1RXFA

Deacetoxycephalosporin c synthase complexed with fe(ii)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
307
structure length
264
Chain Sequence
DTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDLVIDFFEHGSEAEKRAVTSPVPTMRRGFTGSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFMAPHYDLSMVTLIQQTPCAGFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAAPRTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHASE
publication title Structure of a cephalosporin synthase.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
total genus 82
structure length 264
sequence length 307
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1rxfA00
1E5HA 1HJFA 1W3XA 1ODNA 1W04A 1W28A 2VBDA 3ZKYA 1QJFA 1HB4A 1W2NA 2DBNA 1WA6X 1UOGA 1W2OA 4BB3A 2VCMA 3ZKUA 2IVIB 2WO7A 1E5IA 1ODMA 1W2AX 5C3PA 1UNBA 1W9YA 5C3QA 1OC1A 1GP4A 2BRTA 1UOFA 2CSGA 1HJGA 1W05A 2VE1A 1RXFA 4RGKA 1HB3A 1W06A 2JB4A 1BK0A 5C3SA 1HB2A 2JB8A 2BJSA 3ZOIA 1DCSA 1OBNA 1HB1A 2DBIA 5C3RA 1IPSA 2VBBA 2VAUA 1E5SA 1GP5A 1GP6A 1UO9A 2VBPA 2Y6FA 1UOBA 1QJEA 1UZWA 1QIQA 4XAEA 2BU9A 1W03A 1BLZA 5C3OA 3OOXA 2IVJA 1W3VA 1E5RA 1RXGA 2Y60A 5APAA 3ON7A
chains in the Genus database with same CATH superfamily
5JIUA 4OQ8A 5F5CA 1GLHA 1PIV1 4GZ9A 4E2SA 2NP0A 1OA2A 1JUIA 5F39A 1ST8A 1ODNA 3B94A 1K5MA 3AZYA 2XXZA 5BNNA 5CAZA 3ZYJB 1MVQA 2CGNA 5KXDA 2PMWB 4R4XA 1CONA 1TNFA 3KCCA 1W8HA 2W0XA 5CZKA 2WFPA 2JKBA 4DXSA 2B45X 4ZZ5A 5ABJA 4LEJA 3TN92 5FKBA 1NLRA 1RITA 5FYHA 4E8DA 3S7IA 4Q1RA 4BK5A 3GXUA 2IVIB 1FNYA 3DXUA 3NV4A 3K3NA 1V9U1 2W1QA 1G9FA 4I0AA 4LLOA 1QJU1 4YVWA 3U10A 1KGYA 2IZWA 4KWLA 3NAPC 3WNLA 4D6RA 3O0XA 4CUCA 5JR2A 2HLEA 1H4GA 2J42A 3UGHA 3N9NA 1ENSA 3MLJA 3S5QA 2XJQA 2XMLA 5B4NA 1LHUA 5C9AA 2YU2A 3POJA 1VBD3 3OG2A 2P4EA 3AZXA 4TZDA 4FFIA 2QDNA 5FP4A 1OC1A 1ONAA 1NXD1 3AMNA 4HANA 4JAAA 5E1RA 1SACA 4AQSA 5A70A 3R6SA 1ALYA 3OB8A 2WQ4A 4GWJA 3UESA 4YM0A 3B7MA 4QKDA 5DXDA 4AK3A 2X5IB 1YYNA 3HNYM 4LKDA 2VZPA 5GZFA 4QPIA 3VKOA 1B35A 3LZZA 4JRAA 5A3LA 1ZRCA 2EAKA 4YG6A 5J98B 2C5DA 3PUIA 4AEMA 1VB2A 3CJXA 5FWEA 2IXLA 1U12A 3PL0A 1OF4A 2C4XA 4EN6B 4HOOA 1WCKA 3AB0A 3H1MA 5FZGA 4OI1A 1C8M1 5IYYA 2W08A 3NJZA 2BGOA 1RUG2 3NJXA 3PJQA 3K4ZA 4LHLA 4UOJA 4MXWA 2BQPA 1LHOA 3JB4C 4OUMA 5IT6A 4WM8C 4FPEA 1PGL2 1QNWA 2RDNA 5K0UA 2YY1A 2Y0OA 3NNLA 1NXMA 1W2UA 1NG0A 1H9PA 4CDUA 1OLQA 4Z92B 1PK6B 2YFUA 4BISA 1PX4A 2OS2A 1WKYA 4ZS3A 1VRH3 3I4IA 1GOHA 1FMD2 2EALA 4PF5A 1SLLA 4YW7A 3SMHA 2D3PA 1J3PA 2O1QA 3VL8A 2B8MA 2HYXA 3WF2A 1AYN2 3ORJA 1HN0A 2GC2A 4CYDA 3JBG1 2HEYF 2W92A 4A44A 1C1FA 4NN0A 4QGMA 3T0DA 2JWPA 5BNPC 1ASJ2 1NA1B 4QPYA 2ZX3A 1KS4A 1K45A 4TN7A 3WNPA 1O3QA 1AL23 1J1TA 4BM8A 4URTA 1RUNA 2HEWF 4NIHA 5FBJA 1WW7A 1OD5A 2VJXA 3KHCA 1LAJA 1JW6A 1UYZA 1BZWA 3VDDC 4K9SA 1NCRB 4CP9A 3NO8A 4O9GA 4OZOA 3WG3A 3A4UA 3D8CA 4I30A 1LEDA 2CL2A 2YXSA 3WNKA 3ZN4A 1NCQA 4Q4Y1 5AFEA 4QXCA 3UJOA 1BKZA 2BVBA 4C90A 2W2IA 4BQ2A 1WA6X 3C3VA 1ZZ6A 4GH4A 1UXXX 3J8F3 3IT8A 2BGCA 4OUSA 3IDAA 5F5IA 4BQ5A 2DFCA 2VCBA 2OVUA 4LBQD 2WO3A 1AJOA 1COV2 1RUI2 4H55A 4UF0A 4LQRA 5FXXA 3GGLA 1YFWA 2ZZQA 5EXOA 2PYTA 5LBFA 2IXKA 4JRLA 2ZMKA 4XQWA 1X8MA 1W2AX 5TSWA 1N3PA 3WSOA 3R05A 3ZFEB 4Y22B 3AFGA 1YFXA 3IDCB 3LGRA 1T2XA 1HRI2 2V09A 4HSLA 5FRAA 3VHRA 2QTWB 2VW2A 3AZVA 2MEV1 5GKAC 3AMHA 5LBBA 2UURA 1IKPA 3CQOA 1X8EA 1F2NA 2EF6A 4W6WA 3TN93 4AHZA 5A33B 4CCDA 3PMSA 4RHV1 2EXHA 4HG6B 2JDPA 1L7QA 1HKDA 4J6GA 3TRSB 4XOGA 4CEWB 1VE0A 1A6CA 3MLLA 1O4TA 3W9AA 2RS52 4XJUA 2WZR2 2VVDA 4DUXA 4KH9A 4Y5Z0 5E6HA 2Y26A 3FC0A 4IV3C 1KEXA 3KGLA 2E63A 3RZHA 2ZOEB 4AVBA 3VBOB 2O0OA 2BP6A 2XL9A 4OMDA 2D7FA 4QHBA 3ME2A 2R072 4AE2A 4NROA 2ZTNA 3OYWA 5T50A 2FHRA 1UZYA 2CV6A 4CDWC 3VD3A 4M3CB 3RYKA 1CAWA 4A3XA 1PZ8A 1SFNA 3I2IA 1RUC3 5DUXA 2VXJA 4EN8B 2BFUS 4PLNA 4F7ZA 4AHXA 4MZUA 4A7KA 4CDQB 2JENA 2OZ6A 4CEYC 4FOQA 1XPWA 1QJY1 4FFFA 2VOKA 1Z7S3 2DVFA 4A42A 4YZ3A 2YUEA 1HX6A 3MW4A 2D6PA 1DQ5A 2ARAA 1FXZA 1OF3A 1OUXA 2R16A 3GZEA 3BB6A 3I7DA 1NYWA 3LQCA 4KU7A 1RUG3 1UX7A 4QB2A 2JDAA 4M0HA 1SG3A 4JQTA 4O9EA 2GN7A 4QGLA 1VMHA 3V0BA 1W0NA 1R1A2 5CADA 5F32A 2FDGA 1XE0A 3T2OA 4IETA 3OD4A 4V1PA 4QKNA 4JGZB 2JD9A 2ZXQA 1XNBA 1FMD3 2ENRA 5C8WA 3OTFA 4YM2A 2ZX1A 1W6NA 3I2DA 4ISRA 5F3IA 2BNNA 3N9LA 5E88A 1AYN3 3VBUA 1PVC3 3NNFA 4J25A 5BNNB 3NW4A 3POGA 2KA3A 2IVJA 2KR2A 4NIDA 5J36A 1KFUL 4PIZA 2DYCA 1ZA7A 4MGKE 4YZ5A 5IVBA 2WLPA 4C1WA 2WNEA 1W8TA 3ZFGA 4LT5A 4XBQA 5FZBA 1LECA 1W0PA 2QFEA 2JDYA 1W28A 1RC6A 2OUHA 1F4AA 3HBKA 1HRV3 1XNDA 2NLRA 3ES1A 3P6BA 5IW0A 4RQPA 4COZA 2UWBA 4Q8LA 5KC6A 3CZUA 4R52A 3T4HB 1YXWA 4YVWB 2D5FA 3ZXGA 1REEA 4UW6A 3UK9A 5C4WA 2CDPA 5GLWA 1QU0A 5DUVA 1AUYA 2RJ2A 1UYXA 2E53A 5C9AB 5A3MA 1DYOA 2A1XA 4Q2FA 2CGOA 4YZ2A 2ZJCA 2VGDA 4RR3C 2GH2A 1WMEA 4XQDA 2YPJA 1E5IA 4I09A 1Q5OA 5FZEA 1QGLA 3QD6A 2XPJA 5CFDC 3HN3A 2WNVC 4IV1A 2BVVA 1X9PA 1TME2 2D97A 4XMIA 5LZ6A 2GC3A 1WMXA 1AR71 2DVDA 2RM22 2YPDA 5LEKA 4TLFA 4QPIB 2WZEA 1COV3 1RUI3 1PO11 2P1BA 2P3IA 3H42B 3PURA 2JDZA 3DCQA 5A3OA 3FFQA 2HWC2 3SKVA 1Y43B 2GMMA 4RS5A 3AP9A 1D4M2 2ZKNA 5DAPA 1S55A 1ULOA 1XYOA 5IUQA 3KVBA 4MXWB 3VLBB 3E5UA 5FYTA 5J3UA 1MQTA 2DCJA 1HRI3 3WW1A 4LBQB 1BMV2 4Y1YA 5I8SA 4OHWA 3CEWA 1PMHX 1U5IA 2EIEA 5FYUA 5FYMA 1WBFA 2X53S 1UY1A 3UYJA 1MS0A 4D6QA 3MW3A 5JWPA 5A3NA 2WO1A 1FNZA 3ZYRA 1LCLA 4YRDA 2GSYA 1LOCA 1W6MA 1CJPA 1MZFA 2WSUA 4L11A 3ZYHA 2RS53 2QNKA 2WZR3 5FO7B 3B69A 4QD2A 4YVSA 3MICA 1NLSA 4XMAA 3SCHA 3QBQA 5FLJA 2PFWA 2UWCA 2WRAA 4XJ8A 1FOD3 1DGRA 2R0FA 2R073 4YM1A 2JIJA 1NKGA 4X6QB 1OBNA 3WXPA 5FPBA 5C3RA 2JKXA 5FZIA 1XB9A 2WIIB 3OUIA 1S0JA 3AC0A 4QHZA 2V5YA 1O8SA 5J37A 1J84A 3FN9A 1GP6A 2X05A 5DN2A 4IL7A 4PDWA 2VCCA 3AJYA 1UOBA 4M00A 4YZ1A 2A3WA 4M4RA 3MLKA 1AR61 4B1LA 4JQRA 4I3GA 2F4PA 4L8QA 4CP9B 2X5IC 5A1LA 2WFF1 4YW4A 4HN1A 1RJ7A 1W2TA 1LOFC 4AVVA 1UQXA 4AR2A 4BQXA 2RG4A 3R4UA 5GLZA 4D69A 4Z2AA 1SPPA 4AFBA 4CCOA 4IGQA 1I5ZA 2QQVA 3MV11 4IXLA 2OQ6A 5JI9A 1R1A3 1VBE1 1UIJA 4DOUA 1PNFA 2JDHA 3RYPA 4GH4B 4IEZA 2Y64A 5I8TA 4IESA 5KBFA 2GP5A 2MHFA 3R4DB 4Z07A 4YW5A 1YQ2A 4K6BA 3L2YA 5FMOL 2DTYA 1S0BA 2P6CA 1H8TC 4XCAA 1XXNA 1HQNA 1GWKA 2D6LX 2VBDA 3JXSA 4FPJA 4H3WA 4H7LA 3ACLA 1EP0A 4Q1PA 5BNOB 1OQEA 2ORZA 1MS8A 1ZBA1 4FAGA 5EYYA 1NZIA 3ZXKA 3VZMA 2RE9A 4P5HA 1S0FA 5KHIA 1G9CA 1UOGA 2R041 4M0NA 3APBA 3HWJA 3PVNA 2W91A 2XJVA 4NIIA 1OXCA 2QQKA 3HN1A 4O61A 4CDXA 3ENRA 2VNRA 4TYSA 4AHYA 2VCMA 5L19A 1EV12 5H9QA 1YI7A 1LU2A 1YFYA 2IXCA 1L7RA 1NAEA 1OFNA 4PLMA 5KXEA 2GC1A 1PNGA 2DUOA 2R0HA 1BBT2 2FDFA 2WN2A 2VOTA 1WD4A 5L7OA 3KT1A 4XTMA 5JSPA 2D6KA 1ND2A 4XJWA 3PIGA 3O12A 1VBB2 5FYSA 3OY8A 1WCSA 3M3IA 3WQBA 4NHXA 4CP1A 2VQTA 3FBMA 5ERLA 5I0SA 4Y20A 4BU2A 1W6OA 2R061 2WS93 2B39A 2K2SA 3T09A 1JXNA 4AEDA 1HN1A 3F2ZA 1O7FA 4R9DA 3WY6A 3ZIWA 3NSTA 1KDMA 5F9TA 1UU4A 2HWE1 1S4CA 4WM7A 2XDVA 1GP4A 5JUVA 1RHI1 3VBSC 2LRPA 4ZU7A 2RMU2 1UPIA 4ZXKA 2GNBA 4UW5A 5A7SA 1VPHA 3SITA 1TME3 2WC2A 3PVEA 2WWSA 2RM23 3BALA 2HH9A 4UI9L 4XTPA 1HJGA 3WF1A 5DAVA 2IUWA 5HCFA 1LTEA 3P3PA 1IKQA 2NMNA 4ATFA 1VB4A 1JYCA 2HWC3 4W6YA 1W06A 3N9QA 2ZKLA 4S2DA 1BK0A 5BPXA 1D4M3 3OUHA 1Y9QA 2BNOA 4B8EA 1OD3A 5JXJA 4XJZA 2QVSB 5IAVA 5FZ7A 2ZBJA 1JOBA 5J96B 3NV1A 4CTEA 4HSJA 1N3OA 2C9KA 3V0BB 1O3RA 4OZXA 1LRHA 3ZDVA 5F7UA 4DRRA 1AYM2 1GBGA 1V6OA 2LALA 1T6BX 4N7UA 2QQUA 2BFUL 5T5JA 2LROA 2RR11 4XPVA 4BQ3A 2PHTA 2Y6LA 4NVPA 4Q4V1 3WR0A 3LSDA 3H3UA 1POV3 4K8FA 4PI0A 4O65A 3VBUB 1UD1A 2WWJA 4QHOA 5C70A 4OI2A 3PLQA 4INDA 2ID4A 4XUQA 5HV0A 4AFAA 5IHRA 1QIQA 1APNA 1AR83 3BOPA 3PTYA 1TNRA 3C8XA 4LIUA 4ZHNA 1Y7BA 1VMJA 4LHNA 2R49A 4LHKA 3ZFGB 1CESA 2I07B 4HK9A 3FBYA 1M06G 1SZBA 2VOXA 2B4KA 1C28A 1Y3TA 2PHWA 1HDKA 2YU1A 3NKGA 3MIHA 3PTRB 4IGOA 4QM8A 4DY3A 4I2OA 3VD9A 3B9CA 2YBKA 4RQPB 2RVAA 4B29A 3SLIA 5CG8A 1OH3A 3POBA 5LRRA 2DVBA 4H14A 3WDXA 2A73B 3AMPA 1RUD2 2IXJA 1V70A 3ZXFA 1BEV1 1CAVA 1DIWA 3WHUA 5JPMB 1RB8G 4OHXA 3AMMA 3FLTA 2HWB1 2VUCA 3CHXA 5K9YA 4A45A 4NPRA 1IS6A 5DMYA 1WLDA 5F8PA 2H6CA 3POWA 2Z4FA 2E7AA 1XNTA 3O7OA 1LESA 3UV9A 4XHBA 3WVJA 3WW3A 5A7PA 2ZEZA 2W46A 4IV1B 4UWDA 2GNMA 4TXWA 1VRBA 1UU6A 3VBRB 1CN1A 1ZM1A 5FDBA 4ASKA 1GNZA 1LGNA 1OHFA 2O8QA 5BV6A 5CFCA 1STMA 2A3XA 1OQ1A 3A22A 4A4AA 4BPZA 2P3KA 1J3QA 2J1SA 1NA1A 4JGYC 3POSA 3PVBB 5FZHA 4BHPA 2HKXA 4AVTA 1AHSA 4FP3A 5LRSA 2D44A 4FPFA 5DUWA 2ZGUA 2J1TA 4RS5B 5F2WA 4L97A 3VV1A 3ZXAC 2A75A 1K5MC 1CAUA 1JOPA 1WCDJ 1XSRA 3ILRA 5BNNC 3KB5A 3I2OA 1MQTB 2E6VA 4XXAA 1UZVA 3EXUA 4CPBA 4CUGA 1UMIA 4LBNA 3RG0A 1OLMA 4RFRB 4W65A 1VLNA 2Z2SB 5F3EA 4KWKA 2Z69A 2ZGLA 3N7LA 3WG4A 1VAKA 4MGSA 1CJDA 4LNVA 5ABJC 3AFKA 4NWVA 3MUY1 3B00A 3OJBA 4NHLA 1URXA 3ZLIA 2NPIA 5DDJ3 3J7LA 1OOPA 3ZYPA 2QQNA 1VBB3 4YVSB 5C8CB 3AP4A 4MVTA 3FUOA 4YVWC 4QXKA 4XAAA 1X82A 3I59A 3EHKA 5ANNA 3T30A 4CUAA 4Y4YA 1N1YA 3TNPB 2EIDA 4DRVA 1JH5A 1A8MA 4QM9A 4QX1A 2YC4A 3C7FA 5GLUA 2VOWA 4BOWA 1G7YA 2AEZA 4FT8A 1NY72 2FBEA 5GM0A 5IK4A 2QZ2A 2RS11 2PHLA 3MBWA 3T0BA 2CAUA 2HWF3 5M0TA 1ENRA 2X29A 1UY0A 4PDWB 5KHGA 4PT6A 3DF0A 1V6NA 1YHFA 3WDVA 1WLWA 1VBC2 2VZSA 3TAYA 1DCSA 3VGIA 4IUGA 1UN1A 2BERA 3ECQA 1B35C 4IEOA 1H2NA 2D40A 5IFTA 5LY2A 2BV4A 4FSJA 4EYUA 4Q5OA 1RINA 1DZQA 2BOJA 2YGLA 4MHUA 1G6NA 2KM2A 1W8ZA 1SPPB 1S0CA 4FPKA 4KGGA 4UXAA 1KXGA 1IGOA 2P37A 4BLIA 4M3CE 1GOFA 4B3NA 2WR9A 4LBOA 1AYM3 1PM4A 3JD73 3MIDA 1O91A 4O7XA 2PELA 4UBGA 3B93A 2ARBA 4RGAA 4SLIA 1H2LA 5K0UC 3VBOA 5L9RA 4W6XA 2D6OX 4A2UA 4CDUC 4JDMA 2QDRA 3P5BA 5FK7A 4XUOA 3WUCA 2V72A 2XWJB 3N35A 4JKMA 3WDTA 1J59A 1CIWA 2WQZC 5IK7A 1E5RA 1GNHA 4IEQA 3MEPA 1WD3A 2BWAA 2H6BA 5JPNB 2A6VA 4HXCA 2RMU1 2XH6A 1XU2A 2OX0A 5JVVA 3TBDA 2DURA 3VBHA 4CCEA 4CDXB 4IE7A 5I0DA 1NOVA 3GBGA 2P5BA 2QQWA 1GQPA 3RZGA 2QQIA 1E57A 2ORXA 4M3CF 2ZA9A 1QJX3 4HETA 1Q43A 3RFRA 1D2QA 3M3CA 1DQ6A 2XHKA 2NQYA 1RUE1 1XJAA 2WAOA 4BQWA 2B5HA 1FX5A 2AEYA 2RV9A 2XG3A 3A21A 5JDBA 5JZGC 1UZZA 3I3BA 1JYWA 3O1TA 4FFHA 3BIWE 2XLGA 4CU9A 4Q0VA 5J48A 3ACHA 4Y20B 1W6OB 1N1TA 2EVXA 4AEDB 4Y33A 5FBZA 2GZWA 1EUTA 4LKEA 4XFIA 4B7EA 5ACA2 4WM7B 2PLV3 3HQRA 4N53A 3RYRA 5DABA 4Y24A 2BZDA 2RDQA 1NCQC 1IS3A 5FPZA 2WT1A 3SC7X 2VUJA 2UWAA 2Y6HA 5D8AA 3EJKA 4KG8A 4J1XA 2XJRA 1ZX5A 1V9U3 4NAMA 2ETEA 1R091 4S2HA 1EPWA 1G86A 1UAIA 3KD4A 1DQ1A 2E51A 3N3HA 2BRTA 4IQPA 5ANQA 3MF6A 1GV9A 2DVGA 5CA6A 3ZN6A 4ZKTB 3OBAA 1X33A 3CJIC 2CSGA 4AXOA 2P2KA 3GZUC 5HCAA 3RZMA 4HZFA 4AFDA 5H9RA 3KT7A 1D2SA 3N9OA 1XE7A 2WAAA 4PQ9A 4HMZA 5EP9A 3ZFFA 1RUD1 1C5IA 2JB4A 4HVRA 3JQWA 3PHMA 1IQDC 3PVOA 4PCRA 3USUB 4XURA 1RUOA 2GP3A 3WINE 5A6ZA 4HKLA 3B9IA 1UKRA 1JBCA 3LIHA 3K75B 3IM0A 5DAXA 4LR4A 1RUC2 3SEEA 3IWZA 3IDEA 5D2AA 2YC0A 3K3OA 3UETA 3T0AA 3J7HA 5FLIA 1Z7S2 2VBBA 1RMU2 1SQ4A 3KCYA 3L2HA 5D1IA 2A7AA 4F8AA 1DLLA 4NRQA 1YLLA 1JZ6A 3WG1A 4E2GA 2Y8KA 1UWWA 3RZKA 1X9TA 3W21A 4GJZA 1S2BA 1QJEA 5FZMA 3U4SA 4FOWA 4MUVA 1LHVA 1VR3A 4YG3A 1XOYA 2A6YA 4UFLA 1R081 3VHNA 1VBC3 2RS32 3KF5A 3OBRA 5FOBB 1VBA2 5FCCA 2VMHA 1CAVB 4DO0A 5FFOC 1V6KA 2VTFA 4LBQA 4COVA 4QX3A 1O6UA 3ZSJA 2VU9A 3PIJA 5KWRA 1H1AA 1KS5A 3VBFC 1RUF2 3UKVA 2C24A 4N8MA 1WMDA 3BUCA 2DUPA 5LBEA 3QH7A 4LBLA 1VBD1 2D6MA 2PA7A 1L7LA 2HBTA 2C9AA 3ZXEA 1HJFA 1PVC2 4Z82A 5C33A 3FE5A 5CFCB 3VHOA 4DY5A 1PGSA 5A3WA 4XBNA 2SLIA 3ZKYA 1IG3A 1BJQA 1TE1B 1HB4A 5KXBA 1OFSA 2CGPA 4D94A 2GAUA 2Y0IA 4AF9A 3W5MA 2FZ2A 4LE3A 1DGLA 3CDZB 3DPRB 3LOBA 5FZ4A 5AVAA 2ZZJA 1CAUB 4NRMA 1HRV2 2D98A 4WBBA 1TMF2 2VH9A 1GUIA 2XGXA 3FWEA 5EV7A 3FFZA 5JIAA 2HBUA 2JG8B 3OPZA 4FPHA 3BU0A 2F4LA 3WF4A 2O8OA 1JHNA 1OKQA 3TYJA 3E6CC 2C0ZA 3ZFGC 3AZWA 1CX4A 1CR7A 2FCUA 2VNOA 3WQ7A 2FQPA 2UY8A 3DEMA 2JD4A 4LA3A 3JCIA 4LORA 1QQP2 2PQQA 3T2TA 2VECA 5C3QA 3DL3A 1OOPB 3HQUA 4IE5A 4ISQA 4CCCA 3FL7A 1VRH1 4Q8KA 4IEUA 3I59B 3BTZA 5IAXA 4LOSA 5C4WC 4JHZA 3NV3A 2VW0A 4KWJA 5GALA 5ACA3 4K8RB 4AI8A 4QX5A 3O14A 1WW6A 3G6JB 5KC5A 3D0JA 4DPNA 3TWIA 3E1F1 3FLPA 2HWD2 4X8PA 5BNOA 4ZY9A 4COYA 1NQDA 5EHDA 3HJRA 1RUJ2 2JG9C 1WZXA 4UFMA 2P3JA 1AL21 1UIKA 2JE9A 5LEJA 1MZEA 4XACA 4BQYA 1BYHA 1KQRA 4LO5B 4XUPA 1H6YA 4E4SA 3BGAA 3OGSA 2NN8A 4NWWA 3BN6A 5FYZA 3MI8A 3WQ0A 1CPNA 2WBKA 5F5QA 3GCXA 3O0VA 5FPAA 2AH2A 2JB8A 2VPVA 4CXXA 1HV0A 1HXS1 3NRUA 4YW6A 1UPSA 1JYXA 2UYAA 4BWOA 3J7NA 1H2KA 4NOTA 1FATA 2JX9A 2KXLA 4UFJA 3OSDA 1K3IA 4DZGA 4ET7A 1IPSA 3U37A 1SCSA 1QH6A 2EXJA 4AVCA 3POIA 3RMYA 2WNUC 3NJYA 1C1LA 1FOD2 5EWSA 3J8F1 2Q0AA 5BNQA 1LU1A 1JZ2A 3A23A 3VB9A 3NMBA 1AXKA 2DCZA 3GALA 4QB6A 3T3YA 2H0BA 4XAEA 1W39A 5DAWA 1BLZA 5IVFA 5I0TA 1UY3A 3VBHB 5C3OA 5FP8A 3NKTA 1RMU3 1AVBA 1X7NA 2DU1A 5A6YA 1LR5A 4AVAA 1T6GC 4L0PA 5I8YA 3PMEA 5AVPA 1GYKA 2ZGKA 4YGCA 2R7EB 4BDVB 3TN91 2ZABA 4MX3A 1I5PA 4LA2A 1PZ9A 4WZCA 1IPKA 2NMOA 1Q8QA 1S0IA 2JECA 2RS33 1LHNA 1VBA3 3IN9A 3P1IA 1SLIA 4RFT0 4AEJA 3X29B 5IK8A 5A3TA 2IC1A 3KSCA 2XLAA 4Y1XA 4D6SA 1RUF3 3WZ1A 4BMEA 4WM8A 4MGTA 4YW3A 4N53B 4DXRA 3KHBA 2WWUA 1PX3A 2VQAA 5LK7B 4CU6A 2ZEXA 2Y6JA 3ZSEA 4EN9B 5D8AB 3PU8A 3KV6A 4G4FA 4HBNA 1W9WA 2JDNA 4HK8A 1VIWB 4AGRA 1RUC1 3O1PA 1GWMA 1GZWB 3K4AA 4UW3A 4DEQA 2Z42A 2PHDA 4QPGC 4E27A 2YZ4A 4JC1A 1KJRA 1W8UA 1ULDA 2XQRA 4DIQA 1W6QA 4JTNA 4XUTA 5JOXA 1Z7S1 3CNAA 1XC6A 4C1XA 3E97A 3RMXA 3ZN6B 4FXGB 4WVZA 1PZ7A 1SLTA 3OGJA 4X8NA 1O3SA 3MPBA 3POYA 5C7GA 1OA4A 1TMF3 4FTBA 4YFWA 5CKMA 4XF3A 3AL5A 4B4QA 3JZVA 1RUG1 4NHKA 4XILA 3H8UA 3ZFFB 4L2NA 1BHGA 4N9HA 1ND3A 1POV0 4DS0A 2WS92 5A7QA 2YB7A 3AX4A 1PGL1 5T5PA 2AR6A 4I0WB 1PO13 1QQP3 3VDDA 5FXZA 4HKWA 1KJLA 2A6ZA 3ROUA 1ZNPA 1FT9A 1RUH2 3RRDA 2JDMA 3WF0A 5L7OC 1LGCA 1QXRA 1ND2C 1FMD1 4AFCA 4TLGA 3VBRA 1AYN1 1GR3A 1PVC1 1WBLA 1DHKB 3ZR5A 3FX3A 3IDBB 2PHXA 2XHNA 3BU7A 3PU3A 4GAZA 4GB32 2CTVA 5FZAA 3F95A 2HWD3 1ASJ1 2ZHMA 3ASIA 2OT7A 3K48A 3VDBA 4OULA 2EIBA 2DVAA 4QQLA 4R9AA 1O4ZA 1RUJ3 4ZU4A 4CSWA 5A3UA 2J1RA 1FYUA 3C7HA 2HJIA 3SISA 1A3KA 1HQWA 4KU8A 4XHXA 3S7EA 4CVUA 4NMIA 5CB7A 2SBAA 1DZTA 3CZJA 1JZ3A 1YQCA 4XEZA 1Q8PA 1DYKA 2XONA 3HOBA 1N1VA 3I2FA 4YGBA 4AI1A 4LBJA 2GH8A 1SBDA 5L36A 1MACA 4FI9A 3RZLA 4YGDA 1MZ6A 3QOPA 1NE4A 5FY8A 4EQVA 3BTXA 4MLOA 4LULA 4FQZA 2A5ZA 4NPLA 5F5AA 3M3OA 3WDUA 5I91A 3BCWA 4WV8A 2PHRA 3NNMA 5HBAA 1SCRA 5C8CA 4MSVA 1F5FA 3GHMA 4MH0E 3VZNA 1OPMA 5BYNA 1PO23 3N4MA 1WCQA 4R9CA 1AR82 3LDBA 2XBO2 1XQNA 2OPKA 3AP5A 5FQ0A 2VMCA 1ZZ9A 1F5JA 1LOAA 5JMOA 3AXEA 1SBFA 4IE0A 4AYUA 2ZX0A 1U5ZA 2N7GA 4AVSA 5FPLA 4E4HA 1LKNA 4TSVA 1COV1 1RUI1 3H3LA 4CDWA 4AGVA 2VZVA 2R32A 4OHZA 2QBXA 1CWPA 4OYUA 1W3XA 4BCUA 1LEMA 1SHWB 1TG7A 2FDHA 5FWJA 4AAXA 1BVVA 3HEIA 2EICA 2RJLA 3SCGA 2CNAA 3J7MA 1XBFA 4D3WA 1CZSA 2G9ZA 3VD5A 3O1RA 1HRI1 4HFSA 4QWNA 4XVHA 3GM8A 2ZGNA 3D4KA 4A6OA 3N36A 2JDKA 1S0DA 2Q30A 5I93A 2PHFA 1SLBA 1SFYA 2VW1A 4N43A 3EYPA 3LOIA 2ZMNA 5FP7A 5FUNA 3AZZA 3ZKUA 3OPTA 3ACGA 1H6XA 3N7KA 1OURA 2RS51 4IEVA 2WZR1 1UY2A 2D93A 3RPQA 5FZ0A 1QOTA 3BPSA 3D5OA 4GXLA 4QKBA 3RS6A 4C8DA 2PTMA 2XLFA 1JYNA 4MG2A 1PK6C 2Y38A 2R071 2ZEWA 2PAKA 4Y1ZA 3BTYA 1DF0A 1V0AA 2EXKA 3WLUA 4K7JA 3Q9OA 4LK7A 5LWBA 4OHVA 4EWEA 4NE9A 3HIFA 5JOZA 3S5AA 5E8AA 4MADA 2JE8A 4P9JA 1UU5A 3DECA 2XJSA 1A78A 1PGW2 1QKQA 3PDQA 4K3UA 1RVF3 3ZYBA 1D7PM 4DQAA 5K4LA 1W8NA 5FZCA 4LITA 1G9BA 1YFUA 3OF1A 4P9XA 3RJ2X 1NA1C 1H30A 4EWDA 1QOSA 2DCKA 2YMZA 2VTXJ 4GJYA 4MV2A 2HWE3 4ATEA 3N9MA 1RHI3 5DDJ2 4OLLA 5IVJA 5SV8A 4QGNA 4KNCA 1ZRDA 1SMVA 2IXIA 1XYPA 2ZX4A 2NZ9A 4GA9A 3VDAA 4AQ2A 4NO4A 1R1A1 1NCRC 3GDBA 1Y9MA 1JZ4A 3EB7A 2EA7A 2WKKA 3QACA 2ZGTA 1JZ8A 2AREA 3NAPB 4XFGA 5FR3A 3WDYA 1RUH3 3A7QA 3AP7A 4NIGA 4YZ4A 4K20A 1OOPC 5FZFA 3TEZA 4KBZA 3AVRA 4E4ZA 2HWF2 1S2KA 4RR3A 1AF9A 3AK0A 3RVHA 5LB6A 5AC92 2Q1FA 2VZOA 2JICA 1F35A 2E7QA 4P00B 1F31A 4BE3A 5CFDA 3HT2A 2WNVA 2ET1A 2Y33A 3EMRA 2DCYA 4P9LA 4Q4X2 1CGPA 4GB33 3IAQA 5CIRA 1M4WA 3ZXLA 1ZZ8A 3BTAA 3W20A 4DUWA 1EAH2 2XVKA 2ADEA 5J7MA 2W47A 4B1MA 1IS4A 1QHDA 1WWYA 2V4VA 4XJAA 2Q4SA 4EJRA 4BQ1A 5HI0A 2LUWA 4QMAA 4LKFA 4YYOA 1YQ6A 4YNIA 4PF1A 3ZFEC 3VHPA 1C8NA 2ILMA 5KHJA 2RDSA 3ILFA 3LAGA 3JD72 5EJZB 1ZBE2 2IWGB 3AJZA 5JI7A 5BY5A 3DYOA 4WM8B 2WS91 4RN5A 4DUVA 3USUA 3AMQA 1LNSA 1H1MA 1H2MA 1OKOA 4HT1T 1SBEA 3UKTA 1O4YA 2W3JA 4CEWC 3GJBA 4P9GA 5HV4A 1CZVA 4AQ6A 4WVMA 1AR92 2RHPA 3UL2A 5B4XA 4HPKB 4CE8A 2VMGA 3ZMOA 1BEV3 3KV4A 4GMP3 1MEC2 2W1UA 2XBO3 4Q0QA 1TME1 3AKQA 1H9WA 4Q4W2 3VKNA 3VBOC 4BXFA 1W6QB 2RM21 2P34A 4AI2A 5JCTA 5L9VA 4I02A 5C5TA 2PAEA 3AM2A 1BK1A 4XF9A 2FDKA 3GNEA 1QJX2 2BW8A 2YBPA 4AAPA 4AHWA 4FTSA 2AYHA 2QQLA 1PIV2 3SNMA 2WNOA 2VQ0A 3WF3A 2HWC1 4PI2A 3CLPA 5FMCA 1RYYA 1O5UA 3WNOA 3O1UA 4OI4A 2QQOA 2WO7A 2OKXA 1D4M1 2LW8A 2X8KA 4QQOA 1ODMA 4UFKA 4CDQC 4BXSV 2E33A 2BWCA 3MPPG 3RI8A 1W9TA 2B46X 1ND3B 3VKMA 3B5LB 4GQ7A 4XDQA 1BMV1 3ZSKA 4AG4A 5JXGA 2P17A 4IEXA 2ES3A 3VDDB 2VCAA 1UKGA 1I3HA 2XJUA 3N7JA 3OCPA 1OVPA 1OSGA 3LEIA 5A7OA 3V56A 2PLV2 1REFA 5KHKA 3ZMNA 1LOFA 2VM9A 3MW2A 5LATA 4XDOA 4B4RA 1POV1 3MIGA 3ST7A 1LB2A 1V9U2 4OI0A 2VD7A 3OUJA 1QJU2 4OMCA 4XE9A 4COWA 1JI6A 5FPUA 4TTGA 4Y26A 4XFBA 5DAQA 4AFMA 1S0GA 1AR81 4JGZC 3WP3A 4CCLA 4BMBA 1LULA 4N53C 3RSJA 3ZSLA 2F6BA 3Q8AA 3KLSA 1OLME 2ZGOA 4YSFA 1HB3A 2CYFA 2P3YA 1H8TA 2J22A 3DPRA 3K77A 3CIHA 1H1IA 3AP6A 3MV01 3KVAA 5JXHA 4LJHA 2K9ZA 1YIFA 2DF7A 2JG8A 3SHRA 2V5DA 3AKTA 1REDA 4R4ZA 4BIFA 5T52A 5HPOA 2BJSA 4MHRA 1VMFA 4LO6B 3K46A 4GWMA 4XDPA 2BTVC 2QE3A 5I0UA 1G9AA 5H9PA 2RS13 1CAXA 3NL1A 3WCRA 4OVEA 3WUDA 1ZA4A 3ZPYA 1OPOA 1XNCA 4E4DX 4X6RB 5F2SA 4EE2A 3H7JA 3KT4A 1C8M2 1D4VB 2BOIA 5ISLA 3B02A 4P5YA 4Q0UA 3I2KA 2C1FA 1Q56A 3V0AA 4Z1VA 5FQ0B 4JHTA 3ZYIB 4IV3B 2UYBA 3GJAA 5G05L 5C9AC 2ZAAA 5F3GA 5GLTA 2CHHA 3VZJA 1XNKA 3IMNA 1JODA 2VZUA 4AW7A 1JS9A 4CDWB 2Y6GA 3HR9A 2A6XA 2R1BA 1UX6A 2W1WA 1U5YA 3RJRA 4XC9A 5AC93 3GHNA 3JU9A 1Y9GA 1H0BA 3KV9A 4OUEA 3VZKA 1O8PA 2XKOA 4F83A 3JUUA 4ITCA 4WZFA 1V6JA 3AXDA 4Q4X3 2XVLA 3LF7A 2XVGA 3JBG2 4OQ9A 3WT3A 1QXJA 4CEYB 2Y60A 4QPIC 3HAGA 4QAWA 5A7NA 3HNBM 3RQ0A 1OMIA 1MZ5A 1EV11 2YROA 1MVEA 1EAH3 2XUEA 1E5HA 4K21A 3ZX7A 4DNYA 2QCSB 3ITQA 4UFHA 5EIYB 3OBTA 1ENQA 3P3NA 4XABA 4BK4A 4C0BA 3HPNA 4MXVA 4N43B 1BBT1 3OEBA 4QX2A 1WW4A 2BDRA 3K2OA 2VR4A 4V2VA 4CU8A 4COUA 5T5LA 5A1AA 1VBB1 4PIXA 1PVXA 3S6PA 1IG0A 1YJLA 1ZBE3 1FPN3 5GLVA 4CUBA 1UCXA 1YNAA 2UU8A 5IATA 2AACA 2YYOA 3IPVA 1V00A 1GWLA 2E9QA 4UBHA 3H8XA 2ZHKA 1YWKA 4JV4A 4L92A 1AZDA 2WA4A 3MGUA 4OCTA 2ZGMA 3DYMA 3PJYA 1AR93 4FPCA 4QKFA 4Q4Y2 2HWF1 2VVFA 1UNBA 2FCTA 5EQUA 1MEC3 4Q4W3 3H8OA 4AGGA 1QF3A 3LDKA 1ZVFA 3D6EA 4D7SA 3ZN5A 2F17A 4NRPA 3LSEA 1BCXA 3S0MA 3U14A 2E26A 5C6CA 1PIV3 1XE8A 1AJKA 1ENXA 1S0EA 3U07A 2A71A 1NLQA 1JTZX 2CU5A 2PAMA 4R8HA 4A41A 4GKYA 5JOWA 1CPMA 2EXIA 3WNXA 4AWDA 2VVEA 5LCWL 2ZPXA 5H9SA 3UGGA 1TVGA 3WP4A 4RA0A 3MHZA 5FP9A 4HKOA 4P08A 2ZGPA 2XB6C 1AYM1 4EN0A 1NQJA 2MEV2 1K42A 1H4HA 2ZGQA 3E5QA 1ZZBA 5SV5A 5G04L 3SH3A 4YPJA 3PUAA 4RHV2 2ZHNA 2XQXA 4RR3B 4JVAA 4UT5A 1DG6A 3TNQA 4DEVA 4LO4B 2XR4A 1J3RA 1HB2A 1WW5A 4J1WA 4KMQA 1F8VA 1JYTA 1QJU3 4XETA 4GH4C 5CFDB 4XZPA 1GZWA 2WNVB 1HIXA 4L99A 4LPLA 3ZPOA 5JAXA 2B42B 2NYYA 3VZOA 3M7AA 1EYBA 4F3JA 5JLVA 1R1ZA 3H7YA 3AL6A 3AKSA 5BNOC 4KBBA 3I49A 4LBKA 2W52A 5EPAA 5EZWA 3I3QA 4JGYA 3WNMA 2XJTA 2VZRA 4XIKA 3THDA 2WN3A 1KDKA 1POQA 5FYIA 3QCWA 1UZWA 4AI3A 5FMDA 1QJY2 2DFBA 2GDFA 2GC0A 3LFMA 4LUKA 4PQQA 3GF6A 4ZU5A 3DYPA 4LTAA 4KQ7A 1UZ0A 3LA7A 4XBLA 2R30A 1SLAA 1JZ5A 1UMZA 3AYEA 2PLV1 5HXVA 1C8M3 5FUPA 4GWNA 1OUSA 4WVMB 1R083 1LOBA 1FI2A 1W3VA 2AUYA 3K4DA 4CXYA 1LJ7A 1RXGA 3H3ZA 1K12A 4KI5M 5JR7B 2E31A 5APAA 5FO9B 3SXWA 2WL1A 1W8FA 2JXAA 1YC61 3U0ZA 2DV9A 2GNDA 4RGGA 1X50A 4XQ4A 4QT6A 4XF4A 5FZKA 1WLCA 5A1FA 4BYYA 3LE0A 5FZDA 4PLOA 5DQ0A 3B01A 4KG0A 3RNSA 3LB9A 5F37A 3JBG3 3DUIA 1IQAA 4Y4RA 5IVEA 3SH4A 5HXMA 1HQLA 3HBZA 4FXKB 4LE4A 4BLJA 4MO3M 4XXPA 1V6MA 4CCNA 3RGBA 5GZDA 1GZCA 2LTNA 3A0NA 1AL0G 1YCIA 4FPGA 3ELNA 5IWFA 1DU3D 5EFUA 2BNMA 4DINB 3VD4A 4XUNA 4YFZA 1UW8A 1XNAA 5CG9A 1HW5A 2ZCWA 3KM5A 2QQPA 2OA2A 4YARA 5C5UA 4AI0A 2WQ8A 2G1MA 3A0KA 1Z78A 3O1SA 3R4SA 3O1OA 3IB3A 2V73A 3BODA 3MFCA 1Y4WA 1H8TB 1NY71 1C3HA 4Q4Y3 3VBUC 2CY6A 2K46A 2P6HA 2I74A 3ZIXA 4Z8BA 2WZ8A 5FXWA 4PIYA 1N1SA 1VBC1 3KWVA 3MUZ1 1QH7A 1AR72 2W1SA 3VDCA 2VMEA 2W39A 4DFSA 3TEXA 1OQDA 2PHUA 1SDDB 4CU7A 1RXFA 2ZGSA 3TOJA 3NNJA 1ULCA 1GKBA 1CAXB 1PO12 2Q8DA 3O0WA 4HVOA 2DCTA 1DLCA 3U4XA 4ORFA 4RQPC 5KXCA 1RIRA 3I3MA 4LO7A 4DMIA 4KGQA 5FMOS 4G3YC 1K5JA 4XF1A 4Z2WA 1US3A 3ABZA 2WA3A 2KD7A 2WUHA 1ND3C 3ES4A 2WABA 3Q8FA 5JZGA 1BQPA 4BQ4A 4RSUA 1JYVA 3V0AB 3BIEA 3PNAA 5L73A 1ULEA 2MEV3 3M2MA 4HVQA 5FYCA 2WSVA 3CKHA 3QH6A 3ZVXA 1UL9A 4RHV3 4D8MA 4ZZ8A 1HXS3 3G7DA 3KGZA 3RI9A 1JYIA 1QDOA 1W9FA 1JHJA 4IV1C 1R64A 3USSA 1Z0HA 3E5XA 3VBSB 3VBRC 3UNPA 1ZRIA 3H8RA 5CBLA 4A6SA 1LHWA 1DGRN 2ZMLA 3QLQA 3K51A 2AZ5A 1W03A 5CKNA 1CX1A 2ARCA 4AL9A 5K8SA 1CIYA 1NX9A 3I3EA 1YO8A 1IHMA 3GZAA 3IBMA 5CU1A 2B7YA 3AYCA 4JZRA 5EYXA 5FREA 4DXZA 1A34A 1DDLA 2VULA 4RS5C 3WV6A 1US2A 4GWIA 4HL0A 3WG2A 2ZAHA 2J1VA 5E89A 2ZS6B 2ZEYA 4JCKA 5FYVA 1OH4A 5IJRA 4QX0A 1FAYA 1MQTC 2TNFA 3BOWA 3CJIA 1QJY3 2JIGA 1SDWA 4SBVA 2GN3A 2OZJA 4FP2A 4G9SB 1QDCA 1AR62 1PO22 1J1LA 1DQ2A 2VUAA 4MGQA 2Q1ZB 4QDRA 4XCBA 1J83A 3SQOA 2WFF2 3IPVB 3NAPA 4JDOA 3T2QA 1W8WA 1OLRA 1XRUA 2YGMA 3LFIA 3R0RA 4CZSA 5ACA1 3FJSA 1QJFA 2XKPA 4YW1A 2HEVF 2O14A 3HQXA 5DZGA 4XFCA 2Q8CA 4XYXA 3I2JA 4YVSC 3I97A 3M1HA 4MGIE 5C8CC 5IVCA 3PUQA 2PQSA 4IERA 5AFBA 5IVYA 1VBE2 4QU1A 3W5NA 2W68A 3WOGA 5JSRA 4DXTA 4Y5SA 1PMIA 1CQ9A 2JDUA 5JSOA 3NV2A 4I0BA 5J09A 4N7IA 2JJ6A 1CD3G 2Z5WA 4IW3A 3ACFA 1XYNA 1D0GA 3KQ4B 1S1AA 2AENA 1V6IA 4WVWA 1JU4A 2CAVA 4MGYE 4PDWC 1W8OA 4UW4A 2WDBA 1ZBA2 3LPGA 1IS5A 2OUJA 4NPMA 2FMYA 4ARYA 4BH9A 2LM3A 2R042 2Y6KA 5K7PA 1UF2C 2BYVE 2C6SA 1DP0A 1WUVA 3D0SA 2VNGA 2WYFA 3OGVA 2QQJA 2D5HA 1AXYA 1Q8OA 2GNTA 1XU1A 2B9VA 2XUMA 5FZ8A 3VBFA 2WYSA 4EWAA 4N43C 1ULPA 5FPXA 3GZTB 1YUDA 3KF3A 1NT0A 3IKWA 3WX5A 5A6QA 2W87A 4K1ZA 4AZZA 4EV0A 1G8WA 2VO5A 1HV1A 4D0QA 3AVSA 4HPKA 3TEYA 5CVRA 1DZRA 3VKLA 4FPOB 5CYYA 1RVF2 2R062 3ZM8A 5FJKA 1U5XA 2VXRA 3BKZA 3THCA 1RMU1 1QY4A 3MYXA 1GFF2 3N9PA 2GU9A 2VC9A 2HWE2 5BNPA 4JGYB 5F1RA 2R6QA 4IGPA 1RHI2 3WW2A 4A3ZA 3CMGA 4CA9A 1QOOA 1X36A 2VG9A 2IFRA 1K5MB 4CDXC 2RS31 1AR73 1KITA 5FZLA 1VBA1 2MPFA 3WHTA 3D3AA 5FV3A 4PHZA 3W59A 5BXXA 2D3RA 4YWAA 2XL7A 1ASJ3 5FZ1A 2Q8OA 2ERFA 5FMBA 3LEMA 1GP5A 1RUF1 4GMP0 3MFAA 1UO9A 2BBVA 3H1WA 5ABJB 3OPWA 2Q5TA 5BUVA 3ATGA 5HCHA 2WINB 5D21A 2I2SA 1GZ9A 1AXZA 4I01A 3POFA 5FY9A 5L9BA 4AEDC 4FOYA 2WLQA 1VJ2A 3I3DA 2ATFA 5LBCA 1UYYA 3MIEA 4WM7C 4A7YA 1S2EA 5A32A 3O5SA 5A6XA 4JDNA 2RR12 1JN2P 3U11A 4YW2A 4N90A 5FZ3A 3M70A 3E6DA 1CZTA 3B3QE 1JMUB 3KS7A 5GZEA 2ET7A 4Q4V2 1JUHA 3Q8CA 2DUQA 5T54A 1A8DA 3DGTA 1HRV1 5JOYA 2YC2A 1TMF1 4OFGA 4NUBA 5FP3A 2ADDA 2JG9A 5JMCA 3M8LA 4MYEA 3AYAA 1FV3A 4L9BA 3VN4A 4D7TA 4ES9A 1ZREA 4XZUG 2A3YA 2Q8EA 3MF9A 5LASA 2G4IA 1SLCA 2VMIA 5IK5A 1TEIA 3NVCA 4CCKA 1B35B 3SKJE 1TZOA 5FY7A 3NQHA 1UYPA 2DBNA 4Y1VA 1QQP1 4B4PA 1AX1A 4Q0PA 1DBNA 1YRZA 3EQEA 5LA1A 5F3CA 1AR63 5FY4A 1O5LA 3S30A 3T1MA 3THPA 4K40A 4B7KA 5CEHA 1BEV2 4YG0A 3LPFA 2WFF3 2AGSA 3RWKX 4IV3A 4ZXEA 4E8CA 2HWB2 3V65A 3RDIA 2MNGA 1JU3A 3VKFC 5K0UB 3RZJA 2WNUA 4CDUB 4LIVA 5F6LB 1W9YA 4IDZA 5DG1A 2HWD1 4ZS2A 4YGEA 2VOVA 2L9LA 3FHAA 5FPVA 4CP2A 1RUJ1 1KFXL 1VBE3 4P9IA 4YLZA 2AC1A 2FDJA 5A7WA 2XJPA 3FHIB 4QDQA 3DKQA 3CU7A 1VALA 4R9BA 2V4AA 3CO2A 4CEYA 3POEA 4RD7A 5FZ6A 1GU3A 4GALA 1QJZA 3LDRA 2UY9A 1N3QA 1UOFA 1ZRFA 4Q29A 5DZEA 4H7MA 1RTVA 2YDEA 1ZBA3 2B9UA 3M3QA 3I2GA 2WO2A 2R043 4PBOA 4QQ2A 4M4PA 5JZGB 1W9SA 3LEKA 5DG2A 3ZSMA 1UXZA 3DN7A 4CCMA 5IFPA 3UKNA 3ACIA 4U2AA 4NHMA 1PO21 1EY2A 1GICA 1LOGA 2E32A 2XOMA 3RZZA 4Q27A 1FOD1 4LBMA 1GQGA 4E2QA 4Q0SA 4QQPA 1MS3A 3N7MA 4LOTA 1PMJX 4PBPA 5FJHA 3H50A 1D0HA 4JKLA 4QXHA 4S2FA 3J26N 3V64A 4BA6A 4IE6A 1LGBA 2K0GA 4HN0A 3S57A 4D7YA 1NCQB 2BUKA 2R063 2OYZA 1LENA 1F9KA 1QEXA 2GMEA 3GCWA 2YV8A 2DBIA 4XIOA 5FLHA 1QWRA 1G9DA 5GZCA 1E5SA 1U0AA 2YHJA 1ZZCA 4QPGA 4XFAA 3UT0A 4E9KA 2VZ3A 4TWTA 1WMFA 2CDOA 3DPRC 5LA9A 2RS12 1OT5A 4UF0B 3TEWA 3OGGA 3M3EA 4RL7A 2J7MA 1DQ4A 2CWMA 1QMJA 3THTA 1L3JA 3JB8A 2J1AA 5CISA 2ZHLA 2D43A 2BU9A 1F4HA 2VMDA 3CJIB 4NR1A 2JG8C 4ZPIA 1WA4A 5DZFA 1CVNA 4LO8A 3SCFA 4FPLA 4XFFA 2ARXA 3T1LA 5F6KA 4AEKA 2PN5A 3HD8B 1WLTA 3BI3A 3WP5A 2YBSA 3OOXA 3URFA 4QXBA 1GQHA 5T3NA 5FUIA 4DB5A 3LA3A 5FZOA 3ZR6A 5FO8B 5KR7A 5FK8A 3IZOA 4UYBA 5FOJB 2NM1A 2OIIA 4IEPA 4LLFA 3CL1A 2BBAA 1W6PA 4IEWA 2D3SA 2DWRA 1RVF1 2QQMA 4W50A 5T55A 3WEZA 4P02B 1W2NA 2YFZA 3NWKA 4GKXA 2RR13 4BZ4A 3WP6A 3KMHA 3KV5A 3O1VA 3OYWB 1LODA 2G9FA 4Q4V3 4UAPA 1CAWB 2WJSA 1FV2A 1WCUA 4JKKA 3OGRA 1W2OA 4ASLA 3Q8EA 1SEFA 1PHMA 2ZACA 3J9SA 4BB3A 1UOJA 4FFGA 4LK6A 1VAVA 1I6XA 2JEMA 3E6BA 2GALA 5LY1A 2FDIA 4CCJA 3OEAA 1KRIA 3MIFA 3U1XA 1MS9A 1FPN2 3JQXA 3VD7A 4EN7B 1F15A 1Q8VA 5E16A 1ZZ7A 3WNNA 3DV8A 4PJYA 2WZPP 3VBFB 1O3TA 1ULGA 2VUDA 1RUE2 3PUSA 1RUH1 5T5OA 2QZ3A 5DUUA 4MOAA 2G9GA 4LMFA 5CFCC 3HT1A 3CBNA 1JOJA 1RGSA 3MIBA 2A70A 4Y5TA 4IE4A 4Q26A 3AKRA 4W8JA 1GANA 2HWB3 1V6LA 2JE7A 3H0OA 2VZ1A 1BXHA 4ASMB 4GB31 5BNPB 2RJKA 3MZHA 4QU2A 1VP6A 2TEPA 3VL9A 2EIGA 4GIQA 3IAPA 3VZLA 3C7OA 1BVP1 4BJ0A 1UY4A 1W6NB 2BEOA 5HCBA 1W05A 2VE1A 3UGFA 3VBHC 4JX0A 4FPYA 5KHHA 1UMHA 4Y1UA 5I0RA 4RGKA 2VZQA 2OQ7A 1YQ5A 3PUHA 3C7GA 4QX7A 1YQ8A 5FTTC 1O59A 1R092 1YIPA 3WD5A 3WQ1A 1GNYA 5FY5A 3NJVA 4FQ4A 1IZ3A 5GZGA 1W90A 1MS1A 2X5IA 2DU0A 1IOAA 1PM7A 4QB1A 5IVVA 5JXIA 2FD8A 2CWSA 2J1EA 3VUOA 3W58A 4LKSA 1N47A 2RDRA 3D82A 4NJ4A 4NHYA 4XF0A 3ZOIA 2GMPA 3SH5A 1DGWX 1HB1A 1SFPA 2QUOA 2VY0A 4YM3A 5LA0A 2BPA2 4QX8A 2VAUA 1QXPA 1P8JA 2QJVA 2VTXA 2EAAA 2VZTA 2OXBA 4GMP1 5C4WB 2XBO1 5A32B 1VAMA 4ONUA 1YEWA 2HYKA 4EZHA 3BYWA 2IFWA 2TBVA 1OVSA 2Y6FA 3BPZA 4FO9A 2W9XA 1PK6A 3SEPA 4H2AA 2C26A 5D8AC 3OBZA 4FBFA 2ZGRA 2YG0A 1RL3A 4P9WA 3I2HA 1LOEA 2IXHA 2JG9B 4META 3J4UH 1I1EA 4QDSA 1YJKA 5LK5A 3ZDSA 3C2UA 1I9RA 1C4RA 4AQTA 4KL1A 4P9YA 1B09A 4GD4A 3U75A 4QQHA 4IEYA 3ON7A 3FHQA 4NAOA 4CXWA 5LW9A 2I45A 1QNYA 4P14A 1MR5A 2H0VA 4W4ZA 5EJ1B 4C0HA 4C91A 4LHSA 3DKWA 2FCVA 2VMFA 3FMGA 1R082 3ZYFA 1C5HA 1NE6A 3ZFFC 3FUQA 4NIAA 3LCPA 1W04A 4RYDA 4ARXA 3CF6E 2WT2A 1Q3EA 1TQ5A 3WDWA 2TUNA 1EV13 2W5FA 2XWBB 1C57A 2OPWA 5C71A 5FZ9A 2WNUB 4LXLA 1NCRA 2X10A 4JTOA 4CRQA 1BBT3 1Q8SA 1YI9A 3HVDA 4XW3A 3O1MA 1VBD2 4CP0A 3LD8A 1W6MB 1ZYBA 5FY0A 1JZ7A 3VBSA 3L9JT 5A7WB 3LA2A 4I3PA 2Q1MA 3EO6A 3TB0A 3NNGA 2ZX2A 3Q8BA 1PGW1 4KWUA 5FXVA 3LKJA 3ZYGA 2VQUA 1W99A 5DPNA 3KQRA 3U78A 5C3PA 3DXTA 4U36A 4FTEA 4ES8A 2QKDA 3KCXA 2G19A 4FVVA 4M01A 4Y3OA 1GOGA 3FLRA 1GZTA 1OA3A 2W94A 1RJ8A 4HONA 1AX0A 5GJ6A 2RMU3 4XJ9A 5DDJ1 3IMMA 3IIAA 4K1YA 4MGZE 4N9IA 1DYPA 1EPZA 3WCSA 5A80A 4UFIA 4BIOA 3ZFEA 1OI6A 4Y22A 1ULFA 4XFHA 1ZRRA 1GSLA 2J1UA 5FY1A 3T08A 1MS4A 1W0OA 3ZXDA 2E7TA 5J1XA 4V2WA 1RUE3 5EJ3A 2DDUA 3I54A 3GBWA 5A33A 4EROA 5B2GB 3LWCA 4WVVA 1VRH2 3AYDA 2Y34A 2R1DA 4URAA 2PXJA 1XSQA 4CEWA 1DQ0A 5AC91 3MO4A 3HMYA 3OD0A 3H1YA 3ILNA 2OW4A 2WT0A 4FCAA 3T2PA 5C3SA 2FZ1A 3ETPA 3IIIA 4Q4X1 4QPGB 2BGPA 3ZO0B 3RWNA 5CNAA 4GULA 4CPBD 1EAH1 3M4FA 1HLCA 1MPXA 2VNVA 1AX2A 4M3CA 4LUMA 1AL22 2VL4A 5FIXA 2DTWA 4AOCA 1EUUA 1R093 5CKQA 4OHYA 4CDQA 3ETQA 2W95A 5LA2A 2Z79A 4FOVA 3JD71 1GMMA 5FYBA 1ZBE1 2VBPA 1FPN1 3C7EA 3BVCA 3LEGA 1ACCA 3AKPA 3GBFA 5A3PA 5FKCA 3I8TA 1NZCA 3T4VA 1HXS2 5FAXA 1NUKA 3GYDA 3LIGA 5L7OB 5FZOB 3WW4A 3ALQA 3FZ3A 4AI9A 4A7ZA 1ND2B 2A6WA 1AR91 3HNMA 3EBRA 1H8VA 3OY8B 2D6NA 2FMDA 1DFQA 1RUD3 3INAA 2X09A 3ZXJA 1J58A 1W6PB 1MEC1 1WGPA 3MDPA 4Q4W1 4S2GA 3UJQA 4ZONA 4EZ4A 3H9AA 3KZ4C 4FAHA 4HLTA 1KD7A 2LS6A 3J8F2 1MS5A 4QPWA 1DGWA 4JGZA 1QJX1 5FYYA 1IPJA
chains in the Genus database with same CATH topology
1E5HA 1HJFA 1W3XA 1ODNA 1W04A 1W28A 2VBDA 3ZKYA 1QJFA 1HB4A 1W2NA 2DBNA 1WA6X 1UOGA 1W2OA 4BB3A 2VCMA 3ZKUA 2IVIB 2WO7A 1E5IA 1ODMA 1W2AX 5C3PA 1UNBA 1W9YA 5C3QA 1OC1A 1GP4A 2BRTA 1UOFA 2CSGA 1HJGA 1W05A 2VE1A 1RXFA 4RGKA 1HB3A 1W06A 2JB4A 1BK0A 5C3SA 1HB2A 2JB8A 2BJSA 3ZOIA 1DCSA 1OBNA 1HB1A 2DBIA 5C3RA 1IPSA 2VBBA 2VAUA 1E5SA 1GP5A 1GP6A 1UO9A 2VBPA 2Y6FA 1UOBA 1QJEA 1UZWA 1QIQA 4XAEA 2BU9A 1W03A 1BLZA 5C3OA 3OOXA 2IVJA 1W3VA 1E5RA 1RXGA 2Y60A 5APAA 3ON7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E5H A;  1HJF A;  1W3X A;  1ODN A;  1W04 A;  1W28 A;  2VBD A;  3ZKY A;  1QJF A;  1HB4 A;  1W2N A;  2DBN A;  1WA6 X;  1UOG A;  1W2O A;  4BB3 A;  2VCM A;  3ZKU A;  2IVI B;  2WO7 A;  1E5I A;  1ODM A;  1W2A X;  5C3P A;  1UNB A;  1W9Y A;  5C3Q A;  1OC1 A;  1GP4 A;  2BRT A;  1UOF A;  2CSG A;  1HJG A;  1W05 A;  2VE1 A;  1RXF A;  4RGK A;  1HB3 A;  1W06 A;  2JB4 A;  1BK0 A;  5C3S A;  1HB2 A;  2JB8 A;  2BJS A;  3ZOI A;  1DCS A;  1OBN A;  1HB1 A;  2DBI A;  5C3R A;  1IPS A;  2VBB A;  2VAU A;  1E5S A;  1GP5 A;  1GP6 A;  1UO9 A;  2VBP A;  2Y6F A;  1UOB A;  1QJE A;  1UZW A;  1QIQ A;  4XAE A;  2BU9 A;  1W03 A;  1BLZ A;  5C3O A;  3OOX A;  2IVJ A;  1W3V A;  1E5R A;  1RXG A;  2Y60 A;  5APA A;  3ON7 A; 
#chains in the Genus database with same CATH topology
 5JIU A;  4OQ8 A;  5F5C A;  1GLH A;  1PIV 1;  4GZ9 A;  4E2S A;  2NP0 A;  1OA2 A;  1JUI A;  5F39 A;  1ST8 A;  1ODN A;  3B94 A;  1K5M A;  3AZY A;  2XXZ A;  5BNN A;  5CAZ A;  3ZYJ B;  1MVQ A;  2CGN A;  5KXD A;  2PMW B;  4R4X A;  1CON A;  1TNF A;  3KCC A;  1W8H A;  2W0X A;  5CZK A;  2WFP A;  2JKB A;  4DXS A;  2B45 X;  4ZZ5 A;  5ABJ A;  4LEJ A;  3TN9 2;  5FKB A;  1NLR A;  1RIT A;  5FYH A;  4E8D A;  3S7I A;  4Q1R A;  4BK5 A;  3GXU A;  2IVI B;  1FNY A;  3DXU A;  3NV4 A;  3K3N A;  1V9U 1;  2W1Q A;  1G9F A;  4I0A A;  4LLO A;  1QJU 1;  4YVW A;  3U10 A;  1KGY A;  2IZW A;  4KWL A;  3NAP C;  3WNL A;  4D6R A;  3O0X A;  4CUC A;  5JR2 A;  2HLE A;  1H4G A;  2J42 A;  3UGH A;  3N9N A;  1ENS A;  3MLJ A;  3S5Q A;  2XJQ A;  2XML A;  5B4N A;  1LHU A;  5C9A A;  2YU2 A;  3POJ A;  1VBD 3;  3OG2 A;  2P4E A;  3AZX A;  4TZD A;  4FFI A;  2QDN A;  5FP4 A;  1OC1 A;  1ONA A;  1NXD 1;  3AMN A;  4HAN A;  4JAA A;  5E1R A;  1SAC A;  4AQS A;  5A70 A;  3R6S A;  1ALY A;  3OB8 A;  2WQ4 A;  4GWJ A;  3UES A;  4YM0 A;  3B7M A;  4QKD A;  5DXD A;  4AK3 A;  2X5I B;  1YYN A;  3HNY M;  4LKD A;  2VZP A;  5GZF A;  4QPI A;  3VKO A;  1B35 A;  3LZZ A;  4JRA A;  5A3L A;  1ZRC A;  2EAK A;  4YG6 A;  5J98 B;  2C5D A;  3PUI A;  4AEM A;  1VB2 A;  3CJX A;  5FWE A;  2IXL A;  1U12 A;  3PL0 A;  1OF4 A;  2C4X A;  4EN6 B;  4HOO A;  1WCK A;  3AB0 A;  3H1M A;  5FZG A;  4OI1 A;  1C8M 1;  5IYY A;  2W08 A;  3NJZ A;  2BGO A;  1RUG 2;  3NJX A;  3PJQ A;  3K4Z A;  4LHL A;  4UOJ A;  4MXW A;  2BQP A;  1LHO A;  3JB4 C;  4OUM A;  5IT6 A;  4WM8 C;  4FPE A;  1PGL 2;  1QNW A;  2RDN A;  5K0U A;  2YY1 A;  2Y0O A;  3NNL A;  1NXM A;  1W2U A;  1NG0 A;  1H9P A;  4CDU A;  1OLQ A;  4Z92 B;  1PK6 B;  2YFU A;  4BIS A;  1PX4 A;  2OS2 A;  1WKY A;  4ZS3 A;  1VRH 3;  3I4I A;  1GOH A;  1FMD 2;  2EAL A;  4PF5 A;  1SLL A;  4YW7 A;  3SMH A;  2D3P A;  1J3P A;  2O1Q A;  3VL8 A;  2B8M A;  2HYX A;  3WF2 A;  1AYN 2;  3ORJ A;  1HN0 A;  2GC2 A;  4CYD A;  3JBG 1;  2HEY F;  2W92 A;  4A44 A;  1C1F A;  4NN0 A;  4QGM A;  3T0D A;  2JWP A;  5BNP C;  1ASJ 2;  1NA1 B;  4QPY A;  2ZX3 A;  1KS4 A;  1K45 A;  4TN7 A;  3WNP A;  1O3Q A;  1AL2 3;  1J1T A;  4BM8 A;  4URT A;  1RUN A;  2HEW F;  4NIH A;  5FBJ A;  1WW7 A;  1OD5 A;  2VJX A;  3KHC A;  1LAJ A;  1JW6 A;  1UYZ A;  1BZW A;  3VDD C;  4K9S A;  1NCR B;  4CP9 A;  3NO8 A;  4O9G A;  4OZO A;  3WG3 A;  3A4U A;  3D8C A;  4I30 A;  1LED A;  2CL2 A;  2YXS A;  3WNK A;  3ZN4 A;  1NCQ A;  4Q4Y 1;  5AFE A;  4QXC A;  3UJO A;  1BKZ A;  2BVB A;  4C90 A;  2W2I A;  4BQ2 A;  1WA6 X;  3C3V A;  1ZZ6 A;  4GH4 A;  1UXX X;  3J8F 3;  3IT8 A;  2BGC A;  4OUS A;  3IDA A;  5F5I A;  4BQ5 A;  2DFC A;  2VCB A;  2OVU A;  4LBQ D;  2WO3 A;  1AJO A;  1COV 2;  1RUI 2;  4H55 A;  4UF0 A;  4LQR A;  5FXX A;  3GGL A;  1YFW A;  2ZZQ A;  5EXO A;  2PYT A;  5LBF A;  2IXK A;  4JRL A;  2ZMK A;  4XQW A;  1X8M A;  1W2A X;  5TSW A;  1N3P A;  3WSO A;  3R05 A;  3ZFE B;  4Y22 B;  3AFG A;  1YFX A;  3IDC B;  3LGR A;  1T2X A;  1HRI 2;  2V09 A;  4HSL A;  5FRA A;  3VHR A;  2QTW B;  2VW2 A;  3AZV A;  2MEV 1;  5GKA C;  3AMH A;  5LBB A;  2UUR A;  1IKP A;  3CQO A;  1X8E A;  1F2N A;  2EF6 A;  4W6W A;  3TN9 3;  4AHZ A;  5A33 B;  4CCD A;  3PMS A;  4RHV 1;  2EXH A;  4HG6 B;  2JDP A;  1L7Q A;  1HKD A;  4J6G A;  3TRS B;  4XOG A;  4CEW B;  1VE0 A;  1A6C A;  3MLL A;  1O4T A;  3W9A A;  2RS5 2;  4XJU A;  2WZR 2;  2VVD A;  4DUX A;  4KH9 A;  4Y5Z 0;  5E6H A;  2Y26 A;  3FC0 A;  4IV3 C;  1KEX A;  3KGL A;  2E63 A;  3RZH A;  2ZOE B;  4AVB A;  3VBO B;  2O0O A;  2BP6 A;  2XL9 A;  4OMD A;  2D7F A;  4QHB A;  3ME2 A;  2R07 2;  4AE2 A;  4NRO A;  2ZTN A;  3OYW A;  5T50 A;  2FHR A;  1UZY A;  2CV6 A;  4CDW C;  3VD3 A;  4M3C B;  3RYK A;  1CAW A;  4A3X A;  1PZ8 A;  1SFN A;  3I2I A;  1RUC 3;  5DUX A;  2VXJ A;  4EN8 B;  2BFU S;  4PLN A;  4F7Z A;  4AHX A;  4MZU A;  4A7K A;  4CDQ B;  2JEN A;  2OZ6 A;  4CEY C;  4FOQ A;  1XPW A;  1QJY 1;  4FFF A;  2VOK A;  1Z7S 3;  2DVF A;  4A42 A;  4YZ3 A;  2YUE A;  1HX6 A;  3MW4 A;  2D6P A;  1DQ5 A;  2ARA A;  1FXZ A;  1OF3 A;  1OUX A;  2R16 A;  3GZE A;  3BB6 A;  3I7D A;  1NYW A;  3LQC A;  4KU7 A;  1RUG 3;  1UX7 A;  4QB2 A;  2JDA A;  4M0H A;  1SG3 A;  4JQT A;  4O9E A;  2GN7 A;  4QGL A;  1VMH A;  3V0B A;  1W0N A;  1R1A 2;  5CAD A;  5F32 A;  2FDG A;  1XE0 A;  3T2O A;  4IET A;  3OD4 A;  4V1P A;  4QKN A;  4JGZ B;  2JD9 A;  2ZXQ A;  1XNB A;  1FMD 3;  2ENR A;  5C8W A;  3OTF A;  4YM2 A;  2ZX1 A;  1W6N A;  3I2D A;  4ISR A;  5F3I A;  2BNN A;  3N9L A;  5E88 A;  1AYN 3;  3VBU A;  1PVC 3;  3NNF A;  4J25 A;  5BNN B;  3NW4 A;  3POG A;  2KA3 A;  2IVJ A;  2KR2 A;  4NID A;  5J36 A;  1KFU L;  4PIZ A;  2DYC A;  1ZA7 A;  4MGK E;  4YZ5 A;  5IVB A;  2WLP A;  4C1W A;  2WNE A;  1W8T A;  3ZFG A;  4LT5 A;  4XBQ A;  5FZB A;  1LEC A;  1W0P A;  2QFE A;  2JDY A;  1W28 A;  1RC6 A;  2OUH A;  1F4A A;  3HBK A;  1HRV 3;  1XND A;  2NLR A;  3ES1 A;  3P6B A;  5IW0 A;  4RQP A;  4COZ A;  2UWB A;  4Q8L A;  5KC6 A;  3CZU A;  4R52 A;  3T4H B;  1YXW A;  4YVW B;  2D5F A;  3ZXG A;  1REE A;  4UW6 A;  3UK9 A;  5C4W A;  2CDP A;  5GLW A;  1QU0 A;  5DUV A;  1AUY A;  2RJ2 A;  1UYX A;  2E53 A;  5C9A B;  5A3M A;  1DYO A;  2A1X A;  4Q2F A;  2CGO A;  4YZ2 A;  2ZJC A;  2VGD A;  4RR3 C;  2GH2 A;  1WME A;  4XQD A;  2YPJ A;  1E5I A;  4I09 A;  1Q5O A;  5FZE A;  1QGL A;  3QD6 A;  2XPJ A;  5CFD C;  3HN3 A;  2WNV C;  4IV1 A;  2BVV A;  1X9P A;  1TME 2;  2D97 A;  4XMI A;  5LZ6 A;  2GC3 A;  1WMX A;  1AR7 1;  2DVD A;  2RM2 2;  2YPD A;  5LEK A;  4TLF A;  4QPI B;  2WZE A;  1COV 3;  1RUI 3;  1PO1 1;  2P1B A;  2P3I A;  3H42 B;  3PUR A;  2JDZ A;  3DCQ A;  5A3O A;  3FFQ A;  2HWC 2;  3SKV A;  1Y43 B;  2GMM A;  4RS5 A;  3AP9 A;  1D4M 2;  2ZKN A;  5DAP A;  1S55 A;  1ULO A;  1XYO A;  5IUQ A;  3KVB A;  4MXW B;  3VLB B;  3E5U A;  5FYT A;  5J3U A;  1MQT A;  2DCJ A;  1HRI 3;  3WW1 A;  4LBQ B;  1BMV 2;  4Y1Y A;  5I8S A;  4OHW A;  3CEW A;  1PMH X;  1U5I A;  2EIE A;  5FYU A;  5FYM A;  1WBF A;  2X53 S;  1UY1 A;  3UYJ A;  1MS0 A;  4D6Q A;  3MW3 A;  5JWP A;  5A3N A;  2WO1 A;  1FNZ A;  3ZYR A;  1LCL A;  4YRD A;  2GSY A;  1LOC A;  1W6M A;  1CJP A;  1MZF A;  2WSU A;  4L11 A;  3ZYH A;  2RS5 3;  2QNK A;  2WZR 3;  5FO7 B;  3B69 A;  4QD2 A;  4YVS A;  3MIC A;  1NLS A;  4XMA A;  3SCH A;  3QBQ A;  5FLJ A;  2PFW A;  2UWC A;  2WRA A;  4XJ8 A;  1FOD 3;  1DGR A;  2R0F A;  2R07 3;  4YM1 A;  2JIJ A;  1NKG A;  4X6Q B;  1OBN A;  3WXP A;  5FPB A;  5C3R A;  2JKX A;  5FZI A;  1XB9 A;  2WII B;  3OUI A;  1S0J A;  3AC0 A;  4QHZ A;  2V5Y A;  1O8S A;  5J37 A;  1J84 A;  3FN9 A;  1GP6 A;  2X05 A;  5DN2 A;  4IL7 A;  4PDW A;  2VCC A;  3AJY A;  1UOB A;  4M00 A;  4YZ1 A;  2A3W A;  4M4R A;  3MLK A;  1AR6 1;  4B1L A;  4JQR A;  4I3G A;  2F4P A;  4L8Q A;  4CP9 B;  2X5I C;  5A1L A;  2WFF 1;  4YW4 A;  4HN1 A;  1RJ7 A;  1W2T A;  1LOF C;  4AVV A;  1UQX A;  4AR2 A;  4BQX A;  2RG4 A;  3R4U A;  5GLZ A;  4D69 A;  4Z2A A;  1SPP A;  4AFB A;  4CCO A;  4IGQ A;  1I5Z A;  2QQV A;  3MV1 1;  4IXL A;  2OQ6 A;  5JI9 A;  1R1A 3;  1VBE 1;  1UIJ A;  4DOU A;  1PNF A;  2JDH A;  3RYP A;  4GH4 B;  4IEZ A;  2Y64 A;  5I8T A;  4IES A;  5KBF A;  2GP5 A;  2MHF A;  3R4D B;  4Z07 A;  4YW5 A;  1YQ2 A;  4K6B A;  3L2Y A;  5FMO L;  2DTY A;  1S0B A;  2P6C A;  1H8T C;  4XCA A;  1XXN A;  1HQN A;  1GWK A;  2D6L X;  2VBD A;  3JXS A;  4FPJ A;  4H3W A;  4H7L A;  3ACL A;  1EP0 A;  4Q1P A;  5BNO B;  1OQE A;  2ORZ A;  1MS8 A;  1ZBA 1;  4FAG A;  5EYY A;  1NZI A;  3ZXK A;  3VZM A;  2RE9 A;  4P5H A;  1S0F A;  5KHI A;  1G9C A;  1UOG A;  2R04 1;  4M0N A;  3APB A;  3HWJ A;  3PVN A;  2W91 A;  2XJV A;  4NII A;  1OXC A;  2QQK A;  3HN1 A;  4O61 A;  4CDX A;  3ENR A;  2VNR A;  4TYS A;  4AHY A;  2VCM A;  5L19 A;  1EV1 2;  5H9Q A;  1YI7 A;  1LU2 A;  1YFY A;  2IXC A;  1L7R A;  1NAE A;  1OFN A;  4PLM A;  5KXE A;  2GC1 A;  1PNG A;  2DUO A;  2R0H A;  1BBT 2;  2FDF A;  2WN2 A;  2VOT A;  1WD4 A;  5L7O A;  3KT1 A;  4XTM A;  5JSP A;  2D6K A;  1ND2 A;  4XJW A;  3PIG A;  3O12 A;  1VBB 2;  5FYS A;  3OY8 A;  1WCS A;  3M3I A;  3WQB A;  4NHX A;  4CP1 A;  2VQT A;  3FBM A;  5ERL A;  5I0S A;  4Y20 A;  4BU2 A;  1W6O A;  2R06 1;  2WS9 3;  2B39 A;  2K2S A;  3T09 A;  1JXN A;  4AED A;  1HN1 A;  3F2Z A;  1O7F A;  4R9D A;  3WY6 A;  3ZIW A;  3NST A;  1KDM A;  5F9T A;  1UU4 A;  2HWE 1;  1S4C A;  4WM7 A;  2XDV A;  1GP4 A;  5JUV A;  1RHI 1;  3VBS C;  2LRP A;  4ZU7 A;  2RMU 2;  1UPI A;  4ZXK A;  2GNB A;  4UW5 A;  5A7S A;  1VPH A;  3SIT A;  1TME 3;  2WC2 A;  3PVE A;  2WWS A;  2RM2 3;  3BAL A;  2HH9 A;  4UI9 L;  4XTP A;  1HJG A;  3WF1 A;  5DAV A;  2IUW A;  5HCF A;  1LTE A;  3P3P A;  1IKQ A;  2NMN A;  4ATF A;  1VB4 A;  1JYC A;  2HWC 3;  4W6Y A;  1W06 A;  3N9Q A;  2ZKL A;  4S2D A;  1BK0 A;  5BPX A;  1D4M 3;  3OUH A;  1Y9Q A;  2BNO A;  4B8E A;  1OD3 A;  5JXJ A;  4XJZ A;  2QVS B;  5IAV A;  5FZ7 A;  2ZBJ A;  1JOB A;  5J96 B;  3NV1 A;  4CTE A;  4HSJ A;  1N3O A;  2C9K A;  3V0B B;  1O3R A;  4OZX A;  1LRH A;  3ZDV A;  5F7U A;  4DRR A;  1AYM 2;  1GBG A;  1V6O A;  2LAL A;  1T6B X;  4N7U A;  2QQU A;  2BFU L;  5T5J A;  2LRO A;  2RR1 1;  4XPV A;  4BQ3 A;  2PHT A;  2Y6L A;  4NVP A;  4Q4V 1;  3WR0 A;  3LSD A;  3H3U A;  1POV 3;  4K8F A;  4PI0 A;  4O65 A;  3VBU B;  1UD1 A;  2WWJ A;  4QHO A;  5C70 A;  4OI2 A;  3PLQ A;  4IND A;  2ID4 A;  4XUQ A;  5HV0 A;  4AFA A;  5IHR A;  1QIQ A;  1APN A;  1AR8 3;  3BOP A;  3PTY A;  1TNR A;  3C8X A;  4LIU A;  4ZHN A;  1Y7B A;  1VMJ A;  4LHN A;  2R49 A;  4LHK A;  3ZFG B;  1CES A;  2I07 B;  4HK9 A;  3FBY A;  1M06 G;  1SZB A;  2VOX A;  2B4K A;  1C28 A;  1Y3T A;  2PHW A;  1HDK A;  2YU1 A;  3NKG A;  3MIH A;  3PTR B;  4IGO A;  4QM8 A;  4DY3 A;  4I2O A;  3VD9 A;  3B9C A;  2YBK A;  4RQP B;  2RVA A;  4B29 A;  3SLI A;  5CG8 A;  1OH3 A;  3POB A;  5LRR A;  2DVB A;  4H14 A;  3WDX A;  2A73 B;  3AMP A;  1RUD 2;  2IXJ A;  1V70 A;  3ZXF A;  1BEV 1;  1CAV A;  1DIW A;  3WHU A;  5JPM B;  1RB8 G;  4OHX A;  3AMM A;  3FLT A;  2HWB 1;  2VUC A;  3CHX A;  5K9Y A;  4A45 A;  4NPR A;  1IS6 A;  5DMY A;  1WLD A;  5F8P A;  2H6C A;  3POW A;  2Z4F A;  2E7A A;  1XNT A;  3O7O A;  1LES A;  3UV9 A;  4XHB A;  3WVJ A;  3WW3 A;  5A7P A;  2ZEZ A;  2W46 A;  4IV1 B;  4UWD A;  2GNM A;  4TXW A;  1VRB A;  1UU6 A;  3VBR B;  1CN1 A;  1ZM1 A;  5FDB A;  4ASK A;  1GNZ A;  1LGN A;  1OHF A;  2O8Q A;  5BV6 A;  5CFC A;  1STM A;  2A3X A;  1OQ1 A;  3A22 A;  4A4A A;  4BPZ A;  2P3K A;  1J3Q A;  2J1S A;  1NA1 A;  4JGY C;  3POS A;  3PVB B;  5FZH A;  4BHP A;  2HKX A;  4AVT A;  1AHS A;  4FP3 A;  5LRS A;  2D44 A;  4FPF A;  5DUW A;  2ZGU A;  2J1T A;  4RS5 B;  5F2W A;  4L97 A;  3VV1 A;  3ZXA C;  2A75 A;  1K5M C;  1CAU A;  1JOP A;  1WCD J;  1XSR A;  3ILR A;  5BNN C;  3KB5 A;  3I2O A;  1MQT B;  2E6V A;  4XXA A;  1UZV A;  3EXU A;  4CPB A;  4CUG A;  1UMI A;  4LBN A;  3RG0 A;  1OLM A;  4RFR B;  4W65 A;  1VLN A;  2Z2S B;  5F3E A;  4KWK A;  2Z69 A;  2ZGL A;  3N7L A;  3WG4 A;  1VAK A;  4MGS A;  1CJD A;  4LNV A;  5ABJ C;  3AFK A;  4NWV A;  3MUY 1;  3B00 A;  3OJB A;  4NHL A;  1URX A;  3ZLI A;  2NPI A;  5DDJ 3;  3J7L A;  1OOP A;  3ZYP A;  2QQN A;  1VBB 3;  4YVS B;  5C8C B;  3AP4 A;  4MVT A;  3FUO A;  4YVW C;  4QXK A;  4XAA A;  1X82 A;  3I59 A;  3EHK A;  5ANN A;  3T30 A;  4CUA A;  4Y4Y A;  1N1Y A;  3TNP B;  2EID A;  4DRV A;  1JH5 A;  1A8M A;  4QM9 A;  4QX1 A;  2YC4 A;  3C7F A;  5GLU A;  2VOW A;  4BOW A;  1G7Y A;  2AEZ A;  4FT8 A;  1NY7 2;  2FBE A;  5GM0 A;  5IK4 A;  2QZ2 A;  2RS1 1;  2PHL A;  3MBW A;  3T0B A;  2CAU A;  2HWF 3;  5M0T A;  1ENR A;  2X29 A;  1UY0 A;  4PDW B;  5KHG A;  4PT6 A;  3DF0 A;  1V6N A;  1YHF A;  3WDV A;  1WLW A;  1VBC 2;  2VZS A;  3TAY A;  1DCS A;  3VGI A;  4IUG A;  1UN1 A;  2BER A;  3ECQ A;  1B35 C;  4IEO A;  1H2N A;  2D40 A;  5IFT A;  5LY2 A;  2BV4 A;  4FSJ A;  4EYU A;  4Q5O A;  1RIN A;  1DZQ A;  2BOJ A;  2YGL A;  4MHU A;  1G6N A;  2KM2 A;  1W8Z A;  1SPP B;  1S0C A;  4FPK A;  4KGG A;  4UXA A;  1KXG A;  1IGO A;  2P37 A;  4BLI A;  4M3C E;  1GOF A;  4B3N A;  2WR9 A;  4LBO A;  1AYM 3;  1PM4 A;  3JD7 3;  3MID A;  1O91 A;  4O7X A;  2PEL A;  4UBG A;  3B93 A;  2ARB A;  4RGA A;  4SLI A;  1H2L A;  5K0U C;  3VBO A;  5L9R A;  4W6X A;  2D6O X;  4A2U A;  4CDU C;  4JDM A;  2QDR A;  3P5B A;  5FK7 A;  4XUO A;  3WUC A;  2V72 A;  2XWJ B;  3N35 A;  4JKM A;  3WDT A;  1J59 A;  1CIW A;  2WQZ C;  5IK7 A;  1E5R A;  1GNH A;  4IEQ A;  3MEP A;  1WD3 A;  2BWA A;  2H6B A;  5JPN B;  2A6V A;  4HXC A;  2RMU 1;  2XH6 A;  1XU2 A;  2OX0 A;  5JVV A;  3TBD A;  2DUR A;  3VBH A;  4CCE A;  4CDX B;  4IE7 A;  5I0D A;  1NOV A;  3GBG A;  2P5B A;  2QQW A;  1GQP A;  3RZG A;  2QQI A;  1E57 A;  2ORX A;  4M3C F;  2ZA9 A;  1QJX 3;  4HET A;  1Q43 A;  3RFR A;  1D2Q A;  3M3C A;  1DQ6 A;  2XHK A;  2NQY A;  1RUE 1;  1XJA A;  2WAO A;  4BQW A;  2B5H A;  1FX5 A;  2AEY A;  2RV9 A;  2XG3 A;  3A21 A;  5JDB A;  5JZG C;  1UZZ A;  3I3B A;  1JYW A;  3O1T A;  4FFH A;  3BIW E;  2XLG A;  4CU9 A;  4Q0V A;  5J48 A;  3ACH A;  4Y20 B;  1W6O B;  1N1T A;  2EVX A;  4AED B;  4Y33 A;  5FBZ A;  2GZW A;  1EUT A;  4LKE A;  4XFI A;  4B7E A;  5ACA 2;  4WM7 B;  2PLV 3;  3HQR A;  4N53 A;  3RYR A;  5DAB A;  4Y24 A;  2BZD A;  2RDQ A;  1NCQ C;  1IS3 A;  5FPZ A;  2WT1 A;  3SC7 X;  2VUJ A;  2UWA A;  2Y6H A;  5D8A A;  3EJK A;  4KG8 A;  4J1X A;  2XJR A;  1ZX5 A;  1V9U 3;  4NAM A;  2ETE A;  1R09 1;  4S2H A;  1EPW A;  1G86 A;  1UAI A;  3KD4 A;  1DQ1 A;  2E51 A;  3N3H A;  2BRT A;  4IQP A;  5ANQ A;  3MF6 A;  1GV9 A;  2DVG A;  5CA6 A;  3ZN6 A;  4ZKT B;  3OBA A;  1X33 A;  3CJI C;  2CSG A;  4AXO A;  2P2K A;  3GZU C;  5HCA A;  3RZM A;  4HZF A;  4AFD A;  5H9R A;  3KT7 A;  1D2S A;  3N9O A;  1XE7 A;  2WAA A;  4PQ9 A;  4HMZ A;  5EP9 A;  3ZFF A;  1RUD 1;  1C5I A;  2JB4 A;  4HVR A;  3JQW A;  3PHM A;  1IQD C;  3PVO A;  4PCR A;  3USU B;  4XUR A;  1RUO A;  2GP3 A;  3WIN E;  5A6Z A;  4HKL A;  3B9I A;  1UKR A;  1JBC A;  3LIH A;  3K75 B;  3IM0 A;  5DAX A;  4LR4 A;  1RUC 2;  3SEE A;  3IWZ A;  3IDE A;  5D2A A;  2YC0 A;  3K3O A;  3UET A;  3T0A A;  3J7H A;  5FLI A;  1Z7S 2;  2VBB A;  1RMU 2;  1SQ4 A;  3KCY A;  3L2H A;  5D1I A;  2A7A A;  4F8A A;  1DLL A;  4NRQ A;  1YLL A;  1JZ6 A;  3WG1 A;  4E2G A;  2Y8K A;  1UWW A;  3RZK A;  1X9T A;  3W21 A;  4GJZ A;  1S2B A;  1QJE A;  5FZM A;  3U4S A;  4FOW A;  4MUV A;  1LHV A;  1VR3 A;  4YG3 A;  1XOY A;  2A6Y A;  4UFL A;  1R08 1;  3VHN A;  1VBC 3;  2RS3 2;  3KF5 A;  3OBR A;  5FOB B;  1VBA 2;  5FCC A;  2VMH A;  1CAV B;  4DO0 A;  5FFO C;  1V6K A;  2VTF A;  4LBQ A;  4COV A;  4QX3 A;  1O6U A;  3ZSJ A;  2VU9 A;  3PIJ A;  5KWR A;  1H1A A;  1KS5 A;  3VBF C;  1RUF 2;  3UKV A;  2C24 A;  4N8M A;  1WMD A;  3BUC A;  2DUP A;  5LBE A;  3QH7 A;  4LBL A;  1VBD 1;  2D6M A;  2PA7 A;  1L7L A;  2HBT A;  2C9A A;  3ZXE A;  1HJF A;  1PVC 2;  4Z82 A;  5C33 A;  3FE5 A;  5CFC B;  3VHO A;  4DY5 A;  1PGS A;  5A3W A;  4XBN A;  2SLI A;  3ZKY A;  1IG3 A;  1BJQ A;  1TE1 B;  1HB4 A;  5KXB A;  1OFS A;  2CGP A;  4D94 A;  2GAU A;  2Y0I A;  4AF9 A;  3W5M A;  2FZ2 A;  4LE3 A;  1DGL A;  3CDZ B;  3DPR B;  3LOB A;  5FZ4 A;  5AVA A;  2ZZJ A;  1CAU B;  4NRM A;  1HRV 2;  2D98 A;  4WBB A;  1TMF 2;  2VH9 A;  1GUI A;  2XGX A;  3FWE A;  5EV7 A;  3FFZ A;  5JIA A;  2HBU A;  2JG8 B;  3OPZ A;  4FPH A;  3BU0 A;  2F4L A;  3WF4 A;  2O8O A;  1JHN A;  1OKQ A;  3TYJ A;  3E6C C;  2C0Z A;  3ZFG C;  3AZW A;  1CX4 A;  1CR7 A;  2FCU A;  2VNO A;  3WQ7 A;  2FQP A;  2UY8 A;  3DEM A;  2JD4 A;  4LA3 A;  3JCI A;  4LOR A;  1QQP 2;  2PQQ A;  3T2T A;  2VEC A;  5C3Q A;  3DL3 A;  1OOP B;  3HQU A;  4IE5 A;  4ISQ A;  4CCC A;  3FL7 A;  1VRH 1;  4Q8K A;  4IEU A;  3I59 B;  3BTZ A;  5IAX A;  4LOS A;  5C4W C;  4JHZ A;  3NV3 A;  2VW0 A;  4KWJ A;  5GAL A;  5ACA 3;  4K8R B;  4AI8 A;  4QX5 A;  3O14 A;  1WW6 A;  3G6J B;  5KC5 A;  3D0J A;  4DPN A;  3TWI A;  3E1F 1;  3FLP A;  2HWD 2;  4X8P A;  5BNO A;  4ZY9 A;  4COY A;  1NQD A;  5EHD A;  3HJR A;  1RUJ 2;  2JG9 C;  1WZX A;  4UFM A;  2P3J A;  1AL2 1;  1UIK A;  2JE9 A;  5LEJ A;  1MZE A;  4XAC A;  4BQY A;  1BYH A;  1KQR A;  4LO5 B;  4XUP A;  1H6Y A;  4E4S A;  3BGA A;  3OGS A;  2NN8 A;  4NWW A;  3BN6 A;  5FYZ A;  3MI8 A;  3WQ0 A;  1CPN A;  2WBK A;  5F5Q A;  3GCX A;  3O0V A;  5FPA A;  2AH2 A;  2JB8 A;  2VPV A;  4CXX A;  1HV0 A;  1HXS 1;  3NRU A;  4YW6 A;  1UPS A;  1JYX A;  2UYA A;  4BWO A;  3J7N A;  1H2K A;  4NOT A;  1FAT A;  2JX9 A;  2KXL A;  4UFJ A;  3OSD A;  1K3I A;  4DZG A;  4ET7 A;  1IPS A;  3U37 A;  1SCS A;  1QH6 A;  2EXJ A;  4AVC A;  3POI A;  3RMY A;  2WNU C;  3NJY A;  1C1L A;  1FOD 2;  5EWS A;  3J8F 1;  2Q0A A;  5BNQ A;  1LU1 A;  1JZ2 A;  3A23 A;  3VB9 A;  3NMB A;  1AXK A;  2DCZ A;  3GAL A;  4QB6 A;  3T3Y A;  2H0B A;  4XAE A;  1W39 A;  5DAW A;  1BLZ A;  5IVF A;  5I0T A;  1UY3 A;  3VBH B;  5C3O A;  5FP8 A;  3NKT A;  1RMU 3;  1AVB A;  1X7N A;  2DU1 A;  5A6Y A;  1LR5 A;  4AVA A;  1T6G C;  4L0P A;  5I8Y A;  3PME A;  5AVP A;  1GYK A;  2ZGK A;  4YGC A;  2R7E B;  4BDV B;  3TN9 1;  2ZAB A;  4MX3 A;  1I5P A;  4LA2 A;  1PZ9 A;  4WZC A;  1IPK A;  2NMO A;  1Q8Q A;  1S0I A;  2JEC A;  2RS3 3;  1LHN A;  1VBA 3;  3IN9 A;  3P1I A;  1SLI A;  4RFT 0;  4AEJ A;  3X29 B;  5IK8 A;  5A3T A;  2IC1 A;  3KSC A;  2XLA A;  4Y1X A;  4D6S A;  1RUF 3;  3WZ1 A;  4BME A;  4WM8 A;  4MGT A;  4YW3 A;  4N53 B;  4DXR A;  3KHB A;  2WWU A;  1PX3 A;  2VQA A;  5LK7 B;  4CU6 A;  2ZEX A;  2Y6J A;  3ZSE A;  4EN9 B;  5D8A B;  3PU8 A;  3KV6 A;  4G4F A;  4HBN A;  1W9W A;  2JDN A;  4HK8 A;  1VIW B;  4AGR A;  1RUC 1;  3O1P A;  1GWM A;  1GZW B;  3K4A A;  4UW3 A;  4DEQ A;  2Z42 A;  2PHD A;  4QPG C;  4E27 A;  2YZ4 A;  4JC1 A;  1KJR A;  1W8U A;  1ULD A;  2XQR A;  4DIQ A;  1W6Q A;  4JTN A;  4XUT A;  5JOX A;  1Z7S 1;  3CNA A;  1XC6 A;  4C1X A;  3E97 A;  3RMX A;  3ZN6 B;  4FXG B;  4WVZ A;  1PZ7 A;  1SLT A;  3OGJ A;  4X8N A;  1O3S A;  3MPB A;  3POY A;  5C7G A;  1OA4 A;  1TMF 3;  4FTB A;  4YFW A;  5CKM A;  4XF3 A;  3AL5 A;  4B4Q A;  3JZV A;  1RUG 1;  4NHK A;  4XIL A;  3H8U A;  3ZFF B;  4L2N A;  1BHG A;  4N9H A;  1ND3 A;  1POV 0;  4DS0 A;  2WS9 2;  5A7Q A;  2YB7 A;  3AX4 A;  1PGL 1;  5T5P A;  2AR6 A;  4I0W B;  1PO1 3;  1QQP 3;  3VDD A;  5FXZ A;  4HKW A;  1KJL A;  2A6Z A;  3ROU A;  1ZNP A;  1FT9 A;  1RUH 2;  3RRD A;  2JDM A;  3WF0 A;  5L7O C;  1LGC A;  1QXR A;  1ND2 C;  1FMD 1;  4AFC A;  4TLG A;  3VBR A;  1AYN 1;  1GR3 A;  1PVC 1;  1WBL A;  1DHK B;  3ZR5 A;  3FX3 A;  3IDB B;  2PHX A;  2XHN A;  3BU7 A;  3PU3 A;  4GAZ A;  4GB3 2;  2CTV A;  5FZA A;  3F95 A;  2HWD 3;  1ASJ 1;  2ZHM A;  3ASI A;  2OT7 A;  3K48 A;  3VDB A;  4OUL A;  2EIB A;  2DVA A;  4QQL A;  4R9A A;  1O4Z A;  1RUJ 3;  4ZU4 A;  4CSW A;  5A3U A;  2J1R A;  1FYU A;  3C7H A;  2HJI A;  3SIS A;  1A3K A;  1HQW A;  4KU8 A;  4XHX A;  3S7E A;  4CVU A;  4NMI A;  5CB7 A;  2SBA A;  1DZT A;  3CZJ A;  1JZ3 A;  1YQC A;  4XEZ A;  1Q8P A;  1DYK A;  2XON A;  3HOB A;  1N1V A;  3I2F A;  4YGB A;  4AI1 A;  4LBJ A;  2GH8 A;  1SBD A;  5L36 A;  1MAC A;  4FI9 A;  3RZL A;  4YGD A;  1MZ6 A;  3QOP A;  1NE4 A;  5FY8 A;  4EQV A;  3BTX A;  4MLO A;  4LUL A;  4FQZ A;  2A5Z A;  4NPL A;  5F5A A;  3M3O A;  3WDU A;  5I91 A;  3BCW A;  4WV8 A;  2PHR A;  3NNM A;  5HBA A;  1SCR A;  5C8C A;  4MSV A;  1F5F A;  3GHM A;  4MH0 E;  3VZN A;  1OPM A;  5BYN A;  1PO2 3;  3N4M A;  1WCQ A;  4R9C A;  1AR8 2;  3LDB A;  2XBO 2;  1XQN A;  2OPK A;  3AP5 A;  5FQ0 A;  2VMC A;  1ZZ9 A;  1F5J A;  1LOA A;  5JMO A;  3AXE A;  1SBF A;  4IE0 A;  4AYU A;  2ZX0 A;  1U5Z A;  2N7G A;  4AVS A;  5FPL A;  4E4H A;  1LKN A;  4TSV A;  1COV 1;  1RUI 1;  3H3L A;  4CDW A;  4AGV A;  2VZV A;  2R32 A;  4OHZ A;  2QBX A;  1CWP A;  4OYU A;  1W3X A;  4BCU A;  1LEM A;  1SHW B;  1TG7 A;  2FDH A;  5FWJ A;  4AAX A;  1BVV A;  3HEI A;  2EIC A;  2RJL A;  3SCG A;  2CNA A;  3J7M A;  1XBF A;  4D3W A;  1CZS A;  2G9Z A;  3VD5 A;  3O1R A;  1HRI 1;  4HFS A;  4QWN A;  4XVH A;  3GM8 A;  2ZGN A;  3D4K A;  4A6O A;  3N36 A;  2JDK A;  1S0D A;  2Q30 A;  5I93 A;  2PHF A;  1SLB A;  1SFY A;  2VW1 A;  4N43 A;  3EYP A;  3LOI A;  2ZMN A;  5FP7 A;  5FUN A;  3AZZ A;  3ZKU A;  3OPT A;  3ACG A;  1H6X A;  3N7K A;  1OUR A;  2RS5 1;  4IEV A;  2WZR 1;  1UY2 A;  2D93 A;  3RPQ A;  5FZ0 A;  1QOT A;  3BPS A;  3D5O A;  4GXL A;  4QKB A;  3RS6 A;  4C8D A;  2PTM A;  2XLF A;  1JYN A;  4MG2 A;  1PK6 C;  2Y38 A;  2R07 1;  2ZEW A;  2PAK A;  4Y1Z A;  3BTY A;  1DF0 A;  1V0A A;  2EXK A;  3WLU A;  4K7J A;  3Q9O A;  4LK7 A;  5LWB A;  4OHV A;  4EWE A;  4NE9 A;  3HIF A;  5JOZ A;  3S5A A;  5E8A A;  4MAD A;  2JE8 A;  4P9J A;  1UU5 A;  3DEC A;  2XJS A;  1A78 A;  1PGW 2;  1QKQ A;  3PDQ A;  4K3U A;  1RVF 3;  3ZYB A;  1D7P M;  4DQA A;  5K4L A;  1W8N A;  5FZC A;  4LIT A;  1G9B A;  1YFU A;  3OF1 A;  4P9X A;  3RJ2 X;  1NA1 C;  1H30 A;  4EWD A;  1QOS A;  2DCK A;  2YMZ A;  2VTX J;  4GJY A;  4MV2 A;  2HWE 3;  4ATE A;  3N9M A;  1RHI 3;  5DDJ 2;  4OLL A;  5IVJ A;  5SV8 A;  4QGN A;  4KNC A;  1ZRD A;  1SMV A;  2IXI A;  1XYP A;  2ZX4 A;  2NZ9 A;  4GA9 A;  3VDA A;  4AQ2 A;  4NO4 A;  1R1A 1;  1NCR C;  3GDB A;  1Y9M A;  1JZ4 A;  3EB7 A;  2EA7 A;  2WKK A;  3QAC A;  2ZGT A;  1JZ8 A;  2ARE A;  3NAP B;  4XFG A;  5FR3 A;  3WDY A;  1RUH 3;  3A7Q A;  3AP7 A;  4NIG A;  4YZ4 A;  4K20 A;  1OOP C;  5FZF A;  3TEZ A;  4KBZ A;  3AVR A;  4E4Z A;  2HWF 2;  1S2K A;  4RR3 A;  1AF9 A;  3AK0 A;  3RVH A;  5LB6 A;  5AC9 2;  2Q1F A;  2VZO A;  2JIC A;  1F35 A;  2E7Q A;  4P00 B;  1F31 A;  4BE3 A;  5CFD A;  3HT2 A;  2WNV A;  2ET1 A;  2Y33 A;  3EMR A;  2DCY A;  4P9L A;  4Q4X 2;  1CGP A;  4GB3 3;  3IAQ A;  5CIR A;  1M4W A;  3ZXL A;  1ZZ8 A;  3BTA A;  3W20 A;  4DUW A;  1EAH 2;  2XVK A;  2ADE A;  5J7M A;  2W47 A;  4B1M A;  1IS4 A;  1QHD A;  1WWY A;  2V4V A;  4XJA A;  2Q4S A;  4EJR A;  4BQ1 A;  5HI0 A;  2LUW A;  4QMA A;  4LKF A;  4YYO A;  1YQ6 A;  4YNI A;  4PF1 A;  3ZFE C;  3VHP A;  1C8N A;  2ILM A;  5KHJ A;  2RDS A;  3ILF A;  3LAG A;  3JD7 2;  5EJZ B;  1ZBE 2;  2IWG B;  3AJZ A;  5JI7 A;  5BY5 A;  3DYO A;  4WM8 B;  2WS9 1;  4RN5 A;  4DUV A;  3USU A;  3AMQ A;  1LNS A;  1H1M A;  1H2M A;  1OKO A;  4HT1 T;  1SBE A;  3UKT A;  1O4Y A;  2W3J A;  4CEW C;  3GJB A;  4P9G A;  5HV4 A;  1CZV A;  4AQ6 A;  4WVM A;  1AR9 2;  2RHP A;  3UL2 A;  5B4X A;  4HPK B;  4CE8 A;  2VMG A;  3ZMO A;  1BEV 3;  3KV4 A;  4GMP 3;  1MEC 2;  2W1U A;  2XBO 3;  4Q0Q A;  1TME 1;  3AKQ A;  1H9W A;  4Q4W 2;  3VKN A;  3VBO C;  4BXF A;  1W6Q B;  2RM2 1;  2P34 A;  4AI2 A;  5JCT A;  5L9V A;  4I02 A;  5C5T A;  2PAE A;  3AM2 A;  1BK1 A;  4XF9 A;  2FDK A;  3GNE A;  1QJX 2;  2BW8 A;  2YBP A;  4AAP A;  4AHW A;  4FTS A;  2AYH A;  2QQL A;  1PIV 2;  3SNM A;  2WNO A;  2VQ0 A;  3WF3 A;  2HWC 1;  4PI2 A;  3CLP A;  5FMC A;  1RYY A;  1O5U A;  3WNO A;  3O1U A;  4OI4 A;  2QQO A;  2WO7 A;  2OKX A;  1D4M 1;  2LW8 A;  2X8K A;  4QQO A;  1ODM A;  4UFK A;  4CDQ C;  4BXS V;  2E33 A;  2BWC A;  3MPP G;  3RI8 A;  1W9T A;  2B46 X;  1ND3 B;  3VKM A;  3B5L B;  4GQ7 A;  4XDQ A;  1BMV 1;  3ZSK A;  4AG4 A;  5JXG A;  2P17 A;  4IEX A;  2ES3 A;  3VDD B;  2VCA A;  1UKG A;  1I3H A;  2XJU A;  3N7J A;  3OCP A;  1OVP A;  1OSG A;  3LEI A;  5A7O A;  3V56 A;  2PLV 2;  1REF A;  5KHK A;  3ZMN A;  1LOF A;  2VM9 A;  3MW2 A;  5LAT A;  4XDO A;  4B4R A;  1POV 1;  3MIG A;  3ST7 A;  1LB2 A;  1V9U 2;  4OI0 A;  2VD7 A;  3OUJ A;  1QJU 2;  4OMC A;  4XE9 A;  4COW A;  1JI6 A;  5FPU A;  4TTG A;  4Y26 A;  4XFB A;  5DAQ A;  4AFM A;  1S0G A;  1AR8 1;  4JGZ C;  3WP3 A;  4CCL A;  4BMB A;  1LUL A;  4N53 C;  3RSJ A;  3ZSL A;  2F6B A;  3Q8A A;  3KLS A;  1OLM E;  2ZGO A;  4YSF A;  1HB3 A;  2CYF A;  2P3Y A;  1H8T A;  2J22 A;  3DPR A;  3K77 A;  3CIH A;  1H1I A;  3AP6 A;  3MV0 1;  3KVA A;  5JXH A;  4LJH A;  2K9Z A;  1YIF A;  2DF7 A;  2JG8 A;  3SHR A;  2V5D A;  3AKT A;  1RED A;  4R4Z A;  4BIF A;  5T52 A;  5HPO A;  2BJS A;  4MHR A;  1VMF A;  4LO6 B;  3K46 A;  4GWM A;  4XDP A;  2BTV C;  2QE3 A;  5I0U A;  1G9A A;  5H9P A;  2RS1 3;  1CAX A;  3NL1 A;  3WCR A;  4OVE A;  3WUD A;  1ZA4 A;  3ZPY A;  1OPO A;  1XNC A;  4E4D X;  4X6R B;  5F2S A;  4EE2 A;  3H7J A;  3KT4 A;  1C8M 2;  1D4V B;  2BOI A;  5ISL A;  3B02 A;  4P5Y A;  4Q0U A;  3I2K A;  2C1F A;  1Q56 A;  3V0A A;  4Z1V A;  5FQ0 B;  4JHT A;  3ZYI B;  4IV3 B;  2UYB A;  3GJA A;  5G05 L;  5C9A C;  2ZAA A;  5F3G A;  5GLT A;  2CHH A;  3VZJ A;  1XNK A;  3IMN A;  1JOD A;  2VZU A;  4AW7 A;  1JS9 A;  4CDW B;  2Y6G A;  3HR9 A;  2A6X A;  2R1B A;  1UX6 A;  2W1W A;  1U5Y A;  3RJR A;  4XC9 A;  5AC9 3;  3GHN A;  3JU9 A;  1Y9G A;  1H0B A;  3KV9 A;  4OUE A;  3VZK A;  1O8P A;  2XKO A;  4F83 A;  3JUU A;  4ITC A;  4WZF A;  1V6J A;  3AXD A;  4Q4X 3;  2XVL A;  3LF7 A;  2XVG A;  3JBG 2;  4OQ9 A;  3WT3 A;  1QXJ A;  4CEY B;  2Y60 A;  4QPI C;  3HAG A;  4QAW A;  5A7N A;  3HNB M;  3RQ0 A;  1OMI A;  1MZ5 A;  1EV1 1;  2YRO A;  1MVE A;  1EAH 3;  2XUE A;  1E5H A;  4K21 A;  3ZX7 A;  4DNY A;  2QCS B;  3ITQ A;  4UFH A;  5EIY B;  3OBT A;  1ENQ A;  3P3N A;  4XAB A;  4BK4 A;  4C0B A;  3HPN A;  4MXV A;  4N43 B;  1BBT 1;  3OEB A;  4QX2 A;  1WW4 A;  2BDR A;  3K2O A;  2VR4 A;  4V2V A;  4CU8 A;  4COU A;  5T5L A;  5A1A A;  1VBB 1;  4PIX A;  1PVX A;  3S6P A;  1IG0 A;  1YJL A;  1ZBE 3;  1FPN 3;  5GLV A;  4CUB A;  1UCX A;  1YNA A;  2UU8 A;  5IAT A;  2AAC A;  2YYO A;  3IPV A;  1V00 A;  1GWL A;  2E9Q A;  4UBH A;  3H8X A;  2ZHK A;  1YWK A;  4JV4 A;  4L92 A;  1AZD A;  2WA4 A;  3MGU A;  4OCT A;  2ZGM A;  3DYM A;  3PJY A;  1AR9 3;  4FPC A;  4QKF A;  4Q4Y 2;  2HWF 1;  2VVF A;  1UNB A;  2FCT A;  5EQU A;  1MEC 3;  4Q4W 3;  3H8O A;  4AGG A;  1QF3 A;  3LDK A;  1ZVF A;  3D6E A;  4D7S A;  3ZN5 A;  2F17 A;  4NRP A;  3LSE A;  1BCX A;  3S0M A;  3U14 A;  2E26 A;  5C6C A;  1PIV 3;  1XE8 A;  1AJK A;  1ENX A;  1S0E A;  3U07 A;  2A71 A;  1NLQ A;  1JTZ X;  2CU5 A;  2PAM A;  4R8H A;  4A41 A;  4GKY A;  5JOW A;  1CPM A;  2EXI A;  3WNX A;  4AWD A;  2VVE A;  5LCW L;  2ZPX A;  5H9S A;  3UGG A;  1TVG A;  3WP4 A;  4RA0 A;  3MHZ A;  5FP9 A;  4HKO A;  4P08 A;  2ZGP A;  2XB6 C;  1AYM 1;  4EN0 A;  1NQJ A;  2MEV 2;  1K42 A;  1H4H A;  2ZGQ A;  3E5Q A;  1ZZB A;  5SV5 A;  5G04 L;  3SH3 A;  4YPJ A;  3PUA A;  4RHV 2;  2ZHN A;  2XQX A;  4RR3 B;  4JVA A;  4UT5 A;  1DG6 A;  3TNQ A;  4DEV A;  4LO4 B;  2XR4 A;  1J3R A;  1HB2 A;  1WW5 A;  4J1W A;  4KMQ A;  1F8V A;  1JYT A;  1QJU 3;  4XET A;  4GH4 C;  5CFD B;  4XZP A;  1GZW A;  2WNV B;  1HIX A;  4L99 A;  4LPL A;  3ZPO A;  5JAX A;  2B42 B;  2NYY A;  3VZO A;  3M7A A;  1EYB A;  4F3J A;  5JLV A;  1R1Z A;  3H7Y A;  3AL6 A;  3AKS A;  5BNO C;  4KBB A;  3I49 A;  4LBK A;  2W52 A;  5EPA A;  5EZW A;  3I3Q A;  4JGY A;  3WNM A;  2XJT A;  2VZR A;  4XIK A;  3THD A;  2WN3 A;  1KDK A;  1POQ A;  5FYI A;  3QCW A;  1UZW A;  4AI3 A;  5FMD A;  1QJY 2;  2DFB A;  2GDF A;  2GC0 A;  3LFM A;  4LUK A;  4PQQ A;  3GF6 A;  4ZU5 A;  3DYP A;  4LTA A;  4KQ7 A;  1UZ0 A;  3LA7 A;  4XBL A;  2R30 A;  1SLA A;  1JZ5 A;  1UMZ A;  3AYE A;  2PLV 1;  5HXV A;  1C8M 3;  5FUP A;  4GWN A;  1OUS A;  4WVM B;  1R08 3;  1LOB A;  1FI2 A;  1W3V A;  2AUY A;  3K4D A;  4CXY A;  1LJ7 A;  1RXG A;  3H3Z A;  1K12 A;  4KI5 M;  5JR7 B;  2E31 A;  5APA A;  5FO9 B;  3SXW A;  2WL1 A;  1W8F A;  2JXA A;  1YC6 1;  3U0Z A;  2DV9 A;  2GND A;  4RGG A;  1X50 A;  4XQ4 A;  4QT6 A;  4XF4 A;  5FZK A;  1WLC A;  5A1F A;  4BYY A;  3LE0 A;  5FZD A;  4PLO A;  5DQ0 A;  3B01 A;  4KG0 A;  3RNS A;  3LB9 A;  5F37 A;  3JBG 3;  3DUI A;  1IQA A;  4Y4R A;  5IVE A;  3SH4 A;  5HXM A;  1HQL A;  3HBZ A;  4FXK B;  4LE4 A;  4BLJ A;  4MO3 M;  4XXP A;  1V6M A;  4CCN A;  3RGB A;  5GZD A;  1GZC A;  2LTN A;  3A0N A;  1AL0 G;  1YCI A;  4FPG A;  3ELN A;  5IWF A;  1DU3 D;  5EFU A;  2BNM A;  4DIN B;  3VD4 A;  4XUN A;  4YFZ A;  1UW8 A;  1XNA A;  5CG9 A;  1HW5 A;  2ZCW A;  3KM5 A;  2QQP A;  2OA2 A;  4YAR A;  5C5U A;  4AI0 A;  2WQ8 A;  2G1M A;  3A0K A;  1Z78 A;  3O1S A;  3R4S A;  3O1O A;  3IB3 A;  2V73 A;  3BOD A;  3MFC A;  1Y4W A;  1H8T B;  1NY7 1;  1C3H A;  4Q4Y 3;  3VBU C;  2CY6 A;  2K46 A;  2P6H A;  2I74 A;  3ZIX A;  4Z8B A;  2WZ8 A;  5FXW A;  4PIY A;  1N1S A;  1VBC 1;  3KWV A;  3MUZ 1;  1QH7 A;  1AR7 2;  2W1S A;  3VDC A;  2VME A;  2W39 A;  4DFS A;  3TEX A;  1OQD A;  2PHU A;  1SDD B;  4CU7 A;  1RXF A;  2ZGS A;  3TOJ A;  3NNJ A;  1ULC A;  1GKB A;  1CAX B;  1PO1 2;  2Q8D A;  3O0W A;  4HVO A;  2DCT A;  1DLC A;  3U4X A;  4ORF A;  4RQP C;  5KXC A;  1RIR A;  3I3M A;  4LO7 A;  4DMI A;  4KGQ A;  5FMO S;  4G3Y C;  1K5J A;  4XF1 A;  4Z2W A;  1US3 A;  3ABZ A;  2WA3 A;  2KD7 A;  2WUH A;  1ND3 C;  3ES4 A;  2WAB A;  3Q8F A;  5JZG A;  1BQP A;  4BQ4 A;  4RSU A;  1JYV A;  3V0A B;  3BIE A;  3PNA A;  5L73 A;  1ULE A;  2MEV 3;  3M2M A;  4HVQ A;  5FYC A;  2WSV A;  3CKH A;  3QH6 A;  3ZVX A;  1UL9 A;  4RHV 3;  4D8M A;  4ZZ8 A;  1HXS 3;  3G7D A;  3KGZ A;  3RI9 A;  1JYI A;  1QDO A;  1W9F A;  1JHJ A;  4IV1 C;  1R64 A;  3USS A;  1Z0H A;  3E5X A;  3VBS B;  3VBR C;  3UNP A;  1ZRI A;  3H8R A;  5CBL A;  4A6S A;  1LHW A;  1DGR N;  2ZML A;  3QLQ A;  3K51 A;  2AZ5 A;  1W03 A;  5CKN A;  1CX1 A;  2ARC A;  4AL9 A;  5K8S A;  1CIY A;  1NX9 A;  3I3E A;  1YO8 A;  1IHM A;  3GZA A;  3IBM A;  5CU1 A;  2B7Y A;  3AYC A;  4JZR A;  5EYX A;  5FRE A;  4DXZ A;  1A34 A;  1DDL A;  2VUL A;  4RS5 C;  3WV6 A;  1US2 A;  4GWI A;  4HL0 A;  3WG2 A;  2ZAH A;  2J1V A;  5E89 A;  2ZS6 B;  2ZEY A;  4JCK A;  5FYV A;  1OH4 A;  5IJR A;  4QX0 A;  1FAY A;  1MQT C;  2TNF A;  3BOW A;  3CJI A;  1QJY 3;  2JIG A;  1SDW A;  4SBV A;  2GN3 A;  2OZJ A;  4FP2 A;  4G9S B;  1QDC A;  1AR6 2;  1PO2 2;  1J1L A;  1DQ2 A;  2VUA A;  4MGQ A;  2Q1Z B;  4QDR A;  4XCB A;  1J83 A;  3SQO A;  2WFF 2;  3IPV B;  3NAP A;  4JDO A;  3T2Q A;  1W8W A;  1OLR A;  1XRU A;  2YGM A;  3LFI A;  3R0R A;  4CZS A;  5ACA 1;  3FJS A;  1QJF A;  2XKP A;  4YW1 A;  2HEV F;  2O14 A;  3HQX A;  5DZG A;  4XFC A;  2Q8C A;  4XYX A;  3I2J A;  4YVS C;  3I97 A;  3M1H A;  4MGI E;  5C8C C;  5IVC A;  3PUQ A;  2PQS A;  4IER A;  5AFB A;  5IVY A;  1VBE 2;  4QU1 A;  3W5N A;  2W68 A;  3WOG A;  5JSR A;  4DXT A;  4Y5S A;  1PMI A;  1CQ9 A;  2JDU A;  5JSO A;  3NV2 A;  4I0B A;  5J09 A;  4N7I A;  2JJ6 A;  1CD3 G;  2Z5W A;  4IW3 A;  3ACF A;  1XYN A;  1D0G A;  3KQ4 B;  1S1A A;  2AEN A;  1V6I A;  4WVW A;  1JU4 A;  2CAV A;  4MGY E;  4PDW C;  1W8O A;  4UW4 A;  2WDB A;  1ZBA 2;  3LPG A;  1IS5 A;  2OUJ A;  4NPM A;  2FMY A;  4ARY A;  4BH9 A;  2LM3 A;  2R04 2;  2Y6K A;  5K7P A;  1UF2 C;  2BYV E;  2C6S A;  1DP0 A;  1WUV A;  3D0S A;  2VNG A;  2WYF A;  3OGV A;  2QQJ A;  2D5H A;  1AXY A;  1Q8O A;  2GNT A;  1XU1 A;  2B9V A;  2XUM A;  5FZ8 A;  3VBF A;  2WYS A;  4EWA A;  4N43 C;  1ULP A;  5FPX A;  3GZT B;  1YUD A;  3KF3 A;  1NT0 A;  3IKW A;  3WX5 A;  5A6Q A;  2W87 A;  4K1Z A;  4AZZ A;  4EV0 A;  1G8W A;  2VO5 A;  1HV1 A;  4D0Q A;  3AVS A;  4HPK A;  3TEY A;  5CVR A;  1DZR A;  3VKL A;  4FPO B;  5CYY A;  1RVF 2;  2R06 2;  3ZM8 A;  5FJK A;  1U5X A;  2VXR A;  3BKZ A;  3THC A;  1RMU 1;  1QY4 A;  3MYX A;  1GFF 2;  3N9P A;  2GU9 A;  2VC9 A;  2HWE 2;  5BNP A;  4JGY B;  5F1R A;  2R6Q A;  4IGP A;  1RHI 2;  3WW2 A;  4A3Z A;  3CMG A;  4CA9 A;  1QOO A;  1X36 A;  2VG9 A;  2IFR A;  1K5M B;  4CDX C;  2RS3 1;  1AR7 3;  1KIT A;  5FZL A;  1VBA 1;  2MPF A;  3WHT A;  3D3A A;  5FV3 A;  4PHZ A;  3W59 A;  5BXX A;  2D3R A;  4YWA A;  2XL7 A;  1ASJ 3;  5FZ1 A;  2Q8O A;  2ERF A;  5FMB A;  3LEM A;  1GP5 A;  1RUF 1;  4GMP 0;  3MFA A;  1UO9 A;  2BBV A;  3H1W A;  5ABJ B;  3OPW A;  2Q5T A;  5BUV A;  3ATG A;  5HCH A;  2WIN B;  5D21 A;  2I2S A;  1GZ9 A;  1AXZ A;  4I01 A;  3POF A;  5FY9 A;  5L9B A;  4AED C;  4FOY A;  2WLQ A;  1VJ2 A;  3I3D A;  2ATF A;  5LBC A;  1UYY A;  3MIE A;  4WM7 C;  4A7Y A;  1S2E A;  5A32 A;  3O5S A;  5A6X A;  4JDN A;  2RR1 2;  1JN2 P;  3U11 A;  4YW2 A;  4N90 A;  5FZ3 A;  3M70 A;  3E6D A;  1CZT A;  3B3Q E;  1JMU B;  3KS7 A;  5GZE A;  2ET7 A;  4Q4V 2;  1JUH A;  3Q8C A;  2DUQ A;  5T54 A;  1A8D A;  3DGT A;  1HRV 1;  5JOY A;  2YC2 A;  1TMF 1;  4OFG A;  4NUB A;  5FP3 A;  2ADD A;  2JG9 A;  5JMC A;  3M8L A;  4MYE A;  3AYA A;  1FV3 A;  4L9B A;  3VN4 A;  4D7T A;  4ES9 A;  1ZRE A;  4XZU G;  2A3Y A;  2Q8E A;  3MF9 A;  5LAS A;  2G4I A;  1SLC A;  2VMI A;  5IK5 A;  1TEI A;  3NVC A;  4CCK A;  1B35 B;  3SKJ E;  1TZO A;  5FY7 A;  3NQH A;  1UYP A;  2DBN A;  4Y1V A;  1QQP 1;  4B4P A;  1AX1 A;  4Q0P A;  1DBN A;  1YRZ A;  3EQE A;  5LA1 A;  5F3C A;  1AR6 3;  5FY4 A;  1O5L A;  3S30 A;  3T1M A;  3THP A;  4K40 A;  4B7K A;  5CEH A;  1BEV 2;  4YG0 A;  3LPF A;  2WFF 3;  2AGS A;  3RWK X;  4IV3 A;  4ZXE A;  4E8C A;  2HWB 2;  3V65 A;  3RDI A;  2MNG A;  1JU3 A;  3VKF C;  5K0U B;  3RZJ A;  2WNU A;  4CDU B;  4LIV A;  5F6L B;  1W9Y A;  4IDZ A;  5DG1 A;  2HWD 1;  4ZS2 A;  4YGE A;  2VOV A;  2L9L A;  3FHA A;  5FPV A;  4CP2 A;  1RUJ 1;  1KFX L;  1VBE 3;  4P9I A;  4YLZ A;  2AC1 A;  2FDJ A;  5A7W A;  2XJP A;  3FHI B;  4QDQ A;  3DKQ A;  3CU7 A;  1VAL A;  4R9B A;  2V4A A;  3CO2 A;  4CEY A;  3POE A;  4RD7 A;  5FZ6 A;  1GU3 A;  4GAL A;  1QJZ A;  3LDR A;  2UY9 A;  1N3Q A;  1UOF A;  1ZRF A;  4Q29 A;  5DZE A;  4H7M A;  1RTV A;  2YDE A;  1ZBA 3;  2B9U A;  3M3Q A;  3I2G A;  2WO2 A;  2R04 3;  4PBO A;  4QQ2 A;  4M4P A;  5JZG B;  1W9S A;  3LEK A;  5DG2 A;  3ZSM A;  1UXZ A;  3DN7 A;  4CCM A;  5IFP A;  3UKN A;  3ACI A;  4U2A A;  4NHM A;  1PO2 1;  1EY2 A;  1GIC A;  1LOG A;  2E32 A;  2XOM A;  3RZZ A;  4Q27 A;  1FOD 1;  4LBM A;  1GQG A;  4E2Q A;  4Q0S A;  4QQP A;  1MS3 A;  3N7M A;  4LOT A;  1PMJ X;  4PBP A;  5FJH A;  3H50 A;  1D0H A;  4JKL A;  4QXH A;  4S2F A;  3J26 N;  3V64 A;  4BA6 A;  4IE6 A;  1LGB A;  2K0G A;  4HN0 A;  3S57 A;  4D7Y A;  1NCQ B;  2BUK A;  2R06 3;  2OYZ A;  1LEN A;  1F9K A;  1QEX A;  2GME A;  3GCW A;  2YV8 A;  2DBI A;  4XIO A;  5FLH A;  1QWR A;  1G9D A;  5GZC A;  1E5S A;  1U0A A;  2YHJ A;  1ZZC A;  4QPG A;  4XFA A;  3UT0 A;  4E9K A;  2VZ3 A;  4TWT A;  1WMF A;  2CDO A;  3DPR C;  5LA9 A;  2RS1 2;  1OT5 A;  4UF0 B;  3TEW A;  3OGG A;  3M3E A;  4RL7 A;  2J7M A;  1DQ4 A;  2CWM A;  1QMJ A;  3THT A;  1L3J A;  3JB8 A;  2J1A A;  5CIS A;  2ZHL A;  2D43 A;  2BU9 A;  1F4H A;  2VMD A;  3CJI B;  4NR1 A;  2JG8 C;  4ZPI A;  1WA4 A;  5DZF A;  1CVN A;  4LO8 A;  3SCF A;  4FPL A;  4XFF A;  2ARX A;  3T1L A;  5F6K A;  4AEK A;  2PN5 A;  3HD8 B;  1WLT A;  3BI3 A;  3WP5 A;  2YBS A;  3OOX A;  3URF A;  4QXB A;  1GQH A;  5T3N A;  5FUI A;  4DB5 A;  3LA3 A;  5FZO A;  3ZR6 A;  5FO8 B;  5KR7 A;  5FK8 A;  3IZO A;  4UYB A;  5FOJ B;  2NM1 A;  2OII A;  4IEP A;  4LLF A;  3CL1 A;  2BBA A;  1W6P A;  4IEW A;  2D3S A;  2DWR A;  1RVF 1;  2QQM A;  4W50 A;  5T55 A;  3WEZ A;  4P02 B;  1W2N A;  2YFZ A;  3NWK A;  4GKX A;  2RR1 3;  4BZ4 A;  3WP6 A;  3KMH A;  3KV5 A;  3O1V A;  3OYW B;  1LOD A;  2G9F A;  4Q4V 3;  4UAP A;  1CAW B;  2WJS A;  1FV2 A;  1WCU A;  4JKK A;  3OGR A;  1W2O A;  4ASL A;  3Q8E A;  1SEF A;  1PHM A;  2ZAC A;  3J9S A;  4BB3 A;  1UOJ A;  4FFG A;  4LK6 A;  1VAV A;  1I6X A;  2JEM A;  3E6B A;  2GAL A;  5LY1 A;  2FDI A;  4CCJ A;  3OEA A;  1KRI A;  3MIF A;  3U1X A;  1MS9 A;  1FPN 2;  3JQX A;  3VD7 A;  4EN7 B;  1F15 A;  1Q8V A;  5E16 A;  1ZZ7 A;  3WNN A;  3DV8 A;  4PJY A;  2WZP P;  3VBF B;  1O3T A;  1ULG A;  2VUD A;  1RUE 2;  3PUS A;  1RUH 1;  5T5O A;  2QZ3 A;  5DUU A;  4MOA A;  2G9G A;  4LMF A;  5CFC C;  3HT1 A;  3CBN A;  1JOJ A;  1RGS A;  3MIB A;  2A70 A;  4Y5T A;  4IE4 A;  4Q26 A;  3AKR A;  4W8J A;  1GAN A;  2HWB 3;  1V6L A;  2JE7 A;  3H0O A;  2VZ1 A;  1BXH A;  4ASM B;  4GB3 1;  5BNP B;  2RJK A;  3MZH A;  4QU2 A;  1VP6 A;  2TEP A;  3VL9 A;  2EIG A;  4GIQ A;  3IAP A;  3VZL A;  3C7O A;  1BVP 1;  4BJ0 A;  1UY4 A;  1W6N B;  2BEO A;  5HCB A;  1W05 A;  2VE1 A;  3UGF A;  3VBH C;  4JX0 A;  4FPY A;  5KHH A;  1UMH A;  4Y1U A;  5I0R A;  4RGK A;  2VZQ A;  2OQ7 A;  1YQ5 A;  3PUH A;  3C7G A;  4QX7 A;  1YQ8 A;  5FTT C;  1O59 A;  1R09 2;  1YIP A;  3WD5 A;  3WQ1 A;  1GNY A;  5FY5 A;  3NJV A;  4FQ4 A;  1IZ3 A;  5GZG A;  1W90 A;  1MS1 A;  2X5I A;  2DU0 A;  1IOA A;  1PM7 A;  4QB1 A;  5IVV A;  5JXI A;  2FD8 A;  2CWS A;  2J1E A;  3VUO A;  3W58 A;  4LKS A;  1N47 A;  2RDR A;  3D82 A;  4NJ4 A;  4NHY A;  4XF0 A;  3ZOI A;  2GMP A;  3SH5 A;  1DGW X;  1HB1 A;  1SFP A;  2QUO A;  2VY0 A;  4YM3 A;  5LA0 A;  2BPA 2;  4QX8 A;  2VAU A;  1QXP A;  1P8J A;  2QJV A;  2VTX A;  2EAA A;  2VZT A;  2OXB A;  4GMP 1;  5C4W B;  2XBO 1;  5A32 B;  1VAM A;  4ONU A;  1YEW A;  2HYK A;  4EZH A;  3BYW A;  2IFW A;  2TBV A;  1OVS A;  2Y6F A;  3BPZ A;  4FO9 A;  2W9X A;  1PK6 A;  3SEP A;  4H2A A;  2C26 A;  5D8A C;  3OBZ A;  4FBF A;  2ZGR A;  2YG0 A;  1RL3 A;  4P9W A;  3I2H A;  1LOE A;  2IXH A;  2JG9 B;  4MET A;  3J4U H;  1I1E A;  4QDS A;  1YJK A;  5LK5 A;  3ZDS A;  3C2U A;  1I9R A;  1C4R A;  4AQT A;  4KL1 A;  4P9Y A;  1B09 A;  4GD4 A;  3U75 A;  4QQH A;  4IEY A;  3ON7 A;  3FHQ A;  4NAO A;  4CXW A;  5LW9 A;  2I45 A;  1QNY A;  4P14 A;  1MR5 A;  2H0V A;  4W4Z A;  5EJ1 B;  4C0H A;  4C91 A;  4LHS A;  3DKW A;  2FCV A;  2VMF A;  3FMG A;  1R08 2;  3ZYF A;  1C5H A;  1NE6 A;  3ZFF C;  3FUQ A;  4NIA A;  3LCP A;  1W04 A;  4RYD A;  4ARX A;  3CF6 E;  2WT2 A;  1Q3E A;  1TQ5 A;  3WDW A;  2TUN A;  1EV1 3;  2W5F A;  2XWB B;  1C57 A;  2OPW A;  5C71 A;  5FZ9 A;  2WNU B;  4LXL A;  1NCR A;  2X10 A;  4JTO A;  4CRQ A;  1BBT 3;  1Q8S A;  1YI9 A;  3HVD A;  4XW3 A;  3O1M A;  1VBD 2;  4CP0 A;  3LD8 A;  1W6M B;  1ZYB A;  5FY0 A;  1JZ7 A;  3VBS A;  3L9J T;  5A7W B;  3LA2 A;  4I3P A;  2Q1M A;  3EO6 A;  3TB0 A;  3NNG A;  2ZX2 A;  3Q8B A;  1PGW 1;  4KWU A;  5FXV A;  3LKJ A;  3ZYG A;  2VQU A;  1W99 A;  5DPN A;  3KQR A;  3U78 A;  5C3P A;  3DXT A;  4U36 A;  4FTE A;  4ES8 A;  2QKD A;  3KCX A;  2G19 A;  4FVV A;  4M01 A;  4Y3O A;  1GOG A;  3FLR A;  1GZT A;  1OA3 A;  2W94 A;  1RJ8 A;  4HON A;  1AX0 A;  5GJ6 A;  2RMU 3;  4XJ9 A;  5DDJ 1;  3IMM A;  3IIA A;  4K1Y A;  4MGZ E;  4N9I A;  1DYP A;  1EPZ A;  3WCS A;  5A80 A;  4UFI A;  4BIO A;  3ZFE A;  1OI6 A;  4Y22 A;  1ULF A;  4XFH A;  1ZRR A;  1GSL A;  2J1U A;  5FY1 A;  3T08 A;  1MS4 A;  1W0O A;  3ZXD A;  2E7T A;  5J1X A;  4V2W A;  1RUE 3;  5EJ3 A;  2DDU A;  3I54 A;  3GBW A;  5A33 A;  4ERO A;  5B2G B;  3LWC A;  4WVV A;  1VRH 2;  3AYD A;  2Y34 A;  2R1D A;  4URA A;  2PXJ A;  1XSQ A;  4CEW A;  1DQ0 A;  5AC9 1;  3MO4 A;  3HMY A;  3OD0 A;  3H1Y A;  3ILN A;  2OW4 A;  2WT0 A;  4FCA A;  3T2P A;  5C3S A;  2FZ1 A;  3ETP A;  3III A;  4Q4X 1;  4QPG B;  2BGP A;  3ZO0 B;  3RWN A;  5CNA A;  4GUL A;  4CPB D;  1EAH 1;  3M4F A;  1HLC A;  1MPX A;  2VNV A;  1AX2 A;  4M3C A;  4LUM A;  1AL2 2;  2VL4 A;  5FIX A;  2DTW A;  4AOC A;  1EUU A;  1R09 3;  5CKQ A;  4OHY A;  4CDQ A;  3ETQ A;  2W95 A;  5LA2 A;  2Z79 A;  4FOV A;  3JD7 1;  1GMM A;  5FYB A;  1ZBE 1;  2VBP A;  1FPN 1;  3C7E A;  3BVC A;  3LEG A;  1ACC A;  3AKP A;  3GBF A;  5A3P A;  5FKC A;  3I8T A;  1NZC A;  3T4V A;  1HXS 2;  5FAX A;  1NUK A;  3GYD A;  3LIG A;  5L7O B;  5FZO B;  3WW4 A;  3ALQ A;  3FZ3 A;  4AI9 A;  4A7Z A;  1ND2 B;  2A6W A;  1AR9 1;  3HNM A;  3EBR A;  1H8V A;  3OY8 B;  2D6N A;  2FMD A;  1DFQ A;  1RUD 3;  3INA A;  2X09 A;  3ZXJ A;  1J58 A;  1W6P B;  1MEC 1;  1WGP A;  3MDP A;  4Q4W 1;  4S2G A;  3UJQ A;  4ZON A;  4EZ4 A;  3H9A A;  3KZ4 C;  4FAH A;  4HLT A;  1KD7 A;  2LS6 A;  3J8F 2;  1MS5 A;  4QPW A;  1DGW A;  4JGZ A;  1QJX 1;  5FYY A;  1IPJ A; 
#chains in the Genus database with same CATH homology
 1E5H A;  1HJF A;  1W3X A;  1ODN A;  1W04 A;  1W28 A;  2VBD A;  3ZKY A;  1QJF A;  1HB4 A;  1W2N A;  2DBN A;  1WA6 X;  1UOG A;  1W2O A;  4BB3 A;  2VCM A;  3ZKU A;  2IVI B;  2WO7 A;  1E5I A;  1ODM A;  1W2A X;  5C3P A;  1UNB A;  1W9Y A;  5C3Q A;  1OC1 A;  1GP4 A;  2BRT A;  1UOF A;  2CSG A;  1HJG A;  1W05 A;  2VE1 A;  1RXF A;  4RGK A;  1HB3 A;  1W06 A;  2JB4 A;  1BK0 A;  5C3S A;  1HB2 A;  2JB8 A;  2BJS A;  3ZOI A;  1DCS A;  1OBN A;  1HB1 A;  2DBI A;  5C3R A;  1IPS A;  2VBB A;  2VAU A;  1E5S A;  1GP5 A;  1GP6 A;  1UO9 A;  2VBP A;  2Y6F A;  1UOB A;  1QJE A;  1UZW A;  1QIQ A;  4XAE A;  2BU9 A;  1W03 A;  1BLZ A;  5C3O A;  3OOX A;  2IVJ A;  1W3V A;  1E5R A;  1RXG A;  2Y60 A;  5APA A;  3ON7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...