4KWJA

Resting state of rat cysteine dioxygenase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Mechanistic implications of persulfenate and persulfide binding in the active site of cysteine dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 58
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4kwjA00
2MHFA 1ZX5A 2H0VA 4I09A 1NYWA 1VR3A 1YLLA 4A2UA 3ES1A 3L2HA 3H1MA 4OFGA 2IXCA 4YYOA 1DZRA 3NVCA 3OGJA 3JZVA 4ZU4A 4YARA 4IEYA 5FLHA 4N9IA 3CLPA 5C6CA 1EY2A 1J3RA 3LA2A 1QXRA 2QNKA 4AVBA 4KU7A 1CAVA 3SXWA 1CAXA 2ATFA 3M3IA 1EYBA 1SEFA 4XFHA 4F8AA 2PHLA 2FQPA 3BCWA 5LEJA 1DZTA 2H6BA 2IXHA 4O9GA 4EWDA 4MGZE 3E6BA 1GQGA 3OF1A 3BB6A 1V70A 4XF4A 4N9HA 1FXZA 5BPXA 3TNQA 1DGRA 4OLLA 1OMIA 2GZWA 3U0ZA 1H1MA 5I91A 1QWRA 2UYAA 4QGMA 4X6RB 4AVCA 4EROA 2F4PA 4XFIA 1YHFA 3C3VA 2PQQA 4I3PA 1CAWB 1WLTA 4QXKA 2BGCA 4EV0A 2OPKA 4XF1A 3S0MA 4PJYA 4ORFA 4WBBA 1J3QA 1J3PA 1UD1A 2XLFA 3ZDSA 5E16A 2PAEA 2MNGA 3BALA 3CO2A 1ZZBA 1RL3A 1I5ZA 5BXXA 5JCTA 1IPKA 4HLTA 2XL7A 5AVPA 4AXOA 1YFYA 2CAVA 2C0ZA 3UKNA 2QVSB 2PFWA 3RYRA 2CGPA 4JTNA 1NZCA 4I01A 3SCGA 5I0TA 2GC3A 2PAMA 4F7ZA 3DV8A 2O8QA 3E5UA 2GC0A 4B29A 5JSOA 4XF9A 5FLIA 4L2NA 3CL1A 1RUNA 2Q30A 3D0JA 5FCCA 4TLFA 3SCHA 2IXJA 5FQ0A 4FAGA 3MPBA 5BY5A 3QOPA 5CADA 5JSRA 3WW3A 5I8YA 2I45A 1J58A 3NL1A 4JV4A 1WGPA 3IWZA 4I0AA 3E6DA 2OYZA 1ZZ7A 2K9ZA 3ES4A 4MUVA 1Q5OA 4LTAA 4QM9A 1Y3TA 3IBMA 1EP0A 2O1QA 3DN7A 3I59A 2WC2A 3SCFA 1X7NA 4MZUA 2EA7A 4ONUA 5FPXA 3D0SA 3MZHA 2OZJA 1ZRDA 5JSPA 4HBNA 3WW4A 5EZWA 1CGPA 2Y0OA 4QM8A 5I0UA 4D7SA 2CAUA 2Q0AA 3M70A 4MGIE 4XFBA 5LEKA 1GQHA 1OD5A 1UCXA 2BYVE 3USSA 3KCCA 2V09A 3CF6E 1JUHA 4HMZA 4Q29A 4MH0E 4FT8A 4XFGA 3LA7A 2OA2A 1OI6A 2K0GA 1X82A 3LZZA 1SFNA 2Q1ZB 1LB2A 3B02A 2PAKA 3OCPA 1O3QA 4GULA 5I93A 3G7DA 5CU1A 1ZZ6A 2XGXA 4LUKA 1IPJA 4PIYA 2ET1A 4I2OA 5HI0A 1YFUA 1FT9A 3KGZA 4AVAA 4KWJA 1LR5A 4YNIA 1SQ4A 4KL1A 4Q0SA 2KXLA 4JTOA 2IXLA 4IESA 4Z82A 2OZ6A 3U11A 5C8WA 5KHKA 5JR7B 2HJIA 5I0SA 2GAUA 1U12A 4IERA 4I02A 2UY9A 4XF3A 2DCTA 4ZU5A 1ZNPA 2Q4SA 3H7YA 3I54A 4HN1A 5BV6A 3WW2A 3H3ZA 1X8MA 4J1XA 4MV2A 1PM7A 2XLGA 3LOIA 5T3NA 5LRRA 2P17A 3KGLA 3EHKA 4MGKE 1CAUB 4WVZA 5JAXA 1ZZ9A 2QJVA 5I8TA 3UKVA 5D1IA 1UIJA 1HW5A 4UBGA 3E5QA 1UPIA 1XE7A 4LA3A 4LEJA 2GH2A 2IC1A 4E2SA 1CAWA 5BUVA 4FBFA 5J48A 1O7FA 5EFUA 3DKWA 1NXMA 3HT2A 4HVOA 5FDBA 3H1WA 4XF0A 2UYBA 1H1IA 3U10A 4YSFA 4AQ2A 1X8EA 4LUMA 4O9EA 2D93A 4Q0QA 3TNPB 3H1YA 3LA3A 4IEVA 3S7EA 4JVAA 2EAAA 3I7DA 3NJZA 4EWEA 1CAUA 5KHGA 3CJXA 3SMHA 3BU7A 4WZCA 3S7IA 5FPZA 3OD0A 3PLQA 3D82A 3NSTA 4HVQA 5KHJA 3RNSA 2GU9A 4R52A 3DL3A 4BHPA 2XKPA 1VJ2A 1CAVB 1ZRCA 2D5FA 4IEZA 2FMYA 4KWLA 4QGLA 4HVRA 1TQ5A 4Q0UA 3ELNA 1XRUA 1ZVFA 4UBHA 4BIFA 4D7TA 3IDBB 4MX3A 2E9QA 3FWEA 3MYXA 4I0BA 4XFCA 3RZZA 2XL9A 1Q3EA 2ETEA 3VHRA 2BNMA 5KHIA 3FX3A 4YRDA 3FZ3A 3KSCA 3PVBB 2UY8A 3GYDA 1RTVA 2Z2SB 4NVPA 4Z07A 4HSJA 1XE8A 4CYDA 4XFAA 1J59A 1ZRRA 3IDCB 1YWKA 2D5HA 2BNNA 3HT1A 1O5LA 2HKXA 4META 3GBFA 4XEZA 2WFPA 1ZZ8A 1J1LA 3R6SA 3FJSA 1LRHA 3H8UA 4Q0VA 2IXIA 2PYTA 2N7GA 1WA4A 3RDIA 4X6QB 2B8MA 2D40A 3LWCA 4BYYA 5E1RA 4HSLA 4BH9A 2H6CA 1PMIA 3IIAA 2BNOA 1VP6A 2XKOA 1EPZA 4K8FA 4DINB 4HN0A 1O3SA 4E2GA 2PHDA 2GC2A 3EQEA 4L11A 1O3RA 4QMAA 2B5HA 1OFNA 2ET7A 4IEWA 1FI2A 4PIXA 5KBFA 1YFWA 3SHRA 1G6NA 4IEUA 1CX4A 3ETQA 4PIZA 5FQ0B 1O3TA 1ZZCA 5KHHA 4XFFA 1YUDA 2VECA 5K8SA 3H50A 4ZU7A 5CVRA 1L3JA 3KMHA 2XLAA 3RYKA 4QX5A 2VPVA 1Y9QA 4IEOA 4P9GA 1RC6A 4KU8A 4HZFA 1Q43A 3UKTA 4Q0PA 3FE5A 1NE6A 2CV6A 4RD7A 5I8SA 4IEPA 1ZREA 2XHKA 4LLOA 3EBRA 1O5UA 1NE4A 2IXKA 3EJKA 3PNAA 1QXJA 3CEWA 5F1RA 2GC1A 1YFXA 4KWKA 3I59B 1O4TA 2QCSB 3E6CC 2MPFA 3LAGA 1QY4A 2ZCWA 3HQXA 3O14A 3E5XA 2PTMA 3HIFA 4XETA 1ZRFA 3QACA 4FAHA 4R8HA 3RPQA 3RYPA 2B9UA 1LKNA 3BPZA 3WW1A 5J3UA 4J1WA 2PA7A 1UW8A 2Z69A 3EO6A 3H7JA 1I6XA 2EVXA 2BEOA 3MDPA 3NW4A 3ROUA 4IEXA 1RUOA 4UXAA 3E97A 5J7MA 3ST7A 3FHIB 4AQ6A 1CAXB 1RGSA 4H7LA 4QGNA 3H9AA 4LA2A 3FFQA 4LULA 3NKTA 3H3UA 4E2QA 2ZKLA 5FLJA 4IETA 4MGYE 2VQAA 3ACLA 1UIKA 5I0RA 2QDRA 3OTFA 1DGWA 3N4MA 4IEQA 5LRSA 4EWAA
chains in the Genus database with same CATH superfamily
1RXFA 1LOGA 1AXKA 1F5JA 2VTFA 2VZSA 4HG6B 4I09A 4Q1PA 4IE5A 3ALQA 3VUOA 1QJU2 2G4IA 1YLLA 5F3IA 3BTXA 2MEV1 3L2HA 1QXPA 4W6XA 2QZ2A 1AYN3 2LS6A 1HB3A 2VNGA 4FVVA 4OFGA 4C1XA 5A3LA 2YZ4A 1DZRA 3NVCA 4AGGA 4YARA 4ZU4A 3MUZ1 1QOOA 4N53B 1GMMA 1VBB2 4LO4B 2A7AA 4N9IA 5C6CA 1J3RA 3MI8A 5JZGB 4NRMA 2VMFA 5BNPA 4AVBA 2FHRA 4KU7A 1CAVA 3SXWA 4IDZA 1QNYA 4XOGA 1CAXA 1PZ7A 4BLIA 5EP9A 3M3IA 3LSEA 1CZVA 1KJLA 1SEFA 1CD3G 2VE1A 4NRPA 4PBOA 2B46X 4NAMA 2WS92 2PHLA 2FQPA 4M3CB 1XPWA 4RFT0 4AFDA 1XJAA 1XYPA 1OQDA 3KCYA 5D8AA 3WF1A 4AI2A 3ZMNA 4Z8BA 5JR2A 3OG2A 3KS7A 4L9BA 1DQ1A 2BW8A 3BB6A 4HKLA 2X8KA 3MIBA 4XBQA 3RJ2X 3VBSA 5A6ZA 4MGTA 1IZ3A 4E8DA 3HD8B 1LENA 1YIFA 2ORXA 1FV2A 3TNQA 4CUCA 5L7OA 2E7AA 2HWE2 1US3A 4UFHA 3ZFEB 4YVSC 3WR0A 2P3IA 1CPMA 1HRV1 4XZPA 4EROA 3ACFA 2F4PA 3VZLA 4KMQA 2E53A 2FDGA 3K4DA 1XYNA 4XJWA 3AC0A 1W8WA 2OPKA 3OUHA 1JXNA 2JX9A 1SLAA 4PJYA 2UWAA 2ZEWA 4C0BA 1ASJ3 4LHSA 3F95A 2WBKA 4IV3A 1J3PA 1UD1A 3PTYA 2JDAA 4RSUA 5E16A 5H9RA 4XPVA 1R081 3WQ0A 1BK0A 3CO2A 3IPVB 3T0BA 4AFMA 2P37A 4BMBA 1A6CA 1KFUL 2JDHA 4M3CA 3KCXA 1IPKA 2CL2A 5FYHA 5GZDA 3RZMA 3WXPA 1JZ2A 1E5IA 3N7JA 4QQPA 4JGYA 3HJRA 2C0ZA 3ZVXA 4DEQA 4F3JA 4QXBA 3C2UA 5CBLA 1AZDA 3WCSA 3KV4A 1VBD3 5C4WC 5IYYA 3KD4A 2AENA 4F7ZA 3DV8A 2J1AA 2WZR2 5CKNA 2Y8KA 4BWOA 5JXIA 3TEYA 3E5UA 2GC0A 1MZFA 2E26A 1N3PA 2E7TA 1A34A 1W3XA 1W8ZA 2XJUA 4XF9A 2G9GA 3V0BA 4L2NA 1NCQB 4LBKA 3D0JA 3JBG3 3KVAA 4KQ7A 5FCCA 5FMCA 4TLFA 1ENSA 2IXJA 2NLRA 3D3AA 3GBGA 1QF3A 2AREA 3IT8A 3MPBA 5FY7A 3QOPA 5BY5A 1KXGA 3I3EA 1I9RA 1W8UA 3AKSA 3CZJA 1JHNA 3S30A 1AR62 5CADA 1AX2A 3M3OA 1JUIA 3AYEA 2G19A 3ENRA 3HR9A 5T5OA 1B09A 4U36A 4B1MA 1NA1B 2EF6A 5FYZA 2GH8A 5A7PA 5FYTA 4COZA 1HXS1 3ZX7A 3AKPA 4JV4A 1WGPA 3IWZA 4DY3A 5JI9A 1PIV1 4I0AA 3HVDA 3WQ7A 1ND3B 1B35B 1ZZ7A 5A80A 4UAPA 4KH9A 4F83A 1WLWA 2XPJA 3J9SA 5J37A 1Q5OA 4P5HA 4LTAA 1Y3TA 3T4HB 3IBMA 1ENQA 1TMF1 3AL5A 2O1QA 5C71A 2VOWA 3KQ4B 5DABA 4AZZA 1PK6B 4CEYA 3M4FA 3SCFA 1FATA 1HIXA 5LB6A 4CEWA 1NCQA 1MZ6A 2RJKA 3OGVA 2YROA 3PUIA 4ONUA 4QWNA 1LOAA 1VBD2 1XE0A 3AMMA 1ND2A 4P9WA 3P3NA 1ZRDA 1O6UA 4UF0B 2E33A 1DBNA 4XJ9A 5JSPA 3A0NA 3OPZA 1FMD1 2HWF1 3LB9A 2A75A 2DF7A 2PLV1 4PDWA 1OC1A 3VBUB 4HBNA 3VZKA 3WW4A 1W6OA 2VL4A 4K9SA 3A7QA 4XXPA 5DZEA 3J7NA 4LKDA 1WMFA 1NAEA 2Q0AA 1GNZA 4XFBA 4YFZA 2P4EA 2XH6A 2RVAA 2PHRA 3VBFB 5HXMA 4P5YA 3USSA 4AQTA 4OULA 3ZLIA 2JDKA 1CJPA 3CF6E 1JI6A 2BZDA 4RR3C 5CYYA 3ZOIA 2BVBA 1SLTA 1PVC2 3ZN5A 2WAAA 2NM1A 4SLIA 1VRH3 4O61A 2OUHA 2QQWA 2SBAA 5A3OA 2WS91 1OURA 2OA2A 2ZEYA 5DAQA 1K5MC 4U2AA 5F5CA 1PGL2 1V6OA 1L7RA 5K0UA 4G4FA 4QX3A 3SC7X 1S0BA 2Q1ZB 3AXEA 3AZZA 2E31A 4OVEA 1W6QB 1WCKA 1HJGA 1YXWA 1BHGA 1AR91 2YGLA 4PLNA 4XW3A 3F2ZA 4Q4V3 1ZZ6A 4W6WA 1QQP2 2XGXA 1LHUA 2NPIA 2ARAA 2PHWA 1RUG2 3FBMA 4JGZA 2ET1A 4I2OA 1KITA 1YFUA 1AL23 1CVNA 2HEVF 1FT9A 4PF5A 5FPVA 4AVAA 2R063 5FY4A 3WDTA 4Z1VA 3CDZB 3IB3A 1RUJ2 1RUF2 1SQ4A 4XAAA 5FYSA 4DNYA 3I3BA 3I2KA 2BV4A 2DFCA 2Z4FA 1KFXL 2J22A 4DRRA 3ABZA 3PUHA 2OZ6A 3DPRB 2X05A 1D0HA 3VKMA 3O1TA 1F8VA 3Q8BA 3U37A 1W2NA 2WWSA 2GAUA 1U12A 2WWUA 4YVWB 4YW4A 4LIUA 3ZFEC 1X9TA 5JXGA 2YFUA 5CISA 1K12A 4XF3A 3ITQA 3JQWA 2QTWB 5D21A 5DMYA 1LOBA 1U5XA 3H7YA 3I54A 1K45A 1SFYA 4GKYA 5BV6A 4NROA 4LR4A 1PVXA 4AHWA 5CIRA 3U07A 5F3CA 2WO2A 5A7QA 3AZYA 4L97A 2WZR1 4BQ3A 2XLGA 2BOJA 5LRRA 2JWPA 1WCSA 3KGLA 5G05L 3ILRA 4WM8C 4RQPC 3M7AA 1FOD2 3OYWB 1ZZ9A 2XWBB 1VBC1 3UKVA 4LO7A 3I2GA 3NRUA 2ZGQA 5DUXA 3S6PA 3VZNA 3KWVA 4NHKA 1VALA 4URAA 5L36A 3GNEA 2L9LA 3A21A 4NPRA 2RS12 2UWCA 5JPMB 2ARCA 1URXA 2E7QA 3ZYRA 4WZFA 1AX1A 3P1IA 4B1LA 4AK3A 4FBFA 1AR61 3I2IA 1OKQA 1A8DA 4L0PA 1X33A 3G6JB 4LKSA 3KV6A 4ATFA 2R30A 1O7FA 2DTWA 1NXMA 3QH6A 1AR71 3OUIA 3HT2A 1VAVA 4EZ4A 2H0BA 4RS5B 1MVEA 2UYBA 1S2BA 2RS53 2R7EB 1MZ5A 1NOVA 1EAH1 5FYIA 3U10A 1VBE1 2ZMKA 4JDNA 1A78A 4LOTA 1POV3 3LEGA 1U5IA 3W5NA 2NP0A 2D93A 1HQWA 5JOYA 3LA3A 2C5DA 2VZ1A 3USUA 5JUVA 3I7DA 2A1XA 4NHMA 3OYWA 2YU1A 1C8M3 4Y5TA 3BU7A 4WZCA 3BTYA 1YO8A 4XDOA 1NA1C 1W9TA 4A6SA 1GYKA 4UT5A 3INAA 1YQCA 3OD0A 1ND3C 5FYVA 3T08A 2ZGTA 2AC1A 3VL8A 4EE2A 5JOZA 2GU9A 3GHNA 1T6GC 2ADEA 1WBFA 4GJYA 1ULCA 3B9IA 3GBWA 4GB32 2XJRA 1Q8OA 2VOKA 2BJSA 2W92A 4JHZA 1PK6C 5FXZA 2V4VA 2WINB 1H6YA 1ZBE2 2Y6FA 3N35A 4BHPA 2D44A 1ULFA 3UESA 1F2NA 4LBQA 5IVVA 4Q4Y3 1ZRCA 1PVC1 1UKRA 3W59A 4Y1UA 5KXDA 2D6LX 4URTA 3NV2A 3CBNA 2DYCA 1YQ8A 1NQDA 1ULGA 4HVRA 3VBUC 4DS0A 4XTMA 1PGL1 2XMLA 2VTXA 4CCEA 1XNKA 1ZVFA 1OUXA 3N9MA 4Q8KA 1KDKA 3FL7A 4IE4A 3AP7A 4MX3A 1JS9A 2E9QA 3ZXEA 4DMIA 1OVSA 1AL0G 2JD4A 2Y34A 3WP6A 2XL9A 1UY2A 1COV3 1QQP1 2BNMA 2W95A 3AYDA 3VBFC 5BNOA 5K4LA 1RUG1 4YRDA 1LECA 2FDFA 4HKOA 2JB4A 2HH9A 4CU7A 3MW4A 3VD9A 2DCYA 2WNVA 3TWIA 1RUJ1 4CE8A 4AI1A 1RUF1 2VBBA 4IUGA 4NVPA 4HSJA 3TYJA 2D6OX 2VJXA 3J8F2 1J59A 3AJZA 4N43B 1QJFA 3IKWA 3NNJA 1O59A 2RJ2A 2ZEXA 1YWKA 5LA9A 3U75A 3HT1A 3MW2A 3GBFA 1MR5A 2VUCA 3D8CA 1TEIA 4Y4RA 2WFPA 4V2VA 4XVHA 3AFGA 2BWCA 3PIGA 1J1LA 1DYKA 3FJSA 3O0WA 3RMXA 2IXIA 1V0AA 4NHXA 1RUC3 3DXTA 1XC6A 4UW6A 4YZ3A 5E1RA 4HSLA 5HPOA 3R0RA 2H6CA 4EN0A 4QU1A 2D3RA 4K8FA 3ZR5A 1VRBA 5LK7B 3LFIA 2QUOA 1QGLA 4A7ZA 5FZOB 1S2EA 3EQEA 4L11A 4XHXA 3RZKA 2VD7A 2ZMNA 5JWPA 3ON7A 4LPLA 4UI9L 5AC92 4PIXA 1PMJX 3LEMA 5KBFA 2RDQA 1MS4A 4JQRA 2J1EA 5CA6A 5FQ0B 5CFCA 1O3TA 1JHJA 5FO9B 2ZZJA 2VVFA 4DXZA 4ZU7A 3T3YA 2RS11 2HWD3 5FY9A 4N43A 1PO22 4C0HA 4JQTA 4DOUA 1I5PA 1NLSA 3KMHA 1OHFA 1H8VA 5IT6A 1QJY2 2ZHKA 2E6VA 1WCUA 2VPVA 5GJ6A 4LBJA 1W9WA 3OGSA 4E4ZA 2W5FA 3NJYA 4KU8A 3RWKX 3UKTA 2JG9A 5FP9A 4KG0A 5GALA 1QOTA 1SCRA 1NE6A 2GNTA 3UJOA 4RD7A 5FXWA 4QPGA 5JI7A 3WLUA 1PNFA 2KR2A 2XHKA 1NE4A 2IXKA 2JXAA 4R4ZA 1FX5A 2CTVA 4P9XA 4AYUA 4CCOA 3V0AA 1XNBA 4XBLA 3WSOA 2OS2A 4H3WA 2WYSA 4N7UA 5LBBA 3BODA 3RZGA 4YGEA 1U5ZA 1NY72 4A7YA 3LAGA 2P1BA 3LF7A 1HN0A 3URFA 1R1A1 5FPLA 2WABA 3ILNA 1C1LA 1LHNA 3I2OA 4RS5C 1UNBA 2X53S 1AF9A 5A7SA 4IGOA 2A6YA 1V9U2 4UYBA 3V65A 2TBVA 4UW4A 1LOFC 2MEV3 3BUCA 3BKZA 1SBEA 2B7YA 3I3DA 3Q8FA 3BPZA 4RHV2 5F5IA 3WG3A 3WF3A 3O1RA 1ST8A 1ZBA2 2NQYA 1MQTA 4ZZ5A 1VLNA 2VZ3A 2Y6LA 4UFMA 2XQXA 2XUEA 4GB31 4PT6A 4ATEA 1HRI2 3EO6A 1PMHX 2D6NA 4HPKB 3FLRA 1EV11 3MDPA 5D2AA 4XDPA 3ROUA 1DF0A 1R091 3GALA 1H6XA 3O1PA 2XBO2 2ZJCA 4BXSV 4DUVA 1RHI1 1G8WA 4FPEA 4AHZA 3E97A 2WYFA 4KGGA 3FHIB 4QKBA 1BJQA 3VDDA 1RGSA 4W65A 4J6GA 2FD8A 1KS5A 2Q5TA 2Y64A 3AZWA 1PNGA 3H3UA 4H7MA 1I3HA 4QU2A 4YWAA 2QQMA 4YGBA 3RJRA 1OUSA 5FLJA 4E4HA 3WNNA 1BZWA 4NRQA 2D7FA 5FJKA 2OW4A 5ABJB 1JZ8A 1STMA 2DUPA 3RGBA 3OTFA 5A33A 5LRSA 3FHAA 1JZ6A 4ZXEA 5FWEA 1SDWA 5FIXA 4GJZA 3HOBA 1NUKA 3BIEA 1HRV3 2TUNA 3OPWA 3PURA 2GMEA 2MHFA 4EWAA 1ZX5A 5FPBA 4AF9A 2VCCA 3TB0A 4DZGA 4LT5A 1NYWA 2ZAHA 3KM5A 4A2UA 4MO3M 4AW7A 1RXGA 1Z7S1 4XMIA 2YV8A 3I2HA 3ZN4A 4AEDA 2XVLA 4QQ2A 5BNNC 3NMBA 4D3WA 4M01A 5FLHA 4IW3A 3CLPA 3UT0A 5F6LB 1GP4A 4CXWA 3SH5A 1V6JA 2PXJA 3LA2A 4I30A 1NT0A 4FFHA 2VO5A 3LOBA 5CEHA 2YFZA 1Y9MA 2WNUC 4NMIA 1H1AA 4XDQA 5DG1A 5LEJA 2IXHA 2OT7A 2VUDA 4O9GA 3ZXAC 3B00A 4LBNA 2GN7A 3WF2A 4CU9A 4MGZE 1DQ4A 5A32B 1ZA4A 5DDJ2 2A6VA 4IV1B 1CQ9A 1XQNA 4FO9A 1W8TA 2VOTA 4OLLA 3LPGA 4CP0A 3AYAA 4HANA 3U4SA 1QKQA 1YC61 2RM23 5AC91 4X6RB 1SG3A 1TG7A 4QX1A 4BQYA 4LITA 4YFWA 1FV3A 5FUIA 4Q5OA 1W2UA 3C3VA 4I3PA 1PO21 4UFKA 1WLTA 2BGCA 1REEA 4EV0A 4XF1A 1QJY1 2I07B 2FBEA 5C3OA 4ORFA 3O1MA 1LCLA 3WZ1A 1GP6A 2YDEA 2JG8B 4YW6A 3AMNA 5IAVA 5GZGA 4CTEA 2AUYA 4YM2A 5FO8B 3ZDSA 4XCAA 5EJ1B 1WBLA 4P08A 3RSJA 1IS4A 4H14A 4FSJA 1HXS3 5A6YA 4YVSA 1PIV3 4AEKA 5IFTA 5BXXA 5JCTA 1JODA 5CZKA 2XL7A 2FZ1A 4AL9A 3ZN6A 1RVF2 5AVPA 1R082 1VMJA 2P2KA 5CB7A 3N7MA 1UY4A 3VBHC 4JTNA 2X5IB 4BQ2A 4I01A 1OD3A 3SCGA 1W28A 3GZTB 1NY71 3WNLA 2GC3A 3RMYA 1E57A 4NO4A 2O8QA 1VE0A 1RB8G 2QQNA 2WJSA 1D7PM 3BN6A 2RR11 2VVDA 1RUNA 1IKQA 3DCQA 3GJAA 4S2HA 1JYTA 4AQSA 4YM1A 5JIAA 1S55A 1V9U1 5JPNB 4GWNA 4TXWA 4QHZA 1W6PA 2BBAA 2PLV3 3MO4A 1U5YA 3L2YA 1OPMA 1RUI2 2ENRA 5L9RA 1AJOA 1GSLA 1D4M2 1QH7A 2FDJA 2QQIA 2XJPA 3POFA 5FK8A 3A0KA 2R6QA 1HRI1 1VBB3 4OYUA 1JYCA 5C4WA 2AEYA 4KBBA 4MOAA 5I8YA 3H8RA 2TEPA 3WDXA 3HMYA 2HYXA 2XBO1 2JIJA 1J58A 2WKKA 3DEMA 3NL1A 4OMCA 4WM7B 2DBIA 3ZPOA 1UYXA 5FMDA 1RYYA 1G9AA 2Y6JA 4FFGA 2WS93 2O14A 5FZAA 4A42A 3WUCA 1RINA 2K9ZA 4NWVA 2D6KA 1KS4A 2RMU2 3ES4A 4JAAA 4P02B 2VULA 4Q4X1 3FHQA 2YC0A 1PIV2 1SLLA 3GZUC 5EPAA 3WQ1A 3KQRA 4FPOB 1JYWA 5LBEA 1EP0A 1LHVA 2DVBA 1DHKB 2JJ6A 1GOFA 2R1BA 4XCBA 3WF4A 3I59A 4FPHA 1X7NA 1BXHA 1QJEA 4D94A 4PCRA 5FPXA 2QKDA 3D0SA 2OX0A 4CCCA 4GWIA 3MZHA 1TMF2 3ZKYA 4KI5M 2PHUA 3POIA 5CFDA 4CDXC 4Z92B 2W68A 5FZ3A 3B5LB 5T50A 2OVUA 3RG0A 3IDEA 1OPOA 4CUBA 2ZZQA 5LBCA 1K42A 2QQOA 4GWJA 2Y0OA 1JU3A 1FMD2 1Q8QA 2C4XA 1K5MB 2HWF2 4PBPA 2DCZA 2ZOEB 2PLV2 5ABJC 4OQ8A 1KDMA 3WHUA 3ZYIB 2WQZC 5FAXA 2WZPP 1YEWA 4QQLA 1JUHA 1NLRA 5C5UA 5IATA 3E1F1 4Q29A 3ZO0B 2ZGPA 4MH0E 4BLJA 1RMU2 3GF6A 4R9AA 1OF4A 4QPWA 1OI6A 4FPLA 4Y20A 2K0GA 1X82A 3MLKA 2R0HA 4M3CE 1S0JA 1YCIA 3B02A 3LFMA 5DDJ1 2WZR3 2QQVA 4QX7A 4GULA 1QIQA 5A6QA 5A3WA 2ZGMA 3G7DA 3BVCA 2BU9A 3T0DA 4LUKA 4XURA 1VBA2 4K21A 1GP5A 1S0FA 4RR3A 2VNOA 1AR92 1GICA 5HI0A 1UXXX 2IVIB 2VMHA 3MIDA 2VU9A 4YNIA 2XXZA 4KL1A 4X8PA 3RS6A 4CDUB 1K5MA 1UY1A 2WSVA 3LEKA 3POJA 4JTOA 5C5TA 1AR63 3O12A 1R1ZA 5FKCA 4Z82A 3U11A 5CNAA 5IWFA 3BU0A 4IV1C 5FFOC 4N53A 1Z0HA 2GP3A 4OI0A 4XMAA 5I0SA 2PQSA 1AR73 1CJDA 4V2WA 5I0TA 4LOSA 4XUQA 4CUGA 5JZGA 4I02A 1MS3A 4WM8B 1RVF1 4RQPB 1VBE3 1W0PA 1QMJA 1HB4A 2FDHA 4R9BA 2OUJA 1DGLA 1UAIA 2XB6C 3SISA 4GMP0 4A4AA 1PZ8A 2EIGA 1LOEA 2NMNA 4LHNA 2FDIA 1IS5A 5J98B 1H2MA 5FZKA 1NLQA 5DN2A 2ZX0A 3AKRA 5EXOA 4MV2A 2JG8C 5FZ1A 1XNAA 3VHOA 5F9TA 2JD9A 2PHTA 3B69A 2P17A 3FLPA 5AVAA 3PJYA 4WVZA 4Y22B 4YW1A 1OOPB 4CCKA 4YZ4A 2JKBA 4QXHA 5I8TA 3ZFEA 3R4DB 4UBGA 2VQTA 4BK5A 1TNRA 1ZM1A 3E5QA 4AFBA 1UPIA 4D8MA 2W47A 3EB7A 1RUI1 1VBC2 1D4M1 3PVEA 4MSVA 4ZKTB 5HV4A 2IC1A 5GZEA 1W6MB 2X5IC 5BUVA 2C24A 5FZEA 2EICA 1NCRB 5ANQA 5JXJA 1IG0A 4PQ9A 1W0OA 5IK4A 3ZFFB 3ZFGC 4BPZA 2IUWA 2PELA 3BGAA 4YGCA 2W1SA 3GCXA 2C26A 2DDUA 3SITA 1X36A 4WM8A 1PVC3 4DQAA 1H1IA 3IPVA 4CDQB 2KD7A 3CZUA 2BOIA 4JDMA 3A23A 1AR72 2R072 4MHUA 1O4YA 5F37A 2RMU1 3ZYBA 1N47A 4LBLA 1G9FA 2QZ3A 4AFCA 2Y33A 1EAH2 1VBE2 3RQ0A 2VOVA 2EAAA 3NJZA 1IPSA 5KHGA 4Y22A 4Y4YA 2B42B 3FUOA 1D0GA 1QQP3 3SMHA 4B4QA 5FYUA 4YG0A 1R64A 2XVKA 4OZOA 2VZPA 1RUG3 5KXBA 4GZ9A 1XYOA 4WM7C 1MPXA 4HL0A 3AP6A 4M0HA 4YW2A 4NN0A 4CA9A 1RUJ3 3BI3A 1AYM1 1RUF3 2QFEA 3RZHA 3WP3A 3D4KA 3RNSA 4L92A 3J4UH 3WDVA 2J1VA 1DQ5A 3LIHA 3UL2A 3KZ4C 1VMFA 3QD6A 2VUAA 3V56A 2GP5A 1VIWB 4R52A 3THCA 2BFUS 2I2SA 5F3EA 3N9QA 3DL3A 2XVGA 2XKPA 2YG0A 2D5FA 4IEZA 1NA1A 2RG4A 4DPNA 1RMU1 4QB2A 1SLCA 4YW7A 3TAYA 1IG3A 3PHMA 1UMIA 1SLBA 2VZRA 4LO6B 2W2IA 4QGLA 5LA0A 1ND3A 1B35A 5K7PA 3ELNA 1XRUA 2HWB1 4M3CF 4A3XA 5F39A 1CZTA 3ZIXA 1N1SA 5F5AA 4DXTA 5BNPC 1RITA 2YBKA 3BPSA 4BXFA 3ECQA 3KV5A 5ACA2 4K3UA 2ETEA 2GNMA 1PK6A 2R32A 4MGSA 1Y9GA 1VBA1 4NPMA 5JIUA 1FOD3 3NKGA 4AR2A 3CMGA 4FXKB 1PM4A 3MIHA 2HYKA 3LQCA 4TWTA 1KJRA 1N1TA 1APNA 1GNYA 4FPYA 4UF0A 1EUUA 1WMXA 3GYDA 3O0XA 2RS13 5L7OC 2HEWF 4NPLA 3VBUA 2ZMLA 2DV9A 3LGRA 4Z07A 4XUPA 2AACA 1YI7A 3TN92 1WLDA 4A6OA 1RUE1 1VB2A 1M4WA 5LATA 2D5HA 1CIWA 1DDLA 2WDBA 1V6IA 2BNNA 1OF3A 1TNFA 1W9YA 5JVVA 2P3YA 1QHDA 3VBFA 1UF2C 1XXNA 4V1PA 3I49A 1ZZ8A 5IVJA 3GCWA 4IL7A 1LRHA 1SDDB 3H8UA 4AGVA 1D2QA 2PYTA 2R49A 3GZAA 4FFFA 4QT6A 2EIDA 3WVJA 1N1VA 5F2WA 1K3IA 2DFBA 2N7GA 4M4PA 5IVYA 1WA4A 3RDIA 3KT1A 2D40A 4CDUC 3MLLA 5FP4A 5HXVA 1GWLA 4COVA 3ZYGA 2RDRA 1PMIA 1G9BA 5FZFA 3N9LA 2XKOA 1EPZA 3N9OA 3K3OA 4QPIB 1O3SA 1QNWA 3OGRA 1W6QA 5FBJA 4E2GA 5DAVA 4AWDA 1NZIA 1R1A3 5L9VA 3T2TA 3MFCA 4QMAA 3RFRA 2ET7A 2AEZA 4YG3A 5FR3A 3MPPG 1AYN1 1FI2A 1YFWA 1IS6A 4ZHNA 1G6NA 1W2TA 1YQ6A 4IEUA 4IE7A 3ETQA 1M06G 3PIJA 3EXUA 1OH4A 1YUDA 2IWGB 3OBAA 4ISQA 1LGCA 1BBT2 5KXEA 2VR4A 4QKNA 5FZDA 1Y43B 3ZYJB 4QX5A 4GB33 4IEOA 2W94A 2BGPA 1J84A 4RA0A 1RC6A 1SMVA 4HZFA 1Q43A 3DPRA 4Y5Z0 1ZBE3 4OMDA 4Q0PA 2YY1A 1O8SA 1JTZX 2WO1A 4MYEA 1OOPC 3LKJA 2CY6A 2C9KA 1BYHA 2RHPA 4YVWA 5I8SA 1RHI3 4WV8A 3EBRA 1O5UA 3ZSEA 2YHJA 2R071 3MIFA 4DFSA 5F7UA 1OSGA 2QQLA 1GFF2 3NNFA 5F1RA 1JBCA 4IXLA 4ES8A 5A3TA 4BM8A 2RV9A 3WV6A 2B39A 2JDYA 4P9IA 5DZGA 4YW5A 4CUAA 2QCSB 2Y60A 1UMHA 1NCRC 1N3QA 2VMGA 1PO11 1UOBA 3MHZA 3ZFFC 2ZCWA 3OBTA 2WLPA 3D6EA 3O14A 1WA6X 2CDOA 2D97A 2V5YA 3HIFA 1UOFA 3OEBA 4CDQC 4BQ4A 4COWA 3B01A 1R1A2 2EXIA 1ODMA 2VY0A 3ORJA 1SHWB 4CEYC 1JH5A 2B9UA 1ASJ1 1EUTA 2Y6HA 3OJBA 3WW1A 4LQRA 4CEWC 4GWMA 4IGQA 2PA7A 1UW8A 2BGOA 4IE6A 3J8F3 4J1WA 3TBDA 4ARYA 2ZGLA 4PQQA 1BEV2 2J7MA 3B3QE 3J7LA 4HT1T 4XAEA 3H7JA 3UYJA 2NN8A 3NV3A 4IEXA 2RS32 4PDWC 3LDKA 1MS1A 4Y1ZA 2RDSA 1UZ0A 4P9YA 1Z78A 2E32A 4BQ1A 4ZZ8A 4RS5A 1EV12 5J7MA 1JU4A 5T5JA 2ARXA 3ST7A 3GDBA 1R092 4QGNA 3DYPA 3H9AA 1WW5A 3RVHA 2D98A 3FFQA 4LULA 1LTEA 4K1YA 4OZXA 4D6RA 1RHI2 3PUAA 1GBGA 4CCLA 1AR82 1PGSA 1W04A 4ZONA 4W50A 2YBPA 4ITCA 2VUJA 5ACA1 3ACLA 2G9ZA 1UIKA 2BRTA 4M00A 2VVEA 1GANA 5BNNB 3WG4A 5FZGA 1JZ5A 2GN3A 1DGWA 4FOQA 4OHYA 3Q9OA 5AC93 1C5IA 3MUY1 3VGIA 4BK4A 1XU1A 3U14A 1PX4A 2FCVA 1VR3A 2DBNA 3AZXA 1EPWA 1DQ6A 1TME1 3ZXKA 1SPPB 2CGNA 3VDBA 1PO23 1HV0A 2WNUB 5A1FA 5DQ0A 5C8CC 1JOBA 2IXCA 3TN91 1QJY3 3B7MA 4YYOA 3OGJA 3VBOC 1IQAA 4CXXA 3JZVA 4JGZC 1IOAA 1Z7S2 5F6KA 3VDCA 2VMEA 1EY2A 2ZBJA 4GIQA 1PX3A 4UWDA 5DUUA 2BPA2 5B2GB 2LRPA 2G1MA 4XJUA 5GM0A 2BFUL 4XFHA 5A70A 4RFRB 2CHHA 3DF0A 4F8AA 3K2OA 5JXHA 3BCWA 2ZAAA 1DLCA 1DZTA 4N7IA 5FXXA 5FZ8A 1X9PA 3PUQA 1W9SA 4OI1A 2BP6A 2JKXA 2XQRA 5JOWA 2RE9A 3PU8A 2LUWA 1GU3A 1YJKA 2SLIA 3N9PA 3UJQA 3ZDVA 5BNNA 2ZTNA 3P3PA 3K75B 4MXVA 4XF4A 1W90A 3R05A 3WHTA 3DECA 3FUQA 1XU2A 1DGRA 3AMPA 1W6NB 2XWJB 4K8RB 4ZY9A 3VDAA 5HCFA 1JYVA 3U0ZA 2O8OA 1H1MA 3CKHA 1FYUA 4QGMA 4CP1A 4AVCA 5AFBA 4XFIA 1V9U3 1OLMA 3ACGA 4BDVB 1IGOA 4CU6A 5GLTA 1IQDC 4RHV3 2PQQA 1BBT1 3NNMA 5BNQA 1CAWB 1KQRA 1ZBA3 2VCBA 4QXKA 5G04L 5FYCA 2VGDA 1UL9A 1HRI3 1W06A 3VBHB 3MV11 2VNVA 4WBBA 3HAGA 1J3QA 4QPIC 1UX7A 4PLMA 4CRQA 2XLFA 1VRH1 5FZ4A 2DVGA 2VMIA 2XBO3 2MNGA 1J1TA 3BALA 1UU6A 2XJSA 4WVMB 5DPNA 3T2QA 5FYBA 2ZS6B 1OVPA 1AXYA 2A3YA 4CPBD 4EJRA 2CAVA 5LZ6A 4Z2WA 4AVVA 2VTXJ 3VHNA 4Q4X3 2QVSB 1LHWA 1MEC2 4QX2A 3T1LA 1POQA 1NQJA 3IMNA 1W6NA 1QJX2 3AMQA 5F5QA 2PAMA 1HJFA 1CESA 1XOYA 3LPFA 1UZYA 4H55A 1DLLA 1AL21 4B29A 5FZCA 1JYXA 2WL1A 4C8DA 4M0NA 4TZDA 2W1QA 3KVBA 5FZOA 4RL7A 2Q30A 2J1TA 2QE3A 1ULDA 3JCIA 2P6CA 4K7JA 2WSUA 3HWJA 3O0VA 5FMBA 4FQZA 2RR12 5EIYB 3POBA 5FQ0A 2OQ6A 5LW9A 4FAGA 4TTGA 4GD4A 4ASKA 1REFA 3KT4A 1VB4A 3ATGA 1BEV1 3T1MA 5T52A 1GR3A 3HQRA 5T5LA 2W46A 4QKFA 4Y3OA 2GNBA 2Y38A 2RS31 1F4HA 3BTAA 3POWA 1H2NA 1DCSA 3N3HA 2A6ZA 4GQ7A 3E6DA 3FMGA 2JE9A 2OXBA 4D6QA 3N9NA 4FI9A 4MUVA 4CDXB 5CG8A 1XNTA 3O7OA 3W9AA 1UU4A 3MICA 1TZOA 3TEWA 4P9JA 4EN7B 1W0NA 1AR81 5FYMA 4IQPA 5LY2A 5DDJ3 5A6XA 2BTVC 2WNOA 1GZWB 3M3CA 4Q4X2 2VZVA 4MZUA 4BB3A 5IK5A 3VD4A 3WDYA 4NR1A 3AXDA 5GLWA 1NG0A 4PI2A 5LBFA 1WUVA 4D6SA 4QD2A 3VKFC 4XZUG 4TYSA 4CU8A 2OKXA 4QKDA 2A6WA 5EZWA 3GHMA 4LKEA 3VHPA 3WP4A 5I0UA 5JDBA 4ASLA 1XB9A 3BOWA 2WA4A 4LMFA 3O1UA 5FZMA 5B4NA 5LEKA 1SBDA 3MLJA 1OD5A 4R9CA 3TEZA 4HPKA 4UW5A 4M4RA 4AE2A 4LBMA 3KCCA 2V09A 3OSDA 5AFEA 3VKNA 1I1EA 5A7WB 3WNXA 3PMSA 4OUMA 5FRAA 3WY6A 4Z2AA 4HMZA 1FPN1 4QX0A 2JENA 3KF5A 1RVF3 3AP4A 4LHLA 4PLOA 1R083 3LIGA 3HNMA 4UFLA 3OD4A 3NV4A 1DGRN 2QDNA 3LZZA 4GMP1 3ZYHA 1SFNA 4X8NA 3VZOA 3ASIA 1C8M1 3K3NA 2ZHMA 4JCKA 2D43A 2PAKA 1C8NA 3OCPA 3OY8B 4YZ1A 1QU0A 3VZJA 2HBTA 2ERFA 3PUSA 1MZEA 5CU1A 2IFWA 2WWJA 4FPCA 5ABJA 3J7MA 1IPJA 2B9VA 2D6MA 4Q4W2 5FTTC 4LORA 4PIYA 4JRLA 2DCJA 2HLEA 2JDMA 2WAOA 3C8XA 3ZR6A 3MGUA 4CCDA 1BQPA 1VAMA 4QHOA 3PMEA 4GKXA 2C9AA 2X29A 1RUI3 4N8MA 3L9JT 2D6PA 4PI0A 5EV7A 2NYYA 1D4M3 5C3RA 2C1FA 2KXLA 4E4DX 4NIAA 2IXLA 4IESA 4UW3A 5C8WA 2P5BA 5C3PA 5KHKA 4GXLA 1FNZA 2VW0A 4D69A 1GLHA 1W3VA 3W21A 5L73A 2RDNA 3GXUA 4ASMB 5CFCC 5IFPA 3BTZA 2VNRA 5FMOS 1JOPA 1O91A 3DYOA 2CU5A 2Y0IA 4IERA 3ZKUA 4ES9A 3I3MA 3QLQA 2UY9A 4LK6A 4ZU5A 2EAKA 2RMU3 2DURA 3AVRA 1V00A 4EYUA 1MEC1 4BU2A 2ILMA 2JG9C 3WW2A 1CR7A 1WKYA 2ES3A 3U78A 3WQBA 1QJX1 1UYYA 3LE0A 3U1XA 4JHTA 2O0OA 2WA3A 2W9XA 1SBFA 3H3ZA 3N7KA 3HPNA 5A32A 1T2XA 5FP7A 3LOIA 5T3NA 4BA6A 4IV1A 1RIRA 3K77A 4LHKA 3UGHA 3OOXA 4AVTA 5IK8A 5GZCA 1HDKA 2PN5A 3LEIA 1CAUB 4MGKE 4CVUA 2ZGRA 3ZM8A 1TMF3 1UXZA 3R4SA 4FFIA 5F8PA 5JAXA 2QQPA 2QJVA 4OHVA 5D1IA 1HW5A 3BIWE 3ZFGB 2XHNA 2LALA 1D4VB 1XE7A 4FTEA 2W1WA 2X10A 2XONA 4FOVA 4DUWA 1PZ9A 2FZ2A 3DUIA 4RYDA 1FMD3 2HWF3 3BOPA 3Q8AA 5H9QA 5HBAA 1QJZA 4C90A 4OHZA 1G86A 1GZ9A 2WFF1 3AB0A 3DKWA 3WNKA 2JG8A 1KEXA 3T2OA 1RUC1 5EYXA 4HVOA 5FDBA 1A3KA 4Y1YA 2DUOA 3SH3A 1DGWX 5FBZA 3IIIA 3UK9A 1RMU3 1LEDA 2LM3A 5FUPA 1F35A 3C7EA 5GKAC 3SNMA 4YSFA 2DVFA 1X8EA 4LUMA 1WWYA 4O9EA 4QHBA 1YIPA 4O65A 3WCRA 4Q0QA 3H1YA 1RUD1 1RUH2 2X5IA 2ORZA 2KM2A 2ZHLA 4JVAA 4EWEA 2HWC2 1CAUA 5JMCA 5B4XA 4Q1RA 3CJXA 4PHZA 3JD72 1VBA3 4ISRA 1PGW1 5ERLA 2W08A 2K46A 5HV0A 1AR93 3NAPC 3W20A 4AHYA 5IVEA 1OT5A 3NSTA 3TRSB 3QH7A 1N3OA 4HVQA 5KHJA 2ID4A 1H2LA 1OBNA 4LKFA 1LU2A 1RUE3 2CWSA 2C6SA 1AYM2 3ZIWA 4XXAA 4Y26A 4YM3A 2F6BA 3VN4A 2CYFA 5BNPB 1VJ2A 2YGMA 1CAVB 2DVAA 3IMMA 4QPYA 4AFAA 4AOCA 2XJVA 1N1YA 5CKMA 2XG3A 4NWWA 2J1UA 2VZTA 1SFPA 3HNBM 3MW3A 1WW6A 4KWLA 4WM7A 4CDWC 5CAZA 5FPUA 4TLGA 2Q8CA 2VMDA 3OBZA 5D8AB 2GMPA 3I8TA 5IW0A 4E9KA 1H9PA 4Q0UA 5FKBA 1W8NA 3ZXFA 5FOBB 4BIFA 4D7TA 2EXJA 1E5RA 2WQ8A 2YPJA 2Y6GA 2NZ9A 3MYXA 4XFCA 5L7OB 2IFRA 2Z5WA 2P3KA 4BOWA 1IHMA 2HWB2 1Q3EA 2DU1A 1CPNA 3ACHA 5DAPA 5KHIA 3SH4A 5APAA 4Q4W1 3M3QA 1LJ7A 3V64A 3SQOA 5HCHA 5LASA 4NOTA 4OI4A 1OQEA 3T09A 2CSGA 4LBOA 4BQWA 1UKGA 1OA2A 4QB6A 3ZSLA 1OH3A 1VBC3 4L99A 3H0OA 3I2JA 2Q8OA 5FY5A 2CNAA 2UU8A 5FREA 1H2KA 2XJQA 2K2SA 5FZBA 1ALYA 2BUKA 2ZXQA 3IDCB 2WLQA 4INDA 4IV3B 3POEA 4QX8A 1ULOA 4NJ4A 2HKXA 2VQUA 4META 3C7GA 2JECA 4HKWA 2VW2A 4XEZA 1V6MA 1NXD1 1RUE2 2Y6KA 3CHXA 5DAXA 5A7OA 2Q8EA 1F15A 3O1VA 3R6SA 3I97A 4Q26A 3ZXJA 2VOXA 2UWBA 2ZPXA 4XQDA 3HBKA 4JGYB 1KGYA 4UOJA 2QBXA 2R073 3AVSA 3MF9A 1F31A 1POV0 1DFQA 2B8MA 2TNFA 3LWCA 4BYYA 2YU2A 2J1SA 4BH9A 1EAH3 3IIAA 2DUQA 3PDQA 4P9LA 1VP6A 5C70A 2ZGOA 4DINB 4HN0A 4G9SB 2DTYA 2LTNA 1CN1A 1PO13 1WCDJ 2PHDA 4OCTA 2WO3A 2ZX4A 3Q8EA 3V0BB 2R042 1O3RA 2B5HA 1OFNA 3GZEA 3MIGA 4JX0A 4IEWA 3AMHA 4Q8LA 3CJIC 4JKMA 4LXLA 3SHRA 3NNLA 1CX4A 1UZZA 2VC9A 3QCWA 4JKKA 4PIZA 1ZZCA 5K8SA 4XFFA 1AXZA 2VECA 1JZ4A 5FOJB 3AJYA 1D2SA 1YYNA 5CVRA 1AYN2 4CDUA 1MVQA 1S1AA 4YM0A 2YXSA 2IVJA 3THTA 2A3WA 4H2AA 1BVVA 2VXRA 1AHSA 2WR9A 3POSA 4P9GA 5LK5A 3S5QA 3FLTA 1UPSA 4DO0A 4XUOA 4R9DA 2GALA 4FPJA 4IEPA 3I2DA 5FZ7A 5A3MA 1YQ2A 1W2AX 4LE3A 4LLOA 4OI2A 2ZACA 1YI9A 4BZ4A 1BKZA 4GH4C 3EJKA 1OLQA 3DGTA 4S2DA 4KGQA 4RQPA 3WNMA 5FMOL 1QXJA 2WIIB 2BDRA 4MHRA 4QQOA 4COYA 5A3PA 2GC1A 3RWNA 1RUH1 1F5FA 4QAWA 1DZQA 3WG2A 4CEYB 2AR6A 3CIHA 3HN3A 2HWC1 1UMZA 2RM21 4CEWB 5ACA3 3LCPA 1YRZA 2W1UA 3JD71 1ND2B 3OEAA 3HQXA 4KBZA 1BMV1 2E63A 1XSRA 4AGRA 1OOPA 2G9FA 1QEXA 3E5XA 2FMDA 3VBRC 1PO12 4MXWB 4DUXA 4PDWB 2ZABA 3QACA 1C57A 2AZ5A 4R8HA 1LAJA 3KB5A 3PVNA 4Q27A 1OFSA 1TME3 1W6OB 3D5OA 3RPQA 3RYPA 5C9AC 1LKNA 5J09A 1DQ0A 3Q8CA 5FP8A 3EYPA 3TN93 1GUIA 2Z69A 4GALA 3X29B 5JMOA 3MEPA 1GKBA 2ZX2A 1W6MA 4Y1XA 1LHOA 5CFDC 1I6XA 2EVXA 1ACCA 1ASJ2 1NCRA 2BEOA 3NW4A 1H8TC 4XUNA 3ZFFA 2KA3A 3N7LA 3KLSA 4K1ZA 4UFJA 3RZLA 1RUOA 4UXAA 1VAKA 3WDWA 1ENXA 3I2FA 3POGA 4CDQA 1HN1A 5K0UB 4P14A 2VBDA 4LA2A 5KWRA 3VKOA 1V6KA 2PMWB 4JZRA 2ZKLA 3I3QA 2WZEA 1WMEA 4LIVA 4JRAA 4IETA 1FAYA 4MGYE 2VQAA 4DIQA 5C8CB 2UURA 1LGNA 1DP0A 5FZ9A 3VBOB 3NJXA 1UX6A 2OQ7A 5M0TA 1QJU1 4JGZB 3N4MA 1SCSA 4IEQA 4MXWA 2VAUA 5EQUA 1W03A 1W99A 3RI9A 5A1LA 1E5HA 1TE1B 5GLZA 4EQVA 5T5PA 1GWKA 3VD3A 2H0VA 5FZ6A 3JBG2 3ES1A 1VBB1 5D8AC 4A7KA 1BBT3 4WVVA 1JOJA 3H1MA 4Y1VA 1OXCA 2YC2A 3VBSC 3ZXLA 4AHXA 1MS0A 4YPJA 1LU1A 1TME2 1JZ7A 4IEYA 1E5SA 2WN2A 2W52A 3NQHA 1CONA 1QXRA 2QNKA 2VZOA 4J25A 3KHCA 3HEIA 5T55A 3POYA 2ATFA 1EYBA 2W0XA 3AYCA 4ZXKA 5HCBA 5C7GA 5J36A 1AUYA 4QXCA 3NWKA 3SEEA 4AI3A 4BCUA 3A4UA 2H6BA 1SACA 4N53C 4EWDA 1H0BA 4DRVA 4LBQD 2CGOA 5C8CA 2HWE1 1GQGA 3E6BA 3OF1A 3UGFA 4ZS3A 3VBOA 5JZGC 1V70A 2EXHA 1CZSA 4XQ4A 4IV3C 3THDA 4N9HA 3TOJA 3CNAA 5T54A 1FXZA 5BPXA 2YC4A 3AKTA 3W5MA 2R16A 1OMIA 5LCWL 2GZWA 2XDVA 2R041 2V4AA 2HEYF 2AYHA 2JDNA 1WLCA 5I91A 4AEJA 4KWUA 1QWRA 2UYAA 3VV1A 1QOSA 2AH2A 2DVDA 4MG2A 3M8LA 4JGYC 1YHFA 3EMRA 1BLZA 3IDAA 4EN9B 1C1FA 4FPFA 2VBPA 4R4XA 4OHWA 4AI8A 5FPAA 1GOHA 1C5HA 1UYPA 4XC9A 1BEV3 3S0MA 3GM8A 4O7XA 3LD8A 1W9FA 2RS33 1L7QA 2J1RA 2PAEA 1AX0A 1YQ5A 2D3SA 4JDOA 1ZZBA 5FUNA 1DYOA 1RL3A 1EV13 1I5ZA 2P34A 5DG2A 4HLTA 3B9CA 2Q1MA 4Y5SA 1VRH2 1R093 4HK9A 4AXOA 1YFYA 3H8OA 1QDCA 5ISLA 4FOWA 3UKNA 4LO8A 4AI9A 3GGLA 2PFWA 1YNAA 1J83A 3RYRA 2CGPA 3W58A 3ETPA 1NZCA 3CU7A 4MVTA 1AR83 2JEMA 4XILA 5FK7A 3USUB 5C3QA 1GZTA 2OIIA 1MS9A 4FPGA 4ARXA 5K9YA 1HB2A 1T6BX 4QPIA 1Q8SA 4W6YA 4RGAA 4Q4V2 5GZFA 5JSOA 1AVBA 3K46A 5FLIA 3CL1A 5IAXA 3MBWA 4QDSA 5A1AA 4ZS2A 4IE0A 3THPA 1AL22 3O1SA 3ZYFA 3VLBB 2R0FA 4PF1A 2R062 3M1HA 4QB1A 3SCHA 3AFKA 3ME2A 4W4ZA 4G3YC 5J96B 2E51A 4NUBA 4I3GA 4XABA 4DXRA 3ILFA 3C7HA 4A44A 5JSRA 1Z7S3 3WW3A 3MF6A 3VD5A 3UNPA 4GA9A 2XUMA 1X50A 1NCQC 2VH9A 2VXJA 4OUSA 3SKVA 4LBQB 1UYZA 2I45A 2ZGUA 4FTBA 1ND2C 3KHBA 3WNPA 2XR4A 3B93A 2W87A 3JU9A 4XYXA 2YUEA 4BISA 2I74A 3WP5A 1HV1A 3LDRA 3A22A 1FPN3 4B4RA 4YW3A 5A3UA 2YPDA 2V73A 4S2GA 2EIEA 3PJQA 2OYZA 4AEMA 2A73B 3NV1A 1JMUB 2NMOA 4GMP3 4QM9A 5FY0A 3FFZA 5KC5A 2JDZA 1UO9A 1VBD1 2EALA 5C3SA 1LOFA 3DN7A 4NIDA 4KG8A 5BNOB 2WC2A 2D3PA 1P8JA 1PHMA 2OPWA 2B45X 5EJZB 2EA7A 4XE9A 4HETA 1B35C 3DXUA 2OZJA 4KNCA 4XACA 2WNVB 1GWMA 4BQXA 3JBG1 3AZVA 4EN6B 5SV5A 5FZHA 5CG9A 3AL6A 3CQOA 3ZMOA 3M3EA 1F4AA 3WG1A 5K0UC 1S0EA 2EIBA 3FC0A 2GDFA 4OUEA 4RN5A 3IZOA 3QBQA 1CGPA 1OLME 3AX4A 1H9WA 1ZYBA 4QM8A 4D7SA 4E27A 1TVGA 3FN9A 2CAUA 3M70A 1XNDA 4MGIE 5H9SA 4QDRA 1GQHA 4K20A 1O8PA 1UCXA 2BYVE 2WO7A 5FY1A 4WVWA 5LWBA 3AK0A 3H8XA 5LA2A 2LW8A 2Q8DA 1WW7A 4FQ4A 4XIOA 3J26N 5FWJA 3MFAA 5GLUA 1G7YA 1UZVA 2RS52 1DU3D 1DQ2A 2V5DA 4FT8A 4TN7A 1S2KA 4XFGA 4E8CA 3LA7A 2ZX3A 1OA3A 4YGDA 2YBSA 1DIWA 1MEC3 1UN1A 2PHXA 3U4XA 1FPN2 1REDA 1S0DA 1ZRIA 1LB2A 1QJX3 1O3QA 5FJHA 1JYIA 5I93A 4AVSA 2VZUA 1C8M2 2P3JA 2YYOA 2XJTA 5EHDA 5E88A 3MIEA 5E89A 1XBFA 5L9BA 2BQPA 5ANNA 4AAPA 5CFCB 4LJHA 3JB8A 3JUUA 3KGZA 4EN8B 2RR13 4KWJA 1LR5A 3P6BA 3OBRA 1W8HA 2WUHA 4Q0SA 1SPPA 3PTRB 4XBNA 1ULEA 4D0QA 2WNUA 1GOGA 4N90A 3ZXDA 4JC1A 1OQ1A 2JG9B 1CX1A 4L8QA 2WFF3 4LNVA 3HN1A 5JR7B 5LY1A 5IJRA 2P6HA 2HJIA 2ZKNA 2JE8A 1UWWA 1HQNA 1HX6A 4QPGB 5FZLA 4Q4Y2 1W2OA 2HBUA 4FCAA 2WT0A 3V0AB 4GAZA 1CWPA 2DCTA 3IN9A 3T30A 4P00B 1AJKA 1WZXA 1ZNPA 2Q4SA 4HN1A 3VB9A 1XNCA 5F32A 4FTSA 3DPRC 4QDQA 1RUD3 1ZA7A 3H42B 4LK7A 4RGGA 4B7EA 1HKDA 1QH6A 2BERA 1FOD1 2VCMA 4B3NA 4YVWC 4D7YA 4J1XA 1X8MA 3UGGA 4EZHA 5EWSA 1WD3A 1VPHA 1L7LA 1PM7A 2WRAA 2Z79A 5E6HA 1V6LA 2JDUA 4CSWA 4CXYA 2A3XA 4Q4V1 4UFIA 5DAWA 3EHKA 1COV2 5IVFA 2ZHNA 2BVVA 3NO8A 1WW4A 3JB4C 3ZSJA 4XIKA 5J1XA 1GQPA 1UIJA 1VMHA 2Y26A 1H30A 4HOOA 2JDPA 2R061 2ZA9A 2RJLA 3HQUA 4LA3A 4MGQA 4LEJA 1GZCA 3RRDA 4Y24A 1UOJA 5A7NA 3WT3A 3M2MA 3RI8A 1MQTB 5F2SA 2GH2A 4K40A 4CZSA 4E2SA 4DEVA 1IKPA 1CAWA 5J48A 5GLVA 2JIGA 3P5BA 2QQJA 5EFUA 3VBHA 1WCQA 3ZPYA 5FV3A 3SKJE 2WZ8A 3H1WA 3GJBA 4OHXA 4QQHA 4XF0A 1MACA 5FO7B 2BWAA 1SZBA 2WFF2 5FP3A 4WVMA 3VDDB 5C33A 1UY0A 4LE4A 3HBZA 1RUC2 1UQXA 3RZJA 3PU3A 4AQ2A 3NAPB 4NIHA 3SLIA 1CIYA 5A3NA 4I0WB 3TNPB 2LROA 4XJZA 2FDKA 4A41A 1UZWA 4IEVA 3S7EA 3JQXA 3KV9A 1F9KA 1H4HA 1S0IA 1W8OA 3IAQA 5A33B 4C1WA 1ODNA 1RUD2 1UU5A 2VG9A 3VD7A 4Q4W3 2JE7A 2GSYA 2Q1FA 1ULPA 2XOMA 5FZIA 1XSQA 3NJVA 4BIOA 1RJ7A 3S7IA 5FPZA 3T2PA 1OKOA 3S5AA 3PLQA 4Y33A 3D82A 1S0CA 5L19A 1PGW2 2YB7A 5LA1A 4AEDB 4CDWB 1BCXA 5I0DA 5IK7A 2HWD2 2EXKA 4BQ5A 3S57A 3WOGA 4YG6A 1ZBE1 2VZQA 3WNOA 4BE3A 4NIGA 4Q2FA 5BYNA 2WN3A 3WEZA 5SV8A 1C28A 3VL9A 5BNOC 1H4GA 3DKQA 2BBVA 3WF0A 1OLRA 3IAPA 4NIIA 2FMYA 1LNSA 1Y4WA 2DU0A 4YZ2A 2WT1A 5EYYA 2RS51 4TSVA 2WNVC 1LEMA 3HNYM 3NAPA 1K5JA 3K4ZA 2VW1A 2ZEZA 1IS3A 4OQ9A 1JW6A 5FYYA 1Q56A 1TQ5A 3ACIA 1POV1 3AP5A 4UBHA 3T0AA 4CDXA 4MLOA 3IDBB 3MV01 1UOGA 1ONAA 2F17A 3FWEA 4I0BA 3ZYPA 4HONA 1JN2P 3ZXGA 4HFSA 3WD5A 1US2A 1C4RA 1Y7BA 3RZZA 4JKLA 1GZWA 2A71A 5DUWA 3VHRA 1C3HA 5DXDA 3OB8A 2IZWA 3FX3A 1WD4A 1HQLA 2X09A 4DB5A 3FZ3A 3KSCA 3PVBB 1JZ3A 3WDUA 4XUTA 1O4ZA 1S4CA 4YZ5A 1Q8PA 4CDWA 3J8F1 4COUA 2UY8A 3WX5A 1NX9A 1RTVA 5EJ3A 1W8FA 2MEV2 3DYMA 2Z2SB 4W8JA 1XE8A 3O1OA 4CYDA 4XFAA 3K51A 1ZRRA 2WQ4A 5E8AA 1HB1A 3PVOA 1MS8A 2F4LA 1GV9A 3C7OA 4AI0A 4CPBA 3R4UA 1O5LA 2ADDA 2FCTA 4YVSB 3JXSA 4DXSA 4Q4Y1 1G9CA 2WNEA 3I4IA 4HXCA 1LOCA 3K4AA 3UETA 3ZSKA 4BMEA 5A7WA 3ZN6B 4FP3A 4Q0VA 3BYWA 4XTPA 2W91A 4K6BA 1G9DA 1LODA 3O5SA 1V6NA 5FY8A 3KF3A 2VMCA 3N36A 4N43C 4X6QB 1LULA 5JOXA 3CJIB 3PL0A 2ARBA 4B8EA 4CP9B 2DWRA 1RUH3 1WMDA 4IGPA 5IVBA 2BNOA 3AP9A 5KR7A 2HWC3 1OA4A 2VQ0A 3OY8A 2PHFA 2GC2A 1COV1 2J42A 3JD73 1LGBA 2CDPA 4NHLA 1UY3A 3VZMA 4S2FA 3APBA 4QPGC 3LDBA 2W3JA 5FZ0A 1HRV2 2B4KA 2V72A 4BJ0A 1W6PB 2VCAA 4SBVA 4B7KA 1QDOA 2GNDA 4CCNA 5KHHA 4C91A 3H50A 4FOYA 1W39A 4FXGB 3OUJA 4A3ZA 1L3JA 3NNGA 4GH4B 1BK1A 5C4WB 2FCUA 2XLAA 3H3LA 3RYKA 4NHYA 1AYM3 3T4VA 1Y9QA 3WUDA 2ZX1A 1A8MA 4XHBA 1W05A 5F3GA 3TEXA 3AM2A 3FE5A 2A70A 1BVP1 2Z42A 2CV6A 4NAOA 1U0AA 2QQKA 1ZREA 2GMMA 5JLVA 3KT7A 3CJIA 4CP9A 2DCKA 3AKQA 3PNAA 5DUVA 2A6XA 2A5ZA 1NKGA 3CEWA 4RGKA 3VBRB 3VKLA 1MQTC 2VM9A 1YFXA 4KWKA 5C9AB 4NE9A 5CKQA 3I59B 1O4TA 3E6CC 4CCMA 2MPFA 4MADA 4CCJA 1QY4A 2HWB3 2AGSA 2W39A 1QJU3 1YJLA 1LESA 4YLZA 5CFDB 5FXVA 4RHV1 4AAXA 2RM22 1S0GA 3C7FA 1ZBA1 2PTMA 3K48A 1H8TB 2ZGSA 4XETA 3VDDC 1ZRFA 4FAHA 3ZFGA 1BMV2 2YMZA 4GH4A 4ZPIA 1DG6A 5DZFA 2HWD1 5IHRA 5J3UA 5KC6A 4LO5B 1RJ8A 3OPTA 4XJAA 1JYNA 1KD7A 3LSDA 5TSWA 3UV9A 5IUQA 2ZGNA 4FPKA 4A45A 3WINE 1MS5A 1HLCA 3OGGA 4E4SA 3SEPA 4XQWA 1HXS2 3FBYA 5H9PA 3VBRA 4Y20B 4AQ6A 1CAXB 4H7LA 3ZSMA 4LLFA 1ENRA 4ET7A 1KRIA 5HCAA 2JB8A 4CP2A 5C9AA 4XJ8A 2WT2A 2ZGKA 1Q8VA 1FNYA 3NKTA 4AEDC 4DY5A 2HWE3 4E2QA 4AG4A 4B4PA 1SLIA 3J7HA 4FP2A 1GNHA 5IVCA 1DYPA 2CWMA 5KXCA 3VBSB 5I0RA 2QDRA 2R043 4HK8A 4RR3B 2JICA 1H8TA 3B94A 2R1DA 3IM0A 2QQUA
chains in the Genus database with same CATH topology
1LOGA 1AXKA 1F5JA 4I09A 4Q1PA 3VUOA 3ALQA 1QJU2 2G4IA 1YLLA 2MEV1 3L2HA 1QXPA 4W6XA 2QZ2A 1AYN3 4FVVA 2VNGA 4C1XA 4OFGA 5A3LA 2YZ4A 1DZRA 3NVCA 4AGGA 4YARA 4ZU4A 4N53B 1QOOA 1VBB2 4LO4B 2A7AA 4N9IA 5C6CA 1J3RA 3MI8A 5JZGB 5BNPA 4AVBA 2FHRA 4KU7A 1CAVA 3SXWA 4XOGA 1QNYA 4BLIA 1CAXA 1PZ7A 3M3IA 3LSEA 1SEFA 1KJLA 1CD3G 4PBOA 2B46X 4RFT0 2WS92 2PHLA 2FQPA 4M3CB 4AFDA 1XYPA 1OQDA 3KCYA 5D8AA 4AI2A 3ZMNA 4Z8BA 3KS7A 4L9BA 1DQ1A 2BW8A 3BB6A 4HKLA 2X8KA 3MIBA 4XBQA 3RJ2X 3VBSA 1IZ3A 3HD8B 1LENA 1YIFA 3TNQA 1FV2A 5L7OA 2E7AA 2HWE2 3ZFEB 4YVSC 3WR0A 2P3IA 1CPMA 1HRV1 4XZPA 4EROA 2F4PA 3VZLA 2E53A 1XYNA 4XJWA 2OPKA 1JXNA 2JX9A 1SLAA 4PJYA 2UWAA 4C0BA 1ASJ3 4IV3A 1J3PA 1UD1A 3PTYA 4RSUA 5E16A 5H9RA 4XPVA 1R081 3WQ0A 3IPVB 3CO2A 4AFMA 2P37A 4BMBA 1A6CA 1KFUL 4M3CA 5GZDA 3KCXA 1IPKA 2CL2A 3WXPA 3N7JA 4QQPA 4JGYA 2C0ZA 3ZVXA 4F3JA 3C2UA 5CBLA 1AZDA 3WCSA 1VBD3 5C4WC 3KD4A 2AENA 4F7ZA 3DV8A 2WZR2 4BWOA 3E5UA 2GC0A 1MZFA 1N3PA 2E7TA 2XJUA 4XF9A 2G9GA 3V0BA 4L2NA 1NCQB 4LBKA 3D0JA 3JBG3 4KQ7A 5FCCA 4TLFA 1ENSA 2IXJA 2NLRA 3GBGA 1QF3A 2AREA 3IT8A 3MPBA 5BY5A 3QOPA 1KXGA 1I9RA 3AKSA 1JHNA 3S30A 1AR62 5CADA 1AX2A 3M3OA 1JUIA 3AYEA 3ENRA 5T5OA 3HR9A 1B09A 4U36A 1NA1B 2EF6A 2GH8A 4COZA 1HXS1 3ZX7A 3AKPA 4JV4A 1WGPA 3IWZA 4DY3A 5JI9A 1PIV1 4I0AA 3WQ7A 1ND3B 1B35B 1ZZ7A 4F83A 4KH9A 2XPJA 1WLWA 3J9SA 5J37A 1Q5OA 4P5HA 4LTAA 1Y3TA 3IBMA 1ENQA 1TMF1 2O1QA 2VOWA 4CEYA 1PK6B 3M4FA 3SCFA 1FATA 1HIXA 4CEWA 1NCQA 1MZ6A 2RJKA 2YROA 4ONUA 1LOAA 1VBD2 3AMMA 1ND2A 4P9WA 3P3NA 1ZRDA 4XJ9A 1DBNA 5JSPA 3A0NA 3OPZA 1FMD1 2HWF1 3LB9A 2A75A 2DF7A 2PLV1 4PDWA 3VBUB 4HBNA 3VZKA 3WW4A 1W6OA 4K9SA 4XXPA 5DZEA 1WMFA 2Q0AA 1GNZA 4XFBA 4YFZA 2XH6A 3VBFB 2PHRA 3USSA 4AQTA 4OULA 1CJPA 3CF6E 4RR3C 2BVBA 1SLTA 1PVC2 3ZN5A 2NM1A 4SLIA 1VRH3 2OUHA 2SBAA 2WS91 2OA2A 1K5MC 4U2AA 1PGL2 1V6OA 5K0UA 4G4FA 1S0BA 2Q1ZB 3AXEA 3AZZA 4OVEA 1W6QB 1WCKA 4XW3A 1YXWA 1AR91 2YGLA 4PLNA 4Q4V3 1ZZ6A 4W6WA 1QQP2 2XGXA 1LHUA 2NPIA 2PHWA 1RUG2 3FBMA 4JGZA 2ET1A 4I2OA 1KITA 1YFUA 1AL23 1CVNA 2HEVF 1FT9A 4PF5A 4AVAA 2R063 4Z1VA 3WDTA 1RUJ2 1RUF2 1SQ4A 4DNYA 2DFCA 1KFXL 4DRRA 2OZ6A 3DPRB 3VKMA 1D0HA 1F8VA 2WWSA 2GAUA 1U12A 4YVWB 4YW4A 3ZFEC 4XF3A 3JQWA 1LOBA 1U5XA 3H7YA 3I54A 4GKYA 1SFYA 5BV6A 4LR4A 1PVXA 4AHWA 5CIRA 3U07A 3AZYA 4L97A 2WZR1 2XLGA 5LRRA 1WCSA 3KGLA 3ILRA 4WM8C 4RQPC 3M7AA 1FOD2 3OYWB 1ZZ9A 2XWBB 1VBC1 3UKVA 4LO7A 2ZGQA 5DUXA 3S6PA 3VZNA 4NHKA 1VALA 5L36A 3GNEA 4NPRA 2RS12 2UWCA 5JPMB 1URXA 2E7QA 3ZYRA 4WZFA 1AX1A 4AK3A 4FBFA 1AR61 1OKQA 1A8DA 1X33A 3G6JB 4ATFA 2R30A 1O7FA 2DTWA 1NXMA 3QH6A 1AR71 3HT2A 1VAVA 2H0BA 4RS5B 1MVEA 2UYBA 1S2BA 2RS53 1MZ5A 1NOVA 1EAH1 3U10A 1VBE1 2ZMKA 4JDNA 1A78A 1POV3 1U5IA 2NP0A 2D93A 1HQWA 5JOYA 3LA3A 2C5DA 3USUA 3I7DA 4NHMA 3OYWA 1C8M3 3BU7A 4WZCA 1YO8A 1NA1C 1GYKA 3INAA 3OD0A 1ND3C 2ZGTA 3VL8A 5JOZA 2GU9A 3GHNA 1T6GC 1WBFA 1ULCA 3B9IA 3GBWA 4GB32 2XJRA 1Q8OA 2VOKA 1PK6C 2WINB 4BHPA 1ZBE2 3N35A 2D44A 1ULFA 1ZRCA 1F2NA 4LBQA 4Q4Y3 1PVC1 1UKRA 3W59A 4Y1UA 5KXDA 2D6LX 4URTA 3NV2A 2DYCA 1PGL1 1NQDA 1ULGA 4HVRA 3VBUC 4DS0A 4XTMA 1XNKA 1ZVFA 4Q8KA 1KDKA 4MX3A 4DMIA 3AP7A 3ZXEA 2E9QA 1AL0G 2JD4A 3WP6A 2XL9A 1COV3 1QQP1 2BNMA 5BNOA 3AYDA 3VBFC 1RUG1 4YRDA 1LECA 4HKOA 3MW4A 2DCYA 2WNVA 3TWIA 1RUJ1 4AI1A 1RUF1 4NVPA 4HSJA 3TYJA 2D6OX 3J8F2 1J59A 3AJZA 4N43B 3IKWA 1YWKA 3HT1A 3MW2A 3GBFA 1MR5A 3D8CA 1TEIA 2WFPA 3AFGA 2BWCA 1J1LA 1DYKA 3FJSA 3O0WA 3RMXA 2IXIA 1RUC3 4UW6A 4YZ3A 5E1RA 4HSLA 3R0RA 2H6CA 4EN0A 2D3RA 4K8FA 5LK7B 2QUOA 1QGLA 4A7ZA 3EQEA 4L11A 4XHXA 2ZMNA 5JWPA 5AC92 4PIXA 5KBFA 1MS4A 4JQRA 5CFCA 5CA6A 5FQ0B 1O3TA 5FO9B 2ZZJA 2VVFA 4DXZA 4ZU7A 2RS11 2HWD3 4N43A 1PO22 4C0HA 4DOUA 1NLSA 3KMHA 1OHFA 1H8VA 5IT6A 1QJY2 2ZHKA 2E6VA 2VPVA 5GJ6A 4LBJA 4E4ZA 4KU8A 3UKTA 2JG9A 4KG0A 5GALA 1QOTA 1SCRA 1NE6A 2GNTA 3UJOA 4RD7A 4QPGA 5JI7A 3WLUA 1PNFA 2XHKA 1NE4A 2IXKA 2JXAA 4R4ZA 1FX5A 2CTVA 4P9XA 4AYUA 3V0AA 1XNBA 4XBLA 4H3WA 4N7UA 3BODA 4YGEA 1U5ZA 1NY72 4A7YA 3LAGA 3URFA 1R1A1 3ILNA 1C1LA 1LHNA 4RS5C 2X53S 1AF9A 2A6YA 1V9U2 3V65A 2TBVA 4UW4A 1LOFC 2MEV3 1SBEA 2B7YA 4RHV2 3WG3A 3BPZA 1ZBA2 2NQYA 1MQTA 1VLNA 4GB31 4ATEA 1HRI2 3EO6A 2D6NA 4HPKB 3FLRA 1EV11 3MDPA 3ROUA 1DF0A 1R091 3GALA 2XBO2 2ZJCA 1RHI1 1G8WA 4FPEA 4AHZA 3E97A 4KGGA 3FHIB 1BJQA 3VDDA 1RGSA 4W65A 4J6GA 1KS5A 2Q5TA 3AZWA 1PNGA 3H3UA 4H7MA 1I3HA 4QU2A 3RJRA 4YGBA 5FLJA 1BZWA 2D7FA 2OW4A 5ABJB 2DUPA 3OTFA 5A33A 5LRSA 1SDWA 1HRV3 2TUNA 4EWAA 2GMEA 2MHFA 1ZX5A 4AF9A 4DZGA 3TB0A 4LT5A 1NYWA 2ZAHA 3KM5A 4A2UA 4AW7A 1Z7S1 4XMIA 2YV8A 4AEDA 3ZN4A 2XVLA 4QQ2A 5BNNC 4D3WA 4M01A 5FLHA 3CLPA 5F6LB 3SH5A 1V6JA 3LA2A 4I30A 3LOBA 2WNUC 1H1AA 4XDQA 5DG1A 5LEJA 2IXHA 4O9GA 3ZXAC 3B00A 4LBNA 2GN7A 4MGZE 1DQ4A 5A32B 1ZA4A 5DDJ2 2A6VA 4IV1B 1CQ9A 1XQNA 4FO9A 4OLLA 4CP0A 3AYAA 4HANA 1QKQA 2RM23 5AC91 4X6RB 4YFWA 1FV3A 1W2UA 3C3VA 4I3PA 1PO21 1WLTA 2BGCA 1REEA 4EV0A 4XF1A 1QJY1 2I07B 2FBEA 4ORFA 1LCLA 3WZ1A 2YDEA 2JG8B 3AMNA 5GZGA 4CTEA 2AUYA 4YM2A 5FO8B 3ZDSA 1WBLA 3RSJA 4FSJA 1IS4A 4H14A 1HXS3 4YVSA 1PIV3 4AEKA 5BXXA 5JCTA 2XL7A 2FZ1A 3ZN6A 1RVF2 5AVPA 1R082 2P2KA 5CB7A 3N7MA 3VBHC 4JTNA 2X5IB 4I01A 3SCGA 3GZTB 1NY71 2GC3A 3RMYA 1E57A 4NO4A 2O8QA 1RB8G 2WJSA 2RR11 2VVDA 1RUNA 1IKQA 4S2HA 4AQSA 4YM1A 5JIAA 1S55A 1V9U1 5JPNB 4GWNA 1W6PA 2PLV3 1U5YA 3L2YA 1OPMA 1RUI2 2ENRA 1AJOA 1GSLA 1D4M2 1QH7A 2XJPA 3A0KA 2R6QA 1HRI1 1VBB3 5C4WA 1JYCA 4KBBA 5I8YA 2TEPA 3WDXA 3HMYA 2XBO1 1J58A 2WKKA 3NL1A 4WM7B 1G9AA 2WS93 3WUCA 1RINA 2K9ZA 4NWVA 2D6KA 1KS4A 2RMU2 3ES4A 4JAAA 4Q4X1 2VULA 2YC0A 1PIV2 1SLLA 3GZUC 3WQ1A 3KQRA 4FPOB 1EP0A 1LHVA 2DVBA 1DHKB 2JJ6A 2R1BA 3I59A 4FPHA 1X7NA 1BXHA 4D94A 4PCRA 5FPXA 2QKDA 3D0SA 3MZHA 1TMF2 2PHUA 5CFDA 4CDXC 4Z92B 2W68A 3B5LB 5T50A 2OVUA 3RG0A 3IDEA 1OPOA 2ZZQA 2Y0OA 1FMD2 1Q8QA 2HWF2 1K5MB 4PBPA 2DCZA 2ZOEB 2PLV2 5ABJC 1KDMA 3WHUA 3ZYIB 2WQZC 5FAXA 2WZPP 4QQLA 1JUHA 1NLRA 4Q29A 3ZO0B 2ZGPA 4MH0E 4BLJA 1RMU2 3GF6A 4R9AA 1OI6A 4FPLA 4Y20A 2K0GA 1X82A 3MLKA 2R0HA 4M3CE 1S0JA 1YCIA 3B02A 5DDJ1 2WZR3 4GULA 2ZGMA 3G7DA 4LUKA 1VBA2 4K21A 1S0FA 4RR3A 2VNOA 1AR92 1GICA 5HI0A 2VMHA 3MIDA 2VU9A 4YNIA 4KL1A 4X8PA 3RS6A 4CDUB 1K5MA 2WSVA 4JTOA 1AR63 3O12A 1R1ZA 4Z82A 3U11A 5CNAA 4IV1C 5FFOC 4N53A 1Z0HA 4OI0A 4XMAA 5I0SA 1AR73 1CJDA 5JZGA 4I02A 1MS3A 4WM8B 1RVF1 4RQPB 1VBE3 1W0PA 1QMJA 4R9BA 2OUJA 1DGLA 1UAIA 2XB6C 3SISA 4GMP0 1PZ8A 2EIGA 1LOEA 2NMNA 4LHNA 1IS5A 5J98B 1H2MA 2ZX0A 3AKRA 5EXOA 4MV2A 2JG8C 3VHOA 5F9TA 2PHTA 3B69A 3FLPA 2P17A 5AVAA 3PJYA 4WVZA 4Y22B 4YW1A 1OOPB 4YZ4A 2JKBA 5I8TA 3ZFEA 3R4DB 4UBGA 1TNRA 1ZM1A 3E5QA 4AFBA 1UPIA 1RUI1 1VBC2 1D4M1 3PVEA 4MSVA 4ZKTB 2IC1A 5GZEA 1W6MB 2X5IC 5BUVA 1NCRB 4PQ9A 1W0OA 5IK4A 3ZFFB 3ZFGC 4BPZA 2PELA 4YGCA 3SITA 1X36A 4WM8A 1PVC3 4DQAA 1H1IA 3IPVA 4CDQB 4JDMA 1AR72 2R072 1O4YA 2RMU1 1N47A 4LBLA 1G9FA 2QZ3A 4AFCA 1EAH2 1VBE2 3RQ0A 2VOVA 2EAAA 3NJZA 5KHGA 4Y22A 4Y4YA 2B42B 3FUOA 1D0GA 1QQP3 3SMHA 4B4QA 4YG0A 2XVKA 5KXBA 1RUG3 1XYOA 4WM7C 4HL0A 3AP6A 4M0HA 4YW2A 4NN0A 1RUJ3 1AYM1 1RUF3 2QFEA 3WP3A 3D4KA 3RNSA 4L92A 3J4UH 3WDVA 1DQ5A 3UL2A 3KZ4C 3QD6A 3V56A 2VUAA 4R52A 1VIWB 2BFUS 2I2SA 3DL3A 2XVGA 2XKPA 2D5FA 4IEZA 1NA1A 4DPNA 1RMU1 1SLCA 3TAYA 3PHMA 1SLBA 4LO6B 4QGLA 1ND3A 1B35A 5K7PA 3ELNA 1XRUA 2HWB1 4M3CF 4A3XA 3ZIXA 1N1SA 5BNPC 1RITA 3ECQA 5ACA2 4K3UA 2ETEA 2GNMA 1PK6A 2R32A 1VBA1 5JIUA 1FOD3 3NKGA 4FXKB 3MIHA 2HYKA 4TWTA 1KJRA 1N1TA 1APNA 4FPYA 3GYDA 3O0XA 2RS13 5L7OC 2HEWF 3VBUA 2ZMLA 2DV9A 3LGRA 4Z07A 1YI7A 3TN92 1WLDA 1RUE1 1VB2A 1M4WA 2D5HA 1CIWA 1DDLA 1V6IA 2BNNA 1TNFA 5JVVA 1QHDA 3VBFA 1UF2C 1XXNA 4V1PA 1ZZ8A 4IL7A 1LRHA 3H8UA 4AGVA 1D2QA 2PYTA 2R49A 3GZAA 4QT6A 3WVJA 1N1VA 2N7GA 2DFBA 1WA4A 3RDIA 3KT1A 2D40A 4CDUC 3MLLA 5HXVA 4COVA 3ZYGA 1G9BA 1PMIA 2XKOA 1EPZA 1O3SA 4QPIB 1QNWA 4E2GA 1W6QA 4AWDA 1R1A3 3T2TA 3MFCA 4QMAA 2ET7A 4YG3A 3MPPG 1AYN1 1FI2A 1YFWA 1IS6A 1G6NA 4IEUA 3ETQA 1M06G 3EXUA 1YUDA 2IWGB 4ISQA 1LGCA 1BBT2 5KXEA 1Y43B 3ZYJB 4QX5A 4GB33 4IEOA 4RA0A 1RC6A 1SMVA 4HZFA 1Q43A 3DPRA 4Y5Z0 1ZBE3 4Q0PA 2YY1A 1JTZX 4MYEA 1OOPC 3LKJA 2CY6A 2RHPA 1BYHA 4YVWA 5I8SA 1RHI3 4WV8A 3EBRA 1O5UA 3ZSEA 2YHJA 2R071 3MIFA 4DFSA 1OSGA 1GFF2 5F1RA 1JBCA 4IXLA 4ES8A 4BM8A 3WV6A 2B39A 4P9IA 5DZGA 4YW5A 2QCSB 1NCRC 1N3QA 2VMGA 1PO11 3ZFFC 2ZCWA 3OBTA 2WLPA 3D6EA 3O14A 2D97A 2V5YA 3HIFA 4COWA 4CDQC 3B01A 1R1A2 2EXIA 2VY0A 4CEYC 1JH5A 2B9UA 1ASJ1 3OJBA 3WW1A 4CEWC 4GWMA 4J1WA 2PA7A 1UW8A 3TBDA 3J8F3 2ZGLA 1BEV2 4HT1T 3B3QE 3H7JA 2NN8A 3NV3A 4IEXA 2RS32 4PDWC 1MS1A 4Y1ZA 4P9YA 1Z78A 4BQ1A 4RS5A 1EV12 5J7MA 5T5JA 3ST7A 2ARXA 1R092 4QGNA 3H9AA 1WW5A 2D98A 3FFQA 4LULA 1LTEA 4K1YA 4OZXA 1RHI2 1GBGA 1AR82 1PGSA 4ITCA 2VUJA 5ACA1 3ACLA 1UIKA 4M00A 2VVEA 1GANA 5BNNB 3WG4A 2GN3A 1DGWA 4FOQA 4OHYA 3Q9OA 5AC93 1C5IA 3VGIA 1XU1A 1VR3A 3AZXA 1EPWA 1DQ6A 1TME1 3ZXKA 2CGNA 1PO23 1HV0A 2WNUB 5C8CC 2IXCA 3TN91 1QJY3 3B7MA 4YYOA 3OGJA 3VBOC 1IQAA 3JZVA 4JGZC 1IOAA 1Z7S2 5F6KA 1EY2A 2ZBJA 4GIQA 5DUUA 2BPA2 5B2GB 4XJUA 5GM0A 2BFUL 4XFHA 3DF0A 4F8AA 3BCWA 2ZAAA 1DZTA 4N7IA 4OI1A 5JOWA 2RE9A 2LUWA 1YJKA 2SLIA 3UJQA 5BNNA 2ZTNA 3P3PA 4MXVA 4XF4A 3WHTA 3R05A 3FUQA 1XU2A 1DGRA 3AMPA 1W6NB 2XWJB 3U0ZA 5HCFA 2O8OA 1H1MA 1FYUA 4QGMA 4CP1A 4AVCA 5AFBA 4XFIA 1V9U3 1IGOA 5GLTA 4RHV3 2PQQA 1BBT1 5BNQA 1CAWB 1KQRA 1ZBA3 4QXKA 2VGDA 1UL9A 1HRI3 3VBHB 4WBBA 3HAGA 1J3QA 4QPIC 4CRQA 4PLMA 2XLFA 1VRH1 2DVGA 2VMIA 2XBO3 2MNGA 1J1TA 3BALA 1UU6A 2XJSA 4WVMB 2ZS6B 1AXYA 2A3YA 4EJRA 2CAVA 4Z2WA 4AVVA 3VHNA 4Q4X3 2QVSB 1LHWA 1MEC2 3T1LA 1NQJA 3IMNA 1W6NA 1QJX2 3AMQA 5F5QA 2PAMA 5I0TA 1CESA 1UZYA 4H55A 1DLLA 1AL21 4B29A 2WL1A 4M0NA 4TZDA 4RL7A 2Q30A 2QE3A 1ULDA 3JCIA 4K7JA 2WSUA 3HWJA 3O0VA 4FQZA 2RR12 5FQ0A 4FAGA 1REFA 3KT4A 1VB4A 3ATGA 1BEV1 3T1MA 5T52A 1GR3A 5T5LA 2GNBA 2Y38A 2RS31 3BTAA 3POWA 1H2NA 3N3HA 2A6ZA 4GQ7A 3E6DA 3FMGA 2JE9A 4CDXB 4MUVA 5CG8A 3O7OA 3W9AA 1UU4A 3MICA 4P9JA 4EN7B 1AR81 4IQPA 5DDJ3 2BTVC 1GZWB 3M3CA 4Q4X2 4MZUA 5IK5A 3WDYA 4NR1A 3AXDA 5GLWA 1NG0A 1WUVA 4QD2A 3VKFC 4TYSA 2A6WA 5EZWA 3GHMA 3VHPA 3WP4A 5I0UA 5JDBA 4ASLA 3BOWA 2WA4A 5LEKA 1SBDA 3MLJA 1OD5A 4R9CA 4HPKA 4UW5A