5FZFA

Crystal structure of the catalytic domain of human jarid1b in complex with mc3962
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
463
structure length
457
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGKIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Mc3962
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 147
structure length 457
sequence length 463
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzfA01
3AL6A 2OT7A 3UYJA 4V2WA 5FY8A 5F3EA 5A1FA 5FZGA 5FY9A 3PUSA 2YU1A 5FZIA 4CCNA 2OS2A 5F32A 5FZAA 4E4HA 4Y3OA 5FXWA 4CUGA 5F39A 3K3OA 4GJZA 2Q8EA 2Q8DA 5A80A 3NJYA 5FJHA 4XDOA 3AL5A 2OQ6A 5FYBA 5FY5A 5F5IA 5A7QA 2P5BA 5FY7A 4DO0A 5ISLA 4AAPA 5F37A 5FYCA 5FJKA 5FYYA 5FPLA 2XUEA 3KVAA 5FYZA 5F3CA 5FZCA 4CCLA 5LY1A 5FZHA 2VD7A 5FUPA 2XMLA 5FPAA 3K2OA 3N9OA 4UF0A 5FZMA 4LIVA 5A7WB 4Y33A 4XDPA 5FZ4A 2XDVA 4QU1A 3ZLIA 5FZ9A 3N9PA 3KV4A 5A3TA 4AI9A 2OX0A 4GJYA 4BU2A 2PXJA 4LXLA 5FY4A 2GP5A 2WWUA 3KVBA 4BXFA 5IVCA 5FV3A 1VRBA 4GD4A 2OQ7A 4IGPA 2Q8CA 4ASKA 4CSWA 5ANQA 5FYIA 4BISA 4GAZA 5FYSA 2GP3A 3N9QA 4LITA 3KV9A 3DXUA 4HOOA 5F3GA 4CCOA 4DIQA 5FZ1A 5K4LA 4EZ4A 5A3NA 3AVSA 3PTRB 5FWEA 4LIUA 5FPBA 2YBPA 5FY1A 4Y4RA 5FXZA 5FWJA 5FZ6A 5FZ3A 5A7NA 2YPDA 2W2IA 4V2VA 5FZFA 5F2SA 5A7PA 3KV5A 3PURA 5A7OA 5FBJA 4IGOA 5FXXA 5IVVA 2YU2A 5E6HA 5FP3A 5FZKA 4QWNA 4TN7A 5FZOA 5IVEA 3AVRA 5A7SA 3N9MA 3N9NA 5A3WA 3OPWA 5FZ7A 5IVFA 5FYMA 5FPUA 3U4SA 3PDQA 5CEHA 4QX7A 4D6RA 3U78A 5LWBA 3DXTA 5FP9A 3PUAA 5IVYA 5IVBA 5FP8A 3ZPOA 5FYTA 3PU8A 2YBKA 4QXBA 4QX8A 5FZDA 5FYVA 5FZBA 2XXZA 4D6SA 2WWJA 5A3PA 4QXHA 5FZ8A 4QXCA 5IVJA 5IW0A 3OPTA 2YBSA 3LD8A 5FPVA 3RVHA 4URAA 3K3NA 4UF0B 5F5AA 5IWFA 4NUBA 5LY2A 4HONA 5FZLA 4CCJA 3LDBA 5FP4A 4D6QA 3PUQA 5FUNA 5FXVA 5FY0A 4CCKA 5FZEA 5FYUA 4EYUA 5FP7A 5FYHA 5FZ0A 4EZHA 5F3IA 5A7WA 4IGQA 5F5CA 4CCMA 5LW9A 3PU3A 4C8DA 3KV6A 5FZOB 3N9LA 5F2WA 5A1LA 5KR7A
chains in the Genus database with same CATH superfamily
3LIHA 4S2FA 5CG9A 3T0AA 4AHWA 1LHUA 3MV11 3URFA 2YROA 1O91A 3GBFA 3KHCA 1R1A3 4SBVA 3VBHA 4UW4A 1CX1A 3MYXA 4C1WA 1MZ5A 1UPIA 2Z4FA 5FTTC 3D0SA 4LO8A 3WVJA 2R1BA 4CDWC 5HCFA 2ZOEB 3OJBA 2PMWB 2NPIA 2E32A 3T1LA 4QM9A 4KWLA 4BXSV 4IEUA 2VZQA 2Z2SB 3DUIA 3ZFGC 3VBOB 3TEWA 3WDYA 3NV4A 2HYXA 1KITA 1TVGA 3CHXA 4K20A 3WZ1A 1E57A 2QDRA 3KB5A 4JDNA 1U0AA 4XJAA 4EN8B 2C6SA 3T0DA 3N3HA 4HETA 3AZYA 4AVBA 1NCQA 1PO11 5FQ0B 3WXPA 2HLEA 5ACA1 1PGSA 2I74A 3VD3A 2RS51 5A70A 1VBD3 4UF0A 2C9KA 2W52A 4KI5M 1EUTA 1RYYA 3NAPB 5FZ4A 3ILRA 1B35B 2BJSA 2I45A 2QKDA 5C4WA 3ZLIA 2GMMA 1YCIA 2E51A 2OX0A 1FATA 2VTXJ 3JQWA 4OHWA 4PLOA 3KQRA 3WINE 1OURA 4M3CE 3MI8A 5M0TA 1HX6A 2ADDA 4KGGA 4COYA 1G9BA 4QMAA 2VCBA 5ANNA 3SC7X 2J1UA 4YW5A 2D93A 4AXOA 2R043 4AI1A 5F8PA 4KL1A 4CEWB 2XHNA 2Q30A 2TNFA 2XB6C 4HBNA 2DVFA 4MGYE 4OULA 2DYCA 2BFUL 1DGRA 5A3NA 4A44A 2BV4A 2NP0A 3J8F1 2VZRA 1UOFA 1JHNA 3AX4A 1PM7A 1E5HA 4OHZA 2WFF1 4YM3A 3LOBA 4OCTA 3GXUA 4LPLA 1JN2P 1ZRFA 5I8TA 3VD9A 3VBSB 2BYVE 3ZKUA 3PVBB 3ZYBA 5J36A 4IV3A 1I5PA 3DGTA 3JZVA 3WF4A 3KM5A 4EN6B 2ET7A 2AYHA 4PI0A 1JZ5A 1W99A 2X53S 2ZGMA 1GZWB 1MS5A 1PIV2 4GB32 3RMXA 2ZMNA 4PDWB 3AZVA 3Q8FA 1R093 1Y3TA 1DF0A 3AFKA 3I8TA 3H50A 3FJSA 3MW2A 5FO9B 1TME3 1BQPA 1VAKA 4GMP3 3DCQA 3RS6A 3M1HA 4Q4V2 1AL21 4QPIB 1CIWA 3UNPA 1COV1 2VMGA 4UBGA 3WG2A 5FZ8A 3WG4A 1HQWA 4Q4X3 5KXDA 2W3JA 4A7YA 2WLPA 3BTAA 5GKAC 1GLHA 3H0OA 1POV1 1ND3B 3N7MA 3AP7A 3AZXA 1US2A 4RL7A 1LEDA 2EVXA 2FBEA 2JG8A 1XNCA 1C3HA 4CEYB 5CFDB 2AZ5A 2WNVC 3PU3A 1FMD2 4LUMA 4Y5TA 2A70A 4BJ0A 1LESA 3N9LA 4CDXC 2EIGA 3A7QA 2HKXA 3WW3A 4P00B 4XJZA 2BZDA 3WDTA 5I0TA 4YNIA 4A3XA 1ZBA1 1BCXA 3CJXA 2AH2A 4L9BA 2QQLA 5FK8A 4LKDA 5C9AA 5DN2A 4CZSA 4Y22A 1WUVA 4XDQA 1R1A1 2R073 2ZGTA 3NJYA 2D3PA 2D6NA 1ZX5A 3MBWA 5KBFA 2WNVB 3QH6A 1F5FA 2EXHA 4Q2FA 4UT5A 2FHRA 5JZGA 1KEXA 3PUIA 5F37A 4M3CF 5EWSA 4CDXB 3V0AB 2VUCA 2GZWA 3I2GA 2B45X 5D8AA 4ZU5A 2QCSB 5AVAA 4CTEA 1Q8OA 5CYYA 4FPJA 4N43C 3ZIXA 4AFAA 3AMNA 3GJAA 4M0NA 1JH5A 4AQSA 4F8AA 1RVF3 1QJFA 3E5XA 1BMV2 4RQPA 2PHWA 1W06A 1Z0HA 2C26A 4JGYB 4M4PA 2AACA 1Y9QA 1NZIA 3SCFA 4B1LA 3VL8A 1VBD1 4KU7A 5I91A 1RUG3 2QE3A 4YW6A 4W6YA 5DUWA 5HCHA 4EJRA 1HJFA 2VOWA 5FREA 1PGW1 3QBQA 4DY3A 1CAUA 4HVQA 5KWRA 1QH6A 4R8HA 4CSWA 1AYM2 5ANQA 5C5UA 3TEYA 4L11A 2GN3A 4ZPIA 1PZ9A 3RYPA 1UXZA 4FAGA 1AYN2 2JG9A 2A5ZA 5DXDA 3C3VA 4Z07A 1VBB2 5K4LA 5C8WA 2R041 3FFZA 3ILNA 3A22A 1WCUA 2DVGA 1C5IA 2D3SA 2VMEA 1W90A 3BODA 3PTRB 3UKTA 2JICA 1HXS2 2QUOA 4C91A 2PAEA 2IUWA 2CSGA 4XJUA 3GF6A 1HRV3 2J1AA 5A7PA 3AKTA 4RN5A 1VB4A 4CDQA 5A7OA 1TMF2 2EXIA 5IHRA 2P37A 4GWNA 4LBQB 1H9PA 3LCPA 1EAH2 2YFUA 2RS13 5GLTA 4B1MA 4HKOA 4CP0A 3BTXA 5HI0A 1IS5A 4QHBA 1J3RA 4WM8A 1Q8VA 2BFUS 2CDOA 5I93A 1QJX2 3LIGA 5IVFA 4P9GA 2HWC3 4AFBA 3MIHA 5FYMA 2CY6A 2E31A 2GNDA 1GZCA 2VTXA 3MUZ1 2VC9A 3VD4A 1JXNA 4MXWA 1WD4A 3DPRA 4FOVA 4AFDA 3ZPOA 2F4PA 1XOYA 1LENA 1R091 2VBDA 4GWMA 4XTMA 4S2HA 5FZDA 4HN0A 1ND2C 4AVSA 1NUKA 1SPPA 5CAZA 1JYVA 4GMP1 4ISRA 4FP3A 4X8PA 1RUNA 3USUA 4QX1A 3LD8A 4MGIE 3WW1A 4ZS2A 4MOAA 3B00A 3UGFA 3ZO0B 1ZBE3 4PIXA 3V65A 3CU7A 4CYDA 1Z7S3 4Q4X1 3H3LA 4K1YA 2LTNA 3POFA 3FLPA 3CF6E 2Y6KA 1AR82 5H9PA 2EIDA 1SFYA 2E53A 4CXYA 2ZX0A 4AEJA 1V6MA 1VRH2 4LK7A 3VBRB 4FTBA 5FLJA 3ZFEB 2VQUA 2WT2A 3K75B 2YU1A 4Q5OA 4Y1UA 1L7LA 5FZAA 4YVSA 4FPKA 4BYYA 2WIIB 4CUGA 4Q29A 2BRTA 5CB7A 1XU2A 2WZEA 2D43A 3IAQA 1BLZA 4AEKA 4GWIA 4QKBA 5K0UC 3I4IA 3NKTA 1W6NB 4ES9A 2RMU1 2P5BA 1RUC3 1ASJ2 1PO23 2F6BA 3I3QA 1SDDB 4AAPA 2ZEWA 4BA6A 3WNOA 2R071 2CNAA 2OW4A 3A4UA 1IS3A 2XPJA 1LR5A 3I49A 1QOSA 2DVAA 2A6YA 3JBG1 3MIFA 1PK6C 5FYZA 1WWYA 3LDRA 4YW3A 1J84A 4DXSA 4A6OA 4OZXA 4MSVA 3SCHA 2ATFA 4B7KA 3NNFA 3AP6A 1REEA 4QGNA 3UGGA 4DB5A 4QPYA 1A3KA 3MDPA 3UL2A 5BXXA 2ZGLA 1S0BA 3AJYA 3KCYA 3ZYRA 2WSUA 4CP9B 1RVF1 1LHVA 1MEC2 3AB0A 4AVVA 2NN8A 4Y1ZA 4YG3A 4W6XA 5DZEA 3R05A 4I2OA 3ZXLA 2JE7A 4IGPA 4KH9A 1PK6B 3X29B 2OZ6A 1RUG1 2P3JA 5FLHA 4BOWA 4U36A 2WO1A 3NV3A 2PQSA 4DPNA 3GBWA 3U14A 2O1QA 4CP1A 2JDMA 1FNZA 3VKFC 2D6PA 5L7OC 1H2MA 4N9HA 4XJWA 4A42A 1PHMA 1DGWA 1QJY3 4XBLA 5JSRA 4HN1A 1H8TC 3NJVA 3B94A 4R4XA 5I8YA 5JPNB 1HB2A 1YFUA 2VMFA 3R0RA 1RINA 3OOXA 5E88A 5FLIA 1VBE3 1HB4A 3S7IA 5IT6A 1XYNA 1W6MA 2ZS6B 3MIEA 3C7OA 1ENRA 2DURA 1QJU2 5FRAA 1AVBA 2JB8A 1UIJA 1UWWA 3BALA 3POBA 1HRV1 2P3IA 1Y43B 4XQ4A 5JOZA 2WO7A 4FVVA 5EYXA 4URTA 1X50A 1YQ2A 4XHXA 4YGDA 5FZOA 4A7KA 4RHV3 2W1SA 3EB7A 4ASMB 1CJPA 1TEIA 3Q8CA 2YHJA 1ALYA 3PVOA 4HK8A 4WBBA 1SLBA 4BIOA 2RS11 1XYOA 1OQ1A 3PDQA 1VBC2 3SH3A 2GNBA 3HNMA 3FZ3A 2HWD1 3IKWA 4H7MA 4QQPA 3ZIWA 2GMPA 2HWC1 3UGHA 5H9RA 4XETA 3KT7A 5FOBB 4WZCA 2JDNA 5J1XA 4YGBA 1WLWA 1MZEA 3M3OA 4HK9A 1RMU3 3CMGA 4HONA 1UYPA 4IEQA 4B7EA 2BUKA 3W20A 4IV1C 4UW5A 3SH4A 5GLZA 1OLRA 1ZBE1 4Y20B 1MACA 2XBO3 3OGGA 4CCCA 5JXIA 1CIYA 1Z7S1 2ZEYA 4C8DA 3C7EA 2E7QA 4E4ZA 5CNAA 3NQHA 1XJAA 2L9LA 2JDHA 2CAVA 4AI8A 1S0CA 1ZNPA 2RJLA 1GFF2 4RYDA 2WS93 1LOFC 3B9CA 4IV1B 2XKPA 5GLVA 2V4AA 2EXKA 4AF9A 1LJ7A 4NJ4A 2ID4A 1OLQA 4K6BA 4YZ2A 4BDVB 1YEWA 1R082 1UZWA 4COZA 2RDQA 2NMOA 1XBFA 2E26A 4O7XA 3P3NA 4FAHA 4BMBA 4ZS3A 2UY9A 2WAOA 2PHUA 4Q0VA 1C8M2 1RUC1 1S0EA 1PO21 1NCRB 3ACHA 3J9SA 2ARCA 4RD7A 3W5NA 2XMLA 5FO8B 2VMDA 1KS4A 1QJZA 1OA4A 1GZ9A 4JGZC 4DUWA 4AFCA 1Y4WA 2RVAA 2WA3A 5C9AB 1MQTC 2OUHA 5FAXA 5JI9A 2LS6A 2G4IA 5I0DA 1ST8A 4CXXA 3ITQA 2R063 3U11A 3MF9A 3WF1A 4IETA 4LBNA 1ACCA 1DZQA 5A1AA 1AHSA 1VRBA 2QQJA 1POQA 3BTYA 1DGLA 4NVPA 4WV8A 1JOBA 4JKLA 3E6BA 4YVWC 2E7TA 2WNUC 4V1PA 3VD7A 1AJOA 2VOTA 4DNYA 5A6XA 1RXFA 5C8CC 4BISA 1V6OA 2VNVA 2P3KA 4L0PA 2OYZA 4R4ZA 2LALA 2J1VA 1QNWA 2VUAA 4FFIA 3WOGA 3RYKA 5IK7A 2DBIA 4QAWA 4IQPA 1GWLA 3MIGA 3KCXA 3NV1A 1W6PB 3K4DA 3I2FA 1LEMA 1QJY1 1T2XA 2ETEA 2WL1A 3I3BA 3T4VA 3BUCA 5FZ3A 1XC6A 4E2GA 1VAMA 1VALA 3NW4A 2DWRA 2IXHA 4GH4A 4GXLA 3N7JA 4OUEA 4G3YC 5BNQA 4DMIA 3ZXFA 2NZ9A 5BV6A 4C0HA 4KBBA 1VBE1 5F6KA 4COVA 1BZWA 2XUMA 3PIGA 4BHPA 2RM23 2Y64A 3W21A 5BNPC 1WCKA 5J48A 1QF3A 4NWVA 4N90A 5H9SA 3N9MA 4OHYA 2HYKA 1JOPA 5TSWA 4RHV1 3LQCA 3K77A 1VR3A 4D6RA 5LA0A 2UU8A 5FP9A 1AR93 3SNMA 2PA7A 3IAPA 1OOPC 1XE0A 5CFCC 3NNJA 1W2UA 2WQZC 2FDIA 2RS33 4XF0A 1M4WA 1I1EA 1UOJA 2BEOA 5BNNB 3T2QA 5BNPB 4ORFA 3VZNA 1BYHA 1H2LA 1SCSA 5IW0A 2A6ZA 4P9LA 3L2HA 1DYPA 3B5LB 3K3NA 3OF1A 4PF5A 5T3NA 2ET1A 3T09A 5GZFA 2AEZA 5FUNA 3FN9A 2X09A 2HH9A 1UY0A 2Y26A 5LBCA 1RMU1 2OXBA 2VNRA 2CDPA 3WQ1A 1Q43A 2QTWB 1W6QA 4Q4W2 4IGQA 3V56A 3TRSB 1OOPB 1K45A 1PVC3 2WUHA 3QH7A 4N7UA 5BPXA 3TOJA 2XBO1 1B09A 3RRDA 1YFXA 4RS5B 3HWJA 5FZGA 5FY9A 3WP4A 3JB8A 2D97A 1XNTA 1CAWB 1NQDA 3PTYA 4KNCA 2PFWA 1N1YA 2HWF2 3TB0A 4Y1YA 5A33A 1RUD2 1PM4A 2V4VA 5FJHA 4YG0A 4AHYA 4JDOA 5FY5A 2WS91 1CAXB 3WX5A 5K7PA 4PHZA 3C7FA 1SBEA 3LPGA 5DAVA 3B7MA 2F4LA 3DV8A 1F35A 2VE1A 3H3UA 2Y6FA 2ZZJA 2XWJB 4QPGB 4YG6A 1Y9GA 3AP5A 3WW2A 2D6KA 2W92A 1SLTA 4I02A 3RWNA 3KGLA 2UYAA 3K48A 3ZYGA 4YSFA 3AKRA 4P5HA 5C3RA 4XF4A 3WW4A 1LHWA 3TN93 1DLLA 5JIUA 4MG2A 1ULPA 3ACLA 4AEDA 1NA1A 4QU1A 3ZXEA 1D2QA 5A3TA 3AZZA 4OI2A 4RFT0 4DQAA 1DGWX 4CA9A 2GMEA 4BU2A 4XUNA 3ZVXA 3ACFA 1V00A 4AI3A 2XONA 1F9KA 3SITA 2UURA 4DOUA 5LA2A 5KXCA 2AC1A 2R061 1WW6A 2ERFA 1QXRA 2W87A 3VBUC 1IQDC 2GP3A 4XACA 4KG0A 2VVDA 2Y38A 4FXGB 4XZUG 1YI7A 2B39A 4YRDA 1YLLA 3T2OA 2QQVA 2KR2A 2CL2A 5FWEA 1W8WA 1GYKA 3OUHA 4KGQA 5FOJB 2P3YA 1SQ4A 1K12A 5DAXA 3F95A 3JUUA 4RA0A 4V2VA 1RXGA 4IE7A 1RUE2 1GBGA 1XB9A 3CJIB 2XLGA 1DZTA 5DUVA 2G9GA 3E6CC 2ZKNA 4YW7A 5FMOL 3WR0A 5FQ0A 1CVNA 1S55A 2WNOA 3PJYA 4QGLA 1GICA 4Q8LA 1O7FA 3ZSMA 3VD5A 1HRI2 1QY4A 2X5IC 4LNVA 1ODMA 3NAPA 1STMA 2RM21 1CGPA 1B35A 1EY2A 4NRPA 4J25A 1KS5A 3T3YA 1DQ2A 1PIV3 1UY3A 5DZFA 2B7YA 2X05A 1IHMA 1NLSA 1NXMA 3KT1A 2G9FA 5BYNA 3CO2A 2BOJA 3FFQA 3PU8A 4MO3M 1KDKA 1F4HA 1AUYA 1F31A 4Q4V3 4ATEA 2CU5A 1DP0A 3Q8BA 4SLIA 3HAGA 1ZRCA 1BK1A 1GMMA 1UYYA 1HV0A 2RS31 3WEZA 4CEWA 5C3OA 3LDBA 1RHI2 1W39A 3PUQA 2XR4A 1WW4A 3TYJA 2YDEA 3LEGA 4IW3A 1BHGA 5FYUA 5FYHA 1K5JA 4JDMA 4IEYA 1UCXA 2WDBA 5KHIA 4CCMA 3VHRA 5LW9A 1O4ZA 4P9XA 2BPA2 2ZX3A 5EZWA 3SLIA 4ZXEA 3O1OA 4QX3A 2XL7A 5JMOA 5CVRA 5IUQA 3VBSA 4OQ8A 2CGNA 1FMD3 3HJRA 4J1XA 4NHYA 3UYJA 2PHTA 1ZRRA 3VUOA 1PVC1 5GLUA 4Q0QA 5DG1A 1XU1A 5F39A 4A7ZA 5HCAA 5HPOA 1GZWA 1KFXL 3K46A 2Q8DA 5A80A 1NG0A 2ZGKA 4PDWA 4TLGA 5L19A 2ZGUA 2ZHLA 3ATGA 3GALA 5LASA 4LMFA 2DUOA 1CESA 3VB9A 1MS9A 3ZOIA 1GOGA 3ORJA 4IEXA 1IKPA 2BNNA 2K9ZA 3WNPA 3ZN5A 2YV8A 5D1IA 5GJ6A 4LLFA 4MX3A 4OHXA 4HKLA 5FYYA 1EYBA 1HN0A 4PF1A 1FX5A 4QPIA 2K0GA 4QKNA 5LY1A 4D3WA 1MZFA 2FCVA 1UL9A 4BQ3A 4HL0A 3EMRA 1W8TA 5C33A 1AXYA 2IXCA 4Z2AA 5KHKA 4FSJA 4LIVA 1E5RA 1IZ3A 1NY72 2XH6A 1V9U2 1ND3A 4EN7B 4QQ2A 5JOXA 1BVP1 5T52A 4QQLA 3KV4A 3PJQA 4AI0A 2AREA 2MHFA 4FPOB 3HOBA 1R1ZA 2GP5A 2WZ8A 5CFDA 3Q8AA 1HW5A 1RC6A 3TN91 4BXFA 4CEYA 1QOOA 2E6VA 3JD73 1OF4A 4Z82A 3VHNA 1OFSA 2YB7A 3I59A 1CD3G 3ME2A 4CDUB 2PLV2 4YZ5A 3OBAA 3AYCA 4YGCA 5JXJA 2BBVA 1AYM3 1SFNA 3LFIA 2XVGA 4KWJA 1GP6A 1A34A 1GNYA 2VNOA 1W03A 2WA4A 4CE8A 1AYN3 3MPBA 1A8DA 2YGMA 1VBB3 4H7LA 1ODNA 4FOWA 1UPSA 1AR72 2VUJA 2XVKA 4NMIA 2BNOA 4FO9A 1RTVA 4HT1T 4CDWB 2GH8A 2YPDA 2ZA9A 3HPNA 1HXS3 4ISQA 1NKGA 1V6LA 4D7TA 4CPBD 4K8RB 5ABJC 3ZFGB 3V0AA 3BPSA 2ARXA 2WO3A 1QDCA 4CCDA 4PJYA 1TMF3 2D6MA 4TN7A 1UU4A 2F17A 2VR4A 4IEWA 4E2QA 1LOBA 1U5ZA 2EF6A 5A7SA 1UO9A 2CAUA 4RR3C 1EAH3 2BGCA 3OPWA 3AKPA 2W46A 2ZHNA 5A3WA 3S5AA 1T6GC 2HBTA 3ZN4A 2HWE2 4JGYA 1UAIA 1QJX3 4XYXA 1Q8SA 3VBFA 2D5HA 3KWVA 3M3EA 1FV3A 4FOYA 4NPMA 4YZ4A 4YGEA 1I3HA 4I0WB 4Y1VA 4HLTA 1NE4A 2YBKA 2DTWA 1PIV1 1XNAA 4WM7C 5D2AA 5FMOS 4W50A 4UOJA 5BNOC 4Y24A 2I2SA 2GH2A 5CKQA 4FI9A 2O8OA 3RVHA 3M2MA 3RZLA 4XFBA 4BLJA 4X6QB 1OBNA 2W1WA 5EHDA 4D6QA 4Q4V1 3ZN6A 5FBZA 2DFBA 1GV9A 3G7DA 3ZKYA 1GWKA 1OD3A 2Y6GA 4GALA 3HD8B 2XHKA 3CLPA 2JEMA 5A7WA 4Q0PA 3CQOA 1GSLA 5L9RA 1POV0 1RUF2 1W9SA 2A6XA 3MIDA 2J1RA 3ETQA 1AR83 1I9RA 1QGLA 5L73A 4LBQA 3OEBA 3M4FA 2HWB2 5SV5A 1ZM1A 3VDDC 1LOGA 2D7FA 5C3SA 1G7YA 1VRH3 2MEV2 4E4HA 1C8NA 1WCSA 1FMD1 2J1TA 1KGYA 3THTA 4AHXA 5IAXA 1X8EA 1XQNA 2IFWA 3POIA 2GC0A 2ZMLA 1K5MC 4LHNA 5FIXA 3TAYA 3ES1A 3U37A 2O8QA 2WO2A 2VM9A 4QDRA 5FK7A 3T2TA 4EN0A 4ATFA 1DIWA 3HNYM 4LR4A 2EALA 2QQKA 2W9XA 4ES8A 2NMNA 2VZ1A 2YUEA 1OUSA 3ECQA 1ASJ3 3VBHC 2D3RA 1SHWB 4MH0E 5JPMB 3RZKA 1FT9A 3D3AA 4OZOA 5IJRA 4OMCA 5FZHA 3GCXA 1V6IA 3LAGA 1C1LA 2SBAA 2VZ3A 3ZFFA 1L7QA 1W9YA 1S0GA 4G9SB 3D0JA 1RIRA 4Y33A 4YPJA 1JMUB 4B4RA 1K5MB 3LA3A 4H2AA 4FFHA 1O3SA 2VCAA 1RB8G 3ZYJB 1QXJA 2FQPA 3IZOA 5LA1A 2VUDA 2RMU3 4IEPA 4TYSA 4ZHNA 4HZFA 1NCQC 3KVBA 1QHDA 4LK6A 1D2SA 1A6CA 1MEC3 1O8SA 1XNKA 2MPFA 4P9YA 4Q4Y2 4Y5SA 1BMV1 4ET7A 1UD1A 1HLCA 1XSQA 3JBG3 2JXAA 3O1MA 3J26N 1OF3A 4MHUA 1H4HA 1SLAA 4H14A 1ZZ6A 2C0ZA 4ZONA 3VBRA 1QJEA 1UOBA 3JD71 5C4WC 3N35A 1X7NA 3KV9A 5F3GA 4XIKA 2TEPA 4BZ4A 3GZUC 1J3PA 1H6XA 2CWMA 1AYM1 1NXD1 2DUQA 1ENXA 1EV12 1IPSA 1NCQB 3ST7A 1OKOA 3FHQA 4NAMA 5LB6A 3EQEA 1AYN1 1VAVA 3N7LA 1YQ5A 1VBB1 4N8MA 4HPKA 1VMHA 1LNSA 4L92A 1WKYA 4LO5B 4IGOA 4UW3A 2RHPA 1HXS1 4QDQA 3VBFC 4FPFA 3FHAA 2OPKA 1KJRA 1YFYA 1V6KA 1LULA 3G6JB 4L2NA 4XUQA 4MGSA 4EWEA 4N43B 1KQRA 1TMF1 1HQLA 2A7AA 3AMMA 4DRVA 3N36A 2CTVA 4NIHA 3OD4A 1NX9A 1EAH1 2FZ2A 1JZ7A 3VKOA 4AVCA 1VBC3 2XQRA 3BB6A 4IV3C 3H8OA 1A8MA 4L97A 1QJX1 2PN5A 3QOPA 3ZX7A 1RUI2 1W9WA 4JKKA 2ZX1A 4AQ2A 1WCDJ 1IPKA 3WF2A 4XIOA 3OY8B 1F4AA 5F5AA 4LT5A 4ONUA 4OUSA 5IYYA 4Q27A 4KQ7A 3I2JA 1VBA2 1CN1A 2ENRA 1YQ6A 4FT8A 3VGIA 4DZGA 4ZKTB 4HXCA 3CNAA 2LM3A 1YXWA 4AI2A 3HBZA 1TG7A 2DCZA 2HWD3 2Y8KA 4DINB 4CUAA 3TNPB 1L3JA 1W3VA 3IB3A 2JECA 3PVNA 5F2WA 4FQZA 3E5QA 3AL6A 3H9AA 3BYWA 5FY8A 2PQQA 3ENRA 2JX9A 4XFAA 2P17A 1VB2A 2PAKA 2JDAA 2Y34A 1AR81 1YYNA 3BOPA 3LZZA 4COWA 2JG8C 3FMGA 5LK7B 4GJZA 2Q8EA 1RUOA 1BBT2 1W2TA 2ADEA 2D5FA 1K42A 1VRH1 2W47A 4KBZA 4Y1XA 4QHOA 4GQ7A 4JRAA 2YC2A 3ZFFC 4PI2A 3BVCA 2VOKA 3I3EA 1R083 5FYCA 4K8FA 5FJKA 5T5OA 3ZPYA 3BPZA 5FMCA 4JC1A 2BBAA 1XE7A 2W08A 4ITCA 2N7GA 1GKBA 5C9AC 5KXBA 3HEIA 4DXZA 1ND2B 1N3QA 1ASJ1 1UKRA 3WG3A 4ARYA 4EQVA 2HEVF 2BTVC 3EO6A 5K9YA 3WNNA 5JZGC 4PCRA 4B3NA 1OQDA 5I0SA 3NNMA 3OUJA 1OVPA 5HXVA 4Y20A 5D8AC 1YJLA 4ARXA 1MS1A 2GN7A 1OQEA 2IZWA 1UKGA 2OQ7A 2Y6LA 5E89A 3VDAA 2QJVA 2FZ1A 3LEKA 3APBA 4RQPC 1MEC1 5CBLA 1R64A 3EXUA 1TME2 2W68A 4PLNA 1O59A 3NMBA 4P14A 3N9QA 1OLME 3FE5A 1XXNA 4AQTA 3AKQA 3POWA 3NNGA 4B8EA 2TBVA 4LA2A 3UJQA 1W28A 1IG0A 2VMCA 3OYWB 3AXEA 3RI9A 3I54A 1S0JA 1JU4A 3ZXDA 4Y5Z0 2W2IA 5K0UB 1HB1A 5EJ3A 3BU7A 1O4YA 3QACA 4TLFA 4A2UA 2IXLA 5ERLA 4F83A 1DQ4A 2JG9C 2VECA 5JAXA 1US3A 3A23A 1NCRA 4OI4A 1DCSA 2Q5TA 5IVEA 3KQ4B 3DECA 3W9AA 4WVWA 4XXPA 2ZGQA 1QJU1 1FXZA 2WQ4A 4XUTA 2WKKA 2GNTA 3U4SA 4CDQC 4QX7A 1TE1B 4LBOA 1YI9A 1H1IA 3ZXGA 5IVBA 5C5TA 4XUOA 3PHMA 5JVVA 1EUUA 1O3RA 2JG9B 1ZZ7A 1N47A 4ZZ5A 2J7MA 5F6LB 4WM8C 1VBC1 4LO4B 4M00A 5CIRA 2R30A 3B02A 3RMYA 3VL9A 4LKEA 3NL1A 4GA9A 5IWFA 4E2SA 5L7OB 4BK4A 3SMHA 1NLRA 2GDFA 3DPRC 4GKYA 4CDQB 3CL1A 4EYUA 4AR2A 4UAPA 3LFMA 1H8TB 3NO8A 5F5CA 3M3QA 1DZRA 4LOSA 3RG0A 3WP5A 1ULGA 4Q4W3 4QDSA 2BU9A 3CEWA 4EROA 2I07B 3GGLA 1LOCA 1URXA 2P2KA 4NRQA 1RUG2 5A1FA 2A73B 3DF0A 2A3WA 4AHZA 1H2NA 2ORXA 4AQ6A 4Y3OA 1UZ0A 4MXWB 4P9WA 3UJOA 3DPRB 2BGPA 2VXRA 5FKCA 4JZRA 4AGGA 3MLJA 4XE9A 5J98B 1X8MA 1C5HA 4P9IA 2OQ6A 2B46X 2HWF3 5AFBA 1SG3A 1Y7BA 3LA7A 4XFHA 1RUD3 1C4RA 4WVMB 4XW3A 4R9DA 4AGVA 2WINB 3QD6A 1QWRA 1QKQA 5FPLA 2XUEA 4YVSC 2W91A 3LSDA 1XSRA 1R081 3GNEA 3M3IA 4NROA 2WBKA 1VMJA 4NIGA 1CAVB 4NRMA 2BDRA 4OUMA 3D6EA 2FMYA 4LBKA 4AG4A 4CVUA 2D98A 4CRQA 1GR3A 1IGOA 2A3YA 3PUHA 3R4UA 4MUVA 4JKMA 1IS6A 3O5SA 1W8FA 2ZKLA 1VJ2A 2Q1ZB 1X9PA 4KMQA 2VZPA 3MGUA 2X10A 4P5YA 2QNKA 1NLQA 5APAA 3SH5A 4ASKA 3H42B 1X33A 1W9FA 2XGXA 2W1QA 1CQ9A 2QQMA 4RS5A 1DGRN 1OUXA 1ZREA 5J7MA 3DKWA 2DCKA 4AWDA 4BLIA 1CAWA 2QQOA 2ZHKA 4DIQA 2Z42A 3PMSA 1ZRDA 5FMBA 3VKNA 1DU3D 2ZACA 1MVQA 2C24A 5IFTA 1LGBA 2VOXA 2WJSA 2YC0A 3AP9A 1OVSA 2YY1A 1LODA 3S7EA 1ONAA 3WUDA 1YIPA 4RGAA 2BVVA 5FO7B 3KV5A 4IL7A 4O61A 1K3IA 3KT4A 4QKFA 4NIDA 3O7OA 4MGKE 4QPGA 3NJXA 3MLKA 3T08A 5FXXA 3U75A 4NPRA 1ZRIA 4NPLA 5JCTA 4MGZE 1G86A 4AGRA 3J7NA 2D6OX 1Q8PA 2EA7A 2ZGNA 2VNGA 5JMCA 3O1SA 4C1XA 2G19A 1YRZA 2Y60A 3ZYFA 3K4ZA 4EWDA 3NWKA 1HRI3 5T50A 4I30A 1GQHA 1IQAA 2RE9A 4JGZB 4Z92B 3IN9A 1MQTB 4JQRA 2CV6A 5JUVA 4F3JA 3LE0A 4I0BA 3BCWA 4FPCA 4QX8A 1N3PA 3O0WA 2VU9A 3JQXA 1CZSA 5A3PA 1AXZA 2JWPA 3M7AA 3AC0A 2FDKA 1ZZBA 1SACA 4YVWB 2WNUB 4LHLA 1LGNA 2Z5WA 3HT2A 3MF6A 4Z2WA 2AEYA 4CU7A 1LOAA 1LCLA 1YIFA 5C8CB 1W6MB 2DFCA 1CPNA 5C71A 4CCKA 4HMZA 4R52A 2W39A 3A0NA 1RHI3 1ZA4A 3GJBA 4BIFA 5F3IA 4COUA 5FZOB 4QXKA 1LTEA 2BW8A 3CJIA 3LEMA 1CJDA 2JD9A 3IDAA 3LEIA 5J3UA 2OT7A 4NR1A 2RR13 2CWSA 1UYXA 2XJVA 2OS2A 1ULFA 4Q4W1 5F32A 4FCAA 3T4HB 3WP3A 1D4M3 2VL4A 3W58A 1AR62 3WCRA 4D69A 2WT0A 3R6SA 1U5YA 4XMIA 4D94A 1UZVA 1V6JA 4MVTA 3I3MA 2ZGSA 2OUJA 3R4SA 1IOAA 3IDBB 3OTFA 1BJQA 1D0GA 3RJRA 1F15A 4NN0A 3ZSKA 5FMDA 3SQOA 2HWF1 5JIAA 1RUD1 1DBNA 2VH9A 4XAAA 2V09A 5CFCB 3V0BB 4CP2A 1VBE2 2XLFA 4NHLA 2FDJA 4Y26A 4XBQA 4ZY9A 3ELNA 5IK4A 1RITA 2LROA 3AMHA 5LBFA 1U5XA 3F2ZA 4NHXA 1J58A 1W0PA 5GALA 1XNBA 5JR7B 1NT0A 1ZZ9A 1DG6A 4YFZA 1JOJA 1RUH2 1V9U3 3ZMNA 4LKSA 5FY4A 3WF0A 3IIIA 2JDZA 5FV3A 4N53A 4AVAA 3VZKA 1REDA 2WZR2 5FUIA 2Q8CA 1WA6X 1XE8A 3DYMA 4XPVA 4XJ8A 3OSDA 4YW2A 1XPWA 5IK8A 2WAAA 3KF5A 4FBFA 4UWDA 1LU1A 2H0VA 2PLV3 1HKDA 3DXUA 4IE4A 2FCUA 1MS8A 5EV7A 1BK0A 2ZX4A 3RSJA 1AXKA 3A21A 4LIUA 4AYUA 2YBPA 5FY1A 3WF3A 4QQHA 2JE9A 3B93A 5A7NA 1MZ6A 1JS9A 1PMIA 3KSCA 4HVRA 3PVEA 1AR73 1YC61 5EIYB 3PURA 2AGSA 2V5YA 3D8CA 4U2AA 2XQXA 4BQ1A 1DQ0A 4NOTA 3J7LA 5LK5A 1V6NA 2EAKA 1HJGA 1PNFA 2ILMA 5FZKA 1EPZA 5GM0A 4BQ4A 3BIEA 5HBAA 5K8SA 1QU0A 5T5PA 1QMJA 3ILFA 2PHRA 2UY8A 3RWKX 2JENA 2NYYA 2GC1A 3WDXA 2JDKA 3ALQA 4GH4C 5FPUA 2XJRA 4LA3A 4A3ZA 4MYEA 2HWE3 4O9EA 1C1FA 5GZDA 2QQNA 5IVYA 1DQ5A 5FP8A 1HRI1 2VJXA 3RDIA 2B8MA 5FYTA 4GIQA 2RDNA 3EHKA 3FHIB 1O8PA 1PMJX 4CDUA 4UFJA 4K9SA 3VBOA 1GQPA 1JBCA 3IDCB 1RUJ2 3AM2A 1JUHA 2O0OA 4UFKA 3T0BA 4YZ1A 1VPHA 4NUBA 4D7YA 3GHMA 1CPMA 3VBUB 4TZDA 4ASLA 5IFPA 4ZZ8A 2K2SA 2Y33A 2JD4A 4CU6A 1N1SA 5LA9A 1RL3A 2PHDA 4CDWA 4UFHA 1AX2A 1FOD2 2WNEA 1RHI1 4XEZA 1UY2A 2DVBA 1ULCA 3EBRA 4K40A 4CUCA 4GB33 3ZFGA 3QCWA 1RUF3 1RJ8A 4YM2A 1J83A 4E8CA 1JZ2A 1PGL2 1DDLA 4XHBA 5FZIA 4CU8A 1H6YA 4KG8A 3ZM8A 2HWB3 4OLLA 3H8RA 2RR11 4LJHA 2MEV3 3D82A 3P6BA 5J37A 5HXMA 4XDOA 1UU5A 2JB4A 2X5IB 5JDBA 5FYBA 1D4M1 1J59A 1JYIA 1H0BA 3FBYA 3HT1A 1NQJA 4AL9A 5T54A 5ISLA 2WFPA 4QM8A 2EAAA 3RZMA 5JWPA 1JTZX 2J1SA 2KXLA 1FI2A 4QX0A 2AUYA 1WA4A 2BERA 3RNSA 1S4CA 2P4EA 1OD5A 1CX4A 1W8HA 4LE3A 4TXWA 2VD7A 5AC92 1HV1A 4IERA 4K1ZA 5FPAA 4R9BA 1LHNA 4N53C 3N7KA 4BQYA 1O3QA 3VKLA 2IFRA 3AMPA 3MV01 1S0IA 3CZUA 4XFCA 1WLCA 1WMEA 2BWAA 3AKSA 5GLWA 2RM22 1LB2A 3THPA 1OH4A 4E4SA 5EYYA 2B9UA 4DY5A 1S0FA 1Z78A 2WABA 3ZXKA 3KLSA 5EPAA 4FTSA 5IK5A 1NY71 1V9U1 3MW4A 3Q8EA 5DAQA 1HN1A 4Q4Y3 3BKZA 3B3QE 1PNGA 3AP4A 2HEYF 1DFQA 2RDRA 1BEV2 1NA1C 1AR92 4LORA 4P08A 4AEDC 4CCOA 4IE5A 2Y0IA 3AVSA 4LE4A 2ZEZA 2PLV1 3J7MA 4MGTA 2WN3A 1Q8QA 1FNYA 3POJA 5FXZA 5A32B 2VMHA 5FZFA 3POGA 5H9QA 3RGBA 2UWAA 4LQRA 4QX2A 1WCQA 4XCBA 2R6QA 3U0ZA 3FWEA 1AR71 1WMXA 3IPVB 2QQWA 3ZR5A 2RDSA 1GQGA 5DG2A 4PLMA 4LUKA 3NV2A 4E8DA 1W8NA 3AYEA 3OPZA 5DZGA 3VBOC 3DL3A 4FPEA 2GSYA 5DDJ2 2DU0A 4QB2A 1TQ5A 1W6OB 4LOTA 5LWBA 3DXTA 1KRIA 1W2OA 1O4TA 4XF9A 4YZ3A 1FPN2 3VN4A 3LB9A 3ON7A 4FPGA 2FMDA 1QEXA 5FZBA 3WV6A 1FAYA 2VZUA 2BVBA 2ZAHA 2WNVA 2HWE1 1HQNA 5JXHA 4AW7A 5FPVA 1NYWA 3NAPC 3WNKA 1RUI3 4M3CB 1C28A 1B35C 1QQP2 4CDXA 4CXWA 3H1MA 3H7YA 3INAA 4XQDA 3DEMA 1OT5A 1MPXA 4OQ9A 4BB3A 2XVLA 3FUQA 4S2DA 4GZ9A 1VBA3 2LUWA 1UNBA 4YLZA 5KC6A 4M0HA 1Y9MA 5KXEA 2FD8A 4XF3A 3ZYPA 1JUIA 2PTMA 2Q8OA 4DUVA 3TN92 4RGGA 4DEVA 2VXJA 4YW1A 5A1LA 5KR7A 2CYFA 3LKJA 4QB6A 4X8NA 4CEWC 2DU1A 2E9QA 3GYDA 3LA2A 2PELA 2VBBA 5F3EA 3VZMA 3DN7A 3PUSA 5ABJB 2IXKA 4XZPA 4DFSA 3JXSA 4QD2A 4XAEA 4GB31 1EP0A 1RUF1 3FLRA 3WY6A 4N43A 1LECA 1S1AA 1DYOA 1DLCA 5KHJA 1PO12 4RR3B 1APNA 2NM1A 3O1RA 3SXWA 1BBT3 2HWB1 5ACA2 3AMQA 2RS52 4FPYA 4K3UA 3VBSC 2MEV1 2FCTA 1UZYA 4D0QA 1CR7A 1ULEA 3ZXJA 2V73A 3WLUA 2WYFA 2B42B 2DCYA 4CU9A 2XJQA 1XNDA 4AZZA 3K4AA 1OA2A 3GDBA 1SBFA 4LBJA 4IEVA 1OSGA 4WM7B 3OY8A 4PDWC 1E5SA 2V72A 5BNOB 5CISA 2VZOA 3HN3A 4JVAA 3W59A 1SZBA 2WC2A 2V5DA 3HQUA 3LWCA 4LBLA 2E63A 2EIBA 4H3WA 4PIYA 4DXRA 1W8UA 4R9CA 2VBPA 3FLTA 1I6XA 2X29A 3M3CA 3B9IA 2DV9A 5DAPA 4QPIC 1W3XA 2ZGOA 3UESA 5IVCA 1MS4A 2A1XA 3GCWA 3J8F2 4NIAA 4JX0A 1JYCA 2IXJA 2ZX2A 3IBMA 2WFF2 4W65A 5IAVA 1ND3C 4GAZA 3OEAA 1MS3A 2YFZA 1M06G 4D8MA 4N7IA 3LDKA 3ACIA 4Q4Y1 5FZ1A 3VDDB 4L8QA 5CFDC 4CEYC 1G9CA 5B4XA 4JTNA 1UQXA 2VY0A 5FZ6A 1G6NA 2DUPA 2GC2A 4QB1A 4IUGA 2E7AA 3LGRA 4QPWA 4IEOA 3MUY1 3JU9A 2JKXA 1OLMA 3VKMA 1SFPA 4YW4A 5IVVA 4YM0A 1GNZA 1OPMA 2AENA 5E6HA 3M70A 1EV11 4QWNA 4WVZA 3VBHB 1WGPA 3D4KA 1ND2A 2PHXA 4EN9B 1O6UA 2XWBB 1AL22 2QDNA 1H9WA 3U07A 3ZFEA 1COV2 2QQUA 2HJIA 1TZOA 2PYTA 4M4RA 3I59B 3MW3A 5DQ0A 4OI1A 3UETA 2DTYA 5JOWA 4FTEA 1PVXA 3P1IA 1LGCA 4L99A 4NHMA 5C6CA 1HB3A 1OFNA 5FFOC 2VO5A 4Z1VA 1W6NA 2EIEA 2WR9A 1UMIA 2WQ8A 4WVVA 5F5QA 3S0MA 2YBSA 4URAA 1JYWA 5LEKA 4W4ZA 4XQWA 1PZ8A 4JGYC 4UF0B 5LY2A 2PHFA 3SHRA 1W8ZA 2R0FA 3LF7A 4LEJA 5FP4A 1OKQA 2CGOA 1D0HA 1QJU3 1O3TA 5C4WB 1CZTA 1RUI1 2FDFA 2VVFA 2QZ3A 1ZZ8A 2C4XA 3I7DA 3OYWA 1ZBA2 2P34A 2OVUA 3N4MA 1ZYBA 1W0OA 4JHZA 3ZYIB 2G1MA 5K0UA 3U10A 2JDUA 5T55A 4AAXA 4BQ2A 1U12A 4W6WA 4CP9A 5HV4A 1VBA1 3KCCA 3DKQA 3WT3A 3B69A 3VV1A 1R1A2 3KD4A 2AR6A 4N9IA 4HANA 2JJ6A 1U5IA 2GNMA 1N3OA 1Q3EA 1SDWA 1GWMA 1PK6A 1D4VB 3K3OA 3USSA 5A6YA 3JD72 1IPJA 3VBFB 1IG3A 5F7UA 3OGSA 1ZZCA 5E16A 1N1TA 1UF2C 1JYNA 3QLQA 3AL5A 2VZVA 3OUIA 3VLBB 1F5JA 4HVOA 1YQCA 5F5IA 5A7QA 5L9BA 2XG3A 1SLCA 3P3PA 3NSTA 4GMP0 4OHVA 5FY7A 3AYAA 1GP5A 2A6VA 1ENSA 2O14A 4EV0A 3OCPA 1BBT1 5F3CA 3HBKA 3ZN6B 4CCLA 1VBD2 2WSVA 4IV3B 3WQ7A 1NOVA 4IE6A 1FV2A 1W2NA 1Q5OA 2JIJA 4ZU4A 5A7WB 4DUXA 5L7OA 3HQRA 1PGW2 2BQPA 3RZGA 5LBEA 2KM2A 3T2PA 3PMEA 2HEWF 2H6CA 3MIBA 4P02B 1GOHA 4GJYA 3ZYHA 4D7SA 3I2HA 4C0BA 1H8TA 1JZ4A 3NNLA 2D40A 2R0HA 3MLLA 3AZWA 4NO4A 5FKBA 1BVVA 2BNMA 3T30A 3RI8A 2R042 1H1AA 5KHGA 1WLDA 2VOVA 4S2GA 1W9TA 5FYIA 1OPOA 3M8LA 1NZCA 3UKVA 3TBDA 3U4XA 4LTAA 4KWUA 2VQ0A 4LITA 1PZ7A 2WLQA 4IE0A 5A3OA 3CDZB 3PNAA 2ZXQA 1G8WA 1C8M3 4YM1A 1UMZA 5LATA 2J22A 2JG8B 1ULOA 1W2AX 5FPBA 1X9TA 2CHHA 3DYPA 4UBHA 5EP9A 1TME1 4WVMA 3O12A 3E1F1 4BQWA 5FPXA 1LU2A 4PQ9A 4E9KA 3VBRC 3ZFEC 3ZFFB 5FBJA 5B4NA 3RFRA 5JOYA 3CZJA 4XTPA 1YHFA 3I2KA 1C57A 1J1TA 3WSOA 3AFGA 3SEPA 5CZKA 1LKNA 3RPQA 4UFLA 5BY5A 4FXKB 1OH3A 4XABA 1YJKA 1CAVA 1R092 4JHTA 5C70A 5FZ7A 4Y22B 1W04A 2E33A 3PL0A 3FUOA 1H1MA 4TWTA 1DHKB 1HIXA 1OI6A 3O0VA 3GBGA 2XJSA 5CEHA 2YYOA 2GC3A 1YO8A 3U1XA 3ZSJA 3I97A 4XUPA 2TUNA 4I01A 4IV1A 3WNLA 3ZSEA 5JZGB 2Y6HA 2ZCWA 2IXIA 2XJPA 1QXPA 4UI9L 4QXBA 3THCA 5C3QA 5D8AB 3I2IA 2XXZA 4Q4X2 3WQ0A 1ZVFA 2Y0OA 3TEZA 2Z79A 1RJ7A 2VW1A 1UZZA 5IVJA 3HQXA 3OPTA 3UV9A 4I3GA 2IC1A 2IVJA 1RGSA 3H1YA 1HDKA 4IEZA 2XJUA 4RQPB 4JAAA 5DMYA 2R16A 4QQOA 5FXVA 3FX3A 4Z8BA 2B4KA 2ZGRA 3NJZA 2RJKA 1WW5A 5FZEA 1IS4A 2RV9A 4HPKB 1JZ8A 3WCSA 1LOFA 3MO4A 1X82A 2P6CA 4F7ZA 2OA2A 2VW2A 2VQTA 2D6LX 4MZUA 1WLTA 1G9FA 3C7HA 4B29A 2NLRA 1KXGA 1CAUB 4XVHA 5DABA 2DBNA 3RJ2X 2Q1FA 2RMU2 4XFIA 2DCTA 3O1UA 5JSPA 2JKBA 5DUXA 5EXOA 2ES3A 3E5UA 4OVEA 2R072 3SISA 3FBMA 1NAEA 2LW8A 3JBG2 4E4DX 1JW6A 1UW8A 1AR63 4FPLA 3EYPA 4LHKA 3GZEA 4JGZA 1JHJA 3ETPA 2FDGA 3OD0A 4DO0A 5E1RA 3LOIA 1MQTA 5CKMA 3TNQA 3S30A 3WNXA 4DEQA 3LSEA 1W6PA 3E6DA 3HNBM 4AVTA 3BTZA 2X8KA 1RVF2 4BMEA 3MHZA 1UY1A 4BM8A 4FFFA 1O5UA 5FUPA 1SCRA 5JSOA 5EQUA 3K2OA 3N9OA 2GAUA 2WNUA 4YVWA 5HCBA 2ZZQA 2YG0A 4WM8B 3FC0A 3T1MA 2H0BA 3ZDSA 1AF9A 1EPWA 5C8CA 5IATA 2YXSA 4WZFA 5FZ9A 2DDUA 3N9PA 4PIZA 4AI9A 2PXJA 1UIKA 5E8AA 3I2DA 3KMHA 1YNAA 1RUH3 2YC4A 3WD5A 4BQXA 4GD4A 3BN6A 3OGRA 3ZSLA 5GZGA 3RZZA 1SPPB 1MVEA 4TTGA 4IESA 1UMHA 3S5QA 2WZR3 3C2UA 4MGQA 3USUB 5LRSA 1JZ3A 3VZJA 2ZABA 5KC5A 3PLQA 1L7RA 3WDUA 1F8VA 2KA3A 4XOGA 3KHBA 1YUDA 1QH7A 4FQ4A 3O1PA 1OXCA 5BNNA 2VW0A 5BNPA 4YFWA 2RJ2A 5B2GB 2BP6A 3RZHA 2B5HA 2OZJA 1HRV2 1VMFA 4KU8A 4NAOA 2A3XA 3GZTB 3IMNA 5I0UA 1BKZA 1UX6A 4META 1LAJA 5F2SA 1SEFA 4K21A 3MFAA 1C8M1 5KHHA 1GANA 1MS0A 4A6SA 4CCEA 3MZHA 3KS7A 2Y6JA 1GZTA 2RS12 4MV2A 3GM8A 2DF7A 4FPHA 4BCUA 4AOCA 1UU6A 1OOPA 3S6PA 5CFCA 2VMIA 1S2KA 3V0BA 2HWD2 3AVRA 3OG2A 4PQQA 4YVSB 4A4AA 2HWC2 4CPBA 3KZ4C 3N9NA 3J7HA 2QBXA 4XJ9A 3V64A 5L9VA 4FOQA 4H55A 3H1WA 1GUIA 1V0AA 5FCCA 2MNGA 4NHKA 5T5JA 3A0KA 2QQPA 3OB8A 3U78A 2WYSA 2VTFA 3CBNA 3MEPA 5DPNA 1IKQA 1NCRC 5JI7A 3OBZA 3WP6A 2ARAA 1S0DA 1CAXA 4XFFA 4HSLA 4D6SA 4QXHA 4QXCA 4AFMA 5JLVA 1ZBE2 3IIAA 4UFIA 4EE2A 4BQ5A 2PAMA 1Z7S2 4PBPA 3MPPG 4MXVA 4XBNA 2WZPP 1RUE3 2ZTNA 2OIIA 1RUJ3 1PX3A 1YWKA 5G05L 4G4FA 4BPZA 5LCWL 1JYXA 3RZJA 5FP7A 3WUCA 4BH9A 2VVEA 4LBQD 4Q0UA 1FYUA 5DUUA 3WDWA 3O14A 4I3PA 5LRRA 2UWCA 1CZVA 1KFUL 1UXXX 2VQAA 4B4QA 1DQ1A 1FOD3 1S2EA 2JDPA 4HSJA 4V2WA 3MICA 2EXJA 4RFRB 2Q0AA 4O65A 3ASIA 1VE0A 1QNYA 3WHUA 2ZPXA 1OHFA 4PT6A 2R49A 4XILA 4Y4YA 3WNMA 1RUC2 3B01A 1PO22 3BOWA 3O1TA 4C90A 1J3QA 1TNFA 3NRUA 5D21A 1XRUA 2UYBA 4TSVA 2YMZA 4Q8KA 4LO6B 2BOIA 1AR61 1OC1A 2DCJA 4OI0A 4NWWA 2A71A 2KD7A 4OMDA 2RG4A 1KD7A 2NQYA 1REFA 5JR2A 3POYA 2JIGA 4P9JA 4MLOA 4MADA 1CONA 4JRLA 5CU1A 5AC93 1GOFA 3L2YA 2XDVA 3VBUA 4XURA 3CKHA 1UY4A 3O1VA 2W5FA 3E97A 5A3MA 3WDVA 3VHPA 1QDOA 4EWAA 2WWUA 5BNNC 4XF1A 4OYUA 3D5OA 4FP2A 2JE8A 5C7GA 1A78A 4QT6A 4ZXKA 5F9TA 5A6QA 3IMMA 5SV8A 1SLLA 1QJY2 1RUH1 2Z69A 4XFGA 5GZEA 3WHTA 4BWOA 3FL7A 3Q9OA 3KF3A 1KJLA 4YARA 2OPWA 3WQBA 4R9AA 2G9ZA 3VDCA 3ROUA 4AK3A 4EZ4A 1BEV3 5BUVA 2WZR1 1JYTA 1KDMA 4Q1RA 1V70A 2QQIA 2X5IA 3J4UH 4A45A 5FR3A 4O9GA 3IDEA 5CA6A 1Q56A 3L9JT 1D7PM 1OMIA 2IVIB 4RS5C 1GU3A 3SKVA 2GU9A 3UKNA 2ZMKA 3LPFA 3BIWE 2VPVA 3VHOA 1MR5A 4LLOA 1GP4A 2YZ4A 4QKDA 2VCCA 4M01A 4RHV2 3BI3A 2A75A 3OBTA 2CGPA 2XKOA 5L36A 2WT1A 3AXDA 3MFCA 1PX4A 3P5BA 1LHOA 4LBMA 4DRRA 5EJZB 1OA3A 3PIJA 3OGJA 1H2KA 4DXTA 3H7JA 1WBFA 5J96B 4QPGC 3C7GA 5DDJ3 3PUAA 3IM0A 3ABZA 4HFSA 2WRAA 3OGVA 1YQ8A 1WBLA 5FYVA 1WMFA 1FPN3 5EFUA 1DQ6A 1RMU2 5G04L 4XXAA 1W0NA 1QOTA 2P1BA 5CKNA 3VDBA 3HMYA 2YGLA 3H8XA 5T5LA 4BE3A 2R7EB 4IDZA 3ZR6A 2GALA 2JDYA 2VZSA 1QQP3 5FY0A 1UYZA 5CG8A 4INDA 2XBO2 5A3LA 5FZ0A 4EZHA 3SKJE 3TWIA 1JZ6A 2A6WA 1RUE1 1WZXA 4UXAA 1RUJ1 2ZJCA 1P8JA 5A32A 1LRHA 1SLIA 3ACGA 3SEEA 1NE6A 4MHRA 3ZXAC 2QZ2A 5AFEA 5CADA 3W5MA 5LEJA 5FDBA 2WN2A 1JODA 2WS92 5C3PA 1T6BX 2XOMA 4CCNA 3IPVA 1AJKA 5FXWA 2BGOA 1FOD1 3TEXA 3H3ZA 3UT0A 1CWPA 1LOEA 1I5ZA 2VGDA 3AJZA 2XJTA 2J1EA 4CUBA 1W8OA 1PGL1 2VCMA 2FDHA 1W6OA 1WD3A 1SMVA 2QVSB 3CJIC 3ES4A 4B4PA 1PO13 3NKGA 4GKXA 5F1RA 2W94A 5DAWA 4GH4B 5ACA3 1UN1A 2RS53 4QU2A 2XL9A 5I8SA 1E5IA 3KVAA 3IT8A 3DYOA 3KGZA 5FZCA 3K51A 2WWSA 2ZBJA 5A3UA 4AEMA 3AYDA 5A6ZA 1VP6A 2VG9A 4YWAA 4M3CA 4J6GA 4UFMA 2LRPA 3HVDA 2EICA 2ORZA 3NVCA 3OBRA 1SBDA 4Q26A 5FZMA 2ZAAA 4XDPA 3H8UA 3VZOA 5J09A 2P6HA 2R062 1YFWA 4BK5A 1G9DA 1XYPA 1WW7A 4RSUA 3CIHA 5AC91 1UX7A 4LXLA 4UYBA 3JCIA 3POSA 1AX1A 3R4DB 1VIWB 4J1WA 4NE9A 4GWJA 3GHNA 2IWGB 4LKFA 4JTOA 1GNHA 5EJ1B 3ZDVA 5HV0A 2W95A 1QIQA 2K46A 3SCGA 1ENQA 3RQ0A 5ABJA 1O5LA 3J8F3 2VZTA 4JCKA 5FYSA 2PHLA 4QHZA 2R1DA 4HOOA 4HG6B 2WFF3 3VZLA 2C9AA 1J1LA 1JI6A 3RYRA 2Q1MA 3HN1A 3UK9A 4Q0SA 2UWBA 3I3DA 4FFGA 4RR3A 4NIIA 1ZA7A 3JB4C 4DS0A 1W6QB 4Y4RA 5FWJA 3IWZA 1BEV1 2ARBA 1AR91 5FPZA 2C1FA 4ZU7A 3HR9A 3GZAA 2C5DA 3WG1A 4KWKA 2YPJA 4X6RB 4LO7A 4XMAA 4IXLA 2OKXA 4A41A 1AL0G 2SLIA 3S57A 2YU2A 2DVDA 2Q4SA 1WMDA 5FP3A 3BGAA 4RGKA 4WM7A 4UW6A 4I0AA 5BNOA 4W8JA 2HBUA 4GULA 1VLNA 1PMHX 3HIFA 2W1UA 1S2BA 5A33B 3C8XA 1N1VA 2R32A 4I09A 4N53B 1BXHA 3AK0A 1ULDA 1AL23 2RR12 2ZGPA 2BWCA 4LULA 5AVPA 3EJKA 2D44A 3I2OA 1X36A 1AX0A 1COV3 2XLAA 4OFGA 3POEA 2RS32 1D4M2 1F2NA 5GZCA 3O0XA 2W0XA 2H6BA 3THDA 4XC9A 4HKWA 4K7JA 1DYKA 2WWJA 5DDJ1 1H8VA 1POV3 2VAUA 4YYOA 1H4GA 4LHSA 1EV13 2QFEA 4QX5A 1UOGA 4XCAA 1FPN1 1H30A 5FZLA 4CCJA 5JXGA 5LZ6A 4AEDB 3VDDA 1NA1B 4JV4A 4AE2A 4E27A 1TNRA 2B9VA 2VULA 2ZEXA 5I0RA 1PVC2 4Q1PA 3BU0A 2J42A 4CDUC 1QQP1 1W05A 3ZMOA 1G9AA 1K5MA 2ZHMA 4PBOA 4QGMA 3KV6A 1AZDA 1ZBA3 4JQTA 5LBBA 1JU3A
chains in the Genus database with same CATH topology
3AL6A 2OT7A 3UYJA 4V2WA 5FY8A 5F3EA 5A1FA 5FZGA 5FY9A 3PUSA 2YU1A 5FZIA 4CCNA 2OS2A 5F32A 5FZAA 4E4HA 4Y3OA 5FXWA 4CUGA 5F39A 3K3OA 4GJZA 2Q8EA 2Q8DA 5A80A 3NJYA 5FJHA 4XDOA 3AL5A 2OQ6A 5FYBA 5FY5A 5F5IA 5A7QA 2P5BA 5FY7A 4DO0A 5ISLA 4AAPA 5F37A 5FYCA 5FJKA 5FYYA 5FPLA 2XUEA 3KVAA 5FYZA 5F3CA 5FZCA 4CCLA 5LY1A 5FZHA 2VD7A 5FUPA 2XMLA 5FPAA 3K2OA 3N9OA 4UF0A 5FZMA 4LIVA 5A7WB 4Y33A 4XDPA 5FZ4A 2XDVA 4QU1A 3ZLIA 5FZ9A 3N9PA 3KV4A 5A3TA 4AI9A 2OX0A 4GJYA 4BU2A 2PXJA 4LXLA 5FY4A 2GP5A 2WWUA 3KVBA 4BXFA 5IVCA 5FV3A 1VRBA 4GD4A 2OQ7A 4IGPA 2Q8CA 4ASKA 4CSWA 5ANQA 5FYIA 4BISA 4GAZA 5FYSA 2GP3A 3N9QA 4LITA 3KV9A 3DXUA 4HOOA 5F3GA 4CCOA 4DIQA 5FZ1A 5K4LA 4EZ4A 5A3NA 3AVSA 3PTRB 5FWEA 4LIUA 5FPBA 2YBPA 5FY1A 4Y4RA 5FXZA 5FWJA 5FZ6A 5FZ3A 5A7NA 2YPDA 2W2IA 4V2VA 5FZFA 5F2SA 5A7PA 3KV5A 3PURA 5A7OA 5FBJA 4IGOA 5FXXA 5IVVA 2YU2A 5E6HA 5FP3A 5FZKA 4QWNA 4TN7A 5FZOA 5IVEA 3AVRA 5A7SA 3N9MA 3N9NA 5A3WA 3OPWA 5FZ7A 5IVFA 5FYMA 5FPUA 3U4SA 3PDQA 5CEHA 4QX7A 4D6RA 3U78A 5LWBA 3DXTA 5FP9A 3PUAA 5IVYA 5IVBA 5FP8A 3ZPOA 5FYTA 3PU8A 2YBKA 4QXBA 4QX8A 5FZDA 5FYVA 5FZBA 2XXZA 4D6SA 2WWJA 5A3PA 4QXHA 5FZ8A 4QXCA 5IVJA 5IW0A 3OPTA 2YBSA 3LD8A 5FPVA 3RVHA 4URAA 3K3NA 4UF0B 5F5AA 5IWFA 4NUBA 5LY2A 4HONA 5FZLA 4CCJA 3LDBA 5FP4A 4D6QA 3PUQA 5FUNA 5FXVA 5FY0A 4CCKA 5FZEA 5FYUA 4EYUA 5FP7A 5FYHA 5FZ0A 4EZHA 5F3IA 5A7WA 4IGQA 5F5CA 4CCMA 5LW9A 3PU3A 4C8DA 3KV6A 5FZOB 3N9LA 5F2WA 5A1LA 5KR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AL6 A;  2OT7 A;  3UYJ A;  4V2W A;  5FY8 A;  5F3E A;  5A1F A;  5FZG A;  5FY9 A;  3PUS A;  2YU1 A;  5FZI A;  4CCN A;  2OS2 A;  5F32 A;  5FZA A;  4E4H A;  4Y3O A;  5FXW A;  4CUG A;  5F39 A;  3K3O A;  4GJZ A;  2Q8E A;  2Q8D A;  5A80 A;  3NJY A;  5FJH A;  4XDO A;  3AL5 A;  2OQ6 A;  5FYB A;  5FY5 A;  5F5I A;  5A7Q A;  2P5B A;  5FY7 A;  4DO0 A;  5ISL A;  4AAP A;  5F37 A;  5FYC A;  5FJK A;  5FYY A;  5FPL A;  2XUE A;  3KVA A;  5FYZ A;  5F3C A;  5FZC A;  4CCL A;  5LY1 A;  5FZH A;  2VD7 A;  5FUP A;  2XML A;  5FPA A;  3K2O A;  3N9O A;  4UF0 A;  5FZM A;  4LIV A;  5A7W B;  4Y33 A;  4XDP A;  5FZ4 A;  2XDV A;  4QU1 A;  3ZLI A;  5FZ9 A;  3N9P A;  3KV4 A;  5A3T A;  4AI9 A;  2OX0 A;  4GJY A;  4BU2 A;  2PXJ A;  4LXL A;  5FY4 A;  2GP5 A;  2WWU A;  3KVB A;  4BXF A;  5IVC A;  5FV3 A;  1VRB A;  4GD4 A;  2OQ7 A;  4IGP A;  2Q8C A;  4ASK A;  4CSW A;  5ANQ A;  5FYI A;  4BIS A;  4GAZ A;  5FYS A;  2GP3 A;  3N9Q A;  4LIT A;  3KV9 A;  3DXU A;  4HOO A;  5F3G A;  4CCO A;  4DIQ A;  5FZ1 A;  5K4L A;  4EZ4 A;  5A3N A;  3AVS A;  3PTR B;  5FWE A;  4LIU A;  5FPB A;  2YBP A;  5FY1 A;  4Y4R A;  5FXZ A;  5FWJ A;  5FZ6 A;  5FZ3 A;  5A7N A;  2YPD A;  2W2I A;  4V2V A;  5FZF A;  5F2S A;  5A7P A;  3KV5 A;  3PUR A;  5A7O A;  5FBJ A;  4IGO A;  5FXX A;  5IVV A;  2YU2 A;  5E6H A;  5FP3 A;  5FZK A;  4QWN A;  4TN7 A;  5FZO A;  5IVE A;  3AVR A;  5A7S A;  3N9M A;  3N9N A;  5A3W A;  3OPW A;  5FZ7 A;  5IVF A;  5FYM A;  5FPU A;  3U4S A;  3PDQ A;  5CEH A;  4QX7 A;  4D6R A;  3U78 A;  5LWB A;  3DXT A;  5FP9 A;  3PUA A;  5IVY A;  5IVB A;  5FP8 A;  3ZPO A;  5FYT A;  3PU8 A;  2YBK A;  4QXB A;  4QX8 A;  5FZD A;  5FYV A;  5FZB A;  2XXZ A;  4D6S A;  2WWJ A;  5A3P A;  4QXH A;  5FZ8 A;  4QXC A;  5IVJ A;  5IW0 A;  3OPT A;  2YBS A;  3LD8 A;  5FPV A;  3RVH A;  4URA A;  3K3N A;  4UF0 B;  5F5A A;  5IWF A;  4NUB A;  5LY2 A;  4HON A;  5FZL A;  4CCJ A;  3LDB A;  5FP4 A;  4D6Q A;  3PUQ A;  5FUN A;  5FXV A;  5FY0 A;  4CCK A;  5FZE A;  5FYU A;  4EYU A;  5FP7 A;  5FYH A;  5FZ0 A;  4EZH A;  5F3I A;  5A7W A;  4IGQ A;  5F5C A;  4CCM A;  5LW9 A;  3PU3 A;  4C8D A;  3KV6 A;  5FZO B;  3N9L A;  5F2W A;  5A1L A;  5KR7 A; 
#chains in the Genus database with same CATH topology
 3LIH A;  4S2F A;  5CG9 A;  3T0A A;  4AHW A;  1LHU A;  3MV1 1;  3URF A;  2YRO A;  1O91 A;  3GBF A;  3KHC A;  1R1A 3;  4SBV A;  3VBH A;  4UW4 A;  1CX1 A;  3MYX A;  4C1W A;  1MZ5 A;  1UPI A;  2Z4F A;  5FTT C;  3D0S A;  4LO8 A;  3WVJ A;  2R1B A;  4CDW C;  5HCF A;  2ZOE B;  3OJB A;  2PMW B;  2NPI A;  2E32 A;  3T1L A;  4QM9 A;  4KWL A;  4BXS V;  4IEU A;  2VZQ A;  2Z2S B;  3DUI A;  3ZFG C;  3VBO B;  3TEW A;  3WDY A;  3NV4 A;  2HYX A;  1KIT A;  1TVG A;  3CHX A;  4K20 A;  3WZ1 A;  1E57 A;  2QDR A;  3KB5 A;  4JDN A;  1U0A A;  4XJA A;  4EN8 B;  2C6S A;  3T0D A;  3N3H A;  4HET A;  3AZY A;  4AVB A;  1NCQ A;  1PO1 1;  5FQ0 B;  3WXP A;  2HLE A;  5ACA 1;  1PGS A;  2I74 A;  3VD3 A;  2RS5 1;  5A70 A;  1VBD 3;  4UF0 A;  2C9K A;  2W52 A;  4KI5 M;  1EUT A;  1RYY A;  3NAP B;  5FZ4 A;  3ILR A;  1B35 B;  2BJS A;  2I45 A;  2QKD A;  5C4W A;  3ZLI A;  2GMM A;  1YCI A;  2E51 A;  2OX0 A;  1FAT A;  2VTX J;  3JQW A;  4OHW A;  4PLO A;  3KQR A;  3WIN E;  1OUR A;  4M3C E;  3MI8 A;  5M0T A;  1HX6 A;  2ADD A;  4KGG A;  4COY A;  1G9B A;  4QMA A;  2VCB A;  5ANN A;  3SC7 X;  2J1U A;  4YW5 A;  2D93 A;  4AXO A;  2R04 3;  4AI1 A;  5F8P A;  4KL1 A;  4CEW B;  2XHN A;  2Q30 A;  2TNF A;  2XB6 C;  4HBN A;  2DVF A;  4MGY E;  4OUL A;  2DYC A;  2BFU L;  1DGR A;  5A3N A;  4A44 A;  2BV4 A;  2NP0 A;  3J8F 1;  2VZR A;  1UOF A;  1JHN A;  3AX4 A;  1PM7 A;  1E5H A;  4OHZ A;  2WFF 1;  4YM3 A;  3LOB A;  4OCT A;  3GXU A;  4LPL A;  1JN2 P;  1ZRF A;  5I8T A;  3VD9 A;  3VBS B;  2BYV E;  3ZKU A;  3PVB B;  3ZYB A;  5J36 A;  4IV3 A;  1I5P A;  3DGT A;  3JZV A;  3WF4 A;  3KM5 A;  4EN6 B;  2ET7 A;  2AYH A;  4PI0 A;  1JZ5 A;  1W99 A;  2X53 S;  2ZGM A;  1GZW B;  1MS5 A;  1PIV 2;  4GB3 2;  3RMX A;  2ZMN A;  4PDW B;  3AZV A;  3Q8F A;  1R09 3;  1Y3T A;  1DF0 A;  3AFK A;  3I8T A;  3H50 A;  3FJS A;  3MW2 A;  5FO9 B;  1TME 3;  1BQP A;  1VAK A;  4GMP 3;  3DCQ A;  3RS6 A;  3M1H A;  4Q4V 2;  1AL2 1;  4QPI B;  1CIW A;  3UNP A;  1COV 1;  2VMG A;  4UBG A;  3WG2 A;  5FZ8 A;  3WG4 A;  1HQW A;  4Q4X 3;  5KXD A;  2W3J A;  4A7Y A;  2WLP A;  3BTA A;  5GKA C;  1GLH A;  3H0O A;  1POV 1;  1ND3 B;  3N7M A;  3AP7 A;  3AZX A;  1US2 A;  4RL7 A;  1LED A;  2EVX A;  2FBE A;  2JG8 A;  1XNC A;  1C3H A;  4CEY B;  5CFD B;  2AZ5 A;  2WNV C;  3PU3 A;  1FMD 2;  4LUM A;  4Y5T A;  2A70 A;  4BJ0 A;  1LES A;  3N9L A;  4CDX C;  2EIG A;  3A7Q A;  2HKX A;  3WW3 A;  4P00 B;  4XJZ A;  2BZD A;  3WDT A;  5I0T A;  4YNI A;  4A3X A;  1ZBA 1;  1BCX A;  3CJX A;  2AH2 A;  4L9B A;  2QQL A;  5FK8 A;  4LKD A;  5C9A A;  5DN2 A;  4CZS A;  4Y22 A;  1WUV A;  4XDQ A;  1R1A 1;  2R07 3;  2ZGT A;  3NJY A;  2D3P A;  2D6N A;  1ZX5 A;  3MBW A;  5KBF A;  2WNV B;  3QH6 A;  1F5F A;  2EXH A;  4Q2F A;  4UT5 A;  2FHR A;  5JZG A;  1KEX A;  3PUI A;  5F37 A;  4M3C F;  5EWS A;  4CDX B;  3V0A B;  2VUC A;  2GZW A;  3I2G A;  2B45 X;  5D8A A;  4ZU5 A;  2QCS B;  5AVA A;  4CTE A;  1Q8O A;  5CYY A;  4FPJ A;  4N43 C;  3ZIX A;  4AFA A;  3AMN A;  3GJA A;  4M0N A;  1JH5 A;  4AQS A;  4F8A A;  1RVF 3;  1QJF A;  3E5X A;  1BMV 2;  4RQP A;  2PHW A;  1W06 A;  1Z0H A;  2C26 A;  4JGY B;  4M4P A;  2AAC A;  1Y9Q A;  1NZI A;  3SCF A;  4B1L A;  3VL8 A;  1VBD 1;  4KU7 A;  5I91 A;  1RUG 3;  2QE3 A;  4YW6 A;  4W6Y A;  5DUW A;  5HCH A;  4EJR A;  1HJF A;  2VOW A;  5FRE A;  1PGW 1;  3QBQ A;  4DY3 A;  1CAU A;  4HVQ A;  5KWR A;  1QH6 A;  4R8H A;  4CSW A;  1AYM 2;  5ANQ A;  5C5U A;  3TEY A;  4L11 A;  2GN3 A;  4ZPI A;  1PZ9 A;  3RYP A;  1UXZ A;  4FAG A;  1AYN 2;  2JG9 A;  2A5Z A;  5DXD A;  3C3V A;  4Z07 A;  1VBB 2;  5K4L A;  5C8W A;  2R04 1;  3FFZ A;  3ILN A;  3A22 A;  1WCU A;  2DVG A;  1C5I A;  2D3S A;  2VME A;  1W90 A;  3BOD A;  3PTR B;  3UKT A;  2JIC A;  1HXS 2;  2QUO A;  4C91 A;  2PAE A;  2IUW A;  2CSG A;  4XJU A;  3GF6 A;  1HRV 3;  2J1A A;  5A7P A;  3AKT A;  4RN5 A;  1VB4 A;  4CDQ A;  5A7O A;  1TMF 2;  2EXI A;  5IHR A;  2P37 A;  4GWN A;  4LBQ B;  1H9P A;  3LCP A;  1EAH 2;  2YFU A;  2RS1 3;  5GLT A;  4B1M A;  4HKO A;  4CP0 A;  3BTX A;  5HI0 A;  1IS5 A;  4QHB A;  1J3R A;  4WM8 A;  1Q8V A;  2BFU S;  2CDO A;  5I93 A;  1QJX 2;  3LIG A;  5IVF A;  4P9G A;  2HWC 3;  4AFB A;  3MIH A;  5FYM A;  2CY6 A;  2E31 A;  2GND A;  1GZC A;  2VTX A;  3MUZ 1;  2VC9 A;  3VD4 A;  1JXN A;  4MXW A;  1WD4 A;  3DPR A;  4FOV A;  4AFD A;  3ZPO A;  2F4P A;  1XOY A;  1LEN A;  1R09 1;  2VBD A;  4GWM A;  4XTM A;  4S2H A;  5FZD A;  4HN0 A;  1ND2 C;  4AVS A;  1NUK A;  1SPP A;  5CAZ A;  1JYV A;  4GMP 1;  4ISR A;  4FP3 A;  4X8P A;  1RUN A;  3USU A;  4QX1 A;  3LD8 A;  4MGI E;  3WW1 A;  4ZS2 A;  4MOA A;  3B00 A;  3UGF A;  3ZO0 B;  1ZBE 3;  4PIX A;  3V65 A;  3CU7 A;  4CYD A;  1Z7S 3;  4Q4X 1;  3H3L A;  4K1Y A;  2LTN A;  3POF A;  3FLP A;  3CF6 E;  2Y6K A;  1AR8 2;  5H9P A;  2EID A;  1SFY A;  2E53 A;  4CXY A;  2ZX0 A;  4AEJ A;  1V6M A;  1VRH 2;  4LK7 A;  3VBR B;  4FTB A;  5FLJ A;  3ZFE B;  2VQU A;  2WT2 A;  3K75 B;  2YU1 A;  4Q5O A;  4Y1U A;  1L7L A;  5FZA A;  4YVS A;  4FPK A;  4BYY A;  2WII B;  4CUG A;  4Q29 A;  2BRT A;  5CB7 A;  1XU2 A;  2WZE A;  2D43 A;  3IAQ A;  1BLZ A;  4AEK A;  4GWI A;  4QKB A;  5K0U C;  3I4I A;  3NKT A;  1W6N B;  4ES9 A;  2RMU 1;  2P5B A;  1RUC 3;  1ASJ 2;  1PO2 3;  2F6B A;  3I3Q A;  1SDD B;  4AAP A;  2ZEW A;  4BA6 A;  3WNO A;  2R07 1;  2CNA A;  2OW4 A;  3A4U A;  1IS3 A;  2XPJ A;  1LR5 A;  3I49 A;  1QOS A;  2DVA A;  2A6Y A;  3JBG 1;  3MIF A;  1PK6 C;  5FYZ A;  1WWY A;  3LDR A;  4YW3 A;  1J84 A;  4DXS A;  4A6O A;  4OZX A;  4MSV A;  3SCH A;  2ATF A;  4B7K A;  3NNF A;  3AP6 A;  1REE A;  4QGN A;  3UGG A;  4DB5 A;  4QPY A;  1A3K A;  3MDP A;  3UL2 A;  5BXX A;  2ZGL A;  1S0B A;  3AJY A;  3KCY A;  3ZYR A;  2WSU A;  4CP9 B;  1RVF 1;  1LHV A;  1MEC 2;  3AB0 A;  4AVV A;  2NN8 A;  4Y1Z A;  4YG3 A;  4W6X A;  5DZE A;  3R05 A;  4I2O A;  3ZXL A;  2JE7 A;  4IGP A;  4KH9 A;  1PK6 B;  3X29 B;  2OZ6 A;  1RUG 1;  2P3J A;  5FLH A;  4BOW A;  4U36 A;  2WO1 A;  3NV3 A;  2PQS A;  4DPN A;  3GBW A;  3U14 A;  2O1Q A;  4CP1 A;  2JDM A;  1FNZ A;  3VKF C;  2D6P A;  5L7O C;  1H2M A;  4N9H A;  4XJW A;  4A42 A;  1PHM A;  1DGW A;  1QJY 3;  4XBL A;  5JSR A;  4HN1 A;  1H8T C;  3NJV A;  3B94 A;  4R4X A;  5I8Y A;  5JPN B;  1HB2 A;  1YFU A;  2VMF A;  3R0R A;  1RIN A;  3OOX A;  5E88 A;  5FLI A;  1VBE 3;  1HB4 A;  3S7I A;  5IT6 A;  1XYN A;  1W6M A;  2ZS6 B;  3MIE A;  3C7O A;  1ENR A;  2DUR A;  1QJU 2;  5FRA A;  1AVB A;  2JB8 A;  1UIJ A;  1UWW A;  3BAL A;  3POB A;  1HRV 1;  2P3I A;  1Y43 B;  4XQ4 A;  5JOZ A;  2WO7 A;  4FVV A;  5EYX A;  4URT A;  1X50 A;  1YQ2 A;  4XHX A;  4YGD A;  5FZO A;  4A7K A;  4RHV 3;  2W1S A;  3EB7 A;  4ASM B;  1CJP A;  1TEI A;  3Q8C A;  2YHJ A;  1ALY A;  3PVO A;  4HK8 A;  4WBB A;  1SLB A;  4BIO A;  2RS1 1;  1XYO A;  1OQ1 A;  3PDQ A;  1VBC 2;  3SH3 A;  2GNB A;  3HNM A;  3FZ3 A;  2HWD 1;  3IKW A;  4H7M A;  4QQP A;  3ZIW A;  2GMP A;  2HWC 1;  3UGH A;  5H9R A;  4XET A;  3KT7 A;  5FOB B;  4WZC A;  2JDN A;  5J1X A;  4YGB A;  1WLW A;  1MZE A;  3M3O A;  4HK9 A;  1RMU 3;  3CMG A;  4HON A;  1UYP A;  4IEQ A;  4B7E A;  2BUK A;  3W20 A;  4IV1 C;  4UW5 A;  3SH4 A;  5GLZ A;  1OLR A;  1ZBE 1;  4Y20 B;  1MAC A;  2XBO 3;  3OGG A;  4CCC A;  5JXI A;  1CIY A;  1Z7S 1;  2ZEY A;  4C8D A;  3C7E A;  2E7Q A;  4E4Z A;  5CNA A;  3NQH A;  1XJA A;  2L9L A;  2JDH A;  2CAV A;  4AI8 A;  1S0C A;  1ZNP A;  2RJL A;  1GFF 2;  4RYD A;  2WS9 3;  1LOF C;  3B9C A;  4IV1 B;  2XKP A;  5GLV A;  2V4A A;  2EXK A;  4AF9 A;  1LJ7 A;  4NJ4 A;  2ID4 A;  1OLQ A;  4K6B A;  4YZ2 A;  4BDV B;  1YEW A;  1R08 2;  1UZW A;  4COZ A;  2RDQ A;  2NMO A;  1XBF A;  2E26 A;  4O7X A;  3P3N A;  4FAH A;  4BMB A;  4ZS3 A;  2UY9 A;  2WAO A;  2PHU A;  4Q0V A;  1C8M 2;  1RUC 1;  1S0E A;  1PO2 1;  1NCR B;  3ACH A;  3J9S A;  2ARC A;  4RD7 A;  3W5N A;  2XML A;  5FO8 B;  2VMD A;  1KS4 A;  1QJZ A;  1OA4 A;  1GZ9 A;  4JGZ C;  4DUW A;  4AFC A;  1Y4W A;  2RVA A;  2WA3 A;  5C9A B;  1MQT C;  2OUH A;  5FAX A;  5JI9 A;  2LS6 A;  2G4I A;  5I0D A;  1ST8 A;  4CXX A;  3ITQ A;  2R06 3;  3U11 A;  3MF9 A;  3WF1 A;  4IET A;  4LBN A;  1ACC A;  1DZQ A;  5A1A A;  1AHS A;  1VRB A;  2QQJ A;  1POQ A;  3BTY A;  1DGL A;  4NVP A;  4WV8 A;  1JOB A;  4JKL A;  3E6B A;  4YVW C;  2E7T A;  2WNU C;  4V1P A;  3VD7 A;  1AJO A;  2VOT A;  4DNY A;  5A6X A;  1RXF A;  5C8C C;  4BIS A;  1V6O A;  2VNV A;  2P3K A;  4L0P A;  2OYZ A;  4R4Z A;  2LAL A;  2J1V A;  1QNW A;  2VUA A;  4FFI A;  3WOG A;  3RYK A;  5IK7 A;  2DBI A;  4QAW A;  4IQP A;  1GWL A;  3MIG A;  3KCX A;  3NV1 A;  1W6P B;  3K4D A;  3I2F A;  1LEM A;  1QJY 1;  1T2X A;  2ETE A;  2WL1 A;  3I3B A;  3T4V A;  3BUC A;  5FZ3 A;  1XC6 A;  4E2G A;  1VAM A;  1VAL A;  3NW4 A;  2DWR A;  2IXH A;  4GH4 A;  4GXL A;  3N7J A;  4OUE A;  4G3Y C;  5BNQ A;  4DMI A;  3ZXF A;  2NZ9 A;  5BV6 A;  4C0H A;  4KBB A;  1VBE 1;  5F6K A;  4COV A;  1BZW A;  2XUM A;  3PIG A;  4BHP A;  2RM2 3;  2Y64 A;  3W21 A;  5BNP C;  1WCK A;  5J48 A;  1QF3 A;  4NWV A;  4N90 A;  5H9S A;  3N9M A;  4OHY A;  2HYK A;  1JOP A;  5TSW A;  4RHV 1;  3LQC A;  3K77 A;  1VR3 A;  4D6R A;  5LA0 A;  2UU8 A;  5FP9 A;  1AR9 3;  3SNM A;  2PA7 A;  3IAP A;  1OOP C;  1XE0 A;  5CFC C;  3NNJ A;  1W2U A;  2WQZ C;  2FDI A;  2RS3 3;  4XF0 A;  1M4W A;  1I1E A;  1UOJ A;  2BEO A;  5BNN B;  3T2Q A;  5BNP B;  4ORF A;  3VZN A;  1BYH A;  1H2L A;  1SCS A;  5IW0 A;  2A6Z A;  4P9L A;  3L2H A;  1DYP A;  3B5L B;  3K3N A;  3OF1 A;  4PF5 A;  5T3N A;  2ET1 A;  3T09 A;  5GZF A;  2AEZ A;  5FUN A;  3FN9 A;  2X09 A;  2HH9 A;  1UY0 A;  2Y26 A;  5LBC A;  1RMU 1;  2OXB A;  2VNR A;  2CDP A;  3WQ1 A;  1Q43 A;  2QTW B;  1W6Q A;  4Q4W 2;  4IGQ A;  3V56 A;  3TRS B;  1OOP B;  1K45 A;  1PVC 3;  2WUH A;  3QH7 A;  4N7U A;  5BPX A;  3TOJ A;  2XBO 1;  1B09 A;  3RRD A;  1YFX A;  4RS5 B;  3HWJ A;  5FZG A;  5FY9 A;  3WP4 A;  3JB8 A;  2D97 A;  1XNT A;  1CAW B;  1NQD A;  3PTY A;  4KNC A;  2PFW A;  1N1Y A;  2HWF 2;  3TB0 A;  4Y1Y A;  5A33 A;  1RUD 2;  1PM4 A;  2V4V A;  5FJH A;  4YG0 A;  4AHY A;  4JDO A;  5FY5 A;  2WS9 1;  1CAX B;  3WX5 A;  5K7P A;  4PHZ A;  3C7F A;  1SBE A;  3LPG A;  5DAV A;  3B7M A;  2F4L A;  3DV8 A;  1F35 A;  2VE1 A;  3H3U A;  2Y6F A;  2ZZJ A;  2XWJ B;  4QPG B;  4YG6 A;  1Y9G A;  3AP5 A;  3WW2 A;  2D6K A;  2W92 A;  1SLT A;  4I02 A;  3RWN A;  3KGL A;  2UYA A;  3K48 A;  3ZYG A;  4YSF A;  3AKR A;  4P5H A;  5C3R A;  4XF4 A;  3WW4 A;  1LHW A;  3TN9 3;  1DLL A;  5JIU A;  4MG2 A;  1ULP A;  3ACL A;  4AED A;  1NA1 A;  4QU1 A;  3ZXE A;  1D2Q A;  5A3T A;  3AZZ A;  4OI2 A;  4RFT 0;  4DQA A;  1DGW X;  4CA9 A;  2GME A;  4BU2 A;  4XUN A;  3ZVX A;  3ACF A;  1V00 A;  4AI3 A;  2XON A;  1F9K A;  3SIT A;  2UUR A;  4DOU A;  5LA2 A;  5KXC A;  2AC1 A;  2R06 1;  1WW6 A;  2ERF A;  1QXR A;  2W87 A;  3VBU C;  1IQD C;  2GP3 A;  4XAC A;  4KG0 A;  2VVD A;  2Y38 A;  4FXG B;  4XZU G;  1YI7 A;  2B39 A;  4YRD A;  1YLL A;  3T2O A;  2QQV A;  2KR2 A;  2CL2 A;  5FWE A;  1W8W A;  1GYK A;  3OUH A;  4KGQ A;  5FOJ B;  2P3Y A;  1SQ4 A;  1K12 A;  5DAX A;  3F95 A;  3JUU A;  4RA0 A;  4V2V A;  1RXG A;  4IE7 A;  1RUE 2;  1GBG A;  1XB9 A;  3CJI B;  2XLG A;  1DZT A;  5DUV A;  2G9G A;  3E6C C;  2ZKN A;  4YW7 A;  5FMO L;  3WR0 A;  5FQ0 A;  1CVN A;  1S55 A;  2WNO A;  3PJY A;  4QGL A;  1GIC A;  4Q8L A;  1O7F A;  3ZSM A;  3VD5 A;  1HRI 2;  1QY4 A;  2X5I C;  4LNV A;  1ODM A;  3NAP A;  1STM A;  2RM2 1;  1CGP A;  1B35 A;  1EY2 A;  4NRP A;  4J25 A;  1KS5 A;  3T3Y A;  1DQ2 A;  1PIV 3;  1UY3 A;  5DZF A;  2B7Y A;  2X05 A;  1IHM A;  1NLS A;  1NXM A;  3KT1 A;  2G9F A;  5BYN A;  3CO2 A;  2BOJ A;  3FFQ A;  3PU8 A;  4MO3 M;  1KDK A;  1F4H A;  1AUY A;  1F31 A;  4Q4V 3;  4ATE A;  2CU5 A;  1DP0 A;  3Q8B A;  4SLI A;  3HAG A;  1ZRC A;  1BK1 A;  1GMM A;  1UYY A;  1HV0 A;  2RS3 1;  3WEZ A;  4CEW A;  5C3O A;  3LDB A;  1RHI 2;  1W39 A;  3PUQ A;  2XR4 A;  1WW4 A;  3TYJ A;  2YDE A;  3LEG A;  4IW3 A;  1BHG A;  5FYU A;  5FYH A;  1K5J A;  4JDM A;  4IEY A;  1UCX A;  2WDB A;  5KHI A;  4CCM A;  3VHR A;  5LW9 A;  1O4Z A;  4P9X A;  2BPA 2;  2ZX3 A;  5EZW A;  3SLI A;  4ZXE A;  3O1O A;  4QX3 A;  2XL7 A;  5JMO A;  5CVR A;  5IUQ A;  3VBS A;  4OQ8 A;  2CGN A;  1FMD 3;  3HJR A;  4J1X A;  4NHY A;  3UYJ A;  2PHT A;  1ZRR A;  3VUO A;  1PVC 1;  5GLU A;  4Q0Q A;  5DG1 A;  1XU1 A;  5F39 A;  4A7Z A;  5HCA A;  5HPO A;  1GZW A;  1KFX L;  3K46 A;  2Q8D A;  5A80 A;  1NG0 A;  2ZGK A;  4PDW A;  4TLG A;  5L19 A;  2ZGU A;  2ZHL A;  3ATG A;  3GAL A;  5LAS A;  4LMF A;  2DUO A;  1CES A;  3VB9 A;  1MS9 A;  3ZOI A;  1GOG A;  3ORJ A;  4IEX A;  1IKP A;  2BNN A;  2K9Z A;  3WNP A;  3ZN5 A;  2YV8 A;  5D1I A;  5GJ6 A;  4LLF A;  4MX3 A;  4OHX A;  4HKL A;  5FYY A;  1EYB A;  1HN0 A;  4PF1 A;  1FX5 A;  4QPI A;  2K0G A;  4QKN A;  5LY1 A;  4D3W A;  1MZF A;  2FCV A;  1UL9 A;  4BQ3 A;  4HL0 A;  3EMR A;  1W8T A;  5C33 A;  1AXY A;  2IXC A;  4Z2A A;  5KHK A;  4FSJ A;  4LIV A;  1E5R A;  1IZ3 A;  1NY7 2;  2XH6 A;  1V9U 2;  1ND3 A;  4EN7 B;  4QQ2 A;  5JOX A;  1BVP 1;  5T52 A;  4QQL A;  3KV4 A;  3PJQ A;  4AI0 A;  2ARE A;  2MHF A;  4FPO B;  3HOB A;  1R1Z A;  2GP5 A;  2WZ8 A;  5CFD A;  3Q8A A;  1HW5 A;  1RC6 A;  3TN9 1;  4BXF A;  4CEY A;  1QOO A;  2E6V A;  3JD7 3;  1OF4 A;  4Z82 A;  3VHN A;  1OFS A;  2YB7 A;  3I59 A;  1CD3 G;  3ME2 A;  4CDU B;  2PLV 2;  4YZ5 A;  3OBA A;  3AYC A;  4YGC A;  5JXJ A;  2BBV A;  1AYM 3;  1SFN A;  3LFI A;  2XVG A;  4KWJ A;  1GP6 A;  1A34 A;  1GNY A;  2VNO A;  1W03 A;  2WA4 A;  4CE8 A;  1AYN 3;  3MPB A;  1A8D A;  2YGM A;  1VBB 3;  4H7L A;  1ODN A;  4FOW A;  1UPS A;  1AR7 2;  2VUJ A;  2XVK A;  4NMI A;  2BNO A;  4FO9 A;  1RTV A;  4HT1 T;  4CDW B;  2GH8 A;  2YPD A;  2ZA9 A;  3HPN A;  1HXS 3;  4ISQ A;  1NKG A;  1V6L A;  4D7T A;  4CPB D;  4K8R B;  5ABJ C;  3ZFG B;  3V0A A;  3BPS A;  2ARX A;  2WO3 A;  1QDC A;  4CCD A;  4PJY A;  1TMF 3;  2D6M A;  4TN7 A;  1UU4 A;  2F17 A;  2VR4 A;  4IEW A;  4E2Q A;  1LOB A;  1U5Z A;  2EF6 A;  5A7S A;  1UO9 A;  2CAU A;  4RR3 C;  1EAH 3;  2BGC A;  3OPW A;  3AKP A;  2W46 A;  2ZHN A;  5A3W A;  3S5A A;  1T6G C;  2HBT A;  3ZN4 A;  2HWE 2;  4JGY A;  1UAI A;  1QJX 3;  4XYX A;  1Q8S A;  3VBF A;  2D5H A;  3KWV A;  3M3E A;  1FV3 A;  4FOY A;  4NPM A;  4YZ4 A;  4YGE A;  1I3H A;  4I0W B;  4Y1V A;  4HLT A;  1NE4 A;  2YBK A;  2DTW A;  1PIV 1;  1XNA A;  4WM7 C;  5D2A A;  5FMO S;  4W50 A;  4UOJ A;  5BNO C;  4Y24 A;  2I2S A;  2GH2 A;  5CKQ A;  4FI9 A;  2O8O A;  3RVH A;  3M2M A;  3RZL A;  4XFB A;  4BLJ A;  4X6Q B;  1OBN A;  2W1W A;  5EHD A;  4D6Q A;  4Q4V 1;  3ZN6 A;  5FBZ A;  2DFB A;  1GV9 A;  3G7D A;  3ZKY A;  1GWK A;  1OD3 A;  2Y6G A;  4GAL A;  3HD8 B;  2XHK A;  3CLP A;  2JEM A;  5A7W A;  4Q0P A;  3CQO A;  1GSL A;  5L9R A;  1POV 0;  1RUF 2;  1W9S A;  2A6X A;  3MID A;  2J1R A;  3ETQ A;  1AR8 3;  1I9R A;  1QGL A;  5L73 A;  4LBQ A;  3OEB A;  3M4F A;  2HWB 2;  5SV5 A;  1ZM1 A;  3VDD C;  1LOG A;  2D7F A;  5C3S A;  1G7Y A;  1VRH 3;  2MEV 2;  4E4H A;  1C8N A;  1WCS A;  1FMD 1;  2J1T A;  1KGY A;  3THT A;  4AHX A;  5IAX A;  1X8E A;  1XQN A;  2IFW A;  3POI A;  2GC0 A;  2ZML A;  1K5M C;  4LHN A;  5FIX A;  3TAY A;  3ES1 A;  3U37 A;  2O8Q A;  2WO2 A;  2VM9 A;  4QDR A;  5FK7 A;  3T2T A;  4EN0 A;  4ATF A;  1DIW A;  3HNY M;  4LR4 A;  2EAL A;  2QQK A;  2W9X A;  4ES8 A;  2NMN A;  2VZ1 A;  2YUE A;  1OUS A;  3ECQ A;  1ASJ 3;  3VBH C;  2D3R A;  1SHW B;  4MH0 E;  5JPM B;  3RZK A;  1FT9 A;  3D3A A;  4OZO A;  5IJR A;  4OMC A;  5FZH A;  3GCX A;  1V6I A;  3LAG A;  1C1L A;  2SBA A;  2VZ3 A;  3ZFF A;  1L7Q A;  1W9Y A;  1S0G A;  4G9S B;  3D0J A;  1RIR A;  4Y33 A;  4YPJ A;  1JMU B;  4B4R A;  1K5M B;  3LA3 A;  4H2A A;  4FFH A;  1O3S A;  2VCA A;  1RB8 G;  3ZYJ B;  1QXJ A;  2FQP A;  3IZO A;  5LA1 A;  2VUD A;  2RMU 3;  4IEP A;  4TYS A;  4ZHN A;  4HZF A;  1NCQ C;  3KVB A;  1QHD A;  4LK6 A;  1D2S A;  1A6C A;  1MEC 3;  1O8S A;  1XNK A;  2MPF A;  4P9Y A;  4Q4Y 2;  4Y5S A;  1BMV 1;  4ET7 A;  1UD1 A;  1HLC A;  1XSQ A;  3JBG 3;  2JXA A;  3O1M A;  3J26 N;  1OF3 A;  4MHU A;  1H4H A;  1SLA A;  4H14 A;  1ZZ6 A;  2C0Z A;  4ZON A;  3VBR A;  1QJE A;  1UOB A;  3JD7 1;  5C4W C;  3N35 A;  1X7N A;  3KV9 A;  5F3G A;  4XIK A;  2TEP A;  4BZ4 A;  3GZU C;  1J3P A;  1H6X A;  2CWM A;  1AYM 1;  1NXD 1;  2DUQ A;  1ENX A;  1EV1 2;  1IPS A;  1NCQ B;  3ST7 A;  1OKO A;  3FHQ A;  4NAM A;  5LB6 A;  3EQE A;  1AYN 1;  1VAV A;  3N7L A;  1YQ5 A;  1VBB 1;  4N8M A;  4HPK A;  1VMH A;  1LNS A;  4L92 A;  1WKY A;  4LO5 B;  4IGO A;  4UW3 A;  2RHP A;  1HXS 1;  4QDQ A;  3VBF C;  4FPF A;  3FHA A;  2OPK A;  1KJR A;  1YFY A;  1V6K A;  1LUL A;  3G6J B;  4L2N A;  4XUQ A;  4MGS A;  4EWE A;  4N43 B;  1KQR A;  1TMF 1;  1HQL A;  2A7A A;  3AMM A;  4DRV A;  3N36 A;  2CTV A;  4NIH A;  3OD4 A;  1NX9 A;  1EAH 1;  2FZ2 A;  1JZ7 A;  3VKO A;  4AVC A;  1VBC 3;  2XQR A;  3BB6 A;  4IV3 C;  3H8O A;  1A8M A;  4L97 A;  1QJX 1;  2PN5 A;  3QOP A;  3ZX7 A;  1RUI 2;  1W9W A;  4JKK A;  2ZX1 A;  4AQ2 A;  1WCD J;  1IPK A;  3WF2 A;  4XIO A;  3OY8 B;  1F4A A;  5F5A A;  4LT5 A;  4ONU A;  4OUS A;  5IYY A;  4Q27 A;  4KQ7 A;  3I2J A;  1VBA 2;  1CN1 A;  2ENR A;  1YQ6 A;  4FT8 A;  3VGI A;  4DZG A;  4ZKT B;  4HXC A;  3CNA A;  2LM3 A;  1YXW A;  4AI2 A;  3HBZ A;  1TG7 A;  2DCZ A;  2HWD 3;  2Y8K A;  4DIN B;  4CUA A;  3TNP B;  1L3J A;  1W3V A;  3IB3 A;  2JEC A;  3PVN A;  5F2W A;  4FQZ A;  3E5Q A;  3AL6 A;  3H9A A;  3BYW A;  5FY8 A;  2PQQ A;  3ENR A;  2JX9 A;  4XFA A;  2P17 A;  1VB2 A;  2PAK A;  2JDA A;  2Y34 A;  1AR8 1;  1YYN A;  3BOP A;  3LZZ A;  4COW A;  2JG8 C;  3FMG A;  5LK7 B;  4GJZ A;  2Q8E A;  1RUO A;  1BBT 2;  1W2T A;  2ADE A;  2D5F A;  1K42 A;  1VRH 1;  2W47 A;  4KBZ A;  4Y1X A;  4QHO A;  4GQ7 A;  4JRA A;  2YC2 A;  3ZFF C;  4PI2 A;  3BVC A;  2VOK A;  3I3E A;  1R08 3;  5FYC A;  4K8F A;  5FJK A;  5T5O A;  3ZPY A;  3BPZ A;  5FMC A;  4JC1 A;  2BBA A;  1XE7 A;  2W08 A;  4ITC A;  2N7G A;  1GKB A;  5C9A C;  5KXB A;  3HEI A;  4DXZ A;  1ND2 B;  1N3Q A;  1ASJ 1;  1UKR A;  3WG3 A;  4ARY A;  4EQV A;  2HEV F;  2BTV C;  3EO6 A;  5K9Y A;  3WNN A;  5JZG C;  4PCR A;  4B3N A;  1OQD A;  5I0S A;  3NNM A;  3OUJ A;  1OVP A;  5HXV A;  4Y20 A;  5D8A C;  1YJL A;  4ARX A;  1MS1 A;  2GN7 A;  1OQE A;  2IZW A;  1UKG A;  2OQ7 A;  2Y6L A;  5E89 A;  3VDA A;  2QJV A;  2FZ1 A;  3LEK A;  3APB A;  4RQP C;  1MEC 1;  5CBL A;  1R64 A;  3EXU A;  1TME 2;  2W68 A;  4PLN A;  1O59 A;  3NMB A;  4P14 A;  3N9Q A;  1OLM E;  3FE5 A;  1XXN A;  4AQT A;  3AKQ A;  3POW A;  3NNG A;  4B8E A;  2TBV A;  4LA2 A;  3UJQ A;  1W28 A;  1IG0 A;  2VMC A;  3OYW B;  3AXE A;  3RI9 A;  3I54 A;  1S0J A;  1JU4 A;  3ZXD A;  4Y5Z 0;  2W2I A;  5K0U B;  1HB1 A;  5EJ3 A;  3BU7 A;  1O4Y A;  3QAC A;  4TLF A;  4A2U A;  2IXL A;  5ERL A;  4F83 A;  1DQ4 A;  2JG9 C;  2VEC A;  5JAX A;  1US3 A;  3A23 A;  1NCR A;  4OI4 A;  1DCS A;  2Q5T A;  5IVE A;  3KQ4 B;  3DEC A;  3W9A A;  4WVW A;  4XXP A;  2ZGQ A;  1QJU 1;  1FXZ A;  2WQ4 A;  4XUT A;  2WKK A;  2GNT A;  3U4S A;  4CDQ C;  4QX7 A;  1TE1 B;  4LBO A;  1YI9 A;  1H1I A;  3ZXG A;  5IVB A;  5C5T A;  4XUO A;  3PHM A;  5JVV A;  1EUU A;  1O3R A;  2JG9 B;  1ZZ7 A;  1N47 A;  4ZZ5 A;  2J7M A;  5F6L B;  4WM8 C;  1VBC 1;  4LO4 B;  4M00 A;  5CIR A;  2R30 A;  3B02 A;  3RMY A;  3VL9 A;  4LKE A;  3NL1 A;  4GA9 A;  5IWF A;  4E2S A;  5L7O B;  4BK4 A;  3SMH A;  1NLR A;  2GDF A;  3DPR C;  4GKY A;  4CDQ B;  3CL1 A;  4EYU A;  4AR2 A;  4UAP A;  3LFM A;  1H8T B;  3NO8 A;  5F5C A;  3M3Q A;  1DZR A;  4LOS A;  3RG0 A;  3WP5 A;  1ULG A;  4Q4W 3;  4QDS A;  2BU9 A;  3CEW A;  4ERO A;  2I07 B;  3GGL A;  1LOC A;  1URX A;  2P2K A;  4NRQ A;  1RUG 2;  5A1F A;  2A73 B;  3DF0 A;  2A3W A;  4AHZ A;  1H2N A;  2ORX A;  4AQ6 A;  4Y3O A;  1UZ0 A;  4MXW B;  4P9W A;  3UJO A;  3DPR B;  2BGP A;  2VXR A;  5FKC A;  4JZR A;  4AGG A;  3MLJ A;  4XE9 A;  5J98 B;  1X8M A;  1C5H A;  4P9I A;  2OQ6 A;  2B46 X;  2HWF 3;  5AFB A;  1SG3 A;  1Y7B A;  3LA7 A;  4XFH A;  1RUD 3;  1C4R A;  4WVM B;  4XW3 A;  4R9D A;  4AGV A;  2WIN B;  3QD6 A;  1QWR A;  1QKQ A;  5FPL A;  2XUE A;  4YVS C;  2W91 A;  3LSD A;  1XSR A;  1R08 1;  3GNE A;  3M3I A;  4NRO A;  2WBK A;  1VMJ A;  4NIG A;  1CAV B;  4NRM A;  2BDR A;  4OUM A;  3D6E A;  2FMY A;  4LBK A;  4AG4 A;  4CVU A;  2D98 A;  4CRQ A;  1GR3 A;  1IGO A;  2A3Y A;  3PUH A;  3R4U A;  4MUV A;  4JKM A;  1IS6 A;  3O5S A;  1W8F A;  2ZKL A;  1VJ2 A;  2Q1Z B;  1X9P A;  4KMQ A;  2VZP A;  3MGU A;  2X10 A;  4P5Y A;  2QNK A;  1NLQ A;  5APA A;  3SH5 A;  4ASK A;  3H42 B;  1X33 A;  1W9F A;  2XGX A;  2W1Q A;  1CQ9 A;  2QQM A;  4RS5 A;  1DGR N;  1OUX A;  1ZRE A;  5J7M A;  3DKW A;  2DCK A;  4AWD A;  4BLI A;  1CAW A;  2QQO A;  2ZHK A;  4DIQ A;  2Z42 A;  3PMS A;  1ZRD A;  5FMB A;  3VKN A;  1DU3 D;  2ZAC A;  1MVQ A;  2C24 A;  5IFT A;  1LGB A;  2VOX A;  2WJS A;  2YC0 A;  3AP9 A;  1OVS A;  2YY1 A;  1LOD A;  3S7E A;  1ONA A;  3WUD A;  1YIP A;  4RGA A;  2BVV A;  5FO7 B;  3KV5 A;  4IL7 A;  4O61 A;  1K3I A;  3KT4 A;  4QKF A;  4NID A;  3O7O A;  4MGK E;  4QPG A;  3NJX A;  3MLK A;  3T08 A;  5FXX A;  3U75 A;  4NPR A;  1ZRI A;  4NPL A;  5JCT A;  4MGZ E;  1G86 A;  4AGR A;  3J7N A;  2D6O X;  1Q8P A;  2EA7 A;  2ZGN A;  2VNG A;  5JMC A;  3O1S A;  4C1X A;  2G19 A;  1YRZ A;  2Y60 A;  3ZYF A;  3K4Z A;  4EWD A;  3NWK A;  1HRI 3;  5T50 A;  4I30 A;  1GQH A;  1IQA A;  2RE9 A;  4JGZ B;  4Z92 B;  3IN9 A;  1MQT B;  4JQR A;  2CV6 A;  5JUV A;  4F3J A;  3LE0 A;  4I0B A;  3BCW A;  4FPC A;  4QX8 A;  1N3P A;  3O0W A;  2VU9 A;  3JQX A;  1CZS A;  5A3P A;  1AXZ A;  2JWP A;  3M7A A;  3AC0 A;  2FDK A;  1ZZB A;  1SAC A;  4YVW B;  2WNU B;  4LHL A;  1LGN A;  2Z5W A;  3HT2 A;  3MF6 A;  4Z2W A;  2AEY A;  4CU7 A;  1LOA A;  1LCL A;  1YIF A;  5C8C B;  1W6M B;  2DFC A;  1CPN A;  5C71 A;  4CCK A;  4HMZ A;  4R52 A;  2W39 A;  3A0N A;  1RHI 3;  1ZA4 A;  3GJB A;  4BIF A;  5F3I A;  4COU A;  5FZO B;  4QXK A;  1LTE A;  2BW8 A;  3CJI A;  3LEM A;  1CJD A;  2JD9 A;  3IDA A;  3LEI A;  5J3U A;  2OT7 A;  4NR1 A;  2RR1 3;  2CWS A;  1UYX A;  2XJV A;  2OS2 A;  1ULF A;  4Q4W 1;  5F32 A;  4FCA A;  3T4H B;  3WP3 A;  1D4M 3;  2VL4 A;  3W58 A;  1AR6 2;  3WCR A;  4D69 A;  2WT0 A;  3R6S A;  1U5Y A;  4XMI A;  4D94 A;  1UZV A;  1V6J A;  4MVT A;  3I3M A;  2ZGS A;  2OUJ A;  3R4S A;  1IOA A;  3IDB B;  3OTF A;  1BJQ A;  1D0G A;  3RJR A;  1F15 A;  4NN0 A;  3ZSK A;  5FMD A;  3SQO A;  2HWF 1;  5JIA A;  1RUD 1;  1DBN A;  2VH9 A;  4XAA A;  2V09 A;  5CFC B;  3V0B B;  4CP2 A;  1VBE 2;  2XLF A;  4NHL A;  2FDJ A;  4Y26 A;  4XBQ A;  4ZY9 A;  3ELN A;  5IK4 A;  1RIT A;  2LRO A;  3AMH A;  5LBF A;  1U5X A;  3F2Z A;  4NHX A;  1J58 A;  1W0P A;  5GAL A;  1XNB A;  5JR7 B;  1NT0 A;  1ZZ9 A;  1DG6 A;  4YFZ A;  1JOJ A;  1RUH 2;  1V9U 3;  3ZMN A;  4LKS A;  5FY4 A;  3WF0 A;  3III A;  2JDZ A;  5FV3 A;  4N53 A;  4AVA A;  3VZK A;  1RED A;  2WZR 2;  5FUI A;  2Q8C A;  1WA6 X;  1XE8 A;  3DYM A;  4XPV A;  4XJ8 A;  3OSD A;  4YW2 A;  1XPW A;  5IK8 A;  2WAA A;  3KF5 A;  4FBF A;  4UWD A;  1LU1 A;  2H0V A;  2PLV 3;  1HKD A;  3DXU A;  4IE4 A;  2FCU A;  1MS8 A;  5EV7 A;  1BK0 A;  2ZX4 A;  3RSJ A;  1AXK A;  3A21 A;  4LIU A;  4AYU A;  2YBP A;  5FY1 A;  3WF3 A;  4QQH A;  2JE9 A;  3B93 A;  5A7N A;  1MZ6 A;  1JS9 A;  1PMI A;  3KSC A;  4HVR A;  3PVE A;  1AR7 3;  1YC6 1;  5EIY B;  3PUR A;  2AGS A;  2V5Y A;  3D8C A;  4U2A A;  2XQX A;  4BQ1 A;  1DQ0 A;  4NOT A;  3J7L A;  5LK5 A;  1V6N A;  2EAK A;  1HJG A;  1PNF A;  2ILM A;  5FZK A;  1EPZ A;  5GM0 A;  4BQ4 A;  3BIE A;  5HBA A;  5K8S A;  1QU0 A;  5T5P A;  1QMJ A;  3ILF A;  2PHR A;  2UY8 A;  3RWK X;  2JEN A;  2NYY A;  2GC1 A;  3WDX A;  2JDK A;  3ALQ A;  4GH4 C;  5FPU A;  2XJR A;  4LA3 A;  4A3Z A;  4MYE A;  2HWE 3;  4O9E A;  1C1F A;  5GZD A;  2QQN A;  5IVY A;  1DQ5 A;  5FP8 A;  1HRI 1;  2VJX A;  3RDI A;  2B8M A;  5FYT A;  4GIQ A;  2RDN A;  3EHK A;  3FHI B;  1O8P A;  1PMJ X;  4CDU A;  4UFJ A;  4K9S A;  3VBO A;  1GQP A;  1JBC A;  3IDC B;  1RUJ 2;  3AM2 A;  1JUH A;  2O0O A;  4UFK A;  3T0B A;  4YZ1 A;  1VPH A;  4NUB A;  4D7Y A;  3GHM A;  1CPM A;  3VBU B;  4TZD A;  4ASL A;  5IFP A;  4ZZ8 A;  2K2S A;  2Y33 A;  2JD4 A;  4CU6 A;  1N1S A;  5LA9 A;  1RL3 A;  2PHD A;  4CDW A;  4UFH A;  1AX2 A;  1FOD 2;  2WNE A;  1RHI 1;  4XEZ A;  1UY2 A;  2DVB A;  1ULC A;  3EBR A;  4K40 A;  4CUC A;  4GB3 3;  3ZFG A;  3QCW A;  1RUF 3;  1RJ8 A;  4YM2 A;  1J83 A;  4E8C A;  1JZ2 A;  1PGL 2;  1DDL A;  4XHB A;  5FZI A;  4CU8 A;  1H6Y A;  4KG8 A;  3ZM8 A;  2HWB 3;  4OLL A;  3H8R A;  2RR1 1;  4LJH A;  2MEV 3;  3D82 A;  3P6B A;  5J37 A;  5HXM A;  4XDO A;  1UU5 A;  2JB4 A;  2X5I B;  5JDB A;  5FYB A;  1D4M 1;  1J59 A;  1JYI A;  1H0B A;  3FBY A;  3HT1 A;  1NQJ A;  4AL9 A;  5T54 A;  5ISL A;  2WFP A;  4QM8 A;  2EAA A;  3RZM A;  5JWP A;  1JTZ X;  2J1S A;  2KXL A;  1FI2 A;  4QX0 A;  2AUY A;  1WA4 A;  2BER A;  3RNS A;  1S4C A;  2P4E A;  1OD5 A;  1CX4 A;  1W8H A;  4LE3 A;  4TXW A;  2VD7 A;  5AC9 2;  1HV1 A;  4IER A;  4K1Z A;  5FPA A;  4R9B A;  1LHN A;  4N53 C;  3N7K A;  4BQY A;  1O3Q A;  3VKL A;  2IFR A;  3AMP A;  3MV0 1;  1S0I A;  3CZU A;  4XFC A;  1WLC A;  1WME A;  2BWA A;  3AKS A;  5GLW A;  2RM2 2;  1LB2 A;  3THP A;  1OH4 A;  4E4S A;  5EYY A;  2B9U A;  4DY5 A;  1S0F A;  1Z78 A;  2WAB A;  3ZXK A;  3KLS A;  5EPA A;  4FTS A;  5IK5 A;  1NY7 1;  1V9U 1;  3MW4 A;  3Q8E A;  5DAQ A;  1HN1 A;  4Q4Y 3;  3BKZ A;  3B3Q E;  1PNG A;  3AP4 A;  2HEY F;  1DFQ A;  2RDR A;  1BEV 2;  1NA1 C;  1AR9 2;  4LOR A;  4P08 A;  4AED C;  4CCO A;  4IE5 A;  2Y0I A;  3AVS A;  4LE4 A;  2ZEZ A;  2PLV 1;  3J7M A;  4MGT A;  2WN3 A;  1Q8Q A;  1FNY A;  3POJ A;  5FXZ A;  5A32 B;  2VMH A;  5FZF A;  3POG A;  5H9Q A;  3RGB A;  2UWA A;  4LQR A;  4QX2 A;  1WCQ A;  4XCB A;  2R6Q A;  3U0Z A;  3FWE A;  1AR7 1;  1WMX A;  3IPV B;  2QQW A;  3ZR5 A;  2RDS A;  1GQG A;  5DG2 A;  4PLM A;  4LUK A;  3NV2 A;  4E8D A;  1W8N A;  3AYE A;  3OPZ A;  5DZG A;  3VBO C;  3DL3 A;  4FPE A;  2GSY A;  5DDJ 2;  2DU0 A;  4QB2 A;  1TQ5 A;  1W6O B;  4LOT A;  5LWB A;  3DXT A;  1KRI A;  1W2O A;  1O4T A;  4XF9 A;  4YZ3 A;  1FPN 2;  3VN4 A;  3LB9 A;  3ON7 A;  4FPG A;  2FMD A;  1QEX A;  5FZB A;  3WV6 A;  1FAY A;  2VZU A;  2BVB A;  2ZAH A;  2WNV A;  2HWE 1;  1HQN A;  5JXH A;  4AW7 A;  5FPV A;  1NYW A;  3NAP C;  3WNK A;  1RUI 3;  4M3C B;  1C28 A;  1B35 C;  1QQP 2;  4CDX A;  4CXW A;  3H1M A;  3H7Y A;  3INA A;  4XQD A;  3DEM A;  1OT5 A;  1MPX A;  4OQ9 A;  4BB3 A;  2XVL A;  3FUQ A;  4S2D A;  4GZ9 A;  1VBA 3;  2LUW A;  1UNB A;  4YLZ A;  5KC6 A;  4M0H A;  1Y9M A;  5KXE A;  2FD8 A;  4XF3 A;  3ZYP A;  1JUI A;  2PTM A;  2Q8O A;  4DUV A;  3TN9 2;  4RGG A;  4DEV A;  2VXJ A;  4YW1 A;  5A1L A;  5KR7 A;  2CYF A;  3LKJ A;  4QB6 A;  4X8N A;  4CEW C;  2DU1 A;  2E9Q A;  3GYD A;  3LA2 A;  2PEL A;  2VBB A;  5F3E A;  3VZM A;  3DN7 A;  3PUS A;  5ABJ B;  2IXK A;  4XZP A;  4DFS A;  3JXS A;  4QD2 A;  4XAE A;  4GB3 1;  1EP0 A;  1RUF 1;  3FLR A;  3WY6 A;  4N43 A;  1LEC A;  1S1A A;  1DYO A;  1DLC A;  5KHJ A;  1PO1 2;  4RR3 B;  1APN A;  2NM1 A;  3O1R A;  3SXW A;  1BBT 3;  2HWB 1;  5ACA 2;  3AMQ A;  2RS5 2;  4FPY A;  4K3U A;  3VBS C;  2MEV 1;  2FCT A;  1UZY A;  4D0Q A;  1CR7 A;  1ULE A;  3ZXJ A;  2V73 A;  3WLU A;  2WYF A;  2B42 B;  2DCY A;  4CU9 A;  2XJQ A;  1XND A;  4AZZ A;  3K4A A;  1OA2 A;  3GDB A;  1SBF A;  4LBJ A;  4IEV A;  1OSG A;  4WM7 B;  3OY8 A;  4PDW C;  1E5S A;  2V72 A;  5BNO B;  5CIS A;  2VZO A;  3HN3 A;  4JVA A;  3W59 A;  1SZB A;  2WC2 A;  2V5D A;  3HQU A;  3LWC A;  4LBL A;  2E63 A;  2EIB A;  4H3W A;  4PIY A;  4DXR A;  1W8U A;  4R9C A;  2VBP A;  3FLT A;  1I6X A;  2X29 A;  3M3C A;  3B9I A;  2DV9 A;  5DAP A;  4QPI C;  1W3X A;  2ZGO A;  3UES A;  5IVC A;  1MS4 A;  2A1X A;  3GCW A;  3J8F 2;  4NIA A;  4JX0 A;  1JYC A;  2IXJ A;  2ZX2 A;  3IBM A;  2WFF 2;  4W65 A;  5IAV A;  1ND3 C;  4GAZ A;  3OEA A;  1MS3 A;  2YFZ A;  1M06 G;  4D8M A;  4N7I A;  3LDK A;  3ACI A;  4Q4Y 1;  5FZ1 A;  3VDD B;  4L8Q A;  5CFD C;  4CEY C;  1G9C A;  5B4X A;  4JTN A;  1UQX A;  2VY0 A;  5FZ6 A;  1G6N A;  2DUP A;  2GC2 A;  4QB1 A;  4IUG A;  2E7A A;  3LGR A;  4QPW A;  4IEO A;  3MUY 1;  3JU9 A;  2JKX A;  1OLM A;  3VKM A;  1SFP A;  4YW4 A;  5IVV A;  4YM0 A;  1GNZ A;  1OPM A;  2AEN A;  5E6H A;  3M70 A;  1EV1 1;  4QWN A;  4WVZ A;  3VBH B;  1WGP A;  3D4K A;  1ND2 A;  2PHX A;  4EN9 B;  1O6U A;  2XWB B;  1AL2 2;  2QDN A;  1H9W A;  3U07 A;  3ZFE A;  1COV 2;  2QQU A;  2HJI A;  1TZO A;  2PYT A;  4M4R A;  3I59 B;  3MW3 A;  5DQ0 A;  4OI1 A;  3UET A;  2DTY A;  5JOW A;  4FTE A;  1PVX A;  3P1I A;  1LGC A;  4L99 A;  4NHM A;  5C6C A;  1HB3 A;  1OFN A;  5FFO C;  2VO5 A;  4Z1V A;  1W6N A;  2EIE A;  2WR9 A;  1UMI A;  2WQ8 A;  4WVV A;  5F5Q A;  3S0M A;  2YBS A;  4URA A;  1JYW A;  5LEK A;  4W4Z A;  4XQW A;  1PZ8 A;  4JGY C;  4UF0 B;  5LY2 A;  2PHF A;  3SHR A;  1W8Z A;  2R0F A;  3LF7 A;  4LEJ A;  5FP4 A;  1OKQ A;  2CGO A;  1D0H A;  1QJU 3;  1O3T A;  5C4W B;  1CZT A;  1RUI 1;  2FDF A;  2VVF A;  2QZ3 A;  1ZZ8 A;  2C4X A;  3I7D A;  3OYW A;  1ZBA 2;  2P34 A;  2OVU A;  3N4M A;  1ZYB A;  1W0O A;  4JHZ A;  3ZYI B;  2G1M A;  5K0U A;  3U10 A;  2JDU A;  5T55 A;  4AAX A;  4BQ2 A;  1U12 A;  4W6W A;  4CP9 A;  5HV4 A;  1VBA 1;  3KCC A;  3DKQ A;  3WT3 A;  3B69 A;  3VV1 A;  1R1A 2;  3KD4 A;  2AR6 A;  4N9I A;  4HAN A;  2JJ6 A;  1U5I A;  2GNM A;  1N3O A;  1Q3E A;  1SDW A;  1GWM A;  1PK6 A;  1D4V B;  3K3O A;  3USS A;  5A6Y A;  3JD7 2;  1IPJ A;  3VBF B;  1IG3 A;  5F7U A;  3OGS A;  1ZZC A;  5E16 A;  1N1T A;  1UF2 C;  1JYN A;  3QLQ A;  3AL5 A;  2VZV A;  3OUI A;  3VLB B;  1F5J A;  4HVO A;  1YQC A;  5F5I A;  5A7Q A;  5L9B A;  2XG3 A;  1SLC A;  3P3P A;  3NST A;  4GMP 0;  4OHV A;  5FY7 A;  3AYA A;  1GP5 A;  2A6V A;  1ENS A;  2O14 A;  4EV0 A;  3OCP A;  1BBT 1;  5F3C A;  3HBK A;  3ZN6 B;  4CCL A;  1VBD 2;  2WSV A;  4IV3 B;  3WQ7 A;  1NOV A;  4IE6 A;  1FV2 A;  1W2N A;  1Q5O A;  2JIJ A;  4ZU4 A;  5A7W B;  4DUX A;  5L7O A;  3HQR A;  1PGW 2;  2BQP A;  3RZG A;  5LBE A;  2KM2 A;  3T2P A;  3PME A;  2HEW F;  2H6C A;  3MIB A;  4P02 B;  1GOH A;  4GJY A;  3ZYH A;  4D7S A;  3I2H A;  4C0B A;  1H8T A;  1JZ4 A;  3NNL A;  2D40 A;  2R0H A;  3MLL A;  3AZW A;  4NO4 A;  5FKB A;  1BVV A;  2BNM A;  3T30 A;  3RI8 A;  2R04 2;  1H1A A;  5KHG A;  1WLD A;  2VOV A;  4S2G A;  1W9T A;  5FYI A;  1OPO A;  3M8L A;  1NZC A;  3UKV A;  3TBD A;  3U4X A;  4LTA A;  4KWU A;  2VQ0 A;  4LIT A;  1PZ7 A;  2WLQ A;  4IE0 A;  5A3O A;  3CDZ B;  3PNA A;  2ZXQ A;  1G8W A;  1C8M 3;  4YM1 A;  1UMZ A;  5LAT A;  2J22 A;  2JG8 B;  1ULO A;  1W2A X;  5FPB A;  1X9T A;  2CHH A;  3DYP A;  4UBH A;  5EP9 A;  1TME 1;  4WVM A;  3O12 A;  3E1F 1;  4BQW A;  5FPX A;  1LU2 A;  4PQ9 A;  4E9K A;  3VBR C;  3ZFE C;  3ZFF B;  5FBJ A;  5B4N A;  3RFR A;  5JOY A;  3CZJ A;  4XTP A;  1YHF A;  3I2K A;  1C57 A;  1J1T A;  3WSO A;  3AFG A;  3SEP A;  5CZK A;  1LKN A;  3RPQ A;  4UFL A;  5BY5 A;  4FXK B;  1OH3 A;  4XAB A;  1YJK A;  1CAV A;  1R09 2;  4JHT A;  5C70 A;  5FZ7 A;  4Y22 B;  1W04 A;  2E33 A;  3PL0 A;  3FUO A;  1H1M A;  4TWT A;  1DHK B;  1HIX A;  1OI6 A;  3O0V A;  3GBG A;  2XJS A;  5CEH A;  2YYO A;  2GC3 A;  1YO8 A;  3U1X A;  3ZSJ A;  3I97 A;  4XUP A;  2TUN A;  4I01 A;  4IV1 A;  3WNL A;  3ZSE A;  5JZG B;  2Y6H A;  2ZCW A;  2IXI A;  2XJP A;  1QXP A;  4UI9 L;  4QXB A;  3THC A;  5C3Q A;  5D8A B;  3I2I A;  2XXZ A;  4Q4X 2;  3WQ0 A;  1ZVF A;  2Y0O A;  3TEZ A;  2Z79 A;  1RJ7 A;  2VW1 A;  1UZZ A;  5IVJ A;  3HQX A;  3OPT A;  3UV9 A;  4I3G A;  2IC1 A;  2IVJ A;  1RGS A;  3H1Y A;  1HDK A;  4IEZ A;  2XJU A;  4RQP B;  4JAA A;  5DMY A;  2R16 A;  4QQO A;  5FXV A;  3FX3 A;  4Z8B A;  2B4K A;  2ZGR A;  3NJZ A;  2RJK A;  1WW5 A;  5FZE A;  1IS4 A;  2RV9 A;  4HPK B;  1JZ8 A;  3WCS A;  1LOF A;  3MO4 A;  1X82 A;  2P6C A;  4F7Z A;  2OA2 A;  2VW2 A;  2VQT A;  2D6L X;  4MZU A;  1WLT A;  1G9F A;  3C7H A;  4B29 A;  2NLR A;  1KXG A;  1CAU B;  4XVH A;  5DAB A;  2DBN A;  3RJ2 X;  2Q1F A;  2RMU 2;  4XFI A;  2DCT A;  3O1U A;  5JSP A;  2JKB A;  5DUX A;  5EXO A;  2ES3 A;  3E5U A;  4OVE A;  2R07 2;  3SIS A;  3FBM A;  1NAE A;  2LW8 A;  3JBG 2;  4E4D X;  1JW6 A;  1UW8 A;  1AR6 3;  4FPL A;  3EYP A;  4LHK A;  3GZE A;  4JGZ A;  1JHJ A;  3ETP A;  2FDG A;  3OD0 A;  4DO0 A;  5E1R A;  3LOI A;  1MQT A;  5CKM A;  3TNQ A;  3S30 A;  3WNX A;  4DEQ A;  3LSE A;  1W6P A;  3E6D A;  3HNB M;  4AVT A;  3BTZ A;  2X8K A;  1RVF 2;  4BME A;  3MHZ A;  1UY1 A;  4BM8 A;  4FFF A;  1O5U A;  5FUP A;  1SCR A;  5JSO A;  5EQU A;  3K2O A;  3N9O A;  2GAU A;  2WNU A;  4YVW A;  5HCB A;  2ZZQ A;  2YG0 A;  4WM8 B;  3FC0 A;  3T1M A;  2H0B A;  3ZDS A;  1AF9 A;  1EPW A;  5C8C A;  5IAT A;  2YXS A;  4WZF A;  5FZ9 A;  2DDU A;  3N9P A;  4PIZ A;  4AI9 A;  2PXJ A;  1UIK A;  5E8A A;  3I2D A;  3KMH A;  1YNA A;  1RUH 3;  2YC4 A;  3WD5 A;  4BQX A;  4GD4 A;  3BN6 A;  3OGR A;  3ZSL A;  5GZG A;  3RZZ A;  1SPP B;  1MVE A;  4TTG A;  4IES A;  1UMH A;  3S5Q A;  2WZR 3;  3C2U A;  4MGQ A;  3USU B;  5LRS A;  1JZ3 A;  3VZJ A;  2ZAB A;  5KC5 A;  3PLQ A;  1L7R A;  3WDU A;  1F8V A;  2KA3 A;  4XOG A;  3KHB A;  1YUD A;  1QH7 A;  4FQ4 A;  3O1P A;  1OXC A;  5BNN A;  2VW0 A;  5BNP A;  4YFW A;  2RJ2 A;  5B2G B;  2BP6 A;  3RZH A;  2B5H A;  2OZJ A;  1HRV 2;  1VMF A;  4KU8 A;  4NAO A;  2A3X A;  3GZT B;  3IMN A;  5I0U A;  1BKZ A;  1UX6 A;  4MET A;  1LAJ A;  5F2S A;  1SEF A;  4K21 A;  3MFA A;  1C8M 1;  5KHH A;  1GAN A;  1MS0 A;  4A6S A;  4CCE A;  3MZH A;  3KS7 A;  2Y6J A;  1GZT A;  2RS1 2;  4MV2 A;  3GM8 A;  2DF7 A;  4FPH A;  4BCU A;  4AOC A;  1UU6 A;  1OOP A;  3S6P A;  5CFC A;  2VMI A;  1S2K A;  3V0B A;  2HWD 2;  3AVR A;  3OG2 A;  4PQQ A;  4YVS B;  4A4A A;  2HWC 2;  4CPB A;  3KZ4 C;  3N9N A;  3J7H A;  2QBX A;  4XJ9 A;  3V64 A;  5L9V A;  4FOQ A;  4H55 A;  3H1W A;  1GUI A;  1V0A A;  5FCC A;  2MNG A;  4NHK A;  5T5J A;  3A0K A;  2QQP A;  3OB8 A;  3U78 A;  2WYS A;  2VTF A;  3CBN A;  3MEP A;  5DPN A;  1IKQ A;  1NCR C;  5JI7 A;  3OBZ A;  3WP6 A;  2ARA A;  1S0D A;  1CAX A;  4XFF A;  4HSL A;  4D6S A;  4QXH A;  4QXC A;  4AFM A;  5JLV A;  1ZBE 2;  3IIA A;  4UFI A;  4EE2 A;  4BQ5 A;  2PAM A;  1Z7S 2;  4PBP A;  3MPP G;  4MXV A;  4XBN A;  2WZP P;  1RUE 3;  2ZTN A;  2OII A;  1RUJ 3;  1PX3 A;  1YWK A;  5G05 L;  4G4F A;  4BPZ A;  5LCW L;  1JYX A;  3RZJ A;  5FP7 A;  3WUC A;  4BH9 A;  2VVE A;  4LBQ D;  4Q0U A;  1FYU A;  5DUU A;  3WDW A;  3O14 A;  4I3P A;  5LRR A;  2UWC A;  1CZV A;  1KFU L;  1UXX X;  2VQA A;  4B4Q A;  1DQ1 A;  1FOD 3;  1S2E A;  2JDP A;  4HSJ A;  4V2W A;  3MIC A;  2EXJ A;  4RFR B;  2Q0A A;  4O65 A;  3ASI A;  1VE0 A;  1QNY A;  3WHU A;  2ZPX A;  1OHF A;  4PT6 A;  2R49 A;  4XIL A;  4Y4Y A;  3WNM A;  1RUC 2;  3B01 A;  1PO2 2;  3BOW A;  3O1T A;  4C90 A;  1J3Q A;  1TNF A;  3NRU A;  5D21 A;  1XRU A;  2UYB A;  4TSV A;  2YMZ A;  4Q8K A;  4LO6 B;  2BOI A;  1AR6 1;  1OC1 A;  2DCJ A;  4OI0 A;  4NWW A;  2A71 A;  2KD7 A;  4OMD A;  2RG4 A;  1KD7 A;  2NQY A;  1REF A;  5JR2 A;  3POY A;  2JIG A;  4P9J A;  4MLO A;  4MAD A;  1CON A;  4JRL A;  5CU1 A;  5AC9 3;  1GOF A;  3L2Y A;  2XDV A;  3VBU A;  4XUR A;  3CKH A;  1UY4 A;  3O1V A;  2W5F A;  3E97 A;  5A3M A;  3WDV A;  3VHP A;  1QDO A;  4EWA A;  2WWU A;  5BNN C;  4XF1 A;  4OYU A;  3D5O A;  4FP2 A;  2JE8 A;  5C7G A;  1A78 A;  4QT6 A;  4ZXK A;  5F9T A;  5A6Q A;  3IMM A;  5SV8 A;  1SLL A;  1QJY 2;  1RUH 1;  2Z69 A;  4XFG A;  5GZE A;  3WHT A;  4BWO A;  3FL7 A;  3Q9O A;  3KF3 A;  1KJL A;  4YAR A;  2OPW A;  3WQB A;  4R9A A;  2G9Z A;  3VDC A;  3ROU A;  4AK3 A;  4EZ4 A;  1BEV 3;  5BUV A;  2WZR 1;  1JYT A;  1KDM A;  4Q1R A;  1V70 A;  2QQI A;  2X5I A;  3J4U H;  4A45 A;  5FR3 A;  4O9G A;  3IDE A;  5CA6 A;  1Q56 A;  3L9J T;  1D7P M;  1OMI A;  2IVI B;  4RS5 C;  1GU3 A;  3SKV A;  2GU9 A;  3UKN A;  2ZMK A;  3LPF A;  3BIW E;  2VPV A;  3VHO A;  1MR5 A;  4LLO A;  1GP4 A;  2YZ4 A;  4QKD A;  2VCC A;  4M01 A;  4RHV 2;  3BI3 A;  2A75 A;  3OBT A;  2CGP A;  2XKO A;  5L36 A;  2WT1 A;  3AXD A;  3MFC A;  1PX4 A;  3P5B A;  1LHO A;  4LBM A;  4DRR A;  5EJZ B;  1OA3 A;  3PIJ A;  3OGJ A;  1H2K A;  4DXT A;  3H7J A;  1WBF A;  5J96 B;  4QPG C;  3C7G A;  5DDJ 3;  3PUA A;  3IM0 A;  3ABZ A;  4HFS A;  2WRA A;  3OGV A;  1YQ8 A;  1WBL A;  5FYV A;  1WMF A;  1FPN 3;  5EFU A;  1DQ6 A;  1RMU 2;  5G04 L;  4XXA A;  1W0N A;  1QOT A;  2P1B A;  5CKN A;  3VDB A;  3HMY A;  2YGL A;  3H8X A;  5T5L A;  4BE3 A;  2R7E B;  4IDZ A;  3ZR6 A;  2GAL A;  2JDY A;  2VZS A;  1QQP 3;  5FY0 A;  1UYZ A;  5CG8 A;  4IND A;  2XBO 2;  5A3L A;  5FZ0 A;  4EZH A;  3SKJ E;  3TWI A;  1JZ6 A;  2A6W A;  1RUE 1;  1WZX A;  4UXA A;  1RUJ 1;  2ZJC A;  1P8J A;  5A32 A;  1LRH A;  1SLI A;  3ACG A;  3SEE A;  1NE6 A;  4MHR A;  3ZXA C;  2QZ2 A;  5AFE A;  5CAD A;  3W5M A;  5LEJ A;  5FDB A;  2WN2 A;  1JOD A;  2WS9 2;  5C3P A;  1T6B X;  2XOM A;  4CCN A;  3IPV A;  1AJK A;  5FXW A;  2BGO A;  1FOD 1;  3TEX A;  3H3Z A;  3UT0 A;  1CWP A;  1LOE A;  1I5Z A;  2VGD A;  3AJZ A;  2XJT A;  2J1E A;  4CUB A;  1W8O A;  1PGL 1;  2VCM A;  2FDH A;  1W6O A;  1WD3 A;  1SMV A;  2QVS B;  3CJI C;  3ES4 A;  4B4P A;  1PO1 3;  3NKG A;  4GKX A;  5F1R A;  2W94 A;  5DAW A;  4GH4 B;  5ACA 3;  1UN1 A;  2RS5 3;  4QU2 A;  2XL9 A;  5I8S A;  1E5I A;  3KVA A;  3IT8 A;  3DYO A;  3KGZ A;  5FZC A;  3K51 A;  2WWS A;  2ZBJ A;  5A3U A;  4AEM A;  3AYD A;  5A6Z A;  1VP6 A;  2VG9 A;  4YWA A;  4M3C A;  4J6G A;  4UFM A;  2LRP A;  3HVD A;  2EIC A;  2ORZ A;  3NVC A;  3OBR A;  1SBD A;  4Q26 A;  5FZM A;  2ZAA A;  4XDP A;  3H8U A;  3VZO A;  5J09 A;  2P6H A;  2R06 2;  1YFW A;  4BK5 A;  1G9D A;  1XYP A;  1WW7 A;  4RSU A;  3CIH A;  5AC9 1;  1UX7 A;  4LXL A;  4UYB A;  3JCI A;  3POS A;  1AX1 A;  3R4D B;  1VIW B;  4J1W A;  4NE9 A;  4GWJ A;  3GHN A;  2IWG B;  4LKF A;  4JTO A;  1GNH A;  5EJ1 B;  3ZDV A;  5HV0 A;  2W95 A;  1QIQ A;  2K46 A;  3SCG A;  1ENQ A;  3RQ0 A;  5ABJ A;  1O5L A;  3J8F 3;  2VZT A;  4JCK A;  5FYS A;  2PHL A;  4QHZ A;  2R1D A;  4HOO A;  4HG6 B;  2WFF 3;  3VZL A;  2C9A A;  1J1L A;  1JI6 A;  3RYR A;  2Q1M A;  3HN1 A;  3UK9 A;  4Q0S A;  2UWB A;  3I3D A;  4FFG A;  4RR3 A;  4NII A;  1ZA7 A;  3JB4 C;  4DS0 A;  1W6Q B;  4Y4R A;  5FWJ A;  3IWZ A;  1BEV 1;  2ARB A;  1AR9 1;  5FPZ A;  2C1F A;  4ZU7 A;  3HR9 A;  3GZA A;  2C5D A;  3WG1 A;  4KWK A;  2YPJ A;  4X6R B;  4LO7 A;  4XMA A;  4IXL A;  2OKX A;  4A41 A;  1AL0 G;  2SLI A;  3S57 A;  2YU2 A;  2DVD A;  2Q4S A;  1WMD A;  5FP3 A;  3BGA A;  4RGK A;  4WM7 A;  4UW6 A;  4I0A A;  5BNO A;  4W8J A;  2HBU A;  4GUL A;  1VLN A;  1PMH X;  3HIF A;  2W1U A;  1S2B A;  5A33 B;  3C8X A;  1N1V A;  2R32 A;  4I09 A;  4N53 B;  1BXH A;  3AK0 A;  1ULD A;  1AL2 3;  2RR1 2;  2ZGP A;  2BWC A;  4LUL A;  5AVP A;  3EJK A;  2D44 A;  3I2O A;  1X36 A;  1AX0 A;  1COV 3;  2XLA A;  4OFG A;  3POE A;  2RS3 2;  1D4M 2;  1F2N A;  5GZC A;  3O0X A;  2W0X A;  2H6B A;  3THD A;  4XC9 A;  4HKW A;  4K7J A;  1DYK A;  2WWJ A;  5DDJ 1;  1H8V A;  1POV 3;  2VAU A;  4YYO A;  1H4G A;  4LHS A;  1EV1 3;  2QFE A;  4QX5 A;  1UOG A;  4XCA A;  1FPN 1;  1H30 A;  5FZL A;  4CCJ A;  5JXG A;  5LZ6 A;  4AED B;  3VDD A;  1NA1 B;  4JV4 A;  4AE2 A;  4E27 A;  1TNR A;  2B9V A;  2VUL A;  2ZEX A;  5I0R A;  1PVC 2;  4Q1P A;  3BU0 A;  2J42 A;  4CDU C;  1QQP 1;  1W05 A;  3ZMO A;  1G9A A;  1K5M A;  2ZHM A;  4PBO A;  4QGM A;  3KV6 A;  1AZD A;  1ZBA 3;  4JQT A;  5LBB A;  1JU3 A; 
#chains in the Genus database with same CATH homology
 3AL6 A;  2OT7 A;  3UYJ A;  4V2W A;  5FY8 A;  5F3E A;  5A1F A;  5FZG A;  5FY9 A;  3PUS A;  2YU1 A;  5FZI A;  4CCN A;  2OS2 A;  5F32 A;  5FZA A;  4E4H A;  4Y3O A;  5FXW A;  4CUG A;  5F39 A;  3K3O A;  4GJZ A;  2Q8E A;  2Q8D A;  5A80 A;  3NJY A;  5FJH A;  4XDO A;  3AL5 A;  2OQ6 A;  5FYB A;  5FY5 A;  5F5I A;  5A7Q A;  2P5B A;  5FY7 A;  4DO0 A;  5ISL A;  4AAP A;  5F37 A;  5FYC A;  5FJK A;  5FYY A;  5FPL A;  2XUE A;  3KVA A;  5FYZ A;  5F3C A;  5FZC A;  4CCL A;  5LY1 A;  5FZH A;  2VD7 A;  5FUP A;  2XML A;  5FPA A;  3K2O A;  3N9O A;  4UF0 A;  5FZM A;  4LIV A;  5A7W B;  4Y33 A;  4XDP A;  5FZ4 A;  2XDV A;  4QU1 A;  3ZLI A;  5FZ9 A;  3N9P A;  3KV4 A;  5A3T A;  4AI9 A;  2OX0 A;  4GJY A;  4BU2 A;  2PXJ A;  4LXL A;  5FY4 A;  2GP5 A;  2WWU A;  3KVB A;  4BXF A;  5IVC A;  5FV3 A;  1VRB A;  4GD4 A;  2OQ7 A;  4IGP A;  2Q8C A;  4ASK A;  4CSW A;  5ANQ A;  5FYI A;  4BIS A;  4GAZ A;  5FYS A;  2GP3 A;  3N9Q A;  4LIT A;  3KV9 A;  3DXU A;  4HOO A;  5F3G A;  4CCO A;  4DIQ A;  5FZ1 A;  5K4L A;  4EZ4 A;  5A3N A;  3AVS A;  3PTR B;  5FWE A;  4LIU A;  5FPB A;  2YBP A;  5FY1 A;  4Y4R A;  5FXZ A;  5FWJ A;  5FZ6 A;  5FZ3 A;  5A7N A;  2YPD A;  2W2I A;  4V2V A;  5FZF A;  5F2S A;  5A7P A;  3KV5 A;  3PUR A;  5A7O A;  5FBJ A;  4IGO A;  5FXX A;  5IVV A;  2YU2 A;  5E6H A;  5FP3 A;  5FZK A;  4QWN A;  4TN7 A;  5FZO A;  5IVE A;  3AVR A;  5A7S A;  3N9M A;  3N9N A;  5A3W A;  3OPW A;  5FZ7 A;  5IVF A;  5FYM A;  5FPU A;  3U4S A;  3PDQ A;  5CEH A;  4QX7 A;  4D6R A;  3U78 A;  5LWB A;  3DXT A;  5FP9 A;  3PUA A;  5IVY A;  5IVB A;  5FP8 A;  3ZPO A;  5FYT A;  3PU8 A;  2YBK A;  4QXB A;  4QX8 A;  5FZD A;  5FYV A;  5FZB A;  2XXZ A;  4D6S A;  2WWJ A;  5A3P A;  4QXH A;  5FZ8 A;  4QXC A;  5IVJ A;  5IW0 A;  3OPT A;  2YBS A;  3LD8 A;  5FPV A;  3RVH A;  4URA A;  3K3N A;  4UF0 B;  5F5A A;  5IWF A;  4NUB A;  5LY2 A;  4HON A;  5FZL A;  4CCJ A;  3LDB A;  5FP4 A;  4D6Q A;  3PUQ A;  5FUN A;  5FXV A;  5FY0 A;  4CCK A;  5FZE A;  5FYU A;  4EYU A;  5FP7 A;  5FYH A;  5FZ0 A;  4EZH A;  5F3I A;  5A7W A;  4IGQ A;  5F5C A;  4CCM A;  5LW9 A;  3PU3 A;  4C8D A;  3KV6 A;  5FZO B;  3N9L A;  5F2W A;  5A1L A;  5KR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...