 1H4GA 2NLRA 4S2HA 3WQ0A 2Z79A 5HXVA 2VULA 2VG9A 2DCJA 4HKWA 3AKSA 3HD8B 2JEMA 3RI8A 3WR0A 1PVXA 1HV1A 2B46X 1OA2A 1XYPA 1C5HA 1OLQA 1XYOA 4S2FA 4NPRA 2DFCA 3VZLA 3EXUA 1H0BA 3VL9A 2DCKA 2DCZA 1ENXA 3AKPA 3VLBB 1KS5A 3VGIA 1REFA 3VZJA 4XQDA 3WQ1A 1QH7A 1XNDA 5K9YA 1H8VA 1F5JA 1XNBA 1KS4A 4XQ4A 4IXLA 2VUJA 3RI9A 3WXPA 1AXKA 1YNAA 2C1FA 2D97A 2NQYA 1BK1A 3AKRA 3ZSEA 3M4FA 3VZKA 3WP6A 3VL8A 1UU4A 4XPVA 1UU5A 2VGDA 4HK8A 3WT3A 2DFBA 1XYNA 3MF9A 2QZ3A 3AKTA 3AMMA 3VHOA 2JENA 1QH6A 3WP4A 3AMQA 3AMHA 1IGOA 2DCYA 5EJ3A 3WY6A 1UU6A 1UKRA 3O7OA 3WP3A 5K7PA 1REDA 3LGRA 1H4HA 3VHPA 2BVVA 2BW8A 4HK9A 4H7MA 2F6BA 3MF6A 1W2UA 3MFAA 3VZOA 3WQ7A 2QZ2A 3AKQA 2JICA 4S2DA 3AMNA 4HKLA 3VZNA 3WX5A 2B45X 3WP5A 1BVVA 2BWAA 4HKOA 1XNKA 1OA4A 1XNCA 4XQWA 1BCXA 1T6GC 4S2GA 1H1AA 1HIXA 3B7MA 1NLRA 3VHNA 3B5LB 3LB9A 2B42B 2D98A 1M4WA 1OLRA 1C5IA
chains in the Genus database with same CATH superfamily
1RUC1 4BXFA 2JG8C 2Y26A 2MEV3 4AXOA 1UYZA 1I5PA 1HRI3 5FAXA 1W3VA 2HWB2 2RR11 2Y6GA 4WZCA 3SCHA 2YBPA 2NLRA 4BM8A 1KITA 2C6SA 3WNXA 1RUD2 1SPPA 1QJY1 2RVAA 3WF3A 1OF3A 1YO8A 4LBQA 1W6NA 1V9U1 2RJLA 2JG9A 5FUNA 4IV3B 5IVJA 1OQDA 5FP4A 3HNYM 3MICA 2DBNA 3SXWA 1GQHA 3H7YA 4JX0A 3L9JT 3AKSA 1W6QB 2XB6C 1AYN1 3WF1A 2ID4A 4LKDA 3OGRA 5C9AB 2BNNA 2Y6HA 1W03A 5H9SA 4XACA 1CZTA 5FY0A 1KGYA 1JW6A 1PM4A 2WNUC 3VV1A 4AVAA 2VNVA 1W04A 4FT8A 3PVNA 2VW0A 3W21A 3R05A 4P9WA 2VH9A 3ZKYA 4BQ4A 3BUCA 2HWC3 3V0AB 4W6XA 1KFXL 3HT2A 1D0GA 1VBD2 4K7JA 2CGOA 4FFHA 3N7MA 4QXHA 3SH4A 5KHKA 3ZYIB 4IE5A 2WFF1 2X09A 5FUIA 1VRH2 4LHNA 3QH6A 5FZEA 2ZGMA 3K2OA 5FYZA 1NCRA 1DHKB 5C3OA 4OI1A 4KBZA 3MUZ1 5IK4A 2D97A 1R1A2 3ETQA 4O7XA 1IQAA 1HB3A 1CESA 2Y0IA 1RHI2 2WDBA 3UKTA 1WW5A 2GZWA 4ITCA 3CHXA 5A6QA 1MS0A 3OTFA 3BTYA 4BE3A 1ZBA3 1NXMA 1WMXA 2PMWB 1SCRA 1D4VB 3H8UA 3M7AA 3ZYBA 5L36A 4UFJA 3DXTA 2CWSA 1SLIA 2DCYA 1VBA2 3GZAA 3MHZA 2YC0A 4YM1A 4BOWA 4LE3A 2E53A 2BGOA 2RM23 3T09A 4CCKA 4CP1A 4CU8A 4DXTA 2J1UA 1CX1A 1WGPA 3KSCA 4W65A 1SLCA 2WO7A 1OH3A 1EYBA 1XQNA 3ZIWA 1MS3A 1MS9A 3LDKA 1RUE3 3PDQA 2FHRA 5DPNA 5FZ7A 3RNSA 2F6BA 4GZ9A 4ASMB 3GALA 3W5NA 1B09A 1QJZA 2R041 5FIXA 3WDWA 1DGRA 1UWWA 4QDRA 3W59A 4TTGA 1IPJA 3KD4A 1ZBE2 4NIHA 1W90A 2YMZA 5FMDA 5FY7A 2W87A 4ARXA 4GIQA 3UESA 1PGW2 1O4TA 1BVVA 2UWAA 4Q5OA 5IFTA 5KXDA 2O8QA 1H1MA 3DPRC 1XNCA 4RN5A 5FYUA 3PJQA 1E57A 4LO4B 3WG1A 3SCFA 4Q0QA 3PUIA 1HIXA 1MZFA 4CEWA 5CYYA 2Q1ZB 1DYPA 2HWF1 5L9BA 4PF5A 2CY6A 1US2A 1A8DA 3WW3A 3ZFFB 5CKNA 1LU1A 5JMOA 3HOBA 4N9IA 3JD73 2HWE1 3GZUC 5FZOA 4E2SA 1ZRCA 3J7NA 1DGWX 1OA3A 3DV8A 3I2DA 1LULA 1ULCA 3FJSA 4OCTA 2E51A 2XUMA 2ARAA 4CDWB 5C71A 1QEXA 1W6PB 4K1ZA 1LECA 4XABA 4XFGA 3F2ZA 4Y24A 4GXLA 4L8QA 4H3WA 3RMYA 1JZ7A 1YIFA 5EQUA 1NCQB 1GMMA 1HRI2 1MZ5A 2PN5A 3EBRA 2OVUA 2CSGA 1S0EA 4AVBA 3UL2A 1JUIA 4X6QB 2WWJA 2A7AA 1RUG1 1G9CA 1YIPA 5A7WA 5CEHA 2JDPA 3GCXA 4LXLA 4HPKA 5FO8B 4LIUA 3IN9A 5L7OA 2BUKA 2F17A 4A44A 3PUHA 4CCDA 1UMZA 3B00A 3ZFFC 4L97A 3A23A 5LRSA 4YGBA 1QMJA 3M8LA 5EHDA 1SLLA 1P8JA 1QJX3 5LWBA 1U5XA 2ETEA 4AHZA 3FLRA 3HWJA 1CAWA 1LHOA 1YJLA 5JMCA 3AYEA 5FOBB 2XLFA 1C4RA 2BGPA 4AQSA 2O0OA 4ATEA 1H2NA 2VL4A 2JG8A 4OHVA 4WVMA 1I3HA 1BMV1 2ZX0A 1W9FA 4NHKA 1ND2B 1GNYA 3MLJA 4QWNA 4XQ4A 4OZOA 2HWC2 4XUNA 4GMP1 2WO2A 3ZLIA 1S0CA 1BK1A 3RQ0A 1DGLA 5LY1A 1EPZA 1W39A 1W9TA 4FOQA 3VDDC 1JOJA 4HG6B 4XPVA 4XZPA 4B7EA 1R081 4ISQA 5L9RA 1C1FA 3OBTA 1JBCA 1WLDA 4AGRA 2OX0A 2JENA 4R4XA 1DQ4A 2XL9A 4I09A 3RZJA 4YG3A 1AR93 4OQ9A 3TEXA 1RL3A 1G9AA 2ZMNA 1NX9A 2GP5A 3K51A 4COUA 3VBOB 2LALA 5H9RA 1AZDA 1DYKA 1JMUB 3CJXA 2WNUA 5K0UC 1HRV2 3BU0A 1NA1B 2YV8A 1KDMA 4N53B 4XOGA 1RUI3 3AK0A 2WZEA 4WVWA 1CONA 3NV1A 5F3CA 3VUOA 2FDGA 4BQWA 4Q1PA 2VXRA 3WDTA 1XU1A 3OSDA 5F2SA 1LEDA 2RM22 1VAKA 1LOGA 4LLOA 2WWSA 1UMIA 4YZ4A 1MR5A 2QQJA 2ZCWA 5J98B 4AFCA 4XJ8A 1HXS1 2OQ7A 3AYCA 3ZXLA 4A7KA 3ME2A 4B3NA 5JSOA 1DGWA 1R091 2EXIA 4XAEA 3RFRA 3S5AA 3U14A 1HN1A 1FI2A 1RC6A 1WCDJ 2Y8KA 4H14A 3LEKA 4CUAA 5FZ9A 1W6QA 3O0VA 4HVRA 1WWYA 4P00B 5FO9B 4I01A 4ZPIA 3U37A 4D7YA 3NNMA 3CU7A 4FPEA 4TZDA 3EYPA 2VMFA 2BWCA 1DYOA 2RS11 1AX2A 1FATA 4N53C 1O5LA 5FBZA 1LHWA 3AP9A 4Q8LA 1QDCA 4J1XA 2WZR1 4QT6A 1T2XA 2PHLA 4FPJA 3S6PA 4WBBA 5FKBA 3V0AA 3AZYA 5FZHA 4BQYA 2QE3A 2WWUA 3JD72 1VE0A 5D21A 4QX3A 1VBB1 1ZA4A 1POV1 3OB8A 1ULEA 2BJSA 4R8HA 4KWLA 5ERLA 3T3YA 2XPJA 1FAYA 5D1IA 1QKQA 1MPXA 5E89A 2A6YA 2K0GA 4MLOA 3BTZA 3DPRA 5GZCA 3MIGA 2RJKA 1L7QA 2B4KA 4IV1B 5T3NA 4AVVA 3H1YA 2XJUA 4IEXA 5I0TA 4K9SA 1F31A 5JI7A 2ZHNA 4BDVB 5CBLA 3M70A 4NN0A 4RGGA 3MO4A 4X6RB 1Z7S3 3MIDA 1WZXA 4GB31 4GMP0 2QUOA 1UAIA 4GWNA 1JZ5A 1FNYA 4JV4A 4JGZC 4NWVA 4C1XA 5F32A 3FBYA 1IHMA 1CZVA 4PIZA 2MPFA 4YWAA 1DQ5A 4AL9A 2XBO2 1QHDA 3DYOA 3FZ3A 3VBFB 1QXJA 3LIGA 3TAYA 3NWKA 4LO8A 5CISA 2GU9A 3IPVA 3FX3A 4UW5A 3ZSEA 2TBVA 3OGVA 4EV0A 1DZTA 1OOPC 5JPNB 3AJZA 4ZXKA 1DQ6A 1FMD2 3KWVA 1UOFA 1RVF1 4HANA 2VC9A 1J83A 4CDQC 1IKQA 2XQXA 4Q29A 3JBG1 3KS7A 4YW5A 2GMMA 3PUAA 4ZHNA 4NHMA 1LRHA 3WY6A 4LTAA 2V4AA 3THTA 5EIYB 2VOWA 3AZXA 1KJLA 3O5SA 3Q8CA 3RGBA 4NHXA 3IDAA 3AFGA 2RJ2A 2WO1A 3MYXA 5DAWA 2JDNA 4DINB 3TNQA 1OH4A 3ZFFA 1L3JA 4C8DA 5FPUA 5J3UA 4FP3A 5GLUA 4D3WA 2A71A 1WCQA 4LPLA 5EYXA 3SC7X 4QPGB 5A6XA 4XF9A 4LLFA 2ZKLA 1JYXA 1RUI2 2CHHA 1W6PA 2LTNA 3FLTA 1S0GA 2YGLA 4UF0B 4XFBA 1H8TC 1OQEA 2FZ1A 3D0SA 5T55A 2WZPP 4AF9A 4E8DA 4S2GA 4PQ9A 3ETPA 1IKPA 2RS51 2ZGTA 3FLPA 4A4AA 3LB9A 1PMHX 1ULDA 2FDKA 2XHKA 2TUNA 4FFFA 1W8ZA 3ZR5A 1YEWA 5FZKA 4M4RA 4ASLA 2VO5A 4EYUA 3H3LA 5C3QA 4A45A 2HBUA 2IVJA 3ACHA 4NAMA 1H9PA 4XJ9A 1EY2A 4DQAA 4ES8A 3M3QA 1AL22 1CIWA 3ZDSA 3KV5A 5K0UA 1VAVA 3LPGA 3RRDA 4M3CE 4YM0A 3Q8AA 1HQWA 3OBZA 4C91A 2EAAA 1OMIA 1AR61 4GH4B 3K4ZA 4E27A 5DDJ1 2B5HA 2B39A 4D7TA 1BEV3 5DZEA 1FPN3 1ND2A 2ZA9A 2P2KA 2VZOA 4PIYA 3ZXAC 1WMFA 4MVTA 3ABZA 4A7ZA 4H7LA 3T0BA 1W8WA 2EA7A 2DFCA 3KF5A 1SCSA 3T0DA 2GNMA 2BNOA 1OHFA 1OKQA 2UU8A 4Y3OA 2PXJA 1V6JA 4CU6A 3WOGA 2NM1A 1W6OA 5L9VA 4AOCA 2DVBA 2QDRA 1FV2A 2WNVC 3BN6A 2HWB1 3E1F1 3UGHA 3VGIA 4F3JA 4QMAA 1RUJ3 2R6QA 2A1XA 2JDYA 4QKNA 4WM7C 5A32B 2CL2A 1EUTA 5JOZA 2R073 1NA1A 2VUDA 2H6CA 3LDBA 5LA9A 5JWPA 4IUGA 1IPSA 4N53A 4F8AA 1LR5A 1Z7S2 1AXKA 2C9AA 3D4KA 3SH3A 4NIIA 3I97A 1W28A 1U5IA 4D8MA 2VMIA 1NQDA 2C26A 2P6HA 1X7NA 2Y33A 3M4FA 5F2WA 3H42B 3I8TA 3VBSB 2PHXA 3TRSB 4WVZA 1ND3C 3I3DA 3JU9A 1DZRA 2XJRA 3GHMA 1PMJX 1RXGA 1RUH1 2W1UA 3GBFA 3GZEA 3IBMA 5FYYA 5AFBA 1VBC3 3CF6E 5FWJA 2OKXA 1K5JA 1SPPB 1D2QA 4TSVA 4X8PA 1UIJA 4P08A 5EJ3A 4LBQB 5FDBA 2XR4A 2XHNA 2JG9B 1G9FA 4LQRA 4KWJA 3VBHC 5IHRA 3MW4A 2QQKA 1REDA 5BNOB 4NIAA 2Q8OA 4MGZE 3CMGA 2X5IC 2P5BA 2VJXA 2BW8A 5F6LB 5AFEA 4HK9A 1IS4A 4XIOA 5DAVA 1Z78A 5EFUA 5GJ6A 4JKLA 1VRH1 1BBT1 1V6LA 2EIEA 3PMSA 2WN3A 3HBZA 4L2NA 3H9AA 4L0PA 4XXAA 1O59A 3WQ7A 2ARBA 4HKLA 4JGZA 1HJGA 3ZXEA 1OLME 1ST8A 2UY8A 2NP0A 2CNAA 1RHI1 2EXJA 4KBBA 3ZXJA 5C4WB 3VBSC 2YGMA 4XQWA 2P37A 2P3KA 4LR4A 2D93A 4JHTA 1AJOA 2BV4A 3NSTA 5EP9A 1FNZA 4D6QA 5AC91 2GAUA 4B4QA 4Z2WA 2VE1A 1LODA 1QQP3 4NRMA 4PLNA 1PO21 1UZYA 3QCWA 1C28A 5F5QA 3GNEA 1UY3A 1A3KA 1Y4WA 4LBNA 4R9DA 1NCRB 4YGDA 4P5YA 1EAH2 2WAAA 2QJVA 2ZTNA 3T2PA 3AMHA 3OGSA 3ILRA 2R063 4ZU5A 5BNOC 3E5XA 1PIV3 3NJXA 2YBSA 3IB3A 3LE0A 2XJSA 2QDNA 1QJU1 4O9EA 5D2AA 3LQCA 4FO9A 1CQ9A 1YQCA 1LOFC 1O91A 3OCPA 4P9IA 3Q8EA 5FWEA 3SHRA 5LB6A 1O3SA 2V73A 1BK0A 1MACA 3H3UA 2VNGA 1W05A 1GQPA 3C7FA 1CX4A 3I54A 3LWCA 4SLIA 3GGLA 5DUXA 1KDKA 5CAZA 3MIFA 1CPNA 3OPTA 1PGW1 4XJAA 3I2JA 4F7ZA 4Q4X1 5C4WC 1D4M3 5ANQA 4MGIE 1VMHA 3H7JA 3ON7A 4EN6B 3VKFC 3WZ1A 3O1RA 4DXZA 5FZDA 3MPPG 1F4HA 1J84A 1H8TA 3PURA 5F3GA 3L2HA 4E4ZA 2BOIA 2DVFA 3WNNA 4PLMA 2QQPA 4QGNA 5JR7B 3R6SA 4N7UA 1SEFA 4B1LA 3THPA 3I2GA 1KS5A 3KB5A 4UOJA 1VR3A 2E7TA 3AM2A 3QD6A 5EJ1B 1DU3D 4AEMA 3A7QA 2DU0A 4RGAA 2QQLA 4AI3A 4CYDA 3HAGA 4Q4V2 3K3NA 2IC1A 2IFWA 5CIRA 5LK5A 3KV9A 4DZGA 4ORFA 1KS4A 5BNQA 1VALA 1YWKA 2MEV1 5FPVA 3WXPA 5CZKA 3S30A 2P4EA 2XXZA 1SG3A 2RS33 4M00A 4MHUA 1NXD1 3PVEA 2IZWA 5FZ8A 3MW3A 1UU4A 4CUBA 3GHNA 1OUXA 2V72A 3I2OA 5FZOB 3O1UA 3M3CA 4QU2A 4XFCA 3NKTA 3RPQA 2R072 4OULA 2UWBA 3AKTA 3ACFA 3OUJA 3RDIA 5C33A 1UZVA 4IE0A 1PVC3 2J1VA 4JCKA 2W3JA 4UF0A 3O1SA 2EXKA 2WYSA 2YU2A 4DOUA 4HMZA 2PQQA 1UOBA 4XDPA 4J1WA 4MOAA 1W0OA 4QM9A 3KV6A 1VMFA 4YVSC 2ET7A 4J6GA 1RXFA 1YI7A 3AC0A 5I93A 4K3UA 3ITQA 3TN93 4P9YA 1VBC2 4PQQA 3IMNA 3OUHA 4YGCA 2J1EA 1JU4A 5BNPC 1O3TA 3N7KA 2WRAA 3KLSA 4CTEA 3WG3A 2NPIA 1LNSA 3FHIB 1YYNA 3WDVA 1VBA3 2GNTA 4FP2A 3ZR6A 4HPKB 2WNVA 1UIKA 1JZ6A 5ISLA 2W1QA 4OUEA 4EZ4A 2BRTA 3ZXKA 3OEBA 3VZNA 2C0ZA 3NW4A 4G3YC 1GBGA 4LO5B 3ZXGA 2D44A 4WM7A 1JXNA 2BWAA 3VKLA 2EIDA 2WS92 3H1MA 3FBMA 5A3WA 5JI9A 1Q8VA 1V00A 4IEQA 3PU8A 3WHTA 1CAWB 5EZWA 4BB3A 2QQUA 5JOYA 4DRRA 1A34A 2JE8A 4ZY9A 5CFDC 1NLRA 2VUAA 4V2VA 3UV9A 2D3SA 1O4YA 1SFNA 3CNAA 5C7GA 2A6ZA 1OQ1A 2X8KA 1ND3A 5JSRA 1CIYA 1TG7A 2VVDA 4TWTA 1BZWA 3ASIA 4KQ7A 4QXCA 3ZOIA 4COVA 1ZBA1 3KMHA 1GP4A 1QQP2 1SBDA 2R49A 5FZ6A 4XF1A 3WNOA 2KXLA 4TYSA 4BQ3A 2A73B 1TNRA 3VBHA 1H2MA 3IKWA 1OBNA 5F39A 2VECA 4GWJA 5JUVA 3ZO0B 2X5IA 2ZHKA 4HOOA 1VIWB 2R062 1YQ2A 2Z79A 3B94A 2VULA 3HR9A 3NKGA 1PIV2 4GALA 4LULA 4URAA 1XSQA 4FOVA 1XJAA 4M01A 5A32A 1J1TA 1RUE1 1HB2A 2YFZA 4YW6A 2DCJA 4HKWA 3SKJE 4Y20A 3N9PA 4OZXA 2GC3A 2WNUB 3ZPYA 2CV6A 4QB6A 3IT8A 4K21A 1A8MA 3USSA 3RJ2X 5GM0A 2QTWB 4IDZA 2ZGKA 1H9WA 4DB5A 3A4UA 3VBSA 4V2WA 5LBFA 2VMGA 4D7SA 5C8CC 5GZDA 2CAUA 3WQBA 4L11A 1D4M2 5A7NA 3T0AA 4C90A 3UGGA 5CKQA 5FUPA 5DZFA 5HCAA 2Q8CA 2R30A 3WQ1A 4CPBD 2VQTA 1ASJ3 1FOD3 1W9SA 2YU1A 3OPZA 4EN8B 5BNOA 1XNBA 2JB4A 4AAPA 3NAPB 4LBLA 5IVCA 1EP0A 3NV4A 1MEC3 3ILFA 2W9XA 4TLGA 4D0QA 5LEJA 1ODMA 2PA7A 2ILMA 1LOFA 2P17A 4CU7A 4HN0A 2CDPA 4D69A 5KHHA 3CZJA 3RVHA 2JE7A 4FQ4A 3MI8A 1UOJA 3WT3A 4XCAA 1WMEA 4NIGA 1ZVFA 4YW2A 2OUHA 5I8SA 1JN2P 2HYKA 2Q1MA 5C4WA 2OQ6A 2RS32 2R16A 3G7DA 1RUF3 3O0WA 3LDRA 4HSJA 4K20A 4NROA 4FBFA 2WL1A 3I2HA 3U78A 1OT5A 5FYIA 4D94A 3WDUA 3C7GA 3OEAA 3ZMOA 2WO3A 3IM0A 1DDLA 2WLQA 3E5QA 1PVC2 5DXDA 5DG2A 2R32A 3T1LA 1GOHA 2VMHA 4CCLA 3R0RA 1QJX1 5J36A 3NAPC 4TXWA 3BKZA 4XZUG 3DPRB 1E5RA 4MGYE 4NUBA 4AFBA 2WJSA 1QOOA 4GKYA 3TN92 1Y9QA 2JE9A 3ZYGA 4FI9A 4QKDA 4AHXA 1HRV3 2FDIA 2E26A 2VTFA 2HWD1 2JDMA 2YB7A 1EUUA 1W06A 1DP0A 3N35A 5A7SA 5GALA 4I0AA 5J09A 3P5BA 4NO4A 4Q4W1 2YUEA 3AXDA 4FAHA 1ULGA 5FLIA 3ZYRA 2ZPXA 3NNLA 3B9IA 3QLQA 3I49A 3UT0A 4LO6B 1JZ8A 4BQ2A 2ADDA 4QDSA 1COV2 1UY0A 3UKNA 1W8OA 1RMU1 3HQXA 2Q30A 3IPVB 2B9VA 3POIA 3VZMA 4CEYB 3OGJA 3LA7A 2VCAA 4IW3A 3BOWA 5LA2A 1S2BA 3U11A 4YVSA 1AR91 1S0FA 3N3HA 4M4PA 2GMPA 3VBRC 3HEIA 4YPJA 5FYCA 1O5UA 4EN7B 4ZS3A 2W95A 5BNPA 1W2NA 4MH0E 1RUI1 3H3ZA 1IZ3A 5ACA3 2YPJA 3AYAA 4YVWC 1N3OA 1G9DA 1NUKA 3APBA 4ISRA 2TEPA 3U0ZA 1Y9MA 2KM2A 3TNPB 2ARCA 5F6KA 1AJKA 4BQ1A 1H6YA 3MIHA 2VQ0A 4QM8A 3N9NA 5G05L 2V5DA 1AX0A 4IESA 1RUC3 1G86A 1OSGA 4NPLA 4MGSA 3A22A 3LOIA 2WAOA 1URXA 3N9QA 4W6YA 4XJWA 5CFDA 4ZU4A 1ZZ9A 2VZPA 2ZABA 1C8M1 1ZRIA 2O1QA 2HJIA 2RR13 1UPSA 4A41A 4CEYC 4CDXC 2XWBB 3DGTA 4URTA 4D6SA 4NIDA 2GNBA 2RHPA 3VZJA 4XBNA 5BXXA 5IYYA 2QCSB 2LUWA 4BA6A 4CP9B 1KRIA 1EV13 1F5JA 2RDQA 3T08A 3GXUA 2BYVE 3IWZA 4LIVA 5EYYA 5L73A 3S7EA 3VDDB 4MSVA 4LHSA 4XUPA 3SMHA 3ZM8A 3OUIA 4DUVA 4IXLA 4MZUA 5JIUA 1WD3A 1GNZA 2NZ9A 1AYN3 1DQ1A 3DKQA 4HT1T 1ZZCA 2X53S 5JOXA 3AFKA 3USUA 1ASJ2 1FOD2 3KT4A 2VGDA 1ENQA 5E88A 5LW9A 3WLUA 4BPZA 5ABJB 4AI1A 3H1WA 1UY2A 1SBEA 1XB9A 1MEC2 2WKKA 3AMMA 4BH9A 4DRVA 1QH6A 4A7YA 2J1RA 2XBO3 1O3RA 1OKOA 1CJDA 5K0UB 2XWJB 2R1DA 1AR83 4LT5A 5JAXA 3C7EA 3MV11 4H2AA 1JZ2A 2ZGLA 2A6XA 3TB0A 2BVBA 5FO7B 1FMD3 1CR7A 4I3GA 3UYJA 3ZFGC 2WABA 3JXSA 4CZSA 2WFF3 2DVGA 5C8CA 4R9AA 1Y9GA 3A21A 3T30A 1RUF2 1W2TA 2VY0A 4CCOA 1H30A 3EQEA 4FFGA 5IK7A 4FSJA 2EICA 3MFAA 3VZOA 4S2DA 3AKQA 4CVUA 3GF6A 2W94A 1LOBA 1W6MA 1MS8A 3HMYA 1Q8OA 1W6OB 4UW4A 3WDYA 3ZYJB 2Y6KA 2E6VA 1HQLA 2A5ZA 4FPLA 2XUEA 2PAEA 5ABJC 1LU2A 4HETA 3B02A 4JC1A 4UFMA 5CKMA 4XC9A 5FP3A 5T5LA 1AYM3 1YQ6A 4JTOA 3F95A 1GOFA 3HNBM 2CWMA 3V56A 4YSFA 4IGPA 4CCNA 1POQA 3AP4A 4RA0A 5I8YA 3MFCA 1YFWA 3I2FA 4QX7A 1WBLA 5IW0A 4XJUA 3PUQA 4AK3A 5BYNA 4IEWA 5IWFA 2D6LX 1G6NA 3B9CA 3INAA 1PO12 2VNOA 1PX3A 1S2EA 1X36A 2G19A 3ES4A 3LEMA 3OJBA 3EMRA 4XW3A 2I07B 2J1SA 4IEOA 5J1XA 1XOYA 1B35C 5LZ6A 3I2IA 4AWDA 3WUCA 5FXWA 2ZS6B 2X05A 3NAPA 4Q27A 4QPYA 3ZSMA 1TMF2 1GYKA 4CXWA 2JEMA 4AI8A 5FZMA 5JPMB 2P3IA 1AL23 2HYXA 1C5HA 2HWF3 4BU2A 2HH9A 4R9CA 1PZ9A 2D40A 2PHTA 3ZSJA 2ZMKA 4N9HA 5F5AA 4C0BA 5H9QA 1NE6A 3WHUA 4XJZA 4ET7A 5ACA2 2Q0AA 1PMIA 4MGKE 4QX2A 3VD9A 1F4AA 3N4MA 4JGZB 3ZN6A 1VBE1 2OXBA 3RYPA 3RWNA 4IETA 1DBNA 3ACGA 3UKVA 1N1TA 2A3XA 1RUC2 5D8AC 5A3MA 1OC1A 2AYHA 1NY72 4WZFA 5DUUA 5B4XA 4YZ1A 1RYYA 1OOPB 4CXXA 1OVSA 3QH7A 2ERFA 2RR12 3H8RA 4CDQB 3P1IA 1CVNA 2C1FA 3VBRA 2ARXA 2NQYA 4BHPA 1QJY2 4Q8KA 1RUG3 1T6BX 1V9U2 1EV12 5A7PA 3AYDA 3O1OA 5LASA 5FMCA 3K75B 4EZHA 4YVWA 1AYN2 3VBUC 2RMU1 4PLOA 1BEV1 1FPN1 3BOPA 2JB8A 3DL3A 4DEQA 4Y5Z0 5KHJA 1UYYA 4ARYA 3HJRA 3N9OA 5K7PA 5KBFA 1MS1A 3H50A 4XCBA 1U5YA 3OYWA 4ZONA 3VHPA 1H1IA 1K42A 1OD5A 3MZHA 5FXXA 3VD7A 3FHAA 1QNYA 3T1MA 5FY5A 1AR82 2XKPA 4OI2A 4PIXA 4CDXA 3CQOA 1D2SA 2J1TA 3ES1A 3IDEA 4RR3B 3E5UA 5FZGA 4CEYA 5JZGC 3RSJA 3VD3A 3MEPA 1CJPA 1H8TB 4QKFA 4XMIA 3WX5A 4Q4Y3 3S5QA 5JCTA 1R083 5CVRA 2B45X 1WKYA 2FBEA 2WFF2 1RUJ1 3GBGA 3AZZA 4MGTA 1XNKA 1GZTA 1NT0A 2UY9A 1BHGA 1AXZA 2R071 1UL9A 4QHOA 1PGL2 1SBFA 4CCEA 5A6YA 3VHNA 3K4DA 2IXHA 1U12A 2O14A 3FN9A 3ENRA 1GANA 4KG0A 2JDUA 2BP6A 4IL7A 3LCPA 4FVVA 1ACCA 3PNAA 4OI4A 3RZMA 1Y3TA 3RZGA 2XJVA 3AL6A 3HN1A 1KD7A 4UBHA 5FLJA 5FZ1A 5F5IA 1UZWA 2WT1A 1VBC1 3JCIA 5LBCA 4NHYA 1YXWA 4NOTA 1VP6A 1Y7BA 2Q8DA 5CADA 1N3QA 1JOBA 1X8MA 2IXLA 2YPDA 1AYM2 3NQHA 4CP2A 3WW2A 1W3XA 2DU1A 3H0OA 2W46A 4RR3C 3N9MA 3I7DA 4NE9A 3ROUA 3ZFGA 4FPFA 1ZM1A 4BQ5A 1EAH3 1HXS3 3RZZA 4Z2AA 5FYVA 4OUMA 1LTEA 3ORJA 2BFUL 5GKAC 4CP9A 2R042 2V4VA 4DXSA 1NYWA 5JLVA 2LS6A 3VDDA 5I8TA 2XH6A 3I59B 5JXIA 1W2OA 4OYUA 4Z8BA 5KHIA 2ZHLA 1YRZA 3NRUA 1OA2A 4ES9A 3AXEA 1XYOA 2XONA 3ZX7A 1UCXA 5C6CA 2JD4A 2NMOA 1V6NA 4TN7A 4YZ5A 4AQ2A 1NG0A 3QBQA 2D5FA 5FPXA 2WNVB 4INDA 4O61A 3U07A 5ABJA 4DUXA 3BALA 4I3PA 2BERA 1UX7A 4LA3A 4BZ4A 3LSEA 4GA9A 3RJRA 4WM7B 2H0VA 2HWF2 3AKPA 2WZR3 4JVAA 1HW5A 1QQP1 4GULA 2W39A 4FPCA 1JU3A 3PUSA 3KV4A 4TLFA 2KR2A 4KGQA 3RZHA 4KL1A 5FPAA 1XNDA 5KR7A 1QDOA 2HWE2 2QVSB 1H8VA 5HCFA 1POV3 3WSOA 5CFCC 5FLHA 2R061 2EALA 1CAXA 1PIV1 2VZUA 3GYDA 2R7EB 4RGKA 1ND3B 1SACA 3IAPA 3HBKA 3OD0A 1PNFA 3AP5A 4DEVA 4JGYC 1O8PA 1V6IA 4ATFA 5EV7A 1QF3A 2AENA 3OD4A 1X82A 2PFWA 1B35A 5A3OA 2D5HA 4Q4V3 3E6BA 1R1ZA 4QQHA 5ANNA 4R9BA 2BNMA 3VBHB 2GP3A 2PQSA 3HQUA 2PAKA 3M3IA 2JDZA 3D8CA 4ZU7A 3ACLA 3ZVXA 4PDWB 2X5IB 1GP5A 1S0DA 2J7MA 1RUG2 1D4M1 1TEIA 2E63A 1IG3A 2YC4A 4FPHA 1V6OA 1RUD1 3DEMA 4Y1VA 3AL5A 4Y20B 2DWRA 3PVOA 2VZVA 1AVBA 1Q43A 3AJYA 4OMDA 2ZX2A 4NVPA 3WW4A 2RDNA 2YHJA 4FTSA 2DTYA 2E9QA 5EWSA 3THDA 4MX3A 4JHZA 3OF1A 2C24A 4YARA 3W9AA 4AHYA 5DQ0A 5LRRA 3J26N 5D8AA 3WP5A 1BMV2 1QJEA 1U5ZA 2AEZA 2OA2A 4W50A 4CSWA 4OHXA 2WNOA 1IG0A 3JBG3 2C4XA 3TOJA 2BBVA 4CXYA 4CDUC 2Q4SA 1WW4A 3OGGA 1J3RA 5LK7B 3GBWA 1W8TA 1N1SA 1ULFA 5A3TA 1OURA 4Q4Y2 2A6WA 3B5LB 1R082 4A3ZA 2B42B 2R0FA 4OLLA 4QQPA 4Y26A 1VBD1 4PDWC 2SBAA 4AEDC 5K4LA 1F8VA 2AUYA 5FOJB 2CGPA 5KWRA 4MG2A 4OHYA 2E7AA 1GP6A 1C5IA 1DLLA 1YLLA 2VMEA 2WS93 5F1RA 5HI0A 3E6CC 1W8NA 4CCJA 2DUQA 1XXNA 3VBUA 4A2UA 1PVC1 2BFUS 1HV0A 2UYBA 1ENRA 2ET1A 1WLTA 3FWEA 1R1A1 2C5DA 2VR4A 1AR73 4XDQA 1GOGA 1RIRA 4LKFA 2VOXA 1OPOA 3VDCA 5FBJA 1VRBA 5DAPA 4ONUA 4KMQA 5FY1A 3C7HA 1RUOA 1UYXA 3TN91 3U4SA 4LA2A 4MGQA 1LCLA 1UZZA 5FY8A 4I0WB 1OOPA 3SQOA 2YBKA 1LB2A 4B4RA 4EWDA 2RS53 1PVXA 2WR9A 1VBA1 3PMEA 4JDMA 1N1YA 1XYPA 2MNGA 4CDQA 4Z1VA 1QNWA 3T4HB 1HXS2 3UJOA 3B01A 5FYHA 2JWPA 1DCSA 4U36A 4BXSV 2EVXA 1JYWA 4QQLA 3FHQA 4HBNA 1R092 2EXHA 4UYBA 4OI0A 2VOTA 4IE7A 4EROA 2MHFA 1Z0HA 2Y38A 1AXYA 3JQWA 2CYFA 3U4XA 2JD9A 4KWUA 3LA3A 4MUVA 2WT2A 3DCQA 4JRLA 4AFDA 2XDVA 1ZBE1 4QB2A 5IATA 4QX5A 4Z92B 1C8NA 5A7QA 3UETA 3I4IA 2BDRA 2W68A 2ZX1A 4EWAA 3SISA 2VOVA 4E2QA 2VUJA 2WZR2 5FY9A 1TQ5A 3BTXA 1W8FA 2Z4FA 1J58A 2BBAA 4LNVA 3ZPOA 3MLKA 3ZFEC 1CAUB 4RR3A 4DFSA 3A0KA 1ZZBA 4A6SA 1LHUA 1BQPA 4NR1A 2FDFA 4UAPA 1ULOA 1GLHA 4I02A 4YVSB 5GZFA 2ZEZA 5FPLA 2HLEA 3GCWA 2Y6LA 1GWLA 1RTVA 1AHSA 5A1AA 5KXEA 1IGOA 4P5HA 5IT6A 4RD7A 4CE8A 3HPNA 2D43A 3I3QA 1F35A 1FT9A 1N47A 1UKRA 3O7OA 5KHGA 5BNPB 4XF3A 2XJTA 2IXJA 2PLV3 1QY4A 5LBBA 3WF0A 2WSUA 3LD8A 4B4PA 4Q0PA 4M0NA 5FY4A 3B93A 4GJYA 2VMCA 3C2UA 1HRI1 1Q3EA 3QACA 4BK5A 4LJHA 2QQMA 5F8PA 2C9KA 4NWWA 4OFGA 3CJIB 1UY1A 4MADA 1XBFA 1XU2A 2NN8A 5CFDB 1ASJ1 4Q26A 5CFCA 1LGBA 2FDJA 2VW1A 1RUH3 1NLQA 4RS5C 4IQPA 1ODNA 4JTNA 1T6GC 3ZDVA 1O8SA 4KWKA 4AI2A 3ZXFA 1JZ4A 3UJQA 4QX1A 3D3AA 1ALYA 4JGYA 4LO7A 3I59A 1OXCA 1RVF2 2D6NA 2VCCA 1YQ8A 4DIQA 5J48A 1XNTA 2VZSA 5FZ4A 1UXXX 3KVAA 2PTMA 1DF0A 3ALQA 3U1XA 3VKNA 3JBG2 4G4FA 1SZBA 2BQPA 2VXJA 2YFUA 3CZUA 3D82A 3PVBB 3WDXA 4ASKA 1NLSA 4BLIA 3USUB 2IFRA 2XKOA 3THCA 2HWC1 1BBT3 1RUF1 3BYWA 1X9PA 4JZRA 1JYIA 3UGFA 3PIGA 1GSLA 4QGMA 1AX1A 1UPIA 1XSRA 1UOGA 1W0PA 3RG0A 5DZGA 2ZXQA 3CJIC 4UBGA 1COV3 3D5OA 4CP0A 4N8MA 1L7LA 1GWMA 4IGQA 1R64A 5AC93 3E97A 3N36A 4AVTA 3S0MA 3B3QE 2WFPA 3AP7A 3FUQA 5A7OA 3IMMA 3WR0A 1AR72 2B7YA 3VHRA 1LGCA 1LOCA 1PO23 2WQZC 3KZ4C 5FZLA 3L2YA 5C8CB 4KU8A 5E8AA 4BQXA 4NAOA 4Y5TA 1OI6A 5FYSA 1HRV1 1OFSA 1F2NA 4NRPA 3MV01 5BPXA 3QOPA 5E1RA 1KXGA 1LOAA 3VL9A 3CO2A 4AZZA 3WNMA 4CDUA 5LA0A 3KHCA 4L9BA 1PZ8A 2R1BA 3ZN5A 3K4AA 2RS52 2QFEA 1W6MB 3BTAA 4C0HA 4BISA 4MO3M 5C5TA 2RM21 3KT7A 1LAJA 3KGZA 4PDWA 4AEDA 4OMCA 1UQXA 5E6HA 3WW1A 1JI6A 2W08A 3POSA 3C7OA 3AVRA 3T2TA 2JKBA 2KA3A 3EHKA 5BNNC 2W5FA 2WA4A 3IZOA 3KCYA 1IQDC 3NMBA 3NV3A 4UFKA 1L7RA 1ONAA 4N43B 3IIAA 4P02B 4NMIA 3SKVA 2CGNA 3VL8A 1RUNA 1RGSA 1WW6A 4L92A 4HL0A 2Q1FA 3N9LA 4UW6A 3WF2A 5HXMA 2JDHA 2G4IA 3K46A 1C3HA 3J8F3 4CPBA 5DDJ2 4JDNA 2XQRA 3HIFA 4M3CF 5L7OC 3NVCA 4XUQA 5FFOC 5FKCA 1A6CA 2ZBJA 4AI0A 4YM2A 1UY4A 5EPAA 2W0XA 4AEKA 1UU6A 2ZGOA 5K8SA 1ZRDA 2BOJA 2WUHA 1YC61 3JB4C 2Y60A 5FZIA 3JD71 1PK6C 1GUIA 2Y6JA 2GC1A 2E7QA 1NY71 2IXKA 4LORA 2CU5A 4QXBA 2Q5TA 1UW8A 5HCHA 2QZ2A 3D0JA 3OPWA 5LEKA 2ZGRA 2XVGA 3LZZA 1X8EA 1JHNA 1US3A 4N43C 1WBFA 2PLV2 4EQVA 1G8WA 4O9GA 3BPSA 1PNGA 3ZN6B 2RG4A 3PHMA 1UN1A 3ECQA 3OY8A 1EV11 2AACA 5FR3A 1O3QA 4DY3A 1ULPA 2FMDA 1UX6A 1WA4A 4RHV3 3ZFEA 4DUWA 5J37A 3WG2A 4LBQD 1JS9A 3SH5A 3RYRA 4AAXA 5IK8A 5DUWA 4PT6A 5FYMA 4GQ7A 3TYJA 1YHFA 5A80A 2PHFA 5I0RA 1FV3A 1M4WA 1OLRA 1RUH2 1DG6A 5KXCA 5GLZA 3VBRB 5FXVA 2GH2A 2XOMA 5IVVA 4RFRB 5F7UA 3T4VA 1CN1A 1LHVA 2XBO1 5FZBA 3OBRA 3KCCA 2WN2A 4YZ3A 2FDHA 4XHBA 5GLWA 1H4GA 1APNA 1OF4A 4Y4YA 3O1VA 2NYYA 1AR81 1GKBA 4AE2A 2DDUA 1FYUA 2PELA 4MXWA 4Y1UA 3ZSLA 1MS4A 4YVWB 1FMD1 2VNRA 1HDKA 2ZGUA 4FFIA 5FZ3A 5HXVA 4AFAA 1S0BA 2VTXJ 4PJYA 5F3IA 1GZWA 2F4PA 4M3CB 2PHWA 4Z82A 3T2OA 1BBT2 1BVP1 1Q8SA 2DUPA 1J3PA 4IV3C 3OYWB 4Q0UA 1PGL1 4K1YA 4JKMA 1PO13 1UXZA 3R4UA 3EO6A 4NPRA 2E31A 2ZZJA 4ZS2A 1CAUA 4YRDA 4HVOA 5C9AC 1HB1A 4Q1RA 4CDXB 4RS5A 3DYPA 3OG2A 1ZNPA 4DMIA 5AC92 3LF7A 5HBAA 1NAEA 2ZX4A 5FXZA 3UK9A 3JQXA 1U0AA 1ZRFA 1TMF3 1PO22 4K8FA 1O6UA 3K77A 2VBPA 4XYXA 1WMDA 2OUJA 1AYM1 1LEMA 4BLJA 1DIWA 2EF6A 3IDCB 5SV8A 5K9YA 4QHBA 2VVFA 3ZSKA 2ZX3A 4XUOA 3FUOA 4QPIB 3I3MA 2XVLA 1JH5A 4NPMA 4XF0A 4J25A 1QJU2 2VCBA 4KNCA 4B8EA 5A3PA 1TME3 1LHNA 5FK8A 4A6OA 1W0NA 2LRPA 3J4UH 4R52A 4XBLA 3GDBA 2OPKA 2PHRA 3AKRA 1W8UA 3WV6A 3SLIA 4D6RA 3VKMA 1GZ9A 1JOPA 4IGOA 3WNLA 5A3NA 2OZJA 3CJIA 3MF9A 4HXCA 2XVKA 4GKXA 2ZGNA 1VJ2A 4K40A 1QOSA 4YG6A 2PAMA 4W6WA 2NMNA 4E2GA 1X50A 2B9UA 3CBNA 4XHXA 3I3BA 4LITA 1AF9A 4Q4X2 5G04L 4LBKA 5IK5A 4AFMA 1PM7A 3ZFGB 5CU1A 3GJAA 1QJY3 3RMXA 1AL21 3KT1A 3DECA 5EJZB 1KFUL 1V9U3 3ZMNA 4AQTA 3J8F2 2Y0OA 2DTWA 3MBWA 4RFT0 1RB8G 1MZEA 2GC2A 4AG4A 3KQ4B 3MGUA 1GWKA 3T2QA 3LEGA 5FYBA 2X10A 3HVDA 4IE6A 2RDRA 1SQ4A 3WCSA 5A33B 5HPOA 2FCTA 4QPIC 1S2KA 5HV4A 1H2KA 3DUIA 3I2KA 5JXJA 2IVIB 2ZACA 4XFIA 4AGGA 1JYVA 2VZQA 2OPWA 5IVEA 5JOWA 4FOYA 1UF2C 4AEJA 5FTTC 5BNNA 1OA4A 1NE4A 3KGLA 3ZIXA 2MEV2 3RYKA 5FZAA 5F5CA 3VKOA 1XC6A 2HEWF 1H1AA 2GDFA 2EIGA 2FQPA 3GM8A 5CB7A 3CKHA 4XFAA 5JSPA 1BKZA 5JIAA 1CAVB 4ZZ8A 1CAXB 3AZVA 4UI9L 4V1PA 3VD4A 3N7JA 4A3XA 1O7FA 3LA2A 5DAXA 2JIJA 1MVQA 4ZKTB 4QB1A 5IVBA 2G9ZA 1SDWA 1I5ZA 1REEA 4RHV2 1SDDB 3AMPA 3K3OA 4NJ4A 4XILA 5GZGA 1Z7S1 3Q8BA 1B35B 4Y33A 4UFHA 2JDKA 4PI0A 3BODA 3DYMA 1X33A 5JR2A 3WQ0A 1XNAA 5C3RA 2ES3A 2VZ1A 4QPWA 3KVBA 3U10A 2D6OX 2HWD3 2QNKA 3MW2A 1PK6A 2DV9A 1OVPA 4JQTA 4CDWC 3WG4A 3V65A 2VVEA 3R4DB 1Q56A 2GC0A 2G1MA 4Q4W3 4XE9A 4YFWA 5LCWL 3P3PA 2J1AA 4H55A 3AB0A 1UNBA 3S57A 5T52A 4YW7A 3V0BB 1NCQC 3VN4A 3HN3A 1H2LA 1IPKA 4N43A 2VQAA 4CA9A 2Y64A 2Z69A 4I30A 2K2SA 4Q4Y1 3WNKA 3KCXA 3NL1A 2QQVA 2XG3A 3NNJA 1I6XA 1SLAA 2K9ZA 4QQ2A 2VBBA 1RMU3 1YJKA 2VPVA 3POJA 5FZ0A 4OHZA 3V64A 4IEUA 4KI5M 4BIOA 2R043 1ZX5A 4IEZA 4LK6A 1GFF2 2F4LA 3KHBA 4Y1ZA 4SBVA 5A3LA 4IEPA 1WCKA 4GJZA 5D8AB 5FYTA 4Q0SA 5IJRA 2JKXA 2ZJCA 3O1PA 1QOTA 2ZEXA 4ZXEA 1D0HA 4UT5A 2RDSA 5FQ0A 3DN7A 1KQRA 2VOKA 1W2AX 1RJ8A 1UZ0A 1LJ7A 1S0IA 1W9WA 4IERA 4P9XA 5F9TA 5JXGA 2ZKNA 4MV2A 3HNMA 5FMOL 2VAUA 5F37A 1W9YA 2A75A 5CG8A 1ZBA2 5E16A 4YZ2A 2FZ2A 2V5YA 3B69A 1DFQA 3RI9A 4E4SA 5C70A 3HT1A 3BB6A 2QQWA 3M3EA 1LESA 1ND2C 1NKGA 4QKBA 2I2SA 1WCUA 5T5JA 1WLCA 1XYNA 4LKEA 3VBUB 2G9GA 2JECA 2HWE3 3UNPA 1EAH1 1RUE2 5DN2A 4P9LA 1TME2 3AMQA 3WP4A 4JRAA 2Z5WA 1MVEA 4IE4A 2AR6A 4IV3A 1ZZ6A 3AZWA 1LENA 1C8M3 4DO0A 2AC1A 3NNGA 2Y6FA 4I0BA 1QGLA 4Y4RA 1N3PA 3J9SA 4HFSA 4XBQA 5BUVA 1K3IA 3M1HA 3RZLA 1H4HA 5FV3A 1NQJA 1W8HA 5C9AA 4QGLA 3ELNA 3U75A 1IS6A 2FCVA 5JZGB 1SMVA 2YY1A 3VBOC 3WEZA 3ZYPA 2HEVF 2VTXA 3RS6A 5AVAA 3POEA 4AQ6A 2W2IA 4FCAA 1NA1C 1ZREA 5TSWA 1C1LA 1W2UA 1C57A 2W47A 3AMNA 3J7LA 3LAGA 4QX0A 4M0HA 2VU9A 1YUDA 2WQ4A 3BIWE 3LPFA 3R4SA 1TVGA 4HKOA 4LHLA 1OUSA 2QBXA 4OUSA 1D7PM 3SITA 1BCXA 1UMHA 2WQ8A 2OS2A 4PBPA 3SNMA 4CRQA 5GZEA 2D3RA 3WNPA 4M3CA 5H9PA 3AVSA 3KM5A 4WM8B 4BWOA 2FD8A 5FPZA 3BGAA 2D98A 2K46A 1K45A 3POGA 3ZYHA 1AL0G 1UD1A 2N7GA 2YZ4A 5C3PA 5GLVA 4Q4V1 1V0AA 2YROA 3NV2A 4EJRA 4FTEA 3Q9OA 1ZZ7A 4GMP3 1JUHA 4B7KA 1HKDA 1STMA 4QAWA 1JYTA 2BTVC 2J22A 3AP6A 5LBEA 2QKDA 4YLZA 4XTPA 1QWRA 3TWIA 1G7YA 3P6BA 1OD3A 1LOEA 4RSUA 2XMLA 1XE0A 4NRQA 1HQNA 2D3PA 1MZ6A 2JIGA 2VG9A 1QJX2 4HN1A 4P14A 1CGPA 1NZIA 2VUCA 4QPIA 4CCCA 3NJVA 3IAQA 3RI8A 1ZZ8A 1JTZX 2XLGA 3O1TA 2DCTA 2WBKA 2UYAA 1OLQA 3G6JB 3SCGA 1GR3A 2IWGB 2HWD2 5T50A 2HKXA 2JX9A 5BV6A 4WM8C 3TEZA 3TEYA 3CL1A 2HEYF 4OVEA 5IUQA 4Q4W2 1UKGA 4MHRA 1YCIA 2UWCA 3WINE 4DY5A 1MQTB 5FMOS 1G9BA 1VPHA 2ZMLA 1IS3A 2YDEA 1PGSA 3NJYA 4Y22B 1ENSA 1GZCA 1K5MB 1Q5OA 3VLBB 4IV1C 2AH2A 5CNAA 4CUGA 2JJ6A 4F83A 3IDBB 5CFCB 3LIHA 4BIFA 4Z07A 2W1SA 1RMU2 4XAAA 4XFHA 4YGEA 1DZQA 1J59A 4AVSA 2YXSA 2HBTA 1R093 1VB4A 4JGYB 2WS91 5B2GB 3VDBA 2DBIA 4LMFA 4AVCA 1AR92 4FPYA 5CA6A 1HB4A 4EE2A 2LROA 4PI2A 2ZGPA 2B8MA 4LHKA 5IVYA 3WP6A 2D6MA 5A33A 1UU5A 4BMEA 3VBFC 1AR71 5DMYA 3LSDA 3NNFA 4CDWA 4XEZA 3BIEA 1XE7A 2GSYA 3O12A 3POFA 4YNIA 2QZ3A 1WLWA 2RS13 2VM9A 4LBJA 3VHOA 2GN3A 4PF1A 4E4DX 3DKWA 5I0SA 2P1BA 1Q8QA 4HSLA 4META 5FZCA 1OFNA 3X29B 1OLMA 5LA1A 1VBE3 2E33A 5IVFA 2WLPA 3FC0A 1ZA7A 1E5HA 1MQTC 1NCQA 3A0NA 1AUYA 1Q8PA 2SLIA 3FFZA 1WD4A 3MLLA 4MXVA 3WP3A 1JYNA 1K5MC 3LGRA 2ZAAA 4LOSA 1VBB3 3MIEA 1DLCA 2FMYA 2IUWA 3EB7A 4COWA 4JKKA 3PU3A 1CAVA 1WA6X 1VLNA 4Q2FA 3ZN4A 4AR2A 1A78A 4LUMA 1C8M2 2G9FA 2I45A 3MF6A 1POV0 2A3YA 4FOWA 2ZGQA 4DPNA 4OQ8A 2AEYA 2A6VA 4X8NA 3FL7A 5LY2A 4Y1XA 5I0DA 4FXKB 5T5PA 2GN7A 4CDUB 4PHZA 2P3YA 4LE4A 1O4ZA 2O8OA 4BCUA 4QPGC 2DVDA 3JB8A 3K48A 3POYA 4EN0A 2ADEA 2WINB 4AEDB 5L19A 1H6XA 3B7MA 5DG1A 2RMU3 5C3SA 2H0BA 3KQRA 2CTVA 4GB33 2H6BA 1VB2A 5JVVA 2Y34A 1RINA 1YFXA 4W8JA 3M2MA 2A3WA 2VW2A 3C8XA 1E5SA 2V09A 4XETA 5A6ZA 3V0BA 1SHWB 1XRUA 4XMAA 2P6CA 1QXPA 3JUUA 2P3JA 2ZZQA 1I1EA 1XPWA 4DS0A 2VZRA 4QHZA 2ZEYA 3CLPA 5A1FA 2IXIA 2OZ6A 1MS5A 2YG0A 1RVF3 1WUVA 4PBOA 2D6PA 2DUOA 3WVJA 4B29A 2OIIA 2YC2A 4XF4A 1VAMA 4N90A 4HLTA 1SFPA 2LW8A 3VBOA 1LKNA 5DUVA 4FQZA 4XTMA 2PLV1 3RWKX 4EN9B 2OYZA 3LFIA 3POWA 3BCWA 4RQPB 1S4CA 4KGGA 1F9KA 3W58A 3E6DA 2PYTA 2RS31 4L99A 3MPBA 4QXKA 1HV1A 1Y43B 4GH4C 5IAXA 5KC6A 3LKJA 4QDQA 1S1AA 4GD4A 5FJKA 2WZ8A 1N1VA 4Q0VA 4UW3A 3EXUA 3SEPA 3WUDA 1CD3G 4JDOA 4C1WA 4FPKA 2CDOA 1NZCA 5IFPA 2YYOA 2ATFA 2DCKA 1TZOA 4Y1YA 5IAVA 1JODA 1DGRN 3D6EA 3GZTB 3O14A 3Q8FA 4QU1A 2KD7A 3O0XA 4E8CA 1ENXA 2OW4A 4WVVA 5FP7A 2BPA2 4KU7A 3N7LA 4GAZA 1BYHA 1PZ7A 2ZHMA 5HCBA 1W6NB 4GWIA 1ZRRA 3CEWA 3OY8B 4E9KA 4QX8A 2VMDA 3URFA 1QH7A 5T54A 3ZXDA 2W52A 4BYYA 1YI9A 4FXGB 2DVAA 4QD2A 4NHLA 4UFLA 1K12A 4BK4A 5J96B 3ZFEB 4CUCA 2ENRA 1J3QA 3OBAA 4YW4A 2GH8A 3WCRA 5JZGA 4IEVA 1PX4A 2A70A 2ZAHA 1SLBA 1UYPA 2ZEWA 2QQOA 3P3NA 3VZKA 4RQPC 2Q8EA 3VDAA 1JZ3A 3VB9A 1W99A 4HK8A 5JXHA 2DFBA 4LBOA 1XE8A 3DXUA 5A70A 1EPWA 3VD5A 1COV1 2XJPA 4AYUA 4K8RB 2AGSA 4LOTA 3ATGA 4JQRA 4MXWB 2EAKA 5LATA 3SEEA 2LM3A 3WD5A 5FJHA 4DXRA 3J7HA 3LEIA 5GLTA 2EIBA 4WM8A 1GZWB 1YQ5A 2GALA 3MIBA 4XIKA 2RS12 4COYA 5KC5A 2BVVA 1AR63 1CZSA 2VBDA 2W91A 2JG9C 3IIIA 3M3OA 4HONA 1F5FA 5DDJ3 4H7MA 4AHWA 3H8XA 5SV5A 1VBE2 2DYCA 1BJQA 1VMJA 2FCUA 2XGXA 3POBA 1IOAA 1SFYA 4IV1A 4HZFA 5BY5A 3BI3A 4BMBA 2D7FA 4FPOB 4RS5B 4JAAA 1VBB2 2TNFA 1FXZA 4YW1A 4DNYA 1DQ0A 5A1LA 3C3VA 1RITA 5FK7A 2WC2A 1GQGA 2QQNA 3CDZB 1UO9A 4GWMA 5FPBA 4A42A 4RYDA 4XURA 2JDAA 3NO8A 1HJFA 5JDBA 2ZGSA 2VZTA 4LEJA 3BVCA 2HWB3 2VQUA 3AX4A 4PCRA 3VBFA 1RUD3 1YFYA 3CIHA 3BPZA 2WNEA 2GNDA 4CCMA 1M06G 1WW7A 3O1MA 2WT0A 2WIIB 3J8F1 2ORXA 3FMGA 5HV0A 4P9JA 5DABA 2RMU2 1BEV2 4GB32 5FP9A 5KXBA 1NCRC 1FPN2 2UURA 1MQTA 2W1WA 3EJKA 4YYOA 3ZYFA 4CU9A 1TE1B 4Y22A 4YM3A 4S2HA 5FCCA 1K5MA 2J42A 2Z2SB 1PHMA 4HVQA 1FOD1 2VZ3A 3PLQA 3ST7A 4LBMA 4UWDA 4EWEA 5B4NA 3FFQA 2WSVA 4RL7A 1MEC1 4CEWB 5CG9A 1IS5A 1CWPA 4K6BA 3HD8B 5DAQA 5J7MA 2XJQA 4WV8A 3PIJA 4FTBA 2B46X 3JZVA 3MUY1 1V6MA 4S2FA 1RUJ2 1VBD3 4XUTA 4AI9A 4O65A 3VZLA 4LUKA 2I74A 2ORZA 4B1MA 1CPMA 4QPGA 2W92A 3TEWA 2VD7A 1H0BA 1BXHA 5APAA 1VRH3 2JXAA 4YW3A 2DCZA 4LK7A 3S7IA 4I2OA 3WF4A 3LFMA 2WYFA 1NOVA 5BNNB 3ACIA 1R1A3 2CAVA 4RHV1 1REFA 2XL7A 3ILNA 1KJRA 4XQDA 2BGCA 1RHI3 2IXCA 5FMBA 1ZYBA 1E5IA 2BU9A 1WCSA 2DF7A 2RV9A 4XXPA 1I9RA 5C8WA 2R0HA 3PTRB 1S0JA 1GICA 1KEXA 1QIQA 3GJBA 5FP8A 5FREA 1YNAA 3MDPA 2E32A 4KG8A 2P34A 4LKSA 1HX6A 1BLZA 1DQ2A 4MYEA 5A7WB 4UXAA 4UFIA 1F15A 3J7MA 4CEWC 1JYCA 2Z42A 5L7OB 3LOBA 1SLTA 4FPGA 1RJ7A 1GNHA 5AVPA 1HLCA 5T5OA 2PHDA 4COZA 4Y5SA 4KH9A 3RZKA 5FRAA 3ZKUA 1QJU3 3OOXA 1QXRA 2XLAA 2QQIA 5FZFA 2OT7A 4GH4A 4XFFA 1QU0A 2GMEA 1PK6B 4N7IA 1V70A 2X29A 5I0UA 1PO11 4YFZA 5A3UA 2JG8B 4WVMB 1ZBE3 3I3EA 4P9GA 1LGNA 2VCMA 3NJZA 4BJ0A 1FX5A 2AREA 2WA3A 2ZOEB 4FAGA 4Q4X3 3PL0A 3PJYA 1S55A 3KF3A 3W5MA 1J1LA 1TMF1 2RE9A 2JICA 3HQRA 3PTYA 4U2AA 1QJFA 5EXOA 3TBDA 1TNFA 2PHUA 5I91A 1GU3A 1AR62 4ZZ5A 4XDOA 4W4ZA 2D6KA 3W20A 2AZ5A 4E4HA 4QQOA 5ACA1 5C5UA 1JHJA 1HN0A 3FE5A 4IEYA 4XVHA 1X9TA 4R4ZA 5FQ0B 2DURA 2L9LA 3DF0A 2BZDA 1TME1 4G9SB 5F3EA 1GV9A 4RQPA 4OHWA 3H8OA 4YG0A 1V6KA 2BEOA 4AW7A 3BU7A 5M0TA 4AGVA 1OPMA 1YFUA
chains in the Genus database with same CATH topology
1RUC1 2JG8C 2Y26A 2MEV3 4AXOA 1HRI3 5FAXA 2HWB2 2RR11 3SCHA 4WZCA 2NLRA 4BM8A 1KITA 3WNXA 1RUD2 1QJY1 1YO8A 4LBQA 1W6NA 1V9U1 2RJLA 2JG9A 4IV3B 1OQDA 3MICA 3SXWA 1GQHA 3H7YA 3L9JT 3AKSA 1W6QB 2XB6C 1AYN1 5C9AB 2BNNA 5H9SA 1JW6A 2WNUC 3VV1A 4AVAA 4FT8A 3PVNA 2VW0A 3R05A 4P9WA 2VH9A 2HWC3 3V0AB 4W6XA 1KFXL 3HT2A 1D0GA 1VBD2 4K7JA 2CGOA 3SH4A 3N7MA 5KHKA 3ZYIB 2WFF1 1VRH2 4LHNA 3QH6A 2ZGMA 1NCRA 1DHKB 4OI1A 5IK4A 2D97A 1R1A2 3ETQA 1IQAA 2Y0IA 1CESA 1RHI2 3UKTA 1WW5A 2GZWA 4ITCA 1MS0A 3OTFA 4BE3A 1ZBA3 1NXMA 3H8UA 1SCRA 1D4VB 3M7AA 5L36A 2CWSA 1SLIA 2DCYA 1VBA2 3GZAA 4YM1A 2YC0A 4BOWA 4LE3A 2E53A 2RM23 4CP1A 1WGPA 3KSCA 4W65A 1SLCA 1EYBA 1XQNA 3ZIWA 1MS3A 1MS9A 1RUE3 2FHRA 3RNSA 2F6BA 4ASMB 3GALA 1B09A 1QJZA 2R041 3WDWA 1DGRA 3W59A 1IPJA 3KD4A 1ZBE2 2YMZA 4GIQA 1PGW2 1O4TA 1BVVA 2UWAA 5KXDA 2O8QA 1H1MA 3DPRC 1XNCA 3PJQA 1E57A 4LO4B 3WG1A 3SCFA 4Q0QA 1HIXA 1MZFA 4CEWA 2Q1ZB 1DYPA 2HWF1 4PF5A 2CY6A 3ZFFB 1A8DA 3WW3A 1LU1A 4N9IA 3JD73 2HWE1 3GZUC 4E2SA 1ZRCA 1DGWX 1OA3A 3DV8A 3I2DA 1LULA 1ULCA 3FJSA 2E51A 2XUMA 4CDWB 1W6PB 4K1ZA 1LECA 4XFGA 4Y24A 4GXLA 4L8QA 4H3WA 3RMYA 1YIFA 1NCQB 1HRI2 1MZ5A 2PN5A 3EBRA 2OVUA 1S0EA 4AVBA 3UL2A 1JUIA 4X6QB 2A7AA 1RUG1 1G9CA 1YIPA 4HPKA 5FO8B 3IN9A 5L7OA 2BUKA 1UMZA 3B00A 3ZFFC 4L97A 5LRSA 4YGBA 1QMJA 3M8LA 1SLLA 1QJX3 1U5XA 2ETEA 4AHZA 3FLRA 3HWJA 1CAWA 1LHOA 1YJLA 5JMCA 3AYEA 5FOBB 2XLFA 1C4RA 4AQSA 4ATEA 2O0OA 1H2NA 4OHVA 2JG8A 4WVMA 1BMV1 1I3HA 2ZX0A 4NHKA 1ND2B 3MLJA 4XQ4A 2HWC2 4GMP1 1S0CA 1BK1A 3RQ0A 1DGLA 1EPZA 1W39A 4FOQA 3VDDC 1JOJA 4XPVA 4XZPA 4B7EA 1R081 4ISQA 1C1FA 3OBTA 1JBCA 1WLDA 4AGRA 2JENA 4R4XA 1DQ4A 2XL9A 4I09A 4YG3A 1AR93 1RL3A 1G9AA 2ZMNA 4COUA 3K51A 3VBOB 2LALA 5H9RA 1AZDA 1DYKA 3CJXA 2WNUA 5K0UC 1HRV2 1NA1B 2YV8A 1KDMA 4N53B 4XOGA 1RUI3 3AK0A 4WVWA 1CONA 3NV1A 3VUOA 4Q1PA 2VXRA 3WDTA 1XU1A 1LEDA 2RM22 1VAKA 1LOGA 4LLOA 2WWSA 4YZ4A 1MR5A 2ZCWA 5J98B 4AFCA 4XJ8A 1HXS1 3AYCA 3ZXLA 4A7KA 3ME2A 4B3NA 5JSOA 1DGWA 1R091 2EXIA 1FI2A 1RC6A 1WCDJ 4H14A 1W6QA 3O0VA 4HVRA 5FO9B 4I01A 4D7YA 3CU7A 4FPEA 4TZDA 2BWCA 2RS11 1AX2A 1FATA 4N53C 1O5LA 5FBZA 1LHWA 3AP9A 4Q8LA 1QDCA 4J1XA 2WZR1 4QT6A 2PHLA 4FPJA 3S6PA 4WBBA 3V0AA 3AZYA 2QE3A 3JD72 1VBB1 1ZA4A 1POV1 1ULEA 4R8HA 4KWLA 2XPJA 1FAYA 5D1IA 1QKQA 5E89A 2A6YA 2K0GA 4MLOA 3DPRA 5GZCA 3MIGA 2RJKA 4AVVA 5T3NA 4IV1B 3H1YA 2XJUA 4IEXA 5I0TA 4K9SA 1F31A 5JI7A 2ZHNA 5CBLA 3M70A 4NN0A 4RGGA 4X6RB 1Z7S3 3MIDA 4GB31 4GMP0 2QUOA 1UAIA 4GWNA 1FNYA 4JV4A 4JGZC 4NWVA 4C1XA 3FBYA 1IHMA 4PIZA 2MPFA 1DQ5A 2XBO2 1QHDA 3FZ3A 3VBFB 1QXJA 3TAYA 3NWKA 4LO8A 2GU9A 3IPVA 3FX3A 4UW5A 3ZSEA 2TBVA 4EV0A 1DZTA 1OOPC 5JPNB 3AJZA 4ZXKA 1DQ6A 1FMD2 1RVF1 4HANA 4CDQC 1IKQA 4Q29A 3JBG1 3KS7A 4YW5A 2GMMA 4NHMA 1LRHA 3WY6A 4LTAA 3THTA 2VOWA 3AZXA 1KJLA 3O5SA 3AFGA 3MYXA 4DINB 3TNQA 3ZFFA 1L3JA 5J3UA 4FP3A 5GLUA 4D3WA 2A71A 5EYXA 4QPGB 4XF9A 4LLFA 2ZKLA 1RUI2 2LTNA 1W6PA 3FLTA 1S0GA 2YGLA 4XFBA 1H8TC 1OQEA 2FZ1A 3D0SA 5T55A 2WZPP 4AF9A 4S2GA 4PQ9A 1IKPA 2RS51 2ZGTA 3FLPA 3LB9A 1ULDA 2XHKA 2TUNA 4ASLA 1H9PA 4XJ9A 1EY2A 4DQAA 4ES8A 3M3QA 1AL22 1CIWA 3ZDSA 5K0UA 1VAVA 3RRDA 4M3CE 4YM0A 1HQWA 4C91A 2EAAA 1OMIA 1AR61 4GH4B 4E27A 5DDJ1 2B5HA 2B39A 4D7TA 1BEV3 5DZEA 1FPN3 1ND2A 2ZA9A 2P2KA 4PIYA 3ZXAC 1WMFA 4MVTA 4A7ZA 4H7LA 2EA7A 2DFCA 1SCSA 2GNMA 2BNOA 1OHFA 1OKQA 2UU8A 1V6JA 3WOGA 2NM1A 1W6OA 2DVBA 2WNVC 1FV2A 2QDRA 3VGIA 2HWB1 4F3JA 4QMAA 1RUJ3 2R6QA 5A32B 4WM7C 2CL2A 5JOZA 2R073 1NA1A 2H6CA 5JWPA 4N53A 4F8AA 1LR5A 1Z7S2 1AXKA 2C9AA 3D4KA 3SH3A 1U5IA 2VMIA 1NQDA 3M4FA 1X7NA 3I8TA 3VBSB 2PHXA 3TRSB 4WVZA 1ND3C 3JU9A 1DZRA 2XJRA 3GHMA 5AFBA 1RUH1 3GBFA 3IBMA 1VBC3 3CF6E 4X8PA 1D2QA 4TSVA 1UIJA 5EJ3A 4LBQB 5FDBA 2JG9B 1G9FA 3VBHC 4KWJA 3MW4A 1REDA 5BNOB 2Q8OA 4MGZE 2X5IC 2BW8A 5F6LB 5AFEA 4HK9A 1IS4A 4XIOA 1Z78A 5EFUA 5GJ6A 1VRH1 1BBT1 1V6LA 3PMSA 4L2NA 3HBZA 4XXAA 3WQ7A 3H9AA 2ARBA 4HKLA 4JGZA 3ZXEA 2UY8A 2NP0A 2CNAA 1RHI1 2EXJA 4KBBA 3ZXJA 5C4WB 3VBSC 2YGMA 4XQWA 2P37A 2P3KA 4LR4A 2D93A 5AC91 1AJOA 3NSTA 1FNZA 2GAUA 4B4QA 4Z2WA 1LODA 1QQP3 4PLNA 1PO21 1UZYA 3QCWA 1C28A 5F5QA 3GNEA 4LBNA 1A3KA 4R9DA 1NCRB 4YGDA 1EAH2 2QJVA 2ZTNA 3AMHA 3ILRA 2R063 4ZU5A 5BNOC 3E5XA 1PIV3 2XJSA 2QDNA 1QJU1 4O9EA 4FO9A 1CQ9A 4P9IA 1LOFC 1O91A 3OCPA 3SHRA 1O3SA 2V73A 1MACA 3H3UA 2VNGA 4SLIA 1CX4A 3I54A 3LWCA 5DUXA 1KDKA 5CAZA 3MIFA 1CPNA 4XJAA 1PGW1 4F7ZA 4Q4X1 5C4WC 1D4M3 4MGIE 3H7JA 4EN6B 3VKFC 3WZ1A 4DXZA 3MPPG 1H8TA 3L2HA 4E4ZA 2DVFA 4PLMA 2QQPA 4QGNA 5JR7B 3R6SA 4N7UA 1SEFA 3THPA 1KS5A 3KB5A 1VR3A 2E7TA 3AM2A 3QD6A 1DU3D 4AEMA 2DU0A 4RGAA 4CYDA 4AI3A 3HAGA 4Q4V2 2IC1A 2IFWA 5CIRA 5LK5A 4DZGA 4ORFA 1KS4A 5BNQA 1VALA 1YWKA 2MEV1 3WXPA 3S30A 4M00A 2RS33 1NXD1 3PVEA 2IZWA 3MW3A 1UU4A 3GHNA 3M3CA 4QU2A 4XFCA 3NKTA 3RPQA 2R072 4OULA 2UWBA 3AKTA 3RDIA 5C33A 4JCKA 1PVC3 2EXKA 4DOUA 4HMZA 2PQQA 4J1WA 4QM9A 1W0OA 4YVSC 2ET7A 4J6GA 1YI7A 5I93A 4K3UA 3TN93 4P9YA 1VBC2 3IMNA 4YGCA 5BNPC 1O3TA 3N7KA 4CTEA 3KLSA 3WG3A 2NPIA 3FHIB 1YYNA 3WDVA 1VBA3 2GNTA 4FP2A 4HPKB 2WNVA 1UIKA 3ZXKA 3VZNA 2C0ZA 3NW4A 4G3YC 1GBGA 4LO5B 3ZXGA 2D44A 4WM7A 1JXNA 2BWAA 3VKLA 2WS92 3H1MA 3FBMA 5JI9A 1Q8VA 1V00A 4IEQA 3WHTA 1CAWB 5EZWA 5JOYA 4DRRA 5CFDC 1NLRA 2VUAA 3UV9A 2D3SA 1O4YA 1SFNA 3CNAA 2A6ZA 1OQ1A 2X8KA 1ND3A 5JSRA 2VVDA 4TWTA 1BZWA 3ASIA 4KQ7A 4COVA 1ZBA1 3KMHA 1SBDA 1QQP2 2R49A 4XF1A 2KXLA 4TYSA 2A73B 1TNRA 3VBHA 1H2MA 3IKWA 2VECA 3ZO0B 2X5IA 2ZHKA 1VIWB 2R062 2Z79A 3B94A 3HR9A 2VULA 3NKGA 1PIV2 4GALA 4LULA 4FOVA 4M01A 5A32A 1J1TA 1RUE1 2DCJA 4HKWA 4Y20A 4OZXA 2GC3A 2WNUB 3ZPYA 2CV6A 3IT8A 4K21A 1A8MA 3USSA 3RJ2X 5GM0A 2ZGKA 1H9WA 4DB5A 3A4UA 3VBSA 2VMGA 4D7SA 5C8CC 5GZDA 2CAUA 4L11A 1D4M2 4C90A 5DZFA 5HCAA 2R30A 3WQ1A 1ASJ3 1FOD3 3OPZA 4EN8B 5BNOA 1XNBA 3NAPB 4LBLA 1EP0A 3NV4A 1MEC3 3ILFA 5LEJA 2PA7A 2ILMA 1LOFA 2P17A 4HN0A 4D69A 5KHHA 2JE7A 4FQ4A 3MI8A 3WT3A 1WMEA 1ZVFA 4YW2A 2OUHA 5I8SA 1JN2P 2HYKA 2Q1MA 5C4WA 2RS32 2R16A 3G7DA 1RUF3 3O0WA 4HSJA 4K20A 4FBFA 2WL1A 4D94A 3WDUA 3ZMOA 3IM0A 1DDLA 2WLQA 3E5QA 1PVC2 5DXDA 5DG2A 2R32A 3T1LA 2VMHA 3R0RA 1QJX1 5J36A 3NAPC 3DPRB 4AFBA 4MGYE 2WJSA 1QOOA 4GKYA 3TN92 1Y9QA 2JE9A 3ZYGA 4AHXA 1HRV3 2HWD1 3N35A 5GALA 4I0AA 5J09A 4FAHA 4NO4A 4Q4W1 2YUEA 3AXDA 1ULGA 5FLIA 3ZYRA 2ZPXA 3B9IA 3QLQA 4LO6B 1COV2 3UKNA 1RMU1 3HQXA 2Q30A 3IPVB 3VZMA 4CEYB 3OGJA 3LA7A 3BOWA 1S2BA 3U11A 4YVSA 1AR91 1S0FA 3N3HA 2GMPA 3VBRC 1O5UA 4EN7B 5BNPA 4MH0E 1RUI1 3H3ZA 1IZ3A 5ACA3 2YPJA 3AYAA 4YVWC 1N3OA 1G9DA 3APBA 4ISRA 2TEPA 3U0ZA 2KM2A 3TNPB 5F6KA 1AJKA 4BQ1A 3MIHA 2VQ0A 4QM8A 1AX0A 4IESA 1RUC3 1G86A 1OSGA 3LOIA 1URXA 4W6YA 4XJWA 5CFDA 4ZU4A 1ZZ9A 2ZABA 1C8M1 2O1QA 2RR13 2HJIA 4CDXC 1UPSA 4CEYC 2XWBB 3DGTA 4URTA 2GNBA 2RHPA 3VZJA 4XBNA 5BXXA 2QCSB 2LUWA 4BA6A 1KRIA 1EV13 1F5JA 2BYVE 3IWZA 5L73A 5EYYA 3S7EA 3VDDB 4MSVA 3SMHA 4IXLA 4MZUA 5JIUA 1WD3A 1GNZA 2NZ9A 1AYN3 1DQ1A 4HT1T 1ZZCA 2X53S 5JOXA 3AFKA 3USUA 1ASJ2 1FOD2 3KT4A 2VGDA 1ENQA 5E88A 3WLUA 4BPZA 5ABJB 4AI1A 3H1WA 1SBEA 4DRVA 1MEC2 2WKKA 3AMMA 4BH9A 1QH6A 4A7YA 2XBO3 1O3RA 1CJDA 5K0UB 2XWJB 2R1DA 1AR83 4LT5A 5JAXA 2ZGLA 2A6XA 3TB0A 2BVBA 5FO7B 1FMD3 1CR7A 4I3GA 3ZFGC 4CZSA 5C8CA 2WFF3 2DVGA 4R9AA 1RUF2 2VY0A 1H30A 3EQEA 5IK7A 4FSJA 3MFAA 3VZOA 4S2DA 3AKQA 3GF6A 1LOBA 1W6MA 1MS8A 3HMYA 1Q8OA 1W6OB 4UW4A 3WDYA 3ZYJB 2E6VA 1HQLA 2A5ZA 4FPLA 5ABJC 2PAEA 1LU2A 4HETA 3B02A 4JC1A 5T5LA 1AYM3 4JTOA 2CWMA 3V56A 4YSFA 3AP4A 4RA0A 5I8YA 3MFCA 1YFWA 1WBLA 4XJUA 4AK3A 5BYNA 4IEWA 2D6LX 1G6NA 3B9CA 3INAA 1PO12 2VNOA 1X36A 3ES4A 4XW3A 3OJBA 2I07B 4IEOA 1B35C 4AWDA 3WUCA 2ZS6B 3NAPA 4Q27A 4QPYA 3ZSMA 1TMF2 1GYKA 2JEMA 4AI8A 5JPMB 2P3IA 1AL23 1C5HA 2HWF3 4R9CA 1PZ9A 2D40A 2PHTA 3ZSJA 2ZMKA 4N9HA 4C0BA 5H9QA 1NE6A 3WHUA 4XJZA 5ACA2 2Q0AA 1PMIA 4MGKE 3N4MA 4JGZB 3ZN6A 1VBE1 3RYPA 3RWNA 4IETA 1DBNA 3UKVA 1N1TA 2A3XA 1RUC2 5D8AC 5A3MA 2AYHA 1NY72 4WZFA 5DUUA 4YZ1A 1OOPB 3QH7A 2ERFA 2RR12 4CDQB 1CVNA 2C1FA 3VBRA 2ARXA 2NQYA 4BHPA 1QJY2 4Q8KA 1RUG3 1V9U2 1EV12 3AYDA 4YVWA 1AYN2 3VBUC 2RMU1 4PLOA 1BEV1 1FPN1 3BOPA 3DL3A 4Y5Z0 5KHJA 5K7PA 5KBFA 1MS1A 3H50A 1U5YA 3OYWA 3VHPA 1H1IA 1OD5A 3MZHA 1QNYA 3T1MA 1AR82 2XKPA 4OI2A 4PIXA 4CDXA 4CEYA 1D2SA 3IDEA 3ES1A 4RR3B 3E5UA 5JZGC 3RSJA 3MEPA 1CJPA 1H8TB 4XMIA 3WX5A 4Q4Y3 5JCTA 1R083 5CVRA 2B45X 2FBEA 2WFF2 1RUJ1 3GBGA 3AZZA 1XNKA 2UY9A 1AXZA 2R071 1UL9A 1PGL2 1SBFA 3VHNA 2IXHA 1U12A 3ENRA 1GANA 4KG0A 4IL7A 3LCPA 4FVVA 3PNAA 4OI4A 1Y3TA 2XJVA 3HN1A 4UBHA 1KD7A 5FLJA 2WT1A 1VBC1 3JCIA 1YXWA 4NOTA 1VP6A 1Y7BA 5CADA 1N3QA 1X8MA 2IXLA 1AYM2 4CP2A 3WW2A 2DU1A 3H0OA 4RR3C 3I7DA 3ROUA 3ZFGA 4FPFA 1ZM1A 1EAH3 1HXS3 3RZZA 4OUMA 1LTEA 2BFUL 5GKAC 5JLVA 2R042 1NYWA 3VDDA 5I8TA 2XH6A 3I59B 4Z8BA 5KHIA 2ZHLA 1YRZA 1OA2A 4ES9A 3AXEA 1XYOA 3ZX7A 1UCXA 5C6CA 2JD4A 2NMOA 1V6NA 4YZ5A 4AQ2A 1NG0A 3QBQA 2D5FA 5FPXA 2WNVB 4INDA 5ABJA 3U07A 3BALA 4I3PA 4LA3A 4BZ4A 3LSEA 4GA9A 3RJRA 4WM7B 2H0VA 2HWF2 3AKPA 2WZR3 4JVAA 1HW5A 1QQP1 4GULA 2W39A 4FPCA 4TLFA 4KGQA 4KL1A 1XNDA 1QDOA 2HWE2 2QVSB 1H8VA 5HCFA 1POV3 5CFCC 5FLHA 2R061 2EALA 1CAXA 1PIV1 3GYDA 1ND3B 1SACA 3OD0A 1PNFA 3AP5A 4JGYC 1V6IA 4ATFA 5EV7A 1QF3A 2AENA 3OD4A 1X82A 2PFWA 1B35A 2D5HA 4Q4V3 3E6BA 1R1ZA 4QQHA 4R9BA 2BNMA 3VBHB 2PAKA 3M3IA 2JDZA 3D8CA 4ZU7A 3ACLA 3ZVXA 4PDWB 2X5IB 1S0DA 1RUG2 1D4M1 1TEIA 2E63A 4FPHA 1V6OA 1RUD1 4Y1VA 4Y20B 2DWRA 3PVOA 1AVBA 1Q43A 3AJYA 2ZX2A 4NVPA 3WW4A 2YHJA 4FTSA 2DTYA 2E9QA 5EWSA 4MX3A 3OF1A 4YARA 3W9AA 4AHYA 5LRRA 3J26N 5D8AA 3WP5A 1BMV2 1U5ZA 2OA2A 4OHXA 3JBG3 3TOJA 2BBVA 4CDUC 2Q4SA 1WW4A 3OGGA 1J3RA 5LK7B 3GBWA 1N1SA 1ULFA 4Q4Y2 2A6WA 3B5LB 1R082 2B42B 2R0FA 4OLLA 4QQPA 4Y26A 1VBD1 4PDWC 2SBAA 4AEDC 1F8VA 2AUYA 5FOJB 2CGPA 5KWRA 4OHYA 2E7AA 1C5IA 1DLLA 1YLLA 2WS93 5F1RA 5HI0A 3E6CC 2DUQA 1XXNA 3VBUA 4A2UA 1PVC1 2BFUS 1HV0A 2UYBA 1ENRA 2ET1A 1WLTA 3FWEA 1R1A1 2C5DA 1AR73 4XDQA 1RIRA 2VOXA 1OPOA 4ONUA 1RUOA 3TN91 4LA2A 1LCLA 1UZZA 4I0WB 1OOPA 1LB2A 4B4RA 4EWDA 2RS53 1PVXA 3PMEA 1VBA1 4JDMA 1N1YA 1XYPA 2MNGA 4CDQA 4Z1VA 1QNWA 1HXS2 3UJOA 3B01A 4U36A 2EVXA 4QQLA 4HBNA 1R092 2EXHA 4OI0A 4EROA 2MHFA 1Z0HA 2Y38A 1AXYA 3JQWA 2CYFA 3U4XA 3LA3A 4MUVA 2WT2A 4JRLA 4AFDA 1ZBE1 4QX5A 4Z92B 1C8NA 3I4IA 2W68A 2ZX1A 4EWAA 3SISA 2VOVA 4E2QA 2VUJA 2WZR2 1TQ5A 4LNVA 1J58A 3MLKA 3ZFEC 1CAUB 4RR3A 4DFSA 3A0KA 1ZZBA 1LHUA 1BQPA 4NR1A 1GLHA 4I02A 4YVSB 5GZFA 1RTVA 1AHSA 5KXEA 1IGOA 4P5HA 5IT6A 4RD7A 2D43A 1FT9A 1N47A 1UKRA 3O7OA 5KHGA 5BNPB 4XF3A 2XJTA 2IXJA 2PLV3 1QY4A 2WSUA 4B4PA 4Q0PA 4M0NA 3B93A 3C2UA 1HRI1 1Q3EA 3QACA 4NWWA 4OFGA 3CJIB 2NN8A 1XU2A 5CFDB 1ASJ1 4Q26A 5CFCA 1LGBA 2VW1A 1RUH3 4RS5C 4IQPA 4JTNA 1T6GC 4AI2A 4KWKA 3ZXFA 3UJQA 4JGYA 1ALYA 4LO7A 3I59A 1RVF2 2D6NA 5J48A 2PTMA 1DF0A 3ALQA 3VKNA 3JBG2 4G4FA 2BQPA 3D82A 3PVBB 3WDXA 1NLSA 4BLIA 3USUB 2IFRA 2XKOA 2HWC1 1BBT3 1RUF1 1JYIA 1GSLA 4QGMA 1AX1A 1UPIA 3RG0A 1W0PA 5DZGA 3CJIC 4UBGA 1COV3 3D5OA 4CP0A 5AC93 3E97A 3N36A 4AVTA 3S0MA 3B3QE 2WFPA 3AP7A 3FUQA 3WR0A 1AR72 2B7YA 3VHRA 1LGCA 1LOCA 1PO23 2WQZC 3KZ4C 5C8CB 3L2YA 4KU8A 5E8AA 1OI6A 1HRV1 1OFSA 1F2NA 5BPXA 3QOPA 5E1RA 1KXGA 1LOAA 3VL9A 3CO2A 4CDUA 4L9BA 1PZ8A 2R1BA 3ZN5A 2RS52 2QFEA 1W6MB 3BTAA 4C0HA 2RM21 3KT7A 3KGZA 4PDWA 4AEDA 3WW1A 2W08A 3POSA 3T2TA 2JKBA 2KA3A 3EHKA 5BNNC 2WA4A 3NV3A 3KCYA 1ONAA 4N43B 3IIAA 2CGNA 3VL8A 1RUNA 1RGSA 1WW6A 4L92A 4HL0A 4UW6A 2G4IA 1C3HA 3J8F3 5DDJ2 4JDNA 4M3CF 3HIFA 5L7OC 3NVCA 5FFOC 1A6CA 2ZBJA 4AI0A 4YM2A 2W0XA 4AEKA 1UU6A 2ZGOA 5K8SA 1ZRDA 3JB4C 3JD71 1PK6C 2GC1A 2E7QA 1NY71 2IXKA 2Q5TA 1UW8A 2QZ2A 3D0JA 5LEKA 2ZGRA 2XVGA 3LZZA 1X8EA 1JHNA 4N43C 1WBFA 2PLV2 1G8WA 4O9GA 1PNGA 3ZN6B 3PHMA 1UN1A 3ECQA 3OY8A 1EV11 1O3QA 4DY3A 2FMDA 1UX6A 1WA4A 4RHV3 3ZFEA 5J37A 3WG2A 4LBQD 3SH5A 3RYRA 5IK8A 5DUWA 4GQ7A 3TYJA 1YHFA 5I0RA 2PHFA 1FV3A 1M4WA 1OLRA 1RUH2 1DG6A 5KXCA 5GLZA 3VBRB 2GH2A 1CN1A 1LHVA 2XBO1 3OBRA 3KCCA 4YZ3A 4XHBA 5GLWA 1H4GA 1APNA 4Y4YA 2NYYA 1AR81 1GKBA 4AE2A 1FYUA 2PELA 4MXWA 4Y1UA 3ZSLA 1MS4A 4YVWB 1FMD1 2VNRA 1HDKA 2ZGUA 5HXVA 4AFAA 1S0BA 4PJYA 1GZWA 2F4PA 4M3CB 2PHWA 4Z82A 1BBT2 1BVP1 1Q8SA 2DUPA 1J3PA 4IV3C 3OYWB 4Q0UA 1PGL1 4K1YA 1PO13 3R4UA 3EO6A 4NPRA 2ZZJA 1CAUA 4YRDA 4HVOA 5C9AC 4CDXB 4Q1RA 4RS5A 1ZNPA 4DMIA 5AC92 5HBAA 2ZX4A 3UK9A 3JQXA 1U0AA 1ZRFA 1TMF3 1PO22 4K8FA 4XYXA 1WMDA 2OUJA 1AYM1 1LEMA 4BLJA 1DIWA 2EF6A 3IDCB 5SV8A 5K9YA 4QHBA 2VVFA 3ZSKA 2ZX3A 3FUOA 4QPIB 2XVLA 1JH5A 4XF0A 1QJU2 4KNCA 4B8EA 1TME3 1LHNA 3J4UH 4R52A 4XBLA 2OPKA 2PHRA 3AKRA 3WV6A 3SLIA 3VKMA 1GZ9A 2OZJA 3CJIA 3MF9A 2XVKA 4GKXA 2ZGNA 1VJ2A 4K40A 1QOSA 4YG6A 2PAMA 4W6WA 2NMNA 4E2GA 1X50A 2B9UA 4XHXA 4Q4X2 5IK5A 1AF9A 4LBKA 4AFMA 1PM7A 3ZFGB 5CU1A 1QJY3 3RMXA 1AL21 3KT1A 1KFUL 1V9U3 3ZMNA 4AQTA 3J8F2 2Y0OA 2DTWA 4RFT0 1RB8G 1MZEA 2GC2A 4AG4A 3MGUA 1SQ4A 3WCSA 5A33B 4QPIC 1S2KA 1H2KA 3DUIA 2ZACA 4XFIA 4AGGA 5JOWA 4FOYA 1UF2C 4AEJA 5FTTC 5BNNA 1OA4A 1NE4A 3KGLA 3ZIXA 2MEV2 3RYKA 3VKOA 2HEWF 1H1AA 2GDFA 2EIGA 2FQPA 5CB7A