4KWJA

Resting state of rat cysteine dioxygenase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
187
structure length
187
Chain Sequence
b'TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Mechanistic implications of persulfenate and persulfide binding in the active site of cysteine dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 58
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4kwjA00
4IEZA 3BB6A 4JTOA 4META 4TLFA 1ZRDA 4FT8A 1ZVFA 5CVRA 4LULA 2CAVA 4MX3A 2DCTA 3RNSA 5J48A 3MYXA 4I0BA 3E5XA 1X8MA 1GQGA 2ZCWA 4IEXA 4IERA 3IIAA 4EROA 1O3TA 1OI6A 4RD7A 1XRUA 1OFNA 3QACA 3CLPA 5FPZA 3OCPA 1G6NA 2D5HA 3WW4A 3E5UA 4L11A 3KSCA 3U11A 4BYYA 3I59B 3E97A 5E16A 4A2UA 2OZ6A 5JSPA 2ETEA 1RL3A 3H3ZA 3LA3A 4D7SA 4PJYA 1LKNA 4DINB 4XF1A 1H1MA 2MHFA 4J1XA 1ZREA 5CADA 4KWLA 3H8UA 3I59A 1Y9QA 4ZU7A 2VQAA 3EHKA 4QX5A 2MPFA 1PMIA 3UKNA 2FQPA 3WW1A 1SEFA 4XEZA 3ETQA 5AVPA 1ZRRA 1O3SA 2O8QA 3E6DA 1YWKA 3SCHA 4MH0E 4OLLA 5KHIA 5JCTA 4I2OA 3KGLA 4D7TA 1WLTA 5KBFA 3B02A 1YFXA 2BNMA 5HI0A 1RC6A 4YRDA 4JTNA 3WW3A 1EY2A 4H7LA 4YNIA 1ZRCA 4I01A 3CL1A 1Q5OA 2FMYA 4HMZA 3RYRA 1UIKA 4ORFA 3FWEA 2UY8A 4E2GA 4P9GA 4LUMA 3H1MA 4QGNA 2QNKA 3E5QA 5E1RA 5I0RA 4I02A 1RUOA 2XL9A 1RUNA 1VR3A 4ZU5A 2PAKA 3NKTA 1UIJA 4ONUA 5CU1A 1Q3EA 1I5ZA 3H3UA 3S0MA 1CX4A 1XE7A 4MGKE 2B9UA 4HN1A 3E6CC 3H1YA 2BNNA 3UKVA 1EYBA 4MGYE 1Q43A 2Q1ZB 4EV0A 3LWCA 4F7ZA 3RYPA 2Q30A 4X6RB 2F4PA 3I54A 3N4MA 4XF4A 1WA4A 2WFPA 5JSOA 3LA2A 1ZX5A 2Y0OA 3EBRA 3FFQA 3LOIA 4IEQA 3ES4A 5LRRA 1ZZ7A 3G7DA 4NVPA 4E2QA 5I93A 5FQ0A 1EPZA 1NE4A 1CAVA 3ES1A 3BPZA 2PFWA 2QCSB 3HQXA 2IXCA 4K8FA 5BV6A 1IPJA 4N9IA 2XGXA 3H1WA 3QOPA 4XFBA 4Z07A 3D0SA 2GC2A 3D0JA 4B29A 4XFGA 3MZHA 3DN7A 5FLJA 1ZZ8A 2Q4SA 1TQ5A 2WC2A 5KHHA 3KCCA 4HSJA 1J3QA 3U0ZA 3D82A 4AQ2A 3IWZA 3FE5A 2PAMA 4IESA 2VPVA 5JAXA 4OFGA 2K0GA 4UBGA 3FJSA 3IDBB 2H6BA 3PLQA 1UCXA 4O9EA 1UPIA 5JSRA 1O5LA 4LEJA 3S7EA 4AQ6A 4IEYA 3I7DA 4BH9A 3MPBA 3VHRA 2GC3A 4AVBA 1ZZ6A 4MUVA 1Y3TA 5BPXA 1SFNA 3KMHA 4Q29A 3R6SA 5BUVA 3BALA 1X7NA 2HKXA 4Q0SA 1LRHA 4IEWA 5J3UA 4Q0UA 1X82A 1YFYA 4N9HA 3M3IA 5FPXA 5FLHA 5LRSA 1J59A 4KWJA 3FHIB 2BYVE 5BXXA 2V09A 4MZUA 2EA7A 4BIFA 4IETA 4YARA 1GQHA 1CAWB 3SMHA 3OGJA 1CGPA 5FLIA 3ZDSA 4YYOA 5EZWA 2O1QA 3UKTA 1O3QA 3CJXA 3CF6E 1EP0A 4LA2A 2QJVA 2QVSB 1DZRA 3RPQA 4AVCA 2BEOA 1O3RA 4R52A 5KHKA 1YLLA 4KL1A 2EAAA 1CAWA 4FBFA 1I6XA 3DKWA 5C6CA 4IEOA 2PHDA 2ET1A 3H9AA 3NW4A 4YSFA 3GBFA 4I3PA 4EWEA 4JV4A 2PYTA 3ROUA 5LEKA 3USSA 2GC1A 4I0AA 5I0TA 1J58A 4HVOA 5I91A 3E6BA 3HT1A 4QGLA 2UYBA 2XKPA 1QXJA 2K9ZA 5K8SA 5KHGA 4XFAA 4XFIA 2ZKLA 4XF0A 4HZFA 4QXKA 5D1IA 3EQEA 2QDRA 3BU7A 5FQ0B 3TNQA 5J7MA 4IEVA 1CAVB 3SHRA 2KXLA 1LB2A 4XFHA 1FI2A 3RDIA 2GU9A 5JR7B 1O4TA 1QWRA 1J3PA 4HBNA 3NL1A 4HVRA 4F8AA 2CGPA 2PQQA 3ACLA 1WGPA 2ET7A 2PA7A 4AVAA 4PIXA 3EJKA 1LR5A 1YHFA 5EFUA 2IXIA 2PTMA 1FT9A 4FAHA 4HVQA 1NXMA 3PNAA 2XHKA 3ST7A 3RZZA 1JUHA 4JVAA 2C0ZA 1IPKA 1CAXA 5C8WA 1ZNPA 3FZ3A 5KHJA 5I0SA 3C3VA 4XETA 1DZTA 3SCFA 2ATFA 4IEUA 1PM7A 2D93A 5I0UA 2IXHA 2UYAA 4X6QB 4Z82A 1QY4A 3OF1A 1J3RA 1OD5A 2CV6A 4IEPA 4LTAA 1ZRFA 2N7GA 1U12A 2EVXA 4R8HA 3HT2A 1H1IA 2BNOA 4LUKA 5LEJA 4HLTA 4I09A 1ZZCA 1O7FA 3JZVA 4Q0PA 3NVCA 2B5HA 5I8SA 4KU8A 2XLAA 1NE6A 4BHPA 3CEWA 4KU7A 2D40A 3WW2A 2GZWA 1SQ4A 2Q0AA 2IXJA 2OYZA 1RGSA 4GULA 2BGCA 4J1WA 3HIFA 4ZU4A 1OMIA 1HW5A 1DGRA 1O5UA 2GAUA 2OZJA 4XF9A 3RYKA 4FAGA 3LAGA 2MNGA 4XFCA 3EO6A 3NSTA 2PHLA 2H0VA 3IDCB 4QMAA 5T3NA 3DL3A 4QM8A 1CAUB 3DV8A 5FCCA 1ZZ9A 4L2NA 2D5FA 1YFUA 3U10A 1UW8A 5I8TA 4Q0QA 1YFWA 4QGMA 4PIYA 3LA7A 2IXLA 2IC1A 4XFFA 4MGZE 2HJIA 4Q0VA 4MGIE 1DGWA 2XL7A 1RTVA 1CAUA 1V70A 1J1LA 3FX3A 1XE8A 1UD1A 3PVBB 3OTFA 3H7JA 4XF3A 2I45A 2P17A 3TNPB 3ELNA 4O9GA 2Z2SB 4KWKA 5I8YA 2Z69A 3H7YA 3H50A 1VJ2A 2OPKA 3NJZA 2VECA 2UY9A 2XKOA 2H6CA 2B8MA 1NYWA 2CAUA 2GC0A 3KGZA 3SXWA 4HN0A 4WVZA 3LZZA 1X8EA 2OA2A 4CYDA 2XLFA 4PIZA 4EWDA 4UXAA 1NZCA 4LA3A 1L3JA 3MDPA 4UBHA 5BY5A 4E2SA 3S7IA 2E9QA 2XLGA 4EWAA 3IBMA 4QM9A 3OD0A 2GH2A 2PAEA 4LLOA 4WZCA 5F1RA 2IXKA 4MV2A 1VP6A 4HSLA 4WBBA 1ZZBA 1QXRA 1CAXB 5FDBA 3O14A 3SCGA 3M70A 1YUDA 1FXZA 3GYDA 3L2HA 4AXOA 3CO2A 3BCWA
chains in the Genus database with same CATH superfamily
1S1AA 5ABJC 4TLFA 3VDBA 2NLRA 4AOCA 5JZGB 1F9KA 2VTXJ 5J37A 3N9QA 4FT8A 3AYEA 3AFKA 4CDWB 5CVRA 4YGBA 2WABA 1AL0G 2R042 1LOCA 2PLV2 1HLCA 4GMP3 1NA1A 3GNEA 5DZGA 4GH4A 1OXCA 2WL1A 4UW3A 1WA6X 1RUF1 3U1XA 4BWOA 5BNPA 4YW6A 1X8MA 4CUCA 3RZHA 1HN0A 4CP0A 4P00B 3VBSC 4OUSA 4RQPA 5IVVA 2CWMA 3CLPA 3OCPA 1VBE3 1MEC1 2C26A 2HWB1 2TBVA 2WN2A 2YB7A 3E5UA 4KGQA 4L11A 4Q4X2 4QKFA 4CU6A 5J1XA 3HVDA 4QPWA 3IDEA 3T2TA 1GZCA 5FZ6A 3I59B 4WVMB 1A34A 5A7OA 3NO8A 1A3KA 1MS3A 4GWMA 4KI5M 3J7HA 4AFBA 3NKGA 1RUG3 2J1TA 1HDKA 3L2YA 2ETEA 3PVNA 4PJYA 2RS32 4DINB 2JE8A 3R05A 4LBMA 1TNFA 1YJKA 4IQPA 3N7LA 1TMF1 2HWC2 3NV4A 2BFUS 1BVVA 2RVAA 3H8UA 1I5PA 4U2AA 1Y9QA 3AZXA 2JDAA 3ZXJA 5F32A 3ZVXA 1GICA 3FMGA 4D6RA 4FTBA 3UKNA 1F4AA 2WINB 1UZYA 1RIRA 2W1SA 5T5JA 3WW1A 2XB6C 1YEWA 2BVBA 3AMHA 5AVPA 1ZRRA 1ND2A 4YWAA 2WUHA 2TEPA 5T55A 3KF3A 1PO12 1PHMA 1C5HA 2O8QA 3E6DA 1JS9A 3POSA 5H9PA 3VHPA 1KITA 5FOJB 4I3GA 4OLLA 4CCLA 5KHIA 2X5IB 3MHZA 4XCAA 4Q8KA 1PO11 3R0RA 4PLMA 1MQTB 3DCQA 2BNMA 5KBFA 5FZOA 3KZ4C 3AP4A 3ZXGA 4YRDA 2EIDA 3AMQA 4BQ5A 3FHAA 3DYOA 2P3IA 2QFEA 3U4XA 1VBC3 4H7LA 3VDCA 4CDUB 2A3YA 1GNYA 4H2AA 4O65A 2A6VA 1NZIA 2OIIA 2QQWA 1B35B 3P6BA 3Q8BA 2D6KA 4XC9A 2QQUA 3EMRA 3UL2A 3UV9A 1UU5A 3I2DA 4AI1A 4E2GA 1DQ1A 1W9TA 2VVFA 3LPGA 4A7KA 4YZ5A 1U0AA 1W0OA 1OA4A 1PMHX 3LSEA 3VHNA 1PO23 3WNMA 4K7JA 1LEDA 1BHGA 2DCZA 5FXWA 3P3NA 4WZFA 5C9AA 1PK6B 4W6WA 3VBRA 3HOBA 1VR3A 1W8HA 4ZU5A 2BU9A 4X8PA 1FATA 3I97A 4PCRA 3H3UA 1RUC2 2HH9A 2WT1A 3DEMA 1XNBA 5A7SA 3LF7A 1NT0A 1XE7A 3NNMA 1ND3C 2AEZA 3M2MA 5FMOL 5F8PA 2BQPA 4YVWA 3HAGA 3AK0A 5FK8A 1EYBA 4MGYE 3POIA 1C28A 5A7NA 4NOTA 2VO5A 3GCWA 2UWCA 4N43C 1QDCA 2LW8A 1W6NB 3RYPA 1S0DA 3IIIA 4Y3OA 3WQBA 1XB9A 3HN3A 1ZBE3 2F4PA 5KR7A 3I54A 3DPRB 4MGSA 3K3NA 1NCQA 1OKQA 2QZ2A 3RZJA 3ATGA 5HCHA 1PZ9A 2WFPA 4Q1RA 2XJQA 1AX2A 2J22A 1LECA 2VMDA 2Y0OA 2V5YA 5C8CA 3H8OA 1Z7S1 3K48A 4CRQA 2TUNA 1JZ8A 4XQ4A 1H9WA 3TAYA 3VKOA 1K5MB 1C57A 5LBCA 4OI1A 4RQPB 3LIHA 3ZXDA 4ARXA 4C90A 3W59A 1KQRA 3BIWE 1QJU2 2R043 4MVTA 5TSWA 3OBAA 4S2GA 4B8EA 4CXXA 1NE4A 4UFMA 2BERA 4WVWA 3I3BA 4CP1A 1JYIA 2W0XA 1RUE2 2Y6LA 3AVSA 1MS4A 5CB7A 4M4RA 5FZ1A 1GZ9A 3RWNA 3O0WA 1LESA 2AR6A 2R061 2P1BA 4K8FA 3ZYJB 1RUE1 2BZDA 4N9IA 4Y4RA 3I2GA 3H1WA 1BBT2 2ZACA 4NRQA 3D0JA 1SCRA 4XFGA 2R0FA 3DN7A 4FQZA 1UXZA 2Q4SA 4M3CB 1TQ5A 2JIGA 4Q4X3 1F5JA 5EWSA 3KCCA 5FZCA 5KHHA 5CFDA 3PUQA 2WT2A 4TWTA 3D82A 3GXUA 4UW6A 4AQ2A 5T52A 1NXD1 2WNUA 4ARYA 4CEYB 2VPVA 4UFKA 2ID4A 1HQNA 4UBGA 1MACA 4AGGA 2VAUA 3IDBB 2H6BA 3AZYA 1H2MA 2AGSA 5FR3A 3KV5A 2GN7A 1C1FA 5JSRA 1DDLA 2RS33 5LCWL 3ALQA 3C7OA 4LEJA 3S7EA 3MGUA 3NRUA 3PMSA 4IEYA 4QHBA 3VBOB 3ZYRA 2YBPA 3KT4A 2HWC3 3CNAA 2DUOA 1H8VA 2J7MA 4AAXA 5FYYA 3VBHA 4A7ZA 3ASIA 5BPXA 1WW6A 4JGYC 5FO8B 2WLQA 4QQPA 3OPTA 4QXCA 4EN6B 3DUIA 5LBEA 2ZHLA 3PUHA 2YXSA 4B4QA 4MG2A 4FQ4A 2CWSA 3FBMA 3VZNA 4XJUA 5FYMA 2QQMA 4D7YA 4ZS3A 4IEWA 5J3UA 2JIJA 4PQ9A 1ENSA 1X82A 3AYCA 4Q0UA 4YW2A 1DGRN 1O4YA 4XHXA 4BLJA 1S0JA 3M3IA 3OB8A 5ABJB 5FPXA 1PO13 3CDZB 1IG3A 4KWJA 4IE5A 3FHIB 3SH3A 3SISA 2E7QA 2JWPA 4Q4Y1 1NCRC 1WMXA 4BIFA 1W6OA 1Q8SA 4Y4YA 4AHXA 4YARA 2P2KA 5CBLA 5T50A 1DQ2A 1GQHA 1F5FA 4LNVA 1QJY2 1RUJ2 2VZUA 3SMHA 2ZS6B 3N9MA 4HT1T 2ZGSA 4ZONA 4YW1A 1MS0A 3TEWA 4CDXA 5C9AB 4NIGA 3VZJA 4C0HA 5C3QA 3JD72 4NIDA 4CU9A 1DGLA 4Y1UA 2O1QA 5LBBA 3W21A 3ZN4A 3MV11 4Y1ZA 3TWIA 4AVVA 1V6LA 4AVCA 2JG8A 3QD6A 2BEOA 1OVPA 1VLNA 1S0FA 3VV1A 4BQXA 3U4SA 5KHKA 1O3RA 2ZTNA 4LXLA 2XJSA 5CAZA 1K12A 3VDDA 4P9LA 1CONA 4QB6A 4FO9A 1UY3A 4XHBA 4AFAA 5FZ9A 2ET1A 1AF9A 4RGKA 2RR11 5IT6A 1RUC3 4HK9A 3ZN6B 1QOOA 3PUIA 2PYTA 2LTNA 2V72A 4F83A 1GANA 3RI9A 4A3ZA 5CKMA 1LODA 5FREA 5I91A 3GHMA 3E6BA 1VBB2 2YC2A 2XPJA 2EXIA 4K21A 1QXJA 2K9ZA 5KHGA 4XFAA 5C3OA 4A7YA 1Q8OA 2B46X 1JW6A 5A3TA 4HZFA 2D44A 4MXWB 5FZIA 5FUNA 4BDVB 4Q2FA 2ZXQA 1AYM1 4YZ4A 3S57A 2VE1A 4IE0A 3S6PA 3OUJA 5JDBA 2DF7A 4XFHA 4DXZA 4L0PA 3ZYGA 5C4WC 1XC6A 3AC0A 1HIXA 3LFIA 4YPJA 3WDYA 1O4TA 2ZPXA 1W8NA 2XJRA 2XJVA 1QJU3 4FPJA 4L8QA 1QWRA 5L7OA 1UL9A 3DXUA 3LFMA 4HVRA 4OHVA 2DUQA 5CFDB 2JICA 1SBFA 3MFCA 1RUE3 4DOUA 3ECQA 2VZTA 1C8M2 4PIXA 4FSJA 4FPKA 1AX0A 1AR82 5FZEA 1OPOA 3AJYA 3VBFC 1BBT3 5G04L 1LHNA 4A6OA 1RVF2 1JOPA 1H2NA 4HVQA 2WA4A 5J96B 3PNAA 3R4UA 1ULDA 4P9XA 4NHXA 4UOJA 1W8ZA 2D97A 2D6PA 2JE7A 4W6YA 3IKWA 4XBLA 5CKQA 2C0ZA 1CAXA 1RVF1 2V4AA 2VCMA 2RM22 3TN92 4Z2WA 2P4EA 2WQ4A 4XETA 1QU0A 5FO9B 3WCRA 4QXHA 3SCFA 2ATFA 2P6CA 1C8NA 1GYKA 2RMU1 5A80A 5K0UA 5A7QA 1REFA 4OZXA 4GJYA 4X6QB 5A1FA 5FYHA 3GZUC 1D7PM 4Q5OA 3R4DB 3O1PA 3ACFA 4CUAA 2QBXA 3FN9A 4QPIB 2N7GA 1YYNA 4Q4W2 5JI7A 3WDXA 5F3EA 5IFTA 1POV0 1RITA 3HT2A 1H1IA 1X33A 4GXLA 4Y26A 3P1IA 4X8NA 2BFUL 2G9ZA 2YU2A 4LUKA 4K1ZA 3K46A 4AEDA 3BI3A 1YI9A 4CDQA 4PF5A 2O14A 3NVCA 4Q26A 4EN7B 4BQWA 4N53A 5BNOA 3OBTA 1LHWA 2XMLA 3POFA 1W6MB 3D6EA 2GZWA 4UF0B 5FV3A 2CHHA 1H8TC 2G4IA 3J26N 3USUA 3SKVA 5EJ1B 4AI3A 4EZHA 2OS2A 5CG8A 1O6UA 3WX5A 4LIUA 4Q4V2 2E6VA 2VOTA 4AHYA 3ZFGA 1DZQA 4V2VA 1O5UA 2JG8B 1LU1A 1XBFA 2XQXA 4GALA 2FZ2A 2A6ZA 1SCSA 2CSGA 3LAGA 5AFEA 2MNGA 3NSTA 4IL7A 1SG3A 1QJY3 1RUJ3 2ZA9A 4RS5B 5FZ0A 2QZ3A 1NY71 4DQAA 1TME2 3WDUA 2ZX1A 4QMAA 5T3NA 5A3NA 3U07A 4QM8A 1QF3A 2ENRA 5ACA2 5FMBA 3DV8A 5FCCA 1ZZ9A 3BOWA 3JD73 4YM2A 5E88A 4FXKB 2ILMA 4AW7A 2VXRA 1LOFC 1YFUA 2EXHA 2MEV2 5C7GA 3SH4A 1W6QB 2JDPA 2GNBA 3WNNA 3I4IA 1RYYA 1U5XA 2MEV1 3N3HA 1REEA 5J98B 4COWA 4ES8A 2WZR2 3WG1A 5A6QA 5A3OA 4IUGA 1RTVA 2Y6JA 4FPOB 5FXXA 2VBDA 4MGTA 4XIOA 5IATA 2Y0IA 3PVBB 4URTA 1L7RA 5E6HA 3OTFA 5A3WA 2ZMNA 2P17A 1V00A 3ELNA 4O9GA 2Z69A 1WBFA 1AR71 3MBWA 5FZ3A 3O0XA 2VECA 3M3QA 5EYXA 2ZEWA 2H6CA 1WCSA 2B8MA 3NAPA 3QH6A 1DIWA 2DVAA 5IWFA 5LY2A 1V9U1 3EB7A 3T09A 3WNXA 4CEWC 1VBB3 3PUSA 4HN0A 3SQOA 2JKXA 3LZZA 3U75A 3JB8A 4DEVA 4AL9A 3GCXA 5FPUA 3CQOA 1EAH1 4A41A 2P6HA 3DYMA 1BEV1 3IM0A 2ORZA 3KT1A 1ASJ2 1I3HA 5FAXA 3MI8A 4XJ8A 1RXGA 4UXAA 2O8OA 3WXPA 4R4XA 2R0HA 1OH4A 1QEXA 3KLSA 4WM7C 1PVC1 1V6IA 1QJZA 2E9QA 2OUHA 2WNEA 3CJIC 4CCMA 2A3WA 1GWMA 3LQCA 5DUWA 4DXRA 4EWAA 4DO0A 1HV0A 3OD0A 1E5SA 4MO3M 1UOGA 3O1MA 4QKDA 1W8FA 4TTGA 5FUPA 4WZCA 5F1RA 1S55A 3NJVA 2AUYA 1VP6A 1AR62 4LHNA 2BVVA 3WUDA 3CZJA 1QXRA 1CAXB 5FDBA 3AXDA 1F8VA 3O14A 1N3PA 4EN0A 1GSLA 1R092 3OYWA 1FXZA 4QX1A 1HB3A 1C8M3 1AR61 4OYUA 3L2HA 4LJHA 4MADA 4XAAA 3CO2A 4PBPA 3BCWA 1GU3A 1AR83 3U14A 3OD4A 3BB6A 1R091 1OVSA 3N9OA 4META 3ABZA 4XXPA 3PJYA 5IHRA 1RVF3 2BGPA 2YPJA 4CXWA 2VNOA 4NMIA 3PVOA 4QQHA 4LULA 4W4ZA 1JI6A 2D43A 1PMJX 3LPFA 1FV3A 2CAVA 4PT6A 3TN93 4AEDB 1D4VB 2DCTA 2RM23 1W2TA 1R082 2BWAA 4PF1A 3ZSKA 3O1VA 3RNSA 3WQ0A 1GP5A 3JB4C 4QU1A 4COYA 1PIV2 5CZKA 5AC91 2Q8OA 2RHPA 4N53B 1K42A 3HWJA 2ZCWA 3UT0A 1UOJA 4RD7A 5DDJ1 5JXIA 2OVUA 1W39A 1OFNA 2ZX2A 4QDQA 4CDWA 2YZ4A 4FPCA 2ARAA 4Q4W3 4EQVA 4YZ1A 5F37A 5IK4A 3AKSA 5IJRA 1G6NA 2EXKA 3OPWA 4JX0A 4W65A 3TEXA 4QWNA 1XU1A 4RGGA 3LDRA 4DY5A 2WJSA 4GB31 5FXZA 5LA9A 5EIYB 2HEWF 4QX0A 1UY4A 4RFT0 2WQZC 5LWBA 1H0BA 4R9AA 2EIBA 4OQ9A 2OZ6A 2Y6GA 4C8DA 3ZYIB 3AMNA 2JX9A 4YW4A 2WO7A 3SC7X 4K40A 3J8F1 3D3AA 5GLVA 4Q4V3 4FVVA 2MHFA 4J1XA 4ZXKA 5FUIA 1IQDC 1V6MA 3FUOA 2WWUA 4CCDA 4P9YA 1PX3A 4Q1PA 3TOJA 4Y20A 3UJQA 3I59A 4WVMA 3V0BB 5ERLA 1UOFA 3DF0A 1ZA4A 3EHKA 2PHUA 1JZ2A 2XVKA 3A21A 3OBRA 3ZMOA 2OXBA 1TME3 1JOJA 4Y5TA 2VTFA 3NNLA 5ACA3 4BMBA 1UZVA 3ETQA 4WM8C 2MEV3 1KJLA 1RXFA 4LKDA 4KG8A 3VBFB 3RQ0A 1NQDA 1CR7A 2WRAA 4K9SA 1YWKA 1Y9GA 4ZKTB 2UU8A 4FTSA 4P9WA 3T0BA 2X10A 1H2LA 5FPBA 3ZN5A 2WZR3 4BQ4A 4D7TA 1MZEA 2XQRA 4LIVA 4DS0A 1RUI2 1VBA1 4JDOA 3B02A 1YFXA 3M3OA 5HI0A 3Q9OA 5CNAA 5DUXA 5KC5A 2WNVA 1JYVA 4QDRA 4IGPA 4JDMA 1D4M2 1S4CA 2WO1A 1UMZA 1JODA 3LSDA 4XQWA 2VUCA 1JU3A 2JXAA 2VCAA 3AYDA 5A32B 4CUGA 4NO4A 1Q5OA 3GJBA 4HMZA 2E51A 2XWBB 5AVAA 4LQRA 4ORFA 1FAYA 4A6SA 2W91A 3IN9A 4GH4C 2X5IA 1PGSA 1COV1 1US2A 3FWEA 3HMYA 2WKKA 1MQTA 4P9GA 5BNPC 1VRH1 3VN4A 4DY3A 2LUWA 5CIRA 4JKLA 1DLLA 3UETA 5I0RA 2JD4A 3GBWA 4I02A 3JU9A 5A6YA 4EE2A 2XL9A 5DZFA 1HXS2 1RUNA 2PAKA 4S2FA 4CDUA 3NKTA 1UPSA 2W39A 1FPN1 1NG0A 3WF2A 4FOVA 4RN5A 1B35A 1ASJ3 1H8TB 2JDZA 4GA9A 5DUUA 3ZIWA 4AWDA 1RHI2 3ZLIA 2VW1A 3IB3A 3R4SA 3KVAA 3THDA 1CX4A 4YG6A 5CFCA 3S0MA 4MGKE 1W9FA 4LBQB 3E6CC 1EV11 1AYN2 2HEYF 4CP9B 4DRVA 2Q1ZB 1PK6A 3PU3A 4RGAA 5F3CA 5LK5A 3K4AA 2YGLA 1XSRA 1YIPA 2QDNA 1SMVA 1KJRA 2RS52 2SLIA 1W28A 4K20A 4X6RB 4AF9A 1AR63 4URAA 2WLPA 1C1LA 4BQ1A 5HXMA 2AACA 1R093 4FFHA 3ITQA 1WA4A 4XF4A 2O0OA 3LA2A 2FDKA 1GOHA 1OLME 3H8XA 2Y38A 1CWPA 1ZX5A 3EBRA 2G1MA 2RV9A 4BA6A 5IVEA 2W1QA 1X9PA 5FY9A 1JZ4A 4IEQA 1SBEA 1W6NA 1ND2C 3HNMA 4LBOA 2VMIA 1WCKA 2C1FA 2OQ6A 4A44A 4AAPA 3GJAA 1J84A 1LAJA 1ZZ7A 3DPRA 2VMCA 3G7DA 2WS91 3MIEA 4NVPA 4L92A 1HX6A 4UFIA 1RUF2 5I93A 5KC6A 1R083 1G9CA 1EPZA 1H9PA 1WWYA 1GWLA 2BUKA 1PIV3 1UZZA 1CAVA 3ES1A 2QCSB 3I2HA 1JYWA 3I2OA 1XNKA 2IXCA 5HV0A 2NP0A 1U5ZA 1MEC2 1OF4A 2HWB2 1S0EA 1K5MA 1QJEA 2QUOA 2XGXA 3HEIA 3PTYA 4CEWB 3ZFFB 4B29A 1OQDA 1UZWA 4Z07A 2GC2A 3K75B 3MZHA 1WLDA 1DQ4A 1KDKA 2BWCA 3AL6A 4XOGA 1MR5A 1UAIA 1WCDJ 4QX2A 1WD4A 3QLQA 1J3QA 3OUIA 4DUVA 5A3MA 3U0ZA 3TEYA 4Y20B 4FP3A 2DBIA 3IWZA 2VD7A 3QCWA 1GKBA 1K3IA 2ARBA 4LBLA 2ZBJA 4NPMA 4Q8LA 4Y24A 3H8RA 2K0GA 1RUH1 1HRV1 1ZRIA 1QJX1 1NX9A 3VBRC 1QIQA 1VMFA 4HKWA 4AHZA 4LO6B 3JCIA 1OLQA 1TMF2 2QQVA 3URFA 4M3CA 4AQ6A 2G9GA 1IS4A 3I7DA 4PDWB 4BH9A 2V5DA 2P34A 3MPBA 4XTMA 1NUKA 3H0OA 4FPGA 3ZFEC 2RDNA 4AVBA 5JOXA 4CEYA 5A7PA 4CCEA 4NPLA 4V1PA 1SHWB 3PU8A 4Q29A 5F2SA 5FYZA 2VZ1A 2PMWB 4YVWC 2DBNA 3POEA 5BUVA 5F9TA 3KHBA 2WR9A 4Z92B 1UN1A 4NWVA 4LO8A 2X05A 4DB5A 1ONAA 3HNYM 4Q0SA 1V6OA 4CE8A 4D6SA 4ISRA 5DXDA 1YFYA 2WNVB 2XUMA 2YG0A 2EALA 2YV8A 4N9HA 1RUD1 4Y22B 3VBOA 2BP6A 3AP9A 5FLHA 4XJZA 4QQOA 2BYVE 3MICA 1N1YA 4MZUA 1KFUL 2DVDA 2J42A 4RL7A 1RUI3 1HRI1 4KBZA 2D6OX 2EF6A 1O4ZA 2IZWA 1W2NA 3TB0A 4AZZA 1JZ7A 4NHKA 4GWIA 1CGPA 4KNCA 2WZ8A 2WA3A 5FLIA 1D4M3 3ZDSA 5ABJA 5JOYA 3ZPOA 1XOYA 4DEQA 4YYOA 4M01A 3U78A 3ZXFA 4D0QA 3CJXA 2HWF1 3C7FA 3VL9A 2QVSB 4ASLA 1DZRA 3RPQA 5JOZA 3MUZ1 5K9YA 1JZ3A 5CG9A 1MS5A 2ZX4A 1IS3A 5CFCB 3PTRB 4NRPA 1N1TA 4KL1A 4Y1XA 4RA0A 1IOAA 1I1EA 4XUPA 5BNNC 1HXS3 5C6CA 2OT7A 2VUJA 3KS7A 1UY1A 1SZBA 1XJAA 3H9AA 5FRAA 3PIGA 4CCCA 1CIWA 5LATA 3NNGA 2VY0A 2J1SA 1EUUA 3WNOA 1RHI3 3WP4A 2OQ7A 1SLIA 1LCLA 2WNUC 5EV7A 1XXNA 1H4GA 2GNTA 3WLUA 5LEKA 3USSA 2GC1A 1DU3D 1FNZA 2KR2A 4XUTA 5I0TA 3WINE 4HVOA 3L9JT 4NAMA 5IFPA 1KRIA 1AYN3 1D0HA 3HT1A 3QBQA 5SV5A 2ZX0A 4AQSA 4QGLA 4CA9A 2XKPA 2RS53 2AH2A 1OF3A 4INDA 1G9BA 2ZGMA 2YY1A 1H1AA 1W9YA 1DGWX 3NMBA 4NROA 2HWD1 3VBHC 3N9NA 1VRBA 3ZN6A 1QMJA 5KWRA 2HWE1 1Z7S2 4COVA 5J7MA 2JG9C 5D8AB 3IMNA 2E26A 1CAVB 2LROA 3PL0A 5JPNB 1OOPB 1REDA 1LB2A 5CKNA 3O1OA 1FI2A 5HPOA 3MF6A 2VR4A 4BCUA 1SACA 2WYFA 3GALA 3GM8A 4HG6B 4UFJA 2BGOA 2ERFA 2JB4A 3PURA 4MXWA 4HBNA 2ZEZA 3NL1A 4YM1A 1RUF3 4XMAA 3ZXEA 5CEHA 3RS6A 1YJLA 1N3QA 4JGZB 2R062 4COUA 4NJ4A 3ACLA 1IKQA 1P8JA 4N90A 1F31A 1S0GA 1LHUA 3NWKA 3EJKA 1MEC3 2HWB3 4JQTA 4HXCA 4LMFA 3QH7A 3TEZA 1HQLA 1WMDA 1LGNA 1FT9A 2B42B 2R7EB 3ST7A 3AFGA 3WNLA 4A45A 4OHYA 4M00A 5FZ7A 4E4HA 5FZKA 3ME2A 4ET7A 1DG6A 3C3VA 5I0SA 4D94A 3VDDC 5JI9A 1PM7A 4A4AA 1JYCA 3I3DA 4R4ZA 5DPNA 3RZLA 5F3IA 4AEMA 1TMF3 4UYBA 2Y60A 1J3RA 3HJRA 2VG9A 4HONA 3I8TA 4IEPA 4YW5A 1ZRFA 1PGW1 1U12A 2EVXA 1PGL2 5L9VA 1WZXA 3VZOA 2ZKNA 2BNOA 5L36A 3Q8FA 5LEJA 4HLTA 4I09A 4S2HA 2WSVA 1OQ1A 4LBNA 1PGL1 2Z5WA 1OSGA 2G19A 4AEKA 2B5HA 2ZGRA 1DLCA 5I8SA 4FFGA 4KBBA 3AJZA 2DYCA 2VL4A 1NE6A 4R9CA 3CEWA 1YI7A 2Q8DA 4R9DA 3THTA 2IXJA 2YPDA 2ZMKA 4QPIA 2OYZA 5JXHA 3A0NA 1RGSA 4GULA 4Q4Y2 3TRSB 3B3QE 5FZGA 3T2QA 4NR1A 3HIFA 2VH9A 3PMEA 3JQWA 1ENQA 4ZU4A 4W50A 5HCBA 1OMIA 3RMXA 1DGRA 4LBQD 3WNPA 3RYKA 1S0BA 1J1TA 1W6PA 1QOSA 3EO6A 1CN1A 2NMOA 2PHLA 1OPMA 1W6MA 2YMZA 3IDCB 4HK8A 3LOBA 4UF0A 1WW5A 2YYOA 2XXZA 4H3WA 3DL3A 3SKJE 1CAUB 4YFZA 5L7OC 1DYKA 2E7TA 2V73A 3LKJA 4L2NA 2D5FA 1BK0A 3J7MA 4MLOA 1NLQA 5EHDA 2Z79A 4QKBA 4ZZ5A 2ZOEB 4K6BA 3VBSB 4PIYA 4NPRA 3PVEA 4IXLA 2IXLA 4LR4A 2R071 3KCYA 5IAXA 4UWDA 4XFFA 1HV1A 1G9DA 4GZ9A 5FY5A 4MGZE 5A7WB 3N36A 4PLOA 2HJIA 4RS5A 4XCBA 2W92A 2RR12 2XL7A 1NLRA 3MPPG 3THCA 3RZGA 2XBO1 5KXDA 1ZA7A 4IV1C 3VDAA 3OY8B 1LHOA 5FBZA 4B7KA 1LGCA 2ARXA 3WDTA 1UD1A 1W6QA 3ZSEA 3H7JA 4FOWA 3VBUC 1UX7A 1DFQA 3IPVB 3WHUA 2Z2SB 1TNRA 1C4RA 4IGOA 4JHZA 4AQTA 2D98A 3H50A 2OPKA 4ASMB 4L9BA 4QX3A 4QPGC 5J09A 3ZFEB 2A3XA 2UY9A 5ISLA 1SLTA 4AGRA 5FZAA 3NV1A 2HBTA 4YGDA 5K0UC 3POWA 2QTWB 2ZEYA 2ZMLA 1W2AX 1POV1 5IAVA 2RJKA 3ON7A 5DAPA 4CU8A 4EN9B 1GOGA 4GQ7A 3BPSA 1GZWB 1CX1A 1S2BA 5FY8A 4LPLA 2WZEA 1WBLA 3ZPYA 5FWJA 1AYM2 5FY7A 4LORA 4PIZA 1Z7S3 4EWDA 1GLHA 1OT5A 1XYNA 1TEIA 4AFMA 4E2SA 2B39A 4SBVA 5BNOC 1VB2A 4D7SA 2Y34A 3S7IA 2JDYA 3HNBM 2EAKA 1M06G 1A78A 2XLGA 4GKYA 2VZOA 2RG4A 2PAEA 1W3XA 2VNVA 1RMU1 2JKBA 5FYUA 2VMEA 3ZIXA 3ZFGC 2ZGOA 3MW4A 4OUMA 2BDRA 3IZOA 2R063 1W8TA 1ZZBA 2AZ5A 2E31A 2VGDA 2GP5A 1E57A 4OZOA 3M70A 2DU1A 1SFYA 5A3UA 1JYTA 4MHUA 2DCYA 4AXOA 5IVYA 2RS11 3VZLA 2P3YA 1W2OA 2F4LA 1S0CA 4DNYA 2BV4A 1QOTA 4IV3C 4JTOA 3ZOIA 4LKSA 1ZRDA 2VU9A 4BQ3A 4CP2A 1ZVFA 1JYXA 1E5RA 1G9AA 1LOEA 5BNNB 5HCAA 1O59A 2RMU2 2ZEXA 1XSQA 1WCUA 3VZKA 1GR3A 4FP2A 2R1BA 4BMEA 2DVBA 3MYXA 4I0BA 5IVJA 5A32A 5JIUA 4D6QA 2JENA 3O12A 1ND3B 2SBAA 2DCJA 1OI6A 5FPAA 4EROA 1O3TA 1LGBA 4AVSA 4GJZA 4P9JA 1YNAA 3QACA 4M3CF 4BQ2A 5FPZA 4N43B 2D5HA 4DUWA 3WW4A 4PQQA 2W1WA 4UAPA 1CD3G 1UX6A 3CKHA 3NAPC 5T5OA 3KSCA 3U11A 4FPFA 4FXGB 3AKPA 2KM2A 4KGGA 4CVUA 1V6NA 1WLCA 1W6PB 1WLWA 3E97A 3UGHA 4A2UA 3O1UA 1UYXA 5LASA 2JG9B 2YU1A 3ACIA 5JSPA 3AKQA 1RL3A 2A6WA 1XNCA 3LA3A 2GNDA 2PHXA 3FUQA 3K3OA 4Q4Y3 3ZXLA 4XAEA 3BODA 3M3CA 5F5AA 1SLCA 4XF1A 1YXWA 2A70A 1QQP1 1YQCA 1AR91 1VBD1 1NY72 5KXEA 1BMV2 2L9LA 2GMMA 1AL21 4RR3C 3UESA 5ANNA 1WKYA 4ZY9A 3KV9A 3K2OA 1MZFA 4GKXA 2FDIA 1PMIA 2FQPA 5IVFA 1GZTA 1QXPA 2I74A 4YG0A 5FTTC 1DF0A 2WO3A 4XXAA 1BJQA 1W8WA 3BTXA 3VL8A 2DU0A 4QDSA 3J9SA 2ZHNA 1O3SA 2GMPA 3LD8A 4E4DX 4BM8A 4OI0A 2ZAAA 2WWJA 5C3RA 3SCHA 3V0BA 3A7QA 4O7XA 4MH0E 5JCTA 3BGAA 1YQ8A 5FP4A 1OURA 1W06A 3ZDVA 5EXOA 1QH6A 1WLTA 1YQ6A 2RR13 4QXBA 4YVSC 5IW0A 3WSOA 1RC6A 1ZBA1 4JTNA 3NV2A 3O7OA 3WCSA 2P3KA 3LGRA 5JPMB 3AM2A 3W5NA 2JDMA 2EICA 3VKNA 1AR72 5FK7A 3WW3A 3K51A 4GWJA 3GGLA 3VBFA 4YNIA 1ZRCA 3CL1A 2KA3A 3ZR5A 1V9U2 3WR0A 3RYRA 1ODNA 1Q8VA 1UIKA 3KD4A 4AGVA 2NYYA 4OHZA 5A1LA 5A6ZA 2VZPA 3Q8EA 4OI4A 1HB4A 2UY8A 3JBG1 1B09A 3DGTA 4QGNA 4LUMA 2KD7A 3H1MA 5F3GA 3OGRA 4JGYB 5JZGC 1EAH2 3E5QA 5E1RA 2UWAA 1BEV2 2QQLA 4CDWC 1W8UA 2E7AA 1IZ3A 2VW2A 1E5HA 1OUXA 1AXZA 1R1ZA 2XVGA 2D3SA 3C7HA 3MLKA 1AYM3 3B00A 3ENRA 4ONUA 2W5FA 2XJUA 4OULA 1Q3EA 5L9BA 1I5ZA 1PVC2 1AZDA 1G7YA 3OUHA 1UOBA 2PN5A 1POQA 2VTXA 2VC9A 3HD8B 1UXXX 4KH9A 1NCRB 2VW0A 4CCNA 1W0NA 3B7MA 4XW3A 5FP3A 4EV0A 1TVGA 1UYZA 1CZVA 2FDGA 3LWCA 2FDFA 4F7ZA 1YRZA 4CUBA 1F35A 1H8TA 1CJPA 1T6BX 2Q30A 5C70A 3B94A 4AVTA 3EYPA 4BISA 1WD3A 3N7JA 3ZKYA 4C0BA 2LRPA 3N9LA 3GF6A 1PVXA 3KF5A 5FXVA 5HBAA 3LE0A 4LBQA 4E9KA 2B4KA 5IYYA 1XE0A 2W94A 4CP9A 3WVJA 5A6XA 3FFQA 3LOIA 2LM3A 3VGIA 5IK5A 4LE4A 2VZRA 2TNFA 3I3QA 2BOIA 3OJBA 4RHV1 1YQ5A 3KV4A 1W05A 3T4HB 3WUCA 3ES4A 4ATFA 2LALA 1LHVA 1Y4WA 3BTZA 3MFAA 2RMU3 4I0WB 5AC92 5FQ0A 2IVIB 3O0VA 1ENXA 3VBUB 4EYUA 5DDJ2 5E89A 1G8WA 3BPZA 1AVBA 1CZSA 3HQXA 3VKMA 3WQ7A 4QPGB 5EJZB 5GLUA 4JRAA 4S2DA 1SLBA 5DUVA 4XMIA 4GB32 3MIHA 4BK4A 4XFBA 3D0SA 4CU7A 5FLJA 3NJYA 2WC2A 4GWNA 2JDKA 2X5IC 4HSJA 4IGQA 3GDBA 2JDUA 1UYPA 2XJPA 3FL7A 4OHWA 1W04A 1H2KA 1H4HA 2PAMA 3FC0A 1AXKA 3LEMA 4AI0A 5JIAA 3J8F2 3ZYFA 3PLQA 3ACHA 5FJKA 3VZMA 4RSUA 1UPIA 5FJHA 4AR2A 3ZFFA 4CDUC 4CEWA 1OA3A 4IW3A 3W9AA 1LNSA 1O8SA 4LOSA 2NM1A 4P9IA 1B35C 4YM0A 4AYUA 5C4WB 1MVQA 1UZ0A 3MIGA 3VHRA 2GC3A 2A5ZA 5FZDA 1ZZ6A 4UW4A 5IK8A 2B9VA 4LOTA 1RB8G 4LK6A 2VZSA 1SFNA 4KMQA 3KCXA 3I2JA 3ZXKA 3PUAA 2PHFA 1GV9A 3THPA 4BE3A 1VBE1 1PK6C 4M4PA 4PLNA 1JU4A 1XU2A 1L7QA 2BTVC 3BALA 1X7NA 2HKXA 2OX0A 1ULGA 3WG4A 3AP5A 1LOBA 1LRHA 3CJIA 4GAZA 4PDWA 4QPYA 5FZLA 1BKZA 2V4VA 5DN2A 2YBKA 3KT7A 4IV3B 3WP6A 4PHZA 1JXNA 1VBA2 1VAMA 1J59A 1RUG1 1AHSA 4XZUG 2Y6FA 5I0DA 5BXXA 1ZBA3 3V0AA 1IGOA 1OFSA 2XG3A 4L99A 2R6QA 1SFPA 2EA7A 2VQUA 4OMDA 4IETA 1GMMA 4NE9A 2J1UA 1ULFA 1CAWB 4LKEA 4P08A 4D3WA 4G3YC 4Y22A 1AR73 2JB8A 2RJ2A 1JN2P 1KS5A 1C5IA 5GM0A 3DPRC 1COV2 4XJWA 4B4RA 4ES9A 3UKTA 1URXA 5CISA 1ALYA 1V9U3 3CF6E 2VQTA 1VRH2 1EP0A 2QJVA 2YC0A 1NA1C 4BK5A 2W1UA 4ZPIA 1ULCA 5F5IA 2ADEA 3T2PA 2J1VA 4CPBD 4R52A 3ILRA 5M0TA 3G6JB 1W9WA 3HR9A 1BK1A 1E5IA 1EAH3 2EAAA 1BEV3 1FPN2 1KGYA 1PNGA 2D6MA 1K5MC 1UWWA 1ULPA 3KHCA 1BMV1 1TE1B 2ZZQA 4RQPC 1D0GA 1I6XA 2CGNA 2WWSA 3WEZA 3O1SA 3M8LA 3OGVA 3W58A 2A73B 3AMMA 3NW4A 1R1A1 2HEVF 4EN8B 4JDNA 4I3PA 4YSFA 2QQKA 1DQ5A 4A3XA 1PVC3 2HLEA 4GMP0 1EV12 4UI9L 5FYBA 4E8DA 4QD2A 4JV4A 3NV3A 1ULOA 3T30A 2Y6HA 3KQRA 3POJA 4ZXEA 1PX4A 4UT5A 1J58A 2XHNA 1HJGA 4HL0A 1OH3A 3RJRA 4D69A 5FYTA 4BPZA 1TG7A 1JHNA 4XDOA 4MXVA 5FYIA 2ZGQA 4ZS2A 2VVEA 1MZ5A 2X53S 4JZRA 4XFIA 4XURA 4CEYC 2GALA 4WV8A 3I49A 4XF0A 1UF2C 3U37A 1EPWA 5D1IA 5FPVA 3WHTA 1US3A 1L7LA 1W8OA 5FQ0B 4H7MA 3TNQA 3WD5A 3J4UH 4HKLA 2VZVA 4IEVA 1QH7A 2WSUA 3OSDA 2KXLA 5JXJA 1GP6A 4MYEA 2WS92 3RDIA 3A22A 1UU4A 1RJ8A 4YVSB 2PHWA 3N7MA 4NIIA 3ZYHA 2WDBA 2VCBA 5AC93 4GD4A 4F8AA 2CGPA 2PQQA 2K46A 2PELA 1XNDA 3D8CA 4K8RB 5DDJ3 5D8AA 3LEGA 2CNAA 2BBAA 4LO5B 5FP7A 2PQSA 4AHWA 5A33A 2ET7A 3LDKA 4G4FA 1OOPA 1ZBE1 3K4ZA 1LR5A 2JE9A 4TSVA 5EFUA 2CDPA 5DAQA 3WG2A 2IXIA 4GB33 2ZHKA 4Z2AA 2PTMA 5B4NA 3FLPA 1U5IA 2BOJA 3BVCA 2JDHA 2X29A 3CIHA 3SNMA 3ZXAC 1NXMA 4DPNA 2G9FA 4H55A 4DZGA 1C3HA 4JGZA 1JUHA 1RUH2 1HRV2 1QJX2 3H3LA 5C8WA 4DUXA 4HPKB 3FZ3A 4QQ2A 2BJSA 5KHJA 2XR4A 3MIFA 1BCXA 1DZTA 5LA0A 3J8F3 1EUTA 5F39A 2QQJA 1VAKA 3VD9A 2R041 5C9AC 2Y33A 2D93A 2PLV1 2EIEA 4WM7B 4U36A 4Z82A 4YM3A 5JR2A 3T1LA 1QY4A 5HV4A 3CJIB 1N1SA 1OD5A 2CV6A 1WW4A 4EJRA 4LTAA 4AI9A 2VBPA 4J6GA 2AEYA 2VOXA 2HBUA 4UW5A 5DAVA 3WP3A 4LLFA 3PHMA 1G9FA 3AZWA 1JH5A 3V0AB 2B45X 1IS5A 1SDWA 1O7FA 1DQ0A 1PM4A 2WNOA 4FI9A 3JZVA 2E53A 4Q4X1 3UYJA 1RUD2 4XIKA 2XLAA 4N7IA 1V6KA 4BHPA 4FPYA 5GALA 2VMGA 4KU7A 1SQ4A 4E4ZA 3VUOA 1NQJA 3W5MA 2DV9A 1Y9MA 2ES3A 2W08A 2W95A 3B5LB 4J1WA 4LKFA 4TYSA 3POYA 1NCQC 1VBA3 1HRI2 2GNMA 3I3EA 1Q8PA 1HW5A 2JECA 2VBBA 2RS31 4OQ8A 1BYHA 1ENRA 5FZFA 2W3JA 5C8CC 1UKRA 2Q8CA 3J7NA 2C24A 3PJQA 2HWC1 3E1F1 4E4SA 5FPLA 1CZTA 2HWF2 3IMMA 5JMOA 5B2GB 1JYNA 2AC1A 5C33A 1OQEA 2J1RA 1COV3 4MOAA 3AVRA 1YO8A 4NIAA 1W9SA 1OC1A 5I8TA 1XNTA 1VRH3 3O5SA 4LHLA 2Y8KA 1YFWA 4QGMA 4KG0A 4FOYA 5FKBA 2IC1A 5FZMA 5H9QA 1NLSA 2XWJB 3MUY1 4KQ7A 3RSJA 3H42B 5DAWA 3RJ2X 5IVBA 2W9XA 4Q0VA 3CBNA 2ZGNA 1RJ7A 1FPN3 1R1A3 1IS6A 4M0HA 5FP9A 1AJKA 5HCFA 1WMEA 1CAUA 1V70A 3OOXA 1QGLA 4JKMA 4KWUA 3HPNA 4FOQA 2R32A 4JHTA 3LIGA 3FX3A 2JEMA 4FFFA 4UFHA 5CFDC 3ZSJA 3WNKA 3VBSA 1EV13 3TNPB 5I8YA 1YIFA 3H7YA 3HQUA 1UYYA 3MLLA 5A7WA 3I2IA 4IE6A 3PIJA 1WW7A 4K1YA 3LB9A 2IFWA 2GC0A 3KGZA 2W52A 1JZ5A 2VOWA 4P02B 1N47A 1O91A 1O8PA 2HWD2 1CESA 1AUYA 3MLJA 3AP7A 3OY8A 2QQNA 1SLAA 1X8EA 4CYDA 2QQPA 2HWE2 1FMD2 2GN3A 1X36A 5L19A 1OHFA 5FY1A 3FHQA 5F7UA 3IPVA 3DECA 5J36A 4WM8B 3F2ZA 4NHLA 5JWPA 1FMD1 1IKPA 2C9KA 2JJ6A 1X9TA 1NZCA 3C7GA 4QB1A 4LA3A 3ZFEA 3MDPA 5FYCA 1KS4A 5FFOC 5A33B 3RFRA 3RRDA 4BLIA 1RUC1 3B9IA 4CZSA 3FFZA 3OEBA 2WS93 3UNPA 2PHTA 3IDAA 4QPIC 4PBOA 2YGMA 4XABA 5F6KA 1GZWA 1CVNA 4QM9A 3WP5A 2GH2A 3VD3A 2OUJA 3WF4A 2A7AA 1OD3A 3TBDA 4HSLA 4WBBA 5EQUA 2W68A 1D2QA 1SPPA 3P3PA 4Y5SA 2I2SA 4YGEA 3SCGA 4AK3A 2DFCA 2DURA 5BYNA 2C6SA 1NA1B 4FTEA 3GYDA 5DG2A 4GH4B 4H14A 1JMUB 3OPZA 4CDXC 3POGA 4IEZA 5BNPB 1OUSA 3KM5A 3RVHA 3P5BA 4XZPA 2IVJA 1OLMA 3KQ4B 2YBSA 4EZ4A 2CU5A 1QNYA 1OBNA 2E32A 1RUH3 1HRV3 1G86A 2JG8C 1KDMA 4XUQA 1QJX3 4MX3A 4XDPA 4R9BA 2PLV3 3AKTA 3B69A 4RS5C 2D7FA 3MF9A 5J48A 1FV2A 2R49A 3B01A 4E8CA 2DWRA 1QJU1 2WT0A 3E5XA 3POBA 4CPBA 5FKCA 3RZZA 2RJLA 2RDQA 1MS1A 1PGW2 3AL5A 3BN6A 4NHMA 1GQGA 4IEXA 4IERA 5APAA 3IIAA 4YZ3A 4Y5Z0 2FHRA 1XRUA 3DYPA 4AFDA 4B1MA 4CSWA 5BNNA 5LA1A 4AG4A 5KXCA 5L73A 3ZSLA 1XPWA 5LBFA 2IFRA 4UFLA 4JCKA 5CA6A 1BBT1 2JDNA 3HBZA 1K5JA 1DBNA 4NAOA 4BYYA 4C91A 1RUD3 1V0AA 5E16A 4JQRA 1IG0A 5FIXA 1SLLA 1ND3A 4XBNA 2ORXA 3OGSA 4YW7A 1AJOA 1LOAA 2NPIA 1CIYA 2CY6A 3DKQA 3H3ZA 1LKNA 1UMHA 4FCAA 4N43A 4OI2A 4CCJA 1H1MA 1HRI3 2FDJA 4TZDA 1T6GC 3T08A 5L9RA 1ND2B 1ZREA 2Y64A 5CADA 3JXSA 5DAXA 2VJXA 4KWLA 5EJ3A 1Q56A 3WY6A 3LCPA 4QX8A 3T2OA 2FCTA 2RDSA 2VQAA 4ZU7A 3NJXA 4QX5A 5FMCA 3AKRA 2MPFA 2OPWA 2JG9A 4CCKA 4OCTA 2HWF3 5FZOB 1W0PA 3UGGA 1SEFA 2R072 4XEZA 3F95A 2ZGLA 1QNWA 2RE9A 2CYFA 4BZ4A 3FBYA 4XACA 5C71A 3BUCA 4QQLA 5GKAC 2EXJA 2XBO2 3X29B 2AYHA 4YLZA 4I2OA 1JBCA 2XUEA 3KGLA 3WOGA 1Y43B 2GH8A 4NRMA 2VOKA 2Z4FA 4NWWA 4QHZA 4XPVA 2PXJA 3C2UA 4IE7A 4YW3A 2Q1FA 3WF1A 4TN7A 3VBRB 1EY2A 3WT3A 1S0IA 1QJY1 1RUJ1 3A23A 4I01A 4Y1VA 2FMYA 4J25A 4W8JA 3JD71 3BIEA 1GOFA 1W03A 1F2NA 1OLRA 2XOMA 3MIBA 2QNKA 5JVVA 2HWD3 5B4XA 4YVWB 3AB0A 2AREA 1RUOA 3IAPA 5SV8A 3OGGA 1F15A 2C5DA 5C3SA 2ZX3A 2HWE3 1FMD3 5GLZA 3ZMNA 3BTYA 2YUEA 5GLTA 3ZX7A 1UIJA 1SDDB 3M3EA 5CU1A 5F6LB 1S2EA 4AEDC 3RGBA 4CDQC 5T5PA 3K77A 4BQYA 1SPPB 2D6NA 1NCQB 3GZTB 1W99A 2VMFA 4N53C 2B9UA 4HN1A 4JGYA 1DQ6A 4BOWA 3H1YA 3MW2A 4MHRA 1RMU2 2BNNA 2ZJCA 5T5LA 3UKVA 4HOOA 4XILA 5GZFA 1Q43A 2WAOA 5C8CB 1VE0A 4Y1YA 3BTAA 2K2SA 4P5YA 1AX1A 1MS8A 2DVFA 2ARCA 1VBB1 2VUDA 1LEMA 3WZ1A 1FOD2 2RS12 1QKQA 4DXTA 4LE3A 3N4MA 1BZWA 1Z0HA 3ZR6A 5FZBA 1IPSA 3I2FA 1YCIA 1QDOA 1U5YA 5JSOA 1NCRA 1FOD1 3M7AA 4O61A 2DDUA 4JRLA 1WCQA 3APBA 4LBJA 4B3NA 3RZKA 1LOGA 2ZAHA 2D3RA 2WN3A 2VXJA 1ULEA 2P37A 3RI8A 3IAQA 2ZHMA 3AYAA 5KXBA 5LRRA 5LA2A 3KV6A 2B7YA 4E2QA 2E63A 4ISQA 4JKKA 2YFZA 4DXSA 2VNGA 2XONA 5C5UA 5DG1A 2WNUB 2A71A 3K4DA 2PFWA 2Y26A 4FPHA 2NQYA 1IHMA 1Z78A 2Y6KA 1APNA 2Z42A 2VQ0A 3RMYA 5C3PA 3RZMA 3ILNA 3M1HA 4BU2A 5BV6A 1IPJA 5FMDA 1BLZA 2Q5TA 4RFRB 3QOPA 3NQHA 1UMIA 1C8M1 1FYUA 5FY4A 4IV1A 4DRRA 5FOBB 2DFBA 1ZZ8A 2DTWA 3BKZA 1AR81 2BRTA 3VKLA 2DUPA 3VBUA 4K3UA 1GUIA 3B93A 3VBHB 3FE5A 4IESA 3V64A 5JAXA 1GQPA 3ORJA 3VB9A 3MO4A 4QPGA 4MSVA 3AXEA 4OFGA 2W87A 3I3MA 3FJSA 2WQ8A 2WAAA 1UO9A 2FZ1A 2ZABA 3A0KA 1GNZA 1UCXA 1YC61 2FCUA 3TN91 2RM21 4O9EA 4AI2A 1QQP2 1AR92 1VBD2 5GZEA 2ZZJA 3LEIA 1STMA 1O5LA 1AL22 4QKNA 3INAA 4XE9A 4BIOA 3HN1A 3CHXA 4ASKA 5DZEA 3CZUA 2NMNA 3C8XA 4MUVA 1Y3TA 1LENA 3WQ1A 2YDEA 3WDWA 4Q4W1 1HB2A 3AZVA 3KMHA 2BW8A 3R6SA 1W6OB 3B9CA 1FX5A 1KEXA 4A42A 4LBKA 5F5CA 1MS9A 1ODMA 1Q8QA 4P14A 4XJAA 2E33A 3TYJA 2R073 1UNBA 5C4WA 3BOPA 1VIWB 3T4VA 1LU2A 4CDXB 1W2UA 3HQRA 1JUIA 3SEEA 5DMYA 3N7KA 5LRSA 4PI0A 3ILFA 2VZQA 2OW4A 5LZ6A 2XBO3 3BYWA 1ZBA2 2CL2A 5FYSA 1HKDA 2V09A 2F6BA 2VOVA 4Q4V1 2EIGA 1NOVA 1GNHA 4NN0A 5IVCA 4C1XA 2D3PA 3WDVA 4BJ0A 3OGJA 1HJFA 3MEPA 3VDDB 4B4PA 2FBEA 2A75A 5A70A 4IE4A 3SH5A 5GZCA 5FP8A 4ZZ8A 2YHJA 4IV3A 5FYVA 3SEPA 5IK7A 5EZWA 1O3QA 4OUEA 3JBG2 1TME1 4AFCA 3KVBA 3JUUA 4DMIA 3GHNA 4LA2A 4QHOA 3MIDA 4NHYA 3FLTA 5ACA1 1POV3 4W6XA 3LEKA 1XQNA 1I9RA 3VKFC 3ZYPA 1GFF2 1VMJA 1YLLA 2WFF2 3WF0A 1CAWA 3UK9A 4FBFA 1MVEA 3VD4A 1N3OA 4RYDA 1DYOA 2ZGUA 3DKWA 4HANA 1JHJA 3J7LA 4IEOA 2PHDA 2WFF1 2WZR1 2H0BA 3NNFA 2FCVA 3GBFA 4EWEA 5GJ6A 5GZGA 3ZO0B 3OEAA 3ROUA 1GP4A 1HN1A 4I0AA 1CJDA 1UY0A 2A6YA 4HKOA 1RMU3 2WZPP 4BXSV 2X8KA 4Z8BA 2P3JA 3ZFFC 4B7EA 4BB3A 3DXTA 5A3PA 1WMFA 2XH6A 4TXWA 5HXVA 2UYBA 5K8SA 1A8MA 1HB1A 1PZ8A 1XYOA 2ZKLA 4COZA 5FZ4A 1FOD3 1LULA 1QHDA 2RS13 5K4LA 4FFIA 4ATEA 1H6XA 4QXKA 4WVVA 5L7OB 3EQEA 3RWKX 2PHRA 1MPXA 2QDRA 3BU7A 2CGOA 4LT5A 5JXGA 4RHV2 5EPAA 1VALA 1ASJ1 3GZAA 4RR3A 2LS6A 4QX7A 5FMOS 3S5AA 4Y33A 3SHRA 2DCKA 1R64A 1MZ6A 3AZZA 2P5BA 5H9SA 4PDWC 1KD7A 2GU9A 3ZSMA 2W47A 5JR7B 4YFWA 3A4UA 2FDHA 1J83A 2Q1MA 1J3PA 2UURA 4IV1B 2R1DA 1LOFA 2GDFA 4SLIA 5D2AA 4N7UA 4OMCA 4CXYA 1OKOA 4XUOA 4IDZA 5JUVA 4Z1VA 2CTVA 4MGQA 1BXHA 1WGPA 5A3LA 2VNRA 2PA7A 1XYPA 5FO7B 5FWEA 3FLRA 1GWKA 4AVAA 2WNVC 5LY1A 1YHFA 1VAVA 4YVSA 1VPHA 5K0UB 5FY0A 4QAWA 2HYKA 1ACCA 3LDBA 3OBZA 3V56A 5JOWA 5IUQA 1UKGA 1GBGA 2IUWA 5FBJA 4FAHA 5LW9A 5JLVA 1IQAA 3D5OA 1N1VA 1UQXA 2XHKA 4PI2A 2A1XA 1YQ2A 5BNQA 3O1TA 4JVAA 2D6LX 1H6YA 1IPKA 4AI8A 4QU2A 1MQTC 3VHOA 1ZNPA 4JAAA 2YFUA 4BXFA 5K7PA 5EP9A 4CDQB 4NUBA 1LJ7A 4B1LA 5AFBA 4M3CE 5DQ0A 2IWGB 4IEUA 3RG0A 3O1RA 1CQ9A 5I0UA 1QQP3 1R081 2IXHA 4XBQA 4GMP1 1AR93 5BNOB 1VBD3 2UYAA 4XVHA 5JZGA 3OF1A 1AL23 1PIV1 1S2KA 4GIQA 3USUB 1PZ7A 2VVDA 2QE3A 4R8HA 2VM9A 1ST8A 1VBE2 2FMDA 2GSYA 2J1EA 3MV01 4HPKA 4OVEA 1DYPA 4XTPA 1ZYBA 1KFXL 2Q8EA 5CFCC 3ZFGB 3D4KA 1ZZCA 2X09A 4XYXA 1ZM1A 2WYSA 3ACGA 1WUVA 4Q0PA 1W3VA 4AEJA 3I2KA 5F2WA 4KU8A 3UGFA 3W20A 4WM7A 5G05L 5A1AA 4I30A 2D40A 2VZ3A 3WW2A 2R16A 5LK7B 2BBVA 1RUG2 3S5QA 1X50A 2Q0AA 2BPA2 2NN8A 2QQOA 1CPNA 2BGCA 4LO4B 1LTEA 1VMHA 2W2IA 3NNJA 4V2WA 4XQDA 4XJ9A 3AMPA 4NIHA 4ITCA 2GP3A 2F17A 3GBGA 4E27A 1D2SA 1NKGA 2GAUA 2OZJA 3T0DA 4XF9A 4FAGA 5ANQA 2QKDA 4XFCA 3KWVA 2H0VA 5FZHA 3SITA 2OKXA 2DVGA 3HBKA 4G9SB 2C9AA 2RDRA 5GLWA 2WO2A 4P5HA 5H9RA 3JQXA 4DIQA 2A6XA 3JBG3 3U10A 1CPMA 1TZOA 1UW8A 4Q0QA 4HETA 3KB5A 4TLGA 4L97A 3LA7A 5D8AC 5GZDA 4JC1A 1JOBA 3AP6A 2R30A 4FPEA 4DFSA 1V6JA 2VUAA 1A8DA 1UU6A 1OOPC 1W90A 4Q27A 1AXYA 2WFF3 5T54A 3MW3A 4CCOA 3NAPB 1R1A2 4LHKA 1DGWA 4MGIE 5CYYA 2XJTA 3AX4A 4QB2A 3BU0A 2AENA 3PDQA 1XNAA 1J1LA 1F4HA 2QQIA 1RUI1 2J1AA 2JD9A 3IT8A 1BQPA 5D21A 1A6CA 1XE8A 1UY2A 2ZGPA 1VBC2 1NAEA 2DTYA 2ZGKA 4JGZC 4F3JA 4XF3A 2I45A 4FPLA 2C4XA 3ZM8A 4KWKA 1PNFA 3WG3A 1VJ2A 1DHKB 2VULA 3NJZA 1JZ6A 3T3YA 1VBC1 1D4M1 5JMCA 2XKOA 4CTEA 5FZ8A 3SLIA 1NYWA 1VB4A 2CAUA 3SXWA 1K45A 4RR3B 1OA2A 1DP0A 1PO22 1DCSA 4WVZA 3ZKUA 3ETPA 1T2XA 2OA2A 1HQWA 3T1MA 5E8AA 2WBKA 3C7EA 3Q8AA 2ADDA 2XLFA 4LITA 4YGCA 4YG3A 4XDQA 3V65A 1PO21 4AE2A 3WF3A 1HXS1 5DABA 2XDVA 3GZEA 1BVP1 2NZ9A 3N35A 2I07B 3Q8CA 1L3JA 4RHV3 3VD5A 3S30A 4UBHA 2W46A 5BY5A 4LHSA 2YROA 1Y7BA 2GMEA 3OYWB 4YZ2A 1RHI1 4HFSA 2YC4A 2UWBA 2WIIB 3CU7A 4D8MA 4C1WA 3M4FA 4LO7A 3VBOC 2ZGTA 3IBMA 2XVLA 5F5QA 1SBDA 3EXUA 3VLBB 4N8MA 3VD7A 4OHXA 3UJOA 3ZYBA 4QT6A 4LLOA 1QJFA 1AYN1 3N9PA 1H30A 1M4WA 2IXKA 4WM8A 4MV2A 3CMGA 3T0AA 4LK7A 4XUNA 1ZBE2 3OG2A 4M0NA 1RINA 2VCCA 2FD8A 1JTZX 1FNYA 2RS51 4ZHNA 5C5TA 1KXGA 1YUDA 2HYXA 2CDOA 5LB6A 3WV6A 2VMHA 5EYYA
chains in the Genus database with same CATH topology
1S1AA 5ABJC 4TLFA 2NLRA 5JZGB 1F9KA 5J37A 4FT8A 3AYEA 3AFKA 4CDWB 5CVRA 4YGBA 1AL0G 2R042 1LOCA 2PLV2 1HLCA 4GMP3 1NA1A 3GNEA 5DZGA 4GH4A 2WL1A 4UW3A 1RUF1 4BWOA 5BNPA 1X8MA 4CP0A 3VBSC 4OUSA 4RQPA 2CWMA 3CLPA 3OCPA 1VBE3 1MEC1 2HWB1 2TBVA 3E5UA 4Q4X2 4KGQA 4L11A 3IDEA 3T2TA 1GZCA 3I59B 4WVMB 3NO8A 1A3KA 1MS3A 4GWMA 4AFBA 3NKGA 1RUG3 3L2YA 1HDKA 2ETEA 3PVNA 4PJYA 2RS32 4DINB 3R05A 4LBMA 1TNFA 1YJKA 4IQPA 3N7LA 1TMF1 2HWC2 3NV4A 2BFUS 1BVVA 3H8UA 4U2AA 1Y9QA 3AZXA 3ZXJA 3ZVXA 1GICA 3FMGA 4FTBA 3UKNA 2WINB 1UZYA 1RIRA 5T5JA 3WW1A 2XB6C 2BVBA 3AMHA 5AVPA 1ZRRA 1ND2A 2TEPA 5T55A 1PO12 1PHMA 1C5HA 2O8QA 3E6DA 3POSA 5H9PA 3VHPA 1KITA 5FOJB 4I3GA 4OLLA 5KHIA 2X5IB 4Q8KA 1PO11 3R0RA 4PLMA 1MQTB 5KBFA 2BNMA 3KZ4C 3AP4A 3ZXGA 4YRDA 3AMQA 2P3IA 2QFEA 3U4XA 1VBC3 4H7LA 4CDUB 2A3YA 2A6VA 2OIIA 1B35B 2D6KA 3UL2A 3UV9A 1UU5A 3I2DA 4AI1A 4E2GA 1DQ1A 2VVFA 4YZ5A 4A7KA 1U0AA 1W0OA 1OA4A 3LSEA 3VHNA 1PO23 4K7JA 1LEDA 2DCZA 3P3NA 4WZFA 5C9AA 1PK6B 4W6WA 3VBRA 1VR3A 4ZU5A 4X8PA 1FATA 4PCRA 3H3UA 1RUC2 2WT1A 1XNBA 1XE7A 1ND3C 3M2MA 5FMOL 2BQPA 4YVWA 3HAGA 3AK0A 1EYBA 4MGYE 1C28A 4NOTA 2UWCA 4N43C 1QDCA 1W6NB 3RYPA 1S0DA 1ZBE3 2F4PA 3I54A 3DPRB 1NCQA 1OKQA 2QZ2A 3ATGA 1PZ9A 2WFPA 4Q1RA 2XJQA 1AX2A 1LECA 2Y0OA 2V5YA 5C8CA 1Z7S1 3K48A 4CRQA 2TUNA 4XQ4A 1H9WA 3TAYA 3VKOA 1K5MB 1C57A 4OI1A 4RQPB 3ZXDA 4C90A 3W59A 1KQRA 3BIWE 1QJU2 2R043 4MVTA 5TSWA 4B8EA 4S2GA 1NE4A 4WVWA 4CP1A 1JYIA 2W0XA 1RUE2 1MS4A 5CB7A 1GZ9A 3RWNA 3O0WA 1LESA 2AR6A 2R061 4K8FA 3ZYJB 1RUE1 4N9IA 3H1WA 1BBT2 2ZACA 3D0JA 1SCRA 4XFGA 2R0FA 3DN7A 4FQZA 4M3CB 2Q4SA 5EWSA 1TQ5A 4Q4X3 5KHHA 1F5JA 3KCCA 5CFDA 2WT2A 4TWTA 3D82A 4UW6A 4CEYB 4AQ2A 5T52A 1NXD1 2WNUA 2VPVA 1HQNA 4UBGA 1MACA 4AGGA 3IDBB 2H6BA 3AZYA 1H2MA 2AGSA 2GN7A 1C1FA 5JSRA 1DDLA 2RS33 3ALQA 4LEJA 3S7EA 3MGUA 3PMSA 4IEYA 4QHBA 3VBOB 3ZYRA 3KT4A 2HWC3 3CNAA 2DUOA 1H8VA 4A7ZA 3VBHA 3ASIA 5BPXA 1WW6A 4JGYC 5FO8B 2WLQA 4QQPA 4EN6B 3DUIA 2ZHLA 2YXSA 4B4QA 4FQ4A 2CWSA 3FBMA 3VZNA 4XJUA 4D7YA 4IEWA 5J3UA 4PQ9A 4Q0UA 1ENSA 1X82A 3AYCA 4YW2A 1DGRN 1O4YA 4XHXA 4BLJA 1S0JA 3M3IA 5ABJB 5FPXA 1PO13 4KWJA 3SH3A 3FHIB 3SISA 2E7QA 4Q4Y1 1NCRC 4BIFA 1W6OA 1Q8SA 4Y4YA 4AHXA 4YARA 2P2KA 5CBLA 5T50A 1DQ2A 1GQHA 1F5FA 4LNVA 1QJY2 1RUJ2 4AEKA 3SMHA 2ZS6B 4HT1T 2ZGSA 4YW1A 1MS0A 4CDXA 5C9AB 3VZJA 4C0HA 3JD72 1DGLA 4Y1UA 2O1QA 3ZN4A 4Y1ZA 3TWIA 4AVVA 1V6LA 4AVCA 2JG8A 3QD6A 2BEOA 1VLNA 3VV1A 1S0FA 1O3RA 5KHKA 2ZTNA 2XJSA 5CAZA 3VDDA 4P9LA 1CONA 4FO9A 4AFAA 4XHBA 2ET1A 1AF9A 2RR11 5IT6A 1RUC3 4HK9A 3ZN6B 1QOOA 2PYTA 2LTNA 4F83A 1GANA 3RI9A 1LODA 5FREA 5I91A 3GHMA 3E6BA 1VBB2 2XPJA 2EXIA 4K21A 1QXJA 2K9ZA 5KHGA 4XFAA 4A7YA 1Q8OA 2B46X 1JW6A 4HZFA 2D44A 4MXWB 4Q2FA 1AYM1 4YZ4A 3S6PA 5JDBA 2DF7A 4XFHA 4DXZA 3ZYGA 5C4WC 1HIXA 3WDYA 1O4TA 2ZPXA 2XJRA 2XJVA 1QJU3 4FPJA 4L8QA 1QWRA 5L7OA 1UL9A 4HVRA 4OHVA 2DUQA 5CFDB 2JICA 1SBFA 3MFCA 1RUE3 4DOUA 3ECQA 1C8M2 4PIXA 4FSJA 4FPKA 1AX0A 1AR82 1OPOA 3AJYA 3VBFC 1BBT3 1LHNA 1RVF2 1H2NA 4HVQA 2WA4A 5J96B 3PNAA 3R4UA 1ULDA 4P9XA 3RZZA 2JE7A 2D97A 2D6PA 4W6YA 4XBLA 3IKWA 2C0ZA 1CAXA 1RVF1 3TN92 2RM22 4Z2WA 2WQ4A 4XETA 5FO9B 1QU0A 3WCRA 3SCFA 2ATFA 1C8NA 1GYKA 2RMU1 5K0UA 1REFA 4OZXA 4X6QB 3GZUC 3R4DB 4QPIB 3WDXA 2N7GA 1YYNA 4Q4W2 5JI7A 1POV0 1RITA 3HT2A 1H1IA 1X33A 4GXLA 4Y26A 4X8NA 2BFUL 4LUKA 4AEDA 4K1ZA 1YI9A 4CDQA 4PF5A 3NVCA 4Q26A 4EN7B 4N53A 5BNOA 3OBTA 1LHWA 1W6MB 3D6EA 2GZWA 2G4IA 1H8TC 3J26N 3USUA 5CG8A 4AI3A 3WX5A 4Q4V2 2E6VA 4AHYA 3ZFGA 1DZQA 1O5UA 2JG8B 1LU1A 4GALA 2FZ2A 2A6ZA 1SCSA 3LAGA 5AFEA 2MNGA 3NSTA 4IL7A 2ZA9A 1QJY3 1RUJ3 4RS5B 4DQAA 2QZ3A 1NY71 1TME2 3WDUA 2ZX1A 4QMAA 5T3NA 3U07A 4QM8A 1QF3A 2ENRA 5ACA2 3DV8A 5FCCA 1ZZ9A 3BOWA 3JD73 4YM2A 5E88A 4FXKB 2ILMA 4AW7A 2VXRA 1LOFC 1YFUA 2EXHA 2MEV2 3SH4A 1W6QB 2GNBA 3I4IA 1U5XA 2MEV1 3N3HA 1REEA 5J98B 4COWA 4ES8A 2WZR2 3WG1A 1RTVA 4FPOB 4XIOA 2Y0IA 3PVBB 4URTA 3OTFA 2ZMNA 2P17A 1V00A 3ELNA 4O9GA 2Z69A 1WBFA 1AR71 3O0XA 2VECA 3M3QA 5EYXA 2H6CA 1WCSA 2B8MA 3NAPA 3QH6A 1DIWA 2DVAA 3WNXA 1V9U1 4CEWC 1VBB3 4HN0A 3LZZA 3JB8A 1EAH1 3IM0A 1BEV1 3KT1A 1ASJ2 1I3HA 5FAXA 3MI8A 4XJ8A 4UXAA 2O8OA 3WXPA 4R4XA 2R0HA 3KLSA 4WM7C 1PVC1 1V6IA 1QJZA 2E9QA 2OUHA 2WNEA 3CJIC 2A3WA 5DUWA 4EWAA 1HV0A 3OD0A 4WZCA 5F1RA 1S55A 2AUYA 1VP6A 1AR62 4LHNA 2BVVA 3WUDA 1QXRA 1CAXB 5FDBA 3AXDA 1F8VA 3O14A 1N3PA 4EN0A 1GSLA 1R092 3OYWA 1FXZA 1C8M3 1AR61 3L2HA 3CO2A 4PBPA 3BCWA 1AR83 3OD4A 3BB6A 1R091 4META 4XXPA 3PJYA 1RVF3 2YPJA 2VNOA 3PVOA 4QQHA 4LULA 2D43A 1FV3A 2CAVA 3TN93 4AEDB 1D4VB 2DCTA 2RM23 3ZSKA 1R082 2BWAA 3RNSA 3WQ0A 3JB4C 4COYA 1PIV2 5AC91 2Q8OA 2RHPA 4N53B 3HWJA 2ZCWA 4RD7A 5DDJ1 2OVUA 1W39A 1OFNA 2ZX2A 4CDWA 2YZ4A 4FPCA 4Q4W3 4YZ1A 5IK4A 3AKSA 1G6NA 2EXKA 4W65A 1XU1A 4RGGA 4DY5A 2WJSA 4GB31 2HEWF 4RFT0 2WQZC 1H0BA 4R9AA 2OZ6A 3ZYIB 3AMNA 2JX9A 4YW4A 4K40A 3J8F1 5GLVA 4Q4V3 4FVVA 2MHFA 4J1XA 4ZXKA 1V6MA 3FUOA 4P9YA 4Q1PA 3TOJA 4Y20A 3UJQA 3I59A 4WVMA 3V0BB 3DF0A 1ZA4A 3EHKA 2PHUA 2XVKA 3OBRA 3ZMOA 1TME3 1JOJA 5ACA3 4BMBA 3ETQA 4WM8C 2MEV3 1KJLA 4KG8A 3VBFB 3RQ0A 1NQDA 1CR7A 4K9SA 1YWKA 4ZKTB 2UU8A 4FTSA 4P9WA 1H2LA 3ZN5A 2WZR3 4DS0A 4D7TA 1MZEA 1RUI2 1VBA1 4JDOA 3B02A 1YFXA 3M3OA 5HI0A 3Q9OA 5CNAA 5DUXA 5KC5A 2WNVA 4JDMA 1D4M2 4XQWA 1UMZA 3LSDA 3AYDA 2JXAA 5A32B 4NO4A 1Q5OA 5AVAA 4HMZA 2E51A 2XWBB 4ORFA 1FAYA 3IN9A 4GH4C 2X5IA 1PGSA 1COV1 3FWEA 3HMYA 2WKKA 1MQTA 4P9GA 5BNPC 1VRH1 3VN4A 4DY3A 2LUWA 5CIRA 1DLLA 5I0RA 2JD4A 3GBWA 4I02A 3JU9A 2XL9A 5DZFA 1HXS2 1RUNA 2PAKA 4S2FA 4CDUA 3NKTA 1UPSA 2W39A 1FPN1 1NG0A 4FOVA 3ZIWA 1B35A 1ASJ3 1H8TB 2JDZA 4GA9A 5DUUA 4AWDA 1RHI2 2VW1A 3R4SA 3S0MA 1CX4A 4YG6A 5CFCA 4MGKE 4LBQB 3E6CC 1EV11 1AYN2 2HEYF 4DRVA 2Q1ZB 1PK6A 4RGAA 5LK5A 2YGLA 1YIPA 2QDNA 1SMVA 1KJRA 2RS52 2SLIA 4K20A 4X6RB 4AF9A 1AR63 2WLPA 1C1LA 4BQ1A 1R093 4XF4A 1WA4A 2O0OA 3LA2A 2Y38A 1ZX5A 3EBRA 4BA6A 4IEQA 1SBEA 1W6NA 1ND2C 4LBOA 2VMIA 1WCKA 2C1FA 1ZZ7A 3DPRA 3G7DA 4NVPA 2WS91 3MIEA 5I93A 4L92A 1HX6A 1G9CA 1RUF2 5KC6A 1R083 1EPZA 1H9PA 2BUKA 1PIV3 1UZZA 1CAVA 3ES1A 2QCSB 1XNKA 2IXCA 2NP0A 1U5ZA 1MEC2 2HWB2 1S0EA 1K5MA 2QUOA 2XGXA 3PTYA 4CEWB 3ZFFB 4B29A 1OQDA 4Z07A 3MZHA 2GC2A 1WLDA 1DQ4A 1KDKA 2BWCA 4XOGA 1MR5A 1UAIA 1WCDJ 1WD4A 3QLQA 1J3QA 5A3MA 3U0ZA 4Y20B 4FP3A 3IWZA 3QCWA 1GKBA 2ARBA 4LBLA 4Y24A 2ZBJA 4Q8LA 2K0GA 1RUH1 1HRV1 1QJX1 3VBRC 4HKWA 4AHZA 4LO6B 3JCIA 1OLQA 1TMF2 3URFA 4M3CA 4AQ6A 2G9GA 1IS4A 3I7DA 4PDWB 4BH9A 3MPBA 2P34A 4XTMA 3ZFEC 4FPGA 3H0OA 4AVBA 5JOXA 4CEYA 4V1PA 4Q29A 5F9TA 4YVWC 5BUVA 4Z92B 1UN1A 4NWVA 4LO8A 4DB5A 1ONAA 4Q0SA 1V6OA 4ISRA 5DXDA 1YFYA 2WNVB 2XUMA 4Y22B 2EALA 2YV8A 4N9HA 1RUD1 3VBOA 3AP9A 5FLHA 4XJZA 4QQOA 2BYVE 3MICA 1N1YA 4MZUA 1KFUL 2DVDA 4RL7A 1RUI3 1HRI1 2D6OX 2EF6A 1O4ZA 2IZWA 3TB0A 4NHKA 1CGPA 4KNCA 2WA3A 5FLIA 1D4M3 3ZDSA 5ABJA 5JOYA 4YYOA 4M01A 3ZXFA 3CJXA 2HWF1 3VL9A 4ASLA 2QVSB 1DZRA 3RPQA 5JOZA 5K9YA 5CG9A 1MS5A 2ZX4A 1IS3A 5CFCB 1N1TA 4KL1A 4Y1XA 4RA0A 1IOAA 1I1EA 5BNNC 1HXS3 5C6CA 2VUJA 3KS7A 3H9AA 5FRAA 1CIWA 2VY0A 1RHI3 3WP4A 1SLIA 1LCLA 2WNUC 5EV7A 1XXNA 1H4GA 2GNTA 3WLUA 5LEKA 3USSA 2GC1A 1DU3D 1FNZA 3WINE 5I0TA 4HVOA 3L9JT 1KRIA 1AYN3 1D0HA 3HT1A 3QBQA 5SV5A 2ZX0A 4AQSA 4QGLA 2XKPA 2RS53 2AH2A 4INDA 1G9BA 2ZGMA 2YY1A 1H1AA 1DGWX 2HWD1 3VBHC 3ZN6A 1QMJA 5KWRA 2HWE1 1Z7S2 4COVA 5J7MA 2JG9C 5D8AB 3IMNA 1CAVB 5JPNB 1OOPB 1REDA 1LB2A 1FI2A 3MF6A 4BCUA 1SACA 3GALA 2ERFA 4MXWA 4HBNA 3NL1A 4YM1A 1RUF3 4XMAA 3ZXEA 3RS6A 1YJLA 1N3QA 4JGZB 2R062 4COUA 3ACLA 1IKQA 4N90A 1F31A 1S0GA 1LHUA 3NWKA 3EJKA 1MEC3 2HWB3 3QH7A 1HQLA 1WMDA 1LGNA 1FT9A 2B42B 3ST7A 3AFGA 4OHYA 4M00A 3ME2A 1DG6A 3C3VA 5I0SA 4D94A 3VDDC 5JI9A 1PM7A 1JYCA 4R4ZA 4AEMA 1TMF3 1J3RA 2VG9A 3I8TA 4IEPA 4YW5A 1ZRFA 1PGW1 1U12A 2EVXA 1PGL2 3VZOA 2ZKNA 2BNOA 5L36A 5LEJA 4HLTA 4I09A 4S2HA 2WSVA 1OQ1A 4LBNA 1PGL1 2Z5WA 1OSGA 2B5HA 2ZGRA 5I8SA 4KBBA 3AJZA 2DYCA 1NE6A 4R9CA 3CEWA 1YI7A 4R9DA 3THTA 2IXJA 2ZMKA 4QPIA 2OYZA 3A0NA 1RGSA 4GULA 4Q4Y2 3TRSB 3B3QE 4NR1A 3HIFA 2VH9A 3PMEA 3JQWA 1ENQA 4ZU4A 5HCBA 1OMIA 3RMXA 1DGRA 4LBQD 3RYKA 1S0BA 1J1TA 1W6PA 1QOSA 3EO6A 1CN1A 2NMOA 2PHLA 1OPMA 1W6MA 2YMZA 3IDCB 4HK8A 3LOBA 1WW5A 2YYOA 4H3WA 3DL3A 1CAUB 4YFZA 5L7OC 1DYKA 2E7TA 2V73A 3LKJA 4L2NA 2D5FA 4MLOA 2Z79A 2ZOEB 4K6BA 3VBSB 4PIYA 4NPRA 3PVEA 4IXLA 2IXLA 4LR4A 2R071 3KCYA 1G9DA 4XFFA 1HV1A 4MGZE 3N36A 4PLOA 2HJIA 4RS5A 2RR12 2XL7A 1NLRA 3MPPG 2XBO1 5KXDA 4IV1C 3OY8B 1LHOA 5FBZA 4B7KA 1LGCA 2ARXA 3WDTA 1UD1A 1W6QA 3ZSEA 3H7JA 4FOWA 3VBUC 1DFQA 3IPVB 3WHUA 2Z2SB 1TNRA 1C4RA 4AQTA 4ASMB 2D98A 3H50A 2OPKA 4L9BA 5J09A 4QPGC 3ZFEB 2A3XA 2UY9A 1SLTA 4AGRA 3NV1A 4YGDA 5K0UC 3POWA 2ZMLA 1POV1 2RJKA 4EN9B 4GQ7A 1GZWB 1S2BA 1WBLA 3ZPYA 1AYM2 4PIZA 1Z7S3 4EWDA 1GLHA 1XYNA 1TEIA 4AFMA 4E2SA 2B39A 4SBVA 5BNOC 1VB2A 3S7IA 2EAKA 1M06G 1A78A 2XLGA 4GKYA 2PAEA 1RMU1 2JKBA 3ZIXA 3ZFGC 2ZGOA 3MW4A 4OUMA 2R063 1ZZBA 2AZ5A 2VGDA 1E57A 3M70A 2DU1A 1SFYA 2DCYA 4AXOA 2RS11 3VZLA 1S0CA 4DNYA 1QOTA 4IV3C 4JTOA 1ZRDA 2VU9A 4CP2A 1ZVFA 1G9AA 1LOEA 5BNNB 5HCAA 2RMU2 3VZKA 1GR3A 4FP2A 2R1BA 4BMEA 2DVBA 3MYXA 4I0BA 5JIUA 2JENA 3O12A 1ND3B 2SBAA 2DCJA 1OI6A 4EROA 1O3TA 1LGBA 4AVSA 4P9JA 1YNAA 3QACA 4M3CF 5FPZA 4N43B 2D5HA 3WW4A 1CD3G 1UX6A 3NAPC 5T5OA 3KSCA 3U11A 4FPFA 4FXGB 3AKPA 2KM2A 4KGGA 1V6NA 1WLCA 1W6PB 1WLWA 3E97A 4A2UA 2JG9B 5JSPA 3AKQA 1RL3A 2A6WA 1XNCA 3LA3A 2GNDA 2PHXA 3FUQA 4Q4Y3 3ZXLA 4D7SA 3BODA 3M3CA 1SLCA 4XF1A 1YXWA 2A70A 1QQP1 1AR91 1VBD1 1NY72 5KXEA 2GMMA 1AL21 4RR3C 1MZFA 4GKXA 1PMIA 2FQPA 1QXPA 2I74A 4YG0A 5FTTC 1DF0A 4XXAA 1BJQA 3VL8A 2DU0A 3J9SA 2ZHNA 1O3SA 2GMPA 4E4DX 4BM8A 4OI0A 2ZAAA 3V0BA 3SCHA 4MH0E 5JCTA 5EXOA 1QH6A 1WLTA 2RR13 4YVSC 1RC6A 1ZBA1 4JTNA 3NV2A 3O7OA 3WCSA 2P3KA 3LGRA 5JPMB 3AM2A 3VKNA 1AR72 3WW3A 3K51A 3VBFA 4YNIA 1ZRCA 3CL1A 2KA3A 1V9U2 3WR0A 3RYRA 1UIKA 1Q8VA 3KD4A 4AGVA 2NYYA 4OHZA 4OI4A 2UY8A 3JBG1 1B09A 3DGTA 4QGNA 4LUMA 3H1MA 4JGYB 5JZGC 1EAH2 3E5QA 5E1RA 2UWAA 1BEV2 4CDWC 2E7AA 1IZ3A 2VW2A 1R1ZA 1AXZA 2XVGA 3MLKA 2D3SA 4ONUA 4OULA 1AYM3 3B00A 3ENRA 5A32A 2XJUA 1Q3EA 1I5ZA 1PVC2 1AZDA 1G7YA 2PN5A 3HD8B 4KH9A 1NCRB 2VW0A 3B7MA 4XW3A 4EV0A