4KWJA

Resting state of rat cysteine dioxygenase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Mechanistic implications of persulfenate and persulfide binding in the active site of cysteine dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 58
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4kwjA00
4ONUA 4OFGA 2ET1A 2ATFA 4XETA 4B29A 1UW8A 4MGYE 1CGPA 3LOIA 3C3VA 1CAXB 3RDIA 1OD5A 2CAUA 3R6SA 3VHRA 4PIZA 1J59A 1WA4A 2D40A 3UKNA 4QM8A 4KL1A 1EP0A 1Q43A 2XKOA 2CAVA 3SMHA 4D7TA 4XFIA 5I0SA 3FX3A 3EHKA 4KWLA 5FPZA 5I91A 1UPIA 3O14A 4YNIA 2BEOA 3IIAA 2CGPA 2GC2A 5KHJA 4Z82A 3I59A 2ET7A 4HBNA 1JUHA 4Q0PA 4BH9A 3ACLA 1ZZ6A 4HMZA 4HVRA 3U11A 2UY9A 5JSPA 1O4TA 5I8TA 3WW3A 1FI2A 1XRUA 2Q1ZB 1RGSA 1O5UA 4FT8A 3KMHA 4MH0E 1UIJA 5EZWA 4AQ6A 3OGJA 4NVPA 2KXLA 2H0VA 4IEXA 4XFAA 5F1RA 2B5HA 1PMIA 2IXCA 4J1XA 2IXLA 4WBBA 4EWAA 1WGPA 1EY2A 4IESA 2PQQA 4UBHA 2K0GA 4X6RB 2D5FA 3LA3A 1ZZ9A 3U0ZA 4JTOA 4LA3A 2QNKA 5KHIA 3TNQA 1X8EA 2I45A 1LRHA 4HLTA 4PJYA 4I02A 4MV2A 3EO6A 4YYOA 3LZZA 1SQ4A 1YFUA 4PIYA 3ES1A 3S7IA 3NW4A 3I59B 4LULA 2GC1A 4FAHA 1RTVA 1NZCA 3RZZA 3FFQA 4K8FA 1I5ZA 4O9GA 4XF0A 3NKTA 1YFXA 4QGNA 1IPJA 3JZVA 2EAAA 3H7YA 4IEQA 4X6QB 1LR5A 3H3UA 5FLHA 4AVBA 2P17A 1NYWA 3HT2A 3KGZA 2Z69A 1G6NA 5FCCA 2C0ZA 2OA2A 1Y9QA 5C8WA 3DL3A 4LEJA 5FDBA 3UKVA 4XF1A 4I0AA 2PYTA 4BIFA 1CAVA 1FT9A 1ZNPA 4WVZA 3E6CC 3CF6E 1Q3EA 1H1IA 3ROUA 4KWJA 5CU1A 5E1RA 1OFNA 1ZX5A 1CAUB 1XE7A 4HVQA 2BYVE 4QGMA 2IXJA 5JSOA 5LEKA 2GZWA 3H8UA 4O9EA 2N7GA 4LA2A 1H1MA 3FHIB 2UYAA 4ZU4A 4JV4A 4GULA 4HSJA 4LLOA 4HVOA 4QM9A 3OCPA 5J48A 1O3TA 3N4MA 2ETEA 4LTAA 3LA7A 1QWRA 1J1LA 2D93A 3B02A 3BCWA 1QXRA 4E2SA 1O3QA 4EWDA 4IEYA 2Q30A 4IEVA 4L11A 2ZKLA 3BU7A 1ZREA 2PHLA 2B8MA 2GH2A 3H7JA 2IXIA 1YFWA 4MGIE 1CAVB 2UY8A 5JAXA 4HSLA 5K8SA 2B9UA 3RNSA 5T3NA 1Y3TA 4I01A 2IXHA 4PIXA 5JSRA 3I54A 4IETA 5FQ0A 2E9QA 3DN7A 1SEFA 4JVAA 3TNPB 3SCGA 4I2OA 2D5HA 4Z07A 1DZRA 2XGXA 1X8MA 1UCXA 3U10A 5I0TA 1ZRFA 4IEZA 4Q0VA 3E97A 5J3UA 1NE4A 4JTNA 4J1WA 2WC2A 3OD0A 1GQGA 2XL9A 2WFPA 4XF4A 1LKNA 2XLGA 1SFNA 1OI6A 4XFHA 2FQPA 3GYDA 4XF3A 3S7EA 2VQAA 1J3RA 4FBFA 4UBGA 4AVAA 3LAGA 5I0RA 4Q29A 3FZ3A 5FPXA 1CAUA 2XLAA 2XHKA 1YUDA 1EPZA 4XEZA 5HI0A 3H50A 2PHDA 5BXXA 4ZU5A 3SXWA 2PAMA 1ZRCA 4META 2CV6A 3RPQA 4IEWA 4MUVA 2XL7A 1DGRA 1ZZBA 4E2QA 2XLFA 4HN1A 3RYRA 3HIFA 4KWKA 5E16A 3E5UA 3ST7A 2OZ6A 5FQ0B 5EFUA 1I6XA 2BNOA 2ZCWA 4LUMA 1Q5OA 3M3IA 4HZFA 4IEPA 2GU9A 1O3SA 3DV8A 4TLFA 5C6CA 4XFFA 1CAWA 4FAGA 5KHGA 2PTMA 2QCSB 3IWZA 5JR7B 4D7SA 2DCTA 4A2UA 4IEUA 3WW1A 2OPKA 4XFBA 3CO2A 2PFWA 3H3ZA 4E2GA 2QDRA 2Z2SB 2FMYA 4KU8A 1O7FA 5BUVA 5FLIA 2Q4SA 4YARA 1PM7A 1EYBA 2GAUA 4AQ2A 1YFYA 4N9HA 5JCTA 4IERA 4CYDA 4Q0SA 3H9AA 3IDBB 2H6BA 1ZZ8A 4XFCA 2EA7A 3NL1A 2PAKA 3PVBB 3DKWA 4DINB 3E5XA 1XE8A 4Q0QA 1O5LA 3ES4A 3L2HA 3I7DA 2MPFA 3HT1A 3H1WA 4BYYA 5CADA 3H1MA 1WLTA 3BPZA 2MNGA 2O1QA 4XFGA 3EQEA 1FXZA 5CVRA 1ZRDA 4EROA 4XF9A 1CAWB 3MDPA 4UXAA 3E5QA 4LUKA 3NJZA 3M70A 4EWEA 1QY4A 1X7NA 3NSTA 1OMIA 5I93A 3D0SA 5I8SA 1ZVFA 2EVXA 1L3JA 5FLJA 1ZZCA 3EJKA 2OYZA 1RL3A 5LRSA 5BPXA 2QVSB 3CEWA 3SCHA 4EV0A 4QX5A 2O8QA 5BY5A 3KSCA 4ORFA 4I3PA 4YSFA 4MX3A 3FJSA 1DGWA 4F8AA 3USSA 5LRRA 3MPBA 4QGLA 1X82A 4ZU7A 3WW4A 3E6BA 3CLPA 2OZJA 3ZDSA 2VECA 1V70A 1UIKA 3BALA 1QXJA 1YHFA 3UKTA 3CJXA 2Y0OA 5KBFA 4QMAA 2PA7A 4H7LA 3PLQA 3GBFA 2IXKA 4BHPA 3CL1A 1VJ2A 5I8YA 3ELNA 4I0BA 4AVCA 2BNNA 1O3RA 3QACA 2F4PA 3SHRA 1UD1A 3D0JA 3E6DA 3IDCB 2GC3A 2HJIA 2HKXA 4MGZE 3QOPA 2V09A 3OF1A 3KCCA 3LWCA 3OTFA 5KHHA 5KHKA 4L2NA 4I09A 1YWKA 2H6CA 3KGLA 4HN0A 2GC0A 1RUOA 4AXOA 1NXMA 3S0MA 3HQXA 1CAXA 5LEJA 1LB2A 2MHFA 1DZTA 4N9IA 4IEOA 1CX4A 2PAEA 1J3QA 3LA2A 1HW5A 3ETQA 3BB6A 1U12A 1ZRRA 1RC6A 5AVPA 1RUNA 4P9GA 4F7ZA 1YLLA 3RYPA 4R52A 2XKPA 2BNMA 4KU7A 5I0UA 3NVCA 2IC1A 3MYXA 3IBMA 3SCFA 1GQHA 3RYKA 4WZCA 4YRDA 1J58A 3WW2A 2Q0AA 4Q0UA 4MGKE 3FE5A 3D82A 3EBRA 2QJVA 5J7MA 2K9ZA 1IPKA 4RD7A 4MZUA 1ZZ7A 1VR3A 1NE6A 1J3PA 4R8HA 1VP6A 4OLLA 3PNAA 2UYBA 3H1YA 2BGCA 1TQ5A 5BV6A 4QXKA 3G7DA 5D1IA 3MZHA 2VPVA 3FWEA
chains in the Genus database with same CATH superfamily
1J1TA 5T52A 2ATFA 1BQPA 4B29A 1JBCA 1DYPA 2NZ9A 1XE0A 1GFF2 4MGYE 4FFIA 4CVUA 3MLJA 4ITCA 3R6SA 2PHUA 1TEIA 5CEHA 3DYPA 2ZZJA 1C28A 2YMZA 3DEMA 2BV4A 3UV9A 1AX1A 2JDNA 2Y8KA 5KXBA 1J59A 2XJPA 3POBA 1ZA4A 4FXKB 4P9XA 3ZPOA 1K12A 4AI1A 1H6YA 1W0PA 2W1WA 3SMHA 2VOVA 4D7TA 4DO0A 5FKCA 3HNYM 4PBPA 2XB6C 4QX3A 5GJ6A 4SBVA 5I0SA 3EHKA 1ZA7A 4P9JA 5FMDA 5IVYA 2IFWA 2F17A 1ND3C 4PLMA 2ZJCA 1H2LA 1EV12 1ULFA 1UNBA 1UPIA 2VJXA 3KQ4B 4YW3A 3RS6A 4AEJA 4CDWA 2W08A 1X9TA 4E4HA 5L7OC 2WQ4A 5KHJA 1PGW1 3TBDA 5T5LA 2ET7A 2CHHA 2ZACA 1UOJA 4BH9A 2VW2A 3LF7A 4AWDA 2QBXA 2PXJA 2GP3A 1K5JA 1NCRA 4HVRA 3VHNA 5LW9A 3WDXA 3K77A 5I8TA 2HWB1 1EV13 1W6OB 2HYKA 2Y6LA 4UW4A 3WW3A 3PUQA 1WLCA 1XRUA 4MVTA 1O5UA 4CUBA 1W0NA 3ORJA 1Q8OA 3KMHA 3AK0A 1W9YA 4MH0E 2GNMA 3OGJA 4NVPA 2KXLA 2DYCA 3AJZA 4FPEA 3POEA 1AUYA 5A80A 2R16A 3TN93 2IXLA 2ZABA 4WBBA 4EWAA 1IKPA 3T2PA 4CP9B 3HJRA 4ET7A 2V4VA 3MF9A 3O1VA 5AFBA 4IESA 5HBAA 2ZX0A 4XIKA 5FO7B 5C5UA 4X6RB 1H2KA 2JE8A 2QKDA 1W06A 2GNTA 4AHZA 2QNKA 3ZFEC 4LOSA 2DBIA 5LY2A 1H4GA 1LRHA 1UKGA 4OMDA 2ZAAA 1W8UA 2NQYA 1LODA 3PMSA 1TNFA 3BI3A 1VRH2 1YQ6A 1ODNA 4LBNA 2VBDA 3AFGA 3ES1A 5A7WA 2JX9A 5T50A 1N3OA 2P5BA 1DQ0A 3GZTB 5FYMA 4RHV2 2GMPA 2WA4A 4Q4X1 4QXHA 3K4DA 1GANA 3TRSB 3WNLA 3OB8A 2W5FA 3VBFC 2VCBA 4BCUA 1DGWX 4BDVB 1W6QB 1D4M1 2J7MA 5A7PA 3VBRA 4K8FA 3C7HA 4AAPA 3B69A 2C1FA 4GA9A 3VL8A 4FFFA 3GNEA 5DZFA 5CG9A 1OURA 1YFXA 2RM22 3IN9A 4XHXA 1IPJA 5D8AC 2C26A 4ZZ5A 1G9CA 4XCBA 4LBQB 2ARCA 2EAAA 3H7YA 5K7PA 4AEDB 4IE5A 3VHPA 2Z5WA 3L9JT 3SEPA 1UX7A 1Y43B 3KGZA 5FMOL 3JD71 1O91A 1OVPA 2XUEA 4Y33A 4Q4V2 4BPZA 2C0ZA 2WNEA 3I2FA 1YNAA 3WLUA 3THCA 5CKQA 4PT6A 2HLEA 2D6OX 2J1RA 4JGYC 4XCAA 3VD3A 1ULPA 4RR3B 4BLJA 3FBMA 4IL7A 4XF1A 3BU0A 4I0AA 2PYTA 2WSVA 3G6JB 3INAA 1SBEA 2XQRA 4XW3A 1XNAA 1VMFA 3CBNA 4ARXA 4IW3A 5GZEA 2W1UA 4DRRA 4EE2A 4PCRA 2YC2A 2X10A 5DAVA 5FZ8A 3WP4A 2DUQA 5JOYA 5KXEA 5FPVA 4LIUA 1FNZA 1SG3A 4NE9A 5FZGA 4K8RB 4IV3C 1OFNA 5C3OA 1UL9A 4HK8A 1F8VA 4LR4A 3RGBA 4YZ2A 1AYN1 4HVQA 4XZPA 5HCHA 1JZ7A 4XUPA 2IXJA 5JSOA 5LBBA 5LEKA 3URFA 2GZWA 3JB4C 3H8UA 2R30A 5DPNA 1XXNA 5A1FA 2Y6KA 1OOPA 4QQPA 5LA9A 1OHFA 4DY5A 1SDDB 2BDRA 2UWAA 2WNVA 1QJX2 3CIHA 2RJ2A 5FYZA 5A7OA 2N7GA 4LA2A 2WO7A 1A3KA 2JDHA 3FHIB 2UYAA 2ZOEB 1MVQA 2W94A 3PJYA 4Q4W1 3WDWA 3BUCA 1J83A 3J9SA 4JV4A 1UXZA 4HSJA 4W6WA 2A71A 2P34A 5JIAA 4PI2A 3OCPA 4HKOA 4A3ZA 2EIEA 2WWJA 4LPLA 4ASKA 4A4AA 1OLRA 4L92A 3N4MA 5FXXA 4GH4A 1W8NA 3Q8FA 1KITA 2D93A 2YU1A 4ASLA 1BJQA 3CDZB 4OCTA 2VZUA 1H8TA 3BCWA 3KF3A 1O3QA 1MQTA 5LA2A 1GQPA 2JD4A 3A4UA 1CD3G 4IEYA 4PDWA 1UZYA 1BBT1 3FHQA 3V56A 3KHCA 2WZR2 5CIRA 4CU8A 2W68A 1R1A2 1FOD1 3NO8A 4ISRA 5IT6A 4CA9A 1ZREA 1CPNA 4Y20B 4MGIE 3VZKA 1CAVB 1PX4A 3LFIA 1JZ4A 1PNGA 4XJ9A 5A33B 3MLKA 1REFA 4NRMA 2VVEA 3RNSA 5A32A 5EYYA 3VV1A 4I01A 5IK7A 4YZ1A 5FK8A 4W50A 5JSRA 3ALQA 4QU2A 2XWBB 1SLLA 3BTAA 1CVNA 2G1MA 1GP6A 1MZEA 5DG1A 3VBSB 5A3LA 2RR11 1R081 1R1A3 3U07A 1LOEA 3I3EA 4Y5Z0 4JVAA 2D98A 3TNPB 1VIWB 3AZXA 2DU1A 3NMBA 4E8CA 1HJGA 2XGXA 4YFZA 1UCXA 3U10A 2CY6A 3HNBM 5IWFA 1JODA 1DZQA 1K3IA 2HWE3 4Q0VA 1S0EA 1AR61 1POV0 3OBRA 1VBA1 1XNCA 5JVVA 1K5MC 3OD0A 3MFAA 1H2MA 2FMDA 5A7NA 2I07B 4COYA 1COV1 3VD9A 1EAH2 1IS6A 4FPKA 2ORZA 3QLQA 5A3OA 3RJ2X 4LO5B 1UYYA 1QXPA 1PK6B 1XSRA 4V1PA 5F2SA 3LDKA 4GWNA 4UBGA 1RUD3 5FZFA 2DVBA 1IPSA 5EP9A 5I0RA 3SKVA 3IAQA 1B35B 3FZ3A 5BNPC 1ZBE3 1F5FA 5CNAA 4KBZA 2J22A 3AJYA 3NJVA 1HXS3 4GMP3 5FYCA 5HI0A 2JWPA 3KV6A 1LCLA 1W3XA 4XAAA 1QNWA 2VTFA 2XDVA 4IEWA 4P9LA 3S30A 2OXBA 4YFWA 3GGLA 4KH9A 2XLFA 1BEV2 2XUMA 3E5UA 4BU2A 2FDFA 5LBCA 1TMF3 5EFUA 1X50A 5C4WA 1POV1 1E5IA 1TE1B 2VTXJ 4EN0A 3M3IA 5FMCA 4P9YA 1GWLA 3O0VA 4G4FA 4HZFA 3ZFFA 1O3SA 4B7KA 1ULGA 3ON7A 4ZXEA 5LK5A 4B7EA 2ENRA 4CDUB 1JOJA 4ZS2A 3AYDA 1VBB2 2VZRA 1W6MA 2C9AA 1F9KA 2SLIA 4JGZA 2PTMA 1QQP2 1BZWA 4RS5B 3JUUA 3IWZA 4LXLA 2HWF1 3HBZA 3OG2A 3PVEA 4RYDA 4XFBA 1SFPA 3PUIA 4GZ9A 4AL9A 4FI9A 4P08A 4E2GA 4UYBA 4MG2A 5JMOA 2Z2SB 2FMYA 4CCLA 4FPLA 4KU8A 1DGRN 3B94A 1U5IA 1S4CA 1VBB3 5BUVA 1U5XA 2VVDA 1UMHA 1QQP3 4AQSA 4P9WA 5DXDA 1JYXA 3O1TA 4YARA 1JHJA 2JKBA 3UK9A 1F4AA 1YFYA 2RV9A 2G9FA 4AVVA 5JCTA 1UU6A 2GN7A 3PURA 3H9AA 1V6JA 2H6BA 3Q8EA 2DBNA 1W2UA 2EA7A 4XOGA 4OHZA 3NL1A 3KCYA 2A6YA 2Z4FA 4DINB 3ZPYA 1HRI2 3ZLIA 5ABJB 2R1BA 4NIGA 2CTVA 3ES4A 3L2HA 2FZ2A 2Y0IA 3MW4A 1RUH2 4N53B 2O1QA 4XFGA 3LFMA 5EPAA 4NROA 4XBQA 1PZ8A 3EQEA 3K4AA 3UGGA 5FY5A 5B2GB 4BQYA 2IVJA 1VBC2 2C9KA 3C7OA 3POFA 5JOXA 1EV11 3T08A 4LUKA 4PF5A 2X8KA 1NX9A 1V6MA 3N7KA 3I2HA 3NJZA 1DYKA 5DG2A 3WCRA 1ENQA 1X7NA 1NA1A 4IUGA 2RDRA 1R64A 5I8SA 3B7MA 1XYPA 4JDMA 1OPOA 2HEYF 1W9WA 1OKQA 2WNUB 1Y9MA 2WZ8A 4UFHA 1L3JA 3WDYA 3TEZA 1VBE3 2KM2A 2VNGA 3AC0A 2OYZA 1ZBA2 2Y6GA 1RL3A 4XVHA 4MLOA 5DDJ2 1B09A 2DVAA 1A8MA 3NAPB 3PMEA 4M3CB 4YW2A 1SBFA 5H9RA 2W47A 1AHSA 3VBSC 5F7UA 3KSCA 2VUDA 4HXCA 2YY1A 1UKRA 1RUG2 4MX3A 3THPA 2CWSA 4R9AA 2LRPA 4OQ9A 5DN2A 2A7AA 4F8AA 1PO22 3VBUA 2YPJA 2LALA 4OVEA 4LHSA 1C8M2 5GALA 4C1XA 5CFDB 2ZAHA 4QGLA 3AP6A 3ZIXA 2RMU2 4OHWA 5IVFA 5F32A 3BODA 4DZGA 5JMCA 2XG3A 2DFCA 1AXKA 1WA6X 2P3KA 4ES9A 1OD3A 2JXAA 2DV9A 4BQWA 2XXZA 4U36A 5BNOB 2R0FA 2VOKA 3UKTA 1W9SA 2WS92 1C1LA 1RUJ2 3LEIA 4W6XA 1C8M3 4GALA 4WM8B 4H7LA 3JBG2 3ZKUA 5GZGA 3O1SA 2IXKA 3U4SA 4GWMA 1VJ2A 1VRH1 1O59A 2YBPA 4CU9A 4AI3A 1P8JA 4Q1RA 5LBEA 2WT2A 1GBGA 3ZSMA 2BNNA 3MIHA 1ENXA 1UD1A 4FTBA 3IDEA 4RHV1 3E6DA 3IDCB 1W0OA 1W90A 2GC3A 4YW5A 2HYXA 3LWCA 3JBG3 4E4DX 2ARXA 2J1SA 2QQVA 2JD9A 4QDSA 4BE3A 1Q8QA 2RM21 2H6CA 2ZX2A 4JC1A 4XZUG 1UOGA 1DIWA 1CZSA 1SLIA 2GC0A 4IV3A 4LBKA 3I2KA 2Y34A 3UJQA 5F3CA 3W5MA 3KQRA 3LD8A 1RUOA 3B9CA 4AI9A 1TME2 1UMIA 3HQXA 5ISLA 4XJ8A 3UETA 1R092 1CJDA 1HB4A 4V2WA 2MHFA 4OUMA 4LBLA 3KVBA 5EXOA 2XQXA 3ZXGA 4N9IA 4IEOA 1CX4A 4MADA 4Q4V1 4YM1A 4Z2WA 1J3QA 1IOAA 2CDOA 5J98B 1CZTA 3TYJA 1BMV2 4B3NA 2WZEA 3ETQA 4EN7B 1ZRRA 1XBFA 3RSJA 2VY0A 3AKPA 1YLLA 4FOVA 1F5JA 1WZXA 1GZ9A 4S2GA 1O8SA 4KU7A 1PO13 5F37A 4DUVA 2WN2A 1R093 2IC1A 1RJ7A 4XJWA 4B4QA 4BMBA 4JDOA 4RFT0 5G04L 4QU1A 2W87A 1VRBA 4NHYA 2YFUA 3AKSA 5FUNA 3WW2A 4HOOA 2X09A 1OKOA 4AOCA 3AVRA 1UY2A 1QOOA 2BQPA 1W8HA 2DWRA 3D82A 3KCXA 1UMZA 1WD4A 1IPKA 2K9ZA 4RD7A 4NJ4A 2RDNA 5EJ3A 1D7PM 1ONAA 1PIV3 1VR3A 2V5YA 4XMAA 3VBRC 2A6VA 1QJX1 1VP6A 4Q2FA 3W9AA 2VUCA 1W6OA 3POWA 2C6SA 1DF0A 1VE0A 1Z7S2 4OLLA 2Q8CA 3Q8CA 2DFBA 3GCWA 1HIXA 3AFKA 3MEPA 3ZOIA 2LW8A 3G7DA 4I30A 4BQ1A 4NHXA 1LU1A 2W95A 1HV1A 3AYAA 1XU2A 2TBVA 2Y6HA 3R4DB 1HB3A 4TLGA 1URXA 4YW1A 3ACHA 3MGUA 4ONUA 1NY71 2ET1A 3QH7A 4FVVA 1UW8A 1CGPA 4XDOA 3LOIA 3C3VA 1CAXB 5FXZA 4AHYA 1IQAA 1OD5A 2CAUA 3DYOA 2OPWA 3JQWA 2VUJA 4ZHNA 1W99A 4KMQA 1FYUA 3V65A 3WZ1A 4CP9A 3IPVB 3GALA 4CTEA 3VKLA 2ZGPA 2HWC3 4Y5TA 3I4IA 5FJKA 2WZR1 4NWVA 3UKNA 4DPNA 1K5MA 3F95A 1R1A1 4QM8A 4KL1A 3NKGA 2WNUC 3OBZA 1DU3D 3RZJA 2C24A 3D6EA 1V00A 2VZ1A 2ZHKA 3HEIA 5FK7A 4QAWA 3SC7X 3KHBA 4MGQA 4CPBA 3Q8AA 4NHMA 5FZ9A 3Q9OA 1YIFA 3WUCA 1RITA 2FCUA 1W9FA 4KWLA 1HDKA 5FYYA 1C4RA 4CP2A 1KJLA 3OY8B 1MEC2 1OLQA 1S2BA 2TEPA 3O14A 1PVC3 1RUC2 3HOBA 1RHI2 1WMDA 4XHBA 2WR9A 1GUIA 4HBNA 1JUHA 3LPGA 3ACLA 3RMXA 1OOPC 4P00B 4HMZA 2JJ6A 3B3QE 3R4SA 3ETPA 4FO9A 2CU5A 1JYIA 2D3PA 5JSPA 4P02B 4IGQA 4NRQA 2NLRA 4E27A 2HH9A 4H2AA 4QHOA 3LEGA 3SKJE 1RUC3 5LB6A 5FYHA 1EAH1 4FT8A 3J7LA 1N1VA 4LBQA 2QQJA 2EXHA 4AEDA 3VHOA 3PTYA 2FCTA 4KQ7A 1HQWA 2MEV3 4GH4C 4O7XA 4XE9A 3RJRA 3PUAA 2ZEWA 2IXCA 2DURA 3B00A 4J1XA 3T1MA 4CU6A 3AZZA 4XTMA 1QJY3 5BNQA 3BTYA 1MR5A 2WAAA 4DEVA 4PDWC 2X29A 4C0HA 1AR62 5FZ7A 3WEZA 5F39A 1Q8SA 3WNPA 1STMA 1S2KA 1SLAA 3IDAA 5L19A 1C3HA 4RR3A 3LA3A 1UY4A 3BVCA 1HB1A 2DCYA 2SBAA 5J37A 2V4AA 4C91A 4NIHA 4OHVA 1RMU2 4ISQA 3FN9A 3N9NA 3TNQA 3UL2A 4WM7B 2A6XA 2X05A 5AFEA 3R4UA 4HLTA 1JTZX 4PJYA 4UW3A 5DAXA 3T0DA 4COWA 1BEV1 3EO6A 5LBFA 4YYOA 3KV9A 3APBA 2VL4A 2BGPA 4PIYA 5APAA 3O12A 2RS53 3FC0A 2ZX1A 3I59B 2Z42A 3I3MA 2ARAA 3I2DA 5FREA 1RJ8A 3M3QA 3WP5A 1W6PB 1RXGA 1KD7A 3OBAA 4L9BA 1GOFA 1VBB1 3RZZA 1EPWA 2FD8A 2YHJA 1LGBA 4DS0A 1QQP1 2DCZA 1LOBA 1OA4A 3GBWA 2HWD3 1RUF3 4YM2A 5D21A 4XF0A 2VCMA 3VD4A 3GJBA 3MIEA 2ZPXA 3W5NA 5FZ4A 2VH9A 3D5OA 4TSVA 4G3YC 3A22A 3FUOA 1O4ZA 3GF6A 1LR5A 3CZUA 5FYVA 5FLHA 4AVBA 2D7FA 5HPOA 1YQ8A 3GZUC 1NYWA 4N7IA 3HT2A 1AL22 3BPSA 4R4XA 3WQ1A 2OA2A 1D0GA 3PIGA 2RS33 1VBD2 4O61A 5G05L 1AX0A 2YUEA 2EICA 1IHMA 2ERFA 2RDQA 5F6KA 3UKVA 3VBHB 2E7TA 4Y20A 4XUQA 1RVF3 3C7GA 3IIIA 1CAVA 5CKMA 4CDXB 3I2IA 1HRI1 2YYOA 4WVZA 5A33A 3WQ0A 3E6CC 4FFGA 3BOPA 2DTYA 1RXFA 1JN2P 4WVWA 3ZN6A 3MF6A 2WA3A 1VBD3 1RUH1 3VBSA 3VN4A 5C3RA 1UX6A 2JG8B 2ADEA 1XB9A 3SLIA 1UQXA 3ZFFC 1WW7A 1JOBA 4CXYA 1XE7A 3HN3A 2WINB 1G86A 1FPN3 1VBC1 3LE0A 3N9OA 3PUSA 2NMOA 1C5IA 1CONA 3PL0A 4Y1YA 4YM0A 2JICA 4JGZC 2VQ0A 5FXWA 3VKFC 1F2NA 5K0UB 4X8NA 1NOVA 3THDA 3MO4A 2R043 1SBDA 1UU5A 1PX3A 1OBNA 1ZRIA 2AUYA 1BHGA 4QM9A 2WN3A 4Y24A 3FBYA 3WOGA 1PK6A 1US2A 1ZBA1 5F6LB 3M3OA 5DDJ1 1PMJX 3ZXJA 3I3DA 4LTAA 4ZXKA 1TVGA 5HXMA 1JYTA 3B02A 1B35A 4BMEA 5DQ0A 2RVAA 4E2SA 1AR93 1RUG1 4BXSV 1IG0A 4L11A 4IEVA 4EWDA 2VC9A 2BRTA 2ZKLA 3VDDB 3PUHA 5FZDA 4YVWC 1PO21 4W8JA 1ZYBA 5FZ1A 1WLWA 2PHLA 2B8MA 1C8M1 2GH2A 3AKRA 3LQCA 1GMMA 3OPTA 1N47A 4INDA 2BWAA 2UY8A 2RMU1 3TN92 4AHWA 5A3NA 1NUKA 3MIBA 2ZX3A 4HSLA 4WVMB 2Q1MA 4COUA 2RJLA 3C7EA 3RWNA 1W8OA 5GLWA 5FZMA 5LASA 2DVFA 1Y3TA 2VQUA 4DUXA 5JXIA 1DLCA 3VL9A 3I54A 1JYVA 3WG4A 2E9QA 3D4KA 1LEDA 2WS91 2LM3A 3ZSJA 2D43A 2BBVA 1RUJ1 2W0XA 4QB6A 3WG2A 3ACGA 3NV2A 1UN1A 2W3JA 1AR83 3JBG1 4LO8A 1HN0A 4CDUA 2O14A 1WMFA 3OD4A 1D2SA 4E9KA 2VNVA 4HKLA 4CDQA 2G9ZA 4GAZA 4ES8A 2FCVA 1NA1C 4RS5A 4EN9B 2A5ZA 3R05A 1WBFA 3KV5A 1QF3A 2QQWA 4J1WA 4BXFA 1VB4A 3K3NA 4COVA 1Q56A 1LHNA 2OW4A 5JI7A 4YW4A 1RYYA 2WFPA 4FPOB 1HB2A 1OI6A 4LKEA 3I2OA 5IYYA 5CG8A 3KZ4C 4IE7A 5IAXA 3ZYJB 2VQAA 1UYZA 1J3RA 3LSEA 3IMNA 3FLRA 2ID4A 4CEWB 3F2ZA 4OI4A 4N7UA 1VAMA 4Q29A 1CAUA 3IAPA 2WBKA 5IUQA 3TB0A 1TME1 3NNLA 2JEMA 4D3WA 2A3YA 2AH2A 4Q5OA 4MHUA 5JXHA 1GKBA 2I2SA 3VBUC 2PAMA 1R091 1NG0A 5IK4A 3LIGA 2WLPA 2CV6A 5FZOA 1KFUL 5JIUA 2XL7A 3OUHA 1DBNA 1DGRA 1BMV1 5ABJA 1LOGA 2OIIA 1ZZBA 4E2QA 3NV4A 3HIFA 5JPNB 3P1IA 1I6XA 2BNOA 1DG6A 5BYNA 1KRIA 2JENA 1W04A 2B7YA 1BK0A 3K2OA 3DV8A 1NQJA 4I0WB 1OA3A 2ZMKA 4IXLA 1DP0A 5LATA 4Y26A 5FP4A 2RS12 3W59A 4CEYB 5IFPA 1OT5A 3P5BA 2CL2A 5T5PA 3LOBA 4UI9L 3W58A 4COZA 4LJHA 4XAEA 1FV3A 1PGL1 2DCTA 3GZAA 5HV4A 4IEUA 1LHOA 3WW1A 2OPKA 1OFSA 2KD7A 2RHPA 4HG6B 4KWUA 1JHNA 2VW1A 3S5QA 2WNUA 5DMYA 1CQ9A 2VNOA 4CDXC 2QDRA 3AZWA 3KT7A 2RS13 2BW8A 1Z7S1 2YU2A 4D94A 5KWRA 4TZDA 2YROA 3NAPA 5LA1A 3SQOA 3AMQA 2PQSA 2Q4SA 3P3PA 4M3CA 2YGMA 1PM7A 2AACA 1MZ5A 5FZEA 4EJRA 4LKSA 1A6CA 4GWJA 4RA0A 2D6MA 1XPWA 4DNYA 1GNHA 3WF2A 1SDWA 4UOJA 3AZVA 1QJU3 3IDBB 4MGTA 4QPWA 1ZZ8A 1S0JA 5IK8A 5CFDA 5FZ0A 4JHTA 2E6VA 3DKWA 4LT5A 2RG4A 3ZYPA 3E5XA 4MHRA 4Q0QA 4B1LA 5CISA 2P4EA 4K9SA 3I7DA 5CBLA 1MVEA 2JG9B 5T5OA 3U75A 4D0QA 3H1MA 5BNOA 4YGDA 3RRDA 3USUB 4AFDA 4YGBA 5DAPA 4K6BA 5A3WA 3A0NA 1NY72 5A6XA 3WNXA 1FXZA 2R072 4SLIA 1UZZA 3ATGA 1WLDA 4C1WA 3KM5A 2WO2A 5H9PA 3EXUA 4QPIB 3HBKA 2VOWA 3JCIA 1MEC1 2K46A 3FHAA 4LHNA 5JLVA 1RUC1 4EWEA 1QY4A 2GMMA 3NSTA 1RHI1 5C71A 3ASIA 1X33A 3HR9A 3MW2A 3RWKX 4L8QA 3JXSA 2V5DA 1ZVFA 2DVGA 2EVXA 2R073 5FV3A 3NWKA 5A6YA 4A7YA 3K75B 3ZXDA 4GB33 3EJKA 4M0NA 3V0AB 1CJPA 3P6BA 4BZ4A 3ZFGB 2HWE2 2XVGA 2ZS6B 5AVAA 1DLLA 1DQ1A 5B4XA 4EV0A 3DECA 5BY5A 2O8QA 3MI8A 3AM2A 2D3SA 3AKTA 2Q8EA 4FFHA 4YSFA 1LTEA 2KA3A 3HQUA 3BIEA 1F15A 4C8DA 1FMD3 2BFUL 2CNAA 1DQ4A 2RDSA 3USSA 2WO1A 2EXIA 2A70A 3HWJA 4JCKA 1RUD2 3J8F3 4N8MA 1V9U3 5JUVA 1I5PA 5FZCA 4ZU7A 3WW4A 4PQ9A 3AX4A 1ZBE2 4MGSA 4OI0A 2VECA 2ILMA 1V70A 3BALA 1HXS2 4LKFA 4AEKA 4LO6B 3SH3A 3ZYRA 5KBFA 1RMU1 1KEXA 2RE9A 2VOTA 5FBJA 4XQWA 4YGEA 3NNGA 4U2AA 2Y33A 2VZVA 1OPMA 2R0HA 4I0BA 1G9AA 2P3IA 3KWVA 1Q8VA 3NNFA 5K4LA 1TMF2 1O3RA 1ODMA 3QACA 2VU9A 4CUGA 3D0JA 4UWDA 1WW4A 3HPNA 2HJIA 1NAEA 1QDCA 1S0DA 1RIRA 1AYM3 4BIOA 2V09A 4A44A 1H1AA 3KCCA 1W8FA 1NLRA 1OSGA 3OTFA 3EB7A 5KHHA 4XQDA 3WG3A 4DXTA 1NZIA 2VMDA 1YXWA 4RQPB 2AGSA 3KGLA 4Q4Y3 3GJAA 4IE0A 3VBOB 3OBTA 1YJLA 2PLV3 3MBWA 2Y38A 4LE3A 4XXPA 4Y5SA 5FY1A 4AEDC 1QNYA 5ACA3 1NXMA 1XC6A 4YG3A 5BNNB 4JKLA 3S0MA 4CCCA 1IS5A 1CAXA 1LHWA 2VZPA 5DABA 3V0BB 1AL21 1S2EA 1NCRB 2A3WA 2PAEA 3WINE 2WAOA 3MIGA 3BYWA 1ASJ3 1VBD1 5AVPA 1RC6A 3ZM8A 4RR3C 1QHDA 1AXYA 2ZGRA 3RYPA 4UT5A 5F9TA 2XKPA 2BNMA 4AI2A 1ZM1A 2BOJA 1OVSA 4JRLA 3RFRA 2WFF3 2FHRA 2WL1A 3W21A 5SV8A 3NVCA 1UZWA 3JB8A 2J1UA 1QJZA 1JU4A 1MPXA 2R6QA 4A7ZA 2JDZA 3OSDA 3IBMA 4AVTA 1W2TA 4OI1A 2W39A 3OY8A 1BXHA 3RZHA 3S6PA 4YRDA 4K3UA 4YM3A 1SHWB 4YGCA 2Q0AA 4IE6A 5EJ1B 3SNMA 1IS4A 4IV1B 2AZ5A 4PHZA 4AK3A 2P2KA 5J7MA 1W05A 1QDOA 2GDFA 5FY4A 2LTNA 4YVWA 4D8MA 5IHRA 5JWPA 3NV1A 4A6SA 1XNBA 3ITQA 5DAQA 3CKHA 4OI2A 3K46A 1H2NA 4R8HA 3MLLA 2JDUA 3ECQA 3WG1A 4GD4A 1ACCA 1TQ5A 1IQDC 4QPGB 2QQNA 2E31A 1NKGA 3D8CA 5D1IA 4S2DA 3W20A 4TTGA 3FMGA 1H6XA 1EUTA 4YG6A 3WT3A 1GSLA 3FWEA 3TEYA 1ND2B 4AGGA 2WIIB 3OJBA 4XDQA 1HRV3 4BJ0A 1VBE2 5E6HA 1OLME 1KQRA 1UOBA 2B39A 2VMHA 2ZGQA 5SV5A 4D69A 2Y64A 5AC93 1WA4A 2D40A 4TXWA 2BUKA 3ZYGA 1K42A 2VZQA 4AEMA 3KLSA 1ENRA 2G4IA 3J7MA 3O1MA 3C2UA 3OPWA 3POGA 5LCWL 1E5SA 1IG3A 1Q43A 2JDAA 5FIXA 1ULDA 2XKOA 4XACA 4ZONA 4CDQB 2CAVA 2ES3A 2E51A 1FATA 3SH4A 4XFIA 3IKWA 1ALYA 3AP7A 4WM7A 3TN91 2ZGNA 4E4ZA 1KS5A 3FX3A 3WNNA 1DHKB 5FPZA 4ATEA 1SLBA 1PGSA 1XYOA 4XBNA 4K1YA 1H9WA 2CGOA 4XABA 4YVSB 2BEOA 3IIAA 4D7YA 1APNA 1MS0A 1GZCA 5C8CB 3I59A 1LOFA 2PN5A 5GZCA 5C3PA 4Q0PA 1LESA 3KS7A 5F5QA 2GH8A 1ZZ6A 3N36A 2GSYA 3MICA 5GLZA 4ZY9A 5CFCB 3ZSLA 2UY9A 4QQHA 3P3NA 5FY9A 4D6QA 1O4TA 2D6KA 5CB7A 3H8OA 1W2OA 2BJSA 5C3SA 4UFIA 3HD8B 1FI2A 4FPFA 3ZXEA 2OS2A 2Q1ZB 1RGSA 5A6QA 4K7JA 3RG0A 3M3EA 1AX2A 2GNDA 5EZWA 4AQ6A 2D3RA 1PK6C 2ZGLA 3RMYA 2B45X 3OGSA 2H0VA 4IEXA 4XFAA 1NCQB 3I49A 2PHRA 4EYUA 5F1RA 2OUHA 2B5HA 1PMIA 1RUI2 5A7QA 2YDEA 1B35C 5GLTA 4QWNA 2WNVB 5FMOS 1WCSA 2VOXA 4GXLA 5JOWA 2PMWB 4OHYA 2XPJA 2JKXA 3VGIA 5L9VA 2JIJA 1GOHA 1WW6A 3ZKYA 1ZZ9A 1WD3A 4ZS3A 3SITA 3OGVA 2R1DA 3UGFA 3U0ZA 4LA3A 1E5RA 4CDXA 5KHIA 1RUI3 3WD5A 4GWIA 1KDMA 4NAOA 5F3GA 1XSQA 2ZMLA 3CNAA 3FLPA 4FPJA 1HLCA 1F4HA 2HWB3 1SQ4A 4H55A 4QX7A 5FPAA 3TAYA 3WNMA 3VD7A 2JG8A 2WQ8A 3S7IA 1H8TB 3QCWA 4PLNA 5ANNA 2A1XA 4BQ5A 2IUWA 1WW5A 2UURA 2V72A 2VMEA 1PO12 2BBAA 4CDUC 2GC1A 1PZ7A 3J4UH 1MACA 3VKNA 1RTVA 2RS11 3AL5A 1S0BA 3GHNA 1NZCA 4GQ7A 4CDQC 5KC5A 1DFQA 1QOTA 1VAKA 2X5IB 3FFQA 4IGPA 4RS5C 3WV6A 1MS8A 4BB3A 5F8PA 1N3QA 2BOIA 5K0UA 1I5ZA 3PJQA 1LENA 4O9GA 4AI8A 3NKTA 5FUIA 3LEMA 3M2MA 4NIAA 4BK4A 5HV0A 2LROA 3PU8A 5KC6A 3K51A 2QE3A 1A34A 1D4VB 1JH5A 4FPCA 4IEQA 3DPRB 4X6QB 4YPJA 3ZYIB 1PIV2 4HPKB 2B42B 3QH6A 2P17A 3DGTA 5JXJA 1GV9A 2BVBA 3N9PA 2Z69A 2NPIA 1PVXA 3DCQA 1AR72 5IVEA 4FP2A 1Y9QA 1PGL2 4DIQA 3VDDA 3TOJA 2W9XA 4A3XA 3DL3A 4LBMA 3LDRA 2Y60A 3VUOA 2J1VA 2GP5A 1LULA 4P9IA 5FO8B 1JZ5A 5CZKA 3RI9A 1FT9A 2J42A 1ZNPA 5ABJC 3WXPA 1YRZA 3CF6E 4Q4X3 4QKFA 4PF1A 4UFKA 4AG4A 4KGGA 3CMGA 4FXGB 3ROUA 4Y1UA 1AR73 1D4M3 4KWJA 4X8PA 2HWC2 5CU1A 5E1RA 4N53C 4AFMA 5F3IA 2PHFA 1ZX5A 5CYYA 3AB0A 2QQMA 4IE4A 1XNKA 1VLNA 1Z78A 5IVCA 4LIVA 2R071 4OYUA 2W1SA 3MHZA 4QGMA 1CESA 2OQ7A 2VAUA 3OEAA 4ZKTB 3LPFA 4AYUA 3N7MA 1MS1A 2AYHA 2LUWA 4O9EA 1ULEA 5C9AB 4GMP0 4JQTA 1H1MA 4AGRA 5C7GA 4DY3A 3JD73 1PVC2 2VULA 5FZ3A 3WVJA 4JZRA 1VMJA 4ZU4A 3AMHA 3ZXKA 5C4WB 1YIPA 1M4WA 3T2OA 3WDUA 2J1TA 1UOFA 5J48A 4JQRA 1HJFA 2HWE1 3NAPC 4CCKA 2ETEA 3LA7A 3JQXA 4CEWA 1D2QA 1V6NA 4QKNA 4YVSC 5EWSA 3AXDA 1H30A 5FY0A 3VKOA 5IFTA 1W03A 2A6ZA 3BU7A 1CR7A 1GZWB 2XJVA 1NT0A 5FP8A 5CFDC 2QQPA 2BGOA 4AQTA 1AYN3 2WYFA 2MEV2 1W6QA 2IXIA 1FNYA 1YFWA 3H7JA 1RUD1 2IFRA 4NN0A 3WUDA 1MS4A 3GCXA 3AKQA 4HK9A 1GP5A 2XJQA 1QJY2 3RVHA 5JAXA 4LKDA 5K8SA 5A3MA 5L9RA 1ZBE1 1PM4A 5T3NA 5BNOC 1V6LA 1XNTA 1ND3B 2IXHA 1HXS1 2XVKA 3PVOA 4GMP1 4IETA 4QKDA 5L7OB 1RINA 3DF0A 4Q4W3 5L9BA 3H0OA 5LA0A 4NPRA 4OULA 1J84A 4FPGA 4WM8C 4CEYA 5IVBA 4I2OA 2D5HA 2FDKA 1MS5A 4Z07A 1DZRA 1X8MA 1UU4A 5I0TA 1ZRFA 2HBUA 5J3UA 2OQ6A 2WABA 1SLTA 1TMF1 4Q1PA 1NLQA 2DF7A 2RS52 4P5YA 5FRAA 4K1ZA 4XF4A 4BISA 4WV8A 4QD2A 5FP3A 3BN6A 4OUSA 5FKBA 1FOD3 4AE2A 4RGAA 4QQLA 4XF3A 3THTA 2IZWA 5FYUA 1V0AA 3ABZA 1LOAA 1HQLA 4FBFA 3I2JA 5H9SA 3O5SA 4KI5M 3WSOA 1DYOA 3LAGA 2G19A 2HWD2 1RUF2 3GM8A 4PLOA 4UFJA 3C7FA 5T5JA 1JOPA 2XHKA 4Y22B 1YUDA 1UWWA 1HN1A 2PHWA 2ZHNA 3DXUA 2YBKA 4XEZA 1HQNA 3H50A 2PHDA 4OZOA 2GALA 2JECA 5BXXA 2RR13 1R083 3ZDVA 1ZRCA 1XQNA 1US3A 3C8XA 4NAMA 2ZBJA 3ZVXA 5EIYB 1A8DA 3RPQA 3H3LA 4MUVA 4BLIA 3ZSKA 3ZFEB 5FYIA 5F5IA 3I3BA 5I0DA 3H42B 1S0CA 3JU9A 2JG9A 4KWKA 5E16A 4R9DA 1IS3A 1H8VA 2RS32 3ST7A 4B4PA 3TEXA 3HNMA 2P37A 1VBA3 2VVFA 2ZCWA 4LUMA 2BWCA 1YJKA 4IEPA 1R1ZA 2GU9A 3O0WA 4HT1T 1RVF2 4AZZA 1U5ZA 3FFZA 4CXWA 4C0BA 2VO5A 4XFFA 4QPIA 1ST8A 1UZVA 1X36A 1QMJA 2JIGA 3T4VA 3VBFB 2P3YA 5FO9B 2FDIA 1DCSA 2BPA2 4M4RA 2P3JA 4B1MA 4FTEA 4AAXA 4XURA 5FXVA 4A2UA 1S1AA 5GLUA 2PHXA 5D8AB 1FPN2 3AVSA 4R4ZA 1WCKA 4UW5A 1V6KA 3CU7A 5A3PA 3ZFGA 2A75A 2QQLA 3VDBA 2VMFA 1W28A 2YB7A 1WWYA 4DFSA 1E57A 5AC91 2J1AA 1LGCA 3UESA 4FOWA 5A1LA 3ZIWA 4IERA 2R042 1GWMA 4R9BA 1CX1A 1AF9A 4UF0B 1POV3 1G8WA 5EHDA 3WF3A 1VBE1 4E4SA 4JGYB 3OGGA 1V6OA 2PAKA 3PVBB 5HCBA 4DXSA 1XE8A 5JXGA 1SACA 3O1UA 2OKXA 1O5LA 4XYXA 2AC1A 2MPFA 4ASMB 1AR92 3MPPG 1QKQA 5CADA 2ZEZA 2HWF3 3BPZA 2MNGA 3VDCA 3OYWB 4IV3B 2ZMNA 1VAVA 1W2NA 2B4KA 4ZPIA 5C70A 5FY8A 1JS9A 1RUE2 5CVRA 1FV2A 1HX6A 3A0KA 1SPPB 3WR0A 1ZRDA 4AFBA 1SZBA 2BZDA 4CCEA 4EZHA 3HQRA 1AL0G 5B4NA 1CAWB 2ZHLA 5F5CA 2A3XA 3E5QA 3RZMA 1C8NA 4F3JA 5A6ZA 4AI0A 4YLZA 3U37A 5C3QA 1OMIA 3POIA 2HBTA 4N90A 3D0SA 2Q1FA 1CN1A 3ZYFA 4CUAA 2VZ3A 1HV0A 3M8LA 3VLBB 3DXTA 1RUE3 3ZXAC 5FOBB 5IAVA 2XOMA 2OT7A 1AR82 3BIWE 1N3PA 2YFZA 3IT8A 4DXZA 5IATA 3S5AA 4MXVA 4RGGA 4W4ZA 5LRSA 2QVSB 4RQPA 5HXVA 3WX5A 3MV01 5T54A 3VBOA 3AMNA 4BQXA 4QX5A 4YW7A 5CAZA 3NNMA 5IVJA 5BNNA 2VCAA 4MXWB 5F2WA 1A78A 3FJSA 3V0BA 1DGWA 1NXD1 1RUI1 1UY0A 2WYSA 2B46X 2XMLA 1O8PA 3MPBA 1UAIA 5JI9A 4CCJA 3CLPA 2OZJA 3N35A 3ZDSA 1YEWA 4L97A 1UIKA 3WQ7A 2AR6A 4BQ2A 1QGLA 1QXJA 3FL7A 1YHFA 3CJXA 2XJTA 4P14A 1XOYA 1DGLA 4WM7C 1KXGA 4QMAA 1G7YA 4EQVA 5LWBA 1AZDA 4ZZ8A 1W6NB 3GBFA 4WZFA 3AMMA 1YI7A 3ZR5A 1LU2A 4D6SA 5JOZA 4XUTA 2J1EA 1BYHA 3ELNA 5C5TA 1GP4A 2QZ2A 5A70A 1LOFC 2D97A 4IV1A 2F4PA 3SHRA 1UZ0A 1PO11 3A21A 1K5MB 4QX8A 2HKXA 3CJIB 3AP9A 4CP0A 3QOPA 3WNKA 5FR3A 5GM0A 4QB2A 2Y26A 4JX0A 2VCCA 4Y1XA 4QQOA 4W6YA 4DOUA 3B5LB 4LO4B 4YWAA 4WVVA 4LORA 4QPGA 4AW7A 3QBQA 5KHKA 2XVLA 1PZ9A 3OGRA 4I09A 4L2NA 1YWKA 1SMVA 4HN0A 3WF1A 2OUJA 4N53A 5E89A 2P1BA 5FUPA 4URAA 2D6PA 1IZ3A 3I97A 1OUSA 1ND2A 1LJ7A 4JKMA 3WF4A 4AXOA 5BNPB 2XWJB 4DRVA 1PIV1 3UYJA 1N1SA 5J09A 3LEKA 3WQBA 5LEJA 5FZKA 3AYEA 1LB2A 2E63A 1H9PA 4TN7A 3KT4A 1LAJA 1AR71 3GZEA 3LCPA 2ZEYA 2ZKNA 1HW5A 3J26N 1VRH3 1OH3A 2FDGA 2WLQA 1RUNA 4P9GA 2LS6A 5FQ0A 2ZGOA 4F7ZA 4QX1A 3VBHC 3U1XA 1GICA 1QJU2 4LITA 1OQ1A 2W92A 1G9BA 4Y4YA 4RHV3 1WCUA 4XC9A 5I0UA 2PELA 1H0BA 3LSDA 1XU1A 4K40A 2ORXA 3WCSA 3M7AA 2YGLA 1SCRA 1GQHA 2HWC1 4LBOA 4M0HA 4WZCA 2JG8C 4YVSA 3GDBA 5A3UA 3S57A 1J58A 1OF4A 5C8CA 4NHLA 2RM23 1UYXA 4RSUA 2W52A 4MGKE 2NN8A 2QDNA 1Y9GA 2QJVA 3EBRA 4LK6A 4Z8BA 4RL7A 3M1HA 2D6LX 4PBOA 4MZUA 1Y4WA 1ZZ7A 1NE6A 5FP7A 4DMIA 5CFCA 2E7AA 1J3PA 1YC61 5K0UC 5FWEA 2WWSA 1OUXA 1YI9A 2UYBA 5A7SA 1PVC1 3T09A 1PMHX 3MW3A 4Q4V3 4AGVA 2NM1A 4RN5A 2VZOA 3LGRA 2CGNA 2XR4A 2UU8A 1QIQA 3WHTA 1SCSA 2O8OA 4OFGA 4XETA 1NCQA 1JZ3A 4WM8A 2HEWF 1T6BX 5FZ6A 4QPYA 2E26A 2G9GA 1SLCA 4GB32 2WZPP 3RDIA 3VHRA 2BU9A 5GKAC 3LKJA 1W8WA 4PIZA 4ATFA 2XJRA 4XDPA 3EYPA 2VM9A 2VTXA 2DVDA 4K20A 2AENA 3VDDC 4EZ4A 3RZLA 4Z92B 2CYFA 4BM8A 5J1XA 3MIFA 1ULOA 1KJRA 5F5AA 5FBZA 1EP0A 3SH5A 5JZGA 5DZEA 3V64A 1LECA 2MEV1 1FMD2 3LDBA 4N43B 3D3AA 3ILRA 2FDHA 3ZSEA 1QJY1 3FUQA 2XONA 3J8F2 4QHZA 1V9U2 3VZJA 5I91A 4IQPA 1QJX3 1BLZA 1REEA 3ILFA 3ZYBA 1YO8A 1XJAA 4G9SB 3BTXA 3M4FA 5M0TA 2VZSA 4YNIA 2VQTA 3N7JA 4FCAA 1N1YA 2GC2A 2CGPA 5FPLA 4Z82A 4ARYA 2DUOA 4OHXA 4QX2A 5L36A 4A41A 2WNOA 3VZLA 2Z79A 5FTTC 2BERA 3QD6A 2NMNA 1S0IA 3N9LA 3U11A 3K48A 2X5IA 1W8TA 5GZFA 4NUBA 1G9FA 3NRUA 3PHMA 1OXCA 2H0BA 3N3HA 2XJUA 3KF5A 2RS51 3AXEA 3ZN5A 3K4ZA 3HAGA 1JUIA 3AP5A 3HVDA 4QT6A 3ZN6B 4HONA 2WZR3 4UAPA 1JMUB 1TZOA 1UIJA 4GIQA 2R062 3DPRA 4HETA 1AYM2 4HPKA 2W1QA 3AMPA 4CEWC 4LNVA 4Y1VA 3B93A 5J36A 4DQAA 4LE4A 4LO7A 3RQ0A 2HWD1 1RUF1 3SISA 1BVVA 1WGPA 2E7QA 1W2AX 1EY2A 1UPSA 4Y1ZA 4YW6A 4Q4Y2 2PQQA 2PLV2 2UWBA 3WP6A 4XXAA 2DCKA 2XHNA 4GJYA 2K0GA 4UBHA 4A6OA 2D5FA 5ACA2 4MOAA 3CJIC 4AHXA 2R063 1CIWA 4BWOA 4R9CA 4JTOA 2XBO2 1W3VA 1X8EA 2I45A 2VMIA 4QHBA 3H8XA 2GMEA 3J7HA 4LQRA 1WKYA 3ZMOA 4HFSA 4DB5A 1W8ZA 1WUVA 4I02A 4MV2A 1ASJ2 2RS31 3ZYHA 3LZZA 4B4RA 4CDWB 3DYMA 1UXXX 5HCFA 4HL0A 1YFUA 2F6BA 2YPDA 2ARBA 2VUAA 3M3CA 1W9TA 2ZGKA 1JYCA 3WDTA 3NW4A 1GR3A 1RVF1 1EAH3 5FZAA 2WT1A 3N9MA 4LULA 4CEYC 5GLVA 2XBO3 4FAHA 2WFF2 3GBGA 4MSVA 4V2VA 1L7LA 4XJZA 4NOTA 2ZTNA 1DDLA 4BQ3A 2QQIA 3IPVA 5C9AA 2KR2A 1OC1A 1OA2A 2BP6A 5FWJA 4XQ4A 2GNBA 1QH7A 4OZXA 5DZGA 5LZ6A 4AVSA 4B8EA 4C90A 2AEZA 1JYWA 3POSA 4QGNA 3JZVA 5FZLA 1ENSA 3I2GA 1LHUA 1FPN1 5FFOC 3T4HB 3VB9A 3HN1A 4CXXA 1YQ5A 2BVVA 3H3UA 5FZIA 2QQUA 2ZXQA 3WP3A 3N9QA 4AR2A 4KBBA 1G6NA 5FP9A 1UYPA 3N7LA 5DUUA 5ERLA 5FCCA 2NYYA 4QKBA 1BEV3 2R041 1QU0A 1WMEA 2ADDA 3KD4A 5C8WA 1ULCA 1PHMA 1GZWA 3BGAA 4LEJA 4BK5A 5FDBA 4MO3M 5F3EA 2TNFA 1HRV2 3NQHA 3CZJA 1T6GC 4BIFA 5DUXA 2QZ3A 3VZOA 3T2TA 5LY1A 1C57A 3ACIA 1Q3EA 1H1IA 2E33A 2JG9C 3IMMA 4PQQA 3LB9A 1KGYA 1AR91 1QOSA 2P6CA 3OUIA 2YZ4A 1ND3A 5DUVA 5FYSA 5AC92 5L7OA 5CKNA 1M06G 1CAUB 1FX5A 1VMHA 5EQUA 5A7WB 2WO3A 4GJZA 4CCDA 5CA6A 1RUE1 5A3TA 5EV7A 2BYVE 4KNCA 4QPIC 4I3GA 2CWMA 2VG9A 5L73A 1UO9A 5FZOB 3VBRB 1CPMA 4NO4A 1FAYA 5FY7A 4YZ3A 3E1F1 4LOTA 4NMIA 3RZKA 1MZFA 3U78A 1BK1A 4GULA 5FYTA 1AXZA 3X29B 4LLOA 4URTA 4YG0A 2WT0A 1AR81 3T30A 3T2QA 2D6NA 4N43C 4CP1A 3ACFA 5KXCA 3WF0A 3ZFGC 1O3TA 3MUZ1 3BOWA 2DUPA 1DQ2A 2YV8A 2F4LA 3WY6A 4M4PA 1QWRA 1J1LA 5C33A 1HRI3 1D0HA 3DKQA 1GOGA 1YQ2A 1QEXA 4TWTA 4OUEA 1QXRA 4Y22A 3H8RA 1JXNA 2Q30A 2E53A 3UJOA 5LK7B 1OF3A 1RUH3 5FJHA 4Q26A 2P6HA 1W6PA 1QH6A 2C5DA 3O0XA 4YZ5A 1E5HA 1VBC3 3ZFEA 3MUY1 4JHZA 2B9UA 2VNRA 3ENRA 3VZMA 1YQCA 4CPBD 2DCJA 4PIXA 3Q8BA 3R0RA 2IVIB 5T55A 3PTRB 4F83A 2Y6JA 4QXCA 1PGW2 3DN7A 1SEFA 2JDYA 4H3WA 3CHXA 2AEYA 4FOYA 3LIHA 1GU3A 3SCGA 4Z2AA 2CDPA 4CRQA 2VMGA 2ZA9A 1X9PA 4M01A 4QQ2A 4HANA 5JZGB 3POYA 1OOPB 1ZBA3 2ZGMA 2ZZQA 3VBFA 4BOWA 1MS9A 4L0PA 5DDJ3 2WRAA 4IEZA 5J96B 3ILNA 3E97A 4NIDA 4TYSA 2HWB2 1NE4A 4JTNA 4NR1A 1I9RA 2WC2A 1GWKA 2QQOA 5TSWA 1GQGA 1VPHA 2XJSA 2XL9A 3NNJA 3VBHA 1NQDA 1HKDA 1LKNA 1RUG3 2VD7A 3PU3A 4IGOA 4LLFA 2XLGA 1SFNA 5D8AA 4P5HA 4XFHA 2FQPA 2VMCA 3GYDA 1L7QA 1PO23 1XNDA 4LBQD 3RI8A 3A7QA 3S7EA 4JRAA 1JZ8A 1UY3A 4RQPC 4GH4B 4AVAA 5FMBA 3ME2A 4Z1VA 2RMU3 3VBOC 4CDWC 4Q8KA 2DDUA 1WBLA 3HMYA 2YBSA 2EAKA 1UY1A 5FPXA 2XLAA 2FZ1A 5HCAA 4OMCA 5JDBA 1MQTB 3GXUA 1EPZA 1AJKA 4H7MA 2ZX4A 4LMFA 4NPMA 3NJYA 2DU0A 2QFEA 4PDWB 4UF0A 5BNNC 3OEBA 5GZDA 3CQOA 5FPBA 2WS93 4ZU5A 3SXWA 5DAWA 4JGYA 3T1LA 1CWPA 1RUJ3 1NCRC 1JI6A 2VE1A 4META 2Q8DA 3GHMA 4XBLA 2QUOA 3AL6A 2JE7A 4CCMA 3ZR6A 1KFXL 4HN1A 3RYRA 5A32B 2VR4A 1GZTA 3DUIA 5ANQA 2OZ6A 5FQ0B 1S0GA 1QJU1 2JDKA 3OYWA 1Q5OA 2ZGUA 1LGNA 2PHTA 3AYCA 1RB8G 2ZGSA 4Y3OA 3ZO0B 1QJFA 1S55A 1SPPA 4TLFA 2JB4A 3IZOA 4PI0A 5C6CA 1CAWA 1IKQA 4Q4X2 3WHUA 3EMRA 4L99A 3ZMNA 4FPHA 4XMIA 4FAGA 5KHGA 2WWUA 3PVNA 1D4M2 5KR7A 2W2IA 2X53S 3TWIA 2QCSB 1N1TA 3UGHA 4BA6A 4IV1C 5JR7B 4D7SA 2Q5TA 1OQDA 4XUOA 5FZHA 4Q8LA 2YC4A 1TME3 3CO2A 2PFWA 3H3ZA 3FLTA 2JDMA 4EN6B 4KGQA 1LNSA 1O4YA 4UFMA 4WVMA 1O7FA 1Y7BA 4QPGC 2FBEA 2YG0A 4XPVA 5FLIA 2VXJA 3NV3A 4A42A 1GNZA 2RJKA 2V73A 4Y4RA 1AJOA 3JD72 1EYBA 2GAUA 4AQ2A 1I1EA 1ND2C 4GKYA 2R7EB 1TNRA 4N9HA 2EXJA 4QX0A 1S0FA 4CCNA 4CYDA 4MXWA 4DXRA 5FAXA 1LEMA 1MZ6A 2JE9A 4Q0SA 4DUWA 5A1AA 4S2FA 4GB31 4XFCA 1BKZA 2CSGA 3I3QA 3ZXFA 2FDJA 4LHKA 4QDRA 3UT0A 3WDVA 2VGDA 2BFUS 4JKKA 3VKMA 4LK7A 4XILA 3TEWA 3A23A 2EF6A 1OQEA 1WMXA 3PIJA 4JAAA 4RFRB 3HT1A 3H1WA 4BYYA 4EN8B 4M3CF 1WLTA 3J7NA 2GN3A 3ZX7A 5E8AA 1F35A 3O1PA 1FMD1 4A7KA 3NJXA 2B9VA 3POJA 2W46A 3O1OA 1AYN2 2VZTA 2ZGTA 4XTPA 3ZFFB 2ZEXA 1GYKA 2I74A 2K2SA 1V9U1 3J8F1 4XF9A 1W6NA 4EROA 1V6IA 1CIYA 2D44A 2WQZC 3MDPA 5EJZB 4AF9A 4M00A 4UXAA 1Z7S3 4AFCA 1W6MB 2WKKA 1VALA 3B01A 1GNYA 1YCIA 3M70A 4JGZB 5C8CC 3K3OA 3OOXA 4M3CE 2YXSA 2R32A 2O0OA 4S2HA 3MIDA 4UFLA 5I93A 2YC0A 5DUWA 2A6WA 4Q4W2 3WNOA 4XIOA 1O6UA 3IB3A 3CJIA 5CFCC 5D2AA 2Y6FA 3O7OA 5FLJA 1ZZCA 3AZYA 4XJUA 4CZSA 1JZ2A 2EALA 5BPXA 3U4XA 1REDA 1H4HA 3CEWA 4NWWA 4CU7A 4FTSA 3SCHA 2QTWB 5FOJB 1IGOA 1T2XA 2A73B 2DTWA 5FYBA 1U0AA 1DQ6A 1BCXA 2WUHA 4ORFA 4OQ8A 4I3PA 4J25A 4XJAA 5BNPA 1NCQC 2R061 1BBT2 1AYM1 2C4XA 4FQZA 5K9YA 4LHLA 3PDQA 1FOD2 3VZNA 5JZGC 4A45A 3RZGA 4YVWB 5LRRA 1AVBA 2WNVC 4FPYA 2JB8A 1X82A 1SFYA 1WCDJ 3KV4A 3AP4A 4Q4Y1 3OPZA 2VBBA 2PLV1 2ZHMA 3E6BA 1MEC3 4NHKA 2QQKA 1OH4A 3MFCA 5ACA1 5FPUA 1RHI3 4Q27A 5H9QA 1BBT3 1EUUA 2XBO1 2RR12 1R082 2L9LA 2Y0OA 3VD5A 1NLSA 4QXBA 2PA7A 5KXDA 1F31A 3PLQA 4BHPA 3CL1A 4QDQA 1ASJ1 4DEQA 1Z0HA 3KT1A 2R49A 1MS3A 3I8TA 4O65A 1H8TC 5I8YA 4W65A 1MQTC 4J6GA 4AVCA 1NA1B 2EIDA 3BKZA 1VBA2 1UF2C 1LHVA 1VB2A 2WFF1 1COV2 2WJSA 4D6RA 3O1RA 4MGZE 5EYXA 3T3YA 4BQ4A 2X5IC 3OF1A 2OX0A 1CZVA 2OVUA 1GLHA 3KB5A 4CUCA 2W91A 1JW6A 5E88A 2E32A 1TG7A 1JYNA 5JPMB 1KDKA 1AR63 2Q8OA 3USUA 3BTZA 1XYNA 3KVAA 1PNFA 3MV11 4JDNA 3DPRC 1JZ6A 1COV3 1C5HA 1W39A 1YYNA 4AFAA 2VBPA 1RMU3 3VBUB 2VXRA 1DZTA 2EXKA 4HKWA 4XUNA 2IWGB 3U14A 4IDZA 3L2YA 3LA2A 3T0BA 3UNPA 1WCQA 5FZBA 1POQA 3BB6A 1U12A 4FSJA 4FQ4A 1JU3A 2BTVC 4R52A 4RGKA 2NP0A 1HRV1 1LOCA 4KG0A 4N43A 3V0AA 4E8DA 1OLMA 2WDBA 4MYEA 5IK5A 3MYXA 3OUJA 1I3HA 4CE8A 2XH6A 3SCFA 1U5YA 3RYKA 5IVVA 4CCOA 4K21A 3ZXLA 2AREA 2VW0A 3B9IA 2HWF2 1L7RA 2JDPA 4GKXA 4KG8A 2HEVF 4Q0UA 4UW6A 2UWCA 3FE5A 5IW0A 4NIIA 2EIBA 2WSUA 4FP3A 1KS4A 1Q8PA 5C9AC 1QJEA 2EIGA 3VDAA 1G9DA 1BVP1 4QB1A 2TUNA 3PNAA 1C1FA 1AL23 3H1YA 4H14A 1K45A 2BGCA 3IM0A 4FOQA 4NRPA 4YZ4A 5IJRA 4CSWA 5BV6A 1DQ5A 4QXKA 3ZN4A 4LBJA 3T0AA 5C4WC 3MZHA 2VPVA 4HVOA 4NPLA 3SEEA 5JR2A
chains in the Genus database with same CATH topology
1J1TA 5T52A 2ATFA 1BQPA 4B29A 1JBCA 1DYPA 2NZ9A 4MGYE 1GFF2 3MLJA 4ITCA 3R6SA 2PHUA 1TEIA 2ZZJA 1C28A 2YMZA 3UV9A 1AX1A 1J59A 5KXBA 2XJPA 1ZA4A 4FXKB 4P9XA 4AI1A 1W0PA 3SMHA 2VOVA 4D7TA 4PBPA 2XB6C 5I0SA 5GJ6A 4SBVA 3EHKA 4P9JA 2IFWA 4PLMA 1ND3C 2ZJCA 1H2LA 1EV12 1ULFA 4CDWA 1UPIA 5L7OC 4YW3A 3RS6A 4AEJA 2W08A 2WQ4A 5KHJA 1PGW1 3TBDA 5T5LA 2ET7A 2ZACA 4BH9A 2VW2A 4AWDA 1NCRA 4HVRA 3VHNA 3WDXA 5I8TA 2HWB1 1EV13 1W6OB 2HYKA 4UW4A 3WW3A 1WLCA 1XRUA 4MVTA 1O5UA 1Q8OA 3KMHA 3AK0A 4MH0E 2GNMA 3OGJA 4NVPA 2KXLA 2DYCA 3AJZA 4FPEA 1AUYA 2R16A 3TN93 2IXLA 2ZABA 4WBBA 4EWAA 1IKPA 3MF9A 5AFBA 4IESA 5HBAA 2ZX0A 4XIKA 5FO7B 4X6RB 1H2KA 2QKDA 2GNTA 4AHZA 2QNKA 3ZFEC 1H4GA 1LRHA 1UKGA 2ZAAA 2NQYA 1LODA 3PMSA 1TNFA 1VRH2 4LBNA 3AFGA 3ES1A 2JX9A 5T50A 1N3OA 1DQ0A 3GZTB 4RHV2 2GMPA 2WA4A 4Q4X1 1GANA 3TRSB 3VBFC 4BCUA 1DGWX 1W6QB 1D4M1 3VBRA 4K8FA 3B69A 2C1FA 4GA9A 3VL8A 5DZFA 3GNEA 5CG9A 1YFXA 2RM22 3IN9A 4XHXA 1IPJA 5D8AC 1G9CA 4LBQB 2EAAA 3H7YA 5K7PA 4AEDB 3VHPA 2Z5WA 3L9JT 1Y43B 3KGZA 5FMOL 3JD71 1O91A 4BPZA 4Q4V2 2C0ZA 2WNEA 1YNAA 3WLUA 2D6OX 4JGYC 4BLJA 4RR3B 3FBMA 4IL7A 4XF1A 4I0AA 2PYTA 2WSVA 3G6JB 3INAA 1SBEA 4XW3A 4DRRA 5GZEA 4PCRA 3WP4A 2DUQA 5JOYA 5KXEA 1FNZA 4IV3C 1OFNA 1UL9A 4HK8A 1F8VA 4LR4A 4YZ2A 1AYN1 4HVQA 4XZPA 2IXJA 5JSOA 5LEKA 3URFA 2GZWA 3JB4C 3H8UA 2R30A 5JZGA 1XXNA 4DY5A 1OOPA 4QQPA 1OHFA 2UWAA 2WNVA 1QJX2 2N7GA 4LA2A 1A3KA 3FHIB 2UYAA 2ZOEB 1MVQA 4Q4W1 3PJYA 3WDWA 4JV4A 3J9SA 4HSJA 4W6WA 2A71A 2P34A 5JIAA 3OCPA 4HKOA 1OLRA 4L92A 3N4MA 4GH4A 1KITA 2D93A 4ASLA 1BJQA 1H8TA 3BCWA 1O3QA 1MQTA 2JD4A 3A4UA 1CD3G 4IEYA 4PDWA 1UZYA 1BBT1 3V56A 2WZR2 5CIRA 2W68A 1R1A2 1FOD1 3NO8A 4ISRA 5IT6A 1ZREA 1CPNA 4Y20B 4MGIE 3VZKA 1CAVB 1PNGA 4XJ9A 5A33B 3MLKA 1REFA 2VVEA 3RNSA 5A32A 5EYYA 3VV1A 4I01A 5IK7A 4YZ1A 5JSRA 3ALQA 4QU2A 2XWBB 1SLLA 3BTAA 1CVNA 5DG1A 1MZEA 3VBSB 5FQ0A 5A3LA 2RR11 1R081 1R1A3 3U07A 1LOEA 4Y5Z0 4JVAA 2D98A 3TNPB 1VIWB 3AZXA 2DU1A 2XGXA 4YFZA 1UCXA 3U10A 2CY6A 1DZQA 2HWE3 4Q0VA 1S0EA 1AR61 1POV0 3OBRA 1VBA1 1XNCA 5JVVA 1K5MC 3OD0A 3MFAA 1H2MA 2FMDA 4COYA 2I07B 1COV1 1EAH2 1IS6A 4FPKA 3QLQA 3RJ2X 4LO5B 1QXPA 1PK6B 4V1PA 4GWNA 4UBGA 1RUD3 2DVBA 5I0RA 1B35B 3FZ3A 5BNPC 1ZBE3 1F5FA 5CNAA 3AJYA 1HXS3 4GMP3 5HI0A 1LCLA 1QNWA 4IEWA 4P9LA 3S30A 4YFWA 4KH9A 2XLFA 1BEV2 2XUMA 3E5UA 1TMF3 5EFUA 1X50A 5C4WA 1POV1 1TE1B 4EN0A 3M3IA 4P9YA 3O0VA 4G4FA 4HZFA 3ZFFA 1O3SA 4B7KA 1ULGA 5LK5A 4B7EA 2ENRA 4CDUB 1JOJA 3AYDA 1VBB2 4CDQB 1W6MA 2C9AA 1F9KA 2SLIA 4JGZA 2PTMA 1QQP2 1BZWA 4RS5B 3JUUA 3IWZA 2HWF1 3HBZA 3PVEA 4XFBA 4E2GA 2Z2SB 2FMYA 4FPLA 4KU8A 1DGRN 3B94A 1U5IA 1VBB3 5BUVA 1U5XA 2VVDA 1QQP3 4AQSA 4P9WA 5DXDA 4YARA 2JKBA 3UK9A 1YFYA 4AVVA 2G9FA 5JCTA 1UU6A 2GN7A 3H9AA 1V6JA 2H6BA 1W2UA 2EA7A 4XOGA 4OHZA 3NL1A 3KCYA 2A6YA 4DINB 3ZPYA 1HRI2 5ABJB 2R1BA 2CTVA 3ES4A 3L2HA 2FZ2A 2Y0IA 3MW4A 1RUH2 4N53B 2O1QA 4XFGA 4XBQA 1PZ8A 3EQEA 5B2GB 1VBC2 5JOXA 1EV11 4LUKA 4PF5A 2X8KA 1V6MA 3NJZA 3N7KA 1DYKA 5DG2A 3WCRA 1ENQA 1X7NA 1NA1A 5I8SA 3B7MA 1XYPA 4JDMA 1OPOA 2HEYF 1OKQA 2WNUB 3WDYA 1L3JA 1VBE3 2KM2A 2VNGA 2OYZA 1ZBA2 1RL3A 5DDJ2 4MLOA 1B09A 2DVAA 1A8MA 3NAPB 3PMEA 4M3CB 4YW2A 1SBFA 5H9RA 3VBSC 1AHSA 3KSCA 2YY1A 1UKRA 1RUG2 4MX3A 3THPA 2CWSA 4R9AA 2A7AA 4F8AA 1PO22 3VBUA 2YPJA 2LALA 4OVEA 5CFDB 1C8M2 5GALA 4C1XA 2ZAHA 4QGLA 3AP6A 3ZIXA 2RMU2 4OHWA 3BODA 4DZGA 5JMCA 2XG3A 2DFCA 1AXKA 2P3KA 4ES9A 2JXAA 2DV9A 4U36A 5BNOB 2R0FA 2VOKA 3UKTA 2WS92 1C1LA 1RUJ2 4W6XA 1C8M3 4GALA 4WM8B 4H7LA 3JBG2 5GZGA 2IXKA 4GWMA 1VJ2A 1VRH1 4AI3A 4Q1RA 2WT2A 1GBGA 3ZSMA 2BNNA 3MIHA 1ENXA 1UD1A 4FTBA 3IDEA 4RHV1 3E6DA 3IDCB 1W0OA 2GC3A 4YW5A 3LWCA 3JBG3 4E4DX 2ARXA 4BE3A 1Q8QA 2RM21 2H6CA 2ZX2A 4JC1A 1DIWA 1SLIA 2GC0A 4IV3A 4LBKA 1RUOA 3UJQA 3KQRA 3B9CA 1TME2 3HQXA 4XJ8A 1R092 1CJDA 5EXOA 2MHFA 4OUMA 4LBLA 3ZXGA 4N9IA 4IEOA 1CX4A 4YM1A 4Q4V1 4Z2WA 1J3QA 1IOAA 5J98B 1BMV2 3TYJA 4B3NA 3ETQA 4EN7B 1ZRRA 3RSJA 2VY0A 3AKPA 1YLLA 4FOVA 1F5JA 1GZ9A 4S2GA 4KU7A 1PO13 1R093 2IC1A 1RJ7A 4XJWA 4B4QA 4BMBA 4JDOA 4RFT0 3AKSA 3WW2A 3D82A 1QOOA 2BQPA 2DWRA 3KCXA 1UMZA 1WD4A 1IPKA 2K9ZA 4RD7A 5EJ3A 2V5YA 1ONAA 1PIV3 1VR3A 4XMAA 3VBRC 2A6VA 1QJX1 1VP6A 4Q2FA 3W9AA 1W6OA 3POWA 1DF0A 1Z7S2 4OLLA 2DFBA 3MEPA 1HIXA 3AFKA 4BQ1A 3G7DA 4I30A 1LU1A 1HV1A 3AYAA 2TBVA 1XU2A 3R4DB 4DRVA 4YW1A 3S0MA 1URXA 3MGUA 4ONUA 1NY71 2ET1A 3QH7A 4FVVA 1UW8A 1CGPA 3LOIA 3C3VA 1CAXB 4AHYA 1IQAA 1OD5A 2CAUA 3JQWA 2VUJA 3WZ1A 1FYUA 3V65A 4CTEA 3IPVB 3GALA 3VKLA 2ZGPA 2HWC3 3I4IA 2WZR1 4NWVA 3UKNA 4DPNA 1K5MA 4QM8A 1R1A1 4KL1A 3NKGA 2WNUC 1DU3D 3D6EA 1V00A 2ZHKA 4NHMA 3Q9OA 1YIFA 3WUCA 1RITA 4KWLA 1HDKA 1C4RA 4CP2A 1KJLA 3OY8B 1MEC2 1OLQA 1S2BA 2TEPA 3O14A 1PVC3 1RUC2 1RHI2 1WMDA 4XHBA 4HBNA 1JUHA 3ACLA 3RMXA 1OOPC 4HMZA 2JJ6A 3B3QE 3R4SA 4FO9A 1JYIA 2D3PA 5JSPA 2NLRA 4E27A 1RUC3 1EAH1 4FT8A 1N1VA 4LBQA 2EXHA 4AEDA 3VHOA 3PTYA 4KQ7A 1HQWA 2MEV3 4GH4C 4XE9A 3RJRA 3B00A 2IXCA 2DURA 4J1XA 3T1MA 3AZZA 4XTMA 1QJY3 5BNQA 1MR5A 1AR62 4PDWC 2X29A 4C0HA 1Q8SA 1S2KA 1SLAA 5L19A 1C3HA 4RR3A 3LA3A 2DCYA 2SBAA 5J37A 4C91A 4OHVA 1RMU2 4ISQA 3TNQA 3UL2A 4WM7B 2A6XA 5AFEA 3R4UA 4HLTA 1JTZX 4PJYA 4UW3A 4COWA 1BEV1 3EO6A 4YYOA 3APBA 4PIYA 3O12A 2RS53 3FC0A 2ZX1A 3I59B 2Z42A 3I2DA 5FREA 1RJ8A 3M3QA 3WP5A 1W6PB 4L9BA 1KD7A 1VBB1 3RZZA 1EPWA 2YHJA 1LGBA 4DS0A 1QQP1 2DCZA 1LOBA 1OA4A 3GBWA 2HWD3 1RUF3 4YM2A 4XF0A 3MIEA 2ZPXA 2VH9A 3D5OA 4TSVA 4G3YC 3FUOA 1O4ZA 3GF6A 1LR5A 4AVBA 5FLHA 2D7FA 4N7IA 3GZUC 1NYWA 3HT2A 1AL22 4R4XA 3WQ1A 2OA2A 1D0GA 2RS33 1VBD2 1AX0A 2YUEA 2ERFA 1IHMA 3UKVA 5F6KA 3VBHB 2E7TA 4Y20A 1RVF3 1CAVA 4CDXB 1HRI1 2YYOA 4WVZA 5A33A 3WQ0A 3E6CC 3BOPA 2DTYA 1JN2P 4WVWA 3ZN6A 3MF6A 2WA3A 1VBD3 1RUH1 3VBSA 3VN4A 1UX6A 2JG8B 3SLIA 3ZFFC 1WW7A 1XE7A 2WINB 1G86A 1FPN3 1VBC1 2NMOA 1C5IA 1CONA 4Y1YA 4YM0A 2JICA 4JGZC 2VQ0A 3VKFC 1F2NA 5K0UB 4X8NA 1NOVA 2R043 1SBDA 1UU5A 2AUYA 4QM9A 4Y24A 3FBYA 3WOGA 1PK6A 1ZBA1 5F6LB 3M3OA 5DDJ1 3ZXJA 4LTAA 4ZXKA 3B02A 1B35A 4E2SA 1AR93 1RUG1 4EWDA 4L11A 4IEVA 2ZKLA 3VDDB 4YVWC 1PO21 1ZYBA 1WLWA 2PHLA 2B8MA 1C8M1 2GH2A 3AKRA 1N47A 4INDA 2BWAA 2UY8A 2RMU1 3TN92 4AHWA 3MIBA 4HSLA 2ZX3A 4WVMB 2Q1MA 4COUA 2RJLA 3RWNA 5GLWA 2DVFA 1Y3TA 3VL9A 3I54A 3WG4A 2E9QA 3D4KA 1LEDA 2WS91 2LM3A 3ZSJA 2D43A 2BBVA 1RUJ1 2W0XA 3WG2A 3NV2A 1UN1A 3JBG1 1AR83 4LO8A 4CDUA 1WMFA 3OD4A 1D2SA 4E9KA 4HKLA 4CDQA 4ES8A 1NA1C 4RS5A 4EN9B 2A5ZA 3R05A 1WBFA 1QF3A 4J1WA 1VB4A 4COVA 1Q56A 1LHNA 2OW4A 5JI7A 4YW4A 2WFPA 4FPOB 1OI6A 5CG8A 3KZ4C 3ZYJB 2VQAA 1J3RA 3LSEA 3IMNA 3FLRA 4CEWB 4OI4A 4N7UA 1VAMA 4Q29A 1CAUA 5IUQA 3TB0A 1TME1 4D3WA 2JEMA 2A3YA 2AH2A 1GKBA 2I2SA 3VBUC 2PAMA 1R091 1NG0A 5IK4A 2WLPA 2CV6A 1KFUL 5JIUA 2XL7A 1BMV1 1DBNA 1DGRA 5ABJA 1LOGA 2OIIA 1ZZBA 4E2QA 3NV4A 3HIFA 5JPNB 1I6XA 2BNOA 1DG6A 5BYNA 1KRIA 2JENA 2B7YA 3DV8A 1NQJA 4I0WB 1OA3A 2ZMKA 4IXLA 4CEYB 4Y26A 3W59A 2RS12 2CL2A 5T5PA 3LOBA 3W58A 4COZA 1FV3A 1PGL1 2DCTA 3GZAA 4IEUA 1LHOA 3WW1A 2OPKA 1OFSA 2RHPA 1JHNA 2VW1A 2WNUA 1CQ9A 2VNOA 4CDXC 2QDRA 3AZWA 3KT7A 2RS13 2BW8A 1Z7S1 4D94A 5KWRA 4TZDA 2YROA 3NAPA 3AMQA 2Q4SA 3P3PA 4M3CA 2YGMA 1PM7A 1MZ5A 4EJRA 1A6CA 4RA0A 2D6MA 4DNYA 1GNHA 1SDWA 3AZVA 1QJU3 3IDBB 1ZZ8A 1S0JA 5IK8A 5CFDA 4LT5A 2E6VA 3DKWA 3ZYPA 3E5XA 4Q0QA 4K9SA 3I7DA 5CBLA 1MVEA 2JG9B 5T5OA 5BNOA 3H1MA 4YGDA 3RRDA 3USUB 4AFDA 4YGBA 4K6BA 3A0NA 1NY72 3WNXA 1FXZA 2R072 4SLIA 1UZZA 3ATGA 1WLDA 4C1WA 3KM5A 5H9PA 3EXUA 4QPIB 2VOWA 3JCIA 1MEC1 4LHNA 5JLVA 1RUC1 4EWEA 1QY4A 2GMMA 3NSTA 1RHI1 3ASIA 1X33A 3HR9A 3MW2A 4L8QA 1ZVFA 2DVGA 2EVXA 2R073 3NWKA 4A7YA 3ZXDA 4GB33 3EJKA 4M0NA 3V0AB 1CJPA 4BZ4A 3ZFGB 2HWE2 2XVGA 2ZS6B 5AVAA 1DLLA 1DQ1A 4EV0A 5BY5A 2O8QA 3MI8A 3AM2A 2D3SA 3AKTA 4YSFA 1LTEA 2KA3A 1FMD3 2BFUL 2CNAA 1DQ4A 3USSA 3WXPA 4JCKA 2EXIA 2A70A 3HWJA 1G9BA 1RUD2 3J8F3 1V9U3 4ZU7A 3WW4A 4PQ9A 3AX4A 1ZBE2 4OI0A 2VECA 2ILMA 1V70A 3BALA 1HXS2 4AEKA 4LO6B 3SH3A 3ZYRA 5KBFA 1RMU1 2RE9A 4XQWA 4YGEA 4U2AA 1OPMA 2R0HA 4I0BA 1G9AA 2P3IA 1Q8VA 1TMF2 1O3RA 3QACA 2VU9A 3D0JA 1WW4A 2HJIA 1QDCA 1S0DA 1RIRA 1AYM3 4BIOA 2V09A 1H1AA 3KCCA 1NLRA 1OSGA 3OTFA 5KHHA 3WG3A 4XQDA 1YXWA 4RQPB 2AGSA 3KGLA 4Q4Y3 3VBOB 4BLIA 3OBTA 1YJLA 2PLV3 2Y38A 4LE3A 4XXPA 4AEDC 1QNYA 5ACA3 1NXMA 4YG3A 5BNNB 1IS5A 1CAXA 1LHWA 3V0BB 1AL21 1NCRB 2A3WA 2PAEA 3WINE 3MIGA 1ASJ3 1VBD1 5AVPA 1RC6A 4RR3C 1QHDA 1AXYA 2ZGRA 3RYPA 5F9TA 2XKPA 2BNMA 4AI2A 1ZM1A 4JRLA 2WFF3 2FHRA 2WL1A 5SV8A 3NVCA 3JB8A 1QJZA 2R6QA 4A7ZA 2JDZA 3IBMA 4AVTA 4OI1A 2W39A 3OY8A 1BXHA 3S6PA 4YRDA 4K3UA 4YM3A 4YGCA 2Q0AA 3SNMA 1IS4A 4IV1B 2AZ5A 4AK3A 2P2KA 5J7MA 1QDOA 2GDFA 2LTNA 4YVWA 5JWPA 3NV1A 1XNBA 4OI2A 1H2NA 4R8HA 3MLLA 3ECQA 3WG1A 1TQ5A 4QPGB 3D8CA 5D1IA 4S2DA 3FMGA 4YG6A 3WT3A 1GSLA 3FWEA 1ND2B 4AGGA 2WIIB 3OJBA 4XDQA 1HRV3 1VBE2 1KQRA 2B39A 2VMHA 2ZGQA 5SV5A 4D69A 5AC93 1WA4A 2D40A 2BUKA 3ZYGA 4AEMA 3KLSA 1ENRA 2G4IA 3C2UA 1Q43A 1ULDA 2XKOA 2CAVA 2ES3A 2E51A 1FATA 3SH4A 4XFIA 3IKWA 1ALYA 3AP7A 4WM7A 3TN91 2ZGNA 4E4ZA 1KS5A 3FX3A 1DHKB 5FPZA 4ATEA 1SLBA 1PGSA 1XYOA 4XBNA 4K1YA 1H9WA 2CGOA 4YVSB 2BEOA 3IIAA 4D7YA 1APNA 1MS0A 1GZCA 5C8CB 3I59A 1LOFA 2PN5A 5GZCA 4Q0PA 1LESA 3KS7A 5F5QA 2GH8A 1ZZ6A 3N36A 2GSYA 3MICA 5GLZA 5CFCB 3ZSLA 2UY9A 4QQHA 3P3NA 1O4TA 2D6KA 5CB7A 3HD8B 1FI2A 4FPFA 3ZXEA 2Q1ZB 1RGSA 4K7JA 3RG0A 3M3EA 1AX2A 2GNDA 5EZWA 4AQ6A 2D3RA 1PK6C 2ZGLA 3RMYA 2B45X 2H0VA 4IEXA 4XFAA 1NCQB 2PHRA 5F1RA 2OUHA 2B5HA 1PMIA 1RUI2 2YDEA 1B35C 5GLTA 2WNVB 5FMOS 1WCSA 2VOXA 4GXLA 5JOWA 4OHYA 2XPJA 3VGIA 1WW6A 1ZZ9A 1WD3A 3SITA 3U0ZA 2R1DA 4LA3A 4CDXA 5KHIA 1RUI3 3WD5A 1KDMA 2ZMLA 3CNAA 3FLPA 4FPJA 1HLCA 4H55A 2HWB3 1SQ4A 3TAYA 2JG8A 3S7IA 1H8TB 3QCWA 4PLNA 1WW5A 2UURA 1PO12 4CDUC 2GC1A 1PZ7A 3J4UH 1MACA 3VKNA 1RTVA 2RS11 1S0BA 3GHNA 1NZCA 4GQ7A 4CDQC 5KC5A 1DFQA 1QOTA 1VAKA 2X5IB 3FFQA 4RS5C 3WV6A 1MS8A 1N3QA 5K0UA 1I5ZA 3PJQA 1LENA 4O9GA 4AI8A 3NKTA 3M2MA 5KC6A 3K51A 2QE3A 1D4VB 1JH5A 4FPCA 4IEQA 3DPRB 4X6QB 3ZYIB 1PIV2 4HPKB 2B42B 3QH6A 2P17A 3DGTA 1GV9A 2BVBA 2Z69A 2NPIA 1PVXA 1AR72 4FP2A 1Y9QA 1PGL2 3VDDA 3TOJA 4A3XA 3DL3A 4LBMA 3VUOA 4P9IA 1LULA 5FO8B 3RI9A 1FT9A 1ZNPA 5ABJC 1YRZA 3CF6E