3AKTA

Crystal structure of xylanase from trichoderma longibrachiatum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
b'ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase
molecule tags Hydrolase
source organism Trichoderma longibrachiatum
publication title Packing Space Expansion of Protein Crystallization Screening with Synthetic Zeolite as a Heteroepitaxic Nucleant
doi rcsb
total genus 56
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aktA00
3MFAA 1KS5A 3WP5A 2DCKA 3AKPA 2JEMA 3WR0A 2D97A 3AMQA 1XNBA 1IGOA 4S2FA 3AMHA 2JICA 3WP4A 1PVXA 3MF9A 1M4WA 3MFCA 2VGDA 2F6BA 2NLRA 3VHPA 3VZNA 3VHOA 1UU6A 3WQ0A 1C5IA 3VHNA 1YNAA 1UU5A 1XYPA 4XPVA 5HXVA 3LB9A 2QZ2A 1T6GC 1ENXA 2BWAA 1XXNA 3RI9A 2VG9A 1OA4A 1OLQA 3VL8A 5K9YA 3AMPA 1W2UA 3VZLA 4IXLA 1H4GA 4HKOA 4S2HA 3VL9A 1UKRA 1QH7A 1OLRA 1TE1B 4XQWA 2B42B 4NPRA 1XNKA 2QZ3A 3AMNA 1BK1A 3WXPA 4S2DA 1XYOA 1BVVA 3VZKA 2DCZA 2D98A 2DCYA 2B45X 1NLRA 1XNDA 1UU4A 3VZOA 4HKWA 3AKRA 1BCXA 4HK9A 4S2GA 3WX5A 1XNCA 3WP6A 3VZMA 1HV0A 2BVVA 1HIXA 4XQ4A 2B46X 1OA3A 3EXUA 5K7PA 1H8VA 3AMMA 1OA2A 3O7OA 2DCJA 2BWCA 3B7MA 4HK8A 2JENA 3WY6A 2DFCA 1C5HA 3LGRA 4H7MA 1H4HA 1KS4A 1REFA 1REDA 3VLBB 3ZSEA 3AKQA 3AKTA 3HD8B 1H0BA 1HV1A 3MF6A 4XQDA 1F5JA 2C1FA 2Z79A 3AKSA 3RI8A 1REEA 3VZJA 1QH6A 1XYNA 2DFBA 4HKLA 3B5LB 3M4FA 3WQ7A 2BW8A 3WQ1A 3WP3A 1H1AA 2VULA 3VGIA 1AXKA 2NQYA 2VUJA 5EJ3A 3WT3A
chains in the Genus database with same CATH superfamily
3AJZA 1NY72 3BI3A 4DNYA 2ILMA 3WHUA 4DOUA 4XTMA 2RS53 4P9GA 3VB9A 3ZMOA 4D6RA 3K3NA 3SKVA 1OOPC 3POFA 1I9RA 2RHPA 2DF7A 5FYVA 1SHWB 1PIV3 1LOFA 4HN0A 5FY5A 4Q8LA 3OUIA 4S2FA 5HPOA 1MZEA 4N7IA 1AZDA 4QKDA 1JUHA 3RZMA 3I2KA 4NJ4A 1UXZA 4FQZA 2R062 3VBHA 4JGYC 2XUMA 1XSQA 3HWJA 4YNIA 3DV8A 5DG2A 3VHNA 2JG8C 4D7SA 3INAA 1QJX3 2KA3A 3I2GA 4HXCA 3NJXA 4HSJA 3H7JA 5I0TA 5CFDC 3FC0A 3PL0A 1CQ9A 4MGZE 3IIAA 2OXBA 5T5JA 1CWPA 3FHAA 2JE8A 2E53A 4AHXA 4W6XA 5IVVA 3OJBA 1YI9A 2I2SA 3FJSA 1DP0A 2E7QA 1OHFA 2ZMKA 4L11A 1D0GA 2J7MA 1CAUB 1UOJA 4EZ4A 4Z2WA 2WWUA 4YPJA 2VTXA 3U11A 4XFFA 3JB4C 4GJZA 4QGMA 2VMCA 5CG9A 4RR3A 5BNOC 3BIWE 2B7YA 5ANNA 1K12A 3WHTA 4JHZA 3ZLIA 1XYOA 4PLOA 5FZ3A 5AC91 4BH9A 3I49A 4IV1C 3U14A 2BPA2 4IV3A 4RS5B 1R091 1R081 4BCUA 1QJEA 2EALA 3NVCA 5C9AC 2I07B 3RZHA 4UYBA 3FUQA 4PI2A 2K0GA 4XDOA 1HLCA 1ZZ7A 2BUKA 3ES1A 3RMXA 2BBVA 3T4HB 1AX0A 3Q8CA 2PN5A 5BXXA 4CCDA 5LB6A 1JZ5A 1RUNA 3GF6A 1V6IA 5A3TA 2VMFA 2B46X 2GNDA 4DXZA 5T50A 4A2UA 1NAEA 4OUEA 2DVDA 3T3YA 2BOIA 3LEGA 5GM0A 2UURA 4TSVA 5LK5A 5LBCA 3WW1A 2UWCA 3TNQA 3SH4A 4NWWA 1J83A 4Y4RA 1H4HA 3M3EA 1DLCA 4LOTA 1V6JA 4RA0A 2YB7A 3IDEA 3ZSEA 4JX0A 1QQP3 1H0BA 2BQPA 3GHNA 1D0HA 1F5JA 1NQDA 2UY9A 2YU2A 5FREA 3VDDB 3CIHA 3WF0A 4HT1T 3T2QA 4I0WB 5DDJ2 3B94A 3GZAA 3WNLA 5A3NA 3HQRA 4Q0SA 2DFBA 2GC2A 5FUIA 4FCAA 4G3YC 5IHRA 4BMBA 1PK6B 1GANA 3AYCA 3WQ7A 3LQCA 2WINB 3H8RA 2BYVE 5FZHA 5CADA 3CZUA 3NQHA 4B1MA 4ATFA 3CO2A 4YFWA 5C4WB 2JDKA 2VL4A 4PQ9A 5DDJ1 3SCHA 4RHV1 5IK5A 1H8TB 3L2YA 2G4IA 2PHFA 2PAMA 3LAGA 5JMOA 1GQPA 3GALA 1ND2A 1XQNA 4CUBA 5LA0A 1Z0HA 5ACA2 3NRUA 1RUH2 2JEMA 2XKOA 3RDIA 1XC6A 1HQWA 2ZAHA 4BLIA 2QQJA 4MG2A 1UZ0A 1DGLA 2XL7A 3OD4A 1YCIA 2PHUA 5FZMA 4Y5SA 2WFF2 2QQKA 1HXS2 1M4WA 1BBT2 2ZGNA 5A6YA 3S57A 4QPGC 2D93A 3AP7A 1O59A 1OOPB 5BNNA 2FDFA 3VBRA 4CDWC 4XOGA 4YZ5A 5FR3A 1BLZA 1XYPA 3JCIA 3P1IA 4Y5TA 3RYKA 1CZSA 3A23A 1I5ZA 4Q4W3 4XBNA 4V2WA 1ZRCA 4IE6A 3O0WA 4F3JA 1XXNA 4Q4X1 4A45A 3T4VA 3ZM8A 2YYOA 3POGA 5L36A 5JUVA 3LA3A 3VL8A 4FXGB 4CU6A 5T54A 1SLIA 4FP2A 1EP0A 5BYNA 1WLCA 5C33A 1RUJ1 5M0TA 5IK8A 3WVJA 2EIEA 3PMSA 2R32A 1XNAA 4FBFA 3T09A 5BNPB 2EXHA 5BNPC 3ZSMA 5A32A 2A3WA 3N9PA 5EV7A 4DS0A 3ZYRA 2WNVA 4YVWB 5EZWA 3WXPA 1BK1A 4AFCA 2D6OX 3TEWA 1MZFA 2EAAA 1EV12 1S0EA 5KXBA 1RUF2 1S2KA 1WBFA 2GALA 2WZR2 2WT1A 4JGZC 2BEOA 1UY1A 4GWNA 2QDNA 5FY4A 5FY0A 1YWKA 2A6XA 3I97A 5GLTA 2OIIA 4K8FA 3D8CA 2YBPA 3C7GA 1YLLA 2C9KA 1GWMA 2YBKA 1LOEA 3HBKA 4QX5A 4XVHA 4HK9A 3VKOA 2W5FA 1RUD1 4UFIA 5FZGA 4ZU7A 5LW9A 2XLFA 3THPA 2GC3A 1WUVA 1GICA 3LF7A 2CV6A 2HWC1 3KS7A 5C3PA 1KQRA 4WM7B 2BVVA 2DBIA 2W1QA 3QOPA 1RUC2 1N1VA 4MYEA 1GWLA 1L7QA 2JDYA 2WJSA 2W1UA 4FI9A 3VD5A 4TLFA 3DL3A 3G6JB 3M3OA 1GNYA 1R093 1ULOA 3H3LA 1C5HA 3KLSA 3M2MA 1OUXA 4ZKTB 4DO0A 2YXSA 3VDDC 1O5UA 4E4DX 1REDA 3KF5A 4CE8A 4A44A 4ZONA 1K5MC 1PVC2 1RJ8A 4UWDA 3UETA 5E8AA 2YG0A 3H42B 3QH7A 1AR62 2W39A 4YG0A 5C8CC 3I3MA 1X8MA 2NP0A 4DFSA 2Y26A 4IE5A 4LBQA 2Z79A 4NE9A 4RGGA 5FV3A 1VRH1 4EWEA 1PIV2 1HN1A 2P3KA 5GJ6A 1MS3A 2P17A 1UX6A 1XYNA 2W95A 1H8TC 5T55A 2RMU1 4CDUC 2WN3A 4LO7A 4FAGA 4LJHA 5H9RA 4W6WA 1J58A 2ZGSA 2VZ1A 3PVEA 4XFAA 3ZSKA 1N3OA 1SLLA 2VD7A 2YPJA 4MGQA 2FCVA 3WF2A 1TNRA 3FLTA 4I30A 1GKBA 5FZ8A 3ZYFA 3WP5A 3ZFEA 1CR7A 2ZAAA 3LIHA 4YZ3A 2ZX4A 5C3RA 3I54A 5C9AB 5IT6A 1W6OB 1X9TA 4NHMA 5A7WA 2GH2A 4M3CA 1ZREA 1UL9A 4ZU5A 1W6PB 2ZBJA 5DDJ3 3RSJA 4SLIA 3ACIA 5A7SA 3UL2A 1S0FA 1Y43B 3OGRA 2BRTA 4AYUA 3J8F2 3KV4A 4NMIA 4NHXA 2PA7A 4WVMB 5FZLA 3VBUA 4FPKA 3W21A 3ZKYA 4CP9B 4XFBA 4XFHA 1UY2A 1UU5A 3MICA 1CX4A 2ARBA 4XFGA 4DRRA 3CJIA 1NZIA 2F4LA 5D8AB 3T30A 2PAEA 4J6GA 5FPXA 1VB2A 5LEKA 3GZEA 1RUG3 2YC2A 3NKTA 4JAAA 4I3GA 4YYOA 4YG6A 1RUH3 4S2HA 3LA7A 1UKRA 4PLMA 2B8MA 1PHMA 2CU5A 4YW3A 3TN92 4Q4Y3 4GB32 1CESA 1ZNPA 4K1ZA 3I8TA 2YGLA 3MUZ1 3DXTA 5LBFA 5A7WB 2ORXA 2P1BA 4CEYC 5L19A 1CX1A 2WL1A 4S2DA 5FRAA 5FLIA 2J1TA 2NM1A 4TWTA 4UFJA 1O8SA 4HG6B 1G9DA 1ZBA1 1F4HA 2DYCA 2ZX0A 2DCZA 2HWF1 4OYUA 1ENSA 3CNAA 1ZRDA 2A70A 2ZPXA 4IQPA 4HKWA 3K75B 1IS5A 1UF2C 2D43A 1EYBA 1QXJA 1ZZCA 1NUKA 4EZHA 3BUCA 4HOOA 3JBG1 1ND2B 4LHKA 2H0BA 4JTNA 1S0GA 2NN8A 4Q4V3 2WFF3 2ADEA 1MQTA 4AQ6A 1N1SA 2XOMA 1GUIA 3HNMA 2K46A 1QOTA 1V00A 1T6BX 3WSOA 2XWJB 1WCUA 1W0NA 1PX4A 3LPFA 1TMF1 3PMEA 5FP7A 4QQ2A 3S30A 1DGRN 3EXUA 4FQ4A 3AFKA 3IDCB 1BEV3 4PT6A 5APAA 4YVWC 5FZOB 3THCA 1BVP1 2WIIB 5AC93 5CVRA 5FZDA 3LDRA 3GJAA 3B7MA 1VAVA 2HJIA 2WS91 4BQ5A 2J22A 4MGIE 1AL23 3ZN6B 3T0AA 4B1LA 4CCOA 3L9JT 3WDXA 3VDBA 2DV9A 3MIEA 4BU2A 3RJ2X 1OF4A 1VIWB 3CLPA 4AW7A 1UIJA 3HMYA 2JDAA 3N3HA 2R0FA 3PUAA 4AFBA 2EIBA 1IG0A 5IVEA 3FFZA 4Y1ZA 5F5QA 1XU2A 1WLWA 1QJX1 2WAOA 3NNFA 2YFZA 4P02B 4A7ZA 3NV4A 3PTYA 3BU0A 1C1FA 4COUA 1LESA 1POV0 4QX2A 3FMGA 2FHRA 2G9GA 2C4XA 4CSWA 1DG6A 5KC6A 5GZDA 5J09A 4E2GA 1APNA 1ZA7A 1ZZBA 1JBCA 3OBRA 5FY7A 1A8MA 1JU4A 1UYYA 3I4IA 1GQHA 5B4XA 1R1ZA 1PIV1 2NPIA 1G6NA 4XJZA 2VNVA 5LBBA 2W1SA 2WYSA 3WG3A 3ZOIA 1C1LA 4E4HA 3IAQA 4LIUA 3M3QA 4LO4B 2D97A 4PCRA 3ZXGA 2ZGUA 5IVCA 4ZS3A 1WW6A 5HV4A 3O1SA 2VE1A 3BALA 5K4LA 1ZRIA 2WO7A 4IEVA 4XE9A 4PBPA 1T2XA 4YM2A 1ZRFA 2WS92 3MV11 5FYCA 3VBFA 3ZXJA 1VP6A 2GNMA 4QX3A 1YYNA 1PNGA 1W2OA 3OPWA 1UPIA 4N8MA 1LENA 1LECA 3DECA 4IEZA 2Y6JA 4XFCA 5J37A 1I6XA 5DZEA 1PMJX 5J7MA 1OQEA 3ZPOA 3DYMA 5F6KA 4OULA 1MPXA 3WF4A 1D4M2 1Z7S1 1AR63 4GULA 1W6MA 3UJQA 2XMLA 5FYZA 1G9AA 5FZIA 3MLKA 4AVCA 3ZFGA 5FO9B 1NXMA 2R063 1QEXA 5FY8A 4QPIC 1GLHA 5LATA 2CGNA 3VD3A 4XEZA 2DU1A 2K2SA 1F31A 2RV9A 2V4VA 2VMEA 2Y0OA 3E97A 3OGJA 1BK0A 2B42B 3N9QA 2B5HA 1XE8A 4IE7A 5KC5A 2XQRA 4WVMA 4CP9A 2EIDA 1W9TA 3AXEA 1VBE3 2W3JA 2ATFA 4FP3A 1AR92 4DXRA 1QNYA 2E9QA 2RDQA 2O1QA 5G04L 1RVF3 2RJKA 4A3ZA 5FPZA 1XNTA 1XNDA 1QOSA 2DBNA 1G9FA 1EPWA 2HWB3 4ISRA 1HDKA 3RS6A 3WW3A 1WZXA 2VR4A 4D7TA 3PUSA 3WX5A 4CRQA 2VQ0A 4P9LA 2XONA 1PNFA 2CGOA 1I1EA 3AVRA 1W6PA 4BISA 2QQLA 2WFPA 4W50A 5D8AC 1HB3A 1ONAA 4I09A 5FWEA 5KXCA 1DDLA 2GP5A 3DKWA 4R9DA 3ETQA 1IQAA 1DQ0A 1O4ZA 1NA1B 2AH2A 3NAPB 5BNOB 1OH4A 1AYN1 4IERA 3S7EA 1RMU2 2DCJA 3UT0A 4IGQA 3R0RA 3MV01 4AVBA 2GMEA 2LUWA 2VZSA 4QQLA 5A7PA 5LY1A 1GWKA 1KJRA 2VBPA 2BVBA 1KDKA 1HV1A 1AX2A 1YEWA 3AYAA 5T3NA 1OSGA 1XE7A 3U07A 1AR61 1NQJA 3MW3A 4LR4A 5KHKA 4XCAA 1XJAA 4XW3A 1W8NA 1WMFA 1JYIA 2BV4A 1IKQA 2XR4A 3ZN5A 3HAGA 3PLQA 4N53B 2BJSA 2VVFA 1BEV2 3B93A 1QJY1 3IT8A 5CKMA 1UMZA 2HWE3 3UGHA 1VRH2 2W08A 1EV13 4IE4A 4MVTA 4UXAA 3D5OA 1F8VA 3U78A 2P34A 3W5NA 1YIFA 5J98B 4Q4V2 5I0SA 1ULGA 4RHV2 2JKXA 2PXJA 4ZXKA 3IM0A 3VUOA 1UIKA 3AMHA 3PURA 4ASKA 2W68A 2F6BA 4RGAA 1TME3 1POV3 2JX9A 5FQ0A 2CDPA 4XBQA 3FWEA 5FOJB 1SMVA 1VBB3 2IVIB 3T2PA 4BMEA 4D6QA 5F5IA 3JUUA 3LFIA 2ZGOA 2Q1ZB 1LOAA 3IPVB 5C6CA 4GMP1 5FLJA 2ZKLA 1OLME 5HXMA 5L9VA 4BQXA 5FPVA 3ILRA 1HX6A 4CVUA 3AFGA 4EN9B 4JKKA 1LOCA 1O91A 1CIYA 3HBZA 1OBNA 4FPJA 4NRMA 5JCTA 4HKOA 5IVJA 1TE1B 2VCBA 4FOQA 4XIKA 1AL21 5CFCA 4OI0A 4MXVA 4Q4W2 5FP8A 1W6QA 4QXBA 2Q8DA 3VD7A 4TXWA 5JIUA 5F9TA 5JZGA 2Y6GA 1HW5A 3I2HA 1WWYA 3PDQA 2RS12 4HBNA 4XTPA 4YGBA 2BDRA 5LASA 3LPGA 1V6LA 2Q8OA 1HXS3 1DQ6A 1TMF3 3LDBA 4Q1RA 3URFA 1X7NA 1L7RA 1NX9A 4XZPA 4EYUA 2R49A 3K2OA 5FZEA 1GP5A 4YWAA 5FYIA 2JDMA 4Y4YA 3D0JA 2WFF1 1V70A 4WM8A 3JBG3 5K0UC 4K20A 4FTSA 5CAZA 5CYYA 4XUPA 1L3JA 3E6CC 1H6YA 1PO13 4ASMB 4BXFA 1W90A 1YJLA 1LJ7A 2HWC2 4UT5A 2LROA 2WLQA 3CJXA 1LHWA 3CEWA 3SC7X 3QH6A 1ZBA3 2HLEA 3BVCA 4LBKA 2ENRA 4ITCA 4OI4A 4AHWA 1GZWA 1U5YA 4UFLA 5IATA 4COWA 3KT4A 1RUOA 3I7DA 4AZZA 2ZHMA 3PVOA 5GLUA 4QHBA 2WABA 4AWDA 2P3YA 1X50A 4CUAA 4AEDA 4Q4Y1 3VLBB 1IS6A 1JOPA 1XE0A 1ND3A 1NOVA 1FMD1 1RUH1 1UZWA 2A6ZA 2WKKA 1QDOA 5KHJA 4X6QB 3LFMA 4PIYA 1WD3A 1NA1A 3HT1A 4AEDC 3A0NA 2VVDA 3PU3A 2WQ4A 3H7YA 4XHXA 3UYJA 2ZGLA 3VZJA 3WQBA 1EPZA 2UWAA 1NZCA 3IAPA 2Y0IA 4MGYE 5F39A 4HKLA 4AHZA 5G05L 2VCAA 5DUWA 4N43A 4AVAA 4RFRB 1AR83 2VTXJ 4QXHA 3C7OA 4SBVA 1BMV1 2P3JA 4DRVA 4OHXA 2NQYA 1IS4A 1UOBA 2HWB2 4FPLA 1ACCA 1X82A 4ATEA 1CPMA 1XSRA 2XJQA 1D4M3 4UW6A 4COZA 1CAWB 3WNNA 2KR2A 4BQ3A 4CPBD 2FQPA 1VB4A 4AVSA 5IFTA 1AX1A 2RS11 3B69A 4C0BA 4AGVA 3GCWA 4QQHA 5CZKA 1OFNA 4QX1A 4XUNA 4RS5A 4P00B 1SG3A 2JICA 1HRI2 3OOXA 3ZFEC 4AAPA 5LWBA 2ZEXA 4MHUA 1SQ4A 2ZXQA 4NHYA 3DPRC 4QGLA 5IK4A 3WG2A 1KITA 1JZ2A 2G9FA 1BZWA 2WBKA 4XMIA 1Z78A 1O5LA 2CL2A 3ZYIB 4YM3A 4AI9A 4HLTA 4A7YA 1GBGA 1H2LA 2DURA 3IB3A 4JDMA 3RJRA 1AYM2 2DTYA 5KHHA 5CFCC 3V0AA 2TEPA 3KV5A 4KWJA 4AQSA 5LA1A 1LHVA 3OCPA 4CDQA 3ZXFA 1E5IA 4QXKA 4MXWA 1VRH3 2Y34A 3SQOA 3V0AB 2P6CA 2R073 4OI2A 2IXHA 4N53C 5K8SA 3ZXAC 1DGRA 4Y1YA 3O1RA 1W6NB 2OA2A 2P6HA 2ZZJA 1K5MA 2PHDA 2HWF2 3VBOB 5KBFA 2WQ8A 2EF6A 3GHMA 1GZ9A 4ONUA 3C8XA 5BV6A 4NIHA 4ES8A 2YZ4A 2WLPA 4BQ1A 2BNNA 3VKFC 3NV2A 4LK6A 1NLSA 1GFF2 4NIDA 5F3IA 3MBWA 1KGYA 2XJRA 4XUTA 2XL9A 1IS3A 3KGZA 3POJA 1RGSA 1BMV2 2ADDA 4Q4Y2 5IFPA 2DDUA 2H0VA 4UW5A 2A6YA 4HZFA 5AFBA 3EQEA 2XXZA 1GOHA 4WV8A 4MSVA 2ZACA 3AVSA 4RD7A 4DINB 3RWKX 2XKPA 3OUJA 4JC1A 5FMOS 2IXLA 1DQ4A 4JQTA 5F3EA 2ZX3A 1DZQA 1QNWA 2EXKA 2RDNA 3CU7A 3JD71 5FY9A 2WO1A 4IE0A 5A3OA 4YSFA 5CFDB 3WNMA 1VMJA 2XJTA 3E5UA 1Q8VA 3NSTA 3MO4A 3LE0A 5FYSA 3MPPG 1W8HA 5JLVA 2SBAA 1J3PA 3ASIA 1IKPA 3PU8A 1DU3D 4GB33 4IUGA 3OYWB 2VH9A 2WNVC 2E31A 2VZVA 2D5FA 4PF5A 1CIWA 3HJRA 4AEDB 1V9U1 1O3SA 3J7LA 1S0JA 3AC0A 1R64A 1A78A 3Q8EA 3UESA 2R16A 1RUJ3 2D3SA 3PUHA 1AYN2 1LR5A 1V0AA 4LUMA 5CKNA 4E2QA 3VBSB 1DYPA 2L9LA 3LA2A 4YGEA 3JXSA 2CAUA 3I59B 4Q4W1 4FTBA 3LKJA 2CWMA 5DMYA 3HQXA 4CU8A 2QNKA 1K3IA 2XHNA 4WVVA 5BNQA 1YQCA 4PF1A 4ET7A 4CDWA 5IJRA 5A70A 2WUHA 3P5BA 4J1XA 2TNFA 5BNNC 1L7LA 1HQNA 5BPXA 4UF0B 1PMHX 3O1TA 4EV0A 3QLQA 4RQPB 2BFUL 2G9ZA 2IFWA 1J1TA 3KT1A 4KU8A 4N7UA 4UW4A 2FDKA 4BPZA 1YFUA 3ILNA 3K3OA 1S0CA 3AYEA 4JKMA 4P14A 2G19A 2IXCA 1I3HA 1FATA 4FFHA 4Y22A 1MS8A 3W9AA 3J26N 5FYUA 3ZPYA 1MZ5A 3DKQA 4RHV3 4IEPA 1C8NA 2NLRA 1VMFA 4Z82A 4CUCA 1VBA2 2ES3A 4HETA 3ZMNA 3FZ3A 4Q0PA 3LEKA 2YU1A 4JDOA 3VZNA 1LHOA 1O8PA 4LXLA 4U36A 4GH4A 4W65A 2NMNA 3WZ1A 1T6GC 2VMHA 3CHXA 4QPGB 1JYVA 2VW1A 2BWAA 1RMU3 1OA4A 3ZFGC 1TEIA 2Z4FA 3PJQA 1TNFA 1WW7A 4H3WA 3HQUA 3DF0A 1QQP1 4JCKA 1WCQA 3TAYA 3WNOA 1QJU3 3OD0A 4IV3B 2E33A 2NYYA 1GR3A 3HIFA 1S0DA 1PO21 2NMOA 1V6MA 4YW6A 1G86A 1AR82 4D3WA 2VC9A 4AI3A 2R30A 1COV3 2QUOA 2QZ3A 1WCSA 2X5IB 1CAVA 4XDQA 3C3VA 3ORJA 3UNPA 3VKLA 1ALYA 5GZGA 3CKHA 3HNYM 4DY3A 2D98A 1NLRA 4CDQC 2J1AA 2V5YA 4FOVA 4FPEA 4YARA 2GMPA 3DGTA 3KVAA 4OLLA 4CP0A 4B7KA 1UOFA 4Q2FA 5FZCA 4DUWA 1ZVFA 1NG0A 2WNEA 4I02A 4ZZ8A 1WLTA 5LRRA 3ECQA 3BKZA 1SBFA 1QOOA 3P3NA 1DBNA 1RUE2 4QHOA 1GP4A 4LBJA 3ELNA 3DPRA 4XF4A 2JIGA 2ARAA 2PMWB 1IQDC 4M00A 4OUMA 1R083 4PI0A 4QAWA 3MGUA 5EQUA 3OTFA 4RS5C 5I0RA 5FBZA 2X10A 1KD7A 1Y3TA 2H6BA 1W9SA 4FPOB 3RPQA 1H8VA 1HRV1 1POQA 2PQQA 5IYYA 1ZX5A 2HYXA 2J42A 3PIJA 5JSOA 4D7YA 5ANQA 4CXYA 3WY6A 1QJZA 1B35B 4AGGA 4BQ2A 4QX0A 3LGRA 1ZRRA 5T5OA 3MEPA 5A80A 3J7HA 5JXGA 5JI9A 3VD9A 1WA4A 1S2BA 4LA3A 4NIGA 5FPAA 5FYTA 1W3XA 2YPDA 4H55A 2BGOA 2PHTA 3H0OA 3SITA 3UJOA 1J3QA 1XRUA 4N43C 4Z92B 2PLV2 1RL3A 3IIIA 1SBDA 1JN2P 1YO8A 1FOD2 4PHZA 2MEV3 4QDQA 4XACA 4AAXA 4AI1A 4LIVA 4LTAA 4NIAA 1FPN1 3OUHA 4HVOA 1WD4A 2WN2A 1IZ3A 5DG1A 2N7GA 1NA1C 1QHDA 1S4CA 2BW8A 2VBDA 5AVAA 5FK7A 1UX7A 1FX5A 4ZPIA 2ZEWA 1MQTB 2AR6A 3SH3A 2Y64A 4FFIA 1OUSA 1Z7S2 3S7IA 3LEMA 4A6OA 5GLWA 1RTVA 3KB5A 2XJPA 1TMF2 1LOFC 3WNXA 3WDWA 5DZGA 1ULDA 1EAH3 4IEWA 2XJUA 3J7NA 1UZZA 3A22A 2RS51 1I5PA 4GJYA 4NHKA 4NPMA 3LCPA 4OUSA 1PVXA 3MF9A 5J48A 3BPSA 5I93A 5F5CA 4YM0A 4YZ4A 1HB2A 2VXJA 1OI6A 1TVGA 1LEDA 1C8M1 1WLDA 2ZEYA 1DGWA 4M4RA 5GZEA 4CEYA 2VZOA 4F7ZA 4LT5A 5KHIA 3AZVA 2Q8EA 4KH9A 4LBNA 4L0PA 5LRSA 2RM21 1RHI2 5FPUA 3RZGA 3DYOA 4W6YA 3ZXEA 2IZWA 3M1HA 1S1AA 1J84A 3I3BA 4GWMA 4XF1A 3WUCA 2A3XA 5JR2A 2MHFA 4JTOA 4E2SA 1R1A1 1RINA 1HKDA 4CDUB 2CY6A 5DQ0A 3VBRB 4NRPA 1XU1A 2ET1A 3SLIA 1IPSA 3VZLA 4DXTA 3CJIC 4LLFA 1KJLA 1QH7A 3R05A 4N9IA 4I3PA 4R9AA 2RS31 3MDPA 3VBFB 3N7MA 4A4AA 2Y6FA 2CWSA 4CCLA 4YFZA 1ZBE2 4L99A 3K4ZA 5FP9A 5J96B 2WC2A 1VBA3 1Y4WA 1N1YA 1MVQA 4P9XA 4QX8A 5SV5A 1PGL1 5L7OB 1AL22 5FMOL 2JG8B 1UMIA 2EA7A 3N9MA 3J8F1 2R041 1CJDA 4IEOA 1HRV3 3H3UA 2RR11 4LORA 5FP4A 5CBLA 3MLLA 2KXLA 1G7YA 2V09A 5JOXA 1W04A 5LK7B 1H1MA 3TEXA 2GSYA 3AYDA 2F17A 2QBXA 2XGXA 5A6QA 4JGZB 3OBZA 3I3DA 3B9IA 2VUDA 2VUCA 3OY8A 3SXWA 2VECA 2W2IA 3T2TA 3OEBA 2D6NA 4BQWA 3ILFA 3JBG2 2C9AA 4X6RB 4YW2A 1C8M2 1JZ6A 2W92A 3U10A 2VM9A 3QD6A 1XB9A 1PM4A 3BIEA 4XJ8A 3N7JA 4X8NA 2XPJA 1DZRA 1LODA 3KCXA 2E7TA 3N7KA 4CDXB 5IAXA 3K46A 4GKXA 4CDXA 3POBA 2WRAA 3ZR5A 2ZGRA 3RZLA 1W8WA 1OURA 1PO23 5FLHA 3HPNA 4AF9A 3RI8A 4BB3A 1QJU1 3MUY1 2IXIA 3OEAA 4FPFA 2E63A 2X53S 1H1IA 5KXDA 3GBWA 5CG8A 1SBEA 2VCCA 5F37A 4JVAA 4XMAA 5L73A 3UKTA 3VN4A 3WQ1A 4ARXA 3E5XA 4NAMA 3OY8B 3RZZA 1RMU1 2YBSA 1NE4A 1HRI3 1AXKA 4N90A 4GH4C 4K9SA 3LWCA 2BGPA 1E5RA 1FOD1 2OZJA 2GN3A 4QB2A 2AEYA 3PVBB 2SLIA 3GDBA 1AYM3 2JG9B 5J36A 1OVPA 1W2TA 2WQZC 3MIGA 4MLOA 2BNOA 1VJ2A 4RR3B 3UGFA 3ACGA 1WW4A 3GNEA 4O7XA 1YC61 3KZ4C 3AL6A 2PLV3 4JGZA 3MFCA 5IUQA 2VGDA 5FUNA 1FXZA 3O1OA 3IZOA 2R042 3W59A 2DUOA 2DCTA 3LSEA 1NYWA 4XILA 1JTZX 1S55A 2WNVB 1FPN2 3TEZA 3O1PA 3VHOA 1YQ6A 5FPLA 5FYBA 3THTA 5HCFA 3WDUA 3TNPB 4Z2AA 1MVEA 4YW7A 3HN3A 4PIZA 2B39A 2HKXA 3WF3A 3LB9A 2VJXA 3T2OA 2VOWA 3RMYA 4D8MA 3B3QE 1W0PA 2OKXA 3RG0A 2V73A 3BPZA 3QBQA 5HCBA 4AQ2A 2LRPA 1UKGA 2B9VA 1F15A 1PK6C 1FNZA 2Y33A 5DABA 3T1LA 4CA9A 1GQGA 4RSUA 3FFQA 1FV2A 1IPJA 4QKFA 2Y6HA 4QB1A 4COYA 1ASJ1 3K77A 2ORZA 5JDBA 1NE6A 1YFWA 4XF9A 3VBRC 4FFGA 2CGPA 1QJU2 1V6OA 2QFEA 2XBO3 2ZHKA 2JWPA 2B9UA 1UZVA 1ST8A 4ZZ5A 1VBD3 1O3TA 4X8PA 1SDWA 1N3PA 2BP6A 3ALQA 3FLPA 4HFSA 1JHJA 1W6MB 1WBLA 2P4EA 3ATGA 3AZYA 3ACHA 5A7QA 5A3WA 1CPNA 3PTRB 1UPSA 2DCYA 4MUVA 1RHI3 2VOXA 2I74A 4HMZA 1UU4A 4RN5A 1YQ5A 3OGSA 5FXVA 1YRZA 3GGLA 1OMIA 1RC6A 5A7OA 3WCRA 3ACLA 2DU0A 1OD5A 1AR73 2VVEA 1SLCA 3CBNA 2Q0AA 3GBFA 1JXNA 5FJHA 3WW4A 3M8LA 4QX7A 3I59A 1GYKA 3VHRA 4XJUA 3FBYA 2A73B 3I2IA 3UV9A 3ZVXA 1VPHA 1F9KA 1SFYA 2ZGMA 5C3SA 3TYJA 2JD9A 3AMMA 1ZBE3 3IDAA 1MS0A 2JDHA 3BYWA 4JZRA 2HWD1 4M01A 4CEWC 1LCLA 4HK8A 2EXJA 2FD8A 2GP3A 1FV3A 3Q8AA 4CCNA 3AL5A 4AR2A 1JZ8A 4K1YA 1US3A 3HEIA 4MH0E 4E4SA 3MF6A 4QQOA 3F2ZA 1RXGA 3UK9A 1DF0A 1O4YA 2WO2A 4GAZA 4D94A 3GJBA 2VAUA 5JAXA 2AGSA 2BU9A 3WINE 4Y5Z0 4R4ZA 4N53A 5FMDA 5EYXA 4B7EA 4PDWA 4IEQA 5JXJA 1RUF3 2JDNA 2AACA 2WZR3 1U5XA 1EUUA 2VNRA 1LKNA 1RUI3 4QDSA 2VULA 3AK0A 4KG0A 3ZXDA 3VGIA 2PQSA 4NUBA 4TLGA 1H2MA 1VRBA 3AP4A 1AR91 3M7AA 3PVNA 3FL7A 1A34A 5FZBA 1FYUA 2XG3A 3TN93 3U4SA 1JYNA 1DQ1A 1AJKA 1VBC3 2BFUS 2DCKA 5LEJA 3NAPC 5FZAA 1RUE1 5AC92 3BCWA 3EHKA 1BBT3 4YVWA 2HBUA 1U5ZA 2DWRA 2DVBA 2LS6A 2YROA 5J1XA 5A7NA 2WSUA 4FPCA 4AOCA 1OQ1A 5AFEA 3POEA 4FVVA 1BBT1 3D82A 1GZCA 4XF3A 2RS13 4MADA 2RMU2 1RUE3 3POIA 5I0DA 4L97A 1ENQA 3M70A 1VBC1 2GU9A 4RR3C 4EWDA 5BNOA 5I8SA 2ZMNA 3V0BA 1F4AA 5FOBB 1D4M1 4E27A 1JZ7A 2PELA 2ZJCA 2GDFA 3LDKA 3ZXKA 2AYHA 1NCQB 1SFPA 2WAAA 2J1SA 2XLGA 4K40A 4CDQB 4Q0VA 1WGPA 3GBGA 5HV0A 1FT9A 1V6KA 3N9OA 1AR81 2DUPA 1UQXA 2MPFA 4IGPA 4NVPA 2O0OA 3S6PA 5ACA3 1QGLA 2X5IA 2J1RA 3GXUA 4KWLA 2XLAA 1KDMA 4P5YA 1PZ9A 4OHYA 3KCYA 3BTAA 5H9PA 4EN0A 2JG8A 3ZIWA 2AENA 4XAAA 4LBOA 1XPWA 3AM2A 5IVFA 4P08A 2XDVA 4AG4A 3ZSJA 2CHHA 3VBHC 4ORFA 1SCRA 4XAEA 1ND3C 1MS1A 3FLRA 2OT7A 2RE9A 2VO5A 5A32B 2GAUA 5GZFA 1AXZA 1Q8OA 2OZ6A 1PGW1 4LLOA 4Q27A 5DXDA 2O14A 5FO7B 3PUQA 4UBHA 2HWD3 2FDHA 4FXKB 1UAIA 4GH4B 1W8OA 2W47A 3BB6A 3WOGA 2RJLA 5GKAC 3IN9A 3R4SA 2Y60A 4QWNA 2QQOA 3SISA 1LNSA 3RFRA 3VBUC 4GWJA 5FZ6A 1QJX2 5A6ZA 2VQUA 1CZVA 3H1YA 1W8TA 4PDWC 3U1XA 5C4WC 1D4VB 4LNVA 1AR71 4C1WA 2LTNA 3VZMA 4UBGA 1YXWA 4WM8C 5K0UA 4XQ4A 1HIXA 2WZEA 4CEYB 1W06A 4AI8A 5CISA 1SLAA 1QY4A 2J1VA 5CU1A 5FXZA 3WNKA 3WD5A 2RS32 2ZX2A 2WNOA 1ODNA 3ZFEB 1CONA 1RUC3 2VZRA 4DEVA 1JOJA 2FMYA 3HR9A 1K42A 5FXWA 1KEXA 2WNUA 1HXS1 3ZFFB 1VE0A 4IDZA 1RUG2 3I2DA 2V4AA 5FZ7A 3D4KA 2Z2SB 3ENRA 5JZGC 1FI2A 1M06G 1VBE2 5IWFA 2OPWA 3NKGA 4FO9A 1W0OA 4Q8KA 4LKSA 4Q0QA 1DYOA 1H8TA 1IPKA 3RZKA 3MLJA 3GYDA 4FPHA 1UNBA 2WO3A 2JDZA 5HBAA 2EICA 2YUEA 2OUJA 1CN1A 1C3HA 1ULFA 2KM2A 1SFNA 2LM3A 4UFKA 3RRDA 3JU9A 1QF3A 4AXOA 5FZKA 5C8CA 3KHCA 4GKYA 5KWRA 1H1AA 2WDBA 4G9SB 3WDVA 1ZZ6A 5T52A 4AEJA 2D7FA 2ZX1A 4O65A 1S0IA 4MV2A 4KQ7A 3FBMA 3HT2A 2EVXA 3VDDA 5FIXA 2MEV2 4OHWA 2E7AA 3ZYPA 1AR72 2CYFA 3AKPA 4L8QA 3USUA 3ZFFC 2V5DA 1POV1 3RQ0A 2FDJA 4BK5A 1GNZA 4NN0A 2Z69A 3CQOA 2QQWA 3WCSA 3WP4A 3KQRA 3JQWA 4R9CA 1AR93 5DAWA 2Q4SA 4OQ8A 3RGBA 2R0HA 1QJFA 5FZ0A 4LE4A 4AHYA 4QKBA 1W8UA 2AEZA 1VBD2 4L2NA 1RUF1 2WZR1 1EV11 4D69A 3QACA 1BXHA 3PHMA 2F4PA 1FAYA 4XPVA 3RYRA 1H30A 3Q8BA 4XUQA 5F6LB 2LW8A 1QJY3 2ETEA 2GNBA 4OVEA 1C4RA 4LHNA 1MEC3 2WWJA 3IPVA 4YM1A 1A6CA 1FNYA 5F8PA 4IV1B 2WR9A 4E4ZA 4PJYA 4K8RB 3ZIXA 4C90A 3MZHA 5FQ0B 5KR7A 2HWE2 5B2GB 1TQ5A 5F32A 5BNPA 3ES4A 5KHGA 4IW3A 1DIWA 3MIFA 3V0BB 2VZTA 4NPRA 4XBLA 1RITA 4PIXA 2ZOEB 3BTXA 4AEKA 2W1WA 1C57A 1DHKB 2BNMA 2WWSA 5LY2A 2R1DA 3A4UA 2ZHLA 4MXWB 4TYSA 5JIAA 3S5AA 1F2NA 3B9CA 2ET7A 4AVVA 3RWNA 2R1BA 4LUKA 4PDWB 2ZTNA 2PYTA 4TTGA 2A6VA 1QWRA 4DXSA 1LRHA 3DCQA 4NO4A 1H6XA 3VDCA 5D8AA 3B00A 5DAVA 3AX4A 1XNCA 3M3CA 1OH3A 4QPGA 3Q9OA 2ZMLA 1MR5A 1O6UA 2D44A 4YVSB 2VQAA 1RHI1 4GMP0 4OHZA 3UGGA 3JD72 2CAVA 3EYPA 2OYZA 3WP6A 4CP2A 2GC1A 4BQ4A 1SPPA 2ZZQA 1OA3A 4WZFA 5K7PA 3AP9A 1HJGA 5C5UA 2JB4A 3ACFA 3O7OA 2G1MA 2JG9C 2D40A 3KHBA 1E5HA 4WZCA 3J8F3 1WMXA 5H9QA 4E8CA 4KI5M 1LULA 2W52A 4Y22B 3RNSA 5BUVA 4HONA 1KS4A 5FXXA 3UKVA 4A3XA 1GU3A 5EYYA 1MS4A 1NT0A 4LHLA 5GLZA 1ASJ3 1J59A 2O8QA 3O1VA 2JXAA 3GCXA 3C7HA 5FZFA 5I91A 4CCKA 2IVJA 1VBB2 2VTFA 5EP9A 2FDGA 5K0UB 3NNLA 1REEA 2CSGA 3BOPA 4EN8B 4QPIA 4BE3A 1S0BA 4QPIB 4RGKA 1NY71 2R6QA 3C7EA 3KCCA 4AL9A 5A1LA 1J1LA 1W2AX 3H8UA 4YRDA 3V56A 5C71A 1R1A3 2AC1A 4KWKA 4BJ0A 5F3GA 1Q8SA 4QPWA 4KU7A 1TZOA 2XBO2 1ND3B 3I2OA 3EMRA 4LBMA 3ETPA 1DCSA 2PLV1 3MFAA 4LBQB 5IVYA 2UU8A 1HQLA 3SKJE 2E26A 4Y20B 1QKQA 2OVUA 3HNBM 2W0XA 4KWUA 2WA3A 4K3UA 1CAXB 3FN9A 1GP6A 1C8M3 2A6WA 2FMDA 1O7FA 4ZXEA 2VW0A 1AXYA 1AYM1 4FFFA 4MOAA 3VBFC 2PHWA 1QIQA 3WDTA 3U4XA 3V65A 1VBC2 4CTEA 1CVNA 1U5IA 4V2VA 2QDRA 2D6LX 2QJVA 4UI9L 3E6DA 1SEFA 5JI7A 3JB8A 3WUDA 5A33A 4OZOA 1AUYA 2GZWA 2ZGTA 1EAH1 3ABZA 3CF6E 1GOGA 5D21A 4P5HA 1HRV2 1PZ8A 2RDSA 1Y9QA 3ON7A 4LKEA 4QPYA 4Q4X2 3VHPA 4FTEA 3KV9A 1W6QB 1C5IA 3NWKA 4Q0UA 4XIOA 1JH5A 2ID4A 3VBSC 4AI2A 1ENXA 4KGQA 3MHZA 5F1RA 3A0KA 5FBJA 4IV1A 4DEQA 2W9XA 4IEYA 3OSDA 3PNAA 4GA9A 2QE3A 4K7JA 1FPN3 4NHLA 3AZWA 2OUHA 2JB8A 5DAQA 1R092 4L92A 2WT0A 4LULA 4NAOA 5I8TA 4I0AA 5A1FA 4LQRA 4Z1VA 2VXRA 1XNKA 2Q1MA 3AP6A 3KQ4B 1H2KA 2ZCWA 4NPLA 3GM8A 1BVVA 4XABA 5FK8A 1PGSA 1DLLA 4CCJA 3P6BA 2ZEZA 5EJZB 2Y8KA 4URAA 4M4PA 5A3MA 5LA9A 1JYCA 1RUI2 1UD1A 2QCSB 2ARCA 1Q5OA 1STMA 2QVSB 1BEV1 3USUB 4HPKA 5E6HA 5ABJA 1C28A 2HWD2 4YW1A 4A41A 4JV4A 5FY1A 4CXWA 5FDBA 3MW2A 1MZ6A 4LOSA 1MQTC 4ZY9A 1TME2 3NJVA 2W87A 4Q4V1 1UN1A 4F83A 3H8XA 4EE2A 4BIOA 1JS9A 1OOPA 2BGCA 5C3QA 3K51A 3ZYHA 2PFWA 1JHNA 4GIQA 1VBA1 2AREA 3C2UA 1OPOA 2BWCA 2HYKA 2O8OA 2ZKNA 5A33B 2EAKA 1UW8A 1WMEA 2HWF3 3NV1A 5E89A 4AVTA 3ZN6A 2RS33 4XETA 2JE9A 2QQIA 5FYHA 2BZDA 2XVLA 3AKTA 4RFT0 4UF0A 3KGLA 5EPAA 3D0SA 3N9NA 2QQNA 4ARYA 1UXXX 1COV1 3WEZA 4MZUA 3LSDA 4LO6B 3VKMA 5C8CB 3BODA 1KFXL 2LALA 5FZOA 3AKSA 2W94A 3ZXLA 4CYDA 3BU7A 3A21A 3RYPA 5A3LA 2RG4A 4Y1XA 3HOBA 3N9LA 3BTZA 1DQ2A 4B3NA 1IHMA 3VBSA 4JDNA 1RUG1 1D7PM 2RM23 3ITQA 3M4FA 4GQ7A 3SMHA 4N43B 3ZYJB 2D3PA 4FSJA 1BQPA 4FOYA 2A1XA 4FPGA 3DUIA 3I2JA 2VQTA 1W8ZA 3AJYA 2R072 4IESA 4KBZA 5DUXA 5CEHA 3O1MA 1HJFA 2EIGA 4ZU4A 1WA6X 1VALA 2AUYA 4IEXA 4LBQD 3LIGA 3OF1A 4O9EA 1KS5A 1RVF2 4U2AA 2FDIA 4A6SA 4LPLA 2YHJA 2XB6C 2A71A 4XHBA 1YQ2A 5FJKA 2A3YA 4QT6A 3ZYGA 2H6CA 3JQXA 3WF1A 4YG3A 4LMFA 4XFIA 4OHVA 1DFQA 2K9ZA 4OI1A 4CUGA 4LITA 3MPBA 4NOTA 1HN0A 2RR12 4DY5A 4B29A 5JVVA 3K4AA 1PGW2 4H2AA 5LCWL 3KD4A 1GZWB 3FHIB 1F5FA 1RIRA 2NZ9A 3BGAA 2ZHNA 1IOAA 1ZM1A 4C1XA 5FP3A 4NR1A 1R1A2 1LGCA 4ISQA 2QZ2A 3SEPA 1H2NA 2MEV1 1JUIA 3BN6A 5JSPA 2VG9A 4NWVA 4HL0A 4WM8B 4CDUA 1J3RA 3S5QA 4M3CE 3WG1A 4A42A 2RMU3 4C0HA 1LAJA 1OXCA 4UFHA 3VBUB 1UYXA 1WCKA 1JI6A 3APBA 5FYMA 3SHRA 4BWOA 1H4GA 4DMIA 4LE3A 2OW4A 4CCMA 5L7OC 3N36A 2CDOA 4BQYA 1BHGA 1W99A 1W6NA 2JG9A 4QKNA 2VW2A 3RZJA 3SCGA 1V9U3 1AVBA 1WMDA 2Z42A 1VAMA 4XC9A 2B45X 2JD4A 4ES9A 5EHDA 2HEVF 2BBAA 4GB31 4QXCA 1P8JA 2YC0A 1NLQA 1PX3A 5FMBA 1ZZ9A 4WM7C 5HCAA 3AP5A 2HWC3 1Q8QA 4HVRA 4GZ9A 1ZYBA 1O3RA 1LTEA 1ZBA2 1W3VA 3NJYA 1RUD3 3K48A 5FKBA 3IDBB 4QMAA 5C3OA 3PIGA 5IVBA 1UZYA 1W9FA 4QGNA 1PO12 2HEWF 4B4QA 3A7QA 1LU2A 1NCRC 3AXDA 2UWBA 2GN7A 3KMHA 4Q1PA 3ZR6A 4CU7A 1OPMA 2FZ2A 5FTTC 4XURA 1E57A 1F35A 4XDPA 2JENA 5ISLA 2B4KA 4J1WA 3K4DA 4GALA 1GSLA 1SDDB 1YFXA 2UY8A 1OF3A 1REFA 3IKWA 5DN2A 3VV1A 3DEMA 3F95A 3HD8B 2VOTA 2QQUA 1UWWA 4OMDA 5LBEA 4HANA 3TWIA 4M0HA 1LOBA 2Z5WA 2VNGA 3HN1A 4GD4A 2Y6KA 4AI0A 2VZUA 1MEC1 3M3IA 3O14A 4URTA 4Q29A 1Q8PA 2QKDA 3H1MA 1Q56A 3KSCA 3N35A 4CXXA 4XUOA 4DUVA 3NMBA 4LA2A 1WW5A 3B5LB 2R071 3OBTA 4WVWA 5A6XA 2CNAA 2ZA9A 3DYPA 3PJYA 5GZCA 4Q4X3 4BLJA 3IMMA 4DUXA 1DGWX 2OQ7A 2VUJA 5K9YA 1QDCA 2PHRA 4NIIA 5C70A 1GOFA 2JE7A 2BOJA 2UYBA 2ZABA 4LBLA 4PLNA 5A3UA 1LHUA 2XVGA 5JXIA 4M0NA 4IEUA 2VUAA 3ZFFA 1COV2 3ZDSA 1PZ7A 4KGGA 3SEEA 2VZPA 3DXUA 1URXA 1E5SA 2TBVA 4R4XA 3C7FA 5I0UA 5DAXA 4DQAA 5FWJA 4YGDA 1G9CA 1JODA 2E51A 5EIYB 4K6BA 3KT7A 3HVDA 1ND2C 2VU9A 3BOWA 1NXD1 4QU1A 5LA2A 5C7GA 2WT2A 1DZTA 1UU6A 4LO8A 2XWBB 4AFAA 1ULCA 1W03A 4E8DA 1BYHA 1UY3A 5HXVA 3NO8A 5E88A 2C26A 1OT5A 3CZJA 3I3EA 3R6SA 2FCUA 1KXGA 4AFMA 3KV6A 5HCHA 2D6KA 3LZZA 4QB6A 1XOYA 4UW3A 3NNGA 1A3KA 4YW5A 3OPTA 2IUWA 2DVAA 3T0BA 5JZGB 4IXLA 3MIHA 4Y33A 1GV9A 5JPNB 1UYZA 1OKQA 4Q26A 1OLRA 1QXPA 5CFCB 4I2OA 3H8OA 2WNUC 3NJZA 4P9IA 4BA6A 3KF3A 1SACA 1WCDJ 1RUC1 3EB7A 1PM7A 3R4UA 4XZUG 4AGRA 1S2EA 3O5SA 1IG3A 2GC0A 1FMD3 5DPNA 2XH6A 4ZHNA 2JJ6A 2I45A 4EN7B 1CJPA 4BZ4A 4XF0A 2FZ1A 3VZKA 1CAXA 1ULEA 4Y20A 2HBTA 4M3CB 3ZYBA 4INDA 3JD73 1X33A 4NROA 4C8DA 2ZGKA 3CL1A 5TSWA 4LKFA 3VZOA 1OC1A 1UY0A 2PHXA 1ODMA 4O61A 5C4WA 2QQPA 3WLUA 5JPMB 3AZZA 2JKBA 5CB7A 5I8YA 5F5AA 2PHLA 3E1F1 4Y1VA 5DUVA 4S2GA 4F8AA 3OPZA 3D3AA 1AHSA 2PAKA 3AB0A 1NCQA 1ULPA 4MO3M 4PBOA 5IAVA 1MEC2 4RQPA 1PO11 4V1PA 2YY1A 1VR3A 2XJSA 1HV0A 4BHPA 5A3PA 1SZBA 5F7UA 4MGKE 5CNAA 4D0QA 3V64A 5C9AA 2P2KA 2PTMA 4OZXA 1OD3A 3VD4A 2ZGPA 4W4ZA 2QTWB 1RB8G 1GMMA 2Y6LA 4IV3C 4J25A 4LK7A 4B8EA 5JOWA 5EFUA 4H7MA 1V9U2 1YQ8A 4JGYB 1LGBA 3SH5A 1SLTA 1CGPA 4KMQA 4KG8A 2XVKA 1B35A 1LHNA 1OLMA 3AKQA 4D6SA 4Z8BA 1O3QA 3E6BA 4KBBA 2BERA 4ZS2A 4IGOA 5EWSA 1N47A 3H3ZA 3IWZA 3R4DB 3WNPA 2X5IC 3GZUC 4XXPA 1SPPB 3POWA 3KVBA 1JOBA 3IBMA 4I0BA 5ACA1 1KRIA 2DUQA 5F2WA 1YIPA 4BK4A 1W9WA 2RDRA 1QJY2 1QH6A 1EY2A 3W58A 3EBRA 1YHFA 1X9PA 1Y9GA 4OMCA 3N7LA 4E9KA 3MW4A 1YFYA 3T1MA 1QQP2 3WDYA 2BTVC 3O0VA 5J3UA 1W2NA 5CFDA 1UMHA 2P37A 5HI0A 3FHQA 3NNMA 1CZTA 4XJ9A 3L2HA 4FT8A 1B35C 3IMNA 4GMP3 4O9GA 2ARXA 1Y7BA 3MIBA 3S0MA 5F3CA 4JGYA 2D6PA 2FBEA 4QDRA 1HB1A 3I2FA 5ABJC 1LOGA 4CCCA 4HPKB 1VBB1 2GNTA 1JZ4A 2XUEA 2IWGB 2RJ2A 1TME1 1ENRA 2DVGA 4JQRA 3ZSLA 3NAPA 4HSLA 4Y3OA 2KD7A 3TN91 4AQTA 1RJ7A 1ASJ2 5FYYA 3OG2A 5FUPA 4I01A 3RVHA 1G9BA 1CAUA 4CCEA 4R9BA 1B09A 4RQPC 3SNMA 3USSA 2VMDA 4CP1A 1NCQC 2Y38A 4YZ1A 4FOWA 1RUI1 3H1WA 4WVZA 2CTVA 4AK3A 5IK7A 1OKOA 2WZPP 4ASLA 4GWIA 4DPNA 2XJVA 2YC4A 3WV6A 2ERFA 5JOZA 1K5MB 3AZXA 3J9SA 5GLVA 3TB0A 3THDA 1O4TA 3VBOA 4YZ2A 3ME2A 3LOBA 3RI9A 4WBBA 5F2SA 4KL1A 2IXKA 1OLQA 4HN1A 3WW2A 2HEYF 2WZ8A 5DZFA 3VBHB 4B4RA 4Z07A 4YVSC 2JIJA 1RUJ2 1W2UA 2QQVA 5L9RA 1PVC3 3O12A 2YDEA 4YLZA 3W5MA 1AJOA 4CPBA 2X05A 4TZDA 1KFUL 1SCSA 3LEIA 1UY4A 4UAPA 4DIQA 4JRAA 4A7KA 4LHSA 4CEWB 2J1EA 3AMNA 4CEWA 4UOJA 5H9SA 3UKNA 3H9AA 3ZFGB 1ZBE1 4TN7A 3G7DA 3MI8A 2RM22 2ZS6B 3CMGA 4KNCA 2R7EB 1PO22 2QQMA 1JU3A 2YFUA 4MX3A 5A1AA 3N4MA 1N3QA 3ZKUA 1BCXA 2JDUA 5T5LA 4W8JA 2RS52 4CDWB 1UYPA 5B4NA 1CAWA 1R082 2C24A 3U75A 4EWAA 3CJIB 3PUIA 4EROA 3J4UH 3LD8A 1NKGA 4Y26A 2Q8CA 3E5QA 1VAKA 2OX0A 2ZGQA 2X29A 3OGGA 4XCBA 2D3RA 5D2AA 1VBD1 3B02A 2VBBA 2HWB1 3O0XA 5GALA 4XJWA 1FMD2 1YUDA 2UYAA 3X29B 2XBO1 4EQVA 4HVQA 2Q1FA 4H14A 4CU9A 3U0ZA 2DFCA 4P9YA 3W20A 2WNUB 5EJ1B 1US2A 5FO8B 4FAHA 2YMZA 1DQ5A 1N1TA 3TRSB 3FE5A 4XQDA 2OPKA 2W46A 1PGL2 2C1FA 1PK6A 5FKCA 2P5BA 2VOKA 5FZ4A 3EJKA 3ZX7A 4BXSV 2D5HA 4RYDA 5ERLA 1OQDA 2R061 1BJQA 2VMGA 2X09A 4Q5OA 2GH8A 2C0ZA 3TOJA 1U12A 3O1UA 2W91A 5FPBA 1Z7S3 2D6MA 1YI7A 2VPVA 4PQQA 2VNOA 4QQPA 5EJ3A 1UO9A 3DPRB 5JR7B 1JYWA 4XYXA 3KM5A 4LKDA 3ZDVA 1RXFA 3NW4A 4N9HA 4EJRA 5DUUA 3QCWA 1QXRA 1YJKA 1PMIA 4XXAA 2JECA 4JHTA 3WR0A 5JSRA 1W39A 3AMQA 1XNBA 1AF9A 4Y24A 1IGOA 1X36A 1NCRA 5FZ1A 1UOGA 3TEYA 3FX3A 2V72A 5CIRA 1V6NA 1W05A 1X8EA 1FOD3 4EN6B 3BTYA 5FCCA 1QU0A 2IXJA 5IW0A 2P3IA 2VZQA 2HWE1 1A8DA 1HB4A 2A75A 2HH9A 3GZTB 1HRI1 3KWVA 1CAVB 3FUOA 2DTWA 1LU1A 4RL7A 4YGCA 3NL1A 5AVPA 2E32A 1D2SA 4WM7A 5C8WA 2Q5TA 4L9BA 4GXLA 2VY0A 2XHKA 3WQ0A 5JOYA 1YNAA 5FAXA 4BDVB 3B01A 3VDAA 4FPYA 2A5ZA 5BY5A 1JMUB 4BM8A 1H9PA 4YW4A 1SLBA 3U37A 3OGVA 5T5PA 2AZ5A 5ABJB 4BYYA 4P9JA 1Q3EA 2J1UA 1EAH2 3ZN4A 1Q43A 3AMPA 2OS2A 1MS5A 4CDXC 4IL7A 3VL9A 2MNGA 1JW6A 2FCTA 5D1IA 2IFRA 4XQWA 4MGTA 1GNHA 1LEMA 5E16A 5L7OA 1CD3G 2C6SA 2VCMA 4G4FA 4META 2VZ3A 4JRLA 3T08A 3WG4A 4AEMA 4BOWA 1NCRB 4DZGA 5FMCA 5CA6A 4AFDA 1AYN3 5LZ6A 3POYA 4NRQA 1ZZ8A 1RUD2 2EXIA 1WKYA 4OCTA 3ST7A 2Q30A 3MIDA 4LEJA 3EO6A 5DAPA 2WSVA 2WS93 1AL0G 1U0AA 1QMJA 3P3PA 3Q8FA 4H7LA 4OFGA 4COVA 5JWPA 1K5JA 3AKRA 1JZ3A 5JXHA 3POSA 1DYKA 4P9WA 4QHZA 4CZSA 5C5TA 4M3CF 1OVSA 2RR13 4JKLA 2RVAA 3DN7A 3ZO0B 1XBFA 3MYXA 1D2QA 1H9WA 2VMIA 2R043 1W9YA 3I3QA 1W8FA 1LGNA 1RVF1 1UCXA 2XQXA 5SV8A 5L9BA 1W6OA 4R8HA 5BNNB 3NNJA 2VOVA 1VBE1 4AE2A 1EUTA 1OA2A 5E1RA 2C5DA 5CKQA 2JDPA 4QM8A 1MS9A 1RYYA 2YV8A 1K45A 4R52A 1OFSA 4Y1UA 2DVFA 3T0DA 1G8WA 4QU2A 3OBAA 4IETA 2GMMA 3ROUA 1GZTA 2TUNA 2WYFA 3H50A 3SCFA 2WA4A 2IC1A 3J7MA 3TBDA 1JYXA 2E6VA 4BIFA 3CDZB 1JYTA 4QD2A 1ZA4A 3JZVA 4UFMA 1BKZA 2OQ6A 4B4PA 1PVC1 3OYWA 4YVSA 2YGMA 4OQ9A 4K21A 3OB8A 1LB2A 5JMCA 5KXEA 5FFOC 1VMHA 3D6EA 4LO5B 1TG7A 1Y9MA 3NV3A 3WP3A 1W28A 4XJAA 5EXOA 4MHRA 1VLNA 2X8KA 4C91A 5FZ9A 1MACA 3VBOC 4DB5A 3WT3A 2A7AA 4QM9A 4MGSA 3VKNA 3LOIA
chains in the Genus database with same CATH topology
3AJZA 1NY72 4DNYA 2ILMA 3WHUA 4DOUA 4XTMA 2RS53 4P9GA 3ZMOA 1OOPC 1I9RA 2RHPA 2DF7A 1PIV3 1LOFA 4HN0A 4Q8LA 4S2FA 1MZEA 4N7IA 1AZDA 1JUHA 4FQZA 2R062 3VBHA 4JGYC 2XUMA 3HWJA 4YNIA 3DV8A 5DG2A 3VHNA 2JG8C 4D7SA 3INAA 1QJX3 2KA3A 5CFDC 4HSJA 3H7JA 5I0TA 3FC0A 1CQ9A 4MGZE 3IIAA 5T5JA 2E53A 4AHXA 4W6XA 3OJBA 1YI9A 2I2SA 3FJSA 2E7QA 1OHFA 2ZMKA 4L11A 1D0GA 1CAUB 4Z2WA 3U11A 4XFFA 3JB4C 4QGMA 5CG9A 4RR3A 5BNOC 3BIWE 2B7YA 3WHTA 5AC91 1XYOA 4PLOA 4BH9A 4IV1C 2BPA2 4IV3A 4RS5B 1R091 1R081 4BCUA 2EALA 3NVCA 5C9AC 2I07B 3FUQA 2K0GA 1HLCA 1ZZ7A 2BUKA 3ES1A 3RMXA 2BBVA 1AX0A 2PN5A 5BXXA 1RUNA 3GF6A 1V6IA 2B46X 2GNDA 4DXZA 5T50A 4A2UA 2DVDA 5GM0A 2UURA 4TSVA 5LK5A 3WW1A 2UWCA 3TNQA 3SH4A 4NWWA 1H4HA 3M3EA 1V6JA 4RA0A 3IDEA 3ZSEA 1QQP3 1H0BA 2BQPA 3GHNA 1D0HA 1F5JA 1NQDA 2UY9A 5FREA 3VDDB 4HT1T 4I0WB 5DDJ2 3B94A 3GZAA 4Q0SA 2DFBA 2GC2A 4FCAA 4G3YC 4BMBA 1PK6B 1GANA 3AYCA 3WQ7A 2WINB 2BYVE 5CADA 4ATFA 3CO2A 4YFWA 5C4WB 5DDJ1 4PQ9A 3SCHA 4RHV1 5IK5A 1H8TB 3L2YA 2G4IA 2PHFA 2PAMA 3LAGA 3GALA 1ND2A 1XQNA 1Z0HA 5ACA2 1RUH2 2JEMA 2XKOA 3RDIA 1HQWA 2ZAHA 4BLIA 1DGLA 2XL7A 3OD4A 1YCIA 2PHUA 2WFF2 1HXS2 1M4WA 1BBT2 2ZGNA 4QPGC 2D93A 3AP7A 1OOPB 5BNNA 3VBRA 4CDWC 4XOGA 4YZ5A 1XYPA 3RYKA 3JCIA 1ZRCA 1I5ZA 4Q4W3 4XBNA 3O0WA 4F3JA 1XXNA 4Q4X1 2YYOA 5L36A 3LA3A 3VL8A 4FXGB 5C33A 5T54A 1SLIA 4FP2A 1EP0A 5BYNA 1WLCA 1RUJ1 5IK8A 3WVJA 3PMSA 2R32A 4FBFA 5BNPB 5BNPC 2EXHA 3ZSMA 5A32A 2A3WA 5EV7A 4DS0A 3ZYRA 2WNVA 4YVWB 5EZWA 3WXPA 1BK1A 4AFCA 2D6OX 1MZFA 2EAAA 1EV12 1S0EA 5KXBA 2WZR2 1RUF2 1S2KA 1WBFA 2GALA 2WT1A 4JGZC 2BEOA 4GWNA 2QDNA 1YWKA 2A6XA 5GLTA 2OIIA 4K8FA 3D8CA 1YLLA 4QX5A 1LOEA 4HK9A 3VKOA 1RUD1 4ZU7A 2XLFA 3THPA 2GC3A 1WUVA 1GICA 2CV6A 2HWC1 3KS7A 1KQRA 4WM7B 2BVVA 3QOPA 1RUC2 1N1VA 4MYEA 2WJSA 4TLFA 3DL3A 3G6JB 3M3OA 1R093 1C5HA 3KLSA 3M2MA 2YXSA 3VDDC 1O5UA 4E4DX 1REDA 1K5MC 1PVC2 1RJ8A 5E8AA 3QH7A 1AR62 2W39A 4YG0A 5C8CC 1X8MA 2NP0A 4DFSA 2Y26A 4LBQA 2Z79A 4RGGA 1VRH1 4EWEA 1PIV2 2P3KA 5GJ6A 1MS3A 2P17A 1UX6A 1XYNA 1H8TC 5T55A 2RMU1 4CDUC 4LO7A 4FAGA 5H9RA 4W6WA 1J58A 2ZGSA 4XFAA 3PVEA 3ZSKA 1N3OA 1SLLA 2YPJA 1TNRA 3FLTA 4I30A 1GKBA 3WP5A 3ZFEA 1CR7A 2ZAAA 4YZ3A 2ZX4A 3I54A 5C9AB 5IT6A 1W6OB 4NHMA 2GH2A 4M3CA 1ZREA 1UL9A 4ZU5A 1W6PB 2ZBJA 5DDJ3 3RSJA 4SLIA 3UL2A 4AYUA 1S0FA 1Y43B 3J8F2 3VBUA 4WVMB 2PA7A 4FPKA 4XFBA 4XFHA 1UU5A 3MICA 1CX4A 2ARBA 4XFGA 4DRRA 3CJIA 5D8AB 2PAEA 4J6GA 5FPXA 1VB2A 5LEKA 1RUG3 4I3GA 3NKTA 4JAAA 4YYOA 4YG6A 1RUH3 4S2HA 3LA7A 1UKRA 4PLMA 2B8MA 1PHMA 4YW3A 3TN92 4Q4Y3 4GB32 1CESA 1ZNPA 4K1ZA 3I8TA 2YGLA 4CEYC 5L19A 2WL1A 4S2DA 5FRAA 5FLIA 2NM1A 4TWTA 1G9DA 1ZBA1 2ZX0A 2DYCA 2DCZA 2HWF1 1ENSA 3CNAA 1ZRDA 2A70A 2ZPXA 4IQPA 4HKWA 1IS5A 1UF2C 2D43A 1EYBA 1QXJA 1ZZCA 4LHKA 3JBG1 1ND2B 2H0BA 4JTNA 1S0GA 2NN8A 4Q4V3 2WFF3 1MQTA 4AQ6A 1N1SA 1QOTA 1V00A 2XWJB 3PMEA 1TMF1 4QQ2A 3S30A 1DGRN 3EXUA 4FQ4A 3AFKA 3IDCB 1BEV3 4YVWC 3V56A 1BVP1 2WIIB 5AC93 5CVRA 3B7MA 1VAVA 2HJIA 2WS91 4MGIE 1AL23 3ZN6B 3L9JT 3WDXA 2DV9A 3MIEA 3RJ2X 1VIWB 3CLPA 4AW7A 1UIJA 3HMYA 5JOYA 3N3HA 2R0FA 4AFBA 3FFZA 4Y1ZA 5F5QA 1XU2A 1WLWA 1QJX1 4A7ZA 3NV4A 3PTYA 1C1FA 4COUA 1LESA 1POV0 3FMGA 2FHRA 2G9GA 5KC6A 1DG6A 5GZDA 5J09A 4E2GA 1APNA 1ZZBA 3OBRA 1JBCA 1A8MA 3I4IA 1GQHA 1R1ZA 1PIV1 2NPIA 1G6NA 4XJZA 3WG3A 1C1LA 3ZXGA 3M3QA 4LO4B 2D97A 4PCRA 2ZGUA 1WW6A 3BALA 4IEVA 4XE9A 4PBPA 4YM2A 1ZRFA 2WS92 3VBFA 3ZXJA 1VP6A 2GNMA 1PNGA 1YYNA 1UPIA 1LENA 1LECA 4IEZA 4XFCA 5J37A 1I6XA 5DZEA 5J7MA 1OQEA 5F6KA 4OULA 1D4M2 1Z7S1 1AR63 4GULA 1W6MA 3UJQA 1G9AA 3MLKA 4AVCA 3ZFGA 5FO9B 1NXMA 2R063 4QPIC 1GLHA 2CGNA 4XEZA 2DU1A 2K2SA 1F31A 2Y0OA 3E97A 3OGJA 2B42B 2B5HA 1XE8A 5KC5A 4WVMA 3AXEA 1VBE3 2ATFA 4FP3A 1AR92 1QNYA 2E9QA 2O1QA 1RVF3 2RJKA 5FPZA 1XNDA 1QOSA 2HWB3 1G9FA 1EPWA 4ISRA 1HDKA 3RS6A 3WW3A 4D7TA 3WX5A 4CRQA 2VQ0A 4P9LA 1PNFA 2CGOA 1I1EA 1W6PA 2WFPA 5D8AC 1DDLA 1ONAA 4I09A 5KXCA 3DKWA 4R9DA 3ETQA 1IQAA 1DQ0A 1O4ZA 1NA1B 2AH2A 3NAPB 5BNOB 1AYN1 4IERA 3S7EA 1RMU2 2DCJA 3R0RA 4AVBA 2GMEA 2LUWA 4QQLA 1KJRA 2BVBA 1KDKA 1HV1A 1AX2A 5T3NA 3AYAA 1OSGA 1XE7A 3U07A 1AR61 1NQJA 3MW3A 4LR4A 5KHKA 4XW3A 1WMFA 1JYIA 1IKQA 3ZN5A 3HAGA 3PLQA 4N53B 3B93A 1BEV2 2VVFA 1QJY1 3IT8A 1UMZA 2HWE3 1VRH2 2W08A 1EV13 4MVTA 4UXAA 3D5OA 1F8VA 2P34A 1YIFA 5J98B 4Q4V2 5I0SA 1ULGA 4RHV2 4ZXKA 3IM0A 3VUOA 1UIKA 3AMHA 2W68A 2F6BA 4RGAA 1TME3 1POV3 2JX9A 5FQ0A 4XBQA 3FWEA 5FOJB 1SMVA 1VBB3 4BMEA 3JUUA 2ZGOA 2Q1ZB 1LOAA 3IPVB 5C6CA 4GMP1 5FLJA 2ZKLA 3ILRA 1HX6A 3AFGA 4EN9B 1LOCA 1O91A 3HBZA 5JCTA 4FPJA 4HKOA 1TE1B 4FOQA 5CFCA 4XIKA 1AL21 4OI0A 4MXVA 4Q4W2 1W6QA 5JIUA 5F9TA 5JZGA 1HW5A 2RS12 4HBNA 4XTPA 4YGBA 1V6LA 2Q8OA 1HXS3 1DQ6A 1TMF3 4Q1RA 3URFA 1X7NA 4XZPA 2R49A 4Y4YA 3D0JA 2WFF1 1V70A 4WM8A 3JBG3 5K0UC 4K20A 4FTSA 5CAZA 1L3JA 3E6CC 1PO13 4ASMB 1YJLA 1LJ7A 2HWC2 2WLQA 3CJXA 1LHWA 3CEWA 3QH6A 1ZBA3 4LBKA 2ENRA 4ITCA 4OI4A 4AHWA 1GZWA 1U5YA 4COWA 3KT4A 1RUOA 3I7DA 2ZHMA 3PVOA 5GLUA 4QHBA 4AWDA 1X50A 4AEDA 4Q4Y1 3VLBB 1IS6A 1ND3A 1NOVA 1FMD1 1RUH1 2A6ZA 2WKKA 1QDOA 5KHJA 4X6QB 4PIYA 1WD3A 1NA1A 3HT1A 4AEDC 3A0NA 2VVDA 4XHXA 2WQ4A 3H7YA 3VZJA 2ZGLA 1EPZA 2UWAA 1NZCA 2Y0IA 4MGYE 4HKLA 4AHZA 5DUWA 4N43A 4AVAA 1AR83 4SBVA 1BMV1 2P3JA 4DRVA 4OHXA 2NQYA 1IS4A 4FPLA 2HWB2 1X82A 4ATEA 1CPMA 2XJQA 1D4M3 4UW6A 4COZA 1CAWB 2FQPA 1VB4A 4AVSA 1AX1A 2RS11 3B69A 4C0BA 4AGVA 4QQHA 1OFNA 3ZFEC 4RS5A 2JICA 1HRI2 1SQ4A 3DPRC 4QGLA 5IK4A 3WG2A 1KITA 2G9FA 1BZWA 4XMIA 3ZYIB 1Z78A 1O5LA 2CL2A 4YM3A 4HLTA 4A7YA 1GBGA 1H2LA 2DURA 4JDMA 3RJRA 1AYM2 2DTYA 5KHHA 5CFCC 3V0AA 2TEPA 4KWJA 4AQSA 1LHVA 3OCPA 4CDQA 3ZXFA 4QXKA 4MXWA 1VRH3 3V0AB 2R073 4OI2A 2IXHA 4N53C 5K8SA 3ZXAC 1DGRA 4Y1YA 1W6NB 2OA2A 2ZZJA 1K5MA 2PHDA 2HWF2 3VBOB 5KBFA 2EF6A 3GHMA 1GZ9A 4ONUA 5BV6A 4ES8A 2YZ4A 2WLPA 4BQ1A 2BNNA 3VKFC 3NV2A 1NLSA 1GFF2 2XJRA 2XL9A 1IS3A 3KGZA 1RGSA 1BMV2 4Q4Y2 2H0VA 4UW5A 2A6YA 4HZFA 5AFBA 3EQEA 4WV8A 4MSVA 2ZACA 4RD7A 4DINB 2XKPA 5FMOS 4JC1A 2IXLA 1DQ4A 2ZX3A 1DZQA 1QNWA 2EXKA 3JD71 3CU7A 4YSFA 5CFDB 2XJTA 3E5UA 1Q8VA 3NSTA 3MPPG 5JLVA 2SBAA 1J3PA 3ASIA 1IKPA 4GB33 1DU3D 3OYWB 2VH9A 2WNVC 4PF5A 2D5FA 1CIWA 4AEDB 1O3SA 1V9U1 1S0JA 1A78A 2R16A 1RUJ3 2D3SA 1AYN2 1LR5A 4LUMA 4E2QA 3VBSB 1DYPA 3LA2A 4YGEA 2CAUA 3I59B 4Q4W1 4FTBA 3LKJA 2CWMA 3HQXA 2QNKA 4WVVA 5BNQA 4CDWA 4J1XA 2TNFA 5BNNC 5BPXA 1HQNA 4EV0A 3QLQA 4RQPB 2BFUL 2IFWA 1J1TA 3KT1A 4KU8A 4N7UA 4UW4A 4BPZA 1YFUA 3ILNA 1S0CA 3AYEA 4P14A 2IXCA 1I3HA 1FATA 4Y22A 3W9AA 1MS8A 3J26N 3ZPYA 1MZ5A 4RHV3 4IEPA 1C8NA 2NLRA 4Z82A 1VBA2 2ES3A 4HETA 3ZMNA 3FZ3A 4Q0PA 4JDOA 3VZNA 1LHOA 4U36A 4GH4A 4W65A 2NMNA 3WZ1A 1T6GC 2VMHA 4QPGB 2VW1A 2BWAA 1RMU3 1OA4A 3ZFGC 1TEIA 3PJQA 1TNFA 1WW7A 4H3WA 3DF0A 1QQP1 4JCKA 3TAYA 1QJU3 3OD0A 4IV3B 2NYYA 1GR3A 3HIFA 1S0DA 1PO21 2NMOA 1V6MA 1G86A 1AR82 4D3WA 4AI3A 2R30A 1COV3 2QUOA 2QZ3A 1WCSA 2X5IB 1CAVA 4XDQA 3C3VA 3VKLA 1ALYA 5GZGA 4DY3A 2D98A 1NLRA 4CDQC 2V5YA 4FOVA 4FPEA 4YARA 2GMPA 3DGTA 4CP0A 4OLLA 4B7KA 4Q2FA 1ZVFA 1NG0A 2WNEA 4I02A 1WLTA 5LRRA 3ECQA 1SBFA 1QOOA 3P3NA 1DBNA 1RUE2 4XF4A 4LBJA 3ELNA 3DPRA 4M00A 4OUMA 5I0RA 1R083 3MGUA 3OTFA 4RS5C 5FBZA 1KD7A 1Y3TA 2H6BA 4FPOB 3RPQA 1H8VA 1HRV1 2PQQA 1ZX5A 5JSOA 4D7YA 3WY6A 1QJZA 1B35B 4AGGA 3LGRA 1ZRRA 5T5OA 3MEPA 5JI9A 1WA4A 1S2BA 4LA3A 4H55A 2PHTA 3H0OA 3SITA 3UJOA 1J3QA 1XRUA 4N43C 4Z92B 2PLV2 1RL3A 1SBDA 1JN2P 1YO8A 1FOD2 2MEV3 4AI1A 4LTAA 1FPN1 4HVOA 1WD4A 1IZ3A 5DG1A 2N7GA 1NA1C 1QHDA 2BW8A 1FX5A 1MQTB 2AR6A 3SH3A 1Z7S2 3S7IA 5GLWA 1RTVA 3KB5A 2XJPA 1TMF2 1LOFC 3WNXA 3WDWA 5DZGA 1ULDA 1EAH3 4IEWA 2XJUA 1UZZA 2RS51 4NHKA 3LCPA 4OUSA 1PVXA 3MF9A 5J48A 5I93A 4YM0A 4YZ4A 1OI6A 1LEDA 1C8M1 1WLDA 5GZEA 1DGWA 4CEYA 4LT5A 4F7ZA 5KHIA 3AZVA 4KH9A 4LBNA 5LRSA 2RM21 1RHI2 4W6YA 3ZXEA 2IZWA 3M1HA 1S1AA 4XF1A 4GWMA 3WUCA 2A3XA 2MHFA 4JTOA 4E2SA 1R1A1 1RINA 1HKDA 4CDUB 2CY6A 3VBRB 1XU1A 2ET1A 3SLIA 3VZLA 3CJIC 4LLFA 1KJLA 1QH7A 3R05A 4N9IA 4I3PA 4R9AA 2RS31 3MDPA 3VBFB 3N7MA 2CWSA 4YFZA 1ZBE2 4L99A 5J96B 2WC2A 1VBA3 4P9XA 1N1YA 1MVQA 5SV5A 1PGL1 5L7OB 1AL22 5FMOL 2JG8B 2EA7A 3J8F1 2R041 1CJDA 4IEOA 1HRV3 3H3UA 2RR11 5CBLA 3MLLA 2KXLA 1G7YA 2V09A 5JOXA 5LK7B 1H1MA 2GSYA 3AYDA 2XGXA 4JGZB 3B9IA 3OY8A 3SXWA 2VECA 3T2TA 2D6NA 3ILFA 3JBG2 2C9AA 4X6RB 4YW2A 1C8M2 3U10A 3QD6A 4XJ8A 3N7JA 4X8NA 2XPJA 1DZRA 1LODA 3KCXA 2E7TA 3N7KA 4CDXB 4GKXA 4CDXA 2ZGRA 1PO23 5FLHA 4AF9A 3RI8A 1QJU1 2IXIA 4FPFA 2E63A 2X53S 1H1IA 5KXDA 3GBWA 5CG8A 1SBEA 4JVAA 4XMAA 5L73A 3UKTA 3VN4A 3WQ1A 3E5XA 3OY8B 3RZZA 1RMU1 1NE4A 1HRI3 1AXKA 4N90A 4GH4C 4K9SA 3LWCA 1FOD1 2OZJA 2GN3A 3PVBB 2SLIA 1AYM3 2JG9B 5J36A 2WQZC 3MIGA 4MLOA 2BNOA 1VJ2A 4RR3B 1WW4A 3GNEA 3KZ4C 2PLV3 4JGZA 3MFCA 5IUQA 2VGDA 1FXZA 2R042 3W59A 2DUOA 2DCTA 3LSEA 1NYWA 4XILA 1JTZX 1S55A 2WNVB 1FPN2 3VHOA 3THTA 5HCFA 3WDUA 3TNPB 1MVEA 4PIZA 2B39A 2HKXA 3LB9A 2VOWA 3RMYA 3B3QE 1W0PA 3RG0A 2V73A 3BPZA 3QBQA 5HCBA 4AQ2A 1UKGA 3T1LA 1PK6C 1FNZA 1GQGA 4RSUA 3FFQA 1FV2A 1IPJA 4COYA 1ASJ1 5JDBA 1NE6A 1YFWA 4XF9A 3VBRC 2CGPA 2QFEA 1V6OA 2XBO3 2ZHKA 1QJU2 2B9UA 1VBD3 1O3TA 4X8PA 1SDWA 1N3PA 3ALQA 4HFSA 3FLPA 1W6MB 1WBLA 3ATGA 3AZYA 1CPNA 1UPSA 2DCYA 4MUVA 1RHI3 2VOXA 2I74A 4HMZA 1UU4A 1YRZA 1OMIA 1RC6A 3WCRA 3ACLA 2DU0A 1OD5A 1AR73 2VVEA 1SLCA 2Q0AA 3GBFA 1JXNA 3WW4A 3M8LA 3I59A 1GYKA 3VHRA 4XJUA 3FBYA 2A73B 3UV9A 3ZVXA 1F9KA 1SFYA 2ZGMA 3TYJA 3AMMA 1ZBE3 1MS0A 2HWD1 4M01A 4CEWC 1LCLA 4HK8A 2EXJA 1FV3A 4K1YA 4MH0E 4E4SA 3MF6A 4QQOA 3UK9A 1DF0A 1O4YA 4D94A 5JAXA 2AGSA 3WINE 4Y5Z0 4R4ZA 4N53A 4B7EA 5EYXA 4PDWA 4IEQA 1RUF3 2WZR3 1U5XA 2VNRA 1LKNA 1RUI3 2VULA 3AK0A 4KG0A 3ZXDA 3VGIA 1H2MA 3AP4A 3PVNA 1AR91 3M7AA 1FYUA 2XG3A 3TN93 1DQ1A 1AJKA 1VBC3 2BFUS 2DCKA 5LEJA 3NAPC 1RUE1 5AC92 3BCWA 3EHKA 1BBT3 4YVWA 1U5ZA 2DWRA 2DVBA 2YROA 2WSUA 4FPCA 5AFEA 1OQ1A 4FVVA 1BBT1 3D82A 1GZCA 4XF3A 2RS13 2RMU2 1RUE3 4L97A 1ENQA 3M70A 1VBC1 2GU9A 4RR3C 4EWDA 5BNOA 5I8SA 2ZMNA 3V0BA 5FOBB 1D4M1 4E27A 2PELA 2ZJCA 2GDFA 3ZXKA 2AYHA 1NCQB 2XLGA 4K40A 4CDQB 4Q0VA 1WGPA 3GBGA 1FT9A 1V6KA 3S6PA 1AR81 2DUPA 2MPFA 4NVPA 5ACA3 2O0OA 1QGLA 2X5IA 4KWLA 2XLAA 1KDMA 1PZ9A 4OHYA 3KCYA 3BTAA 5H9PA 4EN0A 2JG8A 3ZIWA 2AENA 4LBOA 3AM2A 4AG4A 3ZSJA 3VBHC 4ORFA 1SCRA 1ND3C 1MS1A 3FLRA 2RE9A 5A32B 2GAUA 5GZFA 1AXZA 1Q8OA 2OZ6A 1PGW1 4LLOA 4Q27A 5DXDA 5FO7B 4UBHA 2HWD3 4FXKB 1UAIA 4GH4B 3BB6A 3WOGA 2RJLA 5GKAC 3IN9A 3R4SA 3SISA 3VBUC 1QJX2 3H1YA 4PDWC 5C4WC 1D4VB 4LNVA 1AR71 4C1WA 2LTNA 3VZMA 4UBGA 1YXWA 4WM8C 5K0UA 4XQ4A 1HIXA 4CEYB 4AI8A 1SLAA 1QY4A 5CU1A 3WD5A 2RS32 2ZX2A 3ZFEB 1CONA 1RUC3 1JOJA 2FMYA 3HR9A 2WNUA 1HXS1 3ZFFB 1RUG2 3I2DA 3D4KA 2Z2SB 3ENRA 5JZGC 1FI2A 1M06G 1VBE2 3NKGA 4FO9A 1W0OA 4Q8KA 4Q0QA 1H8TA 1IPKA 3MLJA 3GYDA 4FPHA 2JDZA 5HBAA 2YUEA 2OUJA 1CN1A 1C3HA 1ULFA 2KM2A 1SFNA 2LM3A 3RRDA 3JU9A 1QF3A 4AXOA 5C8CA 4GKYA 5KWRA 1H1AA 4G9SB 3WDVA 1ZZ6A 5T52A 4AEJA 2D7FA 2ZX1A 1S0IA 4MV2A 4KQ7A 3FBMA 3HT2A 2EVXA 3VDDA 2MEV2 4OHWA 2E7AA 3ZYPA 1AR72 2CYFA 3AKPA 4L8QA 3USUA 3ZFFC 1POV1 3RQ0A 1GNZA 4NN0A 2Z69A 3WP4A 3WCSA 3KQRA 3JQWA 4R9CA 1AR93 2Q4SA 2R0HA 4LE4A 4AHYA 1VBD2 4L2NA 1RUF1 2WZR1 1EV11 4D69A 3QACA 1BXHA 3PHMA 2F4PA 1FAYA 4XPVA 3RYRA 1H30A 5F6LB 1QJY3 2ETEA 2GNBA 4OVEA 1C4RA 4LHNA 1MEC3 3IPVA 4YM1A 1A6CA 1FNYA 4IV1B 4E4ZA 4PJYA 3ZIXA 4C90A 3MZHA 5FQ0B 2HWE2 5B2GB 1TQ5A 5BNPA 3ES4A 5KHGA 1DIWA 3MIFA 3V0BB 4NPRA 4XBLA 1RITA 4PIXA 2ZOEB 4AEKA 1C57A 1DHKB 2BNMA 2WWSA 2R1DA 3A4UA 2ZHLA 4MXWB 4TYSA 5JIAA 1F2NA 3B9CA 2ET7A 4AVVA 3RWNA 2R1BA 4LUKA 4PDWB 2ZTNA 2PYTA 2A6VA 1QWRA 1LRHA 4NO4A 5D8AA 3B00A 3AX4A 1XNCA 3M3CA 4QPGA 3Q9OA 2ZMLA 1MR5A 2D44A 4YVSB 2VQAA 1RHI1 4GMP0 4OHZA 3WP6A 3JD72 2CAVA 2OYZA 4CP2A 2GC1A 2ZZQA 1OA3A 4WZFA 5K7PA 3AP9A 3O7OA 2JG9C 2D40A 4WZCA 3J8F3 5H9QA 1LULA 2W52A 4Y22B 3RNSA 5BUVA 1KS4A 3UKVA 4A3XA 5EYYA 5GLZA 1MS4A 4LHLA 1J59A 1ASJ3 2O8QA 2JXAA 5I91A 1VBB2 5K0UB 1REEA 4EN8B 3BOPA 4QPIA 4BE3A 1S0BA 4QPIB 1NY71 2R6QA 3KCCA 1J1LA 3H8UA 4YRDA 1R1A3 4KWKA 1Q8SA 4KU7A 2XBO2 1ND3B 4LBMA 4LBQB 2PLV1 3MFAA 2UU8A 1HQLA 4Y20B 1QKQA 2OVUA 2W0XA 2WA3A 4K3UA 1CAXB 2A6WA 1C8M3 2FMDA 1O7FA 2VW0A 1AXYA 1AYM1 3VBFC 2PHWA 3WDTA 3U4XA 3V65A 1VBC2 4CTEA 1CVNA 1U5IA 2QDRA 2D6LX 2QJVA 3E6DA 1SEFA 5JI7A 3JB8A 3WUDA 5A33A 1AUYA 2GZWA 2ZGTA 1EAH1 3CF6E 4P5HA 1HRV2 1PZ8A 1Y9QA 3VHPA 4QPYA 4Q4X2 4FTEA 1W6QB 1C5IA 3NWKA 4Q0UA 4XIOA 1JH5A 3VBSC 4AI2A 1ENXA 4KGQA 5F1RA 3A0KA 4IV1A 4IEYA 3PNAA 4GA9A 2QE3A 4K7JA 1FPN3 4NHLA 3AZWA 2OUHA 1R092 4L92A 2WT0A 4LULA 5I8TA 4I0AA 4Z1VA 2VXRA 1XNKA 2Q1MA 3AP6A 1H2KA 2ZCWA 1BVVA 1PGSA 1DLLA 5A3MA 1JYCA 1RUI2 1UD1A 2QCSB 1Q5OA 2QVSB 1BEV1 3USUB 4HPKA 5ABJA 1C28A 2HWD2 4YW1A 4JV4A 5FDBA 3MW2A 1MZ6A 1MQTC 1TME2 4Q4V1 4F83A 1UN1A 4BIOA 1OOPA 2BGCA 3K51A 1JHNA 2PFWA 4GIQA 1VBA1 3C2UA 2AREA 1OPOA 2BWCA 2HYKA 2O8OA 2ZKNA 5A33B 2EAKA 1UW8A 1WMEA 2HWF3 3NV1A 5E89A 4AVTA 3ZN6A 2RS33 4XETA 2JE9A 2XVLA 3AKTA 4RFT0 4ZKTB 3KGLA 3D0SA 1COV1 4MZUA 3LSDA 4LO6B 3VKMA 5C8CB 3BODA 1KFXL