3JB4C

Structure of ljungan virus: insight into picornavirus packaging
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
241
structure length
241
Chain Sequence
TVRKTKTSKFKWVRNKIDIAEGPGAMNIANVLSTTGGQTIALVGERAFYDPRTAGAAVRCKDLMEIARMPSVFLGESTEPDGRRGYFTWSHTISPVNWVFDDHIYLENMPNLRLFSSCYNYWRGSFVIKLTVYASTFNKGRLRMAFFPNREGAYTQDDAQNAIFVVCDIGLNNTFEMTIPYTWGNWMRPTRGNSLGHLRIDVLNRLTYNSSSPNAVNCILQIKMGDDAMFMVPTTSNLVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structure of Ljungan virus provides insight into genome packaging of this picornavirus.
pubmed doi rcsb
source organism Ljungan virus 87-012
total genus 26
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3jb4C00
4CDUC 1NCQA 4FTEA 2RS11 2XBO2 1C8M3 1AR81 1VBC3 2WLPA 3VBHA 3HAGA 4Q4V1 1NCQC 5AC91 1B35A 1BEV3 2WZR3 3FBMA 1BMV1 4RR3A 2RR11 3VBHC 1EV13 4Q4V3 5DDJ2 4JGYA 1VAKA 1B35C 2R041 2HWD2 5BNOB 4YVSB 1RVF1 1C8NA 4RR3C 3DPRB 1ZBA2 1NCRB 4JGYC 2R043 5FMOL 3IDEA 2HWB2 2RMU2 4N53B 5J98B 1NG0A 1V9U1 4IV1B 4GMP1 2RS51 5BNOA 4YVSA 1RHI3 1AL22 1RUH2 4GB31 3DPRA 1NCRA 5BNOC 1BBT1 2RS12 1QQP3 4YVSC 1AR82 5FOJB 4N53A 2HWE3 1QJX2 4IV1A 3DPRC 5L7OB 1NCRC 1RUI2 1AUYA 1BBT3 1PGW1 1Z7S1 4N53C 4BCUA 4Y4YA 3LOBA 4IV1C 3TN93 1EAH1 1IHMA 1RUF1 1F8VA 3VBRB 3JBG1 1COV1 1VBE3 1ZBE1 1RUJ2 2HWF2 1RVF2 1RMU1 5BNNB 1FPN3 5L7OA 3JD73 1AR92 1QJU1 3JBG3 1HRV2 4Q4Y1 3VDDB 5CFCB 1V9U2 5L7OC 5ACA1 1RUE2 2RS52 1K5MB 5BNNA 1RUC1 2ZZQA 2VQ0A 1TME1 1ND2B 4NWVA 3ZFGA 1PIV2 1RUD2 4GB32 4EJRA 5ACA3 2WS91 2FZ2A 3VBRC 2RS32 1VBA3 5C4WB 3VDDA 5CFCA 1RUC3 2IZWA 5BNNC 1TME3 1VB2A 3ZFGC 1PGL1 1POV1 1AYN2 1FMD1 1ASJ1 1NY71 5J96B 4Z92B 3VBOB 3VDDC 5CFCC 1ND2A 1HQNA 1MEC3 1VBB2 2PLV3 1FMD3 4GH4B 4RS5B 1RUF2 5C4WA 1K5MC 1ZBE2 3ZFFB 1RMU2 4SBVA 1RUG2 1ND2C 1E57A 3NAPB 4QPIB 1VBC1 1QJU2 5C9AB 5C4WC 3VBOA 4FTSA 2HWC2 1BEV1 2WZR1 4GH4A 2R072 4CEWB 2HWD3 1QJZA 3VBOC 1AR72 1EV11 2R062 3NAPA 5FMOS 1OOPA 2BFUS 4JGZA 4QPIA 4GH4C 2WS92 5C9AA 1NOVA 5A33B 4AEDB 1AR62 4FSJA 3S6PA 3VBUB 3NAPC 1OOPC 4JGZC 4QPIC 3VBSB 1NY72 5C9AC 4YVWB 2GH8A 1PO22 1PO11 1QJY2 4QPGB 2RM22 4RHV1 3VBFB 1R1A2 1PVC2 1ND3B 1RHI1 2BFUL 5A33A 1PO13 4AEDA 2MEV2 1WCDJ 4RHV3 3VBUA 4LLFA 3J8F1 4RQPB 1RUI3 3VBSA 2QQPA 1QQP1 4YVWA 1C8M2 1VBC2 4AEDC 2HWE1 3ZFEB 2WFF1 4QPGA 3VBFA 3VBUC 3J8F3 1H8TB 1BEV2 4Q4X3 2WZR2 3CJIB 1AYM3 3VBSC 4YVWC 2WFF3 1F2NA 4Q4V2 4QPGC 5AC92 3TN91 3VBFC 1TMF1 1VBE1 1ND3C 1BMV2 1A6CA 1FPN1 1VRH1 2RR12 2XPJA 4PDWB 1TMF3 3JD71 4RQPC 1HRI3 2R042 1D4M1 1VRH3 1PIV3 4Y5Z0 1H8TC 2RS33 1D4M3 5BNPB 2Y26A 1HXS1 4PDWA 1AYN3 3VBRA 1FOD1 1VBD1 1VBA1 2TBVA 5CFDB 1HXS3 1R091 4PDWC 1CD3G 1FOD3 1VBD3 1VBB3 5A32B 1BBT2 1R081 4CEYB 5BNPA 4IV3B 1CJDA 1MEC1 1R093 4Q4W3 2PLV1 3TN92 5GKAC 2BPA2 1K5MA 4CDXB 2XBO1 1R083 1VBE2 5BNPC 5CFDA 1PGW2 1Z7S2 1HX6A 1W39A 2HWC3 1EAH2 3JD72 5A32A 2XBO3 3JBG2 1COV2 4IV3A 5CFDC 4CDUB 4CDXA 2HWD1 4Q4Y2 2ZAHA 1DDLA 4IV3C 5DDJ3 1RB8G 1ZBA1 4RS5A 5ACA2 4GMP0 4CDXC 3ZFFA 2HWB1 2RMU1 2ZTNA 1RUC2 1TME2 4N43B 5JZGB 1ZBA3 4RS5C 2HWB3 3ZFFC 2RMU3 1OHFA 4RR3B 1PGL2 1MEC2 1VB4A 3JB4C 4WM8B 4FTBA 2PLV2 4JGYB 4CEWA 1FMD2 1ASJ2 1AL23 2BBVA 4WM7B 1RUH3 4N43A 5JZGA 1QJX1 1NA1B 1RUI1 5C8CB 4CEWC 2RS13 1AR83 1X33A 1QJX3 4N43C 5JZGC 5AC93 4WM8A 4Q4X1 1AYM1 4RFT0 4CDQB 1RUJ1 2HWF1 4WM7A 2RR13 1NA1A 2GSYA 4WM8C 5K0UB 1AR91 1ND3A 5C8CA 1HRV1 1RUJ3 2HWF3 1RVF3 2DF7A 4CDWB 4NWWA 4WM7C 1EV12 4RQPA 1NA1C 1HRI1 1AR93 2X5IB 1AL0G 1RUE1 1HRV3 5C8CC 4CDQA 3ZFEA 1V9U3 1H8TA 1PIV1 1RUD1 3JB8A 3CJIA 5K0UA 4GMP3 1POV0 1RUE3 2RS53 2RS31 1PO12 4CDQC 4CDWA 3ZFEC 5LK7B 1X36A 4RHV2 1RUD3 4GB33 1AYN1 2X5IA 3CJIC 5K0UC 1RHI2 4CDWC 3J8F2 1VBB1 2X5IC 4Q4X2 1AYM2 1QQP2 3ZXAC 2HWE2 1Z7S3 2WFF2 1RUG1 4Q4W1 2BUKA 3ZFGB 1EAH3 1RUF3 1COV3 1ZBE3 1MQTB 1RMU3 1RUG3 2HWC1 1TMF2 5ABJB 1HRI2 5D8AB 2R071 1QJU3 4Q4Y3 1AR71 1FPN2 1VRH2 2R061 2R073 4CEYA 1M06G 1D4M2 1MQTA 1AR73 1AR61 5DDJ1 2R063 1GFF2 5ABJA 1SMVA 5D8AA 2WWSA 2WS93 4CEYC 1PO21 1QJY1 1OPOA 1AR63 1MQTC 1HXS2 1NCQB 2RM21 1POV3 1R1A1 5ABJC 1PVC1 1FOD2 1VBD2 5D8AC 1VBA2 1ASJ3 3M8LA 1PO23 1QJY3 2MEV1 3VBHB 4CDUA 2RM23 1R092 2FZ1A 4Q4W2 1R1A3 1PVC3 1B35B 1OOPB 4JGZB 1R082 1AL21 1C8M1 2MEV3 1RUH1
chains in the Genus database with same CATH superfamily
3BALA 4D3WA 3SEPA 3P3PA 4QPWA 4K1ZA 3OYWA 4PIYA 2RS11 2WQ4A 2B7YA 2Y64A 1NYWA 3I2DA 5M0TA 3VBHA 5JSPA 1W2UA 4AAPA 3HAGA 1D7PM 2GN7A 3MIGA 3HPNA 1YJLA 3LKJA 1BEV3 1A78A 2WUHA 4CUAA 2XR4A 3LD8A 2CYFA 4B1MA 2OPWA 3ZKYA 1LCLA 1JYTA 5CG8A 5IK8A 4KGQA 2YDEA 4RR3A 3RS6A 4L8QA 1H30A 4LK7A 4A3XA 4EE2A 4Q1PA 4OHWA 2E63A 3EBRA 1H4HA 4W65A 3WDTA 5BNQA 3ACGA 1YWKA 1RTVA 2VCAA 1ULEA 1YIFA 1C8NA 2JWPA 2CWMA 3AP9A 3LIHA 4LE4A 4B4QA 3Q8BA 5CA6A 5F3CA 4BLJA 4LO5B 3DPRB 3TEXA 2WNVA 2R043 3VD7A 4NO4A 2A73B 2B46X 1O8SA 3ATGA 3AK0A 3KHBA 4OLLA 2HWB2 4PI0A 4RA0A 3H3ZA 5B4XA 3ZXJA 3ZXLA 3ZN6B 4IV1B 4ZS3A 5BNOA 3OPZA 1JTZX 1RHI3 1ZRIA 3DEMA 1QF3A 1WZXA 3C2UA 1ENRA 4S2DA 5FV3A 2QQUA 1CIWA 1GNZA 1RUH2 2IXCA 2YC2A 1GMMA 3WF1A 3B01A 3NKTA 1O5UA 2XHKA 1US3A 1YFUA 2VOTA 5FZAA 2RS12 4YVSC 5DZGA 3KZ4C 4NUBA 4JTNA 4N53A 5FZBA 1LENA 3QH7A 1H6YA 1HW5A 1W6PA 4AZZA 3ROUA 4CP9A 4YLZA 1NCRC 5FZIA 1WW6A 2ZABA 1BBT3 3USUA 2VVDA 5DG2A 1PGSA 4X6QB 1CESA 2SLIA 3UKTA 4IEQA 1YNAA 5FYCA 4CCCA 2J1TA 3OY8A 2E7QA 3RI8A 3RPQA 1EAH1 2G9ZA 5EZWA 3I3BA 3RQ0A 3VBRB 5T55A 2D6NA 5I8YA 1ZBE1 1X9TA 3K4ZA 4FPGA 2O8QA 3KGLA 5LA2A 1J1LA 4CPBA 1FPN3 2R32A 5IK4A 5FMDA 4C1WA 3V0BB 3KV4A 1XE8A 3GCXA 4A44A 1AR92 4UW6A 3KGZA 4DQAA 5FZ0A 4KQ7A 4OI2A 4A42A 2JG8B 1MACA 3RYPA 4ARYA 4YZ1A 3WNXA 1RUE2 3CU7A 2A6ZA 4XHBA 3WNMA 3KHCA 1O6UA 5BNNA 2ZZQA 4XOGA 1ND2B 2FDJA 3VD9A 1RITA 1PIV2 2ZGKA 4KI5M 1RUD2 1ENQA 5KC5A 4LA2A 4QKFA 2FZ2A 5FY1A 5FLJA 4O9EA 4AEKA 2QCSB 1F5FA 4HK9A 4NHYA 3VDDA 4WVVA 5CFCA 4WVZA 1LGBA 2A3XA 2IZWA 3MBWA 4I3GA 5DUUA 1XYNA 2DCYA 3RFRA 3UGGA 3ZFGC 1POV1 2E7AA 3BU0A 1SBEA 1AYN2 1MZEA 2V09A 4XCAA 4XJ9A 5F6KA 5AVPA 3VKFC 5F37A 1ASJ1 1ZA4A 5IAVA 3WZ1A 2EXHA 2B8MA 1W8HA 5JXIA 5IVEA 3C7FA 1BQPA 5BYNA 3BU7A 4ARXA 3A22A 3MLKA 4NOTA 1HJFA 4LORA 1WUVA 4BQ4A 5JSOA 5FBJA 5C4WA 2AH2A 5C71A 3PURA 4YW3A 5GZGA 1ZBE2 5FO9B 3OPTA 1V6JA 3E6CC 4SBVA 2EIDA 4FPYA 4Q0VA 3UV9A 1E57A 4NROA 4BQ1A 3N36A 4COZA 2OUHA 3IKWA 1SLBA 4CP2A 2YMZA 4OMDA 2XHNA 3GJBA 4M3CF 5FLIA 5FZEA 5JDBA 2JB4A 3VHPA 1SLTA 1SPPA 2GMPA 5HXVA 4EWEA 2R072 1NE6A 3UETA 1G86A 4UFJA 2YC4A 1VE0A 1FATA 1BLZA 3VBOC 4AI8A 1EV11 1UOJA 1YHFA 1HV0A 1C57A 4LO8A 3ELNA 3NAPA 4UFKA 3ZM8A 1OOPA 4BE3A 3AVRA 2ET1A 3FLPA 5C9AA 3PDQA 1XNKA 4XAAA 4YW5A 3WDXA 1NOVA 3ZX7A 4WVWA 2XJTA 3IM0A 5HXMA 1AR62 5H9QA 1XXNA 5IJRA 3BUCA 4XFCA 3K48A 3VBUB 2ZHMA 4YZ4A 2JDPA 2V73A 1LR5A 1RYYA 1OFSA 1PK6B 1OURA 3QBQA 4YVWB 4FI9A 4AK3A 2D40A 1NX9A 4IE6A 5IVFA 1ULFA 4B4PA 5CKMA 2JKXA 4YGEA 3S0MA 3AZXA 4RHV1 3VDBA 1R1A2 5FMBA 5J1XA 2GC0A 2E31A 2XOMA 2D6KA 2E53A 2YU2A 5CISA 2BFUL 2NYYA 1QOTA 2IFRA 2MEV2 4HG6B 4MXWB 1F4HA 3RSJA 5IW0A 1S0BA 4FXGB 1H1AA 3T08A 1MS4A 3OPWA 1UMZA 3VBSA 2GC3A 3ETPA 1QQP1 4QWNA 2QQPA 1Q43A 4AEDC 1UX7A 2P37A 3Q8AA 2YGMA 4NPRA 1S2KA 2RJ2A 1SCRA 4Q4X3 2CGOA 3ACLA 3C3VA 3CJIB 3CZJA 3KT7A 3RYKA 1LOAA 1X9PA 2WLQA 2C24A 5LEJA 2W91A 1OF3A 2WFF3 3CZUA 4NMIA 1V0AA 3OB8A 4QPGC 4Y1UA 3TB0A 3BN6A 3VBFC 1ONAA 1TMF1 4FPJA 1VBE1 4CU7A 2CDPA 2JDUA 3BI3A 3POEA 2XONA 4NIAA 5SV5A 5FQ0A 1G6NA 2RR12 3VB9A 2RV9A 5FPBA 1O59A 5K9YA 1EPZA 1LOGA 2YYOA 4HKOA 5DAPA 5GZEA 4PDWB 2GALA 4RQPC 1HRI3 2R6QA 4HL0A 3I2IA 3R05A 4LITA 5FPZA 1HB2A 1LNSA 2P3IA 1D4M1 2VMEA 4K3UA 2C6SA 4LBLA 4RGAA 5HI0A 1CZVA 1W9WA 5LWBA 3ZYPA 2JG9B 5FXVA 2BNOA 4ISRA 1PIV3 5BUVA 1NLQA 4Y1VA 1DCSA 3V0AB 1WCQA 2BQPA 2OUJA 3I2JA 5FZOB 4CZSA 2NLRA 3LB9A 5IAXA 3B02A 3OUHA 3ZSKA 3VZMA 3DECA 1AYN3 3DUIA 4XQWA 4ITCA 1YQ2A 1IZ3A 3I8TA 2VTFA 2WT0A 1Q5OA 4AVCA 5IVJA 2HLEA 1NAEA 4AQ2A 2X05A 4UFIA 3PTYA 1FOD3 3FBYA 4Q29A 5KC6A 1OA2A 4HANA 3IAPA 1LHWA 2DYCA 3LIGA 5E6HA 4CEYB 3SMHA 2X29A 2Y6KA 3AMQA 4P9IA 1CAVB 3TNPB 1CJDA 2ZHKA 4XETA 3ZDSA 5FOBB 5JAXA 3E5XA 1QH6A 4TYSA 5GKAC 5JVVA 4RYDA 2BPA2 4BB3A 1R083 1RL3A 3MV11 1VBE2 2ET7A 1W6QB 5BNPC 4YM2A 2ZHLA 5FXZA 4AG4A 1PGW2 5LW9A 2WO1A 3WT3A 4PHZA 4XDPA 3F95A 4CUCA 1C28A 1W39A 2RDSA 2BTVC 2HKXA 4A7ZA 4DXTA 2XBO3 3JBG2 3N9PA 2VUAA 4I01A 4N90A 2D43A 5JMOA 2C0ZA 1XSRA 2VOVA 2W95A 3MIHA 4HKLA 5CFDC 1RC6A 5DAQA 4YM0A 1XPWA 5FYHA 1W04A 2VOWA 1XB9A 2QZ3A 3WX5A 4IEOA 4AFCA 4YGDA 4Q4Y2 3D82A 4JDNA 1H0BA 4DO0A 5JPNB 2EA7A 3E6DA 4Y5TA 1W8TA 4RL7A 5FK8A 2IWGB 1V6OA 4TLGA 5ACA2 5D2AA 5CYYA 3O7OA 3NV4A 4W4ZA 2IXLA 5CU1A 1QIQA 2G9GA 2RDRA 3GBWA 2ZTNA 4C91A 1RUC2 3D0SA 3LSEA 4N43B 3H3LA 5EJ3A 3ZYJB 4AI3A 2ZBJA 1UYYA 3WNKA 4ASLA 2D44A 2PHWA 4RS5C 5T5OA 5A3NA 5FKBA 1UPIA 5FY0A 4XCBA 2JECA 3M3QA 1QMJA 1OHFA 4GD4A 2OPKA 5FBZA 1GKBA 2GNMA 4ZZ8A 2CWSA 2YROA 4DIQA 4ES8A 4TWTA 4ZS2A 4MGYE 2BBVA 1UOGA 4OMCA 4WM7B 1YRZA 3UK9A 4DEQA 1CAWA 3ZSLA 4GAZA 5F7UA 1OBNA 2W9XA 4Q0SA 1LOBA 2JD9A 4ISQA 1RUI1 4OHVA 4QHZA 3WW3A 2G9FA 1AR83 1F9KA 3GNEA 1QXJA 2DBNA 4QQLA 1ST8A 1WA6X 4V2WA 3NJXA 4LR4A 4DNYA 3CKHA 5FRAA 1I5PA 1QJX3 5LASA 2DFCA 1UXXX 2VBDA 2CGPA 3HD8B 4RFT0 3ILRA 3NW4A 1JI6A 1OD3A 4CDQB 1W06A 3FHIB 4FFHA 3BB6A 1SFYA 3I3QA 1W6MA 2RR13 2ZA9A 4LOSA 1AXZA 5JWPA 5C5TA 3ZPOA 3DYMA 4WM8C 5K0UB 4HLTA 3WG1A 1HRV1 1W9FA 3DXTA 1ZZ7A 3KCXA 1V00A 3AFKA 2HWF3 4CDWB 2QVSB 1LESA 4RQPA 1Q8QA 1NA1C 4IW3A 3H1WA 3VZLA 1W9YA 3IPVA 2ZGUA 3TYJA 3O1MA 5C8CC 4FT8A 2OZ6A 4GWNA 5IWFA 2QKDA 3WDVA 1S0GA 3AMHA 1V9U3 2ZPXA 2NMNA 2XWBB 2GC1A 5JIAA 4AHXA 4YSFA 1XOYA 2RS53 1AJOA 2V4AA 2RS31 2X09A 3FUOA 3KWVA 3OCPA 3S5QA 1CN1A 1PO12 1ULCA 3ZSMA 3FUQA 5FZHA 3ZFEC 5LK7B 2JDZA 1X36A 5CBLA 4AFMA 3I4IA 5IHRA 1E5RA 2B42B 4AVVA 1QDCA 4ZXKA 3RDIA 3O12A 4G4FA 4IXLA 2V4VA 3M1HA 4LKSA 3WP4A 3ZYGA 2BNNA 3N7MA 4QX0A 1LEDA 1AVBA 2ZGLA 3POFA 2VMHA 1Q3EA 4L92A 1QY4A 4K7JA 3CF6E 2HBUA 5C7GA 4LOTA 2LUWA 1MZ6A 3AVSA 3GBGA 4QAWA 2HWE2 2AENA 1BJQA 4XAEA 2KR2A 1RUG1 3MICA 1CZTA 1LULA 2BUKA 2C5DA 2IVJA 3ZFGB 5BY5A 2CAVA 1SFNA 2DCZA 2OVUA 3WF3A 4QQOA 1ZRDA 4NHKA 4U2AA 2AUYA 4O61A 1WA4A 1GR3A 1Z78A 2DCTA 3DKWA 4IUGA 1OLRA 1RMU3 3EQEA 3I3MA 4Z07A 1E5IA 2VW2A 4E27A 2VULA 4K20A 2ZX1A 4UFLA 4B29A 1V6LA 4Q4Y3 4Z2WA 1AR71 3RG0A 5APAA 1VRH2 3AZZA 5DPNA 4D7SA 2R7EB 4XILA 1WBFA 2VZTA 3BIWE 3RZLA 3VD5A 2Q1ZB 2VE1A 3HBKA 1Q8SA 1X8MA 4IEZA 3RJRA 3WCSA 3RZGA 2B5HA 2QQKA 4E8DA 2ZXQA 4XUOA 1N3PA 2EVXA 3IMNA 4JKLA 5DDJ1 4A3ZA 4YM3A 4XTMA 2ES3A 1OUSA 3ENRA 4EWDA 3CHXA 1OKOA 1XE7A 5ABJA 4BMBA 2WS93 2K0GA 4M3CA 4EYUA 2GP3A 2JE9A 4XF3A 1QJY1 1OPOA 2YG0A 1MQTC 2XJQA 4K9SA 3VZOA 1G7YA 4NIHA 3OBRA 1EP0A 4V2VA 3AP4A 3D4KA 1YFXA 1VBD2 4QT6A 1BXHA 2EALA 4JAAA 4LK6A 3ZO0B 5FLHA 2XKOA 1PO23 4H3WA 2P6HA 4FVVA 4W6XA 2AZ5A 1DLCA 2DDUA 2G4IA 3UGFA 3QH6A 1LOFA 2RM23 1S2BA 2ADDA 4Q26A 4HXCA 3ON7A 5SV8A 1QOSA 3ZR6A 1HQWA 1PVC3 1B35B 1BVVA 2GH2A 4AHWA 3AKTA 3LZZA 5JR2A 1TEIA 4HBNA 3ZXFA 2HBTA 4Y5SA 3JQXA 5F8PA 3WSOA 3GDBA 3FLRA 3PUQA 1NCQA 4P9GA 2FD8A 4F83A 2BOIA 5F2WA 5FPUA 2VZQA 3RJ2X 3V64A 4B4RA 1C8M3 1VBC3 5JSRA 4Y20B 1DGLA 3SC7X 3RZHA 4JDOA 5AC91 3BTXA 2WZ8A 2DBIA 4IQPA 2ADEA 3LPFA 5F5CA 1O3RA 3I2HA 2VAUA 1OXCA 1SBFA 3FBMA 3KV5A 2Q8CA 1BMV1 1YCIA 1GWMA 2LALA 3VBHC 4UYBA 3OBTA 4Q4V3 4YG3A 5DDJ2 5LK5A 1J58A 1EPWA 4XBLA 4R52A 1CPMA 4QKNA 2JJ6A 2R041 4CXYA 3I2OA 4LXLA 3WDWA 3B7MA 3SCGA 1RVF1 4PQ9A 5A3TA 4RR3C 3LDRA 5IUQA 2BV4A 3P6BA 4META 4AW7A 1ZBA2 2ILMA 5C6CA 1AF9A 4UWDA 4MLOA 5FMOL 2RMU2 4OCTA 1UZWA 1XNCA 3NNJA 2QQNA 1YO8A 2KM2A 3NMBA 3S7EA 5FWJA 2WNVC 2IVIB 2K46A 3I54A 4QX7A 3MLJA 5GLZA 3M2MA 4NHXA 1HIXA 3PU3A 3Q8FA 2VMIA 1REDA 2RE9A 3CO2A 3DPRA 4M00A 3LEKA 5LBFA 3P5BA 4EN0A 1KS4A 3TEZA 2DURA 3NJYA 2VY0A 3VGIA 5BNOC 1BBT1 4KWJA 1BZWA 3KVAA 2BERA 3B3QE 3GXUA 3S57A 2XJUA 2HWE3 3ZN6A 2YUEA 1J3RA 2A6VA 1IS3A 4IV1A 1H4GA 1R1ZA 1GZTA 3AKQA 5L7OB 3CBNA 1LHNA 2ZEYA 1JN2P 1TZOA 3AMNA 1AUYA 4XTPA 5I8TA 4LE3A 2Q1MA 4QD2A 3LF7A 5FY4A 1PM4A 4JZRA 4YFZA 4N53C 3FL7A 1AXYA 2W87A 1UX6A 3LPGA 2Q8EA 2ZJCA 1W3XA 2BP6A 4R9AA 1ZZ9A 4CCEA 1RUJ2 2ZX0A 2GNBA 4AQTA 1RVF2 1JH5A 3VHOA 2Q5TA 3LGRA 3I3DA 1REFA 5I0RA 1AX0A 2WA3A 1QOOA 3AZVA 2ZACA 2A3YA 4N9IA 1QJU1 2YY1A 4ZU4A 3PIGA 4YW4A 4I2OA 1YUDA 4H7MA 3VZKA 1DZQA 5KHGA 4BWOA 3C7HA 5FZ7A 4HFSA 3PTRB 3KSCA 1K5MB 5FR3A 1SDDB 4BZ4A 2QDNA 3EJKA 5HV0A 5FZCA 2VQ0A 1JHJA 4NWVA 4QXCA 3PVEA 1D2SA 4YGBA 2PFWA 2DVAA 4ES9A 2GNDA 3IIAA 3PMSA 2JE8A 1X82A 3E97A 2W1WA 1TE1B 2VJXA 3THCA 1K42A 5BNNC 4L0PA 1TME3 4IEPA 4QPYA 2GP5A 1C1LA 3VDAA 4DB5A 2PQQA 4COUA 1W2OA 1NY71 1JXNA 2AGSA 3O0VA 3J7MA 4CCOA 3WQ7A 4B7EA 4DMIA 5J96B 4PLMA 5A3UA 3MFAA 3VDDC 2X10A 4E4DX 5CFCC 1ND2A 1HQNA 1KJRA 2P34A 1ZVFA 1MEC3 1DF0A 3MDPA 3KV9A 2HEVF 1VBB2 2PLV3 1Q8OA 5FUIA 1FMD3 4GH4B 4RS5B 1GU3A 4E2GA 3VL9A 3WY6A 3WXPA 4Z8BA 4LBOA 2XQXA 5F3EA 3W58A 1F5JA 3BCWA 4QPIB 3DXUA 1QJU2 3HIFA 5C4WC 3BTYA 3FHAA 2QFEA 4BDVB 2Q30A 5A1AA 2YFUA 2VBBA 3QLQA 1JYVA 4RGKA 4FTSA 2Z2SB 4MGTA 2LW8A 2WZR1 2ZAAA 2BWAA 2PAEA 4XF1A 1AX1A 5LBBA 2PXJA 1QJFA 1RUNA 2DUPA 2WO2A 4XFHA 4XFIA 2R062 1SLLA 2DCKA 3WCRA 3MPBA 5CKQA 5FMOS 5FXXA 4YPJA 3GZUC 5LB6A 4LJHA 2Z69A 3ETQA 2P17A 3GJAA 1W0NA 2YHJA 4FSJA 2VUJA 4IEUA 5FUNA 5GM0A 3DL3A 1YJKA 5LA9A 3NAPC 3OEBA 4I09A 4H55A 1QJEA 3FJSA 1OOPC 1ULGA 3W20A 2D6PA 3PVOA 1JOBA 3VV1A 2C9AA 1NY72 5C9AC 2HJIA 2Y6JA 2GH8A 5F5AA 5KHHA 2JD4A 1UF2C 1SBDA 4XYXA 4DRRA 1N1YA 3VUOA 1XQNA 1W99A 2HH9A 5DG1A 1L7QA 1ND3B 5FZ1A 1DYPA 1QDOA 1ZZCA 4KH9A 2VO5A 1WCDJ 4MGQA 5DQ0A 2BBAA 1S55A 3VBUA 2Y60A 1PK6A 3CJXA 1JODA 3FHQA 3OGRA 4YVWA 1WCSA 1GICA 5GALA 3H50A 4Y3OA 1TNFA 3UESA 3A0KA 1S4CA 5LRRA 4HN1A 3J7LA 1GWKA 2DCJA 2WFF1 4XMIA 2JB8A 5F39A 4QQ2A 3ZFEB 3SKJE 4HK8A 4D6QA 3J8F3 1H8TB 5G05L 4HPKB 5J36A 2WZR2 4KG8A 2XWJB 1NZIA 3VBSC 4PCRA 2Y6LA 3IDAA 3NL1A 4MXWA 1TG7A 1Y4WA 1TVGA 2V5YA 3BPSA 3WVJA 1JZ7A 2J22A 3O1UA 2O8OA 2VUCA 3TN91 2VR4A 3U11A 1HV1A 2JDHA 2P3YA 2R1DA 3WW4A 4D69A 1HDKA 1BYHA 2ERFA 1O4YA 5IATA 1KITA 2JE7A 3MIDA 4H7LA 4PIZA 3HJRA 4UFHA 2XPJA 4AI9A 2VZRA 3KCYA 1Y43B 2WJSA 5IFPA 1XNTA 3JD71 2UWCA 1IOAA 3AP6A 1WCKA 3C7GA 5C70A 4LO4B 3UKVA 2WNUA 2X8KA 1GOHA 3INAA 5FY5A 2IFWA 4OVEA 1G9CA 2BYVE 4IE0A 1OKQA 2BGPA 1FV3A 2DTYA 1DQ0A 3RRDA 1DHKB 4HONA 4LT5A 1FAYA 4E2QA 5F9TA 2UWAA 2PHFA 4LMFA 5C3PA 4PDWA 4Q0UA 3OEAA 1XU2A 1NQDA 2W52A 1FOD1 2WAOA 1VBA1 1RXGA 3BOPA 2VMCA 4BJ0A 3SH4A 3WR0A 1G9FA 4LTAA 4DY3A 3H3UA 4I0AA 4E4SA 2OKXA 4LBJA 1HXS3 2JG9A 1U5XA 2R49A 1WKYA 2VW0A 3OBAA 3WDYA 5A6XA 1US2A 2XVGA 1VBB3 4IESA 4LPLA 5KXDA 3DYPA 4EN9B 2Y8KA 1R081 3V0AA 4XACA 4D8MA 2BWCA 2JDYA 2JX9A 5FZOA 4FOVA 4GWMA 4IV3B 2WIIB 1R093 4MGSA 5CEHA 3PJYA 1U0AA 2Y34A 2ZGQA 1D2QA 2HYKA 3TN92 1GP6A 4CDXB 2XBO1 1J3QA 2P6CA 3ASIA 4I3PA 4AR2A 5L9VA 3UJQA 2RDNA 4NVPA 3NNMA 4IGPA 4MGIE 4OUEA 5FZ8A 1EAH2 5IYYA 4YYOA 3JD72 4KU8A 1CAXB 5CKNA 2OZJA 2XJVA 5T52A 5FYIA 3MW3A 5BXXA 3O1RA 1E5SA 1H2MA 1WW4A 3ES4A 3O1SA 2PAKA 4FPLA 4QKDA 1VAVA 2HWD1 3I59B 4LBNA 4JVAA 4QB2A 1W6QA 1JHNA 4QX2A 3ZYHA 4CXXA 3AL5A 5A70A 5J3UA 4L11A 1DDLA 5D1IA 1DLLA 4QU1A 4AGGA 2J1AA 1DZRA 1PM7A 4S2FA 4YM1A 4FFFA 1LODA 1V6IA 4A45A 2CGNA 2LTNA 3FFQA 3FLTA 4GMP0 4BQ2A 3ZFFA 5B4NA 4NIDA 1ZRCA 3K4DA 5JZGB 3AFGA 2KXLA 2VOKA 1OH3A 4JCKA 4GXLA 1XNAA 4H14A 4ZZ5A 2HWB3 5A6YA 1YI9A 4FPKA 1C1FA 3H8UA 1W8ZA 1C4RA 2DVGA 2YXSA 3H9AA 4RR3B 1L3JA 3OUIA 3TAYA 4DUVA 1VB4A 5CAZA 1XE0A 4FQZA 4CEWA 1ASJ2 3W5MA 3I7DA 1XBFA 3S5AA 3AC0A 4EV0A 4IL7A 4XQ4A 3LA3A 3RNSA 1BK0A 5F5IA 4CCJA 1RUH3 1WW7A 2ARCA 5DAXA 5AVAA 4N43A 5FYSA 5K7PA 4M01A 1QJX1 3POYA 4UBHA 5A7WB 3LCPA 2A6YA 2WNVB 4AHZA 1GZWA 4Q8KA 2RS13 4CU6A 2W1SA 2XUMA 3AMPA 4Y24A 1KD7A 5FZ3A 2WRAA 1WMEA 2WBKA 3KCCA 1OFNA 3ZVXA 4B3NA 1X33A 2F4LA 4QQHA 2FDHA 1VMJA 2RVAA 4GA9A 1MS1A 1UU6A 4Q0PA 5I0TA 3HBZA 3LSDA 1S1AA 4XQDA 3WLUA 3H8RA 1AYM1 1L7RA 2QQJA 4OZOA 2VTXJ 2XMLA 2OA2A 3AM2A 1DBNA 2ID4A 1W0PA 2HWF1 4IE7A 1VLNA 4FCAA 4MVTA 4WM7A 5ERLA 2Q8DA 3T0BA 3ZMNA 1KDKA 1OT5A 1LHVA 2ZGRA 5B2GB 1I5ZA 3ALQA 3O0XA 3WUCA 5FYMA 2C9KA 3ORJA 4RD7A 2OX0A 2DWRA 3AX4A 5CB7A 4G3YC 4UF0B 4UW4A 3T2QA 1EV12 1MVQA 3GM8A 4JRAA 4BYYA 1AR93 1UY1A 1W9TA 1GQGA 2X5IB 4CP9B 4GKXA 3B9CA 1SZBA 4CDQA 5GLWA 1W9SA 2WDBA 3WG4A 4J6GA 4XABA 4AYUA 1REEA 1VMHA 3JB8A 5K0UA 1RUE3 2LM3A 2IXJA 2XVLA 4P9LA 3WP5A 4AQ6A 1OPMA 1S0DA 5EJ1B 5GLUA 3ZIXA 4COWA 5KHJA 4CDWA 4F7ZA 5FZKA 3VLBB 4RHV2 1RUD3 4D7YA 3O1TA 4EZ4A 4MV2A 4XURA 2A3WA 2XJPA 2W92A 3K77A 2J1EA 1VP6A 3ZXEA 2P3KA 1OQEA 5C8WA 5CIRA 1SDWA 4Q27A 4QXHA 3DF0A 1Y3TA 3IDCB 2A7AA 2D6OX 4QXKA 1AYM2 1QQP2 3NWKA 4URTA 5FP3A 3ACFA 4HN0A 2D6LX 4Q4W1 1DQ2A 1R64A 2D6MA 2QQIA 3ACIA 3AL6A 2ZMNA 2XKPA 3EHKA 2CSGA 1EAH3 4K8RB 4XVHA 1ZX5A 3T2TA 2C4XA 5IK7A 1ZBE3 4JV4A 2FDGA 1ZZ8A 3ACHA 3MF6A 4W6WA 1ACCA 1FX5A 2PHDA 2HWC1 5J7MA 1TMF2 3VZNA 5D8AB 4LUMA 4K6BA 2EXIA 3N9OA 1HN1A 2WSUA 1V6KA 4LIUA 2FDFA 1UZ0A 3BTAA 1MPXA 1GWLA 5CG9A 2R073 2WSVA 1F31A 3EO6A 2JDKA 2Q1FA 1OC1A 1VR3A 4S2HA 1D4M2 3BGAA 4DPNA 2B4KA 3GZEA 2CV6A 3ZDVA 3NNLA 1BCXA 3K2OA 1QU0A 4DINB 4XBQA 1SMVA 3I97A 2VNVA 5LZ6A 2GZWA 3VDCA 1UZVA 1CGPA 4Y22B 1PO21 3KQRA 4CRQA 1AR63 3CNAA 4CU9A 3N4MA 2IXKA 4L97A 4QGMA 5DAVA 5K4LA 3LE0A 2RM21 4OI1A 1POV3 5ABJC 1PVC1 1MVEA 4KWLA 4LQRA 1SPPB 4PF5A 4XJWA 3ZLIA 5HCBA 1ASJ3 5LCWL 4EQVA 4LULA 1K5JA 4LBQD 4YNIA 1RUOA 1T6GC 4CDUA 5J37A 1C5HA 3E6BA 2AR6A 4FPHA 4I0BA 3ZXKA 1K3IA 4Q4W2 2DUQA 1R1A3 4GIQA 3MIFA 1OOPB 1GOFA 5L19A 5IVYA 1K12A 1UZYA 1AL21 1C8M1 5ANQA 1UY0A 1DGWA 2JDAA 2MEV3 3PUHA 4Q8LA 4R9BA 1JUHA 1LRHA 3PNAA 2VZSA 1YFWA 1STMA 1LOFC 2B9VA 1VPHA 2PYTA 1JS9A 5C3QA 3ZOIA 4HSJA 3WG2A 5A7QA 3RYRA 1GNHA 4AVTA 1UY3A 1NT0A 4N8MA 4Q4V1 1NCQC 2PA7A 5FCCA 1FNZA 5L9RA 1B35A 2ZMKA 3T3YA 3VKMA 4YZ3A 1SLIA 4JHTA 5HBAA 4CVUA 1HN0A 4AVBA 4D6SA 1F4AA 1QKQA 2CU5A 2I07B 1EV13 1JUIA 3VHRA 4JGYA 1JYXA 1GOGA 5A7SA 3RZZA 1VAKA 3BYWA 3HEIA 5EV7A 1JZ4A 1I3HA 2YPDA 4YVSB 1W6NB 4Y20A 2F17A 3H0OA 3E5QA 4DZGA 1LGCA 2W68A 1NCRB 2A70A 3ZKUA 2PTMA 4A7KA 1JBCA 5DUVA 2DU1A 1TQ5A 1NG0A 2ZGTA 3OG2A 2D3SA 2UY9A 1FT9A 2VU9A 4GMP1 2V72A 3I49A 2FMDA 1LTEA 5A3MA 1AL22 1KGYA 1KS5A 1W8NA 1EY2A 1UCXA 4GB31 1H9PA 2PN5A 4ZONA 3JUUA 2VZPA 4K8FA 4P02B 2WYFA 3EXUA 4PIXA 2VXRA 1ULPA 2ZHNA 1D0GA 1QQP3 4X8PA 3GBFA 3ZSJA 4AF9A 5FOJB 1RJ8A 5L73A 2WT1A 3WINE 3KV6A 4IGOA 3WW2A 2F4PA 2BGCA 4QX5A 3U4SA 3DPRC 3L9JT 1CAUB 4BK5A 5A6ZA 3K51A 1RUI2 4MGKE 3SISA 4NRPA 2DVBA 2VZUA 1XC6A 3J7NA 4NE9A 3WUDA 5FYZA 3EYPA 2EXJA 4K21A 5JIUA 1Z7S1 5DMYA 2FBEA 1NLRA 4BCUA 1VMFA 2PQSA 3I2GA 3MHZA 3PU8A 4B8EA 4Y4YA 2XDVA 1YIPA 2AACA 4IV1C 1IHMA 2MPFA 2PHUA 1T2XA 1RUF1 4ZXEA 2RJLA 4EN8B 5A3PA 4CPBD 1COV1 1VBE3 3KLSA 1CVNA 4P5YA 4SLIA 1LKNA 2BW8A 2C1FA 5JLVA 3O1PA 1NE4A 2V5DA 5FMCA 4AI2A 5TSWA 1DGRA 2B45X 2QJVA 1I9RA 1VIWB 3MFCA 5L7OA 3FZ3A 2O0OA 2LS6A 3JBG3 1HRV2 2EAAA 3R0RA 4PT6A 2OW4A 3VHNA 4HOOA 3LDKA 1YYNA 1LHOA 4OQ8A 1WD4A 3N7JA 4HMZA 1Y9GA 1V70A 1XYPA 2ZGNA 3N7KA 5EPAA 4WV8A 2A75A 1ZYBA 3Q9OA 5GLTA 1PNGA 2YZ4A 4XUQA 5C33A 4LO7A 1TME1 2WFPA 4XF4A 3AYDA 1H1IA 3N9LA 4UW5A 4GB32 4XJAA 1W6OB 1UOBA 2VQAA 4EJRA 5ACA3 5GLVA 1YQCA 2XVKA 2EIBA 2H0VA 2RS32 3VBRC 2ZKLA 1ZREA 1NZCA 2ARAA 2D7FA 2JICA 1KQRA 1RUC3 5A7PA 5CADA 2Y0OA 1PGL1 4P9WA 1RINA 4PF1A 5DUXA 5KHKA 2Q0AA 3ILFA 1FMD1 3LWCA 3UT0A 5JI9A 1MS0A 2XG3A 1NLSA 4Z92B 3BTZA 3OBZA 3VBOB 3RMYA 3CMGA 4UBGA 3S30A 1DU3D 3RZJA 4MZUA 4GWJA 4BQWA 3U07A 2JG8C 4NPLA 4DXZA 1RUF2 1GQPA 5J48A 4M3CE 5JI7A 4OI0A 4KNCA 1N47A 1RUG2 1ND2C 1UU4A 2DV9A 5FAXA 4CXWA 2A6XA 4J1WA 1QHDA 3HN3A 5A3LA 4LKEA 3J4UH 3HN1A 1OVSA 1LHUA 4LHLA 5L9BA 3ZMOA 3E1F1 5DZFA 2BZDA 1X50A 2QQWA 5A1FA 1BEV1 2IUWA 4GH4A 2W1QA 2W5FA 3POWA 2YGLA 4GQ7A 2GAUA 1AR72 4KWUA 1G9BA 3ZR5A 2UU8A 4P9XA 1XNBA 4XIKA 1JZ8A 1RGSA 3JCIA 1FXZA 1EUUA 1MR5A 4L2NA 3VKLA 3PUSA 4JGZA 4QPIA 2J42A 1W2NA 5FZDA 5A33B 4AEDB 4P00B 1LJ7A 3S6PA 1UIJA 2VPVA 3VKNA 3ZPYA 5JOZA 2YC0A 4L99A 4DY5A 1HB3A 1QJY2 4V1PA 3SKVA 5T50A 3CDZB 5JXJA 4COYA 3CEWA 3ZN4A 2NP0A 4QPGB 2W1UA 2VCCA 1KRIA 3VBFB 2CL2A 1EUTA 2YBSA 1UXZA 4K40A 4Z2AA 3TEWA 1OQDA 3OSDA 1RHI1 4XIOA 1PO13 2ZCWA 4LHSA 1DQ4A 3WF0A 1F15A 2D97A 3FE5A 3POBA 1WLDA 3N3HA 5EYXA 4DXSA 2I45A 3J8F1 4RQPB 4O9GA 3W59A 5F3GA 4RFRB 4Y33A 1RUI3 2QZ2A 2Z4FA 4GALA 2XLFA 1LGNA 1G9DA 5LATA 3UNPA 1QEXA 5DABA 1OLMA 1WMFA 2BRTA 5FY9A 1QH7A 1SFPA 2JXAA 2W39A 3VBUC 2VECA 3WHTA 2ZGMA 3WNOA 1BEV2 3IT8A 1LU2A 1OA3A 3UL2A 3MF9A 1S0IA 1PK6C 4OULA 3O1VA 4MADA 2KA3A 4YVWC 4WZFA 4CP1A 5A7NA 4XHXA 1WGPA 2QDRA 2SBAA 2ZMLA 4X6RB 4BH9A 5AC92 1YFYA 3USSA 3BODA 4I02A 2ZEXA 3OJBA 3V65A 1BMV2 4ASKA 4LA3A 3IN9A 3O1OA 1FPN1 2H0BA 4XFAA 4D0QA 2RHPA 2VMGA 5IK5A 1UKGA 2Y0IA 3WNNA 4GJYA 5FWEA 4XJ8A 3AKPA 4HPKA 2R042 4TTGA 3SCHA 2VCMA 1ENXA 5FO8B 4XZUG 4QDRA 3URFA 3AKSA 3H7JA 1VRH3 1WD3A 3RWNA 4QX1A 1JZ3A 2AC1A 3NNGA 3HVDA 2XLGA 1DQ5A 2WINB 4ONUA 1G8WA 4TLFA 2KD7A 3NO8A 4O7XA 2HEYF 4COVA 3U0ZA 2P5BA 2RS33 5BNPB 3RMXA 3AZWA 4KBBA 2QQLA 2ZGOA 4ZPIA 2WNUC 1SCSA 2Y26A 1J1TA 3POJA 1UOFA 2BU9A 2OXBA 1HXS1 3LOIA 4YW6A 3ZN5A 4ATEA 4KL1A 1LEMA 5CZKA 4FPEA 4W8JA 5FREA 3VBRA 1GZ9A 3HQRA 2AEZA 5FYYA 4E2SA 4FP2A 1JYWA 2LROA 2BOJA 1W8OA 3BOWA 3H42B 3FN9A 3OD0A 3VZJA 4FAHA 2TBVA 3APBA 5CFDB 2J1VA 2MHFA 3P3NA 3V0BA 4OZXA 1R091 4PDWC 1BVP1 4ET7A 1VBD3 4QHBA 3KT1A 5A32B 1ZM1A 4KWKA 3LA2A 1ULDA 2BVBA 1BBT2 3ME2A 1PX4A 4W6YA 3VN4A 4F8AA 3B93A 2O1QA 4GKYA 1CZSA 2JG9C 4IERA 2JG8A 2R0FA 2XUEA 3G6JB 2RDQA 3FC0A 4MOAA 5IT6A 2VD7A 4C1XA 2E26A 5A1LA 1HQLA 1CPNA 4C0HA 3AXEA 1OF4A 4FOQA 2VBPA 4MXVA 5FO7B 2Y33A 3WF2A 4XBNA 4A6OA 1LB2A 4FO9A 5L36A 4IE4A 5FPVA 4EROA 3B00A 3VL8A 2B39A 5AFEA 4AFBA 1RIRA 4G9SB 2WNOA 2EIEA 4URAA 1CJPA 2IXIA 1HLCA 4LBMA 4IV3A 4X8NA 4LNVA 1VAMA 4WBBA 4J1XA 4GWIA 2J7MA 3OD4A 4CDXA 3FWEA 2ZAHA 4KGGA 5D21A 3MLLA 3N7LA 5KXCA 4P5HA 5DDJ3 5F5QA 1RB8G 5IVBA 4IE5A 4Q1RA 1DIWA 3MGUA 3O14A 1CAXA 3T2OA 1FYUA 1YQ8A 5JUVA 2VM9A 2HWB1 1XRUA 2EICA 3UJOA 3B5LB 4HT1T 3AB0A 4LLOA 3MUZ1 5KR7A 2VQTA 3HNMA 1V6MA 4BIOA 3FX3A 1ZBA3 3WOGA 2VZVA 4N9HA 4XJUA 3D0JA 1ZNPA 3I59A 2RJKA 1AJKA 2DVFA 4GULA 2RMU3 4IEVA 3ZFFC 5T5LA 5KBFA 1DGWX 3OGJA 2PAMA 5LY2A 1OI6A 4QX8A 1YQ6A 2VCBA 5LEKA 3JB4C 3ZYFA 4WM8B 1L7LA 5IVVA 4FTBA 1W8WA 4NPMA 4PJYA 3FMGA 5JZGA 3FFZA 2CNAA 3MPPG 3NNFA 4XXPA 1NA1B 4AGRA 4XW3A 4BK4A 5FFOC 3T0AA 3QCWA 4AWDA 5C8CB 3AP7A 4CEWC 4E4HA 3QACA 3W5NA 3K3NA 2XGXA 4LEJA 4N43C 1HB4A 2AEYA 5AC93 4Q4X1 3WD5A 5H9RA 2GN3A 2A5ZA 3MUY1 2D5FA 2WO3A 3GZAA 4A6SA 2FCTA 2RG4A 3DGTA 4CTEA 5DXDA 2OYZA 1UQXA 2VC9A 4GZ9A 2P4EA 3KM5A 5E89A 1S0JA 1E5HA 5A7WA 3PMEA 5EHDA 3ZIWA 4CYDA 5IVCA 1VRBA 2ORZA 1AR91 4JQRA 4MYEA 3BKZA 1RUJ3 4AI1A 1RVF3 2CHHA 2DF7A 3HNYM 4WM7C 4BISA 1UWWA 2DU0A 4OHXA 1U5ZA 4NR1A 1W05A 1HRI1 4YZ5A 3ZSEA 1RUE1 5FZ9A 1IS4A 2WABA 1O5LA 2WR9A 2WYSA 4LBKA 4UT5A 2K9ZA 2OS2A 2XLAA 4E4ZA 1GZCA 1PIV1 1RUD1 2F6BA 4RN5A 3CJIA 3POGA 5FP9A 3VD3A 5BV6A 1EYBA 2ORXA 3WW1A 1FV2A 4CDQC 4UF0A 1Q8VA 3N9MA 2CAUA 3GHNA 1ZRRA 1Y9QA 2ARBA 1J3PA 1AYN1 4QU2A 2X5IA 5K0UC 1UPSA 4JDMA 1GUIA 2P2KA 3SLIA 3T1MA 3TRSB 2WKKA 2BEOA 5I0DA 1UYXA 2YFZA 3DKQA 3IIIA 4CDWC 2WO7A 1JW6A 5F2SA 2WT2A 3KF5A 1W8UA 3QOPA 4Y4RA 2VMFA 1UY4A 2A6WA 4Q4X2 3L2YA 1SG3A 2VQUA 4LKDA 3SHRA 2E6VA 3T09A 2VZ1A 4A7YA 1UY2A 1XJAA 1OLQA 3OTFA 4AEJA 5FZLA 1G9AA 1IPSA 2WFF2 4QDSA 3BIEA 1W8FA 2QQVA 3LA7A 3WP6A 3JZVA 3ST7A 5F32A 4CUBA 2FDIA 2J1UA 3WNPA 1JYIA 2N7GA 4IETA 4NAOA 1UD1A 1MQTB 2WQ8A 5H9SA 1LOCA 4WVMB 3WDUA 3ZXDA 4BQXA 5FZ4A 1HRI2 1Y9MA 2R071 4INDA 1QJU3 4HETA 5A3WA 4B1LA 4DUXA 4FBFA 5T5JA 1PMHX 3R4DB 3AYAA 2TNFA 3WEZA 4P08A 1UMIA 4CEYA 4JTOA 4A41A 1M06G 1DFQA 3WG3A 1CAVA 1AR61 1POQA 2DFBA 3KT4A 5EJZB 2R063 4LBQB 1GFF2 1H2NA 4BHPA 1H6XA 1DZTA 1XU1A 5D8AA 5I0SA 2WWSA 5J09A 4M4PA 4OUSA 4QMAA 4Z82A 2QTWB 4MX3A 3RGBA 3KVBA 1APNA 4BQ3A 1OA4A 1SACA 5E8AA 1O7FA 1O91A 1R1A1 3LEIA 1IPKA 3OGSA 1FOD2 2VUDA 3OYWB 1WMXA 1VBA2 4AVAA 3M8LA 2VOXA 3L2HA 1P8JA 2MEV1 2GMEA 5GJ6A 2JIGA 2R1BA 3TWIA 3VBHB 4LKFA 2ZEZA 5CVRA 2XQRA 4DUWA 5EWSA 2DUOA 4BU2A 4YW2A 2GU9A 1YQ5A 1O4TA 1R082 4YW7A 1WLWA 4Y22A 2UY8A 4Y26A 5KWRA 5A3OA 4AAXA 4AI0A 1W28A 4CDUC 3VKOA 4QXBA 2D3PA 2W94A 4BXFA 3PL0A 4FTEA 1UO9A 4OI4A 2UYAA 2XBO2 2ZGPA 1AR81 2WLPA 3MZHA 4YRDA 1OMIA 3MV01 5JXGA 3EB7A 1KXGA 4ZU7A 3N9QA 2WZR3 3DYOA 4XUPA 4DOUA 2IC1A 2GC2A 4QKBA 1M4WA 4IEWA 1PNFA 4I30A 4XJZA 3AJYA 2RR11 5CNAA 2WZPP 4JX0A 4ZHNA 2WN2A 3C7OA 3K46A 5JPMB 4LO6B 3M4FA 4AE2A 4DRVA 2WWUA 1B35C 3JU9A 5K8SA 2I2SA 2HWD2 5FZGA 5BNOB 4JC1A 3B9IA 3UGHA 1HKDA 3ZYIB 2VGDA 1FI2A 5T54A 4NJ4A 3GHMA 4NIIA 4JGYC 1I1EA 2VMDA 4BM8A 5FP4A 4XC9A 3ZYBA 3Q8EA 1U5IA 3IDEA 1Z0HA 2QQOA 3M70A 3PLQA 4MH0E 4N53B 4MHUA 4MGZE 1V9U1 5GZDA 5J98B 1N1VA 1YLLA 5JMCA 4HVQA 1W6PB 2ZZJA 5HV4A 2WAAA 2RS51 4XEZA 3MYXA 5LBCA 4YVSA 3ABZA 3USUB 1W6NA 4R9CA 1VJ2A 1WLTA 4U36A 3THTA 4XF9A 4MHRA 2JEMA 3BPZA 1GANA 1SLCA 2PMWB 4GJZA 4UW3A 4OQ9A 1MS5A 3OY8B 3C7EA 1NCRA 1CX1A 3R4SA 3PUIA 3D5OA 5JOWA 3C8XA 2DTWA 1AR82 1S0CA 4PQQA 3WNLA 2WNUB 1NXD1 5FPLA 3NJZA 2ENRA 2UWBA 5FYBA 1QJX2 3RZKA 2W3JA 2XL9A 5A7OA 4XUNA 3IZOA 3D3AA 4XZPA 4ATFA 1KFUL 2WNEA 4TZDA 1O4ZA 4XE9A 1PGW1 5HPOA 1MS9A 2FCVA 3M7AA 3LOBA 3TN93 2Y6HA 3IAQA 1K45A 4K1YA 1F8VA 3MIEA 3JBG1 1MS3A 1QXRA 1YC61 2WN3A 3TOJA 5ISLA 2HWF2 1PZ8A 1RMU1 5BNNB 5A6QA 5FY7A 5EP9A 4KBZA 1IS5A 4FFGA 2XL7A 1JMUB 3AP5A 1CAUA 3D6EA 3M3OA 4LIVA 4QHOA 3JD73 2TUNA 4QM9A 4OHZA 2PHXA 4E8CA 4Q4Y1 1CR7A 3VDDB 2O14A 5CFCB 4HSLA 1WLCA 1V9U2 3K3OA 2XJSA 3DV8A 3KF3A 5I93A 1KJLA 3H1YA 5L7OC 3A0NA 4UFMA 5FK7A 5ACA1 1PX3A 5FTTC 3N9NA 2RS52 2PHLA 4R8HA 3W21A 1BK1A 5KXEA 1RUC1 3V56A 3ZFGA 3D8CA 4ZY9A 4FPOB 4D94A 5DZEA 1S0EA 4M0NA 2WS91 3NSTA 5IFTA 4XUTA 3AJZA 5EYYA 1T6BX 1VBA3 3U75A 3N35A 5C4WB 2FDKA 1C3HA 1U12A 2I74A 3ILNA 4DEVA 1VB2A 3ZXGA 2WZEA 2UURA 2ZS6B 3RZMA 3GYDA 5FY8A 2FMYA 1W90A 2G19A 3ITQA 4NIGA 3NKGA 1OSGA 2WC2A 2QNKA 1OVPA 4KU7A 4LUKA 4Q5OA 4QM8A 1LECA 1W6OA 1W2TA 5I0UA 3U14A 1UMHA 2YBKA 2E51A 2ZEWA 1CONA 3LFMA 1NXMA 3LEMA 1KEXA 4QGLA 1K5MC 1IGOA 3ZFFB 4CSWA 1AX2A 4FOYA 1RMU2 1IKQA 1IPJA 3I2KA 4AGVA 3J26N 3NAPB 3LDBA 1YXWA 4FXKB 4B7KA 1PMJX 3AMMA 1VBC1 5C9AB 3IDBB 3VBOA 4H2AA 3O0WA 4XFFA 3GZTB 4R9DA 3LAGA 4P9YA 5FJKA 3HQUA 2HWC2 5F3IA 2XJRA 4M0HA 5FZMA 3A21A 4NHMA 2Q8OA 4BXSV 4IGQA 4CEWB 2HWD3 2VZOA 3JXSA 2VXJA 4PLNA 1QJZA 2PHRA 5C5UA 4FFIA 2H6BA 2VVEA 3KQ4B 4C8DA 4OHYA 2W08A 3EMRA 4FPCA 5JR7B 1ENSA 2BFUS 1U5YA 3KS7A 4JKKA 4GH4C 2WS92 3T2PA 3GALA 3HNBM 1WMDA 4N7UA 1GZWB 4AQSA 1W2AX 5FIXA 4Z1VA 3IB3A 3M3CA 4QB1A 3UKNA 5JCTA 3NQHA 1UU5A 5JXHA 1KDMA 1QWRA 2H6CA 1UYZA 2GNTA 4JRLA 1S2EA 1JU4A 4AFAA 4JGZC 2HEWF 4QPIC 4I0WB 5A80A 3VBSB 4YARA 3RVHA 1PO22 1PO11 3SCFA 2FHRA 2GMMA 5E1RA 1SQ4A 1QNYA 4Y1ZA 1J84A 2RM22 1UYPA 2QUOA 1H2KA 4ASMB 3PUAA 1PVC2 1LOEA 1ZA7A 2W46A 3HMYA 5A33A 4UXAA 4AEDA 3WQ0A 3SITA 2VVFA 5C3SA 2NPIA 4QDQA 4RHV3 2BVVA 2XH6A 5FPAA 4LLFA 2MNGA 2OT7A 1NQJA 2G1MA 3B94A 1UNBA 2ZX2A 1C8M2 1VBC2 2JIJA 1UAIA 2ZGSA 4ORFA 4OUMA 2HWE1 2UYBA 5FQ0B 3MI8A 4QPGA 2D93A 4ZKTB 3VBFA 1N3OA 1SEFA 1H2LA 3AYEA 1UZZA 3ES1A 4AXOA 1AYM3 1N1SA 5FJHA 2QBXA 1QXPA 3A7QA 4CP0A 5FYVA 1DGRN 1F2NA 5HCHA 3RI9A 4Q4V2 1I6XA 4QB6A 3PVNA 4UOJA 3U78A 1BHGA 2WL1A 2CTVA 2ATFA 4QX3A 1W0OA 1RJ7A 3GF6A 5KHIA 3AYCA 1GNYA 2XB6C 1ND3C 1A6CA 3X29B 4Q0QA 4BQYA 5E88A 1VRH1 3TBDA 4PBOA 1J59A 3S7IA 3PVBB 1TMF3 3U37A 1DQ1A 1IG0A 5FXWA 1IG3A 1PZ9A 2AREA 4EZHA 4NRQA 3DN7A 4XDQA 4CA9A 1UN1A 1MZFA 4EN6B 4Y5Z0 2EXKA 1J83A 1H8TC 2P1BA 5DAWA 5F6LB 4M4RA 1CIYA 3NVCA 4AL9A 4F3JA 3A4UA 4YG6A 1D4M3 3HT2A 2E7TA 4AHYA 4RSUA 2BDRA 3O5SA 2Z79A 4XFGA 5EXOA 5C3RA 1WWYA 2W47A 1VBD1 1CX4A 3HQXA 2VW1A 3WP3A 2TEPA 5LA1A 3PHMA 3GCWA 1S0FA 4YZ2A 4NHLA 1YEWA 2VTXA 1Q56A 4DS0A 4N7IA 2NQYA 3SXWA 1ZZ6A 1CD3G 5BPXA 5T5PA 3SNMA 3KB5A 4YFWA 2GDFA 2VNGA 5BNPA 4HZFA 1C5IA 3OUJA 2WA4A 4P9JA 4FAGA 2WQZC 5AFBA 1MEC1 4Q4W3 5JOXA 3TEYA 3WV6A 2PLV1 2D98A 2JENA 1XYOA 3HR9A 4YG0A 4PLOA 1K5MA 2L9LA 4HVOA 1MS8A 2R0HA 5G04L 5CFDA 4PI2A 3B69A 1Z7S2 3WQ1A 1HX6A 4CCLA 4L9BA 4BMEA 1RXFA 3W9AA 5JOYA 2FQPA 2HWC3 3POIA 4JHZA 4R4XA 5FP8A 5A32A 1DYOA 1COV2 2CDOA 4IDZA 3U4XA 2D5HA 2VG9A 5GZFA 3H7YA 3K4AA 4CDUB 2W0XA 2WWJA 2Z5WA 2NMOA 3SQOA 1ODMA 1UL9A 1OQ1A 5ANNA 3QD6A 1DP0A 1JZ5A 3AXDA 2VH9A 4MG2A 4IV3C 4YWAA 4IEYA 1JU3A 4UI9L 1ZBA1 3VD4A 4RS5A 4NRMA 3H1MA 1MZ5A 4LHNA 1NUKA 2OQ7A 4CDXC 4CU8A 4YW1A 4HVRA 2RMU1 2EAKA 4QQPA 4ZU5A 1TME2 4D7TA 5E16A 1CAWB 3F2ZA 5FPXA 4JQTA 1D0HA 4Y1XA 5FKCA 2IXHA 4DXRA 1PMIA 1GP4A 1HB1A 5LA0A 1N3QA 3JQWA 1PGL2 4Y1YA 1MEC2 2NZ9A 3THDA 2PLV2 4JGYB 4QGNA 1FMD2 2CY6A 1XNDA 2B9UA 4BPZA 1UKRA 1AL23 3HT1A 1GQHA 1JOJA 2YPJA 2J1RA 4XFBA 1GYKA 1PZ7A 1H1MA 1W6MB 3J7HA 2YB7A 1GBGA 3KMHA 4HKWA 3POSA 5EQUA 4CCKA 1O3SA 4LHKA 1ALYA 1O8PA 3K75B 3IBMA 3MEPA 4FP3A 4C0BA 1XSQA 4NN0A 3KD4A 4P14A 5FYTA 3CIHA 5JZGC 4CCNA 3M3IA 4XDOA 1OD5A 1A8MA 3LQCA 2P3JA 3IWZA 2BGOA 1X7NA 3NRUA 3R4UA 1DQ6A 4WM8A 3IPVB 4OYUA 1Y7BA 1OUXA 3WQBA 3I2FA 3WHUA 1RUJ1 4XXAA 4TN7A 3P1IA 2LRPA 3MW4A 5FP7A 1TNRA 5LRSA 3THPA 1NA1A 5GZCA 2GSYA 2NN8A 1X8EA 3NV3A 4IEXA 4TXWA 1AHSA 1ND3A 3R6SA 5C8CA 4S2GA 3SEEA 2QE3A 1O3TA 1QNWA 4NWWA 2ZKNA 5LY1A 1OLME 1PVXA 1JZ2A 4BQ5A 5I91A 1DYKA 1LU1A 2E32A 4W50A 1AL0G 1GV9A 1HRV3 3PJQA 2XXZA 2Y6FA 2Z42A 5F1RA 3ZFEA 3PIJA 1W03A 1H8TA 2Y6GA 4MSVA 5DN2A 5C3OA 4A2UA 2A71A 5LBEA 4GMP3 3M3EA 1POV0 5FDBA 2DVDA 2A1XA 3HWJA 4E9KA 5FYUA 2AYHA 2NM1A 1IKPA 3Q8CA 4NAMA 3MO4A 4BIFA 3NJVA 3SH5A 3T1LA 4UAPA 4GB33 5DUWA 3U1XA 1IQDC 1GSLA 2OIIA 3DCQA 3LEGA 3I3EA 4MO3M 3CJIC 4DFSA 3TNQA 1A8DA 1RHI2 1JOPA 3CQOA 4FPFA 2FCUA 2YV8A 2ZOEB 3T4VA 3AZYA 1JYNA 4TSVA 4BA6A 1JYCA 4XPVA 3J8F2 3H8XA 4XMAA 1IQAA 1VBB1 2YBPA 1UIKA 2X5IC 3SH3A 4BOWA 5FUPA 4CUGA 2Q4SA 5HCFA 2E33A 4C90A 1PHMA 4O65A 3ZXAC 1URXA 4AOCA 4R4ZA 1WBLA 1Z7S3 2J1SA 3HOBA 1UW8A 4CE8A 1AZDA 1BKZA 2ETEA 2HYXA 2ZX3A 1W3VA 5EFUA 1A3KA 3E5UA 3OGVA 1RUF3 4MUVA 4WZCA 3BVCA 1COV3 2X53S 3CLPA 4XF0A 1GLHA 3T0DA 1IS6A 1F35A 1RUG3 1D4VB 3OGGA 4BLIA 2BNMA 1ODNA 4J25A 3GGLA 2EIGA 5ABJB 3G7DA 1QGLA 2VL4A 2D3RA 1H8VA 3RWKX 1WW5A 1YI7A 4M3CB 1HJGA 3AKRA 5EIYB 1FPN2 3LFIA 3A23A 3OOXA 2R061 1CWPA 2EF6A 1ULOA 2K2SA 5FZFA 5H9PA 2QQMA 1A34A 2OQ6A 2Y38A 3MW2A 3UYJA 4EWAA 4CCMA 4JKMA 3WF4A 2R16A 4RGGA 1AXKA 1MQTA 1AR73 3MIBA 4FOWA 1O3QA 4CCDA 2JDMA 4WVMA 2VNRA 4OFGA 3T4HB 2YU1A 3CL1A 1SLAA 3IMMA 4AVSA 3NV2A 2PELA 1ZZBA 1CQ9A 3J9SA 1N1TA 3U10A 4CEYC 2PHTA 3OF1A 4PBPA 2VNOA 2ARXA 1GP5A 1SHWB 2E9QA 4Q2FA 5FZ6A 1JZ6A 1LAJA 4KMQA 4YGCA 3ECQA 1HXS2 1NCQB 4AEMA 2JKBA 2C26A 1Q8PA 3NV1A 1FNYA 1H9WA 1NKGA 2ZX4A 1WCUA 5D8AC 4EN7B 1QJY3 3H8OA 4AFDA 2JDNA 1OH4A 1DG6A 5KXBA 4LBQA 1V6NA 2W2IA 4FQ4A 1R092 2FZ1A 2VZ3A 4D6RA 5I8SA 4JGZB 4A4AA 1ZRFA 2R30A 5HCAA 1VALA 3T30A 2BJSA 1KFXL 4KG0A 1B09A 1RUH1 3ZYRA 5T3NA
chains in the Genus database with same CATH topology
3BALA 4D3WA 3P3PA 4K1ZA 3OYWA 4PIYA 2RS11 2WQ4A 2B7YA 1NYWA 3I2DA 3VBHA 5JSPA 1W2UA 3HAGA 2GN7A 3MIGA 1YJLA 3LKJA 1BEV3 1A78A 2CYFA 1LCLA 5CG8A 5IK8A 4KGQA 2YDEA 4RR3A 3RS6A 4L8QA 1H30A 4A3XA 4Q1PA 4OHWA 2E63A 3EBRA 1H4HA 4W65A 3WDTA 5BNQA 1YWKA 1RTVA 1ULEA 1YIFA 1C8NA 3AP9A 2CWMA 4B4QA 4LE4A 5CA6A 4BLJA 4LO5B 3DPRB 2WNVA 2R043 4NO4A 2A73B 2B46X 3ATGA 3AK0A 4OLLA 2HWB2 4RA0A 3H3ZA 3ZXJA 3ZXLA 3ZN6B 4IV1B 5BNOA 3OPZA 1JTZX 1RHI3 1QF3A 3C2UA 1ENRA 4S2DA 1CIWA 1GNZA 1RUH2 2IXCA 3B01A 3NKTA 1O5UA 2XHKA 1YFUA 2RS12 4YVSC 5DZGA 3KZ4C 4JTNA 4N53A 1LENA 3QH7A 1HW5A 1W6PA 3ROUA 4YLZA 1NCRC 1WW6A 2ZABA 1BBT3 3USUA 2VVDA 5DG2A 1PGSA 4X6QB 1CESA 2SLIA 3UKTA 4IEQA 1YNAA 3OY8A 2E7QA 3RI8A 3RPQA 1EAH1 5EZWA 3RQ0A 3VBRB 5T55A 2D6NA 5I8YA 1ZBE1 4FPGA 2O8QA 3KGLA 1J1LA 1FPN3 2R32A 5IK4A 4C1WA 3V0BB 1XE8A 1AR92 4UW6A 3KGZA 4DQAA 4KQ7A 4OI2A 2JG8B 1MACA 3RYPA 4YZ1A 3WNXA 1RUE2 3CU7A 2A6ZA 4XHBA 5BNNA 2ZZQA 4XOGA 1ND2B 1RITA 1PIV2 2ZGKA 1RUD2 1ENQA 5KC5A 4LA2A 2FZ2A 5FLJA 4O9EA 4AEKA 2QCSB 1F5FA 4HK9A 3VDDA 5CFCA 4WVVA 4WVZA 1LGBA 2A3XA 2IZWA 4I3GA 5DUUA 1XYNA 2DCYA 3ZFGC 1POV1 2E7AA 1SBEA 1AYN2 1MZEA 2V09A 4XJ9A 5F6KA 5AVPA 3VKFC 1ASJ1 1ZA4A 3WZ1A 2EXHA 2B8MA 1BQPA 5BYNA 3BU7A 3MLKA 4NOTA 5JSOA 1WUVA 5C4WA 2AH2A 5GZGA 4YW3A 1ZBE2 5FO9B 1V6JA 3E6CC 4SBVA 4FPYA 4Q0VA 3UV9A 1E57A 4BQ1A 3N36A 4COZA 2OUHA 3IKWA 1SLBA 4CP2A 2YMZA 5FLIA 4M3CF 5JDBA 3VHPA 1SLTA 2GMPA 5HXVA 4EWEA 2R072 1NE6A 1G86A 1FATA 3VBOC 4AI8A 1EV11 1YHFA 1HV0A 1C57A 4LO8A 3ELNA 3NAPA 1OOPA 4BE3A 2ET1A 3FLPA 5C9AA 1XNKA 4YW5A 3WDXA 1NOVA 3ZX7A 4WVWA 2XJTA 3IM0A 1AR62 5H9QA 1XXNA 4XFCA 3K48A 3VBUB 2ZHMA 4YZ4A 2V73A 1LR5A 1OFSA 1PK6B 3QBQA 4YVWB 4AK3A 2D40A 1ULFA 4B4PA 4YGEA 3S0MA 3AZXA 4RHV1 1R1A2 2GC0A 2D6KA 2E53A 2BFUL 2NYYA 1QOTA 2IFRA 2MEV2 4MXWB 3RSJA 1S0BA 4FXGB 1H1AA 1MS4A 1UMZA 3VBSA 2GC3A 2QQPA 1QQP1 1Q43A 4AEDC 2P37A 2YGMA 4NPRA 1S2KA 1SCRA 4Q4X3 2CGOA 3ACLA 3C3VA 3CJIB 3KT7A 3RYKA 1LOAA 2WLQA 5LEJA 2WFF3 4Y1UA 4QPGC 3TB0A 3VBFC 1ONAA 1TMF1 4FPJA 1VBE1 5SV5A 5FQ0A 1G6NA 2RR12 5K9YA 1EPZA 1LOGA 2YYOA 4HKOA 5GZEA 4PDWB 2GALA 4RQPC 1HRI3 2R6QA 4HL0A 3R05A 5FPZA 2P3IA 4K3UA 1D4M1 4LBLA 4RGAA 5HI0A 3ZYPA 2JG9B 5BUVA 2BNOA 4ISRA 1PIV3 4Y1VA 3V0AB 2BQPA 2OUJA 4CZSA 2NLRA 3LB9A 3B02A 3ZSKA 3VZMA 1AYN3 3DUIA 4XQWA 4ITCA 1IZ3A 3I8TA 2WT0A 1Q5OA 4AQ2A 3PTYA 1FOD3 3FBYA 4Q29A 5KC6A 1OA2A 4HANA 4CEYB 1LHWA 2DYCA 3SMHA 2X29A 4P9IA 3AMQA 3TNPB 1CAVB 1CJDA 2ZHKA 4XETA 3ZDSA 5FOBB 5JAXA 3E5XA 1QH6A 4TYSA 5GKAC 5JVVA 2BPA2 1R083 1RL3A 1VBE2 2ET7A 1W6QB 5BNPC 4YM2A 2ZHLA 4AG4A 1PGW2 1C28A 1W39A 2BTVC 2HKXA 4A7ZA 2XBO3 3JBG2 4I01A 2VUAA 4N90A 2D43A 2C0ZA 2VOVA 3MIHA 4HKLA 5CFDC 1RC6A 4YM0A 2VOWA 2QZ3A 3WX5A 4IEOA 4AFCA 4YGDA 4Q4Y2 3D82A 4JDNA 1H0BA 5JPNB 2EA7A 3E6DA 4RL7A 2IWGB 1V6OA 5ACA2 3O7OA 3NV4A 2IXLA 5CU1A 2G9GA 3GBWA 4C91A 2ZTNA 1RUC2 3D0SA 3LSEA 4N43B 5EJ3A 3ZYJB 4AI3A 2ZBJA 4ASLA 2D44A 2PHWA 4RS5C 5T5OA 1UPIA 2JECA 3M3QA 1QMJA 1OHFA 2OPKA 5FBZA 1GKBA 2GNMA 2CWSA 2YROA 4ES8A 4TWTA 4MGYE 2BBVA 4WM7B 1YRZA 3UK9A 1CAWA 3ZSLA 4Q0SA 1LOBA 4ISQA 1RUI1 4OHVA 3WW3A 2G9FA 1AR83 1F9KA 3GNEA 1QXJA 4QQLA 4LR4A 4DNYA 5FRAA 1QJX3 2DFCA 2CGPA 3HD8B 4RFT0 3ILRA 3NW4A 4CDQB 3FHIB 3BB6A 1SFYA 1W6MA 2RR13 2ZA9A 1AXZA 5JWPA 4WM8C 5K0UB 4HLTA 3WG1A 1HRV1 3KCXA 1ZZ7A 1V00A 3AFKA 2HWF3 4CDWB 2QVSB 1LESA 4RQPA 1Q8QA 1NA1C 3H1WA 3VZLA 3IPVA 2ZGUA 3TYJA 5C8CC 4FT8A 2OZ6A 4GWNA 2QKDA 3WDVA 1S0GA 3AMHA 1V9U3 2ZPXA 2NMNA 2XWBB 2GC1A 5JIAA 4AHXA 4YSFA 2RS53 1AJOA 3FUOA 2RS31 3OCPA 1CN1A 1PO12 1ULCA 3ZSMA 3FUQA 3ZFEC 5LK7B 2JDZA 1X36A 5CBLA 4AFMA 3I4IA 4AVVA 2B42B 1QDCA 4ZXKA 3RDIA 3O12A 4G4FA 4IXLA 3ZYGA 3M1HA 3WP4A 2BNNA 3N7MA 1LEDA 1AVBA 2ZGLA 2VMHA 1Q3EA 4L92A 1QY4A 4K7JA 3CF6E 2LUWA 1MZ6A 3GBGA 2HWE2 2AENA 1BJQA 1RUG1 3MICA 1LULA 2BUKA 2C5DA 3ZFGB 5BY5A 2CAVA 1SFNA 2DCZA 2OVUA 1ZRDA 4QQOA 4NHKA 4U2AA 2AUYA 1WA4A 1GR3A 1Z78A 2DCTA 3DKWA 1OLRA 1RMU3 3EQEA 4Z07A 4E27A 2VW2A 2VULA 4K20A 2ZX1A 4B29A 1V6LA 4Q4Y3 4Z2WA 1AR71 3RG0A 1VRH2 3AZZA 4D7SA 4XILA 1WBFA 3BIWE 2Q1ZB 1Q8SA 1X8MA 4IEZA 3RJRA 3WCSA 2B5HA 4YM3A 1N3PA 2EVXA 3IMNA 5DDJ1 4XTMA 2ES3A 3ENRA 4EWDA 5ABJA 1XE7A 4BMBA 2WS93 2K0GA 4M3CA 2JE9A 4XF3A 1QJY1 1OPOA 1MQTC 2XJQA 4K9SA 3VZOA 1G7YA 3OBRA 1EP0A 3AP4A 3D4KA 1VBD2 1YFXA 4QT6A 1BXHA 2EALA 4JAAA 3ZO0B 5FLHA 2XKOA 1PO23 4H3WA 4W6XA 4FVVA 2AZ5A 2G4IA 3QH6A 1LOFA 2RM23 1S2BA 5SV8A 4Q26A 1QOSA 1HQWA 1PVC3 1B35B 1BVVA 2GH2A 4AHWA 3AKTA 3LZZA 1TEIA 4HBNA 3ZXFA 3JQXA 3FLRA 1NCQA 4P9GA 4F83A 3RJ2X 3V64A 4B4RA 1C8M3 1VBC3 5JSRA 4Y20B 1DGLA 4JDOA 5AC91 4IQPA 1O3RA 1SBFA 3FBMA 1BMV1 1YCIA 2LALA 3VBHC 3OBTA 4Q4V3 4YG3A 5DDJ2 5LK5A 1J58A 1EPWA 4XBLA 4R52A 1CPMA 2JJ6A 2R041 3WDWA 3B7MA 3SCGA 1RVF1 4PQ9A 4RR3C 5IUQA 4AW7A 4META 5C6CA 1ZBA2 2ILMA 1AF9A 4MLOA 5FMOL 2RMU2 1XNCA 1YO8A 2KM2A 3S7EA 2WNVC 3I54A 3MLJA 5GLZA 3M2MA 1HIXA 2VMIA 1REDA 2RE9A 3CO2A 3DPRA 4M00A 1KS4A 2DURA 2VY0A 3VGIA 5BNOC 1BBT1 4KWJA 1BZWA 3B3QE 2XJUA 2HWE3 3ZN6A 2YUEA 1J3RA 2A6VA 1IS3A 4IV1A 1H4GA 1R1ZA 3AKQA 5L7OB 1LHNA 4XTPA 1JN2P 3AMNA 5I8TA 1AUYA 4LE3A 2Q1MA 4QD2A 4YFZA 4N53C 1AXYA 1UX6A 2ZJCA 4R9AA 1ZZ9A 1RUJ2 2ZX0A 2GNBA 4AQTA 1RVF2 1JH5A 3VHOA 2Q5TA 3LGRA 1REFA 5I0RA 1AX0A 2WA3A 1QOOA 3AZVA 2ZACA 2A3YA 4N9IA 1QJU1 2YY1A 4ZU4A 4YW4A 4I2OA 1YUDA 4H7MA 3VZKA 1DZQA 5KHGA 4BWOA 4HFSA 3KSCA 1K5MB 4BZ4A 2QDNA 3EJKA 2VQ0A 4YGBA 4NWVA 4ES9A 3PVEA 1D2SA 2PFWA 2DVAA 2GNDA 3IIAA 3PMSA 1X82A 3E97A 1TE1B 5BNNC 1TME3 4IEPA 4QPYA 1C1LA 4DB5A 2PQQA 4COUA 1NY71 1JXNA 2AGSA 3O0VA 4DMIA 3WQ7A 4B7EA 5J96B 4PLMA 3MFAA 3VDDC 4E4DX 5CFCC 1ND2A 1HQNA 1KJRA 2P34A 1ZVFA 1MEC3 1DF0A 3MDPA 2HEVF 1VBB2 2PLV3 1Q8OA 1FMD3 4GH4B 4RS5B 4E2GA 3VL9A 3WY6A 3WXPA 4Z8BA 4LBOA 3W58A 1F5JA 3BCWA 4QPIB 1QJU2 3HIFA 5C4WC 2QFEA 2Q30A 3QLQA 4FTSA 2Z2SB 2WZR1 2ZAAA 2BWAA 2PAEA 4XF1A 1AX1A 1RUNA 2DUPA 4XFHA 4XFIA 2R062 1SLLA 2DCKA 3WCRA 3MPBA 5FMOS 3GZUC 2Z69A 3ETQA 2P17A 2YHJA 4FSJA 2VUJA 4IEUA 5GM0A 4EN0A 3DL3A 1YJKA 3NAPC 4I09A 4H55A 3FJSA 1OOPC 1ULGA 2D6PA 3PVOA 3VV1A 2C9AA 1NY72 5C9AC 2HJIA 2GH8A 5KHHA 2JD4A 1UF2C 1SBDA 4XYXA 4DRRA 1N1YA 3VUOA 1XQNA 5DG1A 1ND3B 1DYPA 1QDOA 1ZZCA 4KH9A 1WCDJ 1S55A 3VBUA 1PK6A 3CJXA 4YVWA 5GALA 1WCSA 1GICA 3H50A 1TNFA 3A0KA 5LRRA 4HN1A 3ZFEB 2DCJA 2WFF1 4XMIA 4BM8A 4QQ2A 4HK8A 3J8F3 1H8TB 4HPKB 5J36A 2WZR2 4KG8A 2XWJB 3VBSC 4PCRA 3NL1A 4MXWA 2V5YA 3WVJA 2O8OA 3TN91 3U11A 1HV1A 2R1DA 3WW4A 4D69A 1HDKA 1BYHA 2ERFA 1O4YA 1KITA 2JE7A 3MIDA 4H7LA 4PIZA 2XPJA 3KCYA 1Y43B 2WJSA 3JD71 2UWCA 1IOAA 3AP6A 1WCKA 4LO4B 3UKVA 2WNUA 2X8KA 3INAA 2IFWA 4OVEA 1G9CA 2BYVE 1OKQA 1FV3A 2DTYA 1DQ0A 3RRDA 1DHKB 4LT5A 1FAYA 4E2QA 5F9TA 2UWAA 2PHFA 4PDWA 4Q0UA 1XU2A 1NQDA 2W52A 1FOD1 1VBA1 3BOPA 3SH4A 3WR0A 1G9FA 4LTAA 4DY3A 3H3UA 4I0AA 4E4SA 4LBJA 1HXS3 2JG9A 1U5XA 2R49A 2VW0A 3WDYA 2XVGA 1VBB3 4IESA 5KXDA 4EN9B 3V0AA 1R081 2BWCA 2JX9A 4FOVA 4GWMA 4IV3B 2WIIB 1R093 3PJYA 1U0AA 2ZGQA 1D2QA 2HYKA 3TN92 4CDXB 2XBO1 1J3QA 3ASIA 4I3PA 3UJQA 4NVPA 4MGIE 1EAH2 4YYOA 3JD72 4KU8A 1CAXB 2OZJA 2XJVA 5T52A 3MW3A 5BXXA 1H2MA 1WW4A 3ES4A 2PAKA 4FPLA 4AVCA 1VAVA 2HWD1 3I59B 4LBNA 4JVAA 1W6QA 1JHNA 5J3UA 4L11A 1DDLA 5D1IA 1DLLA 4AGGA 1DZRA 1PM7A 4S2FA 4YM1A 1LODA 1V6IA 2CGNA 2LTNA 3FFQA 3FLTA 4GMP0 3ZFFA 1ZRCA 5JZGB 3AFGA 2KXLA 2VOKA 4JCKA 4GXLA 4H14A 2HWB3 1YI9A 4FPKA 1C1FA 3H8UA 2YXSA 1C4RA 2DVGA 3H9AA 4RR3B 3TAYA 1L3JA 1VB4A 5CAZA 4FQZA 4CEWA 1ASJ2 3I7DA 4EV0A 4IL7A 4XQ4A 3LA3A 3RNSA 1RUH3 1WW7A 5AVAA 4N43A 5K7PA 4M01A 1QJX1 3POYA 4UBHA 3LCPA 2A6YA 2WNVB 4AHZA 1GZWA 4Q8KA 2RS13 3AMPA 2XUMA 4Y24A 3ZVXA 1KD7A 1WMEA 3KCCA 1OFNA 4B3NA 1X33A 4QQHA 4GA9A 1MS1A 1UU6A 4Q0PA 5I0TA 3HBZA 3LSDA 1S1AA 4XQDA 3WLUA 1AYM1 2OA2A 3AM2A 1DBNA 1W0PA 2HWF1 4WM7A 1VLNA 4FCAA 4MVTA 3ZMNA 1KDKA 1LHVA 2ZGRA 5B2GB 1I5ZA 3ALQA 3O0XA 3WUCA 4RD7A 2DWRA 3AX4A 5CB7A 4G3YC 4UW4A 1EV12 1MVQA 4JRAA 4BYYA 1AR93 2X5IB 1GQGA 4GKXA 3B9CA 4CDQA 5GLWA 3WG4A 4J6GA 4AYUA 1REEA 3JB8A 5K0UA 1RUE3 2LM3A 2IXJA 2XVLA 4P9LA 3WP5A 4AQ6A 1OPMA 1S0DA 5GLUA 3ZIXA 4COWA 5KHJA 4CDWA 4F7ZA 3VLBB 4RHV2 1RUD3 4D7YA 4MV2A 2A3WA 2XJPA 1VP6A 3ZXEA 2P3KA 1OQEA 5C8WA 5CIRA 1SDWA 4Q27A 3DF0A 1Y3TA 3IDCB 2A7AA 2D6OX 4QXKA 1AYM2 1QQP2 3NWKA 4URTA 4HN0A 2D6LX 4Q4W1 1DQ2A 2D6MA 2ZMNA 2XKPA 3EHKA 1EAH3 1ZX5A 3T2TA 5IK7A 1ZBE3 4JV4A 1ZZ8A 4W6WA 3MF6A 1FX5A 2PHDA 2HWC1 5J7MA 1TMF2 3VZNA 5D8AB 4LUMA 4K6BA 2EXIA 2WSUA 1V6KA 3BTAA 5CG9A 2R073 2WSVA 1F31A 3EO6A 1VR3A 4S2HA 1D4M2 4DPNA 2CV6A 1BCXA 1QU0A 4DINB 4XBQA 1SMVA 2GZWA 1CGPA 4Y22B 1PO21 3KQRA 4CRQA 1AR63 3CNAA 3N4MA 2IXKA 4L97A 4QGMA 4OI1A 2RM21 1POV3 5ABJC 1PVC1 1MVEA 4KWLA 4PF5A 4XJWA 5HCBA 1ASJ3 4LULA 4YNIA 4LBQD 1RUOA 1T6GC 4CDUA 5J37A 1C5HA 3E6BA 2AR6A 4FPHA 4I0BA 3ZXKA 4Q4W2 2DUQA 1R1A3 4GIQA 3MIFA 1OOPB 5L19A 1UZYA 1AL21 1C8M1 2MEV3 1DGWA 4R9BA 4Q8LA 1JUHA 1LRHA 3PNAA 1YFWA 1LOFC 2PYTA 4HSJA 3WG2A 3RYRA 1GNHA 4AVTA 4Q4V1 1NCQC 2PA7A 5FCCA 1FNZA 1B35A 2ZMKA 3VKMA 4YZ3A 1SLIA 5HBAA 4AVBA 1QKQA 2I07B 1EV13 1JUIA 3VHRA 4JGYA 3RZZA 1VAKA 5EV7A 1I3HA 4YVSB 1W6NB 4Y20A 3H0OA 3E5QA 4DZGA 1LGCA 2W68A 1NCRB 2A70A 2PTMA 4A7KA 1JBCA 5DUVA 2DU1A 1TQ5A 1NG0A 2ZGTA 2D3SA 2UY9A 1FT9A 2VU9A 4GMP1 2FMDA 1LTEA 5A3MA 1AL22 1KS5A 1EY2A 1UCXA 4GB31 1H9PA 2PN5A 3JUUA 4K8FA 3EXUA 4PIXA 2VXRA 2ZHNA 1D0GA 1QQP3 4X8PA 3GBFA 3ZSJA 4AF9A 5FOJB 1RJ8A 5L73A 2WT1A 3WINE 3WW2A 2F4PA 2BGCA 4QX5A 3DPRC 3L9JT 1CAUB 3K51A 1RUI2 4MGKE 3SISA 2DVBA 3WUDA 2EXJA 4K21A 5JIUA 1Z7S1 2FBEA 1NLRA 4BCUA 4B8EA 4Y4YA 1YIPA 4IV1C 1IHMA 2MPFA 2PHUA 4EN8B 1RUF1 2RJLA 1COV1 1VBE3 3KLSA 1CVNA 4SLIA 1LKNA 2BW8A 2C1FA 5JLVA 1NE4A 4AI2A 5TSWA 1DGRA 2B45X 2QJVA 1I9RA 1VIWB 3MFCA 5L7OA 3FZ3A 2O0OA 3JBG3 1HRV2 2EAAA 3R0RA 3VHNA 2OW4A 1YYNA 1LHOA 1WD4A 3N7JA 4HMZA 1V70A 1XYPA 2ZGNA 3N7KA 4WV8A 2A75A 1ZYBA 3Q9OA 5GLTA 1PNGA 2YZ4A 5C33A 4LO7A 1TME1 2WFPA 4XF4A 3AYDA 1H1IA 4UW5A 4GB32 4XJAA 1W6OB 2VQAA 4EJRA 5ACA3 5GLVA 2XVKA 2H0VA 2RS32 3VBRC 2ZKLA 1ZREA 1NZCA 2D7FA 2JICA 1KQRA 1RUC3 5CADA 2Y0OA 1PGL1 4P9WA 1RINA 5DUXA 5KHKA 2Q0AA 3ILFA 1FMD1 3LWCA 5JI9A 1MS0A 2XG3A 1NLSA 4Z92B 3VBOB 3RMYA 4UBGA 3S30A 1DU3D 4MZUA 3U07A 2JG8C 4DXZA 1RUF2 5J48A 4M3CE 5JI7A 4OI0A 4KNCA 1N47A 1RUG2 1ND2C 1UU4A 2DV9A 5FAXA 2A6XA 4J1WA 1QHDA 5A3LA 3J4UH 3HN1A 1LHUA 4LHLA 3ZMOA 5DZFA 1X50A 1BEV1 4GH4A 3POWA 4GQ7A 2YGLA 2GAUA 1AR72 1G9BA 2UU8A 4P9XA 1XNBA 4XIKA 1RGSA 3JCIA 1FXZA 1MR5A 4L2NA 3VKLA 4JGZA 4QPIA 5A33B 4AEDB 1LJ7A