4GIQA

Crystal structure of mouse rank bound to rankl
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
155
structure length
155
Chain Sequence
QPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RANKL Employs Distinct Binding Modes to Engage RANK and the Osteoprotegerin Decoy Receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding/protein binding
molecule keywords Tumor necrosis factor ligand superfamily member 11
total genus 26
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4giqA00
5HBAA 4OUSA 2TNFA 4EN0A 4J6GA 4E4DX 2ZPXA 2Q8OA 3L9JT 2QE3A 2JG8C 1U5YA 4GIQA 5L19A 3B93A 1PK6B 3LKJA 2WNVC 2R32A 2WNUA 1U5ZA 2HEVF 5L36A 3FC0A 3K51A 4DB5A 5KC5A 1DU3D 4G3YC 3ME2A 3B9IA 2O0OA 3ALQA 1JTZX 4MXVA 1PK6A 1A8MA 1GR3A 1U5XA 2HEWF 1D0GA 1JH5A 2R6QA 1PK6C 1KXGA 4KGGA 4TWTA 1KD7A 4QQ2A 4HT1T 2WNUC 1OQDA 1XU1A 4KG8A 5KC6A 4MXWA 1S55A 4QQOA 2X29A 1XU2A 3K48A 4N90A 2JG9B 2JG8A 3B94A 4D7YA 4G4FA 2HEYF 4NN0A 1OSGA 1ALYA 2RJKA 2JG8B 2JG9A 2QDNA 4QQHA 4F3JA 5TSWA 5BNQA 1DG6A 4MXWB 4MSVA 4QPYA 3WD5A 2AZ5A 2E7AA 2OIIA 4RSUA 3TYJA 5CIRA 1C3HA 2R30A 4OULA 3URFA 2WNVA 4TSVA 1IQAA 4OUMA 1D4VB 2KA3A 4QQLA 4QQPA 1RJ8A 1D2QA 4DOUA 3AB0A 1TNFA 2WNUB 2RJLA 3MI8A 4KGQA 2WNVB 1I9RA 1RJ7A 3V56A 1O91A 2RE9A 2JG9C 1C28A 2ZJCA 4E4SA 5KWRA 2Q1MA 1OQEA 3TWIA 3QBQA 1TNRA 2TUNA 3QD6A 3IT8A 2Z5WA 1WCKA
chains in the Genus database with same CATH superfamily
3LSDA 5EHDA 3BIEA 3I7DA 1O3RA 3UT0A 3I2HA 1WCQA 3CZJA 4AGGA 3C7FA 2WLPA 1WWYA 2P37A 5CZKA 5CA6A 1CWPA 4XF4A 4NIGA 3ACGA 1ZA4A 4NVPA 4B29A 1DHKB 1OD5A 1RHI3 4CUCA 2JG8C 2YXSA 2ZX1A 5GLTA 4NJ4A 1SEFA 3GJBA 3KQRA 3V0AB 2OW4A 3NV3A 3RZKA 2R1DA 2OUJA 4FPCA 5FLJA 4LBKA 2CNAA 2CV6A 2ENRA 1LOGA 4FAHA 5EJ1B 5KC5A 3BTYA 1HB4A 1OLME 2IUWA 1GU3A 3IWZA 1JTZX 4DXTA 3QLQA 3AKSA 4WM8A 2D43A 2HWF3 3C7HA 1XE8A 4LUMA 4A7YA 4IGPA 1JZ3A 2XPJA 3NJVA 4IE5A 4UYBA 2CGOA 1JYIA 3GM8A 4UFHA 1OXCA 4AVVA 1MPXA 4GD4A 3VD7A 2IFRA 1RUC3 3U07A 1MQTA 2FZ1A 2D5FA 1RGSA 3AZVA 1CAVB 3BU7A 4LK7A 2ZABA 2YDEA 4R8HA 5FZFA 3SHRA 4ASMB 1HN0A 1MVEA 1ZZ6A 1WBLA 2GP3A 4N7IA 4P00B 3N9OA 2AREA 2HWD3 2FDHA 2VUAA 1CAWA 1W6NA 4M3CB 1S0GA 5FKBA 4Q1RA 5F6KA 2BWCA 3V0BB 3GDBA 1OSGA 3SCHA 4Y3OA 4FPJA 3ZFGA 3VDDB 5FY9A 1ZZBA 5FP8A 5JOWA 2HWB3 4FFIA 1V6NA 4AI1A 2PN5A 2ZMNA 2A3YA 3OGVA 1I6XA 2OPKA 4KQ7A 4XF9A 4YFWA 2BP6A 4ASKA 1UU4A 4CU6A 1FX5A 4AFCA 3VUOA 4H14A 2OUHA 1W2NA 3VKLA 3SKVA 1DQ5A 1Y7BA 2R30A 2W87A 5FUIA 5L9BA 4CDQB 1VLNA 4XURA 4QGMA 1UU6A 3I54A 5FRAA 3R6SA 5CADA 4K40A 4W6YA 4K3UA 1ENRA 4L11A 2HWF1 3HIFA 1IKQA 4M4RA 4O61A 4ZU5A 3ZFEB 5LASA 4OMDA 1Q8QA 3QH7A 5FPBA 3CEWA 3AKPA 4IW3A 4KGQA 5IK5A 3WW2A 5FPAA 1HLCA 3HT2A 3VBSB 3WF3A 4NO4A 5E1RA 1LOFC 3UL2A 2WDBA 3K4DA 1PZ9A 4C8DA 3VBUC 4XOGA 2EF6A 5FZ4A 1AXYA 3DCQA 1OQEA 2PAEA 2R041 4Y24A 3WY6A 1MS3A 1RUG1 4PBOA 4NAMA 4ZHNA 3OPWA 2P2KA 4I0WB 5GZFA 2D7FA 4DXZA 2RV9A 5A6QA 3D5OA 1GWLA 4CPBA 2EIDA 2Y0IA 1ZNPA 3B3QE 1QDCA 3E1F1 4E2QA 5BNOB 2DVDA 4K8RB 4Z1VA 1FATA 2X53S 4XFBA 5FK7A 4QM8A 1WMDA 4Q4X3 1S0DA 3R0RA 3WNKA 3BTXA 4J1WA 1Q8OA 2PXJA 3IPVA 2GZWA 3USSA 5A33A 3WINE 5K0UC 4F83A 3U75A 2C4XA 2WFF2 3ZXAC 1E5RA 3EJKA 1N1SA 1AR92 3AZZA 4K20A 4UI9L 4CDWA 5J09A 1FNZA 1UYPA 1RHI1 3MEPA 2RS12 5FMOS 1U5ZA 5FXZA 1YFUA 3FZ3A 3AFKA 3SEPA 3BUCA 2VUJA 5FXVA 2NN8A 3EO6A 4CU7A 1QKQA 3N9PA 3VBOC 1ZYBA 1EY2A 3ALQA 3KZ4C 4D6SA 2DCZA 3UKTA 4EJRA 2XB6C 1C8M2 4YW4A 2X05A 4BPZA 4NWVA 2D6LX 1JZ7A 1PX4A 2AEZA 3GXUA 5EQUA 1HRV3 2WBKA 1JYWA 2ARAA 4BJ0A 1AL0G 1G86A 1VAMA 4ZY9A 3KV4A 3WG2A 5EV7A 1LRHA 3TAYA 1G9BA 4OI4A 1LHOA 4BWOA 1OC1A 2JENA 4OI0A 3BGAA 2ZHNA 3AYAA 4G9SB 2WN3A 4IQPA 3LWCA 5GLWA 1UY1A 4DXRA 2FBEA 5FZ0A 1PO22 3OBAA 2JE7A 4XDOA 3NNMA 4Y26A 3BN6A 4ISRA 4XTPA 2B7YA 2YYOA 4OQ9A 4AVCA 4EN9B 1YQ6A 3AP4A 4LR4A 4EQVA 5B4NA 4EE2A 5GZCA 4MXWB 1OVPA 1WW4A 2GN3A 3OGJA 1NCQA 2QQIA 2WZR3 2BQPA 3OOXA 4LKDA 5BNPC 4KMQA 4XETA 4MGYE 2JDAA 1HRI3 4DS0A 2BOJA 1C3HA 2VQ0A 2JECA 2R0HA 3HQXA 3WNNA 4FPFA 4ARXA 4ZU7A 2ZCWA 2I07B 4JGZA 2WNVA 3USUA 2YROA 2VZ3A 1MVQA 1SDDB 1BBT1 1QXJA 5IUQA 4D3WA 5LBCA 3M3QA 2IVIB 5C8CC 2IVJA 4AR2A 3RZHA 4RS5A 5EP9A 2O8QA 3TEXA 2HWC3 1KDMA 2VMFA 2YV8A 3HN3A 2Z42A 2A6XA 2ZAHA 3KVAA 4I0AA 4JGYB 5C7GA 5HV4A 3RYPA 3RSJA 2DVBA 4AI8A 1I9RA 1NYWA 1RJ7A 1RUJ1 1LHNA 2LW8A 1L7LA 1DBNA 2AR6A 3WSOA 1OFNA 1AYM3 3J7HA 5LY2A 2VG9A 4PQQA 5IVEA 3EHKA 2HWC1 1VMFA 1COV2 1CZTA 3T2OA 1RITA 5GLUA 4AEDC 2XDVA 5JZGB 3T1LA 2KD7A 1VRH3 3WDVA 1PM4A 2XONA 2PLV2 1RUJ3 1W99A 4LA3A 4WM7A 1MQTC 1OA4A 2V4AA 2W3JA 4PLMA 4R9AA 4UFLA 2XKOA 1S2EA 2HWB2 1YXWA 4JC1A 1KJLA 1EV11 2QZ2A 1ZX5A 5LEJA 2Z5WA 2ZHMA 4O65A 3BOWA 1CD3G 3AYEA 4ZXEA 1CJPA 5L9RA 3T4HB 4AL9A 5T55A 5JMOA 1F31A 5IK8A 4OUSA 5CFCC 1FI2A 2BNOA 3K2OA 4HANA 3RI9A 5KR7A 1HX6A 5EYYA 2HYKA 3ZX7A 4GA9A 3R4DB 3RQ0A 3VZKA 2VUDA 3PDQA 4CP2A 2GNMA 4GB33 1AHSA 4QX8A 1U5YA 4AI0A 2VVDA 4P9JA 4GH4B 4BLJA 1H9PA 5JR2A 1J84A 2DFBA 1W9FA 4Q26A 1W8ZA 1FPN1 2WQ8A 3J8F2 4Y1VA 4Y4YA 4DEQA 2YC0A 2YC4A 3CJIC 3LKJA 2WNVC 3OTFA 5FZ1A 4BQ5A 5H9QA 2C6SA 1BHGA 2ZEZA 3VHNA 3O1PA 4QB6A 4BISA 2R1BA 2VQTA 4CDXB 5D2AA 3JUUA 3T2PA 3WNPA 4IUGA 3NKTA 1V6KA 1QJY1 2C9AA 5EZWA 1I1EA 3FMGA 4D7TA 3WF0A 3NVCA 2EIEA 5D1IA 5CFDB 4NRQA 1PVC2 3GGLA 1RUI2 4URTA 1GQPA 3MBWA 1JHNA 3AMHA 2GH2A 1LULA 5A3TA 4DPNA 4CP9B 2BGCA 4IGOA 1KXGA 4KU8A 4NUBA 3VBHA 4I09A 4Q27A 4YG0A 1OPMA 1PGW1 1VPHA 3POWA 4HXCA 2FCUA 3GBGA 4HPKB 4COVA 4QWNA 1OLMA 5T50A 3OG2A 3D82A 2BZDA 4RHV3 4DRRA 3VBUA 2XJPA 1CX4A 3AX4A 3PVBB 2ZMLA 3ZO0B 1G6NA 2DURA 5C4WC 2XQRA 1GYKA 5F5IA 4XF3A 3AFGA 4XBLA 1CZSA 3DYOA 4BIFA 3IM0A 1WCDJ 4N9HA 4Y1UA 3WX5A 5T5LA 3MV01 3ZFFB 1OKOA 1GBGA 4HZFA 5F1RA 4H7LA 5DUXA 1EPWA 1S0CA 4LHSA 1HRI2 3IN9A 4MSVA 1PVC1 2WN2A 4Y1XA 1FMD1 1QJU1 5FJKA 3ECQA 1E5SA 2VOVA 4A6OA 2DUQA 1QJY2 3VD5A 3KQ4B 3HBZA 2BJSA 4HOOA 5F5CA 3A4UA 5JXJA 1DYKA 3TOJA 1BVVA 1OH3A 4AEDA 1IQAA 2PHFA 3P1IA 1LEDA 4QKFA 1TQ5A 4A3ZA 1FPN2 1QJU3 5ANQA 1D7PM 1UIKA 4FPHA 2VW0A 2J1RA 2G9FA 4QQPA 4CDXA 2UYAA 2WT1A 1REFA 4XMIA 2RDSA 1AJKA 1EPZA 2WO2A 5BV6A 3GF6A 4X6QB 2W1UA 1OT5A 1WKYA 4GWJA 1PIV3 1X36A 1XNKA 2HLEA 5I8TA 1S0EA 2OYZA 1VRH2 3HPNA 5FY1A 1WD4A 1JZ5A 5J98B 4YVSA 2J1AA 3ZN6B 3JD71 1WGPA 4WVWA 4QB2A 1X50A 4XBNA 2K2SA 1JYCA 3N9NA 5A3LA 5CKNA 4YNIA 4CXWA 2YU2A 4P9LA 3B5LB 4N43B 4IEZA 4XCBA 2P6CA 4IERA 4DUVA 2PTMA 2RG4A 5A3OA 3VV1A 2PHUA 1DQ0A 1CR7A 1W6MB 3OGGA 1ZZCA 4YW7A 5FYHA 1GP5A 5JVVA 1AR93 2ATFA 2O8OA 2QZ3A 1WLWA 2VXRA 4Q1PA 5LW9A 2DCKA 4QKBA 4UFMA 5FYUA 1VBB3 4L9BA 1LJ7A 1VBA1 3FL7A 2J1UA 4Q4X2 1KITA 3W58A 3LA7A 1I5PA 1OBNA 2QE3A 2YPJA 3LEMA 3OEAA 1HRV2 2X10A 4TXWA 4AQ2A 4AFMA 4BQ4A 5L7OB 5C33A 2W08A 2JKXA 2WWSA 4WVVA 5A32B 4PQ9A 2WRAA 3VGIA 3DN7A 3ZYIB 4CDUB 4PHZA 1UY3A 4GB31 4JGYA 2UY9A 4V2WA 5G04L 5FYIA 1VBA3 4X8PA 4WBBA 3RZMA 2AC1A 3THCA 1OKQA 5B4XA 5IW0A 1UYXA 3RJRA 1U12A 1W6PB 4MG2A 3W21A 1W9SA 1V9U2 2UWAA 3SH3A 5FZDA 4A7ZA 4CDUA 3LAGA 1ENQA 3CLPA 4B8EA 2GNTA 4JGZB 2VMGA 4C1WA 5A1LA 4BU2A 3H3LA 1JH5A 2SBAA 1PK6C 1R1ZA 2VC9A 2W95A 1PO12 5LZ6A 2DTWA 4K1YA 1CESA 4KGGA 4ATEA 2ET7A 2WYFA 4NR1A 2TBVA 3BU0A 4OHXA 1DYOA 3M70A 2PAKA 2P3IA 4U2AA 4RD7A 2A6VA 4XPVA 3OBRA 5AVPA 3JZVA 1V70A 1RUOA 2VMDA 4B1MA 2KM2A 4TN7A 1PIV2 2JDMA 1PHMA 1PNGA 1N47A 2W92A 5ABJB 2WO3A 1RMU2 5IVYA 4AW7A 3NNFA 4UW3A 2YG0A 1FOD2 4YZ5A 4LLFA 2JG8B 3KS7A 5F6LB 1CIWA 1T6BX 3WP5A 3M1HA 4CCJA 1Z0HA 1G9DA 4I0BA 3WDUA 5C9AA 4NHYA 2VR4A 4XE9A 2Y26A 5FP7A 1MS8A 1AX2A 3MLLA 3H0OA 2ZGUA 2DYCA 5JSPA 1O3SA 2A75A 4QPWA 3AM2A 2CAVA 4JKLA 4KWJA 5A7WA 3H8XA 4F8AA 5IVVA 4TSVA 5F3EA 4OUMA 2I45A 3WV6A 3POEA 1D2SA 5F3CA 1CZVA 4CA9A 4Y22A 4AI9A 5EJZB 5J1XA 2DBIA 1FV2A 1A8DA 1HN1A 4HG6B 5JIUA 3KV6A 5K9YA 2YFUA 4LITA 3AB0A 2NMOA 5DAPA 1W05A 4HBNA 2VZOA 2YFZA 2XUEA 3KB5A 2ZTNA 3AVSA 3C3VA 1RTVA 5A7WB 4M4PA 3S5AA 2B45X 4Y5TA 1A3KA 2YY1A 1RMU1 2F4LA 3J7NA 1YIFA 4OFGA 4M3CF 4QD2A 5IYYA 5HCBA 5JOXA 5KWRA 4A2UA 1PIV1 1SLAA 3VDDC 1IZ3A 1AR63 1EYBA 4MUVA 5KHHA 1A34A 4M00A 4NRMA 3I8TA 2X5IB 1OUSA 4UW4A 3ABZA 4Q4Y3 1IG3A 1NA1B 3NV1A 1RUG2 1H4HA 4JDOA 3UESA 1V0AA 4CCCA 5DAQA 3OPTA 3I3QA 5FMBA 5ABJA 1V6MA 5JMCA 4N7UA 2QVSB 1ND3A 4E2GA 1NA1A 3I59A 3U0ZA 3O14A 1FYUA 5F39A 1W06A 3KSCA 1KQRA 4EN0A 4NE9A 4N8MA 4J6GA 3THPA 3VBHB 1H2LA 1BEV1 1JODA 5T5OA 3ZFEC 3WP4A 3U10A 1RUNA 3MPBA 2V72A 2WQ4A 4GB32 2QFEA 4NPMA 2IWGB 4CEYC 3WDWA 1H6YA 1NOVA 4CPBD 5I0UA 1RC6A 3PLQA 2VNVA 4DNYA 1HRV1 2FDFA 5IAVA 2VBPA 4BQXA 1IGOA 4LBQD 3ZPOA 1JU4A 1OOPB 1IPSA 4YVWA 2WSUA 1QIQA 3LDRA 3KLSA 1VBC3 2Y34A 5FCCA 2WZEA 4Y22B 1UY4A 1DP0A 4BM8A 5CISA 2B9VA 1GANA 1XNAA 2A3WA 2VZVA 5FZKA 3ZR6A 3T30A 1LAJA 4UBHA 4F7ZA 2XBO2 1D0GA 2VBDA 2WFPA 1DZTA 3ZVXA 1RXGA 1YQCA 4GAZA 1UMZA 3PJYA 4LQRA 3WDXA 3H3ZA 2VZ1A 1TG7A 3PUAA 4CCOA 4KG8A 4LE4A 3ZSKA 2PHDA 2P1BA 1S55A 3NAPB 3PNAA 2RDQA 5CU1A 4CVUA 3PURA 3P5BA 3POBA 4GXLA 3ZFGB 3ZN5A 4BXSV 4Q4W1 4H2AA 4YZ1A 1RVF2 4NIIA 3LEGA 3OYWA 1VRH1 1PO23 1VAVA 3IKWA 2ARBA 3AL6A 1SLTA 5FTTC 2J1VA 2LUWA 3WP3A 3E6CC 1J1TA 1KGYA 2A6YA 3LIGA 4FOQA 2CAUA 1CAVA 5IJRA 3PUQA 2E7TA 5FMDA 1REEA 4AHZA 2QCSB 1UX6A 2OIIA 1HXS1 2DU0A 3LA3A 5C3QA 5FPUA 2OQ6A 3I2IA 2B8MA 4IV1B 5FXXA 3JQXA 4CYDA 5LA1A 1UOJA 1W28A 1D4VB 1OA3A 4ZZ8A 1PGL1 3B9CA 4YVWB 4QQLA 5F2WA 2E9QA 5LB6A 2OKXA 1FPN3 1LGNA 1QJU2 2D98A 1CONA 3POJA 4MHRA 4Q8LA 3R4UA 3WDTA 4AEKA 4CRQA 5I8YA 4M0NA 2OZJA 4IE7A 2DUPA 4XUNA 4BCUA 4ES9A 3CJXA 1QU0A 4YW5A 2Y6JA 3G7DA 1YYNA 2MHFA 4KBBA 3Q8CA 3B00A 5EYXA 1XNTA 1NKGA 4JTNA 1H8VA 5JCTA 1TME2 3UGHA 4NIAA 1VBE1 1Q8VA 4PIZA 4CEYA 1TEIA 4QDRA 3ILNA 1ONAA 3S6PA 5LATA 1PGW2 1ND3B 4YFZA 2ADDA 5FPZA 4WVMA 4AE2A 3SC7X 5A3WA 5C3PA 1WMXA 2GN7A 4QPGC 2IXHA 2WT2A 3IB3A 2JD9A 3AP6A 3LOBA 1RUI1 3W5NA 1PM7A 1BQPA 5JWPA 2HYXA 1SHWB 2UWCA 1Z7S3 1OPOA 1V6JA 2ET1A 3LB9A 2KR2A 5LRRA 1MACA 2Q8OA 2ZEYA 2ORZA 2GMMA 1QMJA 1OUXA 2PHXA 4XJWA 2ID4A 1EUTA 5IVJA 1HIXA 2AGSA 3ZXGA 1HV0A 2QTWB 3O0VA 5D8AC 3D8CA 4E9KA 4BYYA 4Q2FA 1ENXA 1NQJA 1LOCA 3BVCA 3C2UA 3JBG3 3HWJA 2FCVA 2W47A 5BNNA 1W0OA 3ZM8A 3I3EA 3BODA 4QX3A 4QDQA 1GFF2 3HNBM 2VCBA 5CB7A 4E4HA 2ZHKA 1A8MA 3C7GA 1IPJA 1W3XA 3IDBB 4QXKA 4Y4RA 4AEDB 1ND2C 3JBG1 4GKYA 4Y5SA 5CVRA 4OZOA 5CKMA 2P17A 1HQNA 1W6OA 5JLVA 4HLTA 5FPLA 5LA0A 3NNGA 4LULA 2PLV1 4LO7A 1EUUA 3CU7A 4OYUA 4ZU4A 3OD0A 2ZGNA 3VDAA 4KL1A 3Q9OA 2Y38A 4D6RA 3F95A 1JZ2A 3LF7A 1COV1 3B02A 1MEC1 2W9XA 4Y1ZA 2Y8KA 1LECA 3ZFFA 5CFCB 2BOIA 5EJ3A 1IPKA 1Z7S1 4Z82A 2BV4A 3JU9A 2BERA 4FBFA 2ORXA 4RFT0 2PLV3 2D6NA 1LU1A 2P3KA 1L7QA 2ZGQA 4B4QA 3OB8A 2DVFA 3JQWA 1H1MA 1MEC3 4ISQA 4R4ZA 4N53C 4ATFA 5DAVA 4S2HA 5FO9B 2ZBJA 4CDXC 2OQ7A 1A78A 3VKFC 1GP6A 1O59A 4UT5A 3WQ0A 1BKZA 3ZDSA 5K4LA 4CCDA 5FZGA 5FREA 1MS9A 1UZVA 3M3OA 3AYCA 4V1PA 2AYHA 4IESA 5JAXA 5A80A 1FNYA 4GMP3 1VE0A 3UKVA 1SLIA 4FPGA 2K0GA 2VNOA 5BXXA 3ETQA 2C24A 5FZIA 4OZXA 3N7JA 3GBWA 4XHBA 1GNZA 4LO4B 3S30A 1AL22 1RUH2 4MGKE 1CJDA 1EAH1 4Q5OA 3M7AA 2P3YA 4YGDA 3RZZA 3HVDA 5E6HA 3ZIXA 3AKQA 3GYDA 4DO0A 4DRVA 1G9AA 5CBLA 3G6JB 1DQ4A 2GC3A 2BTVC 2JX9A 1X82A 1ZRIA 1PO21 1LTEA 4FPYA 4GJYA 4YM0A 5F9TA 2WAOA 1HB2A 2P6HA 3DPRB 3AXDA 5ACA3 1QJX3 2D93A 2DWRA 4CEWB 3AZYA 4IE0A 2Y6HA 2B5HA 1UAIA 3BCWA 1AR83 1SLCA 3WCSA 3ZDVA 2R043 5A70A 4BA6A 1RUD1 4JQTA 2W5FA 1C8M1 2A3XA 4DUXA 4JKKA 4AAPA 4LO8A 1AUYA 4E4DX 4DMIA 2HJIA 1H9WA 2BGOA 3L9JT 3D0SA 2QQLA 1W8TA 1AXKA 2RS11 1RHI2 4BOWA 2D6KA 4CP0A 4M3CE 5L19A 3K4AA 2W91A 4UW5A 3VD4A 2W1SA 1KDKA 4WM8B 2ZEXA 3DL3A 1Y4WA 4QHOA 4META 3TBDA 3IAQA 1UL9A 3CL1A 3MLKA 3PIJA 4D0QA 1RYYA 1R1A3 3PHMA 1LODA 1XOYA 5HCFA 1GKBA 1CVNA 5H9SA 5EPAA 5I0RA 1F8VA 3WW3A 1YWKA 4IEVA 2RS13 5FYCA 2CSGA 3IIAA 1O4ZA 1LB2A 3NNLA 3VL9A 3CIHA 2XKPA 3VB9A 1ZZ8A 4LHLA 4AVBA 3HBKA 4DFSA 2DFCA 3SKJE 3WT3A 1N1TA 4B7EA 5DPNA 2BRTA 3KT1A 4NPRA 4TWTA 1S2KA 4GMP0 3MF6A 5GLVA 1JZ4A 4FPOB 3POGA 2VL4A 3EB7A 3IDEA 1XNCA 5FZMA 2V09A 2PHWA 1TMF3 4MLOA 2XXZA 2R042 1PMHX 2IC1A 1AR82 3AK0A 4Q0QA 2YBPA 1YJKA 1YNAA 3OYWB 4CDQC 3QCWA 1UY2A 3R4SA 3PUIA 2RS33 5F37A 1Y3TA 2JDYA 4QX2A 5L7OC 2DDUA 1UKRA 1C5IA 4LBLA 1AXZA 3SEEA 5FZLA 1F9KA 1O4TA 2W1QA 2XLAA 4A3XA 1G8WA 2D3RA 1SZBA 3P3NA 1YUDA 4H7MA 1SPPB 5CIRA 5DAXA 5C8CA 1NXD1 1W9YA 2H6BA 2Y33A 3URFA 1CAXB 3J7LA 3FX3A 3LIHA 4RQPB 3VBSC 5IVCA 4CUGA 2A5ZA 1JBCA 3FWEA 1GZTA 5HV0A 1SBFA 2WABA 4URAA 1GV9A 3NRUA 2CWSA 1W2OA 3RG0A 1W2UA 5IVBA 5DG1A 1N1VA 2JDZA 1X9TA 4LK6A 1BMV2 1ZVFA 5J48A 3DV8A 4IEXA 5BNNB 3Q8EA 3HNMA 3ES4A 4IDZA 2QQJA 2PHRA 4LHNA 4O9GA 4DOUA 1TNFA 4AFBA 1EP0A 2EVXA 1UN1A 1QJX2 2JWPA 3VZJA 3WG4A 4FO9A 3WDYA 1CAXA 3HEIA 4D94A 1M06G 1S4CA 4LOSA 1NAEA 1TMF1 2AUYA 2WLQA 3C7EA 1ZZ7A 5ABJC 1EAH3 1W04A 3E6BA 3OSDA 4EWEA 2E31A 1APNA 3J4UH 3IDCB 3D6EA 5GALA 2B9UA 2RHPA 1VR3A 2QJVA 4A4AA 1LGCA 4HETA 4LA2A 1FV3A 3NJYA 5DZGA 4C1XA 1WLCA 2AH2A 2BDRA 1BK0A 3U37A 3U4XA 2JE9A 4Q4Y2 1AYN2 1GZWA 5BY5A 2R061 5FWJA 2GAUA 2RR11 5T52A 3VLBB 5GZGA 5AFBA 2IXIA 3HD8B 1QHDA 4L92A 4PIXA 1NT0A 5AFEA 1DGWX 4DY3A 4DUWA 2RR12 2R062 4I30A 2BFUL 3VHRA 3A21A 1UMIA 2XGXA 2ZHLA 2WZR2 1O3QA 3N35A 1ZRDA 5FOBB 1JOPA 3AMPA 3NSTA 3BTAA 3PVNA 3SLIA 3AMMA 3NJXA 4BIOA 1O4YA 3VHPA 2QQNA 4AOCA 1NXMA 2VZTA 2ZGKA 4LMFA 2VXJA 2LTNA 3B93A 1H2KA 1PNFA 3JXSA 1TE1B 1QJFA 2D40A 1SFYA 1ULDA 5D21A 2RS53 2BBVA 3S57A 1K42A 1W8HA 2XL7A 3ZFEA 1WD3A 1TMF2 4BQ1A 2XG3A 3ME2A 2JIJA 2QQPA 4NROA 3UV9A 1BZWA 1QOSA 3FJSA 5A32A 1VIWB 3OJBA 1U5XA 3KV9A 4LBMA 2RS51 3NWKA 2BBAA 5FY7A 1NA1C 2WSVA 2BUKA 1YI7A 2PMWB 2QQWA 2F4PA 3AXEA 2CDPA 4MYEA 5GZEA 3K75B 1BMV1 1KRIA 1XSRA 3N9MA 3X29B 4B1LA 1WBFA 1UXZA 5EXOA 3UJQA 3LOIA 3AP7A 3ZYGA 4ORFA 4PBPA 3ON7A 2XVLA 3T2QA 4XFIA 2D3PA 4LIUA 3I3DA 1R091 4YARA 1GSLA 4G4FA 1UY0A 1V6OA 1GQHA 1DZQA 1ZBA1 4WVMB 3VBHC 2MEV1 4XJ8A 3P3PA 4GWIA 4E8DA 2QDNA 1IS6A 3DPRA 3ZLIA 3GBFA 3MIFA 5DUWA 1JYNA 3H1WA 5TSWA 2B42B 4MGIE 4CEYB 4JAAA 5LBBA 3L2YA 3KD4A 3T2TA 3O1SA 2LRPA 2EIGA 5C6CA 4NAOA 2CL2A 2A6ZA 3PMEA 1H8TA 3N7LA 1S0FA 3OGSA 3AL5A 4QX7A 1LHWA 5I0SA 2RMU1 3ES1A 3T4VA 3VZOA 4YG3A 4GALA 1VRBA 2OXBA 2V4VA 1RVF3 3LSEA 3T0BA 5CYYA 5JR7B 2YHJA 5FV3A 3SQOA 2FD8A 1R1A2 4YPJA 2VECA 2JB4A 4FFGA 4XJ9A 3O1VA 3FUOA 4UAPA 3HOBA 3LDBA 4XFGA 4QDSA 3FBYA 3H7YA 5F2SA 1O6UA 2EIBA 2PQQA 4CDWB 2CGNA 2UURA 2YGMA 5L7OA 2B46X 4NOTA 2ZX3A 3S7IA 4E4SA 1C57A 5E16A 2VNRA 4FVVA 3K77A 3NMBA 3SCFA 3ZMOA 1ASJ3 4YG6A 1K5JA 5CNAA 3BB6A 1GWMA 5BNOA 4LLOA 5FYSA 3FUQA 4YYOA 3EXUA 3RZJA 2XQXA 5ACA2 5DG2A 4AQTA 3NQHA 4YSFA 2ES3A 5CFCA 3H3UA 1SFPA 2XJRA 2WIIB 1W3VA 3J7MA 5JUVA 4I02A 1YRZA 4HPKA 3I2FA 3N3HA 4RL7A 1UWWA 1W0PA 5FWEA 2Y6LA 4YVWC 4Z2AA 1OI6A 5A7SA 4FFHA 2EALA 4GIQA 2XOMA 5KXCA 4FXGB 4FTSA 3VKNA 4AWDA 2ZX0A 4UOJA 2J1TA 1C8NA 4CE8A 1DGRA 3FC0A 4HK8A 3LE0A 2GC1A 1XYPA 2HWD2 2XJTA 1DYPA 3SMHA 4XBQA 2FDJA 5FZEA 3ROUA 4P9XA 1B35C 4WZCA 3JB4C 5FPXA 5F8PA 1EAH2 1PVXA 4EZ4A 1AL21 2HWD1 2IFWA 2W0XA 3GHMA 4H55A 3RS6A 3QH6A 2PAMA 4GH4A 4FPKA 4Q0SA 3MF9A 1D4M2 4WZFA 5I93A 3AMNA 4HT1T 2R0FA 2RM21 5FK8A 2XWJB 4JV4A 1H0BA 3WR0A 5FY5A 1W6QB 3K48A 2ETEA 3ACHA 4YGCA 4XJZA 5A7OA 3A0NA 5JI9A 1T2XA 5KHIA 3B94A 5D8AA 4EN7B 5JXHA 3KT4A 1GUIA 5AC91 1VAKA 5FZ9A 2G19A 1W6NB 4M3CA 4OI2A 3RRDA 4R9DA 5KXEA 3UK9A 4CCLA 3CMGA 4IEQA 4H3WA 5T5JA 2E51A 1STMA 2UY8A 2JDHA 5F3IA 1MS4A 2Q1FA 3INAA 5IATA 4EN6B 4YZ2A 3JB8A 4RSUA 3TEWA 3WLUA 2FMDA 2OVUA 4MADA 1DGRN 4OULA 4AHWA 4WM7C 1PMIA 4QGLA 3B01A 3DEMA 2IXCA 3CJIA 1POV3 4A42A 2MNGA 2Y6GA 1X9PA 2HBUA 2ZEWA 3OBZA 4QHBA 4K8FA 2VPVA 1KJRA 4JTOA 1DFQA 3VKOA 2JKBA 1RJ8A 1YFWA 3WZ1A 3I2OA 1AF9A 2CDOA 3JBG2 1RUC1 4N43C 3USUB 2NQYA 2Z2SB 2P3JA 4BK4A 4KWLA 5ANNA 1XRUA 2BYVE 4CDQA 2NLRA 1JYXA 3ZPYA 5DDJ2 1O3TA 4Z07A 4I3GA 1BCXA 3CZUA 4A44A 4QPIA 4B7KA 4XXAA 3BPSA 2Q1MA 4XDPA 5C4WA 1E57A 5FPVA 2ZGRA 4IEOA 4AHXA 2RMU2 1UZYA 1UYZA 4BK5A 2B39A 5C9AB 3LPGA 3TN92 4AAXA 4AEMA 2WR9A 1N3PA 4OI1A 3LDKA 2TUNA 2VTFA 3NO8A 3RMYA 1BK1A 2TEPA 1W0NA 1G9FA 5A3MA 1W9WA 4P5HA 3OUJA 3LFIA 3AYDA 1AR61 2HBTA 2WS91 1CAWB 1VBD2 2Y0OA 3H9AA 3K3NA 4IEYA 4LKFA 4N43A 3I2GA 2VZRA 2WO1A 4GJZA 5JXGA 1JZ6A 1X8EA 5FUNA 1NCQC 2MEV2 4IL7A 1ZM1A 1ZBA2 3MYXA 2KXLA 1O7FA 1GWKA 3VN4A 2JB8A 3KM5A 4QKNA 4IV3A 4UF0A 2WS93 4TZDA 4JGZC 2EAKA 2ZS6B 1NLQA 2R16A 3DUIA 4GZ9A 3UKNA 4XUTA 4CU9A 1PK6B 5HI0A 4Q4V2 3C8XA 5T3NA 3GNEA 3LD8A 2C5DA 4YM1A 4Y1YA 5FQ0B 4XIOA 4DB5A 4RS5B 1DU3D 5HCHA 2VNGA 4G3YC 2RS32 3FHQA 2Q8EA 5JPNB 2VMCA 5FR3A 2QQVA 1NY71 2O0OA 1UZ0A 3MV11 3KHBA 4XACA 4MXVA 4P02B 1G7YA 4YVSC 2VGDA 3MICA 4YW1A 2R072 1ZZ9A 3MIBA 4V2VA 1Y9GA 2HEWF 1FXZA 4Y33A 3DPRC 4DXSA 2R6QA 4ET7A 4EV0A 3TEZA 1B35A 3Q8AA 1ASJ2 1CPNA 4CEWC 4MH0E 3Q8FA 3NL1A 3WF4A 4KWUA 1JS9A 5DZFA 4A45A 2W68A 1PGL2 3ZKUA 5IK4A 2CTVA 2D5HA 2YBSA 4QT6A 5L9VA 4XXPA 3M4FA 3O5SA 1AYM1 1OHFA 1BVP1 3E5QA 1PMJX 5FZ7A 3I59B 5K7PA 2AEYA 5FXWA 2WZR1 3K4ZA 1F35A 3MW4A 1VJ2A 3AKTA 3FN9A 1HXS2 1RUE1 1W8WA 1CQ9A 3WQ1A 4Q0PA 3U14A 3PIGA 3PUHA 2GP5A 3POSA 4QQHA 2X5IA 1BEV3 3HQUA 4PLOA 4Q29A 1AYN1 2VE1A 5LCWL 4JHZA 2VAUA 2DF7A 4WM8C 2Q0AA 1DCSA 4L2NA 5T54A 3T09A 4Q0VA 4CCKA 3RWKX 4C0BA 1XB9A 2AACA 4AQ6A 4GKXA 4QGNA 2H6CA 4XAAA 2UU8A 1W90A 1VBB1 3HAGA 2BFUS 5DUUA 2I74A 4BMEA 3BYWA 3MZHA 3M8LA 4P9GA 3VKMA 1V6IA 4ZZ5A 1XBFA 3PVEA 3W20A 2X5IC 1R083 3DXTA 3MI8A 3I2JA 5C3OA 4BZ4A 5IT6A 2FDKA 4K7JA 5A7NA 4HVRA 3F2ZA 5AVAA 5GLZA 3MIHA 4CCMA 1I5ZA 3A22A 2I2SA 3LGRA 3RJ2X 2VD7A 3ZSJA 1AX1A 1F5JA 2VZPA 5EFUA 4GWNA 3WF2A 4AQSA 5J3UA 1WW6A 1FT9A 1JXNA 4Q4W3 4E27A 2BGPA 1VBD3 3PU3A 4BH9A 4YGEA 1YCIA 1KFUL 2GDFA 3TWIA 1H8TC 2J7MA 3HJRA 4XTMA 4MGTA 1RUG3 3WQBA 5C5UA 1VBC2 1RUF1 3O1RA 3MPPG 1O5UA 1POV0 4XAEA 5J37A 4QXBA 4RR3C 1UW8A 1E5HA 4EROA 3WNXA 2VY0A 4MZUA 2PA7A 2D3SA 3CF6E 2ZKNA 1OOPC 3ZYPA 2WA4A 3KGLA 3KHCA 2C9KA 2YZ4A 3FE5A 1SFNA 3ZYFA 5BNNC 4S2FA 1QJY3 1GOGA 2R49A 3IDAA 5A7PA 3RNSA 3VBFB 3MIEA 4CP1A 5DZEA 1WLTA 3BIWE 4QMAA 2WT0A 4FOVA 4YRDA 2VMEA 3WOGA 3T08A 5F5QA 4BQ3A 4JCKA 3PJQA 4NHLA 3NAPC 4BDVB 1TME3 1UF2C 3FLRA 4MGSA 2BNNA 4XFAA 3WP6A 1PK6A 1B09A 2B4KA 3ZFGC 5A6ZA 4CXYA 3ACFA 3H42B 3MDPA 1WUVA 4LTAA 3ZSEA 3MW2A 5DMYA 4QU1A 2HWE1 2YPDA 3LA2A 3MO4A 3T0AA 3WHUA 4BQWA 1VB2A 2ADEA 4UWDA 2BWAA 5F7UA 5KHJA 5I0DA 1IQDC 3FHAA 4MOAA 4XIKA 1RUF3 2DCJA 2X29A 4SLIA 4AK3A 1Z78A 3D3AA 3MFCA 3GALA 4DINB 1XQNA 1UQXA 2XLFA 2JG8A 3TNQA 1F4HA 1Q5OA 4IV1C 5A6YA 4IETA 5JOYA 2HEYF 4YLZA 2GU9A 5LRSA 4Z92B 1DQ2A 5JDBA 2HWE2 2WC2A 4N9IA 2D97A 2Y60A 3I2KA 4PDWB 3ZOIA 2VQUA 4TLGA 1CPMA 2ZGPA 1DG6A 4UFJA 4HKWA 2O1QA 3KWVA 4BHPA 1XNBA 1C1FA 2G9ZA 5FIXA 1IS5A 2AZ5A 1UZWA 1POV1 1Q3EA 4YGBA 3ST7A 3A23A 4PF5A 2VCMA 4BLIA 5CG9A 3OBTA 2JDKA 1PX3A 3OUHA 4SBVA 1AR71 1MZFA 4RA0A 1AJOA 1F4AA 5FZAA 4XDQA 5J96B 2W46A 5FAXA 3E6DA 3WW1A 3A0KA 5FZ3A 2KA3A 2EA7A 3RMXA 1OQ1A 2PQSA 2RDNA 2VM9A 4ES8A 4A6SA 2A73B 4PJYA 1CAUA 4XJAA 1OF3A 2WINB 3RZLA 1D2QA 4XQ4A 3AZWA 1OLQA 3DYPA 1OA2A 1MS0A 1QJEA 2ZXQA 2QNKA 3KCYA 2RE9A 3WNOA 3ASIA 2IXKA 4ZXKA 4FSJA 3JCIA 4DEVA 5ISLA 1GNHA 1W2AX 1L3JA 4QXHA 4MX3A 2ERFA 1BYHA 1GZCA 4E8CA 1VBC1 3THTA 2WL1A 4GQ7A 1QNYA 4YM3A 5IWFA 2FDGA 4OHZA 3U1XA 4HSJA 1ZRRA 4XMAA 1XNDA 1HQLA 2QQMA 3CNAA 3OEBA 4P08A 2ZGSA 1NE6A 2CHHA 3KVBA 4FI9A 1YO8A 1LHVA 1W6MA 4QHZA 4WV8A 4ZS2A 3ZXJA 3ILRA 4X8NA 1OVSA 3LCPA 3U11A 1S0JA 4PI2A 2V5YA 3QD6A 1ND2A 1US2A 2P5BA 1F2NA 4JVAA 5D8AB 2YU1A 3IT8A 3BI3A 2QQKA 2ZKLA 4LT5A 1ULPA 4LNVA 4XABA 3VBUB 1DZRA 3N36A 2ZX4A 2EXHA 2JDNA 2W39A 2QKDA 1RINA 1JYVA 4DIQA 3HT1A 5C71A 5I8SA 2E63A 4CUBA 1HJGA 1NUKA 2OPWA 1MEC2 2Q30A 4UFIA 1AX0A 4RGAA 1NZIA 1X33A 2QDRA 4LKSA 3I2DA 3S5QA 4R9CA 3MHZA 4ITCA 2VOXA 3SH4A 1IG0A 2XBO3 3HQRA 4AEJA 1UU5A 3GZAA 3UETA 2XVKA 3AP9A 1VBB2 4YW6A 2ARXA 4XHXA 3WXPA 3FFZA 3DKQA 4CDWC 4OCTA 1IKPA 4XCAA 5FZBA 2HEVF 2BVBA 2WQZC 1K5MA 4L99A 3RYKA 4XYXA 3WHTA 1W9TA 1I3HA 2VO5A 3GHNA 3MIGA 4UFKA 2EXKA 3O0XA 1H30A 4Y20A 4LIVA 5C3RA 2H0BA 1WMEA 1CN1A 3RZGA 3HMYA 1GOFA 4P9WA 1RXFA 4KH9A 5HXVA 5A1FA 4QB1A 4JHTA 3ZSLA 4W6XA 4U36A 3AKRA 3D0JA 1ST8A 3IPVB 1LEMA 1RUE2 2VTXJ 2WNUC 4N53B 2FQPA 3NNJA 2HWE3 1WCSA 4N90A 3WEZA 4NHXA 4D7YA 4NN0A 1J3QA 5EWSA 2NZ9A 4AHYA 3V0BA 5GM0A 1SG3A 2RJKA 4XZUG 4Q8KA 4XC9A 1DGWA 1ASJ1 4FQZA 3J9SA 2CYFA 2AENA 5JZGA 5FZOA 3Q8BA 3VZMA 1NCRB 3AMQA 2R071 1JUIA 1O8SA 1VALA 4LKEA 3VBOA 3FLTA 3W9AA 2BNMA 5FOJB 1HDKA 1NY72 4CP9A 4QAWA 2VW1A 2RS31 3M3IA 1JI6A 1VBE2 1OMIA 1XYOA 1TME1 2Z4FA 3D4KA 3ZYJB 4MGZE 4LORA 3SISA 1OLRA 1ZRCA 3EMRA 4OHYA 4JZRA 1ZA7A 5KHGA 4QPIC 2PYTA 4IGQA 2Q8CA 2FHRA 3V65A 1U0AA 5FYVA 4NHMA 1LR5A 2LM3A 1YIPA 2G9GA 3K3OA 3PVOA 5E8AA 3FFQA 5A7QA 4Z2WA 2PHTA 1SACA 4O7XA 2Z69A 1Y43B 4FTEA 4QU2A 3J8F3 1YEWA 3TN93 1YJLA 5F5AA 4AYUA 4EZHA 1Y9QA 1VBD1 1WA4A 2CY6A 4CXXA 5FLHA 1DGLA 4FOWA 3WUCA 3ZXLA 4BQ2A 1AR62 2XUMA 1O8PA 4C0HA 1T6GC 4OHVA 1BXHA 4XF1A 3KF5A 4XQDA 4NPLA 2MPFA 3A7QA 3T0DA 5FZOB 4JRLA 5APAA 3ZYBA 3W5MA 4W6WA 5DDJ3 4P14A 3WF1A 3O1TA 3N7MA 3J8F1 1MZEA 4D7SA 4JGYC 5A3UA 1C4RA 3TN91 1XXNA 1PVC3 1RMU3 1GZ9A 1FOD3 2DVAA 5FO7B 2VOKA 2VTXA 2RM23 2WKKA 2D6PA 3EQEA 4WM7B 4AVTA 1HQWA 1NLSA 3CO2A 3ZXFA 3ZKYA 3NAPA 4N53A 1W8NA 3TNPB 1RVF1 3U78A 4O9EA 2GC0A 5JZGC 3RDIA 4RR3A 1UD1A 2EICA 1RUC2 1UOGA 2N7GA 4Q4W2 3FHIB 3PMSA 5C70A 1RB8G 1MQTB 2XJVA 1OFSA 4J1XA 3J26N 1GNYA 4I3PA 2HWB1 3M3EA 3TEYA 2BPA2 2ZACA 3ACIA 3MUY1 3OF1A 4PT6A 4LEJA 2D6OX 2WWUA 2X8KA 3I49A 2HWC2 3MUZ1 2XBO1 2FZ2A 1J58A 1K5MB 2L9LA 2XJQA 3LZZA 5CAZA 2UYBA 4NIDA 2YMZA 4UW6A 3B9IA 1TVGA 1YI9A 1OURA 1HB1A 1IS3A 3L2HA 1W8FA 5C9AC 3V0AA 3I3MA 1JYTA 4KWKA 4R4XA 3UNPA 1CIYA 1LOAA 3VBRB 4FAGA 5FZ8A 4LBQA 2E7QA 3KCCA 4LHKA 2C1FA 5A33B 1J1LA 1COV3 1KD7A 5DUVA 4QQ2A 5AC92 2BU9A 2WJSA 5IFPA 4CUAA 5CG8A 3KV5A 1ZBE3 1QXPA 5C3SA 1XYNA 4P5YA 1QNWA 2VQAA 2XLGA 1V6LA 3H8RA 3RI8A 1BEV2 1GZWB 5CFDC 2JG9B 2VZUA 3KMHA 4GWMA 2VVFA 4IV3C 4KBZA 3IMMA 3O1OA 1U5IA 4W50A 4RQPC 2RJ2A 2JG9A 4HL0A 4I01A 1D4M1 2DCYA 1UIJA 4Q0UA 3ZXDA 4F3JA 5BNQA 5M0TA 5KXDA 1Y9MA 2WFF3 5JSOA 1SCSA 2EXIA 1JUHA 4QX0A 2ZOEB 1S0IA 4JDMA 1SQ4A 3WD5A 2VJXA 3ACLA 4RS5C 5FKCA 2JIGA 3O12A 4LBQB 4AGRA 2LROA 4K1ZA 4COUA 3H50A 3PL0A 5E89A 3TRSB 1SCRA 1XSQA 3NJZA 4A41A 1ULFA 1AR72 5CFDA 2YBKA 4Y20B 3ZFFC 4CCEA 4COZA 1ZREA 3MGUA 1AL23 3E5XA 5FFOC 3VDCA 5LEKA 4EWAA 3BOPA 2ZGLA 5LWBA 1WMFA 2C0ZA 4BB3A 4AXOA 4HMZA 3E97A 3GZTB 5FO8B 3KT7A 3S0MA 2PELA 4Q4V3 1LCLA 3AVRA 1V00A 3JD73 4S2DA 3OD4A 1S0BA 1DQ6A 2WZ8A 5JIAA 3ZXKA 4QKDA 3RGBA 2R7EB 2A7AA 3CQOA 2OX0A 2SLIA 4XUOA 1NZCA 3POIA 5LA9A 2Q8DA 5JPMB 5ERLA 2VZQA 3ZIWA 3DECA 3H7JA 1W03A 4HN1A 4LUKA 3HN1A 4HN0A 3MFAA 4HK9A 4XF0A 1XJAA 3HR9A 3DF0A 2ZZQA 1DLLA 4UXAA 3ZN4A 4B3NA 5IVFA 4MO3M 1MZ5A 4FTBA 4OLLA 3QBQA 1TNRA 4XFHA 1QXRA 5GZDA 1AR91 2BVVA 5A1AA 2JE8A 3B7MA 3CHXA 3N9QA 1H1AA 2A1XA 3BPZA 3LEIA 3U4SA 1QWRA 5HXMA 3VZLA 1NG0A 5FZCA 3SNMA 2ZA9A 3TB0A 2J22A 1FOD1 1UZZA 2VCAA 3RWNA 2VCCA 1QEXA 2JXAA 5FBZA 5GKAC 5A6XA 2XH6A 2E6VA 1GOHA 1R64A 2RR13 2J1SA 2VULA 4IEUA 2Y6KA 4R52A 4CSWA 1RUI3 4P9IA 3O1UA 1W8OA 1YQ8A 2DTYA 3AP5A 1VMHA 3H1YA 1HW5A 2R32A 2WNUA 5IK7A 1QH6A 1PO11 1H2MA 3FLPA 2NYYA 2XR4A 3WCRA 5L36A 3K51A 1DDLA 1UPIA 1XPWA 3IAPA 5FQ0A 4X6RB 1UX7A 2YUEA 2P34A 5FY4A 1QJZA 3EBRA 4JRAA 3ELNA 5H9RA 1V9U1 4FXKB 3B69A 4I2OA 1GR3A 3ILFA 1JOBA 3ZMNA 1BBT3 2OA2A 2W1WA 3VBFA 2J42A 1J83A 1ODNA 1PO13 4AFAA 1GLHA 1RUF2 3FBMA 4CDUC 3UJOA 1H8TB 5DQ0A 4BXFA 1JW6A 3MW3A 1XE7A 2XJSA 5FUPA 2GC2A 4BMBA 1N3QA 2HWF2 4FPLA 1OQDA 1P8JA 2OS2A 1NLRA 3IIIA 4XQWA 4MHUA 5L73A 4B4PA 2ZX2A 1PZ7A 3NW4A 4MXWA 4QQOA 2NPIA 5G05L 3GZEA 4RN5A 3RVHA 1WCUA 5SV8A 4Q4X1 3RFRA 3WNMA 2Q4SA 4EWDA 1VBA2 3WW4A 1HJFA 3OPZA 1QGLA 1UMHA 1TZOA 1LNSA 4CEWA 2DCTA 4NRPA 1JZ8A 1LOFA 5JOZA 3IMNA 2WO7A 2QBXA 3VBFC 4XUPA 4AGVA 3OCPA 2RS52 2XVGA 4RYDA 1ULGA 2ILMA 1ZRFA 2LS6A 3IBMA 1CX1A 2E7AA 3KGZA 4LOTA 4RFRB 5FBJA 1S2BA 3SXWA 1SBEA 5BNOC 1PZ8A 4R9BA 2WZPP 3QOPA 1SLBA 4AZZA 4IE6A 5FYYA 4COWA 4XFCA 2OZ6A 1DLCA 5F3GA 4BQYA 4INDA 2W2IA 1HB3A 2E33A 2F17A 1W8UA 3DYMA 3ZYHA 1HXS3 4W65A 3JD72 4LPLA 4NMIA 3PU8A 5K0UB 5HPOA 2XHKA 3POYA 1V9U3 4M0HA 1MS1A 4FP2A 1H2NA 5FYMA 4TYSA 1YLLA 2QQOA 4WVZA 4QX1A 1A6CA 3WG3A 2RJLA 1L7RA 2VMHA 4E2SA 4NHKA 1XC6A 5FMCA 4HKLA 1ODMA 2JJ6A 4L8QA 1MZ6A 3H8UA 5FMOL 1NE4A 2Y6FA 2RDRA 1UXXX 5LBFA 3PUSA 5BUVA 1C28A 2GMEA 3C7OA 1QF3A 3ZSMA 2ZJCA 1KS5A 4AFDA 3V64A 2FMYA 3BTZA 4Q4Y1 2VUCA 2A70A 4FFFA 4RGGA 3VBOB 3VL8A 4PLNA 1AYM2 3KF3A 2CWMA 1NCRA 5DN2A 1D4M3 3THDA 4BE3A 3AJZA 4QM9A 4PDWC 1WA6X 1JHJA 3O7OA 5I0TA 1SDWA 1D0HA 1CGPA 3H1MA 4XILA 1FMD2 1UNBA 2WAAA 4HSLA 2NM1A 1F15A 3VD3A 1N1YA 2GNBA 2DVGA 4XVHA 1HRI1 5FY8A 1K3IA 3RYRA 1ENSA 1WCKA 3ZR5A 5JXIA 4DQAA 5KXBA 3VD9A 1C5HA 2YB7A 3M3CA 1UOBA 2TNFA 1R093 1MS5A 3EYPA 4HVOA 2CGPA 1QJX1 1S1AA 4IE4A 1AVBA 1IOAA 1W6OB 2MEV3 2ZMKA 4ZKTB 1B35B 1KFXL 1KS4A 2LALA 2A71A 5FP3A 4Q4V1 3VBSA 3VBRA 5FDBA 3S7EA 2JD4A 3PTRB 5FJHA 2DU1A 5IAXA 5B2GB 4PF1A 3N4MA 4LO6B 1YFYA 4TLFA 5BNPB 4CCNA 1W2TA 2XMLA 4HONA 3APBA 4AI2A 2ZZJA 4MV2A 2QUOA 4AVAA 4LXLA 3AC0A 3DXUA 2FDIA 1REDA 5DAWA 2RMU3 5BNPA 1X8MA 2XL9A 2VOTA 4KNCA 5E88A 4LJHA 5J7MA 1LHUA 4RQPA 4ZPIA 2WS92 5FY0A 4QXCA 2YGLA 1GQGA 4D69A 2HH9A 1ZBE1 3T1MA 1SPPA 1KEXA 1YFXA 3I3BA 5C8CB 1UYYA 4J25A 5CEHA 3H8OA 1HKDA 4AF9A 3R05A 4C90A 2OT7A 1E5IA 1FAYA 1XU1A 2WNOA 3MLJA 4B4RA 5KC6A 1Q43A 3WQ7A 3BKZA 1ZBA3 2GH8A 4P9YA 1AR81 5HCAA 4PDWA 1LKNA 1RL3A 3VDDA 2R073 3LEKA 5BPXA 1C8M3 4JX0A 1H4GA 2GALA 2D44A 5DDJ1 1QOTA 4A7KA 4OMCA 2ARCA 2W94A 3ATGA 1URXA 3VHOA 2E26A 2G1MA 4RHV2 4Z8BA 2P4EA 5AC93 4YZ4A 1OH4A 2F6BA 4QPYA 1EV12 5T5PA 2R063 3QACA 4KI5M 5A3NA 3O1MA 3OGRA 2VZSA 1IHMA 3GJAA 4HKOA 1QQP2 1W39A 4JQRA 4JDNA 1NX9A 4MGQA 4FQ4A 5A3PA 1DF0A 2BEOA 5K8SA 3SITA 1YHFA 4LBJA 5JI7A 1J59A 5LY1A 1W6PA 2DUOA 2WYSA 2Q1ZB 4ZONA 4K9SA 5LK5A 1RUJ2 1XE0A 4AG4A 4GH4C 2IXJA 4NIHA 5K0UA 2ZGOA 1ACCA 2WNUB 4ASLA 4ARYA 4PCRA 2X09A 3CJIB 4KG0A 2K9ZA 2WNVB 4QPGA 1G9CA 5F32A 4MVTA 3UGGA 1O91A 1LU2A 3ZYRA 2WNEA 2ZGTA 1LGBA 1RUD2 1JU3A 1VBE3 4IV1A 4LBNA 4YM2A 1BBT2 2O14A 3RPQA 5IHRA 1GP4A 5DXDA 1R081 1NCQB 1Q8PA 4OQ8A 2JICA 2V5DA 3LFMA 4QX5A 1UO9A 1K45A 4ONUA 2H0VA 1POQA 2RM22 4W8JA 5FYBA 1YC61 5SV5A 4JKMA 3WUDA 1OF4A 3LPFA 1WW7A 1NCRC 2CU5A 3OY8B 4LBOA 1LESA 1RUH3 1ULCA 1WLDA 3IZOA 1AYN3 1H6XA 1YQ2A 2J1EA 4IXLA 3ITQA 1QOOA 1XU2A 4XW3A 2VH9A 1LOEA 2IXLA 1H1IA 1N3OA 1US3A 1W6QA 3CBNA 5HBAA 2W52A 3W59A 1QQP3 2JEMA 5CKQA 3ETPA 2E32A 3WG1A 4K6BA 4GMP1 5FYTA 5C4WB 1RUH1 5KBFA 1NQDA 2ZPXA 1PGSA 1BLZA 4YW3A 4XZPA 3UYJA 1C1LA 2EAAA 1RUD3 3CDZB 3NKGA 1ND3C 4QPIB 3N7KA 4YVSB 3ZN6A 4FT8A 1GMMA 1MR5A 3AZXA 1IS4A 3BALA 2Q5TA 2NMNA 4QPGB 2XHNA 4IEWA 1RIRA 1JN2P 1Q56A 4RGKA 2GMPA 2WA3A 1R082 3NV2A 4AVSA 1OOPA 3ORJA 4DY5A 5FYZA 1X7NA 4FOYA 2BW8A 2VOWA 3M2MA 4L0PA 4OVEA 4KU7A 3I97A 5C5TA 3KCXA 5FZ6A 1UCXA 2XJUA 4L97A 5KHKA 5LK7B 3UGFA 3N9LA 1AZDA 3VDBA 4D8MA 3GCXA 3O0WA 4ZS3A 5ACA1 2GNDA 2VBBA 5DABA 4TTGA 3LQCA 1Q8SA 2VW2A 1DIWA 1Z7S2 4XFFA 1EV13 1SMVA 3ENRA 2RVAA 3CKHA 4FP3A 2E53A 2UWBA 5C8WA 2WFF1 4K21A 3WVJA 1DQ1A 1VP6A 1M4WA 2VMIA 4PIYA 1BJQA 2Z79A 1QH7A 3K46A 1QQP1 1ND2B 3ZXEA 4E4ZA 5IFTA 3OUIA 5LBEA 1ALYA 1O5LA 1UOFA 2DV9A 2A6WA 5BYNA 1YQ5A 1LENA 2FCTA 4IEPA 4YW2A 2ZAAA 4XJUA 5H9PA 2QQUA 1UPSA 4PI0A 4DZGA 3VZNA 2PHLA 1J3PA 4RHV1 1HV1A 1RUE3 4HFSA 2C26A 2WUHA 4S2GA 5EIYB 3WNLA 1OD3A 2JDUA 3HNYM 1R1A1 3SH5A 4OUEA 3TYJA 2DBNA 1K5MC 2PFWA 4YZ3A 2G4IA 1JOJA 3PTYA 2JDPA 1QDOA 4M01A 1K12A 1F5FA 1UKGA 2D6MA 4Y5Z0 2XWBB 4CZSA 3GZUC 4OHWA 2IZWA 2V73A 4FCAA 1ULEA 3DKWA 5FP9A 4LE3A 1FMD3 4GULA 1WW5A 2HKXA 1CAUB 5FLIA 3VBRC 2GSYA 3P6BA 5J36A 4W4ZA 4LO5B 2WWJA 2VU9A 3GCWA 1ZBE2 5FP4A 1AR73 2ZGMA 2Y64A 2NP0A 4CU8A 4XUQA 4HVQA 3POFA 1WZXA 4XEZA 4EN8B 3V56A 1GICA 1VMJA 5JSRA 1VB4A 3I4IA 4C91A 4NWWA 1LOBA 2JG9C 4IV3B 4UF0B 2VVEA 4D6QA 5GJ6A 1R092 3DGTA 4RR3B 4UBGA 2EXJA 1SBDA 5FZHA 4AI3A 3E5UA 5I91A 1ULOA 4CTEA 1QY4A 4FPEA 3MIDA 1SLLA 1J3RA 3NV4A 4YWAA 5LA2A 3T3YA 1JMUB 4COYA 2YC2A 2K46A 3AJYA 3OY8A 3SCGA 4EYUA
chains in the Genus database with same CATH topology
3LSDA 1O3RA 3I7DA 4AGGA 2WLPA 2P37A 5CA6A 4XF4A 1ZA4A 4NVPA 4B29A 1DHKB 1OD5A 1RHI3 2JG8C 2YXSA 2ZX1A 5GLTA 1SEFA 3KQRA 3V0AB 2OW4A 3NV3A 2R1DA 2OUJA 4FPCA 5FLJA 4LBKA 2CNAA 2CV6A 2ENRA 1LOGA 4FAHA 5KC5A 3IWZA 1JTZX 3QLQA 3AKSA 4WM8A 2D43A 2HWF3 1XE8A 4LUMA 4A7YA 2XPJA 2CGOA 1JYIA 4AVVA 2IFRA 1RUC3 3U07A 1MQTA 2FZ1A 2D5FA 1RGSA 3AZVA 1CAVB 3BU7A 2ZABA 2YDEA 4R8HA 3SHRA 4ASMB 1ZZ6A 1MVEA 4N7IA 1WBLA 2AREA 2HWD3 2VUAA 1CAWA 1W6NA 4M3CB 1S0GA 4Q1RA 5F6KA 2BWCA 3V0BB 1OSGA 3SCHA 4FPJA 3ZFGA 3VDDB 1ZZBA 5JOWA 2HWB3 4AI1A 1V6NA 2PN5A 2ZMNA 2A3YA 1I6XA 2OPKA 4KQ7A 4XF9A 4YFWA 1UU4A 1FX5A 4AFCA 3VUOA 4H14A 2OUHA 3VKLA 1DQ5A 1Y7BA 2R30A 4CDQB 1VLNA 4QGMA 1UU6A 3I54A 5FRAA 3R6SA 5CADA 4K40A 4W6YA 4K3UA 1ENRA 4L11A 2HWF1 3HIFA 1IKQA 4ZU5A 3ZFEB 1Q8QA 3QH7A 3CEWA 3AKPA 4KGQA 5IK5A 3WW2A 1HLCA 3HT2A 3VBSB 4NO4A 5E1RA 1LOFC 3UL2A 1PZ9A 3VBUC 4XOGA 2EF6A 1AXYA 1OQEA 2PAEA 2R041 4Y24A 3WY6A 1MS3A 1RUG1 4PBOA 2P2KA 4I0WB 5GZFA 2D7FA 4DXZA 3D5OA 2Y0IA 1ZNPA 3B3QE 1QDCA 4E2QA 5BNOB 2DVDA 4Z1VA 1FATA 2X53S 4XFBA 4QM8A 1WMDA 4Q4X3 1S0DA 3R0RA 4J1WA 1Q8OA 3WINE 3IPVA 2GZWA 3USSA 5A33A 5K0UC 4F83A 2WFF2 3ZXAC 3EJKA 1N1SA 1AR92 3AZZA 4K20A 4CDWA 5J09A 1FNZA 1RHI1 3MEPA 2RS12 5FMOS 1U5ZA 1YFUA 3FZ3A 3AFKA 2VUJA 2NN8A 3EO6A 1QKQA 3VBOC 1ZYBA 1EY2A 3ALQA 3KZ4C 4EJRA 2DCZA 3UKTA 2XB6C 1C8M2 4YW4A 4BPZA 4NWVA 2D6LX 1HRV3 1AL0G 1G86A 1VAMA 3WG2A 5EV7A 1LRHA 3TAYA 1G9BA 4OI4A 1LHOA 4BWOA 2JENA 4OI0A 2ZHNA 3AYAA 4G9SB 4IQPA 3LWCA 5GLWA 2FBEA 1PO22 2JE7A 4Y26A 4ISRA 4XTPA 2B7YA 2YYOA 4AVCA 4EN9B 3AP4A 4LR4A 5GZCA 4MXWB 1WW4A 2GN3A 3OGJA 1NCQA 2WZR3 2BQPA 5BNPC 4XETA 4MGYE 1HRI3 4DS0A 1C3HA 2VQ0A 2JECA 2R0HA 3HQXA 4FPFA 4ZU7A 2ZCWA 2I07B 4JGZA 2WNVA 3USUA 2YROA 1MVQA 1BBT1 1QXJA 5IUQA 4D3WA 3M3QA 5C8CC 4RS5A 2O8QA 2HWC3 1KDMA 2YV8A 2Z42A 2A6XA 2ZAHA 4I0AA 4JGYB 3RYPA 3RSJA 2DVBA 4AI8A 1I9RA 1NYWA 1RJ7A 1RUJ1 1LHNA 1DBNA 2AR6A 1OFNA 1AYM3 2VG9A 3EHKA 2HWC1 1COV2 1RITA 5GLUA 4AEDC 5JZGB 3T1LA 1VRH3 3WDVA 2PLV2 1RUJ3 4LA3A 4WM7A 1MQTC 1OA4A 4PLMA 4R9AA 2XKOA 2HWB2 1YXWA 4JC1A 1KJLA 1EV11 2QZ2A 1ZX5A 5LEJA 2Z5WA 2ZHMA 3BOWA 1CD3G 3AYEA 1CJPA 5T55A 1F31A 5IK8A 4OUSA 5CFCC 1FI2A 2BNOA 4HANA 3RI9A 1HX6A 5EYYA 2HYKA 3ZX7A 4GA9A 3R4DB 3RQ0A 3VZKA 4CP2A 2GNMA 4GB33 1AHSA 1U5YA 4AI0A 2VVDA 4P9JA 4GH4B 4BLJA 1H9PA 2DFBA 4Q26A 3J8F2 1FPN1 4Y1VA 4Y4YA 2YC0A 3CJIC 3LKJA 3OTFA 2WNVC 5H9QA 3VHNA 2R1BA 4CDXB 3JUUA 3NKTA 1V6KA 1QJY1 2C9AA 5EZWA 1I1EA 3FMGA 4D7TA 3NVCA 5D1IA 5CFDB 1PVC2 1RUI2 4URTA 1JHNA 3AMHA 2GH2A 1LULA 4DPNA 2BGCA 1KXGA 4KU8A 3VBHA 4I09A 4Q27A 4YG0A 1OPMA 1PGW1 3POWA 3GBGA 4HPKB 4COVA 5T50A 3D82A 4RHV3 4DRRA 3VBUA 2XJPA 1CX4A 3AX4A 3PVBB 2ZMLA 3ZO0B 1G6NA 2DURA 5C4WC 1GYKA 4XF3A 3AFGA 4XBLA 4BIFA 3IM0A 1WCDJ 4N9HA 4Y1UA 3WX5A 5T5LA 3ZFFB 1GBGA 4HZFA 5F1RA 4H7LA 5DUXA 1EPWA 1S0CA 1HRI2 3IN9A 4MSVA 1PVC1 4Y1XA 1FMD1 1QJU1 3ECQA 2VOVA 2DUQA 1QJY2 3HBZA 3A4UA 1DYKA 3TOJA 1BVVA 4AEDA 1IQAA 2PHFA 1LEDA 1TQ5A 1FPN2 1QJU3 1UIKA 4FPHA 2VW0A 4CDXA 2G9FA 4QQPA 2UYAA 2WT1A 1REFA 4XMIA 1AJKA 1EPZA 5BV6A 3GF6A 4X6QB 1PIV3 1X36A 1XNKA 5I8TA 1S0EA 2OYZA 1VRH2 1WD4A 5J98B 4YVSA 3ZN6B 3JD71 1WGPA 4WVWA 1X50A 4XBNA 2K2SA 1JYCA 5A3LA 4YNIA 4P9LA 3B5LB 4N43B 4IEZA 4IERA 2PTMA 3VV1A 2PHUA 1DQ0A 1CR7A 1W6MB 3OGGA 1ZZCA 5JVVA 1AR93 2ATFA 2O8OA 2QZ3A 1WLWA 2VXRA 4Q1PA 2DCKA 1VBB3 4L9BA 1LJ7A 1VBA1 4Q4X2 1KITA 3W58A 3LA7A 2YPJA 2QE3A 1HRV2 4AQ2A 4AFMA 5L7OB 5C33A 2W08A 2WWSA 4WVVA 5A32B 4PQ9A 3VGIA 3DN7A 3ZYIB 4CDUB 4JGYA 4GB31 2UY9A 1VBA3 4X8PA 4WBBA 1OKQA 3RJRA 1U12A 1W6PB 1V9U2 2UWAA 3SH3A 4A7ZA 4CDUA 3LAGA 1ENQA 3CLPA 4B8EA 2GNTA 4JGZB 2VMGA 4C1WA 1JH5A 2SBAA 1PK6C 1R1ZA 1PO12 2DTWA 4K1YA 1CESA 4KGGA 4ATEA 2ET7A 4NR1A 2TBVA 4OHXA 3M70A 2PAKA 2P3IA 4U2AA 4RD7A 2A6VA 4XPVA 3OBRA 5AVPA 3JZVA 1V70A 1RUOA 2KM2A 1PIV2 1PHMA 1PNGA 1N47A 5ABJB 1RMU2 4AW7A 4UW3A 1FOD2 4YZ5A 4LLFA 2JG8B 3KS7A 5F6LB 1CIWA 3WP5A 3M1HA 1Z0HA 1G9DA 4I0BA 3WDUA 5C9AA 4XE9A 2Y26A 1MS8A 1AX2A 3MLLA 3H0OA 2ZGUA 2DYCA 5JSPA 1O3SA 2A75A 3AM2A 2CAVA 4KWJA 4F8AA 4TSVA 4OUMA 2I45A 3WV6A 1D2SA 4Y22A 1FV2A 1A8DA 5JIUA 5K9YA 3AB0A 2NMOA 4HBNA 3KB5A 2ZTNA 3C3VA 1RTVA 2B45X 1A3KA 2YY1A 1RMU1 4OFGA 4QD2A 1YIFA 5JOXA 4M3CF 5HCBA 5KWRA 4A2UA 1PIV1 1SLAA 3VDDC 1IZ3A 1AR63 1EYBA 4MUVA 5KHHA 4M00A 3I8TA 2X5IB 4UW4A 4Q4Y3 1NA1B 3NV1A 1RUG2 1H4HA 4JDOA 5ABJA 1V6MA 5JMCA 4N7UA 2QVSB 1ND3A 4E2GA 1NA1A 3I59A 3U0ZA 3O14A 1FYUA 3KSCA 1KQRA 4EN0A 4J6GA 3THPA 3VBHB 1H2LA 1BEV1 5T5OA 3ZFEC 3WP4A 3U10A 1RUNA 3MPBA 2WQ4A 4GB32 2QFEA 2IWGB 4CEYC 3WDWA 1NOVA 5I0UA 1RC6A 3PLQA 4DNYA 1HRV1 1IGOA 4LBQD 1OOPB 4YVWA 2WSUA 3KLSA 1VBC3 5FCCA 4Y22B 4BM8A 1GANA 2A3WA 4UBHA 4F7ZA 2XBO2 1D0GA 2WFPA 1DZTA 3ZVXA 1UMZA 3PJYA 3WDXA 3H3ZA 4KG8A 4LE4A 3ZSKA 2PHDA 3NAPB 1S55A 3PNAA 5CU1A 4GXLA 3ZFGB 3ZN5A 4Q4W1 4YZ1A 1RVF2 3OYWA 1VRH1 1PO23 1VAVA 3IKWA 2ARBA 1SLTA 5FTTC 2LUWA 3WP3A 3E6CC 1J1TA 2A6YA 4FOQA 2CAUA 1CAVA 2E7TA 1REEA 4AHZA 2QCSB 1UX6A 2OIIA 1HXS1 2DU0A 3LA3A 4IV1B 2B8MA 3JQXA 4CYDA 1D4VB 1OA3A 1PGL1 3B9CA 4YVWB 4QQLA 2E9QA 1FPN3 1LGNA 1QJU2 2D98A 1CONA 4Q8LA 3R4UA 3WDTA 4AEKA 4CRQA 5I8YA 4M0NA 2OZJA 2DUPA 4BCUA 4ES9A 3CJXA 1QU0A 4YW5A 3G7DA 1YYNA 2MHFA 4KBBA 3B00A 5EYXA 4JTNA 5JCTA 1H8VA 1TME2 1VBE1 1Q8VA 4PIZA 4CEYA 1TEIA 3ILNA 1ONAA 3S6PA 1PGW2 1ND3B 4YFZA 5FPZA 4WVMA 4AE2A 2GN7A 4QPGC 2IXHA 2WT2A 3LOBA 3AP6A 1RUI1 1PM7A 1BQPA 5JWPA 2UWCA 1Z7S3 1OPOA 1V6JA 2ET1A 3LB9A 5LRRA 1MACA 2Q8OA 2GMMA 1QMJA 4XJWA 2PHXA 1HIXA 2AGSA 3ZXGA 1HV0A 3O0VA 5D8AC 3D8CA 4E9KA 4BYYA 4Q2FA 1ENXA 1NQJA 1LOCA 3C2UA 3JBG3 3HWJA 5BNNA 1W0OA 3BODA 1GFF2 5CB7A 2ZHKA 1A8MA 3IDBB 1IPJA 4QXKA 4AEDB 1ND2C 3JBG1 4GKYA 5CVRA 2P17A 1HQNA 1W6OA 5JLVA 4HLTA 4LULA 2PLV1 4LO7A 3CU7A 4ZU4A 3OD0A 2ZGNA 4KL1A 3Q9OA 2Y38A 1COV1 3B02A 1MEC1 4Y1ZA 3ZFFA 5CFCB 1LECA 5EJ3A 1IPKA 1Z7S1 4Z82A 3JU9A 4RFT0 2PLV3 2D6NA 1LU1A 2P3KA 2ZGQA 4B4QA 2DVFA 3JQWA 1H1MA 1MEC3 4ISQA 4R4ZA 4N53C 4ATFA 4S2HA 5FO9B 2ZBJA 4CDXC 1A78A 3VKFC 3WQ0A 1BKZA 3ZDSA 5FREA 1MS9A 3M3OA 3AYCA 4V1PA 2AYHA 4IESA 5JAXA 1FNYA 4GMP3 3UKVA 1SLIA 4FPGA 2K0GA 2VNOA 5BXXA 3ETQA 4OZXA 3N7JA 3GBWA 4XHBA 1GNZA 4LO4B 3S30A 1AL22 1RUH2 4MGKE 1CJDA 1EAH1 3M7AA 4YGDA 3RZZA 3ZIXA 3AKQA 3GYDA 4DRVA 1G9AA 5CBLA 3G6JB 1DQ4A 2GC3A 2BTVC 2JX9A 1X82A 4FPYA 1PO21 1LTEA 4YM0A 5F9TA 3DPRB 3AXDA 5ACA3 1QJX3 2D93A 2DWRA 4CEWB 3AZYA 2B5HA 1UAIA 3BCWA 1AR83 1SLCA 3WCSA 2R043 4BA6A 1RUD1 1C8M1 2A3XA 4LO8A 1AUYA 4E4DX 4DMIA 2HJIA 1H9WA 3L9JT 3D0SA 1AXKA 2RS11 1RHI2 4BOWA 2D6KA 4CP0A 4M3CE 5L19A 4UW5A 1KDKA 4WM8B 3DL3A 4META 3TBDA 3MLKA 1UL9A 3CL1A 1R1A3 3PHMA 1LODA 5HCFA 1GKBA 1CVNA 5H9SA 5I0RA 1F8VA 3WW3A 1YWKA 4IEVA 2RS13 3IIAA 1O4ZA 1LB2A 3VL9A 4AVBA 2XKPA 1ZZ8A 4LHLA 4DFSA 2DFCA 3WT3A 1N1TA 4B7EA 3KT1A 4NPRA 4TWTA 1S2KA 4GMP0 3MF6A 5GLVA 4FPOB 3IDEA 1XNCA 2V09A 2PHWA 1TMF3 4MLOA 2R042 2IC1A 1AR82 3AK0A 4Q0QA 1YJKA 1YNAA 3OYWB 4CDQC 3QCWA 3R4SA 2RS33 1Y3TA 5L7OC 1UKRA 1C5IA 4LBLA 1AXZA 1F9KA 1O4TA 2XLAA 4A3XA 1G8WA 2D3RA 3P3NA 1YUDA 4H7MA 5CIRA 5C8CA 1NXD1 3URFA 2H6BA 1CAXB 3FX3A 4RQPB 3VBSC 2A5ZA 1JBCA 3FWEA 1SBFA 1GV9A 2CWSA 3RG0A 1W2UA 5DG1A 1N1VA 2JDZA 1BMV2 1ZVFA 5J48A 3DV8A 4IEXA 5BNNB 3ES4A 2PHRA 4LHNA 4O9GA 4DOUA 1TNFA 4AFBA 1EP0A 2EVXA 1UN1A 1QJX2 3VZJA 3WG4A 4FO9A 3WDYA 1CAXA 1M06G 4D94A 1TMF1 2WLQA 2AUYA 5ABJC 1ZZ7A 1EAH3 3E6BA 4EWEA 1APNA 3J4UH 3IDCB 3D6EA 5GALA 2B9UA 2RHPA 1VR3A 2QJVA 1LGCA 4HETA 4LA2A 1FV3A 5DZGA 4C1XA 1WLCA 2AH2A 3U4XA 2JE9A 4Q4Y2 1AYN2 1GZWA 5BY5A 2R061 2GAUA 2RR11 5T52A 3VLBB 5GZGA 5AFBA 2IXIA 3HD8B 1QHDA 4L92A 4PIXA 5AFEA 1DGWX 4DY3A 2RR12 2R062 4I30A 2BFUL 3VHRA 2XGXA 2ZHLA 1O3QA 2WZR2 3N35A 1ZRDA 5FOBB 3NSTA 3AMPA 3PVNA 3BTAA 3SLIA 3AMMA 4BIOA 1O4YA 3VHPA 1NXMA 2ZGKA 2LTNA 3B93A 1H2KA 1PNFA 1TE1B 2D40A 1SFYA 1ULDA 2RS53 2BBVA 3ZFEA 2XL7A 1WD3A 1TMF2 4BQ1A 2XG3A 3ME2A 2QQPA 3UV9A 1BZWA 1QOSA 3FJSA 5A32A 1VIWB 3OJBA 1U5XA 4LBMA 2RS51 3NWKA 2WSVA 1NA1C 2BUKA 1YI7A 4MYEA 5GZEA 2F4PA 3AXEA 1BMV1 1KRIA 3X29B 1WBFA 5EXOA 3UJQA 3LOIA 3AP7A 3ZYGA 4ORFA 4PBPA 2XVLA 4XFIA 2D3PA 1R091 4YARA 1GSLA 4G4FA 1V6OA 1GQHA 1DZQA 1ZBA1 4WVMB 3VBHC 2MEV1 4XJ8A 3P3PA 2QDNA 1IS6A 3DPRA 3GBFA 3MIFA 5DUWA 3H1WA 5TSWA 2B42B 4MGIE 4CEYB 4JAAA 3L2YA 3KD4A 3T2TA 2EIGA 5C6CA 2CL2A 2A6ZA 3PMEA 1H8TA 3N7LA 1S0FA 1LHWA 5I0SA 2RMU1 3ES1A 3VZOA 4YG3A 4GALA 1RVF3 3LSEA 5JR7B 2YHJA 1R1A2 2VECA 4XJ9A 3FUOA 4XFGA 3FBYA 3H7YA 2PQQA 4CDWB 2CGNA 2UURA 2YGMA 5L7OA 2B46X 4NOTA 2ZX3A 3S7IA 4E4SA 1C57A 5E16A 2VNRA 4FVVA 3SCFA 3ZMOA 1ASJ3 4YG6A 5CNAA 3BB6A 5BNOA 4LLOA 4YYOA 3FUQA 3EXUA 5ACA2 5DG2A 4AQTA 4YSFA 2ES3A 5CFCA 3H3UA 2XJRA 2WIIB 4I02A 1YRZA 4HPKA 4RL7A 3N3HA 1W0PA 4YVWC 1OI6A 2EALA 4GIQA 5KXCA 4FXGB 4FTSA 3VKNA 4AWDA 2ZX0A 1C8NA 1DGRA 3FC0A 4HK8A 2GC1A 1XYPA 2HWD2 2XJTA 1DYPA 3SMHA 4XBQA 3ROUA 4P9XA 1B35C 4WZCA 3JB4C 5FPXA 1EAH2 1PVXA 1AL21 2HWD1 2IFWA 2W0XA 3GHMA 4H55A 3RS6A 3QH6A 2PAMA 4GH4A 4FPKA 4Q0SA 3MF9A 1D4M2 4WZFA 5I93A 3AMNA 4HT1T 2R0FA 2RM21 2XWJB 4JV4A 1H0BA 3WR0A 1W6QB 3K48A 2ETEA 4YGCA 4XJZA 3A0NA 5JI9A 5KHIA 3B94A 5D8AA 4EN7B 3KT4A 5AC91 1VAKA 3RRDA 1W6NB 4M3CA 4OI2A 4R9DA 5KXEA 3UK9A 4IEQA 4H3WA 5T5JA 2E51A 2UY8A 1MS4A 3INAA 4EN6B 4YZ2A 3JB8A 4RSUA 3WLUA 2FMDA 2OVUA 4OULA 1DGRN 4AHWA 4WM7C 1PMIA 4QGLA 3B01A 2IXCA 3CJIA 1POV3 2MNGA 4QHBA 4K8FA 2VPVA 1KJRA 4JTOA 1DFQA 3VKOA 2JKBA 1RJ8A 1YFWA 3WZ1A 1AF9A 3JBG2 1RUC1 4N43C 3USUB 2NQYA 2Z2SB 2P3JA 4KWLA 1XRUA 2BYVE 4CDQA 2NLRA 5DDJ2 1O3TA 4Z07A 4I3GA 1BCXA 4QPIA 4B7KA 4XXAA 2Q1MA 5C4WA 1E57A 2ZGRA 4IEOA 4AHXA 2RMU2 1UZYA 2B39A 5C9AB 3TN92 4AEMA 1N3PA 4OI1A 2TUNA 3NO8A 3RMYA 1BK1A 2TEPA 1G9FA 5A3MA 4P5HA 3AYDA 1AR61 2Y0OA 2WS91 1CAWB 1VBD2 3H9AA 4N43A 4IEYA 1X8EA 1NCQC 2MEV2 4IL7A 1ZM1A 1ZBA2 3MYXA 2KXLA 1O7FA 3VN4A 3KM5A 4IV3A 2WS93 4TZDA 4JGZC 2EAKA 2ZS6B 2R16A 3DUIA 3UKNA 1PK6B 5HI0A 4Q4V2 5T3NA 3GNEA 4YM1A 2C5DA 4Y1YA 5FQ0B 4XIOA 4DB5A 4RS5B 1DU3D 2VNGA 4G3YC 2RS32 5JPNB 1NY71 2O0OA 4YVSC 4MXVA 1G7YA 4YW1A 2VGDA 3MICA 2R072 1ZZ9A 3MIBA 2HEWF 1FXZA 3DPRC 4EV0A 2R6QA 1B35A 1ASJ2 1CPNA 4CEWC 4MH0E 3NL1A 5DZFA 2W68A 1PGL2 5IK4A 2CTVA 2D5HA 4QT6A 4XXPA 3M4FA 3O5SA 1AYM1 1OHFA 1BVP1 3E5QA 5K7PA 3I59B 2WZR1 3MW4A 1VJ2A 3AKTA 1HXS2 1RUE1 3WQ1A 1CQ9A 4Q0PA 3POSA 4QQHA 2X5IA 1BEV3 4PLOA 4Q29A 1AYN1 2DF7A 4WM8C 2Q0AA 4L2NA 5T54A 4Q0VA 4C0BA 4AQ6A 4GKXA 4QGNA 2H6CA 2UU8A 1VBB1 3HAGA 2BFUS 5DUUA 2I74A 4BMEA 3MZHA 3M8LA 4P9GA 3VKMA 1V6IA 3PVEA 2X5IC 1R083 3MI8A 4BZ4A 5IT6A 4K7JA 4HVRA 5AVAA 5GLZA 3MIHA 1I5ZA 2I2SA 3LGRA 3RJ2X 3ZSJA 1AX1A 1F5JA 5EFUA 5J3UA 4GWNA 4AQSA 1WW6A 1FT9A 1JXNA 4Q4W3 4E27A 1VBD3 4BH9A 4YGEA 1YCIA 1KFUL 2GDFA 3TWIA 1H8TC 4XTMA 1RUG3 1VBC2 1RUF1 3MPPG 1O5UA 1POV0 5J37A 4RR3C 1UW8A 4EROA 3WNXA 2VY0A 4MZUA 2PA7A 2D3SA 3CF6E 2ZKNA 1OOPC 3ZYPA 2WA4A 3KGLA 2YZ4A 3FE5A 1SFNA 5BNNC 4S2FA 1QJY3 2R49A 3RNSA 3VBFB 3MIEA 4CP1A 5DZEA 1WLTA 3BIWE 4QMAA 2WT0A 4FOVA 4YRDA 3WOGA 5F5QA 4JCKA 3PJQA 4NHLA 3NAPC 1TME3 1UF2C 3FLRA 4XFAA 2BNNA 3WP6A 1PK6A 1B09A 3ZFGC 3MDPA 1WUVA 4LTAA 3ZSEA 3MW2A 2HWE1 3LA2A 3WHUA 1VB2A 2BWAA 5KHJA 4XIKA 1RUF3 2DCJA 2X29A 4SLIA 4AK3A 1Z78A 3MFCA 4DINB 3GALA 1XQNA 2XLFA 3TNQA 2JG8A 1Q5OA 4IV1C 4IETA 5JOYA 2HEYF 4YLZA 2GU9A 5LRSA 4Z92B 1DQ2A 5JDBA 2HWE2 2WC2A 4N9IA 2D97A 4PDWB 4YM3A 1CPMA 2ZGPA 1DG6A 4HKWA 2O1QA 4BHPA 1XNBA 1C1FA 1IS5A 2AZ5A 1POV1 1Q3EA 4YGBA 3ST7A 4PF5A 4BLIA 5CG9A 3OBTA 4SBVA 1AR71 1MZFA 4RA0A 1AJOA 4XDQA 5J96B 5FAXA 3E6DA 3WW1A 3A0KA 2KA3A 2EA7A 3RMXA 1OQ1A 4ES8A 2A73B 4PJYA 1CAUA 4XJAA 2WINB 1D2QA 4XQ4A 3AZWA 1OLQA 1OA2A 1MS0A 2QNKA 3KCYA 2RE9A 3ASIA 2IXKA 4ZXKA 4FSJA 3JCIA 1GNHA 1L3JA 4MX3A 2ERFA 1BYHA 1GZCA 1VBC1 3THTA 2WL1A 4GQ7A 1QNYA 4OHZA 4HSJA 1ZRRA 4XMAA 1XNDA 1HQLA 3CNAA 2ZGSA 1NE6A 1YO8A 1LHVA 1W6MA 4WV8A 3ZXJA 3ILRA 4X8NA 3LCPA 3U11A 1S0JA 2V5YA 3QD6A 1ND2A 4JVAA 1F2NA 5D8AB 3IT8A 2ZKLA 4LT5A 4LNVA 3VBUB 1DZRA 3N36A 2ZX4A 2EXHA 2W39A 2QKDA 1RINA 3HT1A 5I8SA 2E63A 1MEC2 2Q30A 3ZPYA 1AX0A 4RGAA 1X33A 2QDRA 3I2DA 4R9CA 4ITCA 2VOXA 3SH4A 2XBO3 4AEJA 1UU5A 3GZAA 2XVKA 3AP9A 1VBB2 2ARXA 4XHXA 3WXPA 3FFZA 4CDWC 1IKPA 2HEVF 2BVBA 2WQZC 1K5MA 4L99A 3RYKA 4XYXA 3WHTA 1I3HA 3GHNA 3MIGA 2EXKA 3O0XA 1H30A 4Y20A 2H0BA 1WMEA 1CN1A 3HMYA 4P9WA 5HXVA 4KH9A 3ZSLA 4W6XA 4U36A 3AKRA 3D0JA 3IPVB 1LEMA 1RUE2 2WNUC 4N53B 2FQPA 2HWE3 1WCSA 4N90A 4D7YA 4NN0A 1J3QA 5EWSA 2NZ9A 4AHYA 3V0BA 5GM0A 2RJKA 4Q8KA 1DGWA 1ASJ1 4FQZA 3J9SA 2CYFA 2AENA 5JZGA 3VZMA 1NCRB 3AMQA 2R071 1JUIA 1VALA 3VBOA 3W9AA 3FLTA 2BNMA 5FOJB 1HDKA 1NY72 2VW1A 2RS31 3M3IA 1VBE2 1OMIA 1XYOA 1TME1 3D4KA 3ZYJB 4MGZE 3SISA 1OLRA 1ZRCA 4OHYA 5KHGA 4QPIC 2PYTA 2FHRA 3V65A 1U0AA 4NHMA 1LR5A 2LM3A 1YIPA 2G9GA 3PVOA 5E8AA 4Z2WA 3FFQA 2PHTA 1SACA 2Z69A 1Y43B 4FTEA 4QU2A 3J8F3 3TN93 1YJLA 4AYUA 1Y9QA 1VBD1 1WA4A 2CY6A 5FLHA 1DGLA 4FOWA 3WUCA 3ZXLA 1AR62 2XUMA 4C0HA 1T6GC 4OHVA 1BXHA 4XF1A 4XQDA 2MPFA 4JRLA 4W6WA 5DDJ3 4P14A 3N7MA 3J8F1 1MZEA 4D7SA 4JGYC 1C4RA 3TN91 1XXNA 1PVC3 1RMU3 1GZ9A 1FOD3 2DVAA 5FO7B 2VOKA 2RM23 2WKKA 2D6PA 3EQEA 4WM7B 4AVTA 1HQWA 1NLSA 3CO2A 3ZXFA 3NAPA 4N53A 3TNPB 1RVF1 4O9EA