2HWD3

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
238
structure length
238
Chain Sequence
GLPVYITPGSGQFMTTDDMQSPCALPWYHPTKEISIPGEVKNLIEMCQVDTLIPVNNVGNNVGNVSMYTVQLGNQTGMAQKVFSIKVDITSTPLATTLIGEIASYYTHWTGSLRFSFMFCGTANTTLKLLLAYTPPGIDEPTTRKDAMLGTHVVWDVGLQSTISLVVPWVSASHFRLTADNKYSMAGYITCWYQTNLVVPPSTPQTADMLCFVSACKDFCLRMARDTDLHIQSGPIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 1A COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 1a
total genus 33
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwd300
2XBO3 5CFCA 2HWE3 4IV1C 1AYN2 4RQPC 1QJX3 2WFF2 1PGW2 1ZBE1 5C4WA 4LLFA 4CDUA 2RM21 1V9U3 1VBC1 1B35B 2HWD2 4N53A 1OOPA 4N43C 1TME3 4RR3C 1Z7S2 3VBSC 1AR62 1VB4A 4WM8A 1K5MC 5A33A 1RUH1 3ZFFA 5K0UC 4PDWC 3VBRA 4FSJA 2RS53 1FPN1 1AR71 1RUJ1 2BFUL 1VBD3 1PVC3 3J8F1 1AR91 4GMP0 1RMU3 5JZGB 1D4M2 5C9AC 2VQ0A 2XBO2 5ABJA 2HWE2 3CJIA 4GB31 2RS33 1QJX2 2WLPA 1RUF1 1MQTC 1V9U2 2WS93 4GMP1 3TN93 2WZR1 5LK7B 4JGZB 1TME2 2HWF1 2MEV3 1F2NA 1NA1C 4IV1A 4RQPA 3LOBA 1RUC3 1NCQB 4YVSC 1RB8G 5BNOA 2X5IC 2RR13 4Q4X3 4CDQA 1C8M3 2RS52 5J98B 1VBC3 3JD71 1VB2A 4AEDC 4CDXA 5GKAC 1VBD2 1A6CA 1H8TB 5FMOS 1PVC2 1BBT1 3VBSA 3ZXAC 1QJY1 1HRV1 1ASJ1 1ND2B 1NY72 1RMU2 3VBUC 3VBFB 1BEV3 5CFCC 2RMU3 2RS32 3VBOB 1VBA3 4SBVA 1ND3A 4RS5A 5C4WC 4QPGB 2WS92 4WM7B 4Q4Y3 3TN92 4BCUA 4N53C 1OOPC 4CEWB 1K5MB 2MEV2 1R1A1 1RUC2 4WM8C 2FZ1A 4PDWB 3JB8A 2RR12 4Q4X2 3VDDC 1C8M2 1TMF3 1R093 3VBRC 3IDEA 3HAGA 1PO11 1RVF1 4GH4A 1BEV2 2RMU2 4CDWB 5ACA1 1VBA2 3NAPA 2BBVA 2R073 1R083 1FMD1 2R043 4Q4Y2 3JD73 5DDJ1 1RUD3 5FMOL 1RUI1 1AR83 5D8AC 4Q4V1 1PIV1 5BNOC 2R063 3VBHC 1PGL2 1FOD3 4CDQC 1TMF2 1F8VA 1R092 2XPJA 4YVWB 1POV0 1B35A 2HWB3 2RS11 1RHI3 4CDXC 4JGYB 1VRH3 1PO23 4NWWA 4RHV1 1R1A3 1POV1 1QJU1 4CDUB 3VDDA 1X36A 5A32A 4Z92B 1ND3C 1EV13 4RS5C 1AYM1 3DPRB 2R072 1R082 2R042 5BNNA 1HXS1 3JD72 1RUG1 4Q4W1 1RUD2 1COV3 2PLV1 4WM8B 1AR82 1M06G 1RVF3 1VBB1 3JB4C 3ZFFB 4CEYC 2R062 1AL23 1FOD2 3FBMA 3ZFGC 1QQP1 5AC91 1RUE1 2QQPA 2HWB2 5C8CB 2HWC3 5CFDC 1RHI2 5D8AA 1EAH3 1MEC3 1PO22 1VRH2 1VBE3 5ABJB 1RUI3 1AYN1 3CJIB 2WFF1 4GH4C 1PGW1 1R1A2 3VBHA 1OPOA 1ZBE3 3S6PA 2HWD1 1EV12 2RM23 3NAPC 2ZAHA 1E57A 4IV1B 4RQPB 1H8TA 1AR61 4QPIC 1COV2 4FTBA 1ND2A 1RVF2 4IV3C 5L7OA 3VBFA 1RUH3 1AL22 3VBOA 5J96B 4N43B 1W39A 1FPN3 4QPGA 1AR73 4RR3B 4WM7A 1RUJ3 1B35C 3VBSB 2HWC2 2Y26A 1D4M1 3J8F3 1EAH2 1AR93 3ZFEA 1MEC2 2BPA2 1VBE2 2XBO1 2HWE1 1RUI2 4CEWA 1QJX1 4CEYA 5K0UB 2ZTNA 4GB33 1VBB3 1ZBE2 3ZFGA 1AL0G 1V9U1 1NCRA 1RUF3 2RM22 4GMP3 1QQP3 1VBC2 2WZR3 5CFDA 5C9AB 1TME1 5BNNC 1ZBA1 2HWF3 4Y5Z0 1MQTB 3JBG1 5JZGC 2FZ2A 1RUH2 2RS51 4CDWA 2DF7A 1FPN2 1AR72 1CJDA 1VBD1 1NA1B 1PVC1 1IHMA 1RUJ2 4YVSB 1NY71 4QPIA 1RMU1 1BBT3 3J8F2 2X5IB 1QJY3 1AR92 1HRV3 1ASJ3 4IV3A 5BNPA 2IZWA 3NAPB 4GB32 1VBB2 1NCQC 4AEDB 2WS91 3TN91 1RUF2 1QQP2 2WZR2 1CD3G 4YVWA 2MEV1 3VBUB 5CFCB 2HWF2 1RUC1 1H8TC 1HRI1 5C4WB 1WCDJ 2RR11 1ND2C 4Q4X1 1C8M1 5L7OC 3VBFC 1VAKA 1BMV1 3VBOC 4N53B 1OOPB 1X33A 3DPRA 4QPGC 4NWVA 4WM7C 1PO13 5FOJB 1BBT2 1ZBA3 1QJY2 3ZFEC 1HRV2 1ASJ2 5JZGA 1BEV1 1GFF2 3VDDB 5A33B 2RMU1 5A32B 4CEWC 1VBA1 3JBG3 3VBRB 5ACA3 2TBVA 2GH8A 4Q4Y1 1NCRC 5BNNB 1FMD3 4JGZA 5DDJ3 1AUYA 5C8CA 2ZZQA 4Q4V3 1NCQA 1PIV3 1PGL1 1DDLA 1TMF1 1R091 4CDWC 1HQNA 5D8AB 2BUKA 2RS13 1Z7S1 4Y4YA 1PO12 1ZBA2 4EJRA 1HX6A 5BNOB 4RHV3 3VBHB 4FTSA 4CDQB 5BNPC 1HRI3 1POV3 1QJU3 1SMVA 3JBG2 5ACA2 2R071 1R081 1AYM3 2R041 4CDXB 4N43A 1FMD2 3M8LA 2GSYA 1HXS3 1RUD1 1RUG3 4RR3A 4YVWC 5DDJ2 4Q4W3 1AR81 1K5MA 2PLV3 4JGYC 1ND3B 4RS5B 4Q4V2 5L7OB 2R061 1PIV2 5K0UA 1FOD1 4PDWA 4CDUC 5AC93 2HWB1 1RHI1 1RUE3 3DPRC 3ZFEB 1VRH1 1PO21 2RS12 5C9AA 4CEYB 4RHV2 4FTEA 1AYN3 2WFF3 3ZFGB 1HRI2 1QJU2 4RFT0 1MQTA 1EV11 1NCRB 1QJZA 2HWD3 3ZFFC 1AYM2 5CFDB 1BMV2 2BFUS 1HXS2 4JGZC 4GH4B 1NA1A 1RUG2 1OHFA 2WWSA 1COV1 1Z7S3 4Q4W2 1C8NA 4YVSA 1AR63 5C8CC 1NOVA 2PLV2 2RS31 2X5IA 5ABJC 1AL21 3CJIC 4AEDA 5AC92 2HWC1 4QPIB 1RUE2 1EAH1 1NG0A 1MEC1 1VBE1 1D4M3 4IV3B 5BNPB 4JGYA 3VBUA
chains in the Genus database with same CATH superfamily
3LSEA 1W8UA 4RQPC 5C3QA 1SBDA 4BQWA 1PGW2 1ZBE1 2G1MA 1NLRA 3S30A 4EZ4A 4D0QA 1D0HA 3K48A 4QT6A 2YDEA 2RM21 1V9U3 4A42A 5C7GA 4JKMA 5FY9A 2A1XA 1VBC1 2DFCA 3VZKA 2VVDA 3AYEA 5JCTA 1N3QA 4XIOA 5LASA 3OPTA 4RL7A 2OYZA 1LR5A 4RD7A 5A3PA 1KD7A 3MICA 3WDWA 4RR3C 4AI1A 1JU4A 1WZXA 3AM2A 4EWDA 1ACCA 1WW6A 3AX4A 1V6NA 3HD8B 4G3YC 1AR62 2ZXQA 4IQPA 1ZVFA 5B2GB 1T6GC 4GWIA 4XJ8A 5CAZA 2F4PA 1UX7A 1LOCA 1NYWA 5K0UC 1OQDA 3FHIB 2BWAA 4WZFA 3VBRA 1ZREA 2WNEA 4XFCA 1E5RA 3NV4A 3NRUA 2BFUL 2W1UA 4XXPA 2VR4A 4AGGA 1W6OB 3KLSA 3K3OA 2GC1A 5FUIA 4CCEA 3P3NA 5I8TA 1C57A 3MIEA 1RMU3 1LCLA 4GMP0 4OYUA 5FPZA 1RIRA 2R1BA 2OIIA 3ACLA 1W8WA 3AMHA 3ETQA 3SC7X 5ABJA 2VBBA 4GB31 2V72A 3ELNA 5SV5A 1LHUA 4DMIA 4LBOA 3CKHA 3RI8A 1AF9A 4IE0A 4XJUA 2XR4A 1RUF1 2WN3A 4NPLA 2WS93 1CX4A 4CP1A 4UYBA 3IAQA 3EMRA 4YW2A 5LA1A 4FOWA 4JGZB 3OUHA 4QXHA 1CN1A 4P5HA 5FZ3A 3T2TA 1QH6A 5JMCA 3VKFC 1JYNA 1NA1C 2PHWA 2NLRA 3A4UA 4OHVA 3TNQA 1S0FA 3ASIA 5FZDA 4A41A 1MZEA 5BNOA 2ARAA 4LORA 1OH3A 2RR13 4KU7A 1O3SA 5H9RA 4YLZA 2AYHA 4MGQA 4HONA 4R9CA 2Y6JA 3VLBB 4BIOA 1XSQA 5FMBA 3V56A 1W8NA 2JECA 2D6PA 2RS52 4WVMB 5A7WB 1LOFC 1WKYA 4JAAA 3JD71 4TZDA 1Z0HA 1SDDB 4AEDC 4QX8A 3H3UA 4LHNA 5IAXA 1PVC2 2E63A 1LEDA 4YZ4A 2PHXA 4S2HA 2SBAA 1NY72 5A1LA 4GIQA 3RWNA 1US3A 3T08A 4LK7A 1G9BA 4ORFA 5CZKA 2VW0A 1WUVA 3ZYPA 3LEMA 5BV6A 5LY2A 5GZGA 1S0EA 1V0AA 3ILFA 3U4XA 4Q4Y3 4XBQA 1FT9A 4OZXA 3ZX7A 4E4HA 3HQUA 4OMCA 4D7TA 2FDJA 3AFKA 2MEV2 4MXVA 1MS1A 5FXZA 5FZGA 1RUC2 1GOFA 2I07B 4I3PA 2FZ1A 4XZUG 2JKBA 5FR3A 4QX3A 1F9KA 4AQSA 2WNVB 5FWJA 1C8M2 1J1LA 3V0BA 4DUWA 5GZCA 5JXJA 5JUVA 1BLZA 2WSVA 2DUQA 3VBRC 1Q56A 2ZGUA 3HAGA 3J26N 1PK6A 3CMGA 2R0HA 4IXLA 1HQWA 1ZM1A 4P9LA 3DKQA 1SFYA 5FO9B 1WCSA 1RVF1 2HLEA 5L9VA 5F8PA 1DP0A 2GAUA 2BGCA 3LF7A 3VD7A 1W9FA 5ANQA 2BRTA 5FPVA 3SXWA 5ACA1 3N9LA 5HV4A 1VBA2 2WNUB 2YBPA 2EXHA 4YGBA 1UQXA 4FPEA 5L73A 2ZEZA 1R083 1LGBA 1FMD1 4D6RA 5JIAA 3C7GA 3RZLA 5DDJ1 1VPHA 3VHPA 5FMOL 1PM7A 1TG7A 2C4XA 2BOJA 1J3QA 2P34A 5D8AC 2E7QA 4Q4V1 2IC1A 1GWKA 3AFGA 1ZZ9A 4B1LA 4P9IA 5JSPA 1CZSA 2A3WA 2Z2SB 3VDCA 5BNOC 3IAPA 4ZU7A 3MLKA 5FTTC 1FOD3 1YO8A 2VU9A 3H3LA 2XPJA 4YVWB 4ZHNA 4E8DA 5KWRA 4F8AA 1QWRA 1B09A 2HWB3 4XIKA 3T4HB 2ZGQA 4GKXA 4ZONA 2ZGPA 3GALA 4TSVA 1U12A 4NROA 2J1VA 3K4ZA 4RHV1 2P37A 4FPOB 1W2OA 3FLTA 2DCZA 1XNCA 1IKPA 1JOPA 1DLLA 1POV1 2RJ2A 4CDUB 1HIXA 1RTVA 3GM8A 3PL0A 4Z92B 2PN5A 1GNZA 2WQZC 5CB7A 1AYM1 2E31A 3C8XA 4EWEA 3O5SA 4KL1A 3WX5A 5BPXA 2R072 1YIPA 4K1YA 2R042 4X6RB 5A80A 1D0GA 3I49A 3UESA 4AOCA 3JD72 1GZCA 4AI8A 4GAZA 5GLUA 2O0OA 5DABA 2WZEA 3PVBB 3GBGA 3IZOA 1X82A 3ZR5A 3IPVB 3BIWE 3OGGA 2O14A 3MV11 3WF0A 2UWAA 2GNBA 1PMHX 1YYNA 1VBB1 4I0BA 2DURA 1NZCA 4QQ2A 4IUGA 4CEYC 1XJAA 3BGAA 5C3RA 3ACFA 2BERA 2UYAA 3FBMA 3RJRA 3ZXJA 1W05A 3VD9A 2QQMA 3FX3A 3VZLA 4XC9A 5SV8A 3WZ1A 2QQPA 2DCYA 3FL7A 4WVWA 1PK6C 5C8CB 5CFDC 1RHI2 1JMUB 5A7NA 1MEC3 1PO22 1VRH2 3HT2A 2NZ9A 2XKOA 2ZX0A 3CDZB 4A2UA 2B45X 3CJIB 5EHDA 1CAXB 4AI3A 4AYUA 1K42A 2ZX3A 2ZGTA 3PJYA 2P1BA 4W6XA 3USSA 4ASMB 1EV12 3S7IA 4Q29A 2PAKA 1OA3A 1PNGA 3IT8A 3OJBA 4AVSA 3FE5A 3JCIA 5LRRA 3OTFA 1JN2P 4AVAA 4COUA 1P8JA 4LE3A 1HB2A 4YGDA 3HNYM 1IS3A 2BEOA 4HLTA 1COV2 2ZHKA 5LBFA 4EN7B 1RVF2 2DUPA 3KWVA 4KQ7A 5F2SA 5C70A 1WMDA 4PQ9A 3VBFA 5FMCA 1CAVA 3AZVA 1QXRA 1ZZCA 2JG8A 3IDAA 4P9XA 2CL2A 4QPGA 4RGAA 2ZX2A 3I54A 4CP9A 4FPJA 2GMEA 4EYUA 3F95A 3VBSB 2VOKA 3EJKA 3O1UA 4XQWA 3J8F3 3ZXKA 1EAH2 3ZFEA 3KV9A 2ZEXA 4Q2FA 1O3RA 2BPA2 5FQ0B 3OSDA 1NZIA 3FN9A 2ZTNA 2C9KA 3C7OA 4BMBA 3AP4A 5DQ0A 1D2SA 2B8MA 5EP9A 1UPSA 3ZFGA 1V9U1 4LUMA 1RXFA 4XFFA 4O65A 1NCRA 3KD4A 4DY5A 5GZFA 5IYYA 4EE2A 3G6JB 1QXPA 2ZX1A 3BOPA 3N7JA 4GMP3 1NQJA 4M3CB 5D2AA 1HN1A 1WBFA 2ZX4A 3B02A 1KS4A 1YFWA 3BPZA 3B93A 2ES3A 2P3KA 3LOIA 3RSJA 5JI7A 3LEIA 5DUWA 4GA9A 1REFA 5I0UA 3HPNA 1BCXA 4ZZ5A 2A6ZA 4Y5Z0 5FZ6A 2VW2A 3KV5A 4R9AA 4J6GA 2DU0A 3BI3A 4PBPA 2EA7A 3W5NA 1RUH2 4CDWA 3WUCA 3QACA 3HBZA 3NJZA 5E1RA 4BK5A 3RRDA 5DAPA 1QEXA 3GF6A 5FKCA 1FPN2 3AC0A 1AR72 4OI2A 1W6PA 1RUJ2 3ZYRA 1SLAA 3B7MA 5FO7B 1RMU1 4KH9A 2WBKA 3NNMA 5F37A 1DIWA 3W5MA 5JAXA 1HRV3 1YRZA 4HKWA 3HN3A 3MF6A 2VXJA 1XSRA 3FUOA 5DXDA 4B4PA 3DUIA 4BQXA 1VRBA 4XMIA 2D3PA 1IS4A 2JXAA 4KGGA 4MX3A 4OI1A 2CU5A 1GWMA 1VBB2 1OKOA 2CTVA 2WUHA 4PBOA 5DZEA 2WS91 5FZ8A 4PLMA 5FY5A 5FYVA 4QX2A 2E9QA 5EXOA 3O1MA 4V2WA 2Y8KA 2WZR2 2OZJA 4E2QA 4OHYA 4C91A 1GZWA 2VOWA 1PHMA 3NJVA 4Y1UA 2OVUA 3I2DA 2W95A 4B29A 4OI0A 1AZDA 3VBUB 2J1UA 2ZHMA 1ZX5A 1MS9A 3BB6A 4LEJA 3MUZ1 1ZRRA 2FDGA 1DZTA 5CYYA 2ZGOA 1WCDJ 2RR11 3SMHA 4XF1A 1DBNA 5KXEA 1KQRA 1UY2A 3ZDVA 2A3YA 3RZJA 3WNLA 2W68A 3VBFC 5IT6A 4QXBA 5DAXA 2ZGMA 5F3GA 2GMPA 3POGA 4N53B 3N9QA 2EXIA 4FFGA 4NVPA 4LLOA 4LA3A 4QQPA 2QBXA 4QPGC 5FUNA 2A6XA 2BYVE 3UGFA 3R05A 4NRPA 1W6NB 2VG9A 3EYPA 5CEHA 1BBT2 1V6MA 1MS4A 3ZFEC 3G7DA 5A33B 3VDDB 2SLIA 4XFGA 4JTNA 1JOBA 4EZHA 3MIGA 2JJ6A 4AL9A 4CUAA 2C0ZA 3PUSA 3JBG3 4M0NA 3WP5A 3KQ4B 1QOSA 4QQLA 4GALA 3FZ3A 2F17A 2GH8A 1W0OA 4Y1YA 2WO3A 4Q4Y1 4LOSA 1NCRC 5C5TA 5KHJA 5BNNB 2K46A 3EBRA 1NKGA 2XJQA 2V09A 1N1VA 3Q8CA 1IPJA 1WCQA 4ZPIA 4XHXA 1RL3A 1VMJA 1LJ7A 3ZN5A 1JZ4A 1O6UA 3I3EA 4PLNA 2ZZQA 3AP6A 3H7YA 2W0XA 2CGPA 1NCQA 1PGL1 3ZSKA 1ONAA 5FUPA 3A0NA 4OUEA 1DYPA 1OLMA 4CDWC 5FRAA 4CVUA 2XMLA 3WW4A 1UY4A 1SBFA 3O0XA 2EICA 1EPZA 1GNYA 3PVOA 2JWPA 5CU1A 1UY0A 2ET1A 1XYPA 1PO12 4AHXA 1ZA4A 4QDRA 5FYTA 1OKQA 2DCTA 2X8KA 4BQ1A 1W3VA 4CDQB 1XRUA 1TZOA 3AYDA 4K8RB 2KR2A 1QKQA 1JH5A 4LKEA 3BOWA 2V5DA 1R081 2A71A 2YU1A 3HT1A 4N43A 3M8LA 4HVRA 1LHNA 1WD3A 1ZZ6A 2GSYA 4H7MA 1HXS3 5EPAA 4AI9A 3E6DA 5IVBA 4JKKA 3GZEA 5IVYA 4BYYA 1K5MA 1STMA 4JGYC 1ND3B 1W6MA 3AJZA 3L9JT 4QB2A 3SCHA 4Z82A 4LKSA 1PIV2 3OPWA 1FOD1 3H7JA 1H9PA 1GZTA 5HCFA 3ECQA 3S5QA 4JDOA 1RYYA 1W06A 2XGXA 4YM1A 4FFIA 2HWB1 3P6BA 2W47A 3O1VA 2RS12 2XHKA 5IK5A 5C9AA 4MXWA 4FPKA 1HW5A 3I2FA 2DWRA 3HVDA 2PA7A 3PJQA 3ITQA 4NAMA 4Y3OA 1KEXA 3KGLA 4C0BA 4KBBA 2GNTA 3GJAA 1ZRDA 4FTEA 1AYN3 4TXWA 4O61A 2YGMA 3H3ZA 1U0AA 5E8AA 3VD3A 4IEXA 1H1IA 1MQTA 3ETPA 4AFDA 5JOYA 5LZ6A 4LKFA 4I2OA 4AZZA 1W28A 3DN7A 5D1IA 4LTAA 2DV9A 2CHHA 3RJ2X 4PIZA 2G9ZA 3PVNA 3AK0A 4GH4B 1OHFA 2WWSA 5BY5A 4LO6B 3P5BA 1Z7S3 4Q4W2 2N7GA 4V2VA 2FDFA 2RHPA 4K40A 5LRSA 1ALYA 2GC0A 2PLV2 2X5IA 3PTYA 1PGSA 5JVVA 3WG2A 4BA6A 3VD4A 3VZOA 3UV9A 2VCCA 2JDNA 2ENRA 2JDPA 1N47A 3O1PA 2W3JA 3LPFA 3RZZA 2Y6FA 5IUQA 2PQSA 3LAGA 4XACA 1RUE2 4LBQA 2NN8A 1NG0A 1KJRA 1MEC1 4UI9L 4AEJA 1SG3A 1D4M3 1EYBA 2OQ7A 2W9XA 5CNAA 3ZSJA 5I0DA 1N1SA 5FLIA 2VZQA 2CWMA 4TWTA 2Q4SA 2XBO3 5H9PA 3WF2A 4IV1C 1QJX3 2WFF2 3IB3A 4EV0A 1LEMA 1EP0A 1PMIA 4K7JA 2BTVC 3SH3A 2PXJA 4YZ5A 4YRDA 2D40A 3TYJA 2HWD2 4FPHA 2EAAA 4L9BA 1YIFA 2ZMNA 4FXKB 4L99A 5G05L 5DPNA 1O5UA 3H8RA 1OOPA 4N43C 5IK8A 2O8OA 2VOTA 2ARBA 1TME3 5A7OA 2RG4A 1GBGA 4HPKB 1W03A 2QQOA 1BKZA 1K5MC 1MZ5A 3DV8A 3E6BA 1IS6A 3PIGA 3IM0A 2B7YA 4TLGA 3ZFFA 1O8SA 4EROA 5IATA 1T6BX 2A6VA 3POWA 4BQ5A 4XMAA 1YQ2A 4I0AA 3OGVA 5FZ4A 1DGLA 2IXCA 1JOJA 1VBD3 4M00A 3VDAA 4BISA 2NMNA 2PHTA 3J8F1 4E2SA 4W50A 2GMMA 3EB7A 3UT0A 4EN0A 2J7MA 5IVVA 5JZGB 5C9AC 2VH9A 4L11A 3OF1A 5T50A 2DU1A 5FZ7A 3RS6A 1V70A 2HWE2 4UBHA 2RS33 3KS7A 4META 3UK9A 3VKMA 4NMIA 1QJEA 2OT7A 3HN1A 1MQTC 2CY6A 4CXXA 4GMP1 3FC0A 3IBMA 4XF3A 5K9YA 2D43A 3FJSA 4MZUA 2CDOA 3NKTA 5G04L 4A6SA 1O3QA 4AGVA 2JDMA 3LEKA 3NV3A 1VLNA 4YM2A 2W92A 3GDBA 4XCBA 2R30A 4RQPA 2C5DA 4QU1A 1FAYA 1S0CA 1QXJA 1EUUA 3T0DA 4PIYA 3NQHA 2QKDA 2X5IC 3MPPG 4IETA 2VZOA 2LROA 1UIJA 4KNCA 5H9SA 1PZ7A 2W87A 1O3TA 2DFBA 2XOMA 3RYPA 3IDCB 4QGLA 3C7FA 4CDXA 5I91A 5GKAC 2G9GA 1H8TB 4KI5M 1GV9A 4D8MA 4CCJA 5GZEA 2BNOA 1HRV1 5T5PA 1ND2B 1JYCA 1XE0A 3M3EA 2QQKA 1BEV3 4LBJA 1EUTA 1DZRA 1W6QA 4XF4A 3DCQA 1VAVA 2DVFA 4LMFA 3VHNA 1KDMA 1VMFA 3B5LB 3KCXA 3ZN4A 3J9SA 3TN92 2NMOA 2YC4A 3UETA 1I6XA 5KXCA 1OOPC 1Y9GA 3ORJA 4DY3A 4CEWB 3I59A 4PCRA 4Q0SA 2P3IA 3ZVXA 2OUHA 4I09A 5T55A 3I2KA 1OUXA 4NAOA 4Q4X2 3KT7A 2VL4A 1HN0A 1GANA 3I7DA 4N90A 4NJ4A 2WQ8A 3OYWA 2AEZA 1SZBA 3ZN6B 5HCHA 1OLQA 4JHZA 2QQNA 3EQEA 5KXBA 3IDEA 1GP5A 2ATFA 1SLLA 2AZ5A 2HEWF 2UWCA 2VBDA 2XQRA 1ULOA 2WINB 3FLPA 5K4LA 3SH4A 1JXNA 1NT0A 5DUXA 1DGWX 3MLJA 1LHVA 3A21A 4UW4A 1JZ8A 4FCAA 2RMU2 1W2TA 2ZGNA 2JX9A 4UFIA 2EIDA 3H42B 1JU3A 2BBVA 1K5JA 3POSA 1XOYA 1TNRA 3W21A 2CSGA 4AVVA 3AL6A 2RVAA 4XABA 3WDTA 4D6QA 1RUD3 1AXYA 5LW9A 1Q8QA 3AVRA 1RUI1 4OVEA 1ZYBA 4XUOA 5FYZA 4FPFA 2E33A 2Y64A 3BUCA 2B39A 2XUEA 1GR3A 2W2IA 3EHKA 3UYJA 2NM1A 4XJZA 1OVPA 1PX4A 1TQ5A 1W0NA 5F5IA 2YG0A 3VBHC 1FI2A 1W8OA 4FQ4A 3WW3A 1TMF2 2VCAA 1R092 1S2KA 3LGRA 5GLVA 5I0SA 3APBA 3KHBA 2E6VA 5B4XA 1XQNA 4UT5A 1ENSA 1C5IA 1WW4A 3EXUA 4CDXC 2OA2A 2XLAA 3O7OA 4NRQA 5FYSA 4AK3A 2XONA 3QH6A 4CE8A 1FV2A 1R1A3 2DDUA 1DHKB 4WVVA 3WHTA 4Z1VA 4LHLA 4MGTA 4Q1PA 4QX5A 5A7PA 3K4DA 1AX1A 3JXSA 4ZU5A 4FPLA 2VZPA 1Q43A 4B7EA 1H2NA 1TNFA 3AJYA 3DPRB 4XURA 5CKMA 5FOBB 3GHMA 1AXZA 3AP7A 2YROA 5FXXA 2XQXA 1HXS1 3H1WA 1WMFA 5T52A 1MZFA 3U37A 1QJFA 2XUMA 1HQLA 4AWDA 3LDKA 1CVNA 1AR82 5HPOA 2QCSB 3RGBA 4NRMA 5FP9A 3ZXGA 1WMEA 3BTYA 4CTEA 2IFRA 3WF4A 4W6YA 4DRRA 2D5HA 2R062 3L2HA 2WO7A 3AYCA 2VNRA 5JI9A 3A7QA 4AAXA 4N9HA 1IGOA 1L7QA 3MHZA 1QDCA 3USUB 3PUAA 5FZAA 4XUPA 4P9GA 1W8HA 4DPNA 5F3CA 4L2NA 4K1ZA 2HWC3 5D8AA 4MGYE 2JG9C 1VAMA 4OUMA 2KM2A 5ABJB 3OCPA 1AYN1 3RMYA 1L3JA 4PJYA 3W9AA 3WINE 2GNMA 5FYUA 1CIYA 3S6PA 1X50A 4QKBA 2ETEA 4NIDA 5DUVA 5EQUA 3JU9A 4UW6A 4QHBA 4M01A 1Y4WA 4CUGA 3VL8A 1MS0A 4I0WB 1YQCA 5EWSA 5JIUA 4CYDA 3A22A 4DB5A 4QPIC 1WGPA 2FMDA 5IFPA 1FV3A 1LNSA 2JIJA 3NNGA 3VN4A 2W1WA 4XTPA 3ZKUA 3N3HA 3AXEA 4IV3C 4QQHA 4R4XA 5JOWA 5IK7A 4CUBA 2XB6C 3NVCA 4HSJA 4AEKA 4BWOA 3LA3A 1AL22 1S2EA 4J1XA 1IOAA 4MV2A 1M4WA 3ZOIA 5AFBA 1QGLA 5FWEA 1MS5A 4HZFA 4AXOA 3U11A 3RZHA 4WV8A 5LB6A 3ZM8A 4BMEA 5J3UA 1K12A 2UWBA 1D4M1 2Y26A 1IQAA 1KS5A 1AR93 4QHZA 1PM4A 1VBE2 2XBO1 2IXLA 3J7MA 1RUI2 1QJX1 4CEYA 2VMCA 4UFMA 4LIVA 1ZBE2 3TOJA 1AL0G 3O1TA 3H0OA 1F5JA 5DG2A 2WIIB 2RM22 1AX0A 3JQXA 1QQP3 1VBC2 1U5YA 4GWNA 3U1XA 5CFDA 1L7LA 1ZZ8A 2GN3A 5FZ0A 1TME1 1JHNA 1YNAA 4NPMA 2ZJCA 1ZBA1 3S7EA 2R1DA 2HWF3 2C9AA 1LHOA 2FMYA 1OXCA 3KT1A 4P02B 3RVHA 4Y20B 3V0AB 1OD5A 4XYXA 2QE3A 2IUWA 2DBNA 3PUQA 3WQ7A 4CU6A 3MO4A 4JX0A 4LO7A 1A34A 2YC2A 2CAUA 2W94A 2WNUA 3FHAA 2PHDA 1H0BA 3N7KA 2Q8EA 4LOTA 3HMYA 1CJDA 1VBD1 2EIEA 1H2MA 4HN0A 4N7UA 1IHMA 1ZNPA 4ISQA 2RDRA 4YVSB 2WABA 3O12A 2NYYA 1BVVA 2C26A 1QJY3 4AE2A 2P6CA 1ASJ3 2OPKA 2VW1A 2YXSA 1LULA 4MGZE 4Q8KA 3THTA 4C0HA 1O4ZA 2VTXJ 5BNPA 2ID4A 5FPUA 3HWJA 1CGPA 2AEYA 2ZGLA 2IZWA 4GB32 1YQ6A 4EN9B 4ES9A 1T2XA 5EYXA 4RGKA 5CKQA 1WD4A 3ZYIB 1OF3A 1NAEA 5E88A 2ERFA 1RUF2 1A8MA 2VMIA 3AP5A 1D4VB 4CCMA 5FLJA 5I93A 4ZXKA 2RDSA 4YVWA 5FYBA 1HB1A 1GYKA 4AR2A 4CCOA 1O7FA 4H3WA 5CFCB 4QU2A 5JXHA 3ACHA 2YBSA 3I8TA 3T0AA 5J7MA 4Y5TA 1HRI1 5C4WB 2ADEA 1DYKA 2A5ZA 4C1WA 4IL7A 1BMV1 2J1TA 1LGNA 3W59A 1X33A 1KFXL 1APNA 2XVLA 2ZEWA 3AMQA 3ABZA 3AKPA 4PF5A 4WZCA 1C5HA 1PZ8A 4K9SA 5C6CA 2VTFA 3ZYJB 4LK6A 3I2JA 4LUKA 4JC1A 3I2OA 2Q0AA 3DXTA 3WP4A 3OG2A 1BEV1 4L8QA 4XOGA 4E9KA 2X09A 4P9JA 3IPVA 1NXD1 1VIWB 3UJOA 2KA3A 2TBVA 5FZ9A 3MIHA 3K51A 1BK1A 3OOXA 5JSOA 1AJOA 3B01A 3O1RA 5F5AA 2EIGA 2IXJA 3T2OA 3K4AA 4LO8A 2NPIA 5CIRA 4NHMA 1YI7A 4YW5A 4XDQA 1X9PA 1MVEA 5C8CA 3FFZA 3J4UH 4I3GA 3ALQA 2VBPA 4YG0A 2VZ1A 1QNYA 4KG0A 4YFWA 1CAXA 5T5JA 3LD8A 2VMEA 3POFA 5I8YA 2H6CA 4ZS2A 3I97A 3WEZA 1DDLA 3MBWA 4YPJA 4XFHA 3CF6E 2PAEA 2ZS6B 2DYCA 4XPVA 5FPXA 4I02A 2WNUC 3D8CA 4IEWA 5DG1A 4LULA 1G86A 4BQ2A 4BZ4A 5CKNA 4Y4YA 3ZPYA 2L9LA 4S2DA 2PELA 3LKJA 3VHRA 1ZBA2 4HOOA 5A1FA 3B00A 1NXMA 3E97A 4G9SB 1R1ZA 4MYEA 5I0TA 4AHZA 5BNPC 4MH0E 2ZOEB 5FY7A 1QJU3 2EAKA 5JPNB 4U36A 2PHUA 5A7QA 4COZA 5ACA2 3SCGA 5CADA 5FZEA 2X10A 4DEVA 4TN7A 5DN2A 4OZOA 3ILNA 5EIYB 2VZSA 1FMD2 5HV0A 1WA6X 4UW5A 4FPCA 4IGQA 3ST7A 4URAA 1RUD1 4NIHA 3OEAA 1RUG3 1V6LA 4YVWC 4HVQA 1UNBA 5DDJ2 3PDQA 2Y60A 2QFEA 3JZVA 1DYOA 4QGNA 3WP6A 5L36A 1U5ZA 3K2OA 4Q4V2 4JVAA 4RS5B 1W90A 2XJRA 3N36A 2DVGA 4RFRB 1CAVB 5LK5A 4LITA 4B8EA 1SPPA 2BVBA 2JG8B 1RINA 4PDWA 5DZFA 4Z8BA 4UFKA 4CDUC 4CP9B 3C2UA 1CZVA 1EPWA 1YJKA 5AC93 3ZYBA 3HOBA 1AJKA 4JCKA 4ZXEA 3ZFEB 4M3CA 4RA0A 2ORZA 1XNKA 1UYZA 3AKSA 1G6NA 5DAWA 3WNPA 3ZDSA 4CCNA 5FYYA 4RHV2 5B4NA 2Q30A 3B3QE 3GHNA 3M7AA 3ZFGB 1HRI2 2ZCWA 5A7SA 1NCRB 1VMHA 5T5LA 2G19A 2YMZA 3B69A 1LOAA 1SBEA 4JRLA 4YARA 1AYM2 1DGRN 2ET7A 5DUUA 1BMV2 4L97A 2BFUS 2JB4A 4QAWA 1VP6A 1KDKA 4H7LA 2Q5TA 3Q8BA 1F15A 2LM3A 1JBCA 3GJBA 3LFMA 4FFFA 1O4YA 1S0GA 3GZTB 1AR63 5C8CC 1NOVA 4HVOA 2XJPA 1ODMA 5F9TA 5AVPA 2QUOA 3VGIA 3PU8A 3CJIC 1IPKA 4QKNA 4D6SA 3LQCA 1G9FA 3TNPB 1XXNA 1OA4A 1XNBA 3NSTA 2YZ4A 3MFAA 1FNZA 1LRHA 1W6PB 2J1EA 5CVRA 3ENRA 2GU9A 4UAPA 3FUQA 1CPNA 2VVFA 2HWC1 4QD2A 1UOJA 1E5SA 4HXCA 2GC2A 2Q8CA 3POEA 1LU1A 1DQ1A 4JGYA 1H4GA 2P5BA 3VBUA 5FREA 4I30A 1WWYA 3WNOA 1CAUB 3URFA 3CIHA 4Y22A 3UKVA 2P2KA 4LLFA 3NV1A 1JZ2A 2Y0IA 1FXZA 4FFHA 1B35B 1ST8A 3KF5A 2Y34A 3OPZA 1KXGA 4IEYA 3THCA 3ZYFA 3BODA 4N53A 2BJSA 3CEWA 1HV0A 1N1YA 2LRPA 4W65A 1UY1A 3GYDA 3MI8A 3H8XA 1GKBA 2UURA 2DTWA 1YXWA 3IIAA 3VBSC 4GWJA 1UZYA 1VB4A 4WM8A 5GLTA 1H1AA 4FOVA 5IJRA 3VL9A 5A33A 2Y33A 1UY3A 3T0BA 1AVBA 1J58A 4PDWC 3RYKA 2RS53 3MDPA 1ZRFA 4FSJA 4UBGA 1JYTA 2P17A 2YY1A 1W9YA 4P00B 1XYNA 2XVKA 3R0RA 4YSFA 5FXVA 1GWLA 3DL3A 1PVC3 4XJ9A 2BWCA 3LE0A 5FZCA 1AR91 2R49A 2NP0A 2GALA 4ES8A 5IHRA 5DAVA 2W39A 4IE5A 1CAWA 4XW3A 3J7HA 3WR0A 5CG8A 1GZ9A 1PMJX 3CBNA 3I3QA 5EJ3A 2WYSA 4DS0A 3I2HA 1V9U2 4YM3A 5K7PA 1FNYA 2OX0A 3WT3A 4D69A 5LK7B 3RPQA 2NQYA 2FCVA 2HBTA 2VZUA 2WSUA 1D7PM 2ZBJA 3PNAA 3RZGA 1SFNA 4OCTA 3S5AA 2FQPA 4MGSA 3O14A 4QPWA 3J7NA 2IWGB 3WDVA 1SLBA 2HWF1 2MEV3 2DCJA 1F2NA 3OY8A 4DXSA 3U0ZA 2YU2A 4IV1A 1JTZX 4MGKE 2QQWA 5EYYA 3THPA 5ANNA 5LCWL 1RUC3 3LOBA 1NCQB 4E2GA 1DG6A 5KC6A 2HYKA 4B3NA 4E4ZA 2F6BA 5A6QA 1YJLA 3BN6A 1JYWA 2D98A 4CDQA 3PUIA 1C8M3 2Y6KA 1MPXA 1YQ8A 4C8DA 2WWUA 3GNEA 3M3IA 2QQLA 2ZZJA 4PQQA 5J98B 1VBC3 3WG4A 4ARYA 1VB2A 3M3QA 5H9QA 2VVEA 3TAYA 1A6CA 2P4EA 4MO3M 5FMOS 4Z2AA 1QJY1 3WW2A 5F32A 4NIGA 1ASJ1 4AG4A 1D2QA 1RMU2 1SCSA 3AMPA 1X8MA 1UKRA 1O91A 3LPGA 3VBUC 4DQAA 4M0HA 2DUOA 3MW2A 5JXIA 3VBOB 1VBA3 1CR7A 1ND3A 4SBVA 3VKNA 1UOFA 4LHSA 1AX2A 2HBUA 3KHCA 3ZMNA 1OC1A 2WS92 4WM7B 3H9AA 2W5FA 1SHWB 4FOYA 4CPBA 1CJPA 2JDAA 4ONUA 4BB3A 4Y26A 2VQTA 2E7AA 4N53C 2WJSA 3KB5A 1UKGA 3MIBA 4L0PA 4EN8B 1K5MB 1VE0A 3VDBA 3U4SA 2I74A 2QVSB 1W6MB 4QQOA 3UKNA 3WDUA 1HV1A 2YFZA 2A70A 1JYIA 4XBNA 4CXYA 2OXBA 4WM8C 2RR12 2ADDA 3N9PA 1V6JA 4MUVA 3Q8FA 3VDDC 1PVXA 4NHLA 3S57A 3E5QA 2FDHA 2BZDA 1C1FA 5I0RA 2HJIA 3SNMA 4XFBA 1LESA 5AFEA 2YPDA 3AZXA 3AZZA 3P1IA 1LTEA 3N9OA 4XDPA 2XLFA 4CCKA 5FYIA 5FPBA 4FI9A 5C3PA 5FPLA 1ZA7A 3AZYA 5FZBA 2CV6A 1N3OA 1W3XA 3AXDA 4GH4A 1XPWA 4GKYA 4AHWA 4M4PA 3ILRA 5FZOA 4IEZA 2XWJB 4AFBA 4NHYA 5KHHA 4ASLA 5HXVA 3WLUA 3UKTA 1Q8SA 3NAPA 4QMAA 1ENQA 4COWA 3N9MA 4YW7A 4ZU4A 4Z2WA 5LBCA 2DCKA 2R073 3OD4A 2R043 4Q4Y2 4HMZA 4EN6B 3JD73 3CL1A 4ZKTB 1H1MA 5EZWA 1TVGA 2FD8A 3I3BA 4Y33A 3RZMA 4IEVA 1OD3A 1F4HA 3T2PA 1UZZA 3POBA 5DZGA 4CP2A 2VTXA 5JLVA 3ZR6A 2YBKA 3NJYA 2QJVA 3UGGA 1QIQA 2JDYA 2VNVA 2VCBA 2VMFA 2VM9A 4GZ9A 2BU9A 2QZ3A 3BYWA 4BLJA 1PGL2 1CX1A 4CDQC 2D6LX 3WVJA 4OHZA 1S0IA 2PMWB 1XNDA 5FBZA 2HH9A 3HNMA 4LT5A 4LBQB 1DLCA 1NLQA 2VY0A 3M3CA 3CQOA 3RMXA 1RHI3 1SACA 1ULDA 1POQA 3LZZA 4AVTA 5JOZA 1VRH3 1PO23 3ROUA 2WYFA 5J37A 1F5FA 3MLLA 4FPGA 4YW4A 2WFPA 2WO2A 4BXFA 2ZKNA 2H0BA 1Y43B 3QLQA 1QJU1 1GQHA 2D7FA 5DAQA 5HI0A 1X36A 1O4TA 2VGDA 1EY2A 5A32A 4BQ4A 1ND3C 1EV13 5HCAA 1QOOA 4X6QB 1O59A 2WN2A 1Y9MA 3AVSA 4UF0A 2JD9A 2VCMA 5F2WA 3AKRA 3K46A 1R082 4OHWA 5GLWA 2J22A 4QB6A 4QWNA 4MADA 5JSRA 2DTYA 1OA2A 1Q8OA 1UPIA 5FBJA 3WV6A 4P5YA 1RUG1 5EJZB 4AQ6A 5A3NA 2J42A 4MG2A 3ZYGA 1BZWA 4IEPA 4BOWA 1COV3 1QMJA 4KG8A 4PLOA 4C90A 1M06G 1RVF3 4XJWA 4N8MA 3DXUA 4J1WA 3DKWA 4LA2A 4LHKA 3WCSA 3JB4C 1DQ5A 1NUKA 2OKXA 3ZFFB 3IMMA 4JQRA 1N3PA 1ULPA 2D93A 1WW5A 1YLLA 3KT4A 3LFIA 1FOD2 4OHXA 3R6SA 4E4SA 2VAUA 1DQ0A 2AH2A 2RV9A 4QX0A 1K45A 3NJXA 4S2FA 5AC91 2IXIA 5IK4A 1W04A 3Q9OA 2YGLA 3IIIA 2HWB2 3D0JA 3IWZA 3OEBA 2VQAA 1W9TA 1EAH3 4QGMA 4YZ2A 2VZRA 4IESA 4K21A 3ES1A 1PGW1 4GH4C 3VBHA 5JR7B 4ARXA 1RITA 2WT0A 1YCIA 2VJXA 1V6OA 4FAHA 2WC2A 2ZA9A 2VMDA 4O9GA 3GZAA 3T3YA 5FO8B 2HEVF 3NAPC 3M70A 1N1TA 2ZAHA 4B1MA 5FKBA 4IEUA 1IKQA 2AUYA 2IFWA 4XUNA 2JE7A 2EXJA 2CWSA 1SLTA 4RQPB 4P9WA 1UF2C 5CBLA 3T2QA 1H8TA 1AR61 1OQ1A 2RDNA 4LXLA 4FTBA 1ND2A 4RN5A 2VO5A 2C6SA 5L7OA 4AEMA 1IQDC 1ODNA 4FAGA 1RUH3 2D44A 1GICA 4XETA 1J83A 2VUDA 4ATFA 1FPN3 4O9EA 3OBRA 1AR73 4R8HA 4BPZA 4RR3B 1UAIA 1RUJ3 2XVGA 4D3WA 4GWMA 1MACA 1MEC2 3KVAA 1LOBA 1S55A 4A7ZA 5FZFA 1OLME 1W8ZA 2F4LA 3VHOA 4CEWA 5K0UB 1W6QB 3U07A 5FZMA 1I1EA 1VBB3 2PFWA 5APAA 3D4KA 3W58A 5LATA 2LW8A 5FP3A 4XF0A 2ZGRA 1XE7A 5JDBA 3K75B 2RJLA 5GALA 2WZR3 4F3JA 4XZPA 3ZN6A 2VNGA 2XL7A 2XH6A 4FPYA 2JG9A 3QCWA 1HB3A 3I59B 3VB9A 1L7RA 1A78A 5F39A 2Q1ZB 1OSGA 4ZY9A 3MPBA 3WXPA 2W08A 4LBQD 1UOBA 4IGPA 4A45A 2VE1A 3JBG1 4J25A 3U14A 5JZGC 4P08A 4KU8A 4E27A 1YFXA 5JPMB 4PI0A 4UFLA 4HK8A 3J7LA 2RS51 5LA0A 3BIEA 4NHKA 5GLZA 4TTGA 2G4IA 4LR4A 3ZSEA 4QKDA 2W46A 2DF7A 2ARCA 1RUNA 4QXKA 4CU8A 3UNPA 2XJSA 1NA1B 4C1XA 4E8CA 1PVC1 1NQDA 4MHUA 3WNKA 1NY71 3POJA 4QPIA 1BBT3 3J8F2 4H55A 4D7YA 1FYUA 3B94A 3CJXA 2LTNA 4IV3A 2FHRA 4HN1A 2JENA 4AQ2A 5F1RA 3UGHA 1GNHA 5A6XA 2WT1A 5FK8A 1XNAA 5FZIA 3WDYA 1RXGA 4EQVA 4AEDB 3GZUC 1XE8A 2W1QA 5HXMA 3HBKA 5E6HA 3BU7A 5A1AA 5D21A 2BVVA 1CD3G 2B4KA 3QBQA 2MEV1 1WLTA 2W52A 4DUVA 3R4SA 4YM0A 3KZ4C 4H2AA 3WW1A 1C3HA 1RUC1 1TEIA 5K8SA 1H8TC 2Z42A 3LCPA 1WCKA 3KCYA 5FAXA 2GP3A 1ND2C 1F31A 3CZJA 3PVEA 4QB1A 3N7LA 4AFCA 1C8M1 1H6YA 5J48A 5L7OC 3SITA 2GZWA 2QDRA 5KC5A 2Y6HA 3HJRA 3RQ0A 2TEPA 3AKTA 2XDVA 2LALA 3DPRA 1J1TA 5LWBA 1UU4A 3OBAA 1PO13 1UMZA 3MW3A 4ITCA 4QX1A 5C33A 4Y1VA 1W6OA 4PHZA 3NNLA 1HRV2 1XYOA 1UZVA 1GFF2 2CGOA 3HQXA 4XUTA 3ZIWA 2R16A 4CEWC 1VBA1 1W0PA 3HNBM 4YZ3A 4GD4A 5LBBA 3VBRB 1OF4A 3X29B 5JR2A 3VZNA 2WKKA 3TWIA 1G9CA 1YFUA 4F7ZA 4GULA 5M0TA 2JICA 1CQ9A 2OW4A 1VR3A 4JGZA 3SHRA 4Q0UA 1UZWA 3BU0A 3USUA 2CYFA 2VNOA 4FBFA 1LKNA 5JXGA 3LIHA 2XJUA 2Y6GA 5AVAA 4KWUA 1U5XA 1JYVA 3ZMOA 1YI9A 4A4AA 1KITA 1PIV3 2QQUA 2W1SA 1SQ4A 3OBZA 1MVQA 2R7EB 3T1MA 4DFSA 4Z07A 1V6IA 3TEZA 1F4AA 3HEIA 1I9RA 4QM9A 3CZUA 3M2MA 2J1SA 5A7WA 4WVMA 3RFRA 5D8AB 3AKQA 4U2AA 2RS13 4Q0VA 4O7XA 1Z7S1 3HIFA 3O0VA 3ON7A 3L2YA 4CA9A 4HT1T 1UD1A 1SLCA 4ZS3A 4DNYA 1JHJA 5BNOB 4FTSA 4Q27A 1SDWA 1I3HA 4OMDA 4W6WA 4NN0A 1H2KA 2GNDA 2XLGA 3MW4A 4GQ7A 4XHBA 1SMVA 5J1XA 1Q3EA 2XXZA 1UOGA 3JBG2 5FP7A 4CSWA 2R071 4ET7A 3UL2A 5F6KA 2R041 5T5OA 1BVP1 4M3CF 2D6NA 1GQGA 3LB9A 3OUIA 1PNFA 4SLIA 4YG3A 1UO9A 3I4IA 4Q4W3 5L9BA 4MLOA 3V64A 4Q26A 2PLV3 2ZHNA 3JUUA 5F3IA 4DOUA 3O1OA 1HJGA 2XWBB 2GDFA 3RWKX 4NO4A 4FQZA 4YZ1A 4DIQA 2P6HA 4OQ9A 1QH7A 4NPRA 1LOEA 4A44A 2WNVA 1ZRCA 3H50A 4IE4A 5KHGA 3K77A 3AZWA 1S4CA 4LBMA 4IW3A 1RHI1 1RUE3 1UXZA 2R6QA 2Y0OA 3DPRC 3E5XA 1VRH1 1PO21 3MF9A 4Y1ZA 3PTRB 3OB8A 5F5QA 1YEWA 2GC3A 4UXAA 4CEYB 4COVA 2X53S 3MV01 4JDNA 4QM8A 3UJQA 1UYXA 2WFF3 1Q5OA 1Y9QA 2E51A 3KGZA 4AFAA 4Y20A 3V0BB 3V0AA 3MYXA 2RE9A 4IE6A 1EV11 4XILA 1OFSA 3TEYA 5FZHA 1QJZA 2HWD3 3I2GA 5A6ZA 5JOXA 2ZEYA 3I3MA 4G4FA 4OI4A 1WLWA 1PK6B 1GUIA 2JKXA 2XL9A 2DVDA 5CFDB 2BBAA 1YWKA 5EV7A 3ZYHA 3ZXDA 4BDVB 5J09A 3CNAA 2WNOA 2XJVA 1HXS2 1ULFA 4JGZC 2WL1A 5LBEA 2G9FA 2ZACA 1COV1 4X8NA 5A3OA 1C8NA 4F83A 1UMHA 4YVSA 2PAMA 2JB8A 2RS31 4GXLA 4UW3A 5BNQA 3VV1A 3ACIA 4Q1RA 2Z4FA 1LU2A 5ABJC 1S1AA 2K9ZA 2XG3A 1JW6A 2OQ6A 5BYNA 1IZ3A 3KVBA 4Y24A 2C1FA 3BALA 3NMBA 3SCFA 5IVEA 1JZ5A 1S0BA 2BDRA 4UOJA 2JDKA 2AACA 4K6BA 3ZO0B 1EAH1 4HKOA 1H2LA 4OFGA 1AHSA 5BNPB 5FY8A 4XDOA 1CPMA 2JE8A 4NR1A 2VZTA 5CFCA 2HWE3 1AYN2 1F35A 3R4UA 2YC0A 1S0JA 2ZKLA 5C4WA 3VKOA 4CDUA 2VMHA 2J1AA 1UU5A 5KR7A 1RUOA 3WD5A 3DEMA 1H4HA 4ISRA 2FCTA 3U78A 4FT8A 2BGPA 2V4VA 4ZZ8A 1Z7S2 4YW3A 4EWAA 2ARXA 3A0KA 3SLIA 2VZ3A 4XAEA 3PLQA 1V6KA 1S0DA 1RUH1 3S0MA 4B4QA 2YFUA 2ZMKA 1GQPA 1BJQA 1C28A 1FATA 2D6KA 4BLIA 1XC6A 3PHMA 4YNIA 4DUXA 1FPN1 3ME2A 1AR71 2WNVC 1LAJA 2Z69A 1RUJ1 4LIUA 4QHOA 4Y4RA 1OI6A 1UCXA 5KXDA 4CU7A 2WR9A 3DYPA 1CWPA 4OUSA 1D4M2 2W91A 2VQ0A 3E5UA 5F3EA 2XBO2 1QNWA 3INAA 4KMQA 2IVIB 3CJIA 3GXUA 1QJX2 4KWLA 4LNVA 2A6YA 1ZRIA 3KSCA 1JODA 1SLIA 2QQVA 2J1RA 2WLPA 3SH5A 3TN93 2WZR1 4XF9A 4CCCA 4Y5SA 1J3PA 5KHIA 4CXWA 2VC9A 1OBNA 3DYMA 1TME2 4HSLA 5FDBA 1LENA 5L19A 2QQJA 3WOGA 3PIJA 5JMOA 4YVSC 3KM5A 3WNXA 1RB8G 1CONA 1W9WA 2HKXA 2Q1FA 1TE1B 2B9VA 4Q4X3 5IFTA 5HBAA 4S2GA 4XBLA 4ASKA 3FMGA 4IEQA 4R52A 4JRAA 1NE4A 2VULA 3LSDA 1WLDA 4AW7A 4BHPA 1VBD2 3Q8AA 1HJFA 1OH4A 2VPVA 1BBT1 3VBSA 3ZXAC 4XAAA 2A73B 2C24A 2VOXA 2WT2A 2Q8DA 3CLPA 4DO0A 3ZSLA 5GZDA 2IXHA 3FFQA 3WNNA 3VBFB 5FQ0A 2CAVA 3AL5A 1REEA 4L92A 4W8JA 2RMU3 2RS32 3U75A 4CP0A 5CFCC 2B5HA 4RS5A 3NWKA 4AI0A 4H14A 4CUCA 2VMGA 5FLHA 5C4WC 5DMYA 3H1MA 4QPGB 3H8UA 4FP2A 4HK9A 3D6EA 3SISA 2AR6A 4BCUA 3BTXA 3LA7A 5FXWA 1DZQA 3C7HA 3HR9A 3VUOA 3H8OA 2UU8A 1IG3A 4B7KA 2V73A 1R1A1 2KXLA 3F2ZA 2O1QA 5JWPA 2R32A 3W20A 3IN9A 1C1LA 2WA4A 1SPPB 1UZ0A 3SQOA 3ZLIA 4PDWB 3JB8A 2VECA 2EIBA 2XJTA 3LDBA 3PURA 5FFOC 5ISLA 4P14A 1X9TA 1TMF3 1J3RA 1URXA 1R093 1ULEA 1WW7A 1NLSA 2JDHA 2ZABA 1W2NA 3K3NA 3NV2A 4IGOA 3RI9A 1RC6A 1C4RA 4DXTA 2JDUA 2MHFA 1PO11 2LS6A 5T54A 4E4DX 5A3UA 5LY1A 3RYRA 4JV4A 2VUJA 2I2SA 3QH7A 3WUDA 3OBTA 4INDA 5C5UA 1BEV2 4MHRA 4NE9A 5GJ6A 4CDWB 5IAVA 5LA9A 3FHQA 3BPSA 4AVBA 2D3RA 1ENRA 2R0FA 4AFMA 3M4FA 3N35A 1DCSA 5F5CA 1QU0A 4JHTA 1X7NA 2JE9A 4AAPA 1LGCA 3MFCA 4K3UA 2HEYF 2QQIA 3E6CC 1QF3A 2UY9A 5C8WA 4COYA 3E1F1 1OUSA 2MNGA 4AHYA 1AR83 2ILMA 3ZXEA 1QHDA 4PI2A 1PIV1 4Y1XA 1UMIA 1QY4A 1G8WA 2R063 1CAUA 2AREA 2AC1A 2GP5A 4WBBA 3WHUA 2EVXA 1F8VA 1BK0A 1YUDA 5FZ1A 1QOTA 1H8VA 1GZWB 1DU3D 1UN1A 1POV0 1B35A 2PHLA 2WAOA 2RS11 2D6MA 2Z79A 5KHKA 4FVVA 2JEMA 1OQEA 2Y38A 4JGYB 4NWWA 4W4ZA 2Y6LA 1W6NA 1BQPA 2BNMA 3IMNA 1E5HA 2V4AA 3NNJA 4Y22B 4AGRA 2BP6A 1UW8A 3CHXA 3TB0A 4AF9A 1G9AA 2YHJA 3IKWA 3VDDA 1AXKA 2WZPP 1IPSA 3WF3A 5A3TA 1JZ3A 3OGSA 5I8SA 4RS5C 1H9WA 2UYBA 2CDPA 4XJAA 4IDZA 4MOAA 5IVJA 4BH9A 5BUVA 5FCCA 1W9SA 2JG8C 3VD5A 4A7YA 1FX5A 4TLFA 5BNNA 2CNAA 4P9YA 1W2UA 5FYCA 2AGSA 3GBFA 3MIDA 1W8TA 1RUD2 2K2SA 4Q4W1 4LBNA 4YG6A 4R4ZA 4WM8B 2PLV1 3WP3A 5FIXA 2CGNA 5FJKA 2Q8OA 5A3MA 3PUHA 4HFSA 3KQRA 3KV6A 2BGOA 1J84A 2E7TA 2PHFA 1A8DA 1AL23 2WLQA 3AMNA 4YGCA 4BK4A 2DVBA 3ZFGC 1QQP1 1UYPA 2BW8A 3T4VA 5EJ1B 2EALA 4RYDA 4XQ4A 1W99A 1RUE1 1ULCA 3CO2A 5TSWA 1XBFA 2EF6A 3NW4A 2OS2A 3I3DA 4QXCA 1LB2A 2YV8A 1VBE3 2ZHLA 1CAWB 3BCWA 3D3AA 1YFYA 1NE6A 1CIWA 1RUI3 3DF0A 5BXXA 2WFF1 4KWJA 1R1A2 3O1SA 1GOHA 3FLRA 5FV3A 3POIA 4JZRA 1A3KA 1HLCA 1WBLA 1OPOA 1ZBE3 2ZMLA 4NUBA 4PIXA 4UFHA 4XVHA 2E32A 3OUJA 1MS3A 1US2A 2HWD1 3P3PA 2RM23 3DECA 1OURA 2BV4A 2JDZA 2P3YA 4A3XA 4UFJA 3PMSA 1V00A 1PX3A 4YW6A 3RDIA 2WAAA 3OY8B 1E57A 4IV1B 4JKLA 1UIKA 1Z78A 2WDBA 4AQTA 1JUHA 4QDSA 4PF1A 4BU2A 1HDKA 2E26A 3WSOA 3R4DB 3WDXA 4DRVA 4AI2A 4HG6B 3WQ0A 1GP4A 4LBLA 3FWEA 2A3XA 2D5FA 2GN7A 2V5YA 3CU7A 4QX7A 4N43B 3VBOA 4BJ0A 1GOGA 5J96B 5LEKA 1W39A 3LDRA 4JTOA 3C3VA 4WM7A 3TEXA 2X05A 3ZIXA 2P3JA 1G9DA 1B35C 3GGLA 1IG0A 2FCUA 4K8FA 1CZTA 2HWC2 4KBZA 4TYSA 3RG0A 1OPMA 3HQRA 1MS8A 5HCBA 5IVFA 2VZVA 1SEFA 2YB7A 3JQWA 1U5IA 3VZJA 2HWE1 1DGWA 5ERLA 5A3LA 4GB33 4BQ3A 5C71A 1PZ9A 4CZSA 1LHWA 1WLCA 3POYA 1JYXA 3WNMA 2HYXA 1RUF3 3NNFA 4DEQA 4XFAA 3RZKA 5C3SA 3WG3A 5FZLA 1O5LA 2OUJA 3MUY1 1XU1A 2A6WA 1KGYA 4MXWB 1DQ2A 5E89A 5C9AB 5BNNC 3D0SA 5IW0A 4OQ8A 1I5PA 3A23A 4LPLA 3H1YA 1DF0A 4X8PA 1LOGA 2ZAAA 3IDBB 2B42B 1OVSA 1MQTB 2BQPA 3TRSB 4BM8A 3GBWA 1KJLA 4XXAA 4B4RA 2FZ2A 4JQTA 5J36A 3LA2A 1UX6A 2DVAA 3AYAA 1RGSA 4HL0A 3WQ1A 4NHXA 1BYHA 1OMIA 5FK7A 3N4MA 4KGQA 4LE4A 1DGRA 2VQUA 2D3SA 4GJZA 1E5IA 4OLLA 3PU3A 4URTA 3KCCA 4LQRA 2H0VA 5A70A 1KFUL 1DQ4A 4XE9A 4N9IA 2X5IB 2I45A 3EO6A 1AR92 1ZZ7A 5EFUA 3B9IA 5FYHA 2A75A 2VOVA 5FZOB 3GCWA 1Y7BA 1XB9A 3DYOA 1GSLA 3NKGA 2QZ2A 4NOTA 5E16A 3NAPB 2VUAA 1NCQC 5IWFA 4M3CE 3SEEA 4LO5B 3TN91 2VD7A 4XEZA 3TBDA 4NIIA 1QQP2 4D94A 2VXRA 2PYTA 5CG9A 3KMHA 1REDA 1H6XA 3LWCA 4LKDA 5LEJA 2WWJA 2YUEA 3M3OA 4MSVA 2HWF2 5FP8A 3RNSA 1OLRA 1SCRA 1Y3TA 2MPFA 3BKZA 2QTWB 4V1PA 4HPKA 4AVCA 2X29A 4R9DA 4Q4X1 3MZHA 3WG1A 4YYOA 5GM0A 1J59A 1GMMA 2EXKA 1VAKA 1W2AX 1IS5A 1BHGA 3AP9A 3D5OA 4CU9A 1NX9A 3VBOC 1OOPB 3QD6A 5FP4A 5F7UA 1S2BA 3ZXFA 4NWVA 4Q0PA 4WM7C 3QOPA 2YYOA 2ORXA 2OPWA 4A6OA 4CCLA 5FOJB 1LECA 1ZBA3 2Z5WA 4FP3A 2QDNA 1QJY2 1RJ7A 1HKDA 1ASJ2 5JZGA 2KD7A 1OFNA 3OGRA 4YFZA 2RMU1 5A32B 3PMEA 1LODA 4HKLA 5ACA3 1X8EA 2H6BA 3ZSMA 4UF0B 4A3ZA 4XTMA 5A6YA 1KRIA 5A3WA 1WCUA 3ZXLA 1FMD3 2ZGKA 4MGIE 4D7SA 2XKPA 4K20A 3T30A 2WO1A 1YC61 4WVZA 3TEWA 3WY6A 1BXHA 1HB4A 5DDJ3 4Q5OA 3WF1A 2RJKA 2WRAA 1AUYA 2VUCA 4JDMA 3LIGA 2YPJA 4BQYA 3MIFA 3ATGA 4DINB 3SKJE 4Q4V3 1VALA 2Q1MA 5LA2A 5CISA 2PHRA 4IEOA 5FPAA 3AMMA 1TMF1 3D82A 4MVTA 1JZ6A 1R091 3NL1A 4Q8LA 4BIFA 2RDQA 3ES4A 2JIGA 1K3IA 4IERA 2JD4A 2OZ6A 5FYMA 3NO8A 5FZKA 3T09A 1ENXA 4GJYA 3MEPA 5FY1A 1HQNA 3GCXA 5T3NA 2BUKA 3U10A 3KF3A 2FBEA 4XFIA 4CPBD 4QPYA 4HETA 4EJRA 1HX6A 4RHV3 4N7IA 3SKVA 3VBHB 2WQ4A 4BXSV 4NIAA 4DZGA 3M1HA 1HRI3 1XU2A 1POV3 4YW1A 3Q8EA 3DGTA 4Q0QA 1UL9A 2QNKA 1VJ2A 1AYM3 1SFPA 3KV4A 5FJHA 4CDXB 1CESA 4XCAA 4LBKA 3VZMA 1Q8VA 4XQDA 1JI6A 3I2IA 4QKFA 5F6LB 4RR3A 2K0GA 2A7AA 3ZPOA 1AR81 1JS9A 2B9UA 2IXKA 2BNNA 4IE7A 5FMDA 2ZGSA 4DXRA 5L7OB 2R061 4UWDA 2O8QA 3OD0A 5FY0A 5K0UA 4M4RA 1ULGA 4R9BA 4QDQA 2LUWA 4HANA 1G7YA 2XHNA 2D97A 3C7EA 2FDIA 1MZ6A 1H30A 3B9CA 4RSUA 2DBIA 5IVCA 4XUQA 4I01A 2BOIA 1YQ5A 2WA3A 1GLHA 5FY4A 4BE3A 3ZKYA 1DQ6A 1GU3A 2B46X 5C3OA 4HBNA 1I5ZA 2UY8A 2ZPXA 1R64A 1QJU2 3OYWB 4RFT0 3THDA 1QDOA 2D6OX 1UU6A 2GH2A 3FBYA 3MGUA 4YGEA 1UXXX 4PT6A 3ZFFC 3LEGA 1W8FA 4OULA 3BTZA 1ZZBA 1YHFA 1JZ7A 3VKLA 4ATEA 2JG9B 2TUNA 2WZ8A 1MR5A 1GP6A 4RGGA 1OT5A 4LO4B 3WQBA 3N7MA 1NA1A 1XNTA 1RUG2 4CRQA 3OGJA 2TNFA 4FOQA 3T1LA 3WCRA 2AENA 5CA6A 1DFQA 4FO9A 1WA4A 1O8PA 2PTMA 1AL21 1WMXA 1JUIA 5KBFA 1Q8PA 3BTAA 4DXZA 3ACGA 1LOFA 3AB0A 3O0WA 5L9RA 3SEPA 4AEDA 3N9NA 4YWAA 2E53A 4LJHA 1RJ8A 4FXGB 4KWKA 5AC92 2IVJA 3BVCA 3V65A 1UYYA 4QPIB 4CCDA 2FDKA 1UWWA 1VBE1 2PQQA 4IV3B 4A7KA
chains in the Genus database with same CATH topology
3LSEA 4RQPC 1SBDA 1PGW2 1ZBE1 3S30A 1NLRA 1D0HA 3K48A 4QT6A 2YDEA 2RM21 1V9U3 2DFCA 1VBC1 3VZKA 2VVDA 3AYEA 5JCTA 1N3QA 4XIOA 2OYZA 4RL7A 1LR5A 4RD7A 1KD7A 3MICA 3WDWA 4RR3C 4AI1A 3AM2A 4EWDA 1AR62 1WW6A 3AX4A 3HD8B 1V6NA 4G3YC 4IQPA 1ZVFA 5B2GB 1T6GC 4XJ8A 5CAZA 2F4PA 1LOCA 1NYWA 5K0UC 1OQDA 3FHIB 2BWAA 4WZFA 3VBRA 1ZREA 2WNEA 4XFCA 3NV4A 2BFUL 4XXPA 4AGGA 1W6OB 3KLSA 2GC1A 3P3NA 5I8TA 1C57A 3MIEA 1RMU3 1LCLA 4GMP0 5FPZA 1RIRA 2R1BA 2OIIA 3ACLA 3AMHA 3ETQA 5ABJA 4GB31 3ELNA 5SV5A 1LHUA 4DMIA 4LBOA 3RI8A 1AF9A 4XJUA 1RUF1 2WS93 1CX4A 4CP1A 4YW2A 4FOWA 4JGZB 1CN1A 4P5HA 3T2TA 1QH6A 5JMCA 3VKFC 1NA1C 2PHWA 2NLRA 3A4UA 4OHVA 3TNQA 1S0FA 3ASIA 1MZEA 5BNOA 1O3SA 4KU7A 2RR13 5H9RA 4YLZA 2AYHA 4R9CA 3VLBB 4BIOA 3V56A 2JECA 2D6PA 2RS52 4WVMB 4TZDA 1LOFC 4JAAA 3JD71 1Z0HA 4AEDC 3H3UA 4LHNA 1PVC2 2E63A 1LEDA 4YZ4A 2PHXA 4S2HA 2SBAA 1NY72 4GIQA 3RWNA 1G9BA 4ORFA 2VW0A 1WUVA 3ZYPA 5BV6A 5GZGA 1S0EA 3ILFA 3U4XA 4Q4Y3 4XBQA 1FT9A 4OZXA 3ZX7A 4D7TA 3AFKA 2MEV2 4MXVA 1MS1A 1RUC2 2I07B 4I3PA 2FZ1A 2JKBA 1F9KA 4AQSA 2WNVB 3V0BA 1C8M2 1J1LA 5GZCA 2WSVA 2DUQA 3VBRC 1Q56A 2ZGUA 3HAGA 3J26N 1PK6A 2R0HA 4IXLA 1HQWA 1ZM1A 4P9LA 1SFYA 5FO9B 1WCSA 1RVF1 2GAUA 2BGCA 3SXWA 5ACA1 1VBA2 2WNUB 4YGBA 2EXHA 4FPEA 5L73A 1R083 1LGBA 1FMD1 5JIAA 5DDJ1 3VHPA 5FMOL 1PM7A 1J3QA 2P34A 5D8AC 2E7QA 4Q4V1 2IC1A 3AFGA 1ZZ9A 4P9IA 5JSPA 2A3WA 2Z2SB 5BNOC 4ZU7A 3MLKA 5FTTC 1FOD3 1YO8A 2VU9A 2XPJA 4YVWB 5KWRA 4F8AA 1QWRA 1B09A 2HWB3 4XIKA 2ZGQA 4GKXA 2ZGPA 3GALA 4TSVA 1U12A 4RHV1 2P37A 4FPOB 3FLTA 2DCZA 1XNCA 1IKPA 1DLLA 1POV1 4CDUB 1HIXA 1RTVA 4Z92B 2PN5A 1GNZA 2WQZC 5CB7A 1AYM1 4EWEA 3O5SA 4KL1A 3WX5A 5BPXA 2R072 1YIPA 4K1YA 2R042 4X6RB 1D0GA 3JD72 1GZCA 4AI8A 5GLUA 2O0OA 3PVBB 3GBGA 1X82A 3IPVB 3BIWE 3OGGA 2UWAA 2GNBA 1YYNA 1VBB1 4I0BA 2DURA 1NZCA 4QQ2A 4CEYC 2UYAA 3FBMA 3RJRA 3ZXJA 3FX3A 3VZLA 5SV8A 3WZ1A 2QQPA 2DCYA 4WVWA 1PK6C 5C8CB 5CFDC 1RHI2 1MEC3 1PO22 1VRH2 3HT2A 2XKOA 2NZ9A 2ZX0A 4A2UA 2B45X 3CJIB 4AI3A 1CAXB 4AYUA 2ZX3A 2ZGTA 3PJYA 4W6XA 3USSA 4ASMB 1EV12 3S7IA 4Q29A 2PAKA 1OA3A 1PNGA 3IT8A 3OJBA 4AVSA 3FE5A 3JCIA 5LRRA 3OTFA 1JN2P 4AVAA 4COUA 4LE3A 4YGDA 1IS3A 2BEOA 4HLTA 1COV2 2ZHKA 4EN7B 1RVF2 2DUPA 4KQ7A 1WMDA 4PQ9A 3VBFA 1CAVA 3AZVA 1QXRA 1ZZCA 2JG8A 4P9XA 2CL2A 4QPGA 4RGAA 2ZX2A 3I54A 4FPJA 2GMEA 3VBSB 2VOKA 3EJKA 4XQWA 3J8F3 3ZXKA 1EAH2 3ZFEA 4Q2FA 1O3RA 2BPA2 5FQ0B 2ZTNA 4BMBA 3AP4A 1D2SA 2B8MA 1UPSA 3ZFGA 1V9U1 4LUMA 4XFFA 1NCRA 3KD4A 4DY5A 5GZFA 3G6JB 1QXPA 2ZX1A 3BOPA 3N7JA 4GMP3 1NQJA 4M3CB 1WBFA 2ZX4A 3B02A 1KS4A 1YFWA 3BPZA 3B93A 2ES3A 2P3KA 3LOIA 3RSJA 5JI7A 5DUWA 4GA9A 1REFA 5I0UA 1BCXA 2A6ZA 4Y5Z0 2VW2A 4R9AA 4J6GA 2DU0A 4PBPA 2EA7A 1RUH2 4CDWA 3WUCA 3QACA 3HBZA 3NJZA 5E1RA 3RRDA 3GF6A 1FPN2 1AR72 4OI2A 1W6PA 1RUJ2 3ZYRA 1SLAA 3B7MA 5FO7B 1RMU1 4KH9A 1DIWA 5JAXA 1HRV3 1YRZA 4HKWA 3MF6A 4B4PA 3FUOA 5DXDA 3DUIA 4XMIA 2D3PA 1IS4A 2JXAA 4KGGA 4MX3A 4OI1A 1VBB2 5DZEA 2CTVA 4PBOA 2WS91 4PLMA 2E9QA 5EXOA 2WZR2 2OZJA 4E2QA 4OHYA 4C91A 1GZWA 2VOWA 1PHMA 4OI0A 4Y1UA 2OVUA 3I2DA 4B29A 1AZDA 3VBUB 2ZHMA 1ZX5A 1MS9A 3BB6A 4LEJA 1ZRRA 1DZTA 2ZGOA 1WCDJ 2RR11 3SMHA 4XF1A 1DBNA 5KXEA 1KQRA 2A3YA 2W68A 3VBFC 5IT6A 2ZGMA 2GMPA 4N53B 2EXIA 4NVPA 4LLOA 4LA3A 4QQPA 4QPGC 2A6XA 2BYVE 3R05A 1W6NB 2VG9A 1BBT2 1V6MA 1MS4A 3ZFEC 3G7DA 5A33B 3VDDB 2SLIA 4XFGA 4JTNA 3MIGA 2JJ6A 2C0ZA 3JBG3 4M0NA 3WP5A 1QOSA 4QQLA 4GALA 3FZ3A 2GH8A 4Y1YA 1W0OA 4Q4Y1 1NCRC 5KHJA 5BNNB 3EBRA 2XJQA 2V09A 1N1VA 1IPJA 4XHXA 1RL3A 3ZN5A 1LJ7A 4PLNA 2ZZQA 3AP6A 3H7YA 2W0XA 2CGPA 1NCQA 1PGL1 3ZSKA 1ONAA 3A0NA 1DYPA 4CDWC 5FRAA 3WW4A 1SBFA 3O0XA 1EPZA 3PVOA 2ET1A 1XYPA 1PO12 4AHXA 1ZA4A 1OKQA 2DCTA 2X8KA 4BQ1A 4CDQB 1XRUA 3AYDA 1QKQA 1JH5A 3BOWA 1R081 2A71A 3HT1A 4N43A 3M8LA 4HVRA 1LHNA 1WD3A 1ZZ6A 2GSYA 4H7MA 1HXS3 3E6DA 4BYYA 1K5MA 4JGYC 1ND3B 1W6MA 3AJZA 3L9JT 3SCHA 4Z82A 1PIV2 1FOD1 3H7JA 1H9PA 5HCFA 3ECQA 4JDOA 4YM1A 2XGXA 2HWB1 2RS12 2XHKA 5IK5A 5C9AA 4MXWA 4FPKA 1HW5A 2DWRA 3PJQA 2PA7A 3KGLA 4C0BA 4KBBA 2GNTA 1ZRDA 4FTEA 1AYN3 2YGMA 3H3ZA 1U0AA 5E8AA 4IEXA 1H1IA 1MQTA 4AFDA 5JOYA 4I2OA 3DN7A 5D1IA 4LTAA 2DV9A 3RJ2X 4PIZA 3PVNA 3AK0A 4GH4B 1OHFA 2WWSA 5BY5A 4LO6B 1Z7S3 4Q4W2 2N7GA 2RHPA 4K40A 5LRSA 1ALYA 2GC0A 2PLV2 2X5IA 3PTYA 1PGSA 5JVVA 3WG2A 4BA6A 3VZOA 3UV9A 2ENRA 1N47A 3RZZA 5IUQA 3LAGA 1RUE2 4LBQA 2NN8A 1NG0A 1KJRA 1MEC1 4AEJA 5CNAA 1D4M3 1EYBA 3ZSJA 1N1SA 5FLIA 2CWMA 4TWTA 2Q4SA 2XBO3 5H9PA 4IV1C 1QJX3 2WFF2 4EV0A 1LEMA 1EP0A 1PMIA 4K7JA 2BTVC 3SH3A 4YZ5A 4YRDA 2D40A 3TYJA 2HWD2 4FPHA 2EAAA 4L9BA 1YIFA 2ZMNA 4FXKB 4L99A 1O5UA 1OOPA 4N43C 5IK8A 2O8OA 2ARBA 1TME3 1GBGA 4HPKB 1BKZA 1K5MC 1MZ5A 3DV8A 3E6BA 1IS6A 3IM0A 2B7YA 3ZFFA 4EROA 2A6VA 3POWA 4XMAA 4I0AA 1DGLA 2IXCA 1JOJA 1VBD3 4M00A 2NMNA 2PHTA 3J8F1 4E2SA 2GMMA 4EN0A 5JZGB 5C9AC 2VH9A 4L11A 3OF1A 5T50A 2DU1A 3RS6A 1V70A 2HWE2 4UBHA 2RS33 3KS7A 4META 3UK9A 3VKMA 3HN1A 1MQTC 2CY6A 4GMP1 3FC0A 3IBMA 4XF3A 5K9YA 2D43A 3FJSA 4MZUA 3NKTA 1O3QA 4AGVA 3NV3A 1VLNA 4YM2A 2R30A 4RQPA 2C5DA 1FAYA 1S0CA 1QXJA 4PIYA 2QKDA 2X5IC 3MPPG 4IETA 1O3TA 4KNCA 1UIJA 5H9SA 1PZ7A 2DFBA 3RYPA 3IDCB 4QGLA 5I91A 4CDXA 5GKAC 2G9GA 1H8TB 1GV9A 5GZEA 2BNOA 1HRV1 5T5PA 1ND2B 1JYCA 3M3EA 1BEV3 4LBJA 1DZRA 1W6QA 4XF4A 1VAVA 2DVFA 3VHNA 1KDMA 3B5LB 3KCXA 3ZN4A 3J9SA 3TN92 2NMOA 1I6XA 5KXCA 1OOPC 4DY3A 4CEWB 3I59A 4PCRA 4Q0SA 2P3IA 3ZVXA 2OUHA 4I09A 5T55A 4Q4X2 3KT7A 3I7DA 1GANA 4N90A 3OYWA 3ZN6B 1OLQA 3EQEA 5KXBA 3IDEA 2ATFA 1SLLA 2AZ5A 2HEWF 2UWCA 3FLPA 2WINB 3SH4A 1JXNA 5DUXA 1DGWX 3MLJA 1LHVA 4UW4A 4FCAA 2RMU2 2ZGNA 2JX9A 2BBVA 3POSA 1TNRA 4AVVA 3WDTA 1RUD3 1AXYA 1Q8QA 1RUI1 4OVEA 1ZYBA 4FPFA 2B39A 1GR3A 3EHKA 2NM1A 4XJZA 3VBHC 1TQ5A 1FI2A 4FQ4A 3WW3A 1TMF2 1R092 1S2KA 3LGRA 5GLVA 5I0SA 3APBA 2E6VA 1XQNA 1ENSA 1C5IA 1WW4A 3EXUA 4CDXC 2OA2A 2XLAA 3O7OA 4AK3A 3QH6A 1FV2A 1R1A3 3WHTA 1DHKB 4WVVA 4Z1VA 4LHLA 4Q1PA 4QX5A 1AX1A 4ZU5A 4FPLA 1Q43A 4B7EA 1H2NA 1TNFA 3AJYA 3DPRB 5FOBB 3GHMA 1AXZA 3AP7A 2YROA 1HXS1 3H1WA 1WMFA 5T52A 1MZFA 2XUMA 1HQLA 4AWDA 1CVNA 1AR82 2QCSB 3ZXGA 1WMEA 4CTEA 2IFRA 4DRRA 4W6YA 2D5HA 2R062 3L2HA 3AYCA 2VNRA 5JI9A 4N9HA 1IGOA 1QDCA 3USUB 4P9GA 4DPNA 4L2NA 4K1ZA 2HWC3 5D8AA 4MGYE 2JG9C 1VAMA 4OUMA 2KM2A 5ABJB 3OCPA 1AYN1 3RMYA 1L3JA 4PJYA 3W9AA 3WINE 2GNMA 3S6PA 1X50A 2ETEA 5DUVA 3JU9A 4UW6A 4QHBA 4M01A 3VL8A 1MS0A 4I0WB 5EWSA 5JIUA 4CYDA 4DB5A 4QPIC 1WGPA 2FMDA 1FV3A 3VN4A 4XTPA 5JOWA 5IK7A 3N3HA 3AXEA 4IV3C 4QQHA 4R4XA 2XB6C 3NVCA 4HSJA 4AEKA 4BWOA 3LA3A 1AL22 4J1XA 4MV2A 1IOAA 1M4WA 5AFBA 1QGLA 4AXOA 1MS5A 4HZFA 3U11A 4WV8A 4BMEA 5J3UA 2UWBA 1D4M1 2Y26A 1IQAA 1KS5A 1AR93 1VBE2 2XBO1 2IXLA 1RUI2 1QJX1 4CEYA 1ZBE2 3TOJA 1AL0G 3H0OA 1F5JA 5DG2A 2WIIB 2RM22 1AX0A 3JQXA 1QQP3 1VBC2 1U5YA 4GWNA 5CFDA 1ZZ8A 2GN3A 1TME1 1JHNA 1YNAA 2ZJCA 1ZBA1 3S7EA 2R1DA 2HWF3 2C9AA 1LHOA 2FMYA 3KT1A 4Y20B 3V0AB 1OD5A 4XYXA 2QE3A 3WQ7A 4LO7A 2CAUA 2WNUA 2PHDA 1H0BA 3N7KA 3HMYA 1CJDA 1VBD1 1H2MA 4HN0A 4N7UA 1IHMA 1ZNPA 4ISQA 4YVSB 3O12A 2NYYA 1BVVA 1QJY3 4AE2A 2VW1A 1ASJ3 2OPKA 2YXSA 4Q8KA 1LULA 4MGZE 5BNPA 3THTA 4C0HA 1O4ZA 3HWJA 1CGPA 2ZGLA 2IZWA 4GB32 4EN9B 4ES9A 5EYXA 1WD4A 3ZYIB 5E88A 2ERFA 1RUF2 1A8MA 2VMIA 3AP5A 1D4VB 5FLJA 4ZXKA 4YVWA 1GYKA 1O7FA 4H3WA 5CFCB 4QU2A 3I8TA 5J7MA 1HRI1 5C4WB 1DYKA 2A5ZA 4C1WA 4IL7A 1BMV1 1LGNA 3W59A 1X33A 1KFXL 1APNA 2XVLA 3AMQA 3AKPA 4PF5A 4WZCA 1C5HA 1PZ8A 4K9SA 5C6CA 3ZYJB 4LUKA 4JC1A 2Q0AA 3WP4A 1BEV1 4L8QA 4XOGA 4E9KA 4P9JA 3IPVA 1NXD1 1VIWB 3UJOA 2KA3A 2TBVA 3MIHA 3K51A 1BK1A 5JSOA 1AJOA 3B01A 2EIGA 2IXJA 4LO8A 2NPIA 5CIRA 4NHMA 1YI7A 4YW5A 4XDQA 1MVEA 5C8CA 3FFZA 3J4UH 4I3GA 3ALQA 4YG0A 1QNYA 4KG0A 4YFWA 1CAXA 5T5JA 5I8YA 1DDLA 2H6CA 4XFHA 3CF6E 2PAEA 2ZS6B 2DYCA 4XPVA 5FPXA 4I02A 2WNUC 3D8CA 4IEWA 5DG1A 4LULA 1G86A 4BZ4A 4Y4YA 3ZPYA 4S2DA 2PELA 3LKJA 3VHRA 1ZBA2 3B00A 1NXMA 3E97A 1R1ZA 4MYEA 5I0TA 4AHZA 5BNPC 4MH0E 2ZOEB 1QJU3 2EAKA 5JPNB 4U36A 2PHUA 4COZA 5ACA2 3SCGA 5CADA 3ILNA 1FMD2 4UW5A 4FPCA 3ST7A 1RUD1 1RUG3 1V6LA 4YVWC 4HVQA 5DDJ2 2QFEA 3JZVA 4QGNA 3WP6A 5L36A 1U5ZA 4Q4V2 4RS5B 4JVAA 2XJRA 3N36A 2DVGA 5LK5A 1CAVB 4B8EA 2BVBA 2JG8B 1RINA 4PDWA 5DZFA 4Z8BA 4CDUC 3C2UA 1EPWA 1YJKA 5AC93 1AJKA 4JCKA 3ZFEB 4M3CA 4RA0A 1XNKA 3AKSA 1G6NA 3ZDSA 4RHV2 2Q30A 3B3QE 3GHNA 3M7AA 3ZFGB 1HRI2 2ZCWA 1NCRB 5T5LA 2YMZA 3B69A 1LOAA 1SBEA 4JRLA 4YARA 1AYM2 1DGRN 2ET7A 5DUUA 1BMV2 4L97A 2BFUS 1VP6A 1KDKA 4H7LA 2Q5TA 2LM3A 1JBCA 1O4YA 1S0GA 3GZTB 1AR63 5C8CC 1NOVA 4HVOA 2XJPA 5F9TA 5AVPA 2QUOA 3VGIA 3CJIC 1IPKA 1G9FA 3TNPB 1XXNA 1OA4A 1XNBA 3NSTA 2YZ4A 3MFAA 1FNZA 1LRHA 1W6PB 5CVRA 3ENRA 2GU9A 3FUQA 1CPNA 2VVFA 2HWC1 4QD2A 2GC2A 1LU1A 1DQ1A 4JGYA 1H4GA 3VBUA 5FREA 4I30A 1CAUB 3URFA 4Y22A 3UKVA 2P2KA 4LLFA 3NV1A 2Y0IA 1FXZA 1B35B 3OPZA 4IEYA 1KXGA 3BODA 4N53A 3CEWA 1HV0A 1N1YA 4W65A 3GYDA 3MI8A 1GKBA 2UURA 2DTWA 1YXWA 3IIAA 3VBSC 1UZYA 1VB4A 4WM8A 5GLTA 1H1AA 4FOVA 3VL9A 5A33A 1AVBA 1J58A 4PDWC 3RYKA 2RS53 3MDPA 1ZRFA 4FSJA 4UBGA 2P17A 2YY1A 1XYNA 2XVKA 3R0RA 4YSFA 3DL3A 1PVC3 4XJ9A 2BWCA 1AR91 2R49A 2NP0A 2GALA 4ES8A 2W39A 1CAWA 4XW3A 3WR0A 5CG8A 1GZ9A 5EJ3A 4DS0A 1V9U2 4YM3A 5K7PA 1FNYA 3WT3A 4D69A 5LK7B 3RPQA 2NQYA 2WSUA 2ZBJA 3PNAA 1SFNA 2FQPA 3O14A 2IWGB 3WDVA 1SLBA 2HWF1 2MEV3 2DCJA 1F2NA 3OY8A 3U0ZA 4IV1A 1JTZX 4MGKE 5EYYA 3THPA 3LOBA 1RUC3 1NCQB 4E2GA 1DG6A 5KC6A 2HYKA 4B3NA 4E4ZA 2F6BA 1YJLA 2D98A 4CDQA 1C8M3 3GNEA 3M3IA 2ZZJA 5J98B 1VBC3 3WG4A 1VB2A 3M3QA 2VVEA 3TAYA 1A6CA 5FMOS 1QJY1 3WW2A 1ASJ1 4AG4A 1D2QA 1RMU2 1SCSA 3AMPA 1X8MA 1UKRA 1O91A 3VBUC 4DQAA 4M0HA 2DUOA 3MW2A 3VBOB 1VBA3 1CR7A 1ND3A 4SBVA 3VKNA 1AX2A 3ZMNA 2WS92 4WM7B 3H9AA 4FOYA 1CJPA 4ONUA 4Y26A 4N53C 2E7AA 2WJSA 3KB5A 1UKGA 3MIBA 4EN8B 1K5MB 2I74A 2QVSB 1W6MB 4QQOA 3UKNA 3WDUA 1HV1A 1JYIA 2A70A 4XBNA 4WM8C 2RR12 1V6JA 4MUVA 3VDDC 1PVXA 4NHLA 3E5QA 1C1FA 5I0RA 2HJIA 3SNMA 4XFBA 1LESA 5AFEA 3AZXA 3AZZA 1LTEA 2XLFA 3AZYA 2CV6A 1N3OA 3AXDA 4GH4A 4GKYA 4AHWA 3ILRA 4IEZA 2XWJB 4AFBA 5KHHA 4ASLA 5HXVA 3WLUA 3UKTA 1Q8SA 3NAPA 4QMAA 1ENQA 4COWA 4ZU4A 4Z2WA 2DCKA 2R073 3OD4A 2R043 4Q4Y2 4HMZA 4EN6B 3JD73 3CL1A 4ZKTB 1H1MA 5EZWA 4IEVA 1UZZA 4CP2A 5DZGA 5JLVA 2QJVA 2QZ3A 4BLJA 1PGL2 4CDQC 2D6LX 3WVJA 4OHZA 1S0IA 1XNDA 5FBZA 4LT5A 4LBQB 2VY0A 3M3CA 3RMXA 4AVTA 1RHI3 1SACA 1ULDA 5JOZA 3LZZA 1VRH3 1PO23 3ROUA 5J37A 1F5FA 3MLLA 4FPGA 2WFPA 2ZKNA 2H0BA 1Y43B 3QLQA 1QJU1 1GQHA 2D7FA 5HI0A 1X36A 1O4TA 2VGDA