4KWJA

Resting state of rat cysteine dioxygenase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Mechanistic implications of persulfenate and persulfide binding in the active site of cysteine dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 58
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4kwjA00
4JVAA 3ST7A 2QNKA 2IXLA 4I3PA 5I0RA 2EVXA 4KU7A 2GC1A 2PAEA 1CAWB 1ZZBA 2XKPA 1J58A 3ES4A 3RZZA 4PIZA 4QM8A 4EROA 1FI2A 1O5UA 2F4PA 3PVBB 1J3PA 3D0JA 4QGMA 1NYWA 4ONUA 5I8SA 3D82A 3E5UA 3GYDA 3H8UA 3LOIA 4IEZA 3VHRA 4QGLA 4WVZA 3RYPA 4MGYE 2IXJA 1O3RA 5KHGA 1EYBA 3KSCA 5JR7B 3S0MA 4F7ZA 4MZUA 1NZCA 1ZX5A 2N7GA 4XFBA 2CAUA 2GU9A 3FX3A 2OZ6A 3RNSA 1L3JA 1O4TA 2IXHA 3NSTA 2IXIA 5KHIA 2QCSB 4KWJA 4XF4A 4EWAA 4RD7A 3KCCA 4OLLA 5JCTA 5KHHA 3SXWA 4PJYA 2XLGA 2O1QA 1O3TA 4BH9A 2BNMA 1VJ2A 3U0ZA 3HQXA 4KU8A 5JAXA 4LA3A 5KHKA 3S7EA 3H1YA 3H3UA 4I02A 3OGJA 4UXAA 3RYKA 3ACLA 5FCCA 4UBHA 4ZU5A 1OI6A 3UKNA 3I59B 1I6XA 1ZZ9A 5I91A 3H3ZA 3TNQA 2XL7A 2PA7A 1H1MA 3IBMA 4QMAA 4L2NA 2D93A 3EJKA 1ZRRA 4LLOA 1ZRFA 4Q0QA 4LUMA 2GAUA 1RTVA 5CU1A 2PAKA 4HVRA 3SCHA 1NE4A 3BB6A 1OD5A 1CAXB 2ZCWA 5C6CA 4IESA 4R52A 5CADA 5I93A 1RC6A 2XKOA 2XL9A 5FLJA 2XGXA 3H9AA 2VQAA 3FJSA 4XFIA 3MZHA 1UIJA 1RL3A 1YFWA 4HBNA 4Q0SA 4L11A 4XFAA 4QX5A 1OFNA 2VPVA 4IEPA 4R8HA 2Z69A 4E2QA 2EA7A 3OCPA 1EY2A 5FLHA 2Q4SA 5E16A 3SMHA 2OA2A 5EFUA 3H50A 2UY8A 4O9GA 1O3SA 4HMZA 4F8AA 1J1LA 3KGLA 4XFGA 5I0UA 3ELNA 2VECA 3E6DA 2WC2A 1WGPA 3IDCB 4JTOA 2XLFA 1Y3TA 1G6NA 3M3IA 2UY9A 4JV4A 1DZRA 1CAUA 3OF1A 2CGPA 3NW4A 1YUDA 4LEJA 1SEFA 2PYTA 1XE7A 1O7FA 3EBRA 5I0TA 4HN1A 2IXKA 4H7LA 4HLTA 3JZVA 4AQ6A 3HT2A 1UW8A 4PIXA 2B9UA 2ET1A 4LTAA 2WFPA 2KXLA 3RYRA 4AXOA 3KGZA 3O14A 3NL1A 2GC2A 4META 3UKTA 3CF6E 3PLQA 3FFQA 4A2UA 4AVCA 1YHFA 3RPQA 1LRHA 3DV8A 5BY5A 1RUNA 1UD1A 1Y9QA 4I0AA 1WA4A 4HZFA 3HIFA 4KWKA 2D5HA 4Z82A 3WW4A 3ETQA 4IEXA 1GQHA 2PHDA 5J7MA 2FMYA 5JSOA 2PHLA 1UIKA 3I7DA 5LEJA 4Q29A 3PNAA 1J3RA 3B02A 3BALA 5FQ0B 1CX4A 4YSFA 1XRUA 4ORFA 2QDRA 3E5QA 2Q0AA 5I8TA 1PM7A 4KL1A 4FBFA 1DGRA 5AVPA 5HI0A 2OPKA 2E9QA 4IEUA 5JSPA 1FXZA 1UCXA 4Q0PA 4YRDA 3DL3A 3IIAA 4XFCA 3DKWA 1LKNA 3E6CC 2Q1ZB 4MGIE 5FPZA 3BU7A 4OFGA 2QJVA 2IC1A 4XF9A 1ZZ6A 4AVBA 1O5LA 1I5ZA 4XEZA 4YNIA 3WW1A 5I0SA 4MX3A 1QWRA 4N9HA 3HT1A 2B8MA 3E5XA 4HVQA 3EHKA 4X6QB 3U11A 4LA2A 2D40A 4I01A 3FHIB 4XFHA 4BYYA 4I2OA 1NXMA 2I45A 3L2HA 4Q0UA 3LAGA 1J3QA 5JSRA 1CAVA 4JTNA 2UYAA 3BPZA 1ZREA 4KWLA 4MUVA 4WZCA 4MV2A 5KBFA 2K0GA 5F1RA 3USSA 4EV0A 1Q3EA 4IEQA 4IEOA 5C8WA 3I54A 2BNNA 4Z07A 4D7TA 2H6BA 4X6RB 2D5FA 3QOPA 4LUKA 3MDPA 3RDIA 3NKTA 2EAAA 3LZZA 3UKVA 4IEWA 1CGPA 4Q0VA 4B29A 1RUOA 4XFFA 4I0BA 4WBBA 2Y0OA 2GC0A 2H0VA 1ZRCA 3BCWA 5K8SA 2K9ZA 3U10A 3KMHA 1ZNPA 2ETEA 1Q5OA 4DINB 2B5HA 3EQEA 4QGNA 5D1IA 5EZWA 1TQ5A 3CO2A 5FLIA 1ZZ8A 4FAGA 5J3UA 3NJZA 4P9GA 3OTFA 4EWDA 4QM9A 3OD0A 3MPBA 4GULA 1VP6A 4UBGA 4EWEA 4E2SA 1LR5A 3CJXA 1CAXA 1IPKA 4O9EA 2HJIA 4ZU7A 3H1MA 4TLFA 1J59A 2IXCA 1XE8A 4N9IA 1JUHA 1QY4A 2V09A 4J1XA 1X82A 5BPXA 1OMIA 3CLPA 4YARA 1H1IA 4MGZE 5FPXA 2CAVA 3DN7A 2CV6A 1WLTA 3NVCA 1LB2A 3LA2A 4AQ2A 4CYDA 1ZZ7A 1X8EA 3LA7A 2XLAA 3GBFA 2BNOA 4D7SA 1YLLA 3S7IA 3FE5A 1V70A 3IDBB 1O3QA 1X7NA 2Q30A 3SHRA 3G7DA 1IPJA 4HSJA 4IEVA 4AVAA 1YFYA 4YYOA 2UYBA 1CAVB 4XF1A 2OZJA 2HKXA 4PIYA 4LULA 1X8MA 4I09A 5CVRA 2C0ZA 1CAWA 4HSLA 4HN0A 1VR3A 3E97A 3C3VA 2GZWA 4ZU4A 5BUVA 4IEYA 2XHKA 3D0SA 3WW2A 5I8YA 3ZDSA 1ZVFA 4J1WA 2GH2A 3H1WA 4NVPA 2PTMA 5BXXA 1CAUB 2OYZA 2ET7A 1YFUA 1ZRDA 1EPZA 2MHFA 5J48A 2Z2SB 1FT9A 3WW3A 1HW5A 4QXKA 3E6BA 5BV6A 1U12A 4XF3A 1SQ4A 2ATFA 2O8QA 4HVOA 2GC3A 5FDBA 3SCGA 2DCTA 3FZ3A 1YFXA 2PFWA 3N4MA 2QVSB 4XETA 3LA3A 3LWCA 1ZZCA 3CL1A 1EP0A 4FT8A 3QACA 2BYVE 4MGKE 5FQ0A 4XF0A 1DZTA 5LRRA 1DGWA 4E2GA 1RGSA 2PAMA 3H7YA 2PQQA 1PMIA 3EO6A 3SCFA 3TNPB 3CEWA 2FQPA 4FAHA 1QXJA 3IWZA 3R6SA 1YWKA 3ROUA 5LRSA 2MNGA 2BEOA 2BGCA 4IERA 3MYXA 4BHPA 5LEKA 2ZKLA 5E1RA 2H6CA 1NE6A 4IETA 3M70A 3FWEA 2MPFA 1GQGA 1QXRA 3I59A 4MH0E 1UPIA 5KHJA 4BIFA 5T3NA 4K8FA 2P17A 1SFNA 1Q43A 3ES1A 3H7JA
chains in the Genus database with same CATH superfamily
4JVAA 1KRIA 1U0AA 2QQVA 5C4WC 3O1RA 4O61A 2WNUB 1KS4A 5K0UC 2EVXA 2BVBA 3BUCA 1HB1A 2QQIA 2OXBA 2PHRA 4KU7A 1V6OA 1GICA 3FL7A 1UO9A 2A3XA 1HX6A 4GQ7A 3WF4A 1OA3A 3A21A 2VTFA 5A70A 5K9YA 1S4CA 3B69A 3POSA 3ZFEC 2LUWA 4OUSA 5A7QA 3WOGA 1O5UA 1K5JA 3WD5A 1YYNA 3D8CA 1NCQB 4CXYA 3D0JA 1HQWA 4E4SA 2VZOA 4ONUA 5I8SA 3D82A 2MEV1 3FN9A 4CU9A 2JX9A 1CIWA 2VUCA 2W47A 5HV4A 3T2TA 4XXPA 1ALYA 3THCA 5A7WA 2ZGNA 4K8RB 4WVZA 1PGW1 3RYPA 1SZBA 1S0EA 5A3UA 3BVCA 4FOVA 2PLV3 4BOWA 4EN9B 5KHGA 2FBEA 2XR4A 3C7EA 4Y20B 2WS91 2WYFA 2X8KA 5FY7A 4YVSA 5FZ9A 5JR7B 4CSWA 1GNYA 3FBMA 2BV4A 2QZ2A 3FHAA 3NV4A 4UT5A 1NZCA 2C26A 5FY5A 3ZSEA 4DEVA 2QZ3A 5LZ6A 3AYDA 1JZ5A 4FPLA 1WMXA 4GKYA 1QOTA 1S0DA 2OZ6A 3UJQA 3NSTA 2IXIA 3HEIA 4AHYA 5JVVA 2W1WA 4XF4A 3H8RA 5KHHA 2J7MA 3EMRA 5E8AA 1KJLA 3SXWA 2R043 4ES8A 2BVVA 3H8XA 4AFAA 4RGAA 1QXPA 4PJYA 2XLGA 2O1QA 1AYM3 2Y33A 3AZVA 3GM8A 4AEMA 4BH9A 5BNOA 1VBC3 3OPZA 3HQXA 2XHNA 4GWMA 5FKCA 3ZOIA 3UESA 5AC91 1DIWA 1VBD3 5F5QA 5KHKA 5EWSA 5JOYA 1LOEA 5B2GB 3H3UA 2AREA 3MW2A 3OGJA 3R05A 1WLWA 5K7PA 1ULPA 3SH4A 5FCCA 2JDMA 1IZ3A 4AQSA 3I2JA 4FPEA 1JYWA 5FZKA 4NPRA 3ZIWA 5C3QA 5JPMB 2VH9A 4D0QA 4FPFA 1VB2A 1OLMA 2OIIA 3WF3A 3VBFB 3ZYRA 5F7UA 3I3BA 3FMGA 4CXXA 3THDA 2DVDA 2JD9A 2C6SA 2YDEA 4R9CA 4BA6A 2D7FA 5LA9A 1HXS3 2ZGRA 2CDPA 4RFRB 4LLOA 1BBT1 4IV3B 5FZ7A 3IPVB 1QJY3 4C0HA 5IYYA 2DUOA 2ZPXA 3G6JB 5CU1A 4P5HA 1XSRA 4UFHA 3GZEA 4IV1B 1JZ7A 1NE4A 3BB6A 1OD5A 5LBCA 3VBHC 5E6HA 4MO3M 4EN8B 1RUD2 5ABJA 1PMJX 4CEWC 2Y34A 5F2SA 5CADA 1FV3A 2BQPA 2GSYA 3CZJA 2RG4A 3MLJA 4W6WA 2XBO2 2RR13 2X5IB 2XGXA 1CR7A 3VBUA 5C5TA 2VQAA 2P3KA 3T1MA 3MZHA 1RUH3 1MS3A 5FYSA 5JZGB 1LU2A 4CE8A 1A8MA 2E7QA 4FFFA 4QX5A 2RS13 4X8NA 5FZCA 2ZHKA 4IEPA 4R8HA 4MHRA 3O0VA 4KGGA 3VHNA 3WP6A 3ZN6A 1IPSA 1PK6B 1W28A 2PQSA 2Z4FA 1W39A 4GJZA 4L8QA 2CL2A 1HQNA 1R081 1WA6X 1LGCA 1AYN3 3JQXA 4QX7A 2WSUA 3LQCA 4LE3A 5IVYA 3UL2A 4O9GA 4QPIA 2C5DA 2XJTA 4LBKA 4NHYA 4PQQA 5I0UA 2NQYA 3ZSMA 4BLIA 3ZFFB 4GH4A 2VECA 4P9LA 2JG8B 2V5YA 2WC2A 2JDNA 2ZEYA 3HNYM 3I3EA 4JTOA 2XLFA 1Y3TA 4QHBA 4QAWA 1G6NA 3M3IA 5C9AB 1AR93 4N7UA 3KCYA 3VHPA 5FZ1A 1RUC2 1IGOA 5FJHA 3D4KA 2WABA 4XUTA 3EBRA 5I0TA 1CZTA 4Q4V3 5EXOA 4KGQA 2Z42A 2ZA9A 4HN1A 2XUMA 1ZYBA 3ZPOA 1MEC3 4LHLA 3I3DA 3LSDA 2UWCA 4RL7A 3T3YA 2DVGA 1LOFA 2JDUA 5C8CA 2FCTA 2RM23 4IE6A 3WG3A 1OSGA 4RN5A 1S0JA 4CRQA 2GNMA 1PO23 3A23A 2ZZQA 4QDRA 3VBUC 1DGWX 5DXDA 1DHKB 2WZEA 4W50A 2ZS6B 1Q56A 5DDJ3 3TEYA 4TTGA 2GC2A 5FYMA 3WDYA 4META 1AR82 4QD2A 4A7KA 1MS8A 2BFUL 4CUBA 1F4AA 3R4UA 2ZACA 1YHFA 1FMD3 3IIIA 3B7MA 3TWIA 5JDBA 2OQ7A 1OQDA 3LIHA 2W1QA 3ZMOA 1RUG3 4PBOA 1QMJA 1SBFA 3WP5A 1TME2 1RUF1 1XNAA 3I2IA 4Z82A 4GH4C 4D6QA 2ZABA 4L97A 2PHDA 3WINE 1ZRIA 3VKLA 5J7MA 5ACA2 5JIUA 3C7FA 2VVFA 2RS32 3ILRA 1J3RA 3LEMA 5BYNA 1G9DA 1AJOA 3SC7X 3JCIA 4J25A 3LPFA 2CSGA 3ZFEB 2D98A 2BBVA 4HONA 2XJPA 1DQ1A 5DG2A 4H3WA 2QQKA 2ZGLA 5ERLA 4EE2A 4ASMB 1G9BA 3Q9OA 3KQRA 4ORFA 4CP9B 1LOFC 1EAH1 4OUEA 4AW7A 1ASJ3 5J37A 1VMJA 3AMQA 2PHTA 3OD4A 4YVWA 2XG3A 4KL1A 1CD3G 1HDKA 4FBFA 2R6QA 1A3KA 5DAXA 4RS5C 3JBG2 1SLBA 1QIQA 1ND3C 1IG0A 4N43B 4Q0PA 1ND2C 1GSLA 5LCWL 3ASIA 4UYBA 2YFUA 2XONA 3X29B 5IVCA 5FKBA 4HPKB 4JRLA 3NV1A 5A3MA 3DKWA 1LKNA 2Q1ZB 4FTBA 4GWIA 1UY4A 3MIFA 4HL0A 3BU7A 5FPZA 3RZKA 2ZGMA 3T0AA 3FC0A 5FZAA 1W3XA 2Z5WA 2HWD2 3K3NA 4XF9A 1GV9A 3ORJA 4A3ZA 4D94A 1YQ2A 3PUHA 4RFT0 4JQRA 1ULEA 2QQJA 2VQ0A 1VALA 3RGBA 3POEA 3WW1A 4CDUC 1LAJA 4FP2A 4N9HA 3N9QA 1DQ0A 4MHUA 4KG8A 4LBQD 1CESA 1D4M3 5FZIA 3M1HA 5FYCA 3FFZA 4QU1A 5DAPA 3VDDC 4AGVA 1JXNA 1PO11 3H3LA 4LA2A 1UMHA 4TWTA 4YM2A 1W8OA 3H8OA 2D40A 1L7LA 1X33A 2JKBA 2VR4A 3RFRA 1D2SA 2ARAA 5FP9A 4BYYA 3CMGA 1NXMA 4F83A 1RJ7A 1CPMA 2QFEA 4RQPA 4M4PA 4XUQA 1J3QA 4CCKA 2VJXA 4JTNA 2UYAA 4WM8C 5L7OC 5LK7B 2VCAA 1ZREA 4OHYA 1HRI2 1R091 3K77A 4DOUA 1VB4A 2TNFA 1D2QA 4XHXA 5A7WB 1ZBA2 1CX1A 1RUI2 2VMFA 3FHQA 1PVC2 3USSA 4EV0A 1BZWA 5F39A 3M3CA 4Y22A 2OW4A 1UKGA 5F3GA 2GDFA 1WCKA 4IEOA 4Y3OA 2Y60A 1EV11 5A1AA 2H6BA 3NNMA 1AL22 1NA1A 3CHXA 5FYYA 4FTEA 3B93A 1TME1 3OEBA 1LOGA 2D5FA 3QOPA 4LUKA 4TYSA 4XDQA 4JKLA 3RDIA 2A1XA 2WQ8A 3UKVA 4PBPA 2XVKA 2GMEA 5FZMA 3CIHA 3MF6A 2XH6A 4C0BA 1CGPA 1FAYA 4Q0VA 1GWMA 4QDQA 3TN93 3WUCA 4B1LA 5ACA1 4WBBA 1ACCA 2RS31 1HRV3 1TNFA 3CKHA 1LEMA 2H0VA 3CDZB 2RMU2 3O5SA 1NZIA 1AVBA 2A6WA 4YW1A 2FHRA 3POYA 1COV1 1ZNPA 1DBNA 3OYWB 1Q5OA 5LBBA 4DXSA 4DINB 1BHGA 2FDKA 2CHHA 2JIJA 5BNOB 1WW6A 2R30A 1UL9A 1ONAA 4XILA 1W2TA 1W9FA 5J3UA 2ARCA 3VHOA 1XE0A 4EWDA 2R073 3HBKA 2W95A 2WZR2 3OBZA 3OD0A 4EWEA 4BXSV 4XHBA 4O9EA 2ZX3A 5H9PA 3CZUA 2H0BA 2B7YA 5KXBA 3WF0A 1RUE3 1WCDJ 3HMYA 1VMHA 2IXCA 2ZOEB 4EN7B 4ARXA 1O8SA 2Q8DA 3V0AB 3S5QA 2AENA 1QY4A 2V09A 2YC4A 2ZGOA 5BNPC 4Q4W2 1POV3 1H1IA 5CG9A 1K45A 1L7RA 3KM5A 5AFEA 4EN0A 2BOIA 5FPBA 2LS6A 2ENRA 1WLTA 2PMWB 3NVCA 4AQ2A 4JHTA 1B35A 4ZXKA 1DFQA 1ULOA 1W6QB 3N7LA 1E5SA 1OOPA 2XJVA 3AXDA 3IDEA 5GJ6A 3VB9A 1BLZA 5IK8A 1BEV2 2CU5A 1QJFA 4QWNA 4D7SA 1Z7S3 4JDOA 2YROA 1AHSA 1ODMA 1QNWA 2WT0A 5BNNC 5ABJB 1WCSA 4QHOA 3K2OA 4YM3A 1O3QA 2Q30A 1AR72 4EN6B 2VTXA 3RJ2X 2WFF2 3I4IA 3G7DA 1IPJA 4LO8A 4CU7A 2VW1A 4HSJA 5JIAA 3VBUB 5JR2A 2HWB2 5FUPA 2HYKA 4AVAA 4BMEA 3VZKA 1YFYA 1MZ5A 3VDBA 1LTEA 1SCSA 1VBE3 1CAVB 1TMF1 1X9TA 1YO8A 4QU2A 4HT1T 1BK1A 2WNUA 3J7MA 3ZN6B 1H1AA 4KNCA 3W5NA 1DQ5A 2NYYA 1ZBA1 5F2WA 2W08A 1FX5A 1SLAA 2DDUA 2E51A 2JB4A 4XTMA 3WP4A 2VOXA 2OVUA 2WQ4A 4HKOA 4P02B 4AEDC 3RMXA 2P34A 4ET7A 3KWVA 4HN0A 5FZHA 4QPIB 1LEDA 4Q4X3 4XURA 3O0WA 5A7NA 4CCEA 2GP5A 2YC0A 3HPNA 1N3QA 3ACHA 1SCRA 2ZEZA 4GH4B 3EYPA 4QPGC 1NCQA 1C8NA 5F32A 5DZFA 3SH5A 4JZRA 5FV3A 2PXJA 2GH2A 5BXXA 2PTMA 4A3XA 2W46A 4CPBD 2B39A 4JGYC 5C33A 3JD73 2MHFA 2VMHA 2NM1A 1OOPC 3N7KA 3ZX7A 1AXZA 4QXBA 3IAQA 4X8PA 2D6MA 1C3HA 2G4IA 4LITA 1U12A 4PQ9A 5EIYB 3DECA 3U4XA 2JDHA 4AI9A 1QJU3 1WUVA 4LPLA 1DYOA 2JKXA 1HKDA 2DCTA 5J98B 1NLRA 1S0CA 3GGLA 3N4MA 2QVSB 4C90A 1ZZCA 3CL1A 1IOAA 3PUIA 1G9FA 1UZWA 3QH7A 4FT8A 1ND3B 1W0OA 3ZM8A 4E4HA 1I1EA 2HWC3 2PHFA 1H30A 3AP4A 2QTWB 5CNAA 1F35A 1K5MC 1UYZA 3KHBA 4E8CA 3I97A 2VBBA 4XTPA 5F3EA 1C8M3 4E2GA 1RUJ1 4Q4W1 4LNVA 2PAMA 5A3TA 4BLJA 1PMIA 4W6YA 1OD3A 2OPWA 3SCFA 4FAHA 3CEWA 3U07A 4Y5SA 1YWKA 4CDUB 5LRSA 1D0GA 2DUQA 4UW5A 2KD7A 2JDPA 1KS5A 1WWYA 4M0HA 4NWVA 3VDAA 2BEOA 2BGCA 4KH9A 2O0OA 2RDRA 3MYXA 5FOJB 2A6ZA 2EXKA 1UN1A 2W68A 1QGLA 3C7GA 3RZJA 2HLEA 4Z92B 1OLRA 2MPFA 1GQGA 2V4AA 4MH0E 5M0TA 3OOXA 5E89A 5JXJA 4DZGA 5FAXA 4H2AA 1GZ9A 1HB2A 3ZSKA 1K12A 2HWB1 5FP8A 4BIFA 5T3NA 4CDXA 3GJBA 1EUTA 2QE3A 2YU1A 3ES1A 3FLTA 4WM8B 5FYUA 1FV2A 4IV3A 1TNRA 2VXJA 3IPVA 5FMDA 2A71A 2YBSA 3O1TA 2FCUA 3T1LA 4IV1A 4LBQB 4LLFA 2PLV2 2GC1A 1FPN3 4LOSA 3N3HA 1JYXA 3ZIXA 5F37A 1BVP1 4XCBA 5D2AA 3ES4A 3MHZA 2X5IA 2WNEA 3RZZA 1DU3D 4EROA 4R9DA 1JYTA 4AHZA 2QQNA 2BOJA 1J3PA 1G7YA 3AB0A 4AG4A 4E9KA 5IJRA 5J36A 3TEXA 1RHI1 2NMOA 1UYPA 1H6XA 1NYWA 4CCNA 2I2SA 1IS5A 1RMU3 5FMOL 5GZFA 2P3IA 4C8DA 1VBB1 3LOIA 1PGSA 2IVIB 4FPOB 2HYXA 4YLZA 2JD4A 1POV0 4K7JA 3MGUA 1AXYA 4YPJA 2IXJA 3M3QA 4UFJA 3QLQA 1E5HA 1KJRA 2R042 4TLGA 3B3QE 4XUOA 2D6LX 3TAYA 4PDWA 2WNVC 3ZXDA 3LD8A 3VGIA 4CDWC 1REFA 1AYM2 3KB5A 1EYBA 4BB3A 1VBC2 3ZFFA 2WN2A 2JG8A 1HN0A 3JU9A 3I49A 1ZBE3 2VC9A 1VBD2 3RG0A 4PHZA 4XJ8A 1XNKA 4QHZA 5FK8A 3UETA 1XYNA 2ZX1A 4OI0A 1BQPA 1JU4A 3TOJA 1OLQA 1O4TA 2Y6KA 2YGMA 4QQOA 2ZX0A 4JDMA 1MS1A 1PHMA 5L9BA 2A5ZA 3MI8A 2QCSB 4KWJA 3IZOA 4EWAA 2CY6A 3J8F1 3LE0A 1NCRA 4NMIA 4Y22B 5H9QA 1ENXA 4LKFA 4E8DA 1PM4A 5J96B 2A75A 1RVF3 1O3TA 5FWEA 1NA1B 1OA2A 2BNMA 4ZS3A 3U0ZA 3N36A 1HXS2 5GLTA 3N9LA 4KU8A 5JUVA 4EJRA 5JAXA 1G9CA 4Y24A 5FXXA 1QJY2 2HWE1 2E63A 4P5YA 3S7EA 1VBA1 3VL9A 1M06G 4I02A 3A22A 4NE9A 2VL4A 2ZGTA 4OHVA 4YZ5A 3PVOA 4MSVA 3AP9A 2DV9A 5JI7A 2OKXA 1DGRN 1JOJA 1UY3A 1HN1A 1JW6A 1N3PA 4LKEA 5FZ3A 3SEPA 2GMMA 4Y1XA 2R7EB 2RR12 4XE9A 5GLUA 5BNQA 3H3ZA 5FYIA 3TNQA 1RUH2 2XL7A 1SBEA 3WHTA 3HN3A 3WY6A 3PDQA 1W6OA 2Q1MA 3U75A 1XXNA 4FP3A 3WDTA 2RS12 5A33B 4H14A 5C4WA 3WG4A 4WM7C 5K0UA 4MGSA 3DEMA 5DN2A 1SACA 4U2AA 1Q8SA 5CA6A 2PAKA 4WV8A 4AEDB 3SKVA 2PLV1 1AYN2 1ENRA 1R1A3 1WMDA 1P8JA 1UXXX 1U5IA 1JYNA 1GOHA 4R52A 1JODA 4RSUA 1CWPA 1H8VA 4KBBA 1OPOA 3T2PA 3VZJA 1RC6A 2XKOA 2XL9A 2XUEA 1WD4A 3AKSA 4LK7A 5FLJA 4LR4A 1N1VA 4CP9A 5A1LA 5IFPA 4DIQA 1AR92 1CONA 2FDFA 2K2SA 2J1AA 3IMMA 2AH2A 4JGYB 4HOOA 4XACA 1B35B 3OCPA 2JWPA 4M3CF 3RQ0A 1MQTC 1OOPB 1EY2A 3MBWA 4Q4V2 5FLHA 5T5LA 2Q4SA 1H4HA 1N1SA 1MEC2 5E16A 1MR5A 2YG0A 4QQ2A 5FUNA 1OHFA 4HPKA 4NPLA 1Y7BA 2UY8A 2RM22 4HMZA 3AK0A 5DZGA 2EICA 2R0HA 1XU1A 3KGLA 3R4DB 2R061 1PO22 1S0GA 4LJHA 4BQ3A 1DF0A 5A3OA 2KR2A 5IFTA 1PMHX 4YW4A 4AHWA 1WGPA 5FO7B 1ULGA 3IDCB 5GLWA 5DDJ2 3NRUA 1UPSA 2B42B 3SKJE 1S0BA 2ADEA 2UY9A 3CNAA 3F2ZA 3GBGA 3GNEA 1BXHA 1CAUA 3KLSA 3OF1A 4JV4A 1JS9A 3NW4A 5FZGA 1SEFA 2R1DA 1IQAA 1PGL2 5T5JA 1FMD2 1ULDA 1HB4A 3UGHA 3AZXA 4DY5A 1GWKA 2VVDA 4IXLA 4LBMA 2VZ3A 4NRPA 4YW3A 2B9UA 2ET1A 3EXUA 1RUG2 3OBTA 4LTAA 3PVNA 2VD7A 1DLCA 5CAZA 4QKFA 4GD4A 1M4WA 1HXS1 1VRH3 4W65A 1QEXA 5A7SA 3KGZA 2DCYA 4FPJA 3VBSC 2FZ1A 4AXOA 1QJY1 4RHV1 4WVWA 4GAZA 4BQWA 4CXWA 3B9CA 5JXGA 1SFPA 2CDOA 4B8EA 4Y5Z0 2VO5A 3CF6E 2JDYA 3FFQA 1W99A 2Q8EA 4AVCA 5FPUA 1YJLA 1W8HA 3HQUA 2IZWA 2RE9A 2RR11 3KV5A 2WWSA 3SNMA 4COUA 1MPXA 1XC6A 3GXUA 4AL9A 1LRHA 4WVVA 5EV7A 5BY5A 1RUNA 3K75B 2LM3A 1ASJ2 1KITA 3HIFA 5GLZA 3POGA 3O0XA 4ES9A 1W8NA 2HH9A 1GQHA 1YC61 3KV6A 2IUWA 3IKWA 3VBHA 5JSOA 3H0OA 2EIBA 1KD7A 1UIKA 3IB3A 4M4RA 4AE2A 1I3HA 1N3OA 4CEWA 1DG6A 2JIGA 3M8LA 2D3PA 1N47A 1JTZX 4XJ9A 4FOQA 3LKJA 1XRUA 4UWDA 1TVGA 3OBRA 3OB8A 2XOMA 3OYWA 4ISRA 4OMCA 4XABA 3K51A 2J1SA 1JBCA 4ATEA 5FXWA 1LGBA 2NPIA 3PJQA 1LECA 3GDBA 4O65A 2GNTA 5FZBA 4XBLA 1JZ4A 3BTAA 1KGYA 3E5QA 4EZ4A 2Q0AA 1W2NA 3HWJA 2ES3A 2VGDA 4YZ4A 4GB33 3W9AA 1MZFA 1U5ZA 1DGRA 1UMZA 5AVPA 4NIDA 4OULA 3APBA 1FATA 3VUOA 1D4M2 3I2GA 2E9QA 1CJDA 3AP6A 3ZDVA 4CDWB 5E88A 1UCXA 1O59A 1YCIA 3V0AA 3DL3A 3WLUA 2RM21 3U1XA 4A45A 3A7QA 2EXHA 4MGIE 2NZ9A 4QB2A 4AF9A 1LB2A 3CJIA 4BQXA 3NMBA 4B7KA 4CDXB 3NJVA 5DDJ1 4CEYC 5H9RA 2CGOA 5C3OA 5T54A 5FYZA 1ZZ6A 1XU2A 4AZZA 3VD9A 2QQPA 1W6QA 5FZOA 2WQZC 3B01A 1HQLA 5LATA 1QWRA 1W8UA 1PZ8A 2C9KA 3OPWA 5D8AC 3S30A 5IK5A 3HT1A 1FMD1 4AFMA 2B8MA 1F15A 3E5XA 1I9RA 2Y6JA 4QQLA 2FDIA 1AR63 3LFMA 3EHKA 1ENSA 4X6QB 3U11A 2LTNA 2YFZA 2WSVA 2VOVA 4BIOA 3THTA 2ZAAA 3Q8EA 4I2OA 5FBZA 5FP7A 2Y26A 3ATGA 3RZHA 1TZOA 2EF6A 2VMEA 5JSRA 1CAVA 3TN92 5DABA 4BK5A 4JKMA 4XMAA 1FNZA 1HRV2 4MUVA 3GCWA 1AXKA 3VN4A 2QQUA 2MEV3 4Q4Y3 3USUB 1J1TA 5DUXA 5JMOA 4MGTA 4QX2A 4R4ZA 5F1RA 3NNFA 1OLME 4LKDA 1Q3EA 1S2EA 1RITA 4PDWB 2LW8A 1W6PB 2VQUA 1WD3A 3NNGA 2G9GA 4XUPA 4LK6A 3OGGA 5FZ4A 4D7TA 3MIEA 4X6RB 2WS93 3TYJA 5CFDC 3TB0A 3MDPA 1RYYA 4KI5M 2EAAA 2R072 1L7QA 5IVBA 1UXZA 3CJIC 1UOBA 2ZHLA 4B29A 4URAA 4GJYA 4IW3A 3GHNA 2Y0OA 1RUE2 2GC0A 4Q8LA 1QQP3 1ZRCA 2XVGA 3PTYA 4J6GA 5GZDA 1NCRB 2Y38A 4KQ7A 5IT6A 3BYWA 5K8SA 3SH3A 2YBPA 1NAEA 3BGAA 3BODA 3WR0A 3KMHA 2ETEA 3W5MA 2DUPA 3KVBA 4BM8A 3N7MA 2B5HA 5D1IA 4FPHA 3HR9A 5EZWA 1H9PA 1E5IA 2A3WA 4I3GA 3POIA 3V56A 4FAGA 4KG0A 4RS5A 2VG9A 3NJZA 2ADDA 1B09A 4GALA 1SBDA 4QM9A 1BVVA 5A3PA 5AC93 1UX6A 1ND3A 3DYMA 5EYYA 1ND2A 1VMFA 1Z7S2 1CAXA 5IK4A 2HJIA 4UI9L 4ZU7A 3KV4A 3BI3A 2YXSA 4TLFA 4YW6A 1J59A 2D6PA 2W52A 4MYEA 4LQRA 1XE8A 5FYVA 4IGQA 4A4AA 1NT0A 2FD8A 1H6YA 4OI1A 3ZKUA 2R0FA 3CLPA 4AI0A 4Y1VA 1E5RA 1NQJA 4YARA 2VZUA 5FPXA 3QH6A 1W6OB 1EPWA 1VBE2 5FYTA 5LY1A 2DU1A 4CDUA 2FMDA 5C4WB 4LORA 5FR3A 5K0UB 4NHKA 2QQWA 4D7YA 1X8EA 3LA7A 1BBT3 2A70A 3CBNA 5LB6A 1G86A 3GBFA 3U4SA 3VDDA 2BNOA 4CA9A 2YPJA 1RUD1 3JUUA 3M7AA 4YW7A 3ZR6A 1JYIA 1D7PM 1UNBA 3FE5A 3LIGA 4FQ4A 4OI2A 5LA2A 4AQTA 3IDBB 4QPWA 1Z78A 4Q4X2 3Q8CA 4XJZA 5F3IA 3LGRA 5F9TA 5IATA 3NV2A 1IKPA 1X7NA 5IK7A 2XBO1 3V64A 3O7OA 5GZCA 3PURA 2PN5A 4IEVA 4L92A 3SQOA 4WM8A 2CNAA 1OH3A 4NHXA 4BPZA 5L7OA 1J83A 4DXRA 3UNPA 3TN91 2UYBA 1Q8PA 4FFGA 2BW8A 2UWBA 2A7AA 4XF1A 1UU6A 2HKXA 1NQDA 3JD72 3AL6A 1NY72 1OKOA 2E7TA 4QX8A 4LBQA 3WNXA 5APAA 3DXUA 5FBJA 2VMGA 2C0ZA 3MIBA 2X29A 4OUMA 4K1ZA 3SISA 2VUDA 4C1WA 1R083 3WQ1A 3VBOA 4AI8A 1D4VB 3ZYJB 4YW2A 3I2DA 1QJU2 4V2VA 3DPRC 5FZEA 2W2IA 3OEAA 4CCDA 4H55A 4S2GA 4ZU4A 4ZXEA 5BUVA 4NROA 2XHKA 5F6KA 4AI2A 3D0SA 3WW2A 5I8YA 3ZXLA 2R071 4CDQC 2BFUS 3ZDSA 3UJOA 1CPNA 1XNBA 3CQOA 1S1AA 2P37A 3H1WA 3KT7A 4NVPA 2RJ2A 2WINB 1CAUB 2ET7A 2GALA 1RUC1 1TG7A 1W9SA 2HWC2 2LRPA 3HJRA 3P5BA 5KWRA 1JZ6A 3BKZA 4UOJA 5FTTC 5DUUA 2IFRA 3N9NA 1OUSA 4Z2WA 4LHSA 2A6VA 3WW3A 1HW5A 1C8M2 5DQ0A 1POV1 3E6BA 2A6XA 4XF3A 1XB9A 1SQ4A 1H2KA 2O8QA 5JOWA 4Q5OA 4YZ2A 2GC3A 1GZTA 2VNOA 3LF7A 5CBLA 1V6LA 3O1SA 3ITQA 4JHZA 4D3WA 3AFGA 1JHJA 5K4LA 4CCJA 2PFWA 3WDXA 4XETA 5C3PA 1NG0A 1GP5A 1EP0A 2XJQA 1AR81 4FPYA 2DU0A 1Z7S1 3LEGA 2DF7A 3AFKA 3QACA 2BYVE 3I2OA 4COZA 1BCXA 1GP6A 1DZTA 5BNPA 1YXWA 1JU3A 3VL8A 3VBRC 5IAXA 3MFAA 3Q8BA 1DGWA 1RGSA 1DYPA 2D43A 3VBOC 3H7YA 4QB1A 1CQ9A 1LHWA 1ZA7A 3EO6A 2D97A 2EIGA 4FPKA 2DBIA 1QXJA 2TUNA 3IWZA 4JCKA 4BISA 4FOYA 4NRMA 4Y5TA 4YG6A 4B4RA 4YGEA 4RGKA 1RUF3 4COWA 1A34A 1LESA 4M0NA 3VBHB 2E26A 2OX0A 3D3AA 2ZKLA 4ZPIA 5BNNA 5E1RA 2H6CA 1HB3A 1NE6A 4IETA 4OZOA 4CEWB 3ILNA 1KDMA 1FPN2 2RJLA 3M70A 1VE0A 3ENRA 5IVVA 3HBZA 2ZGKA 1DQ2A 2W1UA 3AYAA 4DS0A 5FPAA 3S57A 2DTWA 3J26N 5L73A 2J1VA 2FCVA 1SPPB 4FSJA 2RVAA 2YY1A 2ZHMA 4QPYA 1W04A 4LMFA 4AYUA 4JX0A 5AFBA 4GMP1 5A33A 4MLOA 1RMU2 2XPJA 2P17A 2VZ1A 4JGZC 3VD4A 1Q43A 4QKDA 1EAH3 3ST7A 2QNKA 1QKQA 3JD71 4AVSA 1NY71 4AEDA 5I0RA 3PUQA 4UFKA 4YGDA 2D3SA 3JBG1 5B4XA 1H8TC 4LKSA 3WUDA 3WNOA 4ZY9A 3ZFGC 1UOGA 3ZYIB 5A3NA 4LHNA 3K4AA 4IUGA 3J4UH 2PAEA 3TEWA 2OUJA 2B9VA 5FY9A 4DEQA 1CAWB 2BBAA 1ZZBA 1J58A 2WNOA 4QPGA 3T2QA 4DB5A 5CFDB 1UZ0A 1ZBE2 2SLIA 4QM8A 5FXVA 1FI2A 4UW3A 2WO2A 1F8VA 2AGSA 3CJIB 5CEHA 2HWD1 5FPLA 1URXA 1UYXA 1ULFA 2RDNA 3GYDA 4JGYA 3H8UA 5FZOB 3BN6A 4IEZA 3VHRA 4O7XA 5FZ8A 5CFDA 3RZMA 1SMVA 3JB8A 2XDVA 4MGYE 5IVEA 4OYUA 4HFSA 2D6OX 1LODA 3VZLA 1W0PA 1C8M1 1RVF2 3UGGA 1QJX3 4ISQA 5LA0A 3E1F1 4C91A 2ZMKA 3S0MA 1PO13 2X10A 3O1OA 4F7ZA 2O8OA 5CB7A 1ZX5A 2N7GA 2WWJA 1IG3A 1V6JA 2JICA 1JUIA 3GZUC 3TRSB 1W2UA 2GU9A 2V73A 1HRI1 3EB7A 4RR3C 1L3JA 2GMPA 4CPBA 5IVFA 5FRAA 4YW5A 2RDQA 1RUI1 3RWNA 1W9WA 1R093 1K5MA 1PVC1 3N35A 1CVNA 1A6CA 4RD7A 2SBAA 3RS6A 4OLLA 2W39A 1IS4A 4AVVA 2P5BA 2VOWA 1AL21 1EV13 1VJ2A 2YB7A 1GZCA 4RYDA 1FOD3 2HEYF 1N1YA 3H1YA 4GZ9A 4BJ0A 3PHMA 2VUAA 3AKTA 4UXAA 1T6BX 4V1PA 4B1MA 1R1A2 3ACLA 3FUOA 3AXEA 3MLLA 1UZZA 4NAOA 4UBHA 2RMU1 2V72A 2JDAA 3AC0A 3UKNA 4D6RA 3WXPA 2AEYA 2DCZA 2JE7A 1I6XA 5JXIA 3W21A 4MADA 3NV3A 2ZMLA 4UAPA 1LNSA 4YZ3A 1XSQA 1COV3 1H1MA 1H2NA 3IBMA 4Q27A 3I8TA 1JI6A 4TSVA 2HWF3 2ZGQA 2JECA 4QMAA 5L19A 3NQHA 2D93A 4SBVA 3N7JA 2TEPA 5GLVA 3EJKA 3PJYA 4GKXA 4RS5B 1ZRFA 4LIVA 3NKGA 1HJFA 4LUMA 2G19A 2WZR1 5LWBA 1RTVA 3OUJA 1ND2B 3JXSA 1W6NB 3OG2A 1CAXB 2ZCWA 5F5IA 4K9SA 5LK5A 5C6CA 2ORXA 1LCLA 4G3YC 4A41A 1LULA 5FY1A 5JLVA 1OT5A 1REDA 1ZBE1 4PI0A 5C3RA 4HK8A 4AI1A 2EAKA 1FNYA 1UIJA 4XFIA 5A6XA 1S55A 3ZYGA 2LALA 4HBNA 4Q0SA 4XFAA 1S2KA 1PX3A 2YUEA 4E2QA 1UF2C 4Y1ZA 1DLLA 2WAOA 1GLHA 3IM0A 1BEV1 3LDRA 3MIDA 2WNVA 3VDDB 1SDWA 4CDWA 1EUUA 2YPDA 2WBKA 3AZWA 3CU7A 4IDZA 3A4UA 5EQUA 4OZXA 5EFUA 3ZMNA 2PHWA 3NJYA 1O3SA 2WKKA 1AR71 1OVSA 2XWBB 2P6HA 2WFF1 1J1LA 2WR9A 3B9IA 5FP3A 1VRH2 2VW2A 3PVEA 5A32B 4AAPA 3E6DA 4N8MA 3ZLIA 2DCKA 2ZGUA 2VM9A 4B4QA 5L7OB 1VLNA 2WRAA 3NNJA 5A6QA 3DF0A 2A3YA 3FUQA 2NLRA 3AKQA 4S2FA 5SV8A 1DZRA 1V9U3 1XPWA 3ILFA 2CGPA 3WDVA 1TMF3 3AL5A 2DBNA 4LEJA 2C24A 1XE7A 1O7FA 3K3OA 3WQ0A 3UK9A 4UW4A 3OUHA 3VBRB 5KXDA 2IXKA 1QF3A 1XBFA 3JZVA 1UW8A 3HT2A 2ZEWA 3VBOB 3FBYA 4K21A 1W2OA 1VAVA 4N7IA 2GH8A 2WFPA 1LENA 2WL1A 2E6VA 2KXLA 4P9XA 3RYRA 4UFIA 3K48A 5CZKA 5FY0A 2BERA 3ECQA 2PHUA 4FFIA 4XYXA 3NL1A 3RJRA 5A6YA 1BMV2 2XQXA 1PNGA 3URFA 2VNRA 4S2HA 2Y6LA 2P2KA 3USUA 3UKTA 3ACIA 3PLQA 3U37A 1GNZA 2FDJA 2R16A 4FVVA 1SDDB 4A2UA 4CUAA 4LT5A 3K46A 2P4EA 1YEWA 3VD3A 3TBDA 1OXCA 1W6PA 2QQLA 3OUIA 4M3CA 2YU2A 3WG1A 3ME2A 3WQ7A 3ZXJA 4ZS2A 3ZSJA 4DY3A 2XXZA 4ZHNA 1UD1A 4WM7A 4I0AA 1WA4A 3SITA 2D5HA 1IHMA 3WW4A 4NWWA 2BGPA 2P3YA 4AR2A 4DQAA 4GB32 3MV11 1XYOA 1YI7A 1YIFA 4P9WA 1O4YA 4UF0A 2VULA 5AVAA 2Q1FA 3W58A 1H8TB 2FMYA 1WBFA 2PHLA 3AVSA 3PUAA 4LOTA 4MXWB 4XXAA 1UU4A 4Q29A 1YJKA 3PNAA 5LEJA 2R49A 2AACA 3KD4A 3P3PA 4LO6B 4YZ1A 3F95A 3W20A 2ORZA 4XZPA 5J1XA 3IAPA 2ILMA 4WVMA 3ZN5A 1SLLA 1OQ1A 5BNPB 4BE3A 1W8ZA 4P00B 3DGTA 3VBFC 1UYYA 3JQWA 1RUJ3 2E7AA 1W05A 1GZWB 1N1TA 2YZ4A 3BOPA 4BQ2A 1MQTA 3OY8A 5I8TA 4P9JA 2WZ8A 2HEVF 3OJBA 1NUKA 2P6CA 4XBQA 4Y1UA 4E27A 2OPKA 5BNNB 4IEUA 3HAGA 1O6UA 4AVTA 1YRZA 1AR62 2VW0A 1FXZA 4YRDA 3U14A 3WF1A 4CU8A 5C71A 4DRRA 1KFUL 3ZYBA 2RDSA 3OPTA 4XFCA 4URTA 2F4LA 3E6CC 1VRH1 3AJYA 5FMOS 4OFGA 3KF5A 3WNMA 5DUVA 3LDKA 1PNFA 1O5LA 3WCSA 4BQ5A 4XEZA 4YNIA 2MEV2 2VU9A 4Q4Y2 5FY8A 3T4HB 5JZGC 3BTXA 4MX3A 3LDBA 3VD5A 2A6YA 2DFCA 1PK6C 2NN8A 1C5HA 3OGSA 3BIEA 1MS0A 1GANA 5DZEA 5CISA 4GIQA 2WUHA 5KC5A 3VBSA 4CP1A 4I01A 4QPGB 1ZM1A 2WS92 2VUJA 2ZX2A 4XFHA 5FREA 1UMIA 3Q8FA 3C7HA 4Q0UA 1GNHA 1YQ5A 1BMV1 2Q8OA 1UKRA 3M4FA 2YMZA 3LSEA 2BWCA 1PVXA 1RHI3 3BPZA 4N90A 4LBLA 1NX9A 4KWLA 1J84A 2QUOA 4YM0A 4MV2A 3GZAA 2BWAA 1QQP2 4AI3A 1VBB3 2XJRA 5KBFA 5LASA 3Q8AA 1H2LA 1RIRA 1WZXA 2R041 4OMDA 4QXHA 4R9AA 2BUKA 3C8XA 4HKLA 2ZKNA 3O1MA 1XJAA 2WO1A 1AYM1 3INAA 4OQ9A 4U36A 5KC6A 1G9AA 1VBC1 1W6MB 4H7MA 4Z07A 3ZN4A 2ZEXA 1A78A 1IKQA 1VBD1 4ZKTB 4BWOA 1TE1B 1WMEA 3S6PA 4ZZ5A 4D69A 1UY1A 2UU8A 1F5FA 2V4VA 2VY0A 3LZZA 4GB31 4IL7A 1HJGA 4B7EA 5FO8B 4IEWA 1SG3A 3BU0A 1RUOA 4XFFA 1C28A 1UU5A 2LROA 4I0BA 2IWGB 1ZA4A 1MZ6A 1K5MB 2E32A 1JYCA 5EYXA 1UAIA 3MPPG 1NLQA 3J8F3 5J09A 5JXHA 1QH6A 3ZO0B 3ACFA 2JEMA 3MLKA 2ZZJA 3AZYA 3EQEA 3PTRB 4QGNA 1QH7A 2AZ5A 1TQ5A 2QBXA 3A0NA 3OSDA 4QB6A 5FLIA 1ZZ8A 2VZVA 2KM2A 2JDZA 1VAMA 1XNCA 2ZAHA 4Y33A 3PU3A 1BBT2 5GZGA 2VMIA 3C2UA 4P9IA 2HWE3 4SLIA 1VBA3 3MPBA 4UBGA 2WLPA 1LR5A 4LBNA 3MUZ1 4DRVA 1AR61 1AX2A 2OS2A 4DUWA 2E31A 2VAUA 5KR7A 4XOGA 1STMA 1Z0HA 4YG3A 1JUHA 1RUH1 2GNBA 4J1XA 1X82A 4CEYA 1CIYA 3MUY1 1X9PA 1LGNA 1QOOA 4QX0A 1WBLA 2RS11 1JZ8A 4PT6A 1SLIA 1WW5A 4NJ4A 2JXAA 1UQXA 3ZR5A 3DN7A 2WT2A 3BTZA 3LFIA 4Q4Y1 5D8AA 2DCJA 2VZPA 3LA2A 5IW0A 3VD7A 1OF3A 3UGFA 3WP3A 4COVA 1ZZ7A 5A3LA 1V0AA 4XDOA 1W8FA 4AFCA 1AYN1 1GYKA 4XUNA 5T55A 1FYUA 4K1YA 1R082 1VIWB 1V6MA 5HCBA 4FPCA 3S7IA 5CFCA 2RS53 3UV9A 2HEWF 3VKOA 3MIGA 4N43C 4OVEA 4XQWA 2J42A 1SPPA 2WT1A 4OHZA 1VPHA 3ZXEA 2ZXQA 4LIUA 1DQ6A 4E4DX 1CN1A 2J22A 4AEKA 1UZVA 4I30A 1AR91 1OBNA 4PF1A 3NAPA 1WW4A 1H9WA 3AMHA 4M01A 2OZJA 3WDUA 2HBTA 2W0XA 4Q4V1 1QQP1 4Z2AA 1IS3A 1GOGA 2JB8A 1KDKA 1X8MA 2VNGA 2Q8CA 4ARYA 4I09A 1MEC1 4IE4A 2WNVB 5CVRA 3RSJA 4EZHA 3M3OA 3GZTB 4HETA 3TEZA 1PIV3 5IVJA 1CAWA 2VZTA 2VVEA 3N9OA 3B5LB 1VR3A 1PO21 2O14A 3C3VA 3E97A 2AUYA 2GZWA 2VMCA 3MW4A 4JQTA 5L9RA 4IEYA 2ZHNA 1K42A 2R063 2J1UA 2BRTA 3HQRA 2X05A 3N9PA 1SFYA 3ZXGA 1ZVFA 2VCBA 1GFF2 2J1TA 4XMIA 4OI4A 5LBEA 5T52A 1YFUA 2VOTA 2OYZA 3D6EA 1GR3A 4JKKA 1PGL1 3W59A 1IQDC 1T6GC 1RJ8A 2W5FA 5A7OA 5CKMA 3WCRA 5J48A 4XIKA 2K46A 5C70A 4FI9A 1Q8QA 2RHPA 2D44A 5CFCC 3DUIA 1RUG1 1GOFA 5BV6A 2NP0A 4FXGB 3QD6A 4XJUA 2ATFA 1DP0A 3C7OA 3R4SA 4F3JA 2I07B 5LA1A 4HVOA 3MW3A 5FDBA 3SCGA 3AM2A 5FUIA 2QKDA 3PU8A 4YVSC 5FPVA 4UFMA 4AHXA 4B4PA 3FZ3A 3GCXA 1C4RA 1RUF2 2WO7A 1HLCA 3GHMA 1LJ7A 4K3UA 5FMBA 3RMYA 2VMDA 3BPSA 3LWCA 4MGQA 4RHV3 3IMNA 4A6OA 2FZ2A 3AZZA 4LBJA 2W1SA 3NAPC 1SHWB 1OVPA 1X50A 5FYHA 4MGKE 4QQPA 5FQ0A 2P3JA 2RJKA 2Y6HA 1RXGA 4YFWA 3WEZA 2BP6A 2DFBA 2YV8A 2L9LA 1G8WA 5LRRA 4M3CB 5F6LB 3O1PA 4XQDA 3N9MA 4UW6A 5HPOA 2PQQA 1RXFA 1ASJ1 1JN2P 4WM7B 3TNPB 4AFBA 1MS4A 1EAH2 3ROUA 5BNOC 3I2FA 4TXWA 4UF0B 3S5AA 2JE9A 2Y6GA 4FPGA 5LEKA 4FQZA 2VZSA 3K4DA 4XZUG 5CIRA 1POQA 4MOAA 1CZSA 1C1FA 1QXRA 3DXTA 4WVMB 4BQ4A 1F9KA 4Q26A 5FFOC 2CYFA 4LO7A 5KHJA 1OH4A 4W6XA 1S0FA 3NO8A 3WZ1A 1DCSA 4K8FA 5JMCA 3KHCA 4JAAA 4NPMA 5G04L 1K3IA 1SFNA 1Y9GA 1OPMA 4AQ6A 4DUXA 1MQTB 3GBWA 3OY8B 1US2A 3THPA 1YQ6A 4AFDA 2IXLA 4NIHA 4I3PA 5T5PA 1H4GA 4L99A 2WA3A 1D4M1 1GWLA 4Y26A 1W6NA 1DZQA 1MVEA 2P1BA 3IT8A 5FK7A 3BIWE 3KCXA 1QJEA 4OHWA 3DPRA 4INDA 1QJX2 5F5CA 1D0HA 1SLTA 5ABJC 2XKPA 3P3NA 4XPVA 1PO12 3O1UA 1O4ZA 3MO4A 3B94A 3VKFC 3LOBA 4PIZA 4CDQA 3M2MA 5DMYA 3VKNA 1H0BA 4YM1A 3PVBB 2F4PA 3RI8A 3AYEA 2QDNA 2VBPA 3ZPYA 3MEPA 3LPGA 5HXVA 3JB4C 4QGMA 5A80A 5C5UA 1WMFA 3ZVXA 3E5UA 3J9SA 1QDCA 2X53S 3UYJA 2XVLA 5EJ1B 3WF2A 1XNDA 4QGLA 1R092 2ZMNA 2ERFA 4A44A 5EJ3A 3I2HA 5HV0A 3KVAA 1O3RA 2B45X 3AP5A 5L36A 2JDKA 4Y4RA 1LHUA 4XAEA 5FXZA 3WV6A 1EV12 3VBSB 4AAXA 3KSCA 3FLPA 5A32A 5C8WA 4GA9A 4QPIC 4MZUA 4XFBA 1X36A 1AJKA 3VLBB 1FOD2 4NUBA 1RB8G 3SLIA 3NWKA 4OHXA 5F3CA 2VNVA 4CVUA 1KXGA 1OKQA 2CAUA 1HRV1 3FX3A 3RNSA 2IXHA 4XCAA 3HNMA 2W91A 5KHIA 4WZFA 1GQPA 2C4XA 5FIXA 1W8TA 3I2KA 4NR1A 1UX7A 1OF4A 3VBRA 3KCCA 5JCTA 2X09A 4KMQA 2WZPP 3VZOA 3KQ4B 1COV2 3BOWA 2JENA 5DPNA 2HWF2 1QU0A 1BYHA 4Q8KA 5C8CC 1KEXA 3ALQA 1W0NA 2E53A 4LA3A 3A0KA 1YIPA 2ARBA 4N53A 4CZSA 4BXFA 1C5IA 1GU3A 2YC2A 4CP2A 5FWJA 3NNLA 3RYKA 3SEEA 1NLSA 5ANQA 4BQ1A 3V0BA 3O1VA 1RUE1 3J7NA 4JC1A 4ZU5A 3L2YA 1OI6A 1JH5A 1AX0A 1KQRA 4AGRA 3ZXAC 3K4ZA 3WNLA 2ZGPA 1JZ2A 3I59B 1A8DA 1ZZ9A 4XDPA 5I91A 1AF9A 4QT6A 2PA7A 2IFWA 4JGZA 3ZKYA 2EALA 4P08A 5FYBA 1Y9MA 4NIIA 4L0PA 4GWNA 4L2NA 2XQRA 2XMLA 1ZRRA 3ZFGA 2Y64A 1H8TA 2DVFA 4Q0QA 4MXWA 4AOCA 2GAUA 5EPAA 1PZ9A 1W8WA 3VZNA 4HVRA 3ZXKA 2B4KA 3SCHA 5LW9A 1QJX1 2Z79A 3AKPA 4IESA 4Y1YA 3WVJA 4EQVA 5CKNA 5I93A 1OURA 5HCHA 3OGRA 3H9AA 1QDOA 3PIGA 5EP9A 4CEYB 5GALA 1JMUB 3FJSA 1GKBA 2DVBA 1VBE1 1GZWA 1RL3A 1V6NA 1YFWA 1AX1A 4L11A 4P9YA 3ZYFA 1V9U2 1OFNA 2B46X 2VPVA 4LBOA 5D8AB 2Z69A 1JOPA 1TMF2 2G1MA 1VRBA 2EA7A 4N53C 4K6BA 4GWJA 1QHDA 2CWMA 4NRQA 4QX1A 4YVWC 2VE1A 2EXIA 2JG9A 1CJPA 4IE5A 1S2BA 2F17A 5JPNB 3SMHA 5CFCB 3UT0A 2OA2A 4Q4X1 2ID4A 2VZQA 2OQ6A 3H50A 1RUD3 2NMNA 4CUGA 1W06A 5KXCA 2DWRA 4DPNA 4F8AA 4XFGA 4BMBA 1OQEA 3ELNA 4YVSB 5GKAC 2XBO3 4PLNA 1FOD1 5FOBB 5LBFA 1LU1A 4RR3A 4BDVB 4HXCA 4DNYA 3IN9A 2CTVA 1DDLA 2VCCA 1GMMA 2AR6A 3NAPB 4DMIA 3I3MA 4BK4A 3AVRA 4LHKA 1YUDA 5D21A 3AJZA 1VAKA 3AKRA 4AK3A 2PYTA 4ASKA 2GN3A 1NXD1 5FO9B 1W9YA 4OCTA 4XJWA 4H7LA 1SLCA 4HLTA 5HBAA 1F2NA 1BKZA 1NKGA 1HIXA 1QJU1 4PIXA 4ZONA 3RWKX 4W4ZA 3WNNA 4TZDA 2HWF1 4OQ8A 5IUQA 1AL0G 3I3QA 3MV01 4XQ4A 3O14A 4IE7A 2WIIB 1APNA 2VCMA 4RQPC 2C1FA 2HWC1 4MVTA 3POFA 5IAVA 3WDWA 2DURA 2OUHA 1RUC3 3POWA 4HK9A 5DG1A 1T2XA 4HG6B 3RZGA 3T30A 4LO4B 4ASLA 2EXJA 2JG9C 1JHNA 3RPQA 4YG0A 2VTXJ 1W6MA 1MZEA 1LHVA 3DV8A 4RGGA 1RUJ2 4Y4YA 5C3SA 5KXEA 1I5PA 2FDGA 4YGBA 1Y9QA 2E33A 3L9JT 2XJUA 4HZFA 4KWKA 5LY2A 1LOBA 1NA1C 3ETQA 4NO4A 4GXLA 1W3VA 4IEXA 2Q5TA 4HANA 3I7DA 5A7PA 3T0DA 4K40A 2WWUA 1Q8VA 4A6SA 3B02A 1AR83 1C1LA 1TEIA 4NIGA 3BALA 5FQ0B 1CX4A 4CU6A 4FCAA 4G9SB 4YSFA 1W03A 2BJSA 4EYUA 2W9XA 3ZYHA 1UY0A 1YNAA 2QDRA 4ATFA 4XIOA 1NOVA 1WCUA 2WJSA 1V9U1 1TME3 4Q1PA 5DAWA 4IQPA 1PM7A 4P14A 3GALA 3MIHA 4A42A 4L9BA 5HI0A 4IGOA 1FPN1 5ACA3 5CYYA 2RS33 4CUCA 5JSPA 2R1BA 3HOBA 2WAAA 3QCWA 3IIAA 1E57A 5CKQA 3DCQA 2R32A 1BK0A 1RINA 1HV0A 4FXKB 3AMMA 4DXZA 5A1FA 4YFZA 1XNTA 2W3JA 1GUIA 3MF9A 3WX5A 2QJVA 1RMU1 2ARXA 2IC1A 5DAQA 1RHI2 4AVBA 4GMP3 1I5ZA 5I0SA 3BTYA 3ZXFA 1VBB2 1Y43B 4FO9A 2CWSA 4MXVA 3HN1A 5FZFA 1JZ3A 1B35C 1F31A 4LE4A 5T5OA 2BZDA 1CZVA 2PELA 4A7ZA 4HVQA 3JBG3 2DYCA 4UFLA 1O8PA 3DPRB 2UURA 1ULCA 2W94A 1QOSA 4Y20A 1XYPA 3AMNA 3WSOA 5FJKA 3LCPA 3NJXA 5C8CB 3FHIB 4CDQB 4XC9A 1ST8A 4HKWA 4M00A 5T50A 2I45A 2XB6C 3L2HA 3LAGA 3KF3A 4PF5A 2WLQA 3AMPA 5EHDA 5JWPA 2HWD3 4XBNA 4YGCA 1W90A 4WZCA 2QQMA 5FP4A 2J1EA 2BPA2 2GNDA 3T2OA 2QQOA 2K0GA 4ITCA 1PX4A 2GN7A 2WNUC 3MICA 1YQ8A 5HXMA 1WLDA 1ODNA 3J8F2 4E4ZA 4XJAA 5I0DA 1Q8OA 4ZZ8A 1RVF1 4IEQA 4V2WA 1QNYA 1WW7A 3I54A 4DUVA 5JOZA 2BNNA 4NN0A 4YWAA 5L9VA 3P1IA 3RVHA 1LOAA 3M3EA 3NKTA 3ZSLA 4AGGA 1F4HA 2HWE2 1NCQC 1VBA2 1UZYA 2BTVC 5CG8A 2DTYA 3QBQA 1LHOA 1MVQA 2BU9A 2YYOA 4PI2A 1HRI3 2YHJA 4XW3A 5H9SA 2ZBJA 3DYOA 4PLOA 1DYKA 4CCMA 3LB9A 3BCWA 1ZBA3 2F6BA 1RUI3 5DAVA 5GM0A 3OBAA 1PVC3 5ISLA 4AWDA 1V6IA 5TSWA 2K9ZA 3U10A 4C1XA 4Z8BA 3VBFA 4B3NA 4COYA 2VQTA 2ZJCA 3AYCA 2AEZA 2WDBA 3LEKA 4BCUA 1ENQA 2PHXA 3CO2A 4NHLA 2G9FA 1AL23 3RI9A 1OA4A 1UOJA 3V65A 1XOYA 2D3RA 4N53B 1V00A 3OTFA 4P9GA 1Y4WA 3PMSA 4FOWA 4NHMA 4YVWB 1R1A1 2GP3A 4GULA 1VP6A 1O91A 2EIEA 3U78A 4E2SA 3V0BB 3CJXA 2RS52 1IPKA 5SV5A 2EIDA 2IVJA 3KT4A 3ETPA 3H1MA 2W87A 2CGNA 2RMU3 4FFHA 4Q1RA 1AUYA 4N9IA 3ABZA 4W8JA 3VKMA 1R64A 5BPXA 3WHUA 1OMIA 2XWJB 4MGZE 4JGZB 2CAVA 5JZGA 3RZLA 4KBZA 2ZX4A 2CV6A 4R9BA 4PLMA 4KWUA 5DUWA 3ZFGB 1PK6A 2KA3A 4CYDA 2XLAA 3T4VA 2WZR3 2ZTNA 2HBUA 1PIV2 1QJZA 1YLLA 4G4FA 4CCCA 1AZDA 1V70A 4CTEA 5FZLA 3WT3A 1C57A 1KFXL 4D8MA 3P6BA 4TN7A 3KZ4C 4DXTA 3SHRA 2R062 2WN3A 3WQBA 4CP0A 3GJAA 4Q4W3 3PL0A 5FY4A 2RV9A 4YYOA 4RQPB 5EJZB 3VZMA 5C9AA 4NAMA 3R0RA 4CDXC 3WG2A 2OT7A 4BQYA 1GBGA 5JOXA 2VBDA 2TBVA 3PIJA 1S0IA 4LULA 3DYPA 4IV3C 4PIYA 4QXCA 4XAAA 5FZ0A 1WLCA 3T08A 2Y6FA 2AYHA 2ZGSA 4I0WB 2JG9B 1BEV3 4M3CE 4DO0A 3VV1A 4IV1C 4LXLA 4QKNA 3HNBM 4HSLA 5FZDA 4FTSA 2VZRA 3WNPA 3FLRA 3T09A 2UWAA 4BU2A 1AR73 4QQHA 2D6NA 3OGVA 2WFF3 3ACGA 2X5IC 3HD8B 2HWB3 4RR3B 2G9ZA 4RHV2 4Z1VA 4R4XA 1F5JA 4J1WA 1GP4A 1OUXA 5HCAA 2WYSA 3KV9A 3PUSA 1ZRDA 4DFSA 1EPZA 1PGW2 5ANNA 1W2AX 3RRDA 1OC1A 2J1RA 2Z2SB 1FT9A 2AC1A 4GMP0 4QDSA 5IWFA 1YQCA 3AP7A 4QXKA 3J7LA 3PMEA 4PDWC 2VXRA 1OFSA 4NIAA 3HVDA 2C9AA 4IGPA 4CCOA 5B4NA 4BZ4A 4D6SA 3ZFFC 5A6ZA 3IDAA 2YGLA 1U5XA 2JG8C 1YFXA 3GF6A 4QKBA 3KS7A 5IHRA 1JOBA 3LA3A 1H2MA 1HV1A 2VOKA 2YBKA 3POBA 1W9TA 3ZYPA 1REEA 1UOFA 4LO5B 5F5AA 5HCFA 5C9AC 3J7HA 1LOCA 2RS51 4Q2FA 1U5YA 3LEIA 5FZ6A 2I74A 4XF0A 4AEJA 2JE8A 1PZ7A 3ZFEA 2Y0IA 3MFCA 3O12A 2XJSA 4JRAA 5C7GA 2D6KA 1NCRC 4K20A 1IS6A 1BJQA 1XQNA 5G05L 5F8PA 2WA4A 3WNKA 4RA0A 3T0BA 4PCRA 2FQPA 4MG2A 3R6SA 5AC92 1UWWA 3DKQA 3B00A 3ON7A 2JJ6A 4JDNA 4CCLA 2MNGA 3POJA 4IE0A 4IERA 4NOTA 2V5DA 2DVAA 4BHPA 1US3A 4QX3A 1UY2A 1PIV1 2BDRA 4N43A 3FWEA 1LHNA 1DGLA 3KT1A 2FDHA 2WO3A 5GZEA 2Y8KA 3I59A 5A3WA 4XVHA 1DQ4A 3VDCA 4S2DA 1UPIA 5FMCA 4A7YA 5JI9A 2BGOA 1V6KA 1JYVA 1MS5A 2W92A 1WKYA 3H42B 1MACA 3AX4A 1R1ZA 2A73B 3D5OA 1MS9A 1WCQA 1YI9A 3H7JA
chains in the Genus database with same CATH topology
4JVAA 1KRIA 1U0AA 5C4WC 2WNUB 1KS4A 5K0UC 2EVXA 2BVBA 2PHRA 4KU7A 1V6OA 1GICA 2A3XA 1HX6A 4GQ7A 1OA3A 5K9YA 3POSA 3B69A 3ZFEC 2LUWA 4OUSA 3WOGA 1O5UA 3WD5A 1YYNA 3D8CA 1NCQB 3D0JA 1HQWA 4E4SA 4ONUA 5I8SA 3D82A 2MEV1 2JX9A 1CIWA 3T2TA 4XXPA 1ALYA 2ZGNA 4WVZA 1PGW1 3RYPA 1S0EA 4FOVA 4BOWA 2PLV3 4EN9B 5KHGA 2FBEA 4Y20B 2WS91 2X8KA 4YVSA 5JR7B 3FBMA 3NV4A 2QZ2A 1NZCA 3ZSEA 2QZ3A 3AYDA 4FPLA 4GKYA 1QOTA 1S0DA 2OZ6A 3UJQA 3NSTA 2IXIA 4AHYA 5JVVA 4XF4A 5KHHA 5E8AA 1KJLA 3SXWA 2R043 4ES8A 2BVVA 4AFAA 4RGAA 1QXPA 4PJYA 2XLGA 2O1QA 1AYM3 3AZVA 4AEMA 4BH9A 5BNOA 1VBC3 3OPZA 3HQXA 4GWMA 5AC91 1DIWA 1VBD3 5F5QA 5KHKA 5EWSA 5JOYA 1LOEA 5B2GB 3H3UA 2AREA 3MW2A 3OGJA 3R05A 1WLWA 5K7PA 3SH4A 5FCCA 1IZ3A 4AQSA 4FPEA 4NPRA 3ZIWA 5JPMB 2VH9A 4FPFA 1VB2A 2OIIA 3ZYRA 3VBFB 3FMGA 2DVDA 2YDEA 4R9CA 4BA6A 2D7FA 1HXS3 2ZGRA 4LLOA 1BBT1 4IV3B 3IPVB 1QJY3 4C0HA 2DUOA 2ZPXA 3G6JB 5CU1A 4P5HA 4IV1B 1NE4A 3BB6A 1OD5A 3VBHC 4EN8B 5ABJA 1RUD2 4CEWC 5CADA 1FV3A 2BQPA 2GSYA 3MLJA 4W6WA 2XBO2 2RR13 2X5IB 2XGXA 1CR7A 3VBUA 2VQAA 2P3KA 3T1MA 3MZHA 1RUH3 1MS3A 5JZGB 1LU2A 1A8MA 2E7QA 4QX5A 4X8NA 2RS13 3VHNA 2ZHKA 4IEPA 4R8HA 3O0VA 4KGGA 3WP6A 3ZN6A 1PK6B 4L8QA 1W39A 2CL2A 1HQNA 1R081 1LGCA 1AYN3 3JQXA 2WSUA 4LE3A 3UL2A 4O9GA 4QPIA 2C5DA 2XJTA 4LBKA 5I0UA 2NQYA 3ZSMA 4BLIA 3ZFFB 4GH4A 2VECA 4P9LA 2JG8B 2V5YA 2WC2A 4JTOA 2XLFA 1Y3TA 4QHBA 1G6NA 3M3IA 5C9AB 1AR93 4N7UA 3KCYA 3VHPA 1RUC2 1IGOA 3D4KA 3EBRA 5I0TA 4Q4V3 5EXOA 4KGQA 2Z42A 2ZA9A 4HN1A 2XUMA 1ZYBA 1MEC3 4LHLA 3LSDA 2UWCA 4RL7A 2DVGA 1LOFA 5C8CA 3WG3A 2RM23 1OSGA 1S0JA 4CRQA 2GNMA 1PO23 2ZZQA 3VBUC 1DGWX 5DXDA 1DHKB 5DDJ3 2ZS6B 1Q56A 2GC2A 3WDYA 4META 1AR82 4QD2A 4A7KA 1MS8A 2BFUL 3R4UA 2ZACA 1YHFA 1FMD3 3B7MA 3TWIA 5JDBA 1OQDA 3ZMOA 1RUG3 4PBOA 1QMJA 1SBFA 3WP5A 1TME2 1RUF1 4Z82A 4GH4C 2ZABA 4L97A 2PHDA 3WINE 5J7MA 3VKLA 5ACA2 5JIUA 2VVFA 2RS32 3ILRA 1J3RA 1G9DA 5BYNA 1AJOA 3JCIA 3ZFEB 2D98A 2BBVA 2XJPA 1DQ1A 5DG2A 4H3WA 2ZGLA 1G9BA 4ASMB 3Q9OA 3KQRA 4ORFA 1LOFC 1EAH1 4AW7A 1ASJ3 5J37A 3AMQA 3OD4A 2PHTA 4YVWA 2XG3A 4KL1A 1CD3G 1HDKA 4FBFA 2R6QA 1A3KA 4RS5C 3JBG2 1SLBA 1ND3C 4N43B 4Q0PA 1ND2C 1GSLA 3ASIA 3X29B 4HPKB 4JRLA 3NV1A 5A3MA 3DKWA 1LKNA 2Q1ZB 4FTBA 3MIFA 4HL0A 3BU7A 5FPZA 2ZGMA 3FC0A 2Z5WA 2HWD2 4XF9A 1GV9A 4D94A 4RFT0 3WW1A 4JQRA 1ULEA 2VQ0A 1VALA 4CDUC 4FP2A 4N9HA 1DQ0A 4KG8A 4LBQD 1CESA 1D4M3 3M1HA 3FFZA 3VDDC 4AGVA 1JXNA 1PO11 4LA2A 4YM2A 4TWTA 2D40A 1X33A 2JKBA 4BYYA 1D2SA 1NXMA 4F83A 1RJ7A 1CPMA 2QFEA 4RQPA 1J3QA 4JTNA 2UYAA 4WM8C 5L7OC 5LK7B 4OHYA 1ZREA 1HRI2 1R091 4DOUA 1VB4A 2TNFA 1D2QA 4XHXA 1ZBA2 1RUI2 1PVC2 3USSA 4EV0A 1BZWA 3M3CA 4Y22A 2OW4A 1UKGA 2GDFA 1WCKA 4IEOA 1EV11 2H6BA 4FTEA 1AL22 1NA1A 3B93A 1TME1 1LOGA 2D5FA 3QOPA 4LUKA 4TYSA 4XDQA 3RDIA 3UKVA 4PBPA 2XVKA 2GMEA 3MF6A 2XH6A 4C0BA 1CGPA 1FAYA 4Q0VA 3TN93 3WUCA 5ACA1 4WBBA 2RS31 1HRV3 1TNFA 1LEMA 2H0VA 2RMU2 3O5SA 1AVBA 2A6WA 4YW1A 2FHRA 3POYA 1COV1 1ZNPA 1DBNA 3OYWB 1Q5OA 4DINB 5BNOB 1WW6A 2R30A 1UL9A 1ONAA 4XILA 5J3UA 3VHOA 4EWDA 2R073 2WZR2 3OD0A 4EWEA 4XHBA 4O9EA 2ZX3A 5H9PA 2H0BA 2B7YA 5KXBA 1RUE3 1WCDJ 3HMYA 3V0AB 2IXCA 2ZOEB 4EN7B 2AENA 1QY4A 2V09A 2ZGOA 5BNPC 4Q4W2 1POV3 1H1IA 5CG9A 3KM5A 5AFEA 4EN0A 2ENRA 1WLTA 3NVCA 4AQ2A 1B35A 4ZXKA 1DFQA 1W6QB 3N7LA 1OOPA 2XJVA 3AXDA 5GJ6A 3IDEA 5IK8A 1BEV2 4D7SA 1Z7S3 4JDOA 2YROA 1AHSA 1QNWA 2WT0A 5BNNC 5ABJB 1WCSA 4YM3A 1O3QA 2Q30A 1AR72 4EN6B 3RJ2X 2WFF2 3I4IA 3G7DA 1IPJA 4LO8A 2VW1A 4HSJA 5JIAA 3VBUB 2HWB2 2HYKA 4AVAA 4BMEA 3VZKA 1YFYA 1MZ5A 1LTEA 1SCSA 1VBE3 1CAVB 1TMF1 1YO8A 4QU2A 4HT1T 1BK1A 2WNUA 3ZN6B 1H1AA 4KNCA 1DQ5A 2NYYA 1ZBA1 2W08A 1FX5A 1SLAA 2E51A 3WP4A 4XTMA 2VOXA 2OVUA 2WQ4A 4HKOA 4AEDC 3RMXA 2P34A 4HN0A 4QPIB 1LEDA 4Q4X3 3O0WA 2YC0A 1N3QA 1SCRA 4GH4B 4QPGC 1NCQA 1C8NA 3SH5A 5DZFA 2GH2A 5BXXA 2PTMA 4A3XA 5C33A 2B39A 4JGYC 3JD73 2MHFA 2VMHA 2NM1A 1OOPC 3N7KA 3ZX7A 1AXZA 4X8PA 2D6MA 1C3HA 2G4IA 1U12A 4PQ9A 3U4XA 1QJU3 1WUVA 1HKDA 2DCTA 5J98B 1NLRA 1S0CA 3N4MA 2QVSB 4C90A 1ZZCA 3CL1A 1IOAA 1G9FA 3QH7A 4FT8A 1ND3B 1W0OA 1I1EA 2HWC3 2PHFA 1H30A 3AP4A 5CNAA 1K5MC 4XTPA 1C8M3 4E2GA 1RUJ1 4Q4W1 4LNVA 2PAMA 4BLJA 1PMIA 4W6YA 3SCFA 4FAHA 3CEWA 3U07A 1YWKA 4CDUB 5LRSA 1D0GA 2DUQA 4UW5A 4NWVA 1KS5A 4M0HA 2BEOA 2BGCA 4KH9A 2O0OA 3MYXA 5FOJB 2A6ZA 2EXKA 1UN1A 2W68A 1QGLA 4Z92B 1OLRA 2MPFA 1GQGA 4MH0E 5E89A 4DZGA 5FAXA 1GZ9A 3ZSKA 4BIFA 2HWB1 5T3NA 4CDXA 2QE3A 3ES1A 3FLTA 4WM8B 1FV2A 4IV3A 1TNRA 3IPVA 2A71A 3T1LA 4IV1A 4LBQB 4LLFA 2PLV2 2GC1A 1FPN3 3N3HA 3ZIXA 1BVP1 3ES4A 2X5IA 2WNEA 3RZZA 1DU3D 4EROA 4R9DA 4AHZA 1J3PA 1G7YA 3AB0A 4AG4A 4E9KA 5J36A 1RHI1 2NMOA 1NYWA 2I2SA 1IS5A 1RMU3 5FMOL 5GZFA 2P3IA 1VBB1 3LOIA 1PGSA 4FPOB 4YLZA 2JD4A 1POV0 4K7JA 3MGUA 1AXYA 2IXJA 3M3QA 3QLQA 2R042 1KJRA 3ZXDA 3LOBA 3B3QE 3TAYA 2D6LX 4PDWA 2WNVC 3VGIA 4CDWC 1REFA 1AYM2 3KB5A 1EYBA 1VBC2 3ZFFA 2JG8A 3JU9A 1ZBE3 1VBD2 3RG0A 4XJ8A 1XNKA 1XYNA 2ZX1A 4OI0A 1BQPA 3TOJA 1OLQA 1O4TA 2YGMA 4QQOA 2ZX0A 4JDMA 1MS1A 1PHMA 2A5ZA 3MI8A 2QCSB 4KWJA 4EWAA 2CY6A 3J8F1 1NCRA 4Y22B 5H9QA 1ENXA 5J96B 2A75A 1RVF3 1O3TA 1NA1B 1OA2A 2BNMA 3U0ZA 3N36A 1HXS2 5GLTA 4KU8A 1G9CA 5JAXA 4Y24A 1QJY2 2HWE1 2E63A 3S7EA 1M06G 1VBA1 3VL9A 4I02A 2ZGTA 4OHVA 4YZ5A 3PVOA 4MSVA 3AP9A 2DV9A 5JI7A 1DGRN 1JOJA 1JW6A 1N3PA 2GMMA 4Y1XA 2RR12 4XE9A 5GLUA 5BNQA 3H3ZA 3TNQA 1RUH2 2XL7A 1SBEA 3WHTA 3WY6A 1W6OA 2Q1MA 1XXNA 4FP3A 3WDTA 2RS12 5A33B 4H14A 5C4WA 3WG4A 4WM7C 5K0UA 1SACA 4U2AA 1Q8SA 5CA6A 2PAKA 4WV8A 4AEDB 2PLV1 1AYN2 1ENRA 1R1A3 1WMDA 1U5IA 4R52A 4RSUA 1H8VA 4KBBA 1OPOA 3VZJA 1RC6A 2XKOA 2XL9A 1WD4A 3AKSA 5FLJA 4LR4A 1N1VA 1AR92 1CONA 2K2SA 2AH2A 4JGYB 1B35B 3OCPA 4M3CF 3RQ0A 1MQTC 1OOPB 1EY2A 4Q4V2 5FLHA 5T5LA 2Q4SA 1H4HA 1N1SA 1MEC2 5E16A 1MR5A 4QQ2A 1OHFA 4HPKA 1Y7BA 2UY8A 2RM22 4HMZA 3AK0A 5DZGA 2R0HA 1XU1A 3KGLA 3R4DB 2R061 1PO22 1S0GA 1DF0A 4YW4A 4AHWA 1WGPA 5FO7B 1ULGA 3IDCB 5GLWA 5DDJ2 1UPSA 2B42B 1S0BA 2UY9A 3CNAA 3GBGA 3GNEA 3KLSA 1BXHA 1CAUA 3OF1A 4JV4A 3NW4A 1SEFA 2R1DA 1IQAA 1PGL2 5T5JA 1FMD2 1ULDA 4DY5A 3AZXA 2VVDA 4LBMA 4IXLA 4YW3A 2B9UA 2ET1A 3EXUA 1RUG2 3OBTA 4LTAA 3PVNA 5CAZA 1M4WA 1HXS1 1VRH3 4W65A 3VBSC 4AXOA 3KGZA 2DCYA 4FPJA 5KXDA 2FZ1A 1QJY1 4RHV1 4WVWA 3B9CA 4B8EA 4Y5Z0 3CF6E 3FFQA 4AVCA 1YJLA 2IZWA 2RE9A 2RR11 3SNMA 2WWSA 4COUA 1LRHA 4WVVA 5EV7A 5BY5A 1RUNA 2LM3A 1ASJ2 1KITA 3HIFA 5GLZA 3O0XA 4ES9A 1GQHA 5JSOA 3IKWA 3VBHA 3H0OA 1KD7A 1UIKA 4AE2A 1I3HA 1N3OA 4CEWA 1DG6A 3M8LA 2D3PA 1N47A 1JTZX 4XJ9A 4FOQA 3LKJA 1XRUA 3OBRA 3OYWA 4ISRA 3K51A 1JBCA 4ATEA 1LGBA 2NPIA 3PJQA 1LECA 2GNTA 4XBLA 3BTAA 3E5QA 2Q0AA 3HWJA 2ES3A 2VGDA 4YZ4A 4GB33 3W9AA 1MZFA 1U5ZA 1DGRA 1UMZA 5AVPA 4OULA 3APBA 1FATA 3VUOA 1D4M2 2E9QA 1CJDA 3AP6A 4CDWB 5E88A 1UCXA 1YCIA 3V0AA 3DL3A 3WLUA 2RM21 2EXHA 4MGIE 2NZ9A 4AF9A 3CJIA 4B7KA 4CDXB 5DDJ1 4CEYC 5H9RA 2CGOA 5T54A 1ZZ6A 1XU2A 2QQPA 1W6QA 2WQZC 3B01A 1HQLA 3S30A 1QWRA 1PZ8A 5D8AC 5IK5A 3HT1A 1FMD1 4AFMA 2B8MA 3E5XA 1I9RA 4QQLA 1AR63 3EHKA 1ENSA 4X6QB 3U11A 2LTNA 2WSVA 2VOVA 4BIOA 3THTA 2ZAAA 4I2OA 5FBZA 2Y26A 3ATGA 2EF6A 5JSRA 1CAVA 3TN92 4XMAA 1FNZA 1HRV2 4MUVA 1AXKA 3VN4A 2MEV3 4Q4Y3 3USUB 1J1TA 5DUXA 4R4ZA 5F1RA 1Q3EA 1RITA 4PDWB 5C8WA 1W6PB 1WD3A 2G9GA 3OGGA 4D7TA 3MIEA 4X6RB 2WS93 3TYJA 5CFDC 3TB0A 3MDPA 2EAAA 2R072 3CJIC 2ZHLA 4B29A 3GHNA 2Y0OA 1RUE2 2GC0A 4Q8LA 1QQP3 1ZRCA 2XVGA 3PTYA 4J6GA 5GZDA 1NCRB 2Y38A 4KQ7A 5IT6A 5K8SA 3SH3A 3BODA 3WR0A 3KMHA 2ETEA 2DUPA 4BM8A 3N7MA 2B5HA 5D1IA 4FPHA 3HR9A 5EZWA 1H9PA 4I3GA 2A3WA 3V56A 4FAGA 4KG0A 4RS5A 2VG9A 3NJZA 1B09A 4GALA 1SBDA 4QM9A 1BVVA 5AC93 1UX6A 1ND3A 5EYYA 1ND2A 1Z7S2 1CAXA 5IK4A 2HJIA 4ZU7A 2YXSA 4TLFA 1J59A 2D6PA 2W52A 4MYEA 1XE8A 4OI1A 2R0FA 3CLPA 4AI0A 4Y1VA 1NQJA 4YARA 5FPXA 3QH6A 1W6OB 1EPWA 1VBE2 2DU1A 4CDUA 2FMDA 5C4WB 5K0UB 4NHKA 4D7YA 1X8EA 3LA7A 1BBT3 2A70A 1G86A 3GBFA 3VDDA 2BNOA 2YPJA 1RUD1 3JUUA 3M7AA 1JYIA 4FQ4A 4OI2A 3FE5A 4AQTA 3IDBB 4XJZA 1Z78A 4Q4X2 3LGRA 5F9TA 3NV2A 1IKPA 1X7NA 5IK7A 2XBO1 3V64A 3O7OA 5GZCA 2PN5A 4IEVA 4L92A 5L7OA 4WM8A 2CNAA 4BPZA 3TN91 2UYBA 1Q8PA 2BW8A 2UWBA 2A7AA 4XF1A 1UU6A 2HKXA 1NQDA 3JD72 1NY72 2E7TA 3WNXA 4LBQA 2VMGA 2C0ZA 3MIBA 2X29A 4OUMA 4K1ZA 3SISA 4C1WA 1R083 3WQ1A 3VBOA 4AI8A 1D4VB 3ZYJB 4YW2A 3I2DA 1QJU2 3DPRC 4H55A 4S2GA 4ZU4A 5BUVA 2XHKA 5F6KA 4AI2A 3D0SA 3WW2A 5I8YA 3ZXLA 2R071 4CDQC 2BFUS 3ZDSA 3UJOA 1CPNA 1XNBA 1S1AA 2P37A 3H1WA 3KT7A 4NVPA 2WINB 1CAUB 2ET7A 2GALA 1RUC1 2HWC2 5KWRA 5FTTC 5DUUA 2IFRA 4Z2WA 2A6VA 3WW3A 1HW5A 1C8M2 1POV1 3E6BA 2A6XA 4XF3A 1SQ4A 1H2KA 2O8QA 5JOWA 4YZ2A 2GC3A 2VNOA 5CBLA 1V6LA 4D3WA 3AFGA 2PFWA 3WDXA 4XETA 1NG0A 1EP0A 2XJQA 1AR81 4FPYA 2DU0A 1Z7S1 2DF7A 3AFKA 3QACA 2BYVE 4COZA 1BCXA 1DZTA 5BNPA 1YXWA 3VL8A 3VBRC 3MFAA 1DGWA 1RGSA 1DYPA 2D43A 3VBOC 3H7YA 1CQ9A 1LHWA 3EO6A 2D97A 2EIGA 4FPKA 1QXJA 2TUNA 3IWZA 4JCKA 4FOYA 4YG6A 4B4RA 4YGEA 4COWA 1RUF3 1LESA 4M0NA 3VBHB 2ZKLA 5BNNA 5E1RA 2H6CA 1NE6A 4IETA 4CEWB 3ILNA 1KDMA 1FPN2 2RJLA 3M70A 3ENRA 3HBZA 2ZGKA 1DQ2A 4DS0A 3AYAA 2DTWA 3J26N 5L73A 4FSJA 2YY1A 2ZHMA 4QPYA 5AFBA 4GMP1 5A33A 4MLOA 1RMU2 2XPJA 2P17A 4JGZC 1Q43A 1EAH3 3ST7A 2QNKA 1QKQA 3JD71 4AVSA 1NY71 4AEDA 5I0RA 4YGDA 2D3SA 3JBG1 3WUDA 1H8TC 3ZFGC 3ZYIB 4LHNA 3J4UH 2PAEA 2OUJA 1CAWB 1ZZBA 1J58A 4QPGA 4DB5A 5CFDB 1ZBE2 2SLIA 4QM8A 1FI2A 4UW3A 1F8VA 2AGSA 3CJIB 2HWD1 1URXA 3GYDA 1ULFA 4JGYA 3H8UA 4IEZA 3VHRA 1SMVA 3JB8A 4MGYE 4HFSA 2D6OX 1LODA 3VZLA 1W0PA 1C8M1 1RVF2 1QJX3 4ISQA 4C91A 2ZMKA 3S0MA 1PO13 4F7ZA 2O8OA 5CB7A 1ZX5A 2N7GA 1V6JA 2JICA 1JUIA 3GZUC 3TRSB 1W2UA 2GU9A 2V73A 1HRI1 4RR3C 1L3JA 2GMPA 5FRAA 4YW5A 1RUI1 3RWNA 1R093 1K5MA 1PVC1 3N35A 1CVNA 1A6CA 4RD7A 2SBAA 3RS6A 4OLLA 2W39A 1IS4A 4AVVA 2VOWA 1AL21 1EV13 1VJ2A 1GZCA 1FOD3 2HEYF 1N1YA 3H1YA 3PHMA 2VUAA 3AKTA 4UXAA 4V1PA 1R1A2 3ACLA 3FUOA 3AXEA 3MLLA 1UZZA 4UBHA 2RMU1 3UKNA 3WXPA 2DCZA 2JE7A 1I6XA 3NV3A 2ZMLA 4YZ3A 1COV3 1H1MA 1H2NA 3IBMA 4Q27A 3I8TA 4TSVA 2HWF3 2ZGQA 2JECA 4QMAA 5L19A 2D93A 4SBVA 3N7JA 2TEPA 5GLVA 3EJKA 3PJYA 4GKXA 4RS5B 1ZRFA 3NKGA 4LUMA 2WZR1 1RTVA 1ND2B 1W6NB 1CAXB 2ZCWA 5LK5A 4K9SA 5C6CA 1LCLA 4G3YC 1LULA 5JLVA 1REDA 1ZBE1 4HK8A 4AI1A