3AKTA

Crystal structure of xylanase from trichoderma longibrachiatum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Packing Space Expansion of Protein Crystallization Screening with Synthetic Zeolite as a Heteroepitaxic Nucleant
doi rcsb
source organism Trichoderma longibrachiatum
molecule tags Hydrolase
molecule keywords xylanase
total genus 56
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aktA00
3VZLA 4S2HA 2VUJA 4S2FA 5K7PA 1XNBA 2D97A 2D98A 2DCYA 1XXNA 2VULA 1OLRA 4IXLA 1KS4A 1XNDA 4HK8A 3AKSA 3WP6A 2BWAA 1H4HA 1NLRA 2QZ3A 3WQ0A 3VGIA 3WP4A 3LB9A 1REEA 1KS5A 1PVXA 1QH7A 3VHPA 1HIXA 4XQDA 3WP5A 2B42B 4HKOA 3RI9A 3MF6A 5HXVA 3VHOA 5K9YA 3WQ1A 1BVVA 1F5JA 1YNAA 4S2GA 3AMQA 2DFBA 2DCZA 1OA4A 1XNCA 3VLBB 3VL9A 1BCXA 4HK9A 3MF9A 3WP3A 2B45X 4XQ4A 3AMHA 1H8VA 2JICA 3AMPA 4H7MA 2F6BA 3AMMA 1H1AA 2C1FA 3MFCA 1REDA 3AKQA 1REFA 4NPRA 3B7MA 3WY6A 1XYPA 1HV0A 2DCKA 3VZOA 1OA2A 3VZKA 3HD8B 3VZMA 1IGOA 1UU4A 3WX5A 2QZ2A 2BW8A 3VZJA 2Z79A 3AKTA 2JEMA 2VG9A 1C5IA 2B46X 3AKRA 3VHNA 5EJ3A 1OLQA 3EXUA 3WXPA 4S2DA 1M4WA 1T6GC 2NLRA 1C5HA 3MFAA 3M4FA 3O7OA 2BWCA 3LGRA 3VL8A 2DFCA 1AXKA 3B5LB 1XNKA 1XYOA 2DCJA 2NQYA 1TE1B 3WT3A 1ENXA 1H4GA 1UKRA 1XYNA 1BK1A 3AKPA 1HV1A 1UU6A 4XPVA 4XQWA 3VZNA 1W2UA 2VGDA 3WR0A 3AMNA 3WQ7A 1UU5A 3RI8A 2BVVA 4HKWA 4HKLA 1QH6A 1OA3A 3ZSEA 1H0BA 2JENA
chains in the Genus database with same CATH superfamily
2C4XA 1HX6A 2VECA 3GZAA 2AZ5A 3ZO0B 3RWKX 5GALA 4PDWA 5FQ0A 1MPXA 3O1MA 4RN5A 3ILRA 4XUOA 4KQ7A 4M01A 1UYXA 5F7UA 2A6XA 4F8AA 1V6OA 2P1BA 1JS9A 3VD4A 4FPYA 4M0NA 3U75A 4M00A 5EP9A 2WR9A 4NHYA 1CPNA 2R042 2EIGA 2WS91 1H6YA 2EICA 3ACLA 4IQPA 4RGGA 5DUXA 2V72A 2YC4A 4JGZB 1UYZA 1Y9MA 4AFCA 4C0HA 4UFHA 4B1LA 4JAAA 3ENRA 4ZPIA 2D44A 2XH6A 5FAXA 3ZMOA 2VNRA 4Y1XA 2A3WA 2C0ZA 1AYM2 1CAUA 2WRAA 5CFCC 4EZHA 1OMIA 4LBQD 2ORZA 5FYHA 4CUBA 1AL0G 2VOXA 4YGEA 1DYPA 1UZZA 2XLGA 5C8CC 2J1TA 1PZ7A 3Q8FA 5E6HA 1UMHA 3AXDA 3W59A 2VBBA 4PDWB 5CIRA 3AMQA 5FCCA 4PQQA 4Q0QA 3URFA 3E6BA 1G8WA 1S0FA 4EE2A 2VXJA 4NROA 5LCWL 1EPWA 5FZCA 2VJXA 3PVEA 3IWZA 2HWD2 2R073 2R7EB 2OQ7A 2ZJCA 3OTFA 5A3NA 1F4AA 4DY5A 3SNMA 3NJXA 2UURA 4H7MA 4AEJA 3J7LA 1H1AA 2HKXA 3O1PA 2WWJA 2ZHLA 4KNCA 5FYYA 5ABJA 3BODA 1QQP3 3OEAA 5EYXA 3WDXA 1QU0A 3S30A 1XYPA 1O59A 2IUWA 2XG3A 4AI1A 1LULA 2QQOA 2WO1A 2UY8A 5JOYA 2YC0A 1D0GA 1GU3A 4MGIE 3P3PA 4YM1A 2XJVA 4D7TA 3WZ1A 2AACA 3NAPA 3CJIA 3RMYA 5FYMA 1JYCA 2VTXJ 2R061 4BM8A 1FOD3 5DUWA 1QJZA 1TEIA 3R6SA 4CDQC 1JZ5A 3IKWA 1RUJ2 3B94A 2ORXA 2ZX3A 1JBCA 1HN1A 2BBAA 1NXMA 2LROA 2WABA 3C7OA 2ADEA 2BOIA 2JDAA 5A80A 5JZGB 1M4WA 1UOBA 3NL1A 2DVFA 5LK5A 1W0OA 2XLAA 4CU9A 1T6GC 3LDRA 3THTA 4XCAA 5JXHA 1KXGA 2YXSA 1LESA 4E8DA 3KV4A 1OKOA 3JB8A 3MW2A 3J4UH 5FZ0A 1ZYBA 1RUJ3 2NN8A 1K42A 1IS5A 2XGXA 2GMMA 3DGTA 4LA2A 4ISQA 5DXDA 2V4VA 3ZDVA 1GLHA 1P8JA 1XYNA 3LEGA 1GNHA 2JG8C 2HWF2 1RMU3 2W47A 4FQ4A 1PK6A 4P9YA 3ZN4A 3WDWA 2VBDA 3UKNA 5CADA 1EAH2 5LA1A 1PNGA 3N9NA 4E2SA 3GYDA 3LZZA 3N7LA 4Q0UA 5JI9A 5JCTA 1KGYA 4YZ4A 2QQPA 4ISRA 1IHMA 2GNTA 1ZZ9A 3GCXA 4N9IA 4RFT0 3ZYHA 1BXHA 2VOTA 2Y0OA 1H2MA 1VBE3 1S0DA 2R1BA 3APBA 4JTNA 4RS5B 3VZLA 3ZR5A 4A44A 2RS53 3PUSA 2JJ6A 2ET1A 4OUEA 4AGVA 4LLFA 3VD9A 1S55A 3MBWA 3FMGA 4Y20B 2VUDA 3IPVA 4M3CE 2KXLA 4XXPA 1RUE2 4GJYA 2CGOA 4JHZA 5FK7A 4FTBA 1BBT1 2WQ4A 1ODNA 1F9KA 1SMVA 2J1SA 5IVYA 3M70A 1W8HA 3N36A 4YZ1A 1QJU3 4NIAA 1DFQA 4Y5Z0 2JKBA 2AC1A 2WNUC 3NNMA 1V0AA 1IPKA 2DUPA 2ZGTA 1OH3A 2RE9A 2PN5A 4GULA 3T1MA 3WP5A 1UMIA 3M8LA 2XJRA 4AW7A 2VU9A 4B4PA 1YLLA 1BVVA 2OXBA 3JD73 5I8SA 4V2VA 2G19A 3OPWA 5GLUA 1RXFA 1W2NA 1HW5A 3PVBB 4PIZA 2ZAAA 2J1UA 2R041 3EHKA 3GXUA 1WBFA 4LE4A 1CZTA 3OD4A 4MXVA 3AMHA 1YFWA 1NCRB 2IXLA 3OB8A 2ZGOA 3JXSA 1CAXB 5KXBA 4EV0A 1JUIA 1O5LA 2OS2A 3UKVA 3PU8A 4FFFA 3SHRA 5FZOA 2Q1FA 1APNA 4MYEA 2PA7A 4XIKA 1W28A 3BVCA 2B8MA 4J25A 3IB3A 4Q4V3 1MS3A 4WBBA 5F6KA 1W6PA 1NA1C 4UFIA 3HWJA 2JE8A 4Q8KA 4LIVA 1GOHA 2XQXA 1WW4A 3OBTA 4NO4A 5FZ4A 3AZVA 4JQRA 4KU7A 1W99A 4RR3B 4AEDC 2WNUA 4CU7A 4MUVA 2H6CA 3RRDA 4IGPA 4E2GA 2P6HA 4WM7C 4YVSB 3VBOA 5EJ3A 5C7GA 4CA9A 1FT9A 2W91A 1HXS2 1XPWA 4QX1A 3O1OA 4C90A 4PBOA 2HWE2 2RS51 2OYZA 5K0UC 5FP8A 1VBE1 1DQ1A 4I0AA 3ZYFA 2WN3A 2J1RA 5C9AC 5C71A 2TBVA 1OD3A 2YC2A 1KITA 2RS11 2BGOA 5FDBA 3D5OA 3P3NA 3T08A 1CAWB 1OQ1A 4WVWA 2IZWA 3H8OA 3O0WA 4YW5A 1NXD1 1SQ4A 5HPOA 3HT2A 2WS93 3J8F3 4RGKA 4KI5M 2DWRA 3MPPG 2NM1A 2QFEA 3N7MA 4LPLA 4DEVA 1RUH1 5IATA 4QHOA 1E5SA 3PUIA 3KS7A 2BOJA 5I0RA 1J3RA 1IS6A 3LA3A 4GH4C 1RUJ1 4I0WB 4ITCA 3ZFGC 1VBD2 4YFZA 2R043 1NT0A 4OZXA 1TZOA 4QMAA 4LTAA 3WUCA 3VDDC 5DZEA 2XKOA 3HMYA 1LU2A 5A3TA 3N9OA 4CZSA 3HNYM 2BPA2 3MDPA 5K7PA 1YQ8A 4XBQA 1D4M2 5G05L 1KDMA 4L92A 2D5FA 4JGZC 3WF4A 4IXLA 1QY4A 3WSOA 3JB4C 1QXRA 2G9GA 4EQVA 5DZGA 3ABZA 2RR13 1Z7S2 3GJAA 4DMIA 1BKZA 3DPRA 1QJU1 3JBG1 4QGLA 1Y7BA 5LRSA 3WW2A 2QQIA 4CDQA 3PLQA 1PO13 1HJFA 2VTXA 3QD6A 4UFMA 3E1F1 4WVVA 3T4HB 5FMOL 5IVVA 3R4UA 1HXS3 3T2PA 5FY0A 1KJRA 1VMFA 4CCKA 1BK0A 1H1IA 2XB6C 2JDYA 3RZLA 3AFGA 1JHNA 2ZGSA 4XUNA 1UX7A 2ZOEB 1BVP1 1CZVA 3ASIA 1S1AA 3IMNA 4PBPA 1YI9A 5FP3A 3VHOA 3BGAA 2WO7A 4HMZA 4QGNA 4RQPA 3AFKA 4Y26A 1RVF2 2BGPA 5C33A 1KFUL 1Z0HA 1UWWA 2PQQA 1JH5A 2RDQA 3IDCB 4FP2A 5F1RA 2ZAHA 1ZBE2 3M3QA 4LNVA 4Z8BA 3WDVA 1O4YA 1O4ZA 1U5IA 4CPBA 4B7EA 4CCCA 3K48A 4XQ4A 3SEPA 1ULCA 1C8M2 1W8OA 1ZZ7A 1PK6C 5A3UA 3WG2A 4XHXA 3ZFEC 4Q26A 2BDRA 3H8RA 2RS33 3DPRB 1BEV2 5T52A 4MXWA 4DPNA 3V0BB 2VVEA 4CP9A 4WVMA 2X8KA 3AB0A 2FDKA 4QU1A 2HWC3 4MGSA 3ZX7A 1ZREA 1LHWA 4IE4A 4NUBA 5IFPA 3I3DA 4ET7A 1FNZA 3NNJA 5KC5A 2NZ9A 4WM7A 2VE1A 1RC6A 1ND3C 2RJ2A 3O14A 4LUMA 4E4ZA 1IZ3A 3WX5A 2P34A 4NHXA 1G6NA 4XABA 3QBQA 3LA7A 2KD7A 4PT6A 2E6VA 4QX5A 4IETA 2CTVA 4Y20A 3O5SA 3AKRA 3FBYA 4CP0A 4OQ8A 4HXCA 1XJAA 3EMRA 2K2SA 4QB1A 1JTZX 4I0BA 3CJIC 1F8VA 3T3YA 4CTEA 3LF7A 2E7AA 4P9JA 4WM8A 1S0IA 4Q2FA 1G86A 3H3LA 5A33A 2YZ4A 1RYYA 4XJ9A 4DXSA 1FPN1 2A6YA 1H8TC 1Q8OA 2DCJA 4LBLA 4OCTA 3WHTA 4HPKA 4YRDA 5T50A 3VV1A 5A3LA 1MS5A 1UKGA 3R4DB 4LJHA 1YC61 4AQTA 5A6ZA 1UYPA 1BK1A 4FOVA 1HV1A 4AYUA 3FN9A 4XYXA 3K4AA 1COV1 4QHZA 1G9AA 1DGRA 2FCTA 2VMEA 1DZRA 2VR4A 3RI8A 4BXSV 5DMYA 2R16A 4HKLA 4OMDA 3D8CA 1UY2A 1US2A 4UT5A 5FZ7A 2Q5TA 3IT8A 4LHKA 1TME2 2HEVF 4Q4W2 2JENA 1NLQA 2RDRA 1SFPA 1X8EA 4P5YA 3WNNA 2J42A 4KWKA 3E5XA 4V1PA 2WSVA 3QH7A 4XF0A 4NIGA 2CYFA 5IAXA 4Q1PA 1SBEA 3AJYA 1UW8A 1XXNA 4CXYA 1TME3 3E6DA 4YW3A 3Q8EA 4AFAA 3BTXA 4XACA 4ZU7A 5A7QA 2Q1MA 2BGCA 1CZSA 5KBFA 4CP1A 2ZMNA 1MEC1 3C3VA 1ENQA 5LA0A 4P9LA 5FY8A 1JZ2A 3WQ0A 1AR91 1W8WA 1WMEA 1SCSA 3DECA 3I3BA 3RYPA 5BY5A 4AG4A 1UL9A 1MQTB 1IPJA 1RUH2 5C9AB 2AEZA 3L2HA 3JU9A 4Q4W1 2ZS6B 2D6LX 1RUC3 5BNOA 1Q5OA 5K0UA 1SPPB 1Q3EA 3DF0A 3NO8A 4CDXA 3BYWA 3MF6A 3PVOA 4K6BA 3VKFC 2CDOA 5I91A 2PELA 4K40A 4XFAA 3AP7A 4S2GA 5J37A 4JKKA 1UY3A 3RWNA 2YGMA 5SV5A 4BU2A 3N9QA 1CJPA 3WF2A 3B01A 4XF9A 1GZWA 2QQVA 3BPSA 4LHNA 1GSLA 4AEDB 1K5MB 2J1EA 4CUAA 4QX0A 2JICA 1PO22 3FBMA 1VRH3 5KHJA 4YWAA 3ORJA 1NA1B 2EVXA 3JBG2 1O3TA 1N47A 2HWC1 1OSGA 2LRPA 1AL23 2WFF1 4Y4YA 4KWUA 2CL2A 2FDJA 5FYIA 2JDKA 2YHJA 4GH4A 4LO6B 4UWDA 3WQBA 5CG9A 1ZZCA 5FLIA 2Z42A 1A34A 1MQTA 2GC1A 2WT2A 4ARYA 1O3QA 3U4SA 3SXWA 1RB8G 1PO23 5EHDA 1IGOA 3ECQA 4FT8A 2W9XA 4W6XA 1F5FA 2GN7A 3GBGA 4BLIA 4DUVA 5CNAA 1XE8A 4GB31 5LEJA 1DZTA 3AP9A 2B9VA 2XBO3 5IT6A 1OC1A 2GC3A 3TOJA 3AKTA 4CCMA 2GNBA 5HCFA 3BU7A 3ZOIA 1MZ5A 3Q8AA 1BEV1 4LBJA 4B3NA 1NUKA 1O3SA 5GKAC 4PF5A 4OI1A 4YVWA 1X9TA 2IXJA 3NNLA 5DPNA 1SG3A 4AEDA 1WCKA 4DFSA 1QF3A 3DEMA 2AUYA 1GQPA 1K5MA 1L7QA 2BQPA 3GGLA 3MFAA 4MGZE 4CDQB 4C91A 4TYSA 1O4TA 4F7ZA 2HJIA 3UT0A 2CDPA 5LB6A 1V70A 2O8QA 4HOOA 1QJX2 4XW3A 3MW3A 3MYXA 1W8NA 1QOOA 3I3QA 3N9LA 4UW3A 1XNKA 3ZXGA 3P5BA 5JMOA 2B4KA 2WZEA 4XAEA 2B5HA 1LOEA 2W1SA 3S7IA 3WCRA 3JBG3 1AVBA 3MO4A 3WT3A 4AZZA 4EWDA 2A75A 2FCUA 1XQNA 4X6QB 3BCWA 2WFF3 1MQTC 2KR2A 4GWJA 3W9AA 4MO3M 1FATA 2WNOA 3MV01 3WQ7A 1PVC3 1IG0A 1ULGA 3WVJA 1C8M3 2YPJA 3HNMA 3MUZ1 4HZFA 1VBC1 4XDPA 3LIGA 5CU1A 4XTPA 5EV7A 3U10A 4CEYA 1KQRA 4I02A 3KQRA 4IE5A 3ZXLA 1E5RA 1W06A 1RUF3 3V64A 2Z2SB 1B35B 1NE4A 4WVMB 5F3GA 3V56A 5FZBA 3ALQA 3K75B 1ENRA 3ACFA 1IG3A 4XF3A 3I2IA 3VDDA 5FXWA 4NWWA 1DCSA 4HK8A 1ND3A 3ZSLA 1VBA3 3J8F1 1TMF2 4AVAA 4NIHA 1JZ8A 1JMUB 2R49A 3MEPA 5SV8A 3V0AA 3VD3A 3FLTA 3OYWA 1QDOA 1ZBA1 4RGAA 1YQ5A 4OYUA 3USUB 4AQ6A 1HB3A 5JZGA 1SLIA 4QKBA 1KRIA 2XKPA 1MZFA 4YLZA 1FV3A 5C6CA 4FP3A 2QVSB 5L73A 5FPUA 1AR82 1UIKA 2CHHA 1YFYA 1JOJA 3G7DA 4GD4A 5HXVA 1STMA 2P3JA 4W8JA 4GWNA 4DRVA 5A33B 3PUQA 2QE3A 2C5DA 2DTYA 1B35A 2WL1A 4XTMA 1RUE3 3U37A 4FPHA 1TMF1 1PGSA 4BA6A 1PZ8A 1AXYA 2CWSA 5F2SA 1AR62 3AZZA 1OURA 4QXHA 4IV1B 3T4VA 3SLIA 1COV3 3MLJA 1HQLA 4DY3A 4K1YA 4Q4X1 4R8HA 1LENA 3EB7A 4PLMA 3N7KA 5CA6A 3V0AB 3JUUA 4CVUA 5CFDA 5ERLA 3KF3A 4HT1T 1RHI2 4O9EA 2WWSA 2VMFA 5DABA 5CKMA 4XC9A 3ZFEA 4O61A 1TNRA 2ZA9A 4BHPA 1YQ6A 4TLFA 2ERFA 1XE0A 2A6VA 2HWB2 1WCQA 5A70A 2XWJB 1J1LA 4LQRA 5L9BA 5HCAA 3LKJA 3DUIA 3SCHA 1DBNA 3RZKA 1CWPA 4BJ0A 2E63A 1OLMA 1FMD3 4CDUC 2VY0A 4NN0A 1QJY3 5FO9B 3ES1A 3B9IA 1Y4WA 3O1VA 2P5BA 1YUDA 1A6CA 3NMBA 5EXOA 3LWCA 3WG4A 2BBVA 4R9AA 4AFMA 2VZRA 4LIUA 2JG9B 2QQLA 1D4M1 3NV3A 3TB0A 2BZDA 1VE0A 1W2OA 3B5LB 3D0SA 2E31A 3T0AA 5CISA 2Y6HA 4EYUA 3OD0A 4L8QA 1D0HA 3MIGA 4K3UA 5FYVA 2RDSA 1GWLA 5FZ1A 4DUXA 3AKPA 4BK5A 4DO0A 2YFUA 1FI2A 2G9FA 2EXIA 4L9BA 5GLVA 1W2UA 3VZNA 3KWVA 4IEQA 5CVRA 1H9WA 4A4AA 4E8CA 2P37A 5LY2A 1IKPA 1U5ZA 3OGVA 3VBSA 5FZLA 1MS8A 3H9AA 1AR73 2I45A 2W1QA 3MIDA 1OD5A 4SLIA 3SQOA 3USUA 1QQP2 5FZOB 1DZQA 3AM2A 5A6YA 3GHMA 3RGBA 3ZMNA 5I0UA 5CFCB 4MSVA 3LE0A 4KGGA 3ELNA 1XNBA 1W04A 3IDAA 1LHOA 2ZCWA 1UD1A 4CDWB 2D6MA 4XJUA 1WLCA 1V6KA 4Q4V1 2Y6GA 2BUKA 4H55A 3IAQA 2F17A 2B39A 1OVPA 5C5TA 4AI9A 3ACGA 4ZXKA 1EAH3 1JU4A 4UBGA 2BWAA 1F35A 1RJ8A 3NAPC 2RMU1 3TRSB 4BZ4A 4RS5C 1Q56A 4MH0E 4P9WA 1VLNA 1MVQA 5T5OA 4L97A 1JYIA 2FZ1A 3PHMA 2VAUA 4XJAA 3VKOA 2CGPA 2JIJA 2PHFA 2ZGNA 4QPIA 1AYM3 5H9PA 5FWEA 3POFA 1W8TA 4ZHNA 1K5MC 1VBC2 4RHV1 1ZA7A 5D21A 4RR3C 2ET7A 2A5ZA 2WNVB 2RG4A 3DKWA 1PX4A 5FZEA 3GNEA 1YFXA 1S0BA 4YNIA 3LOIA 3WW4A 4A41A 4XFGA 1RUOA 1L3JA 2EALA 2OT7A 5F3EA 1FOD1 1B09A 4Z2AA 5HXMA 1GWMA 2VOVA 4LHLA 2ZHMA 5FREA 5F3IA 5E1RA 5FP9A 1BLZA 1ZA4A 4RA0A 4JDNA 3M2MA 1W2TA 5JIUA 1LU1A 4BWOA 3KCYA 4ASMB 4DQAA 1REDA 1H1MA 1ONAA 5JSRA 2X09A 4XFBA 4FQZA 3WOGA 2D5HA 4DINB 4N53B 1ZBE3 1OOPB 2A6ZA 4JC1A 4RL7A 2DCKA 4K21A 1OA2A 4FPLA 4LMFA 1XSQA 3ETQA 5TSWA 4KWLA 4XF4A 4IEPA 4Y33A 5G04L 4CCDA 2WNVA 1K5JA 3AZWA 4ES9A 3MIFA 5I0DA 5JI7A 3KHBA 3S5QA 2QDNA 1NKGA 1QOTA 2QBXA 5L36A 3B02A 5B2GB 5JUVA 2CU5A 2DF7A 2WDBA 1PMJX 4P9XA 4OI4A 4DRRA 1RHI1 2VCBA 4XUQA 1RUG3 2V4AA 2VMGA 4LKFA 4DXRA 2O0OA 3M4FA 4ZZ5A 2YY1A 2BWCA 2DFCA 3D82A 4X8NA 3WDUA 3PUHA 5JZGC 3UGHA 5FOBB 3S57A 2V5DA 2OUJA 4DXZA 5J36A 1UY1A 1I1EA 4PF1A 4ZU4A 1UKRA 1ZBE1 2E32A 4BH9A 4TTGA 1PIV3 3NNGA 1LAJA 2ADDA 2ZZQA 5FXXA 3E5QA 3UETA 3Q8BA 4IGQA 3WR0A 1AF9A 4MGTA 1Q43A 5GLWA 2ARBA 3RMXA 5IK7A 1QJY1 3ZFGA 3J7NA 2ZKLA 2PHWA 2PTMA 1IS3A 2ZGMA 3N4MA 1VBD3 4IEOA 2WQZC 3AP4A 2ZMLA 1FX5A 4C0BA 5AVAA 1J84A 2I74A 3NSTA 2JDNA 3CQOA 1E57A 1X82A 5A32B 4YPJA 3JD71 3SISA 3ZKUA 3LA2A 4DIQA 1GNZA 1LEMA 1RIRA 2G4IA 5FP7A 1FAYA 3WG1A 4CEWA 1HQWA 2WS92 5F37A 4WM8C 5F5IA 1RMU2 2ES3A 4WM7B 4BQ1A 5C70A 2R063 2BRTA 2WYSA 3PMEA 5HBAA 4BK4A 3KQ4B 3H3UA 1GZTA 4Y5SA 2SBAA 1C28A 3AVSA 3B69A 4CSWA 1PVC2 2E7QA 2WA3A 1JUHA 2RV9A 3PVNA 1UO9A 5FZKA 5HCBA 1LOBA 3POBA 4QHBA 5ANNA 1W2AX 1MR5A 1WMFA 1UIJA 1CIYA 2Z4FA 5FZAA 2HWE1 1OKQA 2HWC2 2RS52 3AYCA 4HKOA 4IEXA 4YZ3A 4AVVA 4GB32 2WNEA 3H1MA 3RZGA 1JYNA 1VRH2 3O1SA 1QMJA 2VNOA 4TXWA 1ZNPA 4MV2A 1BEV3 5DAXA 3IBMA 5GZFA 3VBRB 2RMU2 1CR7A 4HPKB 2DCZA 4NAOA 4Q4V2 5A7WB 1HRI1 4QM9A 2HH9A 4FXGB 5FPBA 3VL9A 1BCXA 5A7NA 2KM2A 1GP6A 5IJRA 3WP3A 2AR6A 4HANA 3ZN5A 2X5IC 1L7RA 3RS6A 3U11A 2ARCA 4BQ2A 5JXIA 2WO2A 5DZFA 2ZX0A 4E4DX 4FPFA 1RUC2 2WNVC 2VZSA 1JZ6A 4DB5A 4YZ2A 3LSDA 1AL21 3FLPA 2ARXA 2LALA 3NV2A 4BCUA 4COVA 4COYA 1IQDC 1HDKA 3WDTA 1YEWA 4W50A 1YQ2A 1VP6A 4Y1UA 3NRUA 5KR7A 3C2UA 1JZ7A 3TBDA 5C4WB 4GA9A 1WLWA 4A42A 4ASLA 5BNOC 5L9VA 4JGZA 5FTTC 4CDWA 2D6OX 1CAXA 4ONUA 1QXJA 3VBHC 2WLQA 4FAGA 3GM8A 3OY8A 1WLDA 4NHKA 2EXKA 2VUAA 3AP5A 3MHZA 1NY71 5LA2A 2RJLA 3W21A 4RS5A 5FO7B 1RUD1 2PHXA 1HB4A 2XVLA 3ZFGB 1GZ9A 4KBBA 1FXZA 1GZCA 2YBKA 3CIHA 1WZXA 3EJKA 4AQ2A 4CXWA 5AFEA 2IXHA 3DKQA 1AHSA 4A7ZA 3KV9A 5IAVA 1W0PA 4RR3A 3ST7A 1N3PA 3B93A 1C8NA 1O91A 4RSUA 3F2ZA 3EYPA 4BQXA 5A7PA 4Z92B 4UF0B 1H4GA 4GWIA 4ASKA 4IV3C 1O3RA 3QLQA 2FMDA 2LW8A 1UCXA 4XQWA 5DUUA 1GZWB 1QWRA 1SEFA 2AEYA 3H1YA 1AJOA 2PXJA 3L2YA 4FFGA 3ZYIB 4OULA 4A2UA 1V9U3 3WUDA 2FMYA 4ZS2A 1V00A 4TN7A 3LFMA 4QAWA 3ZN6A 3M3EA 4B4QA 5FZ3A 3MW4A 4NPLA 1CONA 3OY8B 1V6JA 1KD7A 3RVHA 4Q29A 4QPWA 3VDCA 4MHUA 1S0GA 2NP0A 1NCQC 3I8TA 2Y0IA 2JWPA 4YVWC 4LT5A 1AX0A 5FUPA 1MACA 5FZ9A 5LBFA 3KSCA 4OFGA 2VZ1A 3WD5A 2W1WA 3KV6A 4D7YA 4LXLA 1UX6A 3AKSA 3WP6A 4ZKTB 3BPZA 3A0KA 3CU7A 4IEYA 1S2KA 1NLRA 2GNDA 2QZ3A 1A8DA 2YUEA 3G6JB 1G9FA 1BMV1 1LOAA 1DYKA 3I2KA 3R05A 3DXTA 5H9SA 1HN0A 4CU6A 1PO21 1RUI2 2JDHA 2ZHNA 2BERA 4A6SA 2DVDA 1S0CA 1SLLA 4PI0A 4R4ZA 1W6PB 4WZFA 2JE7A 2R0FA 2W87A 4OUSA 5F8PA 3ZYBA 3WHUA 1NLSA 1IOAA 1CIWA 4AL9A 4BPZA 3VHPA 2BP6A 3HBKA 4P00B 4JGYC 4QX8A 4FBFA 3OUIA 1OVSA 1DQ5A 3AL5A 4V2WA 4CDXC 3RI9A 1Z7S3 5T3NA 2XQRA 2ZKNA 1UY0A 4OLLA 5HV4A 1YRZA 2QCSB 4B1MA 3POSA 4L99A 4D8MA 3AJZA 2HEYF 3MLKA 1TQ5A 2C26A 2W52A 1D4VB 1PGW1 2O14A 3PJQA 5LBCA 1RJ7A 4MX3A 1NQDA 3AP6A 1SDDB 1PX3A 3PTRB 4Q27A 2ILMA 5C4WA 3SCFA 4IV3B 4CUGA 4I2OA 3MF9A 5FXVA 4C8DA 4KGQA 1KJLA 2RM23 3AMPA 1T6BX 5KC6A 2JXAA 2C1FA 2WC2A 4HVOA 1MEC3 3E5UA 5A3MA 3AKQA 4NPRA 2YG0A 3WF0A 1J3QA 3TN91 5LA9A 1OXCA 3VKMA 4AI8A 5FOJB 2RM22 2XJSA 3PURA 5IYYA 5IVBA 3IPVB 5FKBA 5AC92 5HCHA 3ZFFB 5FZDA 2ID4A 3THCA 2FDGA 3FHIB 2GSYA 1HKDA 3N9MA 2R0HA 1AXZA 4W4ZA 3MLLA 2X10A 2CAUA 3SKVA 2VG9A 2PAKA 2GH2A 4LO4B 2BTVC 4XXAA 2DVBA 2GN3A 1XBFA 3EXUA 3IDBB 4Y1YA 1EP0A 4UW5A 1OPOA 5A6XA 2W0XA 4CCEA 3TEYA 3V0BA 4TZDA 4Y5TA 1GQGA 2ZTNA 1B35C 4ZONA 3WLUA 1VRBA 4DS0A 1W8ZA 2X5IB 1G9BA 4TWTA 1AYN2 1GYKA 3O0VA 1SHWB 4BQ3A 5LEKA 2BYVE 1VJ2A 2BFUL 2F4PA 5BNNB 1QOSA 4N90A 4AEKA 5FYTA 5KXEA 2VO5A 2JE9A 2NQYA 3NJVA 2NMNA 2DVGA 1HB1A 2EIDA 5DAQA 4NMIA 1J3PA 5CFDC 2AENA 2Q8CA 2D6PA 3FC0A 3M3CA 1XRUA 4M0HA 3RJRA 3WINE 1CQ9A 5J09A 3VBRA 3POGA 4GJZA 5J7MA 1UPSA 5F5CA 4AE2A 3ZKYA 1NCQA 3VHRA 2OZJA 2JIGA 2V09A 2A3XA 3HVDA 4IV1A 4BIOA 5I8YA 2VZ3A 4JX0A 5BPXA 2W95A 1HB2A 4FPJA 3THDA 4QQPA 1ULDA 1VBD1 4CP2A 2XUEA 4Y22A 2WFF2 2VUJA 3I59A 2VQUA 2XVKA 4O65A 5C8WA 3AC0A 1WW7A 2W68A 3H50A 2V73A 3PMSA 4GXLA 1V9U2 1W6NA 2NMOA 4IEZA 4IGOA 3KCXA 4QKDA 3HT1A 1WMDA 2QTWB 4BE3A 4BLJA 2WINB 4D3WA 3BI3A 1ZRFA 4Y4RA 3CLPA 1R083 2DURA 3KD4A 3VBUB 3J26N 4QPGB 3S5AA 1NE6A 2DU0A 3TEWA 4Y1ZA 1SLCA 3VKLA 2ZMKA 1FOD2 1O5UA 3MICA 4BIFA 2VCAA 3CJIB 3VKNA 5JPNB 1WMXA 5CEHA 1SLAA 4M3CA 4M4RA 5FPZA 2WYFA 4UFJA 4DXTA 5J48A 5BXXA 1HRI3 1EUTA 1DLLA 5EQUA 3MUY1 4JTOA 4P9GA 2L9LA 4R4XA 4XUTA 4JRAA 1EYBA 2MEV3 1RVF1 1H8TB 2RS31 4N7UA 1AX2A 1CAWA 2D3PA 4PI2A 3RYKA 4N43A 3FFZA 5FYCA 4M4PA 5JOWA 2VZVA 5CG8A 4DUWA 1JYWA 4BYYA 2ZX1A 1W6QA 2CAVA 2WUHA 2VXRA 3I3EA 4Q4Y1 2PLV3 3NJZA 4Y22B 4D6RA 2G9ZA 4QXCA 4LE3A 2YYOA 1XSRA 5FZFA 4IE7A 3VLBB 5DDJ2 5T5JA 3TNPB 4W65A 1AR92 4MZUA 1W6MB 4G9SB 2F6BA 3AMMA 5JR2A 5BNOB 1ODMA 1N3OA 4M3CB 2X53S 3CF6E 4CDXB 5AFBA 3RZMA 1HV0A 2MEV2 3UGFA 4LO8A 2VUCA 3ZXEA 2UYAA 5IW0A 1PO11 5I8TA 4XJZA 3UKTA 2G1MA 1PHMA 3S6PA 4QQ2A 4QKFA 1W3VA 4JCKA 1Y9QA 4NRPA 4EN7B 5EIYB 4LO7A 3ZXKA 4OI0A 4RFRB 4LBMA 4CDUA 4EWEA 2VH9A 3LQCA 1Z78A 3VDAA 3VD7A 3U78A 1UY4A 1ZZ8A 5BNPC 4WV8A 4UOJA 1DIWA 5GLZA 3R4SA 4HONA 3TN92 5A1FA 1PM7A 4XFCA 4IESA 2IVIB 1AJKA 3OCPA 3BN6A 3ACHA 1NCQB 4MGQA 1VBB1 4Q5OA 3O1UA 1W6MA 4DOUA 1F15A 4F3JA 5FIXA 1O6UA 2E51A 4K8FA 4K7JA 1ALYA 2VZQA 3K46A 4FCAA 2PFWA 4XIOA 3ZYJB 5J96B 3NNFA 4JGYA 3T2TA 5KHKA 3VBRC 5LY1A 3SMHA 1K12A 4AVTA 1ASJ3 1LEDA 4YW2A 2XHKA 1LTEA 3TAYA 4XFFA 1W6NB 1WA6X 4YZ5A 1GQHA 1PIV1 3UESA 4XPVA 4H2AA 1W9FA 1URXA 4ZU5A 4ZXEA 1RHI3 5DQ0A 4C1XA 3AMNA 4XURA 2ZPXA 1AZDA 3KVBA 4QPGA 4ATFA 3VBSC 4Z07A 4CDUB 3J7HA 3W58A 2VBPA 4CP9B 5L7OC 1HJGA 2A7AA 3SH4A 1VMHA 4PCRA 2GMPA 1EV11 4IEVA 3H8XA 3LSEA 3PNAA 5ISLA 3OG2A 1EV13 1W90A 4H7LA 4S2HA 1ULEA 2HWD3 4K8RB 3M1HA 1PNFA 4YGBA 3S0MA 4J1XA 4K9SA 4EJRA 2VPVA 3A23A 4E27A 1OF4A 3C8XA 1YJLA 3WNOA 2PLV2 2DYCA 1BZWA 1XNDA 2GP3A 2VZTA 4JDMA 1PIV2 4JGYB 4FAHA 4QX3A 4KH9A 3UJQA 3BUCA 1HXS1 1OQEA 1WD4A 2NPIA 2ZACA 1IKQA 4LOSA 3J7MA 4CCLA 1MS9A 4FPEA 1WWYA 2C24A 3I2OA 1SLTA 2HLEA 1REEA 1KS5A 3RG0A 1S4CA 1WGPA 5GZCA 4K1ZA 4LKEA 2EA7A 1Q8SA 1HIXA 3ZSMA 4QKNA 4QQOA 3HEIA 1QJEA 2XVGA 5JXGA 1LHUA 4P5HA 4QB6A 4N9HA 4JV4A 4PLNA 4MHRA 4QX2A 3GHNA 1ZM1A 2WSUA 4Q0VA 1FMD1 1LGCA 1OHFA 4H14A 2BEOA 1XNCA 3DYMA 3FHAA 3J8F2 4N53C 3KGLA 3OYWB 4YFWA 1H8VA 1V6LA 2P3YA 2GMEA 4KWJA 4YG3A 3AYAA 3C7HA 4KG0A 5IVFA 5JDBA 1GP5A 3PUAA 5C3PA 1F2NA 1OFSA 3POWA 4R9CA 3SC7X 3VZKA 4YW4A 1RTVA 2HWB1 2RS13 2P3KA 4OHYA 2LUWA 3A22A 4CCJA 3HR9A 1HQNA 1SBFA 2ZGPA 2JKXA 3PL0A 3WW3A 2XDVA 1GOGA 3I59B 1SCRA 3KF5A 3ME2A 5D8AC 4BQWA 4CEWB 1HRV3 4AI3A 1D7PM 1H2KA 1QJX3 2Y33A 3LIHA 2UWAA 2Z79A 3KT1A 3OBZA 5DUVA 1X33A 3FX3A 4Q4Y3 4HVRA 1BBT2 5EFUA 1QHDA 3I3MA 4IDZA 2W2IA 3UGGA 2EF6A 5CFDB 1F31A 4PQ9A 3HOBA 5JWPA 1LKNA 2DV9A 1QKQA 3MZHA 1LNSA 3U14A 2BNOA 2WAAA 3B9CA 3VDDB 3WF3A 3I2DA 1O8PA 2XLFA 2OA2A 3PTYA 2FZ2A 1U0AA 3MIHA 3IIAA 4AQSA 1E5HA 4YGDA 3KCCA 1ACCA 4YM2A 1HRI2 5L7OA 2Y6JA 3RSJA 5A1LA 3NJYA 4FO9A 4CPBD 4AWDA 2ZEXA 1ND2C 5FJKA 3LDKA 2VGDA 4XETA 4ES8A 4A3ZA 4CXXA 3VB9A 2FDIA 5A3WA 1COV2 4P14A 2D3SA 1LECA 5T54A 3AYEA 2JB4A 2BVVA 2D6NA 2W1UA 4KU8A 1WW6A 3CO2A 3D0JA 2ETEA 2EXJA 4EZ4A 5I0SA 5IVCA 2WZPP 1HRV2 3Q8CA 1AL22 1WCUA 1VBB3 1EY2A 4HSJA 4LA3A 4CDWC 4EROA 5ABJB 5FYUA 1VBC3 5FZ6A 3WNLA 2XR4A 2XJTA 2W46A 4YG6A 3NV1A 4P02B 3UK9A 3ZXDA 2ENRA 2VMCA 3AL6A 4YARA 3VDBA 4FFIA 3OEBA 1DP0A 1YHFA 2ZGUA 5FLJA 5ACA2 4LEJA 4DZGA 1H4HA 1O7FA 1PGW2 1ZBA2 1E5IA 3EBRA 1I5ZA 3LFIA 4ZY9A 3VBSB 3HAGA 1EUUA 2WWUA 4Q0SA 3I97A 1MS4A 3VD5A 4EWAA 3ZFEB 4BQ5A 1DGRN 1ST8A 1W8FA 1GBGA 1LGBA 3I2GA 1EV12 4LBKA 4F83A 3T0BA 3CZJA 2GC0A 2A1XA 4JHTA 3UJOA 4RHV2 4XQDA 4Q1RA 4TSVA 1OPMA 1WA4A 3AX4A 5K9YA 3K3OA 5LRRA 1F5JA 3K2OA 5CKNA 3AZYA 2YFZA 1AR61 2B9UA 3D3AA 5GJ6A 1IPSA 3DV8A 4HN1A 1RUNA 3AZXA 1GICA 5F5AA 1WLTA 2P6CA 1ZBA3 1C1LA 2VCCA 4HK9A 4QM8A 5F39A 5FR3A 5FYSA 2Z69A 1ZVFA 4TLGA 1CD3G 5EYYA 4FTSA 2HYKA 2OW4A 2WZR2 2JD9A 3MFCA 5DG1A 3SEEA 2MHFA 1X7NA 1MZEA 4HG6B 3TEZA 3LPFA 1WUVA 5FFOC 3I7DA 3LAGA 4P9IA 1S2EA 3CDZB 3ZXJA 3OPZA 1MS0A 4Q4X2 5DG2A 2AYHA 5JXJA 1CVNA 3HD8B 1NYWA 5EJ1B 1CAUB 1OOPC 2A71A 1DGWX 1UU4A 2XMLA 1K3IA 2QZ2A 4AF9A 2YU1A 4XMAA 4JKMA 1WW5A 1C4RA 3TNQA 4BQ4A 2JEMA 3N7JA 2Z5WA 1C5IA 3VBHA 2WIIB 1PZ9A 1GR3A 3C7FA 1M06G 3SCGA 1Z7S1 1MVEA 2H0VA 2QQWA 4W6WA 4CRQA 1PM4A 3ZIWA 4BISA 3I49A 3DL3A 3C7EA 1IQAA 5F6LB 5D1IA 1W9WA 2FDFA 5IFTA 5F2WA 3ZR6A 4YW7A 3M3OA 2C9AA 4PLOA 4AHYA 5BNPA 5C9AA 3KM5A 3O1RA 3GZTB 2CY6A 5BV6A 5IVJA 3ETPA 4P08A 4L0PA 3VN4A 1G9CA 5FK8A 4PHZA 5IK5A 4I09A 1LCLA 1A8MA 1S0EA 4KL1A 5DAPA 3HQUA 4URAA 4XZPA 1ENXA 2Y6FA 2D93A 2XL7A 4NRMA 4XILA 4YGCA 5FJHA 1X8MA 2Y60A 3PDQA 3HQRA 2IVJA 2PHTA 3OF1A 4FPOB 3U4XA 5FKCA 4XDOA 1VMJA 2A6WA 4HKWA 4QPIB 1FV2A 1RUI1 2Q30A 1QH6A 5E88A 2WBKA 3THPA 1YYNA 2H6BA 2XBO1 1H0BA 3B3QE 4I30A 1L7LA 3W5MA 4MGKE 5CAZA 1ZRCA 4FTEA 2HWF3 5FYZA 2LS6A 4Y3OA 5BYNA 3OOXA 2DCYA 3MIEA 5FYBA 2Y64A 3A21A 1NG0A 1CJDA 1OLRA 2JDZA 4ZS3A 2ZHKA 3T1LA 3W20A 1ZX5A 1U5XA 2PYTA 4LITA 4AGGA 2K0GA 4R9DA 1RL3A 4META 1VAMA 4IERA 2WNUB 3V65A 2E53A 3M7AA 4GB33 4MGYE 5FUIA 2Y6KA 3FFQA 3HN1A 3LDBA 4FPGA 3ZYGA 1V6NA 5FY9A 3RYRA 2OUHA 3MI8A 2R072 2MNGA 1TVGA 1QDCA 4GALA 3GZUC 3VGIA 3WDYA 1LRHA 1QNYA 1X9PA 3EO6A 3LB9A 1GWKA 1XU2A 4I3GA 3WNMA 4D69A 5JSPA 5A32A 1XNAA 3ZSKA 4J1WA 4AFDA 2RR12 1RUD2 4QDQA 5F9TA 2DCTA 3IM0A 4OHZA 3KGZA 4G3YC 1H2LA 2IXIA 2R1DA 5FZ8A 4AAXA 2IFRA 2R32A 4LBNA 3RQ0A 2OKXA 2ARAA 2VQTA 3FHQA 4IV1C 1X50A 2Q0AA 4QD2A 4QQLA 1OA4A 1LJ7A 5D8AB 2DVAA 4XUPA 1JZ4A 2RVAA 1R1A1 2VNGA 2WKKA 3GALA 1C8M1 2PHDA 5L7OB 1ND2A 4OHXA 1PVC1 3GCWA 1BYHA 1N1TA 1POV0 5FPLA 1T2XA 1VPHA 4E2QA 1POV3 2E7TA 5E89A 3B7MA 1RUC1 3KV5A 1AYN3 4XMIA 1GP4A 3VZOA 2ZABA 5DDJ3 4BQYA 1TME1 1GOFA 1NOVA 4NHMA 1JYXA 4QXBA 2DDUA 2VQ0A 3HN3A 1YXWA 4AAPA 4BDVB 3OUJA 1OT5A 5JOXA 2WAOA 3K4DA 1JN2P 1XOYA 3KT4A 3T30A 3CHXA 3BU0A 1NQJA 1ULFA 4FFHA 2OPWA 2GP5A 3J9SA 5CZKA 3BTZA 4AGRA 1ND3B 4CYDA 5D8AA 3WXPA 1J83A 4LULA 2WN2A 4MLOA 1C5HA 1ZRDA 1FNYA 4LO5B 5JLVA 5IWFA 4QXKA 2W92A 2ZX4A 2YV8A 5FBZA 2RDNA 2UU8A 4N8MA 1AXKA 5FRAA 4B7KA 5FPVA 1FPN2 1UOGA 2FQPA 5DAWA 3JQXA 1H8TA 5IVEA 1DDLA 1TE1B 1V9U1 5JPMB 1QEXA 2VW2A 5KWRA 4RQPB 2K46A 4FXKB 1R092 1UU6A 2XJUA 1POV1 5FP4A 2FDHA 3HIFA 1VAVA 2XUMA 1Y43B 3KVAA 5JVVA 3VBFA 3HJRA 2J22A 2WT1A 3FZ3A 4LBQB 2QNKA 3MPBA 1OH4A 4O7XA 4FI9A 4KG8A 3FL7A 4NAMA 4YW6A 4NIIA 3TYJA 5A7OA 1R1A3 5B4NA 4WZCA 4YVSA 3VBOB 1BHGA 2QQNA 2JB8A 4HFSA 3GBWA 4Q0PA 5KXCA 3USSA 1UXXX 1UOFA 1RUD3 1GNYA 4PDWC 4S2FA 1YQCA 4GAZA 3POEA 3TEXA 2ZX2A 5FZMA 2XXZA 1LHNA 3ES4A 1DQ4A 4LKDA 4MOAA 1RUH3 2P17A 3ZIXA 3JD72 1AUYA 1FYUA 4YM0A 1J1TA 1R091 4YVWB 5JSOA 3I4IA 5L19A 3BIEA 2OQ6A 2Q8DA 1JZ3A 3I2JA 4U2AA 3H8UA 1FMD2 4LUKA 3LCPA 2C6SA 3SH5A 3ZN6B 1PGL1 5M0TA 2CGNA 4BMEA 1SLBA 3HNBM 1UXZA 4XDQA 2ZZJA 1NCRA 1QJU2 4ORFA 3VBHB 2JG9C 3VBFB 4LBQA 4AVCA 1IS4A 3ZYPA 2XONA 1JXNA 4QPIC 1SFYA 3R0RA 5FY1A 4LORA 2N7GA 3CNAA 5FZGA 3CJXA 1JOPA 2Y26A 3PIGA 2B42B 4QB2A 1CX4A 2WFPA 5FLHA 2BNMA 2LM3A 1VAKA 2Y34A 5EPAA 1V6IA 1DLCA 2YBPA 3WF1A 1OLME 2X05A 4QDSA 3H7YA 4LLOA 1QNWA 4JQTA 1WCSA 2VMHA 4UBHA 2RHPA 4UFLA 4BXFA 1XC6A 3OGGA 1LGNA 1AR63 1Y3TA 2VC9A 4U36A 4YSFA 1RUI3 2IFWA 2KA3A 4RD7A 3FLRA 4I01A 2WT0A 2J1VA 3DXUA 3OGRA 4B4RA 1UZYA 4ARXA 2RR11 4QQHA 3OPTA 3WV6A 4B8EA 1VBE2 2WJSA 2HBUA 5D2AA 1AR83 1UAIA 3E97A 5EWSA 1I6XA 3PIJA 1UN1A 2A73B 2VTFA 3MV11 2QQKA 1ULPA 3ZVXA 3ZXAC 5AC91 2A70A 3I2FA 5GZGA 5EZWA 1OQDA 1ULOA 1LHVA 2IXKA 3LOBA 3ILFA 3FUQA 4AXOA 2VL4A 2ZGKA 4OVEA 4Z82A 1U12A 3DYPA 1YFUA 2VNVA 2VZUA 4A45A 4LHSA 3N35A 1TNFA 1WCDJ 3VHNA 4ATEA 2XJPA 1OLQA 3HQXA 1W9TA 3N9PA 3ZM8A 3F95A 3WNXA 1DQ2A 2W08A 2FCVA 4IE6A 1XU1A 4COUA 4UAPA 3IAPA 2JG8B 4QDRA 2D6KA 2YDEA 4RHV3 1G9DA 4UW6A 3CL1A 3MGUA 2QDRA 1AYM1 1W9YA 2AREA 2ZGQA 3LGRA 2PAEA 3O7OA 3VL8A 3I54A 1LODA 2JX9A 1W9SA 1OUSA 2CSGA 1N3QA 1QXPA 1DGWA 3BOWA 3EQEA 3OGSA 1SPPA 2W3JA 1CN1A 2RS12 1UMZA 4FPCA 1EPZA 3ROUA 2TNFA 4GMP3 2XPJA 2JDUA 1ZZBA 3TWIA 2RS32 4UW4A 5CYYA 2XJQA 3T0DA 1NAEA 5IHRA 2J1AA 2VW1A 5FXZA 1RXGA 4I3PA 1QJFA 4AOCA 1XB9A 1Q8VA 1UQXA 1JHJA 3B00A 2ZXQA 3P6BA 2W39A 2ZGRA 1UU5A 2IWGB 2GAUA 2VQAA 3ZXFA 1HLCA 1OBNA 1W03A 2AGSA 3NKGA 4GKXA 4PJYA 4XZUG 1JYTA 1UZVA 2EXHA 1ND2B 1NA1A 2GC2A 5LW9A 4XCBA 5BNNA 2WA4A 4QU2A 4L11A 2W5FA 2VMDA 2BJSA 4LBOA 1NZCA 5FUNA 5FPXA 4COZA 3BKZA 4LR4A 5APAA 2D43A 2PHUA 1UZWA 1VIWB 1MEC2 1JOBA 5JMCA 2OX0A 3IDEA 1RMU1 2O8OA 1X36A 1AR72 2DU1A 4UI9L 4XEZA 1MZ6A 2VOWA 1GFF2 5EJZB 1ASJ1 2BVBA 4FVVA 1CESA 2WZ8A 3ITQA 1R64A 1RINA 1Q8QA 2MPFA 5H9RA 4CCOA 2HWB3 4HN0A 4N7IA 3X29B 2UWCA 3RFRA 3U1XA 2PHRA 4G4FA 5FBJA 4LK7A 1D4M3 2PMWB 1UF2C 3CZUA 3K4ZA 4QWNA 1TG7A 3GF6A 3POYA 2VW0A 4XBLA 4MXWB 4JDOA 1A78A 4QT6A 3CEWA 4EN8B 2QUOA 3BB6A 1POQA 2VZOA 2R6QA 3WQ1A 4OZOA 3H1WA 4UF0A 3SKJE 1YNAA 2DUQA 5DN2A 1H30A 5LATA 2ZEZA 5T5LA 2ZEWA 4XFHA 1PK6B 4A7KA 2FD8A 4D6QA 1XNTA 4IEWA 5JR7B 5KHGA 5A3PA 1JYVA 5FWJA 1S0JA 5LASA 2IC1A 1NX9A 4AVBA 3ZDSA 5FZHA 5E8AA 4HVQA 4D94A 1PGL2 2X5IA 4YM3A 5I93A 1UNBA 3VBUC 2VD7A 4QPGC 2XHNA 2Q4SA 2R30A 3RZZA 5C5UA 2PAMA 1SDWA 2Y6LA 2Q1ZB 4NR1A 5J3UA 2JG8A 4YVSC 4GQ7A 5B4XA 1QQP1 3ZLIA 5E16A 3DYOA 3KB5A 3H7JA 5J98B 4EN0A 5LZ6A 2EIBA 3S7EA 3WNKA 2VVFA 2JD4A 3M3IA 2OVUA 1AX1A 3RNSA 1CX1A 2LTNA 1SZBA 1WBLA 1TMF3 1DU3D 3DPRC 4UFKA 3VZJA 2GU9A 1RUE1 1D2QA 3D4KA 1RUG1 3H0OA 4Y1VA 5H9QA 1A3KA 2PLV1 1YIPA 1W6OA 2VCMA 2HEWF 3IN9A 4FOWA 1JI6A 3O12A 1SFNA 4JKLA 3U0ZA 4SBVA 3UV9A 4DEQA 1OUXA 3C7GA 3FJSA 1LOCA 2HWD1 2YU2A 4XE9A 3K51A 2Q8OA 1XE7A 2E26A 1QJX1 2NLRA 1YCIA 2E9QA 2GALA 1NCRC 1HRV1 2JDMA 3KMHA 5FZIA 3A0NA 4R9BA 1ZRIA 2I2SA 3BOPA 4PIXA 3SH3A 5BUVA 5C3QA 1NZIA 4GH4B 1BQPA 1DF0A 1F4HA 1XYOA 4OUMA 3VBUA 4HETA 4MADA 3KHCA 1QGLA 5FV3A 4IV3A 5FO8B 1VBA1 2WLPA 2E33A 1RUG2 1R093 4ZZ8A 2YPDA 5FY4A 3QACA 3CKHA 1UZ0A 4QPYA 3ZPOA 4AHZA 5FMBA 4GMP1 1VB2A 3PJYA 4N53A 1MS1A 2D40A 1OOPA 5F32A 1LOFC 2QKDA 2PQSA 4GZ9A 1JU3A 1OA3A 4FSJA 3JCIA 3POIA 3VBFC 2GDFA 4N43B 4NPMA 4WVZA 2P3IA 2Q8EA 2JECA 1YO8A 3O1TA 1GUIA 1H2NA 5K0UB 3SITA 3Q9OA 2D97A 1CPMA 1JW6A 1DYOA 5LK7B 1RITA 1DQ0A 4GKYA 3WG3A 3CMGA 2PHLA 3FE5A 4AI2A 1DG6A 4UXAA 4X6RB 3A7QA 1NY72 1PMHX 4M3CF 3GDBA 2ZEYA 1W0NA 4D6SA 1WKYA 1BBT3 2BNNA 2RMU3 3WP4A 4A6OA 1ZRRA 5C8CA 1EAH1 3T2QA 1AR81 1LR5A 4BMBA 1PVXA 1DGLA 1YWKA 1QH7A 1R082 1GV9A 3NVCA 1GMMA 1KDKA 1US3A 4XF1A 4XVHA 1K45A 3QH6A 4Q4X3 4CEYB 2JDPA 2QQJA 2UWBA 4OMCA 5L9RA 3UYJA 3AK0A 4OHWA 2JG9A 1UYYA 2YROA 3BALA 3VBOC 2GH8A 1GKBA 5IK4A 2C9KA 3AXEA 4RQPC 5KHHA 3OJBA 3IZOA 1CAVA 3OSDA 5CBLA 4IL7A 5C4WC 1AR71 4X8PA 2ZBJA 4YG0A 4NE9A 3ZPYA 2B45X 5JAXA 4FOYA 4CU8A 5HV0A 4NWVA 4IE0A 1ASJ2 2UY9A 1RVF3 5CB7A 2MEV1 5KXDA 2P4EA 2XBO2 1VR3A 3WY6A 1R081 2VZPA 5GZDA 2I07B 3LPGA 3L9JT 2BV4A 3MIBA 5C3OA 5JIAA 4JVAA 2CV6A 2TUNA 2VM9A 2RM21 2XL9A 4CCNA 1RUF1 3RPQA 2D7FA 5BNQA 2J7MA 1YJKA 2EAAA 3RDIA 1J59A 3LEIA 2TEPA 1W3XA 4AHWA 2ATFA 3WCSA 2QJVA 2YMZA 3K77A 4XHBA 1CAVB 5AVPA 4L2NA 3VUOA 3I2HA 4GWMA 2NYYA 4E4SA 1KEXA 2W94A 3LEKA 3NKTA 1G7YA 2V5YA 4W6YA 2BU9A 5GZEA 1DQ6A 4A7YA 3RZJA 3ACIA 4OI2A 4QGMA 4YW1A 4Q4W3 3IIIA 3JZVA 4LK6A 5T5PA 5IK8A 3OUHA 4AK3A 1VBB2 2BFUS 4XFIA 1UPIA 1W6QB 5AC93 1W05A 2YBSA 2ZGLA 1V6MA 3T09A 2UYBA 4B29A 1O8SA 2DTWA 3UL2A 3BTAA 4K20A 4FPKA 1LOFA 3A4UA 3POJA 4YYOA 3E6CC 1W39A 1ZZ6A 3HPNA 3WEZA 4Z1VA 5F3CA 5ANQA 2DBIA 4HL0A 4NIDA 4OQ9A 2R071 4CE8A 1CGPA 2XWBB 1J58A 2P2KA 2QQUA 5FMOS 5JOZA 1SACA 3GJBA 5LWBA 1H9PA 3FWEA 2OIIA 2O1QA 4J6GA 2CNAA 2SLIA 4RYDA 2AH2A 2D98A 5CKQA 3OGJA 1RGSA 4AEMA 1N1SA 2VULA 3KT7A 4C1WA 5BNNC 4CEWC 4Q8LA 1KS4A 1VALA 3N3HA 1OI6A 2B7YA 5I0TA 5KHIA 1VBA2 2YB7A 2DUOA 5HI0A 2F4LA 1S2BA 3ZFFA 1R1ZA 4XBNA 3NV4A 4LOTA 2Y8KA 3HBZA 1OFNA 4Y24A 4D7SA 4WM8B 4AVSA 3KZ4C 2X29A 4IUGA 1Y9GA 1I9RA 1KFXL 4E4HA 3TN93 1W6OB 1N1VA 3H42B 1AYN1 4HBNA 4QX7A 1YI7A 4XJWA 2EIEA 2OPKA 4JZRA 2QQMA 1D2SA 3KLSA 4INDA 3GBFA 4NHLA 3RJ2X 4N43C 3FUOA 5K8SA 2WZR3 1I5PA 1VRH1 4EN6B 3U07A 2D3RA 5LBBA 2EAKA 2K9ZA 5CFCA 2Y38A 4XOGA 3O0XA 2DFBA 5FMDA 2R062 4KMQA 3QOPA 3QCWA 5J1XA 2GZWA 2VMIA 3WW1A 5ACA1 3AYDA 5A1AA 5C3RA 1WD3A 2HBTA 4IW3A 4BB3A 1AR93 4DNYA 2WZR1 4BOWA 4FOQA 3AVRA 3IMMA 4NJ4A 1C3HA 5IUQA 4NRQA 4MVTA 4MG2A 1REFA 1I3HA 2CWMA 3W5NA 4URTA 3ILNA 4COWA 1U5YA 3ZFFC 3UNPA 2H0BA 2RJKA 3P1IA 4R52A 2IXCA 4GIQA 1N1YA 4E9KA 3VZMA 3INAA 4JRLA 5ABJC 1PO12 2A3YA 3CBNA 5GM0A 2HWF1 5FY7A 1VB4A 4GMP0 4PIYA 4D0QA 1LB2A 3BTYA 2BW8A 1JODA 1W8UA 1YIFA 1C1FA 2HYXA 2DBNA 3K3NA 3D6EA 5A3OA 2B46X 4OHVA 1H6XA 1Q8PA 2OZ6A 3ZSJA 3RZHA 3T2OA 1QIQA 1BMV2 5F5QA 4XAAA 1GANA 2FBEA 1PMIA 2VVDA 3JQWA 3LEMA 4S2DA 2FHRA 2HWE3 3OBAA 5FQ0B 5A6QA 5DAVA 3OBRA 4AR2A 1SBDA 5FMCA 4AFBA 4UYBA 5C8CB 1UOJA 3PU3A 4Q4Y2 2VOKA 3DN7A 5GLTA 1FPN3 4EN9B 5FPAA 1C57A 3NAPB 1BJQA 1ENSA 2XOMA 3ATGA 4HSLA 4KBZA 1OF3A 5DDJ1 3ZYRA 4A3XA 2YGLA 3NQHA 1DHKB 3ON7A 3WNPA 2WO3A 4H3WA 5T55A 3NWKA 1RUF2 3NW4A 4HLTA 5K4LA 1QJY2 3H3ZA 5A7WA 4IEUA 4AI0A 2WQ8A 3LD8A 3DCQA 4XJ8A 4O9GA 5FY5A 5LBEA 3GZEA 4LKSA 2GNMA 3BIWE 5A7SA 1R1A2 5C3SA 4AHXA 1LOGA 5ACA3 3ZSEA 4Z2WA 4CEYC 4NVPA 5BNPB 4NOTA 4CUCA
chains in the Genus database with same CATH topology
3GZAA 1HX6A 2VECA 2AZ5A 3ZO0B 5GALA 4PDWA 5FQ0A 3ILRA 4KQ7A 4M01A 2A6XA 4F8AA 1V6OA 4FPYA 4M0NA 4M00A 1CPNA 2R042 2EIGA 2WS91 3ACLA 4IQPA 4RGGA 5DUXA 4JGZB 4AFCA 4C0HA 4JAAA 3ENRA 2D44A 2XH6A 5FAXA 3ZMOA 2VNRA 4Y1XA 2A3WA 2C0ZA 1AYM2 1CAUA 5CFCC 1OMIA 4LBQD 1AL0G 2VOXA 4YGEA 1DYPA 1UZZA 2XLGA 5C8CC 1PZ7A 3AXDA 3W59A 4PDWB 5CIRA 3AMQA 5FCCA 4Q0QA 3URFA 3E6BA 1G8WA 1S0FA 1EPWA 3PVEA 3IWZA 2HWD2 2R073 2ZJCA 3OTFA 4DY5A 3SNMA 2UURA 4H7MA 4AEJA 1H1AA 2HKXA 2ZHLA 4KNCA 5ABJA 3BODA 1QQP3 5EYXA 3WDXA 1QU0A 3S30A 1XYPA 2XG3A 4AI1A 1LULA 2UY8A 5JOYA 2YC0A 1D0GA 4MGIE 3P3PA 4YM1A 2XJVA 4D7TA 3WZ1A 3NAPA 3CJIA 3RMYA 1JYCA 2R061 4BM8A 1FOD3 5DUWA 1QJZA 1TEIA 3R6SA 4CDQC 3IKWA 1RUJ2 3B94A 2ZX3A 1JBCA 1NXMA 5JZGB 1M4WA 3NL1A 2DVFA 5LK5A 1W0OA 2XLAA 1T6GC 3THTA 1KXGA 2YXSA 1LESA 3JB8A 3MW2A 3J4UH 1ZYBA 1RUJ3 2NN8A 1IS5A 2XGXA 2GMMA 3DGTA 4LA2A 4ISQA 5DXDA 1GLHA 1XYNA 1GNHA 2JG8C 2HWF2 1RMU3 4FQ4A 1PK6A 4P9YA 3ZN4A 3WDWA 3UKNA 5CADA 1EAH2 1PNGA 4E2SA 3GYDA 3LZZA 3N7LA 4Q0UA 5JI9A 5JCTA 4YZ4A 2QQPA 4ISRA 1IHMA 2GNTA 1ZZ9A 4N9IA 4RFT0 1BXHA 2Y0OA 1H2MA 1VBE3 1S0DA 2R1BA 3APBA 4JTNA 4RS5B 3VZLA 2RS53 2JJ6A 2ET1A 4AGVA 4LLFA 1S55A 3FMGA 4Y20B 3IPVA 4M3CE 2KXLA 4XXPA 1RUE2 2CGOA 4FTBA 1BBT1 2WQ4A 1F9KA 1SMVA 3M70A 3N36A 4YZ1A 1QJU3 1DFQA 4Y5Z0 2JKBA 2WNUC 1IPKA 2DUPA 2ZGTA 2RE9A 2PN5A 3WP5A 4GULA 3T1MA 3M8LA 2XJRA 4AW7A 2VU9A 4B4PA 1YLLA 1BVVA 3JD73 5I8SA 1HW5A 3PVBB 4PIZA 2ZAAA 2R041 3EHKA 1WBFA 4LE4A 3OD4A 4MXVA 3AMHA 1YFWA 1NCRB 2IXLA 2ZGOA 1CAXB 5KXBA 4EV0A 1JUIA 1O5LA 3UKVA 3SHRA 1APNA 4MYEA 2PA7A 4XIKA 2B8MA 4Q4V3 4WBBA 5F6KA 1MS3A 1W6PA 1NA1C 4Q8KA 3HWJA 1WW4A 3OBTA 4NO4A 3AZVA 4JQRA 4KU7A 4RR3B 4AEDC 2WNUA 4MUVA 2H6CA 3RRDA 4E2GA 4WM7C 4YVSB 3VBOA 5EJ3A 1FT9A 1HXS2 4C90A 4PBOA 2HWE2 2RS51 2OYZA 5K0UC 1VBE1 1DQ1A 4I0AA 5C9AC 2TBVA 1KITA 2RS11 5FDBA 3D5OA 3P3NA 1CAWB 1OQ1A 4WVWA 2IZWA 3O0WA 4YW5A 1NXD1 1SQ4A 3HT2A 2WS93 3J8F3 2DWRA 3MPPG 2NM1A 2QFEA 3N7MA 1RUH1 3KS7A 5I0RA 1J3RA 1IS6A 3LA3A 4GH4C 1RUJ1 4I0WB 4ITCA 3ZFGC 1VBD2 4YFZA 2R043 4OZXA 4QMAA 4LTAA 3WUCA 3VDDC 5DZEA 2XKOA 3HMYA 1LU2A 4CZSA 2BPA2 3MDPA 5K7PA 4XBQA 1D4M2 1KDMA 4L92A 2D5FA 4JGZC 4IXLA 1QY4A 3JB4C 1QXRA 2G9GA 5DZGA 2RR13 1Z7S2 4DMIA 1BKZA 3DPRA 1QJU1 3JBG1 4QGLA 1Y7BA 5LRSA 3WW2A 4CDQA 3PLQA 1PO13 4WVVA 3QD6A 5FMOL 3R4UA 1HXS3 1KJRA 1H1IA 2XB6C 3AFGA 1JHNA 2ZGSA 2ZOEB 1BVP1 3ASIA 4PBPA 1S1AA 3IMNA 1YI9A 3VHOA 4HMZA 4QGNA 4RQPA 3AFKA 4Y26A 1RVF2 5C33A 1KFUL 1Z0HA 2PQQA 3IDCB 1JH5A 4FP2A 5F1RA 2ZAHA 1ZBE2 3M3QA 4LNVA 4Z8BA 3WDVA 1O4YA 1O4ZA 1U5IA 4B7EA 3K48A 4XQ4A 1ULCA 1C8M2 1ZZ7A 1PK6C 3WG2A 4XHXA 3ZFEC 4Q26A 2RS33 3DPRB 1BEV2 5T52A 4MXWA 4DPNA 3V0BB 2VVEA 4WVMA 2X8KA 3AB0A 2HWC3 3ZX7A 1ZREA 1LHWA 1FNZA 5KC5A 2NZ9A 4WM7A 1RC6A 1ND3C 3O14A 4LUMA 4E4ZA 1IZ3A 3WX5A 2P34A 1G6NA 3QBQA 3LA7A 2E6VA 4QX5A 4IETA 2CTVA 4Y20A 3O5SA 3AKRA 3FBYA 4CP0A 2K2SA 1JTZX 4I0BA 3CJIC 1F8VA 4CTEA 2E7AA 4P9JA 4WM8A 1S0IA 4Q2FA 1G86A 5A33A 2YZ4A 4XJ9A 1FPN1 2A6YA 1H8TC 1Q8OA 2DCJA 4LBLA 3WHTA 4HPKA 4YRDA 5T50A 3VV1A 5A3LA 1MS5A 1UKGA 3R4DB 4AQTA 1BK1A 4FOVA 1HV1A 4AYUA 4XYXA 1COV1 1G9AA 1DGRA 1DZRA 3RI8A 2R16A 4HKLA 3D8CA 2Q5TA 3IT8A 4LHKA 1TME2 2HEVF 4Q4W2 2JENA 1X8EA 4KWKA 3E5XA 4V1PA 2WSVA 3QH7A 4XF0A 2CYFA 4Q1PA 1SBEA 3AJYA 1UW8A 1XXNA 1TME3 3E6DA 4YW3A 4AFAA 4ZU7A 2Q1MA 2BGCA 5KBFA 4CP1A 2ZMNA 1MEC1 3C3VA 1ENQA 4P9LA 3WQ0A 1AR91 3RYPA 1WMEA 1SCSA 5BY5A 4AG4A 1UL9A 1MQTB 1IPJA 1RUH2 5C9AB 3L2HA 3JU9A 4Q4W1 2ZS6B 2D6LX 1RUC3 5BNOA 1Q5OA 5K0UA 1Q3EA 3DF0A 3NO8A 4CDXA 3MF6A 3PVOA 4K6BA 3VKFC 5I91A 2PELA 4K40A 4XFAA 3AP7A 4S2GA 5J37A 3RWNA 2YGMA 5SV5A 1CJPA 3B01A 4XF9A 1GZWA 4LHNA 1GSLA 4AEDB 1K5MB 2JICA 1PO22 3FBMA 1VRH3 5KHJA 1NA1B 2EVXA 3JBG2 1O3TA 1N47A 2HWC1 1OSGA 2WFF1 1AL23 4Y4YA 2CL2A 2YHJA 4GH4A 4LO6B 5CG9A 1ZZCA 5FLIA 2Z42A 1MQTA 2GC1A 2WT2A 1O3QA 3SXWA 1RB8G 1PO23 1IGOA 3ECQA 4FT8A 4W6XA 1F5FA 2GN7A 3GBGA 4BLIA 5CNAA 1XE8A 4GB31 5LEJA 1DZTA 3AP9A 2XBO3 5IT6A 2GC3A 3TOJA 3AKTA 2GNBA 5HCFA 3BU7A 1O3SA 1MZ5A 4LBJA 1BEV1 4B3NA 5GKAC 4PF5A 4OI1A 4YVWA 2IXJA 4AEDA 1WCKA 4DFSA 1QF3A 2AUYA 1K5MA 2BQPA 3MFAA 4MGZE 4CDQB 4C91A 4TYSA 1O4TA 4F7ZA 2HJIA 1V70A 2O8QA 1QJX2 4XW3A 3MW3A 3MYXA 1QOOA 4UW3A 1XNKA 3ZXGA 2B5HA 1LOEA 3S7IA 3WCRA 3JBG3 1AVBA 3WT3A 4EWDA 2A75A 1XQNA 4X6QB 3BCWA 2WFF3 1MQTC 3W9AA 1FATA 3WQ7A 1PVC3 1ULGA 3WVJA 1C8M3 2YPJA 4HZFA 5EV7A 5GLUA 1VBC1 5CU1A 1RUNA 3U10A 4XTPA 4CEYA 1KQRA 4I02A 3KQRA 3ZXLA 1RUF3 3V64A 2Z2SB 1B35B 1NE4A 4WVMB 3V56A 3ALQA 1ENRA 4XF3A 3VDDA 4NWWA 4HK8A 1ND3A 3ZSLA 1VBA3 3J8F1 1TMF2 4AVAA 2R49A 3MEPA 5SV8A 3V0AA 3FLTA 3OYWA 1QDOA 1ZBA1 4RGAA 3USUB 4AQ6A 5JZGA 1SLIA 1KRIA 2XKPA 1MZFA 4YLZA 1FV3A 5C6CA 4FP3A 2QVSB 5L73A 1AR82 1UIKA 1YFYA 1JOJA 3G7DA 5HXVA 2P3JA 4GWNA 4DRVA 5A33B 2QE3A 2C5DA 2DTYA 1B35A 2WL1A 4XTMA 1RUE3 4FPHA 1TMF1 1PGSA 4BA6A 1PZ8A 1AXYA 2CWSA 1AR62 3AZZA 4IV1B 3SLIA 1COV3 3MLJA 1HQLA 4DY3A 4K1YA 4Q4X1 4R8HA 1LENA 4PLMA 3N7KA 5CA6A 3V0AB 3JUUA 5CFDA 4HT1T 1RHI2 4O9EA 2WWSA 4BHPA 3ZFEA 1TNRA 2ZA9A 4TLFA 2ERFA 2HWB2 2A6VA 2XWJB 1J1LA 5HCAA 3LKJA 3DUIA 3SCHA 1DBNA 2E63A 1FMD3 4CDUC 2VY0A 4NN0A 1QJY3 5FO9B 3ES1A 3B9IA 1YUDA 1A6CA 5EXOA 3LWCA 3WG4A 2BBVA 4R9AA 4AFMA 2JG9B 3NV3A 1D4M1 3TB0A 3D0SA 3B5LB 3OD0A 4L8QA 1D0HA 3MIGA 4K3UA 3AKPA 1FI2A 2G9FA 2EXIA 4L9BA 5GLVA 1W2UA 3VZNA 5CVRA 4IEQA 1H9WA 2P37A 1IKPA 1U5ZA 3VBSA 1MS8A 3H9AA 1AR73 2I45A 3MIDA 1OD5A 4SLIA 3USUA 1QQP2 1DZQA 3AM2A 3GHMA 3ZMNA 5CFCB 5I0UA 4MSVA 4KGGA 3ELNA 1XNBA 1LHOA 2ZCWA 1UD1A 4CDWB 2D6MA 4XJUA 1WLCA 1V6KA 4Q4V1 2BUKA 4H55A 2B39A 4ZXKA 1EAH3 4UBGA 2BWAA 1RJ8A 3NAPC 2RMU1 3TRSB 4BZ4A 4RS5C 1Q56A 4MH0E 4P9WA 1VLNA 1MVQA 5T5OA 4L97A 1JYIA 2FZ1A 3PHMA 4XJAA 3VKOA 2CGPA 2PHFA 2ZGNA 4QPIA 1AYM3 5H9PA 1K5MC 1VBC2 4RHV1 4RR3C 2ET7A 2A5ZA 2WNVB 3DKWA 3GNEA 1YFXA 1S0BA 4YNIA 3LOIA 3WW4A 4XFGA 1RUOA 1L3JA 2EALA 1FOD1 1B09A 2VOVA 4LHLA 2ZHMA 5FREA 5E1RA 1ZA4A 4RA0A 4JDNA 3M2MA 5JIUA 1LU1A 4BWOA 3KCYA 4ASMB 4DQAA 1REDA 1H1MA 1ONAA 5JSRA 4XFBA 4FQZA 3WOGA 2D5HA 4DINB 4N53B 1ZBE3 1OOPB 2A6ZA 4JC1A 4RL7A 2DCKA 4K21A 1OA2A 4FPLA 3ETQA 5TSWA 4KWLA 4XF4A 4IEPA 2WNVA 3AZWA 4ES9A 3MIFA 5JI7A 2QDNA 1QOTA 5L36A 3B02A 5B2GB 2DF7A 4P9XA 4OI4A 4DRRA 1RHI1 1RUG3 2VMGA 2O0OA 3M4FA 2YY1A 2BWCA 2DFCA 3D82A 4X8NA 3WDUA 5JZGC 5FOBB 2OUJA 4DXZA 5J36A 1I1EA 4ZU4A 1UKRA 1ZBE1 4BH9A 1PIV3 2ZZQA 3E5QA 3WR0A 1AF9A 1Q43A 5GLWA 2ARBA 3RMXA 5IK7A 1QJY1 3ZFGA 2ZKLA 2PHWA 2PTMA 1IS3A 2ZGMA 3N4MA 1VBD3 4IEOA 2WQZC 3AP4A 2ZMLA 1FX5A 4C0BA 5AVAA 2I74A 3NSTA 1E57A 1X82A 5A32B 3SISA 3JD71 3LA2A 1GNZA 1LEMA 1RIRA 2G4IA 1FAYA 3WG1A 4CEWA 1HQWA 2WS92 4WM8C 1RMU2 2ES3A 4WM7B 4BQ1A 2R063 3PMEA 5HBAA 3H3UA 2SBAA 1C28A 3B69A 1PVC2 2E7QA 2WA3A 1JUHA 3PVNA 5HCBA 1LOBA 4QHBA 1MR5A 1WMFA 1UIJA 2HWE1 1OKQA 2HWC2 2RS52 3AYCA 4HKOA 4IEXA 4YZ3A 4AVVA 4GB32 2WNEA 3H1MA 1VRH2 1QMJA 2VNOA 1ZNPA 4MV2A 1BEV3 3IBMA 5GZFA 3VBRB 2RMU2 1CR7A 4HPKB 2DCZA 4Q4V2 1HRI1 4QM9A 4FXGB 3VL9A 1BCXA 2KM2A 3WP3A 2AR6A 4HANA 3ZN5A 2X5IC 3RS6A 3U11A 5DZFA 2ZX0A 4E4DX 4FPFA 1RUC2 2WNVC 4DB5A 4YZ2A 3LSDA 1AL21 3FLPA 2ARXA 2LALA 3NV2A 4BCUA 4COVA 4COYA 1HDKA 3WDTA 1VP6A 4Y1UA 3C2UA 3TBDA 5C4WB 4GA9A 1WLWA 4ASLA 5BNOC 4JGZA 5FTTC 4CDWA 2D6OX 1CAXA 4ONUA 1QXJA 3VBHC 2WLQA 4FAGA 3OY8A 1WLDA 4NHKA 2EXKA 2VUAA 3AP5A 1NY71 2RJLA 4RS5A 5FO7B 1RUD1 2PHXA 2XVLA 3ZFGB 1GZ9A 4KBBA 1FXZA 1GZCA 3EJKA 5AFEA 2IXHA 1AHSA 4A7ZA 1W0PA 4RR3A 3ST7A 1N3PA 3B93A 1C8NA 1O91A 4RSUA 4Z92B 1H4GA 4IV3C 1O3RA 3QLQA 2FMDA 1UCXA 4XQWA 5DUUA 1GZWB 1QWRA 1SEFA 3H1YA 3L2YA 1AJOA 3ZYIB 4A2UA 4OULA 1V9U3 3WUDA 2FMYA 1V00A 3ZN6A 4B4QA 3M3EA 3MW4A 1CONA 3OY8B 1V6JA 1KD7A 4Q29A 1S0GA 2NP0A 1NCQC 3I8TA 2Y0IA 4YVWC 4LT5A 1AX0A 1MACA 3KSCA 4OFGA 3WD5A 4D7YA 1UX6A 3AKSA 3WP6A 4ZKTB 3BPZA 3A0KA 3CU7A 4IEYA 1S2KA 1NLRA 2GNDA 2QZ3A 1A8DA 2YUEA 3G6JB 1G9FA 1BMV1 1LOAA 1DYKA 3R05A 5H9SA 1PO21 1RUI2 2ZHNA 2DVDA 1S0CA 1SLLA 4R4ZA 1W6PB 4WZFA 2JE7A 2R0FA 4OUSA 5CG8A 3WHUA 1NLSA 1IOAA 1CIWA 4BPZA 3VHPA 4JGYC 4FBFA 4CDXC 1DQ5A 3RI9A 1Z7S3 5T3NA 4OLLA 2ZKNA 1YRZA 2QCSB 3POSA 4L99A 3AJZA 2HEYF 3MLKA 1TQ5A 2W52A 1D4VB 1PGW1 3PJQA 1RJ7A 4MX3A 1NQDA 3AP6A 4Q27A 5C4WA 2ILMA 3SCFA 4IV3B 4I2OA 3MF9A 4KGQA 1KJLA 2RM23 3AMPA 5KC6A 2JXAA 2C1FA 2WC2A 4HVOA 1MEC3 3E5UA 5A3MA 3AKQA 4NPRA 1J3QA 3TN91 3VKMA 4AI8A 5FOJB 2RM22 2XJSA 3IPVB 5AC92 3ZFFB 3FHIB 2GSYA 1HKDA 2R0HA 1AXZA 3MLLA 2CAUA 2VG9A 2PAKA 2GH2A 4LO4B 2BTVC 4XXAA 2DVBA 2GN3A 3EXUA 3IDBB 4Y1YA 1EP0A 4UW5A 1OPOA 3V0BA 2W0XA 4TZDA 1GQGA 2ZTNA 1B35C 3WLUA 4DS0A 2X5IB 1G9BA 4TWTA 1AYN2 1GYKA 3O0VA 5LEKA 2BYVE 1VJ2A 2BFUL 2F4PA 5BNNB 1QOSA 4N90A 4AEKA 5KXEA 2NQYA 2JE9A 2NMNA 2DVGA 1J3PA 5CFDC 2AENA 2D6PA 3FC0A 3M3CA 1XRUA 4M0HA 3RJRA 3WINE 1CQ9A 5J09A 3VBRA 5J7MA 1UPSA 4AE2A 1NCQA 3VHRA 2OZJA 2V09A 2A3XA 4IV1A 4BIOA 5I8YA 5BPXA 4FPJA 4QQPA 1ULDA 1VBD1 4CP2A 4Y22A 2WFF2 2VUJA 3I59A 5C8WA 2XVKA 1WW7A 2W68A 3H50A 2V73A 3PMSA 4GXLA 1V9U2 1W6NA 2NMOA 4IEZA 4BLJA 3KCXA 3HT1A 1WMDA 4BE3A 4D3WA 2WINB 1ZRFA 3CLPA 1R083 2DURA 3KD4A 3VBUB 3J26N 4QPGB 1NE6A 2DU0A 4Y1ZA 1SLCA 3VKLA 2ZMKA 1FOD2 1O5UA 3MICA 4BIFA 3CJIB 3VKNA 5JPNB 1SLAA 4M3CA 5FPZA 5J48A 5BXXA 1HRI3 1DLLA 4JTOA 4P9GA 4R4XA 4JRAA 1EYBA 2MEV3 1RVF1 1H8TB 2RS31 4N7UA 1AX2A 1CAWA 2D3PA 3RYKA 4N43A 3FFZA 5JOWA 4BYYA 2ZX1A 1W6QA 2CAVA 2VXRA 4Q4Y1 4Y22B 2PLV3 3NJZA 4LE3A 2YYOA 3VLBB 5DDJ2 5T5JA 3TNPB 4W65A 1AR92 4MZUA 1W6MB 4G9SB 2F6BA 3AMMA 5BNOB 1N3OA 4M3CB 2X53S 3CF6E 4CDXB 5AFBA 1HV0A 2MEV2 4LO8A 3ZXEA 2UYAA 1PO11 5I8TA 4XJZA 3UKTA 1PHMA 3S6PA 4QQ2A 4JCKA 1Y9QA 4EN7B 4LO7A 3ZXKA 4OI0A 4LBMA 4CDUA 4EWEA 2VH9A 1Z78A 1ZZ8A 5BNPC 4WV8A 1DIWA 5GLZA 3R4SA 3TN92 1PM7A 4XFCA 4IESA 1AJKA 3OCPA 1NCQB 1VBB1 1W6MA 4DOUA 4F3JA 2E51A 4K8FA 4K7JA 1ALYA 4XIOA 4FCAA 2PFWA 3ZYJB 5J96B 4JGYA 3T2TA 5KHKA 3VBRC 3SMHA 4AVTA 1ASJ3 1LEDA 4YW2A 2XHKA 1LTEA 3TAYA 4XFFA 1W6NB 4YZ5A 1GQHA 1PIV1 4XPVA 1URXA 4ZU5A 4C1XA 1RHI3 3AMNA 2ZPXA 1AZDA 4QPGA 4ATFA 3VBSC 4Z07A 4CDUB 3W58A 5L7OC 2A7AA 3SH4A 4PCRA 2GMPA 1EV11 4IEVA 3LSEA 3PNAA 1EV13 4H7LA 4S2HA 1ULEA 2HWD3 3M1HA 1PNFA 4YGBA 3S0MA 4J1XA 4K9SA 4EJRA 2VPVA 4E27A 1YJLA 2PLV2 2DYCA 1BZWA 1XNDA 4JDMA 4JGYB 1PIV2 4FAHA 4KH9A 3UJQA 1HXS1 1OQEA 1WD4A 2NPIA 2ZACA 1IKQA 1MS9A 4FPEA 1SLTA 1REEA 1KS5A 3RG0A 5GZCA 1WGPA 4K1ZA 2EA7A 1Q8SA 1HIXA 3ZSMA 4QQOA 2XVGA 1LHUA 4P5HA 4N9HA 4JV4A 4PLNA 3GHNA 1ZM1A 2WSUA 4Q0VA 1FMD1 1LGCA 1OHFA 4H14A 2BEOA 1XNCA 4N53C 3J8F2 3KGLA 3OYWB 4YFWA 1H8VA 1V6LA 2GMEA 4KWJA 4YG3A 3AYAA 4KG0A 5JDBA 1F2NA 1OFSA 3POWA 4R9CA 3VZKA 4YW4A 1RTVA 2HWB1 2RS13 2P3KA 4OHYA 2LUWA 3HR9A 1HQNA 1SBFA 2ZGPA 3WW3A 3I59B 1SCRA 3ME2A 5D8AC 4CEWB 1HRV3 4AI3A 1H2KA 1QJX3 5DUVA 2UWAA 2Z79A 3KT1A 1X33A 3FX3A 4Q4Y3 4HVRA 1BBT2 5EFUA 1QHDA 2EF6A 5CFDB 1F31A 4PQ9A 5JWPA 1LKNA 2DV9A 1QKQA 3MZHA 2BNOA 3B9CA 3VDDB 3I2DA 2XLFA 2OA2A 3PTYA 2FZ2A 1U0AA 3MIHA 3IIAA 4AQSA 4YGDA 3KCCA 4YM2A 1HRI2 5L7OA 3RSJA 4FO9A 4AWDA 1ND2C 4ES8A 2VGDA 4XETA 1COV2 4P14A 2D3SA 1LECA 5T54A 3AYEA 2BVVA 2D6NA 4KU8A 1WW6A 3CO2A 3D0JA 2ETEA 2EXJA 5I0SA 2WZPP 1HRV2 1AL22 4HSJA 1VBB3 1EY2A 4LA3A 4CDWC 4EROA 5ABJB 1VBC3 2XJTA 4YG6A 3NV1A 3ZXDA 3UK9A 4YARA 2ENRA 1YHFA 2ZGUA 5FLJA 5ACA2 4LEJA 4DZGA 1H4HA 1O7FA 1PGW2 1ZBA2 3EBRA 3VBSB 1I5ZA 3HAGA 4Q0SA 1MS4A 4EWAA 3ZFEB 1DGRN 4LBKA 1GBGA 1LGBA 1EV12 4F83A 3UJOA 2GC0A 4RHV2 4XQDA 4Q1RA 4TSVA 1OPMA 1WA4A 3AX4A 5K9YA 5LRRA 1F5JA 3AZYA 1AR61 2B9UA 5GJ6A 3DV8A 4HN1A 3AZXA 1GICA 1WLTA 1ZBA3 1C1LA 4HK9A 4QM8A 2Z69A 1ZVFA 1CD3G 5EYYA 4FTSA 2HYKA 2OW4A 2WZR2 3MFCA 5DG1A 2MHFA 1X7NA 1MZEA 1WUVA 5FFOC 3I7DA 3LAGA 4P9IA 3ZXJA 3OPZA 1MS0A 4Q4X2 5DG2A 2AYHA 1CVNA 3HD8B 1NYWA 1CAUB 1OOPC 2A71A 1DGWX 1UU4A 4AF9A 2QZ2A 4XMAA 1WW5A 1C4RA 3TNQA 2JEMA 3N7JA 2Z5WA 1C5IA 3VBHA 2WIIB 1PZ9A 1GR3A 1M06G 3SCGA 1Z7S1 1MVEA 2H0VA 4W6WA 4CRQA 3ZIWA 3DL3A 1IQAA 5F6LB 5D1IA 3M3OA 2C9AA 4PLOA 4AHYA 5BNPA 5C9AA 3KM5A 3GZTB 2CY6A 5BV6A 3VN4A 1G9CA 5IK5A 4I09A 1LCLA 1A8MA 1S0EA 4KL1A 4XZPA 1ENXA 2D93A 2XL7A 4XILA 4YGCA 1X8MA 2PHTA 3OF1A 4FPOB 3U4XA 2A6WA 4QPIB 4HKWA 1FV2A 1RUI1 2Q30A 1QH6A 5E88A 3THPA 1YYNA 2H6BA 2XBO1 1H0BA 3B3QE 4I30A 4MGKE 5CAZA 1ZRCA 4FTEA 2HWF3 5BYNA 2DCYA 3MIEA 1NG0A 1CJDA 1OLRA 2JDZA 3T1LA 2ZHKA 1ZX5A 1U5XA 2PYTA 4AGGA 2K0GA 4R9DA 1RL3A 4META 1VAMA 4IERA 2WNUB 3V65A 2E53A 3M7AA 4GB33 4MGYE 3FFQA 3HN1A 4FPGA 3ZYGA 1V6NA 3RYRA 3VGIA 2OUHA 3MI8A 2R072 2MNGA 4GALA 1QDCA 3WDYA 3GZUC 4AQ2A 1LRHA 1QNYA 3EO6A 3LB9A 1XU2A 4I3GA 4D69A 5JSPA 5A32A 3ZSKA 4J1WA 4AFDA 2RR12 1RUD2 5F9TA 2DCTA 3IM0A 4OHZA 3KGZA 4G3YC 1H2LA 2IXIA 2R1DA 2IFRA 2R32A 4LBNA 3RQ0A 4IV1C 1X50A 2Q0AA 4QD2A 4QQLA 1OA4A 1LJ7A 5D8AB 2DVAA 1R1A1 2VNGA 2WKKA 3GALA 1C8M1 2PHDA 5L7OB 1ND2A 4OHXA 1PVC1 1BYHA 1N1TA 1POV0 4E2QA 1POV3 2E7TA 5E89A 3B7MA 1RUC1 1AYN3 4XMIA 3VZOA 2ZABA 5DDJ3 1TME1 1NOVA 4NHMA 2VQ0A 1YXWA 5JOXA 1JN2P 3KT4A 1NQJA 1ULFA 3J9SA 4AGRA 1ND3B 4CYDA 5D8AA 3WXPA 4LULA 4MLOA 1C5HA 1ZRDA 1FNYA 4LO5B 5JLVA 4QXKA 2ZX4A 2YV8A