3OOXA

Crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
307
structure length
305
Chain Sequence
TSAIDPVSFSLYAKDFTRFAQELGASFERYGFAVLSDYDLDQARIDAAVDSAKAFFALPVETKKQYAGVKGGARGYIPFGVETAKGADHYDLKEFWHMGRDLPPGHRFRAHMADNVWPAEIPAFKHDVSWLYNSLDGMGGKVLEAIATYLKLERDFFKPTVQDGNSVLRLLHYPPIPKDATRAGAHGDINTITLLLGAEEGGLEVLDRDGQWLPINPPPGCLVINIGDMLERLTNNVLPSTVHRVVNPPPERRGVPRYSTPFFLHFASDYEIKTLQNCVTAENPDRYPESITADEFLQQRLREIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative 2OG-Fe(II) oxygenase family protein
publication title Crystal structure of a putative 2OG-Fe(II) oxygenase family protein (CC_0200) from CAULOBACTER CRESCENTUS at 1.44 A resolution
rcsb
source organism Caulobacter crescentus cb15
molecule tags Oxidoreductase
total genus 91
structure length 305
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 3ooxA00
1HB3A 2VCMA 1ODMA 1QJFA 1W28A 1W2OA 2IVIB 1OC1A 1UOFA 1E5HA 1HB1A 2BU9A 4BB3A 1HJGA 2Y6FA 4XAEA 2WO7A 1W06A 1QJEA 1WA6X 2VAUA 1UOBA 1HB4A 2VBPA 1GP6A 4RGKA 1W3VA 1HJFA 3ZOIA 1UOGA 2DBNA 1E5IA 1RXFA 1BK0A 1W03A 2VBBA 2JB4A 1W2NA 3ON7A 1DCSA 1BLZA 1IPSA 1OBNA 2IVJA 1W04A 3ZKUA 3ZKYA 1UNBA 2VBDA 1W05A 1E5SA 5C3OA 2DBIA 5APAA 1QIQA 1UO9A 5C3QA 1GP4A 5C3PA 1RXGA 5C3RA 1ODNA 1W3XA 2BRTA 2BJSA 1HB2A 5C3SA 2VE1A 1W9YA 3OOXA 1GP5A 2JB8A 1E5RA 1UZWA 1W2AX 2CSGA 2Y60A
chains in the Genus database with same CATH superfamily
2XUEA 4AZZA 2ZX0A 2GN3A 1HRV1 3ILFA 5FMCA 3BOPA 4QB1A 4OZOA 3WT3A 1VIWB 5FZCA 1F4AA 5KXEA 4E4DX 5HXMA 3DXUA 2O14A 2IVIB 1G6NA 1LOFA 4QM8A 4W8JA 3D3AA 3LQCA 1V9U2 4O65A 1FPN2 5FBZA 4E4ZA 1IS3A 4DXTA 3VGIA 5CB7A 1N47A 1YRZA 1US2A 3MICA 1OOPA 3VDBA 4JGZC 4FFHA 4DXSA 2XHKA 1CAVA 3IWZA 3O1OA 1WA6X 1H4GA 3GM8A 1BZWA 2VUAA 4Q1PA 5FYTA 1HB4A 4GA9A 3OJBA 4LULA 3KSCA 5C4WC 5CYYA 1IHMA 5L7OA 1KJLA 4IE7A 4FPYA 2WSVA 2YGLA 3ILRA 4GZ9A 4NROA 3LAGA 3VZLA 2VXRA 3T1LA 1QMJA 2FDHA 1Q8PA 3BOWA 4YVSC 4NIDA 2XONA 2UWCA 4IV3A 4Q0PA 1YJKA 4XF9A 5H9SA 2WBKA 3JB4C 3IMMA 4CZSA 4OHYA 4YARA 4KU8A 4I3GA 1WCUA 2RS32 2IFWA 4PLOA 3VLBB 3U4SA 1GYKA 1F31A 1MVQA 1ND3C 1QJU3 2HYXA 1Z7S2 2IVJA 1CIYA 2WNVB 3VBUA 2OUJA 1C5IA 3FBMA 5FP3A 1GZCA 5HBAA 5KXDA 5A3PA 3G6JB 1O91A 3WG1A 1QJU1 2RS13 4EN0A 2BNOA 4Q4X3 2R16A 1VE0A 4JDOA 3WX5A 3ZSKA 3POSA 4UWDA 1OUXA 1US3A 2RS11 2VW0A 2I07B 4WZFA 4UBGA 4Q4X1 3C7HA 3CF6E 5FLJA 4OMDA 4FPEA 2CV6A 3FL7A 3KS7A 4JTOA 3PHMA 4QHBA 1I5ZA 3SCGA 3WUCA 3VD9A 5FO9B 2ZA9A 1NLQA 4QQHA 5FUPA 5AC92 5LA9A 3N35A 4K3UA 3OGRA 4OQ8A 3I2HA 3PJYA 4CCDA 4QXKA 1M4WA 1DHKB 3N7MA 2JICA 5FXWA 3ZXGA 4HANA 4NHYA 1MS9A 1AUYA 2HJIA 4UT5A 2D6LX 5BNNA 5I8SA 1QU0A 4JHTA 4W4ZA 4ZXEA 3VZOA 5LCWL 3H8UA 3WG4A 3POBA 3OGVA 5BNPB 1GOHA 1HRV2 3LA7A 1PO22 2ILMA 2Y6HA 3WG3A 2Y6GA 1TNFA 1WLWA 3AZWA 1W0OA 4YGBA 3T30A 2LROA 2OA2A 1IPKA 5ABJB 3PVOA 2OQ7A 4BQYA 2YDEA 5FZ9A 5IWFA 3AFGA 3DUIA 1H1MA 5J37A 4PJYA 1SLIA 1URXA 2YC0A 3EHKA 3H1YA 5JSPA 4LIVA 4I0BA 3I59A 1UMZA 1S0FA 3DF0A 1S4CA 1SG3A 5FZIA 4MXVA 4BMBA 4AOCA 1UY1A 1QWRA 2D6KA 2ORXA 3PU3A 3RDIA 5LA0A 4D6SA 2ZZJA 2FZ2A 2WIIB 1W9FA 1Y3TA 1ZRIA 4ASKA 2JE8A 5A7QA 2X10A 1ZBA3 5FYYA 2W87A 1RUI3 2W0XA 1HV0A 2JDKA 1W6QA 2BOIA 1A3KA 1U12A 1ZBA1 5FZ3A 1GZWA 1RUI1 2WYSA 3VBRA 2B8MA 3RZKA 1FX5A 2V72A 5DG2A 4LE4A 5DPNA 3WINE 4Z2AA 1UAIA 1JZ8A 3F95A 3SCFA 3ZIWA 4Y1UA 2W1WA 4BK4A 1HQWA 4AVTA 3BYWA 4QDQA 5A3TA 1J83A 4Y4YA 5LBBA 1XNKA 3FN9A 2BTVC 1YNAA 3ACHA 3THTA 3TWIA 4IE5A 1V6MA 2RDQA 1G8WA 5GLVA 3HNMA 4OCTA 4XBQA 5CVRA 2W1SA 2I45A 2QE3A 4LO8A 3ZO0B 3DCQA 4BIFA 1HXS2 2A6VA 1RUG3 4HONA 3MIGA 1W8OA 3RQ0A 4CCNA 4X8PA 1XE0A 4ISQA 4Y4RA 3ZPYA 1AR63 2ZOEB 5A32A 2YZ4A 1UU4A 3KCYA 2WKKA 2J7MA 2D3PA 2Y8KA 3LCPA 3OEAA 1AR61 3H7YA 2Y0OA 1JI6A 4EWEA 4IETA 2Q30A 2FCTA 4AFMA 4RGAA 1A78A 2IXLA 3KGLA 3WOGA 2LW8A 3ES4A 3L2YA 1RUE3 3B9IA 4UW6A 2X09A 1WD4A 1W04A 5FPUA 1J58A 2YMZA 4BPZA 1O6UA 2AUYA 4GH4A 4P9GA 3KM5A 3QH7A 4LBNA 1G9AA 5FZBA 1RUE1 3VL9A 4CP1A 5FZEA 3ZMNA 1UZZA 4JQRA 2RVAA 4LBKA 4JHZA 1GSLA 2DYCA 3AZVA 1TME3 4KMQA 5F5CA 1UMHA 1BQPA 2PFWA 2FCUA 3IZOA 5EYXA 4OUMA 3IT8A 3ZYIB 1TME1 3U10A 4B1MA 1PHMA 4OI2A 4H7MA 5FCCA 1EYBA 4IESA 1VBD2 1AYN3 1ASJ3 1QEXA 3ZR6A 4XQDA 5J98B 2VQTA 2BRTA 3VN4A 4CXXA 1JYCA 4LA3A 3O1VA 1C8NA 4WZCA 1UXZA 4E9KA 3C7OA 1AYN1 1ASJ1 4OMCA 4YW6A 1WW4A 3VBSA 3VUOA 3RPQA 2P3YA 1XJAA 1CX4A 3MO4A 4RR3A 4EJRA 1D4VB 1ZRCA 1UIKA 5A33A 5JUVA 4FPJA 2VZTA 4M00A 3RI9A 3CBNA 2MHFA 1UXXX 3ZFEC 5DAWA 1U5ZA 3MIHA 2G9FA 4FPKA 4Z8BA 2ARBA 5JR2A 1LULA 2VMEA 2ZGKA 1NE4A 5GZCA 1FMD3 1ZBA2 4FTBA 4TYSA 2Z79A 5A3LA 4XE9A 5CADA 1KGYA 3GZUC 3HQRA 4XFGA 5EZWA 4MZUA 2LS6A 4R52A 5JI7A 2W5FA 4LBOA 3CJXA 3RWKX 5IVEA 2QQPA 4NRMA 4JRAA 4BM8A 4D8MA 1QQP3 1U5XA 1XOYA 1YI9A 2ZGUA 4COYA 1RL3A 2VQAA 3WCSA 3VHNA 5FPAA 3J9SA 4FOVA 1QQP1 2A3WA 3WV6A 1GQHA 2FDIA 1X50A 1NX9A 3QACA 1K3IA 1ZA4A 4FOWA 4BISA 1ZVFA 3P3PA 1MEC2 5FZLA 4TLGA 1UWWA 5CFCB 2WT0A 1YJLA 4A41A 4R9DA 1R092 5KHGA 5FYZA 3V64A 1W6PB 1WCSA 3AP9A 4IGOA 2XLAA 3WF0A 5C7GA 2VNRA 5F7UA 5T50A 4DEQA 2GMMA 4X6RB 1IQDC 4LNVA 4ZS2A 4AHXA 1I9RA 1XU2A 1IQAA 2XR4A 4XJWA 5HV4A 2A6ZA 4PLMA 3Q8FA 5HCBA 1PZ9A 1S2KA 3DXTA 2H6BA 4FO9A 2AH2A 4B4PA 5GKAC 5DXDA 3U11A 3P6BA 3CZJA 3VBFA 3WSOA 3TEZA 1KFXL 2VMFA 4AGVA 2D44A 5FYUA 3TBDA 2VMCA 5C8CC 5CA6A 5ABJA 3KV5A 2RDSA 4QKDA 2A70A 2NMNA 4LXLA 4PLNA 3KF5A 1Q56A 2DVFA 5EJ3A 5F6LB 1QJX3 4XJUA 3NNFA 5JMOA 4COVA 4QPWA 3AMQA 3ZXAC 5JOXA 3TNPB 5IFTA 3Q8BA 1QJX1 2JJ6A 1TME2 4RGGA 1OLME 1DGLA 4K21A 3UYJA 4FT8A 3WW3A 4L92A 4A6SA 2ZX1A 4KNCA 4BIOA 4XOGA 4ITCA 1PK6B 2ADDA 3ZYGA 5LY1A 2HEVF 1H6XA 4QPIC 2QQMA 1XSRA 4A44A 4GXLA 4MSVA 3WDTA 3WW4A 5F32A 3AKPA 1UYYA 2ZX4A 1GU3A 3RI8A 1RTVA 2MNGA 1UYPA 1LOFC 4B8EA 5FPXA 2RR12 1YWKA 2BDRA 2FD8A 1C1FA 4FCAA 4KGGA 1Q43A 4P00B 3ATGA 4CU7A 2H0VA 4JKMA 3KV9A 3VBOB 2B7YA 2QQNA 4MLOA 2R30A 4LT5A 4HVQA 2AR6A 2I2SA 4XJZA 2NP0A 1OLQA 1DGRA 3OUHA 3ETQA 4TTGA 4RD7A 3R4DB 1N1YA 3NRUA 5IVCA 5IVYA 1MS3A 2PAEA 1JUHA 3EBRA 4LHLA 1QQP2 3E5QA 4DO0A 1LGBA 2GZWA 2VCCA 3HR9A 3IBMA 4NAMA 4Q5OA 4Q4W3 2Y34A 3UKTA 5L7OC 4PIXA 5EXOA 3AKRA 3VDDC 1CONA 4I0WB 3CU7A 4BA6A 4LBJA 2RE9A 2DF7A 4JGZA 2EICA 2JG9C 4XUOA 3ZSLA 4Q4W1 4JDNA 2GDFA 1F5JA 4IGPA 4LA2A 1ULOA 1W9WA 1ZZ9A 3J26N 1CZTA 1J3RA 5KHIA 3POYA 4O61A 4D6RA 3KV6A 3GGLA 1AXYA 5F5AA 4H2AA 5C4WA 1LECA 3T0DA 2HH9A 4JQTA 2OQ6A 2D6NA 3H8RA 4N53B 3VBUC 1XPWA 2W47A 4LKEA 4K1YA 4AEKA 3ZYPA 4YRDA 4FAHA 4YVSA 2YG0A 3MGUA 2CWSA 1YQ8A 4IEXA 1OQ1A 3CQOA 4IEVA 2UWAA 1PZ7A 2G19A 3ZMOA 4XBLA 1K5JA 1H2MA 2YY1A 2XVKA 1LOEA 3ETPA 5FKCA 1JU4A 2J22A 4ZXKA 3SCHA 3WHTA 5DAPA 3CIHA 3WDXA 1KEXA 1VAVA 1COV3 1CJPA 1CGPA 3S6PA 3USUB 4XFCA 5JI9A 2LM3A 2EIGA 1LHWA 5CEHA 3NAPC 1WUVA 1RC6A 5BNNC 1COV1 1QHDA 2UWBA 5A70A 5EV7A 4DRVA 1WMXA 3V0BB 4Y5TA 3RWNA 3AP7A 3HBKA 2WZ8A 4YFZA 4AAPA 5C9AB 4UFHA 4XCAA 3UL2A 1GMMA 5CZKA 3K2OA 1GICA 1XE8A 1HDKA 1TNRA 4I30A 4AE2A 1F35A 1ONAA 1DFQA 1RINA 2RV9A 4N43B 5LASA 3VD3A 5CFDC 5LZ6A 5M0TA 2EIDA 4G9SB 2UYBA 3I7DA 4Q1RA 3CZUA 2W9XA 3I54A 2D7FA 5BV6A 5ACA2 2J1TA 1E5SA 3Q8AA 5C8CB 2XL7A 3AZZA 1OPOA 2RMU3 2A71A 2BFUS 4C0BA 4BH9A 2WZEA 5CFCA 5BYNA 1C3HA 2VY0A 2YROA 4QX1A 1EV13 1YIPA 1QDOA 2JDAA 4TXWA 3ZN5A 4AQ6A 1BMV1 2RMU1 2VUJA 3ZFFB 3AZYA 4CTEA 4YZ3A 4HN1A 1EV11 3EXUA 3GBWA 3OGJA 2W1QA 2P6HA 4M4PA 5F3CA 4IEYA 5JZGB 1MS8A 4IQPA 4QX0A 2PQSA 4Q4W2 3IDCB 3RSJA 1OKQA 3E5UA 5JIAA 5IATA 1ODNA 2GC1A 3RZHA 1OURA 4PQ9A 1W0PA 2VQUA 3AP6A 4RQPC 4CRQA 3OYWB 3KGZA 1DYOA 3M2MA 1REEA 4IE6A 2QKDA 4QM9A 5L73A 1SACA 1IPJA 1JTZX 1Y7BA 2QVSB 3ZN6B 2YBKA 3OEBA 3R4UA 3VKFC 4BJ0A 2VVFA 4CXWA 2WQZC 2CAUA 1QGLA 5AFBA 2DWRA 2VE1A 2Z4FA 3OOXA 4MHUA 4QX5A 4RFT0 4AEMA 5HV0A 2UY8A 1FI2A 2B39A 3MHZA 3NNMA 3A4UA 3NJVA 5FDBA 4CUCA 4MUVA 4LEJA 2HYKA 1EAH3 4DUVA 1AF9A 1NY71 4GWMA 3E6DA 3T09A 1H2KA 1CZVA 5JXGA 2Q0AA 3AL5A 4E2QA 3DYMA 1EAH1 1Y4WA 1CD3G 1LOAA 1VBA3 1BXHA 2C1FA 2CYFA 2ZHNA 3M3EA 3PUHA 4DMIA 4XFFA 2ZTNA 5FZ7A 3N9MA 3B01A 2R073 4AI8A 4AL9A 1VBA1 3JD73 5JOWA 5F1RA 3B93A 3RMYA 4AFAA 1COV2 3ALQA 1AXZA 3KT4A 3PU8A 3LPFA 2R071 4AEJA 2RJKA 2OXBA 1PVC3 3JD71 4XBNA 1OFNA 4MGZE 1PNGA 2JG9B 3DGTA 1ULFA 4ORFA 4AQ2A 5CKNA 3KHCA 2AENA 2WJSA 4QKFA 1D2QA 4BB3A 1I6XA 4QDRA 3AYCA 1T6BX 1PVC1 5AFEA 2F4LA 5A7NA 3VBOA 2VZ1A 3POFA 2WLPA 4PDWB 4XQWA 1W8UA 4XURA 1PIV3 3NV2A 3RJ2X 4DB5A 1SPPB 1W8HA 1PMHX 3JQXA 2A1XA 2J1EA 1W6MA 4FPLA 5GLZA 1PIV1 2WINB 2YFUA 3CDZB 4BCUA 3QLQA 4EV0A 1N1SA 1RUOA 3R0RA 1YQ5A 3SEEA 1JUIA 4UW5A 1X8EA 1YIFA 4XTPA 2GSYA 5JR7B 4XFHA 4C8DA 3A0NA 3LKJA 1ZA7A 4XACA 1BMV2 2W92A 2JE7A 3WF2A 5JDBA 1UPSA 2RMU2 4MO3M 3W9AA 3PUSA 4AG4A 3HIFA 1G9BA 4RL7A 4U2AA 3U75A 1UZVA 3K4DA 2BP6A 1Y9GA 3HQUA 5LRSA 4LUKA 4DS0A 1W8FA 1EV12 1S55A 3NL1A 4NRQA 1C1LA 3A22A 3N9NA 4NAOA 1S0BA 5H9QA 3J7HA 2GMEA 2WWJA 3TYJA 5HCHA 4YW2A 5BY5A 2GU9A 1V70A 2V09A 2WNVC 5HXVA 3MLLA 1GNZA 1QY4A 3QCWA 1I3HA 4N53A 1JN2P 4BQ5A 4Z82A 4P9XA 4DIQA 3KT7A 5I0DA 1HLCA 4LBQB 5BPXA 2JG8C 4LIUA 1M06G 1JW6A 4QHOA 3OF1A 4YW1A 3SNMA 4Z1VA 3K3NA 3ACFA 3H1WA 4YSFA 4JX0A 5AVPA 2WZR2 1S2BA 2TNFA 2PHXA 5JSRA 3M3QA 1KRIA 4CXYA 1IS5A 3ZXEA 1DDLA 1STMA 1RXGA 3WNPA 4CVUA 4JGYB 2HBUA 5T3NA 1NY72 1QJY3 3IPVA 5I93A 1FAYA 2Z5WA 3USUA 2CL2A 3F2ZA 4YM1A 1O4ZA 1PMIA 4TN7A 1EAH2 3T0AA 1SLBA 1ZZCA 1QJY1 3OD4A 2JEMA 2XB6C 4A7YA 3V0BA 4ARXA 1HQNA 1O5UA 5BNPC 1AR73 4SBVA 3BALA 4OHXA 1VBA2 1S0EA 3O1MA 2L9LA 3ECQA 2BUKA 5LA2A 1AR71 2W46A 5EIYB 5LEKA 5C8WA 5ABJC 4LITA 4RA0A 1HV1A 3JD72 4OLLA 4Y33A 5IVJA 5K0UB 2SLIA 3T2PA 3O14A 3I2KA 5FTTC 1O8PA 2P34A 1PVC2 2YB7A 4QGNA 5T52A 4CPBA 3MW4A 1HB3A 2V4VA 3KHBA 4LORA 1Q8SA 3PUIA 2OW4A 5FP8A 2XUMA 2P4EA 5C8CA 2BGOA 1SHWB 1ZRRA 2F4PA 3GZTB 2XDVA 5GLWA 1J1TA 3P5BA 4BXSV 5A1AA 4A3ZA 2WUHA 1PIV2 3SH5A 4R9CA 3X29B 5AC93 1IZ3A 2ZX2A 1KFUL 1D2SA 3ZFFA 1E5HA 2H6CA 1WCQA 4BQ4A 1LEDA 4W6YA 5AC91 2CNAA 2HWC2 5GZDA 2UURA 3VKLA 3NO8A 3DKQA 4XIOA 4AEDB 5JVVA 1PX4A 3VV1A 4META 1PO23 1GNHA 3OYWA 3V0AB 2D43A 3B94A 2FCVA 4L9BA 1GZ9A 4QPGB 2CTVA 5B4NA 5DN2A 1DGWX 1JXNA 1W9TA 1H1IA 1PO21 2ZGMA 4YW5A 5DZGA 1F15A 4QPIA 3V65A 4Z2WA 3ZN6A 2JIGA 3AP4A 4NN0A 3WVJA 3VHPA 2BERA 2DFCA 1AYM3 1G9FA 4IEPA 4HKLA 3LA2A 1W3VA 4JRLA 2GNTA 4LUMA 3B9CA 1LHVA 4XXPA 1MS1A 2VW1A 4UFIA 5A6XA 1AYM1 2E51A 4XMIA 2JXAA 1MVEA 1RIRA 3BB6A 3P1IA 1GUIA 5E89A 5FZ6A 5EJ1B 4AHZA 4PF1A 5FPBA 3UGFA 3ORJA 3S5AA 2WNOA 2RDNA 4LKDA 2IC1A 3LSEA 1IPSA 2Y6LA 2E32A 2QZ3A 2GC3A 1T2XA 4XUNA 3VBHB 1FATA 3HPNA 3OY8B 4MGKE 3VZNA 5LB6A 1SFNA 5JWPA 1HKDA 3ROUA 1QJY2 5IHRA 4AI3A 2DU1A 2Z42A 3VDDA 3QOPA 5FK8A 5IK5A 1REDA 1H9PA 2OPKA 2PHTA 2JG9A 4GKXA 3J7NA 3Q9OA 3K46A 5IK8A 3AZXA 2DCTA 1PVXA 2HWD3 4XXAA 4DZGA 4EZHA 1A34A 4C90A 2ZHMA 4YNIA 4MADA 1AR72 3ZYBA 4A45A 1VLNA 2F17A 5F37A 5K7PA 1UX6A 3TEYA 3E1F1 2HWD1 5G04L 1SPPA 3MF6A 2EIEA 3DECA 1SDDB 3MW3A 1Q8VA 2DFBA 2VNVA 3GCWA 4XF1A 1Y9QA 1C8M3 1KQRA 4IE4A 2R063 4NR1A 1HXS3 3O0VA 2BJSA 4YG3A 2D40A 1WD3A 4FTEA 4FP3A 4RS5B 1C8M1 2P37A 3OPTA 1AR91 2R061 1HXS1 2JG8B 3SH3A 3PNAA 3RVHA 4GJYA 5E16A 5FQ0B 3RG0A 3WW1A 2XQRA 4AHWA 2A3YA 5FZOB 4YM3A 4XCBA 2WRAA 2Q5TA 1DGWA 3K48A 3VZJA 4M3CA 3OPZA 1W99A 2VULA 3RS6A 1LOGA 2CU5A 4IW3A 5K9YA 4Y5SA 3I3MA 2ZMKA 4HETA 1DGRN 1JOJA 4RN5A 4Y26A 4Y1ZA 5DAQA 2Y60A 4CCEA 3G7DA 4DPNA 1KITA 2ZHKA 1IKQA 2WFPA 3LFMA 5DAVA 2X05A 3NAPA 1XNCA 2VW2A 1KS4A 1NCQB 5K0UA 3FLPA 3W20A 2QQWA 1JYWA 4QX8A 2C9KA 1KJRA 2PYTA 2PMWB 2VOXA 5BXXA 4YZ5A 2XVLA 4IEOA 3FFZA 3WDYA 2X29A 5FWJA 1VBD3 2D93A 4XEZA 5FXVA 2EA7A 3BKZA 1F2NA 1V6IA 5CFCC 4OUEA 2XHNA 2J1RA 1AYM2 2PHLA 5CFDA 1GBGA 1S2EA 3RZJA 4QU2A 4QKBA 1VBD1 2ZGRA 4YGEA 4FFFA 1H8TC 1X9TA 3VZMA 4COUA 2RM23 2DUOA 2DVAA 2WN3A 2XJSA 5GZEA 4UOJA 3AVRA 1B09A 3BN6A 3FUQA 5DZEA 2BVBA 4BQ1A 5CAZA 2RM21 5LBEA 1KDMA 1NLSA 4QT6A 4C1XA 4UFJA 2A6WA 1JBCA 2J1UA 3HWJA 3EMRA 2MEV3 1S0DA 3AMPA 5IAXA 2R1BA 3RRDA 1ENRA 4CDQB 4IXLA 4S2HA 4YGCA 2MEV1 3R6SA 3UK9A 3ZYFA 4P5HA 4TSVA 1UY4A 2JECA 2VBBA 1LENA 3OG2A 2A5ZA 2LALA 4EN6B 1KXGA 5FYIA 3M8LA 4RQPA 2LUWA 1XC6A 2C9AA 1OXCA 1JOBA 3D8CA 3USSA 2HWD2 5FMOL 1VAKA 4CP9B 2PLV2 4IV1B 4QX3A 4QD2A 4R8HA 2E6VA 3H0OA 3BIWE 3HAGA 3IM0A 3ZKYA 3EJKA 5FY9A 1MEC3 1DP0A 2AEZA 3T4HB 2R043 3GHMA 1R093 1YUDA 4EROA 1PK6C 5CG9A 4NE9A 4XDPA 1NQJA 1C8M2 4YVWB 4XUQA 1AR92 1MEC1 1TMF2 2R062 2ES3A 2C5DA 3RJRA 2R041 4AVSA 4UFLA 4QKNA 5ERLA 5JOZA 1R091 2Z69A 4FI9A 1LGCA 1O3SA 2ARXA 3MPBA 4X6QB 2G4IA 2VNOA 3IAPA 2ADEA 2ZX3A 2Q8EA 3POJA 1GP4A 3IMNA 1LTEA 1W8WA 4JDMA 2Y33A 5F2SA 5BUVA 4LLOA 5JIUA 5KWRA 1RUH1 5FZ1A 3C3VA 1DBNA 1MPXA 1OH4A 4DUWA 2W94A 3VBOC 3WDVA 4AI2A 4D3WA 3AXEA 2KM2A 2GH2A 3FHAA 5A6QA 2BOJA 4BQ2A 3I3BA 1ZZ8A 1YFXA 4AI9A 1W9YA 1HIXA 3KF3A 3ZPOA 4ATFA 3ENRA 3I2JA 1DQ2A 4PBOA 1V6LA 2F6BA 4FQ4A 4ZU4A 3E6CC 4LJHA 5FP7A 2ATFA 4XF4A 4V2WA 3INAA 1NAEA 1YYNA 2E9QA 4BE3A 3RZMA 2R49A 2A3XA 2OIIA 3C7FA 3HN1A 3IAQA 3BU7A 3VBHA 3OY8A 1D0HA 4AGRA 3KZ4C 2ZAAA 3MIDA 1SLAA 1ACCA 1OD3A 2QQKA 2VCMA 3DEMA 3GF6A 3LB9A 2P5BA 1QOTA 1QJFA 4RFRB 5E8AA 3C7EA 4AI0A 2X53S 1YFWA 2PELA 2WR9A 4GIQA 2BWAA 2RM22 2VQ0A 2RR13 1Z78A 4MXWB 1WA4A 4N53C 3RFRA 4ASMB 1X82A 1HB1A 2XBO2 4INDA 5EFUA 5FREA 2RR11 3IDAA 3UESA 3W21A 3N9QA 5DUWA 1F8VA 1ENSA 2ZEYA 3CNAA 3E5XA 3LF7A 5T5JA 1B35B 2MEV2 3ZDSA 3RMXA 3SMHA 2IUWA 3LPGA 3O7OA 3PVBB 1RUNA 2WNVA 4KWKA 4YYOA 2B46X 2WN2A 4UYBA 1QJEA 1J84A 2VAUA 4NIAA 4JTNA 4NUBA 1WMDA 3NKTA 4RS5A 1D4M3 4NO4A 4AVCA 3B5LB 5L9RA 3CHXA 3UNPA 1Q3EA 2JG8A 1XNDA 5FRAA 2XLGA 3BPSA 2W95A 3OTFA 2OX0A 4D0QA 1D4M1 2DTYA 2E31A 4E8DA 3OPWA 3WDWA 1AL23 1ULPA 1R083 3D4KA 3IB3A 4U36A 1GWLA 1LOBA 4NHKA 4QXBA 1DQ0A 2O8QA 2R042 4IERA 4PIYA 4CE8A 2XXZA 4QQLA 1AL21 4YM0A 5C9AC 1JZ2A 4B4RA 1R081 2ZGSA 4GJZA 4MGSA 3GHNA 1SFPA 4FFGA 4IEWA 1AX1A 1H8TB 3L2HA 4E8CA 1NXMA 1YQ2A 3J4UH 4AW7A 4MVTA 3HJRA 2K2SA 3OCPA 4HFSA 2HWE3 3VKOA 3HBZA 1NCQA 1RUH2 5F3GA 1CZSA 4N43C 5FJKA 1REFA 1FXZA 3DN7A 5FUNA 1ZRFA 5BNPA 3CJIB 3IKWA 1V6NA 4KWUA 2JDZA 5I91A 4M01A 2HWE1 1UNBA 3AKQA 1JZ5A 2RS52 1ULDA 3ILNA 5LY2A 2YBSA 4E4HA 4Q8LA 2VC9A 3S7EA 1LAJA 5I0TA 1WLTA 2C4XA 2QZ2A 2DCZA 4HPKB 3U78A 2J42A 3K4AA 4R9AA 5KBFA 1LJ7A 3T2TA 4BXFA 4ZKTB 5C3QA 1T6GC 1LU2A 3ZFFC 3NV4A 4MH0E 4BMEA 1CX1A 2VJXA 2XH6A 3WCRA 3ZXFA 2WWUA 1ULGA 2GNDA 2XWJB 4NPRA 5JZGC 2QDNA 3VZKA 2HLEA 5DMYA 4XUTA 1ZX5A 2VD7A 5BNOB 5A1LA 1O4TA 3GDBA 4NIGA 4L99A 4K6BA 1LR5A 3U14A 4OFGA 4PF5A 4K1ZA 1LGNA 1DZQA 2E53A 4BQWA 3MV01 1DLLA 3KVAA 3HT1A 3T2OA 1V0AA 2VO5A 4BZ4A 3Q8EA 1GP5A 4A7KA 3AL6A 2JB8A 1C5HA 4DY5A 2FBEA 2ZGPA 1QH7A 5KHJA 4W65A 3IIIA 2AGSA 3M3CA 4BLJA 1UU6A 1WKYA 1I5PA 1NG0A 4Q4V3 5KC6A 2N7GA 4HOOA 2BBAA 4KWJA 4N7UA 4WV8A 4CP9A 1V6JA 4XF3A 4TWTA 4ZONA 5ACA3 4IV1A 2OPWA 3H3UA 3PDQA 4Q4V1 3A21A 2OKXA 5D21A 3MFAA 1EP0A 2PQQA 3DPRB 3LE0A 5IJRA 4S2DA 1BHGA 4WVVA 5ACA1 2J1VA 5IK7A 1G9CA 4YVWA 2XOMA 1MQTC 2B4KA 4GALA 2VOWA 4M0NA 1POV3 3T3YA 1D4M2 1LEMA 1UOFA 1OA4A 4ZY9A 3ST7A 5L36A 1POV1 3KD4A 5F5QA 1O59A 2DUQA 2BGCA 2Y0IA 4JKLA 2VECA 3MBWA 1AL22 1HX6A 1OUSA 4HK8A 5IW0A 1R082 1LOCA 1H4HA 2YGMA 3WDUA 4C1WA 2CDPA 1UD1A 2WA3A 5D2AA 3AP5A 4NWWA 3M1HA 4PDWC 3VKMA 2Q4SA 5JXHA 4V1PA 2IXJA 3VB9A 1YO8A 1QNWA 3LWCA 3WUDA 2AREA 4I09A 3JQWA 4YGDA 3O1RA 3N36A 4KH9A 3UKVA 3H3ZA 2VMDA 5JXJA 3MZHA 2VBPA 1SDWA 1W6OB 1GP6A 4J1XA 4BHPA 2HWE2 4Q8KA 4OQ9A 1F5FA 4S2GA 4WM8B 3O1UA 2J1AA 4NPLA 1HJFA 2XKPA 5GZFA 4QB6A 3I49A 2BPA2 1YCIA 5FMDA 2VVEA 4XVHA 3A0KA 1XYPA 5FY1A 4OI1A 4MGIE 4YM2A 3POGA 4B3NA 1ULCA 4F3JA 4Z92B 1ND2B 1POV0 1Y43B 4B7KA 2XJUA 3M3IA 4CEWB 1OHFA 2BV4A 5DDJ2 4I0AA 3LOIA 4C0HA 2IXKA 2ZGQA 2VZ3A 1DF0A 2HKXA 2WAOA 2WQ8A 3WHUA 2VGDA 2WQ4A 2DU0A 4Y24A 4CDUB 1ALYA 5JSOA 1QF3A 1UN1A 4N7IA 1UY2A 2XKOA 2VBDA 2WC2A 4P9YA 4CUBA 1AJKA 1UX7A 4ZS3A 4M4RA 4PT6A 4D94A 2DBIA 5K0UC 4CP2A 2PAMA 3MUY1 1RYYA 4CDXB 4QHZA 3ZYHA 4EN8B 1UO9A 1W0NA 3MDPA 3BTXA 3BPZA 1WWYA 1SLTA 3LEIA 5FLHA 2ZACA 5K4LA 3LSDA 2P1BA 4Y5Z0 2VM9A 4PI2A 3LOBA 4Q2FA 2CGOA 3LD8A 1NCRB 5C5UA 2XGXA 5EPAA 3MEPA 3P3NA 3VD4A 2KR2A 2V4AA 2VZPA 1C28A 4JGYC 1FOD3 1UCXA 2WO1A 4LOTA 1MS5A 4Q4V2 4UW3A 2E7AA 5A7PA 4LK6A 3POWA 1LKNA 1APNA 2HWF2 4XJ9A 2NZ9A 3FX3A 1OLRA 5CNAA 1FOD1 3I3DA 2WAAA 1FNYA 3AB0A 4SLIA 3GZEA 5C3SA 1DZTA 5FUIA 4Y20B 1P8JA 2JDYA 5A1FA 3NKGA 3Q8CA 1L7QA 4LO4B 1W6PA 1VMJA 3QH6A 4Q26A 1H8TA 1IG3A 1L3JA 3H9AA 5HCFA 3LEGA 1ZNPA 5L19A 1RUF3 5F39A 5FXZA 1PO13 3LDKA 3OSDA 3SH4A 1JZ7A 1W39A 2GN7A 4QWNA 4DQAA 4YZ1A 1RUF1 1ODMA 4FXKB 2B9VA 2O8OA 4ZU5A 1PO11 1CAWB 3I2FA 3FHQA 5H9RA 5F9TA 1W2OA 2WZR3 5T54A 3T2QA 2ZEZA 2PHWA 4HPKA 3WP4A 2JDUA 4HT1T 3VD7A 2WO2A 1QKQA 2YFZA 3LEMA 3PMEA 1X8MA 2A7AA 1OVPA 1HQLA 2WZR1 2JIJA 1BEV3 1I1EA 1L7LA 2RHPA 1RUC3 1JYTA 3A7QA 4AR2A 2BQPA 2BBVA 2W2IA 1BEV1 1OD5A 4UFKA 5FIXA 5FYHA 2FHRA 1J59A 4XAEA 1RUC1 5FOBB 1UPIA 2YC4A 4OUSA 5F3EA 4AEDC 3OGGA 4XPVA 2AZ5A 3B00A 2WNUB 1PK6A 2OVUA 3DYPA 4QPGC 5FZFA 3WXPA 4NRPA 1OKOA 1MQTB 4CDWB 2VZVA 1JMUB 4BK5A 2QQIA 5KR7A 4AK3A 1GQGA 1PM4A 1MZ5A 2WABA 3M3OA 1LHUA 1N3PA 2QQJA 3GJAA 4HSLA 2QQVA 1UOGA 1CAUB 4NHXA 3THPA 1KDKA 3JB8A 4D7TA 2YV8A 3PIJA 3LA3A 1ZREA 4AHYA 1XU1A 1JU3A 3GNEA 1IOAA 4KU7A 3HD8B 2BVVA 1EY2A 1NUKA 2JB4A 2JWPA 2ZHLA 5CKMA 1DCSA 1DQ4A 1V6KA 1OOPB 2QFEA 4KWLA 1UF2C 3KV4A 3M7AA 5D8AC 2YYOA 4R4ZA 2ZMLA 5TSWA 4IEQA 3VBHC 3FE5A 2AEYA 5I0UA 3MW2A 2UU8A 2A6YA 4GMP3 3ACGA 4KBBA 5HPOA 2HWC3 2VNGA 3CMGA 4ONUA 1RUJ2 2WT2A 1FOD2 3C2UA 1Y9MA 1LNSA 2V5YA 2W91A 4YLZA 2VZRA 2ID4A 5A3MA 2B9UA 4GMP1 3ZDVA 3H50A 2QUOA 2HWC1 4XMAA 4LO5B 3ZSJA 3D0JA 2VZOA 3S30A 3HEIA 1JZ4A 4HKOA 4XILA 3ZFGB 3GYDA 2Q8CA 3JZVA 2CHHA 2PA7A 2HBTA 4XW3A 3ZIXA 3OUIA 1AL0G 1SFYA 2ZKNA 4CPBD 4LK7A 1DZRA 2GAUA 4OULA 3J7MA 5FZHA 3KB5A 1W6OA 4FPFA 3NJZA 1N3OA 3UV9A 1RHI3 5F2WA 3MIBA 3WNKA 1RUF2 2WDBA 1PO12 3RYPA 4RS5C 3ZSEA 2LRPA 2BNMA 3HN3A 1QXRA 1RHI1 4F83A 3PVNA 4M0HA 1FV3A 2VMGA 4AQSA 4ES8A 1JYIA 4DFSA 2VZSA 4JC1A 3UGGA 1EUUA 2BNNA 1RVF2 1OQEA 1W2AX 2ZZQA 3O5SA 4GMP0 4MGTA 2EVXA 3VHOA 1VMFA 2CSGA 4NJ4A 4AF9A 1DU3D 2Q8DA 1CPNA 1BEV2 2KD7A 4LE3A 4CDUA 4LO6B 3HOBA 1RUC2 2C26A 3IN9A 4FPHA 4Y1YA 5SV5A 2JX9A 1QXJA 2YBPA 3H3LA 5LK7B 4J25A 3BTYA 1NCQC 2RJLA 3FJSA 4YW7A 3LZZA 5CIRA 1OI6A 4OZXA 3WG2A 3M70A 4CDXA 5F8PA 2JD9A 3J7LA 4LTAA 3KCXA 4XHXA 4B4QA 3SQOA 1LHNA 3AFKA 1VBB3 3FLRA 2ZJCA 3GALA 5C9AA 3I3EA 2QCSB 2VG9A 5EP9A 5JOYA 2YHJA 5LATA 1A8MA 4QGLA 1MS4A 1VBB1 3JCIA 3PUQA 1H2LA 4FTSA 4QGMA 1NCRA 3W5NA 2Y6FA 1GWKA 4N43A 3PL0A 3R05A 1JS9A 1RJ7A 3I59B 1R1ZA 4M3CE 5A3UA 1YC61 2AYHA 1WLCA 3WNXA 1GOFA 1UZYA 1WGPA 5FP4A 4N9HA 5GM0A 1MZ6A 4HVRA 2Q1ZB 1SCRA 3ME2A 1WMFA 1VBE3 4RGKA 5FYBA 2CY6A 3EB7A 1CAXB 4I2OA 3WD5A 4D7SA 2DBNA 2QQOA 5FWEA 4B1LA 2ZGLA 1VBE1 4O9EA 4QXCA 4CDQC 4MV2A 4J6GA 4NHLA 2FQPA 1G86A 2VMHA 2GP3A 5JZGA 1LB2A 2ZCWA 1O8SA 1ZM1A 5FP9A 4PIZA 5FZKA 2BEOA 1Q5OA 4Q29A 4ARYA 3B02A 1JODA 1YQ6A 2JE9A 1O3QA 3B7MA 5DQ0A 4IV1C 3KLSA 4L8QA 1K5MB 1S1AA 3ZR5A 1LESA 1BYHA 2VOTA 1GLHA 5FZMA 4D6QA 5A3OA 5JPNB 3ASIA 3HQXA 4EWAA 3SITA 1X9PA 2D6OX 1GNYA 4ES9A 4YVWC 1RHI2 2WFF3 5FZDA 4BOWA 4ZPIA 5FZAA 4KG8A 3VL8A 4BWOA 3HMYA 2WFF1 4K20A 2VTXA 3MI8A 5D8AB 4Y22B 5C3RA 4QQOA 5FO7B 2WNUA 2JDHA 1UY0A 4COZA 2R7EB 1GV9A 2CAVA 3OD0A 1MQTA 2BYVE 4CDWA 3I3QA 4UI9L 1R1A2 5IFPA 4GH4B 1XBFA 4AYUA 4LBQD 4E2GA 4NIHA 3D82A 1FNZA 3URFA 3N9PA 1JYVA 1ST8A 1CAUA 5KHKA 3ZXDA 4AWDA 4CSWA 1W8TA 1X36A 3TN93 1W2UA 3NMBA 2QTWB 4E2SA 5L9BA 2E33A 4ZZ5A 2PLV3 4ZZ8A 2EALA 4PDWA 1H6YA 1VBB2 3TN91 5J36A 5KXBA 3WQ1A 4HN0A 1V00A 3IDBB 1JHNA 1O7FA 2PLV1 4EN7B 5T55A 3WP6A 1NLRA 2ERFA 4JVAA 4HK9A 2G9ZA 1AR93 1TMF3 3S7IA 1SBEA 4EYUA 1NZCA 2XLFA 3D6EA 5DZFA 3OGSA 2ORZA 1VRH3 2UYAA 4XTMA 4QQPA 3VBSB 5K8SA 3FLTA 3FHIB 4RR3B 1UYXA 1TMF1 1LODA 4MGYE 2K0GA 2NPIA 1W90A 5A33B 2ARCA 4AQTA 3WNLA 1VRH1 2NQYA 3SISA 5DABA 2QQLA 3KMHA 4JKKA 3WQBA 2DVBA 2W1UA 1QH6A 1BKZA 1F9KA 2VZUA 2BU9A 1X7NA 3E6BA 3JBG3 2PHDA 2K46A 3EYPA 1R64A 3K4ZA 4L0PA 4WBBA 4HKWA 3ZFGA 4CU6A 3UJQA 1YXWA 5J48A 1VBE2 1XYOA 4XUPA 1CESA 4YZ2A 2NN8A 3HNBM 3FWEA 3JBG1 1BCXA 3PMSA 1B35C 1GR3A 3LGRA 4LMFA 1YFYA 2WO7A 1VR3A 2NMOA 3WNOA 1VBC2 3BTZA 1VB4A 4CYDA 1JHJA 3OBAA 2R0HA 1QXPA 4HG6B 1SBFA 4B7EA 5DUVA 1FT9A 2JDPA 3GXUA 4CUGA 4Z07A 4NMIA 1WCDJ 5IVFA 3U4XA 1NA1B 1N1VA 4LBQA 4CU8A 4P9WA 2VL4A 3ZXLA 4NIIA 2ENRA 4P9IA 2K9ZA 4G4FA 4UF0B 3T1MA 1N1TA 1H0BA 2OZJA 1E5IA 1HRI3 2TUNA 2XQXA 2X8KA 5F5IA 2R6QA 4JGYA 3SEPA 3BI3A 2XJPA 3TRSB 1HRI1 2WFF2 4AVAA 2VZQA 5FZ0A 3HNYM 5FMOS 5FZ4A 2FDKA 2E63A 5ANNA 4F7ZA 2JDNA 1OF4A 4URAA 2VXJA 3VBFB 1W05A 1UY3A 5C3OA 2XBO3 2P2KA 3CJIC 5I8TA 1JZ3A 3BU0A 1EUTA 2FDJA 3FZ3A 5LK5A 5FR3A 3ABZA 2XBO1 1NT0A 3EO6A 1SCSA 3BTAA 4OHWA 1VMHA 2P3KA 3VKNA 1UL9A 4LHKA 3VDAA 3WF1A 2A6XA 1CN1A 1ZZ6A 3H7JA 5C3PA 3KVBA 3AVSA 1H1AA 1CJDA 3TN92 1OFSA 3MUZ1 4H55A 2WO3A 4QX2A 5FKBA 4DY3A 4GWNA 3PLQA 3BGAA 5GZGA 3KQ4B 4XDQA 1RUD3 4PI0A 1IS6A 3K75B 4DRRA 5BNOC 3NJYA 2EXJA 5FV3A 2PTMA 3D0SA 4NVPA 1CAXA 3PTYA 1RUD1 4AAXA 1NQDA 3ZXJA 4CEYB 2PN5A 3WP3A 3O1TA 1F4HA 4YG6A 4XFBA 1VRH2 4WVMB 4IEUA 2R0FA 4IUGA 1U5IA 1RUH3 2FMDA 1CVNA 3AM2A 1WCKA 1G9DA 4KL1A 2JD4A 2R1DA 4AEDA 2OT7A 3ITQA 3JXSA 2YUEA 3ELNA 2ZPXA 2DVDA 3V0AA 1H9WA 2RS53 4FPCA 3PJQA 4QPGA 3JBG2 5C33A 3AMMA 1OA2A 2WL1A 4H14A 3N7JA 5IK4A 1ZRDA 4BQXA 2EXHA 2XJRA 4AFDA 3NVCA 1K5MA 2RS51 1UU5A 3AMHA 1W9SA 2VUDA 4XFIA 1W28A 3DPRC 2NM1A 2XJQA 2C6SA 3K3OA 1K45A 1QJU2 2O1QA 2HEWF 5CBLA 2Y6KA 4LOSA 4MOAA 1TEIA 1BVVA 3O1SA 4A42A 3K51A 5A6ZA 5LRRA 3ZX7A 2RS12 3ZXKA 1U5YA 4RSUA 1RUG1 5FY4A 4Q4X2 4IGQA 3MIEA 1HJGA 4JGZB 1H8VA 3PTRB 5D8AA 4Y22A 4EZ4A 1ZZBA 1D0GA 2R32A 4QX7A 2D97A 2ZGTA 3WLUA 2W08A 1KD7A 5C5TA 4NHMA 1HRI2 3U37A 4OVEA 1ZBE3 5SV8A 2JKXA 4CCLA 1IGOA 1WBLA 5C4WB 4N9IA 2IWGB 5F6KA 2V5DA 4N90A 5JLVA 4CU9A 2C24A 4JCKA 1ZBE1 3B3QE 3O0XA 1WW5A 4XHBA 1FYUA 1GWMA 3HT2A 2NLRA 1Q8QA 3NNGA 1UYZA 3WW2A 4YVSB 4DUXA 3O1PA 4WM8C 2VCAA 4WVWA 4UBHA 1RXFA 4WM7C 4XETA 4MG2A 1ENXA 2VTXJ 4P08A 1HN1A 2XPJA 3BUCA 2JENA 1W2NA 2ET7A 1BK1A 5FYSA 1ND3B 2W68A 4GULA 4ASLA 1ND2C 4OI0A 3FFQA 2DVGA 1K12A 4LHSA 3O12A 4L97A 2VVDA 4CEWC 5JCTA 1AJOA 5T5OA 4XJ8A 3O0WA 4R9BA 1JZ6A 3D5OA 4F8AA 4UW4A 4LO7A 5EYYA 3N4MA 4YWAA 2ARAA 3K77A 4FP2A 4CDUC 3POIA 1EPWA 5FQ0A 5CKQA 4AGGA 5FYMA 4XDOA 2QQUA 4K40A 5FZOA 3FUOA 3RGBA 1NE6A 3PUAA 3BCWA 3QD6A 4GAZA 1RUD2 3BODA 4TZDA 1J3PA 1PGW1 2Y6JA 2PAKA 4CDXC 1S0JA 2ZEWA 1RUI2 2ZABA 3NNLA 4BYYA 1VB2A 1W8NA 1UQXA 3NWKA 1GFF2 1FMD1 2MPFA 1RMU3 2NYYA 1J3QA 4QDSA 2GH8A 1LHOA 2VU9A 4IL7A 4LKSA 1JYXA 5J96B 1YEWA 4HSJA 1NCRC 3H1MA 5EJZB 2D6PA 1RMU1 4P14A 4K8FA 2Q8OA 1NA1A 3AJYA 3WF3A 1AZDA 2XMLA 3GCXA 4K7JA 1HB2A 2P17A 1C4RA 5JXIA 4FBFA 4L2NA 3ZN4A 5IAVA 4QPYA 4Y1VA 4UF0A 5HCAA 1VALA 1HN0A 3T4VA 1UMIA 2P3IA 5C70A 3SHRA 4AVVA 2KXLA 2DUPA 2G9GA 2HWB3 2Y26A 5DDJ3 5A3WA 1OSGA 2YU1A 5CU1A 3VD5A 3AMNA 2Y64A 1IKPA 1RUG2 1YFUA 3W59A 2HWB1 3AC0A 1XRUA 5DDJ1 4AXOA 4FQZA 1AR62 5GLTA 3JU9A 4EN9B 1PGL1 3A23A 1SQ4A 2JDMA 2EF6A 2PHFA 2VOKA 5KHHA 1YLLA 2X5IC 1BBT3 2EXIA 2AC1A 4FVVA 3WF4A 2W3JA 4EE2A 1UOJA 4CCCA 3UT0A 2WS93 2EAAA 2ZGNA 5LWBA 3PURA 5ANQA 2D6MA 3H8OA 1RUE2 1BBT1 5FMBA 2IXCA 4E27A 3AJZA 2WS91 4XYXA 3SXWA 3THCA 1OPMA 1DIWA 1ZBE2 4GQ7A 4CDQA 2C0ZA 2DURA 4Q4Y3 1AR83 2TBVA 1CR7A 3NSTA 3TOJA 4Q0SA 1S0IA 3OBTA 3T0BA 2VCBA 4JV4A 4OHVA 4Q4Y1 1AR81 1XQNA 2B45X 3S5QA 3I2GA 4WVZA 1XB9A 2HWF3 3DL3A 5C71A 4KBZA 4HMZA 4IEZA 2ZGOA 2ZKLA 4HLTA 5IYYA 2OUHA 2UY9A 5GLUA 1UOBA 4XFAA 1YQCA 2HWF1 3N9LA 1MS0A 4A3XA 5B4XA 1X33A 4OI4A 1AYN2 1ASJ2 2WNUC 3PIGA 2GC0A 4ISRA 4CEYA 1IG0A 1AVBA 1WBFA 5J09A 1TE1B 4CDWC 1PM7A 1RITA 5I0RA 4FPGA 4WVMA 2ZBJA 5GJ6A 1W6NB 1BJQA 3TNQA 2SBAA 4GD4A 1PGW2 3HVDA 1ENQA 1W03A 5I0SA 2QBXA 1YHFA 4KI5M 4JZRA 3ON7A 4KG0A 5FPVA 1KS5A 2Q1FA 1FMD2 1WW7A 3I4IA 5FY5A 3ZM8A 1FV2A 4HVOA 5LBFA 5A7WB 1NYWA 1OOPC 4AI1A 4UFMA 1OMIA 5H9PA 1GQPA 1ZZ7A 1MZFA 1YI7A 1RMU2 2QNKA 1W6MB 2EAKA 5A7SA 2QDRA 3N7LA 5FK7A 5A80A 3AXDA 5DUUA 2O0OA 2FDFA 5LBCA 1U0AA 2DV9A 2I74A 5AVAA 5FXXA 1SLLA 1XSQA 1CWPA 1OA3A 1PZ8A 2GC2A 1AXKA 2XJVA 4WM7B 2CDOA 3S57A 1GOGA 4ZHNA 2XWBB 3RZLA 1DYKA 1OH3A 1E57A 4H7LA 3WQ7A 5CG8A 4W50A 1Q8OA 5FBJA 1GKBA 4QXHA 1QOOA 1UKGA 1VP6A 4IV3C 3ZFGC 2HWB2 1W3XA 5FZGA 2Y38A 1IS4A 1PGL2 5FYVA 5FOJB 4ET7A 3BVCA 1CPMA 1JH5A 1NKGA 3OBZA 1XYNA 4PQQA 1DYPA 3ZFEB 2VTFA 2QJVA 4UAPA 3I2DA 3VDCA 4MXWA 4D69A 1L7RA 3MFCA 1DG6A 5A6YA 1BBT2 5FY0A 2RDRA 3CL1A 4ATEA 3LDBA 2BZDA 1A6CA 2D5HA 1E5RA 2WS92 4GWIA 4NPMA 5IVVA 3S0MA 1RGSA 3PVEA 5I8YA 1AX2A 1B35A 4XZUG 3DKWA 1NOVA 3NNJA 4JAAA 2A75A 1ND3A 4IDZA 3CLPA 1GANA 4KQ7A 1O3TA 4I3PA 4Q4Y2 1AR82 1QJX2 4XIKA 3WEZA 3MYXA 4XABA 1HW5A 2E7QA 3CEWA 3IPVB 4W6WA 4Y3OA 3RYRA 1RUJ3 1D7PM 1SZBA 4A4AA 3FMGA 4FOQA 4OHZA 5T5LA 1RUJ1 4LPLA 4CA9A 2XG3A 1CQ9A 1OC1A 3KWVA 2W39A 2B42B 4J1WA 5IVBA 1OQDA 4MX3A 1LCLA 1ZYBA 5D1IA 1VAMA 1XNTA 1OLMA 2VPVA 5LEJA 1WLDA 2ET1A 4LLFA 4P5YA 2IZWA 5IT6A 3GBGA 1QJZA 5FPZA 3TAYA 3H8XA 2PHUA 3LIHA 4LR4A 3VHRA 2YU2A 2E26A 2VR4A 1TQ5A 1O4YA 1W06A 2X5IB 3WY6A 4B29A 4S2FA 2DTWA 4BQ3A 2EIBA 5ISLA 3CJIA 1O3RA 4UXAA 4AVBA 3TB0A 3ZYRA 3W5MA 1VJ2A 2BW8A 2OZ6A 1WZXA 1OVSA 1W8ZA 3ZLIA 1MR5A 2KA3A 1RVF3 5G05L 4CUAA 4L11A 1OT5A 1VRBA 1S0GA 3U0ZA 3IIAA 1XNAA 3E97A 1RVF1 4FOYA 4NWVA 2HEYF 1XNBA 2D98A 3AYDA 2WWSA 3RZZA 1A8DA 3VBRC 3M4FA 3SKVA 3KQRA 4GWJA 4N8MA 3RNSA 3WNNA 2J1SA 2P6CA 4K8RB 3N9OA 3J8F3 4MYEA 5A7OA 4FPOB 4XZPA 4COWA 4G3YC 2AACA 3H42B 4YW3A 2WZPP 5BNOA 2GMPA 3SLIA 3UETA 4DINB 2GNBA 3NJXA 4P9JA 4O7XA 4W6XA 3J8F1 5J3UA 4D7YA 4QPIB 3QBQA 2BFUL 4Q27A 2FMYA 5LW9A 3WZ1A 5APAA 1K5MC 3UKNA 4R4XA 3I8TA 1S0CA 4RHV3 3V56A 3ZSMA 3ZYJB 1WW6A 1NZIA 5FO8B 4NOTA 3C8XA 1XE7A 4YG0A 4YFWA 2DCYA 3N3HA 5FFOC 2H0BA 4MHRA 2G1MA 4RHV1 3GJBA 5FLIA 4XF0A 3LDRA 2E7TA 3ACIA 3TEWA 3I2OA 4GB33 3KT1A 4BU2A 2V73A 5HI0A 4QU1A 2YPDA 3N7KA 3DPRA 1CAVB 2DDUA 1SMVA 2GP5A 2TEPA 4GB31 3APBA 2A73B 4CCOA 5A3NA 5KC5A 4HZFA 3ZVXA 4AFBA 3DV8A 5IUQA 1LRHA 1UIJA 3CO2A 4GH4C 2D5FA 3TEXA 1W6NA 4A2UA 5L7OB 2VH9A 3RZGA 1QDCA 3VDDB 3UGHA 2IXHA 5LA1A 3U07A 4Q0QA 2EXKA 1UZWA 2W52A 2ZAHA 1TZOA 2DCJA 2ZXQA 4GKYA 1O5LA 2VUCA 2XJTA 3I2IA 1EPZA 2ETEA 1VPHA 3WP5A 1AHSA 1OF3A 1V6OA 4IV3B 4QB2A 3U1XA 4YW4A 4M3CF 5A7WA 1QOSA 5T5PA 1GZTA 1K42A 3MF9A 1PGSA 2WNEA 3OUJA 4YPJA 3FBYA 4AFCA 2YPJA 2RJ2A 4C91A 3VBUB 2IFRA 2XVGA 3MLKA 4WM8A 1J1LA 3WQ0A 3VBSC 2YC2A 1C57A 4RR3C 4WM7A 1PX3A 3POEA 2LTNA 4LBMA 4X8NA 5FZ8A 4XQ4A 3RYKA 5J1XA 5L9VA 1N3QA 4KGQA 4Q0UA 1ND2A 2ZEXA 4M3CB 4O9GA 4CEWA 5KXCA 4QMAA 1SBDA 2BWCA 1H30A 1R1A3 3T08A 5JAXA 1W2TA 5E1RA 4LHNA 5GALA 4DXZA 2CGNA 4I02A 4CCJA 3NAPB 2FZ1A 3C7GA 1R1A1 3LFIA 1V9U3 3OB8A 3NV1A 3B69A 5DAXA 5E6HA 5FAXA 4FXGB 3ZFEA 4A6OA 4CCMA 5BNNB 2PHRA 1JYNA 2CGPA 3DYOA 4LBLA 5EHDA 1FPN3 3J8F2 5EQUA 5B2GB 5CISA 1V9U1 3AK0A 1DQ5A 4H3WA 1NA1C 4QQ2A 1RB8G 2B5HA 2PXJA 3AKTA 4LQRA 3LEKA 4PCRA 3AYAA 1JOPA 1FPN1 3NW4A 3ZOIA 2D3SA 2OS2A 1UKRA 4HBNA 4E4SA 1BK0A 1BVP1 2YXSA 2Z2SB 3W58A 1PMJX 2DCKA 1SEFA 1LU1A 2ZS6B 3ACLA 5CFDB 3CKHA 3L9JT 3GBFA 4DOUA 4RHV2 1BLZA 3AYEA 4DXRA 1TG7A 1Z0HA 3GZAA 1NXD1 3WNMA 1OBNA 4PBPA 3BIEA 1WMEA 3SC7X 3ES1A 2WLQA 3NQHA 4LKFA 4RYDA 3ZKUA 4EQVA 1AX0A 4P02B 1QNYA 3I97A 4GB32 4A7ZA 5FJHA 4P9LA 1DQ1A 3VBFC 4Y20A 4V2VA 4URTA 1UW8A 4TLFA 1W6QB 4I01A 1MZEA 1QIQA 4Q0VA 3EQEA 2RS33 4XC9A 3FC0A 5DG1A 2ZMNA 2OYZA 2R072 4CCKA 2P3JA 3LIGA 1GZWB 1TVGA 1VBC3 4K9SA 3VBRB 1Z7S3 1UZ0A 5EWSA 2XL9A 1XXNA 3AX4A 2GALA 2RS31 3MIFA 4OYUA 1DLCA 3UJOA 5JMCA 5FY7A 2X5IA 4CP0A 2VMIA 2VOVA 1VBC1 4RQPB 1Z7S1 3KCCA 5FYCA 4XAAA 4HL0A 3NV3A 3SKJE 4MGQA 5F3IA 1H2NA 2IXIA 2WT1A 3JUUA 4IE0A 1CAWA 3WR0A 1G7YA 5FPLA 2Q1MA 5C6CA 3AKSA 3MLJA 4FFIA 3R4SA 4BLIA 1POQA 4EWDA 4FAGA 2GNMA 2WSUA 5E88A 4YZ4A 2BGPA 4FSJA 2WYFA 3IDEA 2D3RA 2RG4A 4CEYC 1CIWA 5J7MA 4Y1XA 4DNYA 5FY8A 4DEVA 3MV11 4PHZA 1RJ8A 1PNFA 1DQ6A 2JKBA 2WA4A 5A32B 3THDA 4ZU7A 3MPPG 4BDVB 5JPMB 5BNQA 3OBRA 1HRV3 5DUXA 1MACA 4XJAA 4QAWA 1ULEA 2FDGA 4HXCA 1SLCA 2CWMA
chains in the Genus database with same CATH topology
1HB3A 2VCMA 1ODMA 1QJFA 1W28A 1W2OA 2IVIB 1OC1A 1UOFA 1E5HA 1HB1A 2BU9A 4BB3A 1HJGA 2Y6FA 4XAEA 2WO7A 1W06A 1QJEA 1WA6X 2VAUA 1UOBA 1HB4A 2VBPA 1GP6A 4RGKA 1W3VA 1HJFA 3ZOIA 1UOGA 2DBNA 1E5IA 1RXFA 1BK0A 1W03A 2VBBA 2JB4A 1W2NA 3ON7A 1DCSA 1BLZA 1IPSA 1OBNA 2IVJA 1W04A 3ZKUA 3ZKYA 1UNBA 2VBDA 1W05A 1E5SA 5C3OA 2DBIA 5APAA 1QIQA 1UO9A 5C3QA 1GP4A 5C3PA 1RXGA 5C3RA 1ODNA 1W3XA 2BRTA 2BJSA 1HB2A 5C3SA 2VE1A 1W9YA 3OOXA 1GP5A 2JB8A 1E5RA 1UZWA 1W2AX 2CSGA 2Y60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HB3 A;  2VCM A;  1ODM A;  1QJF A;  1W28 A;  1W2O A;  2IVI B;  1OC1 A;  1UOF A;  1E5H A;  1HB1 A;  2BU9 A;  4BB3 A;  1HJG A;  2Y6F A;  4XAE A;  2WO7 A;  1W06 A;  1QJE A;  1WA6 X;  2VAU A;  1UOB A;  1HB4 A;  2VBP A;  1GP6 A;  4RGK A;  1W3V A;  1HJF A;  3ZOI A;  1UOG A;  2DBN A;  1E5I A;  1RXF A;  1BK0 A;  1W03 A;  2VBB A;  2JB4 A;  1W2N A;  3ON7 A;  1DCS A;  1BLZ A;  1IPS A;  1OBN A;  2IVJ A;  1W04 A;  3ZKU A;  3ZKY A;  1UNB A;  2VBD A;  1W05 A;  1E5S A;  5C3O A;  2DBI A;  5APA A;  1QIQ A;  1UO9 A;  5C3Q A;  1GP4 A;  5C3P A;  1RXG A;  5C3R A;  1ODN A;  1W3X A;  2BRT A;  2BJS A;  1HB2 A;  5C3S A;  2VE1 A;  1W9Y A;  3OOX A;  1GP5 A;  2JB8 A;  1E5R A;  1UZW A;  1W2A X;  2CSG A;  2Y60 A; 
#chains in the Genus database with same CATH topology
 2XUE A;  4AZZ A;  2ZX0 A;  2GN3 A;  1HRV 1;  3ILF A;  5FMC A;  3BOP A;  4QB1 A;  4OZO A;  3WT3 A;  1VIW B;  5FZC A;  1F4A A;  5KXE A;  4E4D X;  5HXM A;  3DXU A;  2O14 A;  2IVI B;  1G6N A;  1LOF A;  4QM8 A;  4W8J A;  3D3A A;  3LQC A;  1V9U 2;  4O65 A;  1FPN 2;  5FBZ A;  4E4Z A;  1IS3 A;  4DXT A;  3VGI A;  5CB7 A;  1N47 A;  1YRZ A;  1US2 A;  3MIC A;  1OOP A;  3VDB A;  4JGZ C;  4FFH A;  4DXS A;  2XHK A;  1CAV A;  3IWZ A;  3O1O A;  1WA6 X;  1H4G A;  3GM8 A;  1BZW A;  2VUA A;  4Q1P A;  5FYT A;  1HB4 A;  4GA9 A;  3OJB A;  4LUL A;  3KSC A;  5C4W C;  5CYY A;  1IHM A;  5L7O A;  1KJL A;  4IE7 A;  4FPY A;  2WSV A;  2YGL A;  3ILR A;  4GZ9 A;  4NRO A;  3LAG A;  3VZL A;  2VXR A;  3T1L A;  1QMJ A;  2FDH A;  1Q8P A;  3BOW A;  4YVS C;  4NID A;  2XON A;  2UWC A;  4IV3 A;  4Q0P A;  1YJK A;  4XF9 A;  5H9S A;  2WBK A;  3JB4 C;  3IMM A;  4CZS A;  4OHY A;  4YAR A;  4KU8 A;  4I3G A;  1WCU A;  2RS3 2;  2IFW A;  4PLO A;  3VLB B;  3U4S A;  1GYK A;  1F31 A;  1MVQ A;  1ND3 C;  1QJU 3;  2HYX A;  1Z7S 2;  2IVJ A;  1CIY A;  2WNV B;  3VBU A;  2OUJ A;  1C5I A;  3FBM A;  5FP3 A;  1GZC A;  5HBA A;  5KXD A;  5A3P A;  3G6J B;  1O91 A;  3WG1 A;  1QJU 1;  2RS1 3;  4EN0 A;  2BNO A;  4Q4X 3;  2R16 A;  1VE0 A;  4JDO A;  3WX5 A;  3ZSK A;  3POS A;  4UWD A;  1OUX A;  1US3 A;  2RS1 1;  2VW0 A;  2I07 B;  4WZF A;  4UBG A;  4Q4X 1;  3C7H A;  3CF6 E;  5FLJ A;  4OMD A;  4FPE A;  2CV6 A;  3FL7 A;  3KS7 A;  4JTO A;  3PHM A;  4QHB A;  1I5Z A;  3SCG A;  3WUC A;  3VD9 A;  5FO9 B;  2ZA9 A;  1NLQ A;  4QQH A;  5FUP A;  5AC9 2;  5LA9 A;  3N35 A;  4K3U A;  3OGR A;  4OQ8 A;  3I2H A;  3PJY A;  4CCD A;  4QXK A;  1M4W A;  1DHK B;  3N7M A;  2JIC A;  5FXW A;  3ZXG A;  4HAN A;  4NHY A;  1MS9 A;  1AUY A;  2HJI A;  4UT5 A;  2D6L X;  5BNN A;  5I8S A;  1QU0 A;  4JHT A;  4W4Z A;  4ZXE A;  3VZO A;  5LCW L;  3H8U A;  3WG4 A;  3POB A;  3OGV A;  5BNP B;  1GOH A;  1HRV 2;  3LA7 A;  1PO2 2;  2ILM A;  2Y6H A;  3WG3 A;  2Y6G A;  1TNF A;  1WLW A;  3AZW A;  1W0O A;  4YGB A;  3T30 A;  2LRO A;  2OA2 A;  1IPK A;  5ABJ B;  3PVO A;  2OQ7 A;  4BQY A;  2YDE A;  5FZ9 A;  5IWF A;  3AFG A;  3DUI A;  1H1M A;  5J37 A;  4PJY A;  1SLI A;  1URX A;  2YC0 A;  3EHK A;  3H1Y A;  5JSP A;  4LIV A;  4I0B A;  3I59 A;  1UMZ A;  1S0F A;  3DF0 A;  1S4C A;  1SG3 A;  5FZI A;  4MXV A;  4BMB A;  4AOC A;  1UY1 A;  1QWR A;  2D6K A;  2ORX A;  3PU3 A;  3RDI A;  5LA0 A;  4D6S A;  2ZZJ A;  2FZ2 A;  2WII B;  1W9F A;  1Y3T A;  1ZRI A;  4ASK A;  2JE8 A;  5A7Q A;  2X10 A;  1ZBA 3;  5FYY A;  2W87 A;  1RUI 3;  2W0X A;  1HV0 A;  2JDK A;  1W6Q A;  2BOI A;  1A3K A;  1U12 A;  1ZBA 1;  5FZ3 A;  1GZW A;  1RUI 1;  2WYS A;  3VBR A;  2B8M A;  3RZK A;  1FX5 A;  2V72 A;  5DG2 A;  4LE4 A;  5DPN A;  3WIN E;  4Z2A A;  1UAI A;  1JZ8 A;  3F95 A;  3SCF A;  3ZIW A;  4Y1U A;  2W1W A;  4BK4 A;  1HQW A;  4AVT A;  3BYW A;  4QDQ A;  5A3T A;  1J83 A;  4Y4Y A;  5LBB A;  1XNK A;  3FN9 A;  2BTV C;  1YNA A;  3ACH A;  3THT A;  3TWI A;  4IE5 A;  1V6M A;  2RDQ A;  1G8W A;  5GLV A;  3HNM A;  4OCT A;  4XBQ A;  5CVR A;  2W1S A;  2I45 A;  2QE3 A;  4LO8 A;  3ZO0 B;  3DCQ A;  4BIF A;  1HXS 2;  2A6V A;  1RUG 3;  4HON A;  3MIG A;  1W8O A;  3RQ0 A;  4CCN A;  4X8P A;  1XE0 A;  4ISQ A;  4Y4R A;  3ZPY A;  1AR6 3;  2ZOE B;  5A32 A;  2YZ4 A;  1UU4 A;  3KCY A;  2WKK A;  2J7M A;  2D3P A;  2Y8K A;  3LCP A;  3OEA A;  1AR6 1;  3H7Y A;  2Y0O A;  1JI6 A;  4EWE A;  4IET A;  2Q30 A;  2FCT A;  4AFM A;  4RGA A;  1A78 A;  2IXL A;  3KGL A;  3WOG A;  2LW8 A;  3ES4 A;  3L2Y A;  1RUE 3;  3B9I A;  4UW6 A;  2X09 A;  1WD4 A;  1W04 A;  5FPU A;  1J58 A;  2YMZ A;  4BPZ A;  1O6U A;  2AUY A;  4GH4 A;  4P9G A;  3KM5 A;  3QH7 A;  4LBN A;  1G9A A;  5FZB A;  1RUE 1;  3VL9 A;  4CP1 A;  5FZE A;  3ZMN A;  1UZZ A;  4JQR A;  2RVA A;  4LBK A;  4JHZ A;  1GSL A;  2DYC A;  3AZV A;  1TME 3;  4KMQ A;  5F5C A;  1UMH A;  1BQP A;  2PFW A;  2FCU A;  3IZO A;  5EYX A;  4OUM A;  3IT8 A;  3ZYI B;  1TME 1;  3U10 A;  4B1M A;  1PHM A;  4OI2 A;  4H7M A;  5FCC A;  1EYB A;  4IES A;  1VBD 2;  1AYN 3;  1ASJ 3;  1QEX A;  3ZR6 A;  4XQD A;  5J98 B;  2VQT A;  2BRT A;  3VN4 A;  4CXX A;  1JYC A;  4LA3 A;  3O1V A;  1C8N A;  4WZC A;  1UXZ A;  4E9K A;  3C7O A;  1AYN 1;  1ASJ 1;  4OMC A;  4YW6 A;  1WW4 A;  3VBS A;  3VUO A;  3RPQ A;  2P3Y A;  1XJA A;  1CX4 A;  3MO4 A;  4RR3 A;  4EJR A;  1D4V B;  1ZRC A;  1UIK A;  5A33 A;  5JUV A;  4FPJ A;  2VZT A;  4M00 A;  3RI9 A;  3CBN A;  2MHF A;  1UXX X;  3ZFE C;  5DAW A;  1U5Z A;  3MIH A;  2G9F A;  4FPK A;  4Z8B A;  2ARB A;  5JR2 A;  1LUL A;  2VME A;  2ZGK A;  1NE4 A;  5GZC A;  1FMD 3;  1ZBA 2;  4FTB A;  4TYS A;  2Z79 A;  5A3L A;  4XE9 A;  5CAD A;  1KGY A;  3GZU C;  3HQR A;  4XFG A;  5EZW A;  4MZU A;  2LS6 A;  4R52 A;  5JI7 A;  2W5F A;  4LBO A;  3CJX A;  3RWK X;  5IVE A;  2QQP A;  4NRM A;  4JRA A;  4BM8 A;  4D8M A;  1QQP 3;  1U5X A;  1XOY A;  1YI9 A;  2ZGU A;  4COY A;  1RL3 A;  2VQA A;  3WCS A;  3VHN A;  5FPA A;  3J9S A;  4FOV A;  1QQP 1;  2A3W A;  3WV6 A;  1GQH A;  2FDI A;  1X50 A;  1NX9 A;  3QAC A;  1K3I A;  1ZA4 A;  4FOW A;  4BIS A;  1ZVF A;  3P3P A;  1MEC 2;  5FZL A;  4TLG A;  1UWW A;  5CFC B;  2WT0 A;  1YJL A;  4A41 A;  4R9D A;  1R09 2;  5KHG A;  5FYZ A;  3V64 A;  1W6P B;  1WCS A;  3AP9 A;  4IGO A;  2XLA A;  3WF0 A;  5C7G A;  2VNR A;  5F7U A;  5T50 A;  4DEQ A;  2GMM A;  4X6R B;  1IQD C;  4LNV A;  4ZS2 A;  4AHX A;  1I9R A;  1XU2 A;  1IQA A;  2XR4 A;  4XJW A;  5HV4 A;  2A6Z A;  4PLM A;  3Q8F A;  5HCB A;  1PZ9 A;  1S2K A;  3DXT A;  2H6B A;  4FO9 A;  2AH2 A;  4B4P A;  5GKA C;  5DXD A;  3U11 A;  3P6B A;  3CZJ A;  3VBF A;  3WSO A;  3TEZ A;  1KFX L;  2VMF A;  4AGV A;  2D44 A;  5FYU A;  3TBD A;  2VMC A;  5C8C C;  5CA6 A;  5ABJ A;  3KV5 A;  2RDS A;  4QKD A;  2A70 A;  2NMN A;  4LXL A;  4PLN A;  3KF5 A;  1Q56 A;  2DVF A;  5EJ3 A;  5F6L B;  1QJX 3;  4XJU A;  3NNF A;  5JMO A;  4COV A;  4QPW A;  3AMQ A;  3ZXA C;  5JOX A;  3TNP B;  5IFT A;  3Q8B A;  1QJX 1;  2JJ6 A;  1TME 2;  4RGG A;  1OLM E;  1DGL A;  4K21 A;  3UYJ A;  4FT8 A;  3WW3 A;  4L92 A;  4A6S A;  2ZX1 A;  4KNC A;  4BIO A;  4XOG A;  4ITC A;  1PK6 B;  2ADD A;  3ZYG A;  5LY1 A;  2HEV F;  1H6X A;  4QPI C;  2QQM A;  1XSR A;  4A44 A;  4GXL A;  4MSV A;  3WDT A;  3WW4 A;  5F32 A;  3AKP A;  1UYY A;  2ZX4 A;  1GU3 A;  3RI8 A;  1RTV A;  2MNG A;  1UYP A;  1LOF C;  4B8E A;  5FPX A;  2RR1 2;  1YWK A;  2BDR A;  2FD8 A;  1C1F A;  4FCA A;  4KGG A;  1Q43 A;  4P00 B;  3ATG A;  4CU7 A;  2H0V A;  4JKM A;  3KV9 A;  3VBO B;  2B7Y A;  2QQN A;  4MLO A;  2R30 A;  4LT5 A;  4HVQ A;  2AR6 A;  2I2S A;  4XJZ A;  2NP0 A;  1OLQ A;  1DGR A;  3OUH A;  3ETQ A;  4TTG A;  4RD7 A;  3R4D B;  1N1Y A;  3NRU A;  5IVC A;  5IVY A;  1MS3 A;  2PAE A;  1JUH A;  3EBR A;  4LHL A;  1QQP 2;  3E5Q A;  4DO0 A;  1LGB A;  2GZW A;  2VCC A;  3HR9 A;  3IBM A;  4NAM A;  4Q5O A;  4Q4W 3;  2Y34 A;  3UKT A;  5L7O C;  4PIX A;  5EXO A;  3AKR A;  3VDD C;  1CON A;  4I0W B;  3CU7 A;  4BA6 A;  4LBJ A;  2RE9 A;  2DF7 A;  4JGZ A;  2EIC A;  2JG9 C;  4XUO A;  3ZSL A;  4Q4W 1;  4JDN A;  2GDF A;  1F5J A;  4IGP A;  4LA2 A;  1ULO A;  1W9W A;  1ZZ9 A;  3J26 N;  1CZT A;  1J3R A;  5KHI A;  3POY A;  4O61 A;  4D6R A;  3KV6 A;  3GGL A;  1AXY A;  5F5A A;  4H2A A;  5C4W A;  1LEC A;  3T0D A;  2HH9 A;  4JQT A;  2OQ6 A;  2D6N A;  3H8R A;  4N53 B;  3VBU C;  1XPW A;  2W47 A;  4LKE A;  4K1Y A;  4AEK A;  3ZYP A;  4YRD A;  4FAH A;  4YVS A;  2YG0 A;  3MGU A;  2CWS A;  1YQ8 A;  4IEX A;  1OQ1 A;  3CQO A;  4IEV A;  2UWA A;  1PZ7 A;  2G19 A;  3ZMO A;  4XBL A;  1K5J A;  1H2M A;  2YY1 A;  2XVK A;  1LOE A;  3ETP A;  5FKC A;  1JU4 A;  2J22 A;  4ZXK A;  3SCH A;  3WHT A;  5DAP A;  3CIH A;  3WDX A;  1KEX A;  1VAV A;  1COV 3;  1CJP A;  1CGP A;  3S6P A;  3USU B;  4XFC A;  5JI9 A;  2LM3 A;  2EIG A;  1LHW A;  5CEH A;  3NAP C;  1WUV A;  1RC6 A;  5BNN C;  1COV 1;  1QHD A;  2UWB A;  5A70 A;  5EV7 A;  4DRV A;  1WMX A;  3V0B B;  4Y5T A;  3RWN A;  3AP7 A;  3HBK A;  2WZ8 A;  4YFZ A;  4AAP A;  5C9A B;  4UFH A;  4XCA A;  3UL2 A;  1GMM A;  5CZK A;  3K2O A;  1GIC A;  1XE8 A;  1HDK A;  1TNR A;  4I30 A;  4AE2 A;  1F35 A;  1ONA A;  1DFQ A;  1RIN A;  2RV9 A;  4N43 B;  5LAS A;  3VD3 A;  5CFD C;  5LZ6 A;  5M0T A;  2EID A;  4G9S B;  2UYB A;  3I7D A;  4Q1R A;  3CZU A;  2W9X A;  3I54 A;  2D7F A;  5BV6 A;  5ACA 2;  2J1T A;  1E5S A;  3Q8A A;  5C8C B;  2XL7 A;  3AZZ A;  1OPO A;  2RMU 3;  2A71 A;  2BFU S;  4C0B A;  4BH9 A;  2WZE A;  5CFC A;  5BYN A;  1C3H A;  2VY0 A;  2YRO A;  4QX1 A;  1EV1 3;  1YIP A;  1QDO A;  2JDA A;  4TXW A;  3ZN5 A;  4AQ6 A;  1BMV 1;  2RMU 1;  2VUJ A;  3ZFF B;  3AZY A;  4CTE A;  4YZ3 A;  4HN1 A;  1EV1 1;  3EXU A;  3GBW A;  3OGJ A;  2W1Q A;  2P6H A;  4M4P A;  5F3C A;  4IEY A;  5JZG B;  1MS8 A;  4IQP A;  4QX0 A;  2PQS A;  4Q4W 2;  3IDC B;  3RSJ A;  1OKQ A;  3E5U A;  5JIA A;  5IAT A;  1ODN A;  2GC1 A;  3RZH A;  1OUR A;  4PQ9 A;  1W0P A;  2VQU A;  3AP6 A;  4RQP C;  4CRQ A;  3OYW B;  3KGZ A;  1DYO A;  3M2M A;  1REE A;  4IE6 A;  2QKD A;  4QM9 A;  5L73 A;  1SAC A;  1IPJ A;  1JTZ X;  1Y7B A;  2QVS B;  3ZN6 B;  2YBK A;  3OEB A;  3R4U A;  3VKF C;  4BJ0 A;  2VVF A;  4CXW A;  2WQZ C;  2CAU A;  1QGL A;  5AFB A;  2DWR A;  2VE1 A;  2Z4F A;  3OOX A;  4MHU A;  4QX5 A;  4RFT 0;  4AEM A;  5HV0 A;  2UY8 A;  1FI2 A;  2B39 A;  3MHZ A;  3NNM A;  3A4U A;  3NJV A;  5FDB A;  4CUC A;  4MUV A;  4LEJ A;  2HYK A;  1EAH 3;  4DUV A;  1AF9 A;  1NY7 1;  4GWM A;  3E6D A;  3T09 A;  1H2K A;  1CZV A;  5JXG A;  2Q0A A;  3AL5 A;  4E2Q A;  3DYM A;  1EAH 1;  1Y4W A;  1CD3 G;  1LOA A;  1VBA 3;  1BXH A;  2C1F A;  2CYF A;  2ZHN A;  3M3E A;  3PUH A;  4DMI A;  4XFF A;  2ZTN A;  5FZ7 A;  3N9M A;  3B01 A;  2R07 3;  4AI8 A;  4AL9 A;  1VBA 1;  3JD7 3;  5JOW A;  5F1R A;  3B93 A;  3RMY A;  4AFA A;  1COV 2;  3ALQ A;  1AXZ A;  3KT4 A;  3PU8 A;  3LPF A;  2R07 1;  4AEJ A;  2RJK A;  2OXB A;  1PVC 3;  3JD7 1;  4XBN A;  1OFN A;  4MGZ E;  1PNG A;  2JG9 B;  3DGT A;  1ULF A;  4ORF A;  4AQ2 A;  5CKN A;  3KHC A;  2AEN A;  2WJS A;  4QKF A;  1D2Q A;  4BB3 A;  1I6X A;  4QDR A;  3AYC A;  1T6B X;  1PVC 1;  5AFE A;  2F4L A;  5A7N A;  3VBO A;  2VZ1 A;  3POF A;  2WLP A;  4PDW B;  4XQW A;  1W8U A;  4XUR A;  1PIV 3;  3NV2 A;  3RJ2 X;  4DB5 A;  1SPP B;  1W8H A;  1PMH X;  3JQX A;  2A1X A;  2J1E A;  1W6M A;  4FPL A;  5GLZ A;  1PIV 1;  2WIN B;  2YFU A;  3CDZ B;  4BCU A;  3QLQ A;  4EV0 A;  1N1S A;  1RUO A;  3R0R A;  1YQ5 A;  3SEE A;  1JUI A;  4UW5 A;  1X8E A;  1YIF A;  4XTP A;  2GSY A;  5JR7 B;  4XFH A;  4C8D A;  3A0N A;  3LKJ A;  1ZA7 A;  4XAC A;  1BMV 2;  2W92 A;  2JE7 A;  3WF2 A;  5JDB A;  1UPS A;  2RMU 2;  4MO3 M;  3W9A A;  3PUS A;  4AG4 A;  3HIF A;  1G9B A;  4RL7 A;  4U2A A;  3U75 A;  1UZV A;  3K4D A;  2BP6 A;  1Y9G A;  3HQU A;  5LRS A;  4LUK A;  4DS0 A;  1W8F A;  1EV1 2;  1S55 A;  3NL1 A;  4NRQ A;  1C1L A;  3A22 A;  3N9N A;  4NAO A;  1S0B A;  5H9Q A;  3J7H A;  2GME A;  2WWJ A;  3TYJ A;  5HCH A;  4YW2 A;  5BY5 A;  2GU9 A;  1V70 A;  2V09 A;  2WNV C;  5HXV A;  3MLL A;  1GNZ A;  1QY4 A;  3QCW A;  1I3H A;  4N53 A;  1JN2 P;  4BQ5 A;  4Z82 A;  4P9X A;  4DIQ A;  3KT7 A;  5I0D A;  1HLC A;  4LBQ B;  5BPX A;  2JG8 C;  4LIU A;  1M06 G;  1JW6 A;  4QHO A;  3OF1 A;  4YW1 A;  3SNM A;  4Z1V A;  3K3N A;  3ACF A;  3H1W A;  4YSF A;  4JX0 A;  5AVP A;  2WZR 2;  1S2B A;  2TNF A;  2PHX A;  5JSR A;  3M3Q A;  1KRI A;  4CXY A;  1IS5 A;  3ZXE A;  1DDL A;  1STM A;  1RXG A;  3WNP A;  4CVU A;  4JGY B;  2HBU A;  5T3N A;  1NY7 2;  1QJY 3;  3IPV A;  5I93 A;  1FAY A;  2Z5W A;  3USU A;  2CL2 A;  3F2Z A;  4YM1 A;  1O4Z A;  1PMI A;  4TN7 A;  1EAH 2;  3T0A A;  1SLB A;  1ZZC A;  1QJY 1;  3OD4 A;  2JEM A;  2XB6 C;  4A7Y A;  3V0B A;  4ARX A;  1HQN A;  1O5U A;  5BNP C;  1AR7 3;  4SBV A;  3BAL A;  4OHX A;  1VBA 2;  1S0E A;  3O1M A;  2L9L A;  3ECQ A;  2BUK A;  5LA2 A;  1AR7 1;  2W46 A;  5EIY B;  5LEK A;  5C8W A;  5ABJ C;  4LIT A;  4RA0 A;  1HV1 A;  3JD7 2;  4OLL A;  4Y33 A;  5IVJ A;  5K0U B;  2SLI A;  3T2P A;  3O14 A;  3I2K A;  5FTT C;  1O8P A;  2P34 A;  1PVC 2;  2YB7 A;  4QGN A;  5T52 A;  4CPB A;  3MW4 A;  1HB3 A;  2V4V A;  3KHB A;  4LOR A;  1Q8S A;  3PUI A;  2OW4 A;  5FP8 A;  2XUM A;  2P4E A;  5C8C A;  2BGO A;  1SHW B;  1ZRR A;  2F4P A;  3GZT B;  2XDV A;  5GLW A;  1J1T A;  3P5B A;  4BXS V;  5A1A A;  4A3Z A;  2WUH A;  1PIV 2;  3SH5 A;  4R9C A;  3X29 B;  5AC9 3;  1IZ3 A;  2ZX2 A;  1KFU L;  1D2S A;  3ZFF A;  1E5H A;  2H6C A;  1WCQ A;  4BQ4 A;  1LED A;  4W6Y A;  5AC9 1;  2CNA A;  2HWC 2;  5GZD A;  2UUR A;  3VKL A;  3NO8 A;  3DKQ A;  4XIO A;  4AED B;  5JVV A;  1PX4 A;  3VV1 A;  4MET A;  1PO2 3;  1GNH A;  3OYW A;  3V0A B;  2D43 A;  3B94 A;  2FCV A;  4L9B A;  1GZ9 A;  4QPG B;  2CTV A;  5B4N A;  5DN2 A;  1DGW X;  1JXN A;  1W9T A;  1H1I A;  1PO2 1;  2ZGM A;  4YW5 A;  5DZG A;  1F15 A;  4QPI A;  3V65 A;  4Z2W A;  3ZN6 A;  2JIG A;  3AP4 A;  4NN0 A;  3WVJ A;  3VHP A;  2BER A;  2DFC A;  1AYM 3;  1G9F A;  4IEP A;  4HKL A;  3LA2 A;  1W3V A;  4JRL A;  2GNT A;  4LUM A;  3B9C A;  1LHV A;  4XXP A;  1MS1 A;  2VW1 A;  4UFI A;  5A6X A;  1AYM 1;  2E51 A;  4XMI A;  2JXA A;  1MVE A;  1RIR A;  3BB6 A;  3P1I A;  1GUI A;  5E89 A;  5FZ6 A;  5EJ1 B;  4AHZ A;  4PF1 A;  5FPB A;  3UGF A;  3ORJ A;  3S5A A;  2WNO A;  2RDN A;  4LKD A;  2IC1 A;  3LSE A;  1IPS A;  2Y6L A;  2E32 A;  2QZ3 A;  2GC3 A;  1T2X A;  4XUN A;  3VBH B;  1FAT A;  3HPN A;  3OY8 B;  4MGK E;  3VZN A;  5LB6 A;  1SFN A;  5JWP A;  1HKD A;  3ROU A;  1QJY 2;  5IHR A;  4AI3 A;  2DU1 A;  2Z42 A;  3VDD A;  3QOP A;  5FK8 A;  5IK5 A;  1RED A;  1H9P A;  2OPK A;  2PHT A;  2JG9 A;  4GKX A;  3J7N A;  3Q9O A;  3K46 A;  5IK8 A;  3AZX A;  2DCT A;  1PVX A;  2HWD 3;  4XXA A;  4DZG A;  4EZH A;  1A34 A;  4C90 A;  2ZHM A;  4YNI A;  4MAD A;  1AR7 2;  3ZYB A;  4A45 A;  1VLN A;  2F17 A;  5F37 A;  5K7P A;  1UX6 A;  3TEY A;  3E1F 1;  2HWD 1;  5G04 L;  1SPP A;  3MF6 A;  2EIE A;  3DEC A;  1SDD B;  3MW3 A;  1Q8V A;  2DFB A;  2VNV A;  3GCW A;  4XF1 A;  1Y9Q A;  1C8M 3;  1KQR A;  4IE4 A;  2R06 3;  4NR1 A;  1HXS 3;  3O0V A;  2BJS A;  4YG3 A;  2D40 A;  1WD3 A;  4FTE A;  4FP3 A;  4RS5 B;  1C8M 1;  2P37 A;  3OPT A;  1AR9 1;  2R06 1;  1HXS 1;  2JG8 B;  3SH3 A;  3PNA A;  3RVH A;  4GJY A;  5E16 A;  5FQ0 B;  3RG0 A;  3WW1 A;  2XQR A;  4AHW A;  2A3Y A;  5FZO B;  4YM3 A;  4XCB A;  2WRA A;  2Q5T A;  1DGW A;  3K48 A;  3VZJ A;  4M3C A;  3OPZ A;  1W99 A;  2VUL A;  3RS6 A;  1LOG A;  2CU5 A;  4IW3 A;  5K9Y A;  4Y5S A;  3I3M A;  2ZMK A;  4HET A;  1DGR N;  1JOJ A;  4RN5 A;  4Y26 A;  4Y1Z A;  5DAQ A;  2Y60 A;  4CCE A;  3G7D A;  4DPN A;  1KIT A;  2ZHK A;  1IKQ A;  2WFP A;  3LFM A;  5DAV A;  2X05 A;  3NAP A;  1XNC A;  2VW2 A;  1KS4 A;  1NCQ B;  5K0U A;  3FLP A;  3W20 A;  2QQW A;  1JYW A;  4QX8 A;  2C9K A;  1KJR A;  2PYT A;  2PMW B;  2VOX A;  5BXX A;  4YZ5 A;  2XVL A;  4IEO A;  3FFZ A;  3WDY A;  2X29 A;  5FWJ A;  1VBD 3;  2D93 A;  4XEZ A;  5FXV A;  2EA7 A;  3BKZ A;  1F2N A;  1V6I A;  5CFC C;  4OUE A;  2XHN A;  2J1R A;  1AYM 2;  2PHL A;  5CFD A;  1GBG A;  1S2E A;  3RZJ A;  4QU2 A;  4QKB A;  1VBD 1;  2ZGR A;  4YGE A;  4FFF A;  1H8T C;  1X9T A;  3VZM A;  4COU A;  2RM2 3;  2DUO A;  2DVA A;  2WN3 A;  2XJS A;  5GZE A;  4UOJ A;  3AVR A;  1B09 A;  3BN6 A;  3FUQ A;  5DZE A;  2BVB A;  4BQ1 A;  5CAZ A;  2RM2 1;  5LBE A;  1KDM A;  1NLS A;  4QT6 A;  4C1X A;  4UFJ A;  2A6W A;  1JBC A;  2J1U A;  3HWJ A;  3EMR A;  2MEV 3;  1S0D A;  3AMP A;  5IAX A;  2R1B A;  3RRD A;  1ENR A;  4CDQ B;  4IXL A;  4S2H A;  4YGC A;  2MEV 1;  3R6S A;  3UK9 A;  3ZYF A;  4P5H A;  4TSV A;  1UY4 A;  2JEC A;  2VBB A;  1LEN A;  3OG2 A;  2A5Z A;  2LAL A;  4EN6 B;  1KXG A;  5FYI A;  3M8L A;  4RQP A;  2LUW A;  1XC6 A;  2C9A A;  1OXC A;  1JOB A;  3D8C A;  3USS A;  2HWD 2;  5FMO L;  1VAK A;  4CP9 B;  2PLV 2;  4IV1 B;  4QX3 A;  4QD2 A;  4R8H A;  2E6V A;  3H0O A;  3BIW E;  3HAG A;  3IM0 A;  3ZKY A;  3EJK A;  5FY9 A;  1MEC 3;  1DP0 A;  2AEZ A;  3T4H B;  2R04 3;  3GHM A;  1R09 3;  1YUD A;  4ERO A;  1PK6 C;  5CG9 A;  4NE9 A;  4XDP A;  1NQJ A;  1C8M 2;  4YVW B;  4XUQ A;  1AR9 2;  1MEC 1;  1TMF 2;  2R06 2;  2ES3 A;  2C5D A;  3RJR A;  2R04 1;  4AVS A;  4UFL A;  4QKN A;  5ERL A;  5JOZ A;  1R09 1;  2Z69 A;  4FI9 A;  1LGC A;  1O3S A;  2ARX A;  3MPB A;  4X6Q B;  2G4I A;  2VNO A;  3IAP A;  2ADE A;  2ZX3 A;  2Q8E A;  3POJ A;  1GP4 A;  3IMN A;  1LTE A;  1W8W A;  4JDM A;  2Y33 A;  5F2S A;  5BUV A;  4LLO A;  5JIU A;  5KWR A;  1RUH 1;  5FZ1 A;  3C3V A;  1DBN A;  1MPX A;  1OH4 A;  4DUW A;  2W94 A;  3VBO C;  3WDV A;  4AI2 A;  4D3W A;  3AXE A;  2KM2 A;  2GH2 A;  3FHA A;  5A6Q A;  2BOJ A;  4BQ2 A;  3I3B A;  1ZZ8 A;  1YFX A;  4AI9 A;  1W9Y A;  1HIX A;  3KF3 A;  3ZPO A;  4ATF A;  3ENR A;  3I2J A;  1DQ2 A;  4PBO A;  1V6L A;  2F6B A;  4FQ4 A;  4ZU4 A;  3E6C C;  4LJH A;  5FP7 A;  2ATF A;  4XF4 A;  4V2W A;  3INA A;  1NAE A;  1YYN A;  2E9Q A;  4BE3 A;  3RZM A;  2R49 A;  2A3X A;  2OII A;  3C7F A;  3HN1 A;  3IAQ A;  3BU7 A;  3VBH A;  3OY8 A;  1D0H A;  4AGR A;  3KZ4 C;  2ZAA A;  3MID A;  1SLA A;  1ACC A;  1OD3 A;  2QQK A;  2VCM A;  3DEM A;  3GF6 A;  3LB9 A;  2P5B A;  1QOT A;  1QJF A;  4RFR B;  5E8A A;  3C7E A;  4AI0 A;  2X53 S;  1YFW A;  2PEL A;  2WR9 A;  4GIQ A;  2BWA A;  2RM2 2;  2VQ0 A;  2RR1 3;  1Z78 A;  4MXW B;  1WA4 A;  4N53 C;  3RFR A;  4ASM B;  1X82 A;  1HB1 A;  2XBO 2;  4IND A;  5EFU A;  5FRE A;  2RR1 1;  3IDA A;  3UES A;  3W21 A;  3N9Q A;  5DUW A;  1F8V A;  1ENS A;  2ZEY A;  3CNA A;  3E5X A;  3LF7 A;  5T5J A;  1B35 B;  2MEV 2;  3ZDS A;  3RMX A;  3SMH A;  2IUW A;  3LPG A;  3O7O A;  3PVB B;  1RUN A;  2WNV A;  4KWK A;  4YYO A;  2B46 X;  2WN2 A;  4UYB A;  1QJE A;  1J84 A;  2VAU A;  4NIA A;  4JTN A;  4NUB A;  1WMD A;  3NKT A;  4RS5 A;  1D4M 3;  4NO4 A;  4AVC A;  3B5L B;  5L9R A;  3CHX A;  3UNP A;  1Q3E A;  2JG8 A;  1XND A;  5FRA A;  2XLG A;  3BPS A;  2W95 A;  3OTF A;  2OX0 A;  4D0Q A;  1D4M 1;  2DTY A;  2E31 A;  4E8D A;  3OPW A;  3WDW A;  1AL2 3;  1ULP A;  1R08 3;  3D4K A;  3IB3 A;  4U36 A;  1GWL A;  1LOB A;  4NHK A;  4QXB A;  1DQ0 A;  2O8Q A;  2R04 2;  4IER A;  4PIY A;  4CE8 A;  2XXZ A;  4QQL A;  1AL2 1;  4YM0 A;  5C9A C;  1JZ2 A;  4B4R A;  1R08 1;  2ZGS A;  4GJZ A;  4MGS A;  3GHN A;  1SFP A;  4FFG A;  4IEW A;  1AX1 A;  1H8T B;  3L2H A;  4E8C A;  1NXM A;  1YQ2 A;  3J4U H;  4AW7 A;  4MVT A;  3HJR A;  2K2S A;  3OCP A;  4HFS A;  2HWE 3;  3VKO A;  3HBZ A;  1NCQ A;  1RUH 2;  5F3G A;  1CZS A;  4N43 C;  5FJK A;  1REF A;  1FXZ A;  3DN7 A;  5FUN A;  1ZRF A;  5BNP A;  3CJI B;  3IKW A;  1V6N A;  4KWU A;  2JDZ A;  5I91 A;  4M01 A;  2HWE 1;  1UNB A;  3AKQ A;  1JZ5 A;  2RS5 2;  1ULD A;  3ILN A;  5LY2 A;  2YBS A;  4E4H A;  4Q8L A;  2VC9 A;  3S7E A;  1LAJ A;  5I0T A;  1WLT A;  2C4X A;  2QZ2 A;  2DCZ A;  4HPK B;  3U78 A;  2J42 A;  3K4A A;  4R9A A;  5KBF A;  1LJ7 A;  3T2T A;  4BXF A;  4ZKT B;  5C3Q A;  1T6G C;  1LU2 A;  3ZFF C;  3NV4 A;  4MH0 E;  4BME A;  1CX1 A;  2VJX A;  2XH6 A;  3WCR A;  3ZXF A;  2WWU A;  1ULG A;  2GND A;  2XWJ B;  4NPR A;  5JZG C;  2QDN A;  3VZK A;  2HLE A;  5DMY A;  4XUT A;  1ZX5 A;  2VD7 A;  5BNO B;  5A1L A;  1O4T A;  3GDB A;  4NIG A;  4L99 A;  4K6B A;  1LR5 A;  3U14 A;  4OFG A;  4PF5 A;  4K1Z A;  1LGN A;  1DZQ A;  2E53 A;  4BQW A;  3MV0 1;  1DLL A;  3KVA A;  3HT1 A;  3T2O A;  1V0A A;  2VO5 A;  4BZ4 A;  3Q8E A;  1GP5 A;  4A7K A;  3AL6 A;  2JB8 A;  1C5H A;  4DY5 A;  2FBE A;  2ZGP A;  1QH7 A;  5KHJ A;  4W65 A;  3III A;  2AGS A;  3M3C A;  4BLJ A;  1UU6 A;  1WKY A;  1I5P A;  1NG0 A;  4Q4V 3;  5KC6 A;  2N7G A;  4HOO A;  2BBA A;  4KWJ A;  4N7U A;  4WV8 A;  4CP9 A;  1V6J A;  4XF3 A;  4TWT A;  4ZON A;  5ACA 3;  4IV1 A;  2OPW A;  3H3U A;  3PDQ A;  4Q4V 1;  3A21 A;  2OKX A;  5D21 A;  3MFA A;  1EP0 A;  2PQQ A;  3DPR B;  3LE0 A;  5IJR A;  4S2D A;  1BHG A;  4WVV A;  5ACA 1;  2J1V A;  5IK7 A;  1G9C A;  4YVW A;  2XOM A;  1MQT C;  2B4K A;  4GAL A;  2VOW A;  4M0N A;  1POV 3;  3T3Y A;  1D4M 2;  1LEM A;  1UOF A;  1OA4 A;  4ZY9 A;  3ST7 A;  5L36 A;  1POV 1;  3KD4 A;  5F5Q A;  1O59 A;  2DUQ A;  2BGC A;  2Y0I A;  4JKL A;  2VEC A;  3MBW A;  1AL2 2;  1HX6 A;  1OUS A;  4HK8 A;  5IW0 A;  1R08 2;  1LOC A;  1H4H A;  2YGM A;  3WDU A;  4C1W A;  2CDP A;  1UD1 A;  2WA3 A;  5D2A A;  3AP5 A;  4NWW A;  3M1H A;  4PDW C;  3VKM A;  2Q4S A;  5JXH A;  4V1P A;  2IXJ A;  3VB9 A;  1YO8 A;  1QNW A;  3LWC A;  3WUD A;  2ARE A;  4I09 A;  3JQW A;  4YGD A;  3O1R A;  3N36 A;  4KH9 A;  3UKV A;  3H3Z A;  2VMD A;  5JXJ A;  3MZH A;  2VBP A;  1SDW A;  1W6O B;  1GP6 A;  4J1X A;  4BHP A;  2HWE 2;  4Q8K A;  4OQ9 A;  1F5F A;  4S2G A;  4WM8 B;  3O1U A;  2J1A A;  4NPL A;  1HJF A;  2XKP A;  5GZF A;  4QB6 A;  3I49 A;  2BPA 2;  1YCI A;  5FMD A;  2VVE A;  4XVH A;  3A0K A;  1XYP A;  5FY1 A;  4OI1 A;  4MGI E;  4YM2 A;  3POG A;  4B3N A;  1ULC A;  4F3J A;  4Z92 B;  1ND2 B;  1POV 0;  1Y43 B;  4B7K A;  2XJU A;  3M3I A;  4CEW B;  1OHF A;  2BV4 A;  5DDJ 2;  4I0A A;  3LOI A;  4C0H A;  2IXK A;  2ZGQ A;  2VZ3 A;  1DF0 A;  2HKX A;  2WAO A;  2WQ8 A;  3WHU A;  2VGD A;  2WQ4 A;  2DU0 A;  4Y24 A;  4CDU B;  1ALY A;  5JSO A;  1QF3 A;  1UN1 A;  4N7I A;  1UY2 A;  2XKO A;  2VBD A;  2WC2 A;  4P9Y A;  4CUB A;  1AJK A;  1UX7 A;  4ZS3 A;  4M4R A;  4PT6 A;  4D94 A;  2DBI A;  5K0U C;  4CP2 A;  2PAM A;  3MUY 1;  1RYY A;  4CDX B;  4QHZ A;  3ZYH A;  4EN8 B;  1UO9 A;  1W0N A;  3MDP A;  3BTX A;  3BPZ A;  1WWY A;  1SLT A;  3LEI A;  5FLH A;  2ZAC A;  5K4L A;  3LSD A;  2P1B A;  4Y5Z 0;  2VM9 A;  4PI2 A;  3LOB A;  4Q2F A;  2CGO A;  3LD8 A;  1NCR B;  5C5U A;  2XGX A;  5EPA A;  3MEP A;  3P3N A;  3VD4 A;  2KR2 A;  2V4A A;  2VZP A;  1C28 A;  4JGY C;  1FOD 3;  1UCX A;  2WO1 A;  4LOT A;  1MS5 A;  4Q4V 2;  4UW3 A;  2E7A A;  5A7P A;  4LK6 A;  3POW A;  1LKN A;  1APN A;  2HWF 2;  4XJ9 A;  2NZ9 A;  3FX3 A;  1OLR A;  5CNA A;  1FOD 1;  3I3D A;  2WAA A;  1FNY A;  3AB0 A;  4SLI A;  3GZE A;  5C3S A;  1DZT A;  5FUI A;  4Y20 B;  1P8J A;  2JDY A;  5A1F A;  3NKG A;  3Q8C A;  1L7Q A;  4LO4 B;  1W6P A;  1VMJ A;  3QH6 A;  4Q26 A;  1H8T A;  1IG3 A;  1L3J A;  3H9A A;  5HCF A;  3LEG A;  1ZNP A;  5L19 A;  1RUF 3;  5F39 A;  5FXZ A;  1PO1 3;  3LDK A;  3OSD A;  3SH4 A;  1JZ7 A;  1W39 A;  2GN7 A;  4QWN A;  4DQA A;  4YZ1 A;  1RUF 1;  1ODM A;  4FXK B;  2B9V A;  2O8O A;  4ZU5 A;  1PO1 1;  1CAW B;  3I2F A;  3FHQ A;  5H9R A;  5F9T A;  1W2O A;  2WZR 3;  5T54 A;  3T2Q A;  2ZEZ A;  2PHW A;  4HPK A;  3WP4 A;  2JDU A;  4HT1 T;  3VD7 A;  2WO2 A;  1QKQ A;  2YFZ A;  3LEM A;  3PME A;  1X8M A;  2A7A A;  1OVP A;  1HQL A;  2WZR 1;  2JIJ A;  1BEV 3;  1I1E A;  1L7L A;  2RHP A;  1RUC 3;  1JYT A;  3A7Q A;  4AR2 A;  2BQP A;  2BBV A;  2W2I A;  1BEV 1;  1OD5 A;  4UFK A;  5FIX A;  5FYH A;  2FHR A;  1J59 A;  4XAE A;  1RUC 1;  5FOB B;  1UPI A;  2YC4 A;  4OUS A;  5F3E A;  4AED C;  3OGG A;  4XPV A;  2AZ5 A;  3B00 A;  2WNU B;  1PK6 A;  2OVU A;  3DYP A;  4QPG C;  5FZF A;  3WXP A;  4NRP A;  1OKO A;  1MQT B;  4CDW B;  2VZV A;  1JMU B;  4BK5 A;  2QQI A;  5KR7 A;  4AK3 A;  1GQG A;  1PM4 A;  1MZ5 A;  2WAB A;  3M3O A;  1LHU A;  1N3P A;  2QQJ A;  3GJA A;  4HSL A;  2QQV A;  1UOG A;  1CAU B;  4NHX A;  3THP A;  1KDK A;  3JB8 A;  4D7T A;  2YV8 A;  3PIJ A;  3LA3 A;  1ZRE A;  4AHY A;  1XU1 A;  1JU3 A;  3GNE A;  1IOA A;  4KU7 A;  3HD8 B;  2BVV A;  1EY2 A;  1NUK A;  2JB4 A;  2JWP A;  2ZHL A;  5CKM A;  1DCS A;  1DQ4 A;  1V6K A;  1OOP B;  2QFE A;  4KWL A;  1UF2 C;  3KV4 A;  3M7A A;  5D8A C;  2YYO A;  4R4Z A;  2ZML A;  5TSW A;  4IEQ A;  3VBH C;  3FE5 A;  2AEY A;  5I0U A;  3MW2 A;  2UU8 A;  2A6Y A;  4GMP 3;  3ACG A;  4KBB A;  5HPO A;  2HWC 3;  2VNG A;  3CMG A;  4ONU A;  1RUJ 2;  2WT2 A;  1FOD 2;  3C2U A;  1Y9M A;  1LNS A;  2V5Y A;  2W91 A;  4YLZ A;  2VZR A;  2ID4 A;  5A3M A;  2B9U A;  4GMP 1;  3ZDV A;  3H50 A;  2QUO A;  2HWC 1;  4XMA A;  4LO5 B;  3ZSJ A;  3D0J A;  2VZO A;  3S30 A;  3HEI A;  1JZ4 A;  4HKO A;  4XIL A;  3ZFG B;  3GYD A;  2Q8C A;  3JZV A;  2CHH A;  2PA7 A;  2HBT A;  4XW3 A;  3ZIX A;  3OUI A;  1AL0 G;  1SFY A;  2ZKN A;  4CPB D;  4LK7 A;  1DZR A;  2GAU A;  4OUL A;  3J7M A;  5FZH A;  3KB5 A;  1W6O A;  4FPF A;  3NJZ A;  1N3O A;  3UV9 A;  1RHI 3;  5F2W A;  3MIB A;  3WNK A;  1RUF 2;  2WDB A;  1PO1 2;  3RYP A;  4RS5 C;  3ZSE A;  2LRP A;  2BNM A;  3HN3 A;  1QXR A;  1RHI 1;  4F83 A;  3PVN A;  4M0H A;  1FV3 A;  2VMG A;  4AQS A;  4ES8 A;  1JYI A;  4DFS A;  2VZS A;  4JC1 A;  3UGG A;  1EUU A;  2BNN A;  1RVF 2;  1OQE A;  1W2A X;  2ZZQ A;  3O5S A;  4GMP 0;  4MGT A;  2EVX A;  3VHO A;  1VMF A;  2CSG A;  4NJ4 A;  4AF9 A;  1DU3 D;  2Q8D A;  1CPN A;  1BEV 2;  2KD7 A;  4LE3 A;  4CDU A;  4LO6 B;  3HOB A;  1RUC 2;  2C26 A;  3IN9 A;  4FPH A;  4Y1Y A;  5SV5 A;  2JX9 A;  1QXJ A;  2YBP A;  3H3L A;  5LK7 B;  4J25 A;  3BTY A;  1NCQ C;  2RJL A;  3FJS A;  4YW7 A;  3LZZ A;  5CIR A;  1OI6 A;  4OZX A;  3WG2 A;  3M70 A;  4CDX A;  5F8P A;  2JD9 A;  3J7L A;  4LTA A;  3KCX A;  4XHX A;  4B4Q A;  3SQO A;  1LHN A;  3AFK A;  1VBB 3;  3FLR A;  2ZJC A;  3GAL A;  5C9A A;  3I3E A;  2QCS B;  2VG9 A;  5EP9 A;  5JOY A;  2YHJ A;  5LAT A;  1A8M A;  4QGL A;  1MS4 A;  1VBB 1;  3JCI A;  3PUQ A;  1H2L A;  4FTS A;  4QGM A;  1NCR A;  3W5N A;  2Y6F A;  1GWK A;  4N43 A;  3PL0 A;  3R05 A;  1JS9 A;  1RJ7 A;  3I59 B;  1R1Z A;  4M3C E;  5A3U A;  1YC6 1;  2AYH A;  1WLC A;  3WNX A;  1GOF A;  1UZY A;  1WGP A;  5FP4 A;  4N9H A;  5GM0 A;  1MZ6 A;  4HVR A;  2Q1Z B;  1SCR A;  3ME2 A;  1WMF A;  1VBE 3;  4RGK A;  5FYB A;  2CY6 A;  3EB7 A;  1CAX B;  4I2O A;  3WD5 A;  4D7S A;  2DBN A;  2QQO A;  5FWE A;  4B1L A;  2ZGL A;  1VBE 1;  4O9E A;  4QXC A;  4CDQ C;  4MV2 A;  4J6G A;  4NHL A;  2FQP A;  1G86 A;  2VMH A;  2GP3 A;  5JZG A;  1LB2 A;  2ZCW A;  1O8S A;  1ZM1 A;  5FP9 A;  4PIZ A;  5FZK A;  2BEO A;  1Q5O A;  4Q29 A;  4ARY A;  3B02 A;  1JOD A;  1YQ6 A;  2JE9 A;  1O3Q A;  3B7M A;  5DQ0 A;  4IV1 C;  3KLS A;  4L8Q A;  1K5M B;  1S1A A;  3ZR5 A;  1LES A;  1BYH A;  2VOT A;  1GLH A;  5FZM A;  4D6Q A;  5A3O A;  5JPN B;  3ASI A;  3HQX A;  4EWA A;  3SIT A;  1X9P A;  2D6O X;  1GNY A;  4ES9 A;  4YVW C;  1RHI 2;  2WFF 3;  5FZD A;  4BOW A;  4ZPI A;  5FZA A;  4KG8 A;  3VL8 A;  4BWO A;  3HMY A;  2WFF 1;  4K20 A;  2VTX A;  3MI8 A;  5D8A B;  4Y22 B;  5C3R A;  4QQO A;  5FO7 B;  2WNU A;  2JDH A;  1UY0 A;  4COZ A;  2R7E B;  1GV9 A;  2CAV A;  3OD0 A;  1MQT A;  2BYV E;  4CDW A;  3I3Q A;  4UI9 L;  1R1A 2;  5IFP A;  4GH4 B;  1XBF A;  4AYU A;  4LBQ D;  4E2G A;  4NIH A;  3D82 A;  1FNZ A;  3URF A;  3N9P A;  1JYV A;  1ST8 A;  1CAU A;  5KHK A;  3ZXD A;  4AWD A;  4CSW A;  1W8T A;  1X36 A;  3TN9 3;  1W2U A;  3NMB A;  2QTW B;  4E2S A;  5L9B A;  2E33 A;  4ZZ5 A;  2PLV 3;  4ZZ8 A;  2EAL A;  4PDW A;  1H6Y A;  1VBB 2;  3TN9 1;  5J36 A;  5KXB A;  3WQ1 A;  4HN0 A;  1V00 A;  3IDB B;  1JHN A;  1O7F A;  2PLV 1;  4EN7 B;  5T55 A;  3WP6 A;  1NLR A;  2ERF A;  4JVA A;  4HK9 A;  2G9Z A;  1AR9 3;  1TMF 3;  3S7I A;  1SBE A;  4EYU A;  1NZC A;  2XLF A;  3D6E A;  5DZF A;  3OGS A;  2ORZ A;  1VRH 3;  2UYA A;  4XTM A;  4QQP A;  3VBS B;  5K8S A;  3FLT A;  3FHI B;  4RR3 B;  1UYX A;  1TMF 1;  1LOD A;  4MGY E;  2K0G A;  2NPI A;  1W90 A;  5A33 B;  2ARC A;  4AQT A;  3WNL A;  1VRH 1;  2NQY A;  3SIS A;  5DAB A;  2QQL A;  3KMH A;  4JKK A;  3WQB A;  2DVB A;  2W1U A;  1QH6 A;  1BKZ A;  1F9K A;  2VZU A;  2BU9 A;  1X7N A;  3E6B A;  3JBG 3;  2PHD A;  2K46 A;  3EYP A;  1R64 A;  3K4Z A;  4L0P A;  4WBB A;  4HKW A;  3ZFG A;  4CU6 A;  3UJQ A;  1YXW A;  5J48 A;  1VBE 2;  1XYO A;  4XUP A;  1CES A;  4YZ2 A;  2NN8 A;  3HNB M;  3FWE A;  3JBG 1;  1BCX A;  3PMS A;  1B35 C;  1GR3 A;  3LGR A;  4LMF A;  1YFY A;  2WO7 A;  1VR3 A;  2NMO A;  3WNO A;  1VBC 2;  3BTZ A;  1VB4 A;  4CYD A;  1JHJ A;  3OBA A;  2R0H A;  1QXP A;  4HG6 B;  1SBF A;  4B7E A;  5DUV A;  1FT9 A;  2JDP A;  3GXU A;  4CUG A;  4Z07 A;  4NMI A;  1WCD J;  5IVF A;  3U4X A;  1NA1 B;  1N1V A;  4LBQ A;  4CU8 A;  4P9W A;  2VL4 A;  3ZXL A;  4NII A;  2ENR A;  4P9I A;  2K9Z A;  4G4F A;  4UF0 B;  3T1M A;  1N1T A;  1H0B A;  2OZJ A;  1E5I A;  1HRI 3;  2TUN A;  2XQX A;  2X8K A;  5F5I A;  2R6Q A;  4JGY A;  3SEP A;  3BI3 A;  2XJP A;  3TRS B;  1HRI 1;  2WFF 2;  4AVA A;  2VZQ A;  5FZ0 A;  3HNY M;  5FMO S;  5FZ4 A;  2FDK A;  2E63 A;  5ANN A;  4F7Z A;  2JDN A;  1OF4 A;  4URA A;  2VXJ A;  3VBF B;  1W05 A;  1UY3 A;  5C3O A;  2XBO 3;  2P2K A;  3CJI C;  5I8T A;  1JZ3 A;  3BU0 A;  1EUT A;  2FDJ A;  3FZ3 A;  5LK5 A;  5FR3 A;  3ABZ A;  2XBO 1;  1NT0 A;  3EO6 A;  1SCS A;  3BTA A;  4OHW A;  1VMH A;  2P3K A;  3VKN A;  1UL9 A;  4LHK A;  3VDA A;  3WF1 A;  2A6X A;  1CN1 A;  1ZZ6 A;  3H7J A;  5C3P A;  3KVB A;  3AVS A;  1H1A A;  1CJD A;  3TN9 2;  1OFS A;  3MUZ 1;  4H55 A;  2WO3 A;  4QX2 A;  5FKB A;  4DY3 A;  4GWN A;  3PLQ A;  3BGA A;  5GZG A;  3KQ4 B;  4XDQ A;  1RUD 3;  4PI0 A;  1IS6 A;  3K75 B;  4DRR A;  5BNO C;  3NJY A;  2EXJ A;  5FV3 A;  2PTM A;  3D0S A;  4NVP A;  1CAX A;  3PTY A;  1RUD 1;  4AAX A;  1NQD A;  3ZXJ A;  4CEY B;  2PN5 A;  3WP3 A;  3O1T A;  1F4H A;  4YG6 A;  4XFB A;  1VRH 2;  4WVM B;  4IEU A;  2R0F A;  4IUG A;  1U5I A;  1RUH 3;  2FMD A;  1CVN A;  3AM2 A;  1WCK A;  1G9D A;  4KL1 A;  2JD4 A;  2R1D A;  4AED A;  2OT7 A;  3ITQ A;  3JXS A;  2YUE A;  3ELN A;  2ZPX A;  2DVD A;  3V0A A;  1H9W A;  2RS5 3;  4FPC A;  3PJQ A;  4QPG A;  3JBG 2;  5C33 A;  3AMM A;  1OA2 A;  2WL1 A;  4H14 A;  3N7J A;  5IK4 A;  1ZRD A;  4BQX A;  2EXH A;  2XJR A;  4AFD A;  3NVC A;  1K5M A;  2RS5 1;  1UU5 A;  3AMH A;  1W9S A;  2VUD A;  4XFI A;  1W28 A;  3DPR C;  2NM1 A;  2XJQ A;  2C6S A;  3K3O A;  1K45 A;  1QJU 2;  2O1Q A;  2HEW F;  5CBL A;  2Y6K A;  4LOS A;  4MOA A;  1TEI A;  1BVV A;  3O1S A;  4A42 A;  3K51 A;  5A6Z A;  5LRR A;  3ZX7 A;  2RS1 2;  3ZXK A;  1U5Y A;  4RSU A;  1RUG 1;  5FY4 A;  4Q4X 2;  4IGQ A;  3MIE A;  1HJG A;  4JGZ B;  1H8V A;  3PTR B;  5D8A A;  4Y22 A;  4EZ4 A;  1ZZB A;  1D0G A;  2R32 A;  4QX7 A;  2D97 A;  2ZGT A;  3WLU A;  2W08 A;  1KD7 A;  5C5T A;  4NHM A;  1HRI 2;  3U37 A;  4OVE A;  1ZBE 3;  5SV8 A;  2JKX A;  4CCL A;  1IGO A;  1WBL A;  5C4W B;  4N9I A;  2IWG B;  5F6K A;  2V5D A;  4N90 A;  5JLV A;  4CU9 A;  2C24 A;  4JCK A;  1ZBE 1;  3B3Q E;  3O0X A;  1WW5 A;  4XHB A;  1FYU A;  1GWM A;  3HT2 A;  2NLR A;  1Q8Q A;  3NNG A;  1UYZ A;  3WW2 A;  4YVS B;  4DUX A;  3O1P A;  4WM8 C;  2VCA A;  4WVW A;  4UBH A;  1RXF A;  4WM7 C;  4XET A;  4MG2 A;  1ENX A;  2VTX J;  4P08 A;  1HN1 A;  2XPJ A;  3BUC A;  2JEN A;  1W2N A;  2ET7 A;  1BK1 A;  5FYS A;  1ND3 B;  2W68 A;  4GUL A;  4ASL A;  1ND2 C;  4OI0 A;  3FFQ A;  2DVG A;  1K12 A;  4LHS A;  3O12 A;  4L97 A;  2VVD A;  4CEW C;  5JCT A;  1AJO A;  5T5O A;  4XJ8 A;  3O0W A;  4R9B A;  1JZ6 A;  3D5O A;  4F8A A;  4UW4 A;  4LO7 A;  5EYY A;  3N4M A;  4YWA A;  2ARA A;  3K77 A;  4FP2 A;  4CDU C;  3POI A;  1EPW A;  5FQ0 A;  5CKQ A;  4AGG A;  5FYM A;  4XDO A;  2QQU A;  4K40 A;  5FZO A;  3FUO A;  3RGB A;  1NE6 A;  3PUA A;  3BCW A;  3QD6 A;  4GAZ A;  1RUD 2;  3BOD A;  4TZD A;  1J3P A;  1PGW 1;  2Y6J A;  2PAK A;  4CDX C;  1S0J A;  2ZEW A;  1RUI 2;  2ZAB A;  3NNL A;  4BYY A;  1VB2 A;  1W8N A;  1UQX A;  3NWK A;  1GFF 2;  1FMD 1;  2MPF A;  1RMU 3;  2NYY A;  1J3Q A;  4QDS A;  2GH8 A;  1LHO A;  2VU9 A;  4IL7 A;  4LKS A;  1JYX A;  5J96 B;  1YEW A;  4HSJ A;  1NCR C;  3H1M A;  5EJZ B;  2D6P A;  1RMU 1;  4P14 A;  4K8F A;  2Q8O A;  1NA1 A;  3AJY A;  3WF3 A;  1AZD A;  2XML A;  3GCX A;  4K7J A;  1HB2 A;  2P17 A;  1C4R A;  5JXI A;  4FBF A;  4L2N A;  3ZN4 A;  5IAV A;  4QPY A;  4Y1V A;  4UF0 A;  5HCA A;  1VAL A;  1HN0 A;  3T4V A;  1UMI A;  2P3I A;  5C70 A;  3SHR A;  4AVV A;  2KXL A;  2DUP A;  2G9G A;  2HWB 3;  2Y26 A;  5DDJ 3;  5A3W A;  1OSG A;  2YU1 A;  5CU1 A;  3VD5 A;  3AMN A;  2Y64 A;  1IKP A;  1RUG 2;  1YFU A;  3W59 A;  2HWB 1;  3AC0 A;  1XRU A;  5DDJ 1;  4AXO A;  4FQZ A;  1AR6 2;  5GLT A;  3JU9 A;  4EN9 B;  1PGL 1;  3A23 A;  1SQ4 A;  2JDM A;  2EF6 A;  2PHF A;  2VOK A;  5KHH A;  1YLL A;  2X5I C;  1BBT 3;  2EXI A;  2AC1 A;  4FVV A;  3WF4 A;  2W3J A;  4EE2 A;  1UOJ A;  4CCC A;  3UT0 A;  2WS9 3;  2EAA A;  2ZGN A;  5LWB A;  3PUR A;  5ANQ A;  2D6M A;  3H8O A;  1RUE 2;  1BBT 1;  5FMB A;  2IXC A;  4E27 A;  3AJZ A;  2WS9 1;  4XYX A;  3SXW A;  3THC A;  1OPM A;  1DIW A;  1ZBE 2;  4GQ7 A;  4CDQ A;  2C0Z A;  2DUR A;  4Q4Y 3;  1AR8 3;  2TBV A;  1CR7 A;  3NST A;  3TOJ A;  4Q0S A;  1S0I A;  3OBT A;  3T0B A;  2VCB A;  4JV4 A;  4OHV A;  4Q4Y 1;  1AR8 1;  1XQN A;  2B45 X;  3S5Q A;  3I2G A;  4WVZ A;  1XB9 A;  2HWF 3;  3DL3 A;  5C71 A;  4KBZ A;  4HMZ A;  4IEZ A;  2ZGO A;  2ZKL A;  4HLT A;  5IYY A;  2OUH A;  2UY9 A;  5GLU A;  1UOB A;  4XFA A;  1YQC A;  2HWF 1;  3N9L A;  1MS0 A;  4A3X A;  5B4X A;  1X33 A;  4OI4 A;  1AYN 2;  1ASJ 2;  2WNU C;  3PIG A;  2GC0 A;  4ISR A;  4CEY A;  1IG0 A;  1AVB A;  1WBF A;  5J09 A;  1TE1 B;  4CDW C;  1PM7 A;  1RIT A;  5I0R A;  4FPG A;  4WVM A;  2ZBJ A;  5GJ6 A;  1W6N B;  1BJQ A;  3TNQ A;  2SBA A;  4GD4 A;  1PGW 2;  3HVD A;  1ENQ A;  1W03 A;  5I0S A;  2QBX A;  1YHF A;  4KI5 M;  4JZR A;  3ON7 A;  4KG0 A;  5FPV A;  1KS5 A;  2Q1F A;  1FMD 2;  1WW7 A;  3I4I A;  5FY5 A;  3ZM8 A;  1FV2 A;  4HVO A;  5LBF A;  5A7W B;  1NYW A;  1OOP C;  4AI1 A;  4UFM A;  1OMI A;  5H9P A;  1GQP A;  1ZZ7 A;  1MZF A;  1YI7 A;  1RMU 2;  2QNK A;  1W6M B;  2EAK A;  5A7S A;  2QDR A;  3N7L A;  5FK7 A;  5A80 A;  3AXD A;  5DUU A;  2O0O A;  2FDF A;  5LBC A;  1U0A A;  2DV9 A;  2I74 A;  5AVA A;  5FXX A;  1SLL A;  1XSQ A;  1CWP A;  1OA3 A;  1PZ8 A;  2GC2 A;  1AXK A;  2XJV A;  4WM7 B;  2CDO A;  3S57 A;  1GOG A;  4ZHN A;  2XWB B;  3RZL A;  1DYK A;  1OH3 A;  1E57 A;  4H7L A;  3WQ7 A;  5CG8 A;  4W50 A;  1Q8O A;  5FBJ A;  1GKB A;  4QXH A;  1QOO A;  1UKG A;  1VP6 A;  4IV3 C;  3ZFG C;  2HWB 2;  1W3X A;  5FZG A;  2Y38 A;  1IS4 A;  1PGL 2;  5FYV A;  5FOJ B;  4ET7 A;  3BVC A;  1CPM A;  1JH5 A;  1NKG A;  3OBZ A;  1XYN A;  4PQQ A;  1DYP A;  3ZFE B;  2VTF A;  2QJV A;  4UAP A;  3I2D A;  3VDC A;  4MXW A;  4D69 A;  1L7R A;  3MFC A;  1DG6 A;  5A6Y A;  1BBT 2;  5FY0 A;  2RDR A;  3CL1 A;  4ATE A;  3LDB A;  2BZD A;  1A6C A;  2D5H A;  1E5R A;  2WS9 2;  4GWI A;  4NPM A;  5IVV A;  3S0M A;  1RGS A;  3PVE A;  5I8Y A;  1AX2 A;  1B35 A;  4XZU G;  3DKW A;  1NOV A;  3NNJ A;  4JAA A;  2A75 A;  1ND3 A;  4IDZ A;  3CLP A;  1GAN A;  4KQ7 A;  1O3T A;  4I3P A;  4Q4Y 2;  1AR8 2;  1QJX 2;  4XIK A;  3WEZ A;  3MYX A;  4XAB A;  1HW5 A;  2E7Q A;  3CEW A;  3IPV B;  4W6W A;  4Y3O A;  3RYR A;  1RUJ 3;  1D7P M;  1SZB A;  4A4A A;  3FMG A;  4FOQ A;  4OHZ A;  5T5L A;  1RUJ 1;  4LPL A;  4CA9 A;  2XG3 A;  1CQ9 A;  1OC1 A;  3KWV A;  2W39 A;  2B42 B;  4J1W A;  5IVB A;  1OQD A;  4MX3 A;  1LCL A;  1ZYB A;  5D1I A;  1VAM A;  1XNT A;  1OLM A;  2VPV A;  5LEJ A;  1WLD A;  2ET1 A;  4LLF A;  4P5Y A;  2IZW A;  5IT6 A;  3GBG A;  1QJZ A;  5FPZ A;  3TAY A;  3H8X A;  2PHU A;  3LIH A;  4LR4 A;  3VHR A;  2YU2 A;  2E26 A;  2VR4 A;  1TQ5 A;  1O4Y A;  1W06 A;  2X5I B;  3WY6 A;  4B29 A;  4S2F A;  2DTW A;  4BQ3 A;  2EIB A;  5ISL A;  3CJI A;  1O3R A;  4UXA A;  4AVB A;  3TB0 A;  3ZYR A;  3W5M A;  1VJ2 A;  2BW8 A;  2OZ6 A;  1WZX A;  1OVS A;  1W8Z A;  3ZLI A;  1MR5 A;  2KA3 A;  1RVF 3;  5G05 L;  4CUA A;  4L11 A;  1OT5 A;  1VRB A;  1S0G A;  3U0Z A;  3IIA A;  1XNA A;  3E97 A;  1RVF 1;  4FOY A;  4NWV A;  2HEY F;  1XNB A;  2D98 A;  3AYD A;  2WWS A;  3RZZ A;  1A8D A;  3VBR C;  3M4F A;  3SKV A;  3KQR A;  4GWJ A;  4N8M A;  3RNS A;  3WNN A;  2J1S A;  2P6C A;  4K8R B;  3N9O A;  3J8F 3;  4MYE A;  5A7O A;  4FPO B;  4XZP A;  4COW A;  4G3Y C;  2AAC A;  3H42 B;  4YW3 A;  2WZP P;  5BNO A;  2GMP A;  3SLI A;  3UET A;  4DIN B;  2GNB A;  3NJX A;  4P9J A;  4O7X A;  4W6X A;  3J8F 1;  5J3U A;  4D7Y A;  4QPI B;  3QBQ A;  2BFU L;  4Q27 A;  2FMY A;  5LW9 A;  3WZ1 A;  5APA A;  1K5M C;  3UKN A;  4R4X A;  3I8T A;  1S0C A;  4RHV 3;  3V56 A;  3ZSM A;  3ZYJ B;  1WW6 A;  1NZI A;  5FO8 B;  4NOT A;  3C8X A;  1XE7 A;  4YG0 A;  4YFW A;  2DCY A;  3N3H A;  5FFO C;  2H0B A;  4MHR A;  2G1M A;  4RHV 1;  3GJB A;  5FLI A;  4XF0 A;  3LDR A;  2E7T A;  3ACI A;  3TEW A;  3I2O A;  4GB3 3;  3KT1 A;  4BU2 A;  2V73 A;  5HI0 A;  4QU1 A;  2YPD A;  3N7K A;  3DPR A;  1CAV B;  2DDU A;  1SMV A;  2GP5 A;  2TEP A;  4GB3 1;  3APB A;  2A73 B;  4CCO A;  5A3N A;  5KC5 A;  4HZF A;  3ZVX A;  4AFB A;  3DV8 A;  5IUQ A;  1LRH A;  1UIJ A;  3CO2 A;  4GH4 C;  2D5F A;  3TEX A;  1W6N A;  4A2U A;  5L7O B;  2VH9 A;  3RZG A;  1QDC A;  3VDD B;  3UGH A;  2IXH A;  5LA1 A;  3U07 A;  4Q0Q A;  2EXK A;  1UZW A;  2W52 A;  2ZAH A;  1TZO A;  2DCJ A;  2ZXQ A;  4GKY A;  1O5L A;  2VUC A;  2XJT A;  3I2I A;  1EPZ A;  2ETE A;  1VPH A;  3WP5 A;  1AHS A;  1OF3 A;  1V6O A;  4IV3 B;  4QB2 A;  3U1X A;  4YW4 A;  4M3C F;  5A7W A;  1QOS A;  5T5P A;  1GZT A;  1K42 A;  3MF9 A;  1PGS A;  2WNE A;  3OUJ A;  4YPJ A;  3FBY A;  4AFC A;  2YPJ A;  2RJ2 A;  4C91 A;  3VBU B;  2IFR A;  2XVG A;  3MLK A;  4WM8 A;  1J1L A;  3WQ0 A;  3VBS C;  2YC2 A;  1C57 A;  4RR3 C;  4WM7 A;  1PX3 A;  3POE A;  2LTN A;  4LBM A;  4X8N A;  5FZ8 A;  4XQ4 A;  3RYK A;  5J1X A;  5L9V A;  1N3Q A;  4KGQ A;  4Q0U A;  1ND2 A;  2ZEX A;  4M3C B;  4O9G A;  4CEW A;  5KXC A;  4QMA A;  1SBD A;  2BWC A;  1H30 A;  1R1A 3;  3T08 A;  5JAX A;  1W2T A;  5E1R A;  4LHN A;  5GAL A;  4DXZ A;  2CGN A;  4I02 A;  4CCJ A;  3NAP B;  2FZ1 A;  3C7G A;  1R1A 1;  3LFI A;  1V9U 3;  3OB8 A;  3NV1 A;  3B69 A;  5DAX A;  5E6H A;  5FAX A;  4FXG B;  3ZFE A;  4A6O A;  4CCM A;  5BNN B;  2PHR A;  1JYN A;  2CGP A;  3DYO A;  4LBL A;  5EHD A;  1FPN 3;  3J8F 2;  5EQU A;  5B2G B;  5CIS A;  1V9U 1;  3AK0 A;  1DQ5 A;  4H3W A;  1NA1 C;  4QQ2 A;  1RB8 G;  2B5H A;  2PXJ A;  3AKT A;  4LQR A;  3LEK A;  4PCR A;  3AYA A;  1JOP A;  1FPN 1;  3NW4 A;  3ZOI A;  2D3S A;  2OS2 A;  1UKR A;  4HBN A;  4E4S A;  1BK0 A;  1BVP 1;  2YXS A;  2Z2S B;  3W58 A;  1PMJ X;  2DCK A;  1SEF A;  1LU1 A;  2ZS6 B;  3ACL A;  5CFD B;  3CKH A;  3L9J T;  3GBF A;  4DOU A;  4RHV 2;  1BLZ A;  3AYE A;  4DXR A;  1TG7 A;  1Z0H A;  3GZA A;  1NXD 1;  3WNM A;  1OBN A;  4PBP A;  3BIE A;  1WME A;  3SC7 X;  3ES1 A;  2WLQ A;  3NQH A;  4LKF A;  4RYD A;  3ZKU A;  4EQV A;  1AX0 A;  4P02 B;  1QNY A;  3I97 A;  4GB3 2;  4A7Z A;  5FJH A;  4P9L A;  1DQ1 A;  3VBF C;  4Y20 A;  4V2V A;  4URT A;  1UW8 A;  4TLF A;  1W6Q B;  4I01 A;  1MZE A;  1QIQ A;  4Q0V A;  3EQE A;  2RS3 3;  4XC9 A;  3FC0 A;  5DG1 A;  2ZMN A;  2OYZ A;  2R07 2;  4CCK A;  2P3J A;  3LIG A;  1GZW B;  1TVG A;  1VBC 3;  4K9S A;  3VBR B;  1Z7S 3;  1UZ0 A;  5EWS A;  2XL9 A;  1XXN A;  3AX4 A;  2GAL A;  2RS3 1;  3MIF A;  4OYU A;  1DLC A;  3UJO A;  5JMC A;  5FY7 A;  2X5I A;  4CP0 A;  2VMI A;  2VOV A;  1VBC 1;  4RQP B;  1Z7S 1;  3KCC A;  5FYC A;  4XAA A;  4HL0 A;  3NV3 A;  3SKJ E;  4MGQ A;  5F3I A;  1H2N A;  2IXI A;  2WT1 A;  3JUU A;  4IE0 A;  1CAW A;  3WR0 A;  1G7Y A;  5FPL A;  2Q1M A;  5C6C A;  3AKS A;  3MLJ A;  4FFI A;  3R4S A;  4BLI A;  1POQ A;  4EWD A;  4FAG A;  2GNM A;  2WSU A;  5E88 A;  4YZ4 A;  2BGP A;  4FSJ A;  2WYF A;  3IDE A;  2D3R A;  2RG4 A;  4CEY C;  1CIW A;  5J7M A;  4Y1X A;  4DNY A;  5FY8 A;  4DEV A;  3MV1 1;  4PHZ A;  1RJ8 A;  1PNF A;  1DQ6 A;  2JKB A;  2WA4 A;  5A32 B;  3THD A;  4ZU7 A;  3MPP G;  4BDV B;  5JPM B;  5BNQ A;  3OBR A;  1HRV 3;  5DUX A;  1MAC A;  4XJA A;  4QAW A;  1ULE A;  2FDG A;  4HXC A;  1SLC A;  2CWM A; 
#chains in the Genus database with same CATH homology
 1HB3 A;  2VCM A;  1ODM A;  1QJF A;  1W28 A;  1W2O A;  2IVI B;  1OC1 A;  1UOF A;  1E5H A;  1HB1 A;  2BU9 A;  4BB3 A;  1HJG A;  2Y6F A;  4XAE A;  2WO7 A;  1W06 A;  1QJE A;  1WA6 X;  2VAU A;  1UOB A;  1HB4 A;  2VBP A;  1GP6 A;  4RGK A;  1W3V A;  1HJF A;  3ZOI A;  1UOG A;  2DBN A;  1E5I A;  1RXF A;  1BK0 A;  1W03 A;  2VBB A;  2JB4 A;  1W2N A;  3ON7 A;  1DCS A;  1BLZ A;  1IPS A;  1OBN A;  2IVJ A;  1W04 A;  3ZKU A;  3ZKY A;  1UNB A;  2VBD A;  1W05 A;  1E5S A;  5C3O A;  2DBI A;  5APA A;  1QIQ A;  1UO9 A;  5C3Q A;  1GP4 A;  5C3P A;  1RXG A;  5C3R A;  1ODN A;  1W3X A;  2BRT A;  2BJS A;  1HB2 A;  5C3S A;  2VE1 A;  1W9Y A;  3OOX A;  1GP5 A;  2JB8 A;  1E5R A;  1UZW A;  1W2A X;  2CSG A;  2Y60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...