3OOXA

Crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
307
structure length
305
Chain Sequence
b'TSAIDPVSFSLYAKDFTRFAQELGASFERYGFAVLSDYDLDQARIDAAVDSAKAFFALPVETKKQYAGVKGGARGYIPFGVETAKGADHYDLKEFWHMGRDLPPGHRFRAHMADNVWPAEIPAFKHDVSWLYNSLDGMGGKVLEAIATYLKLERDFFKPTVQDGNSVLRLLHYPPIPKDATRAGAHGDINTITLLLGAEEGGLEVLDRDGQWLPINPPPGCLVINIGDMLERLTNNVLPSTVHRVVNPPPERRGVPRYSTPFFLHFASDYEIKTLQNCVTAENPDRYPESITADEFLQQRLREIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative 2OG-Fe(II) oxygenase family protein
publication title Crystal structure of a putative 2OG-Fe(II) oxygenase family protein (CC_0200) from CAULOBACTER CRESCENTUS at 1.44 A resolution
rcsb
source organism Caulobacter crescentus cb15
molecule tags Oxidoreductase
total genus 91
structure length 305
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 3ooxA00
1OC1A 5C3QA 1W3VA 1UZWA 1GP6A 2WO7A 1UOFA 4XAEA 1W2NA 2Y60A 3ON7A 5APAA 1RXFA 1BLZA 1W9YA 5C3OA 2IVIB 1DCSA 1HB3A 1GP5A 5C3SA 2BU9A 2VBBA 1BK0A 1GP4A 1E5IA 1UO9A 1RXGA 2VBPA 1HB1A 1W05A 1HJFA 1ODNA 1IPSA 2BJSA 1W28A 3OOXA 1UOBA 1QIQA 2JB4A 1QJFA 1UNBA 1HB4A 2VAUA 1W06A 2DBNA 5C3RA 1OBNA 5C3PA 2Y6FA 1E5HA 2DBIA 1UOGA 1ODMA 1W03A 1HJGA 2BRTA 2VBDA 3ZOIA 2VCMA 1W2OA 2JB8A 1W3XA 2CSGA 1E5SA 4RGKA 1HB2A 1W04A 1QJEA 2IVJA 4BB3A 1WA6X 3ZKYA 1W2AX 1E5RA 3ZKUA 2VE1A
chains in the Genus database with same CATH superfamily
1JU3A 1AXZA 3PVNA 5C3QA 4QPGA 1VAKA 2RS33 5A7WB 1J1LA 5FRAA 2D6PA 1YWKA 2QKDA 3POEA 1PGW2 3WZ1A 4Z92B 5KC5A 2DCJA 3Q8BA 1QJU1 4IEYA 4XC9A 3TEXA 2PAKA 2G4IA 3AK0A 3AZWA 1XOYA 4W6YA 3WT3A 4AW7A 4GIQA 1XPWA 4IV1C 3ATGA 4BCUA 3F2ZA 4YVSC 4EV0A 4FCAA 4DUXA 1HXS3 1UY4A 2XG3A 2J7MA 1AL23 1V9U1 3IIIA 1K12A 2J1VA 3FE5A 4NRMA 1LTEA 2DTWA 3OCPA 5A3TA 2BBAA 5LK7B 1H2MA 1VIWB 3ME2A 3RYPA 1QJU2 5A70A 4KWJA 3MIEA 1AXKA 3IWZA 1UZZA 4XFFA 5JMCA 3U11A 3BU7A 3LB9A 4WVMA 3ZYGA 1RUG3 4P9WA 4BQXA 3RYKA 1HQLA 1PO21 3FC0A 2WSUA 4MGZE 5JSPA 5KXEA 4XOGA 1V9U2 4GH4C 5IK4A 2VH9A 3KLSA 3C8XA 2EIEA 5LEKA 2HWC3 1W6QA 4KWUA 2V5DA 2VPVA 2Y38A 1HV0A 1OSGA 1Z0HA 1RJ8A 3OYWB 3JB4C 4NUBA 2WFPA 5A32B 2IXKA 4FTSA 4FTBA 1YIPA 4LO8A 2C0ZA 5EWSA 2XL9A 2WR9A 5JOWA 2WLQA 3NQHA 5LA9A 4Y22A 1PO22 1EYBA 4CDQC 2HJIA 3IM0A 5BNPA 5KWRA 5T5JA 2WZPP 2GC0A 3BALA 1MS9A 2VQ0A 4PLMA 1LOGA 2ZGRA 1QHDA 3EQEA 5E16A 3WNXA 5F1RA 4FQ4A 4GAZA 4CCKA 2AZ5A 1DIWA 2C4XA 3OBAA 1VBC1 1KS4A 4EJRA 4BJ0A 3IIAA 4FPHA 3KWVA 4N8MA 2CHHA 2WBKA 3T2OA 4ZHNA 4PDWA 4K1YA 4Q0QA 2XJUA 5F2SA 5I0UA 5L7OA 1U5XA 2RDQA 4LT5A 1PMHX 1LEDA 4R9AA 1ODMA 5CVRA 5F2WA 4BIOA 1CAXA 1VB2A 1VBC2 4OQ9A 2CY6A 3OUHA 2A70A 2MPFA 3N36A 3KZ4C 1CAWA 4YGCA 2A6VA 3FBYA 3MV11 4NJ4A 4XFHA 1J3QA 3H1YA 4GB33 5CG9A 3E5QA 4JQTA 1REDA 2WA3A 4LORA 3UT0A 3TNPB 3SEPA 4LO4B 5LRRA 5L19A 3BU0A 1K42A 4BISA 2PAMA 2HEWF 2FCUA 3AYEA 5F5IA 5A3OA 4M3CF 3CO2A 4XABA 4AE2A 1FX5A 1PK6C 4LBKA 1AR63 2JG9B 3B9CA 3I54A 3A0NA 3LEGA 1QH7A 4OMDA 4LTAA 1H6XA 3I2IA 2SBAA 4D0QA 2UY8A 4FQZA 1QJEA 2E26A 2R043 3WV6A 1O3RA 4Q8KA 1W2AX 3O1SA 3HR9A 3H8XA 2VZVA 2NYYA 1K5JA 5F7UA 4IEWA 4PJYA 2W9XA 3RZLA 1EPZA 4ZY9A 4D3WA 3U78A 4Q0UA 3OBZA 1UOFA 2WKKA 3BIEA 4L92A 1S4CA 5F5CA 5FZOA 4EE2A 3KQ4B 4AFMA 4RS5A 2JENA 2OQ7A 4V2VA 2A6WA 5APAA 4D7TA 2E7AA 2ADEA 5FPUA 3T0BA 1LOFC 4CU6A 4PLNA 5GM0A 4CCJA 3V64A 1C1LA 5C3OA 5IATA 1QXPA 5FY4A 4C1XA 4XJAA 2D6MA 2G9FA 3S5AA 4A42A 1ULEA 4N43C 2DF7A 4JTOA 2QQLA 1US2A 2ZGQA 5L73A 4NVPA 2A6YA 1GWLA 4P9JA 2RJKA 1B35C 4HT1T 2ZA9A 5H9PA 2VJXA 3KV5A 5D8AA 3HAGA 5ACA1 1Q43A 3FHIB 1I6XA 4WVVA 3AKPA 2JJ6A 4YZ2A 4P9GA 2WS93 1MQTA 3AKTA 3EMRA 3NNFA 1T6GC 3VBRA 4IV3C 3PMSA 5T3NA 2DVGA 4KI5M 4IV1B 4A6SA 3OEAA 4YVSB 1WLWA 5FYHA 1U12A 2ZZQA 1XSQA 1IPSA 3KGLA 5A1LA 2ZMLA 3J9SA 5LEJA 3ZXAC 3ZFFA 5ACA2 3E5XA 1WD3A 2D3RA 3O1UA 4NIIA 3I3DA 3VL9A 1RUJ1 1XNBA 2JDHA 4AR2A 3WG1A 3W5MA 4CDWC 3NV4A 3LWCA 2HWE3 3HBZA 3SCHA 4DY3A 2Z42A 4HKOA 5KHJA 4BIFA 3KCXA 4WM8C 5JXGA 4XQ4A 4P5YA 1V6OA 1S55A 1UQXA 1KFXL 4QGLA 5DUXA 4CUGA 5J09A 4UFKA 1M4WA 5L9VA 1LHNA 3MIHA 3AXDA 1RUJ2 1G7YA 4XDQA 2RR11 4JC1A 4AOCA 1N3QA 3AMQA 1WLDA 1OQEA 2QTWB 4N7IA 2AC1A 1WA4A 4JTNA 2JG8A 4I09A 4MO3M 4LBQD 5FY8A 5JIAA 4CDQB 4DXRA 4CU7A 3H8OA 2VMHA 3K75B 2JDMA 4GWJA 1QGLA 1BBT1 4KQ7A 1J83A 3A0KA 2PA7A 3LCPA 4OHVA 4XJ8A 2PFWA 5I93A 1S0JA 3NV1A 1Q8SA 4WZCA 2RR12 4LK6A 5FZ3A 1FOD1 4MSVA 1W3XA 2F17A 1O7FA 3CDZB 3ZVXA 3N35A 4HK8A 4LITA 2YMZA 2ZMNA 4COYA 4NIAA 2VZRA 3EHKA 4QX2A 5FYSA 2X8KA 1BBT2 1HRV3 1FNYA 2WIIB 2YBSA 1CZSA 1AF9A 1QJU3 4G4FA 1HB2A 4Q4Y1 2RV9A 5JXIA 1X50A 4DUWA 4LOSA 5FZDA 4QKDA 1SG3A 1FOD2 4XFIA 1TMF1 2IZWA 4AGVA 3MUZ1 3PURA 1XRUA 4XBQA 1W9WA 4YZ3A 4S2FA 5DN2A 2YY1A 4UAPA 5IAXA 3WX5A 4CDXC 1CAVA 2YGLA 3MLKA 4Q4Y2 3LGRA 4INDA 1WCKA 4KNCA 4GMP3 1TMF2 2WO7A 4JDOA 3IAQA 2VR4A 1PK6B 1NZCA 1XYOA 3RI8A 3AP7A 2W3JA 4FPOB 2XKOA 4FAGA 1W8FA 2IXLA 5G04L 4DOUA 2PXJA 1PM7A 3LA3A 2ZHMA 1YFXA 4MLOA 4EWAA 3ON7A 2K2SA 2VOXA 1OT5A 5FWEA 4AI2A 3ETQA 3TNQA 3WLUA 3ZO0B 2DUQA 2Y6HA 2A3XA 4Y33A 1HKDA 3ABZA 2BGPA 3WNLA 4BQYA 4DPNA 2A7AA 1QJX3 4YW6A 1ND3A 4GULA 5T52A 3GCXA 2QNKA 3FX3A 5FBJA 5C3SA 4IEZA 2WNEA 2XJSA 1WUVA 1RUD3 3VZNA 5JDBA 5FPZA 1O91A 4G9SB 1VBB3 3WXPA 1FXZA 4AFAA 4N7UA 1DQ6A 1Q8OA 2D43A 3MZHA 1RUOA 3MIFA 4CYDA 4BDVB 1GOFA 1DF0A 2CAUA 5CU1A 1BK1A 3KB5A 2JKBA 2GAUA 1WCQA 1EAH1 3FLRA 4BZ4A 1ODNA 4ZU7A 5JOZA 1ASJ1 2CWSA 3UL2A 3GF6A 1C8M3 1ZBE1 1WCDJ 3LKJA 4AEDC 2ZHNA 1XSRA 4KU8A 4LO7A 1W0NA 4Z07A 3SH5A 3WR0A 2JDPA 5EV7A 3VDDC 4N43B 2KXLA 3C7HA 5IWFA 5FP9A 2WLPA 3VKNA 4RR3C 3VLBB 5FPXA 3ZYJB 4LBQA 1B35B 1UZVA 2Q5TA 1EAH2 4YVWC 5ABJC 3W9AA 3P1IA 4PCRA 5JR2A 1ASJ2 5FDBA 5T50A 4XUNA 4BMEA 1ZBE2 3OGRA 5GZGA 1GZWB 3AKQA 1R093 2Z79A 2QQIA 5FO7B 1D0GA 3DECA 1W9FA 3VBOA 3ZYBA 1LJ7A 4C8DA 3WD5A 3W59A 1MVEA 2I74A 4IV3B 4YFWA 1WMFA 5LK5A 4ATFA 4BHPA 3KV9A 1L3JA 3ENRA 2D5FA 1AR81 2VOWA 4AQSA 2A3WA 5T5OA 2ZGUA 1LEMA 2BP6A 5AC91 4YW7A 2D5HA 4CP0A 5A6QA 5IHRA 2ERFA 3ACGA 2ZGPA 1J1TA 3POFA 4O61A 4CDWB 2FMDA 4B1LA 2D3SA 1NY71 3BOWA 3DKQA 3WQ1A 4IQPA 5DMYA 1ND2A 4H2AA 5F3EA 4Y1XA 4N9HA 3BKZA 1AR82 3THTA 1SCSA 2HWB3 2IXCA 3HNYM 4QQ2A 4YG6A 4AG4A 4CE8A 3I4IA 5AC92 1IGOA 5DXDA 1DFQA 2ARXA 5FK8A 1VPHA 1NLSA 3KM5A 3WQBA 4JKKA 1RMU3 3GZTB 5E8AA 1YCIA 4O9EA 3GZUC 2YV8A 1JHNA 3AMMA 4BB3A 3SMHA 2EIGA 2NN8A 1NY72 1IPJA 1X9PA 4P00B 5FJKA 3SH4A 1QH6A 3ACFA 4RHV1 3E5UA 3WW4A 5I8TA 5CYYA 1OA4A 3AZVA 4W8JA 1W6NB 4XFCA 2WC2A 4FAHA 2VE1A 1G9BA 1XYNA 3VHNA 4KU7A 2VUJA 2ADDA 4YRDA 1BJQA 1LOBA 3H7YA 4KBBA 4META 4YW3A 5CEHA 5IAVA 3O0VA 1JMUB 3LEIA 3N7LA 4CUBA 1IS3A 2W68A 5SV5A 3HQUA 4RHV2 5FYYA 4OQ8A 1V70A 3ZIXA 3PVEA 3VD9A 1GWMA 1QEXA 3JD71 3CZJA 1RVF1 3PDQA 1UU5A 1FNZA 4CA9A 3AJZA 2ORZA 1LOCA 3VD5A 4CU8A 3M3EA 5LCWL 3AZXA 1UIKA 2LTNA 4XW3A 2NLRA 1A34A 4QWNA 4Y24A 5EZWA 4C1WA 4XJUA 1VLNA 4MXWA 2VZQA 3D82A 4KL1A 2RMU1 4LUMA 3UESA 3N9OA 4R4XA 3N7JA 1TQ5A 2WNVC 2A6ZA 3JD72 2YC2A 4CDXB 1RVF2 4NHKA 4U2AA 2AGSA 5DZFA 1NCQA 1BK0A 5A33A 3IAPA 4K20A 4R9DA 3T3YA 1QKQA 5GZDA 1VJ2A 4LO6B 3WNNA 3J7LA 2BBVA 2RJLA 3NAPC 3CMGA 1HQWA 1GQGA 2RMU2 1JOPA 3AP9A 4QQHA 1XBFA 5FMBA 3RWKX 4DXTA 4YG3A 1KJLA 1W90A 3ZN6A 1BYHA 3SCGA 5HXVA 4LKDA 4HL0A 4ARXA 4E8DA 1JYNA 4YZ4A 4EN6B 4RGGA 2XBO1 2XQRA 3H3ZA 3LFIA 4JCKA 2BOIA 4DO0A 1VBE1 1W8NA 2W92A 4IV1A 4HVRA 2G9ZA 4YVSA 3VBUC 3WHTA 4AI8A 1OLRA 1Q8VA 1QF3A 3ACLA 4UFLA 5LBBA 1QOSA 4MUVA 4NOTA 4DXSA 3CLPA 2ZJCA 4E2GA 2BWCA 2DVBA 4QD2A 2ZX0A 1TG7A 2BW8A 4IUGA 3T1MA 2XBO2 3N9QA 4Y20A 4J1XA 1DQ0A 4BLIA 1DBNA 3D8CA 3I2DA 1VBE2 2VUCA 3K48A 1E5HA 2YFZA 5FP8A 4B4QA 2DBIA 3T2PA 2AR6A 4GH4A 2W5FA 4XPVA 3IMMA 3UKNA 5C4WC 1FPN3 1MZ6A 4CCOA 1WW6A 3OSDA 1XNCA 3SITA 3AP5A 4KMQA 1EPWA 2ARBA 1WW4A 4MX3A 3EBRA 4Q29A 2VQUA 3RVHA 4AEDB 4GKYA 1UIJA 2BVVA 1JYCA 4TWTA 4YM2A 2EXKA 3E6DA 2YZ4A 4RR3B 3ZYIB 1YJLA 1CZVA 3HIFA 2R073 5JR7B 4CEWC 3LAGA 1LGNA 1NX9A 1SCRA 4FFIA 4YVWB 5ABJB 3IN9A 1K5MC 2WYSA 2UYBA 1POV3 1OF3A 5A6ZA 4C91A 1EUUA 2I45A 4Z1VA 5F39A 3OGSA 1OD5A 1W2UA 2UWCA 5CISA 5FPAA 1ZRIA 3KHBA 4NHYA 1S0IA 4M0HA 1QU0A 2C6SA 2VNRA 3I8TA 4LKSA 1H2NA 5G05L 3ZKYA 1G9FA 4PLOA 3SCFA 5FR3A 2VMEA 1GKBA 2NMNA 5AVAA 3ZFGA 3VBFA 2V73A 5DDJ1 2OIIA 1X82A 1YLLA 1SPPA 4ET7A 4QXCA 3ACIA 5L9BA 4CSWA 1OC1A 4LEJA 1ZRRA 1TZOA 2ZXQA 3H8RA 3V56A 1TME3 2Q1ZB 2RDRA 1EV13 2H6CA 3O14A 4H7LA 4QB1A 1O3TA 3SISA 1HRI1 2QQMA 3J8F1 4Q5OA 4SLIA 5BPXA 4BH9A 2RDSA 5LA2A 1VBD1 2Q4SA 2CGPA 2Y60A 5DDJ2 1FV2A 1DZQA 1JZ6A 1Y7BA 4IGOA 3I2FA 3M8LA 3POGA 5JLVA 4C90A 1EY2A 2IUWA 3GBGA 4GMP0 4JHZA 3VBHC 3JXSA 4MYEA 4V2WA 2NP0A 3CL1A 2VCAA 2TUNA 1HRI2 3J8F2 3LIGA 1LHWA 1VBD2 3W21A 3S7EA 3MI8A 4NRQA 4XUPA 4IXLA 2VBBA 2KM2A 3FBMA 3ZSLA 3B69A 1LKNA 1O59A 4ASLA 4ZZ5A 5FOBB 1O4TA 1UO9A 2DVAA 4H7MA 2DFBA 2BOJA 3H0OA 3BPZA 4N53A 2P2KA 3WF3A 4NWWA 1MZEA 4UW3A 1OPOA 3E97A 5GLTA 2WZR1 5FZ4A 3WP6A 4EN8B 1CAUA 4FFGA 3RZKA 2GH2A 5LB6A 5FLIA 2XDVA 1C1FA 1QIQA 2W91A 3CJIA 3I59B 3UKTA 4KGGA 2JB4A 3VZOA 4AAPA 3ORJA 1RUNA 2BNNA 1AR83 4M3CE 4F8AA 1LOFA 1QJFA 2VZTA 4ISRA 3WOGA 1JUHA 1RUE3 2WNVB 3MICA 2WZR2 3HEIA 5DG1A 5FAXA 1WLTA 3PUQA 1DG6A 4NO4A 1HN1A 2XWBB 4PF5A 4UBGA 2R061 5FQ0A 1AR71 2DCZA 3ILRA 5F5AA 1WW7A 1S2BA 4LOTA 5HCBA 1GR3A 5CBLA 1B35A 4LHLA 2X29A 2QBXA 2W94A 3NAPB 3H8UA 2JDZA 4XQWA 1JODA 4FPFA 2V5YA 2Y8KA 4TXWA 2UWBA 3CNAA 2WZ8A 3RPQA 2XKPA 2G9GA 4IGPA 2XLFA 4JAAA 4DFSA 4HG6B 3IMNA 1JYWA 2R062 3IBMA 1AR72 1H9PA 5FREA 5C5TA 4QU1A 3VBUB 3ZM8A 4M3CB 2BDRA 3ZXKA 2AEYA 1VALA 2PHTA 3PNAA 4K9SA 4RHV3 4OFGA 1CESA 3G6JB 1ZRCA 2PHUA 3ZN5A 3GJBA 3FWEA 4Q1PA 2VNOA 2WFF1 3ZYPA 1AYN3 1NXD1 1WWYA 1XB9A 4A2UA 5LW9A 3WW2A 2W47A 3LOBA 2XH6A 3FN9A 3OGVA 1LODA 4P02B 5FY9A 2F4LA 2PN5A 2WAOA 3OY8B 4M00A 5A80A 4WM8A 5I91A 4HANA 1X7NA 2JWPA 3PJQA 1T6BX 3VDAA 4D7YA 1C28A 3NJYA 5IVFA 1RVF3 1D4M1 2DCTA 2UU8A 3THCA 3N9LA 1JYIA 2WFF2 4E2SA 4IL7A 1JXNA 1LU2A 1UN1A 3R4SA 3NMBA 4JGYC 3NSTA 3R6SA 1QMJA 3T4VA 1WLCA 4AI9A 1AXYA 2DUPA 4YYOA 5K0UA 1D7PM 3WCRA 3DPRC 1PVC3 4LE4A 4DY5A 4HSJA 2OPWA 2RJ2A 4R4ZA 4P9XA 3HNMA 3OPTA 4CEWB 5C8CA 5JIUA 2QCSB 3T1LA 1D4M2 1J3RA 4AVSA 3MW4A 3LSEA 3ES4A 5KXDA 1TNFA 1UY1A 3ZR5A 3BN6A 1K5MB 1FYUA 3T08A 5LA0A 3HWJA 3WW3A 4A6OA 3AMNA 5JMOA 3M2MA 2VZPA 4HPKB 3PJYA 1RHI3 2QQWA 1TNRA 2DVFA 2WINB 1UX6A 4HBNA 2FD8A 5CNAA 3FHQA 2XBO3 1GMMA 4QPIA 2J42A 1Z7S3 2IXJA 2KA3A 3POWA 2X5IA 3I2KA 1UMIA 3LPFA 4UOJA 2D3PA 4F83A 4XCAA 3GCWA 5J96B 1QDOA 3UV9A 3QH7A 4IESA 4ZS3A 2IFRA 2ZCWA 1CQ9A 1SLBA 1X8EA 3TN91 4DIQA 4NAOA 1YI7A 4L11A 1PNFA 5FPVA 3RZZA 1AZDA 2WT1A 1W0PA 1VRBA 5T5LA 2H0BA 3L9JT 4MHUA 4NAMA 2RS53 2XHNA 3JQWA 2GNBA 2RS13 1A3KA 1BEV3 1LU1A 3NNGA 3Q8AA 4L8QA 2BERA 3AP4A 3VBHB 2JDUA 5JCTA 1UOJA 3Q9OA 1UYZA 3TN92 4G3YC 5FZ8A 5F5QA 1OA3A 2JDNA 1XXNA 2C5DA 1VP6A 5KXCA 4FOYA 3TEWA 1P8JA 3WDXA 3OUJA 4ZU4A 4DNYA 1RUF3 4AHWA 4DRVA 1J59A 1UF2C 2FDFA 1YC61 2V09A 1BCXA 2Y0OA 2O14A 4FXGB 2QDRA 5F8PA 3S6PA 2P4EA 3JBG3 4LBLA 1UOGA 4UW4A 4ZPIA 4CXXA 5BYNA 5B2GB 4MGSA 3I2OA 5LZ6A 3SEEA 3PVBB 3VKMA 4I0BA 5JZGB 1YI9A 2R0FA 1CX1A 4GJYA 3USUB 1NA1B 1ST8A 1YHFA 3OF1A 2Q0AA 1COV1 1MEC3 1NZIA 2H6BA 5BNNC 2ET1A 4EYUA 4BM8A 4JVAA 4W6WA 5B4XA 1WZXA 1GNZA 4BQ1A 5T54A 1S0BA 2VCMA 3VHRA 4AEDA 2GMPA 3HOBA 2ZGNA 1ZZCA 1VBA1 4LHKA 4W50A 5A7SA 5IUQA 2F4PA 3MEPA 2R6QA 3TB0A 1E5SA 2GN7A 3URFA 3VDDA 3R05A 4NROA 1COV2 3P6BA 3PHMA 4IEVA 4LBNA 4UT5A 4LBOA 4RGKA 5FIXA 3HQXA 3BTAA 5M0TA 2W46A 1VBA2 2YXSA 3NV2A 1S2KA 3V0AB 5BNQA 1ACCA 4E8CA 3ZYFA 1KEXA 4AQTA 1POV0 3BIWE 1UMZA 1ZBA3 2ZBJA 2XVGA 3APBA 3D5OA 3WP3A 4EZ4A 4HONA 5DZEA 2ZGMA 4IE4A 4UF0A 3ZXFA 4AWDA 1XU2A 1JYXA 4FPGA 5I0TA 2HKXA 1RUC1 2WRAA 2B39A 3T09A 2PHLA 5FZAA 1CWPA 4NMIA 1G9AA 4PBOA 3I2HA 4A3XA 4NR1A 3KGZA 5C8WA 1OLME 4KWLA 4XAAA 4CXWA 5EIYB 2VXRA 1TEIA 4YPJA 5LBEA 3V0BB 2WNUA 3QCWA 4Q4V3 1RGSA 3VBSA 2Y6KA 3CZUA 3MW2A 4HKLA 1ZYBA 2W39A 3AMPA 3C7FA 1AX0A 1RUC2 4D6SA 2HWD3 1CJDA 1UW8A 1GBGA 3HPNA 3HT1A 5EYXA 2EAAA 1GUIA 3OPWA 2P6CA 2PYTA 1A8MA 4JGYB 3SQOA 3TWIA 4N9IA 2H0VA 4CEYA 4QU2A 2VVEA 4AQ2A 2F6BA 4F7ZA 3DPRB 2FMYA 4ASMB 2C9AA 1CN1A 1D2QA 1KDMA 4RFT0 3TBDA 1E5IA 4NIGA 1GLHA 3SKVA 5K4LA 5CFDB 1IS6A 1DLLA 3N4MA 5GLVA 4LXLA 4UI9L 5JAXA 1QQP1 5FO8B 1ENRA 1PZ7A 2IXIA 2OQ6A 4OMCA 1O4ZA 4D6RA 5ISLA 1Q8QA 5ANQA 4XUOA 5DAQA 4BWOA 3AYCA 5GLWA 5HI0A 1QOTA 3AKSA 4LIUA 2E7QA 2HEVF 1CVNA 1UX7A 3ETPA 2PLV3 1QQP2 4YARA 1V6NA 3A22A 4LLFA 4I2OA 4CDUC 4M4PA 3Q8EA 5FP4A 1MZFA 3MF9A 3NKTA 4NPLA 4FPYA 1XNDA 3KT1A 4YW1A 3D0SA 4CP9B 2W52A 4NIHA 2Y26A 2QQJA 3WSOA 5CFCC 4AI0A 1VE0A 1W03A 1V6MA 3NRUA 5FZ9A 4MXVA 5GLUA 1PMJX 2NPIA 4FBFA 5FXWA 3ZYRA 4P5HA 4UFMA 4AEMA 4I0WB 1FMD3 3OJBA 1DGWA 2AUYA 2OT7A 4K8FA 2VBDA 1ZZ8A 5FZHA 2PQQA 1N1VA 4YZ1A 5J98B 1L7LA 2EICA 3E6CC 1V6IA 4K8RB 2WAAA 1JOBA 3C3VA 4Q26A 2UURA 3LPGA 5J48A 3FJSA 1OURA 3NNJA 1UAIA 1UKGA 1ULDA 2W87A 1SLCA 3ZFEB 2GH8A 2VTFA 2ZX2A 3AZZA 2DCYA 1IKPA 2VVFA 4FFFA 4R9BA 4F3JA 3MO4A 2RM23 3VD7A 4HETA 4QXHA 2IVJA 2ETEA 2W0XA 3BPSA 4CXYA 3MGUA 4YSFA 4GQ7A 2VTXJ 4L99A 3WP4A 2D93A 4Y4YA 4URAA 2BYVE 3I2JA 1G6NA 1C5IA 3HN1A 4PQ9A 2B9VA 4Q4X1 5BNNB 5C4WA 2A75A 1LRHA 2VMFA 1KRIA 1GNYA 3P3NA 3GXUA 4LKFA 1MS8A 2AENA 1GFF2 4NPRA 5FMOS 3K4DA 1UZWA 5T55A 5CKNA 1AX1A 2NMOA 5I0SA 3T0AA 4Q4X2 3NL1A 4OUSA 5EQUA 3RGBA 4OHWA 4HZFA 1XE7A 4OHZA 4QPWA 1F8VA 5CADA 3NV3A 1M06G 1JBCA 4HVOA 1YQ6A 4QM8A 5I0RA 4EWEA 3M3CA 3OBRA 3LA7A 1H4HA 3ZMNA 4ZONA 2CDOA 3PIJA 2IVIB 3T4HB 5KHKA 1V9U3 4K40A 4RSUA 2HBTA 5FZMA 3M7AA 3U4XA 1SBDA 4RFRB 4S2DA 3OPZA 4QM9A 1PZ9A 5E89A 1SMVA 1ZM1A 4Y26A 2D40A 2EALA 4H55A 4LA2A 3ALQA 1PO23 5E6HA 1WCSA 2VBPA 1X33A 4JKMA 1CR7A 5A7WA 5CA6A 3OGJA 2E53A 5FZEA 1HN0A 1YQCA 4HK9A 4K3UA 2Q1FA 2AACA 2D6KA 4DUVA 1H8TB 3UJQA 3MW3A 1SLIA 4QDSA 4QPGC 3C7EA 1NCRB 3DEMA 4YGDA 1YFUA 3OG2A 4I02A 2YYOA 2AREA 5FXVA 4AAXA 4LNVA 2EIDA 4FT8A 5A7QA 5LY2A 1KXGA 2IFWA 1OMIA 4IDZA 5BUVA 4QGNA 1PZ8A 3RMXA 4XFGA 5F9TA 2WDBA 1DP0A 1UYPA 5KHGA 5C3PA 2KD7A 1VBC3 3FHAA 2WWSA 4FPLA 4UFHA 3QOPA 1VBA3 1R081 4GWMA 2PAEA 1YRZA 4MOAA 4BXFA 2VC9A 4JRLA 1IPKA 3OYWA 3I3QA 4E27A 1QDCA 4UW6A 5A32A 2ZOEB 4B29A 2CTVA 5IK5A 4LUKA 2XXZA 5FZLA 3INAA 1R082 3RG0A 2CV6A 1H2KA 2WT2A 4XIOA 2P3KA 3VZLA 1ULCA 1FT9A 4MGKE 1W99A 1W2OA 3I49A 4CDUB 4TN7A 4QB2A 4IEOA 5C9AC 4WVZA 3T2TA 3WUDA 5BNPC 1BHGA 1WBLA 1SFYA 1GU3A 1UZ0A 2OS2A 1WGPA 1F31A 1W0OA 5LWBA 1WCUA 2ZGLA 2WQ4A 1O8PA 5CFCB 1LENA 3C2UA 1D2SA 1WBFA 3KHCA 1SFPA 1H1IA 1XNKA 5C71A 1YQ8A 1PO11 2P5BA 5I8SA 3WNPA 4YM0A 1DLCA 1WMEA 3I3EA 4OLLA 3ZXDA 5A7OA 2OW4A 1YFYA 2JE7A 4NHMA 3LDKA 2VZUA 5LATA 2VM9A 3DKWA 5K7PA 3A7QA 4A44A 1BZWA 1GV9A 4IEPA 1JHJA 2XL7A 1GZ9A 2VU9A 3B01A 1W2TA 3S7IA 1UD1A 1PO12 3AFGA 2YPJA 3E1F1 3AYAA 1DDLA 2VGDA 1OOPB 1S0CA 2DURA 1L7QA 4ONUA 1AX2A 3RDIA 5K9YA 4CP1A 4H14A 3GHNA 1VRH1 4COVA 1ZZBA 4JDMA 2HWF1 4X6QB 2JG9A 3J4UH 1QQP3 1NLRA 5F3IA 4CP2A 2XLGA 5HXMA 5CB7A 1IG0A 1W9TA 4YM3A 4XF3A 3H3LA 5LBCA 3U10A 3BVCA 3PL0A 5FZFA 2VZ1A 4UFIA 4UWDA 2D97A 1VRH2 3OD0A 1NG0A 2J1EA 1REFA 3GYDA 3P5BA 4QX1A 4YW5A 1KDKA 5AVPA 1C5HA 1I5PA 2HWF2 3PU3A 4UW5A 4QHBA 1GSLA 2DFCA 2B9UA 2XR4A 1XE8A 1LGBA 3HNBM 3LDBA 4Q8LA 1RXGA 1US3A 3EYPA 3VKOA 2GC3A 1JH5A 4AFDA 2WO1A 1AR91 4AVBA 5ACA3 2P17A 3WG4A 3BOPA 1WMDA 2RE9A 3SKJE 5BNOB 2BJSA 4QQPA 3MUY1 1J58A 2W1SA 2WUHA 1DZTA 1OLMA 4YLZA 3KF3A 4CCLA 1FV3A 1VAVA 1XYPA 1PIV1 4FI9A 3OGGA 1XU1A 4X6RB 5ERLA 2C24A 5IVYA 2OA2A 5FMOL 1AR92 4BQ2A 5J7MA 1X9TA 3NW4A 1AJOA 3O7OA 3E6BA 3ACHA 1RUJ3 4JV4A 1OHFA 1ONAA 1ENXA 3B02A 2Y6JA 1NT0A 3FLTA 5FZCA 3AYDA 3ZSJA 5J36A 3O0WA 3W20A 5IVCA 2WO3A 1W6MB 5FY0A 2GU9A 4HXCA 1PIV2 5LBFA 3VN4A 2Z2SB 5A7PA 2AYHA 1YFWA 3RJ2X 2YC0A 2BGCA 2OVUA 4W6XA 3M4FA 2Q8DA 1OVPA 1W6OB 2B45X 2FDJA 1VMJA 2RR13 2V4AA 4QPGB 5D8AC 2XJVA 4IETA 3THDA 1BQPA 4XJ9A 2EVXA 2W08A 1MZ5A 3U14A 1IG3A 3VBRC 2VQAA 4JX0A 2QQVA 1V6JA 4OZOA 1BBT3 2XOMA 5FXZA 3RJRA 1ULPA 2CDPA 1PM4A 1UL9A 4RYDA 2FCTA 3WHUA 1FOD3 4AHZA 2VY0A 5C33A 2D7FA 3VZMA 1W8TA 4NPMA 2YHJA 1CZTA 1CD3G 2ZAAA 4XZPA 2FCVA 5IW0A 1W8ZA 2Z5WA 1QJY1 4WVMB 1FAYA 1QNWA 2X53S 2WYFA 4XHBA 2AEZA 3GBFA 4XBNA 4Q4Y3 3VZJA 2FDIA 3UGFA 4E4ZA 4M4RA 5FP3A 1R1A1 3TRSB 2QVSB 1W6QB 1TMF3 4I30A 3KVBA 4LLOA 2VULA 4CDQA 2IXHA 1OQ1A 1DHKB 2B4KA 4OUMA 5HCAA 3NJZA 1QJY2 1HXS1 2E32A 5IK8A 3VV1A 5C9AB 1QNYA 1AL21 2JG8C 4XDPA 4Y22B 4AL9A 5BNPB 4XUTA 1MS3A 1R1A2 3WF0A 1CIWA 4DS0A 4JKLA 1C57A 2JKXA 4E4DX 3PTYA 2P3YA 1CX4A 2GNTA 4GALA 5D1IA 3ZXEA 4DEVA 3ILNA 5IVBA 1IS5A 3KV4A 1OH4A 2ZACA 1RUG1 1VMFA 2B8MA 2VW2A 2BFUL 2PHWA 1HXS2 1YXWA 3QACA 2XUMA 4JGZC 1AL22 3O1OA 2ZGKA 2VMGA 5A3NA 2HWC1 1F4AA 1SDWA 5L7OB 3CU7A 4Y1VA 2Y33A 4BQ3A 1RINA 4FSJA 2HEYF 3K3OA 1CAXB 1UXXX 3PUHA 3R4UA 4QPYA 5DQ0A 4B8EA 1OLQA 5HV0A 1RUG2 4ZKTB 3KV6A 3D3AA 4GWNA 4WZFA 1S0GA 3MIBA 1CAWB 4URTA 3UYJA 1CONA 2I07B 2HWC2 5GZFA 1PK6A 4S2GA 2JE8A 1H8VA 4FP2A 4GA9A 2PHFA 4LMFA 2Q8OA 2VO5A 1W28A 3V65A 1UOBA 2UY9A 1F5FA 4A3ZA 3ZSEA 1HQNA 2ZHLA 1JZ4A 1EAH3 1HV1A 1C4RA 3O1RA 1XC6A 1ASJ3 3AP6A 4OHXA 1UY2A 1ZBE3 1N1YA 4TYSA 1W06A 5CKQA 3ILFA 3SLIA 4QX0A 4AFCA 2R30A 4L9BA 3BODA 4P14A 1OF4A 5CIRA 2CU5A 2W1WA 2QQOA 2VZOA 3I7DA 3FFZA 4CRQA 3GZEA 1CGPA 2BQPA 5FYTA 2LW8A 2DWRA 4YW2A 3NO8A 4LR4A 1LB2A 4HN0A 3NWKA 5FTTC 3USSA 3TAYA 5EJ1B 5JZGC 2QE3A 3S5QA 3Q8CA 4DZGA 1NA1C 3PLQA 1GICA 1HDKA 2J1SA 1Q8PA 2E63A 4NWVA 5DG2A 3ZSKA 5HCFA 2DDUA 5FZ6A 4AF9A 4D8MA 1STMA 2QFEA 4OYUA 4XVHA 3VUOA 2WJSA 3SH3A 5DZGA 1LCLA 3JUUA 2DYCA 2E9QA 4IEUA 1AR61 1UMHA 2Y34A 5FZ0A 5FZOB 4LULA 3ZIWA 3ZYHA 1AUYA 5AC93 3AL5A 3KSCA 4XTMA 1G9DA 1ZZ6A 1JOJA 4BK4A 2VMDA 4N43A 4N90A 4Z82A 4K6BA 2R041 4PI0A 3B3QE 1F2NA 4PT6A 1CPMA 1QXJA 2JD9A 5JWPA 4U36A 4WBBA 1AR62 3N9NA 1XNTA 1Y9GA 1JYVA 2ORXA 1E57A 2D44A 3FMGA 2QQUA 3POBA 4ZS2A 1GZWA 5IVJA 3KS7A 3GHMA 3VDBA 1YUDA 4OI2A 4AVCA 4IV3A 3G7DA 5D8AB 4K21A 2XVKA 5FYUA 4BLJA 4QGMA 2R042 1HX6A 2FZ1A 4Y5Z0 1DQ4A 1MQTB 3B5LB 2JDKA 2J22A 3VBOC 5IT6A 4A45A 2YBKA 3ZXJA 1W3VA 1ALYA 1ZZ9A 5A3WA 3VBRB 2R49A 3AVRA 2PHXA 4HVQA 1N1SA 2XMLA 4FOVA 1IZ3A 2GC1A 3JZVA 3L2HA 4Q0SA 4XHXA 4NIDA 4CDWA 4XAEA 2X09A 1H30A 1MPXA 3M3IA 4A7ZA 3ZFFB 4RQPC 1W8WA 2W95A 1APNA 1GWKA 2YGMA 3ZMOA 3BCWA 2BUKA 1RB8G 3JB8A 1RXFA 4YW4A 2OXBA 5I8YA 2DVDA 1ENQA 4CPBD 1NE4A 2XQXA 3JD73 4Q0PA 2A6XA 3RZHA 1WD4A 3H50A 2VW1A 3QD6A 1ULFA 4UFJA 4Y1UA 5LASA 1ND2C 1XJAA 2BTVC 4OULA 3LFMA 1UYYA 3RWNA 4I3GA 3O1MA 1OPMA 2MEV1 3EO6A 2EIBA 2BGOA 2WS91 5FZKA 5A7NA 2LALA 4FO9A 3SNMA 5KR7A 2LM3A 1WMXA 2RMU3 4YM1A 1GP4A 5T5PA 4TTGA 2GNDA 1IKQA 4JDNA 2B5HA 3U75A 2JIGA 4MVTA 1W6NA 5FZIA 3TYJA 3FFQA 4FPEA 5CFDC 3CQOA 1ZRFA 1U0AA 5H9RA 1NAEA 2JG8B 2B46X 1OUXA 3T0DA 2DUOA 2OZJA 1GZTA 1I9RA 2OZ6A 3CBNA 5CKMA 2MEV2 1HJFA 2WS92 5A3LA 5C6CA 2XUEA 3WDYA 4XUQA 1JTZX 2JEMA 3VB9A 4D7SA 3RZMA 4XF0A 3M3OA 1Q5OA 2EXJA 2HWE1 4DXZA 2OUJA 3VL8A 2JICA 3I97A 4AVVA 4Y3OA 5JOXA 4JGZB 4WVWA 1VBE3 3PMEA 3S0MA 4TZDA 5EXOA 2C9KA 4QKFA 3DYPA 5FJHA 5FFOC 4L0PA 1FATA 1JW6A 3W58A 1LR5A 1F5JA 1PHMA 4MH0E 4I01A 3POJA 3CEWA 4EZHA 5FYBA 4CDXA 1MR5A 5K8SA 2HWE2 4MG2A 2PMWB 1OI6A 3R0RA 3VKFC 4QQOA 4NHXA 3OEBA 3WDWA 2ZAHA 3JU9A 1HJGA 2YROA 4BQ5A 1ZRDA 2E51A 3JCIA 1CAVB 3NNMA 4WM7C 4XF4A 5FXXA 4AEJA 3VGIA 1NE6A 4ATEA 4B3NA 2ARCA 4AI1A 1YYNA 4B7EA 4EN7B 3ZLIA 4YG0A 4Y1YA 1DGWX 2J1RA 4O65A 3WNOA 1NQJA 1KITA 1R1A3 4LE3A 4BK5A 2JB8A 4BQWA 5F6LB 1HRV1 4P08A 3ZFEC 1JUIA 3AB0A 2PHRA 4FOWA 4MGIE 4QKBA 2WA4A 4ISQA 1S0DA 4MGYE 3BTXA 4EN9B 1WW5A 3PIGA 1AYM1 1W04A 3ZPOA 2D98A 4FPCA 4AHYA 1J84A 1ND3B 1UKRA 4YNIA 3TEZA 1WA6X 4AHXA 1FI2A 1HRV2 2CGOA 2B7YA 2BEOA 2YU1A 2P6HA 4XBLA 3PUSA 1LHOA 1F9KA 1S0FA 2GC2A 4YGBA 5FK7A 4ASKA 5GLZA 4GMP1 3ZKUA 4ARYA 4CPBA 2XPJA 3IPVB 3IDBB 4OUEA 1H6YA 2GNMA 1AYM2 3WDTA 3WEZA 5J37A 4PHZA 2GMEA 4Q0VA 3TEYA 4XXPA 5DDJ3 2XWJB 2ZTNA 2ZX1A 3WF1A 1O3SA 2CAVA 2VG9A 2BNMA 3RFRA 1RTVA 1DGLA 3H1MA 4RR3A 5FUNA 4HOOA 3FUQA 4YVWA 3WF2A 2FBEA 5ABJA 1UU6A 4UBHA 5C9AA 3IB3A 1QJX1 2CGNA 1HRI3 2VW0A 3J8F3 4DB5A 1NQDA 2YPDA 3VDCA 1F35A 1VBD3 4QMAA 5CZKA 1HW5A 4LBQB 4LJHA 1RUD1 2VZSA 2XLAA 1DCSA 4ZU5A 4L97A 1VBB1 3AKRA 1ZA4A 3HMYA 3LA2A 3D6EA 5BY5A 2GMMA 1VAMA 4QX7A 3MIDA 3M70A 4DMIA 1QJX2 5HPOA 3QBQA 4L2NA 3VBOB 5J1XA 2FDHA 2DCKA 3LOIA 4XURA 4EROA 4KH9A 2E6VA 2CYFA 2ZGSA 2YB7A 5FYMA 1G8WA 4ORFA 4Z2AA 1ZX5A 1RUD2 3O5SA 2R0HA 1C8M1 2Y64A 1VBB2 3CF6E 4XIKA 3TOJA 3VBFC 1IQDC 4RQPB 3X29B 3ZFGC 3K4ZA 5DAVA 3WNMA 4CUCA 1H8TC 3ZXLA 2GALA 2D6OX 3NJVA 1O4YA 1NCRC 2ZX4A 5F3GA 2KR2A 2WZR3 3DL3A 3H1WA 1GQHA 4FPKA 4AYUA 5A1AA 2P34A 3LEMA 5FV3A 1ND2B 4P9LA 3P3PA 4QKNA 4XEZA 2VOKA 1DGRA 1UNBA 1C8M2 2EXIA 2G19A 2WZEA 2VAUA 3DCQA 3HN3A 3KT4A 3RNSA 4AQ6A 4BU2A 3S30A 2XJQA 5H9SA 1T2XA 1R091 5FY7A 4AVAA 1C8NA 1MS5A 3HBKA 2ZPXA 1LOAA 2Y6FA 2A3YA 3WNKA 2AH2A 3QLQA 2JXAA 2OPKA 2D6NA 2ZMKA 3RMYA 5FLHA 2R063 1AR73 2ID4A 3B7MA 3ZXGA 1V00A 5J3UA 3IDEA 1NOVA 1DQ2A 2HYKA 2JE9A 1V0AA 2VECA 1R092 3D0JA 1UZYA 2WWJA 3CJXA 3AMHA 1H1MA 4K1ZA 3ECQA 3AXEA 1YIFA 3MLLA 4RL7A 4AZZA 4GZ9A 3ZOIA 1TE1B 4EWDA 4A41A 4JHTA 1XQNA 1RL3A 5F3CA 4N53C 2HWB1 5BXXA 4HFSA 3VKLA 5FZGA 2WQZC 3I59A 1IS4A 1QJZA 4LHSA 4LQRA 3DXTA 2LROA 3H7JA 1RMU1 5A3UA 2FDGA 1LECA 2WNVA 3CJIC 2ZX3A 5ANNA 4LK7A 1Y43B 1RC6A 2WFF3 4MXWB 3UNPA 2HWB2 4XYXA 2DU1A 3VHOA 3MIGA 2D6LX 3LD8A 1UU4A 3WY6A 4Y5TA 3NAPA 3ZDVA 4WM7B 3RYRA 1KQRA 1RMU2 3PU8A 1NCQB 4P9YA 1GYKA 5A33B 3KT7A 4COZA 1Q56A 1D4M3 1RITA 5L9RA 3ZN4A 2FZ2A 4HLTA 2YC4A 3HVDA 1OKQA 1XNAA 3VBUA 2RVAA 1SEFA 3K77A 4M3CA 2A73B 2MEV3 4MZUA 1GQPA 3ZN6B 2BPA2 3ROUA 3DF0A 4P9IA 4OHYA 1OOPC 4XFAA 3SHRA 2TNFA 1I3HA 3ZPYA 4PBPA 3OB8A 3SC7X 3KMHA 3WINE 2YDEA 4DQAA 1YEWA 3CHXA 3A21A 2QQKA 4XTPA 2I2SA 5A1FA 1LESA 3OY8A 5CAZA 4A7KA 3RZJA 1GZCA 4I3PA 4Y1ZA 4Y20B 1W9SA 2Y0IA 1ULOA 1QY4A 1GOHA 2BU9A 1TVGA 1KGYA 5HV4A 1PGL1 5DAXA 4PF1A 1D0HA 3KVAA 4Y5SA 4GH4B 2ZGOA 1UPSA 1ZZ7A 5E1RA 1A78A 3Q8FA 2PELA 4Q1RA 4ES9A 3IDAA 4IE6A 4EQVA 5DPNA 3I3MA 3B00A 1S1AA 2VNVA 1F4HA 4CEWA 3AX4A 2WL1A 2NZ9A 5JVVA 3TN93 5BNOC 5K0UC 4NN0A 1PGL2 1K5MA 3RI9A 4W4ZA 4CCNA 4LO5B 5C8CC 1W39A 1AJKA 4HPKA 4QQLA 4D6QA 1H0BA 5IYYA 3POYA 3MV01 3PUAA 1H9WA 4XJWA 2VD7A 1OH3A 5FZ7A 2DBNA 1W6PB 1H2LA 3RRDA 2NQYA 2VNGA 3GALA 4JGZA 2Q8EA 2GSYA 4UXAA 1J3PA 4ZZ8A 2CWMA 1PNGA 2K46A 3DYOA 3VD3A 5C7GA 1FPN1 1CJPA 3KD4A 2HBUA 5L36A 4QHZA 3WCSA 3OTFA 1AHSA 1OUSA 3IDCB 1WKYA 3MPPG 4QPIC 2WN2A 3AVSA 3ZFGB 3VBFB 2CNAA 2O1QA 2X5IC 4W65A 4A7YA 2QQPA 1JZ8A 1SPPB 5EFUA 1AYM3 2L9LA 3DGTA 4CVUA 3AFKA 3LZZA 4I0AA 2XJRA 2R071 1LULA 2X05A 1FPN2 3ELNA 1UPIA 5JUVA 1UYXA 2HYXA 2VOVA 1COV3 2LS6A 4Q4W1 5CG8A 3VBHA 1HIXA 2FHRA 1N3PA 1MS4A 1POV1 2XJPA 2K9ZA 2EA7A 4YGEA 5TSWA 5FZ1A 4XF1A 1QXRA 3UGHA 3DUIA 1SLLA 4COUA 4IE7A 3J26N 3ZDSA 4XFBA 1BVP1 2ZGTA 2ILMA 4K7JA 2ZEYA 2R072 1KD7A 1HLCA 2P37A 4GD4A 4XZUG 5DABA 3C7OA 5GZCA 3IKWA 4O9GA 4D94A 1O5LA 4Q4W2 4DEQA 3LF7A 3UGGA 4BQ4A 1RJ7A 3POSA 4OCTA 3N9PA 4BE3A 2VUDA 5JPNB 2R1DA 5KHHA 1URXA 1Y9MA 3LEKA 4BXSV 5JZGA 2W1UA 4AXOA 1TME1 4SBVA 4E9KA 2TEPA 4Q27A 1EV11 1NA1A 4LA3A 4MGQA 3USUA 3CIHA 4BMBA 2BFUS 4N53B 4R52A 5KXBA 4KWKA 3WDUA 1GOGA 3K46A 1O5UA 4PIYA 2SLIA 3IPVA 1CAUB 5FCCA 2NM1A 1DU3D 3KF5A 3NJXA 2XONA 4H3WA 4CCDA 1SHWB 2VOTA 3CJIB 3GBWA 1RUC3 1TME2 1EV12 5GJ6A 2Q8CA 4C0BA 4B1MA 4JQRA 4QX3A 2R7EB 5IVEA 2UWAA 5EJ3A 4Z8BA 4IEQA 3K3NA 2VQTA 2VTXA 2BWAA 3H42B 3NKGA 2XHKA 4XACA 3O1PA 4PDWC 1GP5A 2A71A 2VUAA 3PUIA 5FQ0B 5GZEA 4KGQA 3K2OA 5L7OC 1SQ4A 3B9IA 5F6KA 3V0AA 2OKXA 3DXUA 2Z4FA 3AM2A 3GZAA 1LOEA 1V6KA 1KS5A 1LHUA 1AL0G 1YQ2A 2WSVA 4FOQA 4RD7A 3ZSMA 4AVTA 4CTEA 5C70A 1DZRA 1PMIA 1CPNA 4AI3A 2BVBA 2P3IA 4QDQA 3MFCA 1A6CA 4RA0A 5FYCA 3S57A 1LAJA 1HB1A 4RGAA 1RUH1 5FY1A 1YO8A 3UETA 5JPMB 2R32A 3VZKA 3R4DB 3GNEA 5DUVA 4XJZA 3KCYA 3J7NA 3ES1A 3IT8A 5FMDA 4IERA 5A3MA 2ES3A 1B09A 2GP5A 1RUE1 3AJYA 4RQPA 3T30A 3V0BA 3PVOA 1UY3A 1EP0A 3RSJA 2ZKNA 1NLQA 1XE0A 2WQ8A 3PTRB 1RUH2 4TSVA 5BV6A 3FUOA 5FKBA 1HB4A 2RDNA 4UYBA 1ZNPA 4A4AA 1SFNA 1X8MA 3WDVA 5C3RA 3A23A 4WM8B 2WNUC 2E33A 4JGYA 3VBSC 2C26A 4M0NA 2IWGB 3VHPA 4CCCA 4JRAA 1OVSA 5FYIA 1RUE2 2E7TA 3SXWA 1ENSA 3DPRA 4IW3A 1X36A 4WV8A 2O8OA 1QOOA 5H9QA 4R9CA 1PX3A 5CFDA 4CEYC 5K0UB 4FFHA 1BMV1 2WN3A 3NVCA 3FZ3A 2Y6LA 1R1ZA 4FXKB 5KC6A 1I1EA 4NRPA 5C8CB 1AYN1 2JIJA 5DAWA 2ATFA 5EYYA 1Y9QA 4AGGA 5AFBA 2VVDA 1JZ2A 4RS5C 3ZR6A 1SACA 5FBZA 3WVJA 4YZ5A 3ASIA 1BMV2 1JI6A 1OXCA 5JI9A 2ARAA 5EJZB 3MYXA 2QDNA 4QHOA 3WP5A 1RUI1 1KJRA 1ZA7A 1OA2A 2X10A 3EJKA 2W2IA 5IVVA 2JD4A 3JQXA 3MFAA 1LHVA 1AYN2 4J1WA 4CP9A 2OUHA 1JU4A 4LHNA 4QPIB 2WT0A 2X5IB 3U1XA 1UCXA 2GDFA 4LKEA 4X8NA 2GZWA 5DUUA 3QH6A 3RS6A 1PVC1 4CCMA 4XMAA 3MPBA 3H9AA 1RYYA 2R1BA 4QT6A 5FO9B 5IK7A 3J7HA 1RUI2 1MQTC 4COWA 4WM7A 2DV9A 3MHZA 1F15A 3RZGA 2PHDA 2ZEXA 4Q4X3 1C3HA 1IOAA 2EXHA 2R16A 1D4VB 4IEXA 4XDOA 3EB7A 1MVQA 2MHFA 2JDYA 1K45A 3AC0A 1PVC2 1ZVFA 5DUWA 1RHI1 1H1AA 5LY1A 1W8OA 2YBPA 3ZFFC 1AVBA 1L7RA 1Q3EA 1REEA 1W2NA 1Z78A 3IZOA 1A8DA 4XETA 5FWJA 2ET7A 2FDKA 3BTZA 1BLZA 3ZFEA 2B42B 2WABA 3M1HA 4R8HA 2Q1MA 5E88A 1W9YA 3WG2A 3BI3A 1Z7S1 1JS9A 1SLAA 3EXUA 3HQRA 4OVEA 4EN0A 1UWWA 2JX9A 2O0OA 2QZ2A 3B93A 3FL7A 4V1PA 4ES8A 1HB3A 1MS0A 3D4KA 4HN1A 1MACA 2RS31 3MDPA 4OZXA 1RHI2 3U07A 1I5ZA 1QWRA 3LSDA 2DTYA 1SZBA 2GN3A 4KBZA 2VMIA 1R64A 1IQAA 2YU2A 2IC1A 5BNNA 1Z7S2 4Y4RA 2P3JA 1LGCA 2RS51 2Y6GA 2OX0A 1OD3A 1SLTA 3I2GA 2PQSA 2RS11 5FLJA 1BEV1 4BOWA 2RS32 2LUWA 4LBMA 5DAPA 1EUTA 3MLJA 2PTMA 3MF6A 5EPAA 1OFSA 3GM8A 3OOXA 3B94A 4Q2FA 1RUF1 2RS52 3M3QA 3OUIA 4LBJA 4ZXEA 4BA6A 2QZ3A 2RS12 2ZHKA 3MBWA 1BEV2 3HD8B 4PDWB 4XE9A 3VDDB 4MGTA 3N7MA 3WG3A 1NUKA 1SBEA 4D69A 3JBG1 4PQQA 4Q4W3 3ITQA 3WQ0A 2BZDA 2VXJA 5FP7A 3UKVA 5LA1A 3AZYA 1W8UA 1RUF2 1DGRN 1W6PA 2V72A 2VCCA 3GDBA 4X8PA 1JN2P 3NNLA 4ZXKA 4CZSA 5JXHA 4XILA 1MEC1 5EP9A 3FLPA 4NHLA 4FP3A 4TLFA 2CL2A 1R083 2ZKLA 5C5UA 2BRTA 5JOYA 5FYVA 3JBG2 1LNSA 1DYPA 5FUPA 4UF0B 5FKCA 2HLEA 3KCCA 4AEKA 4JZRA 4OI1A 3KQRA 4LPLA 4XCBA 1H4GA 1H8TA 2J1UA 1U5ZA 4DINB 1MEC2 1NCRA 3U4SA 4KG8A 2O8QA 5LRSA 4DRRA 1U5YA 3F95A 2XJTA 1VB4A 5KBFA 4B4PA 3BYWA 2WNUB 1N47A 2YUEA 4QB6A 3H3UA 2MNGA 1BXHA 2ZZJA 5FMCA 3VBSB 2GP3A 2P1BA 3LQCA 5FPLA 4AGRA 4OI0A 1OQDA 3U37A 2VCBA 2WO2A 1SBFA 5A3PA 1PGSA 3DYMA 4QDRA 1ZREA 4FTEA 1ND3C 2HH9A 5JSOA 1ULGA 2ZABA 5FYZA 1ZBA1 4GB31 4CEYB 2C1FA 2ZEWA 1OFNA 1KFUL 2UYAA 4AK3A 1JZ7A 2EAKA 2E31A 5I0DA 4XF9A 2BV4A 2TBVA 1PO13 1U5IA 3I3BA 3L2YA 3WQ7A 3WF4A 3VD4A 3C7GA 4J25A 4XQDA 4XXAA 1JYTA 5A6XA 1JZ5A 5AFEA 1JZ3A 1Y3TA 3THPA 4FVVA 4IE5A 4FPJA 1ZBA2 1DQ5A 2EF6A 4GB32 1GP6A 4RS5B 3RQ0A 2XB6C 1CIYA 4Q4V1 4E2QA 5B4NA 1SDDB 1DQ1A 4NE9A 5JI7A 4CDUA 1YJKA 2FQPA 1G9CA 2J1AA 2HWD1 5A6YA 1RUH3 3LDRA 3BTYA 1NYWA 5KHIA 4QX5A 2YFUA 2XVLA 1O3QA 1N3OA 1VRH3 1VMHA 5CFCA 4Z2WA 2ENRA 2HWF3 2K0GA 4Q4V2 3HJRA 3OD4A 1POQA 4M01A 3O0XA 3HT2A 2V4VA 4ITCA 2HWD2 4KG0A 2OYZA 4LIVA 5FOJB 2QUOA 5FUIA 3BGAA 4IGQA 1UXZA 4RN5A 4YFZA 2G1MA 3UK9A 2VZ3A 1DYOA 2J1TA 2ZS6B 3OBTA 4HMZA 1GANA 1W05A 4HKWA 1O8SA 3J7MA 5FPBA 3BUCA 2RG4A 4QAWA 1K3IA 4OI4A 4BYYA 2WWUA 4TLGA 1OOPA 1YNAA 1AR93 1Y4WA 2PLV1 2Q30A 2JDAA 2WNOA 4GKXA 5F37A 5IFTA 1YQ5A 5HCHA 4C0HA 1BVVA 2Z69A 3CKHA 4B4RA 4CCEA 2LRPA 4J6GA 4PIXA 3T2QA 3A4UA 4E4HA 4IE0A 2QQNA 3N3HA 1PIV3 1BKZA 4GXLA 4MADA 1OBNA 1NKGA 5FZBA 5SV8A 2JG9C 5HBAA 2PLV2 3O12A 4E4SA 2YG0A 2RHPA 1FMD1 4YWAA 1MS1A 3GGLA 3K51A 4QX8A 3K4AA 3WW1A 5D2AA 4XMIA 5IJRA 5FY5A 5C4WB 3W5NA 1RUI3 2A5ZA 3WUCA 4O7XA 1G86A 2JECA 4MV2A 1OKOA 2BNOA 3POIA 5GALA 1S2EA 2W1QA 3GJAA 1N1TA 5BNOA 1O6UA 4CUAA 1W8HA 1FMD2 5F32A 4QXBA 1RIRA 4GWIA 5EHDA 3AL6A 3DN7A 2A1XA 4PI2A 1DYKA 3LIHA 4MHRA 5JSRA 3ST7A 3UJOA 1V6LA 1VR3A 2CSGA 4QXKA 2DU0A 2RM21 2VMCA 3O1VA 1GNHA 4S2HA 1UY0A 3N7KA 5GKAC 3BB6A 1NXMA 4AFBA 4BPZA 1PX4A 1S0EA 4PIZA 4B7KA 1PGW1 3N9MA 1W6MA 3LE0A 4GJZA 2ZEZA 5IFPA 1PVXA 1E5RA 3O1TA 1NCQC 2RM22 3DV8A 5D21A 4CU9A 2QJVA 4HSLA 1QJY3 2XGXA 5JXJA 2N7GA 3ZX7A 1W6OA 3U0ZA 1IHMA 2VL4A
chains in the Genus database with same CATH topology
1OC1A 5C3QA 1W3VA 1UZWA 1GP6A 2WO7A 1UOFA 4XAEA 1W2NA 2Y60A 3ON7A 5APAA 1RXFA 1BLZA 1W9YA 5C3OA 2IVIB 1DCSA 1HB3A 1GP5A 5C3SA 2BU9A 2VBBA 1BK0A 1GP4A 1E5IA 1UO9A 1RXGA 2VBPA 1HB1A 1W05A 1HJFA 1ODNA 1IPSA 2BJSA 1W28A 3OOXA 1UOBA 1QIQA 2JB4A 1QJFA 1UNBA 1HB4A 2VAUA 1W06A 2DBNA 5C3RA 1OBNA 5C3PA 2Y6FA 1E5HA 2DBIA 1UOGA 1ODMA 1W03A 1HJGA 2BRTA 2VBDA 3ZOIA 2VCMA 1W2OA 2JB8A 1W3XA 2CSGA 1E5SA 4RGKA 1HB2A 1W04A 1QJEA 2IVJA 4BB3A 1WA6X 3ZKYA 1W2AX 1E5RA 3ZKUA 2VE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OC1 A;  5C3Q A;  1W3V A;  1UZW A;  1GP6 A;  2WO7 A;  1UOF A;  4XAE A;  1W2N A;  2Y60 A;  3ON7 A;  5APA A;  1RXF A;  1BLZ A;  1W9Y A;  5C3O A;  2IVI B;  1DCS A;  1HB3 A;  1GP5 A;  5C3S A;  2BU9 A;  2VBB A;  1BK0 A;  1GP4 A;  1E5I A;  1UO9 A;  1RXG A;  2VBP A;  1HB1 A;  1W05 A;  1HJF A;  1ODN A;  1IPS A;  2BJS A;  1W28 A;  3OOX A;  1UOB A;  1QIQ A;  2JB4 A;  1QJF A;  1UNB A;  1HB4 A;  2VAU A;  1W06 A;  2DBN A;  5C3R A;  1OBN A;  5C3P A;  2Y6F A;  1E5H A;  2DBI A;  1UOG A;  1ODM A;  1W03 A;  1HJG A;  2BRT A;  2VBD A;  3ZOI A;  2VCM A;  1W2O A;  2JB8 A;  1W3X A;  2CSG A;  1E5S A;  4RGK A;  1HB2 A;  1W04 A;  1QJE A;  2IVJ A;  4BB3 A;  1WA6 X;  3ZKY A;  1W2A X;  1E5R A;  3ZKU A;  2VE1 A; 
#chains in the Genus database with same CATH topology
 1JU3 A;  1AXZ A;  3PVN A;  5C3Q A;  4QPG A;  1VAK A;  2RS3 3;  5A7W B;  1J1L A;  5FRA A;  2D6P A;  1YWK A;  2QKD A;  3POE A;  1PGW 2;  3WZ1 A;  4Z92 B;  5KC5 A;  2DCJ A;  3Q8B A;  1QJU 1;  4IEY A;  4XC9 A;  3TEX A;  2PAK A;  2G4I A;  3AK0 A;  3AZW A;  1XOY A;  4W6Y A;  3WT3 A;  4AW7 A;  4GIQ A;  1XPW A;  4IV1 C;  3ATG A;  4BCU A;  3F2Z A;  4YVS C;  4EV0 A;  4FCA A;  4DUX A;  1HXS 3;  1UY4 A;  2XG3 A;  2J7M A;  1AL2 3;  1V9U 1;  3III A;  1K12 A;  2J1V A;  3FE5 A;  4NRM A;  1LTE A;  2DTW A;  3OCP A;  5A3T A;  2BBA A;  5LK7 B;  1H2M A;  1VIW B;  3ME2 A;  3RYP A;  1QJU 2;  5A70 A;  4KWJ A;  3MIE A;  1AXK A;  3IWZ A;  1UZZ A;  4XFF A;  5JMC A;  3U11 A;  3BU7 A;  3LB9 A;  4WVM A;  3ZYG A;  1RUG 3;  4P9W A;  4BQX A;  3RYK A;  1HQL A;  1PO2 1;  3FC0 A;  2WSU A;  4MGZ E;  5JSP A;  5KXE A;  4XOG A;  1V9U 2;  4GH4 C;  5IK4 A;  2VH9 A;  3KLS A;  3C8X A;  2EIE A;  5LEK A;  2HWC 3;  1W6Q A;  4KWU A;  2V5D A;  2VPV A;  2Y38 A;  1HV0 A;  1OSG A;  1Z0H A;  1RJ8 A;  3OYW B;  3JB4 C;  4NUB A;  2WFP A;  5A32 B;  2IXK A;  4FTS A;  4FTB A;  1YIP A;  4LO8 A;  2C0Z A;  5EWS A;  2XL9 A;  2WR9 A;  5JOW A;  2WLQ A;  3NQH A;  5LA9 A;  4Y22 A;  1PO2 2;  1EYB A;  4CDQ C;  2HJI A;  3IM0 A;  5BNP A;  5KWR A;  5T5J A;  2WZP P;  2GC0 A;  3BAL A;  1MS9 A;  2VQ0 A;  4PLM A;  1LOG A;  2ZGR A;  1QHD A;  3EQE A;  5E16 A;  3WNX A;  5F1R A;  4FQ4 A;  4GAZ A;  4CCK A;  2AZ5 A;  1DIW A;  2C4X A;  3OBA A;  1VBC 1;  1KS4 A;  4EJR A;  4BJ0 A;  3IIA A;  4FPH A;  3KWV A;  4N8M A;  2CHH A;  2WBK A;  3T2O A;  4ZHN A;  4PDW A;  4K1Y A;  4Q0Q A;  2XJU A;  5F2S A;  5I0U A;  5L7O A;  1U5X A;  2RDQ A;  4LT5 A;  1PMH X;  1LED A;  4R9A A;  1ODM A;  5CVR A;  5F2W A;  4BIO A;  1CAX A;  1VB2 A;  1VBC 2;  4OQ9 A;  2CY6 A;  3OUH A;  2A70 A;  2MPF A;  3N36 A;  3KZ4 C;  1CAW A;  4YGC A;  2A6V A;  3FBY A;  3MV1 1;  4NJ4 A;  4XFH A;  1J3Q A;  3H1Y A;  4GB3 3;  5CG9 A;  3E5Q A;  4JQT A;  1RED A;  2WA3 A;  4LOR A;  3UT0 A;  3TNP B;  3SEP A;  4LO4 B;  5LRR A;  5L19 A;  3BU0 A;  1K42 A;  4BIS A;  2PAM A;  2HEW F;  2FCU A;  3AYE A;  5F5I A;  5A3O A;  4M3C F;  3CO2 A;  4XAB A;  4AE2 A;  1FX5 A;  1PK6 C;  4LBK A;  1AR6 3;  2JG9 B;  3B9C A;  3I54 A;  3A0N A;  3LEG A;  1QH7 A;  4OMD A;  4LTA A;  1H6X A;  3I2I A;  2SBA A;  4D0Q A;  2UY8 A;  4FQZ A;  1QJE A;  2E26 A;  2R04 3;  3WV6 A;  1O3R A;  4Q8K A;  1W2A X;  3O1S A;  3HR9 A;  3H8X A;  2VZV A;  2NYY A;  1K5J A;  5F7U A;  4IEW A;  4PJY A;  2W9X A;  3RZL A;  1EPZ A;  4ZY9 A;  4D3W A;  3U78 A;  4Q0U A;  3OBZ A;  1UOF A;  2WKK A;  3BIE A;  4L92 A;  1S4C A;  5F5C A;  5FZO A;  4EE2 A;  3KQ4 B;  4AFM A;  4RS5 A;  2JEN A;  2OQ7 A;  4V2V A;  2A6W A;  5APA A;  4D7T A;  2E7A A;  2ADE A;  5FPU A;  3T0B A;  1LOF C;  4CU6 A;  4PLN A;  5GM0 A;  4CCJ A;  3V64 A;  1C1L A;  5C3O A;  5IAT A;  1QXP A;  5FY4 A;  4C1X A;  4XJA A;  2D6M A;  2G9F A;  3S5A A;  4A42 A;  1ULE A;  4N43 C;  2DF7 A;  4JTO A;  2QQL A;  1US2 A;  2ZGQ A;  5L73 A;  4NVP A;  2A6Y A;  1GWL A;  4P9J A;  2RJK A;  1B35 C;  4HT1 T;  2ZA9 A;  5H9P A;  2VJX A;  3KV5 A;  5D8A A;  3HAG A;  5ACA 1;  1Q43 A;  3FHI B;  1I6X A;  4WVV A;  3AKP A;  2JJ6 A;  4YZ2 A;  4P9G A;  2WS9 3;  1MQT A;  3AKT A;  3EMR A;  3NNF A;  1T6G C;  3VBR A;  4IV3 C;  3PMS A;  5T3N A;  2DVG A;  4KI5 M;  4IV1 B;  4A6S A;  3OEA A;  4YVS B;  1WLW A;  5FYH A;  1U12 A;  2ZZQ A;  1XSQ A;  1IPS A;  3KGL A;  5A1L A;  2ZML A;  3J9S A;  5LEJ A;  3ZXA C;  3ZFF A;  5ACA 2;  3E5X A;  1WD3 A;  2D3R A;  3O1U A;  4NII A;  3I3D A;  3VL9 A;  1RUJ 1;  1XNB A;  2JDH A;  4AR2 A;  3WG1 A;  3W5M A;  4CDW C;  3NV4 A;  3LWC A;  2HWE 3;  3HBZ A;  3SCH A;  4DY3 A;  2Z42 A;  4HKO A;  5KHJ A;  4BIF A;  3KCX A;  4WM8 C;  5JXG A;  4XQ4 A;  4P5Y A;  1V6O A;  1S55 A;  1UQX A;  1KFX L;  4QGL A;  5DUX A;  4CUG A;  5J09 A;  4UFK A;  1M4W A;  5L9V A;  1LHN A;  3MIH A;  3AXD A;  1RUJ 2;  1G7Y A;  4XDQ A;  2RR1 1;  4JC1 A;  4AOC A;  1N3Q A;  3AMQ A;  1WLD A;  1OQE A;  2QTW B;  4N7I A;  2AC1 A;  1WA4 A;  4JTN A;  2JG8 A;  4I09 A;  4MO3 M;  4LBQ D;  5FY8 A;  5JIA A;  4CDQ B;  4DXR A;  4CU7 A;  3H8O A;  2VMH A;  3K75 B;  2JDM A;  4GWJ A;  1QGL A;  1BBT 1;  4KQ7 A;  1J83 A;  3A0K A;  2PA7 A;  3LCP A;  4OHV A;  4XJ8 A;  2PFW A;  5I93 A;  1S0J A;  3NV1 A;  1Q8S A;  4WZC A;  2RR1 2;  4LK6 A;  5FZ3 A;  1FOD 1;  4MSV A;  1W3X A;  2F17 A;  1O7F A;  3CDZ B;  3ZVX A;  3N35 A;  4HK8 A;  4LIT A;  2YMZ A;  2ZMN A;  4COY A;  4NIA A;  2VZR A;  3EHK A;  4QX2 A;  5FYS A;  2X8K A;  1BBT 2;  1HRV 3;  1FNY A;  2WII B;  2YBS A;  1CZS A;  1AF9 A;  1QJU 3;  4G4F A;  1HB2 A;  4Q4Y 1;  2RV9 A;  5JXI A;  1X50 A;  4DUW A;  4LOS A;  5FZD A;  4QKD A;  1SG3 A;  1FOD 2;  4XFI A;  1TMF 1;  2IZW A;  4AGV A;  3MUZ 1;  3PUR A;  1XRU A;  4XBQ A;  1W9W A;  4YZ3 A;  4S2F A;  5DN2 A;  2YY1 A;  4UAP A;  5IAX A;  3WX5 A;  4CDX C;  1CAV A;  2YGL A;  3MLK A;  4Q4Y 2;  3LGR A;  4IND A;  1WCK A;  4KNC A;  4GMP 3;  1TMF 2;  2WO7 A;  4JDO A;  3IAQ A;  2VR4 A;  1PK6 B;  1NZC A;  1XYO A;  3RI8 A;  3AP7 A;  2W3J A;  4FPO B;  2XKO A;  4FAG A;  1W8F A;  2IXL A;  5G04 L;  4DOU A;  2PXJ A;  1PM7 A;  3LA3 A;  2ZHM A;  1YFX A;  4MLO A;  4EWA A;  3ON7 A;  2K2S A;  2VOX A;  1OT5 A;  5FWE A;  4AI2 A;  3ETQ A;  3TNQ A;  3WLU A;  3ZO0 B;  2DUQ A;  2Y6H A;  2A3X A;  4Y33 A;  1HKD A;  3ABZ A;  2BGP A;  3WNL A;  4BQY A;  4DPN A;  2A7A A;  1QJX 3;  4YW6 A;  1ND3 A;  4GUL A;  5T52 A;  3GCX A;  2QNK A;  3FX3 A;  5FBJ A;  5C3S A;  4IEZ A;  2WNE A;  2XJS A;  1WUV A;  1RUD 3;  3VZN A;  5JDB A;  5FPZ A;  1O91 A;  4G9S B;  1VBB 3;  3WXP A;  1FXZ A;  4AFA A;  4N7U A;  1DQ6 A;  1Q8O A;  2D43 A;  3MZH A;  1RUO A;  3MIF A;  4CYD A;  4BDV B;  1GOF A;  1DF0 A;  2CAU A;  5CU1 A;  1BK1 A;  3KB5 A;  2JKB A;  2GAU A;  1WCQ A;  1EAH 1;  3FLR A;  4BZ4 A;  1ODN A;  4ZU7 A;  5JOZ A;  1ASJ 1;  2CWS A;  3UL2 A;  3GF6 A;  1C8M 3;  1ZBE 1;  1WCD J;  3LKJ A;  4AED C;  2ZHN A;  1XSR A;  4KU8 A;  4LO7 A;  1W0N A;  4Z07 A;  3SH5 A;  3WR0 A;  2JDP A;  5EV7 A;  3VDD C;  4N43 B;  2KXL A;  3C7H A;  5IWF A;  5FP9 A;  2WLP A;  3VKN A;  4RR3 C;  3VLB B;  5FPX A;  3ZYJ B;  4LBQ A;  1B35 B;  1UZV A;  2Q5T A;  1EAH 2;  4YVW C;  5ABJ C;  3W9A A;  3P1I A;  4PCR A;  5JR2 A;  1ASJ 2;  5FDB A;  5T50 A;  4XUN A;  4BME A;  1ZBE 2;  3OGR A;  5GZG A;  1GZW B;  3AKQ A;  1R09 3;  2Z79 A;  2QQI A;  5FO7 B;  1D0G A;  3DEC A;  1W9F A;  3VBO A;  3ZYB A;  1LJ7 A;  4C8D A;  3WD5 A;  3W59 A;  1MVE A;  2I74 A;  4IV3 B;  4YFW A;  1WMF A;  5LK5 A;  4ATF A;  4BHP A;  3KV9 A;  1L3J A;  3ENR A;  2D5F A;  1AR8 1;  2VOW A;  4AQS A;  2A3W A;  5T5O A;  2ZGU A;  1LEM A;  2BP6 A;  5AC9 1;  4YW7 A;  2D5H A;  4CP0 A;  5A6Q A;  5IHR A;  2ERF A;  3ACG A;  2ZGP A;  1J1T A;  3POF A;  4O61 A;  4CDW B;  2FMD A;  4B1L A;  2D3S A;  1NY7 1;  3BOW A;  3DKQ A;  3WQ1 A;  4IQP A;  5DMY A;  1ND2 A;  4H2A A;  5F3E A;  4Y1X A;  4N9H A;  3BKZ A;  1AR8 2;  3THT A;  1SCS A;  2HWB 3;  2IXC A;  3HNY M;  4QQ2 A;  4YG6 A;  4AG4 A;  4CE8 A;  3I4I A;  5AC9 2;  1IGO A;  5DXD A;  1DFQ A;  2ARX A;  5FK8 A;  1VPH A;  1NLS A;  3KM5 A;  3WQB A;  4JKK A;  1RMU 3;  3GZT B;  5E8A A;  1YCI A;  4O9E A;  3GZU C;  2YV8 A;  1JHN A;  3AMM A;  4BB3 A;  3SMH A;  2EIG A;  2NN8 A;  1NY7 2;  1IPJ A;  1X9P A;  4P00 B;  5FJK A;  3SH4 A;  1QH6 A;  3ACF A;  4RHV 1;  3E5U A;  3WW4 A;  5I8T A;  5CYY A;  1OA4 A;  3AZV A;  4W8J A;  1W6N B;  4XFC A;  2WC2 A;  4FAH A;  2VE1 A;  1G9B A;  1XYN A;  3VHN A;  4KU7 A;  2VUJ A;  2ADD A;  4YRD A;  1BJQ A;  1LOB A;  3H7Y A;  4KBB A;  4MET A;  4YW3 A;  5CEH A;  5IAV A;  3O0V A;  1JMU B;  3LEI A;  3N7L A;  4CUB A;  1IS3 A;  2W68 A;  5SV5 A;  3HQU A;  4RHV 2;  5FYY A;  4OQ8 A;  1V70 A;  3ZIX A;  3PVE A;  3VD9 A;  1GWM A;  1QEX A;  3JD7 1;  3CZJ A;  1RVF 1;  3PDQ A;  1UU5 A;  1FNZ A;  4CA9 A;  3AJZ A;  2ORZ A;  1LOC A;  3VD5 A;  4CU8 A;  3M3E A;  5LCW L;  3AZX A;  1UIK A;  2LTN A;  4XW3 A;  2NLR A;  1A34 A;  4QWN A;  4Y24 A;  5EZW A;  4C1W A;  4XJU A;  1VLN A;  4MXW A;  2VZQ A;  3D82 A;  4KL1 A;  2RMU 1;  4LUM A;  3UES A;  3N9O A;  4R4X A;  3N7J A;  1TQ5 A;  2WNV C;  2A6Z A;  3JD7 2;  2YC2 A;  4CDX B;  1RVF 2;  4NHK A;  4U2A A;  2AGS A;  5DZF A;  1NCQ A;  1BK0 A;  5A33 A;  3IAP A;  4K20 A;  4R9D A;  3T3Y A;  1QKQ A;  5GZD A;  1VJ2 A;  4LO6 B;  3WNN A;  3J7L A;  2BBV A;  2RJL A;  3NAP C;  3CMG A;  1HQW A;  1GQG A;  2RMU 2;  1JOP A;  3AP9 A;  4QQH A;  1XBF A;  5FMB A;  3RWK X;  4DXT A;  4YG3 A;  1KJL A;  1W90 A;  3ZN6 A;  1BYH A;  3SCG A;  5HXV A;  4LKD A;  4HL0 A;  4ARX A;  4E8D A;  1JYN A;  4YZ4 A;  4EN6 B;  4RGG A;  2XBO 1;  2XQR A;  3H3Z A;  3LFI A;  4JCK A;  2BOI A;  4DO0 A;  1VBE 1;  1W8N A;  2W92 A;  4IV1 A;  4HVR A;  2G9Z A;  4YVS A;  3VBU C;  3WHT A;  4AI8 A;  1OLR A;  1Q8V A;  1QF3 A;  3ACL A;  4UFL A;  5LBB A;  1QOS A;  4MUV A;  4NOT A;  4DXS A;  3CLP A;  2ZJC A;  4E2G A;  2BWC A;  2DVB A;  4QD2 A;  2ZX0 A;  1TG7 A;  2BW8 A;  4IUG A;  3T1M A;  2XBO 2;  3N9Q A;  4Y20 A;  4J1X A;  1DQ0 A;  4BLI A;  1DBN A;  3D8C A;  3I2D A;  1VBE 2;  2VUC A;  3K48 A;  1E5H A;  2YFZ A;  5FP8 A;  4B4Q A;  2DBI A;  3T2P A;  2AR6 A;  4GH4 A;  2W5F A;  4XPV A;  3IMM A;  3UKN A;  5C4W C;  1FPN 3;  1MZ6 A;  4CCO A;  1WW6 A;  3OSD A;  1XNC A;  3SIT A;  3AP5 A;  4KMQ A;  1EPW A;  2ARB A;  1WW4 A;  4MX3 A;  3EBR A;  4Q29 A;  2VQU A;  3RVH A;  4AED B;  4GKY A;  1UIJ A;  2BVV A;  1JYC A;  4TWT A;  4YM2 A;  2EXK A;  3E6D A;  2YZ4 A;  4RR3 B;  3ZYI B;  1YJL A;  1CZV A;  3HIF A;  2R07 3;  5JR7 B;  4CEW C;  3LAG A;  1LGN A;  1NX9 A;  1SCR A;  4FFI A;  4YVW B;  5ABJ B;  3IN9 A;  1K5M C;  2WYS A;  2UYB A;  1POV 3;  1OF3 A;  5A6Z A;  4C91 A;  1EUU A;  2I45 A;  4Z1V A;  5F39 A;  3OGS A;  1OD5 A;  1W2U A;  2UWC A;  5CIS A;  5FPA A;  1ZRI A;  3KHB A;  4NHY A;  1S0I A;  4M0H A;  1QU0 A;  2C6S A;  2VNR A;  3I8T A;  4LKS A;  1H2N A;  5G05 L;  3ZKY A;  1G9F A;  4PLO A;  3SCF A;  5FR3 A;  2VME A;  1GKB A;  2NMN A;  5AVA A;  3ZFG A;  3VBF A;  2V73 A;  5DDJ 1;  2OII A;  1X82 A;  1YLL A;  1SPP A;  4ET7 A;  4QXC A;  3ACI A;  5L9B A;  4CSW A;  1OC1 A;  4LEJ A;  1ZRR A;  1TZO A;  2ZXQ A;  3H8R A;  3V56 A;  1TME 3;  2Q1Z B;  2RDR A;  1EV1 3;  2H6C A;  3O14 A;  4H7L A;  4QB1 A;  1O3T A;  3SIS A;  1HRI 1;  2QQM A;  3J8F 1;  4Q5O A;  4SLI A;  5BPX A;  4BH9 A;  2RDS A;  5LA2 A;  1VBD 1;  2Q4S A;  2CGP A;  2Y60 A;  5DDJ 2;  1FV2 A;  1DZQ A;  1JZ6 A;  1Y7B A;  4IGO A;  3I2F A;  3M8L A;  3POG A;  5JLV A;  4C90 A;  1EY2 A;  2IUW A;  3GBG A;  4GMP 0;  4JHZ A;  3VBH C;  3JXS A;  4MYE A;  4V2W A;  2NP0 A;  3CL1 A;  2VCA A;  2TUN A;  1HRI 2;  3J8F 2;  3LIG A;  1LHW A;  1VBD 2;  3W21 A;  3S7E A;  3MI8 A;  4NRQ A;  4XUP A;  4IXL A;  2VBB A;  2KM2 A;  3FBM A;  3ZSL A;  3B69 A;  1LKN A;  1O59 A;  4ASL A;  4ZZ5 A;  5FOB B;  1O4T A;  1UO9 A;  2DVA A;  4H7M A;  2DFB A;  2BOJ A;  3H0O A;  3BPZ A;  4N53 A;  2P2K A;  3WF3 A;  4NWW A;  1MZE A;  4UW3 A;  1OPO A;  3E97 A;  5GLT A;  2WZR 1;  5FZ4 A;  3WP6 A;  4EN8 B;  1CAU A;  4FFG A;  3RZK A;  2GH2 A;  5LB6 A;  5FLI A;  2XDV A;  1C1F A;  1QIQ A;  2W91 A;  3CJI A;  3I59 B;  3UKT A;  4KGG A;  2JB4 A;  3VZO A;  4AAP A;  3ORJ A;  1RUN A;  2BNN A;  1AR8 3;  4M3C E;  4F8A A;  1LOF A;  1QJF A;  2VZT A;  4ISR A;  3WOG A;  1JUH A;  1RUE 3;  2WNV B;  3MIC A;  2WZR 2;  3HEI A;  5DG1 A;  5FAX A;  1WLT A;  3PUQ A;  1DG6 A;  4NO4 A;  1HN1 A;  2XWB B;  4PF5 A;  4UBG A;  2R06 1;  5FQ0 A;  1AR7 1;  2DCZ A;  3ILR A;  5F5A A;  1WW7 A;  1S2B A;  4LOT A;  5HCB A;  1GR3 A;  5CBL A;  1B35 A;  4LHL A;  2X29 A;  2QBX A;  2W94 A;  3NAP B;  3H8U A;  2JDZ A;  4XQW A;  1JOD A;  4FPF A;  2V5Y A;  2Y8K A;  4TXW A;  2UWB A;  3CNA A;  2WZ8 A;  3RPQ A;  2XKP A;  2G9G A;  4IGP A;  2XLF A;  4JAA A;  4DFS A;  4HG6 B;  3IMN A;  1JYW A;  2R06 2;  3IBM A;  1AR7 2;  1H9P A;  5FRE A;  5C5T A;  4QU1 A;  3VBU B;  3ZM8 A;  4M3C B;  2BDR A;  3ZXK A;  2AEY A;  1VAL A;  2PHT A;  3PNA A;  4K9S A;  4RHV 3;  4OFG A;  1CES A;  3G6J B;  1ZRC A;  2PHU A;  3ZN5 A;  3GJB A;  3FWE A;  4Q1P A;  2VNO A;  2WFF 1;  3ZYP A;  1AYN 3;  1NXD 1;  1WWY A;  1XB9 A;  4A2U A;  5LW9 A;  3WW2 A;  2W47 A;  3LOB A;  2XH6 A;  3FN9 A;  3OGV A;  1LOD A;  4P02 B;  5FY9 A;  2F4L A;  2PN5 A;  2WAO A;  3OY8 B;  4M00 A;  5A80 A;  4WM8 A;  5I91 A;  4HAN A;  1X7N A;  2JWP A;  3PJQ A;  1T6B X;  3VDA A;  4D7Y A;  1C28 A;  3NJY A;  5IVF A;  1RVF 3;  1D4M 1;  2DCT A;  2UU8 A;  3THC A;  3N9L A;  1JYI A;  2WFF 2;  4E2S A;  4IL7 A;  1JXN A;  1LU2 A;  1UN1 A;  3R4S A;  3NMB A;  4JGY C;  3NST A;  3R6S A;  1QMJ A;  3T4V A;  1WLC A;  4AI9 A;  1AXY A;  2DUP A;  4YYO A;  5K0U A;  1D7P M;  3WCR A;  3DPR C;  1PVC 3;  4LE4 A;  4DY5 A;  4HSJ A;  2OPW A;  2RJ2 A;  4R4Z A;  4P9X A;  3HNM A;  3OPT A;  4CEW B;  5C8C A;  5JIU A;  2QCS B;  3T1L A;  1D4M 2;  1J3R A;  4AVS A;  3MW4 A;  3LSE A;  3ES4 A;  5KXD A;  1TNF A;  1UY1 A;  3ZR5 A;  3BN6 A;  1K5M B;  1FYU A;  3T08 A;  5LA0 A;  3HWJ A;  3WW3 A;  4A6O A;  3AMN A;  5JMO A;  3M2M A;  2VZP A;  4HPK B;  3PJY A;  1RHI 3;  2QQW A;  1TNR A;  2DVF A;  2WIN B;  1UX6 A;  4HBN A;  2FD8 A;  5CNA A;  3FHQ A;  2XBO 3;  1GMM A;  4QPI A;  2J42 A;  1Z7S 3;  2IXJ A;  2KA3 A;  3POW A;  2X5I A;  3I2K A;  1UMI A;  3LPF A;  4UOJ A;  2D3P A;  4F83 A;  4XCA A;  3GCW A;  5J96 B;  1QDO A;  3UV9 A;  3QH7 A;  4IES A;  4ZS3 A;  2IFR A;  2ZCW A;  1CQ9 A;  1SLB A;  1X8E A;  3TN9 1;  4DIQ A;  4NAO A;  1YI7 A;  4L11 A;  1PNF A;  5FPV A;  3RZZ A;  1AZD A;  2WT1 A;  1W0P A;  1VRB A;  5T5L A;  2H0B A;  3L9J T;  4MHU A;  4NAM A;  2RS5 3;  2XHN A;  3JQW A;  2GNB A;  2RS1 3;  1A3K A;  1BEV 3;  1LU1 A;  3NNG A;  3Q8A A;  4L8Q A;  2BER A;  3AP4 A;  3VBH B;  2JDU A;  5JCT A;  1UOJ A;  3Q9O A;  1UYZ A;  3TN9 2;  4G3Y C;  5FZ8 A;  5F5Q A;  1OA3 A;  2JDN A;  1XXN A;  2C5D A;  1VP6 A;  5KXC A;  4FOY A;  3TEW A;  1P8J A;  3WDX A;  3OUJ A;  4ZU4 A;  4DNY A;  1RUF 3;  4AHW A;  4DRV A;  1J59 A;  1UF2 C;  2FDF A;  1YC6 1;  2V09 A;  1BCX A;  2Y0O A;  2O14 A;  4FXG B;  2QDR A;  5F8P A;  3S6P A;  2P4E A;  3JBG 3;  4LBL A;  1UOG A;  4UW4 A;  4ZPI A;  4CXX A;  5BYN A;  5B2G B;  4MGS A;  3I2O A;  5LZ6 A;  3SEE A;  3PVB B;  3VKM A;  4I0B A;  5JZG B;  1YI9 A;  2R0F A;  1CX1 A;  4GJY A;  3USU B;  1NA1 B;  1ST8 A;  1YHF A;  3OF1 A;  2Q0A A;  1COV 1;  1MEC 3;  1NZI A;  2H6B A;  5BNN C;  2ET1 A;  4EYU A;  4BM8 A;  4JVA A;  4W6W A;  5B4X A;  1WZX A;  1GNZ A;  4BQ1 A;  5T54 A;  1S0B A;  2VCM A;  3VHR A;  4AED A;  2GMP A;  3HOB A;  2ZGN A;  1ZZC A;  1VBA 1;  4LHK A;  4W50 A;  5A7S A;  5IUQ A;  2F4P A;  3MEP A;  2R6Q A;  3TB0 A;  1E5S A;  2GN7 A;  3URF A;  3VDD A;  3R05 A;  4NRO A;  1COV 2;  3P6B A;  3PHM A;  4IEV A;  4LBN A;  4UT5 A;  4LBO A;  4RGK A;  5FIX A;  3HQX A;  3BTA A;  5M0T A;  2W46 A;  1VBA 2;  2YXS A;  3NV2 A;  1S2K A;  3V0A B;  5BNQ A;  1ACC A;  4E8C A;  3ZYF A;  1KEX A;  4AQT A;  1POV 0;  3BIW E;  1UMZ A;  1ZBA 3;  2ZBJ A;  2XVG A;  3APB A;  3D5O A;  3WP3 A;  4EZ4 A;  4HON A;  5DZE A;  2ZGM A;  4IE4 A;  4UF0 A;  3ZXF A;  4AWD A;  1XU2 A;  1JYX A;  4FPG A;  5I0T A;  2HKX A;  1RUC 1;  2WRA A;  2B39 A;  3T09 A;  2PHL A;  5FZA A;  1CWP A;  4NMI A;  1G9A A;  4PBO A;  3I2H A;  4A3X A;  4NR1 A;  3KGZ A;  5C8W A;  1OLM E;  4KWL A;  4XAA A;  4CXW A;  5EIY B;  2VXR A;  1TEI A;  4YPJ A;  5LBE A;  3V0B B;  2WNU A;  3QCW A;  4Q4V 3;  1RGS A;  3VBS A;  2Y6K A;  3CZU A;  3MW2 A;  4HKL A;  1ZYB A;  2W39 A;  3AMP A;  3C7F A;  1AX0 A;  1RUC 2;  4D6S A;  2HWD 3;  1CJD A;  1UW8 A;  1GBG A;  3HPN A;  3HT1 A;  5EYX A;  2EAA A;  1GUI A;  3OPW A;  2P6C A;  2PYT A;  1A8M A;  4JGY B;  3SQO A;  3TWI A;  4N9I A;  2H0V A;  4CEY A;  4QU2 A;  2VVE A;  4AQ2 A;  2F6B A;  4F7Z A;  3DPR B;  2FMY A;  4ASM B;  2C9A A;  1CN1 A;  1D2Q A;  1KDM A;  4RFT 0;  3TBD A;  1E5I A;  4NIG A;  1GLH A;  3SKV A;  5K4L A;  5CFD B;  1IS6 A;  1DLL A;  3N4M A;  5GLV A;  4LXL A;  4UI9 L;  5JAX A;  1QQP 1;  5FO8 B;  1ENR A;  1PZ7 A;  2IXI A;  2OQ6 A;  4OMC A;  1O4Z A;  4D6R A;  5ISL A;  1Q8Q A;  5ANQ A;  4XUO A;  5DAQ A;  4BWO A;  3AYC A;  5GLW A;  5HI0 A;  1QOT A;  3AKS A;  4LIU A;  2E7Q A;  2HEV F;  1CVN A;  1UX7 A;  3ETP A;  2PLV 3;  1QQP 2;  4YAR A;  1V6N A;  3A22 A;  4LLF A;  4I2O A;  4CDU C;  4M4P A;  3Q8E A;  5FP4 A;  1MZF A;  3MF9 A;  3NKT A;  4NPL A;  4FPY A;  1XND A;  3KT1 A;  4YW1 A;  3D0S A;  4CP9 B;  2W52 A;  4NIH A;  2Y26 A;  2QQJ A;  3WSO A;  5CFC C;  4AI0 A;  1VE0 A;  1W03 A;  1V6M A;  3NRU A;  5FZ9 A;  4MXV A;  5GLU A;  1PMJ X;  2NPI A;  4FBF A;  5FXW A;  3ZYR A;  4P5H A;  4UFM A;  4AEM A;  4I0W B;  1FMD 3;  3OJB A;  1DGW A;  2AUY A;  2OT7 A;  4K8F A;  2VBD A;  1ZZ8 A;  5FZH A;  2PQQ A;  1N1V A;  4YZ1 A;  5J98 B;  1L7L A;  2EIC A;  3E6C C;  1V6I A;  4K8R B;  2WAA A;  1JOB A;  3C3V A;  4Q26 A;  2UUR A;  3LPG A;  5J48 A;  3FJS A;  1OUR A;  3NNJ A;  1UAI A;  1UKG A;  1ULD A;  2W87 A;  1SLC A;  3ZFE B;  2GH8 A;  2VTF A;  2ZX2 A;  3AZZ A;  2DCY A;  1IKP A;  2VVF A;  4FFF A;  4R9B A;  4F3J A;  3MO4 A;  2RM2 3;  3VD7 A;  4HET A;  4QXH A;  2IVJ A;  2ETE A;  2W0X A;  3BPS A;  4CXY A;  3MGU A;  4YSF A;  4GQ7 A;  2VTX J;  4L99 A;  3WP4 A;  2D93 A;  4Y4Y A;  4URA A;  2BYV E;  3I2J A;  1G6N A;  1C5I A;  3HN1 A;  4PQ9 A;  2B9V A;  4Q4X 1;  5BNN B;  5C4W A;  2A75 A;  1LRH A;  2VMF A;  1KRI A;  1GNY A;  3P3N A;  3GXU A;  4LKF A;  1MS8 A;  2AEN A;  1GFF 2;  4NPR A;  5FMO S;  3K4D A;  1UZW A;  5T55 A;  5CKN A;  1AX1 A;  2NMO A;  5I0S A;  3T0A A;  4Q4X 2;  3NL1 A;  4OUS A;  5EQU A;  3RGB A;  4OHW A;  4HZF A;  1XE7 A;  4OHZ A;  4QPW A;  1F8V A;  5CAD A;  3NV3 A;  1M06 G;  1JBC A;  4HVO A;  1YQ6 A;  4QM8 A;  5I0R A;  4EWE A;  3M3C A;  3OBR A;  3LA7 A;  1H4H A;  3ZMN A;  4ZON A;  2CDO A;  3PIJ A;  2IVI B;  3T4H B;  5KHK A;  1V9U 3;  4K40 A;  4RSU A;  2HBT A;  5FZM A;  3M7A A;  3U4X A;  1SBD A;  4RFR B;  4S2D A;  3OPZ A;  4QM9 A;  1PZ9 A;  5E89 A;  1SMV A;  1ZM1 A;  4Y26 A;  2D40 A;  2EAL A;  4H55 A;  4LA2 A;  3ALQ A;  1PO2 3;  5E6H A;  1WCS A;  2VBP A;  1X33 A;  4JKM A;  1CR7 A;  5A7W A;  5CA6 A;  3OGJ A;  2E53 A;  5FZE A;  1HN0 A;  1YQC A;  4HK9 A;  4K3U A;  2Q1F A;  2AAC A;  2D6K A;  4DUV A;  1H8T B;  3UJQ A;  3MW3 A;  1SLI A;  4QDS A;  4QPG C;  3C7E A;  1NCR B;  3DEM A;  4YGD A;  1YFU A;  3OG2 A;  4I02 A;  2YYO A;  2ARE A;  5FXV A;  4AAX A;  4LNV A;  2EID A;  4FT8 A;  5A7Q A;  5LY2 A;  1KXG A;  2IFW A;  1OMI A;  4IDZ A;  5BUV A;  4QGN A;  1PZ8 A;  3RMX A;  4XFG A;  5F9T A;  2WDB A;  1DP0 A;  1UYP A;  5KHG A;  5C3P A;  2KD7 A;  1VBC 3;  3FHA A;  2WWS A;  4FPL A;  4UFH A;  3QOP A;  1VBA 3;  1R08 1;  4GWM A;  2PAE A;  1YRZ A;  4MOA A;  4BXF A;  2VC9 A;  4JRL A;  1IPK A;  3OYW A;  3I3Q A;  4E27 A;  1QDC A;  4UW6 A;  5A32 A;  2ZOE B;  4B29 A;  2CTV A;  5IK5 A;  4LUK A;  2XXZ A;  5FZL A;  3INA A;  1R08 2;  3RG0 A;  2CV6 A;  1H2K A;  2WT2 A;  4XIO A;  2P3K A;  3VZL A;  1ULC A;  1FT9 A;  4MGK E;  1W99 A;  1W2O A;  3I49 A;  4CDU B;  4TN7 A;  4QB2 A;  4IEO A;  5C9A C;  4WVZ A;  3T2T A;  3WUD A;  5BNP C;  1BHG A;  1WBL A;  1SFY A;  1GU3 A;  1UZ0 A;  2OS2 A;  1WGP A;  1F31 A;  1W0O A;  5LWB A;  1WCU A;  2ZGL A;  2WQ4 A;  1O8P A;  5CFC B;  1LEN A;  3C2U A;  1D2S A;  1WBF A;  3KHC A;  1SFP A;  1H1I A;  1XNK A;  5C71 A;  1YQ8 A;  1PO1 1;  2P5B A;  5I8S A;  3WNP A;  4YM0 A;  1DLC A;  1WME A;  3I3E A;  4OLL A;  3ZXD A;  5A7O A;  2OW4 A;  1YFY A;  2JE7 A;  4NHM A;  3LDK A;  2VZU A;  5LAT A;  2VM9 A;  3DKW A;  5K7P A;  3A7Q A;  4A44 A;  1BZW A;  1GV9 A;  4IEP A;  1JHJ A;  2XL7 A;  1GZ9 A;  2VU9 A;  3B01 A;  1W2T A;  3S7I A;  1UD1 A;  1PO1 2;  3AFG A;  2YPJ A;  3E1F 1;  3AYA A;  1DDL A;  2VGD A;  1OOP B;  1S0C A;  2DUR A;  1L7Q A;  4ONU A;  1AX2 A;  3RDI A;  5K9Y A;  4CP1 A;  4H14 A;  3GHN A;  1VRH 1;  4COV A;  1ZZB A;  4JDM A;  2HWF 1;  4X6Q B;  2JG9 A;  3J4U H;  1QQP 3;  1NLR A;  5F3I A;  4CP2 A;  2XLG A;  5HXM A;  5CB7 A;  1IG0 A;  1W9T A;  4YM3 A;  4XF3 A;  3H3L A;  5LBC A;  3U10 A;  3BVC A;  3PL0 A;  5FZF A;  2VZ1 A;  4UFI A;  4UWD A;  2D97 A;  1VRH 2;  3OD0 A;  1NG0 A;  2J1E A;  1REF A;  3GYD A;  3P5B A;  4QX1 A;  4YW5 A;  1KDK A;  5AVP A;  1C5H A;  1I5P A;  2HWF 2;  3PU3 A;  4UW5 A;  4QHB A;  1GSL A;  2DFC A;  2B9U A;  2XR4 A;  1XE8 A;  1LGB A;  3HNB M;  3LDB A;  4Q8L A;  1RXG A;  1US3 A;  3EYP A;  3VKO A;  2GC3 A;  1JH5 A;  4AFD A;  2WO1 A;  1AR9 1;  4AVB A;  5ACA 3;  2P17 A;  3WG4 A;  3BOP A;  1WMD A;  2RE9 A;  3SKJ E;  5BNO B;  2BJS A;  4QQP A;  3MUY 1;  1J58 A;  2W1S A;  2WUH A;  1DZT A;  1OLM A;  4YLZ A;  3KF3 A;  4CCL A;  1FV3 A;  1VAV A;  1XYP A;  1PIV 1;  4FI9 A;  3OGG A;  1XU1 A;  4X6R B;  5ERL A;  2C24 A;  5IVY A;  2OA2 A;  5FMO L;  1AR9 2;  4BQ2 A;  5J7M A;  1X9T A;  3NW4 A;  1AJO A;  3O7O A;  3E6B A;  3ACH A;  1RUJ 3;  4JV4 A;  1OHF A;  1ONA A;  1ENX A;  3B02 A;  2Y6J A;  1NT0 A;  3FLT A;  5FZC A;  3AYD A;  3ZSJ A;  5J36 A;  3O0W A;  3W20 A;  5IVC A;  2WO3 A;  1W6M B;  5FY0 A;  2GU9 A;  4HXC A;  1PIV 2;  5LBF A;  3VN4 A;  2Z2S B;  5A7P A;  2AYH A;  1YFW A;  3RJ2 X;  2YC0 A;  2BGC A;  2OVU A;  4W6X A;  3M4F A;  2Q8D A;  1OVP A;  1W6O B;  2B45 X;  2FDJ A;  1VMJ A;  2RR1 3;  2V4A A;  4QPG B;  5D8A C;  2XJV A;  4IET A;  3THD A;  1BQP A;  4XJ9 A;  2EVX A;  2W08 A;  1MZ5 A;  3U14 A;  1IG3 A;  3VBR C;  2VQA A;  4JX0 A;  2QQV A;  1V6J A;  4OZO A;  1BBT 3;  2XOM A;  5FXZ A;  3RJR A;  1ULP A;  2CDP A;  1PM4 A;  1UL9 A;  4RYD A;  2FCT A;  3WHU A;  1FOD 3;  4AHZ A;  2VY0 A;  5C33 A;  2D7F A;  3VZM A;  1W8T A;  4NPM A;  2YHJ A;  1CZT A;  1CD3 G;  2ZAA A;  4XZP A;  2FCV A;  5IW0 A;  1W8Z A;  2Z5W A;  1QJY 1;  4WVM B;  1FAY A;  1QNW A;  2X53 S;  2WYF A;  4XHB A;  2AEZ A;  3GBF A;  4XBN A;  4Q4Y 3;  3VZJ A;  2FDI A;  3UGF A;  4E4Z A;  4M4R A;  5FP3 A;  1R1A 1;  3TRS B;  2QVS B;  1W6Q B;  1TMF 3;  4I30 A;  3KVB A;  4LLO A;  2VUL A;  4CDQ A;  2IXH A;  1OQ1 A;  1DHK B;  2B4K A;  4OUM A;  5HCA A;  3NJZ A;  1QJY 2;  1HXS 1;  2E32 A;  5IK8 A;  3VV1 A;  5C9A B;  1QNY A;  1AL2 1;  2JG8 C;  4XDP A;  4Y22 B;  4AL9 A;  5BNP B;  4XUT A;  1MS3 A;  1R1A 2;  3WF0 A;  1CIW A;  4DS0 A;  4JKL A;  1C57 A;  2JKX A;  4E4D X;  3PTY A;  2P3Y A;  1CX4 A;  2GNT A;  4GAL A;  5D1I A;  3ZXE A;  4DEV A;  3ILN A;  5IVB A;  1IS5 A;  3KV4 A;  1OH4 A;  2ZAC A;  1RUG 1;  1VMF A;  2B8M A;  2VW2 A;  2BFU L;  2PHW A;  1HXS 2;  1YXW A;  3QAC A;  2XUM A;  4JGZ C;  1AL2 2;  3O1O A;  2ZGK A;  2VMG A;  5A3N A;  2HWC 1;  1F4A A;  1SDW A;  5L7O B;  3CU7 A;  4Y1V A;  2Y33 A;  4BQ3 A;  1RIN A;  4FSJ A;  2HEY F;  3K3O A;  1CAX B;  1UXX X;  3PUH A;  3R4U A;  4QPY A;  5DQ0 A;  4B8E A;  1OLQ A;  5HV0 A;  1RUG 2;  4ZKT B;  3KV6 A;  3D3A A;  4GWN A;  4WZF A;  1S0G A;  3MIB A;  1CAW B;  4URT A;  3UYJ A;  1CON A;  2I07 B;  2HWC 2;  5GZF A;  1PK6 A;  4S2G A;  2JE8 A;  1H8V A;  4FP2 A;  4GA9 A;  2PHF A;  4LMF A;  2Q8O A;  2VO5 A;  1W28 A;  3V65 A;  1UOB A;  2UY9 A;  1F5F A;  4A3Z A;  3ZSE A;  1HQN A;  2ZHL A;  1JZ4 A;  1EAH 3;  1HV1 A;  1C4R A;  3O1R A;  1XC6 A;  1ASJ 3;  3AP6 A;  4OHX A;  1UY2 A;  1ZBE 3;  1N1Y A;  4TYS A;  1W06 A;  5CKQ A;  3ILF A;  3SLI A;  4QX0 A;  4AFC A;  2R30 A;  4L9B A;  3BOD A;  4P14 A;  1OF4 A;  5CIR A;  2CU5 A;  2W1W A;  2QQO A;  2VZO A;  3I7D A;  3FFZ A;  4CRQ A;  3GZE A;  1CGP A;  2BQP A;  5FYT A;  2LW8 A;  2DWR A;  4YW2 A;  3NO8 A;  4LR4 A;  1LB2 A;  4HN0 A;  3NWK A;  5FTT C;  3USS A;  3TAY A;  5EJ1 B;  5JZG C;  2QE3 A;  3S5Q A;  3Q8C A;  4DZG A;  1NA1 C;  3PLQ A;  1GIC A;  1HDK A;  2J1S A;  1Q8P A;  2E63 A;  4NWV A;  5DG2 A;  3ZSK A;  5HCF A;  2DDU A;  5FZ6 A;  4AF9 A;  4D8M A;  1STM A;  2QFE A;  4OYU A;  4XVH A;  3VUO A;  2WJS A;  3SH3 A;  5DZG A;  1LCL A;  3JUU A;  2DYC A;  2E9Q A;  4IEU A;  1AR6 1;  1UMH A;  2Y34 A;  5FZ0 A;  5FZO B;  4LUL A;  3ZIW A;  3ZYH A;  1AUY A;  5AC9 3;  3AL5 A;  3KSC A;  4XTM A;  1G9D A;  1ZZ6 A;  1JOJ A;  4BK4 A;  2VMD A;  4N43 A;  4N90 A;  4Z82 A;  4K6B A;  2R04 1;  4PI0 A;  3B3Q E;  1F2N A;  4PT6 A;  1CPM A;  1QXJ A;  2JD9 A;  5JWP A;  4U36 A;  4WBB A;  1AR6 2;  3N9N A;  1XNT A;  1Y9G A;  1JYV A;  2ORX A;  1E57 A;  2D44 A;  3FMG A;  2QQU A;  3POB A;  4ZS2 A;  1GZW A;  5IVJ A;  3KS7 A;  3GHM A;  3VDB A;  1YUD A;  4OI2 A;  4AVC A;  4IV3 A;  3G7D A;  5D8A B;  4K21 A;  2XVK A;  5FYU A;  4BLJ A;  4QGM A;  2R04 2;  1HX6 A;  2FZ1 A;  4Y5Z 0;  1DQ4 A;  1MQT B;  3B5L B;  2JDK A;  2J22 A;  3VBO C;  5IT6 A;  4A45 A;  2YBK A;  3ZXJ A;  1W3V A;  1ALY A;  1ZZ9 A;  5A3W A;  3VBR B;  2R49 A;  3AVR A;  2PHX A;  4HVQ A;  1N1S A;  2XML A;  4FOV A;  1IZ3 A;  2GC1 A;  3JZV A;  3L2H A;  4Q0S A;  4XHX A;  4NID A;  4CDW A;  4XAE A;  2X09 A;  1H30 A;  1MPX A;  3M3I A;  4A7Z A;  3ZFF B;  4RQP C;  1W8W A;  2W95 A;  1APN A;  1GWK A;  2YGM A;  3ZMO A;  3BCW A;  2BUK A;  1RB8 G;  3JB8 A;  1RXF A;  4YW4 A;  2OXB A;  5I8Y A;  2DVD A;  1ENQ A;  4CPB D;  1NE4 A;  2XQX A;  3JD7 3;  4Q0P A;  2A6X A;  3RZH A;  1WD4 A;  3H50 A;  2VW1 A;  3QD6 A;  1ULF A;  4UFJ A;  4Y1U A;  5LAS A;  1ND2 C;  1XJA A;  2BTV C;  4OUL A;  3LFM A;  1UYY A;  3RWN A;  4I3G A;  3O1M A;  1OPM A;  2MEV 1;  3EO6 A;  2EIB A;  2BGO A;  2WS9 1;  5FZK A;  5A7N A;  2LAL A;  4FO9 A;  3SNM A;  5KR7 A;  2LM3 A;  1WMX A;  2RMU 3;  4YM1 A;  1GP4 A;  5T5P A;  4TTG A;  2GND A;  1IKQ A;  4JDN A;  2B5H A;  3U75 A;  2JIG A;  4MVT A;  1W6N A;  5FZI A;  3TYJ A;  3FFQ A;  4FPE A;  5CFD C;  3CQO A;  1ZRF A;  1U0A A;  5H9R A;  1NAE A;  2JG8 B;  2B46 X;  1OUX A;  3T0D A;  2DUO A;  2OZJ A;  1GZT A;  1I9R A;  2OZ6 A;  3CBN A;  5CKM A;  2MEV 2;  1HJF A;  2WS9 2;  5A3L A;  5C6C A;  2XUE A;  3WDY A;  4XUQ A;  1JTZ X;  2JEM A;  3VB9 A;  4D7S A;  3RZM A;  4XF0 A;  3M3O A;  1Q5O A;  2EXJ A;  2HWE 1;  4DXZ A;  2OUJ A;  3VL8 A;  2JIC A;  3I97 A;  4AVV A;  4Y3O A;  5JOX A;  4JGZ B;  4WVW A;  1VBE 3;  3PME A;  3S0M A;  4TZD A;  5EXO A;  2C9K A;  4QKF A;  3DYP A;  5FJH A;  5FFO C;  4L0P A;  1FAT A;  1JW6 A;  3W58 A;  1LR5 A;  1F5J A;  1PHM A;  4MH0 E;  4I01 A;  3POJ A;  3CEW A;  4EZH A;  5FYB A;  4CDX A;  1MR5 A;  5K8S A;  2HWE 2;  4MG2 A;  2PMW B;  1OI6 A;  3R0R A;  3VKF C;  4QQO A;  4NHX A;  3OEB A;  3WDW A;  2ZAH A;  3JU9 A;  1HJG A;  2YRO A;  4BQ5 A;  1ZRD A;  2E51 A;  3JCI A;  1CAV B;  3NNM A;  4WM7 C;  4XF4 A;  5FXX A;  4AEJ A;  3VGI A;  1NE6 A;  4ATE A;  4B3N A;  2ARC A;  4AI1 A;  1YYN A;  4B7E A;  4EN7 B;  3ZLI A;  4YG0 A;  4Y1Y A;  1DGW X;  2J1R A;  4O65 A;  3WNO A;  1NQJ A;  1KIT A;  1R1A 3;  4LE3 A;  4BK5 A;  2JB8 A;  4BQW A;  5F6L B;  1HRV 1;  4P08 A;  3ZFE C;  1JUI A;  3AB0 A;  2PHR A;  4FOW A;  4MGI E;  4QKB A;  2WA4 A;  4ISQ A;  1S0D A;  4MGY E;  3BTX A;  4EN9 B;  1WW5 A;  3PIG A;  1AYM 1;  1W04 A;  3ZPO A;  2D98 A;  4FPC A;  4AHY A;  1J84 A;  1ND3 B;  1UKR A;  4YNI A;  3TEZ A;  1WA6 X;  4AHX A;  1FI2 A;  1HRV 2;  2CGO A;  2B7Y A;  2BEO A;  2YU1 A;  2P6H A;  4XBL A;  3PUS A;  1LHO A;  1F9K A;  1S0F A;  2GC2 A;  4YGB A;  5FK7 A;  4ASK A;  5GLZ A;  4GMP 1;  3ZKU A;  4ARY A;  4CPB A;  2XPJ A;  3IPV B;  3IDB B;  4OUE A;  1H6Y A;  2GNM A;  1AYM 2;  3WDT A;  3WEZ A;  5J37 A;  4PHZ A;  2GME A;  4Q0V A;  3TEY A;  4XXP A;  5DDJ 3;  2XWJ B;  2ZTN A;  2ZX1 A;  3WF1 A;  1O3S A;  2CAV A;  2VG9 A;  2BNM A;  3RFR A;  1RTV A;  1DGL A;  3H1M A;  4RR3 A;  5FUN A;  4HOO A;  3FUQ A;  4YVW A;  3WF2 A;  2FBE A;  5ABJ A;  1UU6 A;  4UBH A;  5C9A A;  3IB3 A;  1QJX 1;  2CGN A;  1HRI 3;  2VW0 A;  3J8F 3;  4DB5 A;  1NQD A;  2YPD A;  3VDC A;  1F35 A;  1VBD 3;  4QMA A;  5CZK A;  1HW5 A;  4LBQ B;  4LJH A;  1RUD 1;  2VZS A;  2XLA A;  1DCS A;  4ZU5 A;  4L97 A;  1VBB 1;  3AKR A;  1ZA4 A;  3HMY A;  3LA2 A;  3D6E A;  5BY5 A;  2GMM A;  1VAM A;  4QX7 A;  3MID A;  3M70 A;  4DMI A;  1QJX 2;  5HPO A;  3QBQ A;  4L2N A;  3VBO B;  5J1X A;  2FDH A;  2DCK A;  3LOI A;  4XUR A;  4ERO A;  4KH9 A;  2E6V A;  2CYF A;  2ZGS A;  2YB7 A;  5FYM A;  1G8W A;  4ORF A;  4Z2A A;  1ZX5 A;  1RUD 2;  3O5S A;  2R0H A;  1C8M 1;  2Y64 A;  1VBB 2;  3CF6 E;  4XIK A;  3TOJ A;  3VBF C;  1IQD C;  4RQP B;  3X29 B;  3ZFG C;  3K4Z A;  5DAV A;  3WNM A;  4CUC A;  1H8T C;  3ZXL A;  2GAL A;  2D6O X;  3NJV A;  1O4Y A;  1NCR C;  2ZX4 A;  5F3G A;  2KR2 A;  2WZR 3;  3DL3 A;  3H1W A;  1GQH A;  4FPK A;  4AYU A;  5A1A A;  2P34 A;  3LEM A;  5FV3 A;  1ND2 B;  4P9L A;  3P3P A;  4QKN A;  4XEZ A;  2VOK A;  1DGR A;  1UNB A;  1C8M 2;  2EXI A;  2G19 A;  2WZE A;  2VAU A;  3DCQ A;  3HN3 A;  3KT4 A;  3RNS A;  4AQ6 A;  4BU2 A;  3S30 A;  2XJQ A;  5H9S A;  1T2X A;  1R09 1;  5FY7 A;  4AVA A;  1C8N A;  1MS5 A;  3HBK A;  2ZPX A;  1LOA A;  2Y6F A;  2A3Y A;  3WNK A;  2AH2 A;  3QLQ A;  2JXA A;  2OPK A;  2D6N A;  2ZMK A;  3RMY A;  5FLH A;  2R06 3;  1AR7 3;  2ID4 A;  3B7M A;  3ZXG A;  1V00 A;  5J3U A;  3IDE A;  1NOV A;  1DQ2 A;  2HYK A;  2JE9 A;  1V0A A;  2VEC A;  1R09 2;  3D0J A;  1UZY A;  2WWJ A;  3CJX A;  3AMH A;  1H1M A;  4K1Z A;  3ECQ A;  3AXE A;  1YIF A;  3MLL A;  4RL7 A;  4AZZ A;  4GZ9 A;  3ZOI A;  1TE1 B;  4EWD A;  4A41 A;  4JHT A;  1XQN A;  1RL3 A;  5F3C A;  4N53 C;  2HWB 1;  5BXX A;  4HFS A;  3VKL A;  5FZG A;  2WQZ C;  3I59 A;  1IS4 A;  1QJZ A;  4LHS A;  4LQR A;  3DXT A;  2LRO A;  3H7J A;  1RMU 1;  5A3U A;  2FDG A;  1LEC A;  2WNV A;  3CJI C;  2ZX3 A;  5ANN A;  4LK7 A;  1Y43 B;  1RC6 A;  2WFF 3;  4MXW B;  3UNP A;  2HWB 2;  4XYX A;  2DU1 A;  3VHO A;  3MIG A;  2D6L X;  3LD8 A;  1UU4 A;  3WY6 A;  4Y5T A;  3NAP A;  3ZDV A;  4WM7 B;  3RYR A;  1KQR A;  1RMU 2;  3PU8 A;  1NCQ B;  4P9Y A;  1GYK A;  5A33 B;  3KT7 A;  4COZ A;  1Q56 A;  1D4M 3;  1RIT A;  5L9R A;  3ZN4 A;  2FZ2 A;  4HLT A;  2YC4 A;  3HVD A;  1OKQ A;  1XNA A;  3VBU A;  2RVA A;  1SEF A;  3K77 A;  4M3C A;  2A73 B;  2MEV 3;  4MZU A;  1GQP A;  3ZN6 B;  2BPA 2;  3ROU A;  3DF0 A;  4P9I A;  4OHY A;  1OOP C;  4XFA A;  3SHR A;  2TNF A;  1I3H A;  3ZPY A;  4PBP A;  3OB8 A;  3SC7 X;  3KMH A;  3WIN E;  2YDE A;  4DQA A;  1YEW A;  3CHX A;  3A21 A;  2QQK A;  4XTP A;  2I2S A;  5A1F A;  1LES A;  3OY8 A;  5CAZ A;  4A7K A;  3RZJ A;  1GZC A;  4I3P A;  4Y1Z A;  4Y20 B;  1W9S A;  2Y0I A;  1ULO A;  1QY4 A;  1GOH A;  2BU9 A;  1TVG A;  1KGY A;  5HV4 A;  1PGL 1;  5DAX A;  4PF1 A;  1D0H A;  3KVA A;  4Y5S A;  4GH4 B;  2ZGO A;  1UPS A;  1ZZ7 A;  5E1R A;  1A78 A;  3Q8F A;  2PEL A;  4Q1R A;  4ES9 A;  3IDA A;  4IE6 A;  4EQV A;  5DPN A;  3I3M A;  3B00 A;  1S1A A;  2VNV A;  1F4H A;  4CEW A;  3AX4 A;  2WL1 A;  2NZ9 A;  5JVV A;  3TN9 3;  5BNO C;  5K0U C;  4NN0 A;  1PGL 2;  1K5M A;  3RI9 A;  4W4Z A;  4CCN A;  4LO5 B;  5C8C C;  1W39 A;  1AJK A;  4HPK A;  4QQL A;  4D6Q A;  1H0B A;  5IYY A;  3POY A;  3MV0 1;  3PUA A;  1H9W A;  4XJW A;  2VD7 A;  1OH3 A;  5FZ7 A;  2DBN A;  1W6P B;  1H2L A;  3RRD A;  2NQY A;  2VNG A;  3GAL A;  4JGZ A;  2Q8E A;  2GSY A;  4UXA A;  1J3P A;  4ZZ8 A;  2CWM A;  1PNG A;  2K46 A;  3DYO A;  3VD3 A;  5C7G A;  1FPN 1;  1CJP A;  3KD4 A;  2HBU A;  5L36 A;  4QHZ A;  3WCS A;  3OTF A;  1AHS A;  1OUS A;  3IDC B;  1WKY A;  3MPP G;  4QPI C;  2WN2 A;  3AVS A;  3ZFG B;  3VBF B;  2CNA A;  2O1Q A;  2X5I C;  4W65 A;  4A7Y A;  2QQP A;  1JZ8 A;  1SPP B;  5EFU A;  1AYM 3;  2L9L A;  3DGT A;  4CVU A;  3AFK A;  3LZZ A;  4I0A A;  2XJR A;  2R07 1;  1LUL A;  2X05 A;  1FPN 2;  3ELN A;  1UPI A;  5JUV A;  1UYX A;  2HYX A;  2VOV A;  1COV 3;  2LS6 A;  4Q4W 1;  5CG8 A;  3VBH A;  1HIX A;  2FHR A;  1N3P A;  1MS4 A;  1POV 1;  2XJP A;  2K9Z A;  2EA7 A;  4YGE A;  5TSW A;  5FZ1 A;  4XF1 A;  1QXR A;  3UGH A;  3DUI A;  1SLL A;  4COU A;  4IE7 A;  3J26 N;  3ZDS A;  4XFB A;  1BVP 1;  2ZGT A;  2ILM A;  4K7J A;  2ZEY A;  2R07 2;  1KD7 A;  1HLC A;  2P37 A;  4GD4 A;  4XZU G;  5DAB A;  3C7O A;  5GZC A;  3IKW A;  4O9G A;  4D94 A;  1O5L A;  4Q4W 2;  4DEQ A;  3LF7 A;  3UGG A;  4BQ4 A;  1RJ7 A;  3POS A;  4OCT A;  3N9P A;  4BE3 A;  2VUD A;  5JPN B;  2R1D A;  5KHH A;  1URX A;  1Y9M A;  3LEK A;  4BXS V;  5JZG A;  2W1U A;  4AXO A;  1TME 1;  4SBV A;  4E9K A;  2TEP A;  4Q27 A;  1EV1 1;  1NA1 A;  4LA3 A;  4MGQ A;  3USU A;  3CIH A;  4BMB A;  2BFU S;  4N53 B;  4R52 A;  5KXB A;  4KWK A;  3WDU A;  1GOG A;  3K46 A;  1O5U A;  4PIY A;  2SLI A;  3IPV A;  1CAU B;  5FCC A;  2NM1 A;  1DU3 D;  3KF5 A;  3NJX A;  2XON A;  4H3W A;  4CCD A;  1SHW B;  2VOT A;  3CJI B;  3GBW A;  1RUC 3;  1TME 2;  1EV1 2;  5GJ6 A;  2Q8C A;  4C0B A;  4B1M A;  4JQR A;  4QX3 A;  2R7E B;  5IVE A;  2UWA A;  5EJ3 A;  4Z8B A;  4IEQ A;  3K3N A;  2VQT A;  2VTX A;  2BWA A;  3H42 B;  3NKG A;  2XHK A;  4XAC A;  3O1P A;  4PDW C;  1GP5 A;  2A71 A;  2VUA A;  3PUI A;  5FQ0 B;  5GZE A;  4KGQ A;  3K2O A;  5L7O C;  1SQ4 A;  3B9I A;  5F6K A;  3V0A A;  2OKX A;  3DXU A;  2Z4F A;  3AM2 A;  3GZA A;  1LOE A;  1V6K A;  1KS5 A;  1LHU A;  1AL0 G;  1YQ2 A;  2WSV A;  4FOQ A;  4RD7 A;  3ZSM A;  4AVT A;  4CTE A;  5C70 A;  1DZR A;  1PMI A;  1CPN A;  4AI3 A;  2BVB A;  2P3I A;  4QDQ A;  3MFC A;  1A6C A;  4RA0 A;  5FYC A;  3S57 A;  1LAJ A;  1HB1 A;  4RGA A;  1RUH 1;  5FY1 A;  1YO8 A;  3UET A;  5JPM B;  2R32 A;  3VZK A;  3R4D B;  3GNE A;  5DUV A;  4XJZ A;  3KCY A;  3J7N A;  3ES1 A;  3IT8 A;  5FMD A;  4IER A;  5A3M A;  2ES3 A;  1B09 A;  2GP5 A;  1RUE 1;  3AJY A;  4RQP A;  3T30 A;  3V0B A;  3PVO A;  1UY3 A;  1EP0 A;  3RSJ A;  2ZKN A;  1NLQ A;  1XE0 A;  2WQ8 A;  3PTR B;  1RUH 2;  4TSV A;  5BV6 A;  3FUO A;  5FKB A;  1HB4 A;  2RDN A;  4UYB A;  1ZNP A;  4A4A A;  1SFN A;  1X8M A;  3WDV A;  5C3R A;  3A23 A;  4WM8 B;  2WNU C;  2E33 A;  4JGY A;  3VBS C;  2C26 A;  4M0N A;  2IWG B;  3VHP A;  4CCC A;  4JRA A;  1OVS A;  5FYI A;  1RUE 2;  2E7T A;  3SXW A;  1ENS A;  3DPR A;  4IW3 A;  1X36 A;  4WV8 A;  2O8O A;  1QOO A;  5H9Q A;  4R9C A;  1PX3 A;  5CFD A;  4CEY C;  5K0U B;  4FFH A;  1BMV 1;  2WN3 A;  3NVC A;  3FZ3 A;  2Y6L A;  1R1Z A;  4FXK B;  5KC6 A;  1I1E A;  4NRP A;  5C8C B;  1AYN 1;  2JIJ A;  5DAW A;  2ATF A;  5EYY A;  1Y9Q A;  4AGG A;  5AFB A;  2VVD A;  1JZ2 A;  4RS5 C;  3ZR6 A;  1SAC A;  5FBZ A;  3WVJ A;  4YZ5 A;  3ASI A;  1BMV 2;  1JI6 A;  1OXC A;  5JI9 A;  2ARA A;  5EJZ B;  3MYX A;  2QDN A;  4QHO A;  3WP5 A;  1RUI 1;  1KJR A;  1ZA7 A;  1OA2 A;  2X10 A;  3EJK A;  2W2I A;  5IVV A;  2JD4 A;  3JQX A;  3MFA A;  1LHV A;  1AYN 2;  4J1W A;  4CP9 A;  2OUH A;  1JU4 A;  4LHN A;  4QPI B;  2WT0 A;  2X5I B;  3U1X A;  1UCX A;  2GDF A;  4LKE A;  4X8N A;  2GZW A;  5DUU A;  3QH6 A;  3RS6 A;  1PVC 1;  4CCM A;  4XMA A;  3MPB A;  3H9A A;  1RYY A;  2R1B A;  4QT6 A;  5FO9 B;  5IK7 A;  3J7H A;  1RUI 2;  1MQT C;  4COW A;  4WM7 A;  2DV9 A;  3MHZ A;  1F15 A;  3RZG A;  2PHD A;  2ZEX A;  4Q4X 3;  1C3H A;  1IOA A;  2EXH A;  2R16 A;  1D4V B;  4IEX A;  4XDO A;  3EB7 A;  1MVQ A;  2MHF A;  2JDY A;  1K45 A;  3AC0 A;  1PVC 2;  1ZVF A;  5DUW A;  1RHI 1;  1H1A A;  5LY1 A;  1W8O A;  2YBP A;  3ZFF C;  1AVB A;  1L7R A;  1Q3E A;  1REE A;  1W2N A;  1Z78 A;  3IZO A;  1A8D A;  4XET A;  5FWJ A;  2ET7 A;  2FDK A;  3BTZ A;  1BLZ A;  3ZFE A;  2B42 B;  2WAB A;  3M1H A;  4R8H A;  2Q1M A;  5E88 A;  1W9Y A;  3WG2 A;  3BI3 A;  1Z7S 1;  1JS9 A;  1SLA A;  3EXU A;  3HQR A;  4OVE A;  4EN0 A;  1UWW A;  2JX9 A;  2O0O A;  2QZ2 A;  3B93 A;  3FL7 A;  4V1P A;  4ES8 A;  1HB3 A;  1MS0 A;  3D4K A;  4HN1 A;  1MAC A;  2RS3 1;  3MDP A;  4OZX A;  1RHI 2;  3U07 A;  1I5Z A;  1QWR A;  3LSD A;  2DTY A;  1SZB A;  2GN3 A;  4KBZ A;  2VMI A;  1R64 A;  1IQA A;  2YU2 A;  2IC1 A;  5BNN A;  1Z7S 2;  4Y4R A;  2P3J A;  1LGC A;  2RS5 1;  2Y6G A;  2OX0 A;  1OD3 A;  1SLT A;  3I2G A;  2PQS A;  2RS1 1;  5FLJ A;  1BEV 1;  4BOW A;  2RS3 2;  2LUW A;  4LBM A;  5DAP A;  1EUT A;  3MLJ A;  2PTM A;  3MF6 A;  5EPA A;  1OFS A;  3GM8 A;  3OOX A;  3B94 A;  4Q2F A;  1RUF 1;  2RS5 2;  3M3Q A;  3OUI A;  4LBJ A;  4ZXE A;  4BA6 A;  2QZ3 A;  2RS1 2;  2ZHK A;  3MBW A;  1BEV 2;  3HD8 B;  4PDW B;  4XE9 A;  3VDD B;  4MGT A;  3N7M A;  3WG3 A;  1NUK A;  1SBE A;  4D69 A;  3JBG 1;  4PQQ A;  4Q4W 3;  3ITQ A;  3WQ0 A;  2BZD A;  2VXJ A;  5FP7 A;  3UKV A;  5LA1 A;  3AZY A;  1W8U A;  1RUF 2;  1DGR N;  1W6P A;  2V72 A;  2VCC A;  3GDB A;  4X8P A;  1JN2 P;  3NNL A;  4ZXK A;  4CZS A;  5JXH A;  4XIL A;  1MEC 1;  5EP9 A;  3FLP A;  4NHL A;  4FP3 A;  4TLF A;  2CL2 A;  1R08 3;  2ZKL A;  5C5U A;  2BRT A;  5JOY A;  5FYV A;  3JBG 2;  1LNS A;  1DYP A;  5FUP A;  4UF0 B;  5FKC A;  2HLE A;  3KCC A;  4AEK A;  4JZR A;  4OI1 A;  3KQR A;  4LPL A;  4XCB A;  1H4G A;  1H8T A;  2J1U A;  1U5Z A;  4DIN B;  1MEC 2;  1NCR A;  3U4S A;  4KG8 A;  2O8Q A;  5LRS A;  4DRR A;  1U5Y A;  3F95 A;  2XJT A;  1VB4 A;  5KBF A;  4B4P A;  3BYW A;  2WNU B;  1N47 A;  2YUE A;  4QB6 A;  3H3U A;  2MNG A;  1BXH A;  2ZZJ A;  5FMC A;  3VBS B;  2GP3 A;  2P1B A;  3LQC A;  5FPL A;  4AGR A;  4OI0 A;  1OQD A;  3U37 A;  2VCB A;  2WO2 A;  1SBF A;  5A3P A;  1PGS A;  3DYM A;  4QDR A;  1ZRE A;  4FTE A;  1ND3 C;  2HH9 A;  5JSO A;  1ULG A;  2ZAB A;  5FYZ A;  1ZBA 1;  4GB3 1;  4CEY B;  2C1F A;  2ZEW A;  1OFN A;  1KFU L;  2UYA A;  4AK3 A;  1JZ7 A;  2EAK A;  2E31 A;  5I0D A;  4XF9 A;  2BV4 A;  2TBV A;  1PO1 3;  1U5I A;  3I3B A;  3L2Y A;  3WQ7 A;  3WF4 A;  3VD4 A;  3C7G A;  4J25 A;  4XQD A;  4XXA A;  1JYT A;  5A6X A;  1JZ5 A;  5AFE A;  1JZ3 A;  1Y3T A;  3THP A;  4FVV A;  4IE5 A;  4FPJ A;  1ZBA 2;  1DQ5 A;  2EF6 A;  4GB3 2;  1GP6 A;  4RS5 B;  3RQ0 A;  2XB6 C;  1CIY A;  4Q4V 1;  4E2Q A;  5B4N A;  1SDD B;  1DQ1 A;  4NE9 A;  5JI7 A;  4CDU A;  1YJK A;  2FQP A;  1G9C A;  2J1A A;  2HWD 1;  5A6Y A;  1RUH 3;  3LDR A;  3BTY A;  1NYW A;  5KHI A;  4QX5 A;  2YFU A;  2XVL A;  1O3Q A;  1N3O A;  1VRH 3;  1VMH A;  5CFC A;  4Z2W A;  2ENR A;  2HWF 3;  2K0G A;  4Q4V 2;  3HJR A;  3OD4 A;  1POQ A;  4M01 A;  3O0X A;  3HT2 A;  2V4V A;  4ITC A;  2HWD 2;  4KG0 A;  2OYZ A;  4LIV A;  5FOJ B;  2QUO A;  5FUI A;  3BGA A;  4IGQ A;  1UXZ A;  4RN5 A;  4YFZ A;  2G1M A;  3UK9 A;  2VZ3 A;  1DYO A;  2J1T A;  2ZS6 B;  3OBT A;  4HMZ A;  1GAN A;  1W05 A;  4HKW A;  1O8S A;  3J7M A;  5FPB A;  3BUC A;  2RG4 A;  4QAW A;  1K3I A;  4OI4 A;  4BYY A;  2WWU A;  4TLG A;  1OOP A;  1YNA A;  1AR9 3;  1Y4W A;  2PLV 1;  2Q30 A;  2JDA A;  2WNO A;  4GKX A;  5F37 A;  5IFT A;  1YQ5 A;  5HCH A;  4C0H A;  1BVV A;  2Z69 A;  3CKH A;  4B4R A;  4CCE A;  2LRP A;  4J6G A;  4PIX A;  3T2Q A;  3A4U A;  4E4H A;  4IE0 A;  2QQN A;  3N3H A;  1PIV 3;  1BKZ A;  4GXL A;  4MAD A;  1OBN A;  1NKG A;  5FZB A;  5SV8 A;  2JG9 C;  5HBA A;  2PLV 2;  3O12 A;  4E4S A;  2YG0 A;  2RHP A;  1FMD 1;  4YWA A;  1MS1 A;  3GGL A;  3K51 A;  4QX8 A;  3K4A A;  3WW1 A;  5D2A A;  4XMI A;  5IJR A;  5FY5 A;  5C4W B;  3W5N A;  1RUI 3;  2A5Z A;  3WUC A;  4O7X A;  1G86 A;  2JEC A;  4MV2 A;  1OKO A;  2BNO A;  3POI A;  5GAL A;  1S2E A;  2W1Q A;  3GJA A;  1N1T A;  5BNO A;  1O6U A;  4CUA A;  1W8H A;  1FMD 2;  5F32 A;  4QXB A;  1RIR A;  4GWI A;  5EHD A;  3AL6 A;  3DN7 A;  2A1X A;  4PI2 A;  1DYK A;  3LIH A;  4MHR A;  5JSR A;  3ST7 A;  3UJO A;  1V6L A;  1VR3 A;  2CSG A;  4QXK A;  2DU0 A;  2RM2 1;  2VMC A;  3O1V A;  1GNH A;  4S2H A;  1UY0 A;  3N7K A;  5GKA C;  3BB6 A;  1NXM A;  4AFB A;  4BPZ A;  1PX4 A;  1S0E A;  4PIZ A;  4B7K A;  1PGW 1;  3N9M A;  1W6M A;  3LE0 A;  4GJZ A;  2ZEZ A;  5IFP A;  1PVX A;  1E5R A;  3O1T A;  1NCQ C;  2RM2 2;  3DV8 A;  5D21 A;  4CU9 A;  2QJV A;  4HSL A;  1QJY 3;  2XGX A;  5JXJ A;  2N7G A;  3ZX7 A;  1W6O A;  3U0Z A;  1IHM A;  2VL4 A; 
#chains in the Genus database with same CATH homology
 1OC1 A;  5C3Q A;  1W3V A;  1UZW A;  1GP6 A;  2WO7 A;  1UOF A;  4XAE A;  1W2N A;  2Y60 A;  3ON7 A;  5APA A;  1RXF A;  1BLZ A;  1W9Y A;  5C3O A;  2IVI B;  1DCS A;  1HB3 A;  1GP5 A;  5C3S A;  2BU9 A;  2VBB A;  1BK0 A;  1GP4 A;  1E5I A;  1UO9 A;  1RXG A;  2VBP A;  1HB1 A;  1W05 A;  1HJF A;  1ODN A;  1IPS A;  2BJS A;  1W28 A;  3OOX A;  1UOB A;  1QIQ A;  2JB4 A;  1QJF A;  1UNB A;  1HB4 A;  2VAU A;  1W06 A;  2DBN A;  5C3R A;  1OBN A;  5C3P A;  2Y6F A;  1E5H A;  2DBI A;  1UOG A;  1ODM A;  1W03 A;  1HJG A;  2BRT A;  2VBD A;  3ZOI A;  2VCM A;  1W2O A;  2JB8 A;  1W3X A;  2CSG A;  1E5S A;  4RGK A;  1HB2 A;  1W04 A;  1QJE A;  2IVJ A;  4BB3 A;  1WA6 X;  3ZKY A;  1W2A X;  1E5R A;  3ZKU A;  2VE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...