5KWRA

Crystal structure of rat cerebellin-1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
139
structure length
139
Chain Sequence
SGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Cerebellin-1
publication title Conformational Plasticity in the Transsynaptic Neurexin-Cerebellin-Glutamate Receptor Adhesion Complex.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 30
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5kwrA00
1JH5A 4NN0A 3MI8A 1OSGA 4KGGA 4TSVA 1ALYA 2O0OA 3L9JT 4E4SA 2HEVF 4OULA 1OQDA 2R6QA 2TNFA 1TNFA 4MSVA 3AB0A 2R30A 5KWRA 3B94A 1D2QA 1PK6A 1I9RA 4KG8A 1XU2A 1WCKA 1S55A 1TNRA 2RE9A 2QDNA 4RSUA 5HBAA 4QQLA 4QQPA 2RJKA 3URFA 4N90A 4OUSA 3K51A 3TWIA 3TYJA 4QPYA 4G3YC 3LKJA 1C3HA 2WNVC 2JG8C 1U5ZA 1PK6B 5KC5A 4QQHA 1JTZX 2WNUC 1KXGA 2AZ5A 2RJLA 5L36A 4DB5A 4E4DX 3QD6A 1GR3A 2Q1MA 2HEYF 2Q8OA 2R32A 4EN0A 2HEWF 2X29A 1XU1A 1OQEA 1U5YA 4D7YA 2JG9B 4DOUA 3ME2A 1A8MA 4TWTA 3QBQA 4MXVA 2JG9A 2ZJCA 4OUMA 4QQ2A 2WNVB 3B9IA 4J6GA 3ALQA 5TSWA 1RJ8A 1O91A 2E7AA 2TUNA 2Z5WA 1D4VB 4F3JA 1RJ7A 2WNVA 4GIQA 1IQAA 2JG8A 1PK6C 2ZPXA 5BNQA 5CIRA 2WNUA 3IT8A 1C28A 3FC0A 4MXWB 2OIIA 3K48A 5L19A 4KGQA 1D0GA 1U5XA 1KD7A 3WD5A 4HT1T 3V56A 1DU3D 3B93A 2JG8B 2JG9C 2KA3A 1DG6A 4MXWA 2QE3A 4QQOA 5KC6A 2WNUB 4G4FA
chains in the Genus database with same CATH superfamily
1RUI1 2C26A 1LRHA 4JGYC 3RDIA 4COVA 1RUC1 3I3EA 5AFEA 3D8CA 4KG0A 4BA6A 3KT4A 4FT8A 1MZEA 4HFSA 3JBG3 1GOGA 2C1FA 1A8DA 4HN0A 1GUIA 4R52A 4JKKA 1LHOA 1B35A 1H1AA 1UY3A 3KGZA 3HD8B 3H8UA 1GQGA 3EB7A 1AR63 3ZFFC 3OGRA 1F2NA 4H14A 4UFIA 4UWDA 1QQP2 1HQNA 1LHWA 1SEFA 1W8OA 2Y6LA 2R062 5FYHA 1D2QA 1Y4WA 5IVEA 5FXZA 5FFOC 3OCPA 4R4XA 3F2ZA 3M4FA 2YG0A 3NKTA 4UFMA 2EIGA 3FE5A 4XQDA 5CADA 5GZGA 5JPMB 1GNZA 1TQ5A 4QQLA 3U4SA 4AR2A 4FCAA 1RUE1 4YVSC 5DDJ2 5F5AA 2GNBA 2Y6KA 3HQXA 3GZTB 4DXZA 4FQZA 2WRAA 1PGL2 3RNSA 2B8MA 3K4DA 4RR3C 3I4IA 4QX2A 4XCAA 3SITA 1VB2A 4IV3A 1HV0A 1UOJA 4CEYB 2DVBA 1JTZX 3AKTA 3LCPA 1G9CA 4LK7A 1YEWA 1R083 5FZBA 1XYNA 2QQVA 1DYOA 2WBKA 4GD4A 4Q4V2 5FZMA 2CDOA 2CAUA 4A45A 2ES3A 4LTAA 5FYTA 5JUVA 1EYBA 1G86A 5D21A 1UKGA 1RITA 2WN2A 3VBSA 3HN3A 3IMNA 4PIZA 4AZZA 1LR5A 4FXKB 1ACCA 3OPZA 3OEAA 1X82A 4BHPA 2IUWA 3GBFA 1MQTB 3H3LA 1I5PA 2VMCA 3HNBM 3QH7A 2WFPA 5JWPA 1HLCA 4UF0B 3U37A 5JI7A 3ZXJA 4TZDA 1RUD3 1W6OA 2PQSA 2WT2A 4WM7C 1V9U3 4OLLA 3AC0A 2TBVA 4FTBA 1DQ5A 4UAPA 1FMD1 2KD7A 4W6WA 3W21A 3ZFGA 1M06G 4GH4A 3ZR6A 2BYVE 1UF2C 3ZXAC 3O1MA 1S1AA 4MO3M 5GJ6A 4RN5A 3UJOA 2VE1A 2VQAA 2E7AA 2LW8A 2FCVA 3AYAA 2DCYA 2R042 2J1SA 3KF3A 4Q2FA 1UMIA 3AJZA 3JQWA 3Q8AA 4K1ZA 3HQRA 4I30A 3RZZA 1E57A 3NJVA 5FQ0B 1JXNA 1EUUA 1CZTA 2WFF1 1L7LA 2VMHA 1VBD2 3I2HA 4W4ZA 5FWEA 4AQ6A 4OMCA 1O3TA 2VMGA 4KU7A 1RUJ3 2JICA 2OQ6A 3EO6A 4XUTA 3RGBA 3ZDVA 5FYIA 1JHNA 3VV1A 5J48A 4AL9A 1UD1A 1UY0A 1NLSA 1H2NA 5C4WB 1JYXA 2CWSA 4XABA 4CP1A 1RHI1 3A23A 1JH5A 3AMMA 3RZLA 4RGAA 5FYUA 3JU9A 1YI7A 2VXJA 2YC0A 1S0GA 3AP4A 4V1PA 3NNMA 2JENA 2WINB 4JGZA 2GDFA 5FXXA 2ZGRA 5KXDA 2EICA 2PLV3 3K46A 1VR3A 3IPVA 4SLIA 4FOQA 4LBQA 4QPIA 4GMP3 1W3XA 2VM9A 2ERFA 2JDKA 1W2TA 4BOWA 1S0EA 1QWRA 1W8TA 5FP8A 4XAEA 3OY8A 5DAVA 3GHNA 1QH6A 3T0BA 5J09A 2A73B 1EUTA 3OD0A 4IEPA 5K0UC 4LA3A 3LEKA 1AZDA 2QJVA 3DXTA 1KITA 2GNMA 4A42A 1REDA 5KHKA 1RUH1 3B01A 2PHFA 2AR6A 3MV11 2GC2A 4AI0A 4EWAA 1OQ1A 2XOMA 3IZOA 5JMOA 4CCNA 3H8RA 1DQ4A 3USUA 2ID4A 4IV3B 3W58A 1PX3A 3M3QA 4IEOA 4A7YA 4P14A 3TYJA 4OI4A 2IFRA 4Z8BA 3OUJA 1MZ6A 3OUHA 3AZWA 3FFZA 5L7OB 2C0ZA 5BV6A 5A6QA 3AP5A 3CJIA 1U5ZA 1QY4A 2R073 5KHIA 3TEWA 5LEKA 5LEJA 2GC1A 1E5RA 1NLRA 4IETA 3TEYA 3VBSB 4E4DX 2A6WA 2EXJA 2HWC1 5EQUA 1W2NA 2HEYF 3VBUA 1REFA 2VOVA 1FAYA 1N3OA 5F37A 2WJSA 2PHLA 3AL5A 3KHBA 4LKDA 4XJAA 2XBO3 4Q0VA 3WQ7A 3OGGA 2YY1A 4FXGB 1CX4A 1ASJ3 1YIPA 5K8SA 1Q8OA 2A75A 1QDOA 1OQEA 2D7FA 1DGWX 1HB1A 1W6OB 2QQNA 3OBZA 2ADDA 4K20A 5FYCA 1O7FA 5HV4A 3T3YA 4JRLA 3VBHB 4QU1A 4QPWA 1VBC2 4IEUA 3SKJE 5FMCA 4NHYA 1CZSA 3RYPA 1OH3A 2ZBJA 3PUHA 4CDUB 1VMFA 4YG3A 1R092 1XOYA 3ES1A 3RPQA 4YGCA 2V4AA 2W1SA 1RUI3 3PTRB 1RUC3 2ZX2A 1RUNA 1TVGA 4R9DA 2WUHA 2RS12 4Q4W1 4TXWA 4CP9A 5FOJB 1F4AA 2WQZC 5FZEA 2RS51 5LBBA 5J37A 2ZPXA 5JSPA 1HRV1 3OD4A 3OUIA 2WN3A 4BJ0A 1RGSA 3KZ4C 3QACA 1UW8A 1LECA 4FI9A 5IVJA 1COV2 2X5IC 5H9SA 1XNBA 3FHAA 5IAXA 2PELA 4YNIA 3RQ0A 2WZR1 4QPGB 1ZBE1 5IFPA 4YRDA 4DEVA 2WR9A 3OBRA 4Q0QA 2A3YA 1FOD3 1C1FA 4B29A 1NCRC 4P5YA 4QWNA 1BBT2 2HWD2 3J8F1 1RUE3 4NIIA 4Z2AA 3VD5A 3V56A 3NMBA 3DCQA 2JG8B 3B93A 2R1DA 1GYKA 1ZZ6A 3LA3A 1N3PA 3POJA 5LRRA 1UN1A 4XIOA 2VOWA 3U10A 4QQOA 5A3WA 3VDDA 1OKOA 2RMU1 1N1VA 4BZ4A 4G4FA 4NN0A 3ST7A 1IS5A 1RMU2 2G9FA 4LBQB 2ARBA 2V73A 4XACA 2VCBA 3M3CA 4KGGA 2G1MA 3L9JT 3O1OA 3M7AA 5JPNB 1RUF2 3C7FA 2YROA 4N9IA 1SHWB 1WCDJ 1ZZ8A 3GYDA 2WLQA 5FZGA 4HSJA 4D94A 2BOJA 3PVNA 3W5MA 2JDUA 4B7KA 4GULA 3I54A 1SACA 2VCMA 3MIEA 2CY6A 3PNAA 1AR81 4LJHA 4DXRA 1DFQA 2DTYA 3H7JA 2J1TA 2PYTA 3BYWA 4HBNA 5CFDB 3RMXA 5IUQA 5LA1A 3B3QE 3B94A 3LFMA 1US2A 4I2OA 1X9TA 2RHPA 1V70A 3EQEA 4Y1ZA 1CPNA 5BXXA 1JUHA 4HVQA 5LB6A 5FK8A 1S55A 3JXSA 3TBDA 3ZSJA 2QDNA 3HPNA 2D6KA 1Y9GA 2XH6A 2JE9A 3HWJA 4AOCA 2IXLA 3CQOA 3VLBB 3TN91 3AZXA 2Y33A 1VAKA 4K8FA 3NRUA 4LK6A 5FYZA 3WCSA 2NZ9A 3LKJA 1W2UA 1FMD3 1G6NA 1UNBA 3B02A 4OHVA 3T2PA 5H9RA 5J98B 3TNQA 2CHHA 1DYPA 2HWE2 3PURA 1XNTA 3VBUB 2OPKA 3VD4A 4S2HA 3NNLA 3AVRA 3WP3A 1H0BA 4XF4A 1YIFA 5I0UA 2E6VA 2C4XA 3GJBA 3MDPA 4AFAA 5JCTA 3WQBA 3C3VA 1QJX2 2WFF3 1BKZA 2WA4A 3GBWA 3KMHA 3MW3A 5A1LA 1MEC1 2W1UA 5JOZA 2D3SA 1UIKA 4OI1A 4UOJA 1VMHA 5J1XA 1NQJA 3E6CC 5IK7A 2PHXA 3BI3A 1K12A 1OH4A 3P3NA 4PT6A 2VOXA 5F2SA 2CGNA 2OUHA 3VD3A 5CEHA 4I09A 4CCLA 1NY71 5GM0A 1PO11 5B2GB 1OKQA 2DV9A 5G04L 4FFIA 4ZY9A 4CP9B 5FZKA 5JZGA 1W8ZA 2BNMA 1BLZA 5FMBA 1GICA 2D5HA 4EE2A 4XHBA 5A7WA 1PZ9A 1PGSA 2JWPA 3LA7A 5KR7A 2JE8A 1D4VB 2P3KA 3N3HA 4WBBA 2O1QA 1EAH1 4JKLA 3V0AA 3PMEA 3NW4A 4CEYC 2QTWB 1BMV1 1URXA 4EZ4A 4XBNA 3HNMA 1UZYA 3I2KA 1YWKA 5KXCA 2AUYA 2Z42A 3C7HA 3MIGA 4I02A 1HRI2 4JCKA 3BGAA 1ZZ7A 1UXZA 3IB3A 1UZZA 1DHKB 2FCUA 2QCSB 3MUZ1 5F3IA 1AYN1 1LOEA 4ARYA 2VZVA 1RUH3 2XMLA 4XIKA 5I8YA 4HL0A 1UU4A 1POQA 3VDDB 3N7JA 4N7UA 2IVJA 3I3DA 4LEJA 1KD7A 1NG0A 3UKVA 2Y38A 1K5JA 4WV8A 5HPOA 1QJY2 3UJQA 4I3PA 1DG6A 5CFCB 2G4IA 2HWB1 1O3RA 3WEZA 5HCHA 2PN5A 5JR7B 4P5HA 2BU9A 1JU3A 1LOBA 1N47A 3DKQA 1JHJA 2WQ4A 4I0WB 1IG0A 4QXKA 1XBFA 4XEZA 5LK7B 1J1LA 2IWGB 1ALYA 3TOJA 1JYNA 1NCQA 4B8EA 5FO9B 4DIQA 4QB6A 3BTYA 4I01A 5FKCA 4KQ7A 5C7GA 3N9LA 2YYOA 5LA2A 3UL2A 2HWC3 1Z7S1 3WNKA 4JDNA 2K9ZA 1U0AA 1VE0A 1ZZCA 5FO7B 1KJRA 2GZWA 1IOAA 1PO21 2ET1A 4RYDA 1YQ2A 3CBNA 1SDWA 3PJYA 3H8OA 5FR3A 1Y9QA 2YFZA 4CUBA 2WWSA 2P34A 1SMVA 4BXSV 1E5IA 3ACGA 2DUQA 3T1MA 3ZSEA 2VZSA 3UKNA 1JI6A 4XFCA 1WA6X 4XURA 2W95A 3LIGA 4NRQA 2CAVA 4Z07A 4D6QA 5AC92 1ULFA 3MICA 4Y5Z0 3Q8FA 5C8CA 5FY7A 2P17A 2VW2A 3O12A 3ZFEA 2D5FA 4LO7A 3MFAA 2VMFA 3H0OA 2YUEA 5C4WC 5FP3A 5FYBA 2FDIA 1UPIA 5K7PA 5A1FA 2UWAA 4CDQA 1SLAA 3IAQA 5JR2A 2HBUA 2HLEA 3JUUA 4Q4W3 2WYFA 3POFA 3U14A 1SLIA 3E6BA 3M3EA 5FY4A 3VBOC 4B4PA 1DF0A 1K5MB 1ZZBA 2QUOA 2W52A 3HBZA 4M0HA 3RWNA 5G05L 1HRV3 4DMIA 1ZRDA 5J7MA 2Q8OA 3OGVA 1AXYA 1F9KA 3MF9A 2DBIA 3WV6A 5ABJB 2HKXA 2J22A 3Q8BA 2VZ3A 5FKBA 5LBCA 1STMA 2JIGA 2WZR3 4ATEA 1DGWA 4NHMA 1ZBE3 4XFBA 4M01A 2VG9A 1DLCA 2BW8A 4XQ4A 3H1WA 5IW0A 4NRPA 1XSQA 3O1TA 5JZGB 3J8F3 2V72A 3D3AA 1WCQA 3SQOA 4AVSA 5T50A 1VAVA 1W06A 2C6SA 1ENSA 3BTAA 5F3EA 3WHTA 1R1A1 4CUCA 2YHJA 3PUQA 2RMU3 1LOFA 4RGGA 3SHRA 1CAVB 1VBB2 2RR11 4LQRA 2F4PA 4LPLA 3J7LA 3WNXA 4JVAA 3CO2A 4Y20B 2D40A 3BN6A 1UCXA 2ZAAA 3LOIA 5L7OC 1ULOA 1H8TA 4LUKA 4RHV1 5F2WA 5I93A 3EHKA 3O1VA 4Y22A 1X8EA 4AGVA 2XKPA 4YWAA 2CYFA 1UMZA 2O8OA 3U0ZA 2ADEA 1PGW1 2ATFA 2QFEA 3L2YA 3O0XA 4XJ8A 4NOTA 1Q8SA 4X6RB 5SV5A 3VBFB 5KHGA 2XUMA 3FLTA 3WQ0A 2WAOA 3N9PA 2J1AA 3CL1A 1YFWA 2X10A 2VUJA 4LO5B 4XMIA 4RS5C 2Q8DA 3UKTA 5IJRA 5A3MA 1BEV1 3UGFA 1XXNA 4AXOA 4BYYA 3OGSA 1VBE1 2WDBA 4HT1T 3JD72 3TN93 3SH5A 3PHMA 4LE3A 1JYWA 3FBMA 4FPHA 1PM4A 5FMOS 2E26A 1JW6A 2QE3A 3VBHC 2A6XA 5ACA1 4COUA 2WNUB 3POGA 3KB5A 4BQYA 3A0NA 1XJAA 2XLFA 3MI8A 1QXJA 4RFRB 1W6NB 1HV1A 4Q8LA 4CDUC 2CDPA 4XBLA 4CVUA 4BMEA 3BU7A 3AMHA 2HEVF 2Z4FA 5KHHA 5FUIA 1CIWA 4HKWA 5E6HA 4HETA 2WA3A 1XNCA 3KCYA 4Q29A 5DG1A 4LOSA 2R0FA 1W05A 3P6BA 4XUNA 1WBFA 5DPNA 1MEC3 4FTSA 1RIRA 2PA7A 2XG3A 5H9QA 1BVVA 4BB3A 3EYPA 4NROA 3NNGA 4PDWA 1SFYA 1UY2A 1QOTA 4GWMA 3TB0A 4EWEA 4RGKA 4AGGA 1CZVA 3ZFEB 4ZU5A 2IFWA 3FX3A 3KT1A 1XNAA 1XE0A 4QPGC 1W9SA 4YZ3A 4DXSA 1QJU1 1PO13 4RFT0 4UYBA 3MHZA 2XJTA 4CRQA 3POYA 4FPYA 2VD7A 2EIDA 4XJZA 4J1XA 5FP9A 4LBJA 5BNNB 5K9YA 2JG8C 2OQ7A 2OT7A 4X6QB 4B1LA 2ZKNA 3PUAA 4N43B 1OOPA 3UK9A 1KXGA 2PHWA 4QX8A 1JYIA 4SBVA 1LNSA 1EAH3 2JKBA 2KM2A 4HVOA 1POV1 2OXBA 1ZBA2 2Q1MA 2VUCA 2XLGA 3HT1A 3B69A 3UYJA 4Q4Y2 1DGRA 1HB4A 4BPZA 1ULGA 2R32A 2HWF1 1KS4A 2QDRA 1PNFA 2OKXA 1AL21 4HG6B 3T30A 1KRIA 4A7KA 3AKRA 3MBWA 4GA9A 4R9AA 1AYN3 3GM8A 1C8M1 5FLJA 3EXUA 2DYCA 3HAGA 5CFDC 3WNLA 3R4SA 3WF3A 5BNPA 1L7QA 1SLTA 4IEQA 2EAAA 4JQTA 1UMHA 3SH3A 1CAUA 1W90A 5FPBA 1ONAA 3NWKA 3VKNA 4AAPA 4TLFA 2Q5TA 2XJVA 4OYUA 1MPXA 5DDJ1 5EFUA 3VL8A 3GXUA 2HWB3 4P9WA 3B00A 2BJSA 1VB4A 1V6KA 1D4M1 4Y33A 4O7XA 4OUMA 2FDGA 4YVWC 1PGL1 1H8TB 2NN8A 4P9GA 4AHZA 1FI2A 4Y22B 1JZ5A 3M3IA 1JN2P 1GZTA 5JOYA 5FPZA 2W68A 1L3JA 1LESA 3KV6A 3MPBA 3U75A 3ON7A 2CL2A 1MS0A 2DU1A 1AJOA 1Z7S3 4XBQA 4Q4V1 1WMDA 4JRAA 3CZUA 2XXZA 3JBG2 1PO23 3LDRA 5A7OA 2EXHA 1ZNPA 2VJXA 3SC7X 1I1EA 4QAWA 4UXAA 3IM0A 1AR62 3J4UH 4PLNA 5F6KA 3FC0A 3THTA 2WKKA 2VH9A 1S0JA 4ZS2A 4COWA 4AHWA 3WCRA 1ND3A 2VVEA 4CPBA 1D0GA 1ZX5A 3BKZA 3HEIA 4CP0A 5IK5A 4BQ5A 4EV0A 3I8TA 2DUPA 4K9SA 2WZPP 4L8QA 5IT6A 1HN1A 2P2KA 1UXXX 2NYYA 2YPDA 3MUY1 2ZEZA 4XJUA 4YM1A 4A6SA 3BVCA 1CN1A 1LHUA 1RUG1 3CF6E 1H6YA 4XTMA 1GBGA 4AI8A 3OGJA 2UWBA 4AE2A 4DRRA 4PDWB 3QOPA 2EXKA 2CU5A 1R082 4QX3A 3AP6A 3PMSA 1S0CA 1AYM1 1VBD1 1ST8A 5F5IA 4RQPB 4X8PA 2QNKA 1TE1B 1JUIA 4XC9A 3ZN5A 4A7ZA 1BK1A 1H9PA 1UOFA 2DU0A 2PFWA 5DZEA 3W20A 4D8MA 3BIEA 4QGNA 2RE9A 2ZGNA 1UU6A 4IEXA 5C5UA 1YRZA 3ZM8A 2FZ2A 4UW5A 3AKPA 3S30A 3URFA 4RA0A 3RZMA 3LF7A 4KI5M 1R1A3 2KR2A 3A0KA 4H2AA 4NE9A 1AF9A 1ZM1A 4YZ5A 2RR13 1RUD2 4YM2A 1ZRCA 1BHGA 1NZCA 1IKPA 2GAUA 1V9U2 1PK6B 3VZOA 3WHUA 3WQ1A 5CFCC 3OEBA 3BUCA 1L7RA 4R9BA 2H0VA 2P6HA 5LCWL 4AGRA 3GCXA 5BNOA 3O5SA 4Q5OA 1SG3A 4RHV3 1SPPA 2VZOA 3DPRC 1VALA 4NUBA 4KL1A 1GANA 4AQSA 3FWEA 1YQ5A 5BNPB 4S2GA 2WAAA 4AEJA 3G7DA 1IHMA 1CAUB 1SBDA 3LAGA 4NHKA 3M70A 4NAOA 3GALA 1XU1A 2K2SA 2VECA 3BCWA 1ND2A 3CKHA 4AEMA 2Y6GA 3HQUA 4BXFA 2UYBA 3I59B 5M0TA 2JJ6A 5DZGA 1BEV3 5DAWA 4C0BA 4DS0A 4H7MA 5FO8B 1VBE3 2YU2A 2GH8A 2W1WA 4ES8A 1KJLA 2CGPA 4CDWA 1NE6A 3THDA 4ZXKA 2QBXA 4CEWA 5ACA3 2VGDA 1FX5A 1GLHA 1RVF1 1UYXA 2LUWA 1F4HA 4AI9A 1X36A 4AEKA 1MS9A 4M3CB 2VMDA 1AR71 4MGTA 1SLCA 2XVKA 2ETEA 1O4TA 3C7OA 1V00A 2Z5WA 5ANQA 2DVFA 5FK7A 1NAEA 1AXKA 1W9YA 4NIGA 2J7MA 3ZSLA 1SBFA 4XDOA 4D6SA 4E2QA 5APAA 2PLV2 3N7MA 4Y1XA 2DURA 2VTFA 1QMJA 2XJUA 1EV11 4O9GA 1TME3 5FREA 1K5MC 4OI2A 3USSA 3IDAA 4LLFA 5F7UA 3RZGA 5F8PA 2A3WA 3FLRA 2VC9A 3WUDA 4EN7B 4CCDA 3H1MA 2WNOA 3RYKA 5C33A 3KVBA 5JIUA 5ABJC 1OLQA 1LGCA 1W9TA 1WMXA 4KGQA 4Y4YA 3I2FA 4ZONA 1NA1B 5AFBA 2JDAA 1QJU3 4WVZA 2J1EA 1YCIA 2YC4A 1SLLA 3PLQA 4HK9A 4WM8A 4ZKTB 5DG2A 1DZTA 2O8QA 2XVLA 2IXCA 1UYPA 4A6OA 1CJDA 3N36A 3ZIXA 5FIXA 4FSJA 2VVFA 3VKLA 4ASKA 4GQ7A 2LRPA 4DY5A 5KXBA 1GQPA 2I07B 5I8SA 3OBAA 4PBPA 1QU0A 4LBKA 3ZFFB 2YU1A 5CB7A 1POV3 2R072 4W65A 4HPKB 3WOGA 1H6XA 1NXMA 1S0FA 2XONA 5F5QA 5FMDA 4W50A 4XFHA 4NPLA 3WY6A 1V0AA 2HWF3 1WCSA 4NR1A 1F5FA 1WA4A 1AL23 1GP5A 3HOBA 3D6EA 4MVTA 4QDRA 4WVMB 3MFCA 5GLVA 3CHXA 1W0NA 3FUOA 2DDUA 4ZS3A 1C8M3 3B9CA 5BPXA 2ARXA 3K3OA 1OF4A 2JD4A 4AHXA 5ISLA 5I0RA 1AR91 2BBVA 2BQPA 1ASJ2 1W8HA 4B7EA 4CYDA 3VBFC 1CPMA 4CCEA 1EP0A 2HWD1 1B35B 4HKOA 4ES9A 5DDJ3 3ZYIB 4XF0A 3FUQA 5E88A 1J59A 2B46X 3HIFA 2ZX4A 4LITA 4GB31 3VZKA 5E16A 3UNPA 1Q8QA 3JCIA 1D4M3 1VBA3 4YFZA 3O1PA 1W39A 3WW1A 4ISQA 5LWBA 2E33A 4JKMA 2WNVC 1SPPB 4PCRA 4QKDA 3SISA 1YFUA 3ZSMA 2E31A 3BODA 1LOAA 3ACLA 3RI9A 3ABZA 5C8WA 1NXD1 2W91A 2WNUC 1JZ6A 2EF6A 4E4HA 2W47A 4Q4V3 2DFBA 2EXIA 2ZMKA 4GKYA 2Q4SA 4NHXA 4OFGA 4Q1RA 2X53S 1VRH1 3NQHA 5LY2A 4AFCA 4MX3A 4ISRA 1LOCA 4DOUA 5IWFA 4TWTA 4AI3A 3HT2A 1O4ZA 2J1VA 4LUMA 1FOD2 5FZ1A 1LHNA 2ZGUA 4G9SB 5A7SA 3POBA 4YW1A 2D6MA 4OMDA 3ZFEC 3ZO0B 4I0BA 5KBFA 1OF3A 4CUGA 3M3OA 2ET7A 1W6QA 4ZZ5A 3MV01 1C1LA 3BALA 4J25A 4Q4X1 3ZYGA 1RUG3 2OW4A 2ZXQA 3WDTA 4MGYE 3ZXEA 4QB2A 4UT5A 5BNNC 3G6JB 3E6DA 4FVVA 3OG2A 2ZTNA 1WWYA 1IQAA 3NNFA 3HR9A 3N9QA 4XTPA 3RFRA 4PBOA 2L9LA 1RUOA 4N43C 4YW6A 1DBNA 3MGUA 1LODA 5HCFA 1QJX1 3QLQA 1AYM3 1VBD3 2YV8A 4AYUA 1TMF1 1NKGA 1HN0A 4FFGA 1H8VA 3VHOA 4FPKA 3ZFGB 1PX4A 4GH4B 1BQPA 3VZLA 5D8AC 2GALA 4AW7A 4Q0SA 1Q8PA 4QB1A 2B45X 3ZLIA 2BGOA 3ASIA 3WD5A 3PU3A 4AEDA 1E5SA 2BNNA 2QZ3A 2BGPA 2I74A 2B5HA 2D3PA 3WG3A 5ANNA 5IVYA 3U11A 1O5UA 3WP5A 1LOFC 4E9KA 5FDBA 5FUPA 4BK4A 3J9SA 2BEOA 3T4VA 3VDBA 3ZYHA 4AF9A 1ZRIA 1BVP1 3LSEA 4IV1A 1EPWA 4WZCA 1FMD2 4YFWA 3WW3A 1H8TC 4J1WA 1OI6A 4CU6A 4LIUA 5CBLA 3ETQA 2B42B 2OA2A 4Y24A 5F3CA 1UO9A 3VN4A 4N53A 2IXKA 4QM9A 1EY2A 3GDBA 4XOGA 1HRI1 1H4GA 4CDXA 4LKEA 3BPSA 2UYAA 5CKMA 2AENA 3CDZB 3N9OA 5LA9A 2WFF2 1CD3G 4LULA 1SLBA 4WVWA 1UU5A 4MG2A 2PHUA 2IC1A 4JTNA 5C3SA 3D5OA 1H2KA 1XYPA 1W8UA 2ZGKA 4JGZB 5FZAA 5F1RA 1YUDA 5CZKA 3IPVB 5FZ6A 2CNAA 2F17A 4N90A 1DLLA 2AGSA 4QPIB 1YXWA 1C5IA 4ITCA 4U36A 1I6XA 5H9PA 1SFNA 1GP4A 1XNKA 5CYYA 4JV4A 5FLHA 2W46A 3VZMA 5EPAA 3OY8B 1RVF3 3T0DA 2RJ2A 4NWVA 4HSLA 4XZUG 3VZJA 2XL7A 1CAXA 4LBQD 3VBRA 4XZPA 1AR73 4M4PA 2AEZA 3K3NA 2LALA 3JB8A 5A80A 1O6UA 1GWKA 1OFSA 1NT0A 2AC1A 2WT1A 4QU2A 2DWRA 4JGYA 4CCJA 1IG3A 1ENRA 1O5LA 1QEXA 4Q26A 3USUB 4YG0A 2X05A 2ZHLA 3ZYBA 2EALA 2E63A 3DL3A 1EV13 4XXPA 4DY3A 2V5DA 2OYZA 1C57A 3H1YA 1OT5A 4NIAA 1UY4A 5CG8A 1NOVA 5DUXA 1MVEA 2X09A 5C3RA 1ZA7A 1PVXA 2VULA 3CJIB 2E32A 2WO2A 3AFGA 2VZPA 4Y3OA 3IDEA 4TN7A 5LATA 4R9CA 4RQPC 3ME2A 1W8NA 4OVEA 4MGSA 5EYXA 1RUH2 2B9VA 3RZKA 3CZJA 4PIYA 3SCFA 2VZTA 5JMCA 3V0BA 2JG9A 4Q1PA 1HXS1 1F8VA 3WDXA 4DUWA 1SFPA 3AP7A 3MZHA 1JYCA 4AQ2A 3AMPA 4YVSA 4TYSA 1FYUA 1S2KA 3DYMA 4NJ4A 1LEMA 5FZ9A 1PVC1 1XYOA 2WNEA 2LS6A 3M2MA 3AFKA 3N35A 4RR3A 2QQLA 4XCBA 5GLWA 3WUCA 1XQNA 1GZWA 4XETA 1PK6C 5BNQA 1DZRA 5CVRA 4I3GA 3LE0A 5EHDA 4Y4RA 4YM3A 2ZEWA 2XKOA 4Z92B 1W0OA 1JZ2A 3NV1A 3E5QA 4JDMA 4OZOA 2HWC2 5F3GA 1HIXA 3D0JA 3WNOA 2JD9A 2VZRA 1SZBA 3Q9OA 3R4DB 1GZ9A 3OJBA 2UWCA 3ZXFA 4JZRA 1AR93 1X7NA 4XMAA 2BFUS 3S57A 3POIA 1JU4A 1H2MA 1FPN1 1RHI3 4YGDA 2HWD3 4EN6B 4HN1A 1RC6A 2PQQA 3ZPYA 2A7AA 2KA3A 4K6BA 1J1TA 1H2LA 4MXWA 4GB33 3VHRA 4FP2A 4UW6A 2BOIA 1YLLA 1CESA 3TAYA 3AXEA 4JHTA 3MF6A 1GV9A 2EA7A 1PZ7A 2PAMA 2J1RA 1QNYA 4WM7A 5AVAA 1OMIA 2R1BA 3H7YA 3WG4A 3JQXA 5J36A 4URAA 2YPJA 2TNFA 2Y60A 3FN9A 4P9IA 1RYYA 3VB9A 2JDHA 4FFHA 4CDXB 4F8AA 1TNFA 5LBFA 2VXRA 2WS91 3OOXA 4LNVA 3AB0A 4Q4W2 5FYVA 1VRH3 4E8DA 1GNHA 1PHMA 1UX7A 1Z78A 4IUGA 3S6PA 2R30A 2JKXA 5LK5A 5T55A 4AVAA 2NM1A 3LDKA 4YZ2A 2VY0A 1OA4A 3DYOA 4LXLA 5FTTC 5FY8A 1MQTC 3ZYJB 5JLVA 2RS31 3R05A 2ZX1A 2WZR2 2YGLA 4RSUA 3GF6A 5FZOA 3W9AA 1ZBE2 2W2IA 5A7NA 1CAXB 2VW0A 4NHLA 3VBRB 1PMJX 3IKWA 4AFBA 4D69A 4DXTA 1NX9A 4LHLA 2BTVC 3SH4A 3O1UA 3J8F2 3KS7A 1C3HA 1RXGA 3D82A 4MH0E 1NA1C 3AYDA 5FJKA 2WABA 5EZWA 2XJSA 1OC1A 1M4WA 3FMGA 4QX5A 4Q4X3 4E27A 2RMU2 1IGOA 2FDJA 3I2DA 1WLWA 2VNVA 4HKLA 1WUVA 1YJLA 4K8RB 2PHTA 5L9RA 3WZ1A 3KGLA 2JX9A 3RJRA 1QJX3 4N9HA 1SDDB 1WD3A 1IS6A 2GH2A 3P5BA 4XXAA 2HEWF 2MEV1 2XJQA 4DEQA 1TMF3 1XE7A 3KT7A 1F35A 4CP2A 2QQUA 4YW7A 3N4MA 1UKRA 5LZ6A 1GOFA 2W87A 3V0BB 5FYYA 2JG9B 2UY9A 1BYHA 2LTNA 3WT3A 5LBEA 5LRSA 1PMIA 4MYEA 2AH2A 3I3MA 4ASLA 2BZDA 4YVSB 2XVGA 3MLJA 4MGKE 1POV0 4LBNA 3ROUA 2ZGSA 1W6MA 4H55A 2Z79A 4IDZA 4V2WA 5JSRA 2ZMLA 2ZJCA 3B5LB 4OHWA 1DDLA 1OHFA 5IHRA 4RR3B 4QQ2A 4ARXA 3FZ3A 1B35C 2RS53 2D3RA 1RJ8A 4LOTA 1PIV1 4BDVB 5DN2A 5FLIA 1RJ7A 3CLPA 3POEA 3TEXA 1LB2A 3B7MA 3PUIA 4XF1A 4XDPA 3KV5A 5KXEA 4EN9B 3W59A 1AJKA 3HN1A 3SXWA 5JXGA 4W6XA 1HRI3 4P02B 4KBZA 2VBBA 4ORFA 2C5DA 2XDVA 4KWKA 2EIBA 1DP0A 4MXWB 5A7WB 4QMAA 3C2UA 1MEC2 4E8CA 5J96B 2D6PA 5T52A 2RM21 2IXHA 2G9ZA 5FXVA 2C9KA 3SEEA 2DCKA 4IV3C 3V0AB 5CA6A 1W8WA 3P3PA 3WF0A 3CJXA 3BU0A 3BPZA 5I8TA 2HYXA 5IVBA 2YFUA 2XHKA 4GWIA 4C8DA 1NY72 2RV9A 1PO12 2FMDA 2Y6HA 3IAPA 3VDAA 4LBLA 4NPRA 3A4UA 2ZZQA 4FFFA 2HJIA 1U5IA 2Y6FA 1GWLA 4L92A 5FPUA 1AR83 4BU2A 4QGMA 3O1SA 2FMYA 2EVXA 2R6QA 4YW5A 3VBSC 5DABA 4EZHA 3I7DA 4A41A 5GLUA 4YW3A 3LB9A 4IGPA 1VPHA 4CU9A 1BJQA 2WSUA 1V6LA 1EAH2 5DAPA 3KV9A 5GLZA 2YBKA 1QJEA 3KQ4B 3ZVXA 2Y8KA 5KWRA 5C5TA 1JZ4A 1BMV2 3AKQA 3M1HA 4XFGA 1CJPA 2QQPA 5FAXA 5FZ0A 3GCWA 2A71A 1H9WA 2VOTA 3LDBA 3FHIB 3EJKA 2FHRA 4XJ9A 2A5ZA 3KF5A 1NCQB 4Y1UA 2VMEA 2IXJA 1CONA 4K7JA 1AYN2 2RDSA 4QQPA 5JXIA 3ZFGC 3KCCA 5CAZA 4GH4C 1ENQA 2YB7A 3Q8CA 4ZPIA 4K1YA 4MADA 2AEYA 1HXS3 4IGQA 3VKFC 1MVQA 2OPWA 1NCRA 3I3QA 2GSYA 4LHSA 3UGGA 5HCAA 1MS1A 1Y7BA 3BOWA 3IMMA 2HWB2 3VZNA 2QQIA 3HJRA 4L99A 2Q8EA 4XW3A 5KHJA 4IXLA 1MS8A 1PVC3 1VMJA 3VKMA 3VD7A 4BH9A 5L36A 1ENXA 2VO5A 4MGZE 4DB5A 2G19A 1O3SA 2NP0A 1HQWA 4DQAA 4QKNA 2FZ1A 1N3QA 5A3TA 1LAJA 5C8CB 2PTMA 1IPJA 2NLRA 3AM2A 1Z7S2 3LD8A 3ACHA 2GNTA 3ZPOA 4DNYA 2ZGTA 1HB3A 1PO22 3OB8A 4Q0UA 5A32A 4UW4A 3AZVA 1W6MB 4JDOA 1LGNA 2VNRA 4XF3A 3L2HA 5EWSA 4H3WA 4CDQB 3CNAA 4QM8A 1FPN3 2BGCA 1UOGA 1FNZA 3VKOA 4Y1VA 4NVPA 4MOAA 4YZ4A 1GU3A 1ULEA 3ZX7A 4HANA 1H1IA 4JGZC 4QDQA 2Q1ZB 1DIWA 1QKQA 3LA2A 3PVOA 5IYYA 2D6OX 4QPIC 4UI9L 2P4EA 5C9AA 3IN9A 2NMOA 5EJZB 3ZXDA 5A33A 2GNDA 3ELNA 2VL4A 4META 2R7EB 2X8KA 2ZGMA 3MW4A 4BWOA 1QQP1 1UOBA 2E51A 5L73A 3PVBB 2WZ8A 4AVVA 2R061 3BB6A 2WS93 2Y0IA 2BPA2 1ULPA 4FOYA 2VTXJ 1CX1A 2DCZA 2YDEA 5JSOA 1H4HA 1W3VA 3IDCB 2NMNA 2ORZA 5A3OA 4DFSA 2NQYA 1YHFA 5A3PA 1LU2A 5FP7A 3RS6A 5DQ0A 3A22A 5E1RA 2OIIA 2RS33 5FXWA 1KGYA 2Y34A 3RRDA 5T3NA 4LHNA 2JECA 1AHSA 3K77A 5IVCA 3VUOA 1CR7A 1DU3D 3CJIC 1HJGA 3ENRA 4XILA 5A7PA 4UBGA 1R1ZA 1V6IA 2D43A 2OZJA 4S2FA 4QDSA 1CQ9A 4BQXA 1R64A 3LPGA 2ZHMA 2P37A 3R4UA 4ZXEA 1O4YA 1OSGA 3ETPA 3E97A 1R1A2 4A3ZA 1ZZ9A 4IE0A 3VBUC 4WVVA 1MR5A 1AX2A 4C91A 2RR12 3NO8A 5GZFA 5HXVA 2RG4A 3CEWA 1IS3A 4AVTA 4YG6A 1Q43A 2VQUA 3DF0A 3POWA 1C8NA 4AFMA 2VPVA 1VJ2A 1N1SA 4KH9A 2GMMA 3RG0A 3RZJA 4XUQA 4RHV2 3DGTA 2QQOA 3ZR5A 1LOGA 2MEV3 2N7GA 3ES4A 1WKYA 1ZRFA 4PI0A 4TTGA 4CSWA 4CEYA 4KNCA 5JOXA 4FOVA 5C3QA 1G9DA 4LO4B 1PGW2 1WCKA 3FBYA 3PU8A 2ZGOA 4MHUA 4AG4A 2OX0A 2WT0A 3WXPA 4XFAA 5HBAA 2FDKA 1V6NA 3PIGA 2DUOA 4LORA 1E5HA 4ZHNA 1BEV2 1TZOA 4BQ2A 2FDHA 1KQRA 1VBE2 3NV4A 3THPA 2R041 1GZCA 1C5HA 1W9FA 4UFKA 4PIXA 4A2UA 3KWVA 1U12A 5ACA2 1PIV3 5C3OA 2MHFA 2JE7A 3T2OA 1C4RA 5DMYA 5LA0A 3FFQA 2R071 3ILRA 4BIFA 2EIEA 4EROA 5A1AA 1WCUA 3J7HA 5A32B 5JDBA 4CXYA 4X8NA 2W5FA 1K42A 4IGOA 4FO9A 5FMOL 2R16A 2H0BA 4E2GA 4QKFA 5CG9A 2RDQA 3ZN4A 2X29A 4COZA 1OPMA 5FY1A 4CUAA 4YW4A 2CWMA 3WG1A 4WZFA 4GZ9A 2RVAA 1XNDA 2VQTA 5FZHA 1TME2 5FPVA 5IATA 2J1UA 3VDDC 1OOPB 1W03A 2RM23 5HXMA 4LA2A 5EXOA 1DYKA 4KMQA 5DAQA 5C9AB 5FQ0A 3HBKA 2PHRA 4DPNA 4BMBA 5A33B 1QH7A 4BISA 2VW1A 1ULDA 1QJU2 2JEMA 1FV3A 3AK0A 4J6GA 3ZKYA 4OQ8A 1ZREA 4FPFA 3I2IA 1LCLA 3I2JA 1US3A 3A21A 3U4XA 1WLTA 5FZDA 3K4AA 1CAWA 3IIAA 3JB4C 4XF9A 1AX1A 5C4WA 1IKQA 4BQ1A 5D1IA 1DQ0A 4UW3A 4K40A 2W39A 3N9MA 4P08A 2ARCA 1T6BX 3VGIA 1OFNA 2F4LA 3VBOA 1CVNA 4FPGA 4XHXA 1AXZA 1RUJ2 1FT9A 1HB2A 1WMFA 3LEMA 4M3CF 4PLOA 4L9BA 5FRAA 2HWF2 5ERLA 4YLZA 5I0DA 3HNYM 1AL22 5T5OA 3AYCA 3K48A 5L19A 2VCAA 3POSA 4QHBA 4ATFA 1C8M2 1U5XA 2IVIB 4N8MA 4XQWA 4CCMA 3N9NA 4HK8A 2Y6JA 1AX0A 2JG9C 2GC3A 4C0HA 1FOD1 1OURA 4NO4A 4R4ZA 2GP3A 4M0NA 2GMEA 4JX0A 2DVGA 4JHZA 3WDVA 2W0XA 2D44A 4IL7A 3GZAA 4TSVA 1D4M2 1EPZA 1S2BA 1GSLA 1VBA2 1Z0HA 3V65A 4E4SA 1YYNA 4EQVA 1JBCA 1F31A 4OHXA 4IESA 3TNPB 3UETA 1ND3B 1O3QA 3AL6A 1JOBA 5FZ7A 3N7KA 5FPAA 2WO1A 1WLCA 2XLAA 3H3ZA 1NYWA 5CKQA 2A6ZA 1RL3A 5F39A 1ODMA 5FUNA 5FZLA 3AX4A 5JAXA 5L7OA 4FPOB 4IE6A 5IVVA 4CPBD 2YC2A 1TEIA 2VVDA 1CIYA 3OBTA 3GZEA 4FP3A 1VBC1 1LKNA 1XU2A 3KD4A 1BK0A 1JYTA 2B9UA 4AHYA 2VAUA 4LLOA 4XDQA 3RZHA 1ZA4A 5F6LB 4FBFA 1R091 1P8JA 4GALA 5JZGC 4DUXA 1UY1A 2RJKA 4XPVA 1W28A 4OUSA 2MNGA 2C24A 1H30A 4YYOA 3AP9A 4RS5A 4W8JA 4GWNA 2PMWB 2BERA 5GZDA 2RS11 3NJYA 4NPMA 2Y64A 1W04A 4ET7A 3WF4A 1VIWB 2VOKA 3MW2A 3FHQA 3VBHA 1WW5A 1J3QA 1QQP3 2W9XA 2YBSA 3QD6A 2XJPA 1COV1 3T0AA 3ZN6A 2R063 4CDUA 4F7ZA 1JODA 4YZ1A 1RUG2 3MO4A 2ZCWA 3J7NA 2XBO2 1F5JA 1D0HA 1LENA 1VRBA 4HVRA 2ZHNA 3O14A 1IQDC 1J83A 3PVEA 5HI0A 1BBT1 3WX5A 1NUKA 1U5YA 3ZYRA 4D7YA 3WF1A 4YARA 1AYM2 2XR4A 1OUSA 1DQ6A 3KM5A 5A3UA 3O7OA 1WGPA 5BNOB 1MZ5A 2ENRA 3KVAA 1RMU1 1UPSA 1NCQC 2R49A 3BTXA 5I0SA 4P9LA 5CKNA 1RUI2 1UZVA 1CAWB 1RUF1 2VQ0A 2Q8CA 1RUC2 2YBPA 4QPGA 4Y26A 1AVBA 1NLQA 1ND2B 2P3YA 1YJKA 3P1IA 1DZQA 3LPFA 5F32A 1UIJA 5K4LA 4NIDA 3VBOB 4LHKA 1SCSA 1G8WA 2JG8A 3S5QA 2DCJA 5CIRA 4BM8A 2BRTA 4CE8A 2WO3A 5BY5A 4CDWB 5FV3A 1GFF2 1S2EA 1W6PA 4AAXA 4CEWB 2B39A 3AZYA 3PJQA 1ZYBA 1GMMA 2WIIB 3OF1A 5C8CC 3VHPA 4YSFA 3EBRA 2BUKA 1Y3TA 3GBGA 1OA3A 3LWCA 2VUDA 1W0PA 4HZFA 3AKSA 1RUE2 2JB4A 4U2AA 3T2QA 4E4ZA 3SKVA 5JXHA 3T08A 3ATGA 2VCCA 5CFDA 3VHNA 4EJRA 2RDRA 2VZQA 2VNGA 4CU7A 2HWE1 4CDQC 3MIFA 1QDCA 1OLME 4QXHA 5EV7A 4BQ4A 5HV0A 4OHYA 2R043 4PLMA 2JDYA 3EMRA 2VBPA 1PM7A 3HVDA 3MPPG 2O0OA 1RVF2 3ZXKA 3GNEA 4YVWA 1OQDA 2IXIA 1WW7A 2BVBA 3ECQA 5LY1A 1AR72 4C1WA 3RVHA 5DUVA 5JXJA 3T2TA 2DCTA 2ORXA 5I91A 2CGOA 2BVVA 1XE8A 5EIYB 3QH6A 4WM8B 1DCSA 3K2OA 3E5UA 3RI8A 4L2NA 4JC1A 2JDPA 2WLPA 1I9RA 4HLTA 2GN7A 4PJYA 5BYNA 1ZVFA 5EYYA 2ZABA 3NKGA 1EV12 1S0DA 3KQRA 4RS5B 2ILMA 3LFIA 2W94A 1OD3A 3WW4A 2XQRA 3TWIA 3LEIA 2P3JA 3NAPA 2UY8A 4R8HA 2Z69A 1RXFA 5DUUA 4LE4A 4AVCA 4FOWA 1UYZA 3ZN6B 4IE4A 1JYVA 2QQKA 4OQ9A 2AREA 2W3JA 3ORJA 4XE9A 4IERA 1HJFA 4CXWA 3QCWA 4JTOA 2RJLA 2V09A 4IEWA 1SBEA 1W8FA 5JI9A 5E8AA 1XRUA 2VZUA 1REEA 1GR3A 3PDQA 4HMZA 5CNAA 3MLLA 5FZ8A 2JB8A 1AL0G 2Q30A 2FD8A 5DXDA 4P9YA 1HW5A 4Z82A 3MIHA 2ZMNA 1K45A 5C6CA 1IS4A 5L9BA 3T1LA 2JDMA 4UFLA 1OPOA 2PXJA 5FJHA 1MS4A 2WYSA 3ZXGA 1QJY1 4P00B 5C3PA 4IE5A 5FWJA 4B1MA 2E53A 4QHZA 4QXBA 4D3WA 5JIAA 4GXLA 4GJYA 1AR92 2XGXA 2ZS6B 1RHI2 5IK4A 3O1RA 3MIDA 3MIBA 3WINE 3O0WA 3SNMA 4LIVA 4MLOA 4GB32 4QXCA 4ZU4A 3RYRA 1Q3EA 3AXDA 3K4ZA 4GWJA 3ILNA 4UFJA 2P1BA 1QXRA 5DZFA 2XQXA 1W6PB 1W99A 3INAA 3KLSA 3UV9A 4F3JA 2D98A 2PHDA 1MS5A 5GZEA 2A1XA 4XJWA 3HMYA 1HKDA 5CFCA 1WLDA 5LASA 5CISA 1GKBA 4PDWC 5GALA 2AACA 4O9EA 2V5YA 4Z1VA 3H9AA 1SQ4A 2ZGQA 3ZMNA 3NJZA 3UESA 1QXPA 1Y43B 2ZGPA 3WNNA 1GNYA 3DPRA 1UAIA 2YZ4A 3SCGA 1D7PM 1VBC3 2QQJA 3GHMA 1HX6A 1PZ8A 1VRH2 1W6QB 2B4KA 2FQPA 1YQ6A 3H50A 3LZZA 4HXCA 4KWLA 5AC91 1JZ8A 1NZIA 1R093 1MZFA 1UZWA 4IQPA 4FAHA 1LU1A 3H8XA 4OZXA 3LSDA 1WD4A 3KHCA 2K46A 4V2VA 1T2XA 1X33A 3J7MA 1OOPC 5FPXA 4YVWB 4C90A 4BLJA 2XJRA 2RS13 5C9AC 1ODNA 4GJZA 5A3LA 3ZSKA 1BCXA 1UX6A 1QGLA 2CTVA 3NVCA 4OULA 1OA2A 1XSRA 3FLPA 1V6OA 3WG2A 2XPJA 1COV3 2BV4A 2OVUA 4Q4X2 4RL7A 4AEDB 4OHZA 4O61A 1WZXA 5BNPC 2CSGA 4M4RA 2Z2SB 2HH9A 1G9BA 2ZZJA 2A6VA 2WWJA 4MHRA 1BBT3 3D0SA 3WW2A 1LULA 3NAPB 3PUSA 4H7LA 1TNRA 4IV1B 1TMF2 1WW6A 3FL7A 4D6RA 4IW3A 1W2OA 4YGBA 1K5MA 3THCA 3WF2A 5IK8A 2DF7A 3DV8A 1VBB1 4BE3A 3GJAA 1RMU3 4INDA 3J26N 2P5BA 3E5XA 4YW2A 5ABJA 5C70A 2H6BA 3MYXA 2QKDA 1RUF3 4N53B 3PIJA 5JVVA 3TEZA 4KWUA 4NMIA 5IAVA 3RWKX 3NJXA 3ZKUA 1YNAA 2ZX0A 2RDNA 4IEZA 2RS52 4BIOA 1JS9A 1NQDA 1HRV2 1APNA 2JDZA 3WP4A 3R0RA 2WZEA 2ZKLA 3DN7A 3OSDA 2ZGLA 4Q8KA 1CAVA 1I5ZA 3IDBB 1QF3A 4HOOA 1ND3C 4MV2A 4Y20A 2HBTA 4L11A 4URTA 2A70A 4XFFA 2VR4A 3LEGA 3ZYFA 3JD71 2Y0OA 3KCXA 1I3HA 3I2OA 1YQ8A 4M3CE 2E7TA 2G9GA 3I49A 1A8MA 1IZ3A 3QBQA 3LIHA 4Y5SA 5T5LA 4JGYB 5A70A 2R0HA 3ZMOA 4CTEA 5B4NA 1JOPA 1G7YA 1PNGA 4AVBA 4DUVA 2HWE3 2DVAA 4QX0A 3VBFA 1MS3A 5FY9A 3ZOIA 3ILFA 4S2DA 4IE7A 1XPWA 2DFCA 1YI9A 3ALQA 4PQQA 3UT0A 1O91A 4AK3A 2TUNA 1S4CA 2YGMA 1YQCA 4FAGA 3ZYPA 4MGIE 2BWCA 2WNVA 1X9PA 3DPRB 1WBLA 4GIQA 3WNMA 2XB6C 3WVJA 1AR82 1D2SA 3IWZA 2BDRA 3ZXLA 3SMHA 1JZ7A 1W2AX 1YFXA 2WNUA 1JMUB 3NL1A 1AUYA 3OPTA 3MEPA 2Q0AA 4NRMA 1KS5A 4BLIA 1W6NA 4I0AA 5LW9A 5K0UA 4DZGA 5B4XA 2UURA 2E9QA 3SEPA 4CCKA 2P6CA 2LROA 2D93A 2NPIA 4LBOA 4B3NA 4FPEA 1GZWB 1OLMA 1OLRA 2LM3A 3I97A 5FPLA 5T5PA 2DBNA 3TN92 3CIHA 5C71A 4LMFA 1CGPA 2W92A 1K3IA 5BNOC 2BWAA 3OPWA 1Q56A 4DINB 3D4KA 4FPJA 1BXHA 1Q5OA 3OYWA 5FYMA 3X29B 1HXS2 4CZSA 1ZBA1 3CU7A 4O65A 1DGRN 1FV2A 1QOSA 2JIJA 4AWDA 2ARAA 1O8SA 4XYXA 5E89A 4Q4Y1 2A3XA 1G9AA 2UU8A 4AQTA 3WNPA 5GZCA 2SBAA 5SV8A 3RJ2X 1ND2C 1PVC2 3LGRA 3NV2A 4AI2A 2QZ2A 3H3UA 4M00A 1A34A 5L9VA 1LTEA 5BNNA 1O59A 3ZDSA 2IZWA 4FTEA 5DUWA 1LHVA 2JXAA 5BUVA 4N43A 5DAXA 5A6YA 1QJY3 4CDWC 2W1QA 4WM7B 4QHOA 4CEWC 3LQCA 3I2GA 2BP6A 5JOWA 1X50A 2GMPA 2V4VA 1UQXA 4W6YA 2B7YA 4HONA 1ZRRA 4YPJA 1F15A 4QPYA 1Q8VA 2JDNA 5D8AA 4G3YC 5I0TA 1XC6A 3T4HB 3AJYA 1FPN2 1DGLA 1UYYA 5FP4A 3AMNA 1DQ2A 1WMEA 3VDCA 4GMP0 1G9FA 3C7GA 4NIHA 2PAEA 5KC5A 4RD7A 1J84A 4BQWA 1OVPA 4PQ9A 1KEXA 3JBG1 1X8MA 4BCUA 2Y26A 4UBHA 2VTXA 2MPFA 5GLTA 4AFDA 3BOPA 1J3RA 1YC61 5FZOB 3NNJA 1V6MA 4K21A 4Y1YA 2VZ1A 4CCCA 5FZCA 2D6NA 3UGHA 1AR61 2I45A 4Q27A 3S7EA 3U07A 3WR0A 1GQHA 2XWJB 3LOBA 4EN0A 4LBMA 5HCBA 5EJ1B 2X5IA 2WS92 1OD5A 1YO8A 1OUXA 4WM8C 2ZACA 4PI2A 4FPLA 3IIIA 4P9XA 5AC93 4A44A 2QQMA 2GU9A 3K75B 2OUJA 3N7LA 2RS32 4ONUA 3WDUA 2WQ8A 3E1F1 4A3XA 2ZA9A 1UZ0A 2Q1FA 2WNVB 1MACA 3OTFA 1UL9A 4E2SA 2DVDA 3ACIA 1WW4A 4C1XA 4GKXA 1GP6A 1QIQA 2BBAA 3DYPA 1R081 1A3KA 2OZ6A 4XFIA 5A7QA 4LT5A 4QX7A 5EP9A 5K0UB 4IEVA 5F5CA 4ZU7A 1KFXL 3IT8A 4L0PA 1C28A 3F95A 5FBJA 5J3UA 2I2SA 2C9AA 3IBMA 1FATA 4PHZA 4EWDA 1PMHX 1LJ7A 4QD2A 4XUPA 5GKAC 2VNOA 3NV3A 1KFUL 3DUIA 1XB9A 4DRVA 2MEV2 3DEMA 1N1TA 5T54A 3WDYA 2VU9A 1JOJA 1TME1 5A6ZA 4BK5A 1DQ1A 4D7TA 4CU8A 4TLGA 5FZ3A 5FZIA 1VBB3 3OYWB 1RUD1 3U1XA 4Y5TA 1KDKA 5AVPA 1V9U1 4UFHA 4Q0PA 3WDWA 3KSCA 5KC6A 2AZ5A 3O0VA 4RQPA 1FNYA 4P9JA 3GGLA 2ZEXA 3PL0A 4QX1A 4EN8B 3U78A 2KXLA 2AYHA 3R6SA 4KWJA 1QHDA 2YXSA 4CXXA 4ASMB 2BNOA 4YGEA 1QJZA 2PAKA 2GP5A 4MUVA 2WC2A 5FY5A 1PIV2 2A6YA 4MSVA 3TRSB 1S0IA 3AYEA 1H1MA 2H6CA 4K3UA 4PF5A 2XHNA 2ZHKA 4OI0A 1IPSA 4D0QA 1PK6A 2QQWA 1LEDA 1W9WA 4KG8A 1RUJ1 3APBA 5A6XA 1S0BA 1JZ3A 4OUEA 5FYSA 3JD73 4NAMA 5D8AB 1QNWA 1Y9MA 2W08A 3DXUA 4PF1A 2HYKA 4LR4A 3I3BA 1J58A 1GWMA 2VMIA 3Q8EA 4YM0A 3WP6A 2ZX3A 3K51A 2XUEA 1A6CA 1RTVA 3KV4A 4XUOA 2FDFA 3S0MA 2RM22 1ULCA 1T6GC 4B4QA 3AZZA 3AMQA 2DTWA 4FPCA 3WLUA 3GZUC 5FOBB 4JAAA 1GOHA 2BFUL 2QVSB 4QQHA 4QT6A 3I59A 1VBA1 2GN3A 1VLNA 4NWWA 4BQ3A 3WSOA 2PLV1 3C8XA 3BIWE 4MGQA 2X5IB 3W5NA 2WL1A 4GMP1 4N7IA 3ACFA 1VP6A 3A7QA 4L97A 2WWUA 5FZFA 2F6BA 2VUAA 2E7QA 3H42B 4QGLA 3C7EA 1LGBA 1OVSA 4D7SA 3CMGA 1IPKA 1HQLA 1NCRB 2O14A 2ZEYA 2ZAHA 3AVSA 3MLKA 4M3CA 4AEDC 4ZZ8A 5IVFA 5CU1A 4LO6B 2VBDA 2TEPA 1FXZA 2P3IA 2EAKA 2XWBB 3M8LA 4KU8A 5D2AA 3SCHA 3SLIA 4XAAA 1CWPA 3VD9A 1HDKA 3NAPC 4MXVA 4LKSA 3RSJA 4IV1C 4MZUA 1TG7A 1MQTA 1O8PA 4A4AA 4FQ4A 2XL9A 1J3PA 5FCCA 1QJFA 4UF0A 3B9IA 4KBBA 4F83A 2D6LX 2OS2A 1YFYA 3JZVA 5TSWA 3S5AA 1ZBA3 1QOOA 5FBZA 4GAZA 5IFTA 2WSVA 1UWWA 4N53C 4Q4Y3 1SCRA 3ZIWA 4CDXC 1NA1A 1VAMA 4AI1A 3ITQA 5FZ4A 3V64A 1NE4A 2GC0A 2YMZA 2SLIA 4IEYA 5FY0A 3PTYA 2D97A 4LO8A 4OCTA 1RINA 2XBO1 3DKWA 4JQRA 1RB8G 2WO7A 1ASJ1 1A78A 3S7IA 4XVHA 2FBEA 4CCOA 3ZFFA 5T5JA 1OBNA 5A3NA 3BTZA 4COYA 2FCTA 1B09A 4QKBA 4DO0A 5F9TA 4CA9A 4HPKA 1BZWA 1OXCA 2ZOEB 3NSTA 3VL9A 4EYUA 2K0GA 2J42A 1N1YA 3FJSA 4LKFA 3T09A 3VBRC 4B4RA 5EJ3A 1KDMA 4Z2WA 3DECA 4WVMA 2CV6A 3RMYA 1V6JA
chains in the Genus database with same CATH topology
1RUI1 4JGYC 1LRHA 3RDIA 4COVA 1RUC1 5AFEA 3D8CA 4KG0A 4BA6A 3KT4A 4FT8A 1MZEA 4HFSA 3JBG3 4HN0A 2C1FA 1A8DA 4R52A 1LHOA 1B35A 1H1AA 3KGZA 3HD8B 3H8UA 1GQGA 1AR63 1F2NA 4H14A 1QQP2 1HQNA 1LHWA 1SEFA 2R062 1D2QA 5FFOC 3OCPA 4R4XA 3M4FA 3NKTA 4FTSA 2EIGA 3FE5A 4XQDA 5CADA 5GZGA 5JPMB 1GNZA 1TQ5A 4QQLA 4FCAA 1RUE1 4YVSC 5DDJ2 2GNBA 3HQXA 3GZTB 4DXZA 4FQZA 1PGL2 3RNSA 2B8MA 4RR3C 3I4IA 3SITA 1VB2A 4IV3A 1HV0A 4CEYB 2DVBA 1JTZX 3AKTA 3LCPA 1G9CA 1R083 1XYNA 4Q4V2 2CAUA 2ES3A 4LTAA 1EYBA 1G86A 1UKGA 1RITA 3VBSA 3IMNA 4PIZA 1LR5A 4FXKB 3OPZA 1X82A 4BHPA 3GBFA 1MQTB 3QH7A 2WFPA 5JWPA 1HLCA 3ZXJA 5JI7A 4TZDA 1RUD3 1W6OA 2WT2A 4WM7C 1V9U3 4OLLA 2TBVA 4FTBA 1DQ5A 1FMD1 4W6WA 3ZFGA 1M06G 4GH4A 2BYVE 1UF2C 3ZXAC 1S1AA 5GJ6A 3UJOA 2VQAA 2E7AA 3AYAA 2DCYA 2R042 4Q2FA 3AJZA 3JQWA 4K1ZA 4I30A 3RZZA 1E57A 5FQ0B 1JXNA 2WFF1 2VMHA 1VBD2 4AQ6A 1O3TA 2VMGA 4KU7A 1RUJ3 2JICA 3EO6A 1JHNA 3VV1A 5J48A 1UD1A 1NLSA 1H2NA 5C4WB 2CWSA 4CP1A 1RHI1 3AMMA 1JH5A 4RGAA 3JU9A 1YI7A 4V1PA 2YC0A 1S0GA 3AP4A 2JENA 2WINB 4JGZA 2GDFA 2ZGRA 5KXDA 2PLV3 1VR3A 3IPVA 4SLIA 4FOQA 4LBQA 4QPIA 4GMP3 2ERFA 4BOWA 1S0EA 1QWRA 3OY8A 3GHNA 1QH6A 5J09A 2A73B 3OD0A 4IEPA 5K0UC 4LA3A 1AZDA 2QJVA 1KITA 2GNMA 1REDA 5KHKA 1RUH1 3B01A 2PHFA 2AR6A 4AI0A 2GC2A 4EWAA 1OQ1A 1DQ4A 3USUA 4IV3B 3W58A 3M3QA 4IEOA 4A7YA 4P14A 3TYJA 4OI4A 2IFRA 4Z8BA 1MZ6A 3AZWA 3FFZA 5L7OB 2C0ZA 5BV6A 3AP5A 3CJIA 1U5ZA 1QY4A 2R073 5KHIA 5LEKA 5LEJA 2GC1A 1NLRA 4IETA 3VBSB 4E4DX 2A6WA 2EXJA 2HWC1 2HEYF 3VBUA 1REFA 2VOVA 1FAYA 1N3OA 2WJSA 2PHLA 4XJAA 2XBO3 4Q0VA 3WQ7A 3OGGA 2YY1A 4FXGB 1CX4A 1ASJ3 1YIPA 5K8SA 1Q8OA 2A75A 1QDOA 1OQEA 2D7FA 1DGWX 1W6OB 4K20A 1O7FA 4JRLA 3VBHB 1VBC2 4IEUA 3RYPA 2ZBJA 4CDUB 4YG3A 1R092 3ES1A 3RPQA 4YGCA 1RUI3 1RUC3 2ZX2A 1RUNA 4R9DA 2RS12 4Q4W1 5FOJB 2WQZC 2RS51 5J37A 2ZPXA 5JSPA 1HRV1 3OD4A 1RGSA 3KZ4C 3QACA 1UW8A 1LECA 1COV2 2X5IC 5H9SA 1XNBA 2PELA 4YNIA 3RQ0A 2WZR1 4QPGB 1ZBE1 4YRDA 3OBRA 4Q0QA 2A3YA 1FOD3 1C1FA 4B29A 1NCRC 1BBT2 2HWD2 3J8F1 1RUE3 3V56A 2JG8B 3B93A 2R1DA 1GYKA 1ZZ6A 3LA3A 1N3PA 5LRRA 1UN1A 4XIOA 2VOWA 3U10A 4QQOA 3VDDA 2RMU1 1N1VA 4BZ4A 4G4FA 4NN0A 3ST7A 1IS5A 1RMU2 2G9FA 4LBQB 2ARBA 2V73A 3M3CA 4KGGA 3L9JT 3M7AA 5JPNB 1RUF2 4N9IA 2YROA 1WCDJ 1ZZ8A 4D94A 3GYDA 2WLQA 4HSJA 3PVNA 4B7KA 4GULA 3I54A 1SACA 3MIEA 3PNAA 2CY6A 1AR81 1DFQA 2DTYA 3H7JA 2PYTA 5CFDB 4HBNA 3RMXA 5IUQA 3B3QE 3B94A 4I2OA 2RHPA 1V70A 3EQEA 4Y1ZA 1CPNA 5BXXA 1JUHA 4HVQA 1S55A 3TBDA 3ZSJA 2QDNA 2D6KA 2XH6A 2JE9A 3HWJA 2IXLA 3VLBB 3TN91 3AZXA 1VAKA 4K8FA 3WCSA 2NZ9A 3LKJA 1W2UA 1FMD3 1G6NA 3B02A 4OHVA 5H9RA 5J98B 3TNQA 1DYPA 2HWE2 3VBUB 2OPKA 4S2HA 3WP3A 1H0BA 4XF4A 1YIFA 5I0UA 2E6VA 3MDPA 4AFAA 5JCTA 3C3VA 1QJX2 2WFF3 1BKZA 2WA4A 3GBWA 3KMHA 3MW3A 1MEC1 5JOZA 2D3SA 1UIKA 4OI1A 1NQJA 3E6CC 5IK7A 2PHXA 3P3NA 2VOXA 2CGNA 2OUHA 4I09A 1NY71 5GM0A 1PO11 5B2GB 1OKQA 2DV9A 5JZGA 2BNMA 1GICA 2D5HA 4XHBA 1PZ9A 1PGSA 3LA7A 1D4VB 2P3KA 3N3HA 4WBBA 2O1QA 1EAH1 3V0AA 3PMEA 3NW4A 4CEYC 1BMV1 1URXA 4XBNA 1UZYA 1YWKA 5KXCA 2AUYA 2Z42A 3MIGA 4I02A 1HRI2 4JCKA 1ZZ7A 1UZZA 1DHKB 2QCSB 1AYN1 1LOEA 4XIKA 1RUH3 5I8YA 4HL0A 1UU4A 3VDDB 3N7JA 4N7UA 4LEJA 1KD7A 1NG0A 3UKVA 2Y38A 4WV8A 1QJY2 3UJQA 4I3PA 1DG6A 5CFCB 2G4IA 2HWB1 1O3RA 2PN5A 5JR7B 4P5HA 1LOBA 1N47A 4I0WB 4XEZA 2WQ4A 4QXKA 5LK7B 1J1LA 2IWGB 1ALYA 3TOJA 1NCQA 4B8EA 5FO9B 4I01A 4KQ7A 2YYOA 3UL2A 2HWC3 1Z7S1 4JDNA 2K9ZA 1U0AA 1ZZCA 5FO7B 1KJRA 2GZWA 1IOAA 1PO21 2ET1A 3PJYA 1SDWA 1Y9QA 2WWSA 2P34A 1SMVA 2DUQA 3T1MA 3ZSEA 3UKNA 4XFCA 5AC92 2CAVA 4Z07A 1ULFA 3MICA 4Y5Z0 5C8CA 2P17A 2VW2A 3O12A 3ZFEA 2D5FA 4LO7A 3MFAA 3H0OA 2YUEA 5C4WC 1UPIA 5K7PA 2UWAA 4CDQA 1SLAA 3JUUA 4Q4W3 1SLIA 3E6BA 3M3EA 3VBOC 4B4PA 1DF0A 1K5MB 1ZZBA 2QUOA 2W52A 3HBZA 4M0HA 3RWNA 1ZRDA 1HRV3 4DMIA 5J7MA 2Q8OA 1AXYA 1F9KA 3MF9A 5ABJB 3WV6A 2HKXA 2WZR3 4ATEA 1DGWA 4NHMA 1ZBE3 4XFBA 4M01A 2VG9A 2BW8A 4XQ4A 3H1WA 5JZGB 3J8F3 4AVSA 5T50A 1VAVA 1ENSA 3BTAA 3WHTA 1R1A1 2YHJA 4RGGA 2RMU3 1LOFA 3SHRA 1CAVB 1VBB2 2RR11 2F4PA 3WNXA 4JVAA 3CO2A 4Y20B 2D40A 1UCXA 2ZAAA 3LOIA 5L7OC 1H8TA 4LUKA 4RHV1 5I93A 3EHKA 4Y22A 1X8EA 4AGVA 2XKPA 2CYFA 1UMZA 2O8OA 3U0ZA 2QFEA 1PGW1 2ATFA 3L2YA 3O0XA 4XJ8A 4NOTA 1Q8SA 4X6RB 5SV5A 3VBFB 5KHGA 2XUMA 3FLTA 3WQ0A 3CL1A 1YFWA 4LO5B 2VUJA 4XMIA 4RS5C 3UKTA 5A3MA 1BEV1 1XXNA 4AXOA 4BYYA 1VBE1 4HT1T 3JD72 3TN93 3SH5A 3PHMA 4LE3A 3FBMA 4FPHA 5FMOS 1JW6A 2QE3A 3VBHC 2A6XA 5ACA1 4COUA 2WNUB 3KB5A 3A0NA 2XLFA 3MI8A 1QXJA 1W6NB 1HV1A 4Q8LA 4CDUC 4XBLA 4BMEA 3BU7A 3AMHA 2HEVF 5KHHA 1CIWA 4HKWA 4HETA 2WA3A 1XNCA 3KCYA 4Q29A 5DG1A 2R0FA 1WBFA 1MEC3 1RIRA 2PA7A 2XG3A 5H9QA 1BVVA 4PDWA 1SFYA 4GWMA 1QOTA 3TB0A 4EWEA 4AGGA 3ZFEB 4ZU5A 2IFWA 3FX3A 3KT1A 4QPGC 4YZ3A 1QJU1 1PO13 4RFT0 2XJTA 4CRQA 3POYA 4FPYA 4XJZA 4J1XA 5BNNB 4LBJA 5K9YA 2JG8C 4X6QB 2ZKNA 4N43B 1OOPA 3UK9A 1KXGA 2PHWA 1JYIA 4SBVA 1EAH3 2JKBA 2KM2A 4HVOA 1POV1 1ZBA2 2Q1MA 2XLGA 3HT1A 3B69A 4Q4Y2 1DGRA 4BPZA 1ULGA 2R32A 2HWF1 1KS4A 2QDRA 1PNFA 1KRIA 1AL21 4A7KA 3AKRA 4GA9A 4R9AA 1AYN3 1C8M1 5FLJA 3EXUA 2DYCA 3HAGA 5CFDC 3R4SA 5BNPA 1SLTA 4IEQA 2EAAA 3SH3A 1CAUA 1ONAA 3NWKA 3VKNA 4TLFA 2Q5TA 2XJVA 5DDJ1 5EFUA 3VL8A 2HWB3 4P9WA 3B00A 1VB4A 1V6KA 1D4M1 1PGL1 4OUMA 4YVWC 1H8TB 2NN8A 4P9GA 4AHZA 1FI2A 4Y22B 3M3IA 1JN2P 5JOYA 5FPZA 2W68A 1L3JA 1LESA 3MPBA 2CL2A 1MS0A 2DU1A 1AJOA 1Z7S3 4XBQA 4Q4V1 1WMDA 4JRAA 3JBG2 1PO23 2EXHA 1ZNPA 1I1EA 4UXAA 3IM0A 1AR62 3J4UH 4PLNA 5F6KA 3FC0A 3THTA 2WKKA 2VH9A 1S0JA 4COWA 4AHWA 1ND3A 2VVEA 1D0GA 1ZX5A 4CP0A 5IK5A 4EV0A 3I8TA 2DUPA 4K9SA 2WZPP 4L8QA 5IT6A 2P2KA 2NYYA 4XJUA 4YM1A 1CN1A 1LHUA 1RUG1 3CF6E 4XTMA 1GBGA 4AI8A 3OGJA 2UWBA 4AE2A 4DRRA 4PDWB 3QOPA 2EXKA 1R082 3AP6A 3PMSA 1S0CA 1AYM1 1VBD1 4RQPB 4X8PA 2QNKA 1TE1B 1JUIA 3ZN5A 4A7ZA 1BK1A 1H9PA 2DU0A 2PFWA 5DZEA 4QGNA 2RE9A 2ZGNA 1UU6A 4IEXA 1YRZA 2FZ2A 4UW5A 3AKPA 3S30A 3URFA 4RA0A 1R1A3 3A0KA 1AF9A 1ZM1A 4YZ5A 2RR13 1RUD2 4YM2A 1ZRCA 1NZCA 1IKPA 2GAUA 1V9U2 1PK6B 3VZOA 3WHUA 3WQ1A 5CFCC 4R9BA 2H0VA 4AGRA 5BNOA 3O5SA 4RHV3 3DPRC 1VALA 4KL1A 1GANA 4AQSA 3FWEA 5BNPB 4S2GA 4AEJA 3G7DA 1IHMA 1CAUB 1SBDA 3LAGA 4NHKA 3M70A 3GALA 1XU1A 2K2SA 2VECA 3BCWA 1ND2A 4AEMA 2UYBA 3I59B 2JJ6A 5DZGA 1BEV3 4DS0A 4C0BA 4H7MA 5FO8B 1VBE3 2GH8A 4ES8A 1KJLA 2CGPA 4CDWA 1NE6A 4ZXKA 4CEWA 5ACA3 2VGDA 1FX5A 1GLHA 1RVF1 2LUWA 1X36A 4AEKA 1MS9A 4M3CB 1AR71 1SLCA 2XVKA 2ETEA 1O4TA 1V00A 2Z5WA 2DVFA 1AXKA 3ZSLA 1SBFA 4E2QA 2PLV2 3N7MA 4Y1XA 2DURA 1QMJA 2XJUA 1EV11 4O9GA 1TME3 5FREA 1K5MC 4OI2A 3USSA 4LLFA 2A3WA 3FLRA 3WUDA 4EN7B 3H1MA 3RYKA 5C33A 5JIUA 5ABJC 1OLQA 1LGCA 4Y4YA 4KGQA 1NA1B 5AFBA 4WVZA 1QJU3 3WCRA 1YCIA 3PLQA 1SLLA 4HK9A 4WM8A 4ZKTB 5DG2A 1DZTA 2O8QA 2XVLA 2IXCA 1CJDA 3N36A 3ZIXA 4FSJA 2VVFA 3VKLA 4GQ7A 4DY5A 5KXBA 2I07B 5I8SA 4PBPA 1QU0A 4LBKA 3ZFFB 5CB7A 1POV3 2R072 4W65A 4HPKB 3WOGA 1NXMA 1S0FA 5F5QA 4XFHA 3WY6A 2HWF3 1WCSA 4NR1A 1F5FA 1WA4A 1AL23 4MVTA 4WVMB 3D6EA 5FMOL 5GLVA 3MFCA 3FUOA 5BPXA 1C8M3 3B9CA 2ARXA 2JD4A 4AHXA 5I0RA 1AR91 2BBVA 2BQPA 1ASJ2 4B7EA 4CYDA 3VBFC 1CPMA 1EP0A 2HWD1 1B35B 4HKOA 4ES9A 5DDJ3 3ZYIB 4XF0A 3FUQA 5E88A 1J59A 2B46X 3HIFA 2ZX4A 3VZKA 4GB31 5E16A 1Q8QA 3JCIA 1D4M3 1VBA3 4YFZA 1W39A 3WW1A 4ISQA 2WNVC 4PCRA 3SISA 1YFUA 3ZSMA 5C8WA 3BODA 1LOAA 3ACLA 3RI9A 1NXD1 2WNUC 2EF6A 4Q4V3 2DFBA 2EXIA 2ZMKA 4GKYA 2Q4SA 4OFGA 4Q1RA 2X53S 1VRH1 4AFCA 4MX3A 4ISRA 1LOCA 4DOUA 4TWTA 4AI3A 3HT2A 1O4ZA 4LUMA 1FOD2 1LHNA 2ZGUA 4G9SB 3ZFEC 4YW1A 3ZO0B 2D6MA 5KBFA 4I0BA 3M3OA 2ET7A 1W6QA 1C1LA 3BALA 4Q4X1 3ZYGA 1RUG3 2OW4A 3WDTA 4MGYE 3ZXEA 5BNNC 3G6JB 3E6DA 4FVVA 2ZTNA 1IQAA 3HR9A 4XTPA 4PBOA 1RUOA 4N43C 1DBNA 3MGUA 1LODA 5HCFA 1QJX1 3QLQA 1AYM3 1VBD3 2YV8A 4AYUA 1TMF1 1H8VA 3VHOA 4FPKA 3ZFGB 4GH4B 1BQPA 3VZLA 5D8AC 2GALA 4AW7A 4Q0SA 1Q8PA 2B45X 3ASIA 3WD5A 4AEDA 2BNNA 2QZ3A 2I74A 2B5HA 2D3PA 3WG3A 3U11A 1O5UA 3WP5A 1LOFC 4E9KA 5FDBA 3J9SA 2BEOA 4AF9A 1BVP1 3LSEA 4IV1A 1EPWA 4WZCA 1FMD2 4YFWA 3WW3A 1H8TC 4J1WA 1OI6A 5CBLA 3ETQA 2B42B 2OA2A 4Y24A 3VN4A 4N53A 2IXKA 4QM9A 1EY2A 4XOGA 4CDXA 1HRI1 1H4GA 2UYAA 2AENA 2WFF2 1CD3G 4LULA 1SLBA 4WVWA 1UU5A 2PHUA 2IC1A 4JTNA 3D5OA 1H2KA 1XYPA 4JGZB 2ZGKA 5F1RA 1YUDA 3IPVB 2CNAA 4N90A 1DLLA 2AGSA 4QPIB 1YXWA 1C5IA 4ITCA 4U36A 1I6XA 5H9PA 1SFNA 1XNKA 3VZMA 4JV4A 5FLHA 3OY8B 1RVF3 4NWVA 4HSLA 3VZJA 2XL7A 1CAXA 4LBQD 3VBRA 4XZPA 1AR73 2LALA 3JB8A 1OFSA 2WT1A 4QU2A 2DWRA 4JGYA 1ENRA 1O5LA 4Q26A 3USUB 4YG0A 2ZHLA 2EALA 2E63A 3DL3A 1EV13 4XXPA 4DY3A 2OYZA 1C57A 3H1YA 5CG8A 1NOVA 5DUXA 1MVEA 3CJIB 1PVXA 2VULA 3AFGA 3IDEA 4R9CA 4RQPC 3ME2A 4OVEA 5EYXA 1RUH2 4PIYA 3SCFA 5JMCA 3V0BA 2JG9A 4Q1PA 1HXS1 1F8VA 3WDXA 3MZHA 3AP7A 1JYCA 4AQ2A 3AMPA 4YVSA 4TYSA 1FYUA 1S2KA 1LEMA 1PVC1 1XYOA 2WNEA 3M2MA 3N35A 3AFKA 4RR3A 5GLWA 4D7TA 3WUCA 1XQNA 1GZWA 4XETA 1PK6C 5BNQA 1DZRA 5CVRA 4I3GA 4YM3A 2XKOA 4Z92B 1W0OA 3NV1A 3E5QA 4JDMA 2HWC2 1HIXA 3D0JA 3Q9OA 3R4DB 1GZ9A 3OJBA 2UWCA 3ZXFA 1AR93 1X7NA 4XMAA 2BFUS 1H2MA 1FPN1 1RHI3 4YGDA 2HWD3 4EN6B 4HN1A 1RC6A 2PQQA 3ZPYA 2A7AA 2KA3A 4K6BA 1J1TA 1H2LA 4MXWA 4GB33 3VHRA 4FP2A 4UW6A 1YLLA 1CESA 3TAYA 3AXEA 3MF6A 1GV9A 2EA7A 1PZ7A 2PAMA 1QNYA 4WM7A 5AVAA 1OMIA 2R1BA 3H7YA 3WG4A 3JQXA 5J36A 2YPJA 2TNFA 4P9IA 4CDXB 4F8AA 1TNFA 2VXRA 2WS91 4LNVA 3AB0A 4Q4W2 1VRH3 1GNHA 1PHMA 1Z78A 3S6PA 2R30A 5T55A 5LK5A 2NM1A 4YZ2A 2VY0A 1OA4A 5FTTC 1MQTC 3ZYJB 5JLVA 2RS31 3R05A 2ZX1A 2WZR2 2YGLA 4RSUA 3GF6A 3W9AA 1ZBE2 1CAXB 2VW0A 4NHLA 3VBRB 4AFBA 3IKWA 4D69A 4LHLA 3SH4A 2BTVC 3J8F2 3KS7A 1C3HA 3D82A 4MH0E 1NA1C 3AYDA 5EZWA 2XJSA 3FMGA 1M4WA 4QX5A 4Q4X3 4E27A 2RMU2 1IGOA 3I2DA 1WLWA 4HKLA 1WUVA 1YJLA 2PHTA 3WZ1A 3KGLA 2JX9A 3RJRA 1QJX3 4N9HA 1WD3A 3ZFFC 1IS6A 2GH2A 4XXAA 2HEWF 2MEV1 2XJQA 1TMF3 1XE7A 3KT7A 4CP2A 3N4MA 1UKRA 3V0BB 2JG9B 2UY9A 1BYHA 2LTNA 3WT3A 5LRSA 1PMIA 4MYEA 2AH2A 4ASLA 4YVSB 2XVGA 3MLJA 4MGKE 1POV0 4LBNA 3ROUA 2ZGSA 1W6MA 4H55A 2Z79A 5JSRA 2ZMLA 2ZJCA 3B5LB 4OHWA 1DDLA 1OHFA 4RR3B 4QQ2A 3FZ3A 1B35C 2RS53 2D3RA 1RJ8A 1PIV1 5FLIA 1RJ7A 3CLPA 1LB2A 3B7MA 4XF1A 5KXEA 4EN9B 3W59A 1AJKA 3HN1A 3SXWA 4W6XA 1HRI3 4ORFA 2C5DA 4KWKA 4MXWB 4QMAA 3C2UA 1MEC2 5J96B 2D6PA 5T52A 2RM21 2IXHA 2DCKA 4IV3C 3V0AB 5CA6A 3P3PA 3CJXA 3BPZA 5I8TA 2XHKA 1NY72 1PO12 2FMDA 4LBLA 4NPRA 3A4UA 2ZZQA 4L92A 2HJIA 1U5IA 1AR83 4QGMA 2FMYA 2EVXA 2R6QA 4YW5A 3VBSC 3I7DA 5GLUA 4YW3A 3LB9A 1BJQA 2WSUA 1V6LA 1EAH2 5GLZA 3ZVXA 5KWRA 1BMV2 3AKQA 3M1HA 4XFGA 1CJPA 2QQPA 5FAXA 2A71A 1H9WA 3FHIB 3EJKA 2FHRA 4XJ9A 2A5ZA 4Y1UA 1NCQB 2IXJA 1CONA 4K7JA 1AYN2 4QQPA 3ZFGC 3KCCA 5CAZA 4GH4C 1ENQA 4K1YA 1HXS3 3VKFC 1MVQA 1NCRA 2GSYA 5HCAA 1MS1A 1Y7BA 3BOWA 2HWB2 3VZNA 4L99A 4XW3A 4IXLA 1MS8A 1PVC3 3VKMA 4BH9A 2NP0A 5L36A 1ENXA 4DB5A 4MGZE 1O3SA 1HQWA 4DQAA 2FZ1A 1N3QA 5C8CB 2PTMA 1IPJA 2NLRA 3AM2A 1Z7S2 2GNTA 4DNYA 2ZGTA 1PO22 4Q0UA 5A32A 4UW4A 3AZVA 1W6MB 4JDOA 1LGNA 2VNRA 4XF3A 3L2HA 5EWSA 4H3WA 4CDQB 3CNAA 4QM8A 1FPN3 2BGCA 1FNZA 3VKOA 4Y1VA 4NVPA 4YZ4A 3ZX7A 1ULEA 4HANA 1H1IA 4JGZC 2Q1ZB 1DIWA 1QKQA 3LA2A 3PVOA 2D6OX 4QPIC 5C9AA 3IN9A 2NMOA 3ZXDA 5A33A 2GNDA 3ELNA 4META 2ZGMA 2X8KA 3MW4A 4BWOA 1QQP1 2E51A 5L73A 3PVBB 4AVVA 2R061 3BB6A 2WS93 2Y0IA 2BPA2 4FOYA 2DCZA 2YDEA 5JSOA 1H4HA 3IDCB 2NMNA 4DFSA 2NQYA 1YHFA 1LU2A 3RS6A 5E1RA 2OIIA 2RS33 3RRDA 5T3NA 4LHNA 2JECA 1AHSA 3VUOA 1CR7A 1DU3D 3CJIC 3ENRA 4XILA 4UBGA 1R1ZA 1V6IA 2D43A 2OZJA 4S2FA 1CQ9A 2ZHMA 2P37A 3R4UA 1O4YA 1OSGA 3E97A 1R1A2 1ZZ9A 3VBUC 4WVVA 1MR5A 1AX2A 4C91A 2RR12 3NO8A 5GZFA 5HXVA 3CEWA 1IS3A 4AVTA 4YG6A 1Q43A 3DF0A 3POWA 1C8NA 4AFMA 2VPVA 1VJ2A 1N1SA 4KH9A 2GMMA 3RG0A 4RHV2 3DGTA 1LOGA 2MEV3 2N7GA 3ES4A 1ZRFA 4CEYA 4KNCA 5JOXA 4FOVA 1G9DA 4LO4B 1PGW2 1WCKA 3FBYA 2ZGOA 4AG4A 3WXPA 2WT0A 4XFAA 5HBAA 1V6NA 2DUOA 1BEV2 1KQRA 1VBE2 3NV4A 3THPA 2R041 1GZCA 1C5HA 4PIXA 4A2UA 1U12A 5ACA2 1PIV3 2MHFA 2JE7A 1C4RA 3FFQA 2R071 3ILRA 4BIFA 4EROA 5JDBA 5A32B 4X8NA 4FO9A 2R16A 2H0BA 4E2GA 5CG9A 3ZN4A 4COZA 2X29A 1OPMA 4YW4A 2CWMA 3WG1A 4WZFA 1XNDA 1TME2 3VDDC 1OOPB 2RM23 4LA2A 5EXOA 1DYKA 5C9AB 5FQ0A 5A33B 2PHRA 4DPNA 4BMBA 1QH7A 2VW1A 1ULDA 1QJU2 2JEMA 1FV3A 3AK0A 4J6GA 1ZREA 4FPFA 1LCLA 3U4XA 1WLTA 1CAWA 3IIAA 3JB4C 4XF9A 1AX1A 5C4WA 1IKQA 4BQ1A 5D1IA 1DQ0A 4UW3A 4K40A 2W39A 3VGIA 1OFNA 3VBOA 1CVNA 4FPGA 4XHXA 1AXZA 1RUJ2 1FT9A 1WMFA 4M3CF 4PLOA 4L9BA 5FRAA 2HWF2 4YLZA 1AL22 5T5OA 3AYCA 3K48A 5L19A 3POSA 4QHBA 4ATFA 1C8M2 1U5XA 4XQWA 4HK8A 1AX0A 2JG9C 2GC3A 4C0HA 1FOD1 4NO4A 4R4ZA 4M0NA 2GMEA 2DVGA 3WDVA 2W0XA 2D44A 4IL7A 3GZAA 4TSVA 1D4M2 1EPZA 1S2BA 1GSLA 1VBA2 1Z0HA 3V65A 4E4SA 1YYNA 1JBCA 1F31A 4OHXA 4IESA 3TNPB 1ND3B 1O3QA 3N7KA 1WLCA 2XLAA 3H3ZA 1NYWA 2A6ZA 1RL3A 5L7OA 5JAXA 3AX4A 4FPOB 1TEIA 2VVDA 3OBTA 4FP3A 1VBC1 1LKNA 1XU2A 3KD4A 2B9UA 4AHYA 4LLOA 4XDQA 1ZA4A 5F6LB 4FBFA 1R091 4GALA 5JZGC 2RJKA 4XPVA 4OUSA 2MNGA 1H30A 4YYOA 3AP9A 4RS5A 4GWNA 5GZDA 2RS11 1VIWB 2VOKA 3MW2A 3VBHA 1WW5A 1J3QA 1QQP3 3QD6A 2XJPA 1COV1 3ZN6A 2R063 4CDUA 4F7ZA 4YZ1A 1RUG2 2ZCWA 2XBO2 1F5JA 1D0HA 1LENA 4HVRA 2ZHNA 3O14A 3PVEA 5HI0A 1BBT1 3WX5A 1U5YA 3ZYRA 4D7YA 4YARA 1AYM2 1DQ6A 3KM5A 3O7OA 1WGPA