5FZFA

Crystal structure of the catalytic domain of human jarid1b in complex with mc3962
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
463
structure length
457
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGKIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Mc3962
rcsb
source organism Homo sapiens
total genus 147
structure length 457
sequence length 463
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzfA01
3AL5A 5FP3A 5FYTA 3ZLIA 5FXVA 3U78A 4CCLA 3U4SA 3PDQA 4LITA 5FYZA 5FZ7A 4QXCA 5FBJA 5CEHA 5F5AA 5A7WA 3LD8A 4CCNA 3DXUA 3KV4A 3AVSA 2OX0A 5F5IA 5FY8A 3OPWA 5F39A 4HONA 3UYJA 4IGOA 2GP5A 5A3WA 5LW9A 5FZCA 2OT7A 3KVBA 3KV6A 4EZ4A 5FPBA 5FZGA 2XMLA 2WWJA 5FPAA 4URAA 3N9MA 4DIQA 3PU3A 4UF0B 4Y3OA 5FYBA 5FZ8A 5FYUA 2PXJA 5F32A 4CCKA 4CCOA 5FZOA 4GJZA 5FUNA 5FY1A 5FPLA 5FY7A 5FYHA 4CCMA 4AI9A 2YBKA 4XDPA 4EZHA 2XDVA 4QX7A 5IVYA 2VD7A 2OQ6A 2GP3A 5E6HA 5FZEA 4BISA 3DXTA 5A7NA 5FJHA 3PUSA 5FY0A 5FZLA 4IGQA 2W2IA 3K3NA 2Q8CA 5A1LA 3N9OA 3NJYA 5FZ0A 4XDOA 2XXZA 3AVRA 3PUAA 4QXHA 5A1FA 3N9QA 4Y33A 5FZ6A 5FZ3A 5IVCA 3N9LA 4V2WA 5FZIA 5IVFA 3PUQA 5IVBA 2YU1A 4IGPA 5FP4A 4GAZA 5FZFA 3RVHA 3LDBA 5A7PA 5FP7A 4QX8A 5FZ4A 5FYCA 5LY2A 4ASKA 5FUPA 5F5CA 4CCJA 5ISLA 2OS2A 2P5BA 2YBSA 3KV5A 4HOOA 5FZ9A 5FV3A 4UF0A 5IW0A 4GJYA 2XUEA 5FP9A 5F2SA 2Q8DA 5LY1A 5A3PA 5ANQA 4BXFA 4CUGA 3K3OA 5FYYA 4TN7A 4BU2A 2Q8EA 5KR7A 3PURA 5FXZA 5FY5A 5FY9A 5FYIA 5FWEA 4QWNA 3AL6A 4D6QA 3ZPOA 3N9NA 5K4LA 3N9PA 3KV9A 3PTRB 5A7QA 5A80A 4C8DA 5F3EA 5FYSA 4D6SA 5A7WB 4LIUA 5IVJA 5FP8A 1VRBA 5FZDA 4QXBA 4D6RA 5A3TA 5A7OA 2OQ7A 4QU1A 5FWJA 5IVVA 5LWBA 5FZHA 5FPUA 5IWFA 5F3IA 5FPVA 2YPDA 4NUBA 5F2WA 5FZAA 5FY4A 5FXXA 5IVEA 2YBPA 4CSWA 5FYMA 4E4HA 5F3CA 4GD4A 4LXLA 5FXWA 4DO0A 5A3NA 4EYUA 4LIVA 2WWUA 5FZ1A 4Y4RA 5FYVA 3OPTA 3PU8A 5F3GA 5FZKA 5FZBA 4AAPA 5FZOB 4V2VA 3K2OA 2YU2A 5FZMA 3KVAA 5F37A 5FJKA 5A7SA
chains in the Genus database with same CATH superfamily
2JIJA 2JDYA 2RS12 2DUPA 4D8MA 1QQP3 2G9FA 1SFNA 3U4SA 1HV1A 4ZS3A 1APNA 2GC3A 1OQDA 5ABJA 1JZ8A 2IVIB 3ROUA 2HWC2 2AEYA 1JH5A 2Z2SB 1NUKA 2PHUA 2VZUA 1MS9A 2JE9A 1Q8QA 3WQ7A 1WLTA 2Q30A 1ZREA 1WCSA 5EXOA 2RJKA 3DXUA 4IW3A 1K5MA 1W0PA 3D6EA 3E5XA 3WZ1A 1O4ZA 2JB8A 2ZGMA 1LAJA 2V73A 3ZXKA 1GZCA 3KF5A 4XQ4A 2NMNA 3UYJA 2R7EB 4DXZA 3QACA 3T0BA 3EO6A 3M8LA 4YW1A 2FZ2A 1QJEA 3KWVA 1RUC1 3DYOA 5CVRA 3WUDA 2GH2A 2LW8A 4GWJA 4YVWA 3B9IA 4QT6A 3U75A 2J1VA 2WAOA 3H8RA 1LB2A 2WN3A 1F4HA 4OZOA 1UKRA 2QVSB 5DDJ3 4AFAA 1OOPC 1YQ6A 3ZO0B 4DB5A 1O3SA 1OVSA 2YXSA 2X29A 5GLWA 4QPGA 2XB6C 2WC2A 2JDMA 2VNGA 1W28A 4BQ5A 3ZFEA 3SXWA 1U5YA 4DRVA 4UI9L 4IXLA 5A33A 4XF3A 2DVDA 4BISA 2VOWA 3C2UA 3HQUA 4M3CF 2VMDA 2RDRA 2A6YA 2W08A 2FDFA 3JU9A 3THCA 1QOOA 1SLTA 3B5LB 3B94A 4CUAA 1ZRCA 2VECA 3UNPA 4AVAA 4CDWC 5ABJB 1MS0A 1YCIA 4GA9A 2CSGA 4AVVA 2P6HA 1W9WA 2P17A 3LB9A 4NR1A 4BLIA 2PHRA 5CFDA 1C8M3 3VKOA 3NV2A 3LDBA 5L19A 3T1LA 1K5MB 1R1A2 4DEVA 3H3UA 4B4RA 4UOJA 5GZDA 1FXZA 1HX6A 2VUJA 2EXKA 4FP3A 3SHRA 3IB3A 5FP9A 3S5QA 2VZ3A 3WG3A 4BDVB 4E2SA 5A3PA 3MIGA 1MS1A 1UL9A 3IDAA 5EJ1B 3INAA 1D4VB 1QHDA 2A1XA 5JIUA 2FMYA 2VMHA 1WKYA 4S2GA 2VY0A 1CAUA 2P2KA 2EXHA 3ZVXA 2Y6LA 4XFHA 2R042 4QPGB 2QQUA 4Z8BA 1US3A 4Q29A 2PYTA 2FDGA 5C4WC 1GFF2 5CA6A 4YG0A 4NRQA 4AAXA 4LA2A 1ULDA 2BYVE 4MXVA 1XPWA 3Q8CA 1XU2A 1W2NA 4WM8A 1QJFA 3LEMA 2QQLA 4RFRB 4CEYA 1QMJA 3IMMA 5EZWA 2C9AA 4XAEA 2VMGA 2ZKLA 1JXNA 2W1QA 4Y1VA 1WCKA 4J25A 2PA7A 2Q8OA 3WDYA 4I30A 1W6PA 2AGSA 2VZTA 4KH9A 5FZHA 3TOJA 4BYYA 1OD3A 4AI2A 5BY5A 3O1TA 3RS6A 3WF3A 5B4NA 3A23A 1OLME 5FO7B 3OBAA 5EP9A 1EY2A 3WINE 1R1A3 2CDOA 4E4SA 4JC1A 4ZS2A 4GD4A 1R092 5A3NA 1W8NA 1XE0A 3FHAA 3KT7A 3O7OA 3PTYA 2WFF2 1SLLA 2CL2A 2VR4A 1ND3B 1Z0HA 2WKKA 3K2OA 5FJKA 3JCIA 3FX3A 3VZKA 4DXSA 4UW6A 5CB7A 2WWSA 5FXVA 2BUKA 4XABA 1W8TA 1VBA1 1WMFA 5FLIA 4BQWA 2WT1A 4IEYA 4OZXA 4UAPA 4K7JA 1FV3A 4RN5A 4Z1VA 2CWSA 4QM8A 2JG8A 3RSJA 4I2OA 3PVOA 1X8MA 1YI9A 1RVF3 5EJ3A 4CCNA 5F7UA 2KR2A 4UXAA 1UF2C 2IZWA 4YM2A 4ASLA 4AEKA 2RDQA 1TVGA 4QPWA 1PMJX 3B7MA 4QHZA 2WSVA 4JQRA 4C1XA 3KD4A 3CNAA 3MW4A 5FKCA 3GZAA 4PBPA 4K21A 1JZ7A 4MADA 3RMXA 1PIV1 1S0FA 4YGEA 2WWJA 1LGCA 4CTEA 4CUCA 4IUGA 3T2TA 1O91A 3OUJA 4IEXA 1AZDA 1OLQA 2D3RA 1JZ5A 2UWCA 5F32A 3AKTA 3WNKA 2UWBA 2WFF3 1B35C 3HNMA 4Y1XA 4E9KA 1G8WA 3KM5A 1NZIA 1RHI1 4CDQC 2EALA 3WP4A 5CISA 3FC0A 2VZPA 1UPIA 3KT1A 3ZFFA 4Z92B 3N7KA 1YFYA 5FJHA 2VG9A 1A8DA 1AL21 4Q4V1 1OVPA 4WVVA 4AGGA 4FPCA 2P3JA 1T2XA 1G9FA 3NJYA 2RV9A 4M01A 3AVRA 5F6KA 4QXHA 4AVBA 5A1FA 1A34A 1HRV1 3A22A 1J83A 1X36A 2DURA 1PX3A 4I0BA 1G9CA 5H9PA 2VCBA 4KWLA 2ZGRA 3AB0A 3VKMA 1LODA 4ZU5A 2AR6A 1JYNA 2XVGA 4FO9A 4HG6B 2ARCA 2ZA9A 1SMVA 5F5CA 3AP5A 4CEWA 5G04L 4DRRA 2IC1A 5A1AA 5I0TA 3VDCA 2R071 2R0FA 1A3KA 4P5HA 3NAPA 4ET7A 4MVTA 2GC2A 4YGCA 1VRH3 2W68A 2Q8EA 1WCQA 4OI4A 3Q9OA 2VW0A 4LMFA 2YC4A 1UIKA 4YGDA 3RZHA 3JZVA 2GNMA 1V9U2 4Q0PA 4RS5B 1K3IA 3I3QA 4LHSA 4CPBD 4ZKTB 2HWB2 4P14A 3H7JA 3NVCA 2P3KA 2HKXA 3T3YA 2Z4FA 4HMZA 1VRBA 2ZS6B 4QB2A 3OUHA 1KXGA 4L9BA 4AR2A 1UX7A 2P6CA 2OA2A 5DAQA 4XILA 1WLDA 2HEYF 5FWJA 1JYWA 4Y1UA 2QQOA 5IFTA 1ULCA 3WVJA 3D82A 2ZGTA 5LK5A 5EV7A 1OFNA 2WA4A 4AG4A 1SCSA 5JVVA 4GZ9A 1ENRA 1COV1 3G6JB 4LIVA 4YW4A 1QJU2 1SZBA 2IFWA 3FBMA 1TME2 5FZKA 1MACA 1YFWA 1W6OA 1YLLA 4C90A 3TRSB 5F37A 4CEWB 4A2UA 3ACGA 5JPNB 1SQ4A 4LUKA 1E57A 1UD1A 4F7ZA 5KHGA 3WHUA 2BPA2 5J7MA 1C1LA 1OF4A 4CDXA 4Q4Y1 4HN0A 1LRHA 1VMHA 4IEZA 4AHXA 3QD6A 1V9U3 5TSWA 2Y34A 3PVEA 5I8SA 2HWB3 4QHBA 3M1HA 4C0HA 1UOBA 1F4AA 1POV3 5CNAA 3POGA 2XUMA 4URTA 3VL9A 3NSTA 4K6BA 3WY6A 5FRAA 1HB3A 2WQ4A 4A7KA 4TXWA 4KQ7A 2PELA 2CTVA 3B00A 1VP6A 3CJIA 4W8JA 4YPJA 2XMLA 5LA1A 2W0XA 4YW6A 3N3HA 3WNXA 3OSDA 4CDUA 1T6GC 4AL9A 3ENRA 4YM0A 1AUYA 5KC5A 3W5MA 4UFLA 1BLZA 2QQVA 5FUNA 3WF1A 2GDFA 1TMF3 3FLTA 3HPNA 1TME3 1W9TA 2RDSA 3I3BA 3KZ4C 4HT1T 2DTYA 4O7XA 5JUVA 3T0DA 2BRTA 2I74A 4EZHA 1SHWB 1MVEA 3LA2A 1RUC2 1XQNA 1V6OA 4M4RA 2CYFA 5L9VA 1NCQA 2VTXJ 1GZ9A 1PNGA 5FZ0A 2PAKA 1RGSA 3WDXA 1YEWA 4RHV1 4XF9A 2FHRA 3N9QA 3AKPA 3N9LA 4CDXB 1H1AA 1DDLA 3NV1A 4CZSA 5IVBA 1RJ7A 3VDDB 1ZZBA 2P3YA 2D6NA 2E33A 2RDNA 1YJLA 4V1PA 4QQ2A 4JDOA 5DZFA 2WABA 4QX2A 4LO4B 4CCJA 1PZ8A 2OS2A 4LJHA 5FZ9A 4YSFA 3I2HA 2A71A 2DCYA 4OUSA 4P00B 4QMAA 2OKXA 5IJRA 5LY1A 1PMIA 4Y22A 4HN1A 1ULEA 1IKQA 4PT6A 5K7PA 4N43C 4CDUB 2IVJA 4TLFA 3J8F1 4OYUA 5FYIA 1SACA 5FPXA 1F9KA 5F5QA 1DGWA 3IMNA 3AL6A 1VBC1 2RJ2A 3UGFA 2WO3A 3V65A 2DU1A 4C1WA 4WVWA 5G05L 5T5LA 2HWE1 4F3JA 4P9XA 4LBQD 2HWD3 5JWPA 5FP8A 3MF6A 1QQP1 3SKJE 1HRI3 5EIYB 2GU9A 1VBE3 3BOWA 1DIWA 3CZJA 3IDCB 2X5IC 1DQ4A 4YRDA 1QOTA 4Q0VA 4OFGA 3UJOA 4N53A 3ZYHA 2YPDA 4LBKA 1W39A 2PHWA 3SH5A 1J3RA 4KWUA 3M3QA 3VHOA 3FHIB 4P9YA 4WZCA 1H8TB 3MIHA 5CBLA 3C7OA 1VAKA 2JJ6A 5T5JA 4SLIA 2P37A 3RYKA 4AVSA 4MGIE 4WVMB 1OBNA 1J3PA 2J1AA 2JKBA 5FZ1A 3V56A 3VBRC 3W58A 4FOWA 2MHFA 3VDBA 3P6BA 4K3UA 5FTTC 1POV0 1ND2C 4ZHNA 5D8AA 3UT0A 4I3GA 3GCXA 5DDJ1 1Y4WA 4R9AA 4BJ0A 4CXWA 2XWBB 1IPJA 5J98B 1LTEA 4R8HA 4KGGA 2C4XA 5IFPA 5AC93 1X7NA 5DG1A 4CP9A 5CEHA 1GZTA 5JXIA 1F5JA 1DP0A 4IV1A 2DF7A 3V0AA 2IWGB 2QQWA 1NQDA 4JVAA 1JYVA 1W8WA 1PNFA 3H50A 4R9CA 3TN91 4YFZA 3OD0A 2GP5A 4NHKA 1JYXA 2Y60A 5EQUA 1S0DA 3WXPA 1VBA2 3AFGA 1PK6B 3CL1A 4H7LA 3SCGA 4XEZA 2R49A 4NOTA 2WINB 3UGGA 2D7FA 3S6PA 1C8M1 3WLUA 5FZOA 3OGJA 2VQ0A 5L9RA 3T0AA 4XJUA 4DXRA 3ZFGC 4BQXA 5BNNC 3BU0A 1YIPA 3O1RA 3OGVA 5FQ0B 5JR7B 3EMRA 4LKDA 2VD7A 3HNBM 3E6CC 4B7KA 1PIV2 2JKXA 2Y33A 5JDBA 2QBXA 3ZKYA 1MZ5A 4FVVA 5C6CA 4IDZA 4P9JA 3SEPA 1Z78A 4CA9A 2DCTA 5L36A 5HPOA 5IUQA 4LHLA 3P3PA 1QIQA 1J84A 1N1VA 2RMU3 5DZGA 5FZ6A 5CAZA 1DYOA 2JWPA 3WQ1A 5C3PA 1RHI2 3MPPG 1A6CA 2IXLA 4NHMA 1JW6A 4AQSA 3U11A 4IV1B 2VULA 4QPIC 1W8FA 4WM7C 3VZLA 1DGRN 1JZ2A 4LBMA 3V0AB 1DQ2A 4FTBA 1AL22 1VBA3 4Q4V2 3PL0A 3I8TA 4ASKA 4NIGA 3F2ZA 2VAUA 2VMCA 2F4LA 4HOOA 3VBSA 4RR3A 4CVUA 2NMOA 3KCXA 5I93A 4XFBA 2O1QA 5BNOC 3AYCA 4NIAA 1CGPA 1QJX3 5FYYA 2VW2A 3ZXEA 5D21A 1R1A1 1R64A 5AVPA 5FLHA 1H8VA 1EYBA 1SLAA 3MW3A 3WV6A 1GP4A 1H6YA 3ZYJB 2VBBA 3KT4A 3NNMA 1RUJ3 5IVFA 4NIDA 3BU7A 2NQYA 1CAWA 1RITA 1H4HA 3K51A 4KGQA 3ES4A 3N9NA 2R072 4RQPA 3L9JT 4HFSA 5FO9B 2VTFA 3ELNA 5F3EA 3ETQA 4I02A 4WZFA 5KHHA 3VBUB 5IVJA 2EAKA 5K0UC 3AMHA 5L7OB 1UYYA 1IGOA 2D6KA 1Q8VA 3TYJA 1W06A 5FAXA 1RUE1 2ARBA 2CWMA 3ACLA 4JGZA 3VD7A 4D6RA 5A3TA 4GULA 5FIXA 1RVF1 4HPKA 4MGKE 5IWFA 5F3IA 1I3HA 3TBDA 3WNMA 4AFDA 5JZGB 1QEXA 3J7LA 3KF3A 4EN7B 5A6YA 1EUUA 1QGLA 4LBNA 4CSWA 2ZABA 3JB4C 3AZWA 5AFBA 2CGNA 1LHUA 1SBDA 3OGRA 1H1MA 2E32A 4XTMA 5CIRA 3ON7A 4DQAA 4ARXA 4OHZA 2QQPA 2GN3A 3U10A 1WLWA 2PHDA 3ZYBA 1T6BX 3VBSB 1PO12 2HEWF 3FJSA 3Q8AA 5FP3A 3B69A 1ALYA 3MICA 1XNTA 5F6LB 4EZ4A 3LPFA 3DF0A 3ZXFA 1N3OA 1COV2 3I97A 1EUTA 4H3WA 2EF6A 2JECA 2ZMNA 3LD8A 3NNGA 4YFWA 3S5AA 3MZHA 2FD8A 4B29A 4RGKA 4DS0A 1OOPA 1QNWA 1UZWA 2OX0A 1UY0A 4XJZA 2WN2A 3HMYA 3OBZA 4RQPB 3H9AA 4QU2A 1ZRFA 1PGL1 3B3QE 2ET1A 2XL7A 3AYAA 2KA3A 2BW8A 2TEPA 3KV6A 3BGAA 4Q4Y2 3DYMA 2WQ8A 3PVNA 2QKDA 4CE8A 4ATFA 2Y6FA 1V6JA 1CAVB 3I2GA 3WR0A 5T55A 5L9BA 3WNLA 3J7NA 4IE4A 3NWKA 2H6BA 5DPNA 2Z79A 1XRUA 4GJZA 2C24A 2LUWA 3WCRA 4CDWA 2BDRA 3POJA 5A3LA 2ZGUA 3SLIA 5JSRA 2PAMA 2XDVA 4MLOA 3LDRA 3NV4A 1L7RA 1PO13 2GP3A 4GB31 1G9AA 1LOGA 4XUTA 1BVP1 5FOJB 4YW7A 5FZLA 4AOCA 3E97A 1VRH1 4IGQA 1DLCA 2P1BA 3N9OA 1YFXA 1NCRC 4D69A 2CNAA 4FPHA 5LK7B 2K46A 4NRPA 1UKGA 1X50A 2SBAA 3CDZB 3VBFB 5JCTA 3S57A 2ZMLA 1AHSA 1XJAA 4N7UA 1GWLA 1C4RA 2WNUC 2XGXA 2NM1A 4HKLA 3AZXA 4UW3A 2OVUA 1OF3A 4NHXA 4CCCA 3PLQA 4C91A 5FZ4A 4JGYC 4TTGA 1BCXA 3N7LA 1I6XA 1AR61 4MXWA 1LKNA 5C4WA 4BZ4A 4RHV2 2ERFA 3KV5A 4NIHA 2XHNA 5A6ZA 5KC6A 5CKQA 3NW4A 5CADA 3NL1A 1O3TA 2ADEA 3C3VA 4EN8B 2QZ3A 5FXZA 2EXJA 2EIEA 1VIWB 2BBVA 2A5ZA 1H4GA 1HN1A 4QWNA 3I2KA 4I3PA 4NPLA 2JB4A 3NNLA 3ZPOA 3VZJA 2JE8A 3HQXA 5EYYA 1S0IA 2C6SA 4FPFA 1D4M3 4Y1ZA 4ZONA 5A7WB 3ACHA 1S0GA 2XJTA 4GH4B 1D0GA 3RG0A 3T1MA 3AJZA 1W3XA 4MGTA 1GLHA 3J8F2 4LLFA 5LWBA 2ZGKA 2ZGLA 3JD73 1RUH1 1W9FA 1URXA 3T30A 2EAAA 4XOGA 3NKTA 2HWE2 2VTXA 4DY3A 1HB2A 1KEXA 1VBB3 2VZ1A 1Y9MA 2Y6KA 4K8FA 5EWSA 3FE5A 1UMIA 2WWUA 3UETA 1JUIA 1AX1A 4SBVA 5DAVA 3VBOC 3E5QA 5IAXA 1J58A 3AK0A 4BXSV 5C4WB 3K4ZA 1UO9A 3MEPA 4LO5B 4BMBA 2B8MA 3ATGA 1PVXA 3VBHC 1PMHX 2VZSA 4UBHA 3S7IA 1SFPA 3E6BA 1TMF1 2WQZC 2YUEA 2JIGA 4QX5A 1KFUL 1ZBA1 4NMIA 1W6NB 2BWAA 2E31A 2EIDA 3LPGA 3BTYA 2HBTA 4LTAA 4MSVA 4CP1A 5JOYA 2D44A 3UESA 1YIFA 2FDKA 5J96B 2RS52 4HONA 1Y43B 2LS6A 1B35A 5DDJ2 3MUY1 4MX3A 1CWPA 4KBBA 2G9ZA 4CDQA 1RTVA 1W2OA 4O65A 4I09A 3ZXLA 3I49A 1AR83 4LO6B 4QGNA 3KSCA 3GHNA 2XLAA 4DUWA 2BGPA 3CQOA 2KM2A 1BBT1 4R4ZA 3FMGA 1HB1A 3IM0A 4UF0B 4Y3OA 4CCOA 5J09A 2DBIA 2D98A 3TN92 5FY1A 3TNQA 3TEZA 1QH6A 3T2QA 4FPGA 3WG4A 3OF1A 1GR3A 5T5OA 1N1YA 1UIJA 4YG6A 3TAYA 1S55A 4D7SA 3FWEA 3IDEA 1GICA 2BBAA 1O4TA 2A75A 2ZEZA 3BB6A 3UKTA 3L2HA 4COZA 2FCTA 1YYNA 4Z2AA 3K3NA 5A1LA 1C8M2 5HCFA 4OUEA 4TWTA 4E8CA 5FDBA 1C28A 4OCTA 1ZZ8A 1AL0G 5FZ3A 1V70A 1OUXA 1OXCA 3JXSA 1ULGA 3GHMA 2MPFA 2DCKA 2VNOA 3SC7X 2VZRA 2RS53 4NVPA 2EA7A 4FQ4A 2HWD1 4OHVA 1GQGA 2GH8A 1HRI1 5C8CB 1VBE1 3SEEA 4KWKA 3K46A 3POIA 1UOGA 2QFEA 2WJSA 4QX1A 5FV3A 1LHNA 4IEVA 1V6LA 2RVAA 4CDQB 3OD4A 2XPJA 3D3AA 1VJ2A 1GQHA 1DYPA 1FI2A 2K9ZA 2R32A 3TN93 2KXLA 3DV8A 2ZPXA 2A3XA 2XVLA 3LIGA 4XZUG 5BNPC 1UMHA 3AZVA 2QQJA 1YI7A 2PQSA 4YGBA 2JG9C 5FPZA 4YZ1A 4UFHA 4OUMA 2QZ2A 2J1TA 2ATFA 1BYHA 2IXCA 2R30A 1UY3A 4PQQA 1AR93 4UFIA 4D6QA 4FTEA 1LECA 2WSUA 3AMNA 5C3SA 1C5IA 1KITA 2VVEA 2VL4A 3F95A 4EN6B 2HYXA 5FYSA 1WA6X 3Q8EA 4BIOA 1TZOA 4LIUA 2D6PA 3LQCA 4PLOA 2VM9A 2VE1A 1LU1A 3BTAA 4M0NA 1LU2A 4Q4W2 5AC91 4ITCA 1BJQA 1NOVA 2FBEA 3TEXA 2OQ7A 2G19A 3ILRA 1YHFA 4OLLA 5C33A 1GNHA 3N7JA 1MR5A 1L3JA 1CJDA 3POBA 3U14A 3VHPA 3WG1A 5FPVA 1R081 4AWDA 4XUPA 1NA1C 3A4UA 1Q8SA 2VMFA 4YVWB 1FV2A 3S30A 4DO0A 1UY1A 5I0DA 1UZYA 1JYTA 3MV11 5C71A 4PIZA 2V09A 3CLPA 3D4KA 4OMDA 5FYVA 4L11A 4LBOA 4PDWC 1RUE2 4N8MA 4LE3A 1O7FA 4YZ4A 1K45A 1WWYA 3A0KA 3K75B 3KVAA 3VHNA 3ZFEB 3H8OA 2FDHA 1RVF2 4JRAA 5SV5A 1G9BA 3AC0A 5A33B 4JKMA 1LHVA 1MQTC 3M3CA 1AJOA 4QXCA 1KQRA 2CV6A 1RUOA 2VC9A 1F15A 2WZ8A 5ACA3 5LZ6A 1M4WA 4ORFA 3V64A 1W2UA 1UNBA 4A44A 1YQ2A 2VZQA 4JQTA 3AVSA 4C0BA 4NROA 5F39A 2J42A 4FBFA 5KHIA 2Y26A 4N9HA 4Q4W3 4LE4A 5CFDB 2R6QA 5D1IA 1GWKA 4LO8A 2RMU1 4YG3A 4W50A 1W8OA 4IE7A 3R6SA 4K1ZA 4AFMA 4Q0QA 2V4VA 2QCSB 2WLPA 2UU8A 1AYN3 3NJVA 4E27A 4QKFA 1AJKA 4UFMA 2E6VA 3HWJA 1PGL2 1RUE3 2E7AA 4NPMA 3RGBA 1OPMA 2YBKA 3AP4A 1CAXA 5T50A 1CN1A 3H1MA 3IPVA 1K5JA 1MZEA 1CAUB 2DFBA 4XBLA 5C9AC 4YVSC 1C1FA 2QDRA 1KDKA 3KS7A 4FCAA 1QJX1 4B3NA 3PUIA 1UOFA 4UFKA 3H3ZA 4GWMA 1D0HA 3JUUA 1RUD3 4EN0A 4WM8B 4Y33A 5FMBA 4CEYB 1OPOA 1RUJ1 1HJGA 4FI9A 4N43A 2WYFA 4GB32 3AMQA 4UFJA 2XQXA 1X9PA 3J7MA 1W6PB 4K9SA 2AENA 1VRH2 2ZEWA 4Q26A 3BN6A 5CKNA 5ISLA 4Y4YA 1K42A 2SLIA 1YQ8A 4PJYA 5CKMA 4LEJA 5E89A 3PJYA 4KG8A 3MYXA 2VMIA 2VW1A 3R4SA 4LK7A 1LEMA 5EFUA 5I8YA 3WF2A 4TN7A 1STMA 5EHDA 3M3IA 1S2EA 1QXPA 4OQ8A 5FY9A 2X5IA 1L7LA 4YLZA 2FZ1A 2PHTA 4CXYA 4Y5TA 3W9AA 1AR62 1W6QA 3N9PA 3PTRB 1ENSA 2JG8B 1CAXB 2ZHLA 2Y6JA 2XKOA 1S0CA 4BH9A 1GMMA 3RPQA 2DWRA 4IERA 1G9DA 2IXHA 4XE9A 1X9TA 3VBRA 2UURA 4MZUA 1IG3A 1GP5A 2Q0AA 4EE2A 1RUI1 1ND2A 3POWA 1WGPA 1MS3A 4GB33 1LJ7A 1UZVA 1IQDC 1NZCA 3CEWA 1OFSA 3NMBA 2D6MA 4Q27A 4XJ8A 5IVEA 5FYMA 2KD7A 1LOFC 4BWOA 5C5TA 3UKNA 4YWAA 3OPTA 5C8WA 1ZRIA 2XHKA 1Y7BA 4IV3A 1KD7A 4AE2A 1RUH2 5FYTA 2XG3A 1NY71 3AYEA 4XF0A 3ZFFB 4YW5A 1GSLA 5C7GA 1AR63 4AGVA 2X5IB 2F17A 2PHFA 1JBCA 1QY4A 4OMCA 3RZMA 2QQKA 1BVVA 2B42B 1PO11 3BIEA 2WT2A 5FY8A 1UYZA 2WLQA 5FOBB 5T54A 2N7GA 2PHXA 1OQ1A 1ST8A 3HEIA 3ORJA 3WW1A 3BKZA 3ZFGA 2WNOA 5BNNA 4ONUA 1WBFA 1W3VA 3M3EA 3NO8A 5FPBA 2G1MA 2GALA 3FBYA 3ZDVA 1TMF2 4XFFA 1I9RA 3DYPA 5JAXA 1ZBA2 4GMP3 3KGLA 1YFUA 2G4IA 2W47A 3QH6A 3BUCA 4A6OA 1O6UA 1RB8G 1XNAA 2FDIA 5JLVA 1ND2B 4LT5A 1G86A 3CHXA 3C7EA 4HKWA 5FZ8A 3A0NA 4AHWA 4OHXA 2ZKNA 3NAPB 1OQEA 1NG0A 2R0HA 4NE9A 4FT8A 3RZGA 2GAUA 1ZM1A 4NAMA 4DFSA 1RUH3 1KS5A 2ETEA 4QPIA 3E1F1 1SPPA 4FPKA 4WM7A 3RRDA 4P5YA 4LLOA 4XUQA 5A7NA 3GXUA 3WUCA 4CCEA 4IV3B 1O3RA 5GJ6A 1JOJA 2Q8CA 4AFBA 4JHTA 1BBT2 3ASIA 1BMV1 1J3QA 1GZWA 1W0NA 1ND3C 3KB5A 2XJRA 2ZZQA 1JTZX 4HK9A 5I0SA 5BYNA 5BNOA 4IESA 4X8PA 1W9YA 1WMDA 2YU1A 1W04A 3E6DA 1WUVA 4COUA 3WP6A 2AACA 3DECA 1D4M1 2XJQA 3LA3A 3THPA 3USUA 3GJBA 5KWRA 5JOWA 1TNFA 2Y64A 3LEIA 2LRPA 2YBSA 1TNRA 5HI0A 1ZBA3 2DCZA 1N1SA 1UX6A 4DUVA 3LDKA 3WDUA 3JD71 3ZYFA 2ZGPA 1H30A 2A3YA 4LOSA 5K0UA 1FOD3 5J3UA 4DZGA 1CIWA 1DU3D 1RUG3 1W6OB 2EVXA 2O8QA 4HVOA 3OJBA 4MOAA 5LA2A 4QPYA 3PIGA 1VE0A 1OA3A 1VBB1 2DU0A 2PTMA 4FFHA 5E88A 2HWD2 3HT1A 5JXGA 1V6KA 3O0XA 2A7AA 1DHKB 3SCHA 3EHKA 1V6MA 1HRI2 2ZJCA 4K40A 1VBE2 1LOBA 5HBAA 2HJIA 3I59A 5DUVA 1I5ZA 1UU4A 5A80A 2ET7A 3I2DA 3NNFA 4BM8A 2E7TA 2YGLA 4BQ1A 1BBT3 2DV9A 2D3SA 4QPIB 5FZDA 2ZX4A 4WM7B 1UPSA 4H7MA 1H2NA 2TUNA 1FATA 2WNVC 1GZWB 3WP3A 4TLGA 1PM7A 1QKQA 2P34A 5GALA 3THDA 2IUWA 2VOKA 3T08A 3U1XA 2ZAAA 3KLSA 4KG0A 4NUBA 3ZSJA 4CCDA 1ULPA 3CJIB 5FY4A 4MGZE 1XSRA 3ETPA 2VVDA 1FNYA 1ZX5A 2VJXA 2Q5TA 3USUB 1MZFA 1VR3A 2BNNA 5AC92 3ILNA 3OTFA 1S2BA 4PLMA 1LHOA 4RA0A 2C0ZA 3RWNA 1AR81 2IFRA 1V6NA 2QTWB 4ES8A 3FUQA 4YZ3A 3AL5A 1A78A 1KS4A 2C26A 4ASMB 2GMMA 1QDCA 2OZ6A 3U78A 1R082 2E7QA 4GWIA 5CU1A 5LEKA 1H1IA 5FYZA 2NP0A 1ASJ3 2DFCA 1XNDA 2V72A 2WS93 3RI8A 3ZSEA 3WSOA 5F5AA 3OBTA 1NCQB 4OI1A 3MDPA 2ZXQA 2H6CA 2D97A 3AYDA 1H6XA 3O12A 1HJFA 4OULA 2WL1A 3GZUC 5C3RA 3OPZA 2RS33 2JDPA 4P9WA 1BKZA 3ZMNA 4CU6A 3LEKA 5FREA 2GZWA 3OCPA 4RS5C 4L92A 4CPBA 1DBNA 3AKSA 1QU0A 4FFGA 1VMJA 2BNOA 4AI1A 4COWA 4PF5A 3HR9A 4BIFA 3IBMA 3O1VA 2RS51 5JXHA 4LKEA 1X8EA 2XOMA 3EB7A 5FYUA 1NCRA 4O9EA 5IATA 1HQLA 4Y22B 1U12A 2D93A 1XXNA 2W46A 4DPNA 5LRSA 4AI9A 4DXTA 2BOIA 1R1ZA 1RUF3 1Y9GA 2WNUA 2RMU2 1UWWA 1W9SA 2WNEA 1Q8OA 2JDAA 1R083 4R52A 1IPKA 4JGYA 1H9WA 1NLQA 5FY0A 2XLGA 5APAA 2W2IA 1OUSA 3ZYIB 1POQA 4IE0A 4RFT0 1ZZ6A 3W20A 4D3WA 4CEWC 1Z7S3 2GMEA 4V2WA 5FZIA 4QB6A 3WNPA 1BK0A 3MBWA 1AR91 3POEA 4ZXKA 4O9GA 3O0WA 1JU4A 3RVHA 1W05A 1WBLA 3AP6A 3DKWA 3A7QA 3MO4A 3N7MA 1OI6A 1HKDA 4N53B 2NYYA 2K0GA 1QJX2 4DINB 2BU9A 1FPN3 2XVKA 1VB2A 4Q5OA 1HV0A 2W5FA 4XUNA 5A32A 1FYUA 2D5FA 2P5BA 4F8AA 5IW0A 1JYCA 2Z42A 1CPNA 2XUEA 3O1OA 4G4FA 2F6BA 1UYXA 3AP9A 1RUJ2 2W1WA 2XJSA 2PFWA 3PHMA 5B2GB 3PVBB 3K3OA 3NV3A 2TBVA 4R9BA 3OEBA 5D8AB 4AK3A 4EQVA 4L97A 4WV8A 4JZRA 2A3WA 3POSA 3GALA 4Q2FA 5GLZA 5FO8B 1JMUB 3BPSA 3IKWA 4CP9B 3M3OA 2FMDA 5FUIA 1SG3A 5LCWL 3RZZA 4A45A 1US2A 4M4PA 4JGYB 1NLRA 3VBOA 1CX4A 3MW2A 3ZSLA 3O1MA 4Q8LA 4GIQA 2VNRA 4U2AA 5ACA1 5DMYA 5KBFA 2YDEA 3WG2A 1OHFA 4EV0A 3WOGA 1XBFA 1QXJA 5H9QA 3VBHA 5CFCC 2VZVA 3MHZA 4A3ZA 2HH9A 2A6WA 4CDXC 3JBG1 4EYUA 4Q4W1 1H2MA 2XQRA 4ZXEA 1D7PM 3RZKA 3IN9A 2HBUA 3BCWA 4BCUA 1NLSA 5F3GA 3VDDC 4P02B 5FZOB 1RUI2 2WDBA 4U36A 1V6IA 2BEOA 3R05A 3WF4A 3OEAA 4AQ6A 1NYWA 3GZEA 2O14A 4FPYA 4AYUA 4EROA 3M7AA 3NRUA 1M06G 1JUHA 3RQ0A 1AYN1 4CU9A 3JQXA 1NE6A 4A41A 3S0MA 5IT6A 4XFGA 3O5SA 1YC61 3HJRA 4LUMA 4HL0A 4FFIA 3LKJA 2DUQA 2JDHA 2ZX3A 1DZTA 5GZGA 1NQJA 2B9UA 3NNJA 1W99A 1N47A 2VCMA 3OYWA 1NY72 1UCXA 4IGOA 5A3WA 1PGW1 3VN4A 4YARA 1BK1A 4NHYA 4QX0A 1G6NA 3ITQA 4FFFA 3IIAA 4WVZA 1DQ0A 1AYM3 1RUD1 4A7YA 1ODMA 1W90A 2QJVA 2ZGSA 4MYEA 3FL7A 2BGCA 4LBQA 3N9MA 4RR3B 1A8MA 4DMIA 2BOJA 1O8PA 1OH4A 1OKOA 4NRMA 5J48A 5I91A 1NX9A 1GOFA 2CAVA 1RUI3 2E51A 5ERLA 5E6HA 1S2KA 4IEWA 3B9CA 1XE8A 1VBD1 1QH7A 1KGYA 1EV11 1H8TC 3R4UA 5FZEA 4DEQA 4MO3M 5A3UA 2E26A 3ZOIA 4Y5SA 2AEZA 1CAWB 2XBO3 1S0EA 2MEV3 2JX9A 1XYNA 2VGDA 2ZOEB 5JI7A 1JYIA 3GF6A 4UW5A 3KHCA 2LALA 5DUWA 1BXHA 2J7MA 3MIDA 1VPHA 2A6ZA 2ZX1A 4D7YA 3VKFC 3RZLA 3FHQA 4JGZB 4JHZA 2AUYA 2RG4A 4JDNA 5BNPA 4FXKB 4XACA 4YM1A 4B1LA 4Y24A 4HPKB 2JG9A 3I2FA 3OG2A 3EJKA 1WW6A 4UBGA 4HSLA 1BMV2 1WA4A 3T2PA 3H7YA 3GZTB 2L9LA 2DDUA 3ZXDA 2JDNA 2R1DA 1AXZA 1UN1A 1WCDJ 1PHMA 1O4YA 2G9GA 2GSYA 4COVA 4BU2A 1PK6C 4XJWA 1D4M2 3T2OA 4YNIA 5FWEA 5ANNA 2ZZJA 4PQ9A 3J9SA 3WQ0A 5LEJA 1PZ9A 5FLJA 4KWJA 1NA1A 2W91A 4QHOA 3JD72 4N9IA 1DZRA 3LWCA 4CP2A 1RL3A 1OOPB 1BZWA 2X09A 2LROA 4QXBA 4PDWA 1VBB2 2XWJB 3FLRA 3ST7A 3RI9A 4ZZ8A 4QU1A 3N4MA 3R0RA 3LGRA 5FKBA 3GNEA 1XC6A 4M3CE 3WQBA 3JQWA 4A3XA 4B7EA 1MQTA 4QKNA 3AMMA 4AEDC 1YXWA 1AX2A 3H3LA 4XETA 4OVEA 4UYBA 4W6XA 3ZN5A 4Q1RA 5J37A 2RR11 1OURA 1XB9A 1QJZA 4KI5M 3ZXJA 4ES9A 3GCWA 4CDWB 2K2SA 4GMP1 5LATA 4AGRA 4F83A 5HV4A 3BIWE 3I54A 1AR73 1O5LA 3GBWA 4PIYA 4LO7A 2WRAA 1CONA 5FZ7A 4EN9B 5LRRA 2JDZA 5FMDA 1CZSA 4BQ4A 3AKQA 4Y26A 3VKNA 2W1UA 1RMU3 4HANA 3ZPYA 3VL8A 2BVVA 1AR82 1E5SA 1QWRA 2XKPA 1IS5A 1DQ5A 1MEC1 4DNYA 2VMEA 4O61A 4I01A 3WF0A 3B01A 4NO4A 1Q43A 4Y5Z0 4QQHA 4XXAA 5KHKA 2VQUA 4B4PA 4J1WA 4LKSA 5C9AA 3ZR6A 1DGLA 3HT2A 4YVSA 3W59A 5L7OC 3VBUC 1LOCA 1W8UA 4MXWB 4R4XA 3LE0A 2WO7A 3WW4A 2Y6HA 3WDVA 1H2KA 1SDDB 4CCKA 4DIQA 1RINA 2GNDA 1PVC3 1JOBA 3IAQA 5H9SA 1HDKA 2J1EA 1WLCA 1WD3A 1D2SA 3I2IA 5FY7A 1UXZA 4J6GA 1MS8A 1F2NA 5JZGC 3BTXA 3UJQA 3CO2A 4QX7A 4A6SA 4YM3A 1EAH3 4DY5A 3KCYA 3BODA 2QQIA 3PMSA 1SFYA 4XXPA 2HLEA 3BALA 3RNSA 1ZRDA 1FOD1 3PIJA 5SV8A 1RUG1 1GOGA 1RC6A 2CGOA 4R9DA 4XDOA 2C9KA 2ARAA 3RYPA 4ATEA 1X33A 4HZFA 1SDWA 2ID4A 4LHNA 2IXIA 3VB9A 4XF4A 1WMEA 4H2AA 3ZSKA 5A6XA 3E5UA 2H0VA 2FDJA 3D0JA 2UYAA 4GWNA 1RIRA 1FX5A 1HLCA 2WZR1 2WO1A 1AF9A 2X10A 5A7PA 3USSA 3ZN4A 1UXXX 1W2AX 1YWKA 3IIIA 2ZTNA 1IQAA 3TEWA 4GJYA 4GALA 2CU5A 2Q8DA 1ULFA 2A73B 4QKDA 1BHGA 5KXDA 2XJVA 4RQPC 1XU1A 1AR92 4KNCA 1LGNA 3BYWA 2UYBA 3B93A 3LFIA 3ZX7A 4BK4A 4Q8KA 5FY5A 2D3PA 4G3YC 3EXUA 1YQCA 2VU9A 5DN2A 3WD5A 5GLTA 5T5PA 1IPSA 4M00A 5JIAA 1O8SA 2W87A 3WP5A 2ZGQA 1KFXL 2XH6A 1W6MA 1IOAA 1SLBA 2D40A 4I0AA 1LOFA 4D6SA 2O0OA 2CHHA 4JDMA 5BUVA 4I0WB 2JICA 2BZDA 2GN7A 1ASJ1 5I0RA 2WS91 4NPRA 3I3MA 5A7OA 2RHPA 4FTSA 3NKGA 1B35B 5FPUA 4CU7A 3H8XA 2I07B 2VXRA 1PO21 3T09A 3U37A 1HXS1 5F2WA 1C8NA 1PGSA 1Q8PA 5FZAA 1FNZA 5L73A 4HVRA 4E4HA 3QLQA 2A6VA 2RS31 3VKLA 3D8CA 2Z69A 4FOYA 3EQEA 3VBFC 3CF6E 3PU8A 1GBGA 1ZZ7A 3O14A 3GDBA 4JTOA 1SCRA 1Y9QA 4HXCA 5FZMA 4A42A 5ACA2 1D2QA 2CDPA 4JKKA 2WT0A 3LSEA 2ZGOA 2WZPP 3DCQA 3RJRA 2NPIA 3PDQA 1UW8A 2BGOA 5A3OA 4NWWA 2B46X 1LHWA 3JBG2 2W39A 5DAWA 1UOJA 2OPWA 1RUF1 4MHRA 1WCUA 2RS13 1GWMA 5F8PA 2ORXA 5F5IA 3I7DA 3RJ2X 4CRQA 1IS6A 1F31A 2HWC3 2ZHNA 2JDUA 1GYKA 1LGBA 1W6MB 2BNMA 3MGUA 3KVBA 1AYN2 2VPVA 3P5BA 1NT0A 3QOPA 1CX1A 5B4XA 2A6XA 1LR5A 5J36A 1Z7S1 4QGMA 5H9RA 1GNYA 4GXLA 1LOAA 4XFCA 4GH4C 3J26N 1CZTA 2HWF2 4QQLA 3DPRC 2A70A 1G7YA 2ARXA 3D5OA 1ND3A 1OMIA 5FPLA 1DGWX 2I45A 4DOUA 4OQ9A 1FPN1 1PGW2 4P9IA 4HSJA 4ISQA 4XDPA 1RUD2 2UY8A 1WW5A 2JXAA 3LA7A 1VAMA 5HCHA 1XOYA 3BTZA 2DTWA 4BQYA 5DABA 3PUSA 3V0BA 2YGMA 4P9GA 1REFA 1TEIA 3JBG3 3PUAA 2PQQA 3CU7A 4RSUA 3MLJA 4AXOA 5HCAA 1S0JA 1ZZ9A 1JU3A 1LCLA 2HEVF 4GAZA 2VOVA 1WMXA 4MGSA 1VBD2 1EV12 2WIIB 4M3CA 4S2HA 2DCJA 4QQPA 1SBEA 3H0OA 1YRZA 5JMOA 3FLPA 5T3NA 4AQTA 4BLJA 4LHKA 3U07A 4RD7A 3ZMOA 4FPLA 4A4AA 4HK8A 4E4DX 3K77A 1MS5A 1C57A 3W5NA 2HWF3 2Q1FA 3AX4A 4XW3A 1O5UA 2V5DA 1ENXA 2I2SA 3C7GA 4Q4X2 2GNBA 5BXXA 2VOXA 3HBKA 4LOTA 4FSJA 3GBGA 3P1IA 2WNVA 2ES3A 4KU8A 2F4PA 3HOBA 1N3QA 2CY6A 5A7QA 2R1BA 1UY2A 2NN8A 4UW4A 5CYYA 5KHJA 3M2MA 1UMZA 4CP0A 3HN1A 3KMHA 1DZQA 2R043 1IZ3A 2WZEA 4MV2A 5HCBA 2XJUA 3FZ3A 3LF7A 4META 3V0BB 5A6QA 4AHZA 2EICA 2C5DA 4BHPA 1SBFA 5LBEA 2Y6GA 1UY4A 2WUHA 4YZ5A 5C3QA 3BI3A 1CJPA 1IS3A 4IEUA 1VBD3 3VZOA 1EV13 3MI8A 2VCAA 2XONA 1UQXA 2B5HA 4TSVA 2YBPA 3RZJA 2UWAA 5F3CA 2R061 3ECQA 2H0BA 3SCFA 4LXLA 3UL2A 1OT5A 3POFA 5IK5A 4M3CB 2W95A 1AYM1 3ACFA 3FFQA 3OBRA 2ZMKA 1TE1B 3Q8FA 2BQPA 4Q4X3 4YYOA 4XTPA 3ZYPA 4E8DA 1R093 2BP6A 5LB6A 1O59A 1B09A 5C8CC 2O8OA 4FOQA 3IAPA 4HETA 3IPVB 1ZZCA 4LPLA 4RS5A 4CCLA 4FP2A 3UK9A 5IK4A 1CPMA 5EJZB 3PNAA 1AXKA 2EIGA 4AF9A 1OSGA 4P9LA 5CG8A 5BNQA 4LORA 2WNVB 2RR12 2QE3A 3DGTA 3K48A 1LOEA 4HLTA 1K12A 4N7IA 3MFCA 4IEPA 1TQ5A 4EWAA 1U5IA 3RFRA 2XBO1 4AEJA 4D0QA 3MF9A 2MEV1 2OT7A 3FFZA 4N43B 4MHUA 5ABJC 1EP0A 1OA2A 2ZGNA 3SQOA 4BK5A 4AW7A 2VOTA 2DVFA 4URAA 1DFQA 3VHRA 2PHLA 2VBPA 4IETA 2QQMA 1K5MC 4YW3A 5FYBA 5DXDA 3QH7A 1YJKA 5E8AA 5F9TA 1QJY2 4L0PA 1JHJA 3DL3A 4OI2A 4EJRA 1MEC2 1E5IA 1Q5OA 2WO2A 2Y8KA 3I3EA 1FT9A 5HV0A 3OUIA 3O1UA 4KMQA 5IVYA 3MV01 2OQ6A 2B45X 3KQRA 5FMCA 4E4ZA 2D6LX 4YVWC 4L99A 1F5FA 1KDMA 1W6QB 2VUDA 2ZACA 3D0SA 1ZBE1 4GQ7A 3JB8A 4QPGC 1S1AA 3CZUA 1P8JA 4RL7A 1OD5A 3IZOA 4ZU7A 3ZFEC 1NXD1 2RR13 3PUQA 4W65A 3VBRB 5DZEA 1O3QA 2UY9A 1EPZA 3NJZA 4PF1A 4IGPA 2W92A 3ZYRA 4NN0A 1MZ6A 3MLKA 2YG0A 4M0HA 5EPAA 1F8VA 4PCRA 4BE3A 4OHYA 1N3PA 1FOD2 2VZOA 2QUOA 1RUG2 1W8ZA 2QQNA 2ZEXA 3SNMA 4OHWA 3DEMA 2PLV2 4QX3A 2Q4SA 3ZN6A 1HQNA 2D5HA 3VDAA 1YNAA 2GMPA 4H14A 2W9XA 4D94A 5T52A 1VLNA 2ZX0A 5CFDC 1QJY3 1XYPA 1LEDA 1LENA 1J1LA 1REDA 4LR4A 1MEC3 2VQAA 2WZR2 1FAYA 3AFKA 4BB3A 1CD3G 5GZCA 3RWKX 5JSPA 3ALQA 3WDTA 5CG9A 4IEOA 3I2JA 1HB4A 3AXEA 3I4IA 3UKVA 3H8UA 3PJQA 2PN5A 1HW5A 1WW4A 3KV9A 2AREA 4INDA 4QDQA 5GZEA 4C8DA 5CFCA 2V5YA 1BQPA 1AR71 5E16A 3VD4A 3KCCA 2X53S 4S2DA 1U0AA 3VDDA 3ES1A 2OIIA 3KHBA 5DUUA 3LZZA 4XPVA 2TNFA 2YPJA 4IQPA 3POYA 3ZFGB 5BNNB 1RMU1 3I3DA 3SITA 1FMD1 1UZZA 1NKGA 3Q8BA 3BVCA 5FK8A 2ZEYA 4AQ2A 4WM8C 1WW7A 1Y3TA 4JCKA 2PLV3 4CEYC 2B39A 1CZVA 3CKHA 5F1RA 4FPEA 4XIOA 3U4XA 1ASJ2 1GKBA 4Y1YA 1H2LA 2WS92 2JD9A 5JOXA 1U5ZA 3HNYM 5I0UA 4MUVA 3VD3A 1MS4A 4FAGA 1JZ6A 3ZN6B 2FCUA 5IK7A 1QF3A 1UAIA 1PO22 1AXYA 1HXS2 4WBBA 2WZR3 1BEV1 4ISRA 1QJU3 4LITA 4BPZA 1PVC1 1SPPB 4K20A 2RS32 3BPZA 3WW3A 2XR4A 4LULA 1YUDA 3WEZA 4HVQA 4XURA 2YZ4A 3VGIA 3I2OA 2BV4A 1EAH1 3TWIA 1CIYA 2YROA 1J59A 1ULOA 1UU5A 2DYCA 2W52A 2YFZA 3KQ4B 4X6RB 2YMZA 3HQRA 4NIIA 5BNOB 5CFCB 1IHMA 3T4HB 5FFOC 1SEFA 4XIKA 4XHBA 4CYDA 3HBZA 5FZGA 1JS9A 1GANA 2FQPA 3VZMA 2OYZA 2EXIA 5DG2A 2JG8C 4AFCA 1ONAA 1H8TA 1W03A 2B7YA 2OUHA 3X29B 1RUF2 5IHRA 3MIEA 4WVMA 3T4VA 4W6WA 5J1XA 3PU3A 1OLMA 2RM21 4LNVA 5K8SA 3AM2A 2WYSA 2Q1MA 4XFIA 5GZFA 4E2GA 5K0UB 1JODA 4J1XA 4XDQA 3CIHA 4W6YA 2ZBJA 4CCMA 2ZHKA 5HXMA 4CU8A 3R4DB 1XSQA 1Z7S2 4GMP0 3LOBA 1LESA 1PO23 1OH3A 1QNYA 1HXS3 2P4EA 2WFPA 3LSDA 4B1MA 5LBFA 4XQWA 2XLFA 3DUIA 3CMGA 3I59B 3AP7A 1JI6A 2OPKA 4XMAA 4K8RB 4Y20A 1RUC3 5JMCA 1FPN2 5DQ0A 4NAOA 3ZM8A 5FP4A 5FZFA 1PK6A 1IKPA 1CR7A 1ENQA 3ZFFC 4JV4A 1GOHA 3HD8B 4ZPIA 2JEMA 4FAHA 3N36A 1VMFA 5FYCA 2OW4A 5KXBA 3QBQA 4XCBA 5FBZA 3FN9A 4B4QA 3GBFA 2GC1A 1OA4A 2NLRA 1J1TA 2DUOA 3OGGA 3CBNA 5LBCA 1AX0A 1RXFA 5ANQA 4CUGA 1PM4A 2WA3A 5BV6A 2VO5A 3H42B 1OKQA 1ZYBA 5FQ0A 3ZIWA 3H1WA 3TB0A 3VV1A 1DQ1A 5A3MA 5KXCA 1LULA 4BA6A 3ZR5A 4XJ9A 3NJXA 5DUXA 2BVBA 4QKBA 4GKXA 4L8QA 4LQRA 2BWCA 5K4LA 3THTA 4TYSA 4QGLA 3K4DA 2YFUA 4TZDA 3NAPC 2ZCWA 3PUHA 2QNKA 3ILFA 4AEDA 4LK6A 2JE7A 1N1TA 4QDRA 2YHJA 3LEGA 3PMEA 1QOSA 2VXJA 2HYKA 2VNVA 3AKRA 2B4KA 3CJXA 1ZRRA 1NAEA 2OXBA 4IV3C 4Y20B 1XE7A 2RS11 2AYHA 1GNZA 2DVAA 3AZZA 4JX0A 1WD4A 1MVQA 1XNKA 4XF1A 2HWC1 3ZKUA 2JDKA 1IS4A 3MPBA 5FXWA 1NCRB 1V0AA 1GU3A 2AZ5A 4EWDA 2ZAHA 3OGSA 2WR9A 3KGZA 2YB7A 3OB8A 3ZLIA 3AMPA 5JR2A 2WNUB 1XYOA 2V4AA 3K4AA 3RYRA 3WDWA 2R062 1QDOA 1E5HA 2B9VA 4LKFA 1H9PA 1RYYA 1L7QA 5DAPA 5GLVA 2OUJA 3VBUA 1GV9A 1HN0A 3VZNA 5L7OA 2MNGA 1AYM2 4G9SB 3KV4A 1GUIA 1V00A 2W3JA 5E1RA 5JPMB 3J4UH 3M4FA 1E5RA 4MG2A 4QXKA 3OPWA 4JAAA 2LTNA 1W0OA 1JHNA 5FZCA 3WHTA 1I1EA 5IK8A 3HIFA 3DN7A 5LA0A 5JZGA 3N35A 4AEDB 2DVBA 1VB4A 3B02A 4Z82A 3AJYA 2R16A 2VUAA 4AI8A 4EWEA 4FQZA 1AVBA 4RYDA 5FPAA 5A32B 1JZ3A 3ZXAC 5CZKA 4UT5A 4XHXA 4AVTA 2PXJA 1OC1A 2RE9A 4JKLA 2LM3A 3WX5A 5C3OA 4W4ZA 2XBO2 4PI0A 3APBA 2MEV2 5FYHA 4KBZA 3H1YA 1HRV2 4NHLA 1REEA 1HQWA 3CJIC 3O0VA 2ENRA 3P3NA 2XJPA 5A70A 1ZVFA 3DXTA 2HWF1 1S0BA 4IE6A 4CDUC 2GNTA 2Z5WA 4HKOA 1Q56A 1ODNA 2R063 4JTNA 5EYXA 2D6OX 4DUXA 2JENA 2XXZA 5FMOS 4XZPA 2J1RA 3GGLA 3J7HA 4QQOA 3OY8A 1PIV3 3GM8A 4L2NA 4PBOA 5C5UA 5IVCA 2YYOA 4GKYA 1ACCA 3UV9A 1JZ4A 4MH0E 4BQ3A 4IE5A 3LOIA 4XAAA 3VBOB 4OI0A 3NQHA 2BTVC 2EIBA 1ZA7A 2Y38A 2Y0OA 1PZ7A 2BJSA 2QDNA 5FP7A 5AFEA 2R041 5LY2A 1NCQC 1CAVA 1ZBE2 4QDSA 4RGAA 1Q3EA 3VBHB 1QXRA 4LBJA 1RHI3 5FK7A 4B8EA 1TG7A 5IYYA 1VALA 2BFUS 2VVFA 2PAEA 5F2SA 4ARYA 5I8TA 5BPXA 4ZY9A 4Z07A 1AL23 4Q4V3 4PIXA 4S2FA 3PURA 4IL7A 2XL9A 5JOZA 3M70A 4QM9A 2D43A 5JI9A 2J1SA 1HRV3 1CVNA 3HVDA 3ZSMA 3QCWA 2CAUA 3ZDSA 5FR3A 1CQ9A 1JOPA 4XBNA 3SKVA 2ZX2A 5FMOL 4Q4X1 3VD5A 4CXXA 1R091 3VD9A 2CGPA 3VBFA 1DGRA 5HXVA 5GLUA 2WFF1 2YC2A 4K1YA 5LA9A 3MLLA 1H0BA 4IEQA 3OYWB 4XYXA 3SH4A 2PMWB 2R073 4KL1A 4Z2WA 2IXKA 2X8KA 3W21A 5IVVA 4FPJA 1UU6A 4E2QA 4XJAA 3VLBB 4AZZA 1DLLA 3HN3A 3OY8B 1DCSA 3LCPA 1EPWA 1W2TA 1NE4A 3MIBA 2AH2A 5FXXA 1IG0A 4PHZA 2BFUL 1ZBE3 4XBQA 1AR72 1CESA 4HBNA 4Q0UA 3IDBB 4X6QB 4LBQB 4XUOA 2J22A 1RXGA 2P3IA 4Y4RA 5FZBA 5FCCA 1MPXA 2YU2A 4AI3A 4BMEA 3LFMA 4N53C 5A7SA 4FOVA 3GJAA 4ZZ5A 1RMU2 1RUNA 4KU7A 1FMD2 4LA3A 1I5PA 4FXGB 3L2YA 5FBJA 3O1PA 1XNCA 1NXMA 3AZYA 1UYPA 5A7WA 5IAVA 1GP6A 3C7HA 4P08A 4YZ2A 4GH4A 3MUZ1 2GC0A 3DKQA 3DPRA 5K9YA 3U0ZA 5KXEA 1ZA4A 1PX4A 2DVGA 2E53A 2YV8A 5D8AC 5LW9A 1COV3 2E9QA 3EBRA 3TEYA 3C7FA 1BEV2 2ILMA 1S4CA 5LASA 1PVC2 3WT3A 4H55A 4XMIA 5BNPB 4NJ4A 2JG9B 4X8NA 2FCVA 3ABZA 4IV1C 5GKAC 1U5XA 1EAH2 3FUOA 2X05A 2E63A 3TNPB 1C5HA 1DQ6A 1KJRA 4QAWA 5AVAA 3ZIXA 3ZXGA 4Q4Y3 2RJLA 3WW2A 5LBBA 4YW2A 3WNNA 3IT8A 1YQ5A 1VAVA 3S7EA 5GM0A 1DYKA 3RMYA 4XC9A 1HIXA 2J1UA 2Y0IA 1FMD3 4XQDA 4D7TA 3O1SA 1QJY1 1W6NA 3VUOA 1ZNPA 3UGHA 3WCSA 2RM22 1NA1B 2C1FA 5JXJA 3ZYGA 2BERA 4MGYE 2AC1A 3WNOA 4XFAA 1JN2P 4PDWB 4QB1A 4AHYA 2IXJA 1C3HA 5D2AA 1W8HA 1X82A 2NZ9A 4XCAA 2VCCA 1RJ8A 1LNSA 1BEV3 2YC0A 3DPRB 4QX8A 4QD2A 1DG6A 5DAXA 1V9U1 5FUPA 1MQTB 2VBDA 2HWB1 4UF0A 4CUBA 1VBC2 1OLRA 5M0TA 3ME2A 2VUCA 1POV1 4AEMA 4BXFA 4Q0SA 1YO8A 1F35A 2ZHMA 5KR7A 2ADDA 4N90A 1SLCA 4RHV3 1QQP2 2YY1A 1SLIA 2PLV1 3RDIA 3LIHA 4ZU4A 2ORZA 3AXDA 3HAGA 3MIFA 3VBSC 4RR3C 5JSOA 3GYDA 4LBLA 3SH3A 1DF0A 1KJLA 2RM23 2VH9A 4PLNA 4JRLA 1QJU1 3IWZA 3SMHA 1TME1 2VQTA 4COYA 3OOXA 1GQPA 3G7DA 3LAGA 2Q1ZB 3ACIA 3A21A 3C8XA 2DBNA 3BOPA 3MFAA 3SISA 4A7ZA 2JD4A 1XNBA 4FPOB 4PI2A 4RGGA 2W1SA 5C8CA 4AVCA 2WAAA 5C9AB 4YVSB 4BOWA 2W94A 3J8F3 3URFA 4AI0A 4BQ2A 4UWDA 5C70A 1KRIA 4Q1PA 1VBC3 1UZ0A 2WBKA 3EYPA 4AAPA 1WZXA 4NWVA 4JGZC 4MGQA 4V2VA 4XVHA 2OZJA 2HWE3
chains in the Genus database with same CATH topology
3AL5A 5FP3A 5FYTA 3ZLIA 5FXVA 3U78A 4CCLA 3U4SA 3PDQA 4LITA 5FYZA 5FZ7A 4QXCA 5FBJA 5CEHA 5F5AA 5A7WA 3LD8A 4CCNA 3DXUA 3KV4A 3AVSA 2OX0A 5F5IA 5FY8A 3OPWA 5F39A 4HONA 3UYJA 4IGOA 2GP5A 5A3WA 5LW9A 5FZCA 2OT7A 3KVBA 3KV6A 4EZ4A 5FPBA 5FZGA 2XMLA 2WWJA 5FPAA 4URAA 3N9MA 4DIQA 3PU3A 4UF0B 4Y3OA 5FYBA 5FZ8A 5FYUA 2PXJA 5F32A 4CCKA 4CCOA 5FZOA 4GJZA 5FUNA 5FY1A 5FPLA 5FY7A 5FYHA 4CCMA 4AI9A 2YBKA 4XDPA 4EZHA 2XDVA 4QX7A 5IVYA 2VD7A 2OQ6A 2GP3A 5E6HA 5FZEA 4BISA 3DXTA 5A7NA 5FJHA 3PUSA 5FY0A 5FZLA 4IGQA 2W2IA 3K3NA 2Q8CA 5A1LA 3N9OA 3NJYA 5FZ0A 4XDOA 2XXZA 3AVRA 3PUAA 4QXHA 5A1FA 3N9QA 4Y33A 5FZ6A 5FZ3A 5IVCA 3N9LA 4V2WA 5FZIA 5IVFA 3PUQA 5IVBA 2YU1A 4IGPA 5FP4A 4GAZA 5FZFA 3RVHA 3LDBA 5A7PA 5FP7A 4QX8A 5FZ4A 5FYCA 5LY2A 4ASKA 5FUPA 5F5CA 4CCJA 5ISLA 2OS2A 2P5BA 2YBSA 3KV5A 4HOOA 5FZ9A 5FV3A 4UF0A 5IW0A 4GJYA 2XUEA 5FP9A 5F2SA 2Q8DA 5LY1A 5A3PA 5ANQA 4BXFA 4CUGA 3K3OA 5FYYA 4TN7A 4BU2A 2Q8EA 5KR7A 3PURA 5FXZA 5FY5A 5FY9A 5FYIA 5FWEA 4QWNA 3AL6A 4D6QA 3ZPOA 3N9NA 5K4LA 3N9PA 3KV9A 3PTRB 5A7QA 5A80A 4C8DA 5F3EA 5FYSA 4D6SA 5A7WB 4LIUA 5IVJA 5FP8A 1VRBA 5FZDA 4QXBA 4D6RA 5A3TA 5A7OA 2OQ7A 4QU1A 5FWJA 5IVVA 5LWBA 5FZHA 5FPUA 5IWFA 5F3IA 5FPVA 2YPDA 4NUBA 5F2WA 5FZAA 5FY4A 5FXXA 5IVEA 2YBPA 4CSWA 5FYMA 4E4HA 5F3CA 4GD4A 4LXLA 5FXWA 4DO0A 5A3NA 4EYUA 4LIVA 2WWUA 5FZ1A 4Y4RA 5FYVA 3OPTA 3PU8A 5F3GA 5FZKA 5FZBA 4AAPA 5FZOB 4V2VA 3K2OA 2YU2A 5FZMA 3KVAA 5F37A 5FJKA 5A7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AL5 A;  5FP3 A;  5FYT A;  3ZLI A;  5FXV A;  3U78 A;  4CCL A;  3U4S A;  3PDQ A;  4LIT A;  5FYZ A;  5FZ7 A;  4QXC A;  5FBJ A;  5CEH A;  5F5A A;  5A7W A;  3LD8 A;  4CCN A;  3DXU A;  3KV4 A;  3AVS A;  2OX0 A;  5F5I A;  5FY8 A;  3OPW A;  5F39 A;  4HON A;  3UYJ A;  4IGO A;  2GP5 A;  5A3W A;  5LW9 A;  5FZC A;  2OT7 A;  3KVB A;  3KV6 A;  4EZ4 A;  5FPB A;  5FZG A;  2XML A;  2WWJ A;  5FPA A;  4URA A;  3N9M A;  4DIQ A;  3PU3 A;  4UF0 B;  4Y3O A;  5FYB A;  5FZ8 A;  5FYU A;  2PXJ A;  5F32 A;  4CCK A;  4CCO A;  5FZO A;  4GJZ A;  5FUN A;  5FY1 A;  5FPL A;  5FY7 A;  5FYH A;  4CCM A;  4AI9 A;  2YBK A;  4XDP A;  4EZH A;  2XDV A;  4QX7 A;  5IVY A;  2VD7 A;  2OQ6 A;  2GP3 A;  5E6H A;  5FZE A;  4BIS A;  3DXT A;  5A7N A;  5FJH A;  3PUS A;  5FY0 A;  5FZL A;  4IGQ A;  2W2I A;  3K3N A;  2Q8C A;  5A1L A;  3N9O A;  3NJY A;  5FZ0 A;  4XDO A;  2XXZ A;  3AVR A;  3PUA A;  4QXH A;  5A1F A;  3N9Q A;  4Y33 A;  5FZ6 A;  5FZ3 A;  5IVC A;  3N9L A;  4V2W A;  5FZI A;  5IVF A;  3PUQ A;  5IVB A;  2YU1 A;  4IGP A;  5FP4 A;  4GAZ A;  5FZF A;  3RVH A;  3LDB A;  5A7P A;  5FP7 A;  4QX8 A;  5FZ4 A;  5FYC A;  5LY2 A;  4ASK A;  5FUP A;  5F5C A;  4CCJ A;  5ISL A;  2OS2 A;  2P5B A;  2YBS A;  3KV5 A;  4HOO A;  5FZ9 A;  5FV3 A;  4UF0 A;  5IW0 A;  4GJY A;  2XUE A;  5FP9 A;  5F2S A;  2Q8D A;  5LY1 A;  5A3P A;  5ANQ A;  4BXF A;  4CUG A;  3K3O A;  5FYY A;  4TN7 A;  4BU2 A;  2Q8E A;  5KR7 A;  3PUR A;  5FXZ A;  5FY5 A;  5FY9 A;  5FYI A;  5FWE A;  4QWN A;  3AL6 A;  4D6Q A;  3ZPO A;  3N9N A;  5K4L A;  3N9P A;  3KV9 A;  3PTR B;  5A7Q A;  5A80 A;  4C8D A;  5F3E A;  5FYS A;  4D6S A;  5A7W B;  4LIU A;  5IVJ A;  5FP8 A;  1VRB A;  5FZD A;  4QXB A;  4D6R A;  5A3T A;  5A7O A;  2OQ7 A;  4QU1 A;  5FWJ A;  5IVV A;  5LWB A;  5FZH A;  5FPU A;  5IWF A;  5F3I A;  5FPV A;  2YPD A;  4NUB A;  5F2W A;  5FZA A;  5FY4 A;  5FXX A;  5IVE A;  2YBP A;  4CSW A;  5FYM A;  4E4H A;  5F3C A;  4GD4 A;  4LXL A;  5FXW A;  4DO0 A;  5A3N A;  4EYU A;  4LIV A;  2WWU A;  5FZ1 A;  4Y4R A;  5FYV A;  3OPT A;  3PU8 A;  5F3G A;  5FZK A;  5FZB A;  4AAP A;  5FZO B;  4V2V A;  3K2O A;  2YU2 A;  5FZM A;  3KVA A;  5F37 A;  5FJK A;  5A7S A; 
#chains in the Genus database with same CATH topology
 2JIJ A;  2JDY A;  2RS1 2;  2DUP A;  4D8M A;  1QQP 3;  2G9F A;  1SFN A;  3U4S A;  1HV1 A;  4ZS3 A;  1APN A;  2GC3 A;  1OQD A;  5ABJ A;  1JZ8 A;  2IVI B;  3ROU A;  2HWC 2;  2AEY A;  1JH5 A;  2Z2S B;  1NUK A;  2PHU A;  2VZU A;  1MS9 A;  2JE9 A;  1Q8Q A;  3WQ7 A;  1WLT A;  2Q30 A;  1ZRE A;  1WCS A;  5EXO A;  2RJK A;  3DXU A;  4IW3 A;  1K5M A;  1W0P A;  3D6E A;  3E5X A;  3WZ1 A;  1O4Z A;  2JB8 A;  2ZGM A;  1LAJ A;  2V73 A;  3ZXK A;  1GZC A;  3KF5 A;  4XQ4 A;  2NMN A;  3UYJ A;  2R7E B;  4DXZ A;  3QAC A;  3T0B A;  3EO6 A;  3M8L A;  4YW1 A;  2FZ2 A;  1QJE A;  3KWV A;  1RUC 1;  3DYO A;  5CVR A;  3WUD A;  2GH2 A;  2LW8 A;  4GWJ A;  4YVW A;  3B9I A;  4QT6 A;  3U75 A;  2J1V A;  2WAO A;  3H8R A;  1LB2 A;  2WN3 A;  1F4H A;  4OZO A;  1UKR A;  2QVS B;  5DDJ 3;  4AFA A;  1OOP C;  1YQ6 A;  3ZO0 B;  4DB5 A;  1O3S A;  1OVS A;  2YXS A;  2X29 A;  5GLW A;  4QPG A;  2XB6 C;  2WC2 A;  2JDM A;  2VNG A;  1W28 A;  4BQ5 A;  3ZFE A;  3SXW A;  1U5Y A;  4DRV A;  4UI9 L;  4IXL A;  5A33 A;  4XF3 A;  2DVD A;  4BIS A;  2VOW A;  3C2U A;  3HQU A;  4M3C F;  2VMD A;  2RDR A;  2A6Y A;  2W08 A;  2FDF A;  3JU9 A;  3THC A;  1QOO A;  1SLT A;  3B5L B;  3B94 A;  4CUA A;  1ZRC A;  2VEC A;  3UNP A;  4AVA A;  4CDW C;  5ABJ B;  1MS0 A;  1YCI A;  4GA9 A;  2CSG A;  4AVV A;  2P6H A;  1W9W A;  2P17 A;  3LB9 A;  4NR1 A;  4BLI A;  2PHR A;  5CFD A;  1C8M 3;  3VKO A;  3NV2 A;  3LDB A;  5L19 A;  3T1L A;  1K5M B;  1R1A 2;  4DEV A;  3H3U A;  4B4R A;  4UOJ A;  5GZD A;  1FXZ A;  1HX6 A;  2VUJ A;  2EXK A;  4FP3 A;  3SHR A;  3IB3 A;  5FP9 A;  3S5Q A;  2VZ3 A;  3WG3 A;  4BDV B;  4E2S A;  5A3P A;  3MIG A;  1MS1 A;  1UL9 A;  3IDA A;  5EJ1 B;  3INA A;  1D4V B;  1QHD A;  2A1X A;  5JIU A;  2FMY A;  2VMH A;  1WKY A;  4S2G A;  2VY0 A;  1CAU A;  2P2K A;  2EXH A;  3ZVX A;  2Y6L A;  4XFH A;  2R04 2;  4QPG B;  2QQU A;  4Z8B A;  1US3 A;  4Q29 A;  2PYT A;  2FDG A;  5C4W C;  1GFF 2;  5CA6 A;  4YG0 A;  4NRQ A;  4AAX A;  4LA2 A;  1ULD A;  2BYV E;  4MXV A;  1XPW A;  3Q8C A;  1XU2 A;  1W2N A;  4WM8 A;  1QJF A;  3LEM A;  2QQL A;  4RFR B;  4CEY A;  1QMJ A;  3IMM A;  5EZW A;  2C9A A;  4XAE A;  2VMG A;  2ZKL A;  1JXN A;  2W1Q A;  4Y1V A;  1WCK A;  4J25 A;  2PA7 A;  2Q8O A;  3WDY A;  4I30 A;  1W6P A;  2AGS A;  2VZT A;  4KH9 A;  5FZH A;  3TOJ A;  4BYY A;  1OD3 A;  4AI2 A;  5BY5 A;  3O1T A;  3RS6 A;  3WF3 A;  5B4N A;  3A23 A;  1OLM E;  5FO7 B;  3OBA A;  5EP9 A;  1EY2 A;  3WIN E;  1R1A 3;  2CDO A;  4E4S A;  4JC1 A;  4ZS2 A;  4GD4 A;  1R09 2;  5A3N A;  1W8N A;  1XE0 A;  3FHA A;  3KT7 A;  3O7O A;  3PTY A;  2WFF 2;  1SLL A;  2CL2 A;  2VR4 A;  1ND3 B;  1Z0H A;  2WKK A;  3K2O A;  5FJK A;  3JCI A;  3FX3 A;  3VZK A;  4DXS A;  4UW6 A;  5CB7 A;  2WWS A;  5FXV A;  2BUK A;  4XAB A;  1W8T A;  1VBA 1;  1WMF A;  5FLI A;  4BQW A;  2WT1 A;  4IEY A;  4OZX A;  4UAP A;  4K7J A;  1FV3 A;  4RN5 A;  4Z1V A;  2CWS A;  4QM8 A;  2JG8 A;  3RSJ A;  4I2O A;  3PVO A;  1X8M A;  1YI9 A;  1RVF 3;  5EJ3 A;  4CCN A;  5F7U A;  2KR2 A;  4UXA A;  1UF2 C;  2IZW A;  4YM2 A;  4ASL A;  4AEK A;  2RDQ A;  1TVG A;  4QPW A;  1PMJ X;  3B7M A;  4QHZ A;  2WSV A;  4JQR A;  4C1X A;  3KD4 A;  3CNA A;  3MW4 A;  5FKC A;  3GZA A;  4PBP A;  4K21 A;  1JZ7 A;  4MAD A;  3RMX A;  1PIV 1;  1S0F A;  4YGE A;  2WWJ A;  1LGC A;  4CTE A;  4CUC A;  4IUG A;  3T2T A;  1O91 A;  3OUJ A;  4IEX A;  1AZD A;  1OLQ A;  2D3R A;  1JZ5 A;  2UWC A;  5F32 A;  3AKT A;  3WNK A;  2UWB A;  2WFF 3;  1B35 C;  3HNM A;  4Y1X A;  4E9K A;  1G8W A;  3KM5 A;  1NZI A;  1RHI 1;  4CDQ C;  2EAL A;  3WP4 A;  5CIS A;  3FC0 A;  2VZP A;  1UPI A;  3KT1 A;  3ZFF A;  4Z92 B;  3N7K A;  1YFY A;  5FJH A;  2VG9 A;  1A8D A;  1AL2 1;  4Q4V 1;  1OVP A;  4WVV A;  4AGG A;  4FPC A;  2P3J A;  1T2X A;  1G9F A;  3NJY A;  2RV9 A;  4M01 A;  3AVR A;  5F6K A;  4QXH A;  4AVB A;  5A1F A;  1A34 A;  1HRV 1;  3A22 A;  1J83 A;  1X36 A;  2DUR A;  1PX3 A;  4I0B A;  1G9C A;  5H9P A;  2VCB A;  4KWL A;  2ZGR A;  3AB0 A;  3VKM A;  1LOD A;  4ZU5 A;  2AR6 A;  1JYN A;  2XVG A;  4FO9 A;  4HG6 B;  2ARC A;  2ZA9 A;  1SMV A;  5F5C A;  3AP5 A;  4CEW A;  5G04 L;  4DRR A;  2IC1 A;  5A1A A;  5I0T A;  3VDC A;  2R07 1;  2R0F A;  1A3K A;  4P5H A;  3NAP A;  4ET7 A;  4MVT A;  2GC2 A;  4YGC A;  1VRH 3;  2W68 A;  2Q8E A;  1WCQ A;  4OI4 A;  3Q9O A;  2VW0 A;  4LMF A;  2YC4 A;  1UIK A;  4YGD A;  3RZH A;  3JZV A;  2GNM A;  1V9U 2;  4Q0P A;  4RS5 B;  1K3I A;  3I3Q A;  4LHS A;  4CPB D;  4ZKT B;  2HWB 2;  4P14 A;  3H7J A;  3NVC A;  2P3K A;  2HKX A;  3T3Y A;  2Z4F A;  4HMZ A;  1VRB A;  2ZS6 B;  4QB2 A;  3OUH A;  1KXG A;  4L9B A;  4AR2 A;  1UX7 A;  2P6C A;  2OA2 A;  5DAQ A;  4XIL A;  1WLD A;  2HEY F;  5FWJ A;  1JYW A;  4Y1U A;  2QQO A;  5IFT A;  1ULC A;  3WVJ A;  3D82 A;  2ZGT A;  5LK5 A;  5EV7 A;  1OFN A;  2WA4 A;  4AG4 A;  1SCS A;  5JVV A;  4GZ9 A;  1ENR A;  1COV 1;  3G6J B;  4LIV A;  4YW4 A;  1QJU 2;  1SZB A;  2IFW A;  3FBM A;  1TME 2;  5FZK A;  1MAC A;  1YFW A;  1W6O A;  1YLL A;  4C90 A;  3TRS B;  5F37 A;  4CEW B;  4A2U A;  3ACG A;  5JPN B;  1SQ4 A;  4LUK A;  1E57 A;  1UD1 A;  4F7Z A;  5KHG A;  3WHU A;  2BPA 2;  5J7M A;  1C1L A;  1OF4 A;  4CDX A;  4Q4Y 1;  4HN0 A;  1LRH A;  1VMH A;  4IEZ A;  4AHX A;  3QD6 A;  1V9U 3;  5TSW A;  2Y34 A;  3PVE A;  5I8S A;  2HWB 3;  4QHB A;  3M1H A;  4C0H A;  1UOB A;  1F4A A;  1POV 3;  5CNA A;  3POG A;  2XUM A;  4URT A;  3VL9 A;  3NST A;  4K6B A;  3WY6 A;  5FRA A;  1HB3 A;  2WQ4 A;  4A7K A;  4TXW A;  4KQ7 A;  2PEL A;  2CTV A;  3B00 A;  1VP6 A;  3CJI A;  4W8J A;  4YPJ A;  2XML A;  5LA1 A;  2W0X A;  4YW6 A;  3N3H A;  3WNX A;  3OSD A;  4CDU A;  1T6G C;  4AL9 A;  3ENR A;  4YM0 A;  1AUY A;  5KC5 A;  3W5M A;  4UFL A;  1BLZ A;  2QQV A;  5FUN A;  3WF1 A;  2GDF A;  1TMF 3;  3FLT A;  3HPN A;  1TME 3;  1W9T A;  2RDS A;  3I3B A;  3KZ4 C;  4HT1 T;  2DTY A;  4O7X A;  5JUV A;  3T0D A;  2BRT A;  2I74 A;  4EZH A;  1SHW B;  1MVE A;  3LA2 A;  1RUC 2;  1XQN A;  1V6O A;  4M4R A;  2CYF A;  5L9V A;  1NCQ A;  2VTX J;  1GZ9 A;  1PNG A;  5FZ0 A;  2PAK A;  1RGS A;  3WDX A;  1YEW A;  4RHV 1;  4XF9 A;  2FHR A;  3N9Q A;  3AKP A;  3N9L A;  4CDX B;  1H1A A;  1DDL A;  3NV1 A;  4CZS A;  5IVB A;  1RJ7 A;  3VDD B;  1ZZB A;  2P3Y A;  2D6N A;  2E33 A;  2RDN A;  1YJL A;  4V1P A;  4QQ2 A;  4JDO A;  5DZF A;  2WAB A;  4QX2 A;  4LO4 B;  4CCJ A;  1PZ8 A;  2OS2 A;  4LJH A;  5FZ9 A;  4YSF A;  3I2H A;  2A71 A;  2DCY A;  4OUS A;  4P00 B;  4QMA A;  2OKX A;  5IJR A;  5LY1 A;  1PMI A;  4Y22 A;  4HN1 A;  1ULE A;  1IKQ A;  4PT6 A;  5K7P A;  4N43 C;  4CDU B;  2IVJ A;  4TLF A;  3J8F 1;  4OYU A;  5FYI A;  1SAC A;  5FPX A;  1F9K A;  5F5Q A;  1DGW A;  3IMN A;  3AL6 A;  1VBC 1;  2RJ2 A;  3UGF A;  2WO3 A;  3V65 A;  2DU1 A;  4C1W A;  4WVW A;  5G05 L;  5T5L A;  2HWE 1;  4F3J A;  4P9X A;  4LBQ D;  2HWD 3;  5JWP A;  5FP8 A;  3MF6 A;  1QQP 1;  3SKJ E;  1HRI 3;  5EIY B;  2GU9 A;  1VBE 3;  3BOW A;  1DIW A;  3CZJ A;  3IDC B;  2X5I C;  1DQ4 A;  4YRD A;  1QOT A;  4Q0V A;  4OFG A;  3UJO A;  4N53 A;  3ZYH A;  2YPD A;  4LBK A;  1W39 A;  2PHW A;  3SH5 A;  1J3R A;  4KWU A;  3M3Q A;  3VHO A;  3FHI B;  4P9Y A;  4WZC A;  1H8T B;  3MIH A;  5CBL A;  3C7O A;  1VAK A;  2JJ6 A;  5T5J A;  4SLI A;  2P37 A;  3RYK A;  4AVS A;  4MGI E;  4WVM B;  1OBN A;  1J3P A;  2J1A A;  2JKB A;  5FZ1 A;  3V56 A;  3VBR C;  3W58 A;  4FOW A;  2MHF A;  3VDB A;  3P6B A;  4K3U A;  5FTT C;  1POV 0;  1ND2 C;  4ZHN A;  5D8A A;  3UT0 A;  4I3G A;  3GCX A;  5DDJ 1;  1Y4W A;  4R9A A;  4BJ0 A;  4CXW A;  2XWB B;  1IPJ A;  5J98 B;  1LTE A;  4R8H A;  4KGG A;  2C4X A;  5IFP A;  5AC9 3;  1X7N A;  5DG1 A;  4CP9 A;  5CEH A;  1GZT A;  5JXI A;  1F5J A;  1DP0 A;  4IV1 A;  2DF7 A;  3V0A A;  2IWG B;  2QQW A;  1NQD A;  4JVA A;  1JYV A;  1W8W A;  1PNF A;  3H50 A;  4R9C A;  3TN9 1;  4YFZ A;  3OD0 A;  2GP5 A;  4NHK A;  1JYX A;  2Y60 A;  5EQU A;  1S0D A;  3WXP A;  1VBA 2;  3AFG A;  1PK6 B;  3CL1 A;  4H7L A;  3SCG A;  4XEZ A;  2R49 A;  4NOT A;  2WIN B;  3UGG A;  2D7F A;  3S6P A;  1C8M 1;  3WLU A;  5FZO A;  3OGJ A;  2VQ0 A;  5L9R A;  3T0A A;  4XJU A;  4DXR A;  3ZFG C;  4BQX A;  5BNN C;  3BU0 A;  1YIP A;  3O1R A;  3OGV A;  5FQ0 B;  5JR7 B;  3EMR A;  4LKD A;  2VD7 A;  3HNB M;  3E6C C;  4B7K A;  1PIV 2;  2JKX A;  2Y33 A;  5JDB A;  2QBX A;  3ZKY A;  1MZ5 A;  4FVV A;  5C6C A;  4IDZ A;  4P9J A;  3SEP A;  1Z78 A;  4CA9 A;  2DCT A;  5L36 A;  5HPO A;  5IUQ A;  4LHL A;  3P3P A;  1QIQ A;  1J84 A;  1N1V A;  2RMU 3;  5DZG A;  5FZ6 A;  5CAZ A;  1DYO A;  2JWP A;  3WQ1 A;  5C3P A;  1RHI 2;  3MPP G;  1A6C A;  2IXL A;  4NHM A;  1JW6 A;  4AQS A;  3U11 A;  4IV1 B;  2VUL A;  4QPI C;  1W8F A;  4WM7 C;  3VZL A;  1DGR N;  1JZ2 A;  4LBM A;  3V0A B;  1DQ2 A;  4FTB A;  1AL2 2;  1VBA 3;  4Q4V 2;  3PL0 A;  3I8T A;  4ASK A;  4NIG A;  3F2Z A;  2VAU A;  2VMC A;  2F4L A;  4HOO A;  3VBS A;  4RR3 A;  4CVU A;  2NMO A;  3KCX A;  5I93 A;  4XFB A;  2O1Q A;  5BNO C;  3AYC A;  4NIA A;  1CGP A;  1QJX 3;  5FYY A;  2VW2 A;  3ZXE A;  5D21 A;  1R1A 1;  1R64 A;  5AVP A;  5FLH A;  1H8V A;  1EYB A;  1SLA A;  3MW3 A;  3WV6 A;  1GP4 A;  1H6Y A;  3ZYJ B;  2VBB A;  3KT4 A;  3NNM A;  1RUJ 3;  5IVF A;  4NID A;  3BU7 A;  2NQY A;  1CAW A;  1RIT A;  1H4H A;  3K51 A;  4KGQ A;  3ES4 A;  3N9N A;  2R07 2;  4RQP A;  3L9J T;  4HFS A;  5FO9 B;  2VTF A;  3ELN A;  5F3E A;  3ETQ A;  4I02 A;  4WZF A;  5KHH A;  3VBU B;  5IVJ A;  2EAK A;  5K0U C;  3AMH A;  5L7O B;  1UYY A;  1IGO A;  2D6K A;  1Q8V A;  3TYJ A;  1W06 A;  5FAX A;  1RUE 1;  2ARB A;  2CWM A;  3ACL A;  4JGZ A;  3VD7 A;  4D6R A;  5A3T A;  4GUL A;  5FIX A;  1RVF 1;  4HPK A;  4MGK E;  5IWF A;  5F3I A;  1I3H A;  3TBD A;  3WNM A;  4AFD A;  5JZG B;  1QEX A;  3J7L A;  3KF3 A;  4EN7 B;  5A6Y A;  1EUU A;  1QGL A;  4LBN A;  4CSW A;  2ZAB A;  3JB4 C;  3AZW A;  5AFB A;  2CGN A;  1LHU A;  1SBD A;  3OGR A;  1H1M A;  2E32 A;  4XTM A;  5CIR A;  3ON7 A;  4DQA A;  4ARX A;  4OHZ A;  2QQP A;  2GN3 A;  3U10 A;  1WLW A;  2PHD A;  3ZYB A;  1T6B X;  3VBS B;  1PO1 2;  2HEW F;  3FJS A;  3Q8A A;  5FP3 A;  3B69 A;  1ALY A;  3MIC A;  1XNT A;  5F6L B;  4EZ4 A;  3LPF A;  3DF0 A;  3ZXF A;  1N3O A;  1COV 2;  3I97 A;  1EUT A;  4H3W A;  2EF6 A;  2JEC A;  2ZMN A;  3LD8 A;  3NNG A;  4YFW A;  3S5A A;  3MZH A;  2FD8 A;  4B29 A;  4RGK A;  4DS0 A;  1OOP A;  1QNW A;  1UZW A;  2OX0 A;  1UY0 A;  4XJZ A;  2WN2 A;  3HMY A;  3OBZ A;  4RQP B;  3H9A A;  4QU2 A;  1ZRF A;  1PGL 1;  3B3Q E;  2ET1 A;  2XL7 A;  3AYA A;  2KA3 A;  2BW8 A;  2TEP A;  3KV6 A;  3BGA A;  4Q4Y 2;  3DYM A;  2WQ8 A;  3PVN A;  2QKD A;  4CE8 A;  4ATF A;  2Y6F A;  1V6J A;  1CAV B;  3I2G A;  3WR0 A;  5T55 A;  5L9B A;  3WNL A;  3J7N A;  4IE4 A;  3NWK A;  2H6B A;  5DPN A;  2Z79 A;  1XRU A;  4GJZ A;  2C24 A;  2LUW A;  3WCR A;  4CDW A;  2BDR A;  3POJ A;  5A3L A;  2ZGU A;  3SLI A;  5JSR A;  2PAM A;  2XDV A;  4MLO A;  3LDR A;  3NV4 A;  1L7R A;  1PO1 3;  2GP3 A;  4GB3 1;  1G9A A;  1LOG A;  4XUT A;  1BVP 1;  5FOJ B;  4YW7 A;  5FZL A;  4AOC A;  3E97 A;  1VRH 1;  4IGQ A;  1DLC A;  2P1B A;  3N9O A;  1YFX A;  1NCR C;  4D69 A;  2CNA A;  4FPH A;  5LK7 B;  2K46 A;  4NRP A;  1UKG A;  1X50 A;  2SBA A;  3CDZ B;  3VBF B;  5JCT A;  3S57 A;  2ZML A;  1AHS A;  1XJA A;  4N7U A;  1GWL A;  1C4R A;  2WNU C;  2XGX A;  2NM1 A;  4HKL A;  3AZX A;  4UW3 A;  2OVU A;  1OF3 A;  4NHX A;  4CCC A;  3PLQ A;  4C91 A;  5FZ4 A;  4JGY C;  4TTG A;  1BCX A;  3N7L A;  1I6X A;  1AR6 1;  4MXW A;  1LKN A;  5C4W A;  4BZ4 A;  4RHV 2;  2ERF A;  3KV5 A;  4NIH A;  2XHN A;  5A6Z A;  5KC6 A;  5CKQ A;  3NW4 A;  5CAD A;  3NL1 A;  1O3T A;  2ADE A;  3C3V A;  4EN8 B;  2QZ3 A;  5FXZ A;  2EXJ A;  2EIE A;  1VIW B;  2BBV A;  2A5Z A;  1H4G A;  1HN1 A;  4QWN A;  3I2K A;  4I3P A;  4NPL A;  2JB4 A;  3NNL A;  3ZPO A;  3VZJ A;  2JE8 A;  3HQX A;  5EYY A;  1S0I A;  2C6S A;  4FPF A;  1D4M 3;  4Y1Z A;  4ZON A;  5A7W B;  3ACH A;  1S0G A;  2XJT A;  4GH4 B;  1D0G A;  3RG0 A;  3T1M A;  3AJZ A;  1W3X A;  4MGT A;  1GLH A;  3J8F 2;  4LLF A;  5LWB A;  2ZGK A;  2ZGL A;  3JD7 3;  1RUH 1;  1W9F A;  1URX A;  3T30 A;  2EAA A;  4XOG A;  3NKT A;  2HWE 2;  2VTX A;  4DY3 A;  1HB2 A;  1KEX A;  1VBB 3;  2VZ1 A;  1Y9M A;  2Y6K A;  4K8F A;  5EWS A;  3FE5 A;  1UMI A;  2WWU A;  3UET A;  1JUI A;  1AX1 A;  4SBV A;  5DAV A;  3VBO C;  3E5Q A;  5IAX A;  1J58 A;  3AK0 A;  4BXS V;  5C4W B;  3K4Z A;  1UO9 A;  3MEP A;  4LO5 B;  4BMB A;  2B8M A;  3ATG A;  1PVX A;  3VBH C;  1PMH X;  2VZS A;  4UBH A;  3S7I A;  1SFP A;  3E6B A;  1TMF 1;  2WQZ C;  2YUE A;  2JIG A;  4QX5 A;  1KFU L;  1ZBA 1;  4NMI A;  1W6N B;  2BWA A;  2E31 A;  2EID A;  3LPG A;  3BTY A;  2HBT A;  4LTA A;  4MSV A;  4CP1 A;  5JOY A;  2D44 A;  3UES A;  1YIF A;  2FDK A;  5J96 B;  2RS5 2;  4HON A;  1Y43 B;  2LS6 A;  1B35 A;  5DDJ 2;  3MUY 1;  4MX3 A;  1CWP A;  4KBB A;  2G9Z A;  4CDQ A;  1RTV A;  1W2O A;  4O65 A;  4I09 A;  3ZXL A;  3I49 A;  1AR8 3;  4LO6 B;  4QGN A;  3KSC A;  3GHN A;  2XLA A;  4DUW A;  2BGP A;  3CQO A;  2KM2 A;  1BBT 1;  4R4Z A;  3FMG A;  1HB1 A;  3IM0 A;  4UF0 B;  4Y3O A;  4CCO A;  5J09 A;  2DBI A;  2D98 A;  3TN9 2;  5FY1 A;  3TNQ A;  3TEZ A;  1QH6 A;  3T2Q A;  4FPG A;  3WG4 A;  3OF1 A;  1GR3 A;  5T5O A;  1N1Y A;  1UIJ A;  4YG6 A;  3TAY A;  1S55 A;  4D7S A;  3FWE A;  3IDE A;  1GIC A;  2BBA A;  1O4T A;  2A75 A;  2ZEZ A;  3BB6 A;  3UKT A;  3L2H A;  4COZ A;  2FCT A;  1YYN A;  4Z2A A;  3K3N A;  5A1L A;  1C8M 2;  5HCF A;  4OUE A;  4TWT A;  4E8C A;  5FDB A;  1C28 A;  4OCT A;  1ZZ8 A;  1AL0 G;  5FZ3 A;  1V70 A;  1OUX A;  1OXC A;  3JXS A;  1ULG A;  3GHM A;  2MPF A;  2DCK A;  2VNO A;  3SC7 X;  2VZR A;  2RS5 3;  4NVP A;  2EA7 A;  4FQ4 A;  2HWD 1;  4OHV A;  1GQG A;  2GH8 A;  1HRI 1;  5C8C B;  1VBE 1;  3SEE A;  4KWK A;  3K46 A;  3POI A;  1UOG A;  2QFE A;  2WJS A;  4QX1 A;  5FV3 A;  1LHN A;  4IEV A;  1V6L A;  2RVA A;  4CDQ B;  3OD4 A;  2XPJ A;  3D3A A;  1VJ2 A;  1GQH A;  1DYP A;  1FI2 A;  2K9Z A;  2R32 A;  3TN9 3;  2KXL A;  3DV8 A;  2ZPX A;  2A3X A;  2XVL A;  3LIG A;  4XZU G;  5BNP C;  1UMH A;  3AZV A;  2QQJ A;  1YI7 A;  2PQS A;  4YGB A;  2JG9 C;  5FPZ A;  4YZ1 A;  4UFH A;  4OUM A;  2QZ2 A;  2J1T A;  2ATF A;  1BYH A;  2IXC A;  2R30 A;  1UY3 A;  4PQQ A;  1AR9 3;  4UFI A;  4D6Q A;  4FTE A;  1LEC A;  2WSU A;  3AMN A;  5C3S A;  1C5I A;  1KIT A;  2VVE A;  2VL4 A;  3F95 A;  4EN6 B;  2HYX A;  5FYS A;  1WA6 X;  3Q8E A;  4BIO A;  1TZO A;  4LIU A;  2D6P A;  3LQC A;  4PLO A;  2VM9 A;  2VE1 A;  1LU1 A;  3BTA A;  4M0N A;  1LU2 A;  4Q4W 2;  5AC9 1;  4ITC A;  1BJQ A;  1NOV A;  2FBE A;  3TEX A;  2OQ7 A;  2G19 A;  3ILR A;  1YHF A;  4OLL A;  5C33 A;  1GNH A;  3N7J A;  1MR5 A;  1L3J A;  1CJD A;  3POB A;  3U14 A;  3VHP A;  3WG1 A;  5FPV A;  1R08 1;  4AWD A;  4XUP A;  1NA1 C;  3A4U A;  1Q8S A;  2VMF A;  4YVW B;  1FV2 A;  3S30 A;  4DO0 A;  1UY1 A;  5I0D A;  1UZY A;  1JYT A;  3MV1 1;  5C71 A;  4PIZ A;  2V09 A;  3CLP A;  3D4K A;  4OMD A;  5FYV A;  4L11 A;  4LBO A;  4PDW C;  1RUE 2;  4N8M A;  4LE3 A;  1O7F A;  4YZ4 A;  1K45 A;  1WWY A;  3A0K A;  3K75 B;  3KVA A;  3VHN A;  3ZFE B;  3H8O A;  2FDH A;  1RVF 2;  4JRA A;  5SV5 A;  1G9B A;  3AC0 A;  5A33 B;  4JKM A;  1LHV A;  1MQT C;  3M3C A;  1AJO A;  4QXC A;  1KQR A;  2CV6 A;  1RUO A;  2VC9 A;  1F15 A;  2WZ8 A;  5ACA 3;  5LZ6 A;  1M4W A;  4ORF A;  3V64 A;  1W2U A;  1UNB A;  4A44 A;  1YQ2 A;  2VZQ A;  4JQT A;  3AVS A;  4C0B A;  4NRO A;  5F39 A;  2J42 A;  4FBF A;  5KHI A;  2Y26 A;  4N9H A;  4Q4W 3;  4LE4 A;  5CFD B;  2R6Q A;  5D1I A;  1GWK A;  4LO8 A;  2RMU 1;  4YG3 A;  4W50 A;  1W8O A;  4IE7 A;  3R6S A;  4K1Z A;  4AFM A;  4Q0Q A;  2V4V A;  2QCS B;  2WLP A;  2UU8 A;  1AYN 3;  3NJV A;  4E27 A;  4QKF A;  1AJK A;  4UFM A;  2E6V A;  3HWJ A;  1PGL 2;  1RUE 3;  2E7A A;  4NPM A;  3RGB A;  1OPM A;  2YBK A;  3AP4 A;  1CAX A;  5T50 A;  1CN1 A;  3H1M A;  3IPV A;  1K5J A;  1MZE A;  1CAU B;  2DFB A;  4XBL A;  5C9A C;  4YVS C;  1C1F A;  2QDR A;  1KDK A;  3KS7 A;  4FCA A;  1QJX 1;  4B3N A;  3PUI A;  1UOF A;  4UFK A;  3H3Z A;  4GWM A;  1D0H A;  3JUU A;  1RUD 3;  4EN0 A;  4WM8 B;  4Y33 A;  5FMB A;  4CEY B;  1OPO A;  1RUJ 1;  1HJG A;  4FI9 A;  4N43 A;  2WYF A;  4GB3 2;  3AMQ A;  4UFJ A;  2XQX A;  1X9P A;  3J7M A;  1W6P B;  4K9S A;  2AEN A;  1VRH 2;  2ZEW A;  4Q26 A;  3BN6 A;  5CKN A;  5ISL A;  4Y4Y A;  1K42 A;  2SLI A;  1YQ8 A;  4PJY A;  5CKM A;  4LEJ A;  5E89 A;  3PJY A;  4KG8 A;  3MYX A;  2VMI A;  2VW1 A;  3R4S A;  4LK7 A;  1LEM A;  5EFU A;  5I8Y A;  3WF2 A;  4TN7 A;  1STM A;  5EHD A;  3M3I A;  1S2E A;  1QXP A;  4OQ8 A;  5FY9 A;  2X5I A;  1L7L A;  4YLZ A;  2FZ1 A;  2PHT A;  4CXY A;  4Y5T A;  3W9A A;  1AR6 2;  1W6Q A;  3N9P A;  3PTR B;  1ENS A;  2JG8 B;  1CAX B;  2ZHL A;  2Y6J A;  2XKO A;  1S0C A;  4BH9 A;  1GMM A;  3RPQ A;  2DWR A;  4IER A;  1G9D A;  2IXH A;  4XE9 A;  1X9T A;  3VBR A;  2UUR A;  4MZU A;  1IG3 A;  1GP5 A;  2Q0A A;  4EE2 A;  1RUI 1;  1ND2 A;  3POW A;  1WGP A;  1MS3 A;  4GB3 3;  1LJ7 A;  1UZV A;  1IQD C;  1NZC A;  3CEW A;  1OFS A;  3NMB A;  2D6M A;  4Q27 A;  4XJ8 A;  5IVE A;  5FYM A;  2KD7 A;  1LOF C;  4BWO A;  5C5T A;  3UKN A;  4YWA A;  3OPT A;  5C8W A;  1ZRI A;  2XHK A;  1Y7B A;  4IV3 A;  1KD7 A;  4AE2 A;  1RUH 2;  5FYT A;  2XG3 A;  1NY7 1;  3AYE A;  4XF0 A;  3ZFF B;  4YW5 A;  1GSL A;  5C7G A;  1AR6 3;  4AGV A;  2X5I B;  2F17 A;  2PHF A;  1JBC A;  1QY4 A;  4OMC A;  3RZM A;  2QQK A;  1BVV A;  2B42 B;  1PO1 1;  3BIE A;  2WT2 A;  5FY8 A;  1UYZ A;  2WLQ A;  5FOB B;  5T54 A;  2N7G A;  2PHX A;  1OQ1 A;  1ST8 A;  3HEI A;  3ORJ A;  3WW1 A;  3BKZ A;  3ZFG A;  2WNO A;  5BNN A;  4ONU A;  1WBF A;  1W3V A;  3M3E A;  3NO8 A;  5FPB A;  2G1M A;  2GAL A;  3FBY A;  3ZDV A;  1TMF 2;  4XFF A;  1I9R A;  3DYP A;  5JAX A;  1ZBA 2;  4GMP 3;  3KGL A;  1YFU A;  2G4I A;  2W47 A;  3QH6 A;  3BUC A;  4A6O A;  1O6U A;  1RB8 G;  1XNA A;  2FDI A;  5JLV A;  1ND2 B;  4LT5 A;  1G86 A;  3CHX A;  3C7E A;  4HKW A;  5FZ8 A;  3A0N A;  4AHW A;  4OHX A;  2ZKN A;  3NAP B;  1OQE A;  1NG0 A;  2R0H A;  4NE9 A;  4FT8 A;  3RZG A;  2GAU A;  1ZM1 A;  4NAM A;  4DFS A;  1RUH 3;  1KS5 A;  2ETE A;  4QPI A;  3E1F 1;  1SPP A;  4FPK A;  4WM7 A;  3RRD A;  4P5Y A;  4LLO A;  4XUQ A;  5A7N A;  3GXU A;  3WUC A;  4CCE A;  4IV3 B;  1O3R A;  5GJ6 A;  1JOJ A;  2Q8C A;  4AFB A;  4JHT A;  1BBT 2;  3ASI A;  1BMV 1;  1J3Q A;  1GZW A;  1W0N A;  1ND3 C;  3KB5 A;  2XJR A;  2ZZQ A;  1JTZ X;  4HK9 A;  5I0S A;  5BYN A;  5BNO A;  4IES A;  4X8P A;  1W9Y A;  1WMD A;  2YU1 A;  1W04 A;  3E6D A;  1WUV A;  4COU A;  3WP6 A;  2AAC A;  3DEC A;  1D4M 1;  2XJQ A;  3LA3 A;  3THP A;  3USU A;  3GJB A;  5KWR A;  5JOW A;  1TNF A;  2Y64 A;  3LEI A;  2LRP A;  2YBS A;  1TNR A;  5HI0 A;  1ZBA 3;  2DCZ A;  1N1S A;  1UX6 A;  4DUV A;  3LDK A;  3WDU A;  3JD7 1;  3ZYF A;  2ZGP A;  1H30 A;  2A3Y A;  4LOS A;  5K0U A;  1FOD 3;  5J3U A;  4DZG A;  1CIW A;  1DU3 D;  1RUG 3;  1W6O B;  2EVX A;  2O8Q A;  4HVO A;  3OJB A;  4MOA A;  5LA2 A;  4QPY A;  3PIG A;  1VE0 A;  1OA3 A;  1VBB 1;  2DU0 A;  2PTM A;  4FFH A;  5E88 A;  2HWD 2;  3HT1 A;  5JXG A;  1V6K A;  3O0X A;  2A7A A;  1DHK B;  3SCH A;  3EHK A;  1V6M A;  1HRI 2;  2ZJC A;  4K40 A;  1VBE 2;  1LOB A;  5HBA A;  2HJI A;  3I59 A;  5DUV A;  1I5Z A;  1UU4 A;  5A80 A;  2ET7 A;  3I2D A;  3NNF A;  4BM8 A;  2E7T A;  2YGL A;  4BQ1 A;  1BBT 3;  2DV9 A;  2D3S A;  4QPI B;  5FZD A;  2ZX4 A;  4WM7 B;  1UPS A;  4H7M A;  1H2N A;  2TUN A;  1FAT A;  2WNV C;  1GZW B;  3WP3 A;  4TLG A;  1PM7 A;  1QKQ A;  2P34 A;  5GAL A;  3THD A;  2IUW A;  2VOK A;  3T08 A;  3U1X A;  2ZAA A;  3KLS A;  4KG0 A;  4NUB A;  3ZSJ A;  4CCD A;  1ULP A;  3CJI B;  5FY4 A;  4MGZ E;  1XSR A;  3ETP A;  2VVD A;  1FNY A;  1ZX5 A;  2VJX A;  2Q5T A;  3USU B;  1MZF A;  1VR3 A;  2BNN A;  5AC9 2;  3ILN A;  3OTF A;  1S2B A;  4PLM A;  1LHO A;  4RA0 A;  2C0Z A;  3RWN A;  1AR8 1;  2IFR A;  1V6N A;  2QTW B;  4ES8 A;  3FUQ A;  4YZ3 A;  3AL5 A;  1A78 A;  1KS4 A;  2C26 A;  4ASM B;  2GMM A;  1QDC A;  2OZ6 A;  3U78 A;  1R08 2;  2E7Q A;  4GWI A;  5CU1 A;  5LEK A;  1H1I A;  5FYZ A;  2NP0 A;  1ASJ 3;  2DFC A;  1XND A;  2V72 A;  2WS9 3;  3RI8 A;  3ZSE A;  3WSO A;  5F5A A;  3OBT A;  1NCQ B;  4OI1 A;  3MDP A;  2ZXQ A;  2H6C A;  2D97 A;  3AYD A;  1H6X A;  3O12 A;  1HJF A;  4OUL A;  2WL1 A;  3GZU C;  5C3R A;  3OPZ A;  2RS3 3;  2JDP A;  4P9W A;  1BKZ A;  3ZMN A;  4CU6 A;  3LEK A;  5FRE A;  2GZW A;  3OCP A;  4RS5 C;  4L92 A;  4CPB A;  1DBN A;  3AKS A;  1QU0 A;  4FFG A;  1VMJ A;  2BNO A;  4AI1 A;  4COW A;  4PF5 A;  3HR9 A;  4BIF A;  3IBM A;  3O1V A;  2RS5 1;  5JXH A;  4LKE A;  1X8E A;  2XOM A;  3EB7 A;  5FYU A;  1NCR A;  4O9E A;  5IAT A;  1HQL A;  4Y22 B;  1U12 A;  2D93 A;  1XXN A;  2W46 A;  4DPN A;  5LRS A;  4AI9 A;  4DXT A;  2BOI A;  1R1Z A;  1RUF 3;  1Y9G A;  2WNU A;  2RMU 2;  1UWW A;  1W9S A;  2WNE A;  1Q8O A;  2JDA A;  1R08 3;  4R52 A;  1IPK A;  4JGY A;  1H9W A;  1NLQ A;  5FY0 A;  2XLG A;  5APA A;  2W2I A;  1OUS A;  3ZYI B;  1POQ A;  4IE0 A;  4RFT 0;  1ZZ6 A;  3W20 A;  4D3W A;  4CEW C;  1Z7S 3;  2GME A;  4V2W A;  5FZI A;  4QB6 A;  3WNP A;  1BK0 A;  3MBW A;  1AR9 1;  3POE A;  4ZXK A;  4O9G A;  3O0W A;  1JU4 A;  3RVH A;  1W05 A;  1WBL A;  3AP6 A;  3DKW A;  3A7Q A;  3MO4 A;  3N7M A;  1OI6 A;  1HKD A;  4N53 B;  2NYY A;  2K0G A;  1QJX 2;  4DIN B;  2BU9 A;  1FPN 3;  2XVK A;  1VB2 A;  4Q5O A;  1HV0 A;  2W5F A;  4XUN A;  5A32 A;  1FYU A;  2D5F A;  2P5B A;  4F8A A;  5IW0 A;  1JYC A;  2Z42 A;  1CPN A;  2XUE A;  3O1O A;  4G4F A;  2F6B A;  1UYX A;  3AP9 A;  1RUJ 2;  2W1W A;  2XJS A;  2PFW A;  3PHM A;  5B2G B;  3PVB B;  3K3O A;  3NV3 A;  2TBV A;  4R9B A;  3OEB A;  5D8A B;  4AK3 A;  4EQV A;  4L97 A;  4WV8 A;  4JZR A;  2A3W A;  3POS A;  3GAL A;  4Q2F A;  5GLZ A;  5FO8 B;  1JMU B;  3BPS A;  3IKW A;  4CP9 B;  3M3O A;  2FMD A;  5FUI A;  1SG3 A;  5LCW L;  3RZZ A;  4A45 A;  1US2 A;  4M4P A;  4JGY B;  1NLR A;  3VBO A;  1CX4 A;  3MW2 A;  3ZSL A;  3O1M A;  4Q8L A;  4GIQ A;  2VNR A;  4U2A A;  5ACA 1;  5DMY A;  5KBF A;  2YDE A;  3WG2 A;  1OHF A;  4EV0 A;  3WOG A;  1XBF A;  1QXJ A;  5H9Q A;  3VBH A;  5CFC C;  2VZV A;  3MHZ A;  4A3Z A;  2HH9 A;  2A6W A;  4CDX C;  3JBG 1;  4EYU A;  4Q4W 1;  1H2M A;  2XQR A;  4ZXE A;  1D7P M;  3RZK A;  3IN9 A;  2HBU A;  3BCW A;  4BCU A;  1NLS A;  5F3G A;  3VDD C;  4P02 B;  5FZO B;  1RUI 2;  2WDB A;  4U36 A;  1V6I A;  2BEO A;  3R05 A;  3WF4 A;  3OEA A;  4AQ6 A;  1NYW A;  3GZE A;  2O14 A;  4FPY A;  4AYU A;  4ERO A;  3M7A A;  3NRU A;  1M06 G;  1JUH A;  3RQ0 A;  1AYN 1;  4CU9 A;  3JQX A;  1NE6 A;  4A41 A;  3S0M A;  5IT6 A;  4XFG A;  3O5S A;  1YC6 1;  3HJR A;  4LUM A;  4HL0 A;  4FFI A;  3LKJ A;  2DUQ A;  2JDH A;  2ZX3 A;  1DZT A;  5GZG A;  1NQJ A;  2B9U A;  3NNJ A;  1W99 A;  1N47 A;  2VCM A;  3OYW A;  1NY7 2;  1UCX A;  4IGO A;  5A3W A;  1PGW 1;  3VN4 A;  4YAR A;  1BK1 A;  4NHY A;  4QX0 A;  1G6N A;  3ITQ A;  4FFF A;  3IIA A;  4WVZ A;  1DQ0 A;  1AYM 3;  1RUD 1;  4A7Y A;  1ODM A;  1W90 A;  2QJV A;  2ZGS A;  4MYE A;  3FL7 A;  2BGC A;  4LBQ A;  3N9M A;  4RR3 B;  1A8M A;  4DMI A;  2BOJ A;  1O8P A;  1OH4 A;  1OKO A;  4NRM A;  5J48 A;  5I91 A;  1NX9 A;  1GOF A;  2CAV A;  1RUI 3;  2E51 A;  5ERL A;  5E6H A;  1S2K A;  4IEW A;  3B9C A;  1XE8 A;  1VBD 1;  1QH7 A;  1KGY A;  1EV1 1;  1H8T C;  3R4U A;  5FZE A;  4DEQ A;  4MO3 M;  5A3U A;  2E26 A;  3ZOI A;  4Y5S A;  2AEZ A;  1CAW B;  2XBO 3;  1S0E A;  2MEV 3;  2JX9 A;  1XYN A;  2VGD A;  2ZOE B;  5JI7 A;  1JYI A;  3GF6 A;  4UW5 A;  3KHC A;  2LAL A;  5DUW A;  1BXH A;  2J7M A;  3MID A;  1VPH A;  2A6Z A;  2ZX1 A;  4D7Y A;  3VKF C;  3RZL A;  3FHQ A;  4JGZ B;  4JHZ A;  2AUY A;  2RG4 A;  4JDN A;  5BNP A;  4FXK B;  4XAC A;  4YM1 A;  4B1L A;  4Y24 A;  4HPK B;  2JG9 A;  3I2F A;  3OG2 A;  3EJK A;  1WW6 A;  4UBG A;  4HSL A;  1BMV 2;  1WA4 A;  3T2P A;  3H7Y A;  3GZT B;  2L9L A;  2DDU A;  3ZXD A;  2JDN A;  2R1D A;  1AXZ A;  1UN1 A;  1WCD J;  1PHM A;  1O4Y A;  2G9G A;  2GSY A;  4COV A;  4BU2 A;  1PK6 C;  4XJW A;  1D4M 2;  3T2O A;  4YNI A;  5FWE A;  5ANN A;  2ZZJ A;  4PQ9 A;  3J9S A;  3WQ0 A;  5LEJ A;  1PZ9 A;  5FLJ A;  4KWJ A;  1NA1 A;  2W91 A;  4QHO A;  3JD7 2;  4N9I A;  1DZR A;  3LWC A;  4CP2 A;  1RL3 A;  1OOP B;  1BZW A;  2X09 A;  2LRO A;  4QXB A;  4PDW A;  1VBB 2;  2XWJ B;  3FLR A;  3ST7 A;  3RI9 A;  4ZZ8 A;  4QU1 A;  3N4M A;  3R0R A;  3LGR A;  5FKB A;  3GNE A;  1XC6 A;  4M3C E;  3WQB A;  3JQW A;  4A3X A;  4B7E A;  1MQT A;  4QKN A;  3AMM A;  4AED C;  1YXW A;  1AX2 A;  3H3L A;  4XET A;  4OVE A;  4UYB A;  4W6X A;  3ZN5 A;  4Q1R A;  5J37 A;  2RR1 1;  1OUR A;  1XB9 A;  1QJZ A;  4KI5 M;  3ZXJ A;  4ES9 A;  3GCW A;  4CDW B;  2K2S A;  4GMP 1;  5LAT A;  4AGR A;  4F83 A;  5HV4 A;  3BIW E;  3I54 A;  1AR7 3;  1O5L A;  3GBW A;  4PIY A;  4LO7 A;  2WRA A;  1CON A;  5FZ7 A;  4EN9 B;  5LRR A;  2JDZ A;  5FMD A;  1CZS A;  4BQ4 A;  3AKQ A;  4Y26 A;  3VKN A;  2W1U A;  1RMU 3;  4HAN A;  3ZPY A;  3VL8 A;  2BVV A;  1AR8 2;  1E5S A;  1QWR A;  2XKP A;  1IS5 A;  1DQ5 A;  1MEC 1;  4DNY A;  2VME A;  4O61 A;  4I01 A;  3WF0 A;  3B01 A;  4NO4 A;  1Q43 A;  4Y5Z 0;  4QQH A;  4XXA A;  5KHK A;  2VQU A;  4B4P A;  4J1W A;  4LKS A;  5C9A A;  3ZR6 A;  1DGL A;  3HT2 A;  4YVS A;  3W59 A;  5L7O C;  3VBU C;  1LOC A;  1W8U A;  4MXW B;  4R4X A;  3LE0 A;  2WO7 A;  3WW4 A;  2Y6H A;  3WDV A;  1H2K A;  1SDD B;  4CCK A;  4DIQ A;  1RIN A;  2GND A;  1PVC 3;  1JOB A;  3IAQ A;  5H9S A;  1HDK A;  2J1E A;  1WLC A;  1WD3 A;  1D2S A;  3I2I A;  5FY7 A;  1UXZ A;  4J6G A;  1MS8 A;  1F2N A;  5JZG C;  3BTX A;  3UJQ A;  3CO2 A;  4QX7 A;  4A6S A;  4YM3 A;  1EAH 3;  4DY5 A;  3KCY A;  3BOD A;  2QQI A;  3PMS A;  1SFY A;  4XXP A;  2HLE A;  3BAL A;  3RNS A;  1ZRD A;  1FOD 1;  3PIJ A;  5SV8 A;  1RUG 1;  1GOG A;  1RC6 A;  2CGO A;  4R9D A;  4XDO A;  2C9K A;  2ARA A;  3RYP A;  4ATE A;  1X33 A;  4HZF A;  1SDW A;  2ID4 A;  4LHN A;  2IXI A;  3VB9 A;  4XF4 A;  1WME A;  4H2A A;  3ZSK A;  5A6X A;  3E5U A;  2H0V A;  2FDJ A;  3D0J A;  2UYA A;  4GWN A;  1RIR A;  1FX5 A;  1HLC A;  2WZR 1;  2WO1 A;  1AF9 A;  2X10 A;  5A7P A;  3USS A;  3ZN4 A;  1UXX X;  1W2A X;  1YWK A;  3III A;  2ZTN A;  1IQA A;  3TEW A;  4GJY A;  4GAL A;  2CU5 A;  2Q8D A;  1ULF A;  2A73 B;  4QKD A;  1BHG A;  5KXD A;  2XJV A;  4RQP C;  1XU1 A;  1AR9 2;  4KNC A;  1LGN A;  3BYW A;  2UYB A;  3B93 A;  3LFI A;  3ZX7 A;  4BK4 A;  4Q8K A;  5FY5 A;  2D3P A;  4G3Y C;  3EXU A;  1YQC A;  2VU9 A;  5DN2 A;  3WD5 A;  5GLT A;  5T5P A;  1IPS A;  4M00 A;  5JIA A;  1O8S A;  2W87 A;  3WP5 A;  2ZGQ A;  1KFX L;  2XH6 A;  1W6M A;  1IOA A;  1SLB A;  2D40 A;  4I0A A;  1LOF A;  4D6S A;  2O0O A;  2CHH A;  4JDM A;  5BUV A;  4I0W B;  2JIC A;  2BZD A;  2GN7 A;  1ASJ 1;  5I0R A;  2WS9 1;  4NPR A;  3I3M A;  5A7O A;  2RHP A;  4FTS A;  3NKG A;  1B35 B;  5FPU A;  4CU7 A;  3H8X A;  2I07 B;  2VXR A;  1PO2 1;  3T09 A;  3U37 A;  1HXS 1;  5F2W A;  1C8N A;  1PGS A;  1Q8P A;  5FZA A;  1FNZ A;  5L73 A;  4HVR A;  4E4H A;  3QLQ A;  2A6V A;  2RS3 1;  3VKL A;  3D8C A;  2Z69 A;  4FOY A;  3EQE A;  3VBF C;  3CF6 E;  3PU8 A;  1GBG A;  1ZZ7 A;  3O14 A;  3GDB A;  4JTO A;  1SCR A;  1Y9Q A;  4HXC A;  5FZM A;  4A42 A;  5ACA 2;  1D2Q A;  2CDP A;  4JKK A;  2WT0 A;  3LSE A;  2ZGO A;  2WZP P;  3DCQ A;  3RJR A;  2NPI A;  3PDQ A;  1UW8 A;  2BGO A;  5A3O A;  4NWW A;  2B46 X;  1LHW A;  3JBG 2;  2W39 A;  5DAW A;  1UOJ A;  2OPW A;  1RUF 1;  4MHR A;  1WCU A;  2RS1 3;  1GWM A;  5F8P A;  2ORX A;  5F5I A;  3I7D A;  3RJ2 X;  4CRQ A;  1IS6 A;  1F31 A;  2HWC 3;  2ZHN A;  2JDU A;  1GYK A;  1LGB A;  1W6M B;  2BNM A;  3MGU A;  3KVB A;  1AYN 2;  2VPV A;  3P5B A;  1NT0 A;  3QOP A;  1CX1 A;  5B4X A;  2A6X A;  1LR5 A;  5J36 A;  1Z7S 1;  4QGM A;  5H9R A;  1GNY A;  4GXL A;  1LOA A;  4XFC A;  4GH4 C;  3J26 N;  1CZT A;  2HWF 2;  4QQL A;  3DPR C;  2A70 A;  1G7Y A;  2ARX A;  3D5O A;  1ND3 A;  1OMI A;  5FPL A;  1DGW X;  2I45 A;  4DOU A;  4OQ9 A;  1FPN 1;  1PGW 2;  4P9I A;  4HSJ A;  4ISQ A;  4XDP A;  1RUD 2;  2UY8 A;  1WW5 A;  2JXA A;  3LA7 A;  1VAM A;  5HCH A;  1XOY A;  3BTZ A;  2DTW A;  4BQY A;  5DAB A;  3PUS A;  3V0B A;  2YGM A;  4P9G A;  1REF A;  1TEI A;  3JBG 3;  3PUA A;  2PQQ A;  3CU7 A;  4RSU A;  3MLJ A;  4AXO A;  5HCA A;  1S0J A;  1ZZ9 A;  1JU3 A;  1LCL A;  2HEV F;  4GAZ A;  2VOV A;  1WMX A;  4MGS A;  1VBD 2;  1EV1 2;  2WII B;  4M3C A;  4S2H A;  2DCJ A;  4QQP A;  1SBE A;  3H0O A;  1YRZ A;  5JMO A;  3FLP A;  5T3N A;  4AQT A;  4BLJ A;  4LHK A;  3U07 A;  4RD7 A;  3ZMO A;  4FPL A;  4A4A A;  4HK8 A;  4E4D X;  3K77 A;  1MS5 A;  1C57 A;  3W5N A;  2HWF 3;  2Q1F A;  3AX4 A;  4XW3 A;  1O5U A;  2V5D A;  1ENX A;  2I2S A;  3C7G A;  4Q4X 2;  2GNB A;  5BXX A;  2VOX A;  3HBK A;  4LOT A;  4FSJ A;  3GBG A;  3P1I A;  2WNV A;  2ES3 A;  4KU8 A;  2F4P A;  3HOB A;  1N3Q A;  2CY6 A;  5A7Q A;  2R1B A;  1UY2 A;  2NN8 A;  4UW4 A;  5CYY A;  5KHJ A;  3M2M A;  1UMZ A;  4CP0 A;  3HN1 A;  3KMH A;  1DZQ A;  2R04 3;  1IZ3 A;  2WZE A;  4MV2 A;  5HCB A;  2XJU A;  3FZ3 A;  3LF7 A;  4MET A;  3V0B B;  5A6Q A;  4AHZ A;  2EIC A;  2C5D A;  4BHP A;  1SBF A;  5LBE A;  2Y6G A;  1UY4 A;  2WUH A;  4YZ5 A;  5C3Q A;  3BI3 A;  1CJP A;  1IS3 A;  4IEU A;  1VBD 3;  3VZO A;  1EV1 3;  3MI8 A;  2VCA A;  2XON A;  1UQX A;  2B5H A;  4TSV A;  2YBP A;  3RZJ A;  2UWA A;  5F3C A;  2R06 1;  3ECQ A;  2H0B A;  3SCF A;  4LXL A;  3UL2 A;  1OT5 A;  3POF A;  5IK5 A;  4M3C B;  2W95 A;  1AYM 1;  3ACF A;  3FFQ A;  3OBR A;  2ZMK A;  1TE1 B;  3Q8F A;  2BQP A;  4Q4X 3;  4YYO A;  4XTP A;  3ZYP A;  4E8D A;  1R09 3;  2BP6 A;  5LB6 A;  1O59 A;  1B09 A;  5C8C C;  2O8O A;  4FOQ A;  3IAP A;  4HET A;  3IPV B;  1ZZC A;  4LPL A;  4RS5 A;  4CCL A;  4FP2 A;  3UK9 A;  5IK4 A;  1CPM A;  5EJZ B;  3PNA A;  1AXK A;  2EIG A;  4AF9 A;  1OSG A;  4P9L A;  5CG8 A;  5BNQ A;  4LOR A;  2WNV B;  2RR1 2;  2QE3 A;  3DGT A;  3K48 A;  1LOE A;  4HLT A;  1K12 A;  4N7I A;  3MFC A;  4IEP A;  1TQ5 A;  4EWA A;  1U5I A;  3RFR A;  2XBO 1;  4AEJ A;  4D0Q A;  3MF9 A;  2MEV 1;  2OT7 A;  3FFZ A;  4N43 B;  4MHU A;  5ABJ C;  1EP0 A;  1OA2 A;  2ZGN A;  3SQO A;  4BK5 A;  4AW7 A;  2VOT A;  2DVF A;  4URA A;  1DFQ A;  3VHR A;  2PHL A;  2VBP A;  4IET A;  2QQM A;  1K5M C;  4YW3 A;  5FYB A;  5DXD A;  3QH7 A;  1YJK A;  5E8A A;  5F9T A;  1QJY 2;  4L0P A;  1JHJ A;  3DL3 A;  4OI2 A;  4EJR A;  1MEC 2;  1E5I A;  1Q5O A;  2WO2 A;  2Y8K A;  3I3E A;  1FT9 A;  5HV0 A;  3OUI A;  3O1U A;  4KMQ A;  5IVY A;  3MV0 1;  2OQ6 A;  2B45 X;  3KQR A;  5FMC A;  4E4Z A;  2D6L X;  4YVW C;  4L99 A;  1F5F A;  1KDM A;  1W6Q B;  2VUD A;  2ZAC A;  3D0S A;  1ZBE 1;  4GQ7 A;  3JB8 A;  4QPG C;  1S1A A;  3CZU A;  1P8J A;  4RL7 A;  1OD5 A;  3IZO A;  4ZU7 A;  3ZFE C;  1NXD 1;  2RR1 3;  3PUQ A;  4W65 A;  3VBR B;  5DZE A;  1O3Q A;  2UY9 A;  1EPZ A;  3NJZ A;  4PF1 A;  4IGP A;  2W92 A;  3ZYR A;  4NN0 A;  1MZ6 A;  3MLK A;  2YG0 A;  4M0H A;  5EPA A;  1F8V A;  4PCR A;  4BE3 A;  4OHY A;  1N3P A;  1FOD 2;  2VZO A;  2QUO A;  1RUG 2;  1W8Z A;  2QQN A;  2ZEX A;  3SNM A;  4OHW A;  3DEM A;  2PLV 2;  4QX3 A;  2Q4S A;  3ZN6 A;  1HQN A;  2D5H A;  3VDA A;  1YNA A;  2GMP A;  4H14 A;  2W9X A;  4D94 A;  5T52 A;  1VLN A;  2ZX0 A;  5CFD C;  1QJY 3;  1XYP A;  1LED A;  1LEN A;  1J1L A;  1RED A;  4LR4 A;  1MEC 3;  2VQA A;  2WZR 2;  1FAY A;  3AFK A;  4BB3 A;  1CD3 G;  5GZC A;  3RWK X;  5JSP A;  3ALQ A;  3WDT A;  5CG9 A;  4IEO A;  3I2J A;  1HB4 A;  3AXE A;  3I4I A;  3UKV A;  3H8U A;  3PJQ A;  2PN5 A;  1HW5 A;  1WW4 A;  3KV9 A;  2ARE A;  4IND A;  4QDQ A;  5GZE A;  4C8D A;  5CFC A;  2V5Y A;  1BQP A;  1AR7 1;  5E16 A;  3VD4 A;  3KCC A;  2X53 S;  4S2D A;  1U0A A;  3VDD A;  3ES1 A;  2OII A;  3KHB A;  5DUU A;  3LZZ A;  4XPV A;  2TNF A;  2YPJ A;  4IQP A;  3POY A;  3ZFG B;  5BNN B;  1RMU 1;  3I3D A;  3SIT A;  1FMD 1;  1UZZ A;  1NKG A;  3Q8B A;  3BVC A;  5FK8 A;  2ZEY A;  4AQ2 A;  4WM8 C;  1WW7 A;  1Y3T A;  4JCK A;  2PLV 3;  4CEY C;  2B39 A;  1CZV A;  3CKH A;  5F1R A;  4FPE A;  4XIO A;  3U4X A;  1ASJ 2;  1GKB A;  4Y1Y A;  1H2L A;  2WS9 2;  2JD9 A;  5JOX A;  1U5Z A;  3HNY M;  5I0U A;  4MUV A;  3VD3 A;  1MS4 A;  4FAG A;  1JZ6 A;  3ZN6 B;  2FCU A;  5IK7 A;  1QF3 A;  1UAI A;  1PO2 2;  1AXY A;  1HXS 2;  4WBB A;  2WZR 3;  1BEV 1;  4ISR A;  1QJU 3;  4LIT A;  4BPZ A;  1PVC 1;  1SPP B;  4K20 A;  2RS3 2;  3BPZ A;  3WW3 A;  2XR4 A;  4LUL A;  1YUD A;  3WEZ A;  4HVQ A;  4XUR A;  2YZ4 A;  3VGI A;  3I2O A;  2BV4 A;  1EAH 1;  3TWI A;  1CIY A;  2YRO A;  1J59 A;  1ULO A;  1UU5 A;  2DYC A;  2W52 A;  2YFZ A;  3KQ4 B;  4X6R B;  2YMZ A;  3HQR A;  4NII A;  5BNO B;  5CFC B;  1IHM A;  3T4H B;  5FFO C;  1SEF A;  4XIK A;  4XHB A;  4CYD A;  3HBZ A;  5FZG A;  1JS9 A;  1GAN A;  2FQP A;  3VZM A;  2OYZ A;  2EXI A;  5DG2 A;  2JG8 C;  4AFC A;  1ONA A;  1H8T A;  1W03 A;  2B7Y A;  2OUH A;  3X29 B;  1RUF 2;  5IHR A;  3MIE A;  4WVM A;  3T4V A;  4W6W A;  5J1X A;  3PU3 A;  1OLM A;  2RM2 1;  4LNV A;  5K8S A;  3AM2 A;  2WYS A;  2Q1M A;  4XFI A;  5GZF A;  4E2G A;  5K0U B;  1JOD A;  4J1X A;  4XDQ A;  3CIH A;  4W6Y A;  2ZBJ A;  4CCM A;  2ZHK A;  5HXM A;  4CU8 A;  3R4D B;  1XSQ A;  1Z7S 2;  4GMP 0;  3LOB A;  1LES A;  1PO2 3;  1OH3 A;  1QNY A;  1HXS 3;  2P4E A;  2WFP A;  3LSD A;  4B1M A;  5LBF A;  4XQW A;  2XLF A;  3DUI A;  3CMG A;  3I59 B;  3AP7 A;  1JI6 A;  2OPK A;  4XMA A;  4K8R B;  4Y20 A;  1RUC 3;  5JMC A;  1FPN 2;  5DQ0 A;  4NAO A;  3ZM8 A;  5FP4 A;  5FZF A;  1PK6 A;  1IKP A;  1CR7 A;  1ENQ A;  3ZFF C;  4JV4 A;  1GOH A;  3HD8 B;  4ZPI A;  2JEM A;  4FAH A;  3N36 A;  1VMF A;  5FYC A;  2OW4 A;  5KXB A;  3QBQ A;  4XCB A;  5FBZ A;  3FN9 A;  4B4Q A;  3GBF A;  2GC1 A;  1OA4 A;  2NLR A;  1J1T A;  2DUO A;  3OGG A;  3CBN A;  5LBC A;  1AX0 A;  1RXF A;  5ANQ A;  4CUG A;  1PM4 A;  2WA3 A;  5BV6 A;  2VO5 A;  3H42 B;  1OKQ A;  1ZYB A;  5FQ0 A;  3ZIW A;  3H1W A;  3TB0 A;  3VV1 A;  1DQ1 A;  5A3M A;  5KXC A;  1LUL A;  4BA6 A;  3ZR5 A;  4XJ9 A;  3NJX A;  5DUX A;  2BVB A;  4QKB A;  4GKX A;  4L8Q A;  4LQR A;  2BWC A;  5K4L A;  3THT A;  4TYS A;  4QGL A;  3K4D A;  2YFU A;  4TZD A;  3NAP C;  2ZCW A;  3PUH A;  2QNK A;  3ILF A;  4AED A;  4LK6 A;  2JE7 A;  1N1T A;  4QDR A;  2YHJ A;  3LEG A;  3PME A;  1QOS A;  2VXJ A;  2HYK A;  2VNV A;  3AKR A;  2B4K A;  3CJX A;  1ZRR A;  1NAE A;  2OXB A;  4IV3 C;  4Y20 B;  1XE7 A;  2RS1 1;  2AYH A;  1GNZ A;  2DVA A;  3AZZ A;  4JX0 A;  1WD4 A;  1MVQ A;  1XNK A;  4XF1 A;  2HWC 1;  3ZKU A;  2JDK A;  1IS4 A;  3MPB A;  5FXW A;  1NCR B;  1V0A A;  1GU3 A;  2AZ5 A;  4EWD A;  2ZAH A;  3OGS A;  2WR9 A;  3KGZ A;  2YB7 A;  3OB8 A;  3ZLI A;  3AMP A;  5JR2 A;  2WNU B;  1XYO A;  2V4A A;  3K4A A;  3RYR A;  3WDW A;  2R06 2;  1QDO A;  1E5H A;  2B9V A;  4LKF A;  1H9P A;  1RYY A;  1L7Q A;  5DAP A;  5GLV A;  2OUJ A;  3VBU A;  1GV9 A;  1HN0 A;  3VZN A;  5L7O A;  2MNG A;  1AYM 2;  4G9S B;  3KV4 A;  1GUI A;  1V00 A;  2W3J A;  5E1R A;  5JPM B;  3J4U H;  3M4F A;  1E5R A;  4MG2 A;  4QXK A;  3OPW A;  4JAA A;  2LTN A;  1W0O A;  1JHN A;  5FZC A;  3WHT A;  1I1E A;  5IK8 A;  3HIF A;  3DN7 A;  5LA0 A;  5JZG A;  3N35 A;  4AED B;  2DVB A;  1VB4 A;  3B02 A;  4Z82 A;  3AJY A;  2R16 A;  2VUA A;  4AI8 A;  4EWE A;  4FQZ A;  1AVB A;  4RYD A;  5FPA A;  5A32 B;  1JZ3 A;  3ZXA C;  5CZK A;  4UT5 A;  4XHX A;  4AVT A;  2PXJ A;  1OC1 A;  2RE9 A;  4JKL A;  2LM3 A;  3WX5 A;  5C3O A;  4W4Z A;  2XBO 2;  4PI0 A;  3APB A;  2MEV 2;  5FYH A;  4KBZ A;  3H1Y A;  1HRV 2;  4NHL A;  1REE A;  1HQW A;  3CJI C;  3O0V A;  2ENR A;  3P3N A;  2XJP A;  5A70 A;  1ZVF A;  3DXT A;  2HWF 1;  1S0B A;  4IE6 A;  4CDU C;  2GNT A;  2Z5W A;  4HKO A;  1Q56 A;  1ODN A;  2R06 3;  4JTN A;  5EYX A;  2D6O X;  4DUX A;  2JEN A;  2XXZ A;  5FMO S;  4XZP A;  2J1R A;  3GGL A;  3J7H A;  4QQO A;  3OY8 A;  1PIV 3;  3GM8 A;  4L2N A;  4PBO A;  5C5U A;  5IVC A;  2YYO A;  4GKY A;  1ACC A;  3UV9 A;  1JZ4 A;  4MH0 E;  4BQ3 A;  4IE5 A;  3LOI A;  4XAA A;  3VBO B;  4OI0 A;  3NQH A;  2BTV C;  2EIB A;  1ZA7 A;  2Y38 A;  2Y0O A;  1PZ7 A;  2BJS A;  2QDN A;  5FP7 A;  5AFE A;  2R04 1;  5LY2 A;  1NCQ C;  1CAV A;  1ZBE 2;  4QDS A;  4RGA A;  1Q3E A;  3VBH B;  1QXR A;  4LBJ A;  1RHI 3;  5FK7 A;  4B8E A;  1TG7 A;  5IYY A;  1VAL A;  2BFU S;  2VVF A;  2PAE A;  5F2S A;  4ARY A;  5I8T A;  5BPX A;  4ZY9 A;  4Z07 A;  1AL2 3;  4Q4V 3;  4PIX A;  4S2F A;  3PUR A;  4IL7 A;  2XL9 A;  5JOZ A;  3M70 A;  4QM9 A;  2D43 A;  5JI9 A;  2J1S A;  1HRV 3;  1CVN A;  3HVD A;  3ZSM A;  3QCW A;  2CAU A;  3ZDS A;  5FR3 A;  1CQ9 A;  1JOP A;  4XBN A;  3SKV A;  2ZX2 A;  5FMO L;  4Q4X 1;  3VD5 A;  4CXX A;  1R09 1;  3VD9 A;  2CGP A;  3VBF A;  1DGR A;  5HXV A;  5GLU A;  2WFF 1;  2YC2 A;  4K1Y A;  5LA9 A;  3MLL A;  1H0B A;  4IEQ A;  3OYW B;  4XYX A;  3SH4 A;  2PMW B;  2R07 3;  4KL1 A;  4Z2W A;  2IXK A;  2X8K A;  3W21 A;  5IVV A;  4FPJ A;  1UU6 A;  4E2Q A;  4XJA A;  3VLB B;  4AZZ A;  1DLL A;  3HN3 A;  3OY8 B;  1DCS A;  3LCP A;  1EPW A;  1W2T A;  1NE4 A;  3MIB A;  2AH2 A;  5FXX A;  1IG0 A;  4PHZ A;  2BFU L;  1ZBE 3;  4XBQ A;  1AR7 2;  1CES A;  4HBN A;  4Q0U A;  3IDB B;  4X6Q B;  4LBQ B;  4XUO A;  2J22 A;  1RXG A;  2P3I A;  4Y4R A;  5FZB A;  5FCC A;  1MPX A;  2YU2 A;  4AI3 A;  4BME A;  3LFM A;  4N53 C;  5A7S A;  4FOV A;  3GJA A;  4ZZ5 A;  1RMU 2;  1RUN A;  4KU7 A;  1FMD 2;  4LA3 A;  1I5P A;  4FXG B;  3L2Y A;  5FBJ A;  3O1P A;  1XNC A;  1NXM A;  3AZY A;  1UYP A;  5A7W A;  5IAV A;  1GP6 A;  3C7H A;  4P08 A;  4YZ2 A;  4GH4 A;  3MUZ 1;  2GC0 A;  3DKQ A;  3DPR A;  5K9Y A;  3U0Z A;  5KXE A;  1ZA4 A;  1PX4 A;  2DVG A;  2E53 A;  2YV8 A;  5D8A C;  5LW9 A;  1COV 3;  2E9Q A;  3EBR A;  3TEY A;  3C7F A;  1BEV 2;  2ILM A;  1S4C A;  5LAS A;  1PVC 2;  3WT3 A;  4H55 A;  4XMI A;  5BNP B;  4NJ4 A;  2JG9 B;  4X8N A;  2FCV A;  3ABZ A;  4IV1 C;  5GKA C;  1U5X A;  1EAH 2;  3FUO A;  2X05 A;  2E63 A;  3TNP B;  1C5H A;  1DQ6 A;  1KJR A;  4QAW A;  5AVA A;  3ZIX A;  3ZXG A;  4Q4Y 3;  2RJL A;  3WW2 A;  5LBB A;  4YW2 A;  3WNN A;  3IT8 A;  1YQ5 A;  1VAV A;  3S7E A;  5GM0 A;  1DYK A;  3RMY A;  4XC9 A;  1HIX A;  2J1U A;  2Y0I A;  1FMD 3;  4XQD A;  4D7T A;  3O1S A;  1QJY 1;  1W6N A;  3VUO A;  1ZNP A;  3UGH A;  3WCS A;  2RM2 2;  1NA1 B;  2C1F A;  5JXJ A;  3ZYG A;  2BER A;  4MGY E;  2AC1 A;  3WNO A;  4XFA A;  1JN2 P;  4PDW B;  4QB1 A;  4AHY A;  2IXJ A;  1C3H A;  5D2A A;  1W8H A;  1X82 A;  2NZ9 A;  4XCA A;  2VCC A;  1RJ8 A;  1LNS A;  1BEV 3;  2YC0 A;  3DPR B;  4QX8 A;  4QD2 A;  1DG6 A;  5DAX A;  1V9U 1;  5FUP A;  1MQT B;  2VBD A;  2HWB 1;  4UF0 A;  4CUB A;  1VBC 2;  1OLR A;  5M0T A;  3ME2 A;  2VUC A;  1POV 1;  4AEM A;  4BXF A;  4Q0S A;  1YO8 A;  1F35 A;  2ZHM A;  5KR7 A;  2ADD A;  4N90 A;  1SLC A;  4RHV 3;  1QQP 2;  2YY1 A;  1SLI A;  2PLV 1;  3RDI A;  3LIH A;  4ZU4 A;  2ORZ A;  3AXD A;  3HAG A;  3MIF A;  3VBS C;  4RR3 C;  5JSO A;  3GYD A;  4LBL A;  3SH3 A;  1DF0 A;  1KJL A;  2RM2 3;  2VH9 A;  4PLN A;  4JRL A;  1QJU 1;  3IWZ A;  3SMH A;  1TME 1;  2VQT A;  4COY A;  3OOX A;  1GQP A;  3G7D A;  3LAG A;  2Q1Z B;  3ACI A;  3A21 A;  3C8X A;  2DBN A;  3BOP A;  3MFA A;  3SIS A;  4A7Z A;  2JD4 A;  1XNB A;  4FPO B;  4PI2 A;  4RGG A;  2W1S A;  5C8C A;  4AVC A;  2WAA A;  5C9A B;  4YVS B;  4BOW A;  2W94 A;  3J8F 3;  3URF A;  4AI0 A;  4BQ2 A;  4UWD A;  5C70 A;  1KRI A;  4Q1P A;  1VBC 3;  1UZ0 A;  2WBK A;  3EYP A;  4AAP A;  1WZX A;  4NWV A;  4JGZ C;  4MGQ A;  4V2V A;  4XVH A;  2OZJ A;  2HWE 3; 
#chains in the Genus database with same CATH homology
 3AL5 A;  5FP3 A;  5FYT A;  3ZLI A;  5FXV A;  3U78 A;  4CCL A;  3U4S A;  3PDQ A;  4LIT A;  5FYZ A;  5FZ7 A;  4QXC A;  5FBJ A;  5CEH A;  5F5A A;  5A7W A;  3LD8 A;  4CCN A;  3DXU A;  3KV4 A;  3AVS A;  2OX0 A;  5F5I A;  5FY8 A;  3OPW A;  5F39 A;  4HON A;  3UYJ A;  4IGO A;  2GP5 A;  5A3W A;  5LW9 A;  5FZC A;  2OT7 A;  3KVB A;  3KV6 A;  4EZ4 A;  5FPB A;  5FZG A;  2XML A;  2WWJ A;  5FPA A;  4URA A;  3N9M A;  4DIQ A;  3PU3 A;  4UF0 B;  4Y3O A;  5FYB A;  5FZ8 A;  5FYU A;  2PXJ A;  5F32 A;  4CCK A;  4CCO A;  5FZO A;  4GJZ A;  5FUN A;  5FY1 A;  5FPL A;  5FY7 A;  5FYH A;  4CCM A;  4AI9 A;  2YBK A;  4XDP A;  4EZH A;  2XDV A;  4QX7 A;  5IVY A;  2VD7 A;  2OQ6 A;  2GP3 A;  5E6H A;  5FZE A;  4BIS A;  3DXT A;  5A7N A;  5FJH A;  3PUS A;  5FY0 A;  5FZL A;  4IGQ A;  2W2I A;  3K3N A;  2Q8C A;  5A1L A;  3N9O A;  3NJY A;  5FZ0 A;  4XDO A;  2XXZ A;  3AVR A;  3PUA A;  4QXH A;  5A1F A;  3N9Q A;  4Y33 A;  5FZ6 A;  5FZ3 A;  5IVC A;  3N9L A;  4V2W A;  5FZI A;  5IVF A;  3PUQ A;  5IVB A;  2YU1 A;  4IGP A;  5FP4 A;  4GAZ A;  5FZF A;  3RVH A;  3LDB A;  5A7P A;  5FP7 A;  4QX8 A;  5FZ4 A;  5FYC A;  5LY2 A;  4ASK A;  5FUP A;  5F5C A;  4CCJ A;  5ISL A;  2OS2 A;  2P5B A;  2YBS A;  3KV5 A;  4HOO A;  5FZ9 A;  5FV3 A;  4UF0 A;  5IW0 A;  4GJY A;  2XUE A;  5FP9 A;  5F2S A;  2Q8D A;  5LY1 A;  5A3P A;  5ANQ A;  4BXF A;  4CUG A;  3K3O A;  5FYY A;  4TN7 A;  4BU2 A;  2Q8E A;  5KR7 A;  3PUR A;  5FXZ A;  5FY5 A;  5FY9 A;  5FYI A;  5FWE A;  4QWN A;  3AL6 A;  4D6Q A;  3ZPO A;  3N9N A;  5K4L A;  3N9P A;  3KV9 A;  3PTR B;  5A7Q A;  5A80 A;  4C8D A;  5F3E A;  5FYS A;  4D6S A;  5A7W B;  4LIU A;  5IVJ A;  5FP8 A;  1VRB A;  5FZD A;  4QXB A;  4D6R A;  5A3T A;  5A7O A;  2OQ7 A;  4QU1 A;  5FWJ A;  5IVV A;  5LWB A;  5FZH A;  5FPU A;  5IWF A;  5F3I A;  5FPV A;  2YPD A;  4NUB A;  5F2W A;  5FZA A;  5FY4 A;  5FXX A;  5IVE A;  2YBP A;  4CSW A;  5FYM A;  4E4H A;  5F3C A;  4GD4 A;  4LXL A;  5FXW A;  4DO0 A;  5A3N A;  4EYU A;  4LIV A;  2WWU A;  5FZ1 A;  4Y4R A;  5FYV A;  3OPT A;  3PU8 A;  5F3G A;  5FZK A;  5FZB A;  4AAP A;  5FZO B;  4V2V A;  3K2O A;  2YU2 A;  5FZM A;  3KVA A;  5F37 A;  5FJK A;  5A7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...