1RXFA

Deacetoxycephalosporin c synthase complexed with fe(ii)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
307
structure length
264
Chain Sequence
DTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDLVIDFFEHGSEAEKRAVTSPVPTMRRGFTGSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFMAPHYDLSMVTLIQQTPCAGFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAAPRTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHASE
publication title Structure of a cephalosporin synthase.
pubmed doi rcsb
source organism Streptomyces clavuligerus
total genus 82
structure length 264
sequence length 307
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1rxfA00
2VBBA 3ZKUA 1W03A 2CSGA 1W9YA 5C3OA 1E5IA 1UOBA 1W04A 2BU9A 1W2OA 1OBNA 1W2AX 1DCSA 1W28A 1GP6A 1W06A 2IVIB 1RXGA 1W3VA 5APAA 5C3QA 1RXFA 1OC1A 1E5RA 1HB4A 2VE1A 2Y6FA 3ZOIA 1HJGA 4XAEA 1GP5A 2DBIA 1W3XA 1W2NA 5C3PA 1QJEA 1UOFA 2IVJA 1HB1A 1E5HA 1UO9A 2JB4A 2VCMA 2VBDA 1UZWA 5C3SA 2VAUA 2BJSA 5C3RA 3ON7A 1QJFA 1UOGA 2WO7A 1BK0A 1W05A 1QIQA 1HB2A 2VBPA 1HB3A 3ZKYA 1HJFA 1UNBA 1IPSA 1GP4A 2BRTA 1ODMA 1E5SA 1ODNA 1WA6X 2Y60A 2JB8A 4RGKA 1BLZA 2DBNA 4BB3A 3OOXA
chains in the Genus database with same CATH superfamily
2HJIA 2O8QA 2XOMA 3T09A 1UX6A 2UY8A 3FLPA 3KF3A 3POJA 1HKDA 2JG9B 2JKBA 5FY9A 2VMGA 2NZ9A 4IERA 5JUVA 2UWBA 4WM8A 4EWAA 5CA6A 3WDWA 3KHBA 3SH5A 2Q1ZB 4D6QA 4LBJA 4QXKA 1W99A 1V9U1 1WLDA 2B7YA 3SH4A 1RGSA 2XJRA 2W68A 4JC1A 1H2KA 3S5AA 1UYZA 3IAPA 4J25A 2AC1A 2VUJA 1AUYA 3OUHA 4GD4A 4MZUA 1DYPA 2ZX3A 3SH3A 3VV1A 1UY0A 4TTGA 1DCSA 1NCQB 1UZZA 3R6SA 1EP0A 1YWKA 1SCRA 5FWEA 4AI9A 4D94A 1APNA 2BOIA 3ES4A 3IMNA 3JD72 3SKVA 1AXZA 1YJKA 3EHKA 1LODA 1QOOA 5H9SA 3CBNA 1HRV2 2R49A 1FV2A 3MDPA 4Y24A 4ZONA 3M70A 1COV3 1DU3D 1AYM2 1VBD1 2ZX2A 3KCXA 4FOVA 3U11A 5HCHA 4IV1C 1XSRA 3N35A 4GJYA 5L7OC 4QGNA 1H9PA 1GWLA 3H1MA 2HWF2 3GHNA 4BCUA 1CAVA 2G9GA 2VZ3A 3HOBA 2SBAA 2VMIA 1X50A 4QKBA 4ZPIA 5LY1A 3ZFEB 5K9YA 3I2IA 2QTWB 3Q8CA 4HONA 3OD4A 4CDUB 5IVCA 4P9IA 4BDVB 3I97A 3PHMA 4WBBA 1R081 3T2OA 4FP2A 3TWIA 1TMF1 1EAH3 2DBIA 1KS4A 4P9XA 4FAGA 1GNZA 3BUCA 5FO7B 2I07B 1IS6A 1ULPA 2JG8A 1SLLA 2DTWA 3MHZA 5IAXA 4AFDA 1QXJA 4M01A 3HPNA 2JDZA 4NROA 3H7YA 3I2FA 2UU8A 5A32B 4FOQA 5ABJA 5C3PA 4KNCA 2VVFA 4GB33 4NR1A 1QJEA 1W2UA 1SLIA 4Q8KA 5A6YA 4YSFA 1LKNA 5FQ0A 4YGEA 2IVJA 5T52A 4UT5A 4ZU5A 1AYN1 3D6EA 5FWJA 3OPTA 3QOPA 5D8AA 2IWGB 4ISQA 4NAOA 3QH6A 1OMIA 4QT6A 1UYYA 2IXLA 1ZZ7A 3ZXGA 1JYCA 1O5UA 2CDOA 2G19A 4OMCA 3Q8BA 2HWE3 1ENRA 4Q0UA 3WP3A 3L9JT 1AL22 1CAUA 1DGLA 4CP9A 1Q5OA 4MGIE 4CE8A 1QQP2 3ABZA 5FJHA 1H1IA 1UOGA 1ZBE3 4Q26A 4QPIC 4YG0A 2P2KA 1IKQA 3JQWA 3I3QA 3WNPA 4YNIA 3ZX7A 5BUVA 1PVC3 1FATA 1SFNA 3DYOA 2P17A 3IN9A 4FAHA 4BISA 3VBRB 2WS93 3NWKA 4MXWB 5KXCA 1FPN1 1IZ3A 3VLBB 1UNBA 1W9FA 2JD9A 2KM2A 2RS52 4E2QA 4CP0A 1XNTA 5BNNB 2FCTA 4H3WA 1PO11 1VB4A 4LO8A 3UKNA 1VRH1 4W50A 1YFXA 4KWLA 2P3IA 3EB7A 1POV1 3MFCA 2Y60A 3DXTA 2RS32 4O65A 1DYKA 2XVGA 1GQGA 1C3HA 4Q2FA 1N1SA 5T50A 1UIJA 1XE0A 5FPVA 3GALA 4I01A 1K5JA 3KM5A 1ND3B 2XHKA 4QPGA 4XF0A 2ZGNA 3PVEA 1W6QB 1SDDB 4K20A 3IM0A 2ATFA 2J22A 3ZSKA 4AHZA 4E4ZA 1R64A 4A7KA 3ENRA 2AEYA 3ACLA 2VO5A 4N8MA 1PO21 1DQ6A 4XDOA 3ZXKA 4RQPB 1US3A 3PVBB 3ILFA 3PL0A 4NRPA 2EA7A 4WM7B 4GKXA 5FYUA 5FZ8A 2DCJA 1JBCA 1RMU2 3D5OA 3CIHA 2ZMNA 3PMEA 4P08A 4XJ8A 3B5LB 1OLRA 2EXIA 4URAA 2QCSB 2X29A 3PUQA 3VDCA 2WAOA 4HANA 3ZFGA 2W5FA 1W3VA 3LF7A 5APAA 3UKVA 2WN2A 2VM9A 4DUVA 1LULA 2QQKA 4B29A 2XJVA 3WD5A 3EQEA 4EN7B 2UURA 1UXZA 5IVVA 2DTYA 4SBVA 2A3XA 4OUSA 1E5RA 1XYNA 2JDUA 4H2AA 2HWB2 4P00B 3WDXA 4Q4Y1 1W0OA 5T54A 1VALA 1U12A 1OA3A 4CXXA 3TEXA 3IDAA 2ZJCA 3K77A 3NKGA 1I5PA 1ZRRA 4AGRA 5A80A 2J1SA 1QF3A 1RUH2 1Q8SA 1W3XA 3Q9OA 4BQXA 4FI9A 4RHV2 1JODA 1B35A 2VNRA 5G05L 4QKFA 1HQNA 3VD7A 2HWC3 3ZR6A 1FV3A 4A6OA 5C9AC 4H7LA 5EXOA 4XE9A 3GJAA 1RUE2 3ZN6A 1XNAA 3MPBA 3W58A 1WCSA 2RMU1 2HBTA 1W6MA 3K46A 5H9QA 2D93A 3T0BA 3IIAA 3LKJA 5CFDB 4JGYB 3OF1A 3ATGA 4QX5A 3HN1A 4HXCA 4HN0A 3ZDSA 2ZEWA 4RFRB 4CCLA 1D4M1 2JXAA 5FUPA 2G1MA 4ZS2A 2QVSB 4P5HA 4P02B 1NZCA 3ZXLA 3I2JA 3J26N 2WLPA 5C3SA 2V4AA 1KQRA 4EJRA 2VOVA 2P3KA 4HN1A 3HIFA 2WUHA 4OHWA 4YGCA 2JDMA 2WNVC 1ULCA 4HK9A 2Y38A 3B93A 1W6NA 5CB7A 2OPWA 3N36A 1XSQA 2A75A 1W05A 4Y3OA 4Y5SA 5CKQA 3GZAA 3UGHA 4IEWA 2LTNA 1WW5A 2RR13 4LK7A 2JE9A 2QDRA 4R4ZA 4CU7A 2WO1A 3K48A 4YM2A 3FMGA 5J09A 2D6LX 1CAWA 1F4AA 1NLSA 3KB5A 1JU4A 4J1XA 1PX4A 3VD9A 3K4DA 5JR2A 3FHAA 2FBEA 3BYWA 1PK6A 3GM8A 3N7MA 4LJHA 3W5MA 1DDLA 2B46X 1JZ8A 4XFAA 3CJIB 1J3QA 5AC93 1OH3A 5DN2A 1YNAA 2E6VA 1VBE2 2WNUC 3OOXA 4LQRA 2BOJA 4XQWA 5I0RA 4KQ7A 3MIFA 5LBFA 4LIVA 4NHLA 2A7AA 3RYKA 2PYTA 1ZZCA 2OW4A 4KI5M 4CDXA 4ATFA 4FTBA 1KFUL 1LU1A 1DZTA 1EUUA 3ITQA 1JMUB 5FOBB 1YYNA 2NP0A 3O1OA 4KGGA 3N9QA 1QNWA 2WIIB 1AZDA 4C0HA 4E2GA 2QQNA 4FFGA 3O1UA 3AP5A 2PAMA 1W2AX 1R092 2D5HA 1PGW1 5IVEA 2Q5TA 2Y26A 4QQHA 4ASLA 1ZM1A 2JWPA 4CP1A 4MG2A 1ND2C 4HPKA 2G9ZA 4ZY9A 1W06A 2TBVA 3LSEA 5JI9A 4INDA 4OUEA 1SQ4A 4LITA 4YFWA 1XXNA 2V4VA 3ZPYA 2H6BA 1YUDA 4JQRA 2Y0OA 4FTEA 4RD7A 4QQPA 5JI7A 3VKOA 4QB1A 4RSUA 3WNNA 3K3NA 4KBBA 5A33B 1W2TA 3EO6A 2C24A 5CVRA 1I1EA 5AFBA 4XZPA 3HR9A 3DUIA 2RDNA 2XH6A 1Y9GA 2V72A 5LA0A 1SDWA 1Y4WA 2A3WA 4FPOB 1SACA 3E5UA 4RA0A 3UT0A 2BWAA 3VB9A 3IIIA 4FPJA 4WV8A 2WDBA 1DFQA 4NMIA 5C8CC 2YB7A 4JVAA 4L9BA 4CUCA 2E53A 2CU5A 1RL3A 4OHXA 1JYIA 3HWJA 1D0GA 2G9FA 4NIGA 2OS2A 2XJUA 4CDQA 1YQCA 3TNPB 2J1TA 1BQPA 1YEWA 4HOOA 3KCYA 4HLTA 3UESA 1LENA 4AG4A 2YPJA 4LPLA 4DUXA 3URFA 2NM1A 3VDDC 1H4GA 1SLBA 2JENA 3NRUA 3T08A 1KITA 5LEKA 3DPRC 4CPBA 2WQ4A 5BNOC 1V9U3 2DFBA 1COV2 3J7HA 1VMHA 4E27A 1UY4A 4JGZA 3CEWA 4DXZA 3UKTA 2XLFA 1JUIA 2DCZA 1Q8PA 2ET7A 4N53A 5JLVA 1BEV1 3K2OA 5KC6A 2WNOA 3H7JA 3LSDA 4J1WA 5FY1A 4LHKA 1CWPA 2J1UA 4JTOA 2YC4A 3HJRA 5JXIA 3DKQA 2ZMLA 2GC1A 4RR3C 1ND3A 2D97A 2YU1A 1IG0A 2ZGLA 3KGLA 3OY8B 4PDWA 5BNPC 2WZR3 1EAH2 1GU3A 3AZWA 3BOWA 3QH7A 5DAWA 5E16A 5LZ6A 4C91A 4Y5TA 3C7EA 5FZDA 1MS5A 1VBD3 4LBQB 2E7AA 5EP9A 3WW1A 2I45A 3D82A 5M0TA 1C1LA 3CKHA 2BRTA 5FK7A 5IK5A 2NLRA 2J1RA 4GB32 4KG0A 1AX0A 5KC5A 1AR61 1KDKA 2J1EA 1BYHA 2OVUA 1R083 1K5MC 1BBT3 1RHI1 1TMF3 3ACHA 1VBA1 1MEC1 4OZOA 4TN7A 1DG6A 4UW5A 2ZGSA 1W04A 4LO6B 1GMMA 1LHVA 2B45X 2YBSA 3B69A 5FPXA 2HWE2 2WLQA 1KXGA 2CNAA 2RS13 2OKXA 1PZ9A 4ZKTB 1HRV3 1T2XA 2WO2A 2Z2SB 1W2OA 4YGDA 4AE2A 1LU2A 2L9LA 2VZTA 3HNMA 4PJYA 4PLNA 4V2WA 3KV6A 5EJZB 3NAPB 2E7QA 2OYZA 1JYWA 1UD1A 1IOAA 1ZBE2 2R061 3VL8A 4PIZA 4IE7A 4V1PA 2VL4A 1PVC2 3PTRB 1AYN3 2XWJB 4BJ0A 3PVNA 2WS92 1F15A 2GDFA 2Y33A 2H6CA 5K8SA 2OIIA 4UXAA 1QY4A 1RXGA 1NCRA 2VQUA 3CJXA 4AQ2A 4FPCA 3ZYHA 4QX3A 1L3JA 3AXEA 4LOTA 4B1MA 2BBVA 2D98A 1H8TA 4GULA 4CEWA 4DEVA 3NNJA 2VMEA 4B4PA 3AZXA 1Z7S1 2ENRA 1LOGA 5IAVA 5B4XA 3I2OA 1ENSA 5FZ3A 1O3SA 3TAYA 1OD3A 1DLLA 3NV4A 2ETEA 2WQZC 3AZYA 4XHXA 3AL6A 3FFZA 2A3YA 5CFDA 1FPN3 1LGNA 3KSCA 1CIWA 1US2A 2V09A 2IXKA 1H30A 3ACGA 3LB9A 2ORZA 3R0RA 5CFCC 1J1LA 2XB6C 4WM8B 4QDQA 4IE0A 1PO13 1RUF2 1LOEA 1FAYA 4NE9A 4NPMA 3N7LA 2ZGUA 3L2HA 4TYSA 2QQLA 5KXEA 4AK3A 3NL1A 5J7MA 2B9VA 2PXJA 3U10A 2CV6A 2QZ2A 1I3HA 2XUEA 3H50A 4XJAA 3I3BA 1VBC1 4XZUG 5HPOA 3P1IA 2Q4SA 1AR72 1XBFA 2VCCA 2PFWA 3UJQA 2ZGRA 1EV12 3WDUA 4QPYA 3GZTB 4MGYE 4Y5Z0 1MR5A 4QXBA 5F7UA 5IVFA 2W1QA 1PO23 2ZAAA 4QWNA 4YZ3A 1EY2A 2LRPA 2RS53 3WNLA 3UK9A 1OXCA 1QXRA 5LBEA 2WWSA 2JG9C 3EBRA 4LBNA 4MHRA 1CAVB 3KD4A 4LULA 4MGQA 3RG0A 5L9BA 3KGZA 2ZX4A 4XIKA 3WQ1A 4GWNA 3AYCA 1L7QA 1K3IA 4H14A 1LECA 2A6WA 3IMMA 4IV1A 4B1LA 5F9TA 1IQDC 4XC9A 2QQVA 4P9LA 4S2FA 4BWOA 1SHWB 1T6GC 5L7OA 3OYWA 2VMHA 4GZ9A 4JRAA 3OEAA 4K7JA 4XFIA 1PMIA 4BXSV 1XU1A 1XNKA 1QHDA 4XUNA 2LW8A 4X6RB 5L73A 3H3UA 2HWC2 2JG8B 4F83A 3VBFA 1Q43A 5CG9A 1NCQC 3IKWA 4RFT0 5DDJ3 2JB8A 2ARCA 1C8NA 2R1BA 3DECA 4R4XA 4RGKA 2TEPA 3J7MA 4CA9A 5ABJB 1OVPA 3FUQA 1DIWA 1QJU1 4Q4Y3 3ZKUA 4BM8A 1R1ZA 2VZPA 4O9GA 4PF1A 1W9YA 3ETPA 2WL1A 4Q4V1 4L8QA 2XJSA 3EYPA 3OUJA 5FQ0B 1DBNA 1RMU3 5DZGA 1XNDA 4IETA 4UW6A 5FTTC 1I9RA 5C71A 5L9RA 3W59A 2VQTA 4XYXA 1O91A 3E5XA 5D8AB 1YQ5A 1U5XA 2ZHKA 3O0WA 4XW3A 4QX8A 3E1F1 1W8ZA 2Q30A 1W8HA 3OJBA 3ZFEC 1NAEA 1PZ8A 1ULGA 2ZX1A 3IWZA 4HMZA 4YW2A 4XFCA 5KXDA 1DF0A 1CAUB 1WKYA 4CP9B 2HBUA 1X8EA 2Y0IA 4NHMA 5FYSA 2AACA 4MOAA 1AHSA 1GP6A 1XJAA 5BNQA 3R4UA 4JTNA 4CXWA 4PIYA 4YYOA 2QKDA 4IEPA 4CVUA 4LIUA 3TEYA 3NNGA 1Y43B 3MW2A 1D4M3 1RUC1 2GP5A 3WW2A 3ZXDA 1JZ7A 4BLIA 3QBQA 5C3QA 4LHSA 2IXJA 2XONA 4Q1RA 4QPIA 1QJX1 3AKPA 1RC6A 2D40A 4X6QB 4BOWA 4YW6A 4M3CA 2YDEA 4IEOA 4NUBA 2JDAA 5FYMA 5LASA 5AC92 5J96B 2EIBA 1LHNA 3I3MA 4E8CA 4Z2WA 2Y6FA 1ZYBA 2ZHNA 3PURA 1HJGA 2O0OA 2WWUA 5T5OA 1Z78A 4PLOA 3IAQA 1V6JA 3OGSA 3PUSA 4YVSC 4QPGB 1PGL2 1R1A2 2ADEA 3GDBA 4LHNA 3T2TA 4LORA 1DZRA 4CEYC 1HXS2 3JUUA 4QDSA 2ORXA 5HXMA 1WLWA 1CZVA 2BFUL 1YQ8A 5JZGC 5JIAA 3HT1A 1O5LA 1GOFA 3AFGA 1H4HA 1UU4A 2DCTA 1IQAA 2HYKA 4L0PA 5I8SA 2D3RA 1QOSA 3I2HA 3HNYM 4HKLA 1N3PA 2YXSA 4LUMA 1XPWA 2DWRA 1C8M1 1KDMA 2Y6LA 2IC1A 3AP4A 3WF2A 1E5HA 1S2EA 5EZWA 4BYYA 5CISA 1WCKA 4O61A 3ZFGB 2VCMA 1BK1A 4LBQA 4WVZA 2J7MA 5FPBA 4NN0A 4MLOA 4XXPA 1RJ8A 2QJVA 1G9BA 2YYOA 3ZSEA 1QKQA 5C3RA 4AQTA 2NPIA 3NV2A 3SQOA 1Q8QA 1OPMA 4D0QA 2WO7A 5DUXA 5K7PA 3ZMOA 4K21A 4HT1T 2ZGQA 4ISRA 4BIFA 4TZDA 1A34A 5LB6A 4A7ZA 4B8EA 3CLPA 3NNFA 2DURA 5BYNA 4NAMA 2ILMA 1NE6A 4CU6A 1LOFC 1U5YA 4RS5A 3VZOA 1UMHA 2FDFA 3RFRA 2NMNA 1B35B 1BZWA 1WA6X 1KD7A 4W8JA 4E9KA 1X8MA 5SV8A 3LGRA 3SCHA 2RJLA 4LBKA 3FLRA 2PN5A 4XF1A 2CSGA 1A8MA 1OPOA 1R093 3ZN6B 1RUD1 4CU8A 2EAKA 1W6MB 5FZCA 3WG1A 5C3OA 3P6BA 3PJQA 5GLUA 1OT5A 1STMA 3O12A 1V9U2 4CP2A 2RDQA 3SHRA 3WHTA 1J83A 4U2AA 2OZJA 4M3CE 2VW0A 4PI0A 2W1SA 4XTPA 4EZHA 1DZQA 2EXHA 3T30A 3RGBA 4A42A 1MACA 3KV9A 3VBOA 4JKKA 1UKGA 4QAWA 4D8MA 4KU8A 2E32A 4EE2A 1NY71 4Q1PA 1W6NB 2A6ZA 1IG3A 5FBJA 5A1LA 1O3TA 1AVBA 2RV9A 3POYA 2WZR2 2VUDA 2J1AA 5C70A 2BGPA 5DZFA 1MZFA 5A3MA 3VBUB 4AQ6A 1VBD2 5FMOL 4DUWA 1CAWB 4IV3C 1W0NA 1BEV3 3H8UA 4QKNA 1FYUA 1PK6B 2VC9A 4YM3A 2X10A 3WUCA 4AEMA 2DDUA 4OVEA 4W6WA 2YMZA 1OFSA 2PQSA 2IUWA 5A3NA 2QQMA 1HV0A 1R082 2JKXA 1BBT2 1TMF2 4FT8A 4XJZA 4GALA 2XVKA 3WOGA 3F95A 2FMDA 5I91A 1KFXL 4UOJA 1FOD1 3ETQA 2ZAHA 1UKRA 2XBO3 3MEPA 2WYFA 3MFAA 1OQ1A 2VNVA 4IGOA 5KBFA 2RS12 1SBEA 3VBSC 1W8WA 4PT6A 3ZYIB 5BV6A 1LRHA 2PLV1 5FZLA 4BQYA 3POWA 1AR63 4YARA 4A2UA 2CTVA 1QEXA 3HNBM 3PUIA 1JS9A 1G8WA 2X8KA 3TEWA 1AYN2 5GZGA 2VH9A 1UAIA 4Q0SA 2IXCA 1RHI3 5DG2A 5FZOA 1VBA3 4XIOA 3ZYRA 1KS5A 3OGJA 4HPKB 1S0EA 4LKEA 1BKZA 3IDCB 4I3PA 5FPZA 5DPNA 3ZXAC 4AVVA 3E6CC 4NIDA 2ARBA 2VY0A 4NJ4A 3HAGA 1ACCA 5C7GA 1UOJA 2QUOA 2Z69A 5FO9B 4C1XA 3MW3A 3SCFA 3K3OA 2R063 5I8YA 5FYYA 1F5FA 1UZVA 4TLFA 3N9OA 4LLOA 1VP6A 3O1SA 1RVF1 5FOJB 2VBPA 4YG3A 5EJ1B 3W20A 3OGVA 4SLIA 3KHCA 2XJQA 1S2KA 1PIV1 1FPN2 2O8OA 3W21A 3GJBA 4AFAA 1A6CA 2XXZA 1PO12 3U0ZA 1K45A 3JBG1 4A7YA 1VBB1 5FYZA 4QM8A 5KHIA 3C7HA 3TN91 3AX4A 4CDQB 4Q27A 4BB3A 1OOPA 1O3RA 3GBFA 3JXSA 4XTMA 3U78A 4ZZ5A 3VDBA 5LA1A 1QXPA 1IHMA 1OLQA 5EYYA 2A6XA 1AYM1 3BU0A 2UYBA 1YRZA 5FP4A 4YVWB 1HQLA 4K3UA 4FPYA 3ALQA 4FQ4A 4XF4A 2X5IA 3BALA 1HX6A 4BE3A 2W39A 4GMP0 1W9WA 4XFFA 3VZNA 2GN3A 1N3OA 1DHKB 1UMZA 1JTZX 1PO22 2H0VA 2EVXA 1J58A 2YBKA 3BGAA 5K0UB 4JGZB 4XMIA 4YW3A 1JZ6A 3BTZA 3B9CA 1O59A 3B01A 4COUA 3MZHA 2F6BA 4N53B 3VDDA 4BH9A 1JUHA 1GOHA 1TG7A 3B02A 3E97A 1VBC3 4FXGB 4K1ZA 5BNOA 5HV0A 3U37A 3AJZA 2OZ6A 3H3ZA 4UFKA 1PNGA 4QM9A 4YGBA 5GZFA 1U5IA 2FDJA 5A1FA 3RMYA 4PDWB 4N43C 5J3UA 1WBLA 2XR4A 3J8F1 3K4AA 1SG3A 3VGIA 3N9LA 2ET1A 1NUKA 1Q8OA 3DKWA 3T4VA 3WQ7A 1ULEA 1X36A 2DVDA 2QE3A 5DDJ2 4Y4RA 5BPXA 3E6BA 2ZGMA 2KXLA 5F8PA 1RUF3 4OHZA 5BNPA 2WA4A 3AKQA 4H55A 5FLHA 4Q4Y2 3RZJA 1YIPA 2Z5WA 1MS1A 2VE1A 1QJY3 3S0MA 4DRVA 1CPNA 1OSGA 2VNGA 4QKDA 5T5PA 3MW4A 4XOGA 1JYXA 1LTEA 4LO4B 2GC2A 1XYOA 4QMAA 4AVSA 5C6CA 1DGRN 5FBZA 4BU2A 4A45A 1AR73 2LS6A 3LQCA 4AVBA 1RTVA 4P9GA 4B4RA 1EV13 1WZXA 3RS6A 4AQSA 2BVVA 2Y6HA 3NJYA 1E57A 1K5MA 1RUG1 4WVVA 3KLSA 3VD4A 2QQPA 1QJU3 1UU6A 2J42A 4JV4A 3VKFC 2RMU2 2YUEA 3VBHC 4Q4V3 4CCDA 3O1TA 1VB2A 2OUHA 4XXAA 4FP3A 4KGQA 1BMV2 3NMBA 1D4M2 5G04L 5C5TA 2AENA 1HN0A 2QQIA 2OQ6A 4CCOA 3I59A 5DABA 1UZWA 1NCRB 4FCAA 4DFSA 1V6KA 4DB5A 1EUTA 1FI2A 2Q1MA 4WVMA 3VUOA 2GMMA 5CU1A 1H8TB 2CAUA 2WC2A 3AMPA 4CEWB 3N9PA 4DY3A 2ARXA 4Z2AA 1RUI1 4BA6A 1FNZA 1V6MA 3MPPG 1GFF2 4JKMA 4XF3A 4FTSA 5A6QA 5J36A 2RHPA 3RJ2X 3MLLA 3FC0A 4FPLA 4UWDA 3VD3A 1PZ7A 5F5CA 2E63A 4A4AA 3LPFA 3MICA 5IYYA 4UFJA 3A23A 4GH4C 2VOWA 3NAPC 1QJX3 2VD7A 1NA1C 2ARAA 3AMNA 3NKTA 2R32A 4OHVA 4PF5A 1E5SA 4UBGA 2GH2A 2GH8A 2DBNA 2C9AA 2D7FA 1ZA7A 4M4PA 3GNEA 3NV1A 4URTA 2RDSA 2RM23 4D6RA 1WWYA 1LR5A 2K9ZA 5CFCA 5LRRA 4AEDC 3HQUA 3DV8A 3OPWA 2BWCA 4GQ7A 3W5NA 4HG6B 1UY1A 3HEIA 3DCQA 4YW5A 5FZ7A 4LA3A 4HETA 3VBUA 5JDBA 4ES8A 1WLTA 4Y4YA 2W3JA 2VVDA 2PHTA 1OBNA 2WRAA 3APBA 2YROA 3RDIA 5FZKA 1QDCA 4NWWA 1B09A 1H6YA 5I0TA 4DPNA 1X9TA 1X9PA 2PHDA 4HBNA 4YW4A 4ZXEA 2BFUS 2BEOA 2E9QA 2W95A 2W94A 3I2DA 5LA9A 5KHGA 1LHOA 1TME1 2WYSA 3ASIA 2P6HA 5C4WC 1HV1A 1VRBA 3LDKA 4IV1B 3TNQA 1S0FA 5L7OB 4KWKA 2E51A 2PA7A 2VULA 3BN6A 3OYWB 1RUE1 1UL9A 2EIDA 3LWCA 3UV9A 4CDWA 4CCMA 1R1A3 5A6XA 5IVBA 3V0AB 2AYHA 1HXS3 3BODA 4ONUA 1MZ5A 4OZXA 3VBFB 1G6NA 3N9NA 4QX2A 4YZ4A 4IGPA 1OI6A 3ILNA 2BVBA 3WF4A 3ELNA 2R6QA 3BB6A 1GQPA 4LNVA 4Y1UA 4ATEA 1LEDA 1JZ5A 3KZ4C 1MQTC 2PTMA 4HVQA 5JOWA 3HMYA 3T2QA 3LIGA 2Y64A 5JMCA 1OA4A 4CCCA 1AJKA 5FMBA 3D3AA 3GXUA 4NRQA 4FFHA 4JHZA 1AX1A 3IPVA 5BXXA 3V65A 5DAPA 3OCPA 2WN3A 1O7FA 3DYPA 2KD7A 4YZ5A 2CGPA 2A6VA 4QPWA 2GMEA 1F8VA 3E6DA 3WG2A 1RUD3 3AYEA 3N7KA 3WP6A 1OH4A 4AI2A 1GBGA 2IFRA 2A71A 2UYAA 4DS0A 3M1HA 4NIAA 1HIXA 3MV11 1FNYA 4FFIA 3GCWA 5FP9A 4A3XA 2LROA 1ZA4A 2BGOA 5ABJC 1BEV2 1WCUA 1ASJ1 1LOBA 4XJ9A 4QPIB 4AF9A 3IB3A 1ZRDA 1VR3A 2ZKLA 4M3CB 5EHDA 3SNMA 2WAAA 3VZLA 3WNOA 3KV5A 1GZWA 4BK5A 2WJSA 3AB0A 3KT7A 5A7NA 3BTXA 4AGVA 1UMIA 1AJOA 4Y1XA 4YVWA 2PAEA 4EN9B 5GZEA 3LZZA 2ID4A 1WBFA 2Z79A 4JCKA 5DAXA 3KWVA 1DQ4A 5F5QA 2O14A 5FMDA 4BPZA 2ZEXA 4XDPA 2XBO2 4YG6A 4NHXA 3WW4A 4BQ1A 5FXWA 3LD8A 2E31A 2RDRA 5BY5A 1WMXA 5K0UA 2BP6A 2D3SA 4QQLA 3WQBA 4EWEA 2VZRA 2Y6GA 4YVSA 1FMD1 3MIHA 4FXKB 5FMOS 5HCFA 3WEZA 1AR62 4I0AA 3EXUA 4CEYA 2B4KA 4FQZA 1XC6A 3RJRA 1RHI2 5FV3A 2VXJA 2BV4A 1VBA2 1Y9QA 4XBQA 5JZGA 5I8TA 1FOD3 1OKQA 1ZREA 2VG9A 5FK8A 1DQ0A 4ZU7A 5FZ9A 1HRI1 2ZOEB 2DF7A 5EJ3A 3O1PA 2WFPA 2MEV1 2R062 1TQ5A 4MGZE 3KS7A 2J1VA 4QPGC 2DU0A 2PHRA 2VR4A 3RZHA 1XYPA 1IKPA 1RB8G 1P8JA 1AR91 2ZMKA 3A22A 3LCPA 4XFHA 2JDYA 1CGPA 4R52A 2C0ZA 3TEZA 4N7IA 4K6BA 2PHXA 4AWDA 5A1AA 3IBMA 3PUHA 1FT9A 4I0BA 5FZGA 2ADDA 3WNXA 1SLAA 2LUWA 4QD2A 4L11A 4RS5B 1I5ZA 3RYRA 1VAMA 2R16A 3U4XA 5LK5A 2XWBB 3W9AA 2AREA 3ZR5A 4IE4A 1RVF3 2GAUA 3H1YA 1LOFA 3S7IA 2FDHA 2ZZQA 1GP5A 2X09A 4HSJA 3ZXFA 5CBLA 1PIV3 1IGOA 1LGBA 3U14A 3ZFGC 4K8RB 5EV7A 5IHRA 3T4HB 3M3IA 3T3YA 4CCJA 5JIUA 4YW7A 2WZPP 3BIWE 4FPEA 4OFGA 3JBG3 3WSOA 1V6LA 2K2SA 5IW0A 3QD6A 2OA2A 1O8PA 3WINE 1C5IA 1AL0G 5F2SA 3TN93 3ZIXA 4B3NA 4Z8BA 3O7OA 3CU7A 5FP8A 2BPA2 5FXXA 1UYPA 1WMEA 2X53S 3MLKA 1ZZBA 3NNMA 4OQ9A 1VBC2 3VN4A 5IJRA 3VBOB 5IK8A 1SLTA 4A3ZA 2UY9A 4R8HA 1X33A 3AL5A 1LAJA 5C33A 5FZ0A 4EN8B 5CADA 1BJQA 4GB31 2E26A 4JAAA 3MIDA 3NJZA 4OI2A 4R9DA 2NYYA 3LE0A 4PIXA 2R041 1N1VA 3KV4A 1W6PA 4QU1A 3RRDA 2XLAA 3AJYA 3HD8B 5FUNA 1C1FA 2WINB 3BPSA 1V6OA 3L2YA 4PHZA 1F2NA 1VRH3 1VIWB 1X82A 3ORJA 3NJXA 5LK7B 3ZFFA 3BIEA 1POV3 1CAXA 4M3CF 3NO8A 3N3HA 4M0HA 3I49A 2YU2A 1QJY2 3LEKA 2R071 4OHYA 1GANA 1QU0A 3SISA 1JYTA 1W8TA 3AMHA 5HXVA 3RZLA 5FKBA 4IV3A 2ZZJA 1AR81 4N7UA 4XBNA 2B8MA 2CHHA 1VE0A 3B00A 1ZBE1 3THCA 1Q8VA 4TSVA 1YJLA 1WCDJ 1W8NA 4MYEA 2F4PA 3GCXA 1SPPA 4QXCA 1NLQA 1RYYA 4COYA 2EXKA 2ZGKA 3RYPA 3FUOA 1QJU2 2BQPA 1C57A 5E6HA 4XUPA 2CY6A 3S7EA 1UX7A 4Q4V2 5EPAA 1KJLA 2QFEA 1XQNA 5KXBA 2A70A 4M0NA 3VBSA 1RUOA 2ZGTA 5FZOB 3QCWA 4UF0A 2WA3A 4D7YA 3BI3A 3X29B 3ME2A 3RPQA 3V0AA 3P5BA 4NPLA 1UIKA 1N3QA 4XFBA 3BCWA 2Q8DA 1RUG3 2XL9A 2ZX0A 4M4RA 3ZN5A 2GN7A 2FD8A 2XUMA 1V0AA 1QJZA 3MV01 3JB4C 3WG4A 1OLMA 3VD5A 2PHWA 4ZU4A 4IQPA 3ECQA 4Q0PA 2A73B 4CDXC 5FLJA 2BNNA 1SFPA 4HKOA 1BCXA 3H1WA 3ZYFA 1F4HA 4KL1A 5JPNB 3WLUA 2C26A 4C90A 5F3GA 1O4ZA 3SITA 3VKMA 5D1IA 5GZCA 4PQ9A 3KMHA 1RXFA 4W6XA 1QJX2 3PU8A 5HCBA 4LBOA 2V73A 3C3VA 1TZOA 1N1YA 2C6SA 4Q4X1 1JYNA 5J1XA 1JOJA 3RWKX 3M3QA 4BQ5A 4EN6B 5L36A 3MIGA 2RM22 4LE4A 1OOPB 2HKXA 1RUI3 2ZCWA 4HZFA 4ITCA 4QX1A 4CDUC 1G9AA 2WFF1 5DUUA 3VHPA 1SZBA 2RMU3 3LPGA 5T5JA 5FCCA 2Y34A 5JWPA 1WCQA 1JZ4A 3JB8A 5FRAA 4WVWA 2X5IB 4GA9A 3H8XA 2FQPA 4IEQA 5FY5A 2I2SA 3PJYA 4YPJA 4XF9A 5JXGA 4LTAA 3PMSA 2P37A 2RVAA 5FZHA 5EIYB 1W6OA 2W0XA 2G4IA 1UCXA 3BU7A 1TNRA 4LEJA 3H0OA 2SLIA 3VDDB 1JH5A 3HQRA 5KHHA 2OQ7A 4AYUA 2EF6A 4HL0A 3NJVA 2P5BA 3MIEA 4ORFA 1UZ0A 5A3OA 3WDTA 5BNOB 5JXHA 4XDQA 2VZOA 3ACIA 1DLCA 1UO9A 4XFGA 2QQJA 4YM1A 3RZZA 2F4LA 2FCUA 1O3QA 5FYHA 4CDQC 1NYWA 2BJSA 3ZMNA 2ZS6B 5FXZA 3VKLA 4Y1ZA 1LCLA 1NX9A 2BTVC 1S0BA 5FMCA 4QXHA 3A7QA 4EROA 2JDKA 4RR3B 1HN1A 1G9CA 4C8DA 5BNPB 3FHIB 3KVAA 4N43A 4K1YA 4NPRA 3WCRA 1TME3 1CJPA 4D6SA 1REEA 2D6NA 3WF3A 3VBRC 1ZRFA 4MGTA 1OF4A 3LFIA 3OBRA 4QU2A 4AI1A 1YHFA 3C8XA 2DUPA 5BNNC 4LK6A 1OURA 1Y9MA 1PNFA 3KT4A 3ZO0B 4DO0A 4JQTA 2HEWF 2B39A 2RR11 1H2LA 2D43A 2ZHMA 4AL9A 4MXVA 4QHBA 3LA2A 5JXJA 3H8RA 1IPKA 3DYMA 2D44A 1K5MB 3I3EA 5CYYA 4Z92B 1ND3C 3O5SA 5JOXA 1RUD2 4CXYA 2GC0A 1J3PA 1X7NA 3I7DA 5F5AA 5GKAC 3VZKA 1UOBA 1G86A 1TVGA 4IUGA 3U75A 1CR7A 4BZ4A 1OUXA 2D6MA 3T1MA 4CUAA 4Q4W1 4CSWA 2B42B 4I09A 1ZX5A 4TLGA 3I59B 3H42B 2ZA9A 4RQPC 3VBHA 2PMWB 2RJ2A 4WZFA 3ZM8A 1NKGA 4Y1YA 1A3KA 4WM7C 3WR0A 3KCCA 1GKBA 4GWJA 4WVMB 5AFEA 2XPJA 4NO4A 1Z0HA 4AR2A 1NY72 5CEHA 1W8OA 3SEEA 4CUBA 1ZZ6A 1VAVA 5LBBA 1GSLA 4RL7A 2P3YA 3MGUA 2XKOA 1VLNA 4EWDA 5FPAA 3LOBA 1A8DA 5IWFA 3BVCA 3OSDA 4DEQA 3GZUC 5FP3A 1XRUA 2V5YA 1ASJ3 3HQXA 5C9AA 3LIHA 2CGNA 4AI0A 5DUVA 3AP9A 1O4YA 4YWAA 1BHGA 2PHFA 5E8AA 3ZOIA 2HWD1 3OBZA 3A0NA 2VMFA 1OUSA 4FPKA 5FPLA 1UZYA 4V2VA 4GH4A 4MSVA 2XG3A 1XE7A 1NA1A 3M3CA 4KWJA 5H9PA 5CFCB 1NCRC 1XE8A 2VECA 1WW7A 5FZFA 2F17A 4Q0QA 5SV5A 1FOD2 4AVTA 3T0AA 2VUCA 3V0BA 1O4TA 1PM4A 4K40A 3MF6A 3EJKA 3NV3A 2R1DA 4KWUA 4D3WA 4E4DX 1UU5A 1IPJA 3FZ3A 3HT2A 5IFTA 5KHJA 2YPDA 4CEWC 1ZNPA 1YLLA 1RUJ1 2WNVA 4AEDA 1D0HA 1FMD3 4MGSA 2D3PA 2EXJA 3T0DA 2DUQA 2YFUA 2JDHA 5ACA1 5JSRA 1CX4A 3OBTA 3JU9A 5CFDC 4P5YA 4JGYC 2D6KA 2QQOA 2P4EA 2AUYA 4COZA 4NIIA 1MS9A 3MF9A 4QQOA 2QQWA 4B4QA 1DGWX 2HEVF 1W9SA 2VZQA 1HRI3 2AGSA 3INAA 4JDOA 1S1AA 3JZVA 2XQRA 2ZGOA 4BQ4A 3ZSJA 2VMCA 5EYXA 2FDKA 2BW8A 1QJFA 2MEV3 5DAVA 4CDWB 3S57A 2WNUA 5FYVA 1H8VA 1JOBA 4RN5A 3VDAA 5C4WA 2Q8OA 5DQ0A 2WNEA 4EQVA 1WW6A 2ZBJA 5GM0A 1QIQA 4FVVA 1RVF2 1G7YA 1CN1A 2P6CA 4YLZA 2GNBA 1AR93 1HB3A 3ZIWA 4UFMA 1PIV2 1HJFA 2BZDA 5FYBA 3ZKYA 4ARXA 3R05A 4P9YA 4AOCA 2TNFA 3LFMA 1W90A 4LE3A 1J1TA 2R0HA 4TXWA 3UGFA 3JBG2 1MEC3 1ODMA 1OF3A 3WHUA 1VBB2 2XKPA 1CX1A 1H2MA 3CQOA 2W1UA 3CJIC 3TN92 1ZBA1 3FFQA 3GHMA 1KEXA 1UW8A 3IPVB 1PM7A 4QQ2A 4DMIA 2WZR1 1GNYA 1GV9A 1MQTA 1W03A 1JOPA 4XABA 2XHNA 2VU9A 5FKCA 5A7QA 3THPA 2EIEA 2YG0A 1ND2A 4XUTA 3ZN4A 3MLJA 4FSJA 2GC3A 4NWVA 4R9CA 2ZABA 2YC0A 2D6OX 2DCKA 1CZSA 5A3LA 4HKWA 3VBFC 3WVJA 5IT6A 5FAXA 3DN7A 2VQAA 3S30A 4FO9A 3NSTA 1UN1A 1VRH2 3HVDA 5CZKA 1BBT1 5FZMA 4LXLA 4YFZA 2NN8A 1PX3A 4MGKE 3AFKA 5C5UA 4YZ2A 2MHFA 5HV4A 1SFYA 4COVA 3M8LA 2VW1A 3JD71 4XHBA 4X8NA 4PBPA 1U0AA 2C5DA 1Z7S3 4J6GA 3NNLA 2DFCA 2RS11 4RYDA 5CKNA 3FN9A 5C8CA 5LW9A 1HRV1 1DGRA 1GZWB 4CCKA 2E33A 1QGLA 2WABA 3ZSMA 3J8F2 4OYUA 3AVRA 4EN0A 4BMEA 2R043 1V00A 4OUMA 5JOZA 2HWF1 2VZVA 4BQ2A 5JR7B 1OKOA 1OHFA 3OBAA 4XUQA 5FZ4A 2XJPA 3ZVXA 4AVAA 3WP5A 3POBA 3LOIA 1K12A 1MVQA 3AKRA 4P14A 2YHJA 1GWMA 1UPSA 5FYIA 1ULDA 1W8UA 1UY2A 3RNSA 1RITA 3GGLA 3THDA 4AHYA 2R073 4E2SA 2Q1FA 4XAEA 4YVSB 2QNKA 4L92A 4F7ZA 2TUNA 4LHLA 1LEMA 2I74A 3NW4A 2WZ8A 3DPRA 4CEYB 1AR83 4G9SB 1NZIA 4D7TA 3CL1A 2CWSA 2VNOA 2B9UA 1LNSA 3RVHA 3USSA 2Q8CA 2DVAA 4GWIA 2YZ4A 2EAAA 4A6SA 5JZGB 4N9IA 2HEYF 1KGYA 4IW3A 3SMHA 3WV6A 4P9JA 5HBAA 4FPFA 1CPMA 3WX5A 1UOFA 1QH7A 1RUG2 3K51A 4DOUA 4UW4A 1Y3TA 2WT0A 5GLWA 3O1RA 1TNFA 1UY3A 1GZ9A 1LGCA 3WNKA 2VCBA 4RR3A 4XPVA 4HVRA 3WF1A 5JOYA 2Z4FA 4AW7A 3MI8A 5A7WA 1TEIA 1REDA 2YV8A 3VHRA 1DQ5A 3CO2A 3FL7A 1DQ1A 3GBGA 1QMJA 3OEBA 3FBYA 1S0IA 3ZYPA 4EV0A 2OPKA 3B7MA 1DGWA 1AL21 2WWJA 3GYDA 2QBXA 1UWWA 2JIGA 2A6YA 1IS3A 1QQP1 2OX0A 1G9FA 4QDRA 2N7GA 2WT2A 5F37A 1ENQA 1YI7A 2WSUA 3KF5A 3N7JA 1RUI2 2Z42A 4HFSA 5DMYA 5B4NA 3O1MA 2GU9A 1GQHA 2WKKA 2JE7A 3DEMA 4OI1A 4DRRA 2GSYA 2RS51 4MH0E 2CAVA 4S2DA 4Z82A 4CTEA 3WF0A 2DVGA 2BGCA 1AF9A 2DUOA 4JDNA 5A7OA 1SLCA 3FLTA 3WDVA 3WT3A 2CDPA 4XUOA 2ES3A 1SEFA 3IT8A 2RS31 3AYDA 1ZVFA 1HDKA 5F5IA 4Q4X3 4L97A 1GWKA 2CL2A 4IE5A 2VBBA 5JCTA 1OFNA 4GJZA 1OD5A 2JDPA 2OUJA 2UWCA 3C7OA 2ZKNA 2WFF3 4META 2Q8EA 4QGMA 3WNMA 1OVSA 1WUVA 4QX7A 1E5IA 5FXVA 1GUIA 1WMDA 3J9SA 1RIRA 3K4ZA 5FZ6A 5DDJ1 2HH9A 1MZEA 3USUA 1VJ2A 4L2NA 1Y7BA 4RS5C 4Y22A 5GALA 3WDYA 4B7KA 1FXZA 1V6IA 3PVOA 5TSWA 1UF2C 1GOGA 1RUC3 4XVHA 3ROUA 3WZ1A 5F39A 2Q0AA 2QQUA 5T5LA 1W6PB 5JSPA 3WUDA 1AXKA 1ENXA 1RMU1 3SEPA 3WW3A 2FZ2A 2FHRA 3PDQA 3SXWA 5A7SA 3VZJA 3ZFFB 3CNAA 1CAXB 1TME2 5DAQA 5A7PA 2EALA 2P3JA 3ACFA 1URXA 1HLCA 4DZGA 1CZTA 1LOAA 4XJUA 2VTXJ 5H9RA 4AGGA 2JD4A 3GF6A 3LEMA 2DYCA 3AZZA 4GAZA 3BTYA 3RZGA 4IV3B 2GP3A 4ZZ8A 3PLQA 4O9EA 1UQXA 3D0SA 1JN2P 1HB4A 1D2SA 1GICA 2HWB1 3POFA 4KU7A 4Q0VA 3VBOC 3UNPA 1CIYA 1SPPB 4GWMA 3ZSLA 1KJRA 1BMV1 5FZIA 1BXHA 5GLVA 3POGA 5F3CA 4XETA 1PGW2 1YFYA 4KH9A 5F3IA 3VL9A 1RUH1 1UYXA 3O14A 1ULFA 3FE5A 5EFUA 3VKNA 1C8M3 4RHV1 1W39A 5E1RA 4E4HA 4L99A 1XNCA 3PUAA 4XURA 4WM8C 3VBSB 3GBWA 3WP4A 4WZCA 5DXDA 2XQXA 3SC7X 4UAPA 1LJ7A 2VPVA 3POSA 4UF0B 5T3NA 4AHXA 4N90A 4XCBA 2JG9A 4FPGA 5FZ1A 5JVVA 1REFA 3SLIA 1VMJA 4BQ3A 1UXXX 3J7LA 1H1AA 3UL2A 5KWRA 2GNTA 3I54A 1S2BA 5A3PA 5A70A 3UJOA 1T6BX 3RI8A 2WSVA 2XJTA 1N1TA 4PQQA 2VZ1A 3ZYBA 4CU9A 4W6YA 1GR3A 2W52A 3MO4A 4FOYA 5A3WA 2JB4A 3TOJA 4R9BA 5J37A 1H1MA 1ST8A 4Q4W3 4Q8LA 3FBMA 5FO8B 4MUVA 5KHKA 4UFIA 4W65A 5J48A 1NCQA 3AXDA 4S2HA 1ASJ2 4BLJA 4FFFA 1OQEA 4IEVA 4IDZA 2BNMA 1I6XA 3AYAA 3IDBB 3ZDVA 4YW1A 1F9KA 5LATA 4CPBD 1LOCA 3KVBA 2ERFA 4IEXA 4UW3A 1JZ2A 1HB2A 3OD0A 3OG2A 4FPHA 2FDGA 3C7GA 4NOTA 1S4CA 2XGXA 5I0UA 1Q56A 4K8FA 4LKSA 4DINB 5ANQA 3ZYGA 3VHOA 2JECA 2DVBA 2VOTA 2GNMA 2B5HA 3M2MA 3ST7A 2YGMA 4XBLA 4E8DA 4F3JA 1GP4A 3EMRA 3ZFEA 2K0GA 2OT7A 4LUKA 5CAZA 1JYVA 4NIHA 2D6PA 2JG8C 4CDUA 4P9WA 1VBE1 3GZEA 4MHUA 1FMD2 3AZVA 3MUY1 3PTYA 4Q29A 5LA2A 4DQAA 2HWD3 1GNHA 3D0JA 4AEJA 4LO5B 1W6OB 3TB0A 5E88A 1CVNA 5LWBA 4LBLA 1PVXA 3I2GA 5A32A 4LR4A 4OCTA 5JSOA 5D8AC 1MS3A 1Q3EA 3AC0A 3DL3A 1HRI2 5L9VA 3M4FA 5E89A 4IL7A 5FPUA 4EZ4A 1MS4A 4UYBA 1R091 1L7RA 2MEV2 1OOPC 1RUJ3 1CONA 2A5ZA 5IK4A 4AVCA 4UFLA 5LBCA 2NMOA 4COWA 4K9SA 5ACA3 3JCIA 5IVJA 1BVVA 3AP7A 3G6JB 2BNOA 4AZZA 4AEKA 1NOVA 1S0DA 3AMQA 4GMP1 1S0GA 4U36A 1AR92 3H8OA 1IS4A 2X5IC 4N43B 3VHNA 3ZPOA 3MBWA 1JU3A 4LBMA 2GALA 2Y8KA 1U5ZA 2AZ5A 1C5HA 2E7TA 2MNGA 1MEC2 4IXLA 1O8SA 3OTFA 1TE1B 1MZ6A 5FIXA 5FY7A 1VMFA 1W9TA 4GIQA 1SMVA 3VBRA 4Y26A 1D7PM 5C8WA 3P3PA 4MXWA 5FLIA 1RJ7A 2PLV3 5IFPA 1GYKA 5BNNA 3MYXA 3S6PA 2KA3A 4LKDA 5FDBA 3Q8FA 5HCAA 2VQ0A 1XU2A 2W1WA 4XQ4A 1MS8A 1YFUA 1MVEA 3SCGA 2ZHLA 4AFBA 5FY8A 2BUKA 5CKMA 5ISLA 1CESA 1W0PA 2IZWA 1ZBA3 3U1XA 2RE9A 5F2WA 1W6QA 4LKFA 4BXFA 4DXTA 1RUNA 1S0JA 1YQ2A 4OLLA 4Y1VA 3VBHB 3G7DA 3LA3A 1JXNA 2AH2A 3OB8A 2GZWA 2XBO1 2C9KA 2ZXQA 4ZS3A 1Z7S2 4BQWA 4QGLA 3DXUA 5FZBA 5A6ZA 3THTA 2ZACA 2R7EB 3NQHA 4XEZA 3T2PA 2P1BA 5FZEA 1COV1 1EYBA 2W46A 3A21A 3BTAA 3OPZA 2BERA 4RQPA 1M4WA 4AFMA 5HI0A 2JIJA 2D5FA 4DNYA 4DY5A 3Q8EA 4WM7A 2R042 1YXWA 4ARYA 1CJDA 2JE8A 2WQ8A 3RZMA 4HSLA 1CD3G 3ZXJA 1J3RA 4LLFA 1W8FA 1XNBA 4G3YC 3N9MA 2VTFA 4PI2A 1C28A 4N9HA 5C9AB 1BVP1 1VBB3 2W9XA 1JHJA 1PHMA 4GKYA 4XMAA 3F2ZA 1FX5A 3JD73 4OULA 2PAKA 1NLRA 2R072 5I0SA 3BKZA 1QDOA 1EAH1 5ANNA 4JDMA 3E5QA 1A78A 3PIJA 4X8PA 3K75B 1XB9A 1AR82 1AYM3 4GH4B 1IPSA 2CGOA 4AI3A 4XCAA 1NA1B 4YZ1A 2YC2A 3CZJA 3AP6A 5FUIA 2MPFA 5LCWL 2HWF3 2JEMA 1CQ9A 3V0BB 1ODNA 3CF6E 2VXRA 1JI6A 1B35C 5JMOA 1BLZA 4JRLA 3LDBA 4C0BA 4LT5A 4NHYA 3LAGA 4MO3M 2K46A 5FFOC 3B3QE 3OUIA 5FY0A 3IDEA 2DVFA 1F35A 2WNVB 4AEDB 1AX2A 4D69A 2GNDA 4Y20B 2FMYA 5F6LB 4YM0A 1YO8A 1POQA 2YBPA 3NVCA 2IFWA 3HBKA 4QB2A 3RSJA 5FYTA 4D7SA 2W91A 2XLGA 2HWE1 3LEGA 1YI9A 2JICA 2WT1A 5FP7A 3RWNA 2BU9A 3V64A 3M7AA 4AAPA 2P34A 1QH6A 3D4KA 4PCRA 4I2OA 4QB6A 4NHKA 3J8F3 4PLMA 5DZEA 4ZHNA 4AAXA 3HBZA 4RGGA 4OMDA 4DIQA 4JGYA 2FZ1A 4DXRA 3I4IA 4UBHA 1PVC1 4I02A 1ULOA 1L7LA 1SBFA 2WNUB 3CHXA 1M06G 5C4WB 3V56A 2WS91 1J84A 2VZSA 4I3GA 1QWRA 3MIBA 1D2QA 5K4LA 2ZEYA 2WR9A 3CDZB 4IEYA 3ZXEA 1WD3A 3O1VA 1H9WA 3BPZA 3VBUC 2PQQA 3AM2A 2WZEA 2W08A 3U07A 1AL23 3FHQA 5IATA 1S0CA 1LHWA 1OC1A 1VPHA 1QQP3 1LESA 1NXMA 4Q4X2 1PK6C 1PMHX 5A3TA 2GMPA 2ZGPA 1WD4A 4I30A 2XL7A 4AHWA 1KRIA 3WXPA 1GLHA 3RMXA 2XMLA 3DF0A 1V6NA 4CCNA 1MQTB 3S5QA 2WFF2 1DP0A 1QOTA 1GZTA 5DUWA 2RG4A 2W2IA 1GZCA 2AR6A 5J98B 1ND2B 1RINA 3OGGA 5GZDA 1XOYA 4ZXKA 3CJIA 4BHPA 3I2KA 4CYDA 4MADA 4QHZA 4XQDA 1RUF1 3A4UA 4KG8A 1ZRCA 2HLEA 2Y6JA 4CDWC 5JAXA 1NE4A 3M3EA 3UYJA 2VMDA 4LOSA 1QJY1 2RS33 1RUC2 2ZEZA 3P3NA 2CWMA 4JHTA 3RI9A 3J4UH 2QDNA 4A44A 2Y6KA 4IESA 2LALA 4KBZA 1EPWA 3PNAA 1WGPA 1HB1A 1AXYA 3C7FA 4GXLA 4O7XA 3D8CA 1AR71 4Z07A 4B7EA 4C1WA 1MPXA 2W47A 3B9IA 4TWTA 5FR3A 2C4XA 1EV11 3H3LA 2PHLA 4I0WB 1F31A 4MVTA 3QACA 5C8CB 2EICA 2VCAA 3C2UA 2DV9A 3FWEA 4IE6A 2JDNA 5FREA 3WQ0A 4ES9A 4HVOA 2VAUA 3AKTA 2OXBA 3WG3A 5F1RA 2PHUA 1ZZ9A 4OQ8A 4XAAA 1NT0A 5F6KA 5IK7A 1HW5A 1BK0A 2H0BA 4CRQA 5JPMB 3ZLIA 4CZSA 4LBQD 1OA2A 2O1QA 3UETA 1SCSA 1WLCA 4Z1VA 2X05A 2C1FA 3CMGA 2V5DA 1C8M2 5LRSA 3R4SA 5A33A 5T55A 2NQYA 3DPRB 3ES1A 2HWC1 2CYFA 1UPIA 2KR2A 5FZAA 1IS5A 2BDRA 1LHUA 2XVLA 3PU3A 4G4FA 3R4DB 1F5JA 3BOPA 3AVSA 3IZOA 4NRMA 2HWB3 2RR12 1PGSA 3FX3A 3OGRA 2R30A 5B2GB 5CG8A 2VTXA 5IUQA 4PBOA 1NQJA 1H6XA 3O0VA 1POV0 1J59A 2YGLA 2W87A 2HYXA 5CNAA 1H2NA 1RUH3 4YVWC 1YIFA 2AEZA 2YFZA 3Q8AA 2DU1A 2VJXA 2JJ6A 5FY4A 5GLZA 4ET7A 4RHV3 3WY6A 2VW2A 5AVAA 3AK0A 5A7WB 2UWAA 1C4RA 4Q4W2 1NXD1 3ZYJB 5LEJA 2DCYA 1H0BA 4IEUA 2A1XA 2RM21 5EQUA 3TYJA 5I93A 1DYOA 3LA7A 4CDXB 3A0KA 4R9AA 3H9AA 5K0UC 4JGZC 1RUE3 2IXHA 4N53C 2VZUA 1ZRIA 1W28A 1N47A 3LDRA 4YRDA 4FOWA 4CUGA 4HK8A 4XILA 3J7NA 1ONAA 3FJSA 2IVIB 4S2GA 2EIGA 4OI0A 3KQRA 5FYCA 1OLME 1WA4A 4PDWC 1O6UA 5KR7A 5IVYA 1YQ6A 3LEIA 2VOXA 4H7MA 4XACA 4BK4A 2W92A 3I3DA 3TRSB 1WW4A 1JZ3A 5AC91 2ZPXA 3ILRA 3DGTA 5I0DA 1JHNA 2XDVA 2YY1A 3I8TA 3OY8A 1DQ2A 3WCSA 1MS0A 4MV2A 1S55A 2HWD2 1QNYA 3M3OA 3UGGA 3AKSA 4JKLA 1PGL1 4A41A 3PIGA 5AVPA 1R1A1 3T1LA 1W2NA 2RJKA 2ZTNA 5ERLA 4XJWA 1ALYA 4AFCA 1HXS1 3POEA 1G9DA 5LY2A 3CZUA 4DXSA 5EWSA 5A3UA 4BIOA 3USUB 2FCVA 1VAKA 4Q5OA 5F32A 4Y22B 1ZZ8A 4F8AA 1V70A 1VBE3 5GLTA 1RUJ2 4QHOA 3VZMA 3KQ4B 2BBAA 1JW6A 4ASKA 4RGAA 4AI8A 5ACA2 4Y33A 4AXOA 5D21A 5GJ6A 5D2AA 5FJKA 1SBDA 4UI9L 3AMMA 5F3EA 2VUAA 4LMFA 4ASMB 4UFHA 1EPZA 3B94A 3MUZ1 3POIA 2VBDA 3NAPA 4MX3A 4E4SA 2FDIA 4LO7A 3SKJE 5DG1A 4NVPA 1HQWA 1YCIA 1NQDA 1OQDA 3ON7A 3U4SA 2JX9A 1YFWA 3O0XA 1LB2A 1K42A 3QLQA 4QX0A 4LA2A 2BYVE 1WMFA 4OI4A 1H8TC 4M00A 2WO3A 4BMBA 1PMJX 2LM3A 4JZRA 2PLV2 4GMP3 4IGQA 5CIRA 3RZKA 4W4ZA 2R0FA 4Y20A 4KMQA 4FBFA 2VGDA 4EYUA 2VVEA 2QZ3A 3HN3A 3RQ0A 1D4VB 4CCEA 1NG0A 4IEZA 2WBKA 5L19A 3JQXA 2IXIA 2PELA 3TBDA 2VOKA 3KT1A 1ZBA2 1YC61 3N4MA 4JX0A 3ZFFC
chains in the Genus database with same CATH topology
2VBBA 3ZKUA 1W03A 2CSGA 1W9YA 5C3OA 1E5IA 1UOBA 1W04A 2BU9A 1W2OA 1OBNA 1W2AX 1DCSA 1W28A 1GP6A 1W06A 2IVIB 1RXGA 1W3VA 5APAA 5C3QA 1RXFA 1OC1A 1E5RA 1HB4A 2VE1A 2Y6FA 3ZOIA 1HJGA 4XAEA 1GP5A 2DBIA 1W3XA 1W2NA 5C3PA 1QJEA 1UOFA 2IVJA 1HB1A 1E5HA 1UO9A 2JB4A 2VCMA 2VBDA 1UZWA 5C3SA 2VAUA 2BJSA 5C3RA 3ON7A 1QJFA 1UOGA 2WO7A 1BK0A 1W05A 1QIQA 1HB2A 2VBPA 1HB3A 3ZKYA 1HJFA 1UNBA 1IPSA 1GP4A 2BRTA 1ODMA 1E5SA 1ODNA 1WA6X 2Y60A 2JB8A 4RGKA 1BLZA 2DBNA 4BB3A 3OOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBB A;  3ZKU A;  1W03 A;  2CSG A;  1W9Y A;  5C3O A;  1E5I A;  1UOB A;  1W04 A;  2BU9 A;  1W2O A;  1OBN A;  1W2A X;  1DCS A;  1W28 A;  1GP6 A;  1W06 A;  2IVI B;  1RXG A;  1W3V A;  5APA A;  5C3Q A;  1RXF A;  1OC1 A;  1E5R A;  1HB4 A;  2VE1 A;  2Y6F A;  3ZOI A;  1HJG A;  4XAE A;  1GP5 A;  2DBI A;  1W3X A;  1W2N A;  5C3P A;  1QJE A;  1UOF A;  2IVJ A;  1HB1 A;  1E5H A;  1UO9 A;  2JB4 A;  2VCM A;  2VBD A;  1UZW A;  5C3S A;  2VAU A;  2BJS A;  5C3R A;  3ON7 A;  1QJF A;  1UOG A;  2WO7 A;  1BK0 A;  1W05 A;  1QIQ A;  1HB2 A;  2VBP A;  1HB3 A;  3ZKY A;  1HJF A;  1UNB A;  1IPS A;  1GP4 A;  2BRT A;  1ODM A;  1E5S A;  1ODN A;  1WA6 X;  2Y60 A;  2JB8 A;  4RGK A;  1BLZ A;  2DBN A;  4BB3 A;  3OOX A; 
#chains in the Genus database with same CATH topology
 2HJI A;  2O8Q A;  2XOM A;  3T09 A;  1UX6 A;  2UY8 A;  3FLP A;  3KF3 A;  3POJ A;  1HKD A;  2JG9 B;  2JKB A;  5FY9 A;  2VMG A;  2NZ9 A;  4IER A;  5JUV A;  2UWB A;  4WM8 A;  4EWA A;  5CA6 A;  3WDW A;  3KHB A;  3SH5 A;  2Q1Z B;  4D6Q A;  4LBJ A;  4QXK A;  1W99 A;  1V9U 1;  1WLD A;  2B7Y A;  3SH4 A;  1RGS A;  2XJR A;  2W68 A;  4JC1 A;  1H2K A;  3S5A A;  1UYZ A;  3IAP A;  4J25 A;  2AC1 A;  2VUJ A;  1AUY A;  3OUH A;  4GD4 A;  4MZU A;  1DYP A;  2ZX3 A;  3SH3 A;  3VV1 A;  1UY0 A;  4TTG A;  1DCS A;  1NCQ B;  1UZZ A;  3R6S A;  1EP0 A;  1YWK A;  1SCR A;  5FWE A;  4AI9 A;  4D94 A;  1APN A;  2BOI A;  3ES4 A;  3IMN A;  3JD7 2;  3SKV A;  1AXZ A;  1YJK A;  3EHK A;  1LOD A;  1QOO A;  5H9S A;  3CBN A;  1HRV 2;  2R49 A;  1FV2 A;  3MDP A;  4Y24 A;  4ZON A;  3M70 A;  1COV 3;  1DU3 D;  1AYM 2;  1VBD 1;  2ZX2 A;  3KCX A;  4FOV A;  3U11 A;  5HCH A;  4IV1 C;  1XSR A;  3N35 A;  4GJY A;  5L7O C;  4QGN A;  1H9P A;  1GWL A;  3H1M A;  2HWF 2;  3GHN A;  4BCU A;  1CAV A;  2G9G A;  2VZ3 A;  3HOB A;  2SBA A;  2VMI A;  1X50 A;  4QKB A;  4ZPI A;  5LY1 A;  3ZFE B;  5K9Y A;  3I2I A;  2QTW B;  3Q8C A;  4HON A;  3OD4 A;  4CDU B;  5IVC A;  4P9I A;  4BDV B;  3I97 A;  3PHM A;  4WBB A;  1R08 1;  3T2O A;  4FP2 A;  3TWI A;  1TMF 1;  1EAH 3;  2DBI A;  1KS4 A;  4P9X A;  4FAG A;  1GNZ A;  3BUC A;  5FO7 B;  2I07 B;  1IS6 A;  1ULP A;  2JG8 A;  1SLL A;  2DTW A;  3MHZ A;  5IAX A;  4AFD A;  1QXJ A;  4M01 A;  3HPN A;  2JDZ A;  4NRO A;  3H7Y A;  3I2F A;  2UU8 A;  5A32 B;  4FOQ A;  5ABJ A;  5C3P A;  4KNC A;  2VVF A;  4GB3 3;  4NR1 A;  1QJE A;  1W2U A;  1SLI A;  4Q8K A;  5A6Y A;  4YSF A;  1LKN A;  5FQ0 A;  4YGE A;  2IVJ A;  5T52 A;  4UT5 A;  4ZU5 A;  1AYN 1;  3D6E A;  5FWJ A;  3OPT A;  3QOP A;  5D8A A;  2IWG B;  4ISQ A;  4NAO A;  3QH6 A;  1OMI A;  4QT6 A;  1UYY A;  2IXL A;  1ZZ7 A;  3ZXG A;  1JYC A;  1O5U A;  2CDO A;  2G19 A;  4OMC A;  3Q8B A;  2HWE 3;  1ENR A;  4Q0U A;  3WP3 A;  3L9J T;  1AL2 2;  1CAU A;  1DGL A;  4CP9 A;  1Q5O A;  4MGI E;  4CE8 A;  1QQP 2;  3ABZ A;  5FJH A;  1H1I A;  1UOG A;  1ZBE 3;  4Q26 A;  4QPI C;  4YG0 A;  2P2K A;  1IKQ A;  3JQW A;  3I3Q A;  3WNP A;  4YNI A;  3ZX7 A;  5BUV A;  1PVC 3;  1FAT A;  1SFN A;  3DYO A;  2P17 A;  3IN9 A;  4FAH A;  4BIS A;  3VBR B;  2WS9 3;  3NWK A;  4MXW B;  5KXC A;  1FPN 1;  1IZ3 A;  3VLB B;  1UNB A;  1W9F A;  2JD9 A;  2KM2 A;  2RS5 2;  4E2Q A;  4CP0 A;  1XNT A;  5BNN B;  2FCT A;  4H3W A;  1PO1 1;  1VB4 A;  4LO8 A;  3UKN A;  1VRH 1;  4W50 A;  1YFX A;  4KWL A;  2P3I A;  3EB7 A;  1POV 1;  3MFC A;  2Y60 A;  3DXT A;  2RS3 2;  4O65 A;  1DYK A;  2XVG A;  1GQG A;  1C3H A;  4Q2F A;  1N1S A;  5T50 A;  1UIJ A;  1XE0 A;  5FPV A;  3GAL A;  4I01 A;  1K5J A;  3KM5 A;  1ND3 B;  2XHK A;  4QPG A;  4XF0 A;  2ZGN A;  3PVE A;  1W6Q B;  1SDD B;  4K20 A;  3IM0 A;  2ATF A;  2J22 A;  3ZSK A;  4AHZ A;  4E4Z A;  1R64 A;  4A7K A;  3ENR A;  2AEY A;  3ACL A;  2VO5 A;  4N8M A;  1PO2 1;  1DQ6 A;  4XDO A;  3ZXK A;  4RQP B;  1US3 A;  3PVB B;  3ILF A;  3PL0 A;  4NRP A;  2EA7 A;  4WM7 B;  4GKX A;  5FYU A;  5FZ8 A;  2DCJ A;  1JBC A;  1RMU 2;  3D5O A;  3CIH A;  2ZMN A;  3PME A;  4P08 A;  4XJ8 A;  3B5L B;  1OLR A;  2EXI A;  4URA A;  2QCS B;  2X29 A;  3PUQ A;  3VDC A;  2WAO A;  4HAN A;  3ZFG A;  2W5F A;  1W3V A;  3LF7 A;  5APA A;  3UKV A;  2WN2 A;  2VM9 A;  4DUV A;  1LUL A;  2QQK A;  4B29 A;  2XJV A;  3WD5 A;  3EQE A;  4EN7 B;  2UUR A;  1UXZ A;  5IVV A;  2DTY A;  4SBV A;  2A3X A;  4OUS A;  1E5R A;  1XYN A;  2JDU A;  4H2A A;  2HWB 2;  4P00 B;  3WDX A;  4Q4Y 1;  1W0O A;  5T54 A;  1VAL A;  1U12 A;  1OA3 A;  4CXX A;  3TEX A;  3IDA A;  2ZJC A;  3K77 A;  3NKG A;  1I5P A;  1ZRR A;  4AGR A;  5A80 A;  2J1S A;  1QF3 A;  1RUH 2;  1Q8S A;  1W3X A;  3Q9O A;  4BQX A;  4FI9 A;  4RHV 2;  1JOD A;  1B35 A;  2VNR A;  5G05 L;  4QKF A;  1HQN A;  3VD7 A;  2HWC 3;  3ZR6 A;  1FV3 A;  4A6O A;  5C9A C;  4H7L A;  5EXO A;  4XE9 A;  3GJA A;  1RUE 2;  3ZN6 A;  1XNA A;  3MPB A;  3W58 A;  1WCS A;  2RMU 1;  2HBT A;  1W6M A;  3K46 A;  5H9Q A;  2D93 A;  3T0B A;  3IIA A;  3LKJ A;  5CFD B;  4JGY B;  3OF1 A;  3ATG A;  4QX5 A;  3HN1 A;  4HXC A;  4HN0 A;  3ZDS A;  2ZEW A;  4RFR B;  4CCL A;  1D4M 1;  2JXA A;  5FUP A;  2G1M A;  4ZS2 A;  2QVS B;  4P5H A;  4P02 B;  1NZC A;  3ZXL A;  3I2J A;  3J26 N;  2WLP A;  5C3S A;  2V4A A;  1KQR A;  4EJR A;  2VOV A;  2P3K A;  4HN1 A;  3HIF A;  2WUH A;  4OHW A;  4YGC A;  2JDM A;  2WNV C;  1ULC A;  4HK9 A;  2Y38 A;  3B93 A;  1W6N A;  5CB7 A;  2OPW A;  3N36 A;  1XSQ A;  2A75 A;  1W05 A;  4Y3O A;  4Y5S A;  5CKQ A;  3GZA A;  3UGH A;  4IEW A;  2LTN A;  1WW5 A;  2RR1 3;  4LK7 A;  2JE9 A;  2QDR A;  4R4Z A;  4CU7 A;  2WO1 A;  3K48 A;  4YM2 A;  3FMG A;  5J09 A;  2D6L X;  1CAW A;  1F4A A;  1NLS A;  3KB5 A;  1JU4 A;  4J1X A;  1PX4 A;  3VD9 A;  3K4D A;  5JR2 A;  3FHA A;  2FBE A;  3BYW A;  1PK6 A;  3GM8 A;  3N7M A;  4LJH A;  3W5M A;  1DDL A;  2B46 X;  1JZ8 A;  4XFA A;  3CJI B;  1J3Q A;  5AC9 3;  1OH3 A;  5DN2 A;  1YNA A;  2E6V A;  1VBE 2;  2WNU C;  3OOX A;  4LQR A;  2BOJ A;  4XQW A;  5I0R A;  4KQ7 A;  3MIF A;  5LBF A;  4LIV A;  4NHL A;  2A7A A;  3RYK A;  2PYT A;  1ZZC A;  2OW4 A;  4KI5 M;  4CDX A;  4ATF A;  4FTB A;  1KFU L;  1LU1 A;  1DZT A;  1EUU A;  3ITQ A;  1JMU B;  5FOB B;  1YYN A;  2NP0 A;  3O1O A;  4KGG A;  3N9Q A;  1QNW A;  2WII B;  1AZD A;  4C0H A;  4E2G A;  2QQN A;  4FFG A;  3O1U A;  3AP5 A;  2PAM A;  1W2A X;  1R09 2;  2D5H A;  1PGW 1;  5IVE A;  2Q5T A;  2Y26 A;  4QQH A;  4ASL A;  1ZM1 A;  2JWP A;  4CP1 A;  4MG2 A;  1ND2 C;  4HPK A;  2G9Z A;  4ZY9 A;  1W06 A;  2TBV A;  3LSE A;  5JI9 A;  4IND A;  4OUE A;  1SQ4 A;  4LIT A;  4YFW A;  1XXN A;  2V4V A;  3ZPY A;  2H6B A;  1YUD A;  4JQR A;  2Y0O A;  4FTE A;  4RD7 A;  4QQP A;  5JI7 A;  3VKO A;  4QB1 A;  4RSU A;  3WNN A;  3K3N A;  4KBB A;  5A33 B;  1W2T A;  3EO6 A;  2C24 A;  5CVR A;  1I1E A;  5AFB A;  4XZP A;  3HR9 A;  3DUI A;  2RDN A;  2XH6 A;  1Y9G A;  2V72 A;  5LA0 A;  1SDW A;  1Y4W A;  2A3W A;  4FPO B;  1SAC A;  3E5U A;  4RA0 A;  3UT0 A;  2BWA A;  3VB9 A;  3III A;  4FPJ A;  4WV8 A;  2WDB A;  1DFQ A;  4NMI A;  5C8C C;  2YB7 A;  4JVA A;  4L9B A;  4CUC A;  2E53 A;  2CU5 A;  1RL3 A;  4OHX A;  1JYI A;  3HWJ A;  1D0G A;  2G9F A;  4NIG A;  2OS2 A;  2XJU A;  4CDQ A;  1YQC A;  3TNP B;  2J1T A;  1BQP A;  1YEW A;  4HOO A;  3KCY A;  4HLT A;  3UES A;  1LEN A;  4AG4 A;  2YPJ A;  4LPL A;  4DUX A;  3URF A;  2NM1 A;  3VDD C;  1H4G A;  1SLB A;  2JEN A;  3NRU A;  3T08 A;  1KIT A;  5LEK A;  3DPR C;  4CPB A;  2WQ4 A;  5BNO C;  1V9U 3;  2DFB A;  1COV 2;  3J7H A;  1VMH A;  4E27 A;  1UY4 A;  4JGZ A;  3CEW A;  4DXZ A;  3UKT A;  2XLF A;  1JUI A;  2DCZ A;  1Q8P A;  2ET7 A;  4N53 A;  5JLV A;  1BEV 1;  3K2O A;  5KC6 A;  2WNO A;  3H7J A;  3LSD A;  4J1W A;  5FY1 A;  4LHK A;  1CWP A;  2J1U A;  4JTO A;  2YC4 A;  3HJR A;  5JXI A;  3DKQ A;  2ZML A;  2GC1 A;  4RR3 C;  1ND3 A;  2D97 A;  2YU1 A;  1IG0 A;  2ZGL A;  3KGL A;  3OY8 B;  4PDW A;  5BNP C;  2WZR 3;  1EAH 2;  1GU3 A;  3AZW A;  3BOW A;  3QH7 A;  5DAW A;  5E16 A;  5LZ6 A;  4C91 A;  4Y5T A;  3C7E A;  5FZD A;  1MS5 A;  1VBD 3;  4LBQ B;  2E7A A;  5EP9 A;  3WW1 A;  2I45 A;  3D82 A;  5M0T A;  1C1L A;  3CKH A;  2BRT A;  5FK7 A;  5IK5 A;  2NLR A;  2J1R A;  4GB3 2;  4KG0 A;  1AX0 A;  5KC5 A;  1AR6 1;  1KDK A;  2J1E A;  1BYH A;  2OVU A;  1R08 3;  1K5M C;  1BBT 3;  1RHI 1;  1TMF 3;  3ACH A;  1VBA 1;  1MEC 1;  4OZO A;  4TN7 A;  1DG6 A;  4UW5 A;  2ZGS A;  1W04 A;  4LO6 B;  1GMM A;  1LHV A;  2B45 X;  2YBS A;  3B69 A;  5FPX A;  2HWE 2;  2WLQ A;  1KXG A;  2CNA A;  2RS1 3;  2OKX A;  1PZ9 A;  4ZKT B;  1HRV 3;  1T2X A;  2WO2 A;  2Z2S B;  1W2O A;  4YGD A;  4AE2 A;  1LU2 A;  2L9L A;  2VZT A;  3HNM A;  4PJY A;  4PLN A;  4V2W A;  3KV6 A;  5EJZ B;  3NAP B;  2E7Q A;  2OYZ A;  1JYW A;  1UD1 A;  1IOA A;  1ZBE 2;  2R06 1;  3VL8 A;  4PIZ A;  4IE7 A;  4V1P A;  2VL4 A;  1PVC 2;  3PTR B;  1AYN 3;  2XWJ B;  4BJ0 A;  3PVN A;  2WS9 2;  1F15 A;  2GDF A;  2Y33 A;  2H6C A;  5K8S A;  2OII A;  4UXA A;  1QY4 A;  1RXG A;  1NCR A;  2VQU A;  3CJX A;  4AQ2 A;  4FPC A;  3ZYH A;  4QX3 A;  1L3J A;  3AXE A;  4LOT A;  4B1M A;  2BBV A;  2D98 A;  1H8T A;  4GUL A;  4CEW A;  4DEV A;  3NNJ A;  2VME A;  4B4P A;  3AZX A;  1Z7S 1;  2ENR A;  1LOG A;  5IAV A;  5B4X A;  3I2O A;  1ENS A;  5FZ3 A;  1O3S A;  3TAY A;  1OD3 A;  1DLL A;  3NV4 A;  2ETE A;  2WQZ C;  3AZY A;  4XHX A;  3AL6 A;  3FFZ A;  2A3Y A;  5CFD A;  1FPN 3;  1LGN A;  3KSC A;  1CIW A;  1US2 A;  2V09 A;  2IXK A;  1H30 A;  3ACG A;  3LB9 A;  2ORZ A;  3R0R A;  5CFC C;  1J1L A;  2XB6 C;  4WM8 B;  4QDQ A;  4IE0 A;  1PO1 3;  1RUF 2;  1LOE A;  1FAY A;  4NE9 A;  4NPM A;  3N7L A;  2ZGU A;  3L2H A;  4TYS A;  2QQL A;  5KXE A;  4AK3 A;  3NL1 A;  5J7M A;  2B9V A;  2PXJ A;  3U10 A;  2CV6 A;  2QZ2 A;  1I3H A;  2XUE A;  3H50 A;  4XJA A;  3I3B A;  1VBC 1;  4XZU G;  5HPO A;  3P1I A;  2Q4S A;  1AR7 2;  1XBF A;  2VCC A;  2PFW A;  3UJQ A;  2ZGR A;  1EV1 2;  3WDU A;  4QPY A;  3GZT B;  4MGY E;  4Y5Z 0;  1MR5 A;  4QXB A;  5F7U A;  5IVF A;  2W1Q A;  1PO2 3;  2ZAA A;  4QWN A;  4YZ3 A;  1EY2 A;  2LRP A;  2RS5 3;  3WNL A;  3UK9 A;  1OXC A;  1QXR A;  5LBE A;  2WWS A;  2JG9 C;  3EBR A;  4LBN A;  4MHR A;  1CAV B;  3KD4 A;  4LUL A;  4MGQ A;  3RG0 A;  5L9B A;  3KGZ A;  2ZX4 A;  4XIK A;  3WQ1 A;  4GWN A;  3AYC A;  1L7Q A;  1K3I A;  4H14 A;  1LEC A;  2A6W A;  3IMM A;  4IV1 A;  4B1L A;  5F9T A;  1IQD C;  4XC9 A;  2QQV A;  4P9L A;  4S2F A;  4BWO A;  1SHW B;  1T6G C;  5L7O A;  3OYW A;  2VMH A;  4GZ9 A;  4JRA A;  3OEA A;  4K7J A;  4XFI A;  1PMI A;  4BXS V;  1XU1 A;  1XNK A;  1QHD A;  4XUN A;  2LW8 A;  4X6R B;  5L73 A;  3H3U A;  2HWC 2;  2JG8 B;  4F83 A;  3VBF A;  1Q43 A;  5CG9 A;  1NCQ C;  3IKW A;  4RFT 0;  5DDJ 3;  2JB8 A;  2ARC A;  1C8N A;  2R1B A;  3DEC A;  4R4X A;  4RGK A;  2TEP A;  3J7M A;  4CA9 A;  5ABJ B;  1OVP A;  3FUQ A;  1DIW A;  1QJU 1;  4Q4Y 3;  3ZKU A;  4BM8 A;  1R1Z A;  2VZP A;  4O9G A;  4PF1 A;  1W9Y A;  3ETP A;  2WL1 A;  4Q4V 1;  4L8Q A;  2XJS A;  3EYP A;  3OUJ A;  5FQ0 B;  1DBN A;  1RMU 3;  5DZG A;  1XND A;  4IET A;  4UW6 A;  5FTT C;  1I9R A;  5C71 A;  5L9R A;  3W59 A;  2VQT A;  4XYX A;  1O91 A;  3E5X A;  5D8A B;  1YQ5 A;  1U5X A;  2ZHK A;  3O0W A;  4XW3 A;  4QX8 A;  3E1F 1;  1W8Z A;  2Q30 A;  1W8H A;  3OJB A;  3ZFE C;  1NAE A;  1PZ8 A;  1ULG A;  2ZX1 A;  3IWZ A;  4HMZ A;  4YW2 A;  4XFC A;  5KXD A;  1DF0 A;  1CAU B;  1WKY A;  4CP9 B;  2HBU A;  1X8E A;  2Y0I A;  4NHM A;  5FYS A;  2AAC A;  4MOA A;  1AHS A;  1GP6 A;  1XJA A;  5BNQ A;  3R4U A;  4JTN A;  4CXW A;  4PIY A;  4YYO A;  2QKD A;  4IEP A;  4CVU A;  4LIU A;  3TEY A;  3NNG A;  1Y43 B;  3MW2 A;  1D4M 3;  1RUC 1;  2GP5 A;  3WW2 A;  3ZXD A;  1JZ7 A;  4BLI A;  3QBQ A;  5C3Q A;  4LHS A;  2IXJ A;  2XON A;  4Q1R A;  4QPI A;  1QJX 1;  3AKP A;  1RC6 A;  2D40 A;  4X6Q B;  4BOW A;  4YW6 A;  4M3C A;  2YDE A;  4IEO A;  4NUB A;  2JDA A;  5FYM A;  5LAS A;  5AC9 2;  5J96 B;  2EIB A;  1LHN A;  3I3M A;  4E8C A;  4Z2W A;  2Y6F A;  1ZYB A;  2ZHN A;  3PUR A;  1HJG A;  2O0O A;  2WWU A;  5T5O A;  1Z78 A;  4PLO A;  3IAQ A;  1V6J A;  3OGS A;  3PUS A;  4YVS C;  4QPG B;  1PGL 2;  1R1A 2;  2ADE A;  3GDB A;  4LHN A;  3T2T A;  4LOR A;  1DZR A;  4CEY C;  1HXS 2;  3JUU A;  4QDS A;  2ORX A;  5HXM A;  1WLW A;  1CZV A;  2BFU L;  1YQ8 A;  5JZG C;  5JIA A;  3HT1 A;  1O5L A;  1GOF A;  3AFG A;  1H4H A;  1UU4 A;  2DCT A;  1IQA A;  2HYK A;  4L0P A;  5I8S A;  2D3R A;  1QOS A;  3I2H A;  3HNY M;  4HKL A;  1N3P A;  2YXS A;  4LUM A;  1XPW A;  2DWR A;  1C8M 1;  1KDM A;  2Y6L A;  2IC1 A;  3AP4 A;  3WF2 A;  1E5H A;  1S2E A;  5EZW A;  4BYY A;  5CIS A;  1WCK A;  4O61 A;  3ZFG B;  2VCM A;  1BK1 A;  4LBQ A;  4WVZ A;  2J7M A;  5FPB A;  4NN0 A;  4MLO A;  4XXP A;  1RJ8 A;  2QJV A;  1G9B A;  2YYO A;  3ZSE A;  1QKQ A;  5C3R A;  4AQT A;  2NPI A;  3NV2 A;  3SQO A;  1Q8Q A;  1OPM A;  4D0Q A;  2WO7 A;  5DUX A;  5K7P A;  3ZMO A;  4K21 A;  4HT1 T;  2ZGQ A;  4ISR A;  4BIF A;  4TZD A;  1A34 A;  5LB6 A;  4A7Z A;  4B8E A;  3CLP A;  3NNF A;  2DUR A;  5BYN A;  4NAM A;  2ILM A;  1NE6 A;  4CU6 A;  1LOF C;  1U5Y A;  4RS5 A;  3VZO A;  1UMH A;  2FDF A;  3RFR A;  2NMN A;  1B35 B;  1BZW A;  1WA6 X;  1KD7 A;  4W8J A;  4E9K A;  1X8M A;  5SV8 A;  3LGR A;  3SCH A;  2RJL A;  4LBK A;  3FLR A;  2PN5 A;  4XF1 A;  2CSG A;  1A8M A;  1OPO A;  1R09 3;  3ZN6 B;  1RUD 1;  4CU8 A;  2EAK A;  1W6M B;  5FZC A;  3WG1 A;  5C3O A;  3P6B A;  3PJQ A;  5GLU A;  1OT5 A;  1STM A;  3O12 A;  1V9U 2;  4CP2 A;  2RDQ A;  3SHR A;  3WHT A;  1J83 A;  4U2A A;  2OZJ A;  4M3C E;  2VW0 A;  4PI0 A;  2W1S A;  4XTP A;  4EZH A;  1DZQ A;  2EXH A;  3T30 A;  3RGB A;  4A42 A;  1MAC A;  3KV9 A;  3VBO A;  4JKK A;  1UKG A;  4QAW A;  4D8M A;  4KU8 A;  2E32 A;  4EE2 A;  1NY7 1;  4Q1P A;  1W6N B;  2A6Z A;  1IG3 A;  5FBJ A;  5A1L A;  1O3T A;  1AVB A;  2RV9 A;  3POY A;  2WZR 2;  2VUD A;  2J1A A;  5C70 A;  2BGP A;  5DZF A;  1MZF A;  5A3M A;  3VBU B;  4AQ6 A;  1VBD 2;  5FMO L;  4DUW A;  1CAW B;  4IV3 C;  1W0N A;  1BEV 3;  3H8U A;  4QKN A;  1FYU A;  1PK6 B;  2VC9 A;  4YM3 A;  2X10 A;  3WUC A;  4AEM A;  2DDU A;  4OVE A;  4W6W A;  2YMZ A;  1OFS A;  2PQS A;  2IUW A;  5A3N A;  2QQM A;  1HV0 A;  1R08 2;  2JKX A;  1BBT 2;  1TMF 2;  4FT8 A;  4XJZ A;  4GAL A;  2XVK A;  3WOG A;  3F95 A;  2FMD A;  5I91 A;  1KFX L;  4UOJ A;  1FOD 1;  3ETQ A;  2ZAH A;  1UKR A;  2XBO 3;  3MEP A;  2WYF A;  3MFA A;  1OQ1 A;  2VNV A;  4IGO A;  5KBF A;  2RS1 2;  1SBE A;  3VBS C;  1W8W A;  4PT6 A;  3ZYI B;  5BV6 A;  1LRH A;  2PLV 1;  5FZL A;  4BQY A;  3POW A;  1AR6 3;  4YAR A;  4A2U A;  2CTV A;  1QEX A;  3HNB M;  3PUI A;  1JS9 A;  1G8W A;  2X8K A;  3TEW A;  1AYN 2;  5GZG A;  2VH9 A;  1UAI A;  4Q0S A;  2IXC A;  1RHI 3;  5DG2 A;  5FZO A;  1VBA 3;  4XIO A;  3ZYR A;  1KS5 A;  3OGJ A;  4HPK B;  1S0E A;  4LKE A;  1BKZ A;  3IDC B;  4I3P A;  5FPZ A;  5DPN A;  3ZXA C;  4AVV A;  3E6C C;  4NID A;  2ARB A;  2VY0 A;  4NJ4 A;  3HAG A;  1ACC A;  5C7G A;  1UOJ A;  2QUO A;  2Z69 A;  5FO9 B;  4C1X A;  3MW3 A;  3SCF A;  3K3O A;  2R06 3;  5I8Y A;  5FYY A;  1F5F A;  1UZV A;  4TLF A;  3N9O A;  4LLO A;  1VP6 A;  3O1S A;  1RVF 1;  5FOJ B;  2VBP A;  4YG3 A;  5EJ1 B;  3W20 A;  3OGV A;  4SLI A;  3KHC A;  2XJQ A;  1S2K A;  1PIV 1;  1FPN 2;  2O8O A;  3W21 A;  3GJB A;  4AFA A;  1A6C A;  2XXZ A;  1PO1 2;  3U0Z A;  1K45 A;  3JBG 1;  4A7Y A;  1VBB 1;  5FYZ A;  4QM8 A;  5KHI A;  3C7H A;  3TN9 1;  3AX4 A;  4CDQ B;  4Q27 A;  4BB3 A;  1OOP A;  1O3R A;  3GBF A;  3JXS A;  4XTM A;  3U78 A;  4ZZ5 A;  3VDB A;  5LA1 A;  1QXP A;  1IHM A;  1OLQ A;  5EYY A;  2A6X A;  1AYM 1;  3BU0 A;  2UYB A;  1YRZ A;  5FP4 A;  4YVW B;  1HQL A;  4K3U A;  4FPY A;  3ALQ A;  4FQ4 A;  4XF4 A;  2X5I A;  3BAL A;  1HX6 A;  4BE3 A;  2W39 A;  4GMP 0;  1W9W A;  4XFF A;  3VZN A;  2GN3 A;  1N3O A;  1DHK B;  1UMZ A;  1JTZ X;  1PO2 2;  2H0V A;  2EVX A;  1J58 A;  2YBK A;  3BGA A;  5K0U B;  4JGZ B;  4XMI A;  4YW3 A;  1JZ6 A;  3BTZ A;  3B9C A;  1O59 A;  3B01 A;  4COU A;  3MZH A;  2F6B A;  4N53 B;  3VDD A;  4BH9 A;  1JUH A;  1GOH A;  1TG7 A;  3B02 A;  3E97 A;  1VBC 3;  4FXG B;  4K1Z A;  5BNO A;  5HV0 A;  3U37 A;  3AJZ A;  2OZ6 A;  3H3Z A;  4UFK A;  1PNG A;  4QM9 A;  4YGB A;  5GZF A;  1U5I A;  2FDJ A;  5A1F A;  3RMY A;  4PDW B;  4N43 C;  5J3U A;  1WBL A;  2XR4 A;  3J8F 1;  3K4A A;  1SG3 A;  3VGI A;  3N9L A;  2ET1 A;  1NUK A;  1Q8O A;  3DKW A;  3T4V A;  3WQ7 A;  1ULE A;  1X36 A;  2DVD A;  2QE3 A;  5DDJ 2;  4Y4R A;  5BPX A;  3E6B A;  2ZGM A;  2KXL A;  5F8P A;  1RUF 3;  4OHZ A;  5BNP A;  2WA4 A;  3AKQ A;  4H55 A;  5FLH A;  4Q4Y 2;  3RZJ A;  1YIP A;  2Z5W A;  1MS1 A;  2VE1 A;  1QJY 3;  3S0M A;  4DRV A;  1CPN A;  1OSG A;  2VNG A;  4QKD A;  5T5P A;  3MW4 A;  4XOG A;  1JYX A;  1LTE A;  4LO4 B;  2GC2 A;  1XYO A;  4QMA A;  4AVS A;  5C6C A;  1DGR N;  5FBZ A;  4BU2 A;  4A45 A;  1AR7 3;  2LS6 A;  3LQC A;  4AVB A;  1RTV A;  4P9G A;  4B4R A;  1EV1 3;  1WZX A;  3RS6 A;  4AQS A;  2BVV A;  2Y6H A;  3NJY A;  1E57 A;  1K5M A;  1RUG 1;  4WVV A;  3KLS A;  3VD4 A;  2QQP A;  1QJU 3;  1UU6 A;  2J42 A;  4JV4 A;  3VKF C;  2RMU 2;  2YUE A;  3VBH C;  4Q4V 3;  4CCD A;  3O1T A;  1VB2 A;  2OUH A;  4XXA A;  4FP3 A;  4KGQ A;  1BMV 2;  3NMB A;  1D4M 2;  5G04 L;  5C5T A;  2AEN A;  1HN0 A;  2QQI A;  2OQ6 A;  4CCO A;  3I59 A;  5DAB A;  1UZW A;  1NCR B;  4FCA A;  4DFS A;  1V6K A;  4DB5 A;  1EUT A;  1FI2 A;  2Q1M A;  4WVM A;  3VUO A;  2GMM A;  5CU1 A;  1H8T B;  2CAU A;  2WC2 A;  3AMP A;  4CEW B;  3N9P A;  4DY3 A;  2ARX A;  4Z2A A;  1RUI 1;  4BA6 A;  1FNZ A;  1V6M A;  3MPP G;  1GFF 2;  4JKM A;  4XF3 A;  4FTS A;  5A6Q A;  5J36 A;  2RHP A;  3RJ2 X;  3MLL A;  3FC0 A;  4FPL A;  4UWD A;  3VD3 A;  1PZ7 A;  5F5C A;  2E63 A;  4A4A A;  3LPF A;  3MIC A;  5IYY A;  4UFJ A;  3A23 A;  4GH4 C;  2VOW A;  3NAP C;  1QJX 3;  2VD7 A;  1NA1 C;  2ARA A;  3AMN A;  3NKT A;  2R32 A;  4OHV A;  4PF5 A;  1E5S A;  4UBG A;  2GH2 A;  2GH8 A;  2DBN A;  2C9A A;  2D7F A;  1ZA7 A;  4M4P A;  3GNE A;  3NV1 A;  4URT A;  2RDS A;  2RM2 3;  4D6R A;  1WWY A;  1LR5 A;  2K9Z A;  5CFC A;  5LRR A;  4AED C;  3HQU A;  3DV8 A;  3OPW A;  2BWC A;  4GQ7 A;  3W5N A;  4HG6 B;  1UY1 A;  3HEI A;  3DCQ A;  4YW5 A;  5FZ7 A;  4LA3 A;  4HET A;  3VBU A;  5JDB A;  4ES8 A;  1WLT A;  4Y4Y A;  2W3J A;  2VVD A;  2PHT A;  1OBN A;  2WRA A;  3APB A;  2YRO A;  3RDI A;  5FZK A;  1QDC A;  4NWW A;  1B09 A;  1H6Y A;  5I0T A;  4DPN A;  1X9T A;  1X9P A;  2PHD A;  4HBN A;  4YW4 A;  4ZXE A;  2BFU S;  2BEO A;  2E9Q A;  2W95 A;  2W94 A;  3I2D A;  5LA9 A;  5KHG A;  1LHO A;  1TME 1;  2WYS A;  3ASI A;  2P6H A;  5C4W C;  1HV1 A;  1VRB A;  3LDK A;  4IV1 B;  3TNQ A;  1S0F A;  5L7O B;  4KWK A;  2E51 A;  2PA7 A;  2VUL A;  3BN6 A;  3OYW B;  1RUE 1;  1UL9 A;  2EID A;  3LWC A;  3UV9 A;  4CDW A;  4CCM A;  1R1A 3;  5A6X A;  5IVB A;  3V0A B;  2AYH A;  1HXS 3;  3BOD A;  4ONU A;  1MZ5 A;  4OZX A;  3VBF B;  1G6N A;  3N9N A;  4QX2 A;  4YZ4 A;  4IGP A;  1OI6 A;  3ILN A;  2BVB A;  3WF4 A;  3ELN A;  2R6Q A;  3BB6 A;  1GQP A;  4LNV A;  4Y1U A;  4ATE A;  1LED A;  1JZ5 A;  3KZ4 C;  1MQT C;  2PTM A;  4HVQ A;  5JOW A;  3HMY A;  3T2Q A;  3LIG A;  2Y64 A;  5JMC A;  1OA4 A;  4CCC A;  1AJK A;  5FMB A;  3D3A A;  3GXU A;  4NRQ A;  4FFH A;  4JHZ A;  1AX1 A;  3IPV A;  5BXX A;  3V65 A;  5DAP A;  3OCP A;  2WN3 A;  1O7F A;  3DYP A;  2KD7 A;  4YZ5 A;  2CGP A;  2A6V A;  4QPW A;  2GME A;  1F8V A;  3E6D A;  3WG2 A;  1RUD 3;  3AYE A;  3N7K A;  3WP6 A;  1OH4 A;  4AI2 A;  1GBG A;  2IFR A;  2A71 A;  2UYA A;  4DS0 A;  3M1H A;  4NIA A;  1HIX A;  3MV1 1;  1FNY A;  4FFI A;  3GCW A;  5FP9 A;  4A3X A;  2LRO A;  1ZA4 A;  2BGO A;  5ABJ C;  1BEV 2;  1WCU A;  1ASJ 1;  1LOB A;  4XJ9 A;  4QPI B;  4AF9 A;  3IB3 A;  1ZRD A;  1VR3 A;  2ZKL A;  4M3C B;  5EHD A;  3SNM A;  2WAA A;  3VZL A;  3WNO A;  3KV5 A;  1GZW A;  4BK5 A;  2WJS A;  3AB0 A;  3KT7 A;  5A7N A;  3BTX A;  4AGV A;  1UMI A;  1AJO A;  4Y1X A;  4YVW A;  2PAE A;  4EN9 B;  5GZE A;  3LZZ A;  2ID4 A;  1WBF A;  2Z79 A;  4JCK A;  5DAX A;  3KWV A;  1DQ4 A;  5F5Q A;  2O14 A;  5FMD A;  4BPZ A;  2ZEX A;  4XDP A;  2XBO 2;  4YG6 A;  4NHX A;  3WW4 A;  4BQ1 A;  5FXW A;  3LD8 A;  2E31 A;  2RDR A;  5BY5 A;  1WMX A;  5K0U A;  2BP6 A;  2D3S A;  4QQL A;  3WQB A;  4EWE A;  2VZR A;  2Y6G A;  4YVS A;  1FMD 1;  3MIH A;  4FXK B;  5FMO S;  5HCF A;  3WEZ A;  1AR6 2;  4I0A A;  3EXU A;  4CEY A;  2B4K A;  4FQZ A;  1XC6 A;  3RJR A;  1RHI 2;  5FV3 A;  2VXJ A;  2BV4 A;  1VBA 2;  1Y9Q A;  4XBQ A;  5JZG A;  5I8T A;  1FOD 3;  1OKQ A;  1ZRE A;  2VG9 A;  5FK8 A;  1DQ0 A;  4ZU7 A;  5FZ9 A;  1HRI 1;  2ZOE B;  2DF7 A;  5EJ3 A;  3O1P A;  2WFP A;  2MEV 1;  2R06 2;  1TQ5 A;  4MGZ E;  3KS7 A;  2J1V A;  4QPG C;  2DU0 A;  2PHR A;  2VR4 A;  3RZH A;  1XYP A;  1IKP A;  1RB8 G;  1P8J A;  1AR9 1;  2ZMK A;  3A22 A;  3LCP A;  4XFH A;  2JDY A;  1CGP A;  4R52 A;  2C0Z A;  3TEZ A;  4N7I A;  4K6B A;  2PHX A;  4AWD A;  5A1A A;  3IBM A;  3PUH A;  1FT9 A;  4I0B A;  5FZG A;  2ADD A;  3WNX A;  1SLA A;  2LUW A;  4QD2 A;  4L11 A;  4RS5 B;  1I5Z A;  3RYR A;  1VAM A;  2R16 A;  3U4X A;  5LK5 A;  2XWB B;  3W9A A;  2ARE A;  3ZR5 A;  4IE4 A;  1RVF 3;  2GAU A;  3H1Y A;  1LOF A;  3S7I A;  2FDH A;  2ZZQ A;  1GP5 A;  2X09 A;  4HSJ A;  3ZXF A;  5CBL A;  1PIV 3;  1IGO A;  1LGB A;  3U14 A;  3ZFG C;  4K8R B;  5EV7 A;  5IHR A;  3T4H B;  3M3I A;  3T3Y A;  4CCJ A;  5JIU A;  4YW7 A;  2WZP P;  3BIW E;  4FPE A;  4OFG A;  3JBG 3;  3WSO A;  1V6L A;  2K2S A;  5IW0 A;  3QD6 A;  2OA2 A;  1O8P A;  3WIN E;  1C5I A;  1AL0 G;  5F2S A;  3TN9 3;  3ZIX A;  4B3N A;  4Z8B A;  3O7O A;  3CU7 A;  5FP8 A;  2BPA 2;  5FXX A;  1UYP A;  1WME A;  2X53 S;  3MLK A;  1ZZB A;  3NNM A;  4OQ9 A;  1VBC 2;  3VN4 A;  5IJR A;  3VBO B;  5IK8 A;  1SLT A;  4A3Z A;  2UY9 A;  4R8H A;  1X33 A;  3AL5 A;  1LAJ A;  5C33 A;  5FZ0 A;  4EN8 B;  5CAD A;  1BJQ A;  4GB3 1;  2E26 A;  4JAA A;  3MID A;  3NJZ A;  4OI2 A;  4R9D A;  2NYY A;  3LE0 A;  4PIX A;  2R04 1;  1N1V A;  3KV4 A;  1W6P A;  4QU1 A;  3RRD A;  2XLA A;  3AJY A;  3HD8 B;  5FUN A;  1C1F A;  2WIN B;  3BPS A;  1V6O A;  3L2Y A;  4PHZ A;  1F2N A;  1VRH 3;  1VIW B;  1X82 A;  3ORJ A;  3NJX A;  5LK7 B;  3ZFF A;  3BIE A;  1POV 3;  1CAX A;  4M3C F;  3NO8 A;  3N3H A;  4M0H A;  3I49 A;  2YU2 A;  1QJY 2;  3LEK A;  2R07 1;  4OHY A;  1GAN A;  1QU0 A;  3SIS A;  1JYT A;  1W8T A;  3AMH A;  5HXV A;  3RZL A;  5FKB A;  4IV3 A;  2ZZJ A;  1AR8 1;  4N7U A;  4XBN A;  2B8M A;  2CHH A;  1VE0 A;  3B00 A;  1ZBE 1;  3THC A;  1Q8V A;  4TSV A;  1YJL A;  1WCD J;  1W8N A;  4MYE A;  2F4P A;  3GCX A;  1SPP A;  4QXC A;  1NLQ A;  1RYY A;  4COY A;  2EXK A;  2ZGK A;  3RYP A;  3FUO A;  1QJU 2;  2BQP A;  1C57 A;  5E6H A;  4XUP A;  2CY6 A;  3S7E A;  1UX7 A;  4Q4V 2;  5EPA A;  1KJL A;  2QFE A;  1XQN A;  5KXB A;  2A70 A;  4M0N A;  3VBS A;  1RUO A;  2ZGT A;  5FZO B;  3QCW A;  4UF0 A;  2WA3 A;  4D7Y A;  3BI3 A;  3X29 B;  3ME2 A;  3RPQ A;  3V0A A;  3P5B A;  4NPL A;  1UIK A;  1N3Q A;  4XFB A;  3BCW A;  2Q8D A;  1RUG 3;  2XL9 A;  2ZX0 A;  4M4R A;  3ZN5 A;  2GN7 A;  2FD8 A;  2XUM A;  1V0A A;  1QJZ A;  3MV0 1;  3JB4 C;  3WG4 A;  1OLM A;  3VD5 A;  2PHW A;  4ZU4 A;  4IQP A;  3ECQ A;  4Q0P A;  2A73 B;  4CDX C;  5FLJ A;  2BNN A;  1SFP A;  4HKO A;  1BCX A;  3H1W A;  3ZYF A;  1F4H A;  4KL1 A;  5JPN B;  3WLU A;  2C26 A;  4C90 A;  5F3G A;  1O4Z A;  3SIT A;  3VKM A;  5D1I A;  5GZC A;  4PQ9 A;  3KMH A;  1RXF A;  4W6X A;  1QJX 2;  3PU8 A;  5HCB A;  4LBO A;  2V73 A;  3C3V A;  1TZO A;  1N1Y A;  2C6S A;  4Q4X 1;  1JYN A;  5J1X A;  1JOJ A;  3RWK X;  3M3Q A;  4BQ5 A;  4EN6 B;  5L36 A;  3MIG A;  2RM2 2;  4LE4 A;  1OOP B;  2HKX A;  1RUI 3;  2ZCW A;  4HZF A;  4ITC A;  4QX1 A;  4CDU C;  1G9A A;  2WFF 1;  5DUU A;  3VHP A;  1SZB A;  2RMU 3;  3LPG A;  5T5J A;  5FCC A;  2Y34 A;  5JWP A;  1WCQ A;  1JZ4 A;  3JB8 A;  5FRA A;  4WVW A;  2X5I B;  4GA9 A;  3H8X A;  2FQP A;  4IEQ A;  5FY5 A;  2I2S A;  3PJY A;  4YPJ A;  4XF9 A;  5JXG A;  4LTA A;  3PMS A;  2P37 A;  2RVA A;  5FZH A;  5EIY B;  1W6O A;  2W0X A;  2G4I A;  1UCX A;  3BU7 A;  1TNR A;  4LEJ A;  3H0O A;  2SLI A;  3VDD B;  1JH5 A;  3HQR A;  5KHH A;  2OQ7 A;  4AYU A;  2EF6 A;  4HL0 A;  3NJV A;  2P5B A;  3MIE A;  4ORF A;  1UZ0 A;  5A3O A;  3WDT A;  5BNO B;  5JXH A;  4XDQ A;  2VZO A;  3ACI A;  1DLC A;  1UO9 A;  4XFG A;  2QQJ A;  4YM1 A;  3RZZ A;  2F4L A;  2FCU A;  1O3Q A;  5FYH A;  4CDQ C;  1NYW A;  2BJS A;  3ZMN A;  2ZS6 B;  5FXZ A;  3VKL A;  4Y1Z A;  1LCL A;  1NX9 A;  2BTV C;  1S0B A;  5FMC A;  4QXH A;  3A7Q A;  4ERO A;  2JDK A;  4RR3 B;  1HN1 A;  1G9C A;  4C8D A;  5BNP B;  3FHI B;  3KVA A;  4N43 A;  4K1Y A;  4NPR A;  3WCR A;  1TME 3;  1CJP A;  4D6S A;  1REE A;  2D6N A;  3WF3 A;  3VBR C;  1ZRF A;  4MGT A;  1OF4 A;  3LFI A;  3OBR A;  4QU2 A;  4AI1 A;  1YHF A;  3C8X A;  2DUP A;  5BNN C;  4LK6 A;  1OUR A;  1Y9M A;  1PNF A;  3KT4 A;  3ZO0 B;  4DO0 A;  4JQT A;  2HEW F;  2B39 A;  2RR1 1;  1H2L A;  2D43 A;  2ZHM A;  4AL9 A;  4MXV A;  4QHB A;  3LA2 A;  5JXJ A;  3H8R A;  1IPK A;  3DYM A;  2D44 A;  1K5M B;  3I3E A;  5CYY A;  4Z92 B;  1ND3 C;  3O5S A;  5JOX A;  1RUD 2;  4CXY A;  2GC0 A;  1J3P A;  1X7N A;  3I7D A;  5F5A A;  5GKA C;  3VZK A;  1UOB A;  1G86 A;  1TVG A;  4IUG A;  3U75 A;  1CR7 A;  4BZ4 A;  1OUX A;  2D6M A;  3T1M A;  4CUA A;  4Q4W 1;  4CSW A;  2B42 B;  4I09 A;  1ZX5 A;  4TLG A;  3I59 B;  3H42 B;  2ZA9 A;  4RQP C;  3VBH A;  2PMW B;  2RJ2 A;  4WZF A;  3ZM8 A;  1NKG A;  4Y1Y A;  1A3K A;  4WM7 C;  3WR0 A;  3KCC A;  1GKB A;  4GWJ A;  4WVM B;  5AFE A;  2XPJ A;  4NO4 A;  1Z0H A;  4AR2 A;  1NY7 2;  5CEH A;  1W8O A;  3SEE A;  4CUB A;  1ZZ6 A;  1VAV A;  5LBB A;  1GSL A;  4RL7 A;  2P3Y A;  3MGU A;  2XKO A;  1VLN A;  4EWD A;  5FPA A;  3LOB A;  1A8D A;  5IWF A;  3BVC A;  3OSD A;  4DEQ A;  3GZU C;  5FP3 A;  1XRU A;  2V5Y A;  1ASJ 3;  3HQX A;  5C9A A;  3LIH A;  2CGN A;  4AI0 A;  5DUV A;  3AP9 A;  1O4Y A;  4YWA A;  1BHG A;  2PHF A;  5E8A A;  3ZOI A;  2HWD 1;  3OBZ A;  3A0N A;  2VMF A;  1OUS A;  4FPK A;  5FPL A;  1UZY A;  4V2V A;  4GH4 A;  4MSV A;  2XG3 A;  1XE7 A;  1NA1 A;  3M3C A;  4KWJ A;  5H9P A;  5CFC B;  1NCR C;  1XE8 A;  2VEC A;  1WW7 A;  5FZF A;  2F17 A;  4Q0Q A;  5SV5 A;  1FOD 2;  4AVT A;  3T0A A;  2VUC A;  3V0B A;  1O4T A;  1PM4 A;  4K40 A;  3MF6 A;  3EJK A;  3NV3 A;  2R1D A;  4KWU A;  4D3W A;  4E4D X;  1UU5 A;  1IPJ A;  3FZ3 A;  3HT2 A;  5IFT A;  5KHJ A;  2YPD A;  4CEW C;  1ZNP A;  1YLL A;  1RUJ 1;  2WNV A;  4AED A;  1D0H A;  1FMD 3;  4MGS A;  2D3P A;  2EXJ A;  3T0D A;  2DUQ A;  2YFU A;  2JDH A;  5ACA 1;  5JSR A;  1CX4 A;  3OBT A;  3JU9 A;  5CFD C;  4P5Y A;  4JGY C;  2D6K A;  2QQO A;  2P4E A;  2AUY A;  4COZ A;  4NII A;  1MS9 A;  3MF9 A;  4QQO A;  2QQW A;  4B4Q A;  1DGW X;  2HEV F;  1W9S A;  2VZQ A;  1HRI 3;  2AGS A;  3INA A;  4JDO A;  1S1A A;  3JZV A;  2XQR A;  2ZGO A;  4BQ4 A;  3ZSJ A;  2VMC A;  5EYX A;  2FDK A;  2BW8 A;  1QJF A;  2MEV 3;  5DAV A;  4CDW B;  3S57 A;  2WNU A;  5FYV A;  1H8V A;  1JOB A;  4RN5 A;  3VDA A;  5C4W A;  2Q8O A;  5DQ0 A;  2WNE A;  4EQV A;  1WW6 A;  2ZBJ A;  5GM0 A;  1QIQ A;  4FVV A;  1RVF 2;  1G7Y A;  1CN1 A;  2P6C A;  4YLZ A;  2GNB A;  1AR9 3;  1HB3 A;  3ZIW A;  4UFM A;  1PIV 2;  1HJF A;  2BZD A;  5FYB A;  3ZKY A;  4ARX A;  3R05 A;  4P9Y A;  4AOC A;  2TNF A;  3LFM A;  1W90 A;  4LE3 A;  1J1T A;  2R0H A;  4TXW A;  3UGF A;  3JBG 2;  1MEC 3;  1ODM A;  1OF3 A;  3WHU A;  1VBB 2;  2XKP A;  1CX1 A;  1H2M A;  3CQO A;  2W1U A;  3CJI C;  3TN9 2;  1ZBA 1;  3FFQ A;  3GHM A;  1KEX A;  1UW8 A;  3IPV B;  1PM7 A;  4QQ2 A;  4DMI A;  2WZR 1;  1GNY A;  1GV9 A;  1MQT A;  1W03 A;  1JOP A;  4XAB A;  2XHN A;  2VU9 A;  5FKC A;  5A7Q A;  3THP A;  2EIE A;  2YG0 A;  1ND2 A;  4XUT A;  3ZN4 A;  3MLJ A;  4FSJ A;  2GC3 A;  4NWV A;  4R9C A;  2ZAB A;  2YC0 A;  2D6O X;  2DCK A;  1CZS A;  5A3L A;  4HKW A;  3VBF C;  3WVJ A;  5IT6 A;  5FAX A;  3DN7 A;  2VQA A;  3S30 A;  4FO9 A;  3NST A;  1UN1 A;  1VRH 2;  3HVD A;  5CZK A;  1BBT 1;  5FZM A;  4LXL A;  4YFZ A;  2NN8 A;  1PX3 A;  4MGK E;  3AFK A;  5C5U A;  4YZ2 A;  2MHF A;  5HV4 A;  1SFY A;  4COV A;  3M8L A;  2VW1 A;  3JD7 1;  4XHB A;  4X8N A;  4PBP A;  1U0A A;  2C5D A;  1Z7S 3;  4J6G A;  3NNL A;  2DFC A;  2RS1 1;  4RYD A;  5CKN A;  3FN9 A;  5C8C A;  5LW9 A;  1HRV 1;  1DGR A;  1GZW B;  4CCK A;  2E33 A;  1QGL A;  2WAB A;  3ZSM A;  3J8F 2;  4OYU A;  3AVR A;  4EN0 A;  4BME A;  2R04 3;  1V00 A;  4OUM A;  5JOZ A;  2HWF 1;  2VZV A;  4BQ2 A;  5JR7 B;  1OKO A;  1OHF A;  3OBA A;  4XUQ A;  5FZ4 A;  2XJP A;  3ZVX A;  4AVA A;  3WP5 A;  3POB A;  3LOI A;  1K12 A;  1MVQ A;  3AKR A;  4P14 A;  2YHJ A;  1GWM A;  1UPS A;  5FYI A;  1ULD A;  1W8U A;  1UY2 A;  3RNS A;  1RIT A;  3GGL A;  3THD A;  4AHY A;  2R07 3;  4E2S A;  2Q1F A;  4XAE A;  4YVS B;  2QNK A;  4L92 A;  4F7Z A;  2TUN A;  4LHL A;  1LEM A;  2I74 A;  3NW4 A;  2WZ8 A;  3DPR A;  4CEY B;  1AR8 3;  4G9S B;  1NZI A;  4D7T A;  3CL1 A;  2CWS A;  2VNO A;  2B9U A;  1LNS A;  3RVH A;  3USS A;  2Q8C A;  2DVA A;  4GWI A;  2YZ4 A;  2EAA A;  4A6S A;  5JZG B;  4N9I A;  2HEY F;  1KGY A;  4IW3 A;  3SMH A;  3WV6 A;  4P9J A;  5HBA A;  4FPF A;  1CPM A;  3WX5 A;  1UOF A;  1QH7 A;  1RUG 2;  3K51 A;  4DOU A;  4UW4 A;  1Y3T A;  2WT0 A;  5GLW A;  3O1R A;  1TNF A;  1UY3 A;  1GZ9 A;  1LGC A;  3WNK A;  2VCB A;  4RR3 A;  4XPV A;  4HVR A;  3WF1 A;  5JOY A;  2Z4F A;  4AW7 A;  3MI8 A;  5A7W A;  1TEI A;  1RED A;  2YV8 A;  3VHR A;  1DQ5 A;  3CO2 A;  3FL7 A;  1DQ1 A;  3GBG A;  1QMJ A;  3OEB A;  3FBY A;  1S0I A;  3ZYP A;  4EV0 A;  2OPK A;  3B7M A;  1DGW A;  1AL2 1;  2WWJ A;  3GYD A;  2QBX A;  1UWW A;  2JIG A;  2A6Y A;  1IS3 A;  1QQP 1;  2OX0 A;  1G9F A;  4QDR A;  2N7G A;  2WT2 A;  5F37 A;  1ENQ A;  1YI7 A;  2WSU A;  3KF5 A;  3N7J A;  1RUI 2;  2Z42 A;  4HFS A;  5DMY A;  5B4N A;  3O1M A;  2GU9 A;  1GQH A;  2WKK A;  2JE7 A;  3DEM A;  4OI1 A;  4DRR A;  2GSY A;  2RS5 1;  4MH0 E;  2CAV A;  4S2D A;  4Z82 A;  4CTE A;  3WF0 A;  2DVG A;  2BGC A;  1AF9 A;  2DUO A;  4JDN A;  5A7O A;  1SLC A;  3FLT A;  3WDV A;  3WT3 A;  2CDP A;  4XUO A;  2ES3 A;  1SEF A;  3IT8 A;  2RS3 1;  3AYD A;  1ZVF A;  1HDK A;  5F5I A;  4Q4X 3;  4L97 A;  1GWK A;  2CL2 A;  4IE5 A;  2VBB A;  5JCT A;  1OFN A;  4GJZ A;  1OD5 A;  2JDP A;  2OUJ A;  2UWC A;  3C7O A;  2ZKN A;  2WFF 3;  4MET A;  2Q8E A;  4QGM A;  3WNM A;  1OVS A;  1WUV A;  4QX7 A;  1E5I A;  5FXV A;  1GUI A;  1WMD A;  3J9S A;  1RIR A;  3K4Z A;  5FZ6 A;  5DDJ 1;  2HH9 A;  1MZE A;  3USU A;  1VJ2 A;  4L2N A;  1Y7B A;  4RS5 C;  4Y22 A;  5GAL A;  3WDY A;  4B7K A;  1FXZ A;  1V6I A;  3PVO A;  5TSW A;  1UF2 C;  1GOG A;  1RUC 3;  4XVH A;  3ROU A;  3WZ1 A;  5F39 A;  2Q0A A;  2QQU A;  5T5L A;  1W6P B;  5JSP A;  3WUD A;  1AXK A;  1ENX A;  1RMU 1;  3SEP A;  3WW3 A;  2FZ2 A;  2FHR A;  3PDQ A;  3SXW A;  5A7S A;  3VZJ A;  3ZFF B;  3CNA A;  1CAX B;  1TME 2;  5DAQ A;  5A7P A;  2EAL A;  2P3J A;  3ACF A;  1URX A;  1HLC A;  4DZG A;  1CZT A;  1LOA A;  4XJU A;  2VTX J;  5H9R A;  4AGG A;  2JD4 A;  3GF6 A;  3LEM A;  2DYC A;  3AZZ A;  4GAZ A;  3BTY A;  3RZG A;  4IV3 B;  2GP3 A;  4ZZ8 A;  3PLQ A;  4O9E A;  1UQX A;  3D0S A;  1JN2 P;  1HB4 A;  1D2S A;  1GIC A;  2HWB 1;  3POF A;  4KU7 A;  4Q0V A;  3VBO C;  3UNP A;  1CIY A;  1SPP B;  4GWM A;  3ZSL A;  1KJR A;  1BMV 1;  5FZI A;  1BXH A;  5GLV A;  3POG A;  5F3C A;  4XET A;  1PGW 2;  1YFY A;  4KH9 A;  5F3I A;  3VL9 A;  1RUH 1;  1UYX A;  3O14 A;  1ULF A;  3FE5 A;  5EFU A;  3VKN A;  1C8M 3;  4RHV 1;  1W39 A;  5E1R A;  4E4H A;  4L99 A;  1XNC A;  3PUA A;  4XUR A;  4WM8 C;  3VBS B;  3GBW A;  3WP4 A;  4WZC A;  5DXD A;  2XQX A;  3SC7 X;  4UAP A;  1LJ7 A;  2VPV A;  3POS A;  4UF0 B;  5T3N A;  4AHX A;  4N90 A;  4XCB A;  2JG9 A;  4FPG A;  5FZ1 A;  5JVV A;  1REF A;  3SLI A;  1VMJ A;  4BQ3 A;  1UXX X;  3J7L A;  1H1A A;  3UL2 A;  5KWR A;  2GNT A;  3I54 A;  1S2B A;  5A3P A;  5A70 A;  3UJO A;  1T6B X;  3RI8 A;  2WSV A;  2XJT A;  1N1T A;  4PQQ A;  2VZ1 A;  3ZYB A;  4CU9 A;  4W6Y A;  1GR3 A;  2W52 A;  3MO4 A;  4FOY A;  5A3W A;  2JB4 A;  3TOJ A;  4R9B A;  5J37 A;  1H1M A;  1ST8 A;  4Q4W 3;  4Q8L A;  3FBM A;  5FO8 B;  4MUV A;  5KHK A;  4UFI A;  4W65 A;  5J48 A;  1NCQ A;  3AXD A;  4S2H A;  1ASJ 2;  4BLJ A;  4FFF A;  1OQE A;  4IEV A;  4IDZ A;  2BNM A;  1I6X A;  3AYA A;  3IDB B;  3ZDV A;  4YW1 A;  1F9K A;  5LAT A;  4CPB D;  1LOC A;  3KVB A;  2ERF A;  4IEX A;  4UW3 A;  1JZ2 A;  1HB2 A;  3OD0 A;  3OG2 A;  4FPH A;  2FDG A;  3C7G A;  4NOT A;  1S4C A;  2XGX A;  5I0U A;  1Q56 A;  4K8F A;  4LKS A;  4DIN B;  5ANQ A;  3ZYG A;  3VHO A;  2JEC A;  2DVB A;  2VOT A;  2GNM A;  2B5H A;  3M2M A;  3ST7 A;  2YGM A;  4XBL A;  4E8D A;  4F3J A;  1GP4 A;  3EMR A;  3ZFE A;  2K0G A;  2OT7 A;  4LUK A;  5CAZ A;  1JYV A;  4NIH A;  2D6P A;  2JG8 C;  4CDU A;  4P9W A;  1VBE 1;  3GZE A;  4MHU A;  1FMD 2;  3AZV A;  3MUY 1;  3PTY A;  4Q29 A;  5LA2 A;  4DQA A;  2HWD 3;  1GNH A;  3D0J A;  4AEJ A;  4LO5 B;  1W6O B;  3TB0 A;  5E88 A;  1CVN A;  5LWB A;  4LBL A;  1PVX A;  3I2G A;  5A32 A;  4LR4 A;  4OCT A;  5JSO A;  5D8A C;  1MS3 A;  1Q3E A;  3AC0 A;  3DL3 A;  1HRI 2;  5L9V A;  3M4F A;  5E89 A;  4IL7 A;  5FPU A;  4EZ4 A;  1MS4 A;  4UYB A;  1R09 1;  1L7R A;  2MEV 2;  1OOP C;  1RUJ 3;  1CON A;  2A5Z A;  5IK4 A;  4AVC A;  4UFL A;  5LBC A;  2NMO A;  4COW A;  4K9S A;  5ACA 3;  3JCI A;  5IVJ A;  1BVV A;  3AP7 A;  3G6J B;  2BNO A;  4AZZ A;  4AEK A;  1NOV A;  1S0D A;  3AMQ A;  4GMP 1;  1S0G A;  4U36 A;  1AR9 2;  3H8O A;  1IS4 A;  2X5I C;  4N43 B;  3VHN A;  3ZPO A;  3MBW A;  1JU3 A;  4LBM A;  2GAL A;  2Y8K A;  1U5Z A;  2AZ5 A;  1C5H A;  2E7T A;  2MNG A;  1MEC 2;  4IXL A;  1O8S A;  3OTF A;  1TE1 B;  1MZ6 A;  5FIX A;  5FY7 A;  1VMF A;  1W9T A;  4GIQ A;  1SMV A;  3VBR A;  4Y26 A;  1D7P M;  5C8W A;  3P3P A;  4MXW A;  5FLI A;  1RJ7 A;  2PLV 3;  5IFP A;  1GYK A;  5BNN A;  3MYX A;  3S6P A;  2KA3 A;  4LKD A;  5FDB A;  3Q8F A;  5HCA A;  2VQ0 A;  1XU2 A;  2W1W A;  4XQ4 A;  1MS8 A;  1YFU A;  1MVE A;  3SCG A;  2ZHL A;  4AFB A;  5FY8 A;  2BUK A;  5CKM A;  5ISL A;  1CES A;  1W0P A;  2IZW A;  1ZBA 3;  3U1X A;  2RE9 A;  5F2W A;  1W6Q A;  4LKF A;  4BXF A;  4DXT A;  1RUN A;  1S0J A;  1YQ2 A;  4OLL A;  4Y1V A;  3VBH B;  3G7D A;  3LA3 A;  1JXN A;  2AH2 A;  3OB8 A;  2GZW A;  2XBO 1;  2C9K A;  2ZXQ A;  4ZS3 A;  1Z7S 2;  4BQW A;  4QGL A;  3DXU A;  5FZB A;  5A6Z A;  3THT A;  2ZAC A;  2R7E B;  3NQH A;  4XEZ A;  3T2P A;  2P1B A;  5FZE A;  1COV 1;  1EYB A;  2W46 A;  3A21 A;  3BTA A;  3OPZ A;  2BER A;  4RQP A;  1M4W A;  4AFM A;  5HI0 A;  2JIJ A;  2D5F A;  4DNY A;  4DY5 A;  3Q8E A;  4WM7 A;  2R04 2;  1YXW A;  4ARY A;  1CJD A;  2JE8 A;  2WQ8 A;  3RZM A;  4HSL A;  1CD3 G;  3ZXJ A;  1J3R A;  4LLF A;  1W8F A;  1XNB A;  4G3Y C;  3N9M A;  2VTF A;  4PI2 A;  1C28 A;  4N9H A;  5C9A B;  1BVP 1;  1VBB 3;  2W9X A;  1JHJ A;  1PHM A;  4GKY A;  4XMA A;  3F2Z A;  1FX5 A;  3JD7 3;  4OUL A;  2PAK A;  1NLR A;  2R07 2;  5I0S A;  3BKZ A;  1QDO A;  1EAH 1;  5ANN A;  4JDM A;  3E5Q A;  1A78 A;  3PIJ A;  4X8P A;  3K75 B;  1XB9 A;  1AR8 2;  1AYM 3;  4GH4 B;  1IPS A;  2CGO A;  4AI3 A;  4XCA A;  1NA1 B;  4YZ1 A;  2YC2 A;  3CZJ A;  3AP6 A;  5FUI A;  2MPF A;  5LCW L;  2HWF 3;  2JEM A;  1CQ9 A;  3V0B B;  1ODN A;  3CF6 E;  2VXR A;  1JI6 A;  1B35 C;  5JMO A;  1BLZ A;  4JRL A;  3LDB A;  4C0B A;  4LT5 A;  4NHY A;  3LAG A;  4MO3 M;  2K46 A;  5FFO C;  3B3Q E;  3OUI A;  5FY0 A;  3IDE A;  2DVF A;  1F35 A;  2WNV B;  4AED B;  1AX2 A;  4D69 A;  2GND A;  4Y20 B;  2FMY A;  5F6L B;  4YM0 A;  1YO8 A;  1POQ A;  2YBP A;  3NVC A;  2IFW A;  3HBK A;  4QB2 A;  3RSJ A;  5FYT A;  4D7S A;  2W91 A;  2XLG A;  2HWE 1;  3LEG A;  1YI9 A;  2JIC A;  2WT1 A;  5FP7 A;  3RWN A;  2BU9 A;  3V64 A;  3M7A A;  4AAP A;  2P34 A;  1QH6 A;  3D4K A;  4PCR A;  4I2O A;  4QB6 A;  4NHK A;  3J8F 3;  4PLM A;  5DZE A;  4ZHN A;  4AAX A;  3HBZ A;  4RGG A;  4OMD A;  4DIQ A;  4JGY A;  2FZ1 A;  4DXR A;  3I4I A;  4UBH A;  1PVC 1;  4I02 A;  1ULO A;  1L7L A;  1SBF A;  2WNU B;  3CHX A;  1M06 G;  5C4W B;  3V56 A;  2WS9 1;  1J84 A;  2VZS A;  4I3G A;  1QWR A;  3MIB A;  1D2Q A;  5K4L A;  2ZEY A;  2WR9 A;  3CDZ B;  4IEY A;  3ZXE A;  1WD3 A;  3O1V A;  1H9W A;  3BPZ A;  3VBU C;  2PQQ A;  3AM2 A;  2WZE A;  2W08 A;  3U07 A;  1AL2 3;  3FHQ A;  5IAT A;  1S0C A;  1LHW A;  1OC1 A;  1VPH A;  1QQP 3;  1LES A;  1NXM A;  4Q4X 2;  1PK6 C;  1PMH X;  5A3T A;  2GMP A;  2ZGP A;  1WD4 A;  4I30 A;  2XL7 A;  4AHW A;  1KRI A;  3WXP A;  1GLH A;  3RMX A;  2XML A;  3DF0 A;  1V6N A;  4CCN A;  1MQT B;  3S5Q A;  2WFF 2;  1DP0 A;  1QOT A;  1GZT A;  5DUW A;  2RG4 A;  2W2I A;  1GZC A;  2AR6 A;  5J98 B;  1ND2 B;  1RIN A;  3OGG A;  5GZD A;  1XOY A;  4ZXK A;  3CJI A;  4BHP A;  3I2K A;  4CYD A;  4MAD A;  4QHZ A;  4XQD A;  1RUF 1;  3A4U A;  4KG8 A;  1ZRC A;  2HLE A;  2Y6J A;  4CDW C;  5JAX A;  1NE4 A;  3M3E A;  3UYJ A;  2VMD A;  4LOS A;  1QJY 1;  2RS3 3;  1RUC 2;  2ZEZ A;  3P3N A;  2CWM A;  4JHT A;  3RI9 A;  3J4U H;  2QDN A;  4A44 A;  2Y6K A;  4IES A;  2LAL A;  4KBZ A;  1EPW A;  3PNA A;  1WGP A;  1HB1 A;  1AXY A;  3C7F A;  4GXL A;  4O7X A;  3D8C A;  1AR7 1;  4Z07 A;  4B7E A;  4C1W A;  1MPX A;  2W47 A;  3B9I A;  4TWT A;  5FR3 A;  2C4X A;  1EV1 1;  3H3L A;  2PHL A;  4I0W B;  1F31 A;  4MVT A;  3QAC A;  5C8C B;  2EIC A;  2VCA A;  3C2U A;  2DV9 A;  3FWE A;  4IE6 A;  2JDN A;  5FRE A;  3WQ0 A;  4ES9 A;  4HVO A;  2VAU A;  3AKT A;  2OXB A;  3WG3 A;  5F1R A;  2PHU A;  1ZZ9 A;  4OQ8 A;  4XAA A;  1NT0 A;  5F6K A;  5IK7 A;  1HW5 A;  1BK0 A;  2H0B A;  4CRQ A;  5JPM B;  3ZLI A;  4CZS A;  4LBQ D;  1OA2 A;  2O1Q A;  3UET A;  1SCS A;  1WLC A;  4Z1V A;  2X05 A;  2C1F A;  3CMG A;  2V5D A;  1C8M 2;  5LRS A;  3R4S A;  5A33 A;  5T55 A;  2NQY A;  3DPR B;  3ES1 A;  2HWC 1;  2CYF A;  1UPI A;  2KR2 A;  5FZA A;  1IS5 A;  2BDR A;  1LHU A;  2XVL A;  3PU3 A;  4G4F A;  3R4D B;  1F5J A;  3BOP A;  3AVS A;  3IZO A;  4NRM A;  2HWB 3;  2RR1 2;  1PGS A;  3FX3 A;  3OGR A;  2R30 A;  5B2G B;  5CG8 A;  2VTX A;  5IUQ A;  4PBO A;  1NQJ A;  1H6X A;  3O0V A;  1POV 0;  1J59 A;  2YGL A;  2W87 A;  2HYX A;  5CNA A;  1H2N A;  1RUH 3;  4YVW C;  1YIF A;  2AEZ A;  2YFZ A;  3Q8A A;  2DU1 A;  2VJX A;  2JJ6 A;  5FY4 A;  5GLZ A;  4ET7 A;  4RHV 3;  3WY6 A;  2VW2 A;  5AVA A;  3AK0 A;  5A7W B;  2UWA A;  1C4R A;  4Q4W 2;  1NXD 1;  3ZYJ B;  5LEJ A;  2DCY A;  1H0B A;  4IEU A;  2A1X A;  2RM2 1;  5EQU A;  3TYJ A;  5I93 A;  1DYO A;  3LA7 A;  4CDX B;  3A0K A;  4R9A A;  3H9A A;  5K0U C;  4JGZ C;  1RUE 3;  2IXH A;  4N53 C;  2VZU A;  1ZRI A;  1W28 A;  1N47 A;  3LDR A;  4YRD A;  4FOW A;  4CUG A;  4HK8 A;  4XIL A;  3J7N A;  1ONA A;  3FJS A;  2IVI B;  4S2G A;  2EIG A;  4OI0 A;  3KQR A;  5FYC A;  1OLM E;  1WA4 A;  4PDW C;  1O6U A;  5KR7 A;  5IVY A;  1YQ6 A;  3LEI A;  2VOX A;  4H7M A;  4XAC A;  4BK4 A;  2W92 A;  3I3D A;  3TRS B;  1WW4 A;  1JZ3 A;  5AC9 1;  2ZPX A;  3ILR A;  3DGT A;  5I0D A;  1JHN A;  2XDV A;  2YY1 A;  3I8T A;  3OY8 A;  1DQ2 A;  3WCS A;  1MS0 A;  4MV2 A;  1S55 A;  2HWD 2;  1QNY A;  3M3O A;  3UGG A;  3AKS A;  4JKL A;  1PGL 1;  4A41 A;  3PIG A;  5AVP A;  1R1A 1;  3T1L A;  1W2N A;  2RJK A;  2ZTN A;  5ERL A;  4XJW A;  1ALY A;  4AFC A;  1HXS 1;  3POE A;  1G9D A;  5LY2 A;  3CZU A;  4DXS A;  5EWS A;  5A3U A;  4BIO A;  3USU B;  2FCV A;  1VAK A;  4Q5O A;  5F32 A;  4Y22 B;  1ZZ8 A;  4F8A A;  1V70 A;  1VBE 3;  5GLT A;  1RUJ 2;  4QHO A;  3VZM A;  3KQ4 B;  2BBA A;  1JW6 A;  4ASK A;  4RGA A;  4AI8 A;  5ACA 2;  4Y33 A;  4AXO A;  5D21 A;  5GJ6 A;  5D2A A;  5FJK A;  1SBD A;  4UI9 L;  3AMM A;  5F3E A;  2VUA A;  4LMF A;  4ASM B;  4UFH A;  1EPZ A;  3B94 A;  3MUZ 1;  3POI A;  2VBD A;  3NAP A;  4MX3 A;  4E4S A;  2FDI A;  4LO7 A;  3SKJ E;  5DG1 A;  4NVP A;  1HQW A;  1YCI A;  1NQD A;  1OQD A;  3ON7 A;  3U4S A;  2JX9 A;  1YFW A;  3O0X A;  1LB2 A;  1K42 A;  3QLQ A;  4QX0 A;  4LA2 A;  2BYV E;  1WMF A;  4OI4 A;  1H8T C;  4M00 A;  2WO3 A;  4BMB A;  1PMJ X;  2LM3 A;  4JZR A;  2PLV 2;  4GMP 3;  4IGQ A;  5CIR A;  3RZK A;  4W4Z A;  2R0F A;  4Y20 A;  4KMQ A;  4FBF A;  2VGD A;  4EYU A;  2VVE A;  2QZ3 A;  3HN3 A;  3RQ0 A;  1D4V B;  4CCE A;  1NG0 A;  4IEZ A;  2WBK A;  5L19 A;  3JQX A;  2IXI A;  2PEL A;  3TBD A;  2VOK A;  3KT1 A;  1ZBA 2;  1YC6 1;  3N4M A;  4JX0 A;  3ZFF C; 
#chains in the Genus database with same CATH homology
 2VBB A;  3ZKU A;  1W03 A;  2CSG A;  1W9Y A;  5C3O A;  1E5I A;  1UOB A;  1W04 A;  2BU9 A;  1W2O A;  1OBN A;  1W2A X;  1DCS A;  1W28 A;  1GP6 A;  1W06 A;  2IVI B;  1RXG A;  1W3V A;  5APA A;  5C3Q A;  1RXF A;  1OC1 A;  1E5R A;  1HB4 A;  2VE1 A;  2Y6F A;  3ZOI A;  1HJG A;  4XAE A;  1GP5 A;  2DBI A;  1W3X A;  1W2N A;  5C3P A;  1QJE A;  1UOF A;  2IVJ A;  1HB1 A;  1E5H A;  1UO9 A;  2JB4 A;  2VCM A;  2VBD A;  1UZW A;  5C3S A;  2VAU A;  2BJS A;  5C3R A;  3ON7 A;  1QJF A;  1UOG A;  2WO7 A;  1BK0 A;  1W05 A;  1QIQ A;  1HB2 A;  2VBP A;  1HB3 A;  3ZKY A;  1HJF A;  1UNB A;  1IPS A;  1GP4 A;  2BRT A;  1ODM A;  1E5S A;  1ODN A;  1WA6 X;  2Y60 A;  2JB8 A;  4RGK A;  1BLZ A;  2DBN A;  4BB3 A;  3OOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...