3AKTA

Crystal structure of xylanase from trichoderma longibrachiatum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Packing Space Expansion of Protein Crystallization Screening with Synthetic Zeolite as a Heteroepitaxic Nucleant
doi rcsb
source organism Trichoderma longibrachiatum
molecule tags Hydrolase
molecule keywords xylanase
total genus 56
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aktA00
3M4FA 4S2GA 1C5HA 4S2HA 2NLRA 3WQ7A 2VULA 3AKSA 4NPRA 3WP3A 1OA4A 1YNAA 2C1FA 1BK1A 1F5JA 2DFCA 3VGIA 1BCXA 1HIXA 2DCZA 3VZMA 4IXLA 1HV1A 3AKPA 3ZSEA 3VZKA 3VHNA 4XQDA 2JEMA 2D97A 2QZ2A 2BWAA 2JENA 3EXUA 3AKRA 3AMHA 3LB9A 1QH6A 1XNCA 3AMPA 2BW8A 4HK8A 3WP4A 3VL9A 3VHPA 2DFBA 4XQ4A 2B45X 3AMMA 1T6GC 3WT3A 2VG9A 3VL8A 1XYNA 2NQYA 1UU5A 3AMNA 2DCJA 3AMQA 3B5LB 1UU6A 3VLBB 3WQ0A 1H1AA 1ENXA 3AKQA 2B46X 1XNDA 2QZ3A 1OA3A 1XNKA 4H7MA 1UKRA 1KS5A 2VUJA 3MF6A 1OLRA 3LGRA 1REFA 1QH7A 2DCYA 1NLRA 1XYOA 3WY6A 3WQ1A 3O7OA 4XPVA 3HD8B 2VGDA 3WP6A 1UU4A 5K7PA 1H0BA 2B42B 4S2FA 1C5IA 2Z79A 3VZOA 3RI8A 5K9YA 5HXVA 1H4HA 1KS4A 2BWCA 1AXKA 2F6BA 3MF9A 3VZJA 3MFCA 4S2DA 3VZLA 1M4WA 3WR0A 1H4GA 1TE1B 1H8VA 2D98A 4HK9A 1OA2A 2DCKA 3B7MA 1REEA 3RI9A 1HV0A 1XNBA 4XQWA 3WX5A 1PVXA 4HKLA 3MFAA 1REDA 1XYPA 4HKOA 3WP5A 1IGOA 3VHOA 3AKTA 2JICA 1BVVA 3VZNA 1W2UA 3WXPA 5EJ3A 1OLQA 2BVVA 1XXNA 4HKWA
chains in the Genus database with same CATH superfamily
2FMYA 1KDMA 1DQ2A 4C91A 3KHBA 4WVWA 4TLFA 4YGDA 2YU1A 1Q3EA 2XKOA 5CBLA 1J83A 2HJIA 2XQRA 2BFUL 3ILNA 4NIDA 2XVGA 2GMEA 4IV3C 1PX3A 4QXBA 1IOAA 5K4LA 2DBNA 3GALA 2OT7A 2PN5A 3NAPA 1Y7BA 2TNFA 4FP2A 4RSUA 4CEWC 1E5SA 2RS13 1W04A 4XURA 5ANQA 1QGLA 2SBAA 1AX2A 4KBBA 4Q0PA 3T4HB 4C0HA 3U0ZA 1VRH3 1YRZA 3I59B 3KT1A 3BPSA 4P9LA 1CAUB 4XABA 4D3WA 2E33A 1BBT1 2E63A 4MGIE 4N43B 3EXUA 1PIV1 1G86A 2P17A 3ZXEA 4FTEA 1MEC2 1QH6A 3IMNA 4YLZA 2ADEA 3VUOA 3ZVXA 4XCAA 4HK8A 1HRI3 1FOD2 5FZOB 4Q0UA 1NA1A 4WVZA 1OMIA 3M3OA 2VZPA 4FT8A 2IZWA 3TBDA 2JG8C 4P9IA 2HWB1 5FMDA 1NOVA 4XXPA 2O1QA 2EAAA 2Q1MA 3B5LB 3ZFFB 3UETA 4FCAA 4IDZA 2GZWA 4GMP1 1WMXA 3MPBA 5FZDA 3PUSA 3FN9A 1J59A 4GWJA 2W1UA 3OBAA 4QM8A 5GLTA 4IESA 5D21A 1W2NA 5KWRA 1LHUA 2ID4A 4N7IA 1K12A 5FWEA 1B35C 1GNZA 1TNRA 3O7OA 4TN7A 4I30A 1QY4A 3CNAA 2VW0A 1H30A 3GM8A 1UAIA 4RFT0 3KF5A 1MQTC 3VKNA 2FD8A 3ZXFA 1E5HA 3POIA 1UNBA 4FOWA 4LO5B 3R05A 4HBNA 2RDQA 4XFGA 3RI8A 5EHDA 1AXZA 3H1WA 1NG0A 2G9GA 1DYOA 4JKLA 1RUG1 4BLIA 1UOFA 5DUUA 3NRUA 2CL2A 1W9TA 1KFUL 3BIEA 1UPIA 1JBCA 1NE6A 1OT5A 2FCUA 3KT4A 5LA1A 3WW4A 2RS31 4XFAA 4Q4X1 4ZXEA 3GYDA 1DGRN 1Y3TA 4K6BA 4YM0A 1TE1B 4NRMA 1ULDA 3UV9A 4PDWB 1W6PB 4PBPA 5FZ6A 3ZM8A 3ZXDA 1JUHA 4AVVA 3NJVA 2V5YA 3A0NA 4I2OA 1GZWB 2VNOA 1R091 2EIBA 3VBHB 3BPZA 4AEMA 3IM0A 4KQ7A 2XJRA 1F35A 4OYUA 4B3NA 1JZ3A 1OURA 1SLCA 3WSOA 4MG2A 2HWF3 1JOPA 2W08A 3O1PA 3R4SA 2AUYA 1JODA 3OBRA 2VMEA 1BHGA 1AL21 1VB4A 2RMU2 4P14A 4NUBA 5FZ0A 1SHWB 5FZIA 3WNLA 4XF3A 2WN2A 3KVBA 4OVEA 4CP9B 2WFF2 2WS91 5A7PA 5DG2A 4RHV1 1CX4A 1Y9QA 2VZ3A 1HW5A 5EWSA 1HB3A 1YWKA 3J26N 4AEJA 1U5IA 5C5UA 2A5ZA 3D3AA 2Q4SA 2CWMA 3M7AA 5FZ8A 5KBFA 3JBG1 4LE3A 1EV11 3VBSC 3CU7A 5FZFA 1ZBE3 4Z1VA 3MO4A 5JIAA 1W6QB 1TZOA 4MUVA 1GU3A 2JDNA 2VO5A 1N1TA 3AXEA 4JHTA 3POEA 2BGPA 4NHMA 1F5JA 3UGFA 2JE7A 4FXGB 5M0TA 5F1RA 1L7RA 1H8TB 3BCWA 5FYIA 3RS6A 2O8QA 3LFIA 1RUD3 1J1LA 1UX6A 1CAVB 1EUTA 4HXCA 4NOTA 3PLQA 3AP5A 5LEJA 1IQDC 2B9VA 3WF0A 5FP4A 4OHYA 1VBC2 3LFMA 1GQHA 4XDOA 4MGYE 3RFRA 2WINB 4CE8A 2HWE1 3I2OA 1HX6A 2BV4A 3NNGA 4H55A 1YI9A 2K46A 3JD73 4B1MA 1P8JA 5FLJA 5FK7A 5LRSA 2FDIA 4DY5A 4Q1PA 2I45A 3J9SA 1FMD1 4FPYA 2B9UA 4MV2A 4P9JA 2VVFA 4XUNA 5F2WA 3WP4A 1S1AA 4QT6A 1MS3A 3RWNA 3T0BA 1GOFA 2WR9A 2VOXA 1JZ4A 3TNPB 3DF0A 4CDUA 3O12A 4W6WA 5L9VA 2NQYA 4PCRA 1JZ6A 1KEXA 1OLMA 2X5IA 1VRBA 1Q56A 1W8HA 2WSUA 4BQ2A 5JZGC 4LUMA 1RUF1 4HVQA 2EXHA 2PELA 2PTMA 5CYYA 5C8WA 1NZCA 2BZDA 4XTMA 1OA3A 1LOEA 1FMD3 1WZXA 4WM8A 5JXHA 1BBT3 4XDQA 4UOJA 5FK8A 5FLIA 1N3OA 5FXZA 3TWIA 4A42A 2OW4A 5KXDA 1RUJ2 2JE9A 3OGJA 3B9CA 2ZEYA 3SH3A 4AQ2A 3HN1A 3WP6A 4EN7B 2B4KA 4HSJA 3CJIC 4RS5C 2XR4A 3H3ZA 1QIQA 2O0OA 3C7FA 1PMIA 3M8LA 1QOOA 4O9GA 4L0PA 4KU8A 3ACLA 2WNUC 1WLWA 2V4VA 3OGVA 5KR7A 2QQIA 3MZHA 2GP5A 2A6XA 4RQPC 2WO1A 5CFCA 1RITA 2F6BA 3KSCA 4Y22B 2BOJA 5E6HA 4ZU7A 1RJ7A 3H42B 1A78A 2PA7A 4SBVA 2R041 5I8YA 2ZGPA 2EICA 2YPJA 3LDBA 5JOZA 1C8NA 2C26A 3SEEA 1YCIA 2BNOA 5T55A 3ZFEA 1OD3A 2A6ZA 3MW3A 1C1LA 4OHXA 4R52A 4BQ5A 1R093 2ARXA 3OGGA 4LORA 2VL4A 4JRLA 2W39A 3KD4A 1GYKA 4XHXA 4AEDB 5C8CB 5I93A 3ZYGA 4AOCA 2XHNA 5IATA 4QQPA 4XQWA 4IEXA 3HNYM 4AQTA 3HQXA 5LK5A 3U4XA 2VOWA 3J8F2 5CAZA 4AAPA 4NN0A 5A3MA 3LDKA 4H14A 3VHOA 2UYAA 3L9JT 5FZ4A 3INAA 5DDJ1 1W3VA 1J58A 5J37A 3PURA 4JGZC 3MYXA 2H0BA 1UZVA 2DUPA 5CB7A 3VD9A 3KM5A 1XYOA 4IQPA 4MZUA 1WCKA 4QQLA 1PGW2 3L2HA 3O1VA 4W65A 3M4FA 2WL1A 1FAYA 4JGYC 4EZHA 3RZJA 1QJU3 3PUQA 5DUXA 4DINB 1KGYA 4NPRA 1O6UA 4P5YA 1VLNA 3KZ4C 3RQ0A 4B1LA 2J1VA 5JMOA 4RQPA 2ZHMA 2R7EB 1L7QA 1PM4A 3TB0A 4YARA 4YG6A 5D2AA 2DCTA 4XJZA 3MPPG 3V0AA 5FOBB 3ORJA 3D82A 3UESA 3ZN5A 4AHXA 1POV0 4Y1VA 4AFCA 1ASJ3 1DQ1A 3BVCA 2KM2A 3PTYA 4IEPA 1H2LA 1NCQA 1U5ZA 3W21A 1S0JA 5C9AC 4DQAA 5A7OA 3AZVA 1NAEA 5DAXA 3AMHA 2ERFA 2W95A 2YBSA 5JPNB 5JI7A 2XKPA 2Z69A 5JOWA 1MZ5A 2E32A 3IIIA 2YYOA 4GKYA 3RMXA 1H6YA 1IG0A 1RUJ1 3AMMA 4KG8A 3T1LA 5BUVA 2VW1A 5JZGA 1CGPA 2J1SA 5H9RA 4QPIA 4LBJA 1X8MA 3AMNA 4CEYB 4HETA 2QKDA 4CCJA 1G6NA 2AYHA 2XL7A 3WQ0A 4NPLA 3H8XA 3F95A 1RUC3 4OMCA 1T2XA 1GZ9A 3HNBM 2E9QA 1ZYBA 3EHKA 1QQP3 4TWTA 1R1A1 4AZZA 2XPJA 4QPGC 3QCWA 1RGSA 2Q30A 1JS9A 2ETEA 4XMIA 3BKZA 2ORXA 4JC1A 4K20A 1PK6A 4D6SA 1SBDA 1YFUA 2DCYA 4X8PA 3WUCA 5IFPA 2R16A 4CXWA 1QXPA 4XFFA 5CKMA 5C8CC 5IVFA 3RGBA 3VBRB 2UY8A 1LB2A 1OQEA 1MEC3 3FHQA 4W8JA 1MEC1 2YUEA 3KV4A 3J7MA 3OUHA 5JDBA 2WO7A 1C4RA 5ERLA 3HQUA 1C5IA 5FYTA 1AVBA 4LBOA 5EJ1B 5A1AA 3GZUC 3I7DA 3ZYJB 1RVF1 1YQ2A 2VXRA 4XJWA 5L36A 4FOYA 1US2A 1PGL1 1XE7A 4ASLA 5EIYB 5FYZA 2A3XA 4FSJA 5T52A 3WHTA 4Y3OA 2C4XA 3WINE 5C3PA 3VZLA 3HMYA 4I3GA 1M4WA 1O8SA 2AGSA 2UY9A 4MXWB 3VBSA 4DIQA 1UMIA 2NM1A 4YVWB 5A7WA 2KD7A 2JB4A 5BNNB 3D0JA 1VBC3 3H3UA 3PIGA 1BK0A 3DGTA 1WKYA 1O8PA 5FJKA 5KHKA 5HI0A 5FTTC 2Q0AA 4PQQA 2LW8A 3SCFA 1MQTB 4FO9A 1OQDA 1DQ5A 1XE8A 2VNGA 2ZEZA 5CU1A 1IS4A 1EPZA 2E6VA 3A21A 4M4RA 3OCPA 3ZFGB 2HBTA 3ZXJA 5CFDB 1AJKA 4NAMA 2RS33 4ZPIA 5FFOC 2XJTA 2DTWA 3THTA 1NA1B 1ZBE2 1X33A 5T5LA 5EJ3A 1VBE3 2Z42A 3QOPA 1W2TA 2BVVA 2DVAA 5IAVA 2OKXA 4AEKA 2P2KA 1YIFA 3O14A 5DAPA 1Q43A 3VKLA 1GMMA 1DQ6A 3K77A 3QD6A 3WG1A 2FDFA 1ZVFA 1YNAA 3GJAA 1Z78A 4QDQA 4WZCA 1KXGA 5FYMA 3DYPA 1Z7S3 3IDBB 2X5IB 3BI3A 2VY0A 5FRAA 4RGKA 1RXFA 2YDEA 5K0UB 4ORFA 2BBAA 3NKGA 1QDOA 3AYDA 3USUB 3WHUA 2HWC2 4R4ZA 1FPN2 3GF6A 4RFRB 1GFF2 4DS0A 4NRQA 1OPOA 5FPXA 3UJQA 2XMLA 3ACGA 2C5DA 1ODNA 1SPPB 1W9YA 5BPXA 2AENA 4INDA 3SXWA 3OEBA 3V56A 4FTBA 3AX4A 4J1XA 5F5AA 1FYUA 1RUI1 5HCHA 2YC0A 4ZONA 3E5XA 4EV0A 1W0PA 4ITCA 2E7AA 4GB32 4NROA 3U78A 2IVJA 2WZ8A 3N9MA 4DRRA 5IK8A 1UIKA 1S0DA 3M2MA 1RUOA 2A73B 2WLQA 2QQLA 5LBBA 2QBXA 1FOD3 4HANA 1V6IA 4YRDA 3T0AA 3AMQA 5FY7A 3U14A 3H50A 4XBQA 4MOAA 1YYNA 2DU1A 1SACA 2CAVA 3VBFC 4DB5A 4D7SA 3IDCB 2VC9A 5FZ9A 1CIWA 1JOJA 2JDHA 1WW5A 1VBA3 5FR3A 1PGSA 1AUYA 3NVCA 2CU5A 1OLRA 1E5RA 1VRH2 4BWOA 2RJKA 4QKBA 5IHRA 2JJ6A 3WQ1A 5CFCC 4BQYA 4UW4A 3AL6A 4BQ3A 5LY1A 1ZZCA 3GZTB 2XJSA 5GLUA 2J1TA 5J1XA 3T2QA 4EWDA 5I91A 2WNEA 4YVSB 4FPGA 3IAPA 2IXJA 1G9BA 3B3QE 3LPFA 3NAPC 5FWJA 1I9RA 3VN4A 4W6XA 1SQ4A 4CXXA 1BEV1 1XOYA 1PVC3 2PFWA 2VPVA 1ZRCA 1QEXA 3O0VA 2P34A 1QJZA 4M01A 4YW6A 4E9KA 4Z92B 4XACA 1W6NB 3JU9A 4B4RA 5ACA2 5FPZA 1OHFA 1W28A 3GZEA 2R1DA 2PHLA 4QXHA 2XWBB 3ILFA 5FY9A 4QQHA 5FPVA 1UOBA 1LODA 3RZHA 3W20A 3AP9A 3CL1A 2PYTA 2WAAA 1O3QA 5A3PA 4MGTA 4Q4Y3 1K5JA 3N35A 2ARBA 3WNPA 3PTRB 3TN92 1W6NA 3KMHA 1IS3A 1RUD2 4LE4A 5FMOL 3WNXA 4X8NA 4BISA 4YZ5A 5J09A 1MZEA 3AJYA 1SPPA 3MIFA 5GZEA 3DYMA 3S5QA 2ZS6B 1QHDA 1RHI3 1D2QA 3ZLIA 1D4VB 3ZMNA 3OPTA 4UFHA 2UWAA 5E1RA 3THDA 4DXRA 3UKNA 3AK0A 1ZZ8A 2ZAHA 4M3CA 4M4PA 3WG4A 1AR71 5IAXA 2HWD2 4K7JA 1NUKA 4MGQA 4IERA 2ARAA 4M3CE 3LA2A 1BMV2 3GBFA 2Y6GA 4GMP0 4MADA 4HKWA 1FV3A 4QGNA 4OQ9A 1C5HA 4E27A 3GNEA 1G9FA 3WF3A 4CEWB 1U5YA 1M06G 1ND2B 1AYM1 2EF6A 1IQAA 2NMNA 4CCOA 4YW2A 3VBUA 3I2DA 4CPBA 3RYKA 2XHKA 4H3WA 2YFUA 3NJXA 3NNJA 1W6MB 5FP8A 4CSWA 4CP0A 1W6MA 2LUWA 5IVJA 5JXIA 1JHNA 4LK7A 3I2IA 2EAKA 3OG2A 5FZLA 1VPHA 1D2SA 1RUC1 1ND2A 3ETPA 4IETA 4LPLA 4YG3A 5FV3A 5HPOA 1MS5A 3PU8A 3WV6A 2QQOA 1C1FA 4AK3A 4LNVA 5LW9A 5FJHA 5C3OA 4PJYA 1V6MA 3KS7A 4O65A 1IG3A 1B09A 2O14A 3LSEA 4N53B 1AR72 1MR5A 2RHPA 3I2JA 1HRV1 2R30A 4M0HA 5FZOA 5GLVA 1KQRA 5BNNA 4MH0E 1LHOA 4JGYB 2MEV2 2QQVA 3I59A 4Y26A 1TQ5A 3FMGA 1LULA 2Q5TA 1C8M2 1T6GC 1LOFA 4I01A 4K8FA 3UJOA 5FPAA 1W8FA 1H2KA 1SG3A 2KXLA 3Q8BA 3J7HA 1TNFA 5F6KA 1ASJ1 5JOXA 1CESA 2QNKA 1Q8PA 1ULCA 1PZ8A 3QH7A 1LECA 3K3OA 3J7LA 3PIJA 2H6BA 1NXD1 3OD4A 4QKNA 3PUHA 1NE4A 3D5OA 4A6SA 1ZA7A 3HBZA 4B4QA 3I2KA 4KH9A 3W59A 1REFA 1QH7A 2Y38A 2CDPA 2J1AA 1DYKA 3LEMA 3OD0A 2RM22 3N9QA 3WVJA 4AVBA 1W3XA 4QX2A 4FOQA 1LNSA 4WVMB 3DPRC 3JD72 3LOIA 5FKBA 1N1YA 4JQTA 4JQRA 1PMHX 1YXWA 3IDEA 2Y6LA 1CWPA 3QACA 3MLLA 3TRSB 3LA3A 3WLUA 3HEIA 2ZGMA 4JDNA 3T3YA 4N7UA 3I3MA 2Q8EA 3H7JA 3KT7A 3WDYA 5KC5A 1PM7A 4N8MA 1LJ7A 1N1VA 2DVGA 2WA4A 3L2YA 4YZ1A 2XXZA 1UOGA 4NHXA 2PAEA 1JYTA 4WM8C 4K21A 5JSOA 3RPQA 1XE0A 2J1RA 4QGMA 4YVWA 3X29B 5CADA 3TEWA 3O1MA 2A3YA 2W52A 1C57A 1WBFA 4A3ZA 3S57A 1JZ5A 2VMCA 3BN6A 4J6GA 1H1MA 1WW7A 3S0MA 1S0BA 2NPIA 1WA6X 1ENQA 1PIV3 2ZZQA 4NPMA 2G19A 2ENRA 3U1XA 4FFHA 1AYM2 4TXWA 3N9OA 4LIVA 1OF4A 2VMFA 2ZGLA 3AKTA 3V0AB 4Q1RA 2WT1A 3LAGA 3H8UA 2H0VA 4LHNA 1OPMA 2AZ5A 5LBEA 5ABJB 2FCVA 1JTZX 3K51A 1V00A 2LROA 2WWSA 3F2ZA 2BOIA 3IKWA 1N3PA 3I3DA 4LO7A 4C8DA 2UU8A 1YQ8A 4Q26A 5LWBA 3GZAA 2VBPA 3ITQA 5IWFA 5C6CA 1OSGA 1VE0A 4S2HA 1F15A 1RVF3 1WA4A 2TUNA 4AVAA 2BU9A 5AFEA 5FZEA 4XVHA 2P6CA 1O59A 3LPGA 4QWNA 1RXGA 2WJSA 3SCHA 1AR62 4ZXKA 1X8EA 1GOHA 2R49A 4I0AA 3N7MA 4Y33A 1QXJA 4EZ4A 4NHYA 4NO4A 4YZ2A 2JD4A 5FZCA 2VVEA 3VKOA 3GHMA 1FI2A 2I74A 1HRV2 4L97A 2PAKA 4IV1C 3OBTA 4YGCA 1AR63 3POJA 2DWRA 4AI3A 5A6ZA 5CISA 3ZFEB 3D4KA 2PMWB 1URXA 3J8F1 4Y24A 3T2TA 3WDVA 1IS6A 4GJYA 4QQOA 4P00B 2WWUA 5LB6A 1GWLA 2D93A 3VZKA 5FO8B 2LM3A 3K2OA 4GALA 3ZIWA 2QZ2A 2X53S 5C4WC 3OY8A 4Y20B 4DOUA 2V4AA 1MVEA 1IKQA 4XETA 4Z82A 1RTVA 3KWVA 4OHVA 3P5BA 4Y1UA 2GNTA 4URAA 3O1OA 2W92A 3N9LA 3E6CC 4IL7A 3M70A 1LOAA 4PF5A 2Y6HA 3ZDVA 1RUJ3 1ND3B 2W68A 5IVEA 3CDZB 1W8TA 1LTEA 4E2SA 4AG4A 2WWJA 1H6XA 1S0IA 4J1WA 5CKQA 4BIFA 5L7OB 2BP6A 3S6PA 1AYN2 4GKXA 5L19A 2JWPA 5LA9A 3ZYIB 1AR92 4BQ4A 4QU2A 5LATA 5FZHA 4X6RB 3O0XA 5IW0A 3NNLA 1NLQA 1ZZBA 3PJYA 4XZPA 1OI6A 2A70A 5FZKA 2YG0A 1BJQA 4WVMA 4A41A 4A44A 4CCDA 2QJVA 4AI8A 5GZGA 1VALA 1C8M1 1U12A 2K0GA 2WT2A 4LO8A 3Q8AA 2YHJA 5JI9A 2VNVA 3I4IA 4Y4YA 3WNNA 3FZ3A 1JW6A 3GBWA 2ZX3A 3WNMA 3T2PA 1GKBA 1RJ8A 1J3QA 4CYDA 4ES9A 1NCRB 4CUAA 3PVOA 2W5FA 4O9EA 1S0EA 4YSFA 2L9LA 1RUH1 2RM23 3HVDA 1Q8OA 3VHRA 2YC4A 1MACA 3MUZ1 3ACIA 5FYSA 4PF1A 4H7LA 4TLGA 4YWAA 4ZS3A 1K42A 3AYAA 4AFMA 2VZSA 1LOCA 1DQ4A 3OJBA 1DLLA 4XTPA 4B4PA 4NE9A 4XDPA 3T08A 3VDDB 2Z4FA 3V65A 5F6LB 4LUKA 1JI6A 3ALQA 1RUG3 1LOGA 3WW1A 3MIDA 5F5CA 1QNWA 4QHBA 1HQLA 5CVRA 1GWMA 1IKPA 3A23A 4IV1B 4FQZA 2YC2A 5H9SA 1JZ7A 1XPWA 2RR11 5FY1A 3JZVA 4AGVA 1PK6C 4NIHA 4YVSC 1NA1C 2RDRA 3LF7A 1OLME 3M3EA 3FL7A 2Q8CA 4BDVB 2WZPP 5LA2A 3AJZA 1UF2C 4Q8KA 1CAVA 4LBQB 4Y5SA 5A32A 2WZR3 4E2QA 2OIIA 5IVBA 5FXXA 4I0WB 4GB33 5LY2A 4YM2A 4JHZA 4DFSA 2X29A 4E2GA 1KJRA 2VZQA 2E51A 3AVSA 3K46A 1DZQA 4UWDA 2XJQA 2P1BA 4KG0A 3O0WA 4CEWA 3VV1A 3ZN6B 3FFZA 3R4UA 5L7OC 2RE9A 3LEIA 2EXJA 4JDOA 3RYRA 3SISA 4F83A 3A22A 3WOGA 1RHI1 4IV3A 3PMEA 1S2BA 4IEZA 4JKMA 4BMBA 2H6CA 2Y60A 4BOWA 1BCXA 3WF4A 5FPBA 1HIXA 4DUWA 2VUAA 4H2AA 3R6SA 2KA3A 1XNAA 5JUVA 4GULA 3MW2A 4RD7A 3POFA 4Q5OA 5FY5A 2VTXJ 4P9YA 1VMFA 1OH4A 4XIKA 2IXCA 3SKVA 2OQ6A 2R061 4XQDA 5KHHA 2BWAA 2ZMNA 4BQWA 2MEV3 2P3IA 3BOPA 3LB9A 4BXSV 2HLEA 4QB2A 5A33A 3VBHC 4PBOA 3ZFFC 2AEZA 1HN1A 2X09A 2JKBA 5SV8A 4R9CA 2BTVC 3SNMA 2WT0A 1MPXA 5T5JA 1YQ5A 5J3UA 1UD1A 2CDOA 3VL8A 1OD5A 3JQWA 5I8SA 3WDWA 3ZXGA 4CA9A 3GXUA 4DXSA 1WLCA 2HWE3 3MV01 3OSDA 4JGZA 5JVVA 3ZYRA 5C71A 4PLMA 3FUOA 3K4DA 2OZJA 1JYXA 3AP7A 5L73A 3VBRC 3GCWA 3MHZA 4EYUA 1XNTA 4FPFA 2OUHA 3FX3A 4EE2A 2W0XA 2WZR1 5T54A 5F3IA 3ES1A 1JYCA 2HWD3 4KBZA 4QM9A 2FQPA 1MS1A 2ADDA 2D5FA 2VOVA 1SDWA 3FLPA 1CAXA 3HD8B 4M3CF 4A3XA 4D0QA 1OQ1A 4PI0A 1CAXB 2GDFA 4Y22A 3BALA 2B39A 5ANNA 1SFYA 4AR2A 4CZSA 3RZKA 5L9BA 1CPMA 3BTZA 1K3IA 2RV9A 4NVPA 4R4XA 5EP9A 4Z2WA 4AI1A 2VVDA 2VAUA 2BNNA 4RYDA 3IDAA 1X82A 3SEPA 2ZGTA 2YY1A 4G3YC 3LA7A 4S2DA 2WNUA 1Z7S1 4WVVA 1UOJA 4CCLA 4FBFA 2J22A 2VW2A 2XVLA 5ACA3 3TEYA 1HQNA 2A6YA 4W4ZA 5B4NA 3IWZA 1O5UA 5J36A 1RUH2 5HCBA 4AYUA 4M00A 1BEV3 3AC0A 2LALA 1RMU2 3CJIA 3NNMA 4RS5A 1S55A 4BB3A 5G04L 1PHMA 3DECA 4HVOA 2XQXA 4YZ4A 3FE5A 5IT6A 1N47A 1GZTA 1DGWA 1Q5OA 1DHKB 1XNBA 2JE8A 1LR5A 2Y8KA 3BYWA 2W1QA 4PT6A 2OA2A 1CN1A 4HT1T 3PVBB 2WC2A 5JSRA 3N36A 2BFUS 4CTEA 5JPMB 1J3RA 2DF7A 2ILMA 3BGAA 3DYOA 1QJX3 1QJU2 2VZTA 1ULPA 1PO21 4COVA 1IHMA 2P37A 3M3CA 4FPCA 4IV3B 3QBQA 4Y1XA 3NNFA 2QQPA 2NLRA 5C70A 4IE4A 1MS8A 2J42A 2JDUA 5F5IA 4QD2A 1W8WA 1K5MA 4YFZA 5JMCA 3Q8EA 3EB7A 4YM1A 3VBFA 3BTYA 4YVSA 2PXJA 5DN2A 2PHFA 4WV8A 5GM0A 1HKDA 3S7EA 1DLCA 4IXLA 1Q8QA 1SFNA 1V6KA 3KVAA 4XF9A 2WZEA 1ZRRA 3HOBA 5F39A 4HONA 1R1ZA 1V6LA 4M0NA 4ISRA 3SMHA 4C0BA 1R092 2FCTA 2CGNA 2XONA 2OS2A 5A7QA 3MLKA 4HPKB 1W8NA 4TTGA 3BTXA 3E1F1 5HV4A 1YI7A 1O3TA 1A6CA 3U4SA 3VKFC 5FXVA 3IBMA 1UXXX 2VCAA 4QQ2A 5FPLA 4P9XA 3PU3A 3VHPA 1AL22 2RMU1 3TEZA 2B45X 1DF0A 4K3UA 4KWKA 1K5MB 2WFF1 4GWMA 2EXKA 2WFF3 1HXS3 5IK4A 1GR3A 4UF0B 5FXWA 3DXUA 2N7GA 1KJLA 1AYM3 1VMJA 3B9IA 1HB1A 5T5OA 3NW4A 2XVKA 3U37A 4AWDA 2BJSA 4E4ZA 1GICA 5LCWL 2RS52 4UBHA 3DKQA 5A3UA 4CCNA 4UT5A 3NAPB 4QHOA 1G9DA 3H3LA 3IB3A 1VAKA 1G9CA 1MS4A 2QQNA 4BK4A 1JUIA 2BERA 2ZGNA 4FQ4A 3VD4A 3VDBA 2JG9B 2PHUA 4MGKE 1Y43B 5TSWA 4AI9A 1GLHA 1UYZA 4S2FA 1HJFA 3WCSA 3RSJA 5K9YA 4XILA 3OYWA 4K9SA 2BRTA 2ZMLA 2D6KA 1V6OA 3OGSA 3CBNA 1DCSA 1XB9A 2G9ZA 4LLFA 1LAJA 3IAQA 5FYCA 1VBD1 2AC1A 4XJ9A 5EFUA 3G6JB 3KCCA 3HJRA 4HL0A 5A70A 4QPIB 5DXDA 1RB8G 2ZHLA 3NWKA 5C4WA 2XDVA 3ZKUA 1SCSA 2XBO3 2GC2A 3V0BB 2W47A 1YFXA 4JDMA 4YFWA 3RNSA 5LBFA 5FYBA 3JCIA 4EN6B 1VBB3 4AE2A 3CO2A 3CIHA 4L11A 1UL9A 5IUQA 4QMAA 1B35A 5A80A 4CEYC 4LTAA 4IV1A 4GJZA 5EPAA 1VBA1 3POWA 3ROUA 3U10A 2FZ2A 3KQ4B 2HKXA 4MSVA 2JG8B 2PLV3 1CAWA 2VM9A 3URFA 1VBE2 2GC3A 2WABA 4FVVA 4GH4A 5LA0A 1CX1A 1UY3A 1WD4A 2HWC1 3O1TA 5CG8A 1OC1A 4CDWB 3DUIA 1W2UA 3A0KA 5HCAA 3AZXA 3BUCA 3O1UA 3VBOA 1D7PM 2BPA2 1HQWA 1BZWA 1AX1A 5AC92 1K5MC 2C1FA 3MIHA 1POQA 1DYPA 2HWF1 1FXZA 1ONAA 5A3NA 4C1WA 2WYSA 4HMZA 1C28A 2E53A 5FIXA 1PNFA 4UFKA 3KB5A 1HB2A 4C1XA 2J1UA 5AFBA 2QTWB 2Q8OA 1W9WA 3KLSA 4QDSA 1DP0A 5ACA1 5JWPA 1UKGA 1JYWA 4IEOA 3KQRA 4OMDA 1PIV2 5FCCA 4LOTA 1LEMA 1O7FA 1SLBA 2JDYA 4A6OA 4YVWC 5DAVA 1XC6A 3NV4A 3N7JA 1EYBA 5J96B 2JENA 4PLOA 1VR3A 4FAHA 4LBQA 4BQ1A 2VTFA 2EIEA 4JKKA 3MUY1 4NRPA 2DU0A 5JXGA 5FQ0B 1CR7A 2VQAA 1V9U3 2BW8A 1RUE1 3KV5A 4PIYA 5H9PA 5KHGA 1YQCA 2DFBA 1G9AA 3ELNA 4J25A 2RVAA 5A3OA 1ZA4A 3WT3A 1ZNPA 1VBB1 1EAH3 2D3RA 2DYCA 1AHSA 3MIEA 1NT0A 3I3BA 3HIFA 4IUGA 4OUMA 4UYBA 4N9IA 4NJ4A 5FMCA 2DBIA 1O4TA 3DKWA 1UN1A 2HWF2 2QDNA 3RZZA 4BQXA 1UMHA 1ZREA 3RRDA 1XNKA 2QQKA 4QPIC 3ZYHA 5IVCA 3EJKA 3GDBA 2PHWA 1NCQB 1D4M2 2GC1A 3HAGA 4WM7B 4NHKA 4CP2A 1PO13 1QMJA 2P4EA 2UYBA 2XL9A 1CZVA 2ZZJA 1MS0A 4XPVA 4D69A 4ET7A 1OBNA 5IVYA 2FDHA 1AR83 1NQDA 2V5DA 2XLGA 2OQ7A 4NR1A 4RQPB 4LHSA 4P5HA 3O1SA 1E5IA 4AVTA 3JB4C 2ZX1A 4YW1A 1DGRA 2A6VA 1NQJA 2ZGKA 4YW7A 4DRVA 5KC6A 3BODA 1SBEA 1LOFC 1YIPA 4Q4Y1 4XJAA 1FX5A 2VMGA 4KMQA 2DUOA 2RR12 4LA2A 1O3SA 2BUKA 3V64A 4NWVA 2CGPA 5EQUA 2WNOA 4I02A 4CDWC 3K4ZA 2R063 5BNNC 3VBRA 1DGWX 4CPBD 3J8F3 1UQXA 2YPDA 4XCBA 3WZ1A 4Q27A 4OI1A 2AH2A 3AP6A 4B8EA 3NKTA 2JECA 2HEYF 1SZBA 4XYXA 1WCQA 1PK6B 1SBFA 4QX0A 2VZVA 4JGYA 4LO6B 4GH4B 4BU2A 4U2AA 2Y34A 4HVRA 3OBZA 4AAXA 1EPWA 2BEOA 1BLZA 3E5UA 2LRPA 3MBWA 4IE0A 4RHV2 1L7LA 1JZ8A 4IW3A 1TME2 1XYPA 4KGQA 2Y6JA 4KNCA 4IEVA 1QKQA 1DU3D 1PX4A 2WIIB 5KHJA 4CVUA 1ULGA 2ZXQA 1BVVA 3C3VA 1JHJA 1ENSA 2D5HA 2CTVA 1UY2A 5GLWA 4YGEA 2ZJCA 1UX7A 1H8TA 2A1XA 2ZABA 3R4DB 4RGGA 2QQMA 3VD7A 4LQRA 3FC0A 1RUF3 2Y64A 4BPZA 3FFQA 1SDDB 3ZFEC 1LHWA 2Y6FA 2XJUA 4EROA 5A6QA 5K0UC 4QGLA 1AL0G 4CU9A 2PLV2 1QJFA 3RG0A 1BK1A 2CV6A 5JR7B 5I0RA 3ACFA 4LR4A 1OH3A 1EV12 2MEV1 3P3PA 5FUIA 3MW4A 4PIZA 3ZYBA 2RS32 1NYWA 3THCA 1RUNA 5C4WB 5A7SA 1CIYA 1HJGA 2DCZA 1VBA2 4BXFA 1HN0A 2DURA 1ZX5A 3CF6E 3ZYFA 4CDUC 4D6QA 3ON7A 3AKPA 3AZYA 3B69A 2ZTNA 4K8RB 2PQQA 2GH2A 4YM3A 3ZSEA 1VBE1 1AJOA 5D8AC 3VHNA 4ZZ5A 4K1ZA 1JYNA 5C3RA 2FDGA 1YJKA 3FBMA 2DVBA 4ARXA 1YJLA 2YZ4A 5A1LA 2GH8A 4A45A 1YEWA 1QQP2 3KF3A 5GALA 2WNVC 3BU7A 3N9PA 1KFXL 1RUD1 4Q4V2 5IJRA 2G1MA 3E5QA 2D6MA 4MX3A 3G7DA 2VZUA 4P08A 1XSRA 2FDKA 4HG6B 4QKDA 4K40A 4CDXB 2DVDA 3EBRA 1N1SA 4QPGB 5DDJ3 3OTFA 3ZKYA 5I8TA 1EV13 4NIAA 1OUSA 2J7MA 3ZR6A 5JLVA 4UF0A 1QJX1 2R32A 1W99A 4MHRA 5E89A 1BMV1 3CZJA 1CQ9A 1QJY1 4KI5M 4XAAA 4PHZA 4KL1A 3MF6A 4RN5A 2WS93 3Q9OA 1CZTA 1WW6A 5A7NA 1JYVA 2IFWA 5FP9A 5BNQA 3APBA 1HRI1 2PHXA 2BYVE 3SC7X 4CCKA 1UU4A 4MGSA 1GOGA 1EAH2 1UCXA 2JDMA 1W6OA 3C7HA 3CKHA 4XOGA 5A3WA 2XBO2 1DBNA 2Z5WA 3VBOC 1OFNA 4ZZ8A 2OVUA 3K3NA 3N3HA 1VBC1 1BXHA 5EXOA 3VZOA 3LEKA 5HXVA 4AVSA 4Q4V1 1H4HA 4EQVA 2OPWA 1I3HA 1UW8A 3JB8A 3OOXA 1LHVA 2D44A 5HBAA 5EJZB 5EYYA 2RDNA 2JDZA 4Z07A 1COV1 4CP9A 4Q4X3 3P1IA 3OEAA 1W8OA 3H1MA 3RVHA 1V70A 2WZR2 3T09A 2CY6A 3S30A 2R072 4ES8A 5FBZA 4HK9A 1OA2A 2DCKA 3EMRA 3LDRA 2TEPA 4R8HA 2VMIA 3ABZA 1REEA 4QXKA 2EVXA 2P5BA 3RI9A 3WX5A 1ZBE1 4HN1A 2A3WA 3AFGA 2HWD1 4RR3A 4X6QB 2DV9A 2IXHA 2R6QA 2Y0IA 3H7YA 4FPEA 4Q29A 3SKJE 5D8AB 1W39A 2XBO1 2YU2A 3T30A 1R64A 4FPJA 1COV3 2GNDA 4RHV3 1S0FA 3R0RA 3AVRA 4QU1A 4UAPA 5LASA 1XSQA 4UFJA 3PDQA 1POV1 1WLTA 3CJXA 3MDPA 4FPLA 4QDRA 3WCRA 4N53A 1EY2A 1LU1A 2FHRA 2WUHA 3LQCA 2BQPA 4GMP3 4RR3B 1WWYA 2WLPA 2VD7A 5GZDA 3WQ7A 5GJ6A 3LIGA 4Y5TA 4OI0A 2RS53 1OA4A 1ULOA 3BIWE 3DPRB 3UT0A 2AREA 4QB6A 3FLTA 2J1EA 3POBA 1ST8A 2AEYA 5F7UA 1EUUA 2UWBA 1GBGA 2ZBJA 3AYEA 1GV9A 4JRAA 3WD5A 1QOSA 2JG8A 2XJVA 2EIDA 3FBYA 2BGOA 1ZRDA 5AVPA 1HV1A 2EXIA 3BOWA 4CU8A 3E6BA 3ZOIA 5GZCA 4GB31 3VBUB 5F32A 5FUPA 5LZ6A 3NQHA 1IPKA 1MQTA 3AKRA 2BVBA 1R083 2RJ2A 4B29A 4BYYA 4OHWA 2A75A 5JOYA 5FZMA 1BBT2 3BU0A 1PNGA 1NKGA 1NY71 4GXLA 3LD8A 4Q0QA 4O7XA 3NSTA 4C90A 3VBFB 2HBUA 4XC9A 2GU9A 4N9HA 1NLSA 5C3SA 4XF4A 5KXBA 2QFEA 3GHNA 1MVQA 4CUBA 1DZRA 1UU5A 3ILRA 1EAH1 1DQ0A 2VH9A 2WSVA 4QPWA 1UU6A 3AZWA 4XIOA 3JXSA 1GNHA 3RZGA 3AKQA 4JGZB 2YBKA 3NV2A 1PMJX 1CJPA 1UKRA 3ES4A 1SLAA 4GWIA 3TYJA 4AFDA 3PL0A 3WNOA 1XQNA 4LBMA 1Q8SA 4QPGA 5HCFA 5IK5A 2IXKA 1GQPA 1YC61 1QF3A 1XU1A 2MPFA 3KV6A 5D8AA 3DPRA 1VP6A 1R1A2 4DO0A 5KXCA 1S0CA 5IVVA 2ZCWA 3D0SA 3J4UH 1GP4A 4LMFA 1GSLA 4F8AA 4QX7A 5JCTA 1W06A 2XH6A 4XF1A 1O4ZA 4MO3M 3AB0A 4EWAA 1S2EA 2EALA 1RUE2 1WBLA 3MIGA 4COUA 4OLLA 2VQUA 4XAEA 3GBGA 3CJIB 4RS5B 5B2GB 4Y5Z0 1NXMA 2X8KA 2ZEWA 1V0AA 3E97A 3HN3A 3MF9A 4HFSA 1X7NA 4EN9B 1NCRA 1DZTA 1W8UA 3B94A 4XFHA 1ULFA 3VB9A 2WNUB 1FPN3 1H8VA 2RS11 1QJY2 5C9AA 5FZ1A 2YROA 3RDIA 5FZ3A 2WN3A 3ZYPA 4COYA 4ZU5A 1FV2A 1ULEA 3N7LA 4HZFA 4B7EA 5D1IA 3KCYA 1Z0HA 3CLPA 4FXKB 4MHUA 4FAGA 1OF3A 2GNMA 4PDWC 2ZX4A 4CP1A 2EIGA 5EYXA 1JH5A 3LIHA 4NAOA 2Z2SB 5BXXA 1Y9MA 3ZXKA 4E4HA 3THPA 4IEQA 2WO2A 4PLNA 4URTA 2IFRA 1GZCA 2P6HA 3ENRA 4NIIA 2JICA 4LA3A 1W6OB 4DUXA 1ND2C 3MEPA 2QVSB 2WFPA 2R0FA 2ZGQA 3OUIA 5CEHA 2HWB3 4QXCA 3VDDA 1XXNA 2GNBA 4EJRA 1LESA 2R062 4D94A 2E26A 3HQRA 1QXRA 3PMSA 3H9AA 2VQTA 1HB4A 2ORZA 3WF1A 4EN8B 3UK9A 1CAUA 4Q2FA 4XJ8A 3W58A 2A6WA 2Q8DA 3M1HA 2F4LA 1GANA 4XZUG 1AR82 1DG6A 2B8MA 4L92A 2GP3A 3FLRA 3T4VA 4IE7A 1X36A 5FDBA 4IGOA 4CXYA 1QOTA 4LITA 3PUIA 3A4UA 1GNYA 1TME3 4SLIA 3WNKA 1TME1 2JIJA 4L8QA 2D97A 3I97A 4UI9L 1WMFA 3WF2A 1IPSA 4CDXA 5CZKA 3I54A 4Q4W3 1PVC1 5FYYA 2IXIA 5L9RA 3WQBA 4ASKA 2Y0OA 1XNCA 1OKQA 1YFYA 1MZ6A 3AMPA 2R042 1L3JA 3TNQA 3C2UA 1VB2A 2GC0A 2VMHA 3I2FA 5BV6A 2JIGA 1QJEA 4E8CA 4UW3A 5J48A 3WW2A 3HT1A 5DPNA 3EO6A 2WBKA 5AC93 2HEVF 4LBNA 4RL7A 3UKVA 5BNPA 3K4AA 4DY3A 4BCUA 5C33A 2D6LX 4WM7C 1O4YA 3TN91 4N90A 2XOMA 4FFGA 4AI2A 4LHLA 3B01A 4XBLA 4H7MA 3ZSLA 2VCBA 4LJHA 1RUH3 2RM21 2XJPA 1STMA 4XW3A 3WDUA 5DG1A 2P3KA 4UFLA 1FNYA 1NCRC 4DXTA 1AL23 5L7OA 3WY6A 4ZKTB 3KV9A 2XG3A 5A7WB 1FOD1 4LKEA 1I1EA 2YB7A 4BLJA 3HT2A 1ENRA 3BB6A 4AFBA 4AXOA 3RJRA 1ZZ7A 1H0BA 4AGRA 4LBKA 2HYXA 2ZKNA 1PO12 1HLCA 1WCSA 2B42B 2GALA 2X5IC 3DEMA 4AQ6A 3VKMA 2P3JA 2WDBA 1QWRA 2ZGUA 4L9BA 3I8TA 2ZKLA 1UPSA 2YBPA 5H9QA 3P3NA 3OYWB 3WW3A 1G8WA 2BWCA 3PVNA 1RUI2 3PJQA 4U36A 1S4CA 2JB8A 3T1MA 4BA6A 4AW7A 3MFCA 4LO4B 2JG9A 2VNRA 1QU0A 1MS9A 1LGNA 3HPNA 2VXJA 4O61A 5F2SA 1PO23 2ZACA 4V1PA 2JXAA 5A33B 1H9PA 1F4HA 4BIOA 4QAWA 1AR91 2D6OX 4GZ9A 1AR93 5F37A 3ZIXA 1HV0A 4QX1A 4LHKA 1UZWA 1RUG2 3VBOB 5T50A 3WUDA 1JZ2A 2DVFA 1VJ2A 4CEYA 2Q1FA 1YQ6A 2ZAAA 3WP5A 4AEDC 2D7FA 3FHIB 1WGPA 3EYPA 3UKTA 1GP6A 5FBJA 3WG2A 1UY0A 1AR61 4YG0A 4R9BA 1OXCA 4NWWA 4RGAA 1JOBA 4ONUA 2CWSA 5APAA 4AI0A 1ASJ2 2OX0A 4BE3A 3AM2A 3LKJA 3TOJA 1CONA 5FYUA 4ZHNA 2O8OA 2VUCA 3UL2A 1KRIA 1LOBA 4RA0A 3JUUA 2PHDA 4L99A 2RJLA 2B7YA 1WMEA 4WBBA 1ND3A 2A7AA 1RL3A 1XJAA 2R043 3VGIA 4CDQA 4AQSA 2ZPXA 3T0DA 4COWA 1VAVA 4G4FA 3VZMA 2WS92 2VZRA 1J84A 3AL5A 3MGUA 4I09A 4UFMA 5IYYA 1O3RA 2WNVB 2FDJA 1RVF2 4Y1YA 2E7QA 5B4XA 5T5PA 3TN93 1W9SA 2PHTA 4PI2A 4Q4W1 5T3NA 4A2UA 4DEVA 3ACHA 1W05A 2ET1A 3IN9A 1SLLA 4B7KA 1IZ3A 1GZWA 2QCSB 4RR3C 2V09A 2YGLA 3D6EA 2RMU3 2ZMKA 2I07B 4TZDA 3CQOA 1AX0A 2NN8A 3N7KA 1JMUB 3NJYA 3FHAA 1BYHA 1I5PA 2GN7A 1CD3G 3PHMA 5SV5A 5A6XA 1KITA 1UYYA 3H8RA 2QZ3A 3NJZA 4NHLA 1EP0A 1POV3 1TVGA 4AEDA 5KHIA 5DDJ2 5JSPA 2CYFA 1US3A 2VOTA 4JCKA 1J3PA 3LGRA 3I2HA 5FY0A 4AF9A 4CCCA 3B93A 1COV2 4XUOA 3HR9A 4OUSA 4R9DA 2VGDA 2I2SA 4FI9A 5FO7B 1WUVA 3I3EA 1W90A 4BMEA 2CHHA 4W50A 1DGLA 3LWCA 1A8DA 4QB1A 3OF1A 5J98B 4Q4Y2 4IEUA 5C7GA 3KCXA 2Z79A 3CHXA 1F8VA 2W2IA 1B35B 2ZGOA 4HPKA 4QKFA 1NY72 1CJDA 1BQPA 4OHZA 3AXDA 1S0GA 3U11A 4CRQA 4FOVA 5BNOC 2W3JA 3RZLA 1WLDA 1YLLA 4LULA 4MVTA 1Z7S2 1JXNA 1PGL2 1J1TA 1SFPA 1ACCA 3CZUA 4D7YA 2GSYA 1JU4A 3WR0A 4IEYA 1H4GA 2MNGA 3ZR5A 4AGGA 4F3JA 5C9AB 2YGMA 2XUMA 1FPN1 1XU2A 3PVEA 5FQ0A 3ECQA 1W2OA 1X9TA 2G4IA 2WKKA 3C7OA 3SCGA 5F3EA 3GGLA 4PIXA 1O91A 5I0SA 3EQEA 4GD4A 2YFZA 3SH5A 3W5MA 1ZBA1 3ZSJA 3UNPA 3ASIA 4XBNA 1R1A3 4N43A 1PVXA 5FYVA 4CCEA 5A3LA 4OZOA 3MFAA 1ZRFA 3SHRA 1IGOA 2F4PA 3POSA 5F5QA 1PO22 2X05A 4JZRA 5LRRA 2C9AA 1IS5A 1S2KA 4AFAA 4W6YA 2ZA9A 4FPHA 3NV1A 4JVAA 5FMOS 3WXPA 5BNPC 1OLQA 2RG4A 5FKCA 1TMF1 5FZAA 3N9NA 4QPYA 2ATFA 2VBBA 4HN0A 5CFDC 4Z8BA 1G7YA 4XUTA 5I0DA 1VAMA 1XRUA 2W91A 2PLV1 3WP3A 3WDXA 4BZ4A 4Q4W2 1RINA 4CDUB 2RS12 3VDAA 2W94A 2GMMA 2DFCA 4LBLA 2JDPA 1N3QA 2R1BA 3OUJA 3QH6A 3FUQA 4XE9A 5FMBA 4ARYA 1VBB2 1ZZ6A 5K0UA 5JAXA 2YXSA 1YHFA 3S7IA 2QQWA 5IFTA 1W0OA 3AFKA 2VU9A 1H8TC 5I0UA 1OOPC 1PGW1 4A7ZA 4IGQA 4V2VA 1R081 1DDLA 2PQSA 1ZRIA 3J7NA 4P9WA 4Q0VA 1FATA 1SLIA 1VIWB 5EV7A 1OOPA 4Q0SA 3SLIA 3FWEA 2OZ6A 4F7ZA 2D6NA 2CAUA 1PZ9A 2VG9A 1XYNA 4I3PA 3ZFGA 2D3SA 3VLBB 4ATFA 1H1IA 1QJX2 1Y4WA 3D8CA 3MV11 5ABJC 4G9SB 2B46X 3ZFGC 3NMBA 2RS51 4XMAA 1AYN3 2VECA 4KU7A 1AYN1 5FY4A 1SMVA 1KS5A 2ES3A 4CU6A 2W1WA 2LS6A 4A4AA 1GUIA 5CNAA 4ZS2A 2EA7A 5CIRA 3WEZA 4TYSA 1W6PA 2ZGSA 5JR2A 2XWJB 5DUWA 3POGA 1QNYA 3UYJA 3ZPOA 1PVC2 2X10A 1ZM1A 2XGXA 2ARCA 4BJ0A 4IGPA 2QQJA 3ZMOA 3KGZA 2Y33A 2DTYA 4AVCA 2R0HA 2NP0A 3LE0A 4JAAA 2VQ0A 4P9GA 5CFCB 1W03A 3K48A 4XFCA 5GLZA 2F17A 3U75A 1FNZA 4Y1ZA 2W46A 2GAUA 1WMDA 2Y26A 4XUPA 3HWJA 1RUE3 1RMU1 3I49A 1W9FA 5KXEA 4XFIA 2BGCA 4LLOA 4A7YA 1LRHA 4FFFA 4OI2A 3FJSA 4PQ9A 5E16A 5CA6A 4QX3A 1F9KA 3OGRA 2QE3A 1HXS1 2QUOA 3LEGA 4CUCA 5BY5A 3IMMA 3UGGA 2B5HA 3POYA 3AP4A 5CFDA 2HYKA 4WZFA 1JN2P 3OPZA 2D40A 3HNMA 5DZGA 3U07A 3CEWA 3LSDA 4UBGA 1LENA 5DQ0A 2VZOA 4Q4V3 4DEQA 4DXZA 2PAMA 2K2SA 2A71A 5IK7A 3USSA 1REDA 1W2AX 2DDUA 4LKSA 2ZX0A 1UY1A 1PO11 1AZDA 4ZU4A 4DPNA 1U0AA 1A34A 5FLHA 1OOPB 4LK6A 5FREA 4N43C 3VZNA 1H2NA 3MLJA 1F2NA 4BHPA 2R073 1V6NA 2HWE2 4AHZA 4CDQB 4XHBA 5FUNA 3KGLA 1H9WA 1ZBA2 3IZOA 5EZWA 4LKFA 4DUVA 1FMD2 3E6DA 2E7TA 4Q8LA 4CU7A 2HWB2 2VULA 3AKSA 2JX9A 1ZBA3 2CSGA 4MGZE 5CKNA 1DIWA 1R082 3UGHA 1RIRA 1UWWA 3QLQA 1GWKA 4MXWA 3VBSB 4FFIA 4E4DX 1TMF2 1WCDJ 4KGGA 4BH9A 1E57A 3C7EA 4CCMA 2OXBA 5FZ7A 2D3PA 2E31A 5BNOA 5J7MA 4L2NA 2VUDA 5FYHA 1UYPA 4YYOA 1X9PA 2BBVA 3JBG2 3W5NA 4GAZA 4FPKA 1LGBA 1RUC2 5CG9A 3ZXLA 4GIQA 5FAXA 3W9AA 5A1FA 4XXAA 2VBDA 2ZEXA 1LU2A 5DZEA 2C6SA 1A3KA 1OVSA 5K8SA 4GH4C 1ZZ9A 4P02B 1V9U1 1W0NA 4YNIA 1HRV3 2D43A 2XUEA 3DV8A 2XLFA 4ISQA 2C0ZA 4JTOA 4XJUA 1H2MA 5JIUA 2FBEA 3NV3A 4QHZA 2UURA 2VTXA 4YZ3A 3RJ2X 3O1RA 2IC1A 2V73A 3BTAA 3MICA 1NZIA 4N53C 3ZDSA 2YV8A 2VMDA 4Q4X2 1GP5A 3OPWA 1CZSA 4FP3A 1F31A 1HDKA 2BNMA 1ND3C 3A7QA 4LKDA 5FZGA 1XNDA 3SH4A 1I6XA 3ZSKA 4GWNA 4LBQD 2VUJA 3I2GA 3SQOA 2Q1ZB 4UFIA 4DNYA 1RMU3 1MZFA 5JZGB 2HWC3 1OKOA 1U5XA 3N4MA 1LKNA 1NLRA 4LXLA 5I0TA 4HSLA 2IVIB 2W1SA 5A32B 1NX9A 3ZN6A 1YO8A 4UW6A 1UYXA 5K7PA 2JKXA 3PUAA 4LEJA 4D6RA 4K1YA 4OQ8A 4I0BA 2RDSA 1D0HA 4KWJA 5DABA 3P6BA 2AACA 2ZHKA 3IPVB 4Y20A 2WYFA 3TAYA 3HBKA 3LOBA 1KS4A 1OFSA 1AXKA 2GN3A 1DFQA 3VZJA 5E88A 4CDQC 4GA9A 1WD3A 1VRH1 2ZOEB 1AF9A 1A8MA 3NO8A 4R9AA 1ODMA 1I5ZA 1RC6A 2CNAA 4OCTA 4OUEA 4DMIA 3ZSMA 2VR4A 5G05L 1QDCA 4E8DA 1PZ7A 4JTNA 5F3GA 3B7MA 1X50A 3C7GA 5FPUA 5FP3A 2WQ4A 4WM8B 2OYZA 1UO9A 4KWUA 4IE5A 1LGCA 1BEV2 1TEIA 3NL1A 5A3TA 4IE6A 2K9ZA 1VBD3 4HKLA 4UW5A 3USUA 3GCXA 2W9XA 4HKOA 3K75B 1D4M1 4UXAA 1D4M3 5F9TA 1UMZA 5BNOB 3ST7A 4A7KA 3SITA 3S5AA 4Z2AA 1OUXA 4XUQA 5F8PA 5FP7A 1GQGA 5A6YA 4OZXA 4D8MA 1VMHA 1FT9A 2YMZA 1O5LA 5HXMA 3C8XA 4S2GA 4QX8A 1CAWB 1AXYA 1UY4A 1Y9GA 3ZPYA 2VCCA 1QJU1 5C8CA 3DN7A 2WQZC 1HXS2 2IWGB 2WA3A 4JV4A 4CUGA 2WNVA 5DZFA 2RR13 4YW3A 1JYIA 1RUF2 1AR81 3O5SA 2JG9C 3IPVA 3LZZA 3TEXA 4WM7A 1V9U2 3B00A 1UZYA 1LEDA 4XFBA 1F4AA 5GZFA 2VZ1A 4AHWA 4LT5A 2VJXA 3VDCA 1CVNA 1OVPA 4MXVA 4EN0A 2HEWF 3MIBA 4META 2FMDA 3H1YA 2WQ8A 5DAQA 5FO9B 1TMF3 1RHI2 5GKAC 2QDRA 3OY8B 2JEMA 1QQP1 2W87A 4JX0A 1LHNA 2NMOA 3ZN4A 3ZXAC 2PHRA 5BNPB 4BK5A 3IIAA 2JD9A 3CMGA 3VD5A 2IUWA 2WO3A 4CDXC 4MYEA 3T2OA 3V0BA 2XLAA 3B02A 3GJBA 1VBD2 3VL9A 3MI8A 1ALYA 3LCPA 4XQ4A 4BM8A 2V72A 3AYCA 2Y6KA 2WAOA 3ETQA 2G9FA 3ATGA 4E4SA 2ET7A 1NCQC 2DCJA 2MHFA 2JDKA 4LIUA 3ZX7A 3JBG3 5DMYA 5LEKA 1UXZA 4YGBA 4DZGA 1H1AA 4HLTA 2VOKA 4Y4RA 5FY8A 3WDTA 1ENXA 3OB8A 4OULA 1WCUA 4XEZA 2IXLA 1JU3A 2FZ1A 2VE1A 4YPJA 2NYYA 2XB6C 1YFWA 4EWEA 2D6PA 4OI4A 2SLIA 1RUI3 1CPNA 1F5FA 1HRI2 2CGOA 1KD7A 3RMYA 2VCMA 1LCLA 4ZY9A 4AHYA 1SLTA 3VD3A 1APNA 4FPOB 5DAWA 3IT8A 5HV0A 1YUDA 5ABJA 2KR2A 1RYYA 3RZMA 5ISLA 3AZZA 1BVP1 4HOOA 2C9KA 2NZ9A 1TG7A 4AL9A 2C24A 1V6JA 2ZX2A 1XBFA 4TSVA 3DCQA 1D0GA 1UIJA 3H0OA 3I3QA 3JQXA 1C8M3 2AR6A 2BDRA 1W8ZA 1W6QA 2OUJA 4KWLA 3RWKX 3VBUC 5LBCA 2ZHNA 4CDWA 1QJY3 1SCRA 1IPJA 1Q8VA 2LTNA 3WG3A 3ZO0B 1AR73 3DXTA 2R071 3M3IA 4ATEA 4LOSA 5E8AA 2QQUA 3DL3A 1UZ0A 4ASMB 3RYPA 2D98A 2DUQA 2GMPA 4GQ7A 2WRAA 3ME2A 4OFGA 5JXJA 5DUVA 5C3QA 1BKZA 1T6BX 4D7TA 4YW4A 4XF0A 3JD71 3H8OA 5C5TA 4MLOA 3VDDC 3Q8FA 5FZBA 4COZA 3KHCA 1UZZA 4NMIA 4YW5A 1WW4A 3Q8CA 5AVAA 1SEFA 5FOJB 1C3HA 2P3YA 2OPKA 3ZFFA 1KDKA 2ZGRA 3VBHA 5LK7B 2HH9A 2UWCA 4M3CB 4V2WA 3M3QA 4NIGA 3PNAA 2TBVA 5BYNA 5AC91 5F3CA 1K45A 4IEWA 2JDAA 4PDWA 4FTSA 4QX5A
chains in the Genus database with same CATH topology
2FMYA 1KDMA 1DQ2A 4C91A 4WVWA 4TLFA 4YGDA 1Q3EA 2XKOA 5CBLA 2HJIA 2BFUL 3ILNA 2XVGA 2GMEA 4IV3C 1IOAA 3GALA 2PN5A 3NAPA 1Y7BA 2TNFA 4FP2A 4RSUA 4CEWC 2RS13 4C0HA 1QGLA 2SBAA 1AX2A 4KBBA 4Q0PA 3U0ZA 1VRH3 1YRZA 3I59B 3KT1A 4P9LA 1CAUB 4D3WA 1BBT1 2E63A 4MGIE 4N43B 3EXUA 1PIV1 1G86A 2P17A 3ZXEA 4FTEA 1MEC2 1QH6A 3IMNA 4YLZA 3VUOA 3ZVXA 4HK8A 1HRI3 1FOD2 4Q0UA 1NA1A 4WVZA 1OMIA 3M3OA 4FT8A 2IZWA 3TBDA 2JG8C 4P9IA 2HWB1 1NOVA 4XXPA 2O1QA 2EAAA 2Q1MA 3B5LB 3ZFFB 4FCAA 2GZWA 4GMP1 3MPBA 1J59A 4QM8A 5GLTA 4IESA 5KWRA 1LHUA 4N7IA 1B35C 1GNZA 1TNRA 3O7OA 4I30A 1QY4A 3CNAA 2VW0A 1H30A 1UAIA 4RFT0 1MQTC 3VKNA 3ZXFA 4FOWA 4LO5B 3R05A 4HBNA 4XFGA 3RI8A 3VZOA 1AXZA 3H1WA 1NG0A 2G9GA 4BLIA 1RUG1 5DUUA 2CL2A 1KFUL 1UPIA 1JBCA 1NE6A 3KT4A 3WW4A 2RS31 4XFAA 4Q4X1 3GYDA 1DGRN 1Y3TA 4K6BA 4YM0A 1TE1B 3UV9A 1ULDA 4PDWB 1W6PB 4PBPA 3ZXDA 1JUHA 4AVVA 2V5YA 3A0NA 4I2OA 1GZWB 2VNOA 1R091 3VBHB 3BPZA 4AEMA 3IM0A 4KQ7A 2XJRA 4B3NA 1SLCA 2HWF3 2W08A 3R4SA 2AUYA 3OBRA 4P14A 1AL21 1VB4A 2RMU2 4XF3A 4OVEA 2WFF2 2WS91 5DG2A 4RHV1 1CX4A 1Y9QA 1HW5A 5EWSA 3J26N 1YWKA 4AEJA 1U5IA 2A5ZA 3M7AA 2Q4SA 2CWMA 5KBFA 3JBG1 4LE3A 1EV11 3VBSC 3CU7A 1ZBE3 4Z1VA 5JIAA 1W6QB 4MUVA 3AXEA 1N1TA 4NHMA 1F5JA 2JE7A 4FXGB 5F1RA 1H8TB 3BCWA 3RS6A 2O8QA 1RUD3 1J1LA 1UX6A 1CAVB 4NOTA 3PLQA 3AP5A 5LEJA 4OHYA 1VBC2 1GQHA 4MGYE 2WINB 2HWE1 1HX6A 4H55A 1YI9A 3JD73 5FLJA 5LRSA 4DY5A 4Q1PA 2I45A 3J9SA 1FMD1 4FPYA 2B9UA 4MV2A 4P9JA 2VVFA 3WP4A 1S1AA 4QT6A 1MS3A 3RWNA 2VOXA 3TNPB 3DF0A 4CDUA 3O12A 4W6WA 2NQYA 4PCRA 2X5IA 1Q56A 5JZGC 2WSUA 4LUMA 1RUF1 4HVQA 2EXHA 2PELA 2PTMA 5C8WA 1NZCA 4XTMA 1OA3A 1LOEA 1FMD3 4WM8A 1BBT3 4XDQA 5FLIA 1N3OA 3TWIA 2OW4A 5KXDA 1RUJ2 2JE9A 3OGJA 3B9CA 3SH3A 4AQ2A 3HN1A 3WP6A 4EN7B 4HSJA 3CJIC 4RS5C 3H3ZA 2O0OA 1PMIA 3M8LA 1QOOA 4O9GA 4KU8A 3ACLA 2WNUC 1WLWA 3MZHA 2A6XA 4RQPC 1RITA 2F6BA 3KSCA 4Y22B 4ZU7A 1RJ7A 1A78A 2PA7A 4SBVA 2R041 5I8YA 2ZGPA 2YPJA 5JOZA 1C8NA 1YCIA 2BNOA 5T55A 3ZFEA 2A6ZA 4R52A 3MW3A 1C1LA 4OHXA 1R093 2ARXA 3OGGA 4JRLA 2W39A 3KD4A 1GYKA 4XHXA 4AEDB 5C8CB 5I93A 3ZYGA 4QQPA 4XQWA 4IEXA 4AQTA 3HQXA 5LK5A 3U4XA 2VOWA 3J8F2 5CAZA 4NN0A 5A3MA 4H14A 3VHOA 2UYAA 3L9JT 3INAA 5DDJ1 1J58A 4JGZC 3MYXA 2H0BA 2DUPA 5CB7A 3KM5A 1XYOA 4IQPA 4MZUA 1WCKA 4QQLA 1PGW2 3L2HA 4W65A 3M4FA 2WL1A 1FAYA 4JGYC 1QJU3 5DUXA 4DINB 5KHKA 4NPRA 3RQ0A 1VLNA 3KZ4C 4RQPA 2ZHMA 3TB0A 4YARA 4YG6A 2DCTA 4XJZA 3MPPG 3V0AA 5FOBB 3D82A 3ZN5A 4AHXA 1POV0 4Y1VA 4AFCA 1ASJ3 1DQ1A 3PTYA 2KM2A 4IEPA 1H2LA 1NCQA 1U5ZA 1S0JA 5C9AC 4DQAA 3AZVA 3AMHA 2ERFA 5JPNB 5JI7A 2XKPA 2Z69A 5JOWA 1MZ5A 4GKYA 2YYOA 3RMXA 1RUJ1 3AMMA 4KG8A 3T1LA 5BUVA 2VW1A 5JZGA 1CGPA 5H9RA 4QPIA 4LBJA 1X8MA 3AMNA 4CEYB 4HETA 2QKDA 1G6NA 2AYHA 2XL7A 3WQ0A 1RUC3 1GZ9A 2E9QA 1ZYBA 3EHKA 1QQP3 4TWTA 1R1A1 2XPJA 4QPGC 3QCWA 1RGSA 2Q30A 2ETEA 4XMIA 4JC1A 4K20A 1PK6A 1SBDA 1YFUA 2DCYA 4X8PA 3WUCA 2R16A 1QXPA 4XFFA 5C8CC 3VBRB 2UY8A 1LB2A 1OQEA 1MEC3 1MEC1 2YUEA 5JDBA 1C4RA 1C5IA 1AVBA 4LBOA 3GZUC 3I7DA 3ZYJB 1RVF1 4XJWA 2VXRA 1PGL1 5L36A 4FOYA 1XE7A 4ASLA 2A3XA 4FSJA 5T52A 3WHTA 3WINE 3VZLA 3HMYA 4I3GA 1M4WA 2AGSA 2UY9A 4MXWB 3VBSA 2NM1A 4YVWB 5BNNB 3D0JA 1VBC3 3H3UA 3DGTA 5HI0A 5FTTC 2Q0AA 3SCFA 1MQTB 4FO9A 1OQDA 1DQ5A 1XE8A 2VNGA 5CU1A 1IS4A 1EPZA 2E6VA 3OCPA 3ZFGB 3ZXJA 5CFDB 1AJKA 2RS33 5FFOC 2XJTA 2DTWA 3THTA 1NA1B 1ZBE2 1X33A 5T5LA 5EJ3A 1VBE3 2Z42A 3QOPA 2BVVA 2DVAA 4AEKA 2P2KA 1YIFA 3O14A 1Q43A 3VKLA 1DQ6A 3QD6A 3WG1A 1ZVFA 1YNAA 1Z78A 4WZCA 1KXGA 1Z7S3 3IDBB 2X5IB 2VY0A 5FRAA 2YDEA 5K0UB 4ORFA 3NKGA 1QDOA 3AYDA 3USUB 3WHUA 2HWC2 4R4ZA 1FPN2 3GF6A 1GFF2 4DS0A 1OPOA 5FPXA 3UJQA 2C5DA 5BPXA 2AENA 4INDA 3SXWA 3V56A 4FTBA 3AX4A 4J1XA 1FYUA 1RUI1 2YC0A 3E5XA 4EV0A 1W0PA 4ITCA 2E7AA 4GB32 4DRRA 5IK8A 1UIKA 1S0DA 3M2MA 1RUOA 2A73B 2WLQA 1FOD3 4HANA 1V6IA 4YRDA 3AMQA 3H50A 4XBQA 1YYNA 2DU1A 1SACA 2CAVA 3VBFC 4DB5A 4D7SA 3IDCB 1CIWA 1JOJA 1WW5A 1VBA3 1PGSA 1AUYA 3NVCA 1OLRA 4BWOA 1VRH2 2RJKA 2JJ6A 3WQ1A 5CFCC 4UW4A 1ZZCA 3GZTB 2XJSA 5GLUA 4EWDA 5I91A 2WNEA 4YVSB 4FPGA 1G9BA 2IXJA 3B3QE 3NAPC 1I9RA 3VN4A 4W6XA 1SQ4A 1BEV1 1PVC3 2PFWA 2VPVA 1ZRCA 3O0VA 2P34A 1QJZA 4M01A 4E9KA 4Z92B 1W6NB 3JU9A 4B4RA 5ACA2 5FPZA 1OHFA 2R1DA 2PHLA 2XWBB 3ILFA 4QQHA 1LODA 3AP9A 3CL1A 2PYTA 1O3QA 4Q4Y3 3N35A 2ARBA 3TN92 1W6NA 3KMHA 1IS3A 1RUD2 4LE4A 5FMOL 3WNXA 4X8NA 5J09A 4YZ5A 1MZEA 3AJYA 3MIFA 5GZEA 2ZS6B 1QHDA 1RHI3 1D2QA 1D4VB 3ZMNA 2UWAA 5E1RA 3UKNA 3AK0A 1ZZ8A 2ZAHA 4M3CA 3WG4A 1AR71 2HWD2 4K7JA 4IERA 4M3CE 3LA2A 1BMV2 3GBFA 4GMP0 4HKWA 1FV3A 4QGNA 1C5HA 4E27A 3GNEA 1G9FA 4CEWB 1U5YA 1M06G 1ND2B 1AYM1 2EF6A 1IQAA 2NMNA 4YW2A 3VBUA 3I2DA 3RYKA 2XHKA 4H3WA 1W6MB 4CP0A 1W6MA 2LUWA 1JHNA 2EAKA 1D2SA 1RUC1 1ND2A 4YG3A 4IETA 1MS5A 3WV6A 1C1FA 4AK3A 4LNVA 4PJYA 1V6MA 3KS7A 1B09A 3LSEA 4N53B 1AR72 1MR5A 2RHPA 4M0HA 1HRV1 2R30A 5GLVA 5BNNA 1KQRA 4MH0E 1LHOA 4JGYB 2MEV2 3I59A 4Y26A 1TQ5A 3FMGA 1LULA 2Q5TA 1C8M2 1T6GC 1LOFA 4I01A 4K8FA 3UJOA 1H2KA 2KXLA 1TNFA 5F6KA 1ASJ1 5JOXA 1CESA 2QNKA 1Q8PA 1ULCA 1PZ8A 3QH7A 1LECA 2H6BA 1NXD1 3OD4A 1NE4A 3D5OA 3HBZA 4B4QA 4KH9A 3W59A 1REFA 1QH7A 2Y38A 1DYKA 3OD0A 2RM22 3WVJA 4AVBA 4FOQA 4WVMB 3DPRC 3JD72 3LOIA 1N1YA 4JQRA 1YXWA 3IDEA 3QACA 3MLLA 3TRSB 3LA3A 3WLUA 2ZGMA 4JDNA 4N7UA 5KC5A 3H7JA 3KT7A 3WDYA 1PM7A 1LJ7A 1N1VA 2DVGA 2WA4A 3L2YA 4YZ1A 2PAEA 4WM8C 4K21A 5JSOA 3RPQA 4QGMA 4YVWA 3X29B 5CADA 2A3YA 2W52A 1C57A 1WBFA 4J6GA 1H1MA 1WW7A 3S0MA 1S0BA 2NPIA 1ENQA 1PIV3 2ZZQA 2ENRA 1AYM2 2ZGLA 3AKTA 3V0AB 4Q1RA 2WT1A 3LAGA 3H8UA 2H0VA 4LHNA 1OPMA 2AZ5A 5ABJB 1JTZX 3K51A 1V00A 2WWSA 3IKWA 1N3PA 4LO7A 2UU8A 4Q26A 3GZAA 5C6CA 1OSGA 4S2HA 1RVF3 1WA4A 2TUNA 4AVAA 5AFEA 3SCHA 1AR62 2WJSA 4ZXKA 1X8EA 2R49A 4I0AA 3N7MA 4YZ2A 1QXJA 4NO4A 2JD4A 2VVEA 3VKOA 3GHMA 1FI2A 2I74A 1HRV2 4L97A 2PAKA 4IV1C 3OBTA 4YGCA 1AR63 4AI3A 2DWRA 3ZFEB 3D4KA 1URXA 3J8F1 4Y24A 3T2TA 3WDVA 1IS6A 4QQOA 2D93A 3VZKA 5FO8B 2LM3A 4GALA 3ZIWA 2QZ2A 2X53S 5C4WC 3OY8A 4Y20B 4DOUA 1MVEA 1IKQA 4XETA 4Z82A 1RTVA 4OHVA 4Y1UA 2GNTA 3E6CC 4IL7A 3M70A 1LOAA 4PF5A 1RUJ3 1ND3B 2W68A 1LTEA 4E2SA 4AG4A 1S0IA 4J1WA 4BIFA 5L7OB 3S6PA 1AYN2 4GKXA 5L19A 3ZYIB 1AR92 4QU2A 4X6RB 3O0XA 3PJYA 1ZZBA 4XZPA 1OI6A 2A70A 1BJQA 4WVMA 2QJVA 4AI8A 5GZGA 1VALA 1C8M1 1U12A 2K0GA 2WT2A 4LO8A 5JI9A 2YHJA 3I4IA 4Y4YA 3FZ3A 1JW6A 3GBWA 2ZX3A 1GKBA 1RJ8A 1J3QA 4CYDA 4ES9A 1NCRB 3PVOA 4O9EA 1S0EA 4YSFA 1RUH1 2RM23 1Q8OA 3VHRA 1MACA 4H7LA 3AYAA 4AFMA 1LOCA 1DQ4A 3OJBA 1DLLA 4XTPA 4B4PA 3VDDB 3V65A 5F6LB 4LUKA 3ALQA 1RUG3 1LOGA 3WW1A 3MIDA 1QNWA 4QHBA 1HQLA 5CVRA 1IKPA 4IV1B 4FQZA 5H9SA 2RR11 3JZVA 4AGVA 1PK6C 4YVSC 1NA1C 3M3EA 2WZPP 3AJZA 1UF2C 4Q8KA 1CAVA 5A32A 2WZR3 4E2QA 2OIIA 4I0WB 4GB33 4YM2A 4DFSA 2X29A 4E2GA 1KJRA 2E51A 1DZQA 2XJQA 4KG0A 3O0WA 4CEWA 3VV1A 3ZN6B 3FFZA 3R4UA 5L7OC 2RE9A 4JDOA 2EXJA 3RYRA 3SISA 4F83A 3WOGA 1RHI1 4IV3A 3PMEA 1S2BA 4IEZA 4BMBA 2H6CA 4BOWA 1BCXA 1HIXA 2VUAA 3R6SA 2KA3A 4GULA 3MW2A 4RD7A 4P9YA 4XIKA 2IXCA 2R061 4XQDA 5KHHA 2BWAA 2ZMNA 2MEV3 2P3IA 3BOPA 3LB9A 5A33A 3VBHC 4PBOA 3ZFFC 5SV8A 2JKBA 4R9CA 2BTVC 3SNMA 2WT0A 5T5JA 5J3UA 1UD1A 3VL8A 1OD5A 3JQWA 5I8SA 3WDWA 3ZXGA 1WLCA 2HWE3 4JGZA 5JVVA 3ZYRA 4PLMA 3FUOA 2OZJA 3AP7A 5L73A 3VBRC 4FPFA 2OUHA 3FX3A 2W0XA 2WZR1 5T54A 3ES1A 1JYCA 2HWD3 4QM9A 2FQPA 1MS1A 2D5FA 3FLPA 2VOVA 1SDWA 3HD8B 1CAXA 4M3CF 4A3XA 1OQ1A 4Y22A 1CAXB 2GDFA 3BALA 2B39A 4CZSA 1SFYA 1CPMA 4NVPA 4R4XA 4Z2WA 4AI1A 2VVDA 2BNNA 1X82A 2ZGTA 2YY1A 4G3YC 3LA7A 4S2DA 2WNUA 1Z7S1 4WVVA 4FBFA 2VW2A 2XVLA 5ACA3 1HQNA 2A6YA 3IWZA 1O5UA 5J36A 1RUH2 5HCBA 4AYUA 4M00A 1BEV3 2LALA 1RMU2 3CJIA 4RS5A 1S55A 1PHMA 4YZ4A 4HVOA 5IT6A 3FE5A 1N47A 1DGWA 1Q5OA 1DHKB 1XNBA 1LR5A 2OA2A 1CN1A 4HT1T 3PVBB 2WC2A 5JSRA 3N36A 2BFUS 4CTEA 5JPMB 1J3RA 2DF7A 2ILMA 1QJX3 1QJU2 5CFCA 1PO21 4COVA 1IHMA 2P37A 3M3CA 4FPCA 4IV3B 3QBQA 4Y1XA 2QQPA 2NLRA 1MS8A 4QD2A 1K5MA 4YFZA 5JMCA 4YM1A 3VBFA 4YVSA 2PHFA 4WV8A 5GM0A 1HKDA 3S7EA 4IXLA 1Q8QA 1SFNA 1V6KA 4XF9A 1ZRRA 1R1ZA 1V6LA 4M0NA 4ISRA 3SMHA 4C0BA 1R092 2CGNA 3MLKA 4HPKB 2BPA2 1YI7A 1O3TA 1A6CA 3VKFC 3IBMA 4QQ2A 4P9XA 3VHPA 1AL22 2RMU1 2B45X 1DF0A 4K3UA 4KWKA 1K5MB 2WFF1 4GWMA 2EXKA 2WFF3 1HXS3 5IK4A 1GR3A 2N7GA 1KJLA 1AYM3 3B9IA 5T5OA 3NW4A 2XVKA 4AWDA 4E4ZA 1GICA 2RS52 4UBHA 3NAPB 1G9DA 1VAKA 1G9CA 1MS4A 1JUIA 2ZGNA 4FQ4A 2JG9B 2PHUA 4MGKE 1Y43B 5TSWA 1GLHA 4S2FA 3WCSA 3RSJA 5K9YA 4XILA 3OYWA 4K9SA 2ZMLA 2D6KA 1V6OA 4LLFA 1VBD1 5EFUA 4XJ9A 3G6JB 3KCCA 4HL0A 4QPIB 5DXDA 1RB8G 2ZHLA 3NWKA 5C4WA 1SCSA 2XBO3 2GC2A 3V0BB 1YFXA 4JDMA 4YFWA 3RNSA 3JCIA 4EN6B 1VBB3 4AE2A 3CO2A 4L11A 1UL9A 5IUQA 4QMAA 1B35A 4CEYC 4LTAA 4IV1A 3ROUA 1VBA1 3POWA 3U10A 2FZ2A 2HKXA 4MSVA 2JG8B 2PLV3 1CAWA 3URFA 1VBE2 2GC3A 4FVVA 4GH4A 1WD4A 2HWC1 5CG8A 4CDWB 3DUIA 1W2UA 3A0KA 5HCAA 3AZXA 3VBOA 1HQWA 1BZWA 1AX1A 5AC92 1K5MC 2C1FA 3MIHA 1DYPA 2HWF1 1FXZA 1ONAA 4C1WA 4HMZA 1C28A 2E53A 1PNFA 3KB5A 4C1XA 5AFBA 2Q8OA 5ACA1 3KLSA 5JWPA 1UKGA 4IEOA 3KQRA 1PIV2 5FCCA 1LEMA 1O7FA 1SLBA 4YVWC 3NV4A 3N7JA 1EYBA 5J96B 2JENA 4PLOA 1VR3A 4FAHA 4LBQA 4BQ1A 2DU0A 5FQ0B 1CR7A 2VQAA 1V9U3 2BW8A 1RUE1 4PIYA 5H9PA 5KHGA 2DFBA 1G9AA 3ELNA 3WT3A 1ZA4A 1ZNPA 1VBB1 1EAH3 2D3RA 2DYCA 1AHSA 3MIEA 3ZO0B 3HIFA 4OUMA 4N9IA 1O4TA 3DKWA 1UN1A 2HWF2 2QDNA 3RZZA 1ZREA 3RRDA 1XNKA 4QPIC 3EJKA 2PHWA 1NCQB 1D4M2 2GC1A 3HAGA 4WM7B 4NHKA 4CP2A 1PO13 1QMJA 2UYBA 2XL9A 2ZZJA 4XPVA 4D69A 1MS0A 1AR83 1NQDA 2XLGA 4NR1A 4RQPB 4P5HA 4AVTA 3JB4C 2ZX1A 4YW1A 1DGRA 2A6VA 1NQJA 2ZGKA 4DRVA 5KC6A 3BODA 1SBEA 1LOFC 1YIPA 4Q4Y1 4XJAA 1FX5A 2VMGA 2DUOA 2RR12 4LA2A 1O3SA 2BUKA 3V64A 4NWVA 2CGPA 4I02A 4CDWC 2R063 5BNNC 3VBRA 1DGWX 3J8F3 3WZ1A 4Q27A 4OI1A 2AH2A 3AP6A 4B8EA 3NKTA 2HEYF 2JECA 4XYXA 1PK6B 1SBFA 4JGYA 4LO6B 4GH4B 4U2AA 4HVRA 1EPWA 2BEOA 3E5UA 4RHV2 1TME2 1XYPA 4KGQA 4KNCA 4IEVA 1QKQA 1DU3D 5KHJA 2WIIB 1ULGA 1BVVA 3C3VA 1ENSA 2D5HA 2CTVA 5GLWA 4YGEA 2ZJCA 1H8TA 2ZABA 3R4DB 4RGGA 3FC0A 1RUF3 4BPZA 3FFQA 3ZFEC 1LHWA 2XJUA 4EROA 5K0UC 4QGLA 1AL0G 2PLV2 3RG0A 1BK1A 2CV6A 5JR7B 5I0RA 4LR4A 2MEV1 1EV12 3P3PA 3MW4A 4PIZA 2RS32 1NYWA 1RUNA 5C4WB 2DCZA 1VBA2 2DURA 3CF6E 1ZX5A 4CDUC 3AKPA 3AZYA 3B69A 2ZTNA 2PQQA 2GH2A 4YM3A 3ZSEA 1VBE1 1AJOA 5D8AC 3VHNA 4K1ZA 1YJKA 3FBMA 2DVBA 1YJLA 2YZ4A 2GH8A 1QQP2 5GALA 2WNVC 3BU7A 4Q4V2 1KFXL 1RUD1 3E5QA 2D6MA 4MX3A 3G7DA 4K40A 4CDXB 2DVDA 3EBRA 1N1SA 4QPGB 5DDJ3 3OTFA 5I8TA 1EV13 5JLVA 1QJX1 2R32A 1BMV1 5E89A 1CQ9A 1QJY1 4KL1A 3MF6A 2WS93 3Q9OA 1WW6A 2IFWA 5BNQA 3APBA 1HRI1 2PHXA 2BYVE 1UU4A 1EAH2 1UCXA 1W6OA 4XOGA 2XBO2 1DBNA 2Z5WA 3VBOC 1OFNA 2OVUA 3N3HA 1VBC1 1BXHA 5EXOA 5HXVA 4AVSA 4Q4V1 1H4HA 1I3HA 1UW8A 3JB8A 1LHVA 2D44A 5HBAA 5EYYA 2JDZA 4Z07A 1COV1 4Q4X3 3H1MA 1V70A 2WZR2 2CY6A 3S30A 2R072 4ES8A 5FBZA 4HK9A 1OA2A 2DCKA 2TEPA 4R8HA 2VMIA 1REEA 4QXKA 2EVXA 3RI9A 3WX5A 1ZBE1 4HN1A 2A3WA 3AFGA 2HWD1 4RR3A 4X6QB 2DV9A 2IXHA 2R6QA 2Y0IA 3H7YA 4FPEA 4Q29A 5D8AB 1W39A 2XBO1 4FPJA 1COV3 2GNDA 4RHV3 1S0FA 3R0RA 1POV1 1WLTA 3CJXA 3MDPA 4FPLA 3WCRA 4N53A 1EY2A 1LU1A 2FHRA 2BQPA 4GMP3 4RR3B 2WLPA 3WQ7A 5GZDA 5GJ6A 4OI0A 2RS53 1OA4A 3BIWE 3DPRB 2AREA 3FLTA 2UWBA 1GBGA 2ZBJA 3AYEA 1GV9A 4JRAA 3WD5A 1QOSA 2JG8A 2XJVA 3FBYA 1ZRDA 5AVPA 1HV1A 2EXIA 3BOWA 3E6BA 5GZCA 4GB31 3VBUB 1IPKA 1MQTA 3AKRA 2BVBA 1R083 4B29A 4BYYA 4OHWA 2A75A 5JOYA 1BBT2 1PNGA 1NY71 4GXLA 4Q0QA 3NSTA 4C90A 3VBFB 2GU9A 4N9HA 1NLSA 4XF4A 5KXBA 2QFEA 3GHNA 1MVQA 1DZRA 1UU5A 3ILRA 1EAH1 1DQ0A 2VH9A 2WSVA 1UU6A 3AZWA 4XIOA 1GNHA 3AKQA 4JGZB 3NV2A 1CJPA 1UKRA 3ES4A 1SLAA 3TYJA 4AFDA 1XQNA 4LBMA 1Q8SA 4QPGA 5HCFA 5IK5A 2IXKA 1QF3A 1XU1A 2MPFA 5D8AA 3DPRA 1VP6A 1R1A2 5KXCA 1S0CA 2ZCWA 3D0SA 3J4UH 1GSLA 4F8AA 5JCTA 2XH6A 4XF1A 1O4ZA 4EWAA 3AB0A 2EALA 1RUE2 1WBLA 3MIGA 4COUA 4OLLA 3GBGA 3CJIB 4RS5B 5B2GB 4Y5Z0 1NXMA 2X8KA 3E97A 3MF9A 4HFSA 1X7NA 4EN9B 1NCRA 1DZTA 3B94A 4XFHA 1ULFA 2WNUB 1FPN3 1H8VA 2RS11 1QJY2 5C9AA 3ZYPA 2YROA 3RDIA 4COYA 4ZU5A 1FV2A 1ULEA 3N7LA 4HZFA 4B7EA 5D1IA 3KCYA 1Z0HA 3CLPA 4FXKB 4FAGA 2GNMA 4PDWC 2ZX4A 4CP1A 2EIGA 5EYXA 1JH5A 5BXXA 2Z2SB 3ZXKA 3THPA 4IEQA 4PLNA 4URTA 2IFRA 1GZCA 3ENRA 2JICA 4LA3A 1W6OB 1ND2C 3MEPA 2QVSB 2WFPA 2ZGQA 2R0FA 2HWB3 3VDDA 1XXNA 2GNBA 4EJRA 1LESA 2R062 4D94A 3PMSA 1QXRA 3H9AA 4EN8B 3UK9A 1CAUA 4Q2FA 4XJ8A 3W58A 2A6WA 3M1HA 1GANA 1AR82 1DG6A 2B8MA 4L92A 3FLRA 1X36A 5FDBA 1QOTA 3A4UA 1TME3 4SLIA 5J37A 1TME1 4L8QA 2D97A 1WMFA 4CDXA 3I54A 4Q4W3 1PVC1 2IXIA 2Y0OA 1XNCA 1OKQA 1YFYA 1MZ6A 3AMPA 2R042 1L3JA 3TNQA 3C2UA 1VB2A 2GC0A 2VMHA 5BV6A 5J48A 4UW3A 3WW2A 3HT1A 3EO6A 5AC93 2HEVF 4LBNA 4RL7A 3UKVA 5BNPA 4DY3A 5C33A 4BCUA 2D6LX 4WM7C 1O4YA 3TN91 4N90A 4AI2A 4LHLA 3B01A 4XBLA 4H7MA 3ZSLA 1RUH3 2RM21 2XJPA 4XW3A 3WDUA 5DG1A 2P3KA 1FNYA 1NCRC 1AL23 5L7OA 3WY6A 4ZKTB 2XG3A 1FOD1 1I1EA 4BLJA 3HT2A 1ENRA 3BB6A 4AFBA 4AXOA 3RJRA 1ZZ7A 1H0BA 4AGRA 4LBKA 2ZKNA 1PO12 1HLCA 1WCSA 2B42B 2GALA 2X5IC 4AQ6A 3VKMA 2P3JA 1QWRA 2ZGUA 4L9BA 3I8TA 2ZKLA 1UPSA 5H9QA 3P3NA 3OYWB