2HWD3

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
238
structure length
238
Chain Sequence
GLPVYITPGSGQFMTTDDMQSPCALPWYHPTKEISIPGEVKNLIEMCQVDTLIPVNNVGNNVGNVSMYTVQLGNQTGMAQKVFSIKVDITSTPLATTLIGEIASYYTHWTGSLRFSFMFCGTANTTLKLLLAYTPPGIDEPTTRKDAMLGTHVVWDVGLQSTISLVVPWVSASHFRLTADNKYSMAGYITCWYQTNLVVPPSTPQTADMLCFVSACKDFCLRMARDTDLHIQSGPIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 1A COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 1a
molecule tags Virus
total genus 33
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwd300
1EAH1 3IDEA 4RHV2 3ZFFB 1AUYA 1RUD2 4JGYC 1C8M3 1MEC3 1NCRA 5FMOL 1COV3 1POV3 2RS31 5CFDC 1AR81 3NAPB 1BMV2 4RR3A 1NCQB 3JD72 3ZFGC 1AYN1 1PGW1 4RQPA 1R091 1FOD1 1R082 2PLV2 4LLFA 1AYM1 1HRI3 1HRV2 5ABJA 1ASJ1 4YVSB 1RUJ2 1NCRB 1TME1 5D8AA 1QJU3 1PVC3 5A32B 1PO13 1FMD2 3DPRA 4IV3A 1H8TB 5C9AA 4RR3B 2WFF1 2RS33 1AR83 1VBE1 5K0UA 5FOJB 4RQPC 3VBSB 1RUE1 1VBB1 4QPGA 1NA1A 4RS5A 1AYN3 3VBUA 1OPOA 2HWB1 2RS11 3VDDB 5ABJC 1R093 4CDUC 1FOD3 1AR91 4SBVA 4WM7C 5D8AC 1AYM3 3DPRC 1ASJ3 2BFUS 5L7OA 1HRI2 1HXS2 1TME3 2R041 4CEYA 5BNOC 5C9AC 5A33A 4IV3B 1B35B 5C8CB 1VAKA 4GH4C 1QJU2 5K0UC 1PVC2 4GMP3 1MQTB 2HWF1 4QPGC 1C8NA 1NA1C 4RS5C 2WFF3 4AEDC 5AC92 2Y26A 3J8F1 1F8VA 1FPN1 3VBUB 4FTSA 2XBO2 1RUF1 5DDJ1 1AL22 1Z7S1 4Q4V1 2X5IB 4CDWA 1RUE3 1VBB3 1K5MA 3HAGA 1VRH2 2WZR1 1A6CA 1RUH1 3M8LA 2HWB3 2RS13 5JZGA 5CFCA 1AYN2 1PGW2 1AR93 5ACA1 5L7OB 1RVF1 3VBOC 3ZFFA 1QJZA 4WM8A 5A33B 1PO21 3VBRC 4CDXB 2R043 1ZBA1 3NAPA 4CEWB 4IV1B 1NCQA 2HWC1 3VBFB 4CDWC 1OOPB 2HWF3 2MEV1 1BBT3 3ZFEB 4NWWA 1K5MC 1ND3A 4N53B 3J8F3 1FPN3 1AR61 5JZGC 1RUF3 3JB4C 1QQP1 1Z7S3 1V9U1 2WFF2 4Q4V3 5DDJ3 5C4WC 4YVSA 2WZR3 1RUH3 1VBB2 1PIV2 2R061 5A32A 4WM8B 1RMU2 5ACA3 5BNPC 1RVF3 2HWB2 3NAPC 1AR92 1HQNA 1RUC2 1H8TA 1NCQC 1PO23 3JB8A 1ZBA3 1NY71 3VBSA 1ND3B 2HWC3 1VB2A 1QJY1 1RB8G 2MEV3 1EV11 3VDDA 1PGL1 4YVSC 1ZBE1 2HWF2 1NCRC 2QQPA 1AR63 1BBT2 1R1A2 1QQP3 1M06G 1V9U3 1EAH3 5LK7B 1W39A 1ND2A 2BPA2 1RUF2 4Q4V2 3ZFGB 2ZAHA 1H8TC 2R063 2RR11 4QPIB 4RR3C 1VBA1 1B35A 5C8CA 1C8M2 1MEC2 5ACA2 3VBSC 1MQTA 2XPJA 1COV2 3VDDC 1QJX1 2X5IA 4Q4Y1 1QJY3 1EV13 2WS91 4CDQB 1TMF1 1RUI1 2HWC2 1ZBE3 4Z92B 1ND2B 4RHV1 4IV3C 1RUD1 1B35C 5C8CC 4YVWB 4CDXA 1QQP2 2RM21 1MQTC 1PO12 2RR13 1EAH2 5GKAC 3ZXAC 4CEWA 1VBA3 4IV1A 3VBUC 1BMV1 2WLPA 3JD71 3VBFA 1VBE3 2X5IC 1OOPA 1HX6A 3ZFEA 2RS32 4N53A 1AR82 4Y4YA 1R081 2PLV1 4NWVA 1QJX3 5J98B 1BEV1 4Y5Z0 4N43A 1SMVA 2GSYA 1OHFA 4Q4Y3 1HRV1 5L7OC 4PDWB 1NY72 4CEYC 1CD3G 1R092 2WS93 1FOD2 1TMF3 1RUI3 1RUJ1 4CDXC 1X33A 4AEDB 1AYM2 2BFUL 4RHV3 1AL0G 1RUD3 1ZBE2 4JGZA 1ASJ2 3CJIB 4Q4W1 4IV1C 3VBFC 1TME2 1OOPC 2RM23 5FMOS 3ZFEC 4GB31 1DDLA 1POV1 1RUG1 3JD73 4N43B 5CFCC 4FSJA 2RS51 3VBRB 3ZFFC 1VBE2 1R083 2PLV3 1RUE2 1BEV3 1WCDJ 4WM8C 5CFDA 2BUKA 1D4M1 3ZFGA 2RS12 4Q4Y2 1HXS1 4JGZB 4QPIA 1RUJ3 4Q4X1 1VBC1 5BNNB 4FTEA 3VBHB 2GH8A 4BCUA 1QJU1 1PVC1 4Q4W3 1ND3C 5C4WB 1F2NA 3S6PA 2R042 1AR71 5AC91 2R071 4JGYB 2HWE1 2XBO1 1AL21 2RM22 4GB33 5BNPB 1RUG3 5CFDB 1VRH1 3TN91 3J8F2 4CDQA 2DF7A 1FPN2 2HWD1 2RS53 5DDJ2 1Z7S2 3JBG1 4QPIC 1IHMA 1D4M3 4YVWA 2WZR2 1BEV2 1RUH2 1X36A 1HXS3 4Q4X3 1RVF2 1VBC3 2VQ0A 4CDUA 2ZZQA 1VBD1 4WM7A 1POV0 1PO22 1RHI1 1AR73 2RMU1 1ZBA2 4Q4W2 5AC93 4GMP1 2R073 4CDQC 2HWE3 5BNOA 2XBO3 1CJDA 1ND2C 1AL23 2FZ1A 4FTBA 1NOVA 4PDWA 1GFF2 2MEV2 4GH4A 3LOBA 1VRH3 4GB32 3TN93 4RQPB 4YVWC 1PIV1 1RUG2 2HWD3 1AR62 1RMU1 4AEDA 1V9U2 3JBG3 5J96B 2RS52 3CJIA 2IZWA 1RUC1 5ABJB 4CDUB 2R062 4WM7B 5D8AB 1D4M2 2TBVA 3DPRB 1VBD3 3VBOA 4Q4X2 1VBC2 1RHI3 5BNOB 2ZTNA 4PDWC 5C9AB 3VBRA 2RMU3 4GH4B 5K0UB 1VB4A 1R1A1 1BBT1 1AR72 4QPGB 1NA1B 1QJY2 2R072 4RS5B 2HWE2 1EV12 1FMD1 3CJIC 4RFT0 1PGL2 4CEWC 2BBVA 1PIV3 5BNNA 1RMU3 3VBHA 3TN92 1C8M1 1MEC1 2HWD2 4EJRA 1RUC3 4N53C 5C4WA 3JBG2 2RR12 1COV1 3VBOB 4CEYB 4N43C 1VBA2 4JGYA 4GMP0 1NG0A 5BNPA 2WWSA 3FBMA 2FZ2A 1VBD2 1HRV3 1RHI2 1QJX2 1E57A 4JGZC 1HRI1 4CDWB 1R1A3 2RMU2 5BNNC 3VBHC 1K5MB 2WS92 1FMD3 1TMF2 1RUI2 5JZGB 5CFCB 1PO11
chains in the Genus database with same CATH superfamily
3ZYIB 1EAH1 1YFUA 3SISA 1WBLA 3HPNA 5FZGA 1QH7A 1AX2A 4AFCA 4JGYC 1LOEA 4M3CB 1NCRA 2DUQA 1V6IA 3FL7A 4OMDA 5HI0A 1CAXA 1FATA 3V0AA 1WGPA 3FLTA 1S4CA 3IPVA 4Q29A 1YRZA 1HB3A 1AR81 3B7MA 2FCVA 1N3PA 2ZHNA 3FHIB 5IAXA 4IEPA 3ILNA 3QBQA 5ANQA 4EWAA 5FZHA 3POGA 1UN1A 4AI1A 4OHXA 1H0BA 5EQUA 4XZUG 4RQPA 2Y8KA 1HLCA 3WD5A 3AP5A 1YXWA 4C91A 3WG1A 3GBWA 5LK5A 1Y7BA 3WF4A 1UOFA 1JH5A 4LLFA 1SCRA 3I2HA 4GJZA 1HRV2 2H6CA 4S2GA 4UW5A 4MXWB 5SV8A 4NIDA 2HBUA 4I30A 4XILA 4MGKE 1ZRFA 1ASJ1 4IGPA 3N9PA 4FCAA 4HFSA 1W3VA 5FCCA 2Q5TA 4QDSA 4EN9B 5DG1A 1VMHA 2R1DA 2GC1A 1RJ8A 2VUJA 3OG2A 4TZDA 1KQRA 4AWDA 1DGRA 2ZABA 4XXPA 4FPYA 5JSRA 4W6YA 3AFKA 5FAXA 1YQCA 1GQHA 3BB6A 4LBQB 4MVTA 3WNNA 3HWJA 1JYWA 4FO9A 1BVVA 3R05A 4LOTA 1TE1B 3VB9A 1AR83 2WWJA 2B9VA 4Q5OA 1ENQA 4LKEA 4XQ4A 3VBSB 1RUE1 3O5SA 2IXHA 5FP8A 2MNGA 1VBB1 1NA1A 1OD3A 3VDCA 2WSUA 1KDKA 3GXUA 2V5DA 3EJKA 2HEVF 3AX4A 3FE5A 4QHZA 4XQDA 3SC7X 1KEXA 5ABJC 1AHSA 4OQ9A 1OH3A 3A0NA 4SBVA 1S0EA 1GOGA 3HN3A 4QXHA 5D8AC 3ZSLA 3RNSA 1QH6A 4EROA 2JENA 2R32A 3TEZA 4PLOA 5E6HA 5F32A 3DPRC 1MS4A 1O8PA 2LUWA 4OI2A 2C0ZA 1ASJ3 2VOWA 2BFUS 2VXJA 1H2MA 4PI0A 4BQYA 2CHHA 3VKNA 3OUHA 1QHDA 5BNOC 3NVCA 5FPLA 2VZTA 5C9AC 3FMGA 3LCPA 3NRUA 4IV3B 5A33A 5FP7A 1NE4A 3VL9A 1B35B 3Q8CA 1JYNA 5GZFA 4BHPA 1NXD1 4GH4C 4CPBD 2FDGA 4K1ZA 1LHNA 4UFMA 1XOYA 3IIAA 1CPNA 1C8NA 1V0AA 1UPIA 2OUHA 2Y26A 3J8F1 4BH9A 2A6VA 5K4LA 3UGGA 3VZNA 5C7GA 4XFCA 1RUF1 1US3A 1XSRA 1Z7S1 4HN1A 4CDWA 3J7MA 1RUE3 4GD4A 1PK6B 3WP6A 1VBB3 2HYXA 3CBNA 1DU3D 1NQDA 3MHZA 3BU0A 4QKBA 3K3OA 4ASMB 4Q0VA 2WZR1 3WZ1A 4K9SA 3M8LA 4W8JA 4QQPA 3WP4A 3VUOA 4QMAA 5JZGA 5CIRA 2PAEA 4CCJA 5CFCA 5I8TA 3SH4A 1RXGA 5L7OB 4AGVA 2YPDA 4HT1T 4E8CA 3HQUA 1QKQA 4BXFA 5ANNA 1CVNA 3K4AA 4I0AA 1ALYA 4Z2AA 4UFHA 2KD7A 4CDXB 4NRMA 3ECQA 5BUVA 2G1MA 4LHLA 3A22A 3HVDA 3JQWA 2UYBA 5A70A 2JG9A 1KXGA 2A5ZA 3T09A 3ZSJA 2ZS6B 3PNAA 3SXWA 1FV3A 3OPWA 5FLIA 3GZAA 4HK8A 3AYAA 3VDBA 4S2DA 5FZAA 1EUUA 3DCQA 4N53B 3J8F3 2AREA 3AXEA 1UZWA 3JCIA 4XF4A 4Y33A 4FTSA 4I0WB 2Z79A 4K7JA 1RUF3 3J26N 1Z7S3 2VBDA 3M3QA 5C33A 1W99A 2EIGA 5FLHA 3KGLA 3LEGA 2CSGA 3BODA 2WZR3 1APNA 1VBB2 4IGQA 1RUOA 4MOAA 1ZRRA 4LIUA 4XFAA 3T0DA 4XPVA 1YFXA 4I0BA 4QM9A 5JR7B 2OKXA 5FV3A 2D6LX 2IUWA 4NUBA 1YI7A 4W50A 4QGNA 4AOCA 2YDEA 3OPTA 4LO4B 4CCKA 4YM2A 1KS4A 3UJQA 3JB8A 1RL3A 3T2OA 3PU8A 5FK8A 4HKLA 3OY8A 1ULGA 2GNDA 3ZXFA 1WCUA 4P5HA 5DZEA 4E4HA 3LSEA 3MV11 1ND3B 4CU6A 5GZEA 4LR4A 1RB8G 3SHRA 3ACIA 1CAWB 1EV11 2ZAAA 3P3PA 3HBKA 1W8OA 4H14A 2K0GA 2WIIB 4YVSC 1ZBE1 1SDWA 5LA0A 4HSLA 1NCRC 2QQPA 5GZGA 4LBJA 2BGPA 2XL7A 2ZEYA 3ZYFA 5J48A 3WG4A 3MUZ1 2DCYA 3S57A 1JHNA 1RUF2 3GGLA 4E4SA 4CUCA 2VM9A 3OUJA 1H8TC 1UWWA 2RR11 3PVNA 4Y5TA 5FXXA 4AFMA 1HN1A 3AVSA 5KBFA 5GZDA 4MLOA 5C8CA 4FPCA 1MEC2 5IVCA 4LHNA 4OQ8A 3LA2A 3DXUA 3KLSA 1TNFA 1MQTA 2Y64A 1XNTA 2X09A 3TYJA 2XPJA 5DUUA 3PUHA 5FREA 2VCBA 3D82A 1ZRDA 2JDPA 1ODNA 2VC9A 4LJHA 4LEJA 4B4PA 5IVEA 3H3UA 1T6GC 1PX4A 4MO3M 4PBOA 3RRDA 1IS5A 3VKOA 2HKXA 1EV13 2WN3A 2FDHA 1SLIA 3ON7A 3KQ4B 4K8FA 4P9XA 1ZBE3 2D7FA 5JXGA 5A6XA 4Z92B 4AW7A 2OQ7A 3ZSMA 2GU9A 4KL1A 2BWAA 1IPJA 4AFBA 1W2UA 2Q1MA 4I09A 4CXWA 4N9IA 5I91A 2RM21 3CL1A 3FZ3A 4GWNA 1PO12 1UYXA 2YV8A 2RR13 3UGFA 4RN5A 3WQ1A 4P9YA 1PM7A 2GNMA 4QQOA 4BQ2A 2PXJA 1QDCA 5FY8A 4KQ7A 4IV1A 1BMV1 4TTGA 1NUKA 1DBNA 2WLPA 3JD71 4BQ1A 1PNGA 1VBE3 3IT8A 1OOPA 3MEPA 4D6QA 2CNAA 3LPFA 1D0GA 3ZFEA 1IGOA 1UX7A 2RJLA 4L0PA 2ADDA 1XNAA 2CGPA 2XWJB 3N7MA 4QX5A 4DOUA 5A3MA 4FP3A 3USUA 3VL8A 1NXMA 3E5QA 3HT1A 4MG2A 1SMVA 2EAAA 1ENRA 2WBKA 3NSTA 4DZGA 4PT6A 4M4PA 1H2KA 4AFDA 4PF1A 4MYEA 4WBBA 2JKBA 4P9GA 2NQYA 1Q8QA 3RZLA 5A3OA 1W9SA 5JXJA 3OUIA 4YARA 2NYYA 5APAA 1R092 3DXTA 1JXNA 1RUJ1 4PIZA 1OD5A 3LIGA 2Y0IA 3AP4A 2JDAA 2NZ9A 3TEXA 2JG8A 1AL0G 1ZBE2 1NZCA 3ABZA 5C70A 2ZGTA 3CJIB 4Q2FA 3THTA 3B01A 4PIXA 4I3PA 3M4FA 3AKTA 3VBFC 2RM23 2W2IA 2XMLA 5FMOS 1IZ3A 5G05L 2I74A 5IFPA 3ASIA 3H3LA 3M2MA 4S2HA 1Z78A 5DQ0A 4YGCA 3UV9A 5JWPA 1C5IA 3JD73 3KV4A 3RG0A 1RINA 5KHKA 4BQXA 3KB5A 5CFCC 1VAMA 2JD9A 1W6OA 3F2ZA 2WYFA 1VBE2 3MGUA 1GOHA 4XFFA 5CFDA 2I2SA 1O6UA 4IDZA 5B4NA 4XFGA 2HEYF 4YW1A 5L9VA 3FWEA 5JOWA 1F15A 2WJSA 1XJAA 4UT5A 1XPWA 3LGRA 3ZFGA 2ZMKA 4DY3A 5IFTA 4PBPA 2JG9C 4HMZA 4COUA 2Y6GA 4I02A 4URTA 3WT3A 1RUJ3 4KNCA 3DYMA 4AEMA 3HD8B 2G9FA 1ODMA 1WCSA 4XJ8A 3D0SA 2Y34A 3DECA 3NKGA 4OMCA 3RPQA 5IUQA 1FI2A 4IEZA 1YCIA 2FCTA 1F2NA 1YLLA 4Z07A 5LBFA 1G8WA 2OUJA 2R042 1XNKA 2ZGLA 5LBBA 3SEPA 4FPKA 5FJKA 1ZZ9A 5DAWA 2BQPA 3ZSEA 3WDVA 2XBO1 2RM22 1VIWB 1JW6A 4YG3A 3V56A 4INDA 2CGNA 1W2NA 4XXAA 4AVVA 4NPRA 3AMNA 4YW3A 1SFYA 1JZ3A 5I0TA 3JBG1 4C0BA 5EHDA 2VZPA 2WUHA 2AC1A 3ILRA 1V6MA 4QPIC 5FZDA 3WHUA 1KRIA 1GNYA 4AFAA 2VCMA 2XR4A 4AVCA 1MS5A 1S0FA 4YZ3A 1RUH2 3WW1A 3MUY1 1X36A 2LROA 4TSVA 3VKLA 4A45A 3TEYA 1A8DA 1OF3A 3LDBA 4EWDA 4OVEA 1YYNA 4AE2A 4YGEA 4DB5A 2QQUA 3H8XA 4I3GA 1LHVA 3NJZA 1X7NA 2Q8CA 1PO22 2HEWF 4XF9A 1CAXB 1WA4A 2ZEWA 3V0AB 1BCXA 2J22A 2YY1A 3IPVB 2I45A 4A44A 3RWKX 3ZYBA 5JXIA 1L7LA 3N7KA 2X05A 4BMBA 1CR7A 4CDQC 2Q4SA 2IXJA 2XBO3 4X8PA 1Q8OA 4JRAA 1UYZA 1XSQA 2LS6A 4P5YA 3KQRA 5FXZA 2MEV2 5LB6A 1U5IA 4CUBA 5FFOC 1AJOA 1N1TA 1X8MA 4ZXKA 2ARBA 4RQPB 2HYKA 4XBLA 1V6KA 1PIV1 5J09A 2XJVA 1AR62 1LOBA 2XQRA 2VMDA 3JBG3 3VZOA 2ZGUA 2WO7A 2VAUA 4MGZE 3UKTA 4Q8KA 1BKZA 2IZWA 2Q8DA 2Y60A 3FUOA 4LPLA 4CDUB 1SG3A 1DIWA 4U36A 2R062 3WHTA 1HQLA 5B2GB 5LEKA 1JU3A 2B39A 2XGXA 3LF7A 1NAEA 1CJPA 4ZPIA 3N9QA 3RFRA 1GNHA 3H8OA 2XUEA 1GANA 1CPMA 5LASA 3LFIA 2NP0A 3W58A 3ST7A 1OKQA 2WAOA 1QOOA 2Q30A 4PDWC 2WFPA 5DMYA 2P37A 5CBLA 4MGSA 2DYCA 1I5ZA 1QNYA 2WQ8A 3DL3A 5E89A 4K20A 5FMBA 3VHRA 3M7AA 3VN4A 1OSGA 2K46A 1DQ2A 1BBT1 1R1A1 3CO2A 4O65A 5FP9A 4XFHA 3O1MA 1NA1B 1H1AA 3KCYA 4IEUA 3FX3A 3BIWE 5FMDA 4CP2A 3WOGA 1FMD1 3BU7A 4ZXEA 4AZZA 4RFT0 3AJZA 1PGL2 2R0HA 1DFQA 1LHUA 1PIV3 2JDHA 2B45X 3CDZB 5FPVA 3KZ4C 5BNNA 4A6OA 2JECA 5A6ZA 4MZUA 3VBHA 3EB7A 5LRSA 5C5UA 3L9JT 4Q8LA 2DFCA 4XC9A 5JMOA 2OS2A 3JBG2 2QQOA 3ZYJB 5BY5A 5C71A 1A34A 1CAVA 3OBRA 4XCAA 4DEQA 4N8MA 3UK9A 4F83A 4XUTA 3VHNA 4JGYA 2SBAA 1OF4A 1LOAA 1UYPA 5KC6A 2BBAA 1DLCA 5EZWA 5GALA 4NHYA 5T3NA 4IEVA 4E27A 3I3EA 4NAOA 4V2WA 1XU2A 5J37A 3I2DA 3EMRA 4XAEA 1XNDA 2RDQA 3MIHA 5IVYA 2VOTA 4QX0A 1JZ7A 5LBCA 2A6YA 2JG8C 5DG2A 5G04L 3ZN5A 4JV4A 4CDWB 3ACFA 1R1A3 5IJRA 5F2WA 1GICA 1GWKA 1DQ4A 1FMD3 3WNMA 3RGBA 1RUI2 2QJVA 4IQPA 5JZGB 5DAXA 5C5TA 5CFCB 1IOAA 5JI7A 4LMFA 1MZ5A 4KG8A 5T54A 1GP4A 2RDRA 3MI8A 3ZIWA 1XE0A 4JKMA 5HV0A 4TN7A 3SEEA 1AUYA 4AVAA 2Z4FA 4W65A 5JMCA 5GLUA 2W3JA 1LU1A 4JKLA 1LCLA 1RGSA 4MHUA 3AKPA 2VNGA 2RS31 5FZMA 1LECA 3RSJA 5CFDC 2LW8A 2A73B 2JG9B 4FOVA 3ZYGA 4Q0SA 3HJRA 1W8HA 5FYHA 3M3EA 2XJQA 4OHZA 3ZFGC 1N47A 3EHKA 1CX1A 4NIGA 5EFUA 4ZZ5A 1W6PB 1CIWA 1SBFA 2WT1A 4W4ZA 1BK0A 3CEWA 4QDQA 1JOJA 2JB4A 4HKOA 3J4UH 1X9PA 2D44A 2GN7A 1AYM1 2DBIA 4O9GA 4FOQA 1FV2A 3GNEA 1XYNA 3IAQA 5ABJA 2EXKA 4ZU5A 1MS0A 1U5XA 1XE8A 2PAMA 2ZGQA 1QJU3 5D8AA 1PVC3 2ZGPA 4D7YA 4ZU7A 5JXHA 2XXZA 3POEA 3DUIA 1FMD2 1KJRA 2VZVA 3DPRA 1ULPA 1I9RA 5I8YA 2QBXA 5FP4A 4DRVA 1H8VA 2W9XA 3KT7A 3N7JA 4M4RA 1GMMA 4AQSA 5C9AA 1DQ6A 3K3NA 2E9QA 4RR3B 4FOYA 4BM8A 2RS33 2W1UA 3GJAA 2RVAA 3SNMA 1W6NA 1UW8A 1O8SA 3F95A 1WZXA 2BYVE 3LB9A 5L19A 3P6BA 2ZXQA 3VBUA 1AF9A 1BHGA 3IAPA 3N36A 5KXCA 2BNMA 4Z8BA 4QXKA 1OPOA 1IPKA 4K21A 2VVEA 1AR91 2XVKA 3WP5A 3RZGA 3BCWA 4C1XA 3EQEA 1AYM3 4WZFA 3PURA 1AVBA 3K48A 4MSVA 1ZNPA 2A70A 4XHXA 5HV4A 4IE0A 4JZRA 1XC6A 4NROA 2CWSA 3VD5A 1O3RA 1HXS2 4ONUA 4B1MA 3OPZA 4GWJA 2VZ3A 5A80A 1Q3EA 2QQLA 2VTXJ 5JIAA 5C8CB 1S2BA 1VAKA 3RVHA 4Y22A 1QJU2 5K0UC 1PVC2 5CISA 4GMP3 5FZ0A 1MQTB 2VPVA 1W9WA 5FY0A 3ZX7A 2WN2A 1IS3A 3TAYA 2OPWA 1LU2A 4UFIA 4LK6A 3L2YA 5A3WA 1F8VA 4GA9A 1FPN1 3SLIA 5F1RA 2Q1FA 5FY9A 5DDJ1 5KHHA 3U14A 2XB6C 3IZOA 2EA7A 1ULDA 2JEMA 3CLPA 4LLOA 5FRAA 2OQ6A 3TEWA 2PFWA 2VTFA 2GC0A 2JJ6A 2VW1A 2YC2A 2AYHA 1VRH2 2VJXA 4NMIA 4B4RA 1QMJA 3LD8A 4LKDA 1CX4A 1O5UA 1NX9A 1UQXA 3VHOA 4RFRB 1AR93 4F7ZA 1J1TA 2Y6KA 2A1XA 3JXSA 4OUEA 2F4PA 4P9JA 3ZFFA 1REDA 3ZMOA 1QJZA 3U4SA 3PU3A 2YBKA 3BTXA 2B9UA 5FZEA 1YQ5A 2DURA 4C1WA 2UY8A 2VNRA 5F3IA 2ZKNA 4E4ZA 3MICA 1NQJA 2F4LA 3NNJA 4Y3OA 2ZGSA 3RQ0A 5FPAA 2DFBA 3ZIXA 3ELNA 1OLRA 1ZBA1 3WW2A 1V6OA 3VDAA 1SDDB 2RJ2A 4IV1B 3OCPA 1QWRA 3R4DB 1OOPB 2P1BA 3POBA 5IHRA 1RJ7A 4MXVA 4Q26A 3ZFEB 1K5MC 1WCKA 1JYVA 4O7XA 1FPN3 4Y1XA 3USSA 4BA6A 3USUB 4QT6A 3JB4C 5DDJ3 1QQP1 1UMHA 1V9U1 3ES4A 3U07A 1LHWA 4QXBA 1DZQA 2PELA 4B3NA 1Q8SA 4PCRA 2WABA 4A6SA 4YVSA 1W28A 1Q56A 1XNCA 2E63A 4OUMA 2OYZA 3U0ZA 3IBMA 3OTFA 4WM8B 2X29A 1REFA 2KM2A 1VPHA 3ZOIA 2E7AA 1HB1A 5F3EA 4IEOA 3NAPC 3WX5A 3D0JA 1AR92 1QXPA 2C26A 4IXLA 4CRQA 1H8TA 1NCQC 4JCKA 3ZM8A 1DCSA 1O5LA 3V0BA 1SZBA 4WVMA 2YUEA 4OCTA 4BXSV 1E5SA 4PF5A 4CU7A 3RS6A 3AZVA 4MGQA 1A8MA 3PUSA 3ZR6A 1ZBA3 3AKRA 3N9LA 4N90A 2XKOA 5J3UA 5JCTA 2CV6A 5FUPA 4E2SA 1IG3A 3OBZA 5FK7A 1JZ8A 1W6OB 4M3CF 5I0UA 5FKCA 3SKVA 4B8EA 2Z69A 4Y20A 4CXXA 1XB9A 3IWZA 1GP6A 3TWIA 3W21A 1QQP3 1M06G 1V9U3 2EF6A 3APBA 3WR0A 2J1AA 2XJTA 1EAH3 4QQ2A 2IXKA 2BPA2 4QB6A 1K42A 3ZFGB 5FZ1A 5JSOA 3KV9A 4KWJA 1YQ8A 2ZAHA 4XF1A 3CJXA 3MIDA 1O4ZA 1VR3A 5FY4A 1OLME 2P6HA 4WVWA 3BUCA 4IGOA 4LUKA 5JI9A 2FDJA 1J84A 2GC3A 4XW3A 2ZZJA 4XMIA 3I49A 2Q1ZB 5F3CA 3IIIA 2P5BA 3O1TA 4A7KA 5F37A 1NLQA 2DVDA 4XUOA 2VNOA 3SKJE 4HN0A 3T1MA 1WLDA 3W9AA 1O4YA 3OGGA 2DWRA 5FPUA 3VDDC 1JZ2A 1QJX1 5IWFA 3MO4A 2D6OX 1J1LA 3T4HB 4Q4Y1 2VOKA 2QVSB 1WW6A 2W1WA 5H9RA 2D6PA 4DNYA 3U1XA 2WS91 2JICA 2PHXA 4OYUA 2D40A 4XVHA 1TMF1 2C4XA 2RHPA 4QWNA 3WDTA 4JHZA 1ND2B 4RD7A 1GKBA 1C4RA 2QQVA 4V2VA 4D7SA 4RHV1 4YM1A 3VKFC 1RUD1 4KBZA 4ARXA 5D1IA 3OBTA 4H55A 1GQPA 1QQP2 1JUIA 1NYWA 2BVBA 5HXMA 1EAH2 3U11A 1OURA 1REEA 3NNGA 4GZ9A 4CEWA 1J59A 1UY0A 3VBUC 4ORFA 2OPKA 2W39A 3QACA 3VBFA 4JTNA 2X5IC 2WRAA 2ARAA 2P6CA 3I3DA 3H7YA 4XAAA 3RZMA 2W87A 4AEJA 5BNQA 2I07B 1AR82 1PZ8A 5JDBA 1JOPA 2UWAA 3WQBA 1R081 1LESA 2PLV1 4K3UA 4NWVA 1QJX3 4D8MA 4N43A 4AF9A 2D3SA 2QE3A 3NJXA 1HB4A 3NNLA 1DGLA 4Q4Y3 3VGIA 2XJPA 3NMBA 1G9FA 3RZHA 1YIFA 2WS93 5J7MA 1TMF3 2KXLA 3KM5A 4YZ2A 5A1LA 1EPZA 3H1YA 2H0VA 1O3SA 1SPPA 2XQXA 3MBWA 4RHV3 4YW2A 2UYAA 5LBEA 3T3YA 3M1HA 4S2FA 1RUD3 3WW3A 2XL9A 1ASJ2 4LBMA 1DG6A 5C3OA 2EALA 4RGKA 3K4ZA 4Y26A 1S0BA 4LKSA 1PHMA 4JDMA 4XFBA 2W1QA 4L97A 3A4UA 4PQ9A 5H9SA 3ZXDA 1UX6A 5A6YA 2C1FA 1OQDA 1URXA 1XBFA 2G4IA 1POV1 2KR2A 5HCHA 4Y1VA 1MS3A 2VMGA 2ARCA 3U75A 1LNSA 1S0GA 3A21A 3ZFFC 4FSJA 4KU8A 3KV5A 4FI9A 1R083 1YJLA 2PLV3 5CEHA 1RUE2 1JS9A 2WYSA 1C1LA 4HETA 4IL7A 3RZZA 2QQJA 5K7PA 3WNXA 4XF0A 2IFRA 1V6LA 2W0XA 4XUNA 2NM1A 4Q4Y2 1DHKB 3SQOA 4AHZA 1TG7A 5E16A 2VVDA 2JDNA 4JGZB 4QPIA 4TWTA 5FWEA 3VBUB 1ZREA 1MS9A 4XACA 5SV5A 3NWKA 3Q8EA 5BNNB 3OYWA 4FTEA 2XOMA 3EXUA 2GH2A 2CDOA 3VBHB 2NN8A 5HCAA 4M3CE 1OXCA 1JI6A 3NV2A 3RJ2X 2VXRA 2VCCA 1J3RA 2XKPA 3S6PA 3QLQA 4XUQA 1MPXA 1W9FA 2ZHMA 5JIUA 4EZHA 2EXJA 5AC91 4JGYB 4JVAA 1LOFC 2CYFA 3ZKYA 2A75A 1O7FA 1DYOA 1LENA 2ZX4A 3PVEA 3MLLA 3AP9A 1AL21 4L8QA 4CXYA 1YWKA 4XJUA 1CWPA 2E7QA 2VY0A 2VOVA 4LHSA 3J8F2 4R9AA 4CDQA 2DF7A 2DTYA 3NW4A 4PJYA 3WY6A 1RIRA 4TLFA 4JC1A 4D0QA 1LB2A 2XVLA 1Z7S2 2ARXA 1JYCA 1ENXA 1MS8A 2P4EA 4JDNA 3CHXA 2J7MA 5LA9A 5T5OA 2V5YA 2WZR2 2YROA 3D8CA 2WA3A 5I0RA 5JPNB 4LOSA 3LSDA 2QQWA 4XBQA 3QD6A 3TOJA 3WNOA 4AI9A 3ZYHA 2WL1A 3HN1A 2VCAA 5FQ0A 1TQ5A 5LRRA 5I93A 5HPOA 4DO0A 1RITA 1UOGA 4WM7A 3HEIA 2Y6LA 3POJA 1RHI1 4JQTA 1GYKA 4C8DA 1V6NA 3GZUC 2D3RA 3DN7A 2IVIB 3O1OA 4D6RA 4URAA 2ZEXA 3URFA 5AC93 3AP6A 4KMQA 5EYXA 3I2GA 2K2SA 3AZYA 1FT9A 3VZKA 1S2EA 1AL23 2XJUA 3QH7A 1WW4A 5J36A 4PDWA 3UESA 3PJYA 2QCSB 4XQWA 3LOBA 1IS6A 2VZOA 3ETPA 4YVWC 5FUIA 1RMU1 4AEDA 4COZA 3LEIA 5FZOA 3POIA 3HNBM 3RWNA 1RUC1 4W6XA 5ABJB 1JYIA 2VBPA 4GAZA 1D2SA 2VNVA 5D8AB 3THCA 4DY5A 3I59A 4U2AA 5FYZA 4KI5M 5JUVA 2WZEA 4BDVB 1QOTA 2CDPA 3DPRB 3V65A 2W68A 1NT0A 4XEZA 2XJSA 3ZN6A 3VBOA 2H6BA 1RHI3 4EQVA 2YFUA 5BNOB 3PJQA 1G9CA 1J58A 4DUWA 5C9AB 1UZVA 5FZ9A 1DQ5A 3VBRA 1WMFA 3I2OA 2A6WA 4GH4B 4A4AA 2V09A 1OQEA 2C24A 2ZOEB 4R9CA 3E5XA 1GZ9A 1Y9MA 1L3JA 3Q8FA 1EV12 1ULOA 3KCCA 4H3WA 3M3CA 3OEAA 1LRHA 4CCEA 4DQAA 1JZ4A 2VMHA 3E6DA 4GKYA 4CEWC 2HH9A 4XUPA 2BBVA 4G3YC 2RE9A 3TB0A 5C3QA 1RMU3 1W8WA 2B7YA 3WEZA 5IK7A 2CU5A 2VZUA 1C8M1 3DF0A 5A7OA 3BIEA 2JIGA 2QQKA 1RUC3 4HXCA 4O61A 4A3XA 2PQSA 2J1EA 1N1YA 1ZZBA 2RR12 1VLNA 1COV1 4HK9A 4M00A 4N43C 4BIOA 1C3HA 4I2OA 4GMP0 3NL1A 3OSDA 1SLLA 2WWUA 4YZ4A 1VMJA 4NPMA 4ET7A 5I8SA 1NG0A 5BNPA 3H3ZA 2WWSA 5F5IA 3ZYRA 4IE6A 4YSFA 2VVFA 5CYYA 2ZHLA 3LWCA 1SCSA 4QQLA 2O8QA 2BW8A 3POWA 4E8DA 5A6QA 1RHI2 5EIYB 2RG4A 2F17A 1O91A 4QM8A 1E57A 1NLSA 4P14A 2P3IA 1HRI1 4AI2A 1VMFA 5FZKA 3A7QA 3OJBA 3Q9OA 4ZONA 1I6XA 2Y6HA 2X10A 3WDUA 1KJLA 2DVAA 4XBNA 4R9DA 2WNEA 4META 2V4VA 4Y1YA 3PHMA 3BTZA 2GZWA 3IDEA 3KCXA 3WSOA 3ZFFB 3AKQA 1OA4A 3I8TA 3JZVA 4QGMA 4BQ3A 5JOYA 1UPSA 1C8M3 2ZX1A 3LDRA 1FYUA 2JIJA 3CZUA 3PDQA 3WF2A 1PMHX 2PHLA 3WDWA 3U4XA 1VALA 3THPA 1COV3 4RA0A 3PUIA 3MLJA 4PLNA 1KGYA 4ARYA 4LBQA 3B9CA 4GIQA 1BMV2 3T30A 3FBYA 3JD72 2Z5WA 3ZVXA 1AYN1 1PGW1 2XHKA 4WVZA 3NJVA 1W6QA 1SBEA 3K4DA 1LEMA 1U5ZA 4IE4A 5CVRA 5FZIA 2BRTA 2VR4A 4ASKA 3PVOA 4P9LA 2Y38A 2GC2A 3DV8A 4FVVA 1FOD1 5D2AA 1BJQA 4AG4A 5CG8A 4NOTA 5KR7A 3J9SA 2E53A 1HRI3 2OZJA 3I7DA 3K2OA 3LQCA 2YBSA 4OHYA 3IDCB 4YVSB 1OBNA 2ZJCA 4QAWA 1YO8A 5AFBA 3HQXA 1RUJ2 1NCRB 1TME1 1ENSA 4BLIA 2CAUA 2OT7A 4QB2A 3HR9A 4M01A 1EPWA 4K1YA 5DPNA 4OLLA 1YI9A 4D94A 4CSWA 2G9GA 2A3WA 3MFCA 4FPHA 1UY1A 1OPMA 1E5IA 3WG3A 4IV3A 1H8TB 5GLZA 3LA7A 4OZXA 3V0BB 4WVMB 4QHBA 1PX3A 1H2NA 2FDIA 1DGWX 5K0UA 5FOJB 2VMFA 4X6RB 2C6SA 2YC0A 4QPWA 4LULA 4A42A 3UKNA 3H9AA 3C8XA 4QDRA 5TSWA 1AYN3 2L9LA 3AC0A 1SBDA 2GNTA 4LUMA 4AAPA 1GNZA 2EIEA 3ACGA 2HWB1 1RTVA 2RS11 2E26A 3AB0A 3MW2A 5FYUA 1FOD3 4Y20B 5D21A 4WM7C 4HG6B 3ZPYA 4COWA 3GJBA 2AGSA 1QXRA 5E88A 1LAJA 1ZRIA 4LORA 3PUAA 4K8RB 2XJRA 3M3IA 3RYRA 5L7OA 1HRI2 2QNKA 2D3PA 4FPGA 1FNZA 4NE9A 4PQQA 5DABA 3B5LB 1TME3 3PLQA 4LT5A 2PTMA 3BPZA 3E97A 4J25A 4BB3A 4IW3A 3NNMA 3W59A 4CP9A 5LZ6A 1YQ6A 3B3QE 1S2KA 1UCXA 2QZ2A 4DXZA 5HXVA 5BPXA 4NO4A 3ZN4A 2RJKA 1UYYA 2ZMNA 1VP6A 1LOGA 2HWF1 3AKSA 3EYPA 4KG0A 4QPGC 2YMZA 4XABA 4UFKA 4RS5C 3RMXA 4QXCA 4AEDC 3AXDA 4KWKA 3AYDA 4YLZA 5T50A 1F4HA 1GZCA 3JQXA 4BOWA 4QPYA 4V1PA 3PTRB 4Z82A 2XBO2 1G9AA 4Q4V1 4UAPA 1L7RA 3FUQA 1IS4A 1E5RA 5FY5A 2TUNA 5LY2A 4IUGA 1N3OA 1K5MA 3KS7A 2YGMA 5EYYA 1A6CA 2VW0A 2HWB3 2P3JA 2RS13 1H9PA 5FXWA 3WDXA 1AYN2 1PGW2 1AJKA 4QB1A 1YEWA 1RVF1 2ZACA 3VBOC 4ASLA 4DMIA 4Y1UA 5FZFA 4MV2A 1IPSA 1ONAA 1X8EA 5A33B 2R7EB 2WINB 1R64A 2G9ZA 4GULA 3VBRC 4D3WA 3AL6A 1XYOA 5L9RA 1JZ6A 4BQ4A 5IYYA 1S0IA 5CKQA 2SLIA 3ITQA 3NAPA 3T0BA 3K77A 4EYUA 5FO9B 4CEWB 1GZWA 5EJ1B 4DXSA 1NCQA 2YZ4A 3T4VA 2C9AA 1TNRA 4R4ZA 3VBFB 3DYPA 1J83A 2HWF3 5FXVA 4XIOA 5CU1A 1BBT3 5J1XA 4NWWA 1ND3A 2J1RA 2R30A 3ZDVA 2CAVA 2WNUC 1OI6A 2IXCA 3AMPA 1MVQA 1OFSA 4Q4V3 5FUNA 3D5OA 4JX0A 5HCBA 5JVVA 1Q8PA 2VU9A 2VMEA 1UXZA 3H8UA 1UIKA 2OA2A 3JUUA 1PIV2 3OOXA 4IEQA 1SLAA 1TZOA 4Y5SA 3J7NA 5A32A 3H8RA 4Q0QA 1UZ0A 2QDNA 4B7KA 2AACA 2Z42A 4Z2WA 2P34A 1RVF3 1SPPB 3M70A 2GAUA 1O3QA 2MHFA 2HWB2 3KHCA 3BOWA 1HQNA 1LODA 4BZ4A 1JUHA 1MZFA 3HIFA 3I2FA 2Q8EA 4BQ5A 4YFZA 1S55A 4HANA 1C57A 3FN9A 3B02A 5T5PA 4FP2A 2YU1A 4B4QA 4DRRA 2BOIA 1NY71 5EV7A 3WQ0A 1QY4A 1IQAA 2XONA 4OFGA 3DGTA 2E6VA 3TNPB 4NHMA 4YW7A 1QJY1 1QEXA 2ENRA 4FFFA 2YU2A 3N9NA 4JQRA 2P3KA 1LGBA 1NZIA 2JB8A 3VDDA 2DVBA 4UI9L 2YFZA 1FXZA 2HWF2 2VZSA 4HVQA 1R1A2 1BBT2 1VRBA 3VD7A 3ZYPA 1PVXA 5T5LA 1B09A 4CCMA 2VZQA 2O1QA 4NPLA 1ZA4A 1VE0A 4Q27A 4ZU4A 5LK7B 4OI4A 4B7EA 2GMEA 5EWSA 3VD4A 3FHQA 4Q4V2 3DKQA 3CQOA 1HKDA 3UNPA 5IAVA 4QPIB 4DUXA 2V72A 3RYKA 3K46A 5DN2A 5FYSA 1VBA1 3AMQA 3OYWB 5DXDA 3LOIA 3MFAA 3OY8B 2A3YA 4XYXA 4AI8A 3VBSC 4Q0UA 4RL7A 1RXFA 3E6BA 3N4MA 3N35A 3DEMA 4XF3A 4J1XA 1V6JA 1PNFA 1CAUA 2XG3A 3E1F1 3O12A 4XDOA 3AM2A 5A7WA 4DS0A 1ZYBA 2X5IA 1POQA 4HSJA 4UFLA 5FO7B 5T55A 2P2KA 1QJY3 4Y1ZA 4FXKB 2VZ1A 2CWMA 4Y4RA 2VULA 4FAGA 4OZOA 2BNNA 2D98A 1CN1A 4P9IA 4QX2A 5F8PA 4CDQB 5E1RA 4CU8A 3OGSA 4HOOA 2WKKA 2D6NA 4LKFA 4BWOA 2VH9A 3O1VA 4IV3C 3ROUA 1KDMA 1B35C 2O8OA 1W6MA 3FFQA 2HBTA 3OEBA 4IE5A 4MX3A 4MADA 2B46X 2TNFA 2FQPA 5FQ0B 2JDKA 3LAGA 2Y6FA 4UFJA 2VUCA 3ZXAC 1VBA3 3ZXJA 2JDZA 2WNVA 3TNQA 5F3GA 1OH4A 4L99A 5FOBB 3GDBA 3CMGA 3WG2A 1WLWA 4ISQA 1HX6A 1PK6C 2LM3A 2J1SA 3X29B 1ZZ8A 1JOBA 2RS32 3P3NA 3UL2A 4XDPA 3H50A 2D6MA 4AVTA 1LTEA 2ZHKA 1BEV1 4Y5Z0 1SQ4A 2PYTA 1SFNA 3LEKA 3HNYM 1UMIA 1HRV1 5L7OC 3WNLA 4E9KA 4PDWB 2EICA 4YG6A 4ES9A 4NHXA 1NY72 1BYHA 1UY3A 4GWMA 1IG0A 1YJKA 2DDUA 3MDPA 2VG9A 1WUVA 5IATA 4CDXC 2ES3A 3ACLA 1W9TA 3H0OA 4IEXA 3H7JA 3WW4A 4AEDB 1AYM2 2BFUL 2QKDA 5FZOB 1X9TA 4LA2A 2W46A 4YW5A 2YG0A 1AXKA 4WVVA 4XJZA 3KHBA 3LA3A 4CTEA 2BJSA 2VMIA 3ACHA 3VZMA 3I59B 1GSLA 4RGGA 1H30A 4XJ9A 1FX5A 4C90A 1UAIA 3O0VA 3ZN6B 1RUG1 5ISLA 3IB3A 1JYXA 5IK8A 2JDMA 4BJ0A 5FPBA 4A7YA 1OMIA 2QDRA 4YG0A 5C3PA 1LOFA 5F5AA 4A3ZA 1QJFA 4LTAA 1GV9A 2RS51 5FZ3A 3VBRB 2UURA 2E7TA 1NE6A 4EN6B 4AHWA 1R1ZA 3KWVA 1BEV3 1WCDJ 1GOFA 2BUKA 3BN6A 4G4FA 4BISA 4UYBA 1DQ0A 4AR2A 1ST8A 4ZZ8A 4DFSA 2JG8B 4LE4A 2AEYA 1BXHA 3MIBA 3OGVA 4N7IA 5JLVA 4Q4X1 5C3SA 2GP5A 2OZ6A 1K5JA 5FTTC 5E8AA 3Q8AA 2LALA 4AGGA 5I0DA 4QU1A 5FZ4A 3I2JA 1QXJA 3T08A 2E51A 2JD4A 4AXOA 2DCKA 1ND3C 3J7LA 3I3QA 5FYVA 2IXIA 3MW4A 3UKVA 2FCUA 1AR71 2WO3A 3WNPA 3LKJA 2NPIA 1GWLA 1Q43A 2H0BA 1QDOA 2R071 2ZCWA 4E2GA 1GQGA 5A3TA 4YPJA 1MZEA 1UOJA 1MACA 1P8JA 3MLKA 3R4SA 4ISRA 4LBOA 4NIAA 5BNPB 1LKNA 5LW9A 1RUG3 2BOJA 3MV01 1HQWA 1HDKA 5CFDB 4EZ4A 3GHMA 1GUIA 4UW6A 3WLUA 4Z1VA 3N9MA 4EN7B 5CZKA 3QOPA 1FPN2 1HV1A 2HWD1 2RS53 4FPFA 4EE2A 5DDJ2 3W20A 4LO8A 1UY2A 3J7HA 2YC4A 5KHIA 3RZJA 1O4TA 3LPGA 3PL0A 4AQ6A 4YVWA 1BEV2 2Y33A 4AEKA 1ULEA 1EY2A 3AL5A 3WF3A 1OKOA 2BNOA 1UU4A 5DZGA 4Q4X3 3VZJA 2UY9A 5EPAA 3E6CC 3HQRA 3PMEA 1AX0A 4HPKA 3WNKA 4CDUA 2ZZQA 3H1WA 1OFNA 2HLEA 1SFPA 4P02B 5DAQA 3ZLIA 5T5JA 3ZXGA 3WVJA 3NO8A 1AR73 2RMU1 4TLGA 1ZBA2 1N1SA 4GALA 1ZRCA 2R073 3ZMNA 4KWUA 3HMYA 4CCCA 1G9DA 3O1SA 1CJDA 1G9BA 2FZ1A 4H7MA 4FTBA 3WCRA 1NOVA 2TEPA 1OT5A 4FAHA 1GFF2 1V00A 3BI3A 4FPJA 4HVOA 1W6QB 4RYDA 4W6WA 5FZ8A 5CKNA 1UMZA 5FWJA 4UOJA 4LE3A 4ZKTB 2W5FA 3VLBB 1RUG2 2BEOA 2HWD3 3GCWA 3WUDA 4ES8A 5DZFA 1LR5A 1JHJA 1V9U2 3SCFA 5A7NA 5J96B 2P17A 2RS52 2MPFA 4AI3A 4KWLA 3KVBA 1JTZX 5B4XA 3NV1A 3WP3A 4D69A 1YC61 3AZZA 5DUVA 4YW6A 5HCFA 1JU4A 1I5PA 2AH2A 2ZBJA 4R8HA 4JDOA 3OD4A 1F5JA 1SHWB 1STMA 2R1BA 3PIGA 1KFXL 3GALA 5F2SA 3H1MA 4Q4X2 4UXAA 3VD9A 2A71A 1LEDA 2B8MA 2EIDA 4QKNA 4YM3A 5LATA 3O7OA 4DIQA 4MUVA 5DAPA 4YZ5A 2RMU3 5BNPC 3E5UA 5KXEA 1JN2P 5A7QA 5K0UB 2F6BA 4CP0A 1AR72 1WLCA 3V64A 5IK5A 2R072 1MR5A 5C6CA 2BGOA 5H9QA 3CJIC 3OD0A 3U78A 5KHGA 2WNVC 4L9BA 4XJAA 4FFGA 2W08A 2ZGNA 4A2UA 2VOXA 4XE9A 1WW7A 1DLLA 1MEC1 2HWD2 5A7SA 4H2AA 4F3JA 1T2XA 2Q8OA 1UZZA 1UOBA 5DUWA 5C4WA 4RSUA 3WV6A 4EN8B 2PHDA 1G7YA 3RI8A 2XDVA 1QF3A 2AUYA 4B1LA 4CUAA 3D3AA 5IVBA 1UY4A 5GM0A 4BPZA 5F7UA 3I97A 5F39A 2ZKLA 2ERFA 3AMMA 4CP9B 4OUSA 4LBNA 1L7QA 2RDSA 1UO9A 3MIGA 4GKXA 4CUGA 1D4VB 3FBMA 1SLCA 5BXXA 3ZXKA 3U10A 1VAVA 2JE7A 1T6BX 1C5HA 1QJX2 2J1UA 4CPBA 3KMHA 2RV9A 2YGLA 2IWGB 2X8KA 1H6YA 1PMIA 1BVP1 1CZVA 1W6PA 3O1RA 2RMU2 4HBNA 4NHLA 2ET1A 2VQAA 1K5MB 3O14A 3ZSKA 2JDYA 2WS92 4P9WA 5GLVA 1TMF2 5LY1A 3KT1A 4MH0E 5IVVA 3CZJA 3O1PA 4FFHA 1OLMA 3ETQA 2AEZA 1PO11 1G86A 1WW5A 2OXBA 1LGNA 2UWBA 2WR9A 3AP7A 4RHV2 1IKPA 1CAVB 3ALQA 4YGBA 1RUD2 3KT4A 1MEC3 4IESA 5FMOL 4QX7A 3S5QA 1XQNA 4FOWA 2A6XA 2Q0AA 3W5NA 2VUAA 1JODA 1POV3 3RZKA 2DUOA 1YQ2A 3C3VA 2DCZA 3NAPB 4LIVA 1NKGA 5CA6A 1H9WA 1GZWB 4RR3A 1XRUA 1NCQB 5FYYA 3UYJA 2GP3A 1ZM1A 2AZ5A 3SH5A 1ACCA 3I4IA 4NN0A 1WKYA 4XZPA 5IT6A 3NJYA 4AI0A 1R091 4QHOA 5T52A 4EWEA 1CZSA 1R082 2PLV2 1PGSA 4BK4A 2WA4A 1YFWA 1KITA 5A3LA 5AFEA 2NMNA 5FJHA 2K9ZA 4HVRA 4X8NA 2LRPA 1AXYA 1YFYA 2D5FA 4COVA 4LA3A 3NNFA 5A32B 1PO13 4YNIA 4O9EA 1UKGA 2QZ3A 3L2HA 3ME2A 4A41A 3GBFA 4BK5A 4XHBA 1S1AA 3QH6A 1GLHA 3C7FA 3R6SA 2CGOA 3ZXLA 2FBEA 4TYSA 2PHFA 2BWCA 5FBJA 4BMEA 3RI9A 2IXLA 2ZX0A 4IETA 2DCTA 2WFF1 1VBE1 2PHTA 4RQPC 2KA3A 1OVPA 4IERA 4CCLA 2N7GA 5M0TA 3IMMA 2W52A 4QPGA 1IKQA 2W94A 1OUXA 2QQNA 3G6JB 4RS5A 3ILFA 5EJZB 4LXLA 5LA1A 1K45A 1M4WA 2NMOA 1OA2A 3ZO0B 3VDDB 1R093 4CDUC 1Y9GA 2YPJA 3O0XA 1QIQA 1QJEA 3BOPA 4LQRA 3KVAA 3NQHA 1EUTA 3CKHA 1MZ6A 5CNAA 4CA9A 1GU3A 4KU7A 1WBFA 3AFGA 3PTYA 3S0MA 2FDKA 1X50A 2R041 4CEYA 1NLRA 2ORZA 5L73A 2RDNA 2C9KA 5C8WA 2XVGA 5A1AA 4Q1RA 4UF0A 1QU0A 3GZEA 3LIHA 2W1SA 4PLMA 1OA3A 5FYTA 1W6NB 1YIPA 3D6EA 3I2KA 1D7PM 1NA1C 2ETEA 2VE1A 4JRLA 4HLTA 4KGGA 2WFF3 3FHAA 3EBRA 5FYCA 5AC92 4ATEA 2UU8A 3FC0A 5LCWL 1CAUB 2C5DA 2WSVA 1UIJA 5FZLA 5A7WB 2WT2A 2WZPP 1I3HA 3DKWA 3U37A 2VL4A 1D2QA 1Q8VA 1AL22 1J3PA 1QGLA 2X5IB 3IKWA 1US2A 4FPOB 1W8FA 4ZS3A 3SCHA 3NV3A 1W0PA 2D93A 4UWDA 5A7PA 1W2TA 3HAGA 5K9YA 1UU5A 2WNUA 1RUH1 2DTWA 4AL9A 5ACA1 5C3RA 1H1MA 5A3UA 1WCQA 5FZ7A 1CESA 4R52A 1TEIA 5GLTA 1W8ZA 3IMNA 4M3CA 3MIFA 2DUPA 4LBQD 4WM8A 2X53S 4XMAA 1W6MB 1PO21 3PIJA 3UJOA 5K8SA 1CGPA 3ZKUA 4Y22B 3CNAA 4LO7A 2ZPXA 2GMMA 2R043 4GWIA 4LHKA 1AXZA 2WNVB 4CYDA 1CZTA 4BYYA 2HWC1 4BE3A 4R4XA 4XOGA 4CDWC 2VW2A 1F9KA 2MEV1 4WV8A 1JZ5A 4ATFA 4UBGA 3MW3A 2O14A 1PZ9A 2W47A 3P1IA 2W95A 5KXDA 3BVCA 1AR61 5JZGC 1WMDA 2PN5A 5A3NA 2WFF2 1W8NA 4D6SA 5C4WC 4AK3A 4KH9A 4MXWA 1GZTA 4PHZA 1U12A 2WQ4A 1DGWA 1HJFA 3VV1A 2JXAA 2FMDA 1ZZCA 1RC6A 1UXXX 1ZZ7A 3UETA 1RUH3 3UT0A 1QNWA 2R061 2XWBB 1SLBA 1Y43B 4NIIA 1RMU2 5JOZA 5ACA3 3S30A 3VZLA 2D6KA 2BU9A 1A78A 2J42A 3B9IA 2WNOA 5FIXA 3WUCA 2QQIA 3QCWA 4QKFA 4IEYA 4UBHA 4DPNA 1RUC2 2QTWB 1FNYA 2ZEZA 4QX1A 1PO23 2FD8A 1UKRA 1O59A 2XLGA 1DQ1A 2WAAA 4NR1A 3OGJA 4CCOA 5AVPA 1JBCA 1K3IA 3VBSA 4OI0A 4AAXA 3ENRA 3OGRA 1HB2A 3B00A 2HWC3 3KF3A 1W06A 1VB2A 5JOXA 1XXNA 4AVSA 2MEV3 3P5BA 1AX1A 1UL9A 5EJ3A 4CCNA 4F8AA 1KD7A 1DP0A 3LEMA 4DINB 1PGL1 2O0OA 2YXSA 4FXGB 1JYTA 1W03A 4NIHA 2BDRA 4QX3A 1F35A 3I54A 4MGTA 3NKTA 1AR63 3T1LA 5JSPA 1PM4A 1XYPA 4KGQA 4XIKA 4NJ4A 1HIXA 2PMWB 3LE0A 2ZGRA 3AZWA 3IM0A 4XTPA 1W39A 1ND2A 5FP3A 4E2QA 1LGCA 3OF1A 3T2QA 3HNMA 5FZBA 4D7TA 2R063 1H1IA 2D97A 3N9OA 4RR3C 4CCDA 5IK4A 5FYBA 1B35A 3IDAA 1C8M2 1YHFA 1XNBA 1H4HA 2P3YA 3HOBA 3IDBB 1OUSA 5ACA2 4M0NA 2VZRA 2E32A 4AQTA 1OQ1A 4XJWA 5LWBA 3Q8BA 1COV2 2BP6A 1YNAA 2UWCA 4NRPA 3HT2A 3IN9A 1SACA 4EN0A 3R0RA 5A3PA 4Q0PA 1PK6A 2PHUA 3AJYA 4QD2A 2V4AA 5GJ6A 5L36A 2XH6A 4OHVA 3WCSA 3AZXA 2R16A 2AENA 3B69A 3T2TA 3O1UA 1HN0A 4ZHNA 1RUI1 2HWC2 2Y0OA 4J1WA 4MGYE 3B94A 5FBZA 3WDYA 3VD3A 2VUDA 1UD1A 2ZA9A 1I1EA 1LULA 1YUDA 2DBNA 5C8CC 3M3OA 2ILMA 3MF9A 5CADA 4YVWB 4CDXA 1DZTA 2EXIA 2ZX2A 3FLPA 1MQTC 3C7EA 5F5QA 5JAXA 1TVGA 5EP9A 5GKAC 3S7EA 2DU1A 2FHRA 3K51A 3KD4A 4LO6B 4ZY9A 3VKMA 2JWPA 2B4KA 2PA7A 3BKZA 4HPKB 4L11A 2NLRA 3I2IA 5FPXA 4P08A 4FPEA 5FPZA 3KGZA 5CAZA 1W0OA 1WWYA 2DU0A 3FLRA 1H6XA 1E5HA 4QGLA 3T2PA 2VECA 4N53A 4YGDA 4DEVA 2DV9A 4LITA 1BQPA 4Y4YA 5JPMB 1K12A 1SEFA 4CP1A 1SLTA 4NRQA 5FY1A 5J98B 2GSYA 1OHFA 2IVJA 2GN3A 3SMHA 3SCGA 2ZGOA 3MYXA 3SH3A 1ULCA 4CEYC 4AHYA 4COYA 1CD3G 1G6NA 2BZDA 2DVFA 5BYNA 1FOD2 2R49A 5KWRA 4GJYA 1PMJX 1GBGA 1RUI3 4YRDA 1X82A 3C7OA 4FPLA 1W3XA 3ZPOA 4YW4A 1X33A 4KBBA 5CG9A 4QKDA 2HJIA 5DUXA 4CVUA 1CIYA 1BK1A 4Q1PA 4JGZA 4XFIA 1WMXA 4Q4W1 4DXRA 4IV1C 3I3MA 1O3TA 3PMSA 2OX0A 3FJSA 3ZR5A 1D0HA 1TME2 5FR3A 1H2LA 1OOPC 5GZCA 1JMUB 1HW5A 4XURA 4QU2A 3ZFEC 2OW4A 2W92A 5FLJA 3GCXA 3T0AA 3ZDSA 3ES1A 4GB31 1S0CA 2B5HA 3GBGA 3O0WA 4K6BA 1RYYA 4SLIA 1ZX5A 2R6QA 3WF0A 1DDLA 3MIEA 4AHXA 2WC2A 4N43B 1CAWA 4IEWA 1H4GA 3JU9A 3R4UA 2XUMA 1OLQA 4XTMA 4MHRA 2QUOA 2WT0A 2ID4A 2PHWA 4C0HA 2YBPA 5FKBA 4WM8C 1C1FA 1UZYA 2VD7A 3LDKA 2XLAA 2GALA 5FZCA 3VHPA 1D4M1 5I0SA 1OVSA 2RS12 4RGAA 3BYWA 2GMPA 1CQ9A 1EP0A 5IW0A 1HXS1 5L9BA 1U5YA 3AYCA 5F6KA 3S7IA 4AVBA 1KFUL 2BGCA 4IE7A 4N7UA 1A3KA 1VBC1 4JKKA 1S0DA 2R0FA 1F4AA 4XCBA 3RMYA 1FAYA 4QX8A 2GH8A 4GQ7A 2Z2SB 4BCUA 3C7GA 1QJU1 1IQDC 1PVC1 2VO5A 3KSCA 2VQTA 4Q4W3 5IVFA 3GHNA 2EXHA 4WZCA 3BALA 3CU7A 5C4WB 5KC5A 1WD3A 2QFEA 1W2AX 3GM8A 3WQ7A 3CIHA 4DXTA 2ZGKA 2ZGMA 3RDIA 2VTXA 1Z0HA 1UU6A 2D43A 4N9HA 4BU2A 2HWE1 3POFA 2AR6A 3K75B 1WMEA 2W91A 4GB33 3UGHA 1DZRA 1PZ7A 1VRH1 1WD4A 1N3QA 2YB7A 1W05A 4UW3A 3TN91 2B42B 1RUNA 2PHRA 3AVRA 4BIFA 1MS1A 4OI1A 5HBAA 3MPPG 4L92A 1LOCA 1ULFA 3A23A 1IHMA 5LA2A 5FO8B 2FMYA 1ZZ6A 4XETA 1EYBA 2ET7A 5FDBA 4TXWA 4UW4A 1KS5A 1D4M3 4LNVA 4R9BA 2DCJA 3W5MA 4BQWA 2WDBA 3C2UA 5FYMA 3POYA 1DYKA 1HXS3 2BV4A 3WXPA 2WO1A 2WO2A 1Q5OA 1RVF2 1VBC3 5JR2A 3NV4A 2BERA 1J3QA 2VQ0A 2VGDA 4G9SB 4PI2A 4XDQA 1VBD1 4CU9A 2PQQA 2ORXA 1Y4WA 2XHNA 5CKMA 3AYEA 2OVUA 1POV0 4AGRA 1W2OA 2LTNA 4YZ1A 4E4DX 1F5FA 2E31A 2JE8A 4OULA 1XE7A 1ZA7A 2ZX3A 4YYOA 4Q4W2 4EV0A 1Y3TA 4GMP1 2VQUA 3WINE 2HWE3 4LBKA 5BNOA 5EXOA 1ND2C 3HBZA 1MVEA 2VMCA 2Y6JA 1W9YA 3OB8A 1W0NA 2J1TA 3C7HA 3GZTB 4GH4A 1VRH3 2EIBA 4LBLA 4GB32 3TN93 1OC1A 5AVAA 2J1VA 4J6GA 4CZSA 1U0AA 2DVGA 5KXBA 3THDA 2JX9A 3POSA 3OBAA 4YFWA 2ZMLA 3TBDA 3A0KA 1GWMA 4FQZA 4JAAA 3CJIA 4X6QB 5DAVA 3ZXEA 1CONA 2YYOA 1DGRN 3B93A 5KHJA 4I01A 4JTOA 5A1FA 2PAKA 4WM7B 2GNBA 2BVVA 3LZZA 1WA6X 2ADEA 5CB7A 4CE8A 1D4M2 1LHOA 1AZDA 3PUQA 3H42B 4B29A 2TBVA 2IFWA 2VBBA 1V70A 4FT8A 1VBD3 4LO5B 1BZWA 1Y9QA 3CF6E 1VBC2 3TRSB 1VJ2A 2YHJA 3KF5A 5BV6A 2ZTNA 2CY6A 4FFIA 3D4KA 3MF6A 2EVXA 3GF6A 5F5CA 2D5HA 2CTVA 4K40A 2WZ8A 1ZVFA 5GLWA 2JDUA 3LFMA 1GP5A 1HJGA 1VB4A 1W8TA 2G19A 2WQZC 3N3HA 4FQ4A 4M0HA 4QPGB 4MGIE 1QJY2 3S5AA 4RS5B 3INAA 4L2NA 1W90A 2HWE2 4LK7A 4FBFA 3ATGA 5F6LB 3G7DA 3PVBB 4NAMA 3EO6A 1DF0A 3BTAA 3GYDA 3MZHA 2CL2A 3KV6A 5FMCA 4HL0A 3WF1A 1WLTA 4PIYA 4A7ZA 3TN92 3RYPA 2BTVC 2XLFA 3RJRA 3BPSA 4EJRA 2A3XA 4N53C 4GXLA 5LEJA 1UF2C 3SITA 3N7LA 4AYUA 3VBOB 4CEYB 3AMHA 3ORJA 1BLZA 4HZFA 1VBA2 4Y24A 1LJ7A 5FYIA 2ATFA 4AQ2A 3BTYA 4JHTA 5H9PA 1XU1A 4UF0B 1HV0A 1W04A 3I3BA 2JKXA 4QQHA 4BLJA 2V73A 2FZ2A 2A6ZA 5F9TA 2JE9A 5FZ6A 1VBD2 4NHKA 1HRV3 1N1VA 1W8UA 2E33A 2IC1A 2GDFA 1C28A 4JGZC 4NVPA 5ERLA 4HKWA 4P00B 1GR3A 1DYPA 3FFZA 4HONA 4OHWA 5BNNC 2A7AA 3BGAA 2OIIA 3VBHC 4YM0A 4H7LA 4ITCA 2WLQA 3DYOA 4ZS2A 1F31A 1UNBA 2WNUB 1QOSA 2FDFA 4DUVA 2QQMA 3AK0A 4YWAA 3MPBA 1S0JA 5FY7A 5IVJA 2EAKA
chains in the Genus database with same CATH topology
3ZYIB 1EAH1 1YFUA 3SISA 1WBLA 1QH7A 1AX2A 4AFCA 4JGYC 1LOEA 4M3CB 1NCRA 2DUQA 1V6IA 5HI0A 1CAXA 1FATA 3V0AA 1WGPA 3FLTA 3IPVA 4Q29A 1YRZA 1AR81 3B7MA 1N3PA 2ZHNA 3FHIB 4IEPA 3ILNA 3QBQA 4EWAA 1UN1A 4AI1A 4OHXA 1H0BA 4RQPA 1HLCA 3WD5A 3AP5A 1YXWA 4C91A 3WG1A 3GBWA 5LK5A 1Y7BA 1JH5A 4LLFA 1SCRA 4S2GA 1HRV2 2H6CA 4UW5A 4MXWB 5SV8A 4I30A 4XILA 1ZRFA 4MGKE 1ASJ1 4FCAA 4HFSA 5FCCA 2Q5TA 4EN9B 5DG1A 2R1DA 2VUJA 2GC1A 1RJ8A 4TZDA 1KQRA 4AWDA 1DGRA 2ZABA 4XXPA 4FPYA 5JSRA 4W6YA 3AFKA 5FAXA 1GQHA 3BB6A 4LBQB 4MVTA 3HWJA 4FO9A 1BVVA 3R05A 1TE1B 1AR83 1ENQA 4XQ4A 3VBSB 1RUE1 3O5SA 2IXHA 2MNGA 1VBB1 1NA1A 2WSUA 1KDKA 3EJKA 2HEVF 3AX4A 3FE5A 5ABJC 4XQDA 1AHSA 3A0NA 4SBVA 1S0EA 5D8AC 3ZSLA 3RNSA 1QH6A 4EROA 2JENA 2R32A 4PLOA 3DPRC 1MS4A 2LUWA 4OI2A 2C0ZA 1ASJ3 2VOWA 2BFUS 1H2MA 3VKNA 1QHDA 5BNOC 3NVCA 5C9AC 3FMGA 3LCPA 4IV3B 5A33A 3VL9A 1NE4A 1B35B 5GZFA 4BHPA 1NXD1 4GH4C 4K1ZA 1LHNA 3IIAA 1CPNA 1C8NA 1UPIA 2OUHA 2Y26A 3J8F1 4BH9A 2A6VA 3VZNA 4XFCA 1RUF1 1Z7S1 4HN1A 4CDWA 1RUE3 1PK6B 3WP6A 1VBB3 1DU3D 1NQDA 4ASMB 4Q0VA 2WZR1 3WZ1A 4K9SA 3M8LA 3VUOA 4QQPA 3WP4A 4QMAA 5JZGA 5CIRA 2PAEA 5CFCA 5I8TA 3SH4A 5L7OB 4AGVA 4HT1T 1QKQA 1CVNA 4I0AA 1ALYA 4CDXB 3ECQA 5BUVA 4LHLA 3JQWA 2UYBA 2JG9A 1KXGA 2A5ZA 3ZSJA 2ZS6B 3PNAA 3SXWA 1FV3A 5FLIA 3GZAA 4HK8A 3AYAA 4S2DA 4N53B 3J8F3 2AREA 3AXEA 3JCIA 4XF4A 4I0WB 2Z79A 4K7JA 1RUF3 3J26N 1Z7S3 3M3QA 5C33A 2EIGA 5FLHA 3KGLA 3BODA 2WZR3 1APNA 1VBB2 1RUOA 1ZRRA 4XFAA 4XPVA 1YFXA 4I0BA 4QM9A 5JR7B 2D6LX 1YI7A 4QGNA 2YDEA 4LO4B 4YM2A 1KS4A 3UJQA 3JB8A 1RL3A 4HKLA 3OY8A 1ULGA 2GNDA 3ZXFA 4P5HA 5DZEA 3LSEA 1ND3B 5GZEA 4LR4A 1RB8G 3SHRA 1CAWB 1EV11 2ZAAA 3P3PA 4H14A 2K0GA 2WIIB 4YVSC 1ZBE1 1SDWA 4HSLA 1NCRC 2QQPA 5GZGA 4LBJA 2XL7A 5J48A 3WG4A 2DCYA 1JHNA 1RUF2 4E4SA 1H8TC 2RR11 3PVNA 4AFMA 5KBFA 5GZDA 4MLOA 5C8CA 4FPCA 1MEC2 4LHNA 3LA2A 3KLSA 1TNFA 1MQTA 2XPJA 3TYJA 5DUUA 5FREA 3D82A 1ZRDA 4LEJA 4B4PA 3H3UA 1T6GC 4PBOA 3RRDA 1IS5A 3VKOA 2HKXA 1EV13 1SLIA 4K8FA 4P9XA 1ZBE3 2D7FA 4Z92B 4AW7A 3ZSMA 2GU9A 4KL1A 2BWAA 1IPJA 4AFBA 1W2UA 2Q1MA 4I09A 4N9IA 5I91A 2RM21 3CL1A 3FZ3A 4GWNA 1PO12 2YV8A 2RR13 3WQ1A 4P9YA 1PM7A 2GNMA 4QQOA 1QDCA 4KQ7A 4IV1A 1BMV1 1DBNA 2WLPA 3JD71 4BQ1A 1PNGA 1VBE3 3IT8A 1OOPA 3MEPA 2CNAA 1D0GA 3ZFEA 1IGOA 2RJLA 2CGPA 2XWJB 3N7MA 4QX5A 4DOUA 5A3MA 4FP3A 3USUA 3VL8A 1NXMA 3E5QA 3HT1A 1SMVA 2EAAA 1ENRA 3NSTA 1H2KA 4AFDA 4WBBA 4MYEA 2JKBA 4P9GA 2NQYA 1Q8QA 4YARA 2NYYA 1R092 1JXNA 1RUJ1 4PIZA 1OD5A 2Y0IA 3AP4A 2NZ9A 2JG8A 1AL0G 1ZBE2 1NZCA 2ZGTA 3CJIB 4Q2FA 3THTA 3B01A 4PIXA 4I3PA 3M4FA 3AKTA 3VBFC 2RM23 5FMOS 1IZ3A 2I74A 3ASIA 3M2MA 4S2HA 1Z78A 4YGCA 3UV9A 5JWPA 1C5IA 3JD73 3RG0A 1RINA 5KHKA 3KB5A 5CFCC 1VAMA 1W6OA 1VBE2 3MGUA 4XFFA 5CFDA 2I2SA 4XFGA 2HEYF 4YW1A 3FWEA 5JOWA 2WJSA 3LGRA 3ZFGA 2ZMKA 4DY3A 4PBPA 2JG9C 4HMZA 4COUA 4I02A 3WT3A 4URTA 1RUJ3 4KNCA 4AEMA 3HD8B 2G9FA 1WCSA 4XJ8A 3D0SA 3NKGA 3RPQA 5IUQA 1FI2A 4IEZA 1YCIA 1F2NA 1YLLA 4Z07A 1G8WA 2OUJA 2R042 1XNKA 2ZGLA 4FPKA 1ZZ9A 2BQPA 3ZSEA 3WDVA 2XBO1 2RM22 1VIWB 1JW6A 4YG3A 3V56A 4INDA 2CGNA 4XXAA 4AVVA 4NPRA 3AMNA 4YW3A 1SFYA 5I0TA 3JBG1 4C0BA 3ILRA 4QPIC 3WHUA 1V6MA 1KRIA 4AFAA 4AVCA 1MS5A 1S0FA 4YZ3A 1RUH2 3WW1A 1X36A 4TSVA 3VKLA 1A8DA 4EWDA 4OVEA 1YYNA 4AE2A 4YGEA 4DB5A 4I3GA 1LHVA 3NJZA 1X7NA 1PO22 2HEWF 4XF9A 1CAXB 1WA4A 3V0AB 1BCXA 2YY1A 3IPVB 2I45A 3N7KA 4BMBA 1CR7A 4CDQC 2Q4SA 2XBO3 2IXJA 4X8PA 1Q8OA 4JRAA 3KQRA 2MEV2 1U5IA 5FFOC 1AJOA 1N1TA 1X8MA 4ZXKA 2ARBA 4RQPB 2HYKA 4XBLA 1V6KA 1PIV1 5J09A 2XJVA 1AR62 1LOBA 3JBG3 3VZOA 2ZGUA 4MGZE 3UKTA 4Q8KA 1BKZA 2IZWA 3FUOA 4CDUB 1DIWA 4U36A 2R062 3WHTA 1HQLA 5B2GB 5LEKA 2B39A 2XGXA 1CJPA 1GNHA 1GANA 1CPMA 2NP0A 3W58A 3ST7A 1OKQA 1QOOA 2Q30A 4PDWC 2WFPA 2P37A 5CBLA 3VHRA 2DYCA 1I5ZA 1QNYA 5E89A 3DL3A 4K20A 3M7AA 3VN4A 1OSGA 3CO2A 1DQ2A 1BBT1 1R1A1 4XFHA 1NA1B 1H1AA 3KCYA 4IEUA 3FX3A 3BIWE 4CP2A 3WOGA 1FMD1 3BU7A 4RFT0 3AJZA 1PGL2 2R0HA 1DFQA 1LHUA 1PIV3 2B45X 5BNNA 3KZ4C 2JECA 4MZUA 3VBHA 5LRSA 3L9JT 4Q8LA 2DFCA 3JBG2 3ZYJB 5BY5A 1CAVA 3OBRA 4F83A 3UK9A 3VHNA 4JGYA 2SBAA 5KC6A 1LOAA 5EZWA 5GALA 5T3NA 4IEVA 4E27A 5J37A 1XU2A 3I2DA 1XNDA 3MIHA 2A6YA 2JG8C 5DG2A 3ZN5A 4JV4A 4CDWB 1R1A3 1GICA 1DQ4A 1FMD3 1RUI2 2QJVA 4IQPA 5JZGB 5CFCB 1IOAA 5JI7A 1MZ5A 4KG8A 5T54A 3MI8A 3ZIWA 1AUYA 4AVAA 4W65A 5JMCA 5GLUA 1LU1A 1LCLA 1RGSA 3AKPA 2VNGA 2RS31 3RSJA 1LECA 5CFDC 2A73B 2JG9B 4FOVA 3ZYGA 4Q0SA 4OHZA 3M3EA 2XJQA 3ZFGC 1N47A 3EHKA 5EFUA 1W6PB 1CIWA 1SBFA 2WT1A 3CEWA 1JOJA 4HKOA 3J4UH 2D44A 2GN7A 1AYM1 4O9GA 4FOQA 1FV2A 3GNEA 1XYNA 5ABJA 2EXKA 4ZU5A 1MS0A 1U5XA 1XE8A 2PAMA 2ZGQA 1QJU3 5D8AA 1PVC3 2ZGPA 4D7YA 4ZU7A 3DUIA 1FMD2 1KJRA 3DPRA 1I9RA 5I8YA 4DRVA 1H8VA 3KT7A 3N7JA 4AQSA 5C9AA 1DQ6A 4RR3B 2E9QA 4FOYA 4BM8A 2RS33 3SNMA 1W6NA 1UW8A 2BYVE 3LB9A 5L19A 3VBUA 1AF9A 3N36A 5KXCA 2BNMA 4Z8BA 4QXKA 1OPOA 1IPKA 4K21A 2VVEA 1AR91 2XVKA 3WP5A 3BCWA 4C1XA 3EQEA 1AYM3 4WZFA 1AVBA 3K48A 4MSVA 1ZNPA 2A70A 4XHXA 2CWSA 1O3RA 1HXS2 4ONUA 3OPZA 1Q3EA 5C8CB 5JIAA 1S2BA 1VAKA 4Y22A 1QJU2 5K0UC 1PVC2 4GMP3 1MQTB 2VPVA 3ZX7A 3TAYA 1IS3A 1LU2A 3L2YA 1F8VA 4GA9A 1FPN1 3SLIA 5F1RA 5DDJ1 5KHHA 2XB6C 2EA7A 1ULDA 2JEMA 3CLPA 4LLOA 5FRAA 2PFWA 2GC0A 2JJ6A 2VW1A 2AYHA 1VRH2 4B4RA 1QMJA 1CX4A 1O5UA 3VHOA 1AR93 4F7ZA 1J1TA 2F4PA 4P9JA 3ZFFA 1REDA 3ZMOA 1QJZA 2B9UA 2DURA 4C1WA 2UY8A 2VNRA 2ZKNA 4E4ZA 3MICA 1NQJA 3RQ0A 3ZIXA 2ZGSA 2DFBA 3ELNA 1OLRA 1ZBA1 3WW2A 1V6OA 4IV1B 3OCPA 1QWRA 3R4DB 1OOPB 1RJ7A 4MXVA 4Q26A 3ZFEB 1K5MC 1WCKA 4Y1XA 1FPN3 3USSA 4BA6A 3USUB 4QT6A 3JB4C 5DDJ3 1QQP1 1V9U1 3U07A 3ES4A 1LHWA 1DZQA 2PELA 4B3NA 1Q8SA 4PCRA 4YVSA 1Q56A 1XNCA 2E63A 4OUMA 2OYZA 3U0ZA 3IBMA 3OTFA 4WM8B 2X29A 1REFA 2KM2A 2E7AA 4IEOA 3NAPC 3WX5A 3D0JA 1AR92 1QXPA 4IXLA 4CRQA 1H8TA 1NCQC 4JCKA 1O5LA 3V0BA 4WVMA 2YUEA 4PF5A 3RS6A 3AZVA 1A8MA 1ZBA3 3AKRA 4N90A 2XKOA 5J3UA 5JCTA 2CV6A 4E2SA 1W6OB 4M3CF 5I0UA 4B8EA 2Z69A 4Y20A 3IWZA 3TWIA 1QQP3 1M06G 1V9U3 2EF6A 3APBA 3WR0A 2XJTA 1EAH3 4QQ2A 2IXKA 2BPA2 3ZFGB 5JSOA 4XF1A 4KWJA 2ZAHA 3CJXA 3MIDA 1O4ZA 1VR3A 4WVWA 4LUKA 5JI9A 2GC3A 4XW3A 2ZZJA 4XMIA 2Q1ZB 4A7KA 2DVDA 2VNOA 4HN0A 3T1MA 1WLDA 3W9AA 1O4YA 3OGGA 2DWRA 3VDDC 1QJX1 2D6OX 1J1LA 4Q4Y1 2VOKA 2QVSB 1WW6A 5H9RA 2D6PA 4DNYA 2WS91 2JICA 2PHXA 2D40A 1TMF1 2RHPA 3WDTA 1ND2B 4RD7A 1GKBA 1C4RA 4D7SA 4RHV1 4YM1A 3VKFC 1RUD1 5D1IA 3OBTA 4H55A 1QQP2 1JUIA 1NYWA 2BVBA 1EAH2 3U11A 1REEA 4CEWA 1J59A 3VBUC 4ORFA 2OPKA 2W39A 3QACA 3VBFA 4JTNA 2X5IC 3H7YA 4AEJA 5BNQA 2I07B 1AR82 1PZ8A 5JDBA 2UWAA 1R081 1LESA 2PLV1 4K3UA 4NWVA 1QJX3 4N43A 4AF9A 2D3SA 2QE3A 4DZGA 1DGLA 4Q4Y3 3VGIA 2XJPA 1G9FA 1YIFA 2WS93 5J7MA 1TMF3 2KXLA 3KM5A 4YZ2A 1EPZA 3H1YA 2H0VA 1O3SA 4RHV3 4YW2A 2UYAA 3M1HA 4S2FA 1RUD3 3WW3A 2XL9A 1ASJ2 4LBMA 1DG6A 2EALA 4Y26A 1S0BA 1PHMA 4JDMA 4XFBA 4L97A 3A4UA 4PQ9A 5H9SA 3ZXDA 1UX6A 2C1FA 1OQDA 1URXA 2G4IA 1POV1 4Y1VA 1MS3A 2VMGA 1S0GA 4FSJA 3ZFFC 4KU8A 1R083 1YJLA 2PLV3 1RUE2 3RZZA 1C1LA 4HETA 4IL7A 5K7PA 3WNXA 4XF0A 2IFRA 1V6LA 2W0XA 2NM1A 4Q4Y2 1DHKB 4AHZA 5E16A 2VVDA 4JGZB 4QPIA 4TWTA 1ZREA 1MS9A 5SV5A 3NWKA 5BNNB 3OYWA 4FTEA 3EXUA 2GH2A 3VBHB 5HCAA 2NN8A 4M3CE 3NV2A 3RJ2X 2VXRA 1J3RA 2XKPA 3S6PA 3QLQA 5JIUA 2ZHMA 5AC91 2EXJA 4JGYB 4JVAA 1LOFC 2CYFA 5LEJA 2A75A 1O7FA 3PVEA 1LENA 2ZX4A 3MLLA 3AP9A 1AL21 4L8QA 1YWKA 4XJUA 2E7QA 2VY0A 2VOVA 4R9AA 3J8F2 4CDQA 2DF7A 2DTYA 3NW4A 4PJYA 3WY6A 1RIRA 4TLFA 4JC1A 1LB2A 2XVLA 1Z7S2 1JYCA 1MS8A 1ENXA 2ARXA 4JDNA 5T5OA 2V5YA 2WZR2 2YROA 3D8CA 2WA3A 5I0RA 5JPNB 3LSDA 4XBQA 3QD6A 3TOJA 2WL1A 3HN1A 5FQ0A 1TQ5A 5LRRA 5I93A 1RITA 4WM7A 1RHI1 1GYKA 1V6NA 3GZUC 2D3RA 3DN7A 3URFA 5AC93 3AP6A 5EYXA 2K2SA 3AZYA 1FT9A 3VZKA 1AL23 2XJUA 3QH7A 1WW4A 5J36A 4PDWA 3PJYA 2QCSB 4XQWA 3LOBA 1IS6A 4YVWC 1RMU1 4AEDA 4COZA 3RWNA 1RUC1 4W6XA 5ABJB 1JYIA 1D2SA 5D8AB 4DY5A 3I59A 4U2AA 1QOTA 3DPRB 3V65A 2W68A 4XEZA 2XJSA 3ZN6A 3VBOA 2H6BA 1RHI3 5BNOB 1G9CA 3PJQA 1J58A 5C9AB 1DQ5A 3VBRA 1WMFA 2A6WA 4GH4B 2V09A 1OQEA 2ZOEB 4R9CA 3E5XA 1GZ9A 1L3JA 1EV12 3KCCA 4H3WA 3M3CA 1LRHA 4DQAA 2VMHA 3E6DA 4GKYA 4CEWC 2BBVA 4G3YC 2RE9A 3TB0A 1RMU3 2B7YA 5IK7A 1C8M1 3DF0A 1RUC3 4A3XA 1N1YA 1ZZBA 2RR12 1VLNA 1COV1 4HK9A 4M00A 4N43C 4BIOA 1C3HA 4I2OA 4GMP0 3NL1A 1SLLA 4YZ4A 5I8SA 1NG0A 5BNPA 3H3ZA 2WWSA 3ZYRA 4YSFA 2VVFA 2ZHLA 3LWCA 1SCSA 4QQLA 2O8QA 2BW8A 3POWA 1RHI2 1O91A 4QM8A 1E57A 1NLSA 4P14A 2P3IA 1HRI1 4AI2A 3OJBA 3Q9OA 1I6XA 3WDUA 1KJLA 2DVAA 4XBNA 4R9DA 2WNEA 4META 4Y1YA 3PHMA 2GZWA 3IDEA 3KCXA 3ZFFB 3AKQA 1OA4A 3I8TA 3JZVA 4QGMA 5JOYA 1UPSA 1C8M3 2ZX1A 1FYUA 2PHLA 3WDWA 3U4XA 1VALA 3THPA 1COV3 4RA0A 3MLJA 4PLNA 4LBQA 3B9CA 4GIQA 1BMV2 3FBYA 3JD72 2Z5WA 3ZVXA 1AYN1 1PGW1 2XHKA 4WVZA 1W6QA 1SBEA 1LEMA 1U5ZA 5CVRA 3PVOA 4P9LA 2Y38A 2GC2A 3DV8A 4FVVA 1FOD1 1BJQA 4AG4A 5CG8A 4NOTA 3J9SA 2E53A 1HRI3 2OZJA 3I7DA 4OHYA 3IDCB 4YVSB 2ZJCA 1YO8A 5AFBA 3HQXA 1RUJ2 1NCRB 1TME1 1ENSA 4BLIA 2CAUA 3HR9A 4M01A 1EPWA 4K1YA 4OLLA 1YI9A 4D94A 2G9GA 2A3WA 3MFCA 4FPHA 1OPMA 3WG3A 4IV3A 1H8TB 5GLZA 3LA7A 4OZXA 3V0BB 4WVMB 4QHBA 1H2NA 1DGWX 5K0UA 5FOJB 4X6RB 2YC0A 4LULA 3UKNA 3H9AA 5TSWA 1AYN3 1SBDA 2GNTA 4LUMA 1GNZA 2HWB1 1RTVA 2RS11 3AB0A 3MW2A 1FOD3 4Y20B 4WM7C 3ZPYA 4COWA 2AGSA 1QXRA 5E88A 3RYRA 2XJRA 3M3IA 5L7OA 1HRI2 2QNKA 2D3PA 4FPGA 1FNZA 4LT5A 3B5LB 1TME3 3PLQA 2PTMA 3BPZA 3E97A 3W59A 3B3QE 1S2KA 1UCXA 2QZ2A 4DXZA 5HXVA 5BPXA 4NO4A 3ZN4A 2RJKA 2ZMNA 3AKSA 1VP6A 1LOGA 2HWF1 4KG0A 4QPGC 2YMZA 4RS5C 3RMXA 4AEDC 3AXDA 4KWKA 3AYDA 4YLZA 5T50A 1GZCA 4BOWA 3JQXA 4QPYA 4V1PA 4Z82A 2XBO2 1G9AA 4Q4V1 3FUQA 1IS4A 2TUNA 1N3OA 1K5MA 3KS7A 2YGMA 5EYYA 1A6CA 2VW0A 2HWB3 2P3JA 2RS13 1H9PA 3WDXA 1AYN2 1PGW2 1AJKA 1RVF1 2ZACA 3VBOC 4ASLA 4DMIA 4Y1UA 4MV2A 1ONAA 1X8EA 5A33B 2WINB 4GULA 3VBRC 4D3WA 1XYOA 1S0IA 2SLIA 3NAPA 5FO9B 4CEWB 1GZWA 1NCQA 2YZ4A 2C9AA 1TNRA 4R4ZA 3VBFB 2HWF3 4XIOA 5CU1A 1BBT3 4NWWA 1ND3A 2R30A 2CAVA 2WNUC 1OI6A 2IXCA 3AMPA 1MVQA 1OFSA 4Q4V3 5HCBA 3D5OA 5JVVA 1Q8PA 2VU9A 3H8UA 1UIKA 2OA2A 3JUUA 1PIV2 4IEQA 1SLAA 5A32A 4Q0QA 2QDNA 4Z2WA 4B7KA 5BNPC 2Z42A 1O3QA 2P34A 1RVF3 3M70A 2GAUA 2MHFA 2HWB2 3BOWA 1HQNA 1LODA 4BZ4A 1JUHA 1MZFA 3HIFA 4YFZA 1S55A 4HANA 1C57A 3B02A 5T5PA 4FP2A 4B4QA 4DRRA 5EV7A 1NY71 3WQ0A 1QY4A 1IQAA 4OFGA 3DGTA 2E6VA 3TNPB 4NHMA 1QJY1 2ENRA 4JQRA 2P3KA 1LGBA 3VDDA 2DVBA 1FXZA 2HWF2 4HVQA 1R1A2 1BBT2 3ZYPA 1PVXA 5T5LA 1B09A 2O1QA 4ZU4A 1ZA4A 4Q27A 5LK7B 4OI4A 4B7EA 2GMEA