3OOXA

Crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
307
structure length
305
Chain Sequence
TSAIDPVSFSLYAKDFTRFAQELGASFERYGFAVLSDYDLDQARIDAAVDSAKAFFALPVETKKQYAGVKGGARGYIPFGVETAKGADHYDLKEFWHMGRDLPPGHRFRAHMADNVWPAEIPAFKHDVSWLYNSLDGMGGKVLEAIATYLKLERDFFKPTVQDGNSVLRLLHYPPIPKDATRAGAHGDINTITLLLGAEEGGLEVLDRDGQWLPINPPPGCLVINIGDMLERLTNNVLPSTVHRVVNPPPERRGVPRYSTPFFLHFASDYEIKTLQNCVTAENPDRYPESITADEFLQQRLREIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords putative 2OG-Fe(II) oxygenase family protein
publication title Crystal structure of a putative 2OG-Fe(II) oxygenase family protein (CC_0200) from CAULOBACTER CRESCENTUS at 1.44 A resolution
rcsb
source organism Caulobacter crescentus cb15
total genus 91
structure length 305
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 3ooxA00
1OC1A 2IVIB 3ZKYA 1RXFA 4BB3A 2DBNA 1BLZA 2JB4A 2VBBA 3ON7A 5C3SA 2JB8A 1HB4A 2CSGA 3ZKUA 1DCSA 1HB3A 4RGKA 5C3PA 1QJFA 1QJEA 1W2AX 3OOXA 1GP6A 1UOFA 1ODNA 1ODMA 1WA6X 1HB2A 1QIQA 1W3XA 5C3QA 2VBPA 1UOBA 1E5SA 2Y6FA 5C3OA 1HB1A 2Y60A 1E5HA 1E5IA 3ZOIA 1GP5A 1W28A 2WO7A 5C3RA 2VE1A 2VAUA 1W04A 1W2NA 1W03A 1W3VA 2VBDA 1UNBA 2IVJA 5APAA 2DBIA 2BRTA 2VCMA 2BJSA 1E5RA 1UO9A 1UZWA 1GP4A 1W06A 1UOGA 1HJFA 1BK0A 1HJGA 1W05A 1W2OA 4XAEA 2BU9A 1W9YA 1OBNA 1RXGA 1IPSA
chains in the Genus database with same CATH superfamily
1VAMA 3RMYA 4D0QA 3TOJA 3RZMA 4K6BA 1RUC1 3MFAA 4LBQA 2ZGLA 3PLQA 4UFMA 4ASKA 1QNYA 4QQOA 1AX2A 2WNVB 1UIKA 2QQLA 4LUKA 2WS92 5FYSA 4OI1A 2XHNA 1H6XA 3S5QA 1GSLA 1PGSA 4WVWA 1N1SA 5ACA2 1IQAA 2JENA 2ZGQA 3AP5A 4HPKA 4PIXA 2XGXA 5CKQA 1VRH2 5JOYA 4W6YA 1LCLA 1RUF3 2PAMA 4ATFA 4Q4X2 4CZSA 1OLRA 1VBA1 3R05A 4MG2A 1GQPA 1RUE2 3ACFA 2VVEA 1VB2A 1IG0A 1UYYA 3S57A 4DXRA 1YI7A 5IYYA 4LIVA 3JB8A 1A8MA 1WLCA 1OOPA 3K3NA 2CHHA 1WMEA 2W2IA 1XQNA 2XJTA 2QBXA 4PT6A 2A3XA 3NJXA 3UV9A 2WA4A 4KWUA 2HWF1 5T5LA 1QOTA 2V09A 1W8NA 2Y6GA 4OI4A 1ODNA 3B93A 3IMNA 3A4UA 2E53A 1ZBA1 2PQQA 3HEIA 4LJHA 1KFUL 2VZ3A 5LK5A 3SKJE 4FAHA 5HV0A 1ZNPA 3O1SA 2AEZA 4JGYA 1DFQA 5FZGA 4AGGA 4GH4C 4AHZA 1OF3A 4YW4A 4Q8LA 1X7NA 1URXA 2CGOA 5CADA 2OA2A 3UKNA 4XJUA 3OYWA 4K3UA 3HNMA 2RJKA 4ASLA 5I93A 5DDJ2 2Y6FA 3GALA 1JHNA 1CZTA 3WDTA 4RA0A 3VZJA 4OI0A 3KT1A 2DUQA 1X9TA 3OPWA 3PIJA 1S0CA 4Y5SA 2VQAA 3JB4C 2FHRA 2OPWA 2WZR2 3HT2A 3HIFA 1LESA 1TVGA 2Z69A 3BOPA 1W28A 4HG6B 1FOD3 2VY0A 1COV1 3W58A 1RITA 2B7YA 3MW2A 4W65A 5A3MA 4IV1B 4DIQA 2EAAA 5J09A 3ZVXA 4W50A 2QFEA 1S0GA 2WS91 3BALA 3AVRA 2HWE2 4KH9A 4QU2A 4P00B 4WM7B 1N1VA 1S0DA 3MF6A 2Y6LA 4B1MA 3PNAA 2ZGSA 4EZHA 4ZU4A 1XNTA 1YHFA 2ZMNA 3GJBA 1BHGA 2EVXA 1GQGA 4LKEA 5E8AA 4QM9A 3AP4A 3FUOA 4XHBA 2HYXA 5FXZA 1VALA 1FPN2 4IDZA 4AVAA 3KF5A 3OY8B 3D82A 4Q1RA 2W47A 4OLLA 4Y33A 1WD3A 3URFA 3ZXAC 3GCXA 3V0AB 1KJLA 5HXVA 2FZ1A 1ENQA 4QQLA 3B02A 5DG1A 5A7WA 5IVJA 4AL9A 5FDBA 3I49A 3MUZ1 5T5PA 1WCSA 5JI7A 3BTAA 3AK0A 2QZ3A 4AWDA 2ID4A 2NMOA 3VKLA 5I0UA 4AZZA 5FPXA 1H8TB 2C24A 2CV6A 3RJ2X 1O5LA 4QX2A 1QXPA 4S2FA 3O14A 4HFSA 4KGGA 1LHWA 4DINB 1WW4A 4DUWA 1RMU2 3POIA 4PLOA 1IKPA 4YVWA 1LJ7A 1V6OA 3ACGA 1H2NA 5T54A 3WP3A 3FHAA 2KA3A 3QCWA 1LU1A 3T4HB 4QXBA 4CDQA 3PL0A 3MO4A 1ULDA 3ZKYA 2X5IC 4HETA 2ZGOA 3OPZA 3LEIA 4YG6A 5A32B 3KV5A 4X8NA 4AFMA 3R4UA 4I0BA 1JODA 1Q8OA 4AAPA 4BB3A 5AC93 1J58A 5LA1A 3MHZA 3NO8A 1O6UA 1XNBA 3AB0A 4RS5B 1LNSA 2WZR1 5F9TA 2XL7A 1CX4A 3PUSA 4R9AA 3AKPA 2XQXA 5CFDA 1VAKA 1OPMA 3D0JA 2VUJA 3MIEA 3CQOA 5I91A 4QX5A 3BIWE 4CCMA 1ZVFA 1F2NA 1R64A 3VZLA 1FV3A 1LOBA 4QX7A 3H3ZA 4MGQA 4EZ4A 5C3PA 4CEWA 2HWE1 2BDRA 1B09A 1C8M3 5ANNA 3SH3A 3U07A 3VBSC 5IT6A 1K3IA 3WR0A 1RUI2 2W46A 2G4IA 2WIIB 1MS4A 3ECQA 1NCRA 1UYZA 2VMFA 4META 1APNA 4Q5OA 1WA6X 3H8RA 2ZKLA 4G4FA 4XFAA 3WSOA 4EN8B 2WAOA 4FPFA 4AF9A 1W99A 2PHRA 3S5AA 2BTVC 4M4RA 3VKNA 2G19A 5K0UC 2GH8A 3HOBA 4BQ3A 5F6LB 4OZXA 2A71A 4QPYA 1WA4A 4XMAA 1FPN1 1F8VA 3O7OA 1PZ8A 2FDFA 2CDPA 2GN3A 2W68A 1CESA 2YHJA 3LIGA 5C3QA 5FY0A 1IGOA 1XNCA 2XR4A 2DCTA 1C57A 3POSA 4WZFA 2VZ1A 4RD7A 4CCLA 2VMGA 4CP9B 5C3OA 4BMBA 2RMU3 3S7IA 2JX9A 3NNMA 3OGVA 4XQ4A 5FYIA 3N7MA 4GWJA 1E5HA 2Z2SB 2RVAA 4XDOA 1H9WA 3C8XA 1XJAA 4TXWA 4CU8A 2X05A 1VJ2A 1F4HA 3NJVA 2AACA 5DQ0A 2JKBA 5T5JA 4DOUA 1RMU1 5KC5A 4PQ9A 4JZRA 4LHSA 2P1BA 1C8M2 5EJ1B 4F7ZA 2R0HA 1PK6A 1C1LA 1TMF3 1F5FA 1GZTA 1ND2C 3HBKA 4YW7A 2DVBA 5I8SA 4QPGC 4YM3A 1VBE2 3BIEA 2C5DA 4AAXA 3TEZA 2ZEYA 3NV1A 2XL9A 4A41A 1N47A 1DGWA 1YUDA 5IVEA 1FMD3 2GALA 4H14A 4U2AA 2ZX0A 2RDNA 4PI0A 4LBQB 4XDQA 2CAUA 4C1XA 3ETPA 1DZQA 2GC2A 2WA3A 3WEZA 1V0AA 1YFYA 2QNKA 3I3MA 3LE0A 4LK7A 4FFGA 4WM8C 2B9VA 2VH9A 3PUAA 4A7KA 4CDXC 1HJGA 5BNPC 4HPKB 4Q27A 2TNFA 3F95A 4FPKA 2WNUC 4Q8KA 4XYXA 2VNOA 4Y5TA 3MLJA 1RB8G 1RUI1 3O0WA 1H9PA 2R16A 4LKSA 5FZCA 1MZ5A 3H1MA 3PVBB 1JW6A 4URTA 1OBNA 2AYHA 2VQ0A 2DUPA 4XFHA 4QPIA 5HCHA 1AXKA 2XJSA 4RL7A 5FYBA 1OC1A 4HSJA 5A3OA 2A6WA 4DY3A 4XILA 4MLOA 1WBFA 3GM8A 3LAGA 5LBFA 5BV6A 5CEHA 3MLLA 4IL7A 2RM22 3VHOA 4LNVA 1YQ2A 4JCKA 3PUQA 1FI2A 1RJ7A 5CAZA 2E31A 2XWJB 4UW6A 4XBLA 4Q0VA 4CU7A 4D7SA 3VZNA 3FN9A 4JGYB 1XOYA 4UFKA 1PIV3 3VDDC 3LEGA 2ZOEB 4DXZA 1U5ZA 1LB2A 3FBMA 4IW3A 4Z82A 4YM2A 3TYJA 1LOGA 3ZFGC 3NWKA 4QHOA 3OYWB 3N36A 4ZS3A 4JV4A 4Y4RA 3VN4A 2E7QA 2VTXJ 3C7EA 3MIDA 4Y5Z0 1SBFA 4A42A 1VBE1 3AZYA 1DYPA 3N7KA 1MS9A 3HR9A 5FPAA 4MGYE 1JOPA 3WF1A 2BP6A 1ZRCA 1BVP1 4J25A 2ADDA 4UFHA 5A1AA 1RYYA 2ZS6B 3IAPA 3L2HA 2YDEA 2GSYA 3ALQA 4CDWC 1YFXA 4RQPC 4YFWA 4N43A 4BPZA 3ZYGA 5FO9B 1VMFA 1DLLA 5IAXA 1UF2C 1R082 2IFWA 5FO8B 4E2QA 3P1IA 1MVEA 1VR3A 5A7OA 1PIV2 2X53S 2BFUL 5L9RA 3H1WA 1STMA 3VGIA 1UMIA 1HV1A 5FYHA 1AR82 1C5HA 5JWPA 2OQ6A 4OCTA 2BGCA 2D98A 2GP3A 3VBHC 1TQ5A 4H55A 1GP5A 3FX3A 4Q4V1 3WINE 3I7DA 3LFIA 3ZIXA 3WLUA 1OD3A 1UZYA 5D8AA 1AL23 3TNQA 5A3UA 5C8CC 3RZHA 2OYZA 1WW5A 4EN7B 5JDBA 4SLIA 4CDUC 2Q1MA 4IE5A 2D3PA 2RR13 2VXJA 4XF9A 3BTZA 3CLPA 4Q0SA 3ZSLA 2CDOA 4XJWA 2F6BA 5E89A 1YNAA 2QQPA 4NR1A 1DZTA 2VR4A 3CJIC 1NA1C 2FCTA 4G9SB 2IXHA 3KGZA 4HVOA 4ZS2A 4CDQB 4B3NA 2W3JA 1JYXA 4NIHA 2C1FA 1WCUA 2GMPA 3M8LA 1LHVA 1AYM2 2ORXA 3JBG3 3OEBA 3PIGA 3LSEA 3Q8FA 1A34A 2AC1A 5DAQA 3H3UA 3HT1A 4LIUA 1AHSA 5FZ8A 1TME3 1ZRFA 4P9IA 2BU9A 1JU3A 1RUD1 5ABJC 1CPNA 1PO12 2D6KA 2P3KA 3P3PA 2XOMA 4M0NA 2Q8CA 4LT5A 2IUWA 4FOYA 5CFDB 3E5QA 4J1WA 1B35A 3SHRA 2VZQA 4OVEA 5HCBA 3WNKA 4I09A 4HT1T 3T08A 3U0ZA 2WWJA 3DGTA 3NNJA 4IEOA 2D5HA 4LEJA 5FP9A 2VZTA 5A7PA 3ZXJA 4CEWB 1ASJ3 5FOJB 3MW3A 1UWWA 4ONUA 5DG2A 3TB0A 1LKNA 4QD2A 4DY5A 1H30A 1PNGA 4Y20A 1W6OA 1R081 1NCRB 5FYCA 3ES4A 5FWJA 2AEYA 3A0NA 3TAYA 1LEMA 3I3EA 1OLME 1J3QA 1J3PA 2GC1A 1SLTA 2WDBA 4Q4W2 5CIRA 4MADA 5BXXA 1EP0A 3DPRC 3VBRC 3ZFFC 1DDLA 4R4XA 4IE0A 4YW2A 2D6PA 4GMP1 4QXCA 3LKJA 1WMFA 2MPFA 5FY9A 2YGLA 3Q8EA 1HXS2 3O1PA 2QCSB 5JIAA 1V9U3 1YC61 3LFMA 3WQ1A 2R072 2Y34A 1AR63 1ULGA 1GP6A 2ZZQA 2V73A 1UMZA 2HWB2 4A3ZA 2JJ6A 5E16A 3RYKA 1DQ5A 3VD4A 1PX3A 3GF6A 3WQ7A 2D44A 2XONA 4TLGA 1OPOA 3APBA 4CTEA 1PK6B 4PDWA 2HH9A 3WDUA 3H8XA 3MEPA 3ZYFA 2P37A 5I0DA 4GA9A 3CDZB 4K8FA 1AYM1 5KXEA 4M0HA 3LDBA 4HKLA 5FZAA 4P9XA 1OQEA 3NAPC 2ZGRA 3PJYA 3BCWA 3EXUA 3SMHA 3WNNA 3ST7A 4Q4Y2 2AENA 2JDKA 1PO11 1AR91 3HQUA 3ITQA 1E5IA 1UKRA 2OQ7A 1OH4A 1AX0A 2G9GA 5LBEA 4XUNA 1D4M2 2LROA 3WVJA 4AHXA 4MUVA 2BNOA 4CPBD 4LLOA 2WRAA 4D6QA 1KXGA 3WP5A 3V0BA 2YUEA 2UYAA 2I74A 3HQRA 2RS33 3P6BA 4NUBA 1MEC3 5FMOS 1K5JA 2XDVA 1BMV2 4EV0A 2VBDA 1DQ6A 4IERA 4A6OA 1GZ9A 3GHNA 3MUY1 1AJOA 3ZX7A 4QDSA 4QPIB 4FXKB 2X29A 1OHFA 2GC0A 3EYPA 5F5QA 1OSGA 3N7JA 3MPBA 3N9LA 3K4ZA 1C3HA 1HW5A 2KD7A 2ZHLA 2WUHA 1US2A 1WCQA 4KL1A 2VNRA 4AW7A 1BKZA 1UOGA 3ORJA 4CUCA 2DF7A 5FK8A 1RUJ3 3RWNA 5H9SA 2UWCA 3UKTA 1YXWA 1OT5A 5L7OA 1NOVA 4FXGB 5C9AA 1ZRRA 3IAQA 4QXHA 2R071 4JRLA 5C7GA 1AZDA 1IS4A 2WZPP 3TBDA 4COZA 1W9YA 1LHNA 2BNMA 4J6GA 1OKQA 2HWB1 5K8SA 5K7PA 1UD1A 5HPOA 1DQ4A 4UYBA 1CONA 2R30A 4MZUA 4WVZA 3AYCA 2DU0A 2HWC1 2VM9A 5GJ6A 5EFUA 3VBUA 3UT0A 5GLUA 3CEWA 3LCPA 3M2MA 4O9EA 5FUNA 4CCDA 4EE2A 1VMHA 1SBDA 1V70A 1DLCA 3WOGA 4EQVA 4HKOA 3AKTA 1QF3A 3N9NA 1VBB3 4DFSA 1NXD1 1UKGA 1W2UA 3WNLA 4PBOA 2YY1A 2VJXA 4M01A 1K5MC 4Q4Y1 4H2AA 3K4AA 4QGMA 2YPJA 3AFGA 3RMXA 2VULA 4BZ4A 4OHVA 3H42B 1ZZ8A 1W6QA 5FMDA 2HBTA 2ZHMA 3PMSA 2DBNA 2J42A 1D4M1 2WBKA 1H1IA 1IOAA 4N43B 5J37A 5B4XA 1OF4A 4I3GA 4ATEA 1POV3 5FUPA 2K9ZA 1RHI3 2UYBA 2KM2A 1HRI2 4XFFA 1G9DA 4JDMA 4S2GA 2B42B 1V6NA 4NPMA 2WL1A 4E2SA 4MYEA 1BMV1 1I3HA 1W0OA 4E8DA 3U14A 3FC0A 1LTEA 5JIUA 4NHKA 3B5LB 1MPXA 3RVHA 2QTWB 1VE0A 1PVC1 4COUA 5F3IA 3ZSEA 2ET1A 2TEPA 1HB2A 2DVDA 4XF0A 3DCQA 4XZPA 4QQ2A 5A6QA 4FPGA 2QE3A 1REEA 5FV3A 3MIFA 4YVSC 4QB6A 3RYPA 4YW3A 5D8AB 5JXHA 2YBPA 4CVUA 3VL9A 1G9FA 3U37A 3WHUA 1W3XA 4L99A 2ILMA 3AXEA 5AVAA 3FUQA 2LS6A 5BNOC 4N9HA 1DGLA 5LBBA 3JCIA 4YYOA 1JHJA 1RVF2 4XFGA 1UU5A 3HMYA 5CZKA 1QHDA 2D93A 2I2SA 4CU9A 3ASIA 5A33A 5C71A 1RUOA 2FDKA 3ZYRA 2CTVA 2YV8A 4QKBA 3JZVA 1NCQC 2ZGTA 1CPMA 3GCWA 3K46A 4AI8A 4B7EA 1QDCA 1X82A 5KHKA 2BUKA 4HVRA 4RGGA 3B94A 3KV4A 2EALA 3O0XA 5JPMB 1H6YA 1RUG3 2VCCA 2V5DA 1YQ5A 3A22A 4IE7A 1L3JA 1W3VA 5H9RA 1UNBA 4D7YA 2DCZA 5C70A 1B35B 5CA6A 1RUH2 2HYKA 4GAZA 4LMFA 1HQLA 2ZX4A 4EN6B 1EAH1 5FP3A 4AOCA 2BRTA 5I0RA 1X9PA 4GWMA 4N53C 2OS2A 4E2GA 3K77A 3I3DA 4FP3A 1LODA 3D0SA 3PUIA 3TEXA 2Q5TA 4AI0A 3ZMOA 2QDNA 4GH4A 1BEV2 2A70A 3B9CA 4LXLA 3P3NA 1W6OB 3AP6A 4FO9A 5LA9A 4HONA 5FZ0A 1CWPA 1V6LA 2R042 1AR72 4RYDA 4ZONA 1Q43A 4BA6A 3UETA 4A3XA 3ZN4A 3GYDA 1MQTC 3GHMA 4L2NA 4X6RB 4GB33 1GBGA 4K40A 2KR2A 3U75A 3M3EA 2N7GA 5DABA 2FMYA 3O0VA 3I2HA 1Q8PA 3AZXA 3BU7A 3U78A 1RXGA 1UU4A 5A70A 1ZRIA 1BBT3 2JEMA 2K0GA 4XF4A 2GNBA 3SCFA 3B9IA 2OX0A 4LKFA 3WP6A 4TLFA 4WBBA 4BISA 4P9LA 4IEXA 1Q8VA 1W8HA 4DRVA 2XPJA 3J8F3 1KD7A 2Y38A 1GNZA 3AYDA 5CFCC 4FFFA 3L2YA 3LZZA 2D7FA 3JU9A 4L97A 3KT4A 1UX6A 3C7HA 4UI9L 3HNBM 3B01A 1EUTA 4GULA 1U5IA 1W6MA 1SDWA 1UY2A 3OBZA 1COV3 1QJX3 4BE3A 1DQ1A 2HEWF 2RDQA 1YQ6A 5SV8A 3W9AA 4FBFA 1K45A 4PDWB 2WT1A 2W1UA 1LOFC 4KMQA 2D40A 1AJKA 3NRUA 3ON7A 2JB8A 3IDEA 1NX9A 4XMIA 1DZRA 3WUDA 4TTGA 1LRHA 1WLWA 1R093 1UIJA 2W5FA 2Y0OA 5DZFA 4MGTA 1Q5OA 1SQ4A 3POYA 4YPJA 2QUOA 1O7FA 5KXCA 1GWLA 1ALYA 4NIIA 2J1AA 1UXXX 1MZEA 1SG3A 1UW8A 4XABA 4LOTA 3T3YA 4COWA 4CCOA 2SLIA 1RUH1 4GWIA 2XBO2 2VGDA 5ANQA 3B00A 5BYNA 2VXRA 1LAJA 4ZY9A 3AMMA 1DGRA 2P3JA 3NW4A 1XE8A 4OMCA 1UL9A 5CYYA 3BYWA 3DECA 3H8OA 3DEMA 3HVDA 3T2TA 3V0BB 4IEPA 4E4SA 1BXHA 1BEV1 4ES8A 3H50A 4ZU7A 1HRV2 4LBQD 4BJ0A 2EXIA 5T50A 3I59A 1U12A 2R041 1AR71 1PZ7A 3LPFA 4XFIA 3AP7A 1GOGA 1QMJA 2X5IA 1T2XA 3WG4A 2ES3A 1D0HA 3IPVA 1CJDA 3OEAA 4N9IA 2R6QA 2ZBJA 3E6CC 1O5UA 4EJRA 3W5MA 3LOIA 1Z78A 3BUCA 5FLHA 4MVTA 1QY4A 3JUUA 5K4LA 2Y8KA 3DYMA 4ZXEA 4IUGA 1BJQA 2CGNA 5L73A 5L7OB 3EMRA 5FY5A 4COVA 5C9AB 2VE1A 2V72A 3OD0A 4QAWA 3HBZA 3WX5A 5F3CA 1R1A1 4JHZA 1J84A 2XKOA 1DQ2A 2RS53 3WF0A 3FMGA 2W9XA 5JR7B 3O1TA 1XPWA 2BERA 3VBSA 1AF9A 1QXJA 1XC6A 1RC6A 1GYKA 1DYKA 4FTBA 4D94A 3VZKA 5A3LA 3VBUB 2YGMA 1RUF2 4YZ4A 1Z7S3 4AVVA 3U4SA 4PLMA 5LK7B 5K0UA 4R9DA 5JCTA 4BK4A 2EIEA 3NVCA 1PO23 4E4DX 4NIGA 1NZCA 3RYRA 5EIYB 5FY1A 3WQ0A 2QVSB 2VOWA 4B4PA 2IXJA 2Z4FA 3C7FA 1D7PM 1F35A 2B8MA 4Y1XA 5CU1A 4AEDC 4AEKA 1QQP3 2RG4A 2ZHKA 4XFCA 3U11A 1OLQA 3EO6A 1W6QB 5T5OA 4YFZA 1QH7A 1S0BA 2XBO1 2X09A 2YC2A 1FNZA 4YM1A 5ACA1 2PHXA 1UOJA 1IPSA 2ZTNA 4X6QB 1D0GA 3BGAA 4BCUA 2JDAA 2VO5A 1VRH1 2XLAA 2VW1A 3ILFA 4NRMA 4XCBA 3D4KA 4FT8A 4AR2A 4O65A 5BY5A 1Q56A 4Q4X1 1GNHA 5FWEA 4B4RA 4AEJA 2WJSA 1RUE1 4O7XA 1REDA 5DN2A 3VKMA 4C1WA 3UGHA 1WCDJ 1LOCA 1U0AA 2V4AA 4L8QA 4QPGA 4ZKTB 3VDCA 4P9JA 5A6YA 1W9FA 3G6JB 3CU7A 3NV3A 1SZBA 1ZZCA 4DZGA 5LY2A 4FP2A 2JE8A 5DUXA 3RWKX 1GU3A 1YQCA 2YBSA 3W5NA 2ZGKA 1HDKA 2WZ8A 1VPHA 4YGEA 1PO22 3ZFEC 4BYYA 4C90A 4UFLA 2CAVA 4HOOA 1W90A 2EICA 4IQPA 4BLJA 4AQ6A 1FOD2 1X8MA 2DCKA 4WM8A 4CDXA 4Y24A 4LHLA 2DWRA 4YW5A 5BNPA 4AXOA 1HV0A 2JG8C 2WNUA 1TE1B 1UYXA 3HAGA 3KT7A 3L9JT 5A33B 3AFKA 1PM7A 2I07B 4IEQA 3JXSA 4MO3M 1RUNA 2PHTA 1QJY3 1N1TA 2BOJA 5A3TA 4UAPA 1EPWA 2O0OA 2XHKA 5DDJ1 2O14A 1W6PA 5JMOA 4RR3C 1NLQA 2VZSA 5G05L 4FVVA 3Q9OA 2EF6A 2EXHA 1CZSA 2J1SA 4XEZA 1UZVA 2PHWA 3OGRA 5GLTA 5TSWA 3Q8AA 2WZEA 2L9LA 3J9SA 1WMDA 1PVXA 2XJRA 3MPPG 2P6HA 3VD9A 1IG3A 4TZDA 4FOQA 2ZPXA 3RZKA 3LA2A 3IZOA 3QH6A 2H0BA 3CNAA 4AGVA 4XXAA 3GBWA 3PVNA 1X33A 5LA2A 5T55A 3VDDA 4GH4B 1ZZ9A 2MEV3 2K46A 2NPIA 3ZOIA 2H6BA 3ACLA 4YARA 4M00A 4DMIA 5FR3A 2WQZC 3VV1A 3ZFGA 3O1OA 4YNIA 5GZFA 4Z2AA 3UGFA 4LHKA 3PUHA 4TYSA 2LM3A 3RPQA 2O8QA 4K1ZA 1ULOA 4Y3OA 2E33A 3I2DA 4YW1A 3FE5A 1A3KA 2ZMKA 1YJLA 2E7TA 2YYOA 1HLCA 1Y9GA 4YGBA 2DBIA 2CGPA 1G6NA 5LY1A 3ZSMA 3VLBB 5AC92 3LPGA 4HK9A 2JWPA 1UO9A 1MS5A 2XJUA 4LBNA 2F17A 3WW1A 1HJFA 4N8MA 5BPXA 1OA4A 4D7TA 4CDWA 1FOD1 4MOAA 1XSQA 4RQPA 4I2OA 2XUMA 2QKDA 5FPLA 2QQVA 1W6MB 4B8EA 1CIWA 1ZBE3 5EYYA 1W8OA 3K4DA 3NMBA 4IEWA 1W05A 4JGZB 2PXJA 3KS7A 1MS8A 4LBOA 2H0VA 2ZGUA 4Z8BA 5BUVA 5AVPA 4BHPA 3B3QE 2BVBA 2XB6C 4D8MA 1JYWA 3PTRB 1OQDA 5CVRA 4CEYB 4AHWA 1X8EA 1J1LA 1O91A 3ACHA 3H3LA 3M7AA 4KBBA 3THPA 4QX1A 1OFSA 1LHUA 2PYTA 2XQRA 4A44A 2ZACA 4E4ZA 5C4WC 1ND3C 2IVIB 3QBQA 3BPZA 2HEYF 4Y1VA 1NQJA 1W0PA 3NNLA 5EPAA 3NQHA 3ZXKA 5C8CA 3OGJA 2AZ5A 3AJZA 1NAEA 1C5IA 3JQWA 3I4IA 4ISQA 4CDUA 4YZ1A 5A1LA 1JYCA 5FYUA 2PFWA 3VKOA 1CR7A 2DCJA 3IN9A 2A6XA 2BWAA 2HLEA 1N3OA 5F8PA 2RMU2 3OUIA 4XJ9A 4A45A 4WV8A 3LB9A 1XRUA 3ZSKA 2E6VA 2ZEXA 3ZIWA 5M0TA 1VBD3 1YIFA 4MGZE 1G8WA 2WFPA 1NA1A 3CJIA 4GALA 1FYUA 3I59B 4MXVA 2Q1ZB 3LA3A 2Y6KA 1XE0A 4XTMA 2BBAA 2GU9A 1OOPB 1T6GC 2VZVA 2X5IB 1S0IA 3SXWA 5JOXA 3FHIB 2JDPA 3IPVB 3Q8BA 1TMF2 2DTYA 2X8KA 2DVGA 2Y6HA 5IK8A 1QJEA 3E97A 2VOXA 1W2AX 5DAPA 3TEWA 2CWSA 1JZ2A 3POFA 4UFJA 5ABJA 4CCKA 2Y6JA 3TRSB 3AJYA 3E5UA 4CA9A 4M3CA 1LULA 2G9ZA 1FMD2 2A6VA 1W8FA 1OD5A 4CP0A 4K20A 2YXSA 3MV11 3THDA 2ERFA 2A5ZA 4Y1YA 3WD5A 4PJYA 5A7SA 2WLQA 4XAAA 3OBRA 2Q8EA 2WNOA 3FLTA 4IV3C 4CUGA 3VBSB 1RUD3 2VW2A 3TN93 4QMAA 4LTAA 5GZEA 3KMHA 2VNGA 2GMEA 4XQWA 2HWD3 3D8CA 4IEUA 2OZJA 1C8M1 4L9BA 4QU1A 3CIHA 4BWOA 2DCYA 4P08A 2PN5A 1K12A 2I45A 4LPLA 3ZYHA 4V1PA 1XYPA 4AQ2A 3NJZA 1XBFA 1JI6A 3N9MA 3BOWA 1BK1A 5C5UA 2O1QA 3HPNA 2XMLA 4C0BA 3LOBA 3DPRA 3VBRA 2J1UA 4KBZA 4OI2A 3ZFFA 2C9KA 1NXMA 3SEPA 4Y1ZA 3ZPYA 4YRDA 2CL2A 3AMQA 2OZ6A 5FZBA 2LTNA 2Y0IA 5JXGA 1MR5A 4GKYA 2LALA 3H7YA 1V6JA 4FFIA 2VVFA 3WDYA 4AFDA 1LOAA 1KDMA 2J1EA 4NWVA 1I1EA 2B9UA 2J7MA 1HQWA 5BNNC 1UQXA 2RMU1 3MFCA 4GMP3 3BB6A 4BQ4A 4OULA 1MS0A 3EQEA 3RQ0A 2ZZJA 4QQHA 4YZ3A 2R063 3O5SA 3INAA 2ARXA 2ET7A 4QPGB 2BW8A 5GKAC 2WABA 3WHTA 1VB4A 2RS13 5KHGA 3M3QA 3PTYA 1LU2A 1TMF1 1K42A 3C3VA 1DBNA 3NAPA 1SPPA 4JKLA 1SCRA 1J83A 2YMZA 5DUUA 3CJXA 3WF4A 2EXKA 1D2QA 3GDBA 2DTWA 5LASA 5A7WB 3M1HA 3VHNA 1POQA 2VUCA 2FQPA 3FBYA 3OGSA 1KS4A 3OB8A 4LA2A 4QGNA 2RM21 1GR3A 4C0HA 5HI0A 1Y9QA 1FMD1 2W39A 5GM0A 5J48A 3MW4A 1O4YA 3DKWA 3UGGA 1BCXA 4WM8B 3VBFC 3OBAA 4CDXB 1DG6A 4NHLA 3NJYA 5BNPB 4SBVA 1DGRN 4NWWA 2PLV3 2GNDA 2WNUB 3ENRA 5FJKA 1SFYA 4YVWB 4QDRA 1O59A 2Z79A 1JXNA 2BWCA 2VCBA 3U10A 1KFXL 3DYPA 2JDYA 4N90A 5LW9A 1W6PB 2D6OX 3HJRA 3EBRA 1V6IA 2Y64A 4Q26A 1QXRA 2XVLA 1JBCA 2D43A 2J1RA 4QT6A 5B2GB 4QX3A 3QOPA 5F1RA 1G86A 3QD6A 5IFTA 3AMHA 5CISA 1ZZBA 1JS9A 3IWZA 1TEIA 1CD3G 1H8VA 1Y9MA 3A7QA 1GZWA 1RGSA 1AL22 2JDNA 4URAA 3ZO0B 3VDDB 4AVTA 1WWYA 1CAUA 2RR12 3H8UA 3CKHA 4GQ7A 3SCGA 4A6SA 1VAVA 2ENRA 4FPHA 5DUVA 3ZFGB 4A2UA 2PAKA 2DVFA 3HN1A 1PIV1 1PMIA 1QIQA 1MACA 4LHNA 5EHDA 3IDAA 1PX4A 5EJZB 1PZ9A 5FUIA 2MNGA 1AR81 2DV9A 4JC1A 4Z07A 5F5AA 5JAXA 3J7NA 1VBC3 4NHMA 3WDVA 3GNEA 3HD8B 4IEVA 4AVCA 5FO7B 2A6YA 3JBG2 3WG3A 5J1XA 4GWNA 1PNFA 2D6LX 4EWDA 1K5MA 5A6XA 1TME2 4NPLA 2Y60A 4JKKA 5E6HA 4MGKE 4IGOA 3RZZA 1S2BA 4CDWB 2BV4A 5KWRA 2DFCA 4RQPB 2WN2A 2RHPA 3RSJA 4Z92B 4DRRA 3ZXEA 1IHMA 2X10A 1FXZA 4NROA 5LZ6A 3KCCA 1ENSA 1WKYA 4XUPA 5FZFA 1W8TA 2VUDA 5IUQA 4Q29A 1ASJ2 5J36A 4COYA 5FZ7A 3K75B 1O4ZA 1CAXA 3MLKA 1UAIA 1IQDC 2R49A 2YG0A 4KU7A 4LULA 2JG9C 2XWBB 4N7UA 4NHXA 4OHWA 2IVJA 4AVSA 4XACA 5APAA 2VZPA 4A7YA 5DMYA 4K9SA 4PIZA 5LRRA 2FZ2A 3VB9A 1LR5A 3WNMA 1EV13 1H1AA 3I3QA 3WZ1A 1G9AA 4MSVA 1YFUA 2WYFA 1UZWA 4IE6A 1GP4A 1QKQA 4YVSA 4FFHA 1O3TA 3NV2A 5C8CB 2P6CA 4Q2FA 5LEJA 1UCXA 3BKZA 3BVCA 4CDUB 1PVC3 5F39A 3VZOA 1J1TA 4AE2A 5BNOA 5JZGC 1S4CA 1YO8A 3K2OA 1V9U2 1AL21 3ZXGA 3M70A 5CKNA 2NMNA 3WF3A 1AR62 5FZEA 1MZ6A 4E8CA 4FPCA 3AP9A 4HVQA 2ZGNA 4IETA 3ZM8A 3CJIB 5CG9A 1NA1B 2VMIA 1NCQA 4JDOA 3ZXFA 4LOSA 1DF0A 3NKTA 4ZPIA 4AI3A 1U5XA 2YC4A 4FQ4A 2ZEWA 1PMHX 4AI1A 3SNMA 4BQWA 2GDFA 3KM5A 5F37A 4Q4W1 1IPKA 2WFF3 1ZX5A 5ABJB 5LCWL 1ENRA 3FHQA 4YG3A 4BQXA 3BI3A 3E1F1 4M3CB 4MXWA 2EIBA 4NJ4A 1HXS1 1TME1 1AYN3 2XJPA 3JD73 1C8NA 3SQOA 2H6CA 4XDPA 4N53A 4LUMA 1IS6A 5FPBA 4ZU5A 2XVGA 1ULFA 1ACCA 4ARYA 1WLDA 1Y43B 2BBVA 1M06G 1ZA7A 2OUJA 5FZKA 4DXTA 4RHV3 3VBOC 5HV4A 1FV2A 5FFOC 3N9OA 1NT0A 2CWMA 1ZM1A 5D1IA 2QQIA 2RS32 5IWFA 1MEC2 1MQTA 2F4LA 4LBKA 5F6KA 2Q8DA 4B4QA 4XETA 1KS5A 1KQRA 2AUYA 1UOFA 4DNYA 3D3AA 4NHYA 5EV7A 3DPRB 3VBRB 2B45X 2UY8A 3ZFFB 4Y22A 4LITA 1H2KA 2JE9A 4LQRA 3UKVA 3O1RA 1HN1A 3WCSA 3DV8A 2W0XA 3UJOA 5FOBB 2XLFA 4K7JA 3WCRA 4YG0A 1KGYA 2D3SA 5G04L 3ZXLA 5F7UA 4YGCA 1AXYA 5FYVA 1RUJ2 3T2PA 4LE4A 2AREA 3OGGA 5CFCA 5F5IA 2EIGA 2VBPA 4CCCA 1N3QA 2ZGMA 1V9U1 1OUSA 1NZIA 4PCRA 3T4VA 3M4FA 1UY3A 1AR61 2C26A 1S1AA 5EXOA 4XTPA 4ZZ8A 4I01A 3NNGA 3ATGA 3LEMA 1AX1A 5FYYA 1PGL2 4XHXA 1LOFA 2G9FA 1CAVA 2DDUA 1ZA4A 2A73B 5GZGA 1O8SA 2P17A 4DS0A 1U5YA 4FOWA 5JSRA 5FPVA 2WO7A 5C3RA 2P5BA 4C91A 2Y26A 3MI8A 4B1LA 3N7LA 2DU1A 3NAPB 1SPPB 3KWVA 4ET7A 3N9QA 3ELNA 3SCHA 1HIXA 1VBB2 2YZ4A 5JVVA 2VTXA 3ES1A 1GOFA 3RRDA 3W21A 5CB7A 1POV0 2PQSA 1GLHA 1BQPA 1AL0G 1G9BA 1CIYA 1QJU3 2P34A 4PDWC 2VCMA 4PI2A 3BN6A 4MX3A 3SITA 3WNXA 3ZDVA 2HEVF 1RUC3 4OQ9A 1EPZA 1O8PA 1GMMA 2OKXA 3LDRA 3KCYA 1BK0A 2ARAA 4CCEA 5I0TA 4BM8A 1G9CA 1RHI2 2PELA 2WQ8A 5DAVA 3W59A 4XIKA 1Q3EA 3SH5A 5KBFA 4UBHA 2WO1A 2B39A 2RS31 1W2OA 1MEC1 5CKMA 2WNVC 4I0AA 4XF3A 5JLVA 1VBA3 1JH5A 4CXXA 2NP0A 4D6SA 2OVUA 2WN3A 1JOBA 2W08A 3KV6A 2VCAA 2ZCWA 4GJYA 2LUWA 1A78A 1GZWB 3KB5A 3WW3A 2W91A 4YSFA 3A21A 3A23A 4JDNA 1RL3A 5CNAA 1SLBA 2WINB 2ATFA 1RIRA 5H9QA 5I8TA 1HKDA 1OH3A 2HWF3 4INDA 3LWCA 4OMDA 4Y20B 4A7ZA 4CP1A 1HRI1 4M4PA 1NE6A 1W9SA 1X36A 2BFUS 2VW0A 3E5XA 4QM8A 4WVMA 5F2SA 4AFAA 4CP2A 2VQTA 1ZRDA 1S2EA 1PMJX 1EYBA 1QEXA 1ZBA3 1PGL1 2PTMA 5BNQA 1BLZA 2IXLA 3USUA 5FZHA 3AZVA 3RI9A 5AFEA 5L7OC 1QGLA 2D5FA 2UURA 2GN7A 2VUAA 3KSCA 2PAEA 4I30A 4I02A 3UL2A 4XVHA 2VD7A 2WC2A 2UWAA 1RUG2 3AKRA 4AEDA 1K5MB 3U1XA 1CQ9A 3V64A 2OW4A 2PA7A 3ZLIA 3J4UH 4JKMA 5LWBA 4O61A 3WNOA 5LATA 3AC0A 2BZDA 4IEZA 3DXTA 2XJQA 2WSUA 2GZWA 4LO5B 3IDCB 1A6CA 1RVF1 2GAUA 2VMHA 5IVFA 5JMCA 1UPIA 2ZA9A 2SBAA 4YZ5A 1BZWA 1CN1A 4HN0A 5JXIA 3PMEA 1CAXB 1QOSA 1VIWB 2WS93 3PURA 4JQRA 1POV1 2XG3A 5IVYA 1H1MA 1RHI1 5GLZA 2JXAA 5ACA3 3SISA 2W1QA 4UW4A 4RGAA 5SV5A 5L9VA 4IV1C 1VRH3 2BQPA 3KQRA 4YGDA 4HL0A 4GB32 1HB1A 4WM7C 2UU8A 3Q8CA 5I0SA 4YVSB 3ZFEA 5D21A 4UW3A 2IXKA 3AKSA 1BBT2 2BVVA 2EXJA 4D3WA 1WBLA 1JU4A 2WWSA 5BNOB 4S2HA 3FLRA 5DZEA 3AKQA 5KHJA 2JG8A 3O1VA 5J96B 4KWLA 3IIIA 3BODA 3J8F2 1F5JA 3SEEA 3N4MA 1W2NA 3EB7A 2A3WA 4XE9A 4LLFA 1NCQB 4JVAA 3BU0A 2XUEA 4F83A 1ENXA 4NIDA 2JD9A 3IKWA 1COV2 1QJX2 1GNYA 2ADEA 4XJAA 2R0FA 3OTFA 4RR3A 5FP7A 2WO2A 4P9WA 2W87A 4P9YA 1DP0A 1YCIA 2ZABA 4Y26A 1H8TC 1R092 1XE7A 4MXWB 4KWKA 2YB7A 5JUVA 1RUG1 4GJZA 4OQ8A 2PHDA 4UBGA 3GZUC 5DDJ3 5DUWA 4W8JA 5FKCA 3ZYBA 1GFF2 5FLJA 4AI9A 4N53B 4PF1A 1YFWA 3CF6E 1Q8QA 4MHUA 4XUOA 4IXLA 3MGUA 3MV01 3TEYA 2PMWB 3KHCA 2WZR3 4QHZA 2VQUA 1OKOA 3S30A 5C8WA 3DKQA 1Z0HA 4LBJA 2QQUA 2C4XA 4DB5A 2FDJA 1QU0A 3KQ4B 4XC9A 4QX8A 4RS5C 4HZFA 4NIAA 1MQTB 5LRSA 3PU3A 1WCKA 4XUTA 2HWE3 3CZUA 4FQZA 2AR6A 1W39A 3UNPA 1WLTA 2D6NA 4Y22B 4ZHNA 3BTYA 5A7NA 1JYNA 4HANA 5GZDA 4RN5A 1TNFA 4EWAA 4GB31 4QKNA 1UY1A 4UXAA 1NE4A 4TWTA 4YM0A 5EJ3A 3THCA 3AZZA 1BBT1 5A3NA 1FPN3 5CFCB 4KWJA 3MDPA 1HB4A 2JIJA 2ZEZA 4H7LA 5FZ4A 5KXBA 5CBLA 1XNAA 2GNTA 1W6NA 2KXLA 3I97A 2EIDA 1XU1A 4H3WA 1RINA 1BYHA 3J8F1 2RS52 3KD4A 3V56A 4BXFA 5JSPA 2FD8A 3KCXA 4M3CE 2GC3A 1HRV1 1ND2A 1CAVB 4G3YC 1XXNA 2ORZA 4JQTA 4PHZA 5JOZA 3ETQA 2FDGA 1QJX1 3RFRA 1QOOA 1S55A 1Z7S2 2WYSA 4HKWA 2BPA2 1MS3A 2CY6A 1S0JA 1RMU3 2W1SA 5C4WA 1W9WA 2XJVA 1ND3A 2A75A 5FRAA 1NLSA 2CYFA 2QQKA 3LIHA 5DZGA 1FX5A 5FQ0A 4K8RB 1R091 3GZTB 5J7MA 4EWEA 3LEKA 4W4ZA 3GXUA 4JGZC 5EWSA 4D69A 3AMNA 4R8HA 1UOBA 2FCUA 3T09A 1QQP2 2VMDA 5IW0A 5IJRA 5FZLA 3ZR6A 2E32A 4XJ8A 5A6ZA 3VKFC 1UN1A 1OI6A 4CEYC 1OA3A 4ARXA 1AXZA 2NYYA 4AFBA 1A8DA 2J22A 2ZJCA 4KG0A 4IGQA 5IHRA 3X29B 5FYMA 4AFCA 1TG7A 1RUF1 1ZYBA 3I54A 3CL1A 1G7YA 2ZHNA 3B7MA 3IB3A 5FYTA 4BQYA 2XXZA 4ZZ5A 4W6WA 1W04A 3AYAA 1MVQA 4XF1A 5F3EA 1GOHA 4HK8A 1LGCA 4XZUG 1ULPA 1RUI3 5B4NA 3NKGA 1JOJA 3WT3A 4GKXA 3F2ZA 3OF1A 2DFBA 4YZ2A 5FZ1A 4CCJA 2IXCA 3R4SA 3T0DA 1ZREA 3FL7A 3QACA 5HXMA 2BGOA 4JRAA 2J1TA 3AX4A 4IV3A 2E63A 3KVAA 1OOPC 3C2UA 4B7KA 2C6SA 2UY9A 4LR4A 2VTFA 4AG4A 4WVMB 5IK4A 2RS51 3FZ3A 1HQNA 3CHXA 4OZOA 5DPNA 5DXDA 2Q1FA 3VHPA 3R0RA 5FPUA 2G1MA 2BEOA 1O3QA 4BQ1A 3USUB 1SLAA 4PF5A 1QJY2 1XB9A 1Z7S1 2VOTA 1NLRA 1LGNA 1V6KA 4MGIE 3VZMA 2Q30A 4CUBA 5IFPA 4BH9A 4JGYC 3ROUA 1DQ0A 1PO21 2D3RA 3QLQA 3T0AA 2JDHA 1XU2A 4Q0QA 4KI5M 3V65A 4AEDB 4BIOA 4FTEA 3MBWA 5FLIA 2YFUA 4UWDA 3SH4A 4MV2A 3C7OA 5FMOL 1VBE3 2V5YA 4WVVA 1ONAA 1L7QA 3AVSA 1I5ZA 1PM4A 1YLLA 3NL1A 1DIWA 3WNPA 3OJBA 5BNNA 1UY0A 3IIAA 1QQP1 1W9TA 5GZCA 3IM0A 1UPSA 4P02B 4IESA 4AVBA 1OURA 4P9GA 2YU1A 1CZVA 4Y4YA 2E26A 4CRQA 3AL5A 3HWJA 2MEV2 2VBBA 1JZ4A 1GWMA 4BOWA 1E57A 1NQDA 1J3RA 4KGQA 2CSGA 2AH2A 2B4KA 2GH2A 3FFQA 4X8PA 2WO3A 3AYEA 3VBHA 2NLRA 3N9PA 5FJHA 2VMEA 4XXPA 1CAWA 5FIXA 1W2TA 4F3JA 5FKBA 2VPVA 1PGW2 3IMMA 3ZFEB 1AUYA 2B46X 5LEKA 1OVSA 5L19A 4AYUA 5H9PA 4FPLA 1I6XA 4XURA 1ODMA 5FZ9A 3LDKA 2PHUA 4UF0A 3VBFA 3KF3A 4Q4V3 3ZYPA 5IVVA 1F9KA 2AGSA 1NY72 2IZWA 4JAAA 4HMZA 2VZOA 1XYOA 2QQWA 2JG8B 3ACIA 3OD4A 4CXWA 3FWEA 1N3PA 2WWUA 1OQ1A 4JHTA 3MF9A 2VNVA 1O4TA 4NPRA 2RM23 4BLIA 1ZBE2 2RE9A 4NRPA 1XSRA 3SKVA 2YPDA 1E5SA 4HBNA 4OHZA 1M4WA 4ZXKA 5KR7A 4RR3B 3VUOA 2ZGPA 1LOEA 2ZKNA 4BQ2A 1JYVA 5JXJA 1QJY1 1DU3D 4FI9A 3POJA 4HLTA 4LBLA 4IE4A 1W8WA 4OFGA 4PLNA 3RJRA 4GIQA 2IWGB 4DQAA 3N35A 4BK5A 5AC91 4YVWC 2OT7A 3WDWA 1D2SA 4QX0A 2QDRA 1LHOA 2DURA 4LO7A 4BDVB 2LW8A 4EN9B 3H0OA 4FPEA 1C1FA 4CDQC 2DYCA 4L92A 4KG8A 1IZ3A 2YU2A 2IXIA 3WP4A 4Q4V2 2MHFA 1SDDB 4AQSA 5HBAA 4YW6A 3O1MA 4LKDA 3GBGA 3OUHA 3M3IA 3ILRA 5KHHA 1H2LA 4LBMA 3DL3A 4NN0A 1SEFA 3WW4A 2MEV1 1X50A 4BIFA 1V6MA 1F4AA 3WF2A 4UFIA 2C0ZA 1VBD2 5K0UB 3JQXA 5CFDC 5K9YA 2WNEA 2P4EA 2HJIA 2ARBA 1GKBA 2ETEA 2WLPA 2XVKA 3A0KA 3B69A 1XNKA 4Q1PA 1MZFA 5F2WA 4RFRB 5GLVA 4CE8A 3VDBA 1R083 4EN0A 1QJZA 4CEWC 4NE9A 3LQCA 4XAEA 3CMGA 1PGW1 2IC1A 4DPNA 3E6BA 4Z2WA 4QB1A 1AR83 3T1LA 2A6ZA 1NCRC 3OUJA 3USSA 1VRBA 5C5TA 5FY7A 4L0PA 1I5PA 1NY71 1W6NB 1JZ5A 1WW6A 1JYIA 4XUQA 3RZGA 2ZX2A 2VOVA 3EJKA 3RS6A 2NQYA 1JZ7A 3HN3A 4R9BA 3QH7A 3PJQA 1RUD2 4FAGA 1JZ8A 1S0EA 3TN92 3ZPOA 3LF7A 5FREA 1ND2B 2JG9A 4WZCA 1ZBE1 1UY4A 5A7QA 3UK9A 4DEQA 3OPTA 2GP5A 4CXYA 1RXFA 2UWBA 2HWD2 2XLGA 5EYXA 1DGWX 4H7MA 4EROA 1VMJA 5C4WB 3SC7X 2VG9A 1ND3B 2JB4A 5FQ0B 5FXVA 2VZRA 1YEWA 5J3UA 2HKXA 1LEDA 3POEA 4FPYA 4XOGA 3RDIA 5IK7A 1SMVA 1RTVA 4UOJA 1PHMA 3AMPA 1DCSA 1HB3A 4IGPA 4GMP0 3OBTA 1AYM3 2RDSA 1YQ8A 1PK6C 4RGKA 5JZGA 2B5HA 4CSWA 1UYPA 3ZYJB 1UX7A 3O12A 3CO2A 3WG2A 1PO13 1AR93 4MHRA 3LGRA 5FBJA 2OPKA 4K21A 5FZOA 2ZX3A 1VBD1 4KQ7A 2FMDA 4FTSA 1IS3A 2R062 2BOIA 4M3CF 1NUKA 3S6PA 3D6EA 3PVOA 5FY8A 5FZ6A 1UZ0A 2RS12 5FYZA 1KRIA 3I2FA 1FATA 3IBMA 1SCSA 1WMXA 1L7RA 1SLIA 4Q0UA 2E51A 4XJZA 3ZDSA 5A1FA 4QHBA 4E4HA 1NKGA 1RJ8A 1H2MA 3LSDA 4NOTA 3T1MA 1N1YA 1WZXA 3AXDA 4GXLA 1WUVA 4Q4W3 2LRPA 4IV3B 4AGRA 5A3WA 1KITA 4BXSV 4JTOA 1GZCA 5EQUA 2JE7A 4QPIC 4AQTA 1QWRA 1IS5A 2PHFA 3FJSA 1V00A 5JSOA 4K1YA 2VAUA 3VBOA 1XNDA 2W94A 2PLV2 4LO4B 2VVDA 1CJPA 1HXS3 4RSUA 3NNFA 1F31A 3PHMA 4N7IA 5JPNB 3KZ4C 3TN91 2R073 3ZMNA 3P5BA 1AR92 5JOWA 3WDXA 2NZ9A 3OCPA 1Y4WA 3EHKA 2HWD1 3SLIA 2HWB3 5KXDA 4OUMA 4E9KA 3TNPB 4Y1UA 3VL8A 3M3CA 5FP8A 4BQ5A 2HWC3 1OMIA 4ES9A 1KEXA 5FZ3A 1E5RA 2YBKA 1HN0A 3VD3A 2VZUA 2YFZA 1YWKA 4B29A 3J7HA 2WT2A 2QQNA 5EZWA 2VC9A 2E9QA 2JDMA 1GUIA 1YRZA 2W52A 3W20A 2VMCA 5BNNB 4PIYA 5HCFA 2D6MA 4GD4A 2VU9A 2ZXQA 3N3HA 4NVPA 5J98B 3AL6A 2XKPA 2RV9A 4Q4Y3 4YWAA 3KGLA 2Z5WA 4LA3A 2JDUA 2DVAA 5D2AA 3WY6A 3ZXDA 3MZHA 4L11A 5IK5A 1JUHA 2JD4A 5C33A 1D4M3 1IKQA 3VBHB 5FMCA 4NO4A 4MH0E 1O3RA 3ZN6A 2R061 4QWNA 3WG1A 1CAWB 1P8JA 1JTZX 2RJ2A 1VBC2 4N43C 1Y3TA 2RS11 1CVNA 4LE3A 3KV9A 2R1BA 1LECA 4NMIA 4LK6A 5FPZA 2HWC2 2RDRA 3POGA 4UF0B 4QKFA 4NRQA 3VBFB 3RNSA 3GZAA 5F3GA 2FCVA 2IFRA 4QXKA 5ISLA 2A1XA 1SACA 3G7DA 4CPBA 5HCAA 4CCNA 4FSJA 2W1WA 2OIIA 2RR11 2OUHA 2DUOA 2QQJA 3I8TA 3K51A 3ZKUA 3ABZA 4IEYA 5FCCA 2PLV1 2WQ4A 4C8DA 2WT0A 5FK7A 5LA0A 3ZN5A 5D8AC 1QJFA 5FP4A 2WNVA 4BMEA 3OOXA 1SHWB 2RJLA 3I2JA 1IPJA 1L7LA 5FXXA 3HNYM 3AM2A 3HQXA 1JYTA 3JBG1 4HSLA 3J26N 5E1RA 3KHBA 5LB6A 1EV12 3J7LA 3POWA 2VOKA 2O8OA 4XFBA 4FPOB 1VLNA 2NM1A 3T0BA 4CUAA 1GV9A 2D97A 1ST8A 3MYXA 1GICA 3I2GA 1W0NA 1JMUB 3WUCA 4E27A 4KU8A 5I8YA 1PVC2 4DO0A 5L36A 3I3BA 1I9RA 1LGBA 1UXZA 5KHIA 4P14A 1FT9A 3WW2A 3S0MA 4J1XA 4GZ9A 3RGBA 1SBEA 1SFNA 1ASJ1 1EAH3 2OXBA 2WSVA 1WW7A 1WGPA 1B35C 1NG0A 2P3IA 1R1ZA 2VL4A 4ISRA 4OUEA 4DEVA 5C6CA 2Q4SA 1JZ3A 3UJQA 3WXPA 1FNYA 3GGLA 4QDQA 1HRI3 4P5HA 5FTTC 1AVBA 1C28A 1VBC1 2WFF2 1H0BA 1REFA 3LA7A 2QQOA 4DUVA 3DYOA 1F15A 3K48A 4LORA 5CG8A 1JUIA 4R9CA 1CX1A 4AEMA 3UESA 1Y7BA 3GZEA 5T3NA 2BGPA 3I2KA 1AYN2 3JD72 2JECA 3OSDA 5FY4A 1SLCA 2BJSA 2QJVA 1SFPA 2R7EB 4FPJA 4A4AA 2ARCA 1OVPA 4YLZA 1JN2P 2A7AA 3FFZA 4TN7A 1W06A 5GALA 3R6SA 2JDZA 1EUUA 5FZIA 1TZOA 1BVVA 1W8ZA 2JG9B 3OG2A 1ULCA 4QB2A 2C9AA 3IDBB 4RHV2 4Z1VA 4TSVA 4I0WB 1FAYA 5AFBA 1EAH2 1RVF3 3BPSA 1H4HA 3DUIA 4IV1A 5EP9A 1ULEA 2GMMA 2W92A 1H4GA 3I2IA 4HN1A 4WM7A 1D4VB 3VD5A 5JR2A 3FLPA 3MICA 3E6DA 4AI2A 4XBNA 1US3A 1EV11 5FMBA 1DHKB 3ZSJA 4JTNA 5JZGB 4JX0A 2TUNA 2P3YA 4FOVA 1KDKA 1OA2A 2CNAA 5A3PA 5F32A 1QH6A 3PVEA 3OY8A 3DN7A 1RUH3 2PHLA 1OUXA 3MIGA 4R4ZA 5ERLA 3V0AA 3RZLA 2QZ2A 4U36A 3KVBA 5FZOB 2F4PA 1ZZ6A 1QNWA 5IVCA 4UT5A 1SLLA 4PQQA 4QGLA 4CYDA 2YC0A 5C3SA 1OLMA 5A80A 3U4XA 1BEV3 5FAXA 3O1UA 1TNRA 1H8TA 2JKXA 4P5YA 4XPVA 3VDAA 1GANA 1WD4A 5FZDA 2Y33A 4OUSA 2R043 1AR73 2JICA 1NYWA 2ZAAA 4I3PA 4OHXA 5FBZA 3THTA 3WQBA 2WFF1 4BU2A 3CBNA 4AHYA 1S2KA 5DAWA 1RUJ1 5IVBA 1MS1A 3T2QA 3I2OA 4ORFA 5FZMA 1YI9A 4W6XA 4XW3A 3H7JA 1AYN1 1CAUB 3JD71 1YIPA 1ZZ7A 4V2WA 1GWKA 5A32A 1QJU2 1W8UA 3PDQA 1VP6A 4NAMA 3VBOB 1T6BX 2XH6A 3WV6A 1RUC2 4PBPA 3RG0A 3VD7A 4RS5A 2Q8OA 1R1A3 3M3OA 4LO8A 1OFNA 2E7AA 2CU5A 3BTXA 2K2SA 2J1VA 3C7GA 4RHV1 5T52A 3ZYIB 2BYVE 4QQPA 4RFT0 4XCAA 5C9AC 2R1DA 3AZWA 2A3YA 1UU6A 1GQHA 3DF0A 4XQDA 1O3SA 2VECA 5LBCA 1S0FA 4DUXA 4HXCA 3R4DB 1VBA2 2WAAA 3K3OA 1VBB1 3ME2A 2WR9A 3CZJA 3GBFA 3RI8A 3RZJA 4LO6B 4F8AA 2FBEA 1LENA 2WKKA 3H9AA 3VBUC 4ITCA 5KC6A 4AK3A 2ZAHA 2BNNA 3KLSA 1UZZA 2JIGA 3T30A 3POBA 1HX6A 5JI9A 4UW5A 1YJKA 3VHRA 5DAXA 5IATA 1W03A 2QQMA 4FCAA 4DXSA 2EA7A 2HWF2 2Q0AA 2ZMLA 3H1YA 3IT8A 4QKDA 4R52A 2FDHA 2FDIA 2XBO3 4OHYA 3UYJA 1DYOA 4EYUA 4KNCA 4OYUA 2R32A 2Z42A 3J7MA 4CP9A 1XYNA 1ZBA2 2W95A 3GJAA 4QPWA 5E88A 1R1A2 3ZN6B 2HBUA 4O9GA 4ASMB 1CGPA 4Q0PA 4Q4X3 3LD8A 4D6RA 3DXUA 2GNMA 2V4VA 1RUE3 3D5OA 1YYNA 5IAVA 1J59A 1HRV3 4XBQA 3ZR5A 4NAOA 3NV4A 2EAKA 2TBVA 4CU6A 5L9BA 1JZ6A 2NN8A 2ZX1A 4JGZA 1Q8SA 4S2DA 2YROA 3MIHA 3S7EA 3TWIA 1EY2A 3MIBA 4V2VA 3T2OA 5FXWA 1KJRA 3NSTA 1UMHA 3ILNA 4XIOA 4CEYA 4MGSA 3PU8A 5F5CA 1QDOA 2P2KA 5GLWA 1C4RA 1QJU1 1OXCA
chains in the Genus database with same CATH topology
1OC1A 2IVIB 3ZKYA 1RXFA 4BB3A 2DBNA 1BLZA 2JB4A 2VBBA 3ON7A 5C3SA 2JB8A 1HB4A 2CSGA 3ZKUA 1DCSA 1HB3A 4RGKA 5C3PA 1QJFA 1QJEA 1W2AX 3OOXA 1GP6A 1UOFA 1ODNA 1ODMA 1WA6X 1HB2A 1QIQA 1W3XA 5C3QA 2VBPA 1UOBA 1E5SA 2Y6FA 5C3OA 1HB1A 2Y60A 1E5HA 1E5IA 3ZOIA 1GP5A 1W28A 2WO7A 5C3RA 2VE1A 2VAUA 1W04A 1W2NA 1W03A 1W3VA 2VBDA 1UNBA 2IVJA 5APAA 2DBIA 2BRTA 2VCMA 2BJSA 1E5RA 1UO9A 1UZWA 1GP4A 1W06A 1UOGA 1HJFA 1BK0A 1HJGA 1W05A 1W2OA 4XAEA 2BU9A 1W9YA 1OBNA 1RXGA 1IPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OC1 A;  2IVI B;  3ZKY A;  1RXF A;  4BB3 A;  2DBN A;  1BLZ A;  2JB4 A;  2VBB A;  3ON7 A;  5C3S A;  2JB8 A;  1HB4 A;  2CSG A;  3ZKU A;  1DCS A;  1HB3 A;  4RGK A;  5C3P A;  1QJF A;  1QJE A;  1W2A X;  3OOX A;  1GP6 A;  1UOF A;  1ODN A;  1ODM A;  1WA6 X;  1HB2 A;  1QIQ A;  1W3X A;  5C3Q A;  2VBP A;  1UOB A;  1E5S A;  2Y6F A;  5C3O A;  1HB1 A;  2Y60 A;  1E5H A;  1E5I A;  3ZOI A;  1GP5 A;  1W28 A;  2WO7 A;  5C3R A;  2VE1 A;  2VAU A;  1W04 A;  1W2N A;  1W03 A;  1W3V A;  2VBD A;  1UNB A;  2IVJ A;  5APA A;  2DBI A;  2BRT A;  2VCM A;  2BJS A;  1E5R A;  1UO9 A;  1UZW A;  1GP4 A;  1W06 A;  1UOG A;  1HJF A;  1BK0 A;  1HJG A;  1W05 A;  1W2O A;  4XAE A;  2BU9 A;  1W9Y A;  1OBN A;  1RXG A;  1IPS A; 
#chains in the Genus database with same CATH topology
 1VAM A;  3RMY A;  4D0Q A;  3TOJ A;  3RZM A;  4K6B A;  1RUC 1;  3MFA A;  4LBQ A;  2ZGL A;  3PLQ A;  4UFM A;  4ASK A;  1QNY A;  4QQO A;  1AX2 A;  2WNV B;  1UIK A;  2QQL A;  4LUK A;  2WS9 2;  5FYS A;  4OI1 A;  2XHN A;  1H6X A;  3S5Q A;  1GSL A;  1PGS A;  4WVW A;  1N1S A;  5ACA 2;  1IQA A;  2JEN A;  2ZGQ A;  3AP5 A;  4HPK A;  4PIX A;  2XGX A;  5CKQ A;  1VRH 2;  5JOY A;  4W6Y A;  1LCL A;  1RUF 3;  2PAM A;  4ATF A;  4Q4X 2;  4CZS A;  1OLR A;  1VBA 1;  3R05 A;  4MG2 A;  1GQP A;  1RUE 2;  3ACF A;  2VVE A;  1VB2 A;  1IG0 A;  1UYY A;  3S57 A;  4DXR A;  1YI7 A;  5IYY A;  4LIV A;  3JB8 A;  1A8M A;  1WLC A;  1OOP A;  3K3N A;  2CHH A;  1WME A;  2W2I A;  1XQN A;  2XJT A;  2QBX A;  4PT6 A;  2A3X A;  3NJX A;  3UV9 A;  2WA4 A;  4KWU A;  2HWF 1;  5T5L A;  1QOT A;  2V09 A;  1W8N A;  2Y6G A;  4OI4 A;  1ODN A;  3B93 A;  3IMN A;  3A4U A;  2E53 A;  1ZBA 1;  2PQQ A;  3HEI A;  4LJH A;  1KFU L;  2VZ3 A;  5LK5 A;  3SKJ E;  4FAH A;  5HV0 A;  1ZNP A;  3O1S A;  2AEZ A;  4JGY A;  1DFQ A;  5FZG A;  4AGG A;  4GH4 C;  4AHZ A;  1OF3 A;  4YW4 A;  4Q8L A;  1X7N A;  1URX A;  2CGO A;  5CAD A;  2OA2 A;  3UKN A;  4XJU A;  3OYW A;  4K3U A;  3HNM A;  2RJK A;  4ASL A;  5I93 A;  5DDJ 2;  2Y6F A;  3GAL A;  1JHN A;  1CZT A;  3WDT A;  4RA0 A;  3VZJ A;  4OI0 A;  3KT1 A;  2DUQ A;  1X9T A;  3OPW A;  3PIJ A;  1S0C A;  4Y5S A;  2VQA A;  3JB4 C;  2FHR A;  2OPW A;  2WZR 2;  3HT2 A;  3HIF A;  1LES A;  1TVG A;  2Z69 A;  3BOP A;  1W28 A;  4HG6 B;  1FOD 3;  2VY0 A;  1COV 1;  3W58 A;  1RIT A;  2B7Y A;  3MW2 A;  4W65 A;  5A3M A;  4IV1 B;  4DIQ A;  2EAA A;  5J09 A;  3ZVX A;  4W50 A;  2QFE A;  1S0G A;  2WS9 1;  3BAL A;  3AVR A;  2HWE 2;  4KH9 A;  4QU2 A;  4P00 B;  4WM7 B;  1N1V A;  1S0D A;  3MF6 A;  2Y6L A;  4B1M A;  3PNA A;  2ZGS A;  4EZH A;  4ZU4 A;  1XNT A;  1YHF A;  2ZMN A;  3GJB A;  1BHG A;  2EVX A;  1GQG A;  4LKE A;  5E8A A;  4QM9 A;  3AP4 A;  3FUO A;  4XHB A;  2HYX A;  5FXZ A;  1VAL A;  1FPN 2;  4IDZ A;  4AVA A;  3KF5 A;  3OY8 B;  3D82 A;  4Q1R A;  2W47 A;  4OLL A;  4Y33 A;  1WD3 A;  3URF A;  3ZXA C;  3GCX A;  3V0A B;  1KJL A;  5HXV A;  2FZ1 A;  1ENQ A;  4QQL A;  3B02 A;  5DG1 A;  5A7W A;  5IVJ A;  4AL9 A;  5FDB A;  3I49 A;  3MUZ 1;  5T5P A;  1WCS A;  5JI7 A;  3BTA A;  3AK0 A;  2QZ3 A;  4AWD A;  2ID4 A;  2NMO A;  3VKL A;  5I0U A;  4AZZ A;  5FPX A;  1H8T B;  2C24 A;  2CV6 A;  3RJ2 X;  1O5L A;  4QX2 A;  1QXP A;  4S2F A;  3O14 A;  4HFS A;  4KGG A;  1LHW A;  4DIN B;  1WW4 A;  4DUW A;  1RMU 2;  3POI A;  4PLO A;  1IKP A;  4YVW A;  1LJ7 A;  1V6O A;  3ACG A;  1H2N A;  5T54 A;  3WP3 A;  3FHA A;  2KA3 A;  3QCW A;  1LU1 A;  3T4H B;  4QXB A;  4CDQ A;  3PL0 A;  3MO4 A;  1ULD A;  3ZKY A;  2X5I C;  4HET A;  2ZGO A;  3OPZ A;  3LEI A;  4YG6 A;  5A32 B;  3KV5 A;  4X8N A;  4AFM A;  3R4U A;  4I0B A;  1JOD A;  1Q8O A;  4AAP A;  4BB3 A;  5AC9 3;  1J58 A;  5LA1 A;  3MHZ A;  3NO8 A;  1O6U A;  1XNB A;  3AB0 A;  4RS5 B;  1LNS A;  2WZR 1;  5F9T A;  2XL7 A;  1CX4 A;  3PUS A;  4R9A A;  3AKP A;  2XQX A;  5CFD A;  1VAK A;  1OPM A;  3D0J A;  2VUJ A;  3MIE A;  3CQO A;  5I91 A;  4QX5 A;  3BIW E;  4CCM A;  1ZVF A;  1F2N A;  1R64 A;  3VZL A;  1FV3 A;  1LOB A;  4QX7 A;  3H3Z A;  4MGQ A;  4EZ4 A;  5C3P A;  4CEW A;  2HWE 1;  2BDR A;  1B09 A;  1C8M 3;  5ANN A;  3SH3 A;  3U07 A;  3VBS C;  5IT6 A;  1K3I A;  3WR0 A;  1RUI 2;  2W46 A;  2G4I A;  2WII B;  1MS4 A;  3ECQ A;  1NCR A;  1UYZ A;  2VMF A;  4MET A;  1APN A;  4Q5O A;  1WA6 X;  3H8R A;  2ZKL A;  4G4F A;  4XFA A;  3WSO A;  4EN8 B;  2WAO A;  4FPF A;  4AF9 A;  1W99 A;  2PHR A;  3S5A A;  2BTV C;  4M4R A;  3VKN A;  2G19 A;  5K0U C;  2GH8 A;  3HOB A;  4BQ3 A;  5F6L B;  4OZX A;  2A71 A;  4QPY A;  1WA4 A;  4XMA A;  1FPN 1;  1F8V A;  3O7O A;  1PZ8 A;  2FDF A;  2CDP A;  2GN3 A;  2W68 A;  1CES A;  2YHJ A;  3LIG A;  5C3Q A;  5FY0 A;  1IGO A;  1XNC A;  2XR4 A;  2DCT A;  1C57 A;  3POS A;  4WZF A;  2VZ1 A;  4RD7 A;  4CCL A;  2VMG A;  4CP9 B;  5C3O A;  4BMB A;  2RMU 3;  3S7I A;  2JX9 A;  3NNM A;  3OGV A;  4XQ4 A;  5FYI A;  3N7M A;  4GWJ A;  1E5H A;  2Z2S B;  2RVA A;  4XDO A;  1H9W A;  3C8X A;  1XJA A;  4TXW A;  4CU8 A;  2X05 A;  1VJ2 A;  1F4H A;  3NJV A;  2AAC A;  5DQ0 A;  2JKB A;  5T5J A;  4DOU A;  1RMU 1;  5KC5 A;  4PQ9 A;  4JZR A;  4LHS A;  2P1B A;  1C8M 2;  5EJ1 B;  4F7Z A;  2R0H A;  1PK6 A;  1C1L A;  1TMF 3;  1F5F A;  1GZT A;  1ND2 C;  3HBK A;  4YW7 A;  2DVB A;  5I8S A;  4QPG C;  4YM3 A;  1VBE 2;  3BIE A;  2C5D A;  4AAX A;  3TEZ A;  2ZEY A;  3NV1 A;  2XL9 A;  4A41 A;  1N47 A;  1DGW A;  1YUD A;  5IVE A;  1FMD 3;  2GAL A;  4H14 A;  4U2A A;  2ZX0 A;  2RDN A;  4PI0 A;  4LBQ B;  4XDQ A;  2CAU A;  4C1X A;  3ETP A;  1DZQ A;  2GC2 A;  2WA3 A;  3WEZ A;  1V0A A;  1YFY A;  2QNK A;  3I3M A;  3LE0 A;  4LK7 A;  4FFG A;  4WM8 C;  2B9V A;  2VH9 A;  3PUA A;  4A7K A;  4CDX C;  1HJG A;  5BNP C;  4HPK B;  4Q27 A;  2TNF A;  3F95 A;  4FPK A;  2WNU C;  4Q8K A;  4XYX A;  2VNO A;  4Y5T A;  3MLJ A;  1RB8 G;  1RUI 1;  3O0W A;  1H9P A;  2R16 A;  4LKS A;  5FZC A;  1MZ5 A;  3H1M A;  3PVB B;  1JW6 A;  4URT A;  1OBN A;  2AYH A;  2VQ0 A;  2DUP A;  4XFH A;  4QPI A;  5HCH A;  1AXK A;  2XJS A;  4RL7 A;  5FYB A;  1OC1 A;  4HSJ A;  5A3O A;  2A6W A;  4DY3 A;  4XIL A;  4MLO A;  1WBF A;  3GM8 A;  3LAG A;  5LBF A;  5BV6 A;  5CEH A;  3MLL A;  4IL7 A;  2RM2 2;  3VHO A;  4LNV A;  1YQ2 A;  4JCK A;  3PUQ A;  1FI2 A;  1RJ7 A;  5CAZ A;  2E31 A;  2XWJ B;  4UW6 A;  4XBL A;  4Q0V A;  4CU7 A;  4D7S A;  3VZN A;  3FN9 A;  4JGY B;  1XOY A;  4UFK A;  1PIV 3;  3VDD C;  3LEG A;  2ZOE B;  4DXZ A;  1U5Z A;  1LB2 A;  3FBM A;  4IW3 A;  4Z82 A;  4YM2 A;  3TYJ A;  1LOG A;  3ZFG C;  3NWK A;  4QHO A;  3OYW B;  3N36 A;  4ZS3 A;  4JV4 A;  4Y4R A;  3VN4 A;  2E7Q A;  2VTX J;  3C7E A;  3MID A;  4Y5Z 0;  1SBF A;  4A42 A;  1VBE 1;  3AZY A;  1DYP A;  3N7K A;  1MS9 A;  3HR9 A;  5FPA A;  4MGY E;  1JOP A;  3WF1 A;  2BP6 A;  1ZRC A;  1BVP 1;  4J25 A;  2ADD A;  4UFH A;  5A1A A;  1RYY A;  2ZS6 B;  3IAP A;  3L2H A;  2YDE A;  2GSY A;  3ALQ A;  4CDW C;  1YFX A;  4RQP C;  4YFW A;  4N43 A;  4BPZ A;  3ZYG A;  5FO9 B;  1VMF A;  1DLL A;  5IAX A;  1UF2 C;  1R08 2;  2IFW A;  5FO8 B;  4E2Q A;  3P1I A;  1MVE A;  1VR3 A;  5A7O A;  1PIV 2;  2X53 S;  2BFU L;  5L9R A;  3H1W A;  1STM A;  3VGI A;  1UMI A;  1HV1 A;  5FYH A;  1AR8 2;  1C5H A;  5JWP A;  2OQ6 A;  4OCT A;  2BGC A;  2D98 A;  2GP3 A;  3VBH C;  1TQ5 A;  4H55 A;  1GP5 A;  3FX3 A;  4Q4V 1;  3WIN E;  3I7D A;  3LFI A;  3ZIX A;  3WLU A;  1OD3 A;  1UZY A;  5D8A A;  1AL2 3;  3TNQ A;  5A3U A;  5C8C C;  3RZH A;  2OYZ A;  1WW5 A;  4EN7 B;  5JDB A;  4SLI A;  4CDU C;  2Q1M A;  4IE5 A;  2D3P A;  2RR1 3;  2VXJ A;  4XF9 A;  3BTZ A;  3CLP A;  4Q0S A;  3ZSL A;  2CDO A;  4XJW A;  2F6B A;  5E89 A;  1YNA A;  2QQP A;  4NR1 A;  1DZT A;  2VR4 A;  3CJI C;  1NA1 C;  2FCT A;  4G9S B;  2IXH A;  3KGZ A;  4HVO A;  4ZS2 A;  4CDQ B;  4B3N A;  2W3J A;  1JYX A;  4NIH A;  2C1F A;  1WCU A;  2GMP A;  3M8L A;  1LHV A;  1AYM 2;  2ORX A;  3JBG 3;  3OEB A;  3PIG A;  3LSE A;  3Q8F A;  1A34 A;  2AC1 A;  5DAQ A;  3H3U A;  3HT1 A;  4LIU A;  1AHS A;  5FZ8 A;  1TME 3;  1ZRF A;  4P9I A;  2BU9 A;  1JU3 A;  1RUD 1;  5ABJ C;  1CPN A;  1PO1 2;  2D6K A;  2P3K A;  3P3P A;  2XOM A;  4M0N A;  2Q8C A;  4LT5 A;  2IUW A;  4FOY A;  5CFD B;  3E5Q A;  4J1W A;  1B35 A;  3SHR A;  2VZQ A;  4OVE A;  5HCB A;  3WNK A;  4I09 A;  4HT1 T;  3T08 A;  3U0Z A;  2WWJ A;  3DGT A;  3NNJ A;  4IEO A;  2D5H A;  4LEJ A;  5FP9 A;  2VZT A;  5A7P A;  3ZXJ A;  4CEW B;  1ASJ 3;  5FOJ B;  3MW3 A;  1UWW A;  4ONU A;  5DG2 A;  3TB0 A;  1LKN A;  4QD2 A;  4DY5 A;  1H30 A;  1PNG A;  4Y20 A;  1W6O A;  1R08 1;  1NCR B;  5FYC A;  3ES4 A;  5FWJ A;  2AEY A;  3A0N A;  3TAY A;  1LEM A;  3I3E A;  1OLM E;  1J3Q A;  1J3P A;  2GC1 A;  1SLT A;  2WDB A;  4Q4W 2;  5CIR A;  4MAD A;  5BXX A;  1EP0 A;  3DPR C;  3VBR C;  3ZFF C;  1DDL A;  4R4X A;  4IE0 A;  4YW2 A;  2D6P A;  4GMP 1;  4QXC A;  3LKJ A;  1WMF A;  2MPF A;  5FY9 A;  2YGL A;  3Q8E A;  1HXS 2;  3O1P A;  2QCS B;  5JIA A;  1V9U 3;  1YC6 1;  3LFM A;  3WQ1 A;  2R07 2;  2Y34 A;  1AR6 3;  1ULG A;  1GP6 A;  2ZZQ A;  2V73 A;  1UMZ A;  2HWB 2;  4A3Z A;  2JJ6 A;  5E16 A;  3RYK A;  1DQ5 A;  3VD4 A;  1PX3 A;  3GF6 A;  3WQ7 A;  2D44 A;  2XON A;  4TLG A;  1OPO A;  3APB A;  4CTE A;  1PK6 B;  4PDW A;  2HH9 A;  3WDU A;  3H8X A;  3MEP A;  3ZYF A;  2P37 A;  5I0D A;  4GA9 A;  3CDZ B;  4K8F A;  1AYM 1;  5KXE A;  4M0H A;  3LDB A;  4HKL A;  5FZA A;  4P9X A;  1OQE A;  3NAP C;  2ZGR A;  3PJY A;  3BCW A;  3EXU A;  3SMH A;  3WNN A;  3ST7 A;  4Q4Y 2;  2AEN A;  2JDK A;  1PO1 1;  1AR9 1;  3HQU A;  3ITQ A;  1E5I A;  1UKR A;  2OQ7 A;  1OH4 A;  1AX0 A;  2G9G A;  5LBE A;  4XUN A;  1D4M 2;  2LRO A;  3WVJ A;  4AHX A;  4MUV A;  2BNO A;  4CPB D;  4LLO A;  2WRA A;  4D6Q A;  1KXG A;  3WP5 A;  3V0B A;  2YUE A;  2UYA A;  2I74 A;  3HQR A;  2RS3 3;  3P6B A;  4NUB A;  1MEC 3;  5FMO S;  1K5J A;  2XDV A;  1BMV 2;  4EV0 A;  2VBD A;  1DQ6 A;  4IER A;  4A6O A;  1GZ9 A;  3GHN A;  3MUY 1;  1AJO A;  3ZX7 A;  4QDS A;  4QPI B;  4FXK B;  2X29 A;  1OHF A;  2GC0 A;  3EYP A;  5F5Q A;  1OSG A;  3N7J A;  3MPB A;  3N9L A;  3K4Z A;  1C3H A;  1HW5 A;  2KD7 A;  2ZHL A;  2WUH A;  1US2 A;  1WCQ A;  4KL1 A;  2VNR A;  4AW7 A;  1BKZ A;  1UOG A;  3ORJ A;  4CUC A;  2DF7 A;  5FK8 A;  1RUJ 3;  3RWN A;  5H9S A;  2UWC A;  3UKT A;  1YXW A;  1OT5 A;  5L7O A;  1NOV A;  4FXG B;  5C9A A;  1ZRR A;  3IAQ A;  4QXH A;  2R07 1;  4JRL A;  5C7G A;  1AZD A;  1IS4 A;  2WZP P;  3TBD A;  4COZ A;  1W9Y A;  1LHN A;  2BNM A;  4J6G A;  1OKQ A;  2HWB 1;  5K8S A;  5K7P A;  1UD1 A;  5HPO A;  1DQ4 A;  4UYB A;  1CON A;  2R30 A;  4MZU A;  4WVZ A;  3AYC A;  2DU0 A;  2HWC 1;  2VM9 A;  5GJ6 A;  5EFU A;  3VBU A;  3UT0 A;  5GLU A;  3CEW A;  3LCP A;  3M2M A;  4O9E A;  5FUN A;  4CCD A;  4EE2 A;  1VMH A;  1SBD A;  1V70 A;  1DLC A;  3WOG A;  4EQV A;  4HKO A;  3AKT A;  1QF3 A;  3N9N A;  1VBB 3;  4DFS A;  1NXD 1;  1UKG A;  1W2U A;  3WNL A;  4PBO A;  2YY1 A;  2VJX A;  4M01 A;  1K5M C;  4Q4Y 1;  4H2A A;  3K4A A;  4QGM A;  2YPJ A;  3AFG A;  3RMX A;  2VUL A;  4BZ4 A;  4OHV A;  3H42 B;  1ZZ8 A;  1W6Q A;  5FMD A;  2HBT A;  2ZHM A;  3PMS A;  2DBN A;  2J42 A;  1D4M 1;  2WBK A;  1H1I A;  1IOA A;  4N43 B;  5J37 A;  5B4X A;  1OF4 A;  4I3G A;  4ATE A;  1POV 3;  5FUP A;  2K9Z A;  1RHI 3;  2UYB A;  2KM2 A;  1HRI 2;  4XFF A;  1G9D A;  4JDM A;  4S2G A;  2B42 B;  1V6N A;  4NPM A;  2WL1 A;  4E2S A;  4MYE A;  1BMV 1;  1I3H A;  1W0O A;  4E8D A;  3U14 A;  3FC0 A;  1LTE A;  5JIU A;  4NHK A;  3B5L B;  1MPX A;  3RVH A;  2QTW B;  1VE0 A;  1PVC 1;  4COU A;  5F3I A;  3ZSE A;  2ET1 A;  2TEP A;  1HB2 A;  2DVD A;  4XF0 A;  3DCQ A;  4XZP A;  4QQ2 A;  5A6Q A;  4FPG A;  2QE3 A;  1REE A;  5FV3 A;  3MIF A;  4YVS C;  4QB6 A;  3RYP A;  4YW3 A;  5D8A B;  5JXH A;  2YBP A;  4CVU A;  3VL9 A;  1G9F A;  3U37 A;  3WHU A;  1W3X A;  4L99 A;  2ILM A;  3AXE A;  5AVA A;  3FUQ A;  2LS6 A;  5BNO C;  4N9H A;  1DGL A;  5LBB A;  3JCI A;  4YYO A;  1JHJ A;  1RVF 2;  4XFG A;  1UU5 A;  3HMY A;  5CZK A;  1QHD A;  2D93 A;  2I2S A;  4CU9 A;  3ASI A;  5A33 A;  5C71 A;  1RUO A;  2FDK A;  3ZYR A;  2CTV A;  2YV8 A;  4QKB A;  3JZV A;  1NCQ C;  2ZGT A;  1CPM A;  3GCW A;  3K46 A;  4AI8 A;  4B7E A;  1QDC A;  1X82 A;  5KHK A;  2BUK A;  4HVR A;  4RGG A;  3B94 A;  3KV4 A;  2EAL A;  3O0X A;  5JPM B;  1H6Y A;  1RUG 3;  2VCC A;  2V5D A;  1YQ5 A;  3A22 A;  4IE7 A;  1L3J A;  1W3V A;  5H9R A;  1UNB A;  4D7Y A;  2DCZ A;  5C70 A;  1B35 B;  5CA6 A;  1RUH 2;  2HYK A;  4GAZ A;  4LMF A;  1HQL A;  2ZX4 A;  4EN6 B;  1EAH 1;  5FP3 A;  4AOC A;  2BRT A;  5I0R A;  1X9P A;  4GWM A;  4N53 C;  2OS2 A;  4E2G A;  3K77 A;  3I3D A;  4FP3 A;  1LOD A;  3D0S A;  3PUI A;  3TEX A;  2Q5T A;  4AI0 A;  3ZMO A;  2QDN A;  4GH4 A;  1BEV 2;  2A70 A;  3B9C A;  4LXL A;  3P3N A;  1W6O B;  3AP6 A;  4FO9 A;  5LA9 A;  4HON A;  5FZ0 A;  1CWP A;  1V6L A;  2R04 2;  1AR7 2;  4RYD A;  4ZON A;  1Q43 A;  4BA6 A;  3UET A;  4A3X A;  3ZN4 A;  3GYD A;  1MQT C;  3GHM A;  4L2N A;  4X6R B;  4GB3 3;  1GBG A;  4K40 A;  2KR2 A;  3U75 A;  3M3E A;  2N7G A;  5DAB A;  2FMY A;  3O0V A;  3I2H A;  1Q8P A;  3AZX A;  3BU7 A;  3U78 A;  1RXG A;  1UU4 A;  5A70 A;  1ZRI A;  1BBT 3;  2JEM A;  2K0G A;  4XF4 A;  2GNB A;  3SCF A;  3B9I A;  2OX0 A;  4LKF A;  3WP6 A;  4TLF A;  4WBB A;  4BIS A;  4P9L A;  4IEX A;  1Q8V A;  1W8H A;  4DRV A;  2XPJ A;  3J8F 3;  1KD7 A;  2Y38 A;  1GNZ A;  3AYD A;  5CFC C;  4FFF A;  3L2Y A;  3LZZ A;  2D7F A;  3JU9 A;  4L97 A;  3KT4 A;  1UX6 A;  3C7H A;  4UI9 L;  3HNB M;  3B01 A;  1EUT A;  4GUL A;  1U5I A;  1W6M A;  1SDW A;  1UY2 A;  3OBZ A;  1COV 3;  1QJX 3;  4BE3 A;  1DQ1 A;  2HEW F;  2RDQ A;  1YQ6 A;  5SV8 A;  3W9A A;  4FBF A;  1K45 A;  4PDW B;  2WT1 A;  2W1U A;  1LOF C;  4KMQ A;  2D40 A;  1AJK A;  3NRU A;  3ON7 A;  2JB8 A;  3IDE A;  1NX9 A;  4XMI A;  1DZR A;  3WUD A;  4TTG A;  1LRH A;  1WLW A;  1R09 3;  1UIJ A;  2W5F A;  2Y0O A;  5DZF A;  4MGT A;  1Q5O A;  1SQ4 A;  3POY A;  4YPJ A;  2QUO A;  1O7F A;  5KXC A;  1GWL A;  1ALY A;  4NII A;  2J1A A;  1UXX X;  1MZE A;  1SG3 A;  1UW8 A;  4XAB A;  4LOT A;  3T3Y A;  4COW A;  4CCO A;  2SLI A;  1RUH 1;  4GWI A;  2XBO 2;  2VGD A;  5ANQ A;  3B00 A;  5BYN A;  2VXR A;  1LAJ A;  4ZY9 A;  3AMM A;  1DGR A;  2P3J A;  3NW4 A;  1XE8 A;  4OMC A;  1UL9 A;  5CYY A;  3BYW A;  3DEC A;  3H8O A;  3DEM A;  3HVD A;  3T2T A;  3V0B B;  4IEP A;  4E4S A;  1BXH A;  1BEV 1;  4ES8 A;  3H50 A;  4ZU7 A;  1HRV 2;  4LBQ D;  4BJ0 A;  2EXI A;  5T50 A;  3I59 A;  1U12 A;  2R04 1;  1AR7 1;  1PZ7 A;  3LPF A;  4XFI A;  3AP7 A;  1GOG A;  1QMJ A;  2X5I A;  1T2X A;  3WG4 A;  2ES3 A;  1D0H A;  3IPV A;  1CJD A;  3OEA A;  4N9I A;  2R6Q A;  2ZBJ A;  3E6C C;  1O5U A;  4EJR A;  3W5M A;  3LOI A;  1Z78 A;  3BUC A;  5FLH A;  4MVT A;  1QY4 A;  3JUU A;  5K4L A;  2Y8K A;  3DYM A;  4ZXE A;  4IUG A;  1BJQ A;  2CGN A;  5L73 A;  5L7O B;  3EMR A;  5FY5 A;  4COV A;  5C9A B;  2VE1 A;  2V72 A;  3OD0 A;  4QAW A;  3HBZ A;  3WX5 A;  5F3C A;  1R1A 1;  4JHZ A;  1J84 A;  2XKO A;  1DQ2 A;  2RS5 3;  3WF0 A;  3FMG A;  2W9X A;  5JR7 B;  3O1T A;  1XPW A;  2BER A;  3VBS A;  1AF9 A;  1QXJ A;  1XC6 A;  1RC6 A;  1GYK A;  1DYK A;  4FTB A;  4D94 A;  3VZK A;  5A3L A;  3VBU B;  2YGM A;  1RUF 2;  4YZ4 A;  1Z7S 3;  4AVV A;  3U4S A;  4PLM A;  5LK7 B;  5K0U A;  4R9D A;  5JCT A;  4BK4 A;  2EIE A;  3NVC A;  1PO2 3;  4E4D X;  4NIG A;  1NZC A;  3RYR A;  5EIY B;  5FY1 A;  3WQ0 A;  2QVS B;  2VOW A;  4B4P A;  2IXJ A;  2Z4F A;  3C7F A;  1D7P M;  1F35 A;  2B8M A;  4Y1X A;  5CU1 A;  4AED C;  4AEK A;  1QQP 3;  2RG4 A;  2ZHK A;  4XFC A;  3U11 A;  1OLQ A;  3EO6 A;  1W6Q B;  5T5O A;  4YFZ A;  1QH7 A;  1S0B A;  2XBO 1;  2X09 A;  2YC2 A;  1FNZ A;  4YM1 A;  5ACA 1;  2PHX A;  1UOJ A;  1IPS A;  2ZTN A;  4X6Q B;  1D0G A;  3BGA A;  4BCU A;  2JDA A;  2VO5 A;  1VRH 1;  2XLA A;  2VW1 A;  3ILF A;  4NRM A;  4XCB A;  3D4K A;  4FT8 A;  4AR2 A;  4O65 A;  5BY5 A;  1Q56 A;  4Q4X 1;  1GNH A;  5FWE A;  4B4R A;  4AEJ A;  2WJS A;  1RUE 1;  4O7X A;  1RED A;  5DN2 A;  3VKM A;  4C1W A;  3UGH A;  1WCD J;  1LOC A;  1U0A A;  2V4A A;  4L8Q A;  4QPG A;  4ZKT B;  3VDC A;  4P9J A;  5A6Y A;  1W9F A;  3G6J B;  3CU7 A;  3NV3 A;  1SZB A;  1ZZC A;  4DZG A;  5LY2 A;  4FP2 A;  2JE8 A;  5DUX A;  3RWK X;  1GU3 A;  1YQC A;  2YBS A;  3W5N A;  2ZGK A;  1HDK A;  2WZ8 A;  1VPH A;  4YGE A;  1PO2 2;  3ZFE C;  4BYY A;  4C90 A;  4UFL A;  2CAV A;  4HOO A;  1W90 A;  2EIC A;  4IQP A;  4BLJ A;  4AQ6 A;  1FOD 2;  1X8M A;  2DCK A;  4WM8 A;  4CDX A;  4Y24 A;  4LHL A;  2DWR A;  4YW5 A;  5BNP A;  4AXO A;  1HV0 A;  2JG8 C;  2WNU A;  1TE1 B;  1UYX A;  3HAG A;  3KT7 A;  3L9J T;  5A33 B;  3AFK A;  1PM7 A;  2I07 B;  4IEQ A;  3JXS A;  4MO3 M;  1RUN A;  2PHT A;  1QJY 3;  1N1T A;  2BOJ A;  5A3T A;  4UAP A;  1EPW A;  2O0O A;  2XHK A;  5DDJ 1;  2O14 A;  1W6P A;  5JMO A;  4RR3 C;  1NLQ A;  2VZS A;  5G05 L;  4FVV A;  3Q9O A;  2EF6 A;  2EXH A;  1CZS A;  2J1S A;  4XEZ A;  1UZV A;  2PHW A;  3OGR A;  5GLT A;  5TSW A;  3Q8A A;  2WZE A;  2L9L A;  3J9S A;  1WMD A;  1PVX A;  2XJR A;  3MPP G;  2P6H A;  3VD9 A;  1IG3 A;  4TZD A;  4FOQ A;  2ZPX A;  3RZK A;  3LA2 A;  3IZO A;  3QH6 A;  2H0B A;  3CNA A;  4AGV A;  4XXA A;  3GBW A;  3PVN A;  1X33 A;  5LA2 A;  5T55 A;  3VDD A;  4GH4 B;  1ZZ9 A;  2MEV 3;  2K46 A;  2NPI A;  3ZOI A;  2H6B A;  3ACL A;  4YAR A;  4M00 A;  4DMI A;  5FR3 A;  2WQZ C;  3VV1 A;  3ZFG A;  3O1O A;  4YNI A;  5GZF A;  4Z2A A;  3UGF A;  4LHK A;  3PUH A;  4TYS A;  2LM3 A;  3RPQ A;  2O8Q A;  4K1Z A;  1ULO A;  4Y3O A;  2E33 A;  3I2D A;  4YW1 A;  3FE5 A;  1A3K A;  2ZMK A;  1YJL A;  2E7T A;  2YYO A;  1HLC A;  1Y9G A;  4YGB A;  2DBI A;  2CGP A;  1G6N A;  5LY1 A;  3ZSM A;  3VLB B;  5AC9 2;  3LPG A;  4HK9 A;  2JWP A;  1UO9 A;  1MS5 A;  2XJU A;  4LBN A;  2F17 A;  3WW1 A;  1HJF A;  4N8M A;  5BPX A;  1OA4 A;  4D7T A;  4CDW A;  1FOD 1;  4MOA A;  1XSQ A;  4RQP A;  4I2O A;  2XUM A;  2QKD A;  5FPL A;  2QQV A;  1W6M B;  4B8E A;  1CIW A;  1ZBE 3;  5EYY A;  1W8O A;  3K4D A;  3NMB A;  4IEW A;  1W05 A;  4JGZ B;  2PXJ A;  3KS7 A;  1MS8 A;  4LBO A;  2H0V A;  2ZGU A;  4Z8B A;  5BUV A;  5AVP A;  4BHP A;  3B3Q E;  2BVB A;  2XB6 C;  4D8M A;  1JYW A;  3PTR B;  1OQD A;  5CVR A;  4CEY B;  4AHW A;  1X8E A;  1J1L A;  1O91 A;  3ACH A;  3H3L A;  3M7A A;  4KBB A;  3THP A;  4QX1 A;  1OFS A;  1LHU A;  2PYT A;  2XQR A;  4A44 A;  2ZAC A;  4E4Z A;  5C4W C;  1ND3 C;  2IVI B;  3QBQ A;  3BPZ A;  2HEY F;  4Y1V A;  1NQJ A;  1W0P A;  3NNL A;  5EPA A;  3NQH A;  3ZXK A;  5C8C A;  3OGJ A;  2AZ5 A;  3AJZ A;  1NAE A;  1C5I A;  3JQW A;  3I4I A;  4ISQ A;  4CDU A;  4YZ1 A;  5A1L A;  1JYC A;  5FYU A;  2PFW A;  3VKO A;  1CR7 A;  2DCJ A;  3IN9 A;  2A6X A;  2BWA A;  2HLE A;  1N3O A;  5F8P A;  2RMU 2;  3OUI A;  4XJ9 A;  4A45 A;  4WV8 A;  3LB9 A;  1XRU A;  3ZSK A;  2E6V A;  2ZEX A;  3ZIW A;  5M0T A;  1VBD 3;  1YIF A;  4MGZ E;  1G8W A;  2WFP A;  1NA1 A;  3CJI A;  4GAL A;  1FYU A;  3I59 B;  4MXV A;  2Q1Z B;  3LA3 A;  2Y6K A;  1XE0 A;  4XTM A;  2BBA A;  2GU9 A;  1OOP B;  1T6G C;  2VZV A;  2X5I B;  1S0I A;  3SXW A;  5JOX A;  3FHI B;  2JDP A;  3IPV B;  3Q8B A;  1TMF 2;  2DTY A;  2X8K A;  2DVG A;  2Y6H A;  5IK8 A;  1QJE A;  3E97 A;  2VOX A;  1W2A X;  5DAP A;  3TEW A;  2CWS A;  1JZ2 A;  3POF A;  4UFJ A;  5ABJ A;  4CCK A;  2Y6J A;  3TRS B;  3AJY A;  3E5U A;  4CA9 A;  4M3C A;  1LUL A;  2G9Z A;  1FMD 2;  2A6V A;  1W8F A;  1OD5 A;  4CP0 A;  4K20 A;  2YXS A;  3MV1 1;  3THD A;  2ERF A;  2A5Z A;  4Y1Y A;  3WD5 A;  4PJY A;  5A7S A;  2WLQ A;  4XAA A;  3OBR A;  2Q8E A;  2WNO A;  3FLT A;  4IV3 C;  4CUG A;  3VBS B;  1RUD 3;  2VW2 A;  3TN9 3;  4QMA A;  4LTA A;  5GZE A;  3KMH A;  2VNG A;  2GME A;  4XQW A;  2HWD 3;  3D8C A;  4IEU A;  2OZJ A;  1C8M 1;  4L9B A;  4QU1 A;  3CIH A;  4BWO A;  2DCY A;  4P08 A;  2PN5 A;  1K12 A;  2I45 A;  4LPL A;  3ZYH A;  4V1P A;  1XYP A;  4AQ2 A;  3NJZ A;  1XBF A;  1JI6 A;  3N9M A;  3BOW A;  1BK1 A;  5C5U A;  2O1Q A;  3HPN A;  2XML A;  4C0B A;  3LOB A;  3DPR A;  3VBR A;  2J1U A;  4KBZ A;  4OI2 A;  3ZFF A;  2C9K A;  1NXM A;  3SEP A;  4Y1Z A;  3ZPY A;  4YRD A;  2CL2 A;  3AMQ A;  2OZ6 A;  5FZB A;  2LTN A;  2Y0I A;  5JXG A;  1MR5 A;  4GKY A;  2LAL A;  3H7Y A;  1V6J A;  4FFI A;  2VVF A;  3WDY A;  4AFD A;  1LOA A;  1KDM A;  2J1E A;  4NWV A;  1I1E A;  2B9U A;  2J7M A;  1HQW A;  5BNN C;  1UQX A;  2RMU 1;  3MFC A;  4GMP 3;  3BB6 A;  4BQ4 A;  4OUL A;  1MS0 A;  3EQE A;  3RQ0 A;  2ZZJ A;  4QQH A;  4YZ3 A;  2R06 3;  3O5S A;  3INA A;  2ARX A;  2ET7 A;  4QPG B;  2BW8 A;  5GKA C;  2WAB A;  3WHT A;  1VB4 A;  2RS1 3;  5KHG A;  3M3Q A;  3PTY A;  1LU2 A;  1TMF 1;  1K42 A;  3C3V A;  1DBN A;  3NAP A;  1SPP A;  4JKL A;  1SCR A;  1J83 A;  2YMZ A;  5DUU A;  3CJX A;  3WF4 A;  2EXK A;  1D2Q A;  3GDB A;  2DTW A;  5LAS A;  5A7W B;  3M1H A;  3VHN A;  1POQ A;  2VUC A;  2FQP A;  3FBY A;  3OGS A;  1KS4 A;  3OB8 A;  4LA2 A;  4QGN A;  2RM2 1;  1GR3 A;  4C0H A;  5HI0 A;  1Y9Q A;  1FMD 1;  2W39 A;  5GM0 A;  5J48 A;  3MW4 A;  1O4Y A;  3DKW A;  3UGG A;  1BCX A;  4WM8 B;  3VBF C;  3OBA A;  4CDX B;  1DG6 A;  4NHL A;  3NJY A;  5BNP B;  4SBV A;  1DGR N;  4NWW A;  2PLV 3;  2GND A;  2WNU B;  3ENR A;  5FJK A;  1SFY A;  4YVW B;  4QDR A;  1O59 A;  2Z79 A;  1JXN A;  2BWC A;  2VCB A;  3U10 A;  1KFX L;  3DYP A;  2JDY A;  4N90 A;  5LW9 A;  1W6P B;  2D6O X;  3HJR A;  3EBR A;  1V6I A;  2Y64 A;  4Q26 A;  1QXR A;  2XVL A;  1JBC A;  2D43 A;  2J1R A;  4QT6 A;  5B2G B;  4QX3 A;  3QOP A;  5F1R A;  1G86 A;  3QD6 A;  5IFT A;  3AMH A;  5CIS A;  1ZZB A;  1JS9 A;  3IWZ A;  1TEI A;  1CD3 G;  1H8V A;  1Y9M A;  3A7Q A;  1GZW A;  1RGS A;  1AL2 2;  2JDN A;  4URA A;  3ZO0 B;  3VDD B;  4AVT A;  1WWY A;  1CAU A;  2RR1 2;  3H8U A;  3CKH A;  4GQ7 A;  3SCG A;  4A6S A;  1VAV A;  2ENR A;  4FPH A;  5DUV A;  3ZFG B;  4A2U A;  2PAK A;  2DVF A;  3HN1 A;  1PIV 1;  1PMI A;  1QIQ A;  1MAC A;  4LHN A;  5EHD A;  3IDA A;  1PX4 A;  5EJZ B;  1PZ9 A;  5FUI A;  2MNG A;  1AR8 1;  2DV9 A;  4JC1 A;  4Z07 A;  5F5A A;  5JAX A;  3J7N A;  1VBC 3;  4NHM A;  3WDV A;  3GNE A;  3HD8 B;  4IEV A;  4AVC A;  5FO7 B;  2A6Y A;  3JBG 2;  3WG3 A;  5J1X A;  4GWN A;  1PNF A;  2D6L X;  4EWD A;  1K5M A;  5A6X A;  1TME 2;  4NPL A;  2Y60 A;  4JKK A;  5E6H A;  4MGK E;  4IGO A;  3RZZ A;  1S2B A;  4CDW B;  2BV4 A;  5KWR A;  2DFC A;  4RQP B;  2WN2 A;  2RHP A;  3RSJ A;  4Z92 B;  4DRR A;  3ZXE A;  1IHM A;  2X10 A;  1FXZ A;  4NRO A;  5LZ6 A;  3KCC A;  1ENS A;  1WKY A;  4XUP A;  5FZF A;  1W8T A;  2VUD A;  5IUQ A;  4Q29 A;  1ASJ 2;  5J36 A;  4COY A;  5FZ7 A;  3K75 B;  1O4Z A;  1CAX A;  3MLK A;  1UAI A;  1IQD C;  2R49 A;  2YG0 A;  4KU7 A;  4LUL A;  2JG9 C;  2XWB B;  4N7U A;  4NHX A;  4OHW A;  2IVJ A;  4AVS A;  4XAC A;  5APA A;  2VZP A;  4A7Y A;  5DMY A;  4K9S A;  4PIZ A;  5LRR A;  2FZ2 A;  3VB9 A;  1LR5 A;  3WNM A;  1EV1 3;  1H1A A;  3I3Q A;  3WZ1 A;  1G9A A;  4MSV A;  1YFU A;  2WYF A;  1UZW A;  4IE6 A;  1GP4 A;  1QKQ A;  4YVS A;  4FFH A;  1O3T A;  3NV2 A;  5C8C B;  2P6C A;  4Q2F A;  5LEJ A;  1UCX A;  3BKZ A;  3BVC A;  4CDU B;  1PVC 3;  5F39 A;  3VZO A;  1J1T A;  4AE2 A;  5BNO A;  5JZG C;  1S4C A;  1YO8 A;  3K2O A;  1V9U 2;  1AL2 1;  3ZXG A;  3M70 A;  5CKN A;  2NMN A;  3WF3 A;  1AR6 2;  5FZE A;  1MZ6 A;  4E8C A;  4FPC A;  3AP9 A;  4HVQ A;  2ZGN A;  4IET A;  3ZM8 A;  3CJI B;  5CG9 A;  1NA1 B;  2VMI A;  1NCQ A;  4JDO A;  3ZXF A;  4LOS A;  1DF0 A;  3NKT A;  4ZPI A;  4AI3 A;  1U5X A;  2YC4 A;  4FQ4 A;  2ZEW A;  1PMH X;  4AI1 A;  3SNM A;  4BQW A;  2GDF A;  3KM5 A;  5F37 A;  4Q4W 1;  1IPK A;  2WFF 3;  1ZX5 A;  5ABJ B;  5LCW L;  1ENR A;  3FHQ A;  4YG3 A;  4BQX A;  3BI3 A;  3E1F 1;  4M3C B;  4MXW A;  2EIB A;  4NJ4 A;  1HXS 1;  1TME 1;  1AYN 3;  2XJP A;  3JD7 3;  1C8N A;  3SQO A;  2H6C A;  4XDP A;  4N53 A;  4LUM A;  1IS6 A;  5FPB A;  4ZU5 A;  2XVG A;  1ULF A;  1ACC A;  4ARY A;  1WLD A;  1Y43 B;  2BBV A;  1M06 G;  1ZA7 A;  2OUJ A;  5FZK A;  4DXT A;  4RHV 3;  3VBO C;  5HV4 A;  1FV2 A;  5FFO C;  3N9O A;  1NT0 A;  2CWM A;  1ZM1 A;  5D1I A;  2QQI A;  2RS3 2;  5IWF A;  1MEC 2;  1MQT A;  2F4L A;  4LBK A;  5F6K A;  2Q8D A;  4B4Q A;  4XET A;  1KS5 A;  1KQR A;  2AUY A;  1UOF A;  4DNY A;  3D3A A;  4NHY A;  5EV7 A;  3DPR B;  3VBR B;  2B45 X;  2UY8 A;  3ZFF B;  4Y22 A;  4LIT A;  1H2K A;  2JE9 A;  4LQR A;  3UKV A;  3O1R A;  1HN1 A;  3WCS A;  3DV8 A;  2W0X A;  3UJO A;  5FOB B;  2XLF A;  4K7J A;  3WCR A;  4YG0 A;  1KGY A;  2D3S A;  5G04 L;  3ZXL A;  5F7U A;  4YGC A;  1AXY A;  5FYV A;  1RUJ 2;  3T2P A;  4LE4 A;  2ARE A;  3OGG A;  5CFC A;  5F5I A;  2EIG A;  2VBP A;  4CCC A;  1N3Q A;  2ZGM A;  1V9U 1;  1OUS A;  1NZI A;  4PCR A;  3T4V A;  3M4F A;  1UY3 A;  1AR6 1;  2C26 A;  1S1A A;  5EXO A;  4XTP A;  4ZZ8 A;  4I01 A;  3NNG A;  3ATG A;  3LEM A;  1AX1 A;  5FYY A;  1PGL 2;  4XHX A;  1LOF A;  2G9F A;  1CAV A;  2DDU A;  1ZA4 A;  2A73 B;  5GZG A;  1O8S A;  2P17 A;  4DS0 A;  1U5Y A;  4FOW A;  5JSR A;  5FPV A;  2WO7 A;  5C3R A;  2P5B A;  4C91 A;  2Y26 A;  3MI8 A;  4B1L A;  3N7L A;  2DU1 A;  3NAP B;  1SPP B;  3KWV A;  4ET7 A;  3N9Q A;  3ELN A;  3SCH A;  1HIX A;  1VBB 2;  2YZ4 A;  5JVV A;  2VTX A;  3ES1 A;  1GOF A;  3RRD A;  3W21 A;  5CB7 A;  1POV 0;  2PQS A;  1GLH A;  1BQP A;  1AL0 G;  1G9B A;  1CIY A;  1QJU 3;  2P34 A;  4PDW C;  2VCM A;  4PI2 A;  3BN6 A;  4MX3 A;  3SIT A;  3WNX A;  3ZDV A;  2HEV F;  1RUC 3;  4OQ9 A;  1EPZ A;  1O8P A;  1GMM A;  2OKX A;  3LDR A;  3KCY A;  1BK0 A;  2ARA A;  4CCE A;  5I0T A;  4BM8 A;  1G9C A;  1RHI 2;  2PEL A;  2WQ8 A;  5DAV A;  3W59 A;  4XIK A;  1Q3E A;  3SH5 A;  5KBF A;  4UBH A;  2WO1 A;  2B39 A;  2RS3 1;  1W2O A;  1MEC 1;  5CKM A;  2WNV C;  4I0A A;  4XF3 A;  5JLV A;  1VBA 3;  1JH5 A;  4CXX A;  2NP0 A;  4D6S A;  2OVU A;  2WN3 A;  1JOB A;  2W08 A;  3KV6 A;  2VCA A;  2ZCW A;  4GJY A;  2LUW A;  1A78 A;  1GZW B;  3KB5 A;  3WW3 A;  2W91 A;  4YSF A;  3A21 A;  3A23 A;  4JDN A;  1RL3 A;  5CNA A;  1SLB A;  2WIN B;  2ATF A;  1RIR A;  5H9Q A;  5I8T A;  1HKD A;  1OH3 A;  2HWF 3;  4IND A;  3LWC A;  4OMD A;  4Y20 B;  4A7Z A;  4CP1 A;  1HRI 1;  4M4P A;  1NE6 A;  1W9S A;  1X36 A;  2BFU S;  2VW0 A;  3E5X A;  4QM8 A;  4WVM A;  5F2S A;  4AFA A;  4CP2 A;  2VQT A;  1ZRD A;  1S2E A;  1PMJ X;  1EYB A;  1QEX A;  1ZBA 3;  1PGL 1;  2PTM A;  5BNQ A;  1BLZ A;  2IXL A;  3USU A;  5FZH A;  3AZV A;  3RI9 A;  5AFE A;  5L7O C;  1QGL A;  2D5F A;  2UUR A;  2GN7 A;  2VUA A;  3KSC A;  2PAE A;  4I30 A;  4I02 A;  3UL2 A;  4XVH A;  2VD7 A;  2WC2 A;  2UWA A;  1RUG 2;  3AKR A;  4AED A;  1K5M B;  3U1X A;  1CQ9 A;  3V64 A;  2OW4 A;  2PA7 A;  3ZLI A;  3J4U H;  4JKM A;  5LWB A;  4O61 A;  3WNO A;  5LAT A;  3AC0 A;  2BZD A;  4IEZ A;  3DXT A;  2XJQ A;  2WSU A;  2GZW A;  4LO5 B;  3IDC B;  1A6C A;  1RVF 1;  2GAU A;  2VMH A;  5IVF A;  5JMC A;  1UPI A;  2ZA9 A;  2SBA A;  4YZ5 A;  1BZW A;  1CN1 A;  4HN0 A;  5JXI A;  3PME A;  1CAX B;  1QOS A;  1VIW B;  2WS9 3;  3PUR A;  4JQR A;  1POV 1;  2XG3 A;  5IVY A;  1H1M A;  1RHI 1;  5GLZ A;  2JXA A;  5ACA 3;  3SIS A;  2W1Q A;  4UW4 A;  4RGA A;  5SV5 A;  5L9V A;  4IV1 C;  1VRH 3;  2BQP A;  3KQR A;  4YGD A;  4HL0 A;  4GB3 2;  1HB1 A;  4WM7 C;  2UU8 A;  3Q8C A;  5I0S A;  4YVS B;  3ZFE A;  5D21 A;  4UW3 A;  2IXK A;  3AKS A;  1BBT 2;  2BVV A;  2EXJ A;  4D3W A;  1WBL A;  1JU4 A;  2WWS A;  5BNO B;  4S2H A;  3FLR A;  5DZE A;  3AKQ A;  5KHJ A;  2JG8 A;  3O1V A;  5J96 B;  4KWL A;  3III A;  3BOD A;  3J8F 2;  1F5J A;  3SEE A;  3N4M A;  1W2N A;  3EB7 A;  2A3W A;  4XE9 A;  4LLF A;  1NCQ B;  4JVA A;  3BU0 A;  2XUE A;  4F83 A;  1ENX A;  4NID A;  2JD9 A;  3IKW A;  1COV 2;  1QJX 2;  1GNY A;  2ADE A;  4XJA A;  2R0F A;  3OTF A;  4RR3 A;  5FP7 A;  2WO2 A;  4P9W A;  2W87 A;  4P9Y A;  1DP0 A;  1YCI A;  2ZAB A;  4Y26 A;  1H8T C;  1R09 2;  1XE7 A;  4MXW B;  4KWK A;  2YB7 A;  5JUV A;  1RUG 1;  4GJZ A;  4OQ8 A;  2PHD A;  4UBG A;  3GZU C;  5DDJ 3;  5DUW A;  4W8J A;  5FKC A;  3ZYB A;  1GFF 2;  5FLJ A;  4AI9 A;  4N53 B;  4PF1 A;  1YFW A;  3CF6 E;  1Q8Q A;  4MHU A;  4XUO A;  4IXL A;  3MGU A;  3MV0 1;  3TEY A;  2PMW B;  3KHC A;  2WZR 3;  4QHZ A;  2VQU A;  1OKO A;  3S30 A;  5C8W A;  3DKQ A;  1Z0H A;  4LBJ A;  2QQU A;  2C4X A;  4DB5 A;  2FDJ A;  1QU0 A;  3KQ4 B;  4XC9 A;  4QX8 A;  4RS5 C;  4HZF A;  4NIA A;  1MQT B;  5LRS A;  3PU3 A;  1WCK A;  4XUT A;  2HWE 3;  3CZU A;  4FQZ A;  2AR6 A;  1W39 A;  3UNP A;  1WLT A;  2D6N A;  4Y22 B;  4ZHN A;  3BTY A;  5A7N A;  1JYN A;  4HAN A;  5GZD A;  4RN5 A;  1TNF A;  4EWA A;  4GB3 1;  4QKN A;  1UY1 A;  4UXA A;  1NE4 A;  4TWT A;  4YM0 A;  5EJ3 A;  3THC A;  3AZZ A;  1BBT 1;  5A3N A;  1FPN 3;  5CFC B;  4KWJ A;  3MDP A;  1HB4 A;  2JIJ A;  2ZEZ A;  4H7L A;  5FZ4 A;  5KXB A;  5CBL A;  1XNA A;  2GNT A;  1W6N A;  2KXL A;  3I97 A;  2EID A;  1XU1 A;  4H3W A;  1RIN A;  1BYH A;  3J8F 1;  2RS5 2;  3KD4 A;  3V56 A;  4BXF A;  5JSP A;  2FD8 A;  3KCX A;  4M3C E;  2GC3 A;  1HRV 1;  1ND2 A;  1CAV B;  4G3Y C;  1XXN A;  2ORZ A;  4JQT A;  4PHZ A;  5JOZ A;  3ETQ A;  2FDG A;  1QJX 1;  3RFR A;  1QOO A;  1S55 A;  1Z7S 2;  2WYS A;  4HKW A;  2BPA 2;  1MS3 A;  2CY6 A;  1S0J A;  1RMU 3;  2W1S A;  5C4W A;  1W9W A;  2XJV A;  1ND3 A;  2A75 A;  5FRA A;  1NLS A;  2CYF A;  2QQK A;  3LIH A;  5DZG A;  1FX5 A;  5FQ0 A;  4K8R B;  1R09 1;  3GZT B;  5J7M A;  4EWE A;  3LEK A;  4W4Z A;  3GXU A;  4JGZ C;  5EWS A;  4D69 A;  3AMN A;  4R8H A;  1UOB A;  2FCU A;  3T09 A;  1QQP 2;  2VMD A;  5IW0 A;  5IJR A;  5FZL A;  3ZR6 A;  2E32 A;  4XJ8 A;  5A6Z A;  3VKF C;  1UN1 A;  1OI6 A;  4CEY C;  1OA3 A;  4ARX A;  1AXZ A;  2NYY A;  4AFB A;  1A8D A;  2J22 A;  2ZJC A;  4KG0 A;  4IGQ A;  5IHR A;  3X29 B;  5FYM A;  4AFC A;  1TG7 A;  1RUF 1;  1ZYB A;  3I54 A;  3CL1 A;  1G7Y A;  2ZHN A;  3B7M A;  3IB3 A;  5FYT A;  4BQY A;  2XXZ A;  4ZZ5 A;  4W6W A;  1W04 A;  3AYA A;  1MVQ A;  4XF1 A;  5F3E A;  1GOH A;  4HK8 A;  1LGC A;  4XZU G;  1ULP A;  1RUI 3;  5B4N A;  3NKG A;  1JOJ A;  3WT3 A;  4GKX A;  3F2Z A;  3OF1 A;  2DFB A;  4YZ2 A;  5FZ1 A;  4CCJ A;  2IXC A;  3R4S A;  3T0D A;  1ZRE A;  3FL7 A;  3QAC A;  5HXM A;  2BGO A;  4JRA A;  2J1T A;  3AX4 A;  4IV3 A;  2E63 A;  3KVA A;  1OOP C;  3C2U A;  4B7K A;  2C6S A;  2UY9 A;  4LR4 A;  2VTF A;  4AG4 A;  4WVM B;  5IK4 A;  2RS5 1;  3FZ3 A;  1HQN A;  3CHX A;  4OZO A;  5DPN A;  5DXD A;  2Q1F A;  3VHP A;  3R0R A;  5FPU A;  2G1M A;  2BEO A;  1O3Q A;  4BQ1 A;  3USU B;  1SLA A;  4PF5 A;  1QJY 2;  1XB9 A;  1Z7S 1;  2VOT A;  1NLR A;  1LGN A;  1V6K A;  4MGI E;  3VZM A;  2Q30 A;  4CUB A;  5IFP A;  4BH9 A;  4JGY C;  3ROU A;  1DQ0 A;  1PO2 1;  2D3R A;  3QLQ A;  3T0A A;  2JDH A;  1XU2 A;  4Q0Q A;  4KI5 M;  3V65 A;  4AED B;  4BIO A;  4FTE A;  3MBW A;  5FLI A;  2YFU A;  4UWD A;  3SH4 A;  4MV2 A;  3C7O A;  5FMO L;  1VBE 3;  2V5Y A;  4WVV A;  1ONA A;  1L7Q A;  3AVS A;  1I5Z A;  1PM4 A;  1YLL A;  3NL1 A;  1DIW A;  3WNP A;  3OJB A;  5BNN A;  1UY0 A;  3IIA A;  1QQP 1;  1W9T A;  5GZC A;  3IM0 A;  1UPS A;  4P02 B;  4IES A;  4AVB A;  1OUR A;  4P9G A;  2YU1 A;  1CZV A;  4Y4Y A;  2E26 A;  4CRQ A;  3AL5 A;  3HWJ A;  2MEV 2;  2VBB A;  1JZ4 A;  1GWM A;  4BOW A;  1E57 A;  1NQD A;  1J3R A;  4KGQ A;  2CSG A;  2AH2 A;  2B4K A;  2GH2 A;  3FFQ A;  4X8P A;  2WO3 A;  3AYE A;  3VBH A;  2NLR A;  3N9P A;  5FJH A;  2VME A;  4XXP A;  1CAW A;  5FIX A;  1W2T A;  4F3J A;  5FKB A;  2VPV A;  1PGW 2;  3IMM A;  3ZFE B;  1AUY A;  2B46 X;  5LEK A;  1OVS A;  5L19 A;  4AYU A;  5H9P A;  4FPL A;  1I6X A;  4XUR A;  1ODM A;  5FZ9 A;  3LDK A;  2PHU A;  4UF0 A;  3VBF A;  3KF3 A;  4Q4V 3;  3ZYP A;  5IVV A;  1F9K A;  2AGS A;  1NY7 2;  2IZW A;  4JAA A;  4HMZ A;  2VZO A;  1XYO A;  2QQW A;  2JG8 B;  3ACI A;  3OD4 A;  4CXW A;  3FWE A;  1N3P A;  2WWU A;  1OQ1 A;  4JHT A;  3MF9 A;  2VNV A;  1O4T A;  4NPR A;  2RM2 3;  4BLI A;  1ZBE 2;  2RE9 A;  4NRP A;  1XSR A;  3SKV A;  2YPD A;  1E5S A;  4HBN A;  4OHZ A;  1M4W A;  4ZXK A;  5KR7 A;  4RR3 B;  3VUO A;  2ZGP A;  1LOE A;  2ZKN A;  4BQ2 A;  1JYV A;  5JXJ A;  1QJY 1;  1DU3 D;  4FI9 A;  3POJ A;  4HLT A;  4LBL A;  4IE4 A;  1W8W A;  4OFG A;  4PLN A;  3RJR A;  4GIQ A;  2IWG B;  4DQA A;  3N35 A;  4BK5 A;  5AC9 1;  4YVW C;  2OT7 A;  3WDW A;  1D2S A;  4QX0 A;  2QDR A;  1LHO A;  2DUR A;  4LO7 A;  4BDV B;  2LW8 A;  4EN9 B;  3H0O A;  4FPE A;  1C1F A;  4CDQ C;  2DYC A;  4L92 A;  4KG8 A;  1IZ3 A;  2YU2 A;  2IXI A;  3WP4 A;  4Q4V 2;  2MHF A;  1SDD B;  4AQS A;  5HBA A;  4YW6 A;  3O1M A;  4LKD A;  3GBG A;  3OUH A;  3M3I A;  3ILR A;  5KHH A;  1H2L A;  4LBM A;  3DL3 A;  4NN0 A;  1SEF A;  3WW4 A;  2MEV 1;  1X50 A;  4BIF A;  1V6M A;  1F4A A;  3WF2 A;  4UFI A;  2C0Z A;  1VBD 2;  5K0U B;  3JQX A;  5CFD C;  5K9Y A;  2WNE A;  2P4E A;  2HJI A;  2ARB A;  1GKB A;  2ETE A;  2WLP A;  2XVK A;  3A0K A;  3B69 A;  1XNK A;  4Q1P A;  1MZF A;  5F2W A;  4RFR B;  5GLV A;  4CE8 A;  3VDB A;  1R08 3;  4EN0 A;  1QJZ A;  4CEW C;  4NE9 A;  3LQC A;  4XAE A;  3CMG A;  1PGW 1;  2IC1 A;  4DPN A;  3E6B A;  4Z2W A;  4QB1 A;  1AR8 3;  3T1L A;  2A6Z A;  1NCR C;  3OUJ A;  3USS A;  1VRB A;  5C5T A;  5FY7 A;  4L0P A;  1I5P A;  1NY7 1;  1W6N B;  1JZ5 A;  1WW6 A;  1JYI A;  4XUQ A;  3RZG A;  2ZX2 A;  2VOV A;  3EJK A;  3RS6 A;  2NQY A;  1JZ7 A;  3HN3 A;  4R9B A;  3QH7 A;  3PJQ A;  1RUD 2;  4FAG A;  1JZ8 A;  1S0E A;  3TN9 2;  3ZPO A;  3LF7 A;  5FRE A;  1ND2 B;  2JG9 A;  4WZC A;  1ZBE 1;  1UY4 A;  5A7Q A;  3UK9 A;  4DEQ A;  3OPT A;  2GP5 A;  4CXY A;  1RXF A;  2UWB A;  2HWD 2;  2XLG A;  5EYX A;  1DGW X;  4H7M A;  4ERO A;  1VMJ A;  5C4W B;  3SC7 X;  2VG9 A;  1ND3 B;  2JB4 A;  5FQ0 B;  5FXV A;  2VZR A;  1YEW A;  5J3U A;  2HKX A;  1LED A;  3POE A;  4FPY A;  4XOG A;  3RDI A;  5IK7 A;  1SMV A;  1RTV A;  4UOJ A;  1PHM A;  3AMP A;  1DCS A;  1HB3 A;  4IGP A;  4GMP 0;  3OBT A;  1AYM 3;  2RDS A;  1YQ8 A;  1PK6 C;  4RGK A;  5JZG A;  2B5H A;  4CSW A;  1UYP A;  3ZYJ B;  1UX7 A;  3O12 A;  3CO2 A;  3WG2 A;  1PO1 3;  1AR9 3;  4MHR A;  3LGR A;  5FBJ A;  2OPK A;  4K21 A;  5FZO A;  2ZX3 A;  1VBD 1;  4KQ7 A;  2FMD A;  4FTS A;  1IS3 A;  2R06 2;  2BOI A;  4M3C F;  1NUK A;  3S6P A;  3D6E A;  3PVO A;  5FY8 A;  5FZ6 A;  1UZ0 A;  2RS1 2;  5FYZ A;  1KRI A;  3I2F A;  1FAT A;  3IBM A;  1SCS A;  1WMX A;  1L7R A;  1SLI A;  4Q0U A;  2E51 A;  4XJZ A;  3ZDS A;  5A1F A;  4QHB A;  4E4H A;  1NKG A;  1RJ8 A;  1H2M A;  3LSD A;  4NOT A;  3T1M A;  1N1Y A;  1WZX A;  3AXD A;  4GXL A;  1WUV A;  4Q4W 3;  2LRP A;  4IV3 B;  4AGR A;  5A3W A;  1KIT A;  4BXS V;  4JTO A;  1GZC A;  5EQU A;  2JE7 A;  4QPI C;  4AQT A;  1QWR A;  1IS5 A;  2PHF A;  3FJS A;  1V00 A;  5JSO A;  4K1Y A;  2VAU A;  3VBO A;  1XND A;  2W94 A;  2PLV 2;  4LO4 B;  2VVD A;  1CJP A;  1HXS 3;  4RSU A;  3NNF A;  1F31 A;  3PHM A;  4N7I A;  5JPN B;  3KZ4 C;  3TN9 1;  2R07 3;  3ZMN A;  3P5B A;  1AR9 2;  5JOW A;  3WDX A;  2NZ9 A;  3OCP A;  1Y4W A;  3EHK A;  2HWD 1;  3SLI A;  2HWB 3;  5KXD A;  4OUM A;  4E9K A;  3TNP B;  4Y1U A;  3VL8 A;  3M3C A;  5FP8 A;  4BQ5 A;  2HWC 3;  1OMI A;  4ES9 A;  1KEX A;  5FZ3 A;  1E5R A;  2YBK A;  1HN0 A;  3VD3 A;  2VZU A;  2YFZ A;  1YWK A;  4B29 A;  3J7H A;  2WT2 A;  2QQN A;  5EZW A;  2VC9 A;  2E9Q A;  2JDM A;  1GUI A;  1YRZ A;  2W52 A;  3W20 A;  2VMC A;  5BNN B;  4PIY A;  5HCF A;  2D6M A;  4GD4 A;  2VU9 A;  2ZXQ A;  3N3H A;  4NVP A;  5J98 B;  3AL6 A;  2XKP A;  2RV9 A;  4Q4Y 3;  4YWA A;  3KGL A;  2Z5W A;  4LA3 A;  2JDU A;  2DVA A;  5D2A A;  3WY6 A;  3ZXD A;  3MZH A;  4L11 A;  5IK5 A;  1JUH A;  2JD4 A;  5C33 A;  1D4M 3;  1IKQ A;  3VBH B;  5FMC A;  4NO4 A;  4MH0 E;  1O3R A;  3ZN6 A;  2R06 1;  4QWN A;  3WG1 A;  1CAW B;  1P8J A;  1JTZ X;  2RJ2 A;  1VBC 2;  4N43 C;  1Y3T A;  2RS1 1;  1CVN A;  4LE3 A;  3KV9 A;  2R1B A;  1LEC A;  4NMI A;  4LK6 A;  5FPZ A;  2HWC 2;  2RDR A;  3POG A;  4UF0 B;  4QKF A;  4NRQ A;  3VBF B;  3RNS A;  3GZA A;  5F3G A;  2FCV A;  2IFR A;  4QXK A;  5ISL A;  2A1X A;  1SAC A;  3G7D A;  4CPB A;  5HCA A;  4CCN A;  4FSJ A;  2W1W A;  2OII A;  2RR1 1;  2OUH A;  2DUO A;  2QQJ A;  3I8T A;  3K51 A;  3ZKU A;  3ABZ A;  4IEY A;  5FCC A;  2PLV 1;  2WQ4 A;  4C8D A;  2WT0 A;  5FK7 A;  5LA0 A;  3ZN5 A;  5D8A C;  1QJF A;  5FP4 A;  2WNV A;  4BME A;  3OOX A;  1SHW B;  2RJL A;  3I2J A;  1IPJ A;  1L7L A;  5FXX A;  3HNY M;  3AM2 A;  3HQX A;  1JYT A;  3JBG 1;  4HSL A;  3J26 N;  5E1R A;  3KHB A;  5LB6 A;  1EV1 2;  3J7L A;  3POW A;  2VOK A;  2O8O A;  4XFB A;  4FPO B;  1VLN A;  2NM1 A;  3T0B A;  4CUA A;  1GV9 A;  2D97 A;  1ST8 A;  3MYX A;  1GIC A;  3I2G A;  1W0N A;  1JMU B;  3WUC A;  4E27 A;  4KU8 A;  5I8Y A;  1PVC 2;  4DO0 A;  5L36 A;  3I3B A;  1I9R A;  1LGB A;  1UXZ A;  5KHI A;  4P14 A;  1FT9 A;  3WW2 A;  3S0M A;  4J1X A;  4GZ9 A;  3RGB A;  1SBE A;  1SFN A;  1ASJ 1;  1EAH 3;  2OXB A;  2WSV A;  1WW7 A;  1WGP A;  1B35 C;  1NG0 A;  2P3I A;  1R1Z A;  2VL4 A;  4ISR A;  4OUE A;  4DEV A;  5C6C A;  2Q4S A;  1JZ3 A;  3UJQ A;  3WXP A;  1FNY A;  3GGL A;  4QDQ A;  1HRI 3;  4P5H A;  5FTT C;  1AVB A;  1C28 A;  1VBC 1;  2WFF 2;  1H0B A;  1REF A;  3LA7 A;  2QQO A;  4DUV A;  3DYO A;  1F15 A;  3K48 A;  4LOR A;  5CG8 A;  1JUI A;  4R9C A;  1CX1 A;  4AEM A;  3UES A;  1Y7B A;  3GZE A;  5T3N A;  2BGP A;  3I2K A;  1AYN 2;  3JD7 2;  2JEC A;  3OSD A;  5FY4 A;  1SLC A;  2BJS A;  2QJV A;  1SFP A;  2R7E B;  4FPJ A;  4A4A A;  2ARC A;  1OVP A;  4YLZ A;  1JN2 P;  2A7A A;  3FFZ A;  4TN7 A;  1W06 A;  5GAL A;  3R6S A;  2JDZ A;  1EUU A;  5FZI A;  1TZO A;  1BVV A;  1W8Z A;  2JG9 B;  3OG2 A;  1ULC A;  4QB2 A;  2C9A A;  3IDB B;  4RHV 2;  4Z1V A;  4TSV A;  4I0W B;  1FAY A;  5AFB A;  1EAH 2;  1RVF 3;  3BPS A;  1H4H A;  3DUI A;  4IV1 A;  5EP9 A;  1ULE A;  2GMM A;  2W92 A;  1H4G A;  3I2I A;  4HN1 A;  4WM7 A;  1D4V B;  3VD5 A;  5JR2 A;  3FLP A;  3MIC A;  3E6D A;  4AI2 A;  4XBN A;  1US3 A;  1EV1 1;  5FMB A;  1DHK B;  3ZSJ A;  4JTN A;  5JZG B;  4JX0 A;  2TUN A;  2P3Y A;  4FOV A;  1KDK A;  1OA2 A;  2CNA A;  5A3P A;  5F32 A;  1QH6 A;  3PVE A;  3OY8 A;  3DN7 A;  1RUH 3;  2PHL A;  1OUX A;  3MIG A;  4R4Z A;  5ERL A;  3V0A A;  3RZL A;  2QZ2 A;  4U36 A;  3KVB A;  5FZO B;  2F4P A;  1ZZ6 A;  1QNW A;  5IVC A;  4UT5 A;  1SLL A;  4PQQ A;  4QGL A;  4CYD A;  2YC0 A;  5C3S A;  1OLM A;  5A80 A;  3U4X A;  1BEV 3;  5FAX A;  3O1U A;  1TNR A;  1H8T A;  2JKX A;  4P5Y A;  4XPV A;  3VDA A;  1GAN A;  1WD4 A;  5FZD A;  2Y33 A;  4OUS A;  2R04 3;  1AR7 3;  2JIC A;  1NYW A;  2ZAA A;  4I3P A;  4OHX A;  5FBZ A;  3THT A;  3WQB A;  2WFF 1;  4BU2 A;  3CBN A;  4AHY A;  1S2K A;  5DAW A;  1RUJ 1;  5IVB A;  1MS1 A;  3T2Q A;  3I2O A;  4ORF A;  5FZM A;  1YI9 A;  4W6X A;  4XW3 A;  3H7J A;  1AYN 1;  1CAU B;  3JD7 1;  1YIP A;  1ZZ7 A;  4V2W A;  1GWK A;  5A32 A;  1QJU 2;  1W8U A;  3PDQ A;  1VP6 A;  4NAM A;  3VBO B;  1T6B X;  2XH6 A;  3WV6 A;  1RUC 2;  4PBP A;  3RG0 A;  3VD7 A;  4RS5 A;  2Q8O A;  1R1A 3;  3M3O A;  4LO8 A;  1OFN A;  2E7A A;  2CU5 A;  3BTX A;  2K2S A;  2J1V A;  3C7G A;  4RHV 1;  5T52 A;  3ZYI B;  2BYV E;  4QQP A;  4RFT 0;  4XCA A;  5C9A C;  2R1D A;  3AZW A;  2A3Y A;  1UU6 A;  1GQH A;  3DF0 A;  4XQD A;  1O3S A;  2VEC A;  5LBC A;  1S0F A;  4DUX A;  4HXC A;  3R4D B;  1VBA 2;  2WAA A;  3K3O A;  1VBB 1;  3ME2 A;  2WR9 A;  3CZJ A;  3GBF A;  3RI8 A;  3RZJ A;  4LO6 B;  4F8A A;  2FBE A;  1LEN A;  2WKK A;  3H9A A;  3VBU C;  4ITC A;  5KC6 A;  4AK3 A;  2ZAH A;  2BNN A;  3KLS A;  1UZZ A;  2JIG A;  3T30 A;  3POB A;  1HX6 A;  5JI9 A;  4UW5 A;  1YJK A;  3VHR A;  5DAX A;  5IAT A;  1W03 A;  2QQM A;  4FCA A;  4DXS A;  2EA7 A;  2HWF 2;  2Q0A A;  2ZML A;  3H1Y A;  3IT8 A;  4QKD A;  4R52 A;  2FDH A;  2FDI A;  2XBO 3;  4OHY A;  3UYJ A;  1DYO A;  4EYU A;  4KNC A;  4OYU A;  2R32 A;  2Z42 A;  3J7M A;  4CP9 A;  1XYN A;  1ZBA 2;  2W95 A;  3GJA A;  4QPW A;  5E88 A;  1R1A 2;  3ZN6 B;  2HBU A;  4O9G A;  4ASM B;  1CGP A;  4Q0P A;  4Q4X 3;  3LD8 A;  4D6R A;  3DXU A;  2GNM A;  2V4V A;  1RUE 3;  3D5O A;  1YYN A;  5IAV A;  1J59 A;  1HRV 3;  4XBQ A;  3ZR5 A;  4NAO A;  3NV4 A;  2EAK A;  2TBV A;  4CU6 A;  5L9B A;  1JZ6 A;  2NN8 A;  2ZX1 A;  4JGZ A;  1Q8S A;  4S2D A;  2YRO A;  3MIH A;  3S7E A;  3TWI A;  1EY2 A;  3MIB A;  4V2V A;  3T2O A;  5FXW A;  1KJR A;  3NST A;  1UMH A;  3ILN A;  4XIO A;  4CEY A;  4MGS A;  3PU8 A;  5F5C A;  1QDO A;  2P2K A;  5GLW A;  1C4R A;  1QJU 1;  1OXC A; 
#chains in the Genus database with same CATH homology
 1OC1 A;  2IVI B;  3ZKY A;  1RXF A;  4BB3 A;  2DBN A;  1BLZ A;  2JB4 A;  2VBB A;  3ON7 A;  5C3S A;  2JB8 A;  1HB4 A;  2CSG A;  3ZKU A;  1DCS A;  1HB3 A;  4RGK A;  5C3P A;  1QJF A;  1QJE A;  1W2A X;  3OOX A;  1GP6 A;  1UOF A;  1ODN A;  1ODM A;  1WA6 X;  1HB2 A;  1QIQ A;  1W3X A;  5C3Q A;  2VBP A;  1UOB A;  1E5S A;  2Y6F A;  5C3O A;  1HB1 A;  2Y60 A;  1E5H A;  1E5I A;  3ZOI A;  1GP5 A;  1W28 A;  2WO7 A;  5C3R A;  2VE1 A;  2VAU A;  1W04 A;  1W2N A;  1W03 A;  1W3V A;  2VBD A;  1UNB A;  2IVJ A;  5APA A;  2DBI A;  2BRT A;  2VCM A;  2BJS A;  1E5R A;  1UO9 A;  1UZW A;  1GP4 A;  1W06 A;  1UOG A;  1HJF A;  1BK0 A;  1HJG A;  1W05 A;  1W2O A;  4XAE A;  2BU9 A;  1W9Y A;  1OBN A;  1RXG A;  1IPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...