3OOXA

Crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
307
structure length
305
Chain Sequence
TSAIDPVSFSLYAKDFTRFAQELGASFERYGFAVLSDYDLDQARIDAAVDSAKAFFALPVETKKQYAGVKGGARGYIPFGVETAKGADHYDLKEFWHMGRDLPPGHRFRAHMADNVWPAEIPAFKHDVSWLYNSLDGMGGKVLEAIATYLKLERDFFKPTVQDGNSVLRLLHYPPIPKDATRAGAHGDINTITLLLGAEEGGLEVLDRDGQWLPINPPPGCLVINIGDMLERLTNNVLPSTVHRVVNPPPERRGVPRYSTPFFLHFASDYEIKTLQNCVTAENPDRYPESITADEFLQQRLREIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative 2OG-Fe(II) oxygenase family protein
publication title Crystal structure of a putative 2OG-Fe(II) oxygenase family protein (CC_0200) from CAULOBACTER CRESCENTUS at 1.44 A resolution
rcsb
source organism Caulobacter crescentus cb15
molecule tags Oxidoreductase
total genus 91
structure length 305
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 3ooxA00
1E5IA 1W28A 1UOGA 1UO9A 1OBNA 1WA6X 1QJEA 1HJGA 1W06A 4XAEA 2CSGA 1GP6A 1W9YA 1W2OA 2BRTA 1BLZA 1ODNA 2Y6FA 1IPSA 1HB2A 1HB3A 2VBBA 1QIQA 1E5RA 1HB1A 4RGKA 1UOFA 2VBPA 1W3VA 5APAA 5C3QA 1RXFA 2DBIA 1W03A 2VE1A 1GP5A 2IVJA 1RXGA 1GP4A 1W2AX 3ZKYA 2BU9A 1W05A 3ZOIA 2IVIB 5C3PA 3ZKUA 3ON7A 3OOXA 1W2NA 2WO7A 1BK0A 2VAUA 1HJFA 5C3RA 1E5HA 1UOBA 2Y60A 1E5SA 1UZWA 5C3SA 5C3OA 2JB4A 1ODMA 1UNBA 1DCSA 2DBNA 2VBDA 1W04A 1QJFA 2JB8A 2VCMA 1W3XA 2BJSA 4BB3A 1HB4A 1OC1A
chains in the Genus database with same CATH superfamily
1OT5A 2QDNA 4XHXA 4Y5TA 3WVJA 4MXWA 1MS3A 5FYTA 4FTEA 1FT9A 1CVNA 3GDBA 2ZABA 2QZ2A 4K6BA 1G7YA 4IV1B 5DAPA 1UX7A 1O91A 5FZCA 4IE6A 3LOBA 2GAUA 2D44A 2LUWA 4YNIA 5H9PA 4EN9B 5JCTA 4BMBA 5J37A 2Z5WA 4Q1PA 1QEXA 1DDLA 2QQJA 1D4M1 2VZQA 4XURA 1G9AA 4EN7B 1NE6A 1QMJA 2VY0A 3VL9A 4Z92B 1AR91 4NUBA 4OLLA 1FPN2 3TN93 5FJHA 4OI2A 4GQ7A 2B9VA 2BERA 3IIIA 1MZ6A 2CHHA 1MS8A 1PZ9A 1XNAA 1RUH2 2EA7A 2WL1A 3JUUA 2W1UA 5CFDC 4WVMA 3NKGA 5F6LB 4HG6B 1MS0A 1ODNA 4LBMA 3OD0A 3UGHA 2PHRA 3PIJA 1MZFA 4AFMA 1H8TC 2VVFA 2VTXJ 1AR83 5JPMB 1HB3A 1K42A 2Q8OA 2VOXA 3N9PA 4YGCA 2PAMA 3TYJA 4YM2A 4ATFA 4KMQA 4QX5A 4QGMA 1CX4A 4Y20A 2MNGA 4UXAA 2D3RA 4WM7B 1WW4A 1WLTA 5A32A 4QPGB 4YFZA 3J7NA 2JKBA 2QCSB 5IUQA 5TSWA 2VVDA 4BQYA 3VDCA 2XUMA 4OHYA 2WZEA 2ZMNA 4E27A 4ZZ5A 4GB33 3WW1A 4AAPA 4A7YA 1LGNA 1TE1B 1LOFC 3AKPA 1QJY2 3LAGA 3N3HA 2AENA 3AYCA 1RUG3 5DN2A 2VMFA 1W2AX 4WVMB 1RVF3 1TG7A 5FMCA 3VDDC 3VD9A 4QXCA 4QB1A 5FBZA 3UETA 3E5QA 4DOUA 3V56A 4OQ8A 4LE3A 3H1WA 1XB9A 1AR63 1YCIA 4MGSA 1JODA 2P3IA 2RG4A 3AP5A 5D8AA 1VRH3 3B69A 3MF6A 4IEVA 4L99A 1VBA2 2FMYA 3E5UA 1JZ3A 2ZHKA 3FZ3A 1RTVA 3WP4A 3U37A 1S0EA 2RVAA 2CAUA 4IW3A 5A32B 4FFHA 3SEEA 3DV8A 3JB8A 1N1SA 3I3BA 3WZ1A 4K8FA 2D6OX 3O1UA 4BQWA 4R4XA 4XBQA 1FXZA 1C5HA 2HYXA 2VW1A 3POSA 1XYNA 2BUKA 1UOJA 4CU9A 2ZA9A 1UZWA 5LK7B 5FYBA 4ISRA 5I0TA 5SV8A 1TMF2 1ST8A 2QQIA 3GM8A 4MGKE 3B9CA 4CCLA 2DV9A 1DGRN 4E9KA 3D3AA 5C3OA 2XQXA 4GIQA 3JB4C 1HQNA 4AHZA 3W21A 3BN6A 4UBHA 4YRDA 4D6SA 4AGRA 4XCBA 1WGPA 1CIWA 5D8AB 5LRRA 5DZEA 2J42A 3FHAA 2P37A 3C7EA 1DZTA 5A6QA 4L92A 5FZLA 4XJ9A 4XFBA 3PUIA 2HEVF 4QGLA 1H2LA 3MUY1 1V6LA 4YW4A 5IJRA 2QVSB 3SH5A 1OPOA 2GSYA 1YXWA 2Y64A 1BYHA 3I2DA 1XE8A 2JDUA 3C2UA 3NSTA 4QDQA 5D1IA 2KR2A 4N43A 3JQWA 4WVZA 4B4QA 4RQPA 1F5JA 1AYN1 1WA6X 4UYBA 3PL0A 2D6MA 1H9PA 5I93A 4IV3C 1RUD2 1UY4A 3AZWA 3H8XA 3PNAA 4O61A 3SC7X 4DINB 2WINB 5FZAA 5CFCA 1VAKA 4KWKA 4NIHA 3E6CC 2R0HA 2PFWA 4QM8A 4GKYA 4XF3A 4N90A 4TLGA 5KHKA 4KI5M 4PF1A 3DKQA 3PDQA 1AXKA 1L7QA 2CWSA 4LEJA 4IEQA 1BLZA 1OOPA 1FNZA 4N43B 4MGYE 1X8EA 2W68A 2PN5A 2WLQA 5GKAC 4RQPB 2NPIA 3QBQA 4LHNA 1PX3A 2Q8DA 2PHLA 3WNXA 1LCLA 2Y6KA 2DYCA 3IM0A 3H3LA 3AX4A 3POFA 5C8CB 2RS13 4FPCA 1APNA 1XE0A 2DCYA 2XLGA 5CFCB 3NNLA 5DZFA 2R0FA 4BQ2A 5HBAA 3C7FA 3CZJA 3IMMA 4YM1A 3VZNA 5FUNA 4QX2A 1BK1A 1AR82 4YG6A 3RPQA 3TEWA 2G9FA 2IVJA 1AL21 1AYM1 1FMD1 2EXIA 1GP4A 3POJA 4IL7A 4MLOA 1OLQA 2FCVA 3ILFA 4BIFA 3S30A 4HBNA 3ACLA 3S0MA 3V65A 3WQ0A 1OOPB 1FNYA 4KBZA 1WKYA 2VMEA 2XVLA 4GWNA 1UN1A 5JZGA 1ZRCA 3AJYA 1J3RA 5FY9A 3EHKA 3SMHA 1NZIA 1RUJ3 1BBT1 1YFXA 1V6KA 3AFGA 4GAZA 3ZSKA 1S0BA 4GB32 1W2TA 3EQEA 3LEGA 2VNOA 2QDRA 5GZEA 2ZGTA 5L73A 5EIYB 4CDUA 1W2NA 1RVF2 1HN0A 2W94A 5I91A 2WNEA 3ZPOA 2YG0A 2VNVA 4L11A 5BNNA 4LTAA 4PBOA 1RUE3 5D21A 1PVXA 1GZCA 4RFT0 5EP9A 2AACA 2R041 4LBQA 5IK8A 1CGPA 4IGOA 1UOBA 5FPBA 2VULA 4E2GA 1ZBE2 2YBKA 3H50A 4HKOA 3VHRA 1B35C 2VR4A 5I8YA 2W91A 3THDA 2WT0A 2PQQA 1VBB3 4DXZA 1OUXA 4A44A 1W9FA 3HNBM 5JZGB 2B9UA 4QQPA 1VBC3 4XUNA 3VBHB 5BNPC 4IE5A 5L9VA 3KM5A 1DQ6A 3VZOA 5L9RA 2BNNA 1QJU1 5F32A 4NE9A 5L7OB 2RMU3 1H9WA 2W47A 2XJUA 1QJFA 5EQUA 5FAXA 4HSLA 4Y26A 1K5MB 1UIKA 4QGNA 4CDUB 5FOJB 4YG0A 1Y9GA 1Z7S1 2HH9A 4YVWB 4Q4V1 4QWNA 1BXHA 4LBQB 3NJXA 4AFAA 1MEC2 3HVDA 5A3MA 2AZ5A 5B4NA 1DQ4A 4PJYA 1DGWX 4JGZA 1BEV2 4K7JA 4AAXA 5CKNA 5ISLA 1MACA 2ZGMA 2ZGPA 1PO13 4HLTA 1HJGA 1NCRA 1UZZA 3QACA 3MBWA 4TZDA 4NIDA 4MX3A 4RSUA 1PZ7A 2AGSA 4Q0UA 2EF6A 2YMZA 4JZRA 4XDOA 1LR5A 2DCKA 2XQRA 1KDMA 4FOYA 4UFHA 3J7MA 3RS6A 1I6XA 4FPLA 2R1DA 1UXXX 2H0VA 3FHQA 3CHXA 3OY8A 1W8UA 1LHOA 1W9YA 2YUEA 4E4ZA 5DMYA 5E6HA 2VZ3A 1X8MA 1GZWA 2W46A 4DY3A 1T2XA 4HN0A 5FZ0A 1PO21 4JGZB 1HB2A 3C7OA 2EIBA 1QXJA 4LK6A 2RS31 3JQXA 3MUZ1 1ULDA 1NCRB 2ETEA 1D4VB 1LHWA 5C7GA 3AKQA 1UQXA 1LJ7A 3K46A 3USUA 4AI3A 4MGZE 3T0BA 1UY2A 3H3UA 2UYBA 3B3QE 4AXOA 3VD4A 3ZIXA 1HLCA 2EXJA 2DUQA 1POV1 3BPZA 3FLTA 3FUQA 2D7FA 4DMIA 2YXSA 2JICA 2CGOA 1HXS3 1YYNA 4M3CF 3GZAA 4PIZA 1RXGA 3X29B 2B7YA 1HRV1 1A3KA 2A6XA 4H3WA 1NA1A 3ZYRA 1ZM1A 2RS12 2XLAA 1GZWB 1WCUA 1SLBA 2DVBA 2PHDA 3M3CA 1KFUL 3KLSA 4Z82A 3AXEA 1ASJ3 3J8F1 4IEUA 2GC0A 5FKCA 3D0SA 3J7LA 2QQNA 2VECA 1OMIA 4CDWC 1LESA 4BQ3A 2DDUA 3PHMA 4IERA 1A8MA 2X10A 2IUWA 3DL3A 3DXUA 2OQ7A 2BPA2 4MG2A 5T52A 1PM7A 4DEVA 1EUTA 2OUHA 2ZEZA 2VNRA 3R6SA 3IPVA 3USUB 4AVCA 4ORFA 2YPJA 4D0QA 4FQ4A 5FO9B 5DXDA 3AYAA 5LCWL 4ET7A 2RDNA 2HWC3 2VQAA 1CZTA 4P14A 4DB5A 4N7UA 3THTA 1RUI1 1RUJ2 2AREA 2QQVA 1DZRA 3R05A 1S0GA 1LHNA 2GP5A 2KXLA 2A6VA 4LKEA 3AZVA 5K9YA 4XUQA 1SPPA 1TZOA 5FP4A 2HYKA 1GFF2 1NA1B 2JG8A 3ITQA 3WXPA 4NHMA 4KU8A 5A7SA 4GH4A 1AJOA 4HZFA 3N4MA 5LA2A 2R49A 4QX8A 3RMYA 2C9KA 1JZ2A 1YJLA 3FBMA 1XE7A 3V0AA 3DYPA 4KU7A 3IPVB 4ZY9A 4M4PA 2JDNA 1CPNA 1YEWA 3D6EA 3LEKA 3RNSA 5IVEA 3VBRC 3EJKA 2BJSA 2RS53 3HQRA 1VRBA 1WD3A 3MO4A 2WNVA 1RUOA 2VCCA 1VBC2 3NWKA 4D69A 1OBNA 4C91A 2HWB3 1DLCA 3QD6A 1TEIA 3WF0A 4A2UA 1O3TA 1PIV1 3NV1A 3J4UH 4N53C 5FY8A 1POV0 1SPPB 3KF5A 2JG8B 4NHXA 4CVUA 3IKWA 5C4WB 4LBJA 2RMU2 5JSOA 3WSOA 2JEMA 3B93A 5FTTC 4CDXB 4B7KA 2X09A 5DDJ1 3OBAA 4EQVA 1J1LA 5BPXA 4QQOA 3EYPA 3THPA 2C0ZA 2CNAA 5ABJA 3K3NA 5EYYA 3GXUA 3IAPA 5FZ1A 2W52A 2WUHA 2R073 3V0AB 1SFPA 1C8NA 1MS1A 2ZHMA 4MXVA 5IVVA 4Y33A 4XQDA 4HOOA 4BLIA 3HN3A 3ZFFC 5HV4A 3AL6A 2OPWA 5JOXA 1PNFA 1PO12 3CJIA 2BRTA 2OKXA 2WNVB 4YZ3A 2Q1MA 3BGAA 1YQ6A 3ZFEA 2W92A 2ZCWA 4CCEA 2ZX1A 4Y22B 2LW8A 3HMYA 1F9KA 4BHPA 2A1XA 3M1HA 3FL7A 3WQ1A 3WLUA 3HQXA 4YZ4A 4CCNA 5CB7A 3WF1A 5J96B 4LO6B 1LULA 2DF7A 2TUNA 5A3PA 2WRAA 2PLV1 5FZOA 5IVFA 2Y26A 4DFSA 5ABJB 1W8HA 5F3IA 2DTWA 1XOYA 3MI8A 5I8SA 3MZHA 2ARXA 3ES1A 5F5AA 4PCRA 3GCXA 3LDBA 3WCSA 4B29A 4PHZA 5DG1A 4FPEA 5FPUA 2TEPA 4C0BA 2HWE1 1YFYA 1VMJA 4FT8A 1CAXA 3ILRA 3LA2A 5IVYA 3ZKYA 2BU9A 3DN7A 1YC61 3ZFEB 5KXDA 2ZKNA 3A22A 3VZMA 5BUVA 3L2HA 2P1BA 1WA4A 2ES3A 2AUYA 1OSGA 1QJX3 1CONA 1GYKA 1W8NA 2OQ6A 5LEKA 4Q4Y3 1MVQA 1TQ5A 2XH6A 3FE5A 5FZOB 5ACA1 5F39A 5T5LA 1IQDC 5IAVA 1GUIA 2ZGLA 5CVRA 3ZPYA 1ASJ2 2WQ8A 1F5FA 2HWF3 3RJ2X 4YW1A 4YZ1A 2XJTA 1XNBA 3MDPA 3PU3A 3PVOA 3ZXGA 1E5SA 4YVSC 1ZVFA 2VO5A 1O8SA 3I2KA 4WM8C 5F2SA 1UWWA 1VR3A 1CAXB 2O14A 3BODA 2A7AA 4MADA 5FZ6A 1JZ5A 4E2SA 1O4ZA 1XU2A 1A78A 1SHWB 3KQ4B 5JI9A 5CG9A 2HWC2 4QAWA 4Z1VA 4XXPA 4ZXEA 1O3SA 3O1OA 3JCIA 5A33A 2MEV1 5JMCA 4CU7A 2VZTA 1H1MA 1BHGA 2IXIA 3PJQA 5EZWA 2XJSA 2VBDA 2ZGRA 1JOBA 1AYN2 4YW3A 4YM3A 3OEAA 3TNPB 4W8JA 3BU0A 2BFUS 1W3XA 1QQP1 2CU5A 3HJRA 1N1YA 4XZPA 1OC1A 1RB8G 5DQ0A 2WIIB 1PK6A 1YRZA 1AF9A 4NO4A 5JUVA 1W28A 4NPLA 1RITA 3ETQA 1UF2C 4QKNA 3RZMA 4JCKA 1RIRA 5A1AA 1OKQA 3CNAA 4LLFA 3U07A 5DPNA 5G05L 1CR7A 1MQTC 3OSDA 1QWRA 1CZVA 1RUF1 3K4AA 2VQ0A 3U14A 3FLRA 2RS33 1SLLA 4CPBA 3E6BA 4M0NA 2EXHA 5F9TA 4NIIA 2FQPA 5LK5A 4P9JA 4S2FA 4WVVA 5A33B 2ET7A 2VCBA 1PGW1 1W2UA 4R4ZA 4JQTA 4X8PA 5JXGA 4XETA 1ND3A 3D82A 4Y24A 4RS5A 1GP6A 2CGNA 3WQBA 4CP1A 1DZQA 3LFMA 4CYDA 1ULGA 1EP0A 2PTMA 1W0PA 3VKLA 2UU8A 2HWD1 4OFGA 4W6WA 3VD5A 3MIFA 1CN1A 1WLCA 5FRAA 1PK6B 3KWVA 3NNJA 3WNKA 3GYDA 5E1RA 3UGFA 4FO9A 4RHV3 1V70A 2QJVA 4FCAA 2R072 5I0DA 1JOJA 3MIBA 3LD8A 4JGYC 2JE9A 3ES4A 2WNOA 3MHZA 2G9GA 1J1TA 1JOPA 2O8QA 3M3QA 4P9WA 1RHI1 5CEHA 3VDBA 3OB8A 1DYKA 3O12A 1W6MA 4HL0A 4AWDA 1OXCA 2VBPA 4CEYC 4S2HA 2DURA 2JDHA 4YSFA 3KHBA 2V72A 3WF4A 1XSQA 1NCQA 2YC0A 2FZ1A 1ND3B 4CSWA 4RS5B 1UU5A 2Y0IA 3WG4A 4N9IA 1BBT2 1Z0HA 2JG9C 2YFZA 4HPKA 2A3XA 2OYZA 4ZHNA 1GICA 5LY1A 2FDKA 3RSJA 3VV1A 1D7PM 3WUCA 2Y34A 2R16A 3I8TA 1HW5A 3ZXDA 3KSCA 3OD4A 1WMEA 3KV4A 2IVIB 2R042 2K9ZA 4QXBA 3LDKA 1CAVA 3ZKUA 5BNOA 3HBZA 3R0RA 4EN6B 4R9CA 1HV0A 5JOYA 2FDHA 4YARA 2V09A 4ZU4A 1KDKA 1L7LA 3W5NA 2E31A 2PQSA 5LB6A 3MIHA 2GMMA 3MLLA 5GALA 1BCXA 2I2SA 4KQ7A 2R32A 4R9DA 5IVJA 3ZXLA 3O0XA 4Q0VA 3SHRA 1KRIA 3N36A 1QJX2 1QHDA 1VBA3 1WW6A 2BNOA 3D0JA 3JD71 4O65A 2P3KA 2VD7A 2WDBA 4HPKB 2W08A 3M2MA 4OHVA 2DCTA 4Q4Y2 4XFHA 2ZMKA 5C8WA 1EAH3 2Y33A 3ZYIB 5FQ0B 2JIJA 2ORZA 4XBLA 3T30A 1KS4A 1XXNA 4J1WA 1GANA 4F83A 5HPOA 3I3MA 4AEDA 3CLPA 2HWF2 3RZLA 1JUIA 4Q4V2 4OUEA 5K0UA 4B3NA 1CAVB 3POIA 5BNOB 4EJRA 2VTFA 1R1ZA 2R061 3FBYA 3VZJA 2JIGA 5A70A 5JOZA 1LU2A 4BPZA 2H6CA 4W50A 3TEZA 2WSUA 2VQTA 1MS4A 4G4FA 4DRRA 1D0GA 5DAQA 1HB4A 4YWAA 2E33A 3DEMA 4GWMA 3KCYA 4QX3A 1K12A 3RZKA 4CUAA 3AZXA 1W0OA 3NL1A 2GNMA 2ZPXA 3HOBA 5F2WA 1SLAA 1JI6A 3I3DA 2VZSA 1NT0A 3EXUA 2J1AA 4QPIC 4YW6A 1IOAA 4A41A 1RINA 1EYBA 4URTA 4HKWA 3WCRA 4AEDB 1C8M1 2PLV3 4J1XA 3C7GA 5K0UB 3EMRA 4P08A 1ENSA 4RYDA 1RYYA 3ZFGA 2JECA 4Q0PA 3MV11 1O3RA 1L7RA 2LRPA 2FHRA 3RZZA 4EN0A 3RYKA 4GD4A 2UWBA 5EJZB 3VN4A 5F7UA 2QNKA 1W6PA 1F4AA 4FPHA 4LITA 1W2OA 2GMEA 2OA2A 1DLLA 4R9BA 4RGAA 2RS32 2WT2A 1YWKA 4XUPA 4GWJA 2HWE3 1H8TA 5FWJA 1DBNA 1R1A1 5L19A 3AKRA 2Q1FA 3EBRA 3DPRB 4XHBA 5FP9A 1PNGA 3BVCA 4FQZA 3LWCA 3I54A 3VKNA 5JXIA 4Q29A 1OH4A 5JIAA 1RUC3 2RDQA 2RM21 4FFGA 3W9AA 4FAGA 4YZ5A 4PDWC 3FFZA 4BDVB 1HRV2 4RR3A 1UOFA 2Z79A 4RHV2 1Q8VA 4DIQA 2ZAAA 3NJYA 4NRPA 3ZFGB 4LBNA 4XF1A 1LOFA 3J8F2 5IHRA 2FDGA 1AX0A 1R091 3M3IA 3MEPA 2VUAA 3VDDA 1ZZ8A 3M7AA 4FP3A 1UIJA 3M3OA 3OBRA 5LA0A 1RJ7A 1CAWA 4EZHA 3PUQA 3WX5A 4CEWA 4MXWB 1ULEA 4IV1C 5AVAA 2ZKLA 3FC0A 5L36A 1QH7A 4OHXA 2ZAHA 4DY5A 1PGL2 1UYZA 3ON7A 3ELNA 4FPGA 1JN2P 2X8KA 3EO6A 4ES9A 3I2FA 4BLJA 5J36A 3AM2A 4LO5B 1IKQA 4RR3B 2HBUA 2O1QA 3WDVA 4JX0A 4K40A 1O5LA 2ZGOA 2V5DA 4AVBA 4EZ4A 3HQUA 5C3RA 2CL2A 5GLUA 1E57A 3H0OA 2Q1ZB 3N9QA 2WKKA 1Q8QA 3CJXA 3BTAA 1XBFA 1X36A 2ZJCA 4BK5A 1R083 4C1XA 1VBD1 4MYEA 1JXNA 1CAWB 3JXSA 4LQRA 5IW0A 3ZSMA 2ERFA 2Y8KA 4CCKA 4CEWB 3GF6A 3OJBA 2VMDA 4AQTA 1VPHA 1QXRA 1IGOA 4P5YA 3DUIA 4BQXA 4BIOA 4XMAA 1M06G 4DEQA 5FXVA 1UL9A 2AR6A 1ZBE3 4OMDA 2D98A 3RZHA 4EROA 5FMOS 2UURA 4FAHA 2XONA 4Q0SA 3HWJA 4WM7C 1UY0A 4Y20B 4QPGC 1EAH2 1PIV2 4AOCA 5L9BA 1WMFA 2YGLA 4LULA 1H4GA 2E7TA 1W0NA 1C3HA 1E5IA 2LM3A 5F3EA 5LBEA 4A7KA 1UMIA 2HWD3 5DDJ2 4OULA 2VJXA 4CCCA 3AZYA 2ZEWA 3MIDA 3CZUA 1O59A 4QX0A 4WZCA 4JHZA 1N3PA 2AEYA 2FMDA 2WZR1 3NV4A 3OYWA 3T2PA 2Y38A 4XF4A 1HRI1 1B09A 5FZKA 2IFWA 3S5AA 3DCQA 5GZDA 4XFAA 4FSJA 5F6KA 1V9U1 1MEC3 3K4ZA 3MPPG 5KXEA 1FOD1 1H6XA 3BOPA 4NHLA 5KXBA 5G04L 5CYYA 3CU7A 1BEV3 4XOGA 4HXCA 2C9AA 3VKMA 2RDRA 3POYA 4Q4W1 3TEXA 2BWAA 1QOTA 4E4HA 2AC1A 3QH6A 3HEIA 4QQLA 5LA1A 2RR11 2QFEA 1GOGA 5A6ZA 3WNLA 4XF0A 1ND2C 2PLV2 4I3PA 4D7TA 3C8XA 3SNMA 4LBOA 1COV3 2XBO3 5FZHA 4CCMA 4LIUA 4TSVA 3BIWE 3BPSA 1CWPA 4FBFA 3B5LB 4LHKA 5FZDA 3BI3A 1MR5A 5GZCA 3VDAA 3WD5A 3K75B 4HVOA 4XW3A 5D8AC 5FYZA 1Q8OA 5GLWA 2OVUA 5A7QA 2HWE2 1JHJA 1ZBA1 3H7YA 3H42B 4GKXA 5ANNA 4ITCA 2BZDA 3IIAA 3WF2A 4ASKA 3ZXAC 1ZZCA 4XIKA 3Q8EA 3VL8A 1AL0G 3AJZA 4BYYA 5C33A 1DQ5A 3INAA 5LBFA 3I2OA 2HKXA 3VLBB 1GSLA 4NIGA 1RUC2 5DAWA 2VH9A 2VM9A 5FOBB 4Y1VA 3NV2A 4HFSA 5CG8A 2N7GA 1S2EA 4FPOB 5ACA2 4CCDA 2W1QA 4IE7A 3FN9A 4LHLA 1OFNA 1DFQA 1Y9MA 4L2NA 1W8WA 3WHTA 3LPFA 1US3A 1WLWA 1S55A 1LOBA 1MS5A 3LPGA 2L9LA 2ADEA 5LY2A 5FXZA 2VOTA 5T5PA 4MVTA 3ZMOA 1CESA 1S2KA 4MGTA 2SLIA 5JPNB 4J6GA 2BV4A 3H1MA 3N7JA 4LO4B 1D2SA 4H7LA 5FZEA 1IS5A 1B35A 3WG1A 4XJWA 2VZOA 4G9SB 2XG3A 3J26N 2XHNA 4QDRA 1XNCA 3V64A 2BQPA 3UK9A 2Y60A 4N43C 1JYVA 1V6IA 3LA7A 2MEV2 4K8RB 1GZ9A 4RQPC 4CDQA 2E9QA 3LZZA 1UZVA 3WNMA 1DQ0A 3AL5A 3PUHA 4PIXA 3K77A 4AHWA 1QQP2 3N7LA 4HONA 2CGPA 3POEA 3L9JT 5C8CC 5A6YA 1AR71 3K3OA 5IAXA 1R082 2WNUA 2ZOEB 3PJYA 4GMP1 4O9EA 3KV9A 2WZ8A 5FZ3A 5CFCC 5A1FA 2WFF3 4QHOA 2YB7A 2A5ZA 5AC91 1Y7BA 2DUPA 4IESA 1NUKA 1W9SA 2C6SA 2XVGA 3FFQA 2C26A 3HD8B 2YY1A 2EIDA 1DGLA 2QQLA 1LAJA 1QOOA 1OOPC 5LBCA 1QF3A 1SG3A 4D7SA 4UWDA 2NM1A 3A23A 4RA0A 3WG3A 3P5BA 4CDQB 2BGCA 5FY7A 5JR2A 1UXZA 2WA3A 4NOTA 4JTNA 1PMIA 3CO2A 3THCA 1ZA7A 3E97A 2HWD2 1D4M3 1N3QA 4XBNA 3WR0A 2EICA 2VZPA 3LQCA 2WNUB 1ALYA 4PT6A 1GKBA 1VJ2A 3AVSA 1AR93 5IFPA 2WQ4A 3BIEA 5BNNB 5CISA 3KS7A 3ZYBA 1GZTA 1RHI2 3P1IA 4K3UA 2GC1A 3B7MA 3NQHA 3WV6A 4INDA 3H8OA 1IPSA 1G9CA 4AI0A 1XQNA 3Q9OA 2WA4A 1S0IA 1UYXA 2YGMA 4WVWA 3J9SA 4JVAA 4DS0A 3AKTA 1UZ0A 5JZGC 3RYPA 3VBHC 4AQSA 1N3OA 1KJRA 1H2MA 4E4SA 4CZSA 2PELA 4C8DA 5L7OC 5A3OA 1OVPA 1COV2 1YLLA 1OI6A 2EALA 2XBO2 2ZHLA 4O7XA 4BK4A 1K5MC 1W9WA 2VW2A 1W03A 5LASA 2VE1A 1U5IA 3OPWA 3RI8A 4YVWC 1TNRA 1OF3A 5FPZA 1DYOA 4Y4YA 1FATA 2WT1A 3T1LA 5F1RA 4AFDA 3NVCA 3R4UA 3MW2A 3MW3A 2JENA 4GMP0 1TME1 2V5YA 4AHYA 5KHJA 3TB0A 2BGOA 1AUYA 1VBD3 1YNAA 2TNFA 5JI7A 3VGIA 4CDWA 4FFFA 4AYUA 1CAUA 4HVRA 3ATGA 5FP7A 2XPJA 5LW9A 1UZYA 1WMXA 2A3YA 3ACGA 3RYRA 2W87A 3IMNA 4O9GA 1PMHX 2Y0OA 5FP3A 1I1EA 4LOSA 3NAPA 4IEXA 4C90A 2WO7A 3AFKA 4PI2A 3POWA 2CY6A 5I0RA 4AI8A 1ENXA 1KS5A 2WO2A 3OY8B 3S7EA 3WUDA 4KG8A 5BNQA 1ENRA 4XFIA 1Q8SA 1S0FA 1QH6A 4AG4A 5IWFA 1OA3A 3RMXA 2F6BA 2RDSA 5BY5A 1I9RA 3W5MA 3FWEA 4JGZC 2XWJB 4UFIA 4CDWB 2E53A 3IWZA 4JQRA 4W6XA 1CAUB 1HRI3 2YROA 4B7EA 1WUVA 2IXHA 1LOAA 4UW6A 1KXGA 2MHFA 2D93A 1NCRC 3ILNA 5FO7B 1IHMA 1U5ZA 4XFCA 3CBNA 4JRAA 2YZ4A 1SLTA 1RMU1 2B8MA 3VBRA 4BB3A 2UYAA 4DUVA 5C9AA 1KQRA 3NAPB 4XFFA 4I0AA 3RJRA 4TLFA 1SMVA 2VXRA 3U10A 2DVGA 1WWYA 2W5FA 3AP9A 1LOCA 5FY0A 2BOJA 1EPZA 4D94A 2DTYA 4OI0A 1FPN1 2CV6A 1C8M2 3ZR5A 5T3NA 2LS6A 1W8FA 3ME2A 3WP6A 4AQ6A 2QUOA 1AYN3 2D3PA 2YBSA 3IB3A 2ZGUA 4A42A 1GWLA 1JW6A 4Q5OA 1PM4A 2ID4A 3HAGA 2WFF2 4UOJA 3Q8CA 1ONAA 3DGTA 1XYPA 3BB6A 2J1UA 2CSGA 5JIUA 1ULPA 3NJZA 3ZFFA 2FDIA 3HPNA 1Q3EA 4ZZ8A 2BW8A 5A3UA 5CZKA 5C9AB 4CE8A 3MFAA 2PHUA 4RN5A 4Q27A 4LE4A 3ZYPA 3K48A 3WHUA 1W90A 2JDAA 1JH5A 3C7HA 3O1SA 2V73A 2W2IA 3PUAA 2NMOA 4A45A 4FP2A 1D4M2 1UY3A 2Y6FA 3PTYA 1NA1C 2ZGNA 3MIEA 1QGLA 4LIVA 5FFOC 2ZZJA 1UW8A 1W6QA 1YIFA 4E8DA 1GQPA 5JVVA 1Y9QA 2Z42A 1IZ3A 1QJY1 1AR92 3AZZA 3VB9A 5FYMA 3QCWA 1J58A 2LALA 4GH4B 3MF9A 3ZN6A 1R092 4EV0A 3O1VA 5CAZA 1FV3A 5FV3A 4KGQA 1VAMA 4PBPA 3CF6E 3Q8AA 3VBOC 4PLMA 5CA6A 1N1TA 3JBG1 2D5HA 3LEIA 5DZGA 3ZXEA 4B1MA 5CADA 4QU2A 3U1XA 1G9BA 2DFCA 2R7EB 1G86A 4XXAA 5H9SA 1GOFA 1OLMA 5JXHA 2QBXA 5KWRA 1AL23 1AYM3 1J3QA 1FMD3 1H30A 4FXKB 4XDPA 2ET1A 2E26A 1IPKA 2A6ZA 1KEXA 2QQPA 5KXCA 1LOGA 2YHJA 1DQ2A 1GOHA 1UYYA 2RV9A 4M3CA 2JG8C 3ZYFA 1JS9A 5C4WC 3T2TA 1YQ2A 4DXSA 3ZYGA 1W6QB 2QQOA 3AYDA 2WS91 1W05A 1OH3A 3OUJA 4IGQA 3RI9A 4FOVA 3T2QA 4CDXC 3ZSLA 5C3PA 1OQ1A 1BBT3 2P6CA 4QX7A 1SFYA 1TMF1 2W1SA 1OQEA 4FOQA 2CTVA 4LXLA 4Y5SA 2ZZQA 2YFUA 4NRQA 3KVAA 2XXZA 3LCPA 4BISA 5CKMA 3VBSA 1DGWA 2WN3A 1BK0A 4JKLA 4EN8B 1VBD2 4PLOA 4UI9L 5J48A 3U75A 1HJFA 2A6YA 2GC3A 3HN1A 3Q8BA 4QU1A 2R043 1WCKA 4WM8A 3VBFA 2WNVC 1SACA 3W59A 1UU6A 3ECQA 1VMHA 2CAVA 2ZACA 3CJIB 3FHIB 3UV9A 1UYPA 1R64A 3LE0A 4NAMA 4XJ8A 3WDTA 4OUMA 5GLVA 2JB4A 2BVBA 2PHFA 2BBAA 2G19A 1GQGA 5EPAA 3O1PA 1DCSA 3HT2A 3PLQA 4NPRA 4OVEA 4Q4X1 4NJ4A 1WBFA 4YGDA 2X05A 5J7MA 4OHZA 4P9YA 3A21A 1HKDA 4HK8A 5ABJC 4FXGB 1FYUA 1RUD1 1FV2A 1QJU3 4QM9A 5ANQA 5JXJA 2YYOA 4CCOA 3VBSB 3VUOA 4P00B 3TAYA 2WZR2 1PHMA 3VKFC 4U36A 5IK7A 1POQA 1NLSA 2YU1A 5A3WA 1CIYA 1HRI2 3VBUC 3FX3A 1OKOA 1Z7S3 4XIOA 3ZYJB 1S0JA 1UO9A 1MS9A 1S0DA 2ORXA 2XVKA 1V9U2 4Q4V3 3KMHA 4TN7A 2ZTNA 2JDZA 4R8HA 5LBBA 3VBFB 1AZDA 1JZ6A 2DCZA 3GZTB 4C1WA 3K51A 1CPMA 1NLQA 2I74A 2PAKA 4GJYA 3ZFEC 2X5IA 1XSRA 2WO3A 5EJ3A 4P9IA 4AGGA 3R4SA 1CX1A 2CWMA 1UKRA 3PMEA 3H8UA 3ZN5A 1NQJA 2JKXA 4META 3GZEA 3TN91 2A73B 5A80A 2PHWA 1JBCA 1G8WA 1U0AA 4JKKA 3LDRA 3SISA 2BNMA 3OUHA 4LORA 4Y3OA 1SEFA 2Q8EA 2VNGA 1SZBA 5IYYA 5JMOA 4XUOA 4TWTA 1URXA 2NQYA 1K3IA 2XMLA 4BOWA 1GMMA 1NY71 4HN1A 2XR4A 1AR81 2GDFA 3WP5A 3GZUC 4QKBA 4ARXA 1DG6A 1PO23 2P5BA 4EWEA 2X5IB 2RHPA 3UKVA 5BV6A 4WBBA 1QIQA 4OHWA 4CEYA 3HR9A 5GZGA 5T5OA 2VMCA 5A7PA 4I30A 1H1AA 4GB31 4J25A 5C71A 3B02A 1POV3 2ZX2A 4UFKA 5DAVA 1N47A 4BE3A 1RUG1 2C1FA 1L3JA 1W39A 4K9SA 5EV7A 5LEJA 1RVF1 2BGPA 4AI9A 3CL1A 2C4XA 4L8QA 1HRV3 3KT1A 4AW7A 3CKHA 1VP6A 5A7NA 1SBEA 3KV6A 2XB6C 2ZGSA 2NLRA 1AR61 4CU8A 4PLNA 3BKZA 1WCDJ 1V6NA 2W1WA 3J8F3 4QDSA 1VRH1 4UW5A 2W3JA 3URFA 4LA3A 3JU9A 4LO8A 2GN7A 4PIYA 2VMHA 1BQPA 4S2DA 2WWUA 4CEYB 1AL22 1AYM2 1FMD2 1CJPA 3A4UA 5IFTA 1W6OA 3M70A 1D2QA 3A7QA 4H55A 1LB2A 3GBWA 4MO3M 1DF0A 2IXJA 5FZ4A 4JDMA 4G3YC 3SITA 2GNBA 3MPBA 5C6CA 3KF3A 5HXVA 4XQ4A 3LIHA 1NAEA 5FYUA 3WDXA 4CXWA 1RUI3 1V0AA 1PK6C 3ZLIA 1QNWA 4BZ4A 5FO8B 1AR72 2PMWB 1AXZA 1CZSA 3N9OA 5E16A 4UW4A 4XF9A 1ODMA 2JJ6A 1LEDA 3GALA 3H1YA 4GALA 2D40A 2VMIA 2WJSA 1BJQA 1QXPA 3OGRA 4AFCA 5LZ6A 4XQWA 1C4RA 2DBNA 2LROA 3OGSA 3H3ZA 4NPMA 5FYHA 2CDPA 2DVAA 1A8DA 2D6NA 2DVFA 1W6MB 1W6OB 2JB8A 1AX1A 1UU4A 3G6JB 4FPFA 4AEMA 2NN8A 1XRUA 1VAVA 2J7MA 2Q8CA 5A3NA 1LTEA 1ND3C 4LUKA 2IZWA 4RS5C 1OA2A 1NCQB 1UOGA 2OT7A 5CBLA 2FZ2A 2Y6LA 2A3WA 2W39A 5J3UA 4AF9A 3TNQA 4ZONA 1W8OA 4AQ2A 1TVGA 3AK0A 5AVPA 2IFRA 1PIV3 1QJU2 4CU6A 5KC5A 4FTBA 2WWSA 5GZFA 1JYXA 2OIIA 5FMDA 5FZ8A 4K20A 4QQ2A 2XOMA 4N7IA 3SKVA 1Z7S2 2PYTA 1SLCA 4FTSA 3OCPA 5DDJ3 3UT0A 1W06A 4XAEA 2Q0AA 2ZMLA 1YJKA 2VTXA 3O1TA 3HT1A 2Y6GA 1YHFA 2Z69A 3UKNA 1HX6A 3KT4A 4XABA 4XUTA 5CIRA 1NQDA 4D7YA 2ILMA 3AMMA 4YW2A 3IZOA 3ZR6A 1Q56A 2OXBA 4PQQA 4V2VA 1RUNA 5LWBA 1GU3A 5HCHA 2GC2A 1U5YA 2ATFA 3C3VA 3OTFA 5B4XA 1DIWA 3I7DA 2GNTA 2VZUA 4B4PA 3N9MA 1YQ8A 5GLZA 1LNSA 3WY6A 3ZM8A 2AEZA 4XCAA 3MLKA 2FDJA 3RGBA 2RS11 2NYYA 2X53S 4AEKA 3BTXA 2PHXA 1HB1A 3VHOA 3IT8A 3F2ZA 4PQ9A 3VZKA 3D8CA 3I2JA 4Y4RA 3UJOA 5BNOC 2WFPA 1W3VA 5ERLA 4Z2AA 2IC1A 2PA7A 2UY8A 2A71A 1A6CA 3B01A 1PO22 5CFDA 2JE7A 1FX5A 4AVTA 2C24A 1G9DA 4AGVA 3AMNA 4IV1A 5FZ7A 4NAOA 1O7FA 3KQRA 3ACHA 4LKFA 1UX6A 1RUJ1 5KR7A 2G9ZA 1JYWA 4ZU5A 3OGGA 2VUDA 4FFIA 3USSA 4XEZA 2HJIA 3LKJA 4AEDC 3T3YA 1SQ4A 1W8ZA 5K0UC 3OOXA 1JMUB 4FPKA 1C5IA 1JHNA 1RUE1 2B4KA 3FUOA 4JKMA 1HQLA 5FZBA 2R6QA 3E5XA 4QHZA 2VAUA 1MVEA 1OVSA 1S1AA 3T4VA 1FAYA 1DGRA 5BYNA 4L0PA 3ACIA 5JLVA 5IVCA 1E5HA 4IDZA 5CFDB 4KWJA 2DVDA 1N1VA 1ZRIA 1W6PB 2A6WA 2VCAA 4AI2A 1F2NA 2YV8A 3B94A 2DU1A 4LA2A 4QB2A 1ZREA 5C3SA 1VBB1 3KZ4C 4B1LA 1H8TB 1RMU2 2JDKA 1VBC1 2B46X 3DPRC 1EUUA 4OI1A 4P9XA 2ZEXA 1NX9A 1F31A 5FLHA 4GJZA 4WM7A 2K2SA 4IQPA 4QPGA 4HMZA 1RUI2 1TNFA 2RMU1 4M01A 2MEV3 3BALA 3KB5A 1A34A 3ZFGC 1WCQA 2WQZC 1QJZA 5EJ1B 4ZXKA 1OFSA 3UGGA 3SCGA 1QQP3 2VUCA 2WR9A 2G1MA 4LBQD 1GV9A 3DF0A 4FOWA 3VDDB 1IPJA 4F8AA 4D6QA 2EAKA 4Q1RA 5HV0A 4NWVA 2JDYA 5FZGA 3TRSB 5KHIA 1PO11 5FUPA 5J1XA 1IQAA 1EV11 4F7ZA 2LTNA 4Y1UA 1JYIA 1WBLA 3AYEA 3CIHA 5FYIA 2KD7A 4MSVA 1RUF3 1LHVA 1K5JA 2BTVC 4I09A 3AMQA 4K21A 3NNFA 4KL1A 4XDQA 4BH9A 4OYUA 4XTPA 2ARCA 4RR3C 1X9TA 2VGDA 3LSDA 3OF1A 2GH8A 3O7OA 4AE2A 2DFBA 2E7AA 2BOIA 3BYWA 3AP6A 1F35A 4QT6A 5F5CA 5JDBA 1ND2A 4D8MA 5IVBA 1UPSA 1VLNA 1XPWA 4NRMA 1VMFA 2B42B 4MGQA 3S5QA 3T0DA 1I3HA 1J3PA 2K46A 3SH3A 5FIXA 4IV3A 3U4SA 4IEOA 1HN1A 1VE0A 5F5IA 3JBG2 1OF4A 1XC6A 4CEWC 1WMDA 1X50A 4XTMA 5I8TA 1LGBA 4Y1ZA 2KM2A 5JR7B 4RGGA 1JYNA 1IKPA 2WSVA 2XJQA 4NR1A 1RHI3 4RGKA 2BFUL 1QKQA 2EIEA 4HVQA 3BTYA 5HCBA 1US2A 3GCWA 1HXS1 1UAIA 5C3QA 2Y6JA 3IDAA 2Q4SA 3WW4A 5JOWA 2XUEA 3VD7A 1XJAA 1GWMA 4WV8A 1ND2B 2WS92 4YZ2A 4I3GA 1HIXA 4CCJA 1ASJ1 2Q30A 1ZRDA 1UMZA 1GNHA 4ZKTB 5FREA 2I07B 4IV3B 4JTOA 2YC2A 4P5HA 3KCXA 3V0BA 3KHCA 4YLZA 3OYWB 1YIPA 5F3GA 2XJVA 3O14A 2VOVA 4W4ZA 4P02B 1RL3A 2WC2A 1F4HA 2C5DA 3NNGA 2EVXA 3OEBA 1PMJX 3NKTA 3VHPA 2HWC1 3RFRA 4AVAA 4Y5Z0 3WW2A 5C5UA 4NVPA 1ZZ6A 4UFMA 4LPLA 1WZXA 2Q5TA 4IEZA 4LNVA 4FI9A 1BVP1 3ZXJA 3LA3A 3I2GA 4B4RA 3VD3A 4Q4X2 5DUVA 5FPAA 3GBGA 3JD73 3RRDA 3AXDA 4U2AA 4NROA 5HCAA 4NWWA 2D3SA 1WW5A 3I49A 3IDCB 4E4DX 1VALA 2R1BA 4I0WB 5C8CA 5AFEA 2JWPA 3WNNA 3DXTA 2VZRA 4HETA 4XVHA 2VXJA 3N7KA 1SDDB 2WZPP 3V0BB 3G7DA 5BXXA 4AI1A 2R30A 5E88A 1REEA 3ZDVA 5D2AA 3KVBA 1QDOA 1IG3A 3PTRB 4XFGA 3VHNA 4BA6A 4BM8A 2SBAA 2R063 1WW7A 2RS51 3OG2A 4A7ZA 5F3CA 3ZSJA 4QD2A 1YI9A 3ENRA 1S4CA 3ZMNA 2HWB1 2ZBJA 3SEPA 3WG2A 4UW3A 4KNCA 5K7PA 1IS4A 3O1MA 2Z4FA 3R4DB 3ZSEA 5FCCA 4MUVA 3TN92 5BNPA 1KGYA 1H2KA 2YBPA 3JZVA 1QJEA 4GXLA 3UESA 2J1EA 1J59A 3RWKX 2QQWA 4D6RA 3P6BA 4Q2FA 4XJZA 2R071 4Q26A 2Z2SB 1C8M3 5DG2A 3O0WA 5EXOA 3OUIA 1NY72 2H6BA 2P6HA 3AMPA 2MPFA 1W99A 4I0BA 5I0SA 1ULFA 4BJ0A 4DRVA 5EYXA 5JAXA 3MYXA 2UWCA 1B35B 1RUF2 3AP4A 3MGUA 1HDKA 1YFUA 4NHKA 4UFLA 1IG0A 1R1A3 2IXCA 4QX1A 3VBHA 5FR3A 4A4AA 1C1LA 4GWIA 1PGW2 5CKQA 5BNPB 1ZYBA 3NRUA 5EFUA 3J7HA 5K4LA 1QY4A 2E63A 4DQAA 3POGA 4OI4A 4Q8LA 1RC6A 3MICA 5L7OA 1GBGA 2AYHA 2RM23 3I3QA 1RUG2 4IEWA 1NYWA 1REDA 4PI0A 1ULCA 1ZNPA 1K5MA 4DO0A 2ARAA 4YVWA 5FJKA 3WDWA 3T2OA 2VC9A 3IDEA 3OBZA 1AR62 4BQ1A 4CP9A 1H0BA 4DUWA 4XZUG 1VRH2 1R093 1UD1A 1OD5A 2HEYF 3IN9A 2FCUA 2RE9A 2VG9A 4A6OA 2D5FA 4IXLA 4C0HA 3TEYA 5J09A 4TTGA 1C28A 3ST7A 4XILA 2JXAA 3PVBB 2RJLA 1AXYA 1BMV1 4CDQC 4ES8A 1QJX1 4LKSA 1LECA 4BQ5A 3ORJA 4Q4Y1 2DU0A 2GNDA 4A3ZA 4A3XA 2ZEYA 1LU1A 4BQ4A 1JZ7A 3PU8A 5FK8A 1J83A 4EWAA 3NO8A 2F4PA 2IXLA 3SXWA 1LGCA 4L9BA 4N9HA 2HWF1 2WNUC 3AP7A 3NV3A 4MZUA 5EWSA 4CDUC 5HI0A 1QNYA 2DCJA 3BOWA 1X7NA 5A3LA 1QU0A 3N9LA 5A7OA 3IBMA 4CP9B 5BNNC 5I0UA 2ZGKA 1UY1A 2O0OA 2QQUA 4KG0A 5FP8A 2WAOA 2HBTA 5K8SA 4NMIA 4DZGA 1F15A 1NE4A 1VBE1 3POBA 1V6MA 2E6VA 2HLEA 2TBVA 3QOPA 4HKLA 1BKZA 4X6RB 4IETA 2NMNA 1EV13 3ZIWA 4COYA 1VB2A 1NKGA 1XNDA 5EHDA 4YYOA 4BXSV 5JSRA 1DU3D 5C5TA 4DXRA 2YU2A 3JD72 2VQUA 3GGLA 1W04A 4QMAA 5FZFA 4FVVA 2VU9A 3WW3A 4QHBA 2D43A 5A1LA 5KC6A 4ISQA 5H9RA 5AFBA 3TWIA 1PZ8A 2E7QA 3VZLA 1CQ9A 1PVC1 2XHKA 4TYSA 2QQMA 2Y6HA 3TBDA 1ZRFA 1V6OA 3LEMA 1G6NA 3LOIA 5GM0A 3FJSA 2R062 2WZR3 3KCCA 5A6XA 2BBVA 5FMBA 1LODA 4UBGA 5FPVA 1STMA 2QKDA 3B00A 4AK3A 4CRQA 3K2OA 3LB9A 3PUSA 4I01A 4RFRB 1V9U3 2D97A 3GHNA 3WQ7A 1FOD3 1Q43A 2YPDA 4DPNA 1KFXL 1NXD1 2VPVA 5HCFA 5FLJA 1DP0A 3Q8FA 4Q4W3 4BWOA 4COVA 4F3JA 4WZFA 2V4VA 4L97A 3KGZA 3PMSA 3DYMA 4R52A 5IATA 1Y3TA 4N8MA 2RR13 4N53A 4RHV1 4XC9A 2P3YA 3ABZA 2ARBA 3HBKA 1OLRA 3ZXKA 4S2GA 2XDVA 3MW4A 5FK7A 1NXMA 5LRSA 2OW4A 4Q0QA 1AVBA 2YDEA 3GJBA 5FMOL 1RUH1 2VBBA 1PX4A 3H8RA 5E8AA 4AHXA 4R9AA 1PGSA 3PIGA 4YPJA 3VBOA 2PHTA 1E5RA 2A70A 3KT7A 3OPTA 4LR4A 3SKJE 5FZ9A 4CPBD 3GBFA 2HEWF 2D6KA 3FMGA 3NAPC 4OUSA 4QKDA 1ZBA3 3VBRB 3WT3A 1R1A2 3ALQA 4CA9A 3ZYHA 4M0HA 3ZDSA 5FY4A 3I97A 1W8TA 2VZ1A 2WAAA 3O1RA 4MHUA 3ZVXA 1IS6A 4PF5A 4CP2A 2OZ6A 4LJHA 2RM22 5C4WA 4N53B 1SBDA 4LBLA 3I2HA 3UNPA 2A75A 3BU7A 3ZO0B 2UY9A 4CDXA 1RUE2 2J1SA 4MOAA 5GJ6A 2WYSA 3MFCA 4ZS2A 2BEOA 3OBTA 4K1ZA 4YW5A 3ZOIA 5IK5A 2V4AA 2JD9A 2EIGA 2ZX4A 3H9AA 4IGPA 3LF7A 5FYYA 3VBOB 4COWA 1AHSA 5DUXA 1ZA4A 2VOKA 1V6JA 1ZRRA 4YW7A 1VBB2 3S57A 4QB6A 3ZFFB 5C9AC 3UKTA 4BMEA 1M4WA 1VBA1 1AX2A 5FBJA 5FYCA 4SBVA 2E51A 4P9LA 4Y22A 1EAH1 2H0BA 2XJPA 4YFWA 4CXYA 1Q5OA 4ASMB 4BCUA 4AVSA 4Y1YA 5FZMA 4JV4A 3PURA 3T4HB 1MZEA 2RJ2A 5FXWA 2X29A 4OZOA 2K0GA 4JDOA 3U78A 4GZ9A 3S6PA 2BYVE 4COUA 4GH4C 3I59A 1UKGA 3T08A 1UCXA 1XYOA 1O5UA 3NMBA 3UL2A 4IEYA 2XKPA 4H7MA 3ZN6B 5B2GB 3W20A 4M00A 1AR73 1YQ5A 3VBUA 2J1RA 4GMP3 5DUUA 2ZHNA 4X6QB 2OPKA 3L2YA 4D3WA 1P8JA 4XYXA 4KGGA 2VVEA 4LLOA 3D4KA 5AC93 1EV12 4YVSA 4HANA 2VOWA 3HNMA 2WYFA 5F5QA 1GLHA 4LT5A 1GNYA 3WNPA 3ZX7A 1O4TA 2ZGQA 2NZ9A 2WO1A 3SCFA 1OD3A 1ZZ9A 2XGXA 4JAAA 4M3CB 4ATEA 4Z07A 2OX0A 1GR3A 2WBKA 5T50A 1I5PA 4LK7A 4LOTA 2QTWB 4CUBA 1WLDA 1IS3A 1U12A 4E8CA 3I59B 4GA9A 2QE3A 2DWRA 3M3EA 4KH9A 1GNZA 5KHGA 1T6BX 2XL7A 2B39A 3VBUB 5FDBA 3U4XA 5FLIA 3W58A 4BXFA 1LENA 2BP6A 4CP0A 3D5OA 4JRLA 1AJKA 2OS2A 2XJRA 1ZX5A 2P34A 1DHKB 4WM8B 4YVSB 3WNOA 1ZZ7A 3CJIC 1XNTA 2IXKA 1MQTA 3OGJA 1FOD2 4P9GA 2VMGA 5F8PA 1C1FA 3NW4A 4EYUA 4LUMA 4DUXA 4OCTA 2PXJA 2VZVA 4OZXA 4CTEA 3I3EA 1RUC1 4OQ9A 4Y1XA 1HXS2 2XKOA 3K4DA 4Q4W2 4XJAA 2D6PA 1O8PA 5T55A 1RJ8A 2FCTA 1BVVA 4XPVA 3MV01 5FYVA 5FZIA 4Z8BA 1O3QA 5T54A 2W0XA 3P3PA 2RR12 2QQKA 4ZU7A 5LATA 1K45A 1SFNA 5APAA 1OUSA 2W95A 4IE4A 3VBSC 2AH2A 2GN3A 1RXFA 2EAAA 2WABA 2ZS6B 3KV5A 3N7MA 3QLQA 4LKDA 4XMIA 1U5XA 5FPLA 1H8VA 4IUGA 1EPWA 1OHFA 2VL4A 1X82A 3LFIA 1LEMA 3WDYA 2FDFA 1BZWA 1GQHA 3NNMA 4XAAA 3IDBB 5CU1A 3VBFC 3RWNA 4AL9A 4UAPA 5FPXA 4JGYA 2NP0A 1TME3 4XE9A 1VBE3 3WF3A 3OPZA 1MQTB 3F95A 1OLME 4B8EA 1ZBA2 2FD8A 1JZ4A 2DUOA 4YG3A 1LHUA 2PAEA 3HNYM 2XLFA 4ASLA 2VW0A 5A7WA 3U0ZA 3P3NA 3N9NA 3GNEA 3O5SA 4M3CE 1XNKA 5FY5A 3LGRA 1SDWA 3KD4A 4BU2A 1YO8A 5FKBA 1JU3A 4KWLA 4YM0A 3RZGA 3RG0A 3MIGA 2JG9A 2J1TA 3LSEA 2JDPA 5H9QA 2D6LX 1R081 4HT1T 3BUCA 5JWPA 2J22A 4CXXA 1PVC3 1JZ8A 1F8VA 3APBA 1PGL1 2ZX3A 3RVHA 2OZJA 2ENRA 4QPYA 1H2NA 1NOVA 1D0HA 4MHRA 4YGEA 4ARYA 4JGYB 5J98B 3A0KA 3AVRA 4HK9A 1UNBA 2RS52 3AC0A 3AMHA 3S7IA 1ZBE1 2X5IC 1XU1A 4GULA 4LO7A 4LBKA 1YI7A 3WP3A 2EXKA 1SCRA 5CNAA 3A0NA 1W6NA 3SLIA 4QXKA 4URAA 3SCHA 5A7WB 2BVVA 5DUWA 2HWB2 4QPWA 1J84A 3SH4A 1O4YA 3E1F1 2B45X 2UWAA 4H14A 4IEPA 5KHHA 4AFBA 1NG0A 1RMU3 1CJDA 1MZ5A 1RGSA 1JUHA 1NZCA 2ZX0A 3HIFA 4UF0A 4I02A 5A3TA 4LHSA 3WINE 2JG9B 3GHMA 5FY1A 3VKOA 4DNYA 4W6YA 3UYJA 2GH2A 2JX9A 1JYCA 4MGIE 1X9PA 2IWGB 1FPN3 1KJLA 1X33A 2P2KA 3GJAA 4XACA 4NIAA 3U11A 5JSPA 2ADDA 3LIGA 1V00A 2GMPA 1YQCA 5KBFA 1RUH3 1MEC1 4AEJA 4EE2A 3B9IA 4AZZA 2WWJA 4DXTA 3RQ0A 3WDUA 4CUCA 2XWBB 5AC92 1YFWA 5DAXA 3SQOA 1BEV1 4H2AA 1W6NB 1YUDA 4X8NA 3N35A 1CD3G 4KWUA 1Q8PA 4V1PA 1T6GC 3AB0A 3KGLA 1S0CA 2JE8A 1UPIA 4UF0B 3CQOA 2WLPA 1GWKA 1KD7A 4IE0A 4QKFA 2F4LA 1COV1 4RL7A 2XBO1 1W9TA 5FQ0A 1HQWA 3O0VA 2GU9A 2W9XA 3ASIA 2OUJA 4QPIA 1OQDA 1OURA 3T1MA 3I2IA 5IT6A 3FLPA 4A6SA 4AR2A 1FI2A 1QJY3 3NJVA 3E6DA 2O8OA 4RD7A 3M8LA 5FYSA 1JYTA 3MLJA 4FPYA 3T0AA 5LA9A 2F17A 2QZ3A 3ZN4A 1EY2A 1Z78A 1G9FA 2P4EA 2XL9A 4M4RA 4JDNA 4NN0A 1H4HA 4FPJA 5SV5A 1HV1A 3JBG3 4COZA 4OMCA 2DBIA 3CEWA 3ZXFA 5C70A 1GP5A 2YC4A 4MH0E 2J1VA 4E2QA 1BMV2 3I4IA 3ACFA 5M0TA 5HXMA 3QH7A 1NCQC 1NLRA 3IAQA 4I2OA 2E32A 2BDRA 2I45A 2B5HA 4K1YA 4CUGA 3CMGA 2FBEA 3ROUA 1LKNA 5GLTA 2JDMA 2KA3A 3PVNA 3RDIA 4XJUA 3OGVA 2RJKA 2JD4A 4QPIB 5IK4A 4PDWA 3BTZA 4YGBA 2WS93 1JU4A 4Z2WA 2BWCA 4MV2A 1DYPA 5FUIA 4EWDA 1DQ1A 1TMF3 4UFJA 3T09A 5DABA 1SBFA 2GALA 1OPMA 1MPXA 2CDOA 1QOSA 3CDZB 4TXWA 4UT5A 1TME2 3TOJA 1VBE2 2P3JA 1JTZX 4W65A 1Y43B 4QXHA 3EB7A 1ACCA 1ENQA 1LRHA 1VB4A 4ZS3A 1O6UA 3UJQA 1WD4A 4AVVA 5FWEA 1H6YA 1OA4A 3H7JA 1KITA 3AKSA 2CYFA 3DPRA 1SCSA 3BCWA 1ULOA 4SLIA 1LOEA 3DKWA 4NHYA 4JC1A 3DYOA 4HSJA 3WEZA 5E89A 5ACA3 2G4IA 1I5ZA 1QDCA 1VIWB 1C57A 4QQHA 5FXXA 2ZXQA 3PVEA 3RZJA 4Q8KA 4JHTA 4PDWB 3M4FA 4Q4X3 1WCSA 4V2WA 1H1IA 1Y4WA 2P17A 3DECA 1REFA 1UMHA 2GP3A 1PVC2 3ETPA 2WFF1 4KBBA 4LMFA 1SLIA 5T5JA 5F37A 1ZZBA 1RUD3 2GZWA 2WN2A 2VCMA 4ZPIA 2VUJA 3WOGA 1S2BA 4ONUA
chains in the Genus database with same CATH topology
1E5IA 1W28A 1UOGA 1UO9A 1OBNA 1WA6X 1QJEA 1HJGA 1W06A 4XAEA 2CSGA 1GP6A 1W9YA 1W2OA 2BRTA 1BLZA 1ODNA 2Y6FA 1IPSA 1HB2A 1HB3A 2VBBA 1QIQA 1E5RA 1HB1A 4RGKA 1UOFA 2VBPA 1W3VA 5APAA 5C3QA 1RXFA 2DBIA 1W03A 2VE1A 1GP5A 2IVJA 1RXGA 1GP4A 1W2AX 3ZKYA 2BU9A 1W05A 3ZOIA 2IVIB 5C3PA 3ZKUA 3ON7A 3OOXA 1W2NA 2WO7A 1BK0A 2VAUA 1HJFA 5C3RA 1E5HA 1UOBA 2Y60A 1E5SA 1UZWA 5C3SA 5C3OA 2JB4A 1ODMA 1UNBA 1DCSA 2DBNA 2VBDA 1W04A 1QJFA 2JB8A 2VCMA 1W3XA 2BJSA 4BB3A 1HB4A 1OC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E5I A;  1W28 A;  1UOG A;  1UO9 A;  1OBN A;  1WA6 X;  1QJE A;  1HJG A;  1W06 A;  4XAE A;  2CSG A;  1GP6 A;  1W9Y A;  1W2O A;  2BRT A;  1BLZ A;  1ODN A;  2Y6F A;  1IPS A;  1HB2 A;  1HB3 A;  2VBB A;  1QIQ A;  1E5R A;  1HB1 A;  4RGK A;  1UOF A;  2VBP A;  1W3V A;  5APA A;  5C3Q A;  1RXF A;  2DBI A;  1W03 A;  2VE1 A;  1GP5 A;  2IVJ A;  1RXG A;  1GP4 A;  1W2A X;  3ZKY A;  2BU9 A;  1W05 A;  3ZOI A;  2IVI B;  5C3P A;  3ZKU A;  3ON7 A;  3OOX A;  1W2N A;  2WO7 A;  1BK0 A;  2VAU A;  1HJF A;  5C3R A;  1E5H A;  1UOB A;  2Y60 A;  1E5S A;  1UZW A;  5C3S A;  5C3O A;  2JB4 A;  1ODM A;  1UNB A;  1DCS A;  2DBN A;  2VBD A;  1W04 A;  1QJF A;  2JB8 A;  2VCM A;  1W3X A;  2BJS A;  4BB3 A;  1HB4 A;  1OC1 A; 
#chains in the Genus database with same CATH topology
 1OT5 A;  2QDN A;  4XHX A;  4Y5T A;  3WVJ A;  4MXW A;  1MS3 A;  5FYT A;  4FTE A;  1FT9 A;  1CVN A;  3GDB A;  2ZAB A;  2QZ2 A;  4K6B A;  1G7Y A;  4IV1 B;  5DAP A;  1UX7 A;  1O91 A;  5FZC A;  4IE6 A;  3LOB A;  2GAU A;  2D44 A;  2LUW A;  4YNI A;  5H9P A;  4EN9 B;  5JCT A;  4BMB A;  5J37 A;  2Z5W A;  4Q1P A;  1QEX A;  1DDL A;  2QQJ A;  1D4M 1;  2VZQ A;  4XUR A;  1G9A A;  4EN7 B;  1NE6 A;  1QMJ A;  2VY0 A;  3VL9 A;  4Z92 B;  1AR9 1;  4NUB A;  4OLL A;  1FPN 2;  3TN9 3;  5FJH A;  4OI2 A;  4GQ7 A;  2B9V A;  2BER A;  3III A;  1MZ6 A;  2CHH A;  1MS8 A;  1PZ9 A;  1XNA A;  1RUH 2;  2EA7 A;  2WL1 A;  3JUU A;  2W1U A;  5CFD C;  4WVM A;  3NKG A;  5F6L B;  4HG6 B;  1MS0 A;  1ODN A;  4LBM A;  3OD0 A;  3UGH A;  2PHR A;  3PIJ A;  1MZF A;  4AFM A;  1H8T C;  2VVF A;  2VTX J;  1AR8 3;  5JPM B;  1HB3 A;  1K42 A;  2Q8O A;  2VOX A;  3N9P A;  4YGC A;  2PAM A;  3TYJ A;  4YM2 A;  4ATF A;  4KMQ A;  4QX5 A;  4QGM A;  1CX4 A;  4Y20 A;  2MNG A;  4UXA A;  2D3R A;  4WM7 B;  1WW4 A;  1WLT A;  5A32 A;  4QPG B;  4YFZ A;  3J7N A;  2JKB A;  2QCS B;  5IUQ A;  5TSW A;  2VVD A;  4BQY A;  3VDC A;  2XUM A;  4OHY A;  2WZE A;  2ZMN A;  4E27 A;  4ZZ5 A;  4GB3 3;  3WW1 A;  4AAP A;  4A7Y A;  1LGN A;  1TE1 B;  1LOF C;  3AKP A;  1QJY 2;  3LAG A;  3N3H A;  2AEN A;  3AYC A;  1RUG 3;  5DN2 A;  2VMF A;  1W2A X;  4WVM B;  1RVF 3;  1TG7 A;  5FMC A;  3VDD C;  3VD9 A;  4QXC A;  4QB1 A;  5FBZ A;  3UET A;  3E5Q A;  4DOU A;  3V56 A;  4OQ8 A;  4LE3 A;  3H1W A;  1XB9 A;  1AR6 3;  1YCI A;  4MGS A;  1JOD A;  2P3I A;  2RG4 A;  3AP5 A;  5D8A A;  1VRH 3;  3B69 A;  3MF6 A;  4IEV A;  4L99 A;  1VBA 2;  2FMY A;  3E5U A;  1JZ3 A;  2ZHK A;  3FZ3 A;  1RTV A;  3WP4 A;  3U37 A;  1S0E A;  2RVA A;  2CAU A;  4IW3 A;  5A32 B;  4FFH A;  3SEE A;  3DV8 A;  3JB8 A;  1N1S A;  3I3B A;  3WZ1 A;  4K8F A;  2D6O X;  3O1U A;  4BQW A;  4R4X A;  4XBQ A;  1FXZ A;  1C5H A;  2HYX A;  2VW1 A;  3POS A;  1XYN A;  2BUK A;  1UOJ A;  4CU9 A;  2ZA9 A;  1UZW A;  5LK7 B;  5FYB A;  4ISR A;  5I0T A;  5SV8 A;  1TMF 2;  1ST8 A;  2QQI A;  3GM8 A;  4MGK E;  3B9C A;  4CCL A;  2DV9 A;  1DGR N;  4E9K A;  3D3A A;  5C3O A;  2XQX A;  4GIQ A;  3JB4 C;  1HQN A;  4AHZ A;  3W21 A;  3BN6 A;  4UBH A;  4YRD A;  4D6S A;  4AGR A;  4XCB A;  1WGP A;  1CIW A;  5D8A B;  5LRR A;  5DZE A;  2J42 A;  3FHA A;  2P37 A;  3C7E A;  1DZT A;  5A6Q A;  4L92 A;  5FZL A;  4XJ9 A;  4XFB A;  3PUI A;  2HEV F;  4QGL A;  1H2L A;  3MUY 1;  1V6L A;  4YW4 A;  5IJR A;  2QVS B;  3SH5 A;  1OPO A;  2GSY A;  1YXW A;  2Y64 A;  1BYH A;  3I2D A;  1XE8 A;  2JDU A;  3C2U A;  3NST A;  4QDQ A;  5D1I A;  2KR2 A;  4N43 A;  3JQW A;  4WVZ A;  4B4Q A;  4RQP A;  1F5J A;  1AYN 1;  1WA6 X;  4UYB A;  3PL0 A;  2D6M A;  1H9P A;  5I93 A;  4IV3 C;  1RUD 2;  1UY4 A;  3AZW A;  3H8X A;  3PNA A;  4O61 A;  3SC7 X;  4DIN B;  2WIN B;  5FZA A;  5CFC A;  1VAK A;  4KWK A;  4NIH A;  3E6C C;  2R0H A;  2PFW A;  4QM8 A;  4GKY A;  4XF3 A;  4N90 A;  4TLG A;  5KHK A;  4KI5 M;  4PF1 A;  3DKQ A;  3PDQ A;  1AXK A;  1L7Q A;  2CWS A;  4LEJ A;  4IEQ A;  1BLZ A;  1OOP A;  1FNZ A;  4N43 B;  4MGY E;  1X8E A;  2W68 A;  2PN5 A;  2WLQ A;  5GKA C;  4RQP B;  2NPI A;  3QBQ A;  4LHN A;  1PX3 A;  2Q8D A;  2PHL A;  3WNX A;  1LCL A;  2Y6K A;  2DYC A;  3IM0 A;  3H3L A;  3AX4 A;  3POF A;  5C8C B;  2RS1 3;  4FPC A;  1APN A;  1XE0 A;  2DCY A;  2XLG A;  5CFC B;  3NNL A;  5DZF A;  2R0F A;  4BQ2 A;  5HBA A;  3C7F A;  3CZJ A;  3IMM A;  4YM1 A;  3VZN A;  5FUN A;  4QX2 A;  1BK1 A;  1AR8 2;  4YG6 A;  3RPQ A;  3TEW A;  2G9F A;  2IVJ A;  1AL2 1;  1AYM 1;  1FMD 1;  2EXI A;  1GP4 A;  3POJ A;  4IL7 A;  4MLO A;  1OLQ A;  2FCV A;  3ILF A;  4BIF A;  3S30 A;  4HBN A;  3ACL A;  3S0M A;  3V65 A;  3WQ0 A;  1OOP B;  1FNY A;  4KBZ A;  1WKY A;  2VME A;  2XVL A;  4GWN A;  1UN1 A;  5JZG A;  1ZRC A;  3AJY A;  1J3R A;  5FY9 A;  3EHK A;  3SMH A;  1NZI A;  1RUJ 3;  1BBT 1;  1YFX A;  1V6K A;  3AFG A;  4GAZ A;  3ZSK A;  1S0B A;  4GB3 2;  1W2T A;  3EQE A;  3LEG A;  2VNO A;  2QDR A;  5GZE A;  2ZGT A;  5L73 A;  5EIY B;  4CDU A;  1W2N A;  1RVF 2;  1HN0 A;  2W94 A;  5I91 A;  2WNE A;  3ZPO A;  2YG0 A;  2VNV A;  4L11 A;  5BNN A;  4LTA A;  4PBO A;  1RUE 3;  5D21 A;  1PVX A;  1GZC A;  4RFT 0;  5EP9 A;  2AAC A;  2R04 1;  4LBQ A;  5IK8 A;  1CGP A;  4IGO A;  1UOB A;  5FPB A;  2VUL A;  4E2G A;  1ZBE 2;  2YBK A;  3H50 A;  4HKO A;  3VHR A;  1B35 C;  2VR4 A;  5I8Y A;  2W91 A;  3THD A;  2WT0 A;  2PQQ A;  1VBB 3;  4DXZ A;  1OUX A;  4A44 A;  1W9F A;  3HNB M;  5JZG B;  2B9U A;  4QQP A;  1VBC 3;  4XUN A;  3VBH B;  5BNP C;  4IE5 A;  5L9V A;  3KM5 A;  1DQ6 A;  3VZO A;  5L9R A;  2BNN A;  1QJU 1;  5F32 A;  4NE9 A;  5L7O B;  2RMU 3;  1H9W A;  2W47 A;  2XJU A;  1QJF A;  5EQU A;  5FAX A;  4HSL A;  4Y26 A;  1K5M B;  1UIK A;  4QGN A;  4CDU B;  5FOJ B;  4YG0 A;  1Y9G A;  1Z7S 1;  2HH9 A;  4YVW B;  4Q4V 1;  4QWN A;  1BXH A;  4LBQ B;  3NJX A;  4AFA A;  1MEC 2;  3HVD A;  5A3M A;  2AZ5 A;  5B4N A;  1DQ4 A;  4PJY A;  1DGW X;  4JGZ A;  1BEV 2;  4K7J A;  4AAX A;  5CKN A;  5ISL A;  1MAC A;  2ZGM A;  2ZGP A;  1PO1 3;  4HLT A;  1HJG A;  1NCR A;  1UZZ A;  3QAC A;  3MBW A;  4TZD A;  4NID A;  4MX3 A;  4RSU A;  1PZ7 A;  2AGS A;  4Q0U A;  2EF6 A;  2YMZ A;  4JZR A;  4XDO A;  1LR5 A;  2DCK A;  2XQR A;  1KDM A;  4FOY A;  4UFH A;  3J7M A;  3RS6 A;  1I6X A;  4FPL A;  2R1D A;  1UXX X;  2H0V A;  3FHQ A;  3CHX A;  3OY8 A;  1W8U A;  1LHO A;  1W9Y A;  2YUE A;  4E4Z A;  5DMY A;  5E6H A;  2VZ3 A;  1X8M A;  1GZW A;  2W46 A;  4DY3 A;  1T2X A;  4HN0 A;  5FZ0 A;  1PO2 1;  4JGZ B;  1HB2 A;  3C7O A;  2EIB A;  1QXJ A;  4LK6 A;  2RS3 1;  3JQX A;  3MUZ 1;  1ULD A;  1NCR B;  2ETE A;  1D4V B;  1LHW A;  5C7G A;  3AKQ A;  1UQX A;  1LJ7 A;  3K46 A;  3USU A;  4AI3 A;  4MGZ E;  3T0B A;  1UY2 A;  3H3U A;  2UYB A;  3B3Q E;  4AXO A;  3VD4 A;  3ZIX A;  1HLC A;  2EXJ A;  2DUQ A;  1POV 1;  3BPZ A;  3FLT A;  3FUQ A;  2D7F A;  4DMI A;  2YXS A;  2JIC A;  2CGO A;  1HXS 3;  1YYN A;  4M3C F;  3GZA A;  4PIZ A;  1RXG A;  3X29 B;  2B7Y A;  1HRV 1;  1A3K A;  2A6X A;  4H3W A;  1NA1 A;  3ZYR A;  1ZM1 A;  2RS1 2;  2XLA A;  1GZW B;  1WCU A;  1SLB A;  2DVB A;  2PHD A;  3M3C A;  1KFU L;  3KLS A;  4Z82 A;  3AXE A;  1ASJ 3;  3J8F 1;  4IEU A;  2GC0 A;  5FKC A;  3D0S A;  3J7L A;  2QQN A;  2VEC A;  1OMI A;  4CDW C;  1LES A;  4BQ3 A;  2DDU A;  3PHM A;  4IER A;  1A8M A;  2X10 A;  2IUW A;  3DL3 A;  3DXU A;  2OQ7 A;  2BPA 2;  4MG2 A;  5T52 A;  1PM7 A;  4DEV A;  1EUT A;  2OUH A;  2ZEZ A;  2VNR A;  3R6S A;  3IPV A;  3USU B;  4AVC A;  4ORF A;  2YPJ A;  4D0Q A;  4FQ4 A;  5FO9 B;  5DXD A;  3AYA A;  5LCW L;  4ET7 A;  2RDN A;  2HWC 3;  2VQA A;  1CZT A;  4P14 A;  4DB5 A;  4N7U A;  3THT A;  1RUI 1;  1RUJ 2;  2ARE A;  2QQV A;  1DZR A;  3R05 A;  1S0G A;  1LHN A;  2GP5 A;  2KXL A;  2A6V A;  4LKE A;  3AZV A;  5K9Y A;  4XUQ A;  1SPP A;  1TZO A;  5FP4 A;  2HYK A;  1GFF 2;  1NA1 B;  2JG8 A;  3ITQ A;  3WXP A;  4NHM A;  4KU8 A;  5A7S A;  4GH4 A;  1AJO A;  4HZF A;  3N4M A;  5LA2 A;  2R49 A;  4QX8 A;  3RMY A;  2C9K A;  1JZ2 A;  1YJL A;  3FBM A;  1XE7 A;  3V0A A;  3DYP A;  4KU7 A;  3IPV B;  4ZY9 A;  4M4P A;  2JDN A;  1CPN A;  1YEW A;  3D6E A;  3LEK A;  3RNS A;  5IVE A;  3VBR C;  3EJK A;  2BJS A;  2RS5 3;  3HQR A;  1VRB A;  1WD3 A;  3MO4 A;  2WNV A;  1RUO A;  2VCC A;  1VBC 2;  3NWK A;  4D69 A;  1OBN A;  4C91 A;  2HWB 3;  1DLC A;  3QD6 A;  1TEI A;  3WF0 A;  4A2U A;  1O3T A;  1PIV 1;  3NV1 A;  3J4U H;  4N53 C;  5FY8 A;  1POV 0;  1SPP B;  3KF5 A;  2JG8 B;  4NHX A;  4CVU A;  3IKW A;  5C4W B;  4LBJ A;  2RMU 2;  5JSO A;  3WSO A;  2JEM A;  3B93 A;  5FTT C;  4CDX B;  4B7K A;  2X09 A;  5DDJ 1;  3OBA A;  4EQV A;  1J1L A;  5BPX A;  4QQO A;  3EYP A;  3THP A;  2C0Z A;  2CNA A;  5ABJ A;  3K3N A;  5EYY A;  3GXU A;  3IAP A;  5FZ1 A;  2W52 A;  2WUH A;  2R07 3;  3V0A B;  1SFP A;  1C8N A;  1MS1 A;  2ZHM A;  4MXV A;  5IVV A;  4Y33 A;  4XQD A;  4HOO A;  4BLI A;  3HN3 A;  3ZFF C;  5HV4 A;  3AL6 A;  2OPW A;  5JOX A;  1PNF A;  1PO1 2;  3CJI A;  2BRT A;  2OKX A;  2WNV B;  4YZ3 A;  2Q1M A;  3BGA A;  1YQ6 A;  3ZFE A;  2W92 A;  2ZCW A;  4CCE A;  2ZX1 A;  4Y22 B;  2LW8 A;  3HMY A;  1F9K A;  4BHP A;  2A1X A;  3M1H A;  3FL7 A;  3WQ1 A;  3WLU A;  3HQX A;  4YZ4 A;  4CCN A;  5CB7 A;  3WF1 A;  5J96 B;  4LO6 B;  1LUL A;  2DF7 A;  2TUN A;  5A3P A;  2WRA A;  2PLV 1;  5FZO A;  5IVF A;  2Y26 A;  4DFS A;  5ABJ B;  1W8H A;  5F3I A;  2DTW A;  1XOY A;  3MI8 A;  5I8S A;  3MZH A;  2ARX A;  3ES1 A;  5F5A A;  4PCR A;  3GCX A;  3LDB A;  3WCS A;  4B29 A;  4PHZ A;  5DG1 A;  4FPE A;  5FPU A;  2TEP A;  4C0B A;  2HWE 1;  1YFY A;  1VMJ A;  4FT8 A;  1CAX A;  3ILR A;  3LA2 A;  5IVY A;  3ZKY A;  2BU9 A;  3DN7 A;  1YC6 1;  3ZFE B;  5KXD A;  2ZKN A;  3A22 A;  3VZM A;  5BUV A;  3L2H A;  2P1B A;  1WA4 A;  2ES3 A;  2AUY A;  1OSG A;  1QJX 3;  1CON A;  1GYK A;  1W8N A;  2OQ6 A;  5LEK A;  4Q4Y 3;  1MVQ A;  1TQ5 A;  2XH6 A;  3FE5 A;  5FZO B;  5ACA 1;  5F39 A;  5T5L A;  1IQD C;  5IAV A;  1GUI A;  2ZGL A;  5CVR A;  3ZPY A;  1ASJ 2;  2WQ8 A;  1F5F A;  2HWF 3;  3RJ2 X;  4YW1 A;  4YZ1 A;  2XJT A;  1XNB A;  3MDP A;  3PU3 A;  3PVO A;  3ZXG A;  1E5S A;  4YVS C;  1ZVF A;  2VO5 A;  1O8S A;  3I2K A;  4WM8 C;  5F2S A;  1UWW A;  1VR3 A;  1CAX B;  2O14 A;  3BOD A;  2A7A A;  4MAD A;  5FZ6 A;  1JZ5 A;  4E2S A;  1O4Z A;  1XU2 A;  1A78 A;  1SHW B;  3KQ4 B;  5JI9 A;  5CG9 A;  2HWC 2;  4QAW A;  4Z1V A;  4XXP A;  4ZXE A;  1O3S A;  3O1O A;  3JCI A;  5A33 A;  2MEV 1;  5JMC A;  4CU7 A;  2VZT A;  1H1M A;  1BHG A;  2IXI A;  3PJQ A;  5EZW A;  2XJS A;  2VBD A;  2ZGR A;  1JOB A;  1AYN 2;  4YW3 A;  4YM3 A;  3OEA A;  3TNP B;  4W8J A;  3BU0 A;  2BFU S;  1W3X A;  1QQP 1;  2CU5 A;  3HJR A;  1N1Y A;  4XZP A;  1OC1 A;  1RB8 G;  5DQ0 A;  2WII B;  1PK6 A;  1YRZ A;  1AF9 A;  4NO4 A;  5JUV A;  1W28 A;  4NPL A;  1RIT A;  3ETQ A;  1UF2 C;  4QKN A;  3RZM A;  4JCK A;  1RIR A;  5A1A A;  1OKQ A;  3CNA A;  4LLF A;  3U07 A;  5DPN A;  5G05 L;  1CR7 A;  1MQT C;  3OSD A;  1QWR A;  1CZV A;  1RUF 1;  3K4A A;  2VQ0 A;  3U14 A;  3FLR A;  2RS3 3;  1SLL A;  4CPB A;  3E6B A;  4M0N A;  2EXH A;  5F9T A;  4NII A;  2FQP A;  5LK5 A;  4P9J A;  4S2F A;  4WVV A;  5A33 B;  2ET7 A;  2VCB A;  1PGW 1;  1W2U A;  4R4Z A;  4JQT A;  4X8P A;  5JXG A;  4XET A;  1ND3 A;  3D82 A;  4Y24 A;  4RS5 A;  1GP6 A;  2CGN A;  3WQB A;  4CP1 A;  1DZQ A;  3LFM A;  4CYD A;  1ULG A;  1EP0 A;  2PTM A;  1W0P A;  3VKL A;  2UU8 A;  2HWD 1;  4OFG A;  4W6W A;  3VD5 A;  3MIF A;  1CN1 A;  1WLC A;  5FRA A;  1PK6 B;  3KWV A;  3NNJ A;  3WNK A;  3GYD A;  5E1R A;  3UGF A;  4FO9 A;  4RHV 3;  1V70 A;  2QJV A;  4FCA A;  2R07 2;  5I0D A;  1JOJ A;  3MIB A;  3LD8 A;  4JGY C;  2JE9 A;  3ES4 A;  2WNO A;  3MHZ A;  2G9G A;  1J1T A;  1JOP A;  2O8Q A;  3M3Q A;  4P9W A;  1RHI 1;  5CEH A;  3VDB A;  3OB8 A;  1DYK A;  3O12 A;  1W6M A;  4HL0 A;  4AWD A;  1OXC A;  2VBP A;  4CEY C;  4S2H A;  2DUR A;  2JDH A;  4YSF A;  3KHB A;  2V72 A;  3WF4 A;  1XSQ A;  1NCQ A;  2YC0 A;  2FZ1 A;  1ND3 B;  4CSW A;  4RS5 B;  1UU5 A;  2Y0I A;  3WG4 A;  4N9I A;  1BBT 2;  1Z0H A;  2JG9 C;  2YFZ A;  4HPK A;  2A3X A;  2OYZ A;  4ZHN A;  1GIC A;  5LY1 A;  2FDK A;  3RSJ A;  3VV1 A;  1D7P M;  3WUC A;  2Y34 A;  2R16 A;  3I8T A;  1HW5 A;  3ZXD A;  3KSC A;  3OD4 A;  1WME A;  3KV4 A;  2IVI B;  2R04 2;  2K9Z A;  4QXB A;  3LDK A;  1CAV A;  3ZKU A;  5BNO A;  3HBZ A;  3R0R A;  4EN6 B;  4R9C A;  1HV0 A;  5JOY A;  2FDH A;  4YAR A;  2V09 A;  4ZU4 A;  1KDK A;  1L7L A;  3W5N A;  2E31 A;  2PQS A;  5LB6 A;  3MIH A;  2GMM A;  3MLL A;  5GAL A;  1BCX A;  2I2S A;  4KQ7 A;  2R32 A;  4R9D A;  5IVJ A;  3ZXL A;  3O0X A;  4Q0V A;  3SHR A;  1KRI A;  3N36 A;  1QJX 2;  1QHD A;  1VBA 3;  1WW6 A;  2BNO A;  3D0J A;  3JD7 1;  4O65 A;  2P3K A;  2VD7 A;  2WDB A;  4HPK B;  2W08 A;  3M2M A;  4OHV A;  2DCT A;  4Q4Y 2;  4XFH A;  2ZMK A;  5C8W A;  1EAH 3;  2Y33 A;  3ZYI B;  5FQ0 B;  2JIJ A;  2ORZ A;  4XBL A;  3T30 A;  1KS4 A;  1XXN A;  4J1W A;  1GAN A;  4F83 A;  5HPO A;  3I3M A;  4AED A;  3CLP A;  2HWF 2;  3RZL A;  1JUI A;  4Q4V 2;  4OUE A;  5K0U A;  4B3N A;  1CAV B;  3POI A;  5BNO B;  4EJR A;  2VTF A;  1R1Z A;  2R06 1;  3FBY A;  3VZJ A;  2JIG A;  5A70 A;  5JOZ A;  1LU2 A;  4BPZ A;  2H6C A;  4W50 A;  3TEZ A;  2WSU A;  2VQT A;  1MS4 A;  4G4F A;  4DRR A;  1D0G A;  5DAQ A;  1HB4 A;  4YWA A;  2E33 A;  3DEM A;  4GWM A;  3KCY A;  4QX3 A;  1K12 A;  3RZK A;  4CUA A;  3AZX A;  1W0O A;  3NL1 A;  2GNM A;  2ZPX A;  3HOB A;  5F2W A;  1SLA A;  1JI6 A;  3I3D A;  2VZS A;  1NT0 A;  3EXU A;  2J1A A;  4QPI C;  4YW6 A;  1IOA A;  4A41 A;  1RIN A;  1EYB A;  4URT A;  4HKW A;  3WCR A;  4AED B;  1C8M 1;  2PLV 3;  4J1X A;  3C7G A;  5K0U B;  3EMR A;  4P08 A;  1ENS A;  4RYD A;  1RYY A;  3ZFG A;  2JEC A;  4Q0P A;  3MV1 1;  1O3R A;  1L7R A;  2LRP A;  2FHR A;  3RZZ A;  4EN0 A;  3RYK A;  4GD4 A;  2UWB A;  5EJZ B;  3VN4 A;  5F7U A;  2QNK A;  1W6P A;  1F4A A;  4FPH A;  4LIT A;  1W2O A;  2GME A;  2OA2 A;  1DLL A;  4R9B A;  4RGA A;  2RS3 2;  2WT2 A;  1YWK A;  4XUP A;  4GWJ A;  2HWE 3;  1H8T A;  5FWJ A;  1DBN A;  1R1A 1;  5L19 A;  3AKR A;  2Q1F A;  3EBR A;  3DPR B;  4XHB A;  5FP9 A;  1PNG A;  3BVC A;  4FQZ A;  3LWC A;  3I54 A;  3VKN A;  5JXI A;  4Q29 A;  1OH4 A;  5JIA A;  1RUC 3;  2RDQ A;  2RM2 1;  4FFG A;  3W9A A;  4FAG A;  4YZ5 A;  4PDW C;  3FFZ A;  4BDV B;  1HRV 2;  4RR3 A;  1UOF A;  2Z79 A;  4RHV 2;  1Q8V A;  4DIQ A;  2ZAA A;  3NJY A;  4NRP A;  3ZFG B;  4LBN A;  4XF1 A;  1LOF A;  3J8F 2;  5IHR A;  2FDG A;  1AX0 A;  1R09 1;  3M3I A;  3MEP A;  2VUA A;  3VDD A;  1ZZ8 A;  3M7A A;  4FP3 A;  1UIJ A;  3M3O A;  3OBR A;  5LA0 A;  1RJ7 A;  1CAW A;  4EZH A;  3PUQ A;  3WX5 A;  4CEW A;  4MXW B;  1ULE A;  4IV1 C;  5AVA A;  2ZKL A;  3FC0 A;  5L36 A;  1QH7 A;  4OHX A;  2ZAH A;  4DY5 A;  1PGL 2;  1UYZ A;  3ON7 A;  3ELN A;  4FPG A;  1JN2 P;  2X8K A;  3EO6 A;  4ES9 A;  3I2F A;  4BLJ A;  5J36 A;  3AM2 A;  4LO5 B;  1IKQ A;  4RR3 B;  2HBU A;  2O1Q A;  3WDV A;  4JX0 A;  4K40 A;  1O5L A;  2ZGO A;  2V5D A;  4AVB A;  4EZ4 A;  3HQU A;  5C3R A;  2CL2 A;  5GLU A;  1E57 A;  3H0O A;  2Q1Z B;  3N9Q A;  2WKK A;  1Q8Q A;  3CJX A;  3BTA A;  1XBF A;  1X36 A;  2ZJC A;  4BK5 A;  1R08 3;  4C1X A;  1VBD 1;  4MYE A;  1JXN A;  1CAW B;  3JXS A;  4LQR A;  5IW0 A;  3ZSM A;  2ERF A;  2Y8K A;  4CCK A;  4CEW B;  3GF6 A;  3OJB A;  2VMD A;  4AQT A;  1VPH A;  1QXR A;  1IGO A;  4P5Y A;  3DUI A;  4BQX A;  4BIO A;  4XMA A;  1M06 G;  4DEQ A;  5FXV A;  1UL9 A;  2AR6 A;  1ZBE 3;  4OMD A;  2D98 A;  3RZH A;  4ERO A;  5FMO S;  2UUR A;  4FAH A;  2XON A;  4Q0S A;  3HWJ A;  4WM7 C;  1UY0 A;  4Y20 B;  4QPG C;  1EAH 2;  1PIV 2;  4AOC A;  5L9B A;  1WMF A;  2YGL A;  4LUL A;  1H4G A;  2E7T A;  1W0N A;  1C3H A;  1E5I A;  2LM3 A;  5F3E A;  5LBE A;  4A7K A;  1UMI A;  2HWD 3;  5DDJ 2;  4OUL A;  2VJX A;  4CCC A;  3AZY A;  2ZEW A;  3MID A;  3CZU A;  1O59 A;  4QX0 A;  4WZC A;  4JHZ A;  1N3P A;  2AEY A;  2FMD A;  2WZR 1;  3NV4 A;  3OYW A;  3T2P A;  2Y38 A;  4XF4 A;  1HRI 1;  1B09 A;  5FZK A;  2IFW A;  3S5A A;  3DCQ A;  5GZD A;  4XFA A;  4FSJ A;  5F6K A;  1V9U 1;  1MEC 3;  3K4Z A;  3MPP G;  5KXE A;  1FOD 1;  1H6X A;  3BOP A;  4NHL A;  5KXB A;  5G04 L;  5CYY A;  3CU7 A;  1BEV 3;  4XOG A;  4HXC A;  2C9A A;  3VKM A;  2RDR A;  3POY A;  4Q4W 1;  3TEX A;  2BWA A;  1QOT A;  4E4H A;  2AC1 A;  3QH6 A;  3HEI A;  4QQL A;  5LA1 A;  2RR1 1;  2QFE A;  1GOG A;  5A6Z A;  3WNL A;  4XF0 A;  1ND2 C;  2PLV 2;  4I3P A;  4D7T A;  3C8X A;  3SNM A;  4LBO A;  1COV 3;  2XBO 3;  5FZH A;  4CCM A;  4LIU A;  4TSV A;  3BIW E;  3BPS A;  1CWP A;  4FBF A;  3B5L B;  4LHK A;  5FZD A;  3BI3 A;  1MR5 A;  5GZC A;  3VDA A;  3WD5 A;  3K75 B;  4HVO A;  4XW3 A;  5D8A C;  5FYZ A;  1Q8O A;  5GLW A;  2OVU A;  5A7Q A;  2HWE 2;  1JHJ A;  1ZBA 1;  3H7Y A;  3H42 B;  4GKX A;  5ANN A;  4ITC A;  2BZD A;  3IIA A;  3WF2 A;  4ASK A;  3ZXA C;  1ZZC A;  4XIK A;  3Q8E A;  3VL8 A;  1AL0 G;  3AJZ A;  4BYY A;  5C33 A;  1DQ5 A;  3INA A;  5LBF A;  3I2O A;  2HKX A;  3VLB B;  1GSL A;  4NIG A;  1RUC 2;  5DAW A;  2VH9 A;  2VM9 A;  5FOB B;  4Y1V A;  3NV2 A;  4HFS A;  5CG8 A;  2N7G A;  1S2E A;  4FPO B;  5ACA 2;  4CCD A;  2W1Q A;  4IE7 A;  3FN9 A;  4LHL A;  1OFN A;  1DFQ A;  1Y9M A;  4L2N A;  1W8W A;  3WHT A;  3LPF A;  1US3 A;  1WLW A;  1S55 A;  1LOB A;  1MS5 A;  3LPG A;  2L9L A;  2ADE A;  5LY2 A;  5FXZ A;  2VOT A;  5T5P A;  4MVT A;  3ZMO A;  1CES A;  1S2K A;  4MGT A;  2SLI A;  5JPN B;  4J6G A;  2BV4 A;  3H1M A;  3N7J A;  4LO4 B;  1D2S A;  4H7L A;  5FZE A;  1IS5 A;  1B35 A;  3WG1 A;  4XJW A;  2VZO A;  4G9S B;  2XG3 A;  3J26 N;  2XHN A;  4QDR A;  1XNC A;  3V64 A;  2BQP A;  3UK9 A;  2Y60 A;  4N43 C;  1JYV A;  1V6I A;  3LA7 A;  2MEV 2;  4K8R B;  1GZ9 A;  4RQP C;  4CDQ A;  2E9Q A;  3LZZ A;  1UZV A;  3WNM A;  1DQ0 A;  3AL5 A;  3PUH A;  4PIX A;  3K77 A;  4AHW A;  1QQP 2;  3N7L A;  4HON A;  2CGP A;  3POE A;  3L9J T;  5C8C C;  5A6Y A;  1AR7 1;  3K3O A;  5IAX A;  1R08 2;  2WNU A;  2ZOE B;  3PJY A;  4GMP 1;  4O9E A;  3KV9 A;  2WZ8 A;  5FZ3 A;  5CFC C;  5A1F A;  2WFF 3;  4QHO A;  2YB7 A;  2A5Z A;  5AC9 1;  1Y7B A;  2DUP A;  4IES A;  1NUK A;  1W9S A;  2C6S A;  2XVG A;  3FFQ A;  2C26 A;  3HD8 B;  2YY1 A;  2EID A;  1DGL A;  2QQL A;  1LAJ A;  1QOO A;  1OOP C;  5LBC A;  1QF3 A;  1SG3 A;  4D7S A;  4UWD A;  2NM1 A;  3A23 A;  4RA0 A;  3WG3 A;  3P5B A;  4CDQ B;  2BGC A;  5FY7 A;  5JR2 A;  1UXZ A;  2WA3 A;  4NOT A;  4JTN A;  1PMI A;  3CO2 A;  3THC A;  1ZA7 A;  3E97 A;  2HWD 2;  1D4M 3;  1N3Q A;  4XBN A;  3WR0 A;  2EIC A;  2VZP A;  3LQC A;  2WNU B;  1ALY A;  4PT6 A;  1GKB A;  1VJ2 A;  3AVS A;  1AR9 3;  5IFP A;  2WQ4 A;  3BIE A;  5BNN B;  5CIS A;  3KS7 A;  3ZYB A;  1GZT A;  1RHI 2;  3P1I A;  4K3U A;  2GC1 A;  3B7M A;  3NQH A;  3WV6 A;  4IND A;  3H8O A;  1IPS A;  1G9C A;  4AI0 A;  1XQN A;  3Q9O A;  2WA4 A;  1S0I A;  1UYX A;  2YGM A;  4WVW A;  3J9S A;  4JVA A;  4DS0 A;  3AKT A;  1UZ0 A;  5JZG C;  3RYP A;  3VBH C;  4AQS A;  1N3O A;  1KJR A;  1H2M A;  4E4S A;  4CZS A;  2PEL A;  4C8D A;  5L7O C;  5A3O A;  1OVP A;  1COV 2;  1YLL A;  1OI6 A;  2EAL A;  2XBO 2;  2ZHL A;  4O7X A;  4BK4 A;  1K5M C;  1W9W A;  2VW2 A;  1W03 A;  5LAS A;  2VE1 A;  1U5I A;  3OPW A;  3RI8 A;  4YVW C;  1TNR A;  1OF3 A;  5FPZ A;  1DYO A;  4Y4Y A;  1FAT A;  2WT1 A;  3T1L A;  5F1R A;  4AFD A;  3NVC A;  3R4U A;  3MW2 A;  3MW3 A;  2JEN A;  4GMP 0;  1TME 1;  2V5Y A;  4AHY A;  5KHJ A;  3TB0 A;  2BGO A;  1AUY A;  1VBD 3;  1YNA A;  2TNF A;  5JI7 A;  3VGI A;  4CDW A;  4FFF A;  4AYU A;  1CAU A;  4HVR A;  3ATG A;  5FP7 A;  2XPJ A;  5LW9 A;  1UZY A;  1WMX A;  2A3Y A;  3ACG A;  3RYR A;  2W87 A;  3IMN A;  4O9G A;  1PMH X;  2Y0O A;  5FP3 A;  1I1E A;  4LOS A;  3NAP A;  4IEX A;  4C90 A;  2WO7 A;  3AFK A;  4PI2 A;  3POW A;  2CY6 A;  5I0R A;  4AI8 A;  1ENX A;  1KS5 A;  2WO2 A;  3OY8 B;  3S7E A;  3WUD A;  4KG8 A;  5BNQ A;  1ENR A;  4XFI A;  1Q8S A;  1S0F A;  1QH6 A;  4AG4 A;  5IWF A;  1OA3 A;  3RMX A;  2F6B A;  2RDS A;  5BY5 A;  1I9R A;  3W5M A;  3FWE A;  4JGZ C;  2XWJ B;  4UFI A;  4CDW B;  2E53 A;  3IWZ A;  4JQR A;  4W6X A;  1CAU B;  1HRI 3;  2YRO A;  4B7E A;  1WUV A;  2IXH A;  1LOA A;  4UW6 A;  1KXG A;  2MHF A;  2D93 A;  1NCR C;  3ILN A;  5FO7 B;  1IHM A;  1U5Z A;  4XFC A;  3CBN A;  4JRA A;  2YZ4 A;  1SLT A;  1RMU 1;  2B8M A;  3VBR A;  4BB3 A;  2UYA A;  4DUV A;  5C9A A;  1KQR A;  3NAP B;  4XFF A;  4I0A A;  3RJR A;  4TLF A;  1SMV A;  2VXR A;  3U10 A;  2DVG A;  1WWY A;  2W5F A;  3AP9 A;  1LOC A;  5FY0 A;  2BOJ A;  1EPZ A;  4D94 A;  2DTY A;  4OI0 A;  1FPN 1;  2CV6 A;  1C8M 2;  3ZR5 A;  5T3N A;  2LS6 A;  1W8F A;  3ME2 A;  3WP6 A;  4AQ6 A;  2QUO A;  1AYN 3;  2D3P A;  2YBS A;  3IB3 A;  2ZGU A;  4A42 A;  1GWL A;  1JW6 A;  4Q5O A;  1PM4 A;  2ID4 A;  3HAG A;  2WFF 2;  4UOJ A;  3Q8C A;  1ONA A;  3DGT A;  1XYP A;  3BB6 A;  2J1U A;  2CSG A;  5JIU A;  1ULP A;  3NJZ A;  3ZFF A;  2FDI A;  3HPN A;  1Q3E A;  4ZZ8 A;  2BW8 A;  5A3U A;  5CZK A;  5C9A B;  4CE8 A;  3MFA A;  2PHU A;  4RN5 A;  4Q27 A;  4LE4 A;  3ZYP A;  3K48 A;  3WHU A;  1W90 A;  2JDA A;  1JH5 A;  3C7H A;  3O1S A;  2V73 A;  2W2I A;  3PUA A;  2NMO A;  4A45 A;  4FP2 A;  1D4M 2;  1UY3 A;  2Y6F A;  3PTY A;  1NA1 C;  2ZGN A;  3MIE A;  1QGL A;  4LIV A;  5FFO C;  2ZZJ A;  1UW8 A;  1W6Q A;  1YIF A;  4E8D A;  1GQP A;  5JVV A;  1Y9Q A;  2Z42 A;  1IZ3 A;  1QJY 1;  1AR9 2;  3AZZ A;  3VB9 A;  5FYM A;  3QCW A;  1J58 A;  2LAL A;  4GH4 B;  3MF9 A;  3ZN6 A;  1R09 2;  4EV0 A;  3O1V A;  5CAZ A;  1FV3 A;  5FV3 A;  4KGQ A;  1VAM A;  4PBP A;  3CF6 E;  3Q8A A;  3VBO C;  4PLM A;  5CA6 A;  1N1T A;  3JBG 1;  2D5H A;  3LEI A;  5DZG A;  3ZXE A;  4B1M A;  5CAD A;  4QU2 A;  3U1X A;  1G9B A;  2DFC A;  2R7E B;  1G86 A;  4XXA A;  5H9S A;  1GOF A;  1OLM A;  5JXH A;  2QBX A;  5KWR A;  1AL2 3;  1AYM 3;  1J3Q A;  1FMD 3;  1H30 A;  4FXK B;  4XDP A;  2ET1 A;  2E26 A;  1IPK A;  2A6Z A;  1KEX A;  2QQP A;  5KXC A;  1LOG A;  2YHJ A;  1DQ2 A;  1GOH A;  1UYY A;  2RV9 A;  4M3C A;  2JG8 C;  3ZYF A;  1JS9 A;  5C4W C;  3T2T A;  1YQ2 A;  4DXS A;  3ZYG A;  1W6Q B;  2QQO A;  3AYD A;  2WS9 1;  1W05 A;  1OH3 A;  3OUJ A;  4IGQ A;  3RI9 A;  4FOV A;  3T2Q A;  4CDX C;  3ZSL A;  5C3P A;  1OQ1 A;  1BBT 3;  2P6C A;  4QX7 A;  1SFY A;  1TMF 1;  2W1S A;  1OQE A;  4FOQ A;  2CTV A;  4LXL A;  4Y5S A;  2ZZQ A;  2YFU A;  4NRQ A;  3KVA A;  2XXZ A;  3LCP A;  4BIS A;  5CKM A;  3VBS A;  1DGW A;  2WN3 A;  1BK0 A;  4JKL A;  4EN8 B;  1VBD 2;  4PLO A;  4UI9 L;  5J48 A;  3U75 A;  1HJF A;  2A6Y A;  2GC3 A;  3HN1 A;  3Q8B A;  4QU1 A;  2R04 3;  1WCK A;  4WM8 A;  3VBF A;  2WNV C;  1SAC A;  3W59 A;  1UU6 A;  3ECQ A;  1VMH A;  2CAV A;  2ZAC A;  3CJI B;  3FHI B;  3UV9 A;  1UYP A;  1R64 A;  3LE0 A;  4NAM A;  4XJ8 A;  3WDT A;  4OUM A;  5GLV A;  2JB4 A;  2BVB A;  2PHF A;  2BBA A;  2G19 A;  1GQG A;  5EPA A;  3O1P A;  1DCS A;  3HT2 A;  3PLQ A;  4NPR A;  4OVE A;  4Q4X 1;  4NJ4 A;  1WBF A;  4YGD A;  2X05 A;  5J7M A;  4OHZ A;  4P9Y A;  3A21 A;  1HKD A;  4HK8 A;  5ABJ C;  4FXG B;  1FYU A;  1RUD 1;  1FV2 A;  1QJU 3;  4QM9 A;  5ANQ A;  5JXJ A;  2YYO A;  4CCO A;  3VBS B;  3VUO A;  4P00 B;  3TAY A;  2WZR 2;  1PHM A;  3VKF C;  4U36 A;  5IK7 A;  1POQ A;  1NLS A;  2YU1 A;  5A3W A;  1CIY A;  1HRI 2;  3VBU C;  3FX3 A;  1OKO A;  1Z7S 3;  4XIO A;  3ZYJ B;  1S0J A;  1UO9 A;  1MS9 A;  1S0D A;  2ORX A;  2XVK A;  1V9U 2;  4Q4V 3;  3KMH A;  4TN7 A;  2ZTN A;  2JDZ A;  4R8H A;  5LBB A;  3VBF B;  1AZD A;  1JZ6 A;  2DCZ A;  3GZT B;  4C1W A;  3K51 A;  1CPM A;  1NLQ A;  2I74 A;  2PAK A;  4GJY A;  3ZFE C;  2X5I A;  1XSR A;  2WO3 A;  5EJ3 A;  4P9I A;  4AGG A;  3R4S A;  1CX1 A;  2CWM A;  1UKR A;  3PME A;  3H8U A;  3ZN5 A;  1NQJ A;  2JKX A;  4MET A;  3GZE A;  3TN9 1;  2A73 B;  5A80 A;  2PHW A;  1JBC A;  1G8W A;  1U0A A;  4JKK A;  3LDR A;  3SIS A;  2BNM A;  3OUH A;  4LOR A;  4Y3O A;  1SEF A;  2Q8E A;  2VNG A;  1SZB A;  5IYY A;  5JMO A;  4XUO A;  4TWT A;  1URX A;  2NQY A;  1K3I A;  2XML A;  4BOW A;  1GMM A;  1NY7 1;  4HN1 A;  2XR4 A;  1AR8 1;  2GDF A;  3WP5 A;  3GZU C;  4QKB A;  4ARX A;  1DG6 A;  1PO2 3;  2P5B A;  4EWE A;  2X5I B;  2RHP A;  3UKV A;  5BV6 A;  4WBB A;  1QIQ A;  4OHW A;  4CEY A;  3HR9 A;  5GZG A;  5T5O A;  2VMC A;  5A7P A;  4I30 A;  1H1A A;  4GB3 1;  4J25 A;  5C71 A;  3B02 A;  1POV 3;  2ZX2 A;  4UFK A;  5DAV A;  1N47 A;  4BE3 A;  1RUG 1;  2C1F A;  1L3J A;  1W39 A;  4K9S A;  5EV7 A;  5LEJ A;  1RVF 1;  2BGP A;  4AI9 A;  3CL1 A;  2C4X A;  4L8Q A;  1HRV 3;  3KT1 A;  4AW7 A;  3CKH A;  1VP6 A;  5A7N A;  1SBE A;  3KV6 A;  2XB6 C;  2ZGS A;  2NLR A;  1AR6 1;  4CU8 A;  4PLN A;  3BKZ A;  1WCD J;  1V6N A;  2W1W A;  3J8F 3;  4QDS A;  1VRH 1;  4UW5 A;  2W3J A;  3URF A;  4LA3 A;  3JU9 A;  4LO8 A;  2GN7 A;  4PIY A;  2VMH A;  1BQP A;  4S2D A;  2WWU A;  4CEY B;  1AL2 2;  1AYM 2;  1FMD 2;  1CJP A;  3A4U A;  5IFT A;  1W6O A;  3M70 A;  1D2Q A;  3A7Q A;  4H55 A;  1LB2 A;  3GBW A;  4MO3 M;  1DF0 A;  2IXJ A;  5FZ4 A;  4JDM A;  4G3Y C;  3SIT A;  2GNB A;  3MPB A;  5C6C A;  3KF3 A;  5HXV A;  4XQ4 A;  3LIH A;  1NAE A;  5FYU A;  3WDX A;  4CXW A;  1RUI 3;  1V0A A;  1PK6 C;  3ZLI A;  1QNW A;  4BZ4 A;  5FO8 B;  1AR7 2;  2PMW B;  1AXZ A;  1CZS A;  3N9O A;  5E16 A;  4UW4 A;  4XF9 A;  1ODM A;  2JJ6 A;  1LED A;  3GAL A;  3H1Y A;  4GAL A;  2D40 A;  2VMI A;  2WJS A;  1BJQ A;  1QXP A;  3OGR A;  4AFC A;  5LZ6 A;  4XQW A;  1C4R A;  2DBN A;  2LRO A;  3OGS A;  3H3Z A;  4NPM A;  5FYH A;  2CDP A;  2DVA A;  1A8D A;  2D6N A;  2DVF A;  1W6M B;  1W6O B;  2JB8 A;  1AX1 A;  1UU4 A;  3G6J B;  4FPF A;  4AEM A;  2NN8 A;  1XRU A;  1VAV A;  2J7M A;  2Q8C A;  5A3N A;  1LTE A;  1ND3 C;  4LUK A;  2IZW A;  4RS5 C;  1OA2 A;  1NCQ B;  1UOG A;  2OT7 A;  5CBL A;  2FZ2 A;  2Y6L A;  2A3W A;  2W39 A;  5J3U A;  4AF9 A;  3TNQ A;  4ZON A;  1W8O A;  4AQ2 A;  1TVG A;  3AK0 A;  5AVP A;  2IFR A;  1PIV 3;  1QJU 2;  4CU6 A;  5KC5 A;  4FTB A;  2WWS A;  5GZF A;  1JYX A;  2OII A;  5FMD A;  5FZ8 A;  4K20 A;  4QQ2 A;  2XOM A;  4N7I A;  3SKV A;  1Z7S 2;  2PYT A;  1SLC A;  4FTS A;  3OCP A;  5DDJ 3;  3UT0 A;  1W06 A;  4XAE A;  2Q0A A;  2ZML A;  1YJK A;  2VTX A;  3O1T A;  3HT1 A;  2Y6G A;  1YHF A;  2Z69 A;  3UKN A;  1HX6 A;  3KT4 A;  4XAB A;  4XUT A;  5CIR A;  1NQD A;  4D7Y A;  2ILM A;  3AMM A;  4YW2 A;  3IZO A;  3ZR6 A;  1Q56 A;  2OXB A;  4PQQ A;  4V2V A;  1RUN A;  5LWB A;  1GU3 A;  5HCH A;  2GC2 A;  1U5Y A;  2ATF A;  3C3V A;  3OTF A;  5B4X A;  1DIW A;  3I7D A;  2GNT A;  2VZU A;  4B4P A;  3N9M A;  1YQ8 A;  5GLZ A;  1LNS A;  3WY6 A;  3ZM8 A;  2AEZ A;  4XCA A;  3MLK A;  2FDJ A;  3RGB A;  2RS1 1;  2NYY A;  2X53 S;  4AEK A;  3BTX A;  2PHX A;  1HB1 A;  3VHO A;  3IT8 A;  3F2Z A;  4PQ9 A;  3VZK A;  3D8C A;  3I2J A;  4Y4R A;  3UJO A;  5BNO C;  2WFP A;  1W3V A;  5ERL A;  4Z2A A;  2IC1 A;  2PA7 A;  2UY8 A;  2A71 A;  1A6C A;  3B01 A;  1PO2 2;  5CFD A;  2JE7 A;  1FX5 A;  4AVT A;  2C24 A;  1G9D A;  4AGV A;  3AMN A;  4IV1 A;  5FZ7 A;  4NAO A;  1O7F A;  3KQR A;  3ACH A;  4LKF A;  1UX6 A;  1RUJ 1;  5KR7 A;  2G9Z A;  1JYW A;  4ZU5 A;  3OGG A;  2VUD A;  4FFI A;  3USS A;  4XEZ A;  2HJI A;  3LKJ A;  4AED C;  3T3Y A;  1SQ4 A;  1W8Z A;  5K0U C;  3OOX A;  1JMU B;  4FPK A;  1C5I A;  1JHN A;  1RUE 1;  2B4K A;  3FUO A;  4JKM A;  1HQL A;  5FZB A;  2R6Q A;  3E5X A;  4QHZ A;  2VAU A;  1MVE A;  1OVS A;  1S1A A;  3T4V A;  1FAY A;  1DGR A;  5BYN A;  4L0P A;  3ACI A;  5JLV A;  5IVC A;  1E5H A;  4IDZ A;  5CFD B;  4KWJ A;  2DVD A;  1N1V A;  1ZRI A;  1W6P B;  2A6W A;  2VCA A;  4AI2 A;  1F2N A;  2YV8 A;  3B94 A;  2DU1 A;  4LA2 A;  4QB2 A;  1ZRE A;  5C3S A;  1VBB 1;  3KZ4 C;  4B1L A;  1H8T B;  1RMU 2;  2JDK A;  1VBC 1;  2B46 X;  3DPR C;  1EUU A;  4OI1 A;  4P9X A;  2ZEX A;  1NX9 A;  1F31 A;  5FLH A;  4GJZ A;  4WM7 A;  2K2S A;  4IQP A;  4QPG A;  4HMZ A;  1RUI 2;  1TNF A;  2RMU 1;  4M01 A;  2MEV 3;  3BAL A;  3KB5 A;  1A34 A;  3ZFG C;  1WCQ A;  2WQZ C;  1QJZ A;  5EJ1 B;  4ZXK A;  1OFS A;  3UGG A;  3SCG A;  1QQP 3;  2VUC A;  2WR9 A;  2G1M A;  4LBQ D;  1GV9 A;  3DF0 A;  4FOW A;  3VDD B;  1IPJ A;  4F8A A;  4D6Q A;  2EAK A;  4Q1R A;  5HV0 A;  4NWV A;  2JDY A;  5FZG A;  3TRS B;  5KHI A;  1PO1 1;  5FUP A;  5J1X A;  1IQA A;  1EV1 1;  4F7Z A;  2LTN A;  4Y1U A;  1JYI A;  1WBL A;  3AYE A;  3CIH A;  5FYI A;  2KD7 A;  4MSV A;  1RUF 3;  1LHV A;  1K5J A;  2BTV C;  4I09 A;  3AMQ A;  4K21 A;  3NNF A;  4KL1 A;  4XDQ A;  4BH9 A;  4OYU A;  4XTP A;  2ARC A;  4RR3 C;  1X9T A;  2VGD A;  3LSD A;  3OF1 A;  2GH8 A;  3O7O A;  4AE2 A;  2DFB A;  2E7A A;  2BOI A;  3BYW A;  3AP6 A;  1F35 A;  4QT6 A;  5F5C A;  5JDB A;  1ND2 A;  4D8M A;  5IVB A;  1UPS A;  1VLN A;  1XPW A;  4NRM A;  1VMF A;  2B42 B;  4MGQ A;  3S5Q A;  3T0D A;  1I3H A;  1J3P A;  2K46 A;  3SH3 A;  5FIX A;  4IV3 A;  3U4S A;  4IEO A;  1HN1 A;  1VE0 A;  5F5I A;  3JBG 2;  1OF4 A;  1XC6 A;  4CEW C;  1WMD A;  1X50 A;  4XTM A;  5I8T A;  1LGB A;  4Y1Z A;  2KM2 A;  5JR7 B;  4RGG A;  1JYN A;  1IKP A;  2WSV A;  2XJQ A;  4NR1 A;  1RHI 3;  4RGK A;  2BFU L;  1QKQ A;  2EIE A;  4HVQ A;  3BTY A;  5HCB A;  1US2 A;  3GCW A;  1HXS 1;  1UAI A;  5C3Q A;  2Y6J A;  3IDA A;  2Q4S A;  3WW4 A;  5JOW A;  2XUE A;  3VD7 A;  1XJA A;  1GWM A;  4WV8 A;  1ND2 B;  2WS9 2;  4YZ2 A;  4I3G A;  1HIX A;  4CCJ A;  1ASJ 1;  2Q30 A;  1ZRD A;  1UMZ A;  1GNH A;  4ZKT B;  5FRE A;  2I07 B;  4IV3 B;  4JTO A;  2YC2 A;  4P5H A;  3KCX A;  3V0B A;  3KHC A;  4YLZ A;  3OYW B;  1YIP A;  5F3G A;  2XJV A;  3O14 A;  2VOV A;  4W4Z A;  4P02 B;  1RL3 A;  2WC2 A;  1F4H A;  2C5D A;  3NNG A;  2EVX A;  3OEB A;  1PMJ X;  3NKT A;  3VHP A;  2HWC 1;  3RFR A;  4AVA A;  4Y5Z 0;  3WW2 A;  5C5U A;  4NVP A;  1ZZ6 A;  4UFM A;  4LPL A;  1WZX A;  2Q5T A;  4IEZ A;  4LNV A;  4FI9 A;  1BVP 1;  3ZXJ A;  3LA3 A;  3I2G A;  4B4R A;  3VD3 A;  4Q4X 2;  5DUV A;  5FPA A;  3GBG A;  3JD7 3;  3RRD A;  3AXD A;  4U2A A;  4NRO A;  5HCA A;  4NWW A;  2D3S A;  1WW5 A;  3I49 A;  3IDC B;  4E4D X;  1VAL A;  2R1B A;  4I0W B;  5C8C A;  5AFE A;  2JWP A;  3WNN A;  3DXT A;  2VZR A;  4HET A;  4XVH A;  2VXJ A;  3N7K A;  1SDD B;  2WZP P;  3V0B B;  3G7D A;  5BXX A;  4AI1 A;  2R30 A;  5E88 A;  1REE A;  3ZDV A;  5D2A A;  3KVB A;  1QDO A;  1IG3 A;  3PTR B;  4XFG A;  3VHN A;  4BA6 A;  4BM8 A;  2SBA A;  2R06 3;  1WW7 A;  2RS5 1;  3OG2 A;  4A7Z A;  5F3C A;  3ZSJ A;  4QD2 A;  1YI9 A;  3ENR A;  1S4C A;  3ZMN A;  2HWB 1;  2ZBJ A;  3SEP A;  3WG2 A;  4UW3 A;  4KNC A;  5K7P A;  1IS4 A;  3O1M A;  2Z4F A;  3R4D B;  3ZSE A;  5FCC A;  4MUV A;  3TN9 2;  5BNP A;  1KGY A;  1H2K A;  2YBP A;  3JZV A;  1QJE A;  4GXL A;  3UES A;  2J1E A;  1J59 A;  3RWK X;  2QQW A;  4D6R A;  3P6B A;  4Q2F A;  4XJZ A;  2R07 1;  4Q26 A;  2Z2S B;  1C8M 3;  5DG2 A;  3O0W A;  5EXO A;  3OUI A;  1NY7 2;  2H6B A;  2P6H A;  3AMP A;  2MPF A;  1W99 A;  4I0B A;  5I0S A;  1ULF A;  4BJ0 A;  4DRV A;  5EYX A;  5JAX A;  3MYX A;  2UWC A;  1B35 B;  1RUF 2;  3AP4 A;  3MGU A;  1HDK A;  1YFU A;  4NHK A;  4UFL A;  1IG0 A;  1R1A 3;  2IXC A;  4QX1 A;  3VBH A;  5FR3 A;  4A4A A;  1C1L A;  4GWI A;  1PGW 2;  5CKQ A;  5BNP B;  1ZYB A;  3NRU A;  5EFU A;  3J7H A;  5K4L A;  1QY4 A;  2E63 A;  4DQA A;  3POG A;  4OI4 A;  4Q8L A;  1RC6 A;  3MIC A;  5L7O A;  1GBG A;  2AYH A;  2RM2 3;  3I3Q A;  1RUG 2;  4IEW A;  1NYW A;  1RED A;  4PI0 A;  1ULC A;  1ZNP A;  1K5M A;  4DO0 A;  2ARA A;  4YVW A;  5FJK A;  3WDW A;  3T2O A;  2VC9 A;  3IDE A;  3OBZ A;  1AR6 2;  4BQ1 A;  4CP9 A;  1H0B A;  4DUW A;  4XZU G;  1VRH 2;  1R09 3;  1UD1 A;  1OD5 A;  2HEY F;  3IN9 A;  2FCU A;  2RE9 A;  2VG9 A;  4A6O A;  2D5F A;  4IXL A;  4C0H A;  3TEY A;  5J09 A;  4TTG A;  1C28 A;  3ST7 A;  4XIL A;  2JXA A;  3PVB B;  2RJL A;  1AXY A;  1BMV 1;  4CDQ C;  4ES8 A;  1QJX 1;  4LKS A;  1LEC A;  4BQ5 A;  3ORJ A;  4Q4Y 1;  2DU0 A;  2GND A;  4A3Z A;  4A3X A;  2ZEY A;  1LU1 A;  4BQ4 A;  1JZ7 A;  3PU8 A;  5FK8 A;  1J83 A;  4EWA A;  3NO8 A;  2F4P A;  2IXL A;  3SXW A;  1LGC A;  4L9B A;  4N9H A;  2HWF 1;  2WNU C;  3AP7 A;  3NV3 A;  4MZU A;  5EWS A;  4CDU C;  5HI0 A;  1QNY A;  2DCJ A;  3BOW A;  1X7N A;  5A3L A;  1QU0 A;  3N9L A;  5A7O A;  3IBM A;  4CP9 B;  5BNN C;  5I0U A;  2ZGK A;  1UY1 A;  2O0O A;  2QQU A;  4KG0 A;  5FP8 A;  2WAO A;  2HBT A;  5K8S A;  4NMI A;  4DZG A;  1F15 A;  1NE4 A;  1VBE 1;  3POB A;  1V6M A;  2E6V A;  2HLE A;  2TBV A;  3QOP A;  4HKL A;  1BKZ A;  4X6R B;  4IET A;  2NMN A;  1EV1 3;  3ZIW A;  4COY A;  1VB2 A;  1NKG A;  1XND A;  5EHD A;  4YYO A;  4BXS V;  5JSR A;  1DU3 D;  5C5T A;  4DXR A;  2YU2 A;  3JD7 2;  2VQU A;  3GGL A;  1W04 A;  4QMA A;  5FZF A;  4FVV A;  2VU9 A;  3WW3 A;  4QHB A;  2D43 A;  5A1L A;  5KC6 A;  4ISQ A;  5H9R A;  5AFB A;  3TWI A;  1PZ8 A;  2E7Q A;  3VZL A;  1CQ9 A;  1PVC 1;  2XHK A;  4TYS A;  2QQM A;  2Y6H A;  3TBD A;  1ZRF A;  1V6O A;  3LEM A;  1G6N A;  3LOI A;  5GM0 A;  3FJS A;  2R06 2;  2WZR 3;  3KCC A;  5A6X A;  2BBV A;  5FMB A;  1LOD A;  4UBG A;  5FPV A;  1STM A;  2QKD A;  3B00 A;  4AK3 A;  4CRQ A;  3K2O A;  3LB9 A;  3PUS A;  4I01 A;  4RFR B;  1V9U 3;  2D97 A;  3GHN A;  3WQ7 A;  1FOD 3;  1Q43 A;  2YPD A;  4DPN A;  1KFX L;  1NXD 1;  2VPV A;  5HCF A;  5FLJ A;  1DP0 A;  3Q8F A;  4Q4W 3;  4BWO A;  4COV A;  4F3J A;  4WZF A;  2V4V A;  4L97 A;  3KGZ A;  3PMS A;  3DYM A;  4R52 A;  5IAT A;  1Y3T A;  4N8M A;  2RR1 3;  4N53 A;  4RHV 1;  4XC9 A;  2P3Y A;  3ABZ A;  2ARB A;  3HBK A;  1OLR A;  3ZXK A;  4S2G A;  2XDV A;  3MW4 A;  5FK7 A;  1NXM A;  5LRS A;  2OW4 A;  4Q0Q A;  1AVB A;  2YDE A;  3GJB A;  5FMO L;  1RUH 1;  2VBB A;  1PX4 A;  3H8R A;  5E8A A;  4AHX A;  4R9A A;  1PGS A;  3PIG A;  4YPJ A;  3VBO A;  2PHT A;  1E5R A;  2A70 A;  3KT7 A;  3OPT A;  4LR4 A;  3SKJ E;  5FZ9 A;  4CPB D;  3GBF A;  2HEW F;  2D6K A;  3FMG A;  3NAP C;  4OUS A;  4QKD A;  1ZBA 3;  3VBR B;  3WT3 A;  1R1A 2;  3ALQ A;  4CA9 A;  3ZYH A;  4M0H A;  3ZDS A;  5FY4 A;  3I97 A;  1W8T A;  2VZ1 A;  2WAA A;  3O1R A;  4MHU A;  3ZVX A;  1IS6 A;  4PF5 A;  4CP2 A;  2OZ6 A;  4LJH A;  2RM2 2;  5C4W A;  4N53 B;  1SBD A;  4LBL A;  3I2H A;  3UNP A;  2A75 A;  3BU7 A;  3ZO0 B;  2UY9 A;  4CDX A;  1RUE 2;  2J1S A;  4MOA A;  5GJ6 A;  2WYS A;  3MFC A;  4ZS2 A;  2BEO A;  3OBT A;  4K1Z A;  4YW5 A;  3ZOI A;  5IK5 A;  2V4A A;  2JD9 A;  2EIG A;  2ZX4 A;  3H9A A;  4IGP A;  3LF7 A;  5FYY A;  3VBO B;  4COW A;  1AHS A;  5DUX A;  1ZA4 A;  2VOK A;  1V6J A;  1ZRR A;  4YW7 A;  1VBB 2;  3S57 A;  4QB6 A;  3ZFF B;  5C9A C;  3UKT A;  4BME A;  1M4W A;  1VBA 1;  1AX2 A;  5FBJ A;  5FYC A;  4SBV A;  2E51 A;  4P9L A;  4Y22 A;  1EAH 1;  2H0B A;  2XJP A;  4YFW A;  4CXY A;  1Q5O A;  4ASM B;  4BCU A;  4AVS A;  4Y1Y A;  5FZM A;  4JV4 A;  3PUR A;  3T4H B;  1MZE A;  2RJ2 A;  5FXW A;  2X29 A;  4OZO A;  2K0G A;  4JDO A;  3U78 A;  4GZ9 A;  3S6P A;  2BYV E;  4COU A;  4GH4 C;  3I59 A;  1UKG A;  3T08 A;  1UCX A;  1XYO A;  1O5U A;  3NMB A;  3UL2 A;  4IEY A;  2XKP A;  4H7M A;  3ZN6 B;  5B2G B;  3W20 A;  4M00 A;  1AR7 3;  1YQ5 A;  3VBU A;  2J1R A;  4GMP 3;  5DUU A;  2ZHN A;  4X6Q B;  2OPK A;  3L2Y A;  4D3W A;  1P8J A;  4XYX A;  4KGG A;  2VVE A;  4LLO A;  3D4K A;  5AC9 3;  1EV1 2;  4YVS A;  4HAN A;  2VOW A;  3HNM A;  2WYF A;  5F5Q A;  1GLH A;  4LT5 A;  1GNY A;  3WNP A;  3ZX7 A;  1O4T A;  2ZGQ A;  2NZ9 A;  2WO1 A;  3SCF A;  1OD3 A;  1ZZ9 A;  2XGX A;  4JAA A;  4M3C B;  4ATE A;  4Z07 A;  2OX0 A;  1GR3 A;  2WBK A;  5T50 A;  1I5P A;  4LK7 A;  4LOT A;  2QTW B;  4CUB A;  1WLD A;  1IS3 A;  1U12 A;  4E8C A;  3I59 B;  4GA9 A;  2QE3 A;  2DWR A;  3M3E A;  4KH9 A;  1GNZ A;  5KHG A;  1T6B X;  2XL7 A;  2B39 A;  3VBU B;  5FDB A;  3U4X A;  5FLI A;  3W58 A;  4BXF A;  1LEN A;  2BP6 A;  4CP0 A;  3D5O A;  4JRL A;  1AJK A;  2OS2 A;  2XJR A;  1ZX5 A;  2P34 A;  1DHK B;  4WM8 B;  4YVS B;  3WNO A;  1ZZ7 A;  3CJI C;  1XNT A;  2IXK A;  1MQT A;  3OGJ A;  1FOD 2;  4P9G A;  2VMG A;  5F8P A;  1C1F A;  3NW4 A;  4EYU A;  4LUM A;  4DUX A;  4OCT A;  2PXJ A;  2VZV A;  4OZX A;  4CTE A;  3I3E A;  1RUC 1;  4OQ9 A;  4Y1X A;  1HXS 2;  2XKO A;  3K4D A;  4Q4W 2;  4XJA A;  2D6P A;  1O8P A;  5T55 A;  1RJ8 A;  2FCT A;  1BVV A;  4XPV A;  3MV0 1;  5FYV A;  5FZI A;  4Z8B A;  1O3Q A;  5T54 A;  2W0X A;  3P3P A;  2RR1 2;  2QQK A;  4ZU7 A;  5LAT A;  1K45 A;  1SFN A;  5APA A;  1OUS A;  2W95 A;  4IE4 A;  3VBS C;  2AH2 A;  2GN3 A;  1RXF A;  2EAA A;  2WAB A;  2ZS6 B;  3KV5 A;  3N7M A;  3QLQ A;  4LKD A;  4XMI A;  1U5X A;  5FPL A;  1H8V A;  4IUG A;  1EPW A;  1OHF A;  2VL4 A;  1X82 A;  3LFI A;  1LEM A;  3WDY A;  2FDF A;  1BZW A;  1GQH A;  3NNM A;  4XAA A;  3IDB B;  5CU1 A;  3VBF C;  3RWN A;  4AL9 A;  4UAP A;  5FPX A;  4JGY A;  2NP0 A;  1TME 3;  4XE9 A;  1VBE 3;  3WF3 A;  3OPZ A;  1MQT B;  3F95 A;  1OLM E;  4B8E A;  1ZBA 2;  2FD8 A;  1JZ4 A;  2DUO A;  4YG3 A;  1LHU A;  2PAE A;  3HNY M;  2XLF A;  4ASL A;  2VW0 A;  5A7W A;  3U0Z A;  3P3N A;  3N9N A;  3GNE A;  3O5S A;  4M3C E;  1XNK A;  5FY5 A;  3LGR A;  1SDW A;  3KD4 A;  4BU2 A;  1YO8 A;  5FKB A;  1JU3 A;  4KWL A;  4YM0 A;  3RZG A;  3RG0 A;  3MIG A;  2JG9 A;  2J1T A;  3LSE A;  2JDP A;  5H9Q A;  2D6L X;  1R08 1;  4HT1 T;  3BUC A;  5JWP A;  2J22 A;  4CXX A;  1PVC 3;  1JZ8 A;  1F8V A;  3APB A;  1PGL 1;  2ZX3 A;  3RVH A;  2OZJ A;  2ENR A;  4QPY A;  1H2N A;  1NOV A;  1D0H A;  4MHR A;  4YGE A;  4ARY A;  4JGY B;  5J98 B;  3A0K A;  3AVR A;  4HK9 A;  1UNB A;  2RS5 2;  3AC0 A;  3AMH A;  3S7I A;  1ZBE 1;  2X5I C;  1XU1 A;  4GUL A;  4LO7 A;  4LBK A;  1YI7 A;  3WP3 A;  2EXK A;  1SCR A;  5CNA A;  3A0N A;  1W6N A;  3SLI A;  4QXK A;  4URA A;  3SCH A;  5A7W B;  2BVV A;  5DUW A;  2HWB 2;  4QPW A;  1J84 A;  3SH4 A;  1O4Y A;  3E1F 1;  2B45 X;  2UWA A;  4H14 A;  4IEP A;  5KHH A;  4AFB A;  1NG0 A;  1RMU 3;  1CJD A;  1MZ5 A;  1RGS A;  1JUH A;  1NZC A;  2ZX0 A;  3HIF A;  4UF0 A;  4I02 A;  5A3T A;  4LHS A;  3WIN E;  2JG9 B;  3GHM A;  5FY1 A;  3VKO A;  4DNY A;  4W6Y A;  3UYJ A;  2GH2 A;  2JX9 A;  1JYC A;  4MGI E;  1X9P A;  2IWG B;  1FPN 3;  1KJL A;  1X33 A;  2P2K A;  3GJA A;  4XAC A;  4NIA A;  3U11 A;  5JSP A;  2ADD A;  3LIG A;  1V00 A;  2GMP A;  1YQC A;  5KBF A;  1RUH 3;  1MEC 1;  4AEJ A;  4EE2 A;  3B9I A;  4AZZ A;  2WWJ A;  4DXT A;  3RQ0 A;  3WDU A;  4CUC A;  2XWB B;  5AC9 2;  1YFW A;  5DAX A;  3SQO A;  1BEV 1;  4H2A A;  1W6N B;  1YUD A;  4X8N A;  3N35 A;  1CD3 G;  4KWU A;  1Q8P A;  4V1P A;  1T6G C;  3AB0 A;  3KGL A;  1S0C A;  2JE8 A;  1UPI A;  4UF0 B;  3CQO A;  2WLP A;  1GWK A;  1KD7 A;  4IE0 A;  4QKF A;  2F4L A;  1COV 1;  4RL7 A;  2XBO 1;  1W9T A;  5FQ0 A;  1HQW A;  3O0V A;  2GU9 A;  2W9X A;  3ASI A;  2OUJ A;  4QPI A;  1OQD A;  1OUR A;  3T1M A;  3I2I A;  5IT6 A;  3FLP A;  4A6S A;  4AR2 A;  1FI2 A;  1QJY 3;  3NJV A;  3E6D A;  2O8O A;  4RD7 A;  3M8L A;  5FYS A;  1JYT A;  3MLJ A;  4FPY A;  3T0A A;  5LA9 A;  2F17 A;  2QZ3 A;  3ZN4 A;  1EY2 A;  1Z78 A;  1G9F A;  2P4E A;  2XL9 A;  4M4R A;  4JDN A;  4NN0 A;  1H4H A;  4FPJ A;  5SV5 A;  1HV1 A;  3JBG 3;  4COZ A;  4OMC A;  2DBI A;  3CEW A;  3ZXF A;  5C70 A;  1GP5 A;  2YC4 A;  4MH0 E;  2J1V A;  4E2Q A;  1BMV 2;  3I4I A;  3ACF A;  5M0T A;  5HXM A;  3QH7 A;  1NCQ C;  1NLR A;  3IAQ A;  4I2O A;  2E32 A;  2BDR A;  2I45 A;  2B5H A;  4K1Y A;  4CUG A;  3CMG A;  2FBE A;  3ROU A;  1LKN A;  5GLT A;  2JDM A;  2KA3 A;  3PVN A;  3RDI A;  4XJU A;  3OGV A;  2RJK A;  2JD4 A;  4QPI B;  5IK4 A;  4PDW A;  3BTZ A;  4YGB A;  2WS9 3;  1JU4 A;  4Z2W A;  2BWC A;  4MV2 A;  1DYP A;  5FUI A;  4EWD A;  1DQ1 A;  1TMF 3;  4UFJ A;  3T09 A;  5DAB A;  1SBF A;  2GAL A;  1OPM A;  1MPX A;  2CDO A;  1QOS A;  3CDZ B;  4TXW A;  4UT5 A;  1TME 2;  3TOJ A;  1VBE 2;  2P3J A;  1JTZ X;  4W65 A;  1Y43 B;  4QXH A;  3EB7 A;  1ACC A;  1ENQ A;  1LRH A;  1VB4 A;  4ZS3 A;  1O6U A;  3UJQ A;  1WD4 A;  4AVV A;  5FWE A;  1H6Y A;  1OA4 A;  3H7J A;  1KIT A;  3AKS A;  2CYF A;  3DPR A;  1SCS A;  3BCW A;  1ULO A;  4SLI A;  1LOE A;  3DKW A;  4NHY A;  4JC1 A;  3DYO A;  4HSJ A;  3WEZ A;  5E89 A;  5ACA 3;  2G4I A;  1I5Z A;  1QDC A;  1VIW B;  1C57 A;  4QQH A;  5FXX A;  2ZXQ A;  3PVE A;  3RZJ A;  4Q8K A;  4JHT A;  4PDW B;  3M4F A;  4Q4X 3;  1WCS A;  4V2W A;  1H1I A;  1Y4W A;  2P17 A;  3DEC A;  1REF A;  1UMH A;  2GP3 A;  1PVC 2;  3ETP A;  2WFF 1;  4KBB A;  4LMF A;  1SLI A;  5T5J A;  5F37 A;  1ZZB A;  1RUD 3;  2GZW A;  2WN2 A;  2VCM A;  4ZPI A;  2VUJ A;  3WOG A;  1S2B A;  4ONU A; 
#chains in the Genus database with same CATH homology
 1E5I A;  1W28 A;  1UOG A;  1UO9 A;  1OBN A;  1WA6 X;  1QJE A;  1HJG A;  1W06 A;  4XAE A;  2CSG A;  1GP6 A;  1W9Y A;  1W2O A;  2BRT A;  1BLZ A;  1ODN A;  2Y6F A;  1IPS A;  1HB2 A;  1HB3 A;  2VBB A;  1QIQ A;  1E5R A;  1HB1 A;  4RGK A;  1UOF A;  2VBP A;  1W3V A;  5APA A;  5C3Q A;  1RXF A;  2DBI A;  1W03 A;  2VE1 A;  1GP5 A;  2IVJ A;  1RXG A;  1GP4 A;  1W2A X;  3ZKY A;  2BU9 A;  1W05 A;  3ZOI A;  2IVI B;  5C3P A;  3ZKU A;  3ON7 A;  3OOX A;  1W2N A;  2WO7 A;  1BK0 A;  2VAU A;  1HJF A;  5C3R A;  1E5H A;  1UOB A;  2Y60 A;  1E5S A;  1UZW A;  5C3S A;  5C3O A;  2JB4 A;  1ODM A;  1UNB A;  1DCS A;  2DBN A;  2VBD A;  1W04 A;  1QJF A;  2JB8 A;  2VCM A;  1W3X A;  2BJS A;  4BB3 A;  1HB4 A;  1OC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...