1RXFA

Deacetoxycephalosporin c synthase complexed with fe(ii)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
307
structure length
264
Chain Sequence
b'DTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDLVIDFFEHGSEAEKRAVTSPVPTMRRGFTGSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFMAPHYDLSMVTLIQQTPCAGFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAAPRTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHASE
publication title Structure of a cephalosporin synthase.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
total genus 82
structure length 264
sequence length 307
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1rxfA00
2DBNA 2VBDA 1W06A 1HB1A 5C3SA 1W2OA 2JB8A 1HB3A 4XAEA 2BU9A 1W2NA 5C3OA 5APAA 2Y6FA 1UOBA 5C3RA 1QJFA 1W28A 1BLZA 2VE1A 1RXGA 1ODMA 5C3QA 2DBIA 1E5SA 1IPSA 1UZWA 1GP4A 3OOXA 1WA6X 1BK0A 2JB4A 5C3PA 1UNBA 3ON7A 1UOGA 1W05A 1UOFA 1HB2A 2VBBA 4BB3A 1UO9A 1HJGA 2CSGA 3ZKYA 1ODNA 1DCSA 1QIQA 2BJSA 2IVJA 1W9YA 2Y60A 1E5IA 2VCMA 1E5RA 1OC1A 1HJFA 1W04A 1W2AX 2IVIB 1RXFA 1GP6A 1QJEA 2VBPA 4RGKA 1W03A 2VAUA 1HB4A 1E5HA 2WO7A 1GP5A 1W3VA 2BRTA 3ZKUA 3ZOIA 1OBNA 1W3XA
chains in the Genus database with same CATH superfamily
1Q3EA 3AP9A 1R082 2RG4A 2D43A 5CYYA 5DPNA 5IAXA 3FBMA 1VBA2 1GYKA 1LOCA 5FYCA 1W2TA 4B3NA 5C8CB 1MEC1 5FPXA 4CEWB 1LOEA 2XL7A 2W95A 2BGOA 5CB7A 3N4MA 1OLQA 2VULA 4AEDA 4KNCA 4Y5SA 5EJ1B 3FL7A 3AMHA 4AGRA 3N9PA 1QJFA 4CCCA 1ZRCA 2FDFA 1IQDC 4Y1ZA 1S0IA 1W2UA 2Z42A 4YW5A 1LGBA 1UXZA 4HKOA 3WQ0A 1S0FA 2DTWA 5FPBA 3WVJA 4CCNA 5FR3A 3KCXA 4NIAA 4GALA 2A3WA 3ES1A 4Y3OA 4NMIA 4P5HA 2IXHA 4P5YA 3MLJA 4AFAA 3IIAA 5DG1A 2JIJA 3IM0A 4N53B 1TZOA 2AZ5A 2P34A 5FUPA 4DXSA 4Y20A 1UPSA 5C4WA 3FC0A 1C8M1 1VAKA 2XLFA 4Y4YA 4QU1A 1QGLA 1SMVA 5ABJB 5KHJA 1H1IA 1CAVA 4L92A 1UKRA 3I2FA 1H8VA 1ZNPA 3RG0A 4C0BA 1N1YA 1Z0HA 3LOBA 4IEWA 4OI0A 3C2UA 4JKLA 5H9QA 2ZABA 5SV8A 1W6MB 1ND3A 1GWMA 2XH6A 4GULA 3I59B 4Y24A 3IKWA 4A3XA 5FY5A 2ZEWA 2TBVA 3BN6A 2GC0A 5A3TA 1C8M2 1JN2P 1GZ9A 1OMIA 3IWZA 3VKNA 5C8CC 2X5IB 4M3CF 1TVGA 2CL2A 5LK5A 1W05A 2Q4SA 4CEWC 4RQPA 1ST8A 2VBBA 4TXWA 4BZ4A 2XVLA 1ALYA 1CAXB 4HN0A 4QKDA 3C3VA 3GZAA 4FOWA 2W92A 5EZWA 1QEXA 1W39A 2CSGA 3S5QA 3J8F3 5FPVA 5B4XA 3VBUA 4NN0A 3O0WA 4ZU4A 4ATEA 1ENRA 3GDBA 1V70A 1NZCA 4W6YA 1Q8QA 5FZHA 2X05A 3AZYA 3TNQA 1D2SA 1OD3A 5EYYA 1VBD1 2DTYA 4XF4A 1ND2B 2JDNA 3W20A 2DCTA 2IXLA 4N53C 4ASLA 4G4FA 1ZBA3 4QX7A 3POJA 4QKNA 5CVRA 2PLV1 3NV4A 5A33A 3KHBA 5A32B 2B9VA 4BIFA 5ABJC 2VW1A 2YB7A 2ZPXA 2GMEA 3OSDA 3IMNA 4HK8A 3FWEA 3NNJA 2R063 4Y1VA 3WV6A 1NCRB 2YUEA 1I5ZA 1VBD2 4HXCA 3GBFA 3BCWA 4JRAA 3EO6A 1JHNA 2F4LA 5FFOC 4Z8BA 1WCUA 5IVJA 2PLV2 1ZA4A 3IDCB 4CCDA 5FZCA 3ENRA 2UU8A 3OF1A 4QDQA 2X5IC 1UD1A 4LHSA 4QB1A 4YVSA 1AYM1 2VQUA 5C6CA 4F3JA 5GZGA 2TNFA 4XJWA 5A3OA 1AL21 3W59A 2XOMA 3NV2A 3PL0A 1HIXA 4E27A 4UFKA 4WZCA 4OZXA 4Q4V1 2EF6A 3LDKA 4SBVA 4LBNA 4QXCA 5LW9A 4DRVA 1I3HA 4FPHA 4ES8A 4R52A 1F2NA 3RJ2X 3WF1A 2JKBA 5K4LA 1N3OA 2V4AA 5GM0A 4JHTA 4XUOA 4YFZA 2EICA 5APAA 5JPNB 2J1RA 4BISA 5L19A 3O1VA 1AYM2 3NRUA 2ARAA 1AL22 4UBGA 3FLTA 4L99A 1LNSA 1PVC2 2V72A 4TSVA 4WV8A 5AC91 2Z4FA 2PAKA 2ZX4A 1E57A 1LGNA 3BOWA 4UBHA 4YPJA 1VMJA 5C7GA 3WZ1A 3MW3A 1YNAA 2ENRA 4FSJA 1YQ6A 3ACIA 4EROA 2B9UA 2UWBA 3LF7A 3VKMA 2XBO3 1V6IA 2RDNA 1OD5A 1HQWA 4RS5B 3LSEA 4LR4A 3LWCA 2CGOA 2PHWA 4NHYA 3ZXEA 1GWLA 1NCRC 5FXVA 5E88A 1IG0A 1SACA 3JD72 1JZ8A 2ZHNA 4AGGA 1UCXA 1W6PB 1Y9GA 3AB0A 4YVWB 5AC92 3E6CC 3DV8A 3THDA 1CGPA 4QXKA 4AFMA 2LRPA 1POV1 2EAAA 3BVCA 1RUOA 1JHJA 3S6PA 3V56A 1DP0A 1ULCA 3Q8BA 4Q26A 1UY2A 1WBLA 2HBTA 3WW2A 2B7YA 3USUA 2VJXA 2OQ6A 3SH5A 4B4QA 1NG0A 2WNUB 4YW1A 4A44A 4HMZA 4EZHA 1YHFA 1R1A2 2BDRA 1LKNA 1BK0A 1NLQA 4XF9A 5K0UA 2R1BA 2MNGA 2CY6A 4LPLA 4XUTA 1AR62 1DBNA 4PLNA 4AI9A 4AL9A 5DABA 3DEMA 1SFPA 2D6MA 2ZGPA 3DXUA 1DYOA 3ETPA 4AHWA 3OGRA 1DYKA 4LKEA 2JX9A 1RUF1 4X8NA 3ELNA 5DUVA 3ME2A 2ZKNA 1WW7A 5EV7A 3ZR6A 3OGJA 1SLCA 4NPRA 4FOVA 3PVOA 3D8CA 1IHMA 1VLNA 3O14A 3KD4A 4RS5C 1IS3A 5I91A 1PGL1 1WBFA 5M0TA 3PUSA 4N90A 3CIHA 4JGZB 4E8DA 1E5IA 3FLRA 3WW1A 4AXOA 1V9U1 2OXBA 4RHV3 5CISA 4DY3A 1RUF2 3AZWA 3VBHB 1NCQB 4YVWC 2XLGA 4Y4RA 4ZS2A 4BWOA 1KGYA 4DFSA 5JR2A 2P37A 3J26N 4H3WA 2ZKLA 4IQPA 5K9YA 1UF2C 4JKKA 3LGRA 3T08A 2Y8KA 5E1RA 1ZBE3 1DGRN 2PHUA 3ZYBA 5CADA 1PGL2 4K3UA 3H3ZA 2A6VA 2P3IA 5A3MA 2WUHA 5JOYA 2OUJA 3VBFA 1ENQA 1EAH1 4G3YC 1LHOA 1NA1A 3I7DA 4XF3A 2VZSA 3KT7A 3HT2A 4XE9A 3RS6A 3RWNA 3ZM8A 1JOBA 4BXFA 5JSPA 1QXJA 5FYTA 3DYMA 3VZMA 3J9SA 4WZFA 5C5UA 5I0RA 2EXHA 2ZGOA 5IVFA 1MZ6A 4XQWA 5LRRA 4DRRA 4DUVA 4ATFA 2RS13 4AVSA 2DBNA 5C33A 1RUI1 1TMF2 2VQTA 3RZJA 5DN2A 1EAH2 1CAUA 3OTFA 5C9AB 3ZXDA 5FTTC 3ASIA 3HAGA 2VM9A 2ZZQA 2BU9A 4LO7A 3TEYA 1ACCA 4OUMA 5TSWA 4KI5M 4P9WA 1A78A 4QX5A 1H2LA 1V6OA 3IDBB 2A6WA 1CAWB 2FZ1A 3UT0A 4JGZC 2YG0A 1M4WA 1C1FA 1B35A 1GKBA 4O61A 4XZUG 2VOKA 4AI8A 1IQAA 3VBHC 3O1UA 1NCQC 4LHKA 3ZN4A 1RUI2 4EV0A 1LHWA 2HWD1 1YIFA 3VZLA 2ZGLA 1YQCA 4OQ8A 3MYXA 3PLQA 5J36A 4KWLA 2ZX3A 3UKTA 1SLBA 4YW4A 2RJKA 5HCBA 5CA6A 2FDIA 4RR3B 2CV6A 1YUDA 2VZ3A 4X6RB 4AAXA 2VCBA 2QQOA 1BMV1 4PHZA 3KS7A 2OIIA 4Y5TA 1UZ0A 2QQUA 1PM4A 3V0AA 1I5PA 3V64A 4DIQA 2BTVC 2JD4A 4LOSA 3VD9A 3O0VA 4P9GA 1FV2A 4HVQA 4IGQA 2XKOA 4I0AA 4LE4A 1PMIA 1Y9QA 4QPGB 1EPZA 4MZUA 4Y26A 1VRH1 3QBQA 4AEMA 4AHYA 4M3CA 3K46A 2ZX2A 1BMV2 2XGXA 2G1MA 1UNBA 5C9AC 1FX5A 2VXJA 3PMEA 2XUMA 1QNWA 2EAKA 2B39A 1AF9A 4E4DX 1B09A 4HBNA 5FZDA 1UOGA 2HWB1 4N43B 1VBC3 2W87A 4FXGB 1UKGA 1MS3A 1VRH2 2NPIA 3PVBB 1SZBA 2YPJA 3KF5A 4QPIA 5FZIA 5FY4A 2RJLA 3HBZA 1QJY1 1CWPA 4I3GA 2CYFA 3O5SA 4XIOA 4CCJA 1FPN1 1GWKA 1KRIA 4UF0A 3MI8A 2WL1A 2WZR2 1YFWA 1QQP1 1O3RA 2HWB2 4FPYA 1AR83 1LEDA 4RR3C 1ULFA 2JE7A 2EXIA 4OHYA 4GJZA 4WBBA 4W6XA 2VZPA 5JMCA 2JDPA 1WA4A 4YW3A 3RZKA 1OF4A 4GIQA 1FPN2 5FQ0A 3DYOA 4D7TA 1APNA 4LBQB 1O8SA 1H1MA 3RFRA 4XJ9A 3HNBM 2QZ3A 2VBPA 4QPGC 4WM7A 1ASJ1 4AYUA 3C7FA 3PJQA 2WLPA 5KWRA 1EUUA 1CD3G 1YC61 3HBKA 3BPZA 4Y1YA 1HV1A 1K45A 2ATFA 1WCSA 5D1IA 2Z5WA 1SEFA 3U4SA 4JZRA 5CFCB 1ZZ6A 2Q0AA 3N7MA 4OHWA 5CG8A 4JC1A 3RI8A 1JMUB 1RUJ3 1DQ4A 3B01A 1GR3A 3I2HA 4QGMA 2YZ4A 4N43C 2HYXA 2CU5A 1ASJ2 1GZWB 3J4UH 4JQTA 4NE9A 1ENSA 1W3XA 4LO6B 3S7IA 3ZIWA 1DIWA 4TLGA 2WNEA 5DDJ2 5FKBA 4Q1PA 4QHBA 3PURA 5A7OA 3OY8A 1KDMA 4IEYA 5IW0A 2E51A 3OD0A 1QOOA 1L7LA 1AVBA 2W1UA 1WW4A 1ZM1A 3WXPA 4UFHA 5FZOB 4AGVA 2GALA 1W0NA 3S5AA 1FOD3 4GH4B 4FFGA 1US2A 5FYIA 1DZQA 1OLRA 1UWWA 3M3IA 3NJVA 4JTOA 1N3QA 2R6QA 4R9CA 2GSYA 4ZXKA 1UOBA 1AR91 2HWF3 4QX3A 3WF2A 1T6GC 3TNPB 1YWKA 5BXXA 4BMBA 5A1AA 2C6SA 4HONA 2IXCA 5FK7A 4ASMB 1ZX5A 4CEYA 5A3LA 3M8LA 1YI7A 4M3CE 1QJX3 3ZSEA 5HCFA 3NNLA 2WFF3 3H50A 2QQJA 1AR92 1BVP1 1FYUA 5L9BA 4A7YA 5CFCC 4YW2A 1UXXX 5AFBA 2XJVA 1BHGA 2MHFA 5DG2A 3ZDSA 2DU1A 2GZWA 1BQPA 1PGSA 3NAPB 3THCA 2VOTA 1RUG2 2VTXJ 5FREA 4P9JA 5I0UA 2W2IA 3E6BA 1Z7S1 3N9QA 2IXKA 3FFQA 4Q0QA 3WNKA 4EWDA 4EWEA 2Q8DA 4CYDA 1NQJA 1BBT3 4XHBA 2JE9A 4FO9A 3WG2A 1SLTA 3PVEA 5IHRA 2WS93 5F6KA 5GJ6A 2E6VA 2VNOA 5IVYA 2K9ZA 1JUHA 2IXJA 4MGIE 5D21A 1XU2A 4F7ZA 5KHKA 4AEDB 2NQYA 1UX7A 4IL7A 1CN1A 3T2PA 4GH4C 1S2BA 1PHMA 2XJRA 2LUWA 1Z7S2 3Q8CA 1XYNA 1WLTA 1HRV2 3D4KA 2HWE1 2SLIA 2XJUA 5JUVA 4HOOA 1COV3 1W8FA 4IEQA 1QOSA 4A42A 4CUAA 2G4IA 4WM8B 3KCYA 4J6GA 4XUNA 4Q27A 5KR7A 1DCSA 1TQ5A 5BUVA 4META 3SH4A 1O5UA 2QUOA 1W9YA 2C9KA 4P00B 5IT6A 4P9XA 4DY5A 1BJQA 3VBSA 2VCAA 3ZYIB 1W04A 2HWE2 3LDRA 4NIGA 3N3HA 2JG9A 5FZMA 4QPYA 4W8JA 4CP9A 2X10A 4AI1A 4BYYA 1DDLA 3MLKA 4XJZA 2XR4A 4YG6A 4BHPA 5JXIA 3NAPC 3VHPA 3WW4A 2D98A 1QJEA 1UAIA 3Q9OA 2VZUA 5IAVA 2XXZA 4GQ7A 3O1TA 4EQVA 1BEV2 3IN9A 5H9PA 1YCIA 1OQ1A 4YWAA 1CQ9A 2BOJA 2IFWA 2A6XA 1J1LA 3RYRA 2QQWA 4AFCA 1A34A 3OEAA 1LECA 1PMHX 2ZEXA 3K75B 2XG3A 3PMSA 2BVVA 4M01A 3ZSLA 4AEDC 3MFCA 2WBKA 1CZVA 1H8TA 2QZ2A 4XEZA 5C5TA 1SPPB 5LCWL 1C5HA 2Y38A 2Z2SB 3CQOA 2E63A 5LZ6A 1D7PM 3MGUA 1GBGA 1O59A 1RJ8A 1WLWA 2B45X 3TN93 2E7AA 4AG4A 3JCIA 3KVBA 3N35A 3GCWA 5I0SA 2ZAAA 2GH2A 4QGNA 4WM8C 2A3YA 2GN3A 4SLIA 2JD9A 4LIUA 2RS53 2WAOA 3OYWA 3B94A 2AEZA 1CVNA 1YIPA 1DQ6A 4PIXA 5A33B 2AREA 5JLVA 1LESA 5JOZA 5IK8A 3I2KA 3J7MA 1EV11 1J3PA 3T30A 2DCYA 2Z69A 4IE4A 5DAVA 2J1VA 5FWEA 4F8AA 2BEOA 3MBWA 1QJZA 3EBRA 1PX4A 1NE4A 1JYCA 2W68A 3E97A 1AX0A 3B69A 1PO13 4EJRA 1MS8A 3NNGA 3WSOA 4EE2A 4NROA 1YO8A 2BNMA 4XZPA 3MHZA 5JOWA 2WWSA 1XSQA 2ZMKA 4FPLA 5EJ3A 1XNKA 2ZGRA 2P4EA 2J22A 1VPHA 4NHLA 3HIFA 1EV12 4CCKA 4QQHA 4P9IA 2YYOA 2VR4A 2R0HA 1MVEA 1YI9A 2CTVA 5FPUA 1RIRA 1PIV3 4BLIA 3KV5A 1PO23 2AEYA 3NWKA 3UK9A 4QQOA 3SCGA 4Q5OA 5BNQA 5JXJA 3T2TA 4NVPA 1DQ0A 1KDKA 4HANA 2A7AA 3NJXA 4MOAA 4AQ2A 1H2MA 3HN1A 4E8CA 3ZIXA 4BIOA 2WNVA 3A21A 1HLCA 3AZXA 1AJKA 2WAAA 4ZPIA 1OI6A 4LTAA 3WD5A 4NHMA 5F3EA 4Q4Y1 3MIBA 1H4GA 5GLVA 4NPLA 5SV5A 4CDUA 4YYOA 3SEEA 1LEMA 1MZ5A 5LBEA 2RMU3 4RFT0 3D0SA 1H9PA 3VZKA 3WDUA 1UO9A 1UMHA 2DV9A 3BALA 1JI6A 1VBE2 2QNKA 3I3BA 2VUCA 1CR7A 1W8TA 4FP3A 4P08A 4H7LA 2VOWA 4ITCA 4QD2A 2VPVA 2X09A 4GWMA 4A45A 4S2HA 3WCSA 2YGLA 3R6SA 2ZEYA 1LU2A 3EXUA 4Q4Y2 3LZZA 4ISRA 5J1XA 1RUC1 3KT1A 3POEA 1Q8SA 3OPZA 5F2SA 4BK4A 3RYKA 5BNOB 1RMU2 1SLIA 3WNPA 1I1EA 5LRSA 2V73A 2VCMA 5BNPB 5AVPA 2NZ9A 3B9CA 1E5RA 4LO8A 1HJFA 1RINA 1UQXA 4MGZE 3RRDA 3WUDA 3VDCA 3NMBA 2OPKA 4ZU5A 4CDXB 4IEPA 3RSJA 1CIWA 1AXYA 3ORJA 4UW3A 3C7OA 2DFBA 3LD8A 4K8RB 4XYXA 4QPWA 2DF7A 4YLZA 4BXSV 5FZGA 3WNXA 3SKJE 1W99A 4D6RA 4XAAA 2YY1A 1RUC2 4YM0A 2XDVA 4D3WA 5FIXA 2XJSA 4FCAA 3CL1A 3ILNA 4XFFA 3ZFEA 4F83A 1WMXA 4KG0A 2VD7A 5DAQA 5FBZA 3BIWE 3SQOA 4L8QA 1FMD1 2VVDA 4EN9B 3H1WA 1JYXA 5FZ7A 1UPIA 1GP5A 1QDOA 5HI0A 3FE5A 4ZZ5A 2BRTA 5T5OA 3ZKUA 2ZBJA 4R9BA 2CGNA 2VMFA 4N9IA 1Q43A 1VB2A 4OYUA 1R64A 1DF0A 1AYN2 3FX3A 3T1LA 1FNZA 1K5MB 1W6OB 2JXAA 3OGVA 2W91A 3OUJA 4GMP3 5D8AB 4D94A 1YFXA 3PUQA 3U75A 1TG7A 2H6BA 3VHOA 1D4M3 2Y64A 1FMD2 1DGLA 1HN0A 1GMMA 1QJU3 1IS5A 4KU8A 1ZZ8A 2EIDA 5BNOC 5E8AA 5BNPC 3RZMA 3QD6A 4GB33 1ZBA1 1W6NA 2X53S 2PAEA 2JENA 4S2GA 1PNGA 1YXWA 2HWC2 3VDAA 4CDXC 1W9SA 5FYSA 4Q0UA 1W9WA 1RXGA 2VZOA 5GLUA 3K4AA 4JVAA 4QKFA 2FCTA 1D0GA 1JXNA 1NA1B 1UZVA 5CG9A 4C91A 2Y6LA 4J1XA 5J09A 1G9AA 3L2HA 2AYHA 1NAEA 3FLPA 3M4FA 3OEBA 4XPVA 2C24A 1AL0G 2ZEZA 2QQLA 3ILFA 3RZGA 1G7YA 4L97A 4Q4W2 4BLJA 4LEJA 4OQ9A 4CU7A 1STMA 3V0BB 2YV8A 2WKKA 3ILRA 5KXBA 3ZYGA 3BTAA 2BW8A 2VZQA 4LHLA 3E1F1 1LTEA 2KR2A 3LPFA 5FZ3A 3VD3A 1K5MC 1H6YA 5D8AC 5GKAC 3ZFGA 3DYPA 4KH9A 5IK5A 4D6SA 1UYZA 3HOBA 2DFCA 4C1WA 4A2UA 2ZHMA 4Q29A 3EJKA 1MEC2 1HXS3 5F5QA 4CU8A 1L7QA 4V2WA 1YJLA 2E32A 2AENA 2YMZA 5CIRA 3SISA 4FQ4A 3KSCA 1OH3A 1SCRA 3VL9A 3LEMA 1LOGA 4IE0A 1RUE3 5DXDA 2W46A 3LFIA 3R05A 3U1XA 1DQ5A 4AEJA 4E4ZA 5JZGB 5EHDA 4HG6B 1OKQA 2E26A 4XXPA 3ZXJA 4FBFA 4PT6A 2CDPA 4IERA 1QIQA 2XBO1 1NA1C 2BJSA 1A8DA 4L11A 3O7OA 3TBDA 3R4SA 2C26A 5KC6A 3JQXA 1IKPA 3FJSA 1PK6A 1RUD1 4PDWA 1J83A 4CA9A 2IVIB 4DQAA 1FAYA 3W5MA 2V5YA 2VTXA 5CFDA 1SFNA 1GOHA 4O9EA 4OMDA 5LA2A 1V00A 4N8MA 1A8MA 3L2YA 2VMHA 2XVKA 3AYCA 2XBO2 3AX4A 4AFBA 5FYUA 3DPRB 3M3EA 2FDGA 4OHXA 1CONA 1O3TA 4NRQA 3POIA 1W03A 1RUD2 2GNTA 1LOFA 4AEKA 4Y22B 3MFAA 1KD7A 3U11A 4XBQA 3TYJA 3IPVB 5KBFA 2PYTA 2PAMA 3K3OA 2WSUA 4DO0A 4PIZA 1O91A 4XBNA 1O4ZA 2HH9A 1W6QA 2RM21 2XMLA 5F7UA 1GOGA 2MEV3 1UZZA 2XJPA 3CBNA 4WVVA 2D6OX 1OBNA 1SLLA 1L3JA 4HSLA 4D7SA 2CDOA 3TRSB 5JZGC 5IFTA 4OFGA 2ZTNA 3AP6A 5H9SA 2OZ6A 1EYBA 3CEWA 3PVNA 4XF1A 2YC2A 3U10A 1REFA 2NN8A 3N7KA 3VBRA 2BGPA 2XJQA 2RM22 1X8MA 3IB3A 3BTZA 1ZZ9A 3AYEA 2VZTA 5GZFA 4CDQA 2XWBB 3PTRB 4JHZA 2RR13 4RHV1 1OH4A 5FYYA 2WRAA 2R073 3E5UA 1R083 5EP9A 3A7QA 1O5LA 2WJSA 5K8SA 1LRHA 1UY4A 1VBA3 2VXRA 5H9RA 3ZFFA 4OCTA 4LE3A 3KHCA 2UYBA 2W94A 5FRAA 1ZBE1 3AKSA 4YRDA 4IEOA 4BE3A 4PBPA 5FY0A 3DPRC 1OXCA 4LUMA 2BYVE 2DCKA 5I8YA 5F3IA 4QKBA 4RHV2 4QT6A 3H7JA 3RQ0A 4CP0A 1W8ZA 3RZLA 4BH9A 1D4VB 4FI9A 4UT5A 1QY4A 3WP3A 1U5ZA 4HLTA 4YGBA 4COYA 4C90A 3OY8B 4C8DA 1RUNA 3H8OA 1OA3A 1ZBE2 2D3PA 3Q8FA 4OI1A 1KQRA 3AP4A 2O8QA 1GQPA 5JI7A 4KU7A 1Q56A 4Q4V2 5LEKA 2E9QA 4NIDA 4Z2WA 1DHKB 4QX0A 3UGHA 1NE6A 2PELA 2BVBA 1VE0A 1QMJA 4XJUA 3OPTA 3H9AA 1HW5A 3H8XA 4XURA 3VZNA 3GYDA 3N7JA 5FYHA 2Y33A 4RGAA 1KJLA 3P1IA 4LJHA 2XWJB 5FP4A 1OPMA 4HN1A 1DQ1A 1X9PA 2YHJA 2HLEA 1HJGA 2EXJA 4CXYA 4CCOA 3PU3A 2OZJA 3NNMA 2QQPA 1C8M3 1K3IA 5JSOA 2D93A 2PHFA 2JKXA 3NJZA 2J42A 3WP4A 3AJYA 1WCDJ 3D82A 3JUUA 1XNTA 2R30A 4OI4A 2LALA 1K42A 3GJAA 2FMDA 1W2AX 4JGYB 1LHNA 5A6XA 2F4PA 2ORZA 5F9TA 2ZGSA 2EXKA 1X36A 4PI2A 5FY7A 5L7OA 2JECA 3OCPA 3U07A 3E5XA 2A6YA 2WZPP 5F3CA 1RHI3 2VNGA 4IEUA 5FPLA 2CNAA 1QOTA 3VBOA 5L9VA 1RYYA 1DLCA 4P9LA 3H8RA 5FP7A 4RD7A 3ETQA 2X29A 4FQZA 2XUEA 1JZ3A 2RE9A 4KMQA 4ZS3A 4YSFA 3SHRA 4HPKA 4R9AA 2JWPA 4CDWA 4DEQA 1S4CA 2XHNA 1X7NA 2WIIB 1GNZA 2QJVA 1W8UA 1YQ5A 2JJ6A 5LEJA 4AFDA 1VBC1 3RMYA 1JZ2A 5AFEA 4R4ZA 1MPXA 2PHRA 5CAZA 5CNAA 5DZGA 2GNDA 4XJ8A 2B42B 3VL8A 3GF6A 3VLBB 2VBDA 5GZCA 5ISLA 1OT5A 2L9LA 4ZU7A 4XDOA 5FP8A 5FXXA 3ZYPA 4Z1VA 4Q4X3 1HB3A 4CCEA 5IK4A 2PLV3 4NWWA 2VZRA 1C8NA 1NOVA 3J7NA 1C5IA 2P6CA 5E89A 1MZEA 5C3OA 5GLWA 2O14A 1AR81 4CP9B 1VBC2 1V9U2 5KXCA 5LWBA 1XRUA 5G05L 3VB9A 2ADEA 1KITA 4JGYC 2H0VA 1HQLA 2YU1A 4IV3A 1VRBA 1SBEA 4QM8A 5BNNB 4NHXA 4B7KA 4ET7A 3OJBA 4U36A 1JH5A 3N9NA 4BQ2A 2E31A 2AACA 3AZVA 2R7EB 4Q0SA 4ISQA 1AR82 1AYM3 3CKHA 2XB6C 1UL9A 2WQ8A 1AL23 5K7PA 3GNEA 2OA2A 1GFF2 1PVC3 1DGRA 4KQ7A 1YQ2A 2YGMA 1JYVA 1IPSA 1RGSA 1VBB3 1TME3 3UYJA 1RUJ1 1KFUL 1NLRA 4JV4A 1YLLA 5JXGA 1G9FA 1NXD1 5A7QA 4QHZA 2O8OA 2QQIA 2V4VA 5DZFA 2WO1A 1NZIA 2PHDA 1JU4A 2ZGQA 3LIHA 3POBA 3LKJA 2VMDA 4NIIA 1XXNA 5LK7B 1X33A 3JB8A 3JD73 4LUKA 5C8CA 2LS6A 4MXWB 4B29A 2ZHLA 4CEWA 4CXWA 2XONA 2A5ZA 5EPAA 3VBSC 3VD4A 2GMPA 1RUJ2 2PA7A 3MIHA 2JG9C 3IT8A 1FOD1 4UXAA 4Y5Z0 2ZZJA 1WW6A 1US3A 3MICA 1R1A3 3RZHA 2ARBA 5FOJB 2HWD2 3KWVA 3ZPOA 1AR71 2OUHA 4IV1B 4BCUA 1AR63 1ZYBA 2R041 3UV9A 5E16A 5FXWA 4TN7A 3ZKYA 5BNNC 2XKPA 2HEYF 2Q1FA 1OUXA 5T55A 5A6YA 5FZ4A 3BTYA 2W52A 1F8VA 1FOD2 5JPMB 4QB2A 1GNHA 2O0OA 3MIEA 3R0RA 4GMP0 2VNVA 1M06G 2WFF1 1RVF3 2PFWA 2PTMA 2Y0IA 1JZ7A 3EYPA 1AR72 3EHKA 3WDVA 5ANNA 5JSRA 2R042 3CJIB 3HR9A 3M3QA 4M0HA 5FAXA 3W5NA 1YEWA 3ZSKA 5IVEA 2ZHKA 4YZ4A 5T3NA 2DU0A 2QVSB 1JZ6A 3JXSA 2WNVB 4EYUA 2HJIA 3ZXAC 1BBT1 3UJOA 4I3PA 2VAUA 3VD7A 3WY6A 5FZ1A 5HCHA 3MLLA 2X5IA 4CDUB 2WLQA 3UKVA 5FV3A 4AI0A 1W3VA 2ZGUA 2AC1A 4BMEA 1UMIA 4Y33A 3LFMA 3TEXA 3P5BA 4KBZA 2ES3A 1CAXA 1S0JA 4QWNA 4K7JA 5CKNA 3AMPA 5EXOA 4FVVA 3SCFA 1UYPA 2YFUA 1QJY2 2ZA9A 3GJBA 1GU3A 4YG3A 2JDAA 5GLZA 2WSVA 3VUOA 1ULDA 4IV1C 1COV1 4JX0A 5EJZB 2VUAA 1GUIA 4QGLA 2RS31 4WVZA 2R16A 1WMDA 4DS0A 1QQP2 1MS9A 3GGLA 3FHAA 1QU0A 1ND2A 2VG9A 1G6NA 1EY2A 3JQWA 3NQHA 5DZEA 5JCTA 3WX5A 4BQ1A 1JOJA 3LA3A 2XQXA 1ZZ7A 2QDRA 1VR3A 3HT1A 3WG1A 5A32A 3DGTA 3GBWA 4TLFA 1TMF3 5C3RA 2DVFA 4XFCA 4EZ4A 1EAH3 3JBG1 3NV3A 3RYPA 1COV2 2WWUA 3CJIC 3C7EA 4IDZA 2RS32 1GNYA 3ZFEB 4DNYA 2A73B 3WNOA 2BNOA 4OHVA 2WNVC 3H42B 4TZDA 1X82A 3ZPYA 4CPBD 2W1QA 4WVMA 1SLAA 2QQKA 4XMAA 4CDUC 3T0DA 2QDNA 3JBG2 4BK5A 2Y6HA 3LOIA 4AQTA 3FBYA 1T2XA 2VU9A 4FOYA 3GBGA 2IXIA 1A6CA 3POGA 2JG8A 5FZBA 1XE7A 4GJYA 1A3KA 3KGZA 4LOTA 4ONUA 3VD5A 2VOVA 4XTMA 3TN91 3DKQA 3T1MA 1PZ8A 5DMYA 3IDAA 2ERFA 2DUOA 5JIUA 3AMNA 3ON7A 3GCXA 1LB2A 2RS51 4HFSA 3CDZB 3W21A 3WINE 1SCSA 3ABZA 3QACA 1SDWA 4JCKA 4CU6A 1KS4A 2C0ZA 2ZOEB 4XVHA 5G04L 5GALA 3ROUA 1JYIA 2OW4A 3EMRA 4XCAA 5FKCA 1VAVA 3TN92 5FY9A 4FP2A 3CF6E 3BYWA 3LCPA 2HYKA 4RS5A 3B93A 2JDZA 4UYBA 4ZY9A 5LB6A 3ZFEC 1ODNA 1LU1A 5A1LA 1J84A 1VMFA 2GP5A 3MF6A 2GU9A 1EUTA 1K5JA 2NLRA 2GNBA 1N47A 2RS52 1CJDA 1OKOA 1PO11 1W8WA 3LEKA 4QQPA 4YVWA 2CHHA 2QQNA 5FBJA 1CX1A 1VRH3 3OBTA 4NHKA 5FPZA 1F4HA 1H0BA 1ZRIA 3ZN6A 5CEHA 1PVXA 3C8XA 2K2SA 3D6EA 4KG8A 2HEVF 1GP6A 3FUOA 3B7MA 3DXTA 1KEXA 1UW8A 4IUGA 5FCCA 4D7YA 2WNUA 2WZR3 4CPBA 1GZCA 2LM3A 2BFUL 1PIV1 3T2OA 3WQ7A 1PO21 2HWB3 3T2QA 3IMMA 1VIWB 2YBKA 1PO12 1BXHA 4ZONA 5KHIA 4R9DA 2WABA 5A7WA 4FAHA 2YXSA 1OA4A 3CO2A 2IC1A 5A3NA 4O7XA 2P5BA 3N7LA 1ULGA 4XXAA 5FO9B 3KQ4B 4FTEA 1FPN3 5J96B 3RWKX 1YFUA 1Y3TA 2ET7A 4HVOA 5T50A 3UESA 4Y20B 2V09A 4PCRA 5C4WB 4BJ0A 2Y6KA 3WDXA 2H6CA 3CHXA 4W4ZA 5I8SA 1CAVB 3TEWA 2RMU1 3M3OA 2A1XA 2W47A 2D6PA 5IK7A 4MGYE 2PHTA 1MR5A 5FJHA 3ZXGA 1ND3B 4MVTA 3FZ3A 2A71A 2ID4A 3MPPG 4JGZA 1C4RA 2Q8CA 2FHRA 3G7DA 4DEVA 3ES4A 2DVDA 5FYZA 3ECQA 4XETA 4XFGA 3VBHA 1ASJ3 4Y1UA 5CFDB 4JKMA 2VUDA 4CXXA 5DDJ3 2WFPA 1GLHA 3DUIA 4FFHA 1UN1A 1WD4A 4RL7A 4RQPB 1PNFA 2ARCA 4CZSA 1W28A 2WO3A 3AYDA 2QE3A 2P1BA 3RVHA 1SHWB 2D6LX 4LO5B 1YJKA 4TWTA 1LOBA 3VGIA 3B00A 3OGSA 2P6HA 4CVUA 3AKQA 3VBUB 1Y4WA 4UW5A 4V1PA 2HBUA 5IYYA 2E53A 1MACA 3PTYA 3X29B 4H2AA 1W90A 2ZACA 1W6QB 3NW4A 3QOPA 4AVCA 4COZA 1EPWA 1BYHA 2Y0OA 4KGGA 1HRI3 4RGGA 3E5QA 3POWA 1S0EA 1UZWA 2NMNA 3AP7A 5FZ0A 4DB5A 4NAMA 4YM3A 1FT9A 5C4WC 1GV9A 4I30A 1CJPA 3WHTA 5C9AA 2ZGTA 1AJOA 1O4TA 1QWRA 4N7IA 2UYAA 3VBRB 2EIGA 2NP0A 2JB4A 1Z78A 3PIGA 1AR93 3I8TA 1ND3C 1D4M1 1VJ2A 3ZO0B 1R1ZA 2DCZA 1JW6A 1SBFA 1ZA7A 3K48A 3AKTA 1S55A 5KC5A 1RUG3 3SH3A 3O12A 2DWRA 1V6KA 5C70A 4UFJA 5CFDC 3SLIA 2QQVA 1K12A 4YVSB 3ZFFB 4B4PA 5A7PA 3KQRA 4RQPC 4OHZA 2CGPA 2WN2A 3OBRA 4PF1A 1OVPA 1T6BX 1WLCA 4K8FA 2KXLA 1G9CA 1F5JA 1OSGA 4XW3A 3MV11 3U37A 4XIKA 4LBQD 2W08A 4CCLA 3VBUC 4KBBA 1LAJA 3F2ZA 3SNMA 3ZYJB 3HQUA 1GZTA 3KCCA 4LO4B 4MH0E 2Y6JA 4CUBA 1HRV3 2C1FA 2QQMA 3QLQA 4FPJA 3DL3A 4AF9A 1HX6A 2PXJA 3MIGA 1RL3A 3UJQA 1OVSA 4LITA 1RXFA 2AUYA 3CZJA 4QPGA 3ZSJA 4O65A 3IBMA 1HV0A 4CE8A 2G9ZA 2K0GA 1VAMA 4FT8A 5LY2A 3VV1A 1POQA 2ARXA 4JQRA 1F4AA 1SG3A 2DVAA 5L9RA 2J1AA 5LBCA 3A22A 3VBRC 1WZXA 4ARXA 3AKRA 3H3UA 2XL9A 3BI3A 1YRZA 1E5HA 2D7FA 3TAYA 4N43A 2WA3A 3MIDA 4BQXA 3O1RA 4UAPA 4B8EA 1C1LA 3NSTA 1QDCA 1WLDA 2Q30A 3CNAA 3ZOIA 3M70A 2A75A 2OVUA 1OQEA 4Z2AA 4EN6B 1G9DA 1URXA 2WYSA 4OULA 2GNMA 3UNPA 3S57A 3ZYFA 1TNRA 4YVSC 3USUB 3ZFFC 1ZRFA 3CZUA 1W06A 1BEV3 2GMMA 4GA9A 1ZZCA 4YNIA 4YZ2A 4IEZA 1SQ4A 2ZGKA 4URAA 2F17A 5K0UB 3O1OA 2XQRA 1O4YA 1V0AA 1W2NA 3GALA 3NVCA 3KLSA 4NR1A 2DVGA 3UGGA 2ADDA 3BIEA 5CZKA 4CP1A 2XLAA 2DUQA 3VDDA 2J1EA 1YFYA 2Y6FA 5FZEA 1OPOA 4IESA 1ULEA 4MUVA 4LBQA 2J7MA 1F9KA 4A6OA 2IZWA 3WHUA 1NT0A 3WR0A 3ITQA 3EQEA 5CKMA 2ILMA 2VL4A 4D6QA 3W58A 3I49A 5CFCA 2ZGMA 3P6BA 4BQWA 1OQDA 5I93A 2FDJA 3J8F1 4DUWA 1MS0A 1R093 3U78A 3H8UA 4H7MA 1OF3A 4KL1A 4GKYA 3GM8A 5IVVA 2D3RA 3T09A 4HL0A 4LORA 3WCRA 2AH2A 2YBPA 3POYA 4R8HA 2RHPA 2A3XA 3CMGA 1DQ2A 3A4UA 5F5CA 3I3EA 1H30A 5FZOA 5B2GB 3J8F2 3DKWA 5FMCA 1JZ5A 3VBFB 4GH4A 5K0UC 3LQCA 1RUH3 1F35A 2PN5A 2XJTA 1W8NA 2D6NA 4YZ1A 4IV3B 2KA3A 2R061 2TUNA 1PGW1 3ACLA 2DDUA 4FFFA 3CJXA 2EIBA 1UIJA 5GLTA 4AHXA 2RR11 4LQRA 5I0TA 1ZBA2 3S7EA 3KV6A 2VW2A 1UU6A 2R071 3J7HA 4HETA 3GZUC 3HNMA 5L73A 1R081 5DAXA 4QX1A 4Q8KA 2LROA 1FV3A 3U4XA 4MO3M 1XBFA 4CCMA 2G19A 1VBA1 1ZRDA 1CAUB 5FLIA 2BPA2 2R062 2GN7A 3AVRA 5A7NA 1IS4A 2WA4A 3ZDVA 5FDBA 3WNLA 4ZKTB 4XBLA 2RDSA 2RR12 2YROA 3MW2A 3OBAA 4WVWA 3VHNA 4K6BA 1VBE3 2R072 3M3CA 4ASKA 4Z92B 1RITA 1B35B 2Z79A 2W0XA 3BB6A 1ULOA 4JTNA 1LHVA 5FK8A 3WW3A 3ZN5A 4Q4Y3 2WT2A 5HPOA 2VW0A 4BA6A 1Q8VA 3LAGA 4RGKA 5DAWA 1RMU3 1LGCA 1OUSA 4JDMA 5F6LB 3POFA 3K4ZA 3NO8A 5FZ9A 3TOJA 4LKDA 1L7RA 3ZSMA 1QXRA 2VO5A 2GH8A 1NQDA 2WO7A 3ACHA 4H55A 3VBFC 4OI2A 1OFSA 3LA7A 5FP3A 1UU5A 3WDTA 2W1WA 3V0AB 3H1MA 3SC7X 2D5FA 4BQ3A 4IV3C 1NLSA 4XTPA 1HN1A 1F31A 5KHGA 5EFUA 1RUC3 2JICA 3AZZA 4LHNA 3WDYA 4E2QA 4WM8A 4K1YA 2WZEA 1W2OA 4M3CB 1H1AA 4QXHA 5FYBA 1LHUA 3VHRA 4LK6A 4BU2A 1V6JA 4L9BA 4PQQA 4Q8LA 4QDRA 3R4DB 5IJRA 3LEGA 3ZYRA 4AVBA 1ULPA 4AI2A 1HDKA 4HK9A 2SBAA 3PJYA 5FMOS 1XU1A 3JZVA 4AQ6A 2QTWB 1AYN3 5FZ6A 2CWMA 2VVFA 2BNNA 3PUHA 5C71A 2WT0A 4QPIB 5ACA3 1B35C 4A41A 3AJZA 3C7HA 3O1MA 1FMD3 2NMOA 3FMGA 1DLLA 1X8EA 2O1QA 2NYYA 4COWA 3DECA 2QKDA 4UF0B 1RHI1 2B8MA 3H1YA 2DVBA 3NKTA 3P3NA 3LEIA 3T4VA 4XILA 3OPWA 1QH6A 5LA9A 3I2IA 3RGBA 5LY1A 3THPA 1AUYA 4FXKB 1N1TA 4XF0A 3OGGA 2WQZC 1SPPA 2OQ7A 1XNAA 2V5DA 4L2NA 2HWC3 4M00A 3SCHA 5JMOA 1AXKA 5KXDA 5JIAA 4COUA 2JDKA 3LA2A 4CU9A 3K51A 3AKPA 2G9FA 4ORFA 2RVAA 3H7YA 5FQ0B 5FY1A 3WUCA 3OBZA 3MV01 4X6QB 1RHI2 4LK7A 2D6KA 4Q2FA 3IDEA 4NWVA 1WA6X 1O8PA 4WM7B 3T3YA 5J3UA 2P3KA 4NPMA 2XPJA 2JEMA 2P3YA 4Q4X1 1AHSA 1J3QA 4Q4W3 1MQTA 5FY8A 1X9TA 5JXHA 4LT5A 2VVEA 3DF0A 1DG6A 2YC0A 5AVAA 4XHXA 1N1SA 4BQ4A 2PHLA 4UFIA 4R4XA 4MGTA 3D0JA 2FQPA 4Z82A 1H4HA 4LLFA 1AX1A 1NXMA 3KV4A 2ORXA 3HJRA 4MGQA 4QPIC 2BOIA 2JDHA 5F5AA 1YQ8A 2ZCWA 1J1TA 3O0XA 4MLOA 4Q4X2 3RNSA 1P8JA 4B4RA 1MEC3 4WVMB 4ZZ8A 2DUPA 2RJ2A 2RS11 3LDBA 5LA0A 2Y34A 4A7ZA 2QCSB 2A70A 4XMIA 3AVSA 1PVC1 1S2KA 5DUUA 2JG8B 5FZKA 4AR2A 2RDQA 3AMQA 1F15A 5CU1A 3HQRA 1VBB1 1TME1 4B7EA 5J37A 3O1SA 3WP6A 5J98B 4BM8A 1FXZA 2H0BA 2VCCA 2RS12 5IATA 4GWIA 2K46A 4WM7C 4CEYB 3B5LB 3PUIA 1ND2C 3BKZA 1HKDA 1DU3D 1HB4A 3JD71 3N9MA 1TEIA 3SITA 2E7TA 1C28A 4K9SA 1REEA 4BQ5A 3U14A 4U2AA 4W50A 4XFIA 1OOPA 2WN3A 4MGSA 1JTZX 1VBB2 1TME2 1XNDA 2RDRA 4CP2A 1U12A 4Q0PA 5DUWA 2A6ZA 4IE7A 2AGSA 3RI9A 1U0AA 2EA7A 1LULA 1QXPA 1OLMA 3HEIA 1R1A1 1DZTA 2UWAA 4K20A 4YGEA 5D2AA 4I0BA 4OLLA 1RUD3 1UYXA 3KMHA 4AW7A 1AR61 2OKXA 1XE0A 4XFBA 2OX0A 3OUIA 5BNOA 1O3QA 1N1VA 4IGPA 2Q1MA 4XJAA 4Y1XA 3ZN6B 5BNPA 5FYVA 2ETEA 4URTA 1ZZBA 1ZRRA 1BZWA 4MGKE 4CDXA 1XSRA 1RVF1 2J1SA 5E6HA 1G86A 3AXEA 2JG8C 4LA2A 2BWCA 1I9RA 1G8WA 1IGOA 2CAUA 2NM1A 4DXZA 5A7WB 4YGCA 1OHFA 2R49A 1S0CA 3BTXA 3C7GA 5FPAA 3BU0A 3K2OA 5A70A 2RM23 4PF5A 2WQ4A 4UFLA 3ACFA 2FCVA 3D5OA 1GSLA 1VBD3 4QQLA 3AM2A 1XYOA 3T0BA 3VKFC 4A3ZA 4CEYC 2I2SA 2DBIA 1RVF2 1JUIA 4QX8A 3BODA 4UWDA 1FNYA 3N36A 1GQHA 3SEPA 1W9TA 3VBSB 1H2KA 3I2GA 4FPEA 4FTSA 2JG9B 1ONAA 1K5MA 1W6OA 4W65A 5IFPA 2JDUA 5D8AA 5FUNA 3RZZA 3CU7A 4LIVA 4NAOA 4CUGA 3U0ZA 1XNCA 4NRPA 1PZ9A 1SFYA 4UFMA 4E2SA 3I2OA 1OFNA 1N3PA 2D40A 3DCQA 3HQXA 3KT4A 3PDQA 2PQSA 2FCUA 3TB0A 5JDBA 3MEPA 4YZ3A 5F3GA 2Q8OA 2ZJCA 3RDIA 3WT3A 2TEPA 3HMYA 1H8TB 1UY3A 2VMCA 2WNUC 4QAWA 4DZGA 3DN7A 4Q4V3 3ZMNA 3VZJA 3A0KA 1JYTA 1TMF1 2EVXA 4GKXA 1JODA 3H0OA 4PLOA 3MUZ1 4PI0A 2LW8A 4LXLA 4KWUA 4Z07A 5J7MA 3LPGA 1BK1A 2VQAA 1W0PA 4QMAA 1OURA 3KZ4C 2BBAA 2BBVA 3OYWB 5FO7B 1UY1A 3I2JA 3USSA 1OC1A 5AC93 2JIGA 3V0BA 3VZOA 2GAUA 3WDWA 1XC6A 5FZLA 4N7UA 3FHQA 1JU3A 1TNFA 2HEWF 1ZVFA 3KGLA 1MS5A 1WMEA 1GICA 5BY5A 4I02A 1VALA 1G9BA 1OLME 3AK0A 5F1RA 3QH6A 2HWF1 3M2MA 4LNVA 4HZFA 3ZX7A 4PIYA 3A0NA 3MIFA 3NKGA 2LTNA 5FZAA 4KWKA 1POV3 2WWJA 2VUJA 1JYWA 2WYFA 2DCJA 3NV1A 4N53A 3S30A 3I54A 2ZMLA 1QJX1 1CZTA 3ZR5A 5I8TA 3NL1A 4LBLA 5JZGA 1H8TC 5ABJA 5JI9A 4N9HA 2VGDA 2HWF2 3QCWA 3GHNA 2BGCA 4LKFA 4O9GA 3B02A 3WOGA 1W6MA 1W9FA 2C4XA 4NRMA 3I59A 2VQ0A 5B4NA 1GANA 3VKLA 3L9JT 2W39A 3WF3A 1QJX2 2WFF2 5F2WA 5F5IA 2I07B 1RUF3 4YW6A 2WS91 3WG4A 4CUCA 1WKYA 4XDPA 1AXZA 3A23A 4AHZA 5A80A 5T5PA 4QDSA 1QH7A 1MS4A 3DPRA 4MHRA 3ZXFA 2WZR1 3FUQA 1ODMA 1RJ7A 5LA1A 3UGFA 4AVAA 3Q8AA 1I6XA 4LMFA 4CSWA 5C3QA 1DGWA 2JDYA 2OT7A 2ZX0A 3WNMA 4Y22A 3BGAA 1Y43B 1V9U3 1BBT2 1WW5A 3IPVA 4OVEA 4J25A 3ZXKA 1XPWA 2YU2A 4JRLA 2WS92 3K4DA 4LBOA 2BERA 3BUCA 4I01A 5FMBA 3WG3A 5DAPA 4JDNA 4PJYA 4B1LA 1GP4A 1MVQA 3E6DA 3OOXA 2YPDA 2ZMNA 4Q1RA 1KJRA 4QXBA 4UOJA 2G9GA 1LODA 4I2OA 3BPSA 1WUVA 2PHXA 5HV0A 4M0NA 1BVVA 3I2DA 5CKQA 2D3SA 3WEZA 4MG2A 4XABA 2ZX1A 3CLPA 5KHHA 1QHDA 3GZEA 1W8OA 3VDDB 1NCRA 1NYWA 4BPZA 4I09A 1REDA 4EN7B 3AXDA 1HQNA 2R32A 1XNBA 3AL6A 1HB2A 1NUKA 1NKGA 2BP6A 2VMIA 2B5HA 2W1SA 5IVCA 4HKWA 1UMZA 4BB3A 4E2GA 2GP3A 3NJYA 3MF9A 1RUI3 4MX3A 5DDJ1 3IIIA 1VP6A 3HN3A 2C9AA 3J7LA 4GWNA 4UI9L 2QFEA 4XDQA 4MXVA 1BCXA 4BQYA 5EQUA 2VNRA 3I3QA 1XJAA 5A3PA 4D0QA 3I3MA 1JZ4A 4E9KA 1SBDA 1XOYA 1V6NA 1NY71 1S0BA 2VECA 4YW7A 4G9SB 4XUQA 3MZHA 4XC9A 2E7QA 1XB9A 4RFRB 5LBBA 1S0DA 2HWD3 4E4SA 2FZ2A 1S0GA 3N9OA 2FDKA 1HRI1 4EN0A 4GWJA 4GZ9A 2Q8EA 2B4KA 1W6NB 3G6JB 4P14A 3QH7A 5L36A 1DFQA 2WO2A 3HNYM 4P02B 4AZZA 1QKQA 3MUY1 4C1XA 5T5JA 4YG0A 3F95A 1NY72 2Y26A 5KXEA 1EP0A 3KF3A 2ZXQA 1U5IA 2RV9A 1Q8PA 2IUWA 2WT1A 2W5FA 1RTVA 3V65A 5A6ZA 1AR73 4MHUA 4X8PA 3VDDC 2VC9A 3ATGA 2W3JA 2X8KA 1HRI2 2R043 1QF3A 3EB7A 3LIGA 5JVVA 4DXRA 5EWSA 5T54A 1RB8G 1W6PA 4LKSA 5HBAA 1RUG1 2CWSA 3BU7A 3RMXA 3URFA 3D3AA 1W0OA 5LASA 4M4PA 4EN8B 3GHMA 3HD8B 5EIYB 4HKLA 4IXLA 2XVGA 2HKXA 4FOQA 4UW6A 4AI3A 4NJ4A 5C3SA 4DMIA 4GXLA 2OS2A 4K40A 2PMWB 1PM7A 2JB8A 3KV9A 2P17A 4OUEA 4XQ4A 1MZFA 4MADA 4XAEA 3MPBA 2UURA 2UY8A 5LBFA 3ZFGB 3GZTB 4D69A 4W6WA 3M1HA 3B3QE 1IPJA 1J58A 5F8PA 5FMDA 2B46X 4JGYA 1DGWX 1Y7BA 3PHMA 4ZXEA 5FO8B 2Q5TA 2W9XA 4LLOA 1QJY3 1HRV1 3I97A 4ES9A 3JB4C 4A6SA 1BLZA 5F39A 5IVBA 2VE1A 3APBA 1QQP3 1PIV2 3M7AA 5F37A 1IZ3A 1PO22 5FLJA 3ZYHA 1U5XA 4RSUA 4KWJA 5EYXA 1JS9A 3LE0A 3UL2A 1UX6A 3FHIB 5DUXA 4HSJA 4XFHA 5JOXA 2YFZA 2J1UA 3O1PA 4PDWB 1PK6B 1E5SA 2DYCA 3PU8A 2RS33 1NCQA 1NX9A 3PUAA 1V6MA 4IETA 2RMU2 4LBKA 3WQBA 3ACGA 2IWGB 2VMEA 5A7SA 5HV4A 1BEV1 2GC3A 1S1AA 2KD7A 3ZLIA 2R1DA 1O6UA 1WD3A 1LR5A 3JBG3 4OZOA 3TWIA 5C8WA 3ZFGC 4Q0VA 4DUXA 4PBOA 2VOXA 1UOJA 4S2FA 1UOFA 4TTGA 4I0WB 4NOTA 5BYNA 1C57A 1UZYA 4LULA 5BNNA 4IEVA 1J3RA 1CX4A 4QX2A 3JU9A 3WQ1A 5ERLA 4BOWA 1WGPA 2UWCA 5BPXA 5A3UA 2VTFA 1JYNA 3ZVXA 3ST7A 2P3JA 2VY0A 3AC0A 3IZOA 3SKVA 4IGOA 4GAZA 4JDOA 4DPNA 4NIHA 3NNFA 2IVJA 2YC4A 3Q8EA 3WF4A 2Y60A 2BQPA 3P3PA 4GMP1 5JAXA 2ZS6B 1RC6A 2D5HA 2IFRA 4YGDA 4ZHNA 2WZ8A 4CDQB 1CAWA 2OYZA 1UYYA 3HPNA 1QJU1 1PK6C 1Q5OA 1R091 4PDWC 4XQDA 3BOPA 2FMYA 3N9LA 4FAGA 2P2KA 1CPMA 4FPCA 1LENA 1IG3A 4DOUA 4FPOB 5GZDA 4MV2A 5FZFA 1TE1B 3KB5A 1MQTB 1WCQA 4MXWA 1FI2A 4GB31 4GD4A 4XFAA 5FUIA 4AVVA 4H14A 4YARA 5FOBB 3WLUA 1D4M2 1UY0A 4RR3A 1WMFA 4XACA 1QJU2 1O7FA 1R092 1LOFC 4CRQA 1RUH1 2DURA 1XE8A 3MW4A 3T0AA 1SDDB 3ALQA 3OB8A 3UETA 2WINB 3WF0A 4AQSA 1Z7S3 1J59A 1CZSA 4IV1A 3I4IA 2ZGNA 2E33A 1U5YA 4GB32 3MO4A 2GDFA 1HB1A 3ZMOA 1XYPA 4IE5A 1PMJX 3LSDA 1WCKA 2N7GA 5FZ8A 1OA2A 1RUH2 2VMGA 4JAAA 2MPFA 1VMHA 3RPQA 3H3LA 1UIKA 2ZAHA 3AL5A 5JR7B 3B9IA 1IOAA 3FFZA 3PNAA 2YDEA 5FWJA 2HWE3 3AYAA 3CJIA 4FPFA 4LBJA 4TYSA 5BV6A 1MS1A 2WNOA 1UU4A 1VBE1 5ANQA 4CDQC 1CESA 5FMOL 4CTEA 5FYMA 4HVRA 1VB4A 1HXS1 4K1ZA 5LATA 1KFXL 1LOAA 1KXGA 2Q1ZB 4L0PA 3GXUA 3IAQA 2CAVA 4K21A 4E4HA 1F5FA 2JE8A 4S2DA 1LJ7A 4QB6A 4FPGA 4PQ9A 2F6BA 5JWPA 1MQTC 1RUE1 2UY9A 1LCLA 1OOPB 1RMU1 2FDHA 2XHKA 5HXVA 4OUSA 4XCBA 1WWYA 2BWAA 2BV4A 1YYNA 1PZ7A 2PQQA 4ARYA 4BDVB 1HXS2 4AK3A 4IE6A 3ZXLA 1IPKA 5T5LA 4AVTA 4RN5A 3PIJA 4RA0A 5L7OB 5A6QA 4COVA 2GC2A 2I74A 1Q8OA 1IKQA 4XOGA 1RUE2 5FJKA 4YM1A 3R4UA 3VBOB 5C3PA 1H2NA 4QU2A 3W9AA 5FLHA 1CPNA 2BFUS 1KS5A 4QQ2A 4FPKA 3AFGA 4HT1T 1ZREA 3AMMA 1AX2A 1Y9MA 1IS6A 4V2VA 4HPKB 5F32A 4QM9A 4CDWB 3LB9A 1O3SA 5I0DA 2AR6A 2WR9A 2Y6GA 3S0MA 4OMCA 4MSVA 4YM2A 2C5DA 3KVAA 3K77A 4XUPA 5DQ0A 1AYN1 2VH9A 2OPWA 3OUHA 1POV0 1PX3A 1D2QA 2D97A 5IWFA 4AAPA 4FTBA 1GZWA 5ACA1 3OD4A 4NUBA 2WDBA 3KM5A 3POSA 5FXZA 2J1TA 5GZEA 4P9YA 4AWDA 4A4AA 3MDPA 4YZ5A 2VZ1A 2FD8A 2MEV1 2R0FA 4A7KA 4YFWA 3WNNA 1D0HA 4AE2A 2WC2A 1OOPC 4QHOA 4FFIA 1DZRA 1DYPA 3THTA 3TEZA 1S2EA 3T4HB 1EV13 1AZDA 2BZDA 5A3WA 5FP9A 2JDMA 3K3NA 4KGQA 4NO4A 2HWC1 4PLMA 3WP5A 5ACA2 3AP5A 1H6XA 2EALA 4EWAA 1JOPA 4AOCA 4MYEA 1GOFA 4M4RA 4C0HA 5CBLA 1FATA 2MEV2 5IUQA 2FBEA 4LBMA 3SXWA 2EIEA 5HCAA 1JBCA 3OG2A 4IW3A 3SMHA 5L7OC 1X50A 2ET1A 1ENXA 2I45A 3VKOA 5HXMA 5J48A 4RYDA 3IAPA 4DINB 3HVDA 3RJRA 3VBOC 2QBXA 4INDA 2GC1A 2D44A 4D8MA 1V6LA 5T52A 4B1MA 3UKNA 4Q4W1 2BUKA 1QNYA 1C3HA 1W8HA 4DXTA 4J1WA 1CIYA 1H9WA 1PGW2 1XQNA 1BKZA 2VZVA 4LA3A 4CDWC 3VDBA 3INAA 1GQGA 2YBSA 3AFKA 3I3DA 3VN4A 4IEXA 3FN9A 4UW4A 2KM2A 3NAPA 3HWJA 5A1FA
chains in the Genus database with same CATH topology
2DBNA 2VBDA 1W06A 1HB1A 5C3SA 1W2OA 2JB8A 1HB3A 4XAEA 2BU9A 1W2NA 5C3OA 5APAA 2Y6FA 1UOBA 5C3RA 1QJFA 1W28A 1BLZA 2VE1A 1RXGA 1ODMA 5C3QA 2DBIA 1E5SA 1IPSA 1UZWA 1GP4A 3OOXA 1WA6X 1BK0A 2JB4A 5C3PA 1UNBA 3ON7A 1UOGA 1W05A 1UOFA 1HB2A 2VBBA 4BB3A 1UO9A 1HJGA 2CSGA 3ZKYA 1ODNA 1DCSA 1QIQA 2BJSA 2IVJA 1W9YA 2Y60A 1E5IA 2VCMA 1E5RA 1OC1A 1HJFA 1W04A 1W2AX 2IVIB 1RXFA 1GP6A 1QJEA 2VBPA 4RGKA 1W03A 2VAUA 1HB4A 1E5HA 2WO7A 1GP5A 1W3VA 2BRTA 3ZKUA 3ZOIA 1OBNA 1W3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBN A;  2VBD A;  1W06 A;  1HB1 A;  5C3S A;  1W2O A;  2JB8 A;  1HB3 A;  4XAE A;  2BU9 A;  1W2N A;  5C3O A;  5APA A;  2Y6F A;  1UOB A;  5C3R A;  1QJF A;  1W28 A;  1BLZ A;  2VE1 A;  1RXG A;  1ODM A;  5C3Q A;  2DBI A;  1E5S A;  1IPS A;  1UZW A;  1GP4 A;  3OOX A;  1WA6 X;  1BK0 A;  2JB4 A;  5C3P A;  1UNB A;  3ON7 A;  1UOG A;  1W05 A;  1UOF A;  1HB2 A;  2VBB A;  4BB3 A;  1UO9 A;  1HJG A;  2CSG A;  3ZKY A;  1ODN A;  1DCS A;  1QIQ A;  2BJS A;  2IVJ A;  1W9Y A;  2Y60 A;  1E5I A;  2VCM A;  1E5R A;  1OC1 A;  1HJF A;  1W04 A;  1W2A X;  2IVI B;  1RXF A;  1GP6 A;  1QJE A;  2VBP A;  4RGK A;  1W03 A;  2VAU A;  1HB4 A;  1E5H A;  2WO7 A;  1GP5 A;  1W3V A;  2BRT A;  3ZKU A;  3ZOI A;  1OBN A;  1W3X A; 
#chains in the Genus database with same CATH topology
 1Q3E A;  3AP9 A;  1R08 2;  2RG4 A;  2D43 A;  5CYY A;  5DPN A;  5IAX A;  3FBM A;  1VBA 2;  1GYK A;  1LOC A;  5FYC A;  1W2T A;  4B3N A;  5C8C B;  1MEC 1;  5FPX A;  4CEW B;  1LOE A;  2XL7 A;  2W95 A;  2BGO A;  5CB7 A;  3N4M A;  1OLQ A;  2VUL A;  4AED A;  4KNC A;  4Y5S A;  5EJ1 B;  3FL7 A;  3AMH A;  4AGR A;  3N9P A;  1QJF A;  4CCC A;  1ZRC A;  2FDF A;  1IQD C;  4Y1Z A;  1S0I A;  1W2U A;  2Z42 A;  4YW5 A;  1LGB A;  1UXZ A;  4HKO A;  3WQ0 A;  1S0F A;  2DTW A;  5FPB A;  3WVJ A;  4CCN A;  5FR3 A;  3KCX A;  4NIA A;  4GAL A;  2A3W A;  3ES1 A;  4Y3O A;  4NMI A;  4P5H A;  2IXH A;  4P5Y A;  3MLJ A;  4AFA A;  3IIA A;  5DG1 A;  2JIJ A;  3IM0 A;  4N53 B;  1TZO A;  2AZ5 A;  2P34 A;  5FUP A;  4DXS A;  4Y20 A;  1UPS A;  5C4W A;  3FC0 A;  1C8M 1;  1VAK A;  2XLF A;  4Y4Y A;  4QU1 A;  1QGL A;  1SMV A;  5ABJ B;  5KHJ A;  1H1I A;  1CAV A;  4L92 A;  1UKR A;  3I2F A;  1H8V A;  1ZNP A;  3RG0 A;  4C0B A;  1N1Y A;  1Z0H A;  3LOB A;  4IEW A;  4OI0 A;  3C2U A;  4JKL A;  5H9Q A;  2ZAB A;  5SV8 A;  1W6M B;  1ND3 A;  1GWM A;  2XH6 A;  4GUL A;  3I59 B;  4Y24 A;  3IKW A;  4A3X A;  5FY5 A;  2ZEW A;  2TBV A;  3BN6 A;  2GC0 A;  5A3T A;  1C8M 2;  1JN2 P;  1GZ9 A;  1OMI A;  3IWZ A;  3VKN A;  5C8C C;  2X5I B;  4M3C F;  1TVG A;  2CL2 A;  5LK5 A;  1W05 A;  2Q4S A;  4CEW C;  4RQP A;  1ST8 A;  2VBB A;  4TXW A;  4BZ4 A;  2XVL A;  1ALY A;  1CAX B;  4HN0 A;  4QKD A;  3C3V A;  3GZA A;  4FOW A;  2W92 A;  5EZW A;  1QEX A;  1W39 A;  2CSG A;  3S5Q A;  3J8F 3;  5FPV A;  5B4X A;  3VBU A;  4NN0 A;  3O0W A;  4ZU4 A;  4ATE A;  1ENR A;  3GDB A;  1V70 A;  1NZC A;  4W6Y A;  1Q8Q A;  5FZH A;  2X05 A;  3AZY A;  3TNQ A;  1D2S A;  1OD3 A;  5EYY A;  1VBD 1;  2DTY A;  4XF4 A;  1ND2 B;  2JDN A;  3W20 A;  2DCT A;  2IXL A;  4N53 C;  4ASL A;  4G4F A;  1ZBA 3;  4QX7 A;  3POJ A;  4QKN A;  5CVR A;  2PLV 1;  3NV4 A;  5A33 A;  3KHB A;  5A32 B;  2B9V A;  4BIF A;  5ABJ C;  2VW1 A;  2YB7 A;  2ZPX A;  2GME A;  3OSD A;  3IMN A;  4HK8 A;  3FWE A;  3NNJ A;  2R06 3;  4Y1V A;  3WV6 A;  1NCR B;  2YUE A;  1I5Z A;  1VBD 2;  4HXC A;  3GBF A;  3BCW A;  4JRA A;  3EO6 A;  1JHN A;  2F4L A;  5FFO C;  4Z8B A;  1WCU A;  5IVJ A;  2PLV 2;  1ZA4 A;  3IDC B;  4CCD A;  5FZC A;  3ENR A;  2UU8 A;  3OF1 A;  4QDQ A;  2X5I C;  1UD1 A;  4LHS A;  4QB1 A;  4YVS A;  1AYM 1;  2VQU A;  5C6C A;  4F3J A;  5GZG A;  2TNF A;  4XJW A;  5A3O A;  1AL2 1;  3W59 A;  2XOM A;  3NV2 A;  3PL0 A;  1HIX A;  4E27 A;  4UFK A;  4WZC A;  4OZX A;  4Q4V 1;  2EF6 A;  3LDK A;  4SBV A;  4LBN A;  4QXC A;  5LW9 A;  4DRV A;  1I3H A;  4FPH A;  4ES8 A;  4R52 A;  1F2N A;  3RJ2 X;  3WF1 A;  2JKB A;  5K4L A;  1N3O A;  2V4A A;  5GM0 A;  4JHT A;  4XUO A;  4YFZ A;  2EIC A;  5APA A;  5JPN B;  2J1R A;  4BIS A;  5L19 A;  3O1V A;  1AYM 2;  3NRU A;  2ARA A;  1AL2 2;  4UBG A;  3FLT A;  4L99 A;  1LNS A;  1PVC 2;  2V72 A;  4TSV A;  4WV8 A;  5AC9 1;  2Z4F A;  2PAK A;  2ZX4 A;  1E57 A;  1LGN A;  3BOW A;  4UBH A;  4YPJ A;  1VMJ A;  5C7G A;  3WZ1 A;  3MW3 A;  1YNA A;  2ENR A;  4FSJ A;  1YQ6 A;  3ACI A;  4ERO A;  2B9U A;  2UWB A;  3LF7 A;  3VKM A;  2XBO 3;  1V6I A;  2RDN A;  1OD5 A;  1HQW A;  4RS5 B;  3LSE A;  4LR4 A;  3LWC A;  2CGO A;  2PHW A;  4NHY A;  3ZXE A;  1GWL A;  1NCR C;  5FXV A;  5E88 A;  1IG0 A;  1SAC A;  3JD7 2;  1JZ8 A;  2ZHN A;  4AGG A;  1UCX A;  1W6P B;  1Y9G A;  3AB0 A;  4YVW B;  5AC9 2;  3E6C C;  3DV8 A;  3THD A;  1CGP A;  4QXK A;  4AFM A;  2LRP A;  1POV 1;  2EAA A;  3BVC A;  1RUO A;  1JHJ A;  3S6P A;  3V56 A;  1DP0 A;  1ULC A;  3Q8B A;  4Q26 A;  1UY2 A;  1WBL A;  2HBT A;  3WW2 A;  2B7Y A;  3USU A;  2VJX A;  2OQ6 A;  3SH5 A;  4B4Q A;  1NG0 A;  2WNU B;  4YW1 A;  4A44 A;  4HMZ A;  4EZH A;  1YHF A;  1R1A 2;  2BDR A;  1LKN A;  1BK0 A;  1NLQ A;  4XF9 A;  5K0U A;  2R1B A;  2MNG A;  2CY6 A;  4LPL A;  4XUT A;  1AR6 2;  1DBN A;  4PLN A;  4AI9 A;  4AL9 A;  5DAB A;  3DEM A;  1SFP A;  2D6M A;  2ZGP A;  3DXU A;  1DYO A;  3ETP A;  4AHW A;  3OGR A;  1DYK A;  4LKE A;  2JX9 A;  1RUF 1;  4X8N A;  3ELN A;  5DUV A;  3ME2 A;  2ZKN A;  1WW7 A;  5EV7 A;  3ZR6 A;  3OGJ A;  1SLC A;  4NPR A;  4FOV A;  3PVO A;  3D8C A;  1IHM A;  1VLN A;  3O14 A;  3KD4 A;  4RS5 C;  1IS3 A;  5I91 A;  1PGL 1;  1WBF A;  5M0T A;  3PUS A;  4N90 A;  3CIH A;  4JGZ B;  4E8D A;  1E5I A;  3FLR A;  3WW1 A;  4AXO A;  1V9U 1;  2OXB A;  4RHV 3;  5CIS A;  4DY3 A;  1RUF 2;  3AZW A;  3VBH B;  1NCQ B;  4YVW C;  2XLG A;  4Y4R A;  4ZS2 A;  4BWO A;  1KGY A;  4DFS A;  5JR2 A;  2P37 A;  3J26 N;  4H3W A;  2ZKL A;  4IQP A;  5K9Y A;  1UF2 C;  4JKK A;  3LGR A;  3T08 A;  2Y8K A;  5E1R A;  1ZBE 3;  1DGR N;  2PHU A;  3ZYB A;  5CAD A;  1PGL 2;  4K3U A;  3H3Z A;  2A6V A;  2P3I A;  5A3M A;  2WUH A;  5JOY A;  2OUJ A;  3VBF A;  1ENQ A;  1EAH 1;  4G3Y C;  1LHO A;  1NA1 A;  3I7D A;  4XF3 A;  2VZS A;  3KT7 A;  3HT2 A;  4XE9 A;  3RS6 A;  3RWN A;  3ZM8 A;  1JOB A;  4BXF A;  5JSP A;  1QXJ A;  5FYT A;  3DYM A;  3VZM A;  3J9S A;  4WZF A;  5C5U A;  5I0R A;  2EXH A;  2ZGO A;  5IVF A;  1MZ6 A;  4XQW A;  5LRR A;  4DRR A;  4DUV A;  4ATF A;  2RS1 3;  4AVS A;  2DBN A;  5C33 A;  1RUI 1;  1TMF 2;  2VQT A;  3RZJ A;  5DN2 A;  1EAH 2;  1CAU A;  3OTF A;  5C9A B;  3ZXD A;  5FTT C;  3ASI A;  3HAG A;  2VM9 A;  2ZZQ A;  2BU9 A;  4LO7 A;  3TEY A;  1ACC A;  4OUM A;  5TSW A;  4KI5 M;  4P9W A;  1A78 A;  4QX5 A;  1H2L A;  1V6O A;  3IDB B;  2A6W A;  1CAW B;  2FZ1 A;  3UT0 A;  4JGZ C;  2YG0 A;  1M4W A;  1C1F A;  1B35 A;  1GKB A;  4O61 A;  4XZU G;  2VOK A;  4AI8 A;  1IQA A;  3VBH C;  3O1U A;  1NCQ C;  4LHK A;  3ZN4 A;  1RUI 2;  4EV0 A;  1LHW A;  2HWD 1;  1YIF A;  3VZL A;  2ZGL A;  1YQC A;  4OQ8 A;  3MYX A;  3PLQ A;  5J36 A;  4KWL A;  2ZX3 A;  3UKT A;  1SLB A;  4YW4 A;  2RJK A;  5HCB A;  5CA6 A;  2FDI A;  4RR3 B;  2CV6 A;  1YUD A;  2VZ3 A;  4X6R B;  4AAX A;  2VCB A;  2QQO A;  1BMV 1;  4PHZ A;  3KS7 A;  2OII A;  4Y5T A;  1UZ0 A;  2QQU A;  1PM4 A;  3V0A A;  1I5P A;  3V64 A;  4DIQ A;  2BTV C;  2JD4 A;  4LOS A;  3VD9 A;  3O0V A;  4P9G A;  1FV2 A;  4HVQ A;  4IGQ A;  2XKO A;  4I0A A;  4LE4 A;  1PMI A;  1Y9Q A;  4QPG B;  1EPZ A;  4MZU A;  4Y26 A;  1VRH 1;  3QBQ A;  4AEM A;  4AHY A;  4M3C A;  3K46 A;  2ZX2 A;  1BMV 2;  2XGX A;  2G1M A;  1UNB A;  5C9A C;  1FX5 A;  2VXJ A;  3PME A;  2XUM A;  1QNW A;  2EAK A;  2B39 A;  1AF9 A;  4E4D X;  1B09 A;  4HBN A;  5FZD A;  1UOG A;  2HWB 1;  4N43 B;  1VBC 3;  2W87 A;  4FXG B;  1UKG A;  1MS3 A;  1VRH 2;  2NPI A;  3PVB B;  1SZB A;  2YPJ A;  3KF5 A;  4QPI A;  5FZI A;  5FY4 A;  2RJL A;  3HBZ A;  1QJY 1;  1CWP A;  4I3G A;  2CYF A;  3O5S A;  4XIO A;  4CCJ A;  1FPN 1;  1GWK A;  1KRI A;  4UF0 A;  3MI8 A;  2WL1 A;  2WZR 2;  1YFW A;  1QQP 1;  1O3R A;  2HWB 2;  4FPY A;  1AR8 3;  1LED A;  4RR3 C;  1ULF A;  2JE7 A;  2EXI A;  4OHY A;  4GJZ A;  4WBB A;  4W6X A;  2VZP A;  5JMC A;  2JDP A;  1WA4 A;  4YW3 A;  3RZK A;  1OF4 A;  4GIQ A;  1FPN 2;  5FQ0 A;  3DYO A;  4D7T A;  1APN A;  4LBQ B;  1O8S A;  1H1M A;  3RFR A;  4XJ9 A;  3HNB M;  2QZ3 A;  2VBP A;  4QPG C;  4WM7 A;  1ASJ 1;  4AYU A;  3C7F A;  3PJQ A;  2WLP A;  5KWR A;  1EUU A;  1CD3 G;  1YC6 1;  3HBK A;  3BPZ A;  4Y1Y A;  1HV1 A;  1K45 A;  2ATF A;  1WCS A;  5D1I A;  2Z5W A;  1SEF A;  3U4S A;  4JZR A;  5CFC B;  1ZZ6 A;  2Q0A A;  3N7M A;  4OHW A;  5CG8 A;  4JC1 A;  3RI8 A;  1JMU B;  1RUJ 3;  1DQ4 A;  3B01 A;  1GR3 A;  3I2H A;  4QGM A;  2YZ4 A;  4N43 C;  2HYX A;  2CU5 A;  1ASJ 2;  1GZW B;  3J4U H;  4JQT A;  4NE9 A;  1ENS A;  1W3X A;  4LO6 B;  3S7I A;  3ZIW A;  1DIW A;  4TLG A;  2WNE A;  5DDJ 2;  5FKB A;  4Q1P A;  4QHB A;  3PUR A;  5A7O A;  3OY8 A;  1KDM A;  4IEY A;  5IW0 A;  2E51 A;  3OD0 A;  1QOO A;  1L7L A;  1AVB A;  2W1U A;  1WW4 A;  1ZM1 A;  3WXP A;  4UFH A;  5FZO B;  4AGV A;  2GAL A;  1W0N A;  3S5A A;  1FOD 3;  4GH4 B;  4FFG A;  1US2 A;  5FYI A;  1DZQ A;  1OLR A;  1UWW A;  3M3I A;  3NJV A;  4JTO A;  1N3Q A;  2R6Q A;  4R9C A;  2GSY A;  4ZXK A;  1UOB A;  1AR9 1;  2HWF 3;  4QX3 A;  3WF2 A;  1T6G C;  3TNP B;  1YWK A;  5BXX A;  4BMB A;  5A1A A;  2C6S A;  4HON A;  2IXC A;  5FK7 A;  4ASM B;  1ZX5 A;  4CEY A;  5A3L A;  3M8L A;  1YI7 A;  4M3C E;  1QJX 3;  3ZSE A;  5HCF A;  3NNL A;  2WFF 3;  3H50 A;  2QQJ A;  1AR9 2;  1BVP 1;  1FYU A;  5L9B A;  4A7Y A;  5CFC C;  4YW2 A;  1UXX X;  5AFB A;  2XJV A;  1BHG A;  2MHF A;  5DG2 A;  3ZDS A;  2DU1 A;  2GZW A;  1BQP A;  1PGS A;  3NAP B;  3THC A;  2VOT A;  1RUG 2;  2VTX J;  5FRE A;  4P9J A;  5I0U A;  2W2I A;  3E6B A;  1Z7S 1;  3N9Q A;  2IXK A;  3FFQ A;  4Q0Q A;  3WNK A;  4EWD A;  4EWE A;  2Q8D A;  4CYD A;  1NQJ A;  1BBT 3;  4XHB A;  2JE9 A;  4FO9 A;  3WG2 A;  1SLT A;  3PVE A;  5IHR A;  2WS9 3;  5F6K A;  5GJ6 A;  2E6V A;  2VNO A;  5IVY A;  2K9Z A;  1JUH A;  2IXJ A;  4MGI E;  5D21 A;  1XU2 A;  4F7Z A;  5KHK A;  4AED B;  2NQY A;  1UX7 A;  4IL7 A;  1CN1 A;  3T2P A;  4GH4 C;  1S2B A;  1PHM A;  2XJR A;  2LUW A;  1Z7S 2;  3Q8C A;  1XYN A;  1WLT A;  1HRV 2;  3D4K A;  2HWE 1;  2SLI A;  2XJU A;  5JUV A;  4HOO A;  1COV 3;  1W8F A;  4IEQ A;  1QOS A;  4A42 A;  4CUA A;  2G4I A;  4WM8 B;  3KCY A;  4J6G A;  4XUN A;  4Q27 A;  5KR7 A;  1DCS A;  1TQ5 A;  5BUV A;  4MET A;  3SH4 A;  1O5U A;  2QUO A;  1W9Y A;  2C9K A;  4P00 B;  5IT6 A;  4P9X A;  4DY5 A;  1BJQ A;  3VBS A;  2VCA A;  3ZYI B;  1W04 A;  2HWE 2;  3LDR A;  4NIG A;  3N3H A;  2JG9 A;  5FZM A;  4QPY A;  4W8J A;  4CP9 A;  2X10 A;  4AI1 A;  4BYY A;  1DDL A;  3MLK A;  4XJZ A;  2XR4 A;  4YG6 A;  4BHP A;  5JXI A;  3NAP C;  3VHP A;  3WW4 A;  2D98 A;  1QJE A;  1UAI A;  3Q9O A;  2VZU A;  5IAV A;  2XXZ A;  4GQ7 A;  3O1T A;  4EQV A;  1BEV 2;  3IN9 A;  5H9P A;  1YCI A;  1OQ1 A;  4YWA A;  1CQ9 A;  2BOJ A;  2IFW A;  2A6X A;  1J1L A;  3RYR A;  2QQW A;  4AFC A;  1A34 A;  3OEA A;  1LEC A;  1PMH X;  2ZEX A;  3K75 B;  2XG3 A;  3PMS A;  2BVV A;  4M01 A;  3ZSL A;  4AED C;  3MFC A;  2WBK A;  1CZV A;  1H8T A;  2QZ2 A;  4XEZ A;  5C5T A;  1SPP B;  5LCW L;  1C5H A;  2Y38 A;  2Z2S B;  3CQO A;  2E63 A;  5LZ6 A;  1D7P M;  3MGU A;  1GBG A;  1O59 A;  1RJ8 A;  1WLW A;  2B45 X;  3TN9 3;  2E7A A;  4AG4 A;  3JCI A;  3KVB A;  3N35 A;  3GCW A;  5I0S A;  2ZAA A;  2GH2 A;  4QGN A;  4WM8 C;  2A3Y A;  2GN3 A;  4SLI A;  2JD9 A;  4LIU A;  2RS5 3;  2WAO A;  3OYW A;  3B94 A;  2AEZ A;  1CVN A;  1YIP A;  1DQ6 A;  4PIX A;  5A33 B;  2ARE A;  5JLV A;  1LES A;  5JOZ A;  5IK8 A;  3I2K A;  3J7M A;  1EV1 1;  1J3P A;  3T30 A;  2DCY A;  2Z69 A;  4IE4 A;  5DAV A;  2J1V A;  5FWE A;  4F8A A;  2BEO A;  3MBW A;  1QJZ A;  3EBR A;  1PX4 A;  1NE4 A;  1JYC A;  2W68 A;  3E97 A;  1AX0 A;  3B69 A;  1PO1 3;  4EJR A;  1MS8 A;  3NNG A;  3WSO A;  4EE2 A;  4NRO A;  1YO8 A;  2BNM A;  4XZP A;  3MHZ A;  5JOW A;  2WWS A;  1XSQ A;  2ZMK A;  4FPL A;  5EJ3 A;  1XNK A;  2ZGR A;  2P4E A;  2J22 A;  1VPH A;  4NHL A;  3HIF A;  1EV1 2;  4CCK A;  4QQH A;  4P9I A;  2YYO A;  2VR4 A;  2R0H A;  1MVE A;  1YI9 A;  2CTV A;  5FPU A;  1RIR A;  1PIV 3;  4BLI A;  3KV5 A;  1PO2 3;  2AEY A;  3NWK A;  3UK9 A;  4QQO A;  3SCG A;  4Q5O A;  5BNQ A;  5JXJ A;  3T2T A;  4NVP A;  1DQ0 A;  1KDK A;  4HAN A;  2A7A A;  3NJX A;  4MOA A;  4AQ2 A;  1H2M A;  3HN1 A;  4E8C A;  3ZIX A;  4BIO A;  2WNV A;  3A21 A;  1HLC A;  3AZX A;  1AJK A;  2WAA A;  4ZPI A;  1OI6 A;  4LTA A;  3WD5 A;  4NHM A;  5F3E A;  4Q4Y 1;  3MIB A;  1H4G A;  5GLV A;  4NPL A;  5SV5 A;  4CDU A;  4YYO A;  3SEE A;  1LEM A;  1MZ5 A;  5LBE A;  2RMU 3;  4RFT 0;  3D0S A;  1H9P A;  3VZK A;  3WDU A;  1UO9 A;  1UMH A;  2DV9 A;  3BAL A;  1JI6 A;  1VBE 2;  2QNK A;  3I3B A;  2VUC A;  1CR7 A;  1W8T A;  4FP3 A;  4P08 A;  4H7L A;  2VOW A;  4ITC A;  4QD2 A;  2VPV A;  2X09 A;  4GWM A;  4A45 A;  4S2H A;  3WCS A;  2YGL A;  3R6S A;  2ZEY A;  1LU2 A;  3EXU A;  4Q4Y 2;  3LZZ A;  4ISR A;  5J1X A;  1RUC 1;  3KT1 A;  3POE A;  1Q8S A;  3OPZ A;  5F2S A;  4BK4 A;  3RYK A;  5BNO B;  1RMU 2;  1SLI A;  3WNP A;  1I1E A;  5LRS A;  2V73 A;  2VCM A;  5BNP B;  5AVP A;  2NZ9 A;  3B9C A;  1E5R A;  4LO8 A;  1HJF A;  1RIN A;  1UQX A;  4MGZ E;  3RRD A;  3WUD A;  3VDC A;  3NMB A;  2OPK A;  4ZU5 A;  4CDX B;  4IEP A;  3RSJ A;  1CIW A;  1AXY A;  3ORJ A;  4UW3 A;  3C7O A;  2DFB A;  3LD8 A;  4K8R B;  4XYX A;  4QPW A;  2DF7 A;  4YLZ A;  4BXS V;  5FZG A;  3WNX A;  3SKJ E;  1W99 A;  4D6R A;  4XAA A;  2YY1 A;  1RUC 2;  4YM0 A;  2XDV A;  4D3W A;  5FIX A;  2XJS A;  4FCA A;  3CL1 A;  3ILN A;  4XFF A;  3ZFE A;  4F83 A;  1WMX A;  4KG0 A;  2VD7 A;  5DAQ A;  5FBZ A;  3BIW E;  3SQO A;  4L8Q A;  1FMD 1;  2VVD A;  4EN9 B;  3H1W A;  1JYX A;  5FZ7 A;  1UPI A;  1GP5 A;  1QDO A;  5HI0 A;  3FE5 A;  4ZZ5 A;  2BRT A;  5T5O A;  3ZKU A;  2ZBJ A;  4R9B A;  2CGN A;  2VMF A;  4N9I A;  1Q43 A;  1VB2 A;  4OYU A;  1R64 A;  1DF0 A;  1AYN 2;  3FX3 A;  3T1L A;  1FNZ A;  1K5M B;  1W6O B;  2JXA A;  3OGV A;  2W91 A;  3OUJ A;  4GMP 3;  5D8A B;  4D94 A;  1YFX A;  3PUQ A;  3U75 A;  1TG7 A;  2H6B A;  3VHO A;  1D4M 3;  2Y64 A;  1FMD 2;  1DGL A;  1HN0 A;  1GMM A;  1QJU 3;  1IS5 A;  4KU8 A;  1ZZ8 A;  2EID A;  5BNO C;  5E8A A;  5BNP C;  3RZM A;  3QD6 A;  4GB3 3;  1ZBA 1;  1W6N A;  2X53 S;  2PAE A;  2JEN A;  4S2G A;  1PNG A;  1YXW A;  2HWC 2;  3VDA A;  4CDX C;  1W9S A;  5FYS A;  4Q0U A;  1W9W A;  1RXG A;  2VZO A;  5GLU A;  3K4A A;  4JVA A;  4QKF A;  2FCT A;  1D0G A;  1JXN A;  1NA1 B;  1UZV A;  5CG9 A;  4C91 A;  2Y6L A;  4J1X A;  5J09 A;  1G9A A;  3L2H A;  2AYH A;  1NAE A;  3FLP A;  3M4F A;  3OEB A;  4XPV A;  2C24 A;  1AL0 G;  2ZEZ A;  2QQL A;  3ILF A;  3RZG A;  1G7Y A;  4L97 A;  4Q4W 2;  4BLJ A;  4LEJ A;  4OQ9 A;  4CU7 A;  1STM A;  3V0B B;  2YV8 A;  2WKK A;  3ILR A;  5KXB A;  3ZYG A;  3BTA A;  2BW8 A;  2VZQ A;  4LHL A;  3E1F 1;  1LTE A;  2KR2 A;  3LPF A;  5FZ3 A;  3VD3 A;  1K5M C;  1H6Y A;  5D8A C;  5GKA C;  3ZFG A;  3DYP A;  4KH9 A;  5IK5 A;  4D6S A;  1UYZ A;  3HOB A;  2DFC A;  4C1W A;  4A2U A;  2ZHM A;  4Q29 A;  3EJK A;  1MEC 2;  1HXS 3;  5F5Q A;  4CU8 A;  1L7Q A;  4V2W A;  1YJL A;  2E32 A;  2AEN A;  2YMZ A;  5CIR A;  3SIS A;  4FQ4 A;  3KSC A;  1OH3 A;  1SCR A;  3VL9 A;  3LEM A;  1LOG A;  4IE0 A;  1RUE 3;  5DXD A;  2W46 A;  3LFI A;  3R05 A;  3U1X A;  1DQ5 A;  4AEJ A;  4E4Z A;  5JZG B;  5EHD A;  4HG6 B;  1OKQ A;  2E26 A;  4XXP A;  3ZXJ A;  4FBF A;  4PT6 A;  2CDP A;  4IER A;  1QIQ A;  2XBO 1;  1NA1 C;  2BJS A;  1A8D A;  4L11 A;  3O7O A;  3TBD A;  3R4S A;  2C26 A;  5KC6 A;  3JQX A;  1IKP A;  3FJS A;  1PK6 A;  1RUD 1;  4PDW A;  1J83 A;  4CA9 A;  2IVI B;  4DQA A;  1FAY A;  3W5M A;  2V5Y A;  2VTX A;  5CFD A;  1SFN A;  1GOH A;  4O9E A;  4OMD A;  5LA2 A;  1V00 A;  4N8M A;  1A8M A;  3L2Y A;  2VMH A;  2XVK A;  3AYC A;  2XBO 2;  3AX4 A;  4AFB A;  5FYU A;  3DPR B;  3M3E A;  2FDG A;  4OHX A;  1CON A;  1O3T A;  4NRQ A;  3POI A;  1W03 A;  1RUD 2;  2GNT A;  1LOF A;  4AEK A;  4Y22 B;  3MFA A;  1KD7 A;  3U11 A;  4XBQ A;  3TYJ A;  3IPV B;  5KBF A;  2PYT A;  2PAM A;  3K3O A;  2WSU A;  4DO0 A;  4PIZ A;  1O91 A;  4XBN A;  1O4Z A;  2HH9 A;  1W6Q A;  2RM2 1;  2XML A;  5F7U A;  1GOG A;  2MEV 3;  1UZZ A;  2XJP A;  3CBN A;  4WVV A;  2D6O X;  1OBN A;  1SLL A;  1L3J A;  4HSL A;  4D7S A;  2CDO A;  3TRS B;  5JZG C;  5IFT A;  4OFG A;  2ZTN A;  3AP6 A;  5H9S A;  2OZ6 A;  1EYB A;  3CEW A;  3PVN A;  4XF1 A;  2YC2 A;  3U10 A;  1REF A;  2NN8 A;  3N7K A;  3VBR A;  2BGP A;  2XJQ A;  2RM2 2;  1X8M A;  3IB3 A;  3BTZ A;  1ZZ9 A;  3AYE A;  2VZT A;  5GZF A;  4CDQ A;  2XWB B;  3PTR B;  4JHZ A;  2RR1 3;  4RHV 1;  1OH4 A;  5FYY A;  2WRA A;  2R07 3;  3E5U A;  1R08 3;  5EP9 A;  3A7Q A;  1O5L A;  2WJS A;  5K8S A;  1LRH A;  1UY4 A;  1VBA 3;  2VXR A;  5H9R A;  3ZFF A;  4OCT A;  4LE3 A;  3KHC A;  2UYB A;  2W94 A;  5FRA A;  1ZBE 1;  3AKS A;  4YRD A;  4IEO A;  4BE3 A;  4PBP A;  5FY0 A;  3DPR C;  1OXC A;  4LUM A;  2BYV E;  2DCK A;  5I8Y A;  5F3I A;  4QKB A;  4RHV 2;  4QT6 A;  3H7J A;  3RQ0 A;  4CP0 A;  1W8Z A;  3RZL A;  4BH9 A;  1D4V B;  4FI9 A;  4UT5 A;  1QY4 A;  3WP3 A;  1U5Z A;  4HLT A;  4YGB A;  4COY A;  4C90 A;  3OY8 B;  4C8D A;  1RUN A;  3H8O A;  1OA3 A;  1ZBE 2;  2D3P A;  3Q8F A;  4OI1 A;  1KQR A;  3AP4 A;  2O8Q A;  1GQP A;  5JI7 A;  4KU7 A;  1Q56 A;  4Q4V 2;  5LEK A;  2E9Q A;  4NID A;  4Z2W A;  1DHK B;  4QX0 A;  3UGH A;  1NE6 A;  2PEL A;  2BVB A;  1VE0 A;  1QMJ A;  4XJU A;  3OPT A;  3H9A A;  1HW5 A;  3H8X A;  4XUR A;  3VZN A;  3GYD A;  3N7J A;  5FYH A;  2Y33 A;  4RGA A;  1KJL A;  3P1I A;  4LJH A;  2XWJ B;  5FP4 A;  1OPM A;  4HN1 A;  1DQ1 A;  1X9P A;  2YHJ A;  2HLE A;  1HJG A;  2EXJ A;  4CXY A;  4CCO A;  3PU3 A;  2OZJ A;  3NNM A;  2QQP A;  1C8M 3;  1K3I A;  5JSO A;  2D93 A;  2PHF A;  2JKX A;  3NJZ A;  2J42 A;  3WP4 A;  3AJY A;  1WCD J;  3D82 A;  3JUU A;  1XNT A;  2R30 A;  4OI4 A;  2LAL A;  1K42 A;  3GJA A;  2FMD A;  1W2A X;  4JGY B;  1LHN A;  5A6X A;  2F4P A;  2ORZ A;  5F9T A;  2ZGS A;  2EXK A;  1X36 A;  4PI2 A;  5FY7 A;  5L7O A;  2JEC A;  3OCP A;  3U07 A;  3E5X A;  2A6Y A;  2WZP P;  5F3C A;  1RHI 3;  2VNG A;  4IEU A;  5FPL A;  2CNA A;  1QOT A;  3VBO A;  5L9V A;  1RYY A;  1DLC A;  4P9L A;  3H8R A;  5FP7 A;  4RD7 A;  3ETQ A;  2X29 A;  4FQZ A;  2XUE A;  1JZ3 A;  2RE9 A;  4KMQ A;  4ZS3 A;  4YSF A;  3SHR A;  4HPK A;  4R9A A;  2JWP A;  4CDW A;  4DEQ A;  1S4C A;  2XHN A;  1X7N A;  2WII B;  1GNZ A;  2QJV A;  1W8U A;  1YQ5 A;  2JJ6 A;  5LEJ A;  4AFD A;  1VBC 1;  3RMY A;  1JZ2 A;  5AFE A;  4R4Z A;  1MPX A;  2PHR A;  5CAZ A;  5CNA A;  5DZG A;  2GND A;  4XJ8 A;  2B42 B;  3VL8 A;  3GF6 A;  3VLB B;  2VBD A;  5GZC A;  5ISL A;  1OT5 A;  2L9L A;  4ZU7 A;  4XDO A;  5FP8 A;  5FXX A;  3ZYP A;  4Z1V A;  4Q4X 3;  1HB3 A;  4CCE A;  5IK4 A;  2PLV 3;  4NWW A;  2VZR A;  1C8N A;  1NOV A;  3J7N A;  1C5I A;  2P6C A;  5E89 A;  1MZE A;  5C3O A;  5GLW A;  2O14 A;  1AR8 1;  4CP9 B;  1VBC 2;  1V9U 2;  5KXC A;  5LWB A;  1XRU A;  5G05 L;  3VB9 A;  2ADE A;  1KIT A;  4JGY C;  2H0V A;  1HQL A;  2YU1 A;  4IV3 A;  1VRB A;  1SBE A;  4QM8 A;  5BNN B;  4NHX A;  4B7K A;  4ET7 A;  3OJB A;  4U36 A;  1JH5 A;  3N9N A;  4BQ2 A;  2E31 A;  2AAC A;  3AZV A;  2R7E B;  4Q0S A;  4ISQ A;  1AR8 2;  1AYM 3;  3CKH A;  2XB6 C;  1UL9 A;  2WQ8 A;  1AL2 3;  5K7P A;  3GNE A;  2OA2 A;  1GFF 2;  1PVC 3;  1DGR A;  4KQ7 A;  1YQ2 A;  2YGM A;  1JYV A;  1IPS A;  1RGS A;  1VBB 3;  1TME 3;  3UYJ A;  1RUJ 1;  1KFU L;  1NLR A;  4JV4 A;  1YLL A;  5JXG A;  1G9F A;  1NXD 1;  5A7Q A;  4QHZ A;  2O8O A;  2QQI A;  2V4V A;  5DZF A;  2WO1 A;  1NZI A;  2PHD A;  1JU4 A;  2ZGQ A;  3LIH A;  3POB A;  3LKJ A;  2VMD A;  4NII A;  1XXN A;  5LK7 B;  1X33 A;  3JB8 A;  3JD7 3;  4LUK A;  5C8C A;  2LS6 A;  4MXW B;  4B29 A;  2ZHL A;  4CEW A;  4CXW A;  2XON A;  2A5Z A;  5EPA A;  3VBS C;  3VD4 A;  2GMP A;  1RUJ 2;  2PA7 A;  3MIH A;  2JG9 C;  3IT8 A;  1FOD 1;  4UXA A;  4Y5Z 0;  2ZZJ A;  1WW6 A;  1US3 A;  3MIC A;  1R1A 3;  3RZH A;  2ARB A;  5FOJ B;  2HWD 2;  3KWV A;  3ZPO A;  1AR7 1;  2OUH A;  4IV1 B;  4BCU A;  1AR6 3;  1ZYB A;  2R04 1;  3UV9 A;  5E16 A;  5FXW A;  4TN7 A;  3ZKY A;  5BNN C;  2XKP A;  2HEY F;  2Q1F A;  1OUX A;  5T55 A;  5A6Y A;  5FZ4 A;  3BTY A;  2W52 A;  1F8V A;  1FOD 2;  5JPM B;  4QB2 A;  1GNH A;  2O0O A;  3MIE A;  3R0R A;  4GMP 0;  2VNV A;  1M06 G;  2WFF 1;  1RVF 3;  2PFW A;  2PTM A;  2Y0I A;  1JZ7 A;  3EYP A;  1AR7 2;  3EHK A;  3WDV A;  5ANN A;  5JSR A;  2R04 2;  3CJI B;  3HR9 A;  3M3Q A;  4M0H A;  5FAX A;  3W5N A;  1YEW A;  3ZSK A;  5IVE A;  2ZHK A;  4YZ4 A;  5T3N A;  2DU0 A;  2QVS B;  1JZ6 A;  3JXS A;  2WNV B;  4EYU A;  2HJI A;  3ZXA C;  1BBT 1;  3UJO A;  4I3P A;  2VAU A;  3VD7 A;  3WY6 A;  5FZ1 A;  5HCH A;  3MLL A;  2X5I A;  4CDU B;  2WLQ A;  3UKV A;  5FV3 A;  4AI0 A;  1W3V A;  2ZGU A;  2AC1 A;  4BME A;  1UMI A;  4Y33 A;  3LFM A;  3TEX A;  3P5B A;  4KBZ A;  2ES3 A;  1CAX A;  1S0J A;  4QWN A;  4K7J A;  5CKN A;  3AMP A;  5EXO A;  4FVV A;  3SCF A;  1UYP A;  2YFU A;  1QJY 2;  2ZA9 A;  3GJB A;  1GU3 A;  4YG3 A;  2JDA A;  5GLZ A;  2WSV A;  3VUO A;  1ULD A;  4IV1 C;  1COV 1;  4JX0 A;  5EJZ B;  2VUA A;  1GUI A;  4QGL A;  2RS3 1;  4WVZ A;  2R16 A;  1WMD A;  4DS0 A;  1QQP 2;  1MS9 A;  3GGL A;  3FHA A;  1QU0 A;  1ND2 A;  2VG9 A;  1G6N A;  1EY2 A;  3JQW A;  3NQH A;  5DZE A;  5JCT A;  3WX5 A;  4BQ1 A;  1JOJ A;  3LA3 A;  2XQX A;  1ZZ7 A;  2QDR A;  1VR3 A;  3HT1 A;  3WG1 A;  5A32 A;  3DGT A;  3GBW A;  4TLF A;  1TMF 3;  5C3R A;  2DVF A;  4XFC A;  4EZ4 A;  1EAH 3;  3JBG 1;  3NV3 A;  3RYP A;  1COV 2;  2WWU A;  3CJI C;  3C7E A;  4IDZ A;  2RS3 2;  1GNY A;  3ZFE B;  4DNY A;  2A73 B;  3WNO A;  2BNO A;  4OHV A;  2WNV C;  3H42 B;  4TZD A;  1X82 A;  3ZPY A;  4CPB D;  2W1Q A;  4WVM A;  1SLA A;  2QQK A;  4XMA A;  4CDU C;  3T0D A;  2QDN A;  3JBG 2;  4BK5 A;  2Y6H A;  3LOI A;  4AQT A;  3FBY A;  1T2X A;  2VU9 A;  4FOY A;  3GBG A;  2IXI A;  1A6C A;  3POG A;  2JG8 A;  5FZB A;  1XE7 A;  4GJY A;  1A3K A;  3KGZ A;  4LOT A;  4ONU A;  3VD5 A;  2VOV A;  4XTM A;  3TN9 1;  3DKQ A;  3T1M A;  1PZ8 A;  5DMY A;  3IDA A;  2ERF A;  2DUO A;  5JIU A;  3AMN A;  3ON7 A;  3GCX A;  1LB2 A;  2RS5 1;  4HFS A;  3CDZ B;  3W21 A;  3WIN E;  1SCS A;  3ABZ A;  3QAC A;  1SDW A;  4JCK A;  4CU6 A;  1KS4 A;  2C0Z A;  2ZOE B;  4XVH A;  5G04 L;  5GAL A;  3ROU A;  1JYI A;  2OW4 A;  3EMR A;  4XCA A;  5FKC A;  1VAV A;  3TN9 2;  5FY9 A;  4FP2 A;  3CF6 E;  3BYW A;  3LCP A;  2HYK A;  4RS5 A;  3B93 A;  2JDZ A;  4UYB A;  4ZY9 A;  5LB6 A;  3ZFE C;  1ODN A;  1LU1 A;  5A1L A;  1J84 A;  1VMF A;  2GP5 A;  3MF6 A;  2GU9 A;  1EUT A;  1K5J A;  2NLR A;  2GNB A;  1N47 A;  2RS5 2;  1CJD A;  1OKO A;  1PO1 1;  1W8W A;  3LEK A;  4QQP A;  4YVW A;  2CHH A;  2QQN A;  5FBJ A;  1CX1 A;  1VRH 3;  3OBT A;  4NHK A;  5FPZ A;  1F4H A;  1H0B A;  1ZRI A;  3ZN6 A;  5CEH A;  1PVX A;  3C8X A;  2K2S A;  3D6E A;  4KG8 A;  2HEV F;  1GP6 A;  3FUO A;  3B7M A;  3DXT A;  1KEX A;  1UW8 A;  4IUG A;  5FCC A;  4D7Y A;  2WNU A;  2WZR 3;  4CPB A;  1GZC A;  2LM3 A;  2BFU L;  1PIV 1;  3T2O A;  3WQ7 A;  1PO2 1;  2HWB 3;  3T2Q A;  3IMM A;  1VIW B;  2YBK A;  1PO1 2;  1BXH A;  4ZON A;  5KHI A;  4R9D A;  2WAB A;  5A7W A;  4FAH A;  2YXS A;  1OA4 A;  3CO2 A;  2IC1 A;  5A3N A;  4O7X A;  2P5B A;  3N7L A;  1ULG A;  4XXA A;  5FO9 B;  3KQ4 B;  4FTE A;  1FPN 3;  5J96 B;  3RWK X;  1YFU A;  1Y3T A;  2ET7 A;  4HVO A;  5T50 A;  3UES A;  4Y20 B;  2V09 A;  4PCR A;  5C4W B;  4BJ0 A;  2Y6K A;  3WDX A;  2H6C A;  3CHX A;  4W4Z A;  5I8S A;  1CAV B;  3TEW A;  2RMU 1;  3M3O A;  2A1X A;  2W47 A;  2D6P A;  5IK7 A;  4MGY E;  2PHT A;  1MR5 A;  5FJH A;  3ZXG A;  1ND3 B;  4MVT A;  3FZ3 A;  2A71 A;  2ID4 A;  3MPP G;  4JGZ A;  1C4R A;  2Q8C A;  2FHR A;  3G7D A;  4DEV A;  3ES4 A;  2DVD A;  5FYZ A;  3ECQ A;  4XET A;  4XFG A;  3VBH A;  1ASJ 3;  4Y1U A;  5CFD B;  4JKM A;  2VUD A;  4CXX A;  5DDJ 3;  2WFP A;  1GLH A;  3DUI A;  4FFH A;  1UN1 A;  1WD4 A;  4RL7 A;  4RQP B;  1PNF A;  2ARC A;  4CZS A;  1W28 A;  2WO3 A;  3AYD A;  2QE3 A;  2P1B A;  3RVH A;  1SHW B;  2D6L X;  4LO5 B;  1YJK A;  4TWT A;  1LOB A;  3VGI A;  3B00 A;  3OGS A;  2P6H A;  4CVU A;  3AKQ A;  3VBU B;  1Y4W A;  4UW5 A;  4V1P A;  2HBU A;  5IYY A;  2E53 A;  1MAC A;  3PTY A;  3X29 B;  4H2A A;  1W90 A;  2ZAC A;  1W6Q B;  3NW4 A;  3QOP A;  4AVC A;  4COZ A;  1EPW A;  1BYH A;  2Y0O A;  4KGG A;  1HRI 3;  4RGG A;  3E5Q A;  3POW A;  1S0E A;  1UZW A;  2NMN A;  3AP7 A;  5FZ0 A;  4DB5 A;  4NAM A;  4YM3 A;  1FT9 A;  5C4W C;  1GV9 A;  4I30 A;  1CJP A;  3WHT A;  5C9A A;  2ZGT A;  1AJO A;  1O4T A;  1QWR A;  4N7I A;  2UYA A;  3VBR B;  2EIG A;  2NP0 A;  2JB4 A;  1Z78 A;  3PIG A;  1AR9 3;  3I8T A;  1ND3 C;  1D4M 1;  1VJ2 A;  3ZO0 B;  1R1Z A;  2DCZ A;  1JW6 A;  1SBF A;  1ZA7 A;  3K48 A;  3AKT A;  1S55 A;  5KC5 A;  1RUG 3;  3SH3 A;  3O12 A;  2DWR A;  1V6K A;  5C70 A;  4UFJ A;  5CFD C;  3SLI A;  2QQV A;  1K12 A;  4YVS B;  3ZFF B;  4B4P A;  5A7P A;  3KQR A;  4RQP C;  4OHZ A;  2CGP A;  2WN2 A;  3OBR A;  4PF1 A;  1OVP A;  1T6B X;  1WLC A;  4K8F A;  2KXL A;  1G9C A;  1F5J A;  1OSG A;  4XW3 A;  3MV1 1;  3U37 A;  4XIK A;  4LBQ D;  2W08 A;  4CCL A;  3VBU C;  4KBB A;  1LAJ A;  3F2Z A;  3SNM A;  3ZYJ B;  3HQU A;  1GZT A;  3KCC A;  4LO4 B;  4MH0 E;  2Y6J A;  4CUB A;  1HRV 3;  2C1F A;  2QQM A;  3QLQ A;  4FPJ A;  3DL3 A;  4AF9 A;  1HX6 A;  2PXJ A;  3MIG A;  1RL3 A;  3UJQ A;  1OVS A;  4LIT A;  1RXF A;  2AUY A;  3CZJ A;  4QPG A;  3ZSJ A;  4O65 A;  3IBM A;  1HV0 A;  4CE8 A;  2G9Z A;  2K0G A;  1VAM A;  4FT8 A;  5LY2 A;  3VV1 A;  1POQ A;  2ARX A;  4JQR A;  1F4A A;  1SG3 A;  2DVA A;  5L9R A;  2J1A A;  5LBC A;  3A22 A;  3VBR C;  1WZX A;  4ARX A;  3AKR A;  3H3U A;  2XL9 A;  3BI3 A;  1YRZ A;  1E5H A;  2D7F A;  3TAY A;  4N43 A;  2WA3 A;  3MID A;  4BQX A;  3O1R A;  4UAP A;  4B8E A;  1C1L A;  3NST A;  1QDC A;  1WLD A;  2Q30 A;  3CNA A;  3ZOI A;  3M70 A;  2A75 A;  2OVU A;  1OQE A;  4Z2A A;  4EN6 B;  1G9D A;  1URX A;  2WYS A;  4OUL A;  2GNM A;  3UNP A;  3S57 A;  3ZYF A;  1TNR A;  4YVS C;  3USU B;  3ZFF C;  1ZRF A;  3CZU A;  1W06 A;  1BEV 3;  2GMM A;  4GA9 A;  1ZZC A;  4YNI A;  4YZ2 A;  4IEZ A;  1SQ4 A;  2ZGK A;  4URA A;  2F17 A;  5K0U B;  3O1O A;  2XQR A;  1O4Y A;  1V0A A;  1W2N A;  3GAL A;  3NVC A;  3KLS A;  4NR1 A;  2DVG A;  3UGG A;  2ADD A;  3BIE A;  5CZK A;  4CP1 A;  2XLA A;  2DUQ A;  3VDD A;  2J1E A;  1YFY A;  2Y6F A;  5FZE A;  1OPO A;  4IES A;  1ULE A;  4MUV A;  4LBQ A;  2J7M A;  1F9K A;  4A6O A;  2IZW A;  3WHU A;  1NT0 A;  3WR0 A;  3ITQ A;  3EQE A;  5CKM A;  2ILM A;  2VL4 A;  4D6Q A;  3W58 A;  3I49 A;  5CFC A;  2ZGM A;  3P6B A;  4BQW A;  1OQD A;  5I93 A;  2FDJ A;  3J8F 1;  4DUW A;  1MS0 A;  1R09 3;  3U78 A;  3H8U A;  4H7M A;  1OF3 A;  4KL1 A;  4GKY A;  3GM8 A;  5IVV A;  2D3R A;  3T09 A;  4HL0 A;  4LOR A;  3WCR A;  2AH2 A;  2YBP A;  3POY A;  4R8H A;  2RHP A;  2A3X A;  3CMG A;  1DQ2 A;  3A4U A;  5F5C A;  3I3E A;  1H30 A;  5FZO A;  5B2G B;  3J8F 2;  3DKW A;  5FMC A;  1JZ5 A;  3VBF B;  4GH4 A;  5K0U C;  3LQC A;  1RUH 3;  1F35 A;  2PN5 A;  2XJT A;  1W8N A;  2D6N A;  4YZ1 A;  4IV3 B;  2KA3 A;  2R06 1;  2TUN A;  1PGW 1;  3ACL A;  2DDU A;  4FFF A;  3CJX A;  2EIB A;  1UIJ A;  5GLT A;  4AHX A;  2RR1 1;  4LQR A;  5I0T A;  1ZBA 2;  3S7E A;  3KV6 A;  2VW2 A;  1UU6 A;  2R07 1;  3J7H A;  4HET A;  3GZU C;  3HNM A;  5L73 A;  1R08 1;  5DAX A;  4QX1 A;  4Q8K A;  2LRO A;  1FV3 A;  3U4X A;  4MO3 M;  1XBF A;  4CCM A;  2G19 A;  1VBA 1;  1ZRD A;  1CAU B;  5FLI A;  2BPA 2;  2R06 2;  2GN7 A;  3AVR A;  5A7N A;  1IS4 A;  2WA4 A;  3ZDV A;  5FDB A;  3WNL A;  4ZKT B;  4XBL A;  2RDS A;  2RR1 2;  2YRO A;  3MW2 A;  3OBA A;  4WVW A;  3VHN A;  4K6B A;  1VBE 3;  2R07 2;  3M3C A;  4ASK A;  4Z92 B;  1RIT A;  1B35 B;  2Z79 A;  2W0X A;  3BB6 A;  1ULO A;  4JTN A;  1LHV A;  5FK8 A;  3WW3 A;  3ZN5 A;  4Q4Y 3;  2WT2 A;  5HPO A;  2VW0 A;  4BA6 A;  1Q8V A;  3LAG A;  4RGK A;  5DAW A;  1RMU 3;  1LGC A;  1OUS A;  4JDM A;  5F6L B;  3POF A;  3K4Z A;  3NO8 A;  5FZ9 A;  3TOJ A;  4LKD A;  1L7R A;  3ZSM A;  1QXR A;  2VO5 A;  2GH8 A;  1NQD A;  2WO7 A;  3ACH A;  4H55 A;  3VBF C;  4OI2 A;  1OFS A;  3LA7 A;  5FP3 A;  1UU5 A;  3WDT A;  2W1W A;  3V0A B;  3H1M A;  3SC7 X;  2D5F A;  4BQ3 A;  4IV3 C;  1NLS A;  4XTP A;  1HN1 A;  1F31 A;  5KHG A;  5EFU A;  1RUC 3;  2JIC A;  3AZZ A;  4LHN A;  3WDY A;  4E2Q A;  4WM8 A;  4K1Y A;  2WZE A;  1W2O A;  4M3C B;  1H1A A;  4QXH A;  5FYB A;  1LHU A;  3VHR A;  4LK6 A;  4BU2 A;  1V6J A;  4L9B A;  4PQQ A;  4Q8L A;  4QDR A;  3R4D B;  5IJR A;  3LEG A;  3ZYR A;  4AVB A;  1ULP A;  4AI2 A;  1HDK A;  4HK9 A;  2SBA A;  3PJY A;  5FMO S;  1XU1 A;  3JZV A;  4AQ6 A;  2QTW B;  1AYN 3;  5FZ6 A;  2CWM A;  2VVF A;  2BNN A;  3PUH A;  5C71 A;  2WT0 A;  4QPI B;  5ACA 3;  1B35 C;  4A41 A;  3AJZ A;  3C7H A;  3O1M A;  1FMD 3;  2NMO A;  3FMG A;  1DLL A;  1X8E A;  2O1Q A;  2NYY A;  4COW A;  3DEC A;  2QKD A;  4UF0 B;  1RHI 1;  2B8M A;  3H1Y A;  2DVB A;  3NKT A;  3P3N A;  3LEI A;  3T4V A;  4XIL A;  3OPW A;  1QH6 A;  5LA9 A;  3I2I A;  3RGB A;  5LY1 A;  3THP A;  1AUY A;  4FXK B;  1N1T A;  4XF0 A;  3OGG A;  2WQZ C;  1SPP A;  2OQ7 A;  1XNA A;  2V5D A;  4L2N A;  2HWC 3;  4M00 A;  3SCH A;  5JMO A;  1AXK A;  5KXD A;  5JIA A;  4COU A;  2JDK A;  3LA2 A;  4CU9 A;  3K51 A;  3AKP A;  2G9F A;  4ORF A;  2RVA A;  3H7Y A;  5FQ0 B;  5FY1 A;  3WUC A;  3OBZ A;  3MV0 1;  4X6Q B;  1RHI 2;  4LK7 A;  2D6K A;  4Q2F A;  3IDE A;  4NWV A;  1WA6 X;  1O8P A;  4WM7 B;  3T3Y A;  5J3U A;  2P3K A;  4NPM A;  2XPJ A;  2JEM A;  2P3Y A;  4Q4X 1;  1AHS A;  1J3Q A;  4Q4W 3;  1MQT A;  5FY8 A;  1X9T A;  5JXH A;  4LT5 A;  2VVE A;  3DF0 A;  1DG6 A;  2YC0 A;  5AVA A;  4XHX A;  1N1S A;  4BQ4 A;  2PHL A;  4UFI A;  4R4X A;  4MGT A;  3D0J A;  2FQP A;  4Z82 A;  1H4H A;  4LLF A;  1AX1 A;  1NXM A;  3KV4 A;  2ORX A;  3HJR A;  4MGQ A;  4QPI C;  2BOI A;  2JDH A;  5F5A A;  1YQ8 A;  2ZCW A;  1J1T A;  3O0X A;  4MLO A;  4Q4X 2;  3RNS A;  1P8J A;  4B4R A;  1MEC 3;  4WVM B;  4ZZ8 A;  2DUP A;  2RJ2 A;  2RS1 1;  3LDB A;  5LA0 A;  2Y34 A;  4A7Z A;  2QCS B;  2A70 A;  4XMI A;  3AVS A;  1PVC 1;  1S2K A;  5DUU A;  2JG8 B;  5FZK A;  4AR2 A;  2RDQ A;  3AMQ A;  1F15 A;  5CU1 A;  3HQR A;  1VBB 1;  1TME 1;  4B7E A;  5J37 A;  3O1S A;  3WP6 A;  5J98 B;  4BM8 A;  1FXZ A;  2H0B A;  2VCC A;  2RS1 2;  5IAT A;  4GWI A;  2K46 A;  4WM7 C;  4CEY B;  3B5L B;  3PUI A;  1ND2 C;  3BKZ A;  1HKD A;  1DU3 D;  1HB4 A;  3JD7 1;  3N9M A;  1TEI A;  3SIT A;  2E7T A;  1C28 A;  4K9S A;  1REE A;  4BQ5 A;  3U14 A;  4U2A A;  4W50 A;  4XFI A;  1OOP A;  2WN3 A;  4MGS A;  1JTZ X;  1VBB 2;  1TME 2;  1XND A;  2RDR A;  4CP2 A;  1U12 A;  4Q0P A;  5DUW A;  2A6Z A;  4IE7 A;  2AGS A;  3RI9 A;  1U0A A;  2EA7 A;  1LUL A;  1QXP A;  1OLM A;  3HEI A;  1R1A 1;  1DZT A;  2UWA A;  4K20 A;  4YGE A;  5D2A A;  4I0B A;  4OLL A;  1RUD 3;  1UYX A;  3KMH A;  4AW7 A;  1AR6 1;  2OKX A;  1XE0 A;  4XFB A;  2OX0 A;  3OUI A;  5BNO A;  1O3Q A;  1N1V A;  4IGP A;  2Q1M A;  4XJA A;  4Y1X A;  3ZN6 B;  5BNP A;  5FYV A;  2ETE A;  4URT A;  1ZZB A;  1ZRR A;  1BZW A;  4MGK E;  4CDX A;  1XSR A;  1RVF 1;  2J1S A;  5E6H A;  1G86 A;  3AXE A;  2JG8 C;  4LA2 A;  2BWC A;  1I9R A;  1G8W A;  1IGO A;  2CAU A;  2NM1 A;  4DXZ A;  5A7W B;  4YGC A;  1OHF A;  2R49 A;  1S0C A;  3BTX A;  3C7G A;  5FPA A;  3BU0 A;  3K2O A;  5A70 A;  2RM2 3;  4PF5 A;  2WQ4 A;  4UFL A;  3ACF A;  2FCV A;  3D5O A;  1GSL A;  1VBD 3;  4QQL A;  3AM2 A;  1XYO A;  3T0B A;  3VKF C;  4A3Z A;  4CEY C;  2I2S A;  2DBI A;  1RVF 2;  1JUI A;  4QX8 A;  3BOD A;  4UWD A;  1FNY A;  3N36 A;  1GQH A;  3SEP A;  1W9T A;  3VBS B;  1H2K A;  3I2G A;  4FPE A;  4FTS A;  2JG9 B;  1ONA A;  1K5M A;  1W6O A;  4W65 A;  5IFP A;  2JDU A;  5D8A A;  5FUN A;  3RZZ A;  3CU7 A;  4LIV A;  4NAO A;  4CUG A;  3U0Z A;  1XNC A;  4NRP A;  1PZ9 A;  1SFY A;  4UFM A;  4E2S A;  3I2O A;  1OFN A;  1N3P A;  2D40 A;  3DCQ A;  3HQX A;  3KT4 A;  3PDQ A;  2PQS A;  2FCU A;  3TB0 A;  5JDB A;  3MEP A;  4YZ3 A;  5F3G A;  2Q8O A;  2ZJC A;  3RDI A;  3WT3 A;  2TEP A;  3HMY A;  1H8T B;  1UY3 A;  2VMC A;  2WNU C;  4QAW A;  4DZG A;  3DN7 A;  4Q4V 3;  3ZMN A;  3VZJ A;  3A0K A;  1JYT A;  1TMF 1;  2EVX A;  4GKX A;  1JOD A;  3H0O A;  4PLO A;  3MUZ 1;  4PI0 A;  2LW8 A;  4LXL A;  4KWU A;  4Z07 A;  5J7M A;  3LPG A;  1BK1 A;  2VQA A;  1W0P A;  4QMA A;  1OUR A;  3KZ4 C;  2BBA A;  2BBV A;  3OYW B;  5FO7 B;  1UY1 A;  3I2J A;  3USS A;  1OC1 A;  5AC9 3;  2JIG A;  3V0B A;  3VZO A;  2GAU A;  3WDW A;  1XC6 A;  5FZL A;  4N7U A;  3FHQ A;  1JU3 A;  1TNF A;  2HEW F;  1ZVF A;  3KGL A;  1MS5 A;  1WME A;  1GIC A;  5BY5 A;  4I02 A;  1VAL A;  1G9B A;  1OLM E;  3AK0 A;  5F1R A;  3QH6 A;  2HWF 1;  3M2M A;  4LNV A;  4HZF A;  3ZX7 A;  4PIY A;  3A0N A;  3MIF A;  3NKG A;  2LTN A;  5FZA A;  4KWK A;  1POV 3;  2WWJ A;  2VUJ A;  1JYW A;  2WYF A;  2DCJ A;  3NV1 A;  4N53 A;  3S30 A;  3I54 A;  2ZML A;  1QJX 1;  1CZT A;  3ZR5 A;  5I8T A;  3NL1 A;  4LBL A;  5JZG A;  1H8T C;  5ABJ A;  5JI9 A;  4N9H A;  2VGD A;  2HWF 2;  3QCW A;  3GHN A;  2BGC A;  4LKF A;  4O9G A;  3B02 A;  3WOG A;  1W6M A;  1W9F A;  2C4X A;  4NRM A;  3I59 A;  2VQ0 A;  5B4N A;  1GAN A;  3VKL A;  3L9J T;  2W39 A;  3WF3 A;  1QJX 2;  2WFF 2;  5F2W A;  5F5I A;  2I07 B;  1RUF 3;  4YW6 A;  2WS9 1;  3WG4 A;  4CUC A;  1WKY A;  4XDP A;  1AXZ A;  3A23 A;  4AHZ A;  5A80 A;  5T5P A;  4QDS A;  1QH7 A;  1MS4 A;  3DPR A;  4MHR A;  3ZXF A;  2WZR 1;  3FUQ A;  1ODM A;  1RJ7 A;  5LA1 A;  3UGF A;  4AVA A;  3Q8A A;  1I6X A;  4LMF A;  4CSW A;  5C3Q A;  1DGW A;  2JDY A;  2OT7 A;  2ZX0 A;  3WNM A;  4Y22 A;  3BGA A;  1Y43 B;  1V9U 3;  1BBT 2;  1WW5 A;  3IPV A;  4OVE A;  4J25 A;  3ZXK A;  1XPW A;  2YU2 A;  4JRL A;  2WS9 2;  3K4D A;  4LBO A;  2BER A;  3BUC A;  4I01 A;  5FMB A;  3WG3 A;  5DAP A;  4JDN A;  4PJY A;  4B1L A;  1GP4 A;  1MVQ A;  3E6D A;  3OOX A;  2YPD A;  2ZMN A;  4Q1R A;  1KJR A;  4QXB A;  4UOJ A;  2G9G A;  1LOD A;  4I2O A;  3BPS A;  1WUV A;  2PHX A;  5HV0 A;  4M0N A;  1BVV A;  3I2D A;  5CKQ A;  2D3S A;  3WEZ A;  4MG2 A;  4XAB A;  2ZX1 A;  3CLP A;  5KHH A;  1QHD A;  3GZE A;  1W8O A;  3VDD B;  1NCR A;  1NYW A;  4BPZ A;  4I09 A;  1RED A;  4EN7 B;  3AXD A;  1HQN A;  2R32 A;  1XNB A;  3AL6 A;  1HB2 A;  1NUK A;  1NKG A;  2BP6 A;  2VMI A;  2B5H A;  2W1S A;  5IVC A;  4HKW A;  1UMZ A;  4BB3 A;  4E2G A;  2GP3 A;  3NJY A;  3MF9 A;  1RUI 3;  4MX3 A;  5DDJ 1;  3III A;  1VP6 A;  3HN3 A;  2C9A A;  3J7L A;  4GWN A;  4UI9 L;  2QFE A;  4XDQ A;  4MXV A;  1BCX A;  4BQY A;  5EQU A;  2VNR A;  3I3Q A;  1XJA A;  5A3P A;  4D0Q A;  3I3M A;  1JZ4 A;  4E9K A;  1SBD A;  1XOY A;  1V6N A;  1NY7 1;  1S0B A;  2VEC A;  4YW7 A;  4G9S B;  4XUQ A;  3MZH A;  4XC9 A;  2E7Q A;  1XB9 A;  4RFR B;  5LBB A;  1S0D A;  2HWD 3;  4E4S A;  2FZ2 A;  1S0G A;  3N9O A;  2FDK A;  1HRI 1;  4EN0 A;  4GWJ A;  4GZ9 A;  2Q8E A;  2B4K A;  1W6N B;  3G6J B;  4P14 A;  3QH7 A;  5L36 A;  1DFQ A;  2WO2 A;  3HNY M;  4P02 B;  4AZZ A;  1QKQ A;  3MUY 1;  4C1X A;  5T5J A;  4YG0 A;  3F95 A;  1NY7 2;  2Y26 A;  5KXE A;  1EP0 A;  3KF3 A;  2ZXQ A;  1U5I A;  2RV9 A;  1Q8P A;  2IUW A;  2WT1 A;  2W5F A;  1RTV A;  3V65 A;  5A6Z A;  1AR7 3;  4MHU A;  4X8P A;  3VDD C;  2VC9 A;  3ATG A;  2W3J A;  2X8K A;  1HRI 2;  2R04 3;  1QF3 A;  3EB7 A;  3LIG A;  5JVV A;  4DXR A;  5EWS A;  5T54 A;  1RB8 G;  1W6P A;  4LKS A;  5HBA A;  1RUG 1;  2CWS A;  3BU7 A;  3RMX A;  3URF A;  3D3A A;  1W0O A;  5LAS A;  4M4P A;  4EN8 B;  3GHM A;  3HD8 B;  5EIY B;  4HKL A;  4IXL A;  2XVG A;  2HKX A;  4FOQ A;  4UW6 A;  4AI3 A;  4NJ4 A;  5C3S A;  4DMI A;  4GXL A;  2OS2 A;  4K40 A;  2PMW B;  1PM7 A;  2JB8 A;  3KV9 A;  2P17 A;  4OUE A;  4XQ4 A;  1MZF A;  4MAD A;  4XAE A;  3MPB A;  2UUR A;  2UY8 A;  5LBF A;  3ZFG B;  3GZT B;  4D69 A;  4W6W A;  3M1H A;  3B3Q E;  1IPJ A;  1J58 A;  5F8P A;  5FMD A;  2B46 X;  4JGY A;  1DGW X;  1Y7B A;  3PHM A;  4ZXE A;  5FO8 B;  2Q5T A;  2W9X A;  4LLO A;  1QJY 3;  1HRV 1;  3I97 A;  4ES9 A;  3JB4 C;  4A6S A;  1BLZ A;  5F39 A;  5IVB A;  2VE1 A;  3APB A;  1QQP 3;  1PIV 2;  3M7A A;  5F37 A;  1IZ3 A;  1PO2 2;  5FLJ A;  3ZYH A;  1U5X A;  4RSU A;  4KWJ A;  5EYX A;  1JS9 A;  3LE0 A;  3UL2 A;  1UX6 A;  3FHI B;  5DUX A;  4HSJ A;  4XFH A;  5JOX A;  2YFZ A;  2J1U A;  3O1P A;  4PDW B;  1PK6 B;  1E5S A;  2DYC A;  3PU8 A;  2RS3 3;  1NCQ A;  1NX9 A;  3PUA A;  1V6M A;  4IET A;  2RMU 2;  4LBK A;  3WQB A;  3ACG A;  2IWG B;  2VME A;  5A7S A;  5HV4 A;  1BEV 1;  2GC3 A;  1S1A A;  2KD7 A;  3ZLI A;  2R1D A;  1O6U A;  1WD3 A;  1LR5 A;  3JBG 3;  4OZO A;  3TWI A;  5C8W A;  3ZFG C;  4Q0V A;  4DUX A;  4PBO A;  2VOX A;  1UOJ A;  4S2F A;  1UOF A;  4TTG A;  4I0W B;  4NOT A;  5BYN A;  1C57 A;  1UZY A;  4LUL A;  5BNN A;  4IEV A;  1J3R A;  1CX4 A;  4QX2 A;  3JU9 A;  3WQ1 A;  5ERL A;  4BOW A;  1WGP A;  2UWC A;  5BPX A;  5A3U A;  2VTF A;  1JYN A;  3ZVX A;  3ST7 A;  2P3J A;  2VY0 A;  3AC0 A;  3IZO A;  3SKV A;  4IGO A;  4GAZ A;  4JDO A;  4DPN A;  4NIH A;  3NNF A;  2IVJ A;  2YC4 A;  3Q8E A;  3WF4 A;  2Y60 A;  2BQP A;  3P3P A;  4GMP 1;  5JAX A;  2ZS6 B;  1RC6 A;  2D5H A;  2IFR A;  4YGD A;  4ZHN A;  2WZ8 A;  4CDQ B;  1CAW A;  2OYZ A;  1UYY A;  3HPN A;  1QJU 1;  1PK6 C;  1Q5O A;  1R09 1;  4PDW C;  4XQD A;  3BOP A;  2FMY A;  3N9L A;  4FAG A;  2P2K A;  1CPM A;  4FPC A;  1LEN A;  1IG3 A;  4DOU A;  4FPO B;  5GZD A;  4MV2 A;  5FZF A;  1TE1 B;  3KB5 A;  1MQT B;  1WCQ A;  4MXW A;  1FI2 A;  4GB3 1;  4GD4 A;  4XFA A;  5FUI A;  4AVV A;  4H14 A;  4YAR A;  5FOB B;  3WLU A;  1D4M 2;  1UY0 A;  4RR3 A;  1WMF A;  4XAC A;  1QJU 2;  1O7F A;  1R09 2;  1LOF C;  4CRQ A;  1RUH 1;  2DUR A;  1XE8 A;  3MW4 A;  3T0A A;  1SDD B;  3ALQ A;  3OB8 A;  3UET A;  2WIN B;  3WF0 A;  4AQS A;  1Z7S 3;  1J59 A;  1CZS A;  4IV1 A;  3I4I A;  2ZGN A;  2E33 A;  1U5Y A;  4GB3 2;  3MO4 A;  2GDF A;  1HB1 A;  3ZMO A;  1XYP A;  4IE5 A;  1PMJ X;  3LSD A;  1WCK A;  2N7G A;  5FZ8 A;  1OA2 A;  1RUH 2;  2VMG A;  4JAA A;  2MPF A;  1VMH A;  3RPQ A;  3H3L A;  1UIK A;  2ZAH A;  3AL5 A;  5JR7 B;  3B9I A;  1IOA A;  3FFZ A;  3PNA A;  2YDE A;  5FWJ A;  2HWE 3;  3AYA A;  3CJI A;  4FPF A;  4LBJ A;  4TYS A;  5BV6 A;  1MS1 A;  2WNO A;  1UU4 A;  1VBE 1;  5ANQ A;  4CDQ C;  1CES A;  5FMO L;  4CTE A;  5FYM A;  4HVR A;  1VB4 A;  1HXS 1;  4K1Z A;  5LAT A;  1KFX L;  1LOA A;  1KXG A;  2Q1Z B;  4L0P A;  3GXU A;  3IAQ A;  2CAV A;  4K21 A;  4E4H A;  1F5F A;  2JE8 A;  4S2D A;  1LJ7 A;  4QB6 A;  4FPG A;  4PQ9 A;  2F6B A;  5JWP A;  1MQT C;  1RUE 1;  2UY9 A;  1LCL A;  1OOP B;  1RMU 1;  2FDH A;  2XHK A;  5HXV A;  4OUS A;  4XCB A;  1WWY A;  2BWA A;  2BV4 A;  1YYN A;  1PZ7 A;  2PQQ A;  4ARY A;  4BDV B;  1HXS 2;  4AK3 A;  4IE6 A;  3ZXL A;  1IPK A;  5T5L A;  4AVT A;  4RN5 A;  3PIJ A;  4RA0 A;  5L7O B;  5A6Q A;  4COV A;  2GC2 A;  2I74 A;  1Q8O A;  1IKQ A;  4XOG A;  1RUE 2;  5FJK A;  4YM1 A;  3R4U A;  3VBO B;  5C3P A;  1H2N A;  4QU2 A;  3W9A A;  5FLH A;  1CPN A;  2BFU S;  1KS5 A;  4QQ2 A;  4FPK A;  3AFG A;  4HT1 T;  1ZRE A;  3AMM A;  1AX2 A;  1Y9M A;  1IS6 A;  4V2V A;  4HPK B;  5F32 A;  4QM9 A;  4CDW B;  3LB9 A;  1O3S A;  5I0D A;  2AR6 A;  2WR9 A;  2Y6G A;  3S0M A;  4OMC A;  4MSV A;  4YM2 A;  2C5D A;  3KVA A;  3K77 A;  4XUP A;  5DQ0 A;  1AYN 1;  2VH9 A;  2OPW A;  3OUH A;  1POV 0;  1PX3 A;  1D2Q A;  2D97 A;  5IWF A;  4AAP A;  4FTB A;  1GZW A;  5ACA 1;  3OD4 A;  4NUB A;  2WDB A;  3KM5 A;  3POS A;  5FXZ A;  2J1T A;  5GZE A;  4P9Y A;  4AWD A;  4A4A A;  3MDP A;  4YZ5 A;  2VZ1 A;  2FD8 A;  2MEV 1;  2R0F A;  4A7K A;  4YFW A;  3WNN A;  1D0H A;  4AE2 A;  2WC2 A;  1OOP C;  4QHO A;  4FFI A;  1DZR A;  1DYP A;  3THT A;  3TEZ A;  1S2E A;  3T4H B;  1EV1 3;  1AZD A;  2BZD A;  5A3W A;  5FP9 A;  2JDM A;  3K3N A;  4KGQ A;  4NO4 A;  2HWC 1;  4PLM A;  3WP5 A;  5ACA 2;  3AP5 A;  1H6X A;  2EAL A;  4EWA A;  1JOP A;  4AOC A;  4MYE A;  1GOF A;  4M4R A;  4C0H A;  5CBL A;  1FAT A;  2MEV 2;  5IUQ A;  2FBE A;  4LBM A;  3SXW A;  2EIE A;  5HCA A;  1JBC A;  3OG2 A;  4IW3 A;  3SMH A;  5L7O C;  1X50 A;  2ET1 A;  1ENX A;  2I45 A;  3VKO A;  5HXM A;  5J48 A;  4RYD A;  3IAP A;  4DIN B;  3HVD A;  3RJR A;  3VBO C;  2QBX A;  4IND A;  2GC1 A;  2D44 A;  4D8M A;  1V6L A;  5T52 A;  4B1M A;  3UKN A;  4Q4W 1;  2BUK A;  1QNY A;  1C3H A;  1W8H A;  4DXT A;  4J1W A;  1CIY A;  1H9W A;  1PGW 2;  1XQN A;  1BKZ A;  2VZV A;  4LA3 A;  4CDW C;  3VDB A;  3INA A;  1GQG A;  2YBS A;  3AFK A;  3I3D A;  3VN4 A;  4IEX A;  3FN9 A;  4UW4 A;  2KM2 A;  3NAP A;  3HWJ A;  5A1F A; 
#chains in the Genus database with same CATH homology
 2DBN A;  2VBD A;  1W06 A;  1HB1 A;  5C3S A;  1W2O A;  2JB8 A;  1HB3 A;  4XAE A;  2BU9 A;  1W2N A;  5C3O A;  5APA A;  2Y6F A;  1UOB A;  5C3R A;  1QJF A;  1W28 A;  1BLZ A;  2VE1 A;  1RXG A;  1ODM A;  5C3Q A;  2DBI A;  1E5S A;  1IPS A;  1UZW A;  1GP4 A;  3OOX A;  1WA6 X;  1BK0 A;  2JB4 A;  5C3P A;  1UNB A;  3ON7 A;  1UOG A;  1W05 A;  1UOF A;  1HB2 A;  2VBB A;  4BB3 A;  1UO9 A;  1HJG A;  2CSG A;  3ZKY A;  1ODN A;  1DCS A;  1QIQ A;  2BJS A;  2IVJ A;  1W9Y A;  2Y60 A;  1E5I A;  2VCM A;  1E5R A;  1OC1 A;  1HJF A;  1W04 A;  1W2A X;  2IVI B;  1RXF A;  1GP6 A;  1QJE A;  2VBP A;  4RGK A;  1W03 A;  2VAU A;  1HB4 A;  1E5H A;  2WO7 A;  1GP5 A;  1W3V A;  2BRT A;  3ZKU A;  3ZOI A;  1OBN A;  1W3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...