1RXFA

Deacetoxycephalosporin c synthase complexed with fe(ii)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
307
structure length
264
Chain Sequence
DTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDLVIDFFEHGSEAEKRAVTSPVPTMRRGFTGSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFMAPHYDLSMVTLIQQTPCAGFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAAPRTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHASE
publication title Structure of a cephalosporin synthase.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
total genus 82
structure length 264
sequence length 307
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1rxfA00
1HB4A 4XAEA 1E5SA 1E5HA 1ODNA 1DCSA 1W3VA 1ODMA 1W3XA 1UOBA 2IVJA 1W9YA 5C3RA 2DBIA 5C3SA 1E5RA 3ZKUA 1UOFA 4RGKA 5C3PA 1RXFA 1E5IA 5C3QA 2CSGA 2Y60A 2IVIB 1BLZA 2VCMA 1GP6A 1WA6X 2WO7A 1OBNA 2VBPA 5C3OA 1UNBA 2JB4A 1OC1A 2VE1A 2JB8A 3ZKYA 2VBDA 1HB2A 1RXGA 1W28A 1W2AX 4BB3A 1W04A 1W03A 1GP4A 3ON7A 2BJSA 1UZWA 1HB3A 1W06A 2DBNA 3OOXA 1HB1A 1QJEA 1IPSA 2VAUA 2Y6FA 1UO9A 1HJFA 3ZOIA 1QJFA 2BU9A 2VBBA 1W2NA 2BRTA 1BK0A 1UOGA 1W2OA 1HJGA 5APAA 1QIQA 1GP5A 1W05A
chains in the Genus database with same CATH superfamily
2UWCA 1HB4A 4CVUA 4XFIA 1PIV2 4Z92B 5CIRA 2GNMA 3WDVA 1ASJ1 1H1AA 4JKKA 5A7SA 5F8PA 3T4HB 1XPWA 1TMF3 5CYYA 3RDIA 3O1OA 1HV0A 1JN2P 3ZFFC 4AVVA 2PELA 1TME3 3NV4A 4AQ6A 4C90A 1W8OA 4RSUA 1H8VA 2DUOA 2HJIA 4P9JA 5D8AB 4YVWA 1ZBA3 4RFRB 1YFWA 2XJSA 5FP3A 5LA9A 2HWF3 5A70A 5CA6A 1PGSA 2D40A 2AREA 2YU1A 5SV5A 2GSYA 4AEDB 1ZNPA 1YQ2A 3ZIXA 5A3NA 4HVOA 4JGYB 2VZRA 1KQRA 5C33A 2R0HA 1UXXX 5KHHA 1RUD2 1YQ8A 4E4HA 1QH7A 5J98B 4ARYA 4P9YA 3KF5A 2VCMA 2QDRA 4NE9A 4QX5A 4UAPA 2SLIA 3VZMA 1W0PA 3RI9A 1R1A3 2ZBJA 3LA3A 4IEYA 1MACA 4BU2A 3AMPA 1VE0A 2QTWB 2GMMA 2VPVA 4M3CA 3MF9A 1Z7S2 2W94A 4LUKA 4XJUA 3WDTA 3HIFA 4AFCA 5L73A 2ZAAA 1PK6A 3MIDA 3OD0A 5EXOA 3ZPOA 4RS5A 4LNVA 2H0BA 1AL22 1EUUA 4CCOA 3AZYA 5A6ZA 4LBQB 3A7QA 4U36A 4OMCA 3VDAA 1JXNA 4QHZA 1SACA 4K8FA 5FZDA 3EMRA 1OPOA 1OLQA 2WAOA 2QBXA 5GZFA 3RZGA 5C8CB 1NE4A 1OA2A 5LBBA 3OF1A 3L2HA 1W04A 2FDJA 3O1PA 1KS4A 1QJU1 1O4YA 5I0SA 5FBZA 2VZVA 1APNA 4X8NA 4GKYA 1KXGA 2YC2A 1S0DA 4L99A 2PMWB 2ZMKA 3N9OA 1AX0A 1GV9A 2Y38A 3WSOA 2FZ1A 3OGVA 5FY1A 1YO8A 2ARBA 4H14A 3CNAA 5FYMA 4CCDA 2D3RA 1TMF2 3MPBA 5JPNB 4PT6A 1Y43B 4N43B 4R8HA 2QQWA 4WM8A 3FWEA 1TME2 2VXRA 1QF3A 1CN1A 4QPIA 2BU9A 1U5ZA 1W2NA 1WW6A 4LBJA 3VBHB 1QH6A 3ATGA 1XXNA 3TRSB 2F4PA 3SMHA 2IFWA 2VUAA 5BNOA 1NX9A 3HQUA 2XJUA 4XQWA 3BTZA 1SEFA 4ZHNA 4EV0A 3WQ7A 5JOZA 1LHVA 1LRHA 4WBBA 2HWF2 5EFUA 4EJRA 3DYMA 2Z69A 2ZGNA 3RNSA 4CEYC 3DYPA 4FPOB 1PVC1 1QOSA 5HV0A 1LHUA 3ACLA 3P3NA 1LU2A 4FFIA 2C4XA 2R0FA 1EV13 5FOJB 4FO9A 2JG9C 2VU9A 4LE3A 1C5IA 1C5HA 2J1RA 3MEPA 1XYNA 3DYOA 4XDQA 2DCZA 4Y4YA 4XCBA 4AGRA 4CU7A 2G4IA 3NNGA 3W5MA 4HONA 4DMIA 1X7NA 3JXSA 5GLVA 2CYFA 1R1A2 3AZZA 2AH2A 3M3IA 4KU7A 2V72A 4Y22B 1VBD3 3IPVA 4A3ZA 4EWDA 1W39A 1JZ6A 1I5PA 1V0AA 4Q4Y3 5C9AC 4PQ9A 1AL0G 2VZUA 2V5YA 3WT3A 1ND2A 2IXHA 2JICA 3TNQA 1GWLA 4AI1A 4GWJA 3HMYA 3PJYA 5IVEA 3DL3A 1XNAA 5C3PA 2EIGA 4I2OA 2ET1A 3AYCA 5EPAA 3UK9A 4CRQA 1C3HA 2RHPA 1RUOA 5IJRA 3I2GA 3U10A 1GMMA 4LBOA 1LU1A 2PAMA 3JB8A 1MR5A 4YGEA 4AEDA 5IAXA 1PO23 5I0UA 1BEV3 4JGYA 3T0AA 4OHYA 1YNAA 4CUBA 3N9QA 1V6IA 4YRDA 3TAYA 1EPZA 3ES1A 2GALA 2C24A 3WUCA 4CPBD 3LIGA 1J83A 2P3KA 2WR9A 3D4KA 4DXZA 3E5QA 4P9WA 4XJAA 1WA6X 1CJDA 2XJQA 2X10A 3CZJA 3POWA 1F9KA 4G9SB 1RUF1 1OBNA 2RVAA 2D6MA 3VHNA 3BPZA 1NKGA 4F7ZA 3F2ZA 5F5IA 4A7KA 3ZLIA 2TNFA 2VMCA 3VD4A 1ULGA 1SDDB 1PVC2 3NKTA 1RHI1 4GB33 1CQ9A 1FMD1 4RQPC 3I2FA 5J36A 2Q1FA 2AUYA 1UY2A 4IDZA 1SFNA 5B4NA 5FP9A 1F4AA 1PX4A 5BV6A 2EAAA 1EPWA 4NHXA 1ENXA 2WLPA 1W90A 5FMDA 1KJLA 2WJSA 1TQ5A 4LK7A 4CP9A 5F6KA 4BISA 4ASKA 5DAWA 5BYNA 5EQUA 1R093 3KSCA 3AP5A 3NNFA 2BQPA 3IIAA 4I3GA 4CP1A 1D7PM 2ID4A 2K0GA 3POEA 4BQ5A 1EV12 3K46A 1L7LA 4KQ7A 1LKNA 3GGLA 5A1LA 1QNWA 2ZGKA 4MHRA 4RR3B 4R9AA 4XJ8A 1FT9A 3MBWA 1Y9MA 2UY8A 1WA4A 3ZOIA 1Q56A 2J1UA 4JDMA 1D4M3 4R52A 4URTA 3R4SA 4CDWC 3KWVA 3HNYM 4UF0B 1ULDA 3AL6A 5T50A 3TEYA 1HJGA 3E1F1 3JBG3 3C2UA 1WW7A 2EALA 3O0XA 2Q8DA 1VBD2 1CX4A 3KLSA 4I0BA 2VC9A 5T54A 3VBHA 4Q4Y2 1QIQA 1CAXB 1UOJA 2D5FA 3ST7A 5CG9A 1W6NB 1H6XA 2Z5WA 1QWRA 1UZ0A 1VMFA 3J26N 2NQYA 1OF4A 4FCAA 1XYOA 1OQEA 4WVZA 3V65A 1ODNA 1RUF2 4Z2AA 1C8M3 3N7JA 4OHVA 2PHFA 4FFGA 4LBLA 3N3HA 1ZVFA 4RA0A 4X6QB 5FREA 5IUQA 4A7YA 1PO22 5JOYA 3CL1A 4HN0A 1RUH3 3IBMA 1VMJA 5I8TA 2R7EB 1FMD2 4E8CA 1W9YA 2A5ZA 2D98A 4Q0UA 5JOWA 4GWIA 1VLNA 2WFPA 3AL5A 5IK5A 3BALA 1CIWA 1NAEA 3HVDA 4QT6A 2D3SA 2VZTA 3OY8B 2GDFA 4AK3A 2AC1A 2Y6LA 1JOJA 3DF0A 2PA7A 1X36A 4K1ZA 1S0CA 3DKQA 3SXWA 3NV3A 3I8TA 1O4ZA 4BQ3A 5KXCA 4O9EA 3O1VA 4NIHA 3OG2A 4LHLA 2PTMA 4HPKA 4OYUA 4XFGA 1DQ2A 3MDPA 3WVJA 4CCLA 4JGZC 3CMGA 3BUCA 2EAKA 4OHXA 4EN0A 2WQ8A 4HL0A 4KMQA 4ZPIA 1BKZA 2VTXA 2V4AA 1H8TC 1VBE3 1EUTA 4XF3A 1AYM1 2BGPA 4LOSA 3Q8EA 2VUCA 1R092 3FZ3A 2RS33 2GN7A 1S0GA 4K1YA 3JD73 2E32A 1CAWA 4Z07A 2VECA 2TUNA 1L7QA 2TEPA 3LPFA 3PJQA 4KU8A 2W1WA 3U4SA 4BQ1A 5FR3A 1AR93 4XF9A 4H2AA 5DAXA 2WN2A 4HVRA 4NO4A 4Y26A 2WLQA 4AGVA 4YZ3A 1UX7A 2VZQA 4LULA 4CP2A 4XEZA 5F3CA 1XU1A 1GOGA 2DU1A 3UKNA 3D3AA 5ABJB 1YQ5A 3RPQA 4AL9A 1CPMA 2VUDA 2VOVA 4META 1XE7A 3RZLA 1D4M2 4QHBA 3ILFA 3K4AA 5GJ6A 3AXEA 2O1QA 3ZSKA 1IGOA 1ND3C 3ILNA 3GZAA 4KH9A 5T5PA 3UGGA 1DYOA 1HQWA 3JBG2 4GMP3 3MF6A 2UY9A 1SHWB 2ET7A 2QQJA 3MV11 1DGRA 1TVGA 3JUUA 2HYXA 1QMJA 3WF1A 4IEVA 4MGQA 2HWC1 3JZVA 4ZXEA 1I5ZA 2O14A 1QQP1 2P6HA 4CP0A 3RZHA 2CGOA 3WW3A 2QQMA 2QQOA 3BU0A 1C8M2 2GP3A 2LALA 2JDMA 3H8XA 2QZ2A 5LK5A 2NZ9A 3HBZA 3B94A 1V6NA 1HIXA 3M4FA 1HJFA 5FZ4A 4D7TA 1U5IA 1VB2A 4URAA 2BW8A 1W2OA 1G9DA 2JDAA 1O3RA 1DQ6A 2P3YA 5FYCA 4IW3A 3GJAA 1VPHA 1JZ8A 3I59B 1CAUA 3K48A 1OKOA 4PLNA 5APAA 1OLMA 4UF0A 1NG0A 5FYZA 1W05A 2WS91 2VO5A 1XSQA 4C91A 2KD7A 5FY8A 2VH9A 3UNPA 1ZBE1 1W6NA 1W8NA 2Q5TA 2W92A 4A7ZA 4D6RA 5CBLA 2ZX3A 3AVSA 1UY3A 1MS9A 2GH8A 2DCKA 3USSA 1Q43A 1GFF2 2XL9A 2QDNA 3BCWA 1LGNA 5JUVA 1BQPA 2XJRA 4RD7A 4Q4V3 1DLCA 4IQPA 3VBRA 2RS32 3GZUC 5IVBA 3VB9A 2J1AA 3JD72 4A2UA 4NWVA 3UESA 3GF6A 5A7PA 3U07A 1O3QA 4CCNA 4AI2A 3POIA 2YC0A 2ZGSA 2Y26A 3D0JA 3QOPA 4PI2A 4QX7A 2WO1A 2YBPA 3IB3A 3VBSB 3U75A 3OY8A 1XJAA 5I8SA 4QPGB 5HBAA 4NUBA 5A3OA 3OYWB 4XIKA 4FOQA 4MXVA 1AXKA 1EAH3 4P9GA 3USUB 1AX1A 1W9SA 2VOTA 1H6YA 1BVVA 4COUA 4HN1A 3TOJA 2B4KA 3ZYHA 3ZFGC 4Q1PA 1H30A 1NA1C 2ZKNA 4PF5A 3CJXA 3NL1A 4XJZA 5LEKA 4LBNA 1Z0HA 4BDVB 2G9ZA 3M70A 3T2PA 3ZSJA 4YVWC 4XE9A 3BU7A 3I3QA 3NJZA 2ERFA 5H9PA 5LY2A 2XVKA 5DQ0A 4DPNA 1IS4A 4ATFA 3Q9OA 4M01A 3Q8AA 2WBKA 3O1TA 5GZGA 4CCJA 2VR4A 3O7OA 4LOTA 2YUEA 5EZWA 4P9IA 5LRRA 3WD5A 4YW5A 2Y64A 2ZCWA 3ACHA 3KQ4B 4QU2A 4MXWA 1ST8A 3MICA 2Y0IA 2IC1A 1RXGA 3AJZA 3ZXDA 1MS1A 5ABJA 3KT7A 4PIXA 3E5XA 4AW7A 4BB3A 4W4ZA 3C7HA 1W03A 1RVF3 1AR73 2BJSA 4IESA 1JYWA 1UF2C 1FX5A 3P6BA 1HB3A 2OIIA 2ZHNA 2X5IB 2RJLA 3LOIA 4XTMA 3WDWA 4N53A 4G4FA 3N9PA 2AZ5A 4JC1A 1TNRA 4AQ2A 1OQDA 1W6QA 3FL7A 4XFCA 2XQRA 4C1WA 1NLSA 4NR1A 4YW3A 3QBQA 4MSVA 1PNFA 1FPN3 1AR61 1NZCA 2Y6FA 4JQTA 1UAIA 3S7IA 3ACIA 1N3OA 1PK6C 3AKTA 1N47A 4WM7B 1UOGA 4RS5C 2O0OA 2ZHKA 3V0BB 1I1EA 1W6MA 4GIQA 4N8MA 4YVSA 3WX5A 3BIWE 2KA3A 1VR3A 5JDBA 1D2QA 2HWD1 4Y1UA 1JBCA 3KF3A 2DWRA 1C1LA 3I59A 1WCKA 2QCSB 2ZAHA 4UFIA 2L9LA 5FZIA 4OI0A 1W3VA 4LQRA 2XOMA 4HFSA 3ELNA 3PUHA 4CDXB 4D6SA 2WKKA 1EAH2 2D7FA 5GZDA 1U12A 3RWNA 3OBZA 4B7EA 4EWAA 5AC91 4JZRA 4FAGA 2ADDA 3AMQA 5HI0A 2FCVA 2RJKA 3BB6A 3E97A 1W0OA 4HMZA 2J42A 1OVSA 2ZXQA 1U5YA 2WO3A 4WM8C 4XF1A 2JE7A 3RRDA 1KD7A 1C28A 4HXCA 3D6EA 3ZXKA 3KCYA 3AMHA 3N7LA 3NAPB 5F6LB 5BNOC 3VKLA 1W8HA 5IVJA 5CFDB 3KHCA 4XTPA 1PO13 4GKXA 1JTZX 3H8RA 5FZ6A 3CLPA 4M0HA 4MVTA 4CXXA 1NXD1 5FY4A 5C7GA 4YW2A 2CV6A 5C3QA 4ITCA 2XONA 3BVCA 3NW4A 1VAMA 4BCUA 5FOBB 5M0TA 3MO4A 2YBSA 2IVIB 3B5LB 1H8TA 2PXJA 4ET7A 5EYYA 2R16A 2VTXJ 4QPGA 4Q4W3 5FYSA 2GC2A 1S4CA 3OYWA 1J3PA 3HQRA 4Y5TA 1C1FA 3VBOB 5L7OB 2WWJA 2XLFA 1RVF2 2B5HA 3H7YA 4TTGA 1OQ1A 2XH6A 2GN3A 3LA2A 3RZZA 3USUA 2WNEA 5J37A 4BXSV 1JH5A 5IWFA 3O1MA 5DUVA 5G05L 2RS13 2JDHA 2WSVA 4UW5A 3KT4A 4IE4A 4I01A 3C7GA 2YG0A 2JB4A 2XJPA 3UKTA 2OXBA 4F8AA 1FPN2 3NRUA 4XMIA 1AYN3 1NY71 5D8AC 5DXDA 5JIUA 1W8WA 3FBYA 1S0FA 3A4UA 2CNAA 2HWE1 1SZBA 4KNCA 2VNGA 5FQ0B 5LASA 3VBFB 5FLHA 1HB2A 1YFUA 1HQNA 4F83A 4YZ5A 1G9BA 4XFBA 1LR5A 4XPVA 3ECQA 2JG8A 1K5MB 3LIHA 1LTEA 4AEDC 4BE3A 4AVTA 4CXYA 4JGYC 4NAOA 1WZXA 1PIV1 1G6NA 2Z79A 3ZXLA 4B4PA 5K0UB 1MS0A 2DVBA 2YY1A 2JDKA 1Y3TA 3GJBA 2MEV1 5I91A 2VL4A 1JMUB 1QJEA 1EYBA 1PZ8A 2X5IA 4LO6B 1CPNA 3B00A 4XQDA 1NLQA 2B46X 2VTFA 5FV3A 2ZABA 3QD6A 3S57A 4BIFA 3DGTA 3T3YA 2RR13 2XJVA 4E27A 4QKFA 4WM7A 2B9VA 3WEZA 2GC3A 5IVVA 1K12A 2QQPA 2RS53 1GP5A 2J1EA 5IFTA 1IKQA 3KVBA 3V0BA 4UFHA 4FTBA 4XW3A 3WG4A 3M8LA 1PO12 5JSOA 4L11A 2A6YA 3KV9A 2XDVA 1LHOA 5FZFA 1OT5A 1RUD1 5E16A 4QX3A 4B8EA 2E53A 2EXJA 1E5HA 4K6BA 4N9IA 4COYA 1DCSA 1O4TA 2Q30A 5DAQA 4CCEA 2R071 4Y5Z0 4OVEA 2GH2A 4D7YA 1W8UA 4EZ4A 5E6HA 3TYJA 2RR11 3I2DA 1H2NA 4UFLA 1WMEA 3WHTA 3J7HA 2LUWA 1NY72 5FZ7A 1E57A 2ZMLA 4OUEA 3WDUA 4CDXA 2IXJA 2D44A 2HWE2 3RYPA 5A3WA 3GALA 2WABA 2W3JA 3SEEA 2E26A 4W6YA 2DVGA 5JMOA 1GOFA 4Q8LA 1P8JA 2XMLA 5A32B 1W8FA 2JDPA 1J84A 3AP4A 4AG4A 4LK6A 1WMXA 3DCQA 1PMIA 4PHZA 1LB2A 3OCPA 3KT1A 3VBHC 3ZN6B 1N3PA 3OBTA 1AL21 4MV2A 4XYXA 5EYXA 4FSJA 1AYN2 2G9GA 1OUXA 4F3JA 1BYHA 1DYPA 5CFDA 1A3KA 2WA4A 2XKOA 1QXJA 2YU2A 5DAVA 2MEV2 3WZ1A 5LATA 4UFMA 1BXHA 1BLZA 2ATFA 3S5QA 3ZFGA 4E2SA 1NA1A 2P17A 5FP8A 2Q8EA 5FP7A 3M7AA 2Q1ZB 1PHMA 5C4WB 2HYKA 2W39A 1JS9A 1S0EA 1PMHX 2QQNA 4XJWA 5C71A 1A6CA 1UPSA 2FHRA 3POFA 4PLOA 4A45A 5FXZA 4I30A 2I07B 3VBOA 3OGJA 2Y6HA 5L7OA 2XHNA 4IL7A 3PTRB 3VGIA 3U0ZA 1UYZA 1HN0A 1TMF1 3LSDA 3ZMNA 4A4AA 2JE8A 2XWBB 2ZHLA 5HXVA 4XXAA 3ACGA 5CKMA 4CYDA 1TME1 3H3UA 2A3XA 4BJ0A 4XHBA 4QGMA 2R49A 5T55A 2WNVB 3H1WA 4FFFA 5DN2A 3ZKYA 3FLRA 1ZBA1 5FIXA 2R072 3C3VA 2R1BA 1LJ7A 3TEXA 2HWF1 2RR12 1G9CA 5BUVA 4RGAA 4B1MA 2AENA 4S2FA 3ON7A 1LEDA 5FQ0A 5FZHA 2RS52 3ZIWA 1ZRRA 4MGKE 1ZM1A 1UKRA 2RMU3 2ES3A 4OMDA 1POV0 3FHQA 1IPSA 2P4EA 3MW3A 4NRQA 2WT1A 4J25A 5K0UA 1IPJA 4LUMA 3H7JA 2VOXA 4R4XA 3T4VA 4AE2A 5FK8A 5FZ1A 3WNKA 3HN3A 3I2KA 5TSWA 2H0VA 3ZFFA 2VBBA 1KGYA 1R1A1 4HLTA 1NZIA 4YG6A 1JU4A 3L2YA 1IKPA 4O65A 3SH4A 4TN7A 2GMPA 3MIEA 4MGSA 5LA0A 4YM2A 3ZSEA 3FHAA 3C7FA 4PIZA 3AMNA 5HCAA 4PI0A 4LHKA 2A7AA 1K42A 2B9UA 1S2KA 4YG3A 3GHNA 3PIGA 4QQ2A 3HNMA 1NOVA 3RI8A 1RUI3 2DVFA 3BPSA 2DF7A 3ILRA 1QJX3 4OFGA 5FWJA 3KV5A 2RDQA 4Z1VA 1ZRIA 4JV4A 2HBTA 5FZAA 2IVJA 2PHUA 5C3RA 1V6OA 1WLTA 3NWKA 1XYPA 4P5HA 1KRIA 2BEOA 3I3EA 1VRH3 2F6BA 3CJIB 4Q4X3 5KBFA 3TEWA 3ITQA 5JR2A 1ZBA2 2WNOA 4RR3C 5CU1A 1MS8A 1AR83 4LO5B 1UYXA 4GQ7A 4L0PA 3SISA 4BQ2A 2XGXA 4X6RB 4QGLA 2CL2A 3VD9A 3BTAA 4IEZA 5A32A 1SLLA 1O5UA 3VKMA 1D0GA 3BKZA 1A34A 1F35A 1DZRA 3T09A 4Z82A 3BTYA 5D1IA 2WIIB 2VY0A 3OJBA 5HCFA 3RZKA 4CTEA 2W1QA 5FYBA 1XE8A 5A1AA 4MGYE 1OA4A 3CF6E 4D69A 3PL0A 3NJVA 4UOJA 3MI8A 5EHDA 4NMIA 2FMDA 4XFAA 1QDOA 2DCTA 5F32A 1UY0A 1MQTB 2TBVA 2WO7A 1SBEA 1EV11 2J1VA 4Q1RA 5C4WA 2RMU2 1RJ8A 5FUPA 3VBRC 5D8AA 1ZZ8A 3RG0A 1XNTA 1YCIA 1H2KA 2Q8CA 2PHRA 4E2QA 5JI7A 2G19A 3WV6A 1ULOA 5G04L 2GC0A 3MHZA 4DUXA 4Q27A 4XBLA 5FLJA 2NP0A 2VZSA 2PLV3 2C0ZA 5FZLA 1J59A 4JKMA 5A3PA 4OQ8A 3MGUA 1LECA 4H55A 1VBD1 4FP2A 1OFSA 2BERA 1KITA 1XOYA 2JJ6A 2WNVA 4Q4Y1 4A6OA 4YARA 5I0RA 1CX1A 2E7TA 5FUNA 5KWRA 4PDWB 1GNYA 3TNPB 3KV6A 4BZ4A 2XUEA 5FY9A 4BQYA 4ISRA 1GU3A 1REDA 4CDQB 5D21A 3DXTA 5E1RA 5I0TA 1ULFA 2ZGMA 1ONAA 4HBNA 4UWDA 1F8VA 3HOBA 3VD3A 1RUI2 3RMYA 3G6JB 5JZGB 1PO21 1QJX2 1BEV1 1O8SA 2R6QA 2GNTA 3IAQA 4IV1B 5FZEA 2KXLA 2ZEZA 5K7PA 1V9U3 1F31A 3JB4C 1JYTA 5IVFA 2OT7A 4IEWA 5ANQA 4IV3B 1BK0A 2W46A 1H4GA 3H3ZA 3AZWA 4Q4X2 2BGOA 4XFHA 4DFSA 3NNJA 2ZX2A 1G86A 1DGWA 2YPDA 3LPGA 3N35A 4LBQA 1UZVA 1AR82 3AYEA 1QJY3 2VQAA 3K3OA 3E5UA 3WQ1A 4B7KA 5ABJC 4XUOA 3J4UH 1X82A 4UBHA 4AQTA 1WLWA 4IGQA 5JXJA 5C8CA 1OLRA 3ES4A 5BNNB 4GB31 1QEXA 1GWKA 3MIGA 2HLEA 4H7LA 4D8MA 2YROA 4NROA 2P6CA 4L92A 3LKJA 3SKVA 1GQPA 4BYYA 4N90A 4CXWA 4N53C 3GM8A 1FXZA 1UYYA 3SNMA 3W58A 4DO0A 2H6BA 1JW6A 1WGPA 1UOBA 3Q8FA 5JXIA 1UMHA 3D5OA 4SLIA 5EJZB 2YFZA 2WNUB 3SLIA 5F7UA 5E89A 1UKGA 4ORFA 1AF9A 2VNRA 1R091 3N7MA 3ME2A 1W0NA 2DBIA 3OB8A 3VDCA 4AYUA 4N43A 4PBOA 2E9QA 1E5RA 1YJKA 4D94A 4XVHA 2NPIA 1MEC3 3C8XA 3C7OA 4GWNA 3ZO0B 3DPRB 1H0BA 3BOWA 3VBUB 2ZX0A 3MW2A 1WD3A 3D82A 4RGGA 2A75A 1D2SA 5EV7A 5FO7B 5T5LA 1DQ1A 1OURA 4YVSC 4ONUA 3TBDA 1IS6A 2ZX1A 4XCAA 1D4M1 1GANA 3LB9A 5FPUA 1SLCA 2WDBA 1WCQA 1S0BA 2PLV2 5FY7A 4BLIA 1ENQA 3JBG1 4PJYA 1BBT3 2PN5A 1BEV2 1HX6A 3E6CC 4M3CF 1GZTA 5DZEA 4TWTA 1Q5OA 3K51A 5J48A 2FDIA 4GJYA 4A42A 1OFNA 3LE0A 1UCXA 5T3NA 4RHV3 3WHUA 4WVMB 1J3QA 2BNNA 2HWB3 5C3OA 1C8M1 2OPKA 2A6WA 4I02A 3WF3A 4MG2A 4N7IA 4Y22A 1K45A 5DAPA 2VMFA 1AJKA 1RUH1 2R063 1Q8SA 5L9BA 4GB32 5A3MA 4NHKA 3T2TA 2DTWA 3APBA 2SBAA 4EN7B 2Y33A 3MLKA 4I09A 3RWKX 3K4ZA 1LGBA 5A3UA 1FNYA 4H7MA 4IE6A 4NOTA 1LOEA 3PVEA 1ULEA 2PQSA 5I0DA 4GA9A 5FPAA 1GP4A 2XBO3 2ILMA 4QPGC 4IEXA 1GICA 1ZZ7A 4QPYA 2R061 1UY4A 3IDBB 2PHDA 4E2GA 3VKFC 3VKOA 1Q8VA 3MV01 2DBNA 5AVPA 4PDWA 1HQLA 3B9CA 4GH4B 4AI9A 1RUC3 4B4QA 2WL1A 2E63A 3EHKA 4HKOA 4JTOA 1DZTA 4CDQA 1KFUL 2BPA2 4N9HA 2OUJA 1VBA3 2W2IA 4KI5M 5FUIA 4YZ1A 2K2SA 1UO9A 5DUXA 2FDKA 1VBE1 1WMFA 4Q2FA 1CJPA 4K3UA 5JZGA 1VB4A 1LHNA 3I2IA 5KC6A 4IV1A 2RS31 4W8JA 2JX9A 3JD71 3H3LA 5I8YA 3UV9A 1LODA 4RQPB 1IPKA 3K75B 4ASLA 4LIVA 1AR91 3K2OA 5A3LA 3OSDA 5B4XA 3WF4A 4AGGA 4XC9A 4JQRA 4IV3A 5BXXA 3UETA 1DBNA 1O6UA 2CWSA 1JZ3A 2EXKA 1UPIA 3H0OA 2JG8C 3I7DA 1S2BA 3H42B 2MPFA 1IOAA 4R9CA 4BMEA 5KHJA 3U14A 2EF6A 1GWMA 2ORZA 4QKBA 4JTNA 3THPA 4HKLA 5JPMB 5LWBA 1XNKA 3FLTA 4BQXA 5BNNA 3UGFA 4GMP1 2JENA 1BBT2 2GMEA 3RYRA 1XNBA 1B35B 1RUH2 1SBFA 1HRI3 2JDNA 4V2VA 2X5IC 4RR3A 2CU5A 2VCAA 3A0KA 1CD3G 3DUIA 4LKEA 1F4HA 4RFT0 2AR6A 1M06G 2WC2A 4L2NA 4XDOA 1O3SA 2WNUA 3ZKUA 4YSFA 1JYIA 4FPCA 1GUIA 1UOFA 3KGLA 4YYOA 2ARCA 2UURA 4J6GA 3AP7A 4MX3A 2JEMA 2EIEA 1ALYA 4CDUB 1ZA4A 3MIHA 3M3EA 4QDSA 5DMYA 1DHKB 3F95A 2WT0A 4WM7C 1Q8OA 1RXFA 2B8MA 2R062 5CZKA 3DPRA 4CUCA 2VVDA 1LGCA 4YW1A 1CAXA 1YYNA 2JIGA 3VBUA 3BOPA 5C8WA 3ZXFA 4INDA 4EYUA 5FJHA 4KGQA 3IZOA 4HG6B 2A6XA 3NO8A 3UJOA 3IMNA 4AFDA 4FXGB 4LJHA 2A71A 3WNMA 4B4RA 2NLRA 1VBB3 4ISQA 5IHRA 4A41A 2A73B 2OZ6A 3ZYGA 1VBE2 3WF2A 4Q8KA 2XBO2 4MGTA 2D43A 1Y7BA 5F39A 1YC61 3GCWA 3ZM8A 4DQAA 3WNNA 5CAZA 4CDXC 2VQUA 1CIYA 3MLLA 5A33B 1TEIA 3BGAA 1AR92 4G3YC 4NAMA 5FPVA 3JQXA 3AZVA 3CIHA 1RUC2 4QAWA 4DUVA 2XHKA 1AX2A 3CZUA 3OPWA 4WVMA 5CFCB 1IQAA 1URXA 4XQ4A 3IIIA 4UXAA 4Y3OA 1UL9A 1VBA2 1V00A 1W2UA 5FPXA 1AZDA 3UT0A 2DDUA 1CZSA 3OGGA 4Q4V1 1I6XA 1IZ3A 5DDJ3 4YGBA 1LAJA 3RZJA 1RUG3 2J22A 1KFXL 1W2AX 5CFDC 5A80A 1JOPA 2WINB 3ALQA 4LORA 2CWMA 3M3QA 1NXMA 4LBQD 2PHXA 4QX2A 2WUHA 1OMIA 3E6BA 3WW2A 4MOAA 4JCKA 4DINB 2X09A 4Q26A 5AFEA 3T08A 2WZR3 1X9TA 2Q0AA 5F9TA 4NHYA 1XNDA 3IDCB 1N1YA 1HRV3 1EAH1 5GLWA 3VBOC 2ARXA 2NMOA 4RN5A 5L7OC 4QQPA 3OGSA 4Q0QA 1W6OB 2JDYA 2WYSA 3DV8A 5FDBA 4GH4A 1HRI2 3WG3A 3ZYPA 4TSVA 2WQ4A 5FMOL 3PHMA 2DUQA 5H9SA 5JI9A 3DN7A 3N9MA 5LY1A 4NVPA 5FMOS 3PU3A 4GMP0 1UMIA 1QDCA 2QVSB 4M4RA 2ORXA 5BNQA 2G9FA 2FDHA 2UU8A 1LULA 1VBC3 3W9AA 1ND3B 1OF3A 1UN1A 4AFMA 5CADA 4LITA 5GLZA 2W1SA 3A0NA 1U5XA 4JRLA 4OI1A 3PMEA 4GD4A 1E5SA 5FJKA 5H9RA 2B7YA 2VQ0A 1IS5A 2W08A 1ENRA 3I3DA 1X9PA 1G9FA 3PVOA 4DOUA 3POSA 3H50A 4Y33A 3VDDB 5LBCA 1K5MC 1GZWB 2W95A 1I3HA 1WMDA 3B7MA 4FQZA 4H3WA 1T6GC 4UW6A 4C0HA 4LKFA 4YGCA 1DQ5A 3R0RA 3UL2A 1RVF1 1AR71 1R64A 4NRMA 4XOGA 4ZS3A 5K0UC 3OUHA 3SCFA 2BNOA 2WZEA 4Q4V2 1GZ9A 1REEA 4P00B 1B35A 1Y4WA 3CU7A 3VLBB 2Y6JA 2BTVC 1LNSA 4KWKA 5FZMA 5AVAA 1WBFA 3POYA 4R9BA 4QKNA 4ZS2A 4CZSA 1STMA 1ZZ9A 1DYKA 2VVFA 4UT5A 1SPPB 1FPN1 2OVUA 1NQJA 1X8EA 2P37A 1BHGA 1GYKA 2AEZA 2VW0A 5FPLA 4MUVA 2VOKA 3VZKA 4JVAA 3ABZA 3O0WA 1DGRN 5KHKA 2W0XA 5LW9A 4K8RB 4CDUA 1NCRB 3AFKA 2I74A 4MGIE 5LBFA 2EXIA 5DDJ2 5FYHA 1RUG2 4ES9A 1ZYBA 2RM23 1R1ZA 1HDKA 4YM0A 3B01A 3UYJA 2BVBA 2V4VA 4S2HA 1VALA 3SHRA 5A7WB 1GP6A 2X8KA 3AXDA 3WDXA 3OEAA 4CU9A 1OOPB 2WWSA 2W91A 2WZR2 1FOD3 4NWWA 3J8F3 1IG0A 4W6XA 2UYBA 1G8WA 2ZS6B 4M3CE 4K21A 1YFYA 1ZX5A 3WCRA 5GZCA 1HRV2 2ETEA 4COVA 3AC0A 3SH5A 5LZ6A 2QKDA 2YDEA 1K5JA 1OC1A 2W87A 3C7EA 4OUMA 3WP4A 5IT6A 2A70A 5CNAA 1H1MA 3T0DA 2IFRA 3WQ0A 1RMU3 2W52A 2XB6C 1YFXA 3A23A 4ZZ5A 2ZGPA 3G7DA 4XDPA 3VBSA 2VMIA 1L3JA 3AKRA 3ZYIB 1LOFA 3HNBM 2EIBA 4A6SA 4ZZ8A 1EP0A 1XBFA 2XR4A 5CFCA 3NMBA 4YFZA 1RUE3 3VL9A 4XACA 3WP3A 5FZ9A 3EQEA 2R043 2VULA 1AR72 3ORJA 4LKSA 1VBC2 2DYCA 4GWMA 1FATA 1GBGA 4PQQA 1PO11 1UZYA 4BLJA 2VZ1A 4E4DX 4AHXA 4S2DA 3PTYA 4N7UA 1RMU1 4Y24A 3FUQA 3SH3A 4AEMA 4AVCA 1Y9QA 1W2TA 1JYXA 2F4LA 4UYBA 2JDZA 4FPKA 4EZHA 2VAUA 3OD4A 4HOOA 4FPFA 4Q4W1 5C4WC 5ACA3 1O3TA 3NV1A 3P5BA 1NYWA 1ZA7A 1YIFA 3B9IA 5JMCA 2FQPA 3UJQA 4AZZA 4AF9A 3ZN5A 5KXDA 3O12A 4UW3A 3QLQA 2PAKA 4CE8A 5A1FA 1YJLA 4MO3M 3KMHA 1QJZA 2RS11 4P08A 4COWA 3AM2A 4FPLA 3IAPA 3ZX7A 3V56A 3NSTA 5FMCA 4QB1A 1ULPA 1U0AA 2WNVC 4ZONA 4BMBA 3HBKA 4CSWA 2PFWA 1AYN1 3HN1A 3CDZB 5FYUA 3BIEA 4NIGA 5F2WA 2YC4A 1XQNA 3LFIA 2WT2A 2XVLA 3V0AB 5J3UA 3NNLA 4AAPA 2PQQA 5F5AA 4LKDA 1BCXA 4BHPA 2HEWF 4QMAA 2BDRA 1US2A 1G9AA 4HK9A 4GJZA 2YHJA 1X8MA 2ZMNA 3CBNA 2CDPA 1PZ7A 2WYFA 2DFCA 4HSJA 4MH0E 3HAGA 2ZACA 1X50A 1DG6A 2RM22 3E6DA 3OPTA 2ENRA 4I3PA 3KHBA 1UYPA 5FZ0A 3NKGA 3PURA 1SCRA 1IQDC 2ZGLA 2ZGOA 3VDDA 3VKNA 3WW4A 5LK7B 3GBWA 1QY4A 3ZYRA 1JZ7A 1NCQB 3LDBA 1W28A 5KHGA 1JI6A 4BA6A 3LA7A 5F5QA 5C5TA 3ZYBA 1FOD2 1PK6B 2D5HA 2JE9A 3J8F2 3PLQA 4AEKA 1UXZA 3W20A 1XE0A 3A22A 1JYVA 1MZFA 1VAKA 2QJVA 1ZRCA 4FAHA 1SCSA 1POV3 1XNCA 2RDRA 3SKJE 3H1MA 4DXTA 4ES8A 1UX6A 3VD5A 1RMU2 5C8CC 1CR7A 3GCXA 1HXS3 3WCSA 2Y60A 5IVYA 2XQXA 3W59A 4ASMB 4CU8A 4Q4W2 4WVVA 4YZ2A 1OVPA 2IXIA 3POJA 4ZY9A 1NCRA 2RS51 1UY1A 1DDLA 2ARAA 5FPZA 2R042 1H1IA 3WY6A 3O1SA 1A8DA 3TN93 4AVBA 1OH3A 2VOWA 1S55A 2LRPA 1NQDA 1YUDA 2ZX4A 3MFCA 4IE0A 3I2OA 4NIDA 1NT0A 4BPZA 4CCMA 4IXLA 2RS12 5FPBA 1FI2A 1Z7S3 3IMMA 4N43C 1DU3D 5A7WA 2ZA9A 4Y20B 1D0HA 1QKQA 4WM8B 3FUOA 4QPIB 3GXUA 1UW8A 4RL7A 3WDYA 3AKSA 3NAPA 4LO8A 5ACA2 4QX0A 2GNDA 4CEWB 1O8PA 2W47A 1ASJ3 2RV9A 1JOBA 1B09A 4KWJA 2RE9A 4LBKA 5FKBA 2LW8A 2IXCA 1X33A 2JD4A 5BNPB 2GNBA 1TE1B 1RUNA 3N4MA 1ULCA 2EXHA 1UZWA 4KG8A 5JXHA 4A3XA 2DCYA 3HQXA 5GM0A 3ZR5A 3LF7A 1NUKA 3R4UA 2IXKA 5DUWA 3ZDSA 3INAA 2HBUA 3RSJA 3AYAA 5FY0A 5GKAC 2WA3A 1V70A 1HW5A 3CHXA 4I0AA 1QHDA 4Y1VA 2LTNA 1N1TA 1SG3A 2E6VA 1POQA 1UWWA 3OEBA 2O8OA 3I2JA 4IEQA 3ASIA 3GNEA 4BQ4A 3ZR6A 1MQTC 3IPVB 4BXFA 2YXSA 4NPRA 3ZSLA 5DZFA 1MZEA 4Q0SA 5IATA 5KXBA 3O1UA 3ZYJB 1RINA 3D8CA 3MIBA 1Y9GA 2KM2A 3ZFEB 1UQXA 1ND2B 2E7QA 2VZOA 5LRSA 5C6CA 4XUQA 3ZXGA 5D2AA 4C1XA 5JLVA 3LWCA 1JYNA 1FYUA 1JZ2A 3VBFA 4IEUA 2ZOEB 1QXPA 3OUJA 1ZZBA 3IT8A 1K5MA 4LTAA 3M1HA 4YPJA 3LEKA 2AACA 5FCCA 4FI9A 2JD9A 3U11A 4DEQA 4NN0A 1HXS2 3PIJA 1WKYA 4YGDA 2P3JA 2RDSA 4PDWC 1IS3A 1WW5A 2W68A 3V0AA 2LS6A 2C9AA 3KCXA 4MLOA 3I2HA 2RDNA 3BODA 4CDQC 4D3WA 3GZEA 2HH9A 2NN8A 2Y8KA 5FP4A 4LEJA 4PBPA 3TN92 5C3SA 2RMU1 5JZGC 3RFRA 4Z2WA 3GBFA 4IV1C 3UGHA 3LFMA 2JKXA 4UFJA 1H2MA 1NCQA 1UIKA 4Y1XA 3RVHA 4JX0A 4DY5A 1CONA 1QJU3 1S0JA 4GXLA 3AJYA 4IV3C 1RJ7A 5J96B 1E5IA 1RGSA 4D7SA 5EP9A 1YHFA 4CP9B 3CQOA 1ASJ2 4LIUA 4YM1A 4K7JA 3PUSA 5IK8A 2W1UA 4JRAA 4XBQA 1A8MA 3WR0A 5BNNC 2IWGB 3M3CA 5FTTC 4DRVA 1YQ6A 3I49A 2OPWA 2OUHA 3MIFA 4PIYA 5HPOA 3MW4A 4CCKA 4FVVA 3ENRA 4IERA 2VXJA 1CAVB 3PVBB 3ROUA 2E31A 1RUI1 2R30A 4WV8A 1RTVA 5FAXA 4AAXA 1QJX1 2WQZC 3AK0A 1UNBA 2WNUC 1HKDA 2EIDA 4KL1A 3KM5A 1J3RA 4QD2A 1REFA 2WZPP 3HT1A 1PVC3 1PM7A 3WP5A 2AEYA 2UYAA 1GNHA 2DUPA 4V2WA 3PUAA 2YGMA 1G7YA 4Y20A 2QQUA 5F3GA 1AVBA 4ZXKA 4PF1A 1DQ4A 1VRH1 4GALA 5FYTA 4Q4X1 3I3MA 3KB5A 3ZN6A 1CZVA 2V73A 3DPRC 1QGLA 5FO9B 1HV1A 3VBUC 3I4IA 1AR81 2FD8A 4CEWA 5F37A 2FCUA 3RYKA 1TZOA 3FFQA 1XU2A 4A44A 2LM3A 2QQLA 4FOVA 3ZFFB 5BNPA 4JAAA 3TWIA 3KV4A 1O59A 4ZU7A 1MZ5A 2QNKA 3OTFA 3GZTB 1ENSA 4FFHA 4GULA 3MFAA 3SCGA 3WG1A 1OD5A 4LE4A 5C5UA 4IETA 4QX8A 4PCRA 4U2AA 4AVAA 1MZ6A 3LDRA 4FPEA 3I97A 4YWAA 3VHOA 2WAAA 3LEGA 4DY3A 4WVWA 5BY5A 2BYVE 3SC7X 1T6BX 3VDBA 4LBMA 4XURA 1XC6A 2C26A 4JKLA 2DU0A 2D6LX 4UI9L 2PHLA 1H9WA 1LEMA 1MPXA 4XMAA 2MNGA 2XXZA 1BMV1 3FX3A 5K4LA 3WQBA 4FPJA 3JU9A 2Q4SA 3VHPA 2P2KA 1HN1A 1QOOA 3ZFEA 3KCCA 4QWNA 2DVDA 1OLME 4DZGA 4HVQA 1QJU2 4K9SA 3FLPA 5FMBA 4XUNA 4HPKB 5LBEA 4QGNA 2CY6A 4P14A 2PLV1 3LGRA 4OZXA 1PZ9A 2Z42A 1RUF3 4QQLA 5FK7A 3BTXA 1DQ0A 3EB7A 2CDOA 1OI6A 3WUDA 5GZEA 5T52A 2DVAA 2Y34A 1PX3A 2VMHA 3HR9A 3QH7A 1CAWB 1RHI3 4OLLA 1FMD3 4QQOA 2X29A 1OH4A 3PNAA 3WP6A 4ZKTB 1VRH2 1WWYA 5A6XA 4GH4C 1N3QA 5JCTA 3PUQA 3J7MA 3UKVA 4Y1ZA 2HEYF 2K9ZA 4NIIA 3U78A 3T1MA 1KEXA 1W6PB 5L9VA 3ZN4A 2VMGA 1JYCA 3O5SA 1W99A 2VCBA 3S6PA 2FDGA 1KDKA 1LOBA 1V9U1 1PGL1 2ZKLA 4FQ4A 1JU3A 2PHWA 1T2XA 1YI7A 3K77A 2JWPA 4KWUA 3R05A 3JCIA 4FT8A 2VM9A 2VUJA 2E33A 4LPLA 2ZEXA 2D97A 1KS5A 1QJY1 1SFYA 2PHTA 4HSLA 4QXCA 4AFBA 4JHZA 1J58A 4C8DA 1SLBA 1QU0A 4QPWA 3MLJA 4Z8BA 4AOCA 2OZJA 3RJRA 5FZ3A 5IW0A 3I3BA 4AI8A 4LHNA 1DLLA 3DECA 3AYDA 1PMJX 2BGCA 2VZPA 1YIPA 3T1LA 1BMV2 1B35C 4KBZA 3CJIA 4LHSA 3RJ2X 1S1AA 2KR2A 4TZDA 3P1IA 1LOAA 2QQKA 4XBNA 4HANA 1CAVA 3U37A 4OULA 2VD7A 3GYDA 5FZ8A 4AEJA 1HLCA 2P3IA 4JHTA 5FXWA 2VE1A 3U1XA 2XLGA 2JB8A 5J1XA 1F5FA 4CEYB 4WZCA 1SMVA 2G1MA 2D93A 1CAUB 3AMMA 5JVVA 2VQTA 4DXSA 1WUVA 1MEC1 3GHMA 1W9TA 4Q0PA 2YZ4A 4CDUC 1F5JA 2JG9B 5C70A 1XRUA 5LEJA 3PUIA 2BBAA 2C6SA 2WN3A 5F2SA 1OPMA 2N7GA 2OX0A 3SEPA 3LEMA 3VZLA 3DKWA 2Z4FA 2BOJA 5BPXA 4KG0A 1CVNA 3O14A 4CUAA 2D6NA 3EJKA 4AVSA 3RZMA 2OS2A 1WD4A 4LLOA 1S2EA 1FV2A 1MVQA 1BBT1 2D6PA 1SDWA 2JIJA 1MQTA 3FFZA 3MYXA 3OGRA 3Q8BA 2NYYA 4QQHA 3HJRA 4DIQA 5C9AB 1V9U2 1PGL2 3T0BA 3VBRB 5SV8A 3WNLA 1OUSA 4O9GA 1YRZA 1RHI2 3QACA 1QJFA 4YW6A 5HV4A 4XJ9A 4QDRA 3WOGA 3BYWA 4RHV1 1C57A 3DEMA 3PU8A 2QE3A 4W6WA 5L19A 3POGA 2GU9A 2HWB1 1GZCA 2XWJB 3VBSC 5IK7A 3T2OA 1QJY2 1LOFC 3J9SA 5DABA 5CFCC 1GOHA 4IGOA 2BOIA 3P3PA 2WSUA 4FP3A 5EJ1B 3ZSMA 5J09A 4AR2A 1AYM3 5FZGA 3THCA 4LMFA 4TYSA 5FYVA 4E9KA 4XAEA 2WZ8A 1K3IA 1N1VA 3ACFA 5JR7B 1BVP1 1UMZA 4LLFA 1DIWA 4YW7A 1J1LA 3ZXEA 2FCTA 1VJ2A 1W3XA 3B69A 3VZOA 1FV3A 3LCPA 4MYEA 1OKQA 1ZZ6A 4FXKB 4V1PA 3VHRA 5FZCA 2XBO1 2XUMA 1ACCA 4FPYA 2BVVA 3U4XA 4MZUA 4XXPA 3ETPA 4R4ZA 2HKXA 4BIOA 3NV2A 1JZ4A 3OBRA 3WNPA 1MEC2 4QKDA 1RUC1 1RUJ3 2EICA 1RC6A 4FOYA 1WW4A 4AWDA 4L8QA 1LHWA 3TEZA 1OSGA 3D0SA 1RIRA 1PVXA 1QOTA 1VBA1 2CAVA 1AXYA 4MXWB 2WFF3 4OHZA 1W6PA 1RITA 2GAUA 2HWC3 1YQCA 4EN8B 3M2MA 1DGLA 1QQP3 4I0WB 3NQHA 5JIAA 4AQSA 4JDNA 3WLUA 2JECA 2B42B 2J7MA 5AFBA 1ZRDA 2WO2A 1W9FA 1LOGA 2ZEYA 3GBGA 1RUJ1 4N53B 3PDQA 3FJSA 2BUKA 4QB6A 1BZWA 1LOCA 4P02B 5CISA 1W6QB 3VUOA 4P9XA 1MVEA 5IK4A 2WFF1 3VDDC 3WW1A 2QQVA 4Q29A 4RHV2 1FAYA 2VNVA 4P5YA 2XPJA 1COV3 1TG7A 2YPJA 2HWB2 2VBPA 3GDBA 4CDWB 2R32A 1GQHA 1V6LA 3LAGA 4M00A 3R4DB 4J1XA 1CWPA 1US3A 5IFPA 5A3TA 1HRI1 1WCUA 2WS93 3QH6A 2OA2A 2D6OX 1W6MB 1VAVA 2Y6KA 4OI2A 2IXLA 4QX1A 3B3QE 2ZGRA 4DB5A 4NJ4A 4PLMA 1ZBE3 4XUTA 1DZQA 4YVSB 1W8TA 5F3EA 4XUPA 2NMNA 1COV1 3HD8B 3RMXA 4CEYA 2P1BA 1H4HA 2J1SA 4LA2A 1RYYA 4D0QA 3NVCA 3FC0A 1GNZA 3OUIA 2DFBA 2B45X 5A7OA 5FXVA 5K9YA 3BI3A 5CB7A 4FTEA 3H9AA 1NCRC 1AYM2 2JG9A 1W06A 4QXHA 5FKCA 2LROA 3AFGA 3S5AA 2YYOA 3R6SA 1W9WA 3ZXJA 1HB1A 1GSLA 3ZMOA 5CKQA 1WBLA 1I9RA 2BP6A 4QHOA 3SITA 4ZU4A 4AFAA 1UD1A 3LEIA 4Q0VA 4HK8A 5E88A 1VBB1 4OUSA 4XFFA 2MHFA 3N7KA 4ATEA 3ZXAC 1OOPC 2C9KA 1GLHA 2VCCA 3WNOA 4FPGA 2CAUA 4OCTA 2BRTA 3NAPC 1VIWB 2Z2SB 2DCJA 4BK5A 4AHWA 5C9AA 4YZ4A 1QXRA 1JUHA 2IUWA 2QQIA 2UWBA 2VG9A 3X29B 2AGSA 3KD4A 2OKXA 3MPPG 4NIAA 5I93A 1RUJ2 2XLAA 3N9NA 4LO4B 3M3OA 4JGZB 4IE5A 4XHXA 1YI9A 4DNYA 1IG3A 2K46A 4B1LA 2WFF2 1AXZA 3O1RA 1H8TB 2HWC2 2Y0OA 5JWPA 4K40A 1QNYA 1QQP2 3I54A 2OQ7A 2YGLA 5DDJ1 2EA7A 1RUG1 4KWLA 2UWAA 4XABA 1N1SA 2IZWA 3SQOA 2CTVA 2ZGUA 4B3NA 3POBA 3EBRA 1V6JA 1GQGA 3AP6A 2ZZJA 5IVCA 5ERLA 5DZGA 2X53S 4UW4A 3THDA 2VW1A 2WZR1 1UU6A 3WG2A 2BNMA 2A3WA 3RS6A 1HRV1 1COV2 4FPHA 1DP0A 3SCHA 1GR3A 4RQPA 4NHLA 3AKQA 4HT1T 2VMEA 4EWEA 5CG8A 5F5CA 2F17A 3VBFC 1YEWA 2WS92 5FZOB 4CU6A 3L9JT 1AUYA 4KGGA 4XF0A 3ZVXA 4Y5SA 2QZ3A 3WINE 2RG4A 4DUWA 2CSGA 2JG8B 2YFUA 1ZREA 4CCCA 3EXUA 1SLIA 3Q8CA 1ZBE2 2RJ2A 1SFPA 3OPZA 5DG2A 3N9LA 1O5LA 1WLCA 1OHFA 3O0VA 1AR63 1VBC1 2JKBA 3ZPYA 1VBB2 4XZUG 2Y6GA 4XZPA 4NHMA 4OHWA 2DV9A 4ARXA 4EN9B 3LD8A 1VP6A 4AHYA 4IUGA 1TNFA 3NNMA 2PYTA 4L97A 1WCDJ 4FTSA 3FBMA 2DTYA 1Q8PA 3A21A 4AI0A 5HXMA 3ETQA 2OYZA 4MADA 5T5JA 1RL3A 5E8AA 3AP9A 2ZJCA 2I2SA 3FMGA 2HWD3 4Q5OA 2BBVA 4W65A 1AHSA 1NCQC 2E7AA 2JXAA 4S2GA 4Y4RA 1OXCA 5CVRA 5HCBA 4B29A 4CDWA 2XKPA 3FN9A 3PVNA 2D3PA 3AB0A 2ZHMA 4TLFA 2VBDA 2YBKA 1JUIA 1EY2A 2AYHA 4XILA 4YW4A 2BWAA 3LQCA 1V6KA 2A1XA 3AZXA 3LZZA 4XF4A 4YM3A 5GALA 5AC93 3HT2A 3URFA 4DS0A 3VV1A 5LCWL 2X05A 1OA3A 4BM8A 3S30A 5FZKA 1XB9A 3T2QA 5FRAA 4AXOA 1ZZCA 2O8QA 3KGZA 3KS7A 4EROA 1A78A 2FMYA 5KXEA 3BN6A 4YG0A 3NJXA 2NM1A 2QUOA 4TLGA 2J1TA 3WNXA 4XAAA 3THTA 4EQVA 2VW2A 2BV4A 5A33A 2C1FA 4OZOA 3VZNA 2RM21 3QCWA 5LB6A 3N36A 4D6QA 5CKNA 5F1RA 5JSRA 4LT5A 1BJQA 4E8DA 5FO8B 4XETA 5IYYA 3ZDVA 2XVGA 4O7XA 1Z78A 2W9XA 3MUZ1 1PGW1 5LA1A 1AJOA 1JHJA 2VJXA 2I45A 1M4WA 5IAVA 3W5NA 1FOD1 1SLTA 2YB7A 3J8F1 3AVRA 3S7EA 4QPIC 2HEVF 2XL7A 4BWOA 3JQWA 1O91A 3KZ4C 2Q8OA 4R9DA 2Q1MA 5DPNA 3CEWA 4CEWC 3KVAA 4COZA 3HEIA 1MS5A 4QXBA 4MGZE 2BFUL 2OQ6A 1YWKA 3PMSA 1R083 3LSEA 1DF0A 1SLAA 2BFUS 2FBEA 4RYDA 4AI3A 4JGZA 5B2GB 3ZFGB 1UU4A 5BNPC 1NA1B 4OI4A 3EO6A 4UFKA 1ODMA 4QDQA 5JXGA 5FYIA 4YLZA 3VL8A 1KDMA 1RUE1 2WWUA 4YVWB 3EYPA 3WF0A 2VNOA 5JAXA 3B93A 2R041 4YNIA 5L9RA 1AR62 2A6VA 4IEPA 5A6QA 4FBFA 4LXLA 2OW4A 1PM4A 2VMDA 3IDAA 3OBAA 2HWE3 1W6OA 5DG1A 5JOXA 4GAZA 1PNGA 2DURA 1KJRA 1R081 1VMHA 3IM0A 4EN6B 2ZPXA 1NLRA 4E4ZA 2ZGTA 5A6YA 1LENA 3KQRA 3H1YA 4RGKA 1XSRA 3H8UA 5GLTA 1GKBA 5H9QA 1D4VB 3J7NA 4DXRA 1W8ZA 5ACA1 2FDFA 4HKWA 5FY5A 5FFOC 1PIV3 2HWD2 1FNZA 4XIOA 4JDOA 3ZFEC 4DRRA 4KBBA 3J7LA 1ND3A 1NE6A 3CO2A 3HWJA 1UU5A 2XJTA 1ND2C 2PAEA 2CHHA 2XG3A 3DXUA 4FOWA 4IGPA 3VD7A 4BQWA 3IDEA 3MZHA 1CGPA 3MUY1 5KHIA 2CGPA 1S0IA 2MEV3 4GZ9A 2BWCA 1J1TA 5FZOA 2GC1A 4J1WA 1O7FA 4K20A 2YMZA 2V09A 5A7QA 4L9BA 1GZWA 1YXWA 1Q8QA 4M3CB 4M4PA 3RQ0A 4CA9A 4W50A 5AC92 2ZTNA 2C5DA 3HPNA 1PGW2 2P34A 4NPMA 2WRAA 1WCSA 4QXKA 3VN4A 1MS3A 4CUGA 5ISLA 2P5BA 2ZGQA 5FBJA 3WXPA 3H8OA 2YV8A 5A7NA 5FXXA 3RGBA 4IE7A 4RS5B 3IN9A 2VGDA 3B02A 3IWZA 4WZFA 4P9LA 1RB8G 4E4SA 1MS4A 1L7RA 1SQ4A 2H6CA 4Y1YA 1F2NA 2ADEA 2EVXA 4IEOA 4O61A 5FWEA 4BK4A 3W21A 1C4RA 4LA3A 2R1DA 3AX4A 3CKHA 1RUD3 1SPPA 2E51A 1Q3EA 2QFEA 2V5DA 2VVEA 4C0BA 1H9PA 1OD3A 1VRBA 5EJ3A 5F3IA 4QM8A 5GLUA 4UBGA 4HETA 3K4DA 4HZFA 2R073 3K3NA 1LCLA 1RUE2 1V6MA 1DGWX 3LDKA 4LO7A 4CPBA 4QM9A 2A6ZA 4NRPA 5DUUA 1YLLA 1CZTA 2FZ2A 3LOBA 4OQ9A 5KC5A 4LR4A 2BZDA 1F15A 5K8SA 2A3YA 1POV1 3AKPA 2ZEWA 3V64A 4EE2A 3FHIB 4AHZA 2D6KA 4NPLA 4QB2A 1JODA 3TB0A 4BH9A 5KR7A 1R082 5FYYA 4X8PA 1HXS1 5T5OA 4YFWA 2GZWA 3ZYFA 3OOXA 1OOPA 5JSPA 2W5FA 5EIYB 1BK1A 2CGNA 4SBVA 1C8NA 3VZJA 3CJIC 5BNOB 4DEVA 3NJYA 1AL23 1IHMA 2B39A 5FLIA 5HCHA 5CEHA 2VZ3A 4QU1A 4ZU5A 3TN91 1DFQA 2ZZQA 2GP5A 1CESA 1UIJA 4TXWA 1LESA 5FZBA 1ZRFA 5L36A 1H2LA 3FE5A 4BOWA 4MHUA 5EWSA 1JZ5A 1Z7S1 1UZZA 5LA2A 1WLDA 3S0MA 3IKWA 5J7MA 1SBDA 1JHNA 3T30A 5ANNA 2JDUA 4M0NA
chains in the Genus database with same CATH topology
1HB4A 4XAEA 1E5SA 1E5HA 1ODNA 1DCSA 1W3VA 1ODMA 1W3XA 1UOBA 2IVJA 1W9YA 5C3RA 2DBIA 5C3SA 1E5RA 3ZKUA 1UOFA 4RGKA 5C3PA 1RXFA 1E5IA 5C3QA 2CSGA 2Y60A 2IVIB 1BLZA 2VCMA 1GP6A 1WA6X 2WO7A 1OBNA 2VBPA 5C3OA 1UNBA 2JB4A 1OC1A 2VE1A 2JB8A 3ZKYA 2VBDA 1HB2A 1RXGA 1W28A 1W2AX 4BB3A 1W04A 1W03A 1GP4A 3ON7A 2BJSA 1UZWA 1HB3A 1W06A 2DBNA 3OOXA 1HB1A 1QJEA 1IPSA 2VAUA 2Y6FA 1UO9A 1HJFA 3ZOIA 1QJFA 2BU9A 2VBBA 1W2NA 2BRTA 1BK0A 1UOGA 1W2OA 1HJGA 5APAA 1QIQA 1GP5A 1W05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HB4 A;  4XAE A;  1E5S A;  1E5H A;  1ODN A;  1DCS A;  1W3V A;  1ODM A;  1W3X A;  1UOB A;  2IVJ A;  1W9Y A;  5C3R A;  2DBI A;  5C3S A;  1E5R A;  3ZKU A;  1UOF A;  4RGK A;  5C3P A;  1RXF A;  1E5I A;  5C3Q A;  2CSG A;  2Y60 A;  2IVI B;  1BLZ A;  2VCM A;  1GP6 A;  1WA6 X;  2WO7 A;  1OBN A;  2VBP A;  5C3O A;  1UNB A;  2JB4 A;  1OC1 A;  2VE1 A;  2JB8 A;  3ZKY A;  2VBD A;  1HB2 A;  1RXG A;  1W28 A;  1W2A X;  4BB3 A;  1W04 A;  1W03 A;  1GP4 A;  3ON7 A;  2BJS A;  1UZW A;  1HB3 A;  1W06 A;  2DBN A;  3OOX A;  1HB1 A;  1QJE A;  1IPS A;  2VAU A;  2Y6F A;  1UO9 A;  1HJF A;  3ZOI A;  1QJF A;  2BU9 A;  2VBB A;  1W2N A;  2BRT A;  1BK0 A;  1UOG A;  1W2O A;  1HJG A;  5APA A;  1QIQ A;  1GP5 A;  1W05 A; 
#chains in the Genus database with same CATH topology
 2UWC A;  1HB4 A;  4CVU A;  4XFI A;  1PIV 2;  4Z92 B;  5CIR A;  2GNM A;  3WDV A;  1ASJ 1;  1H1A A;  4JKK A;  5A7S A;  5F8P A;  3T4H B;  1XPW A;  1TMF 3;  5CYY A;  3RDI A;  3O1O A;  1HV0 A;  1JN2 P;  3ZFF C;  4AVV A;  2PEL A;  1TME 3;  3NV4 A;  4AQ6 A;  4C90 A;  1W8O A;  4RSU A;  1H8V A;  2DUO A;  2HJI A;  4P9J A;  5D8A B;  4YVW A;  1ZBA 3;  4RFR B;  1YFW A;  2XJS A;  5FP3 A;  5LA9 A;  2HWF 3;  5A70 A;  5CA6 A;  1PGS A;  2D40 A;  2ARE A;  2YU1 A;  5SV5 A;  2GSY A;  4AED B;  1ZNP A;  1YQ2 A;  3ZIX A;  5A3N A;  4HVO A;  4JGY B;  2VZR A;  1KQR A;  5C33 A;  2R0H A;  1UXX X;  5KHH A;  1RUD 2;  1YQ8 A;  4E4H A;  1QH7 A;  5J98 B;  4ARY A;  4P9Y A;  3KF5 A;  2VCM A;  2QDR A;  4NE9 A;  4QX5 A;  4UAP A;  2SLI A;  3VZM A;  1W0P A;  3RI9 A;  1R1A 3;  2ZBJ A;  3LA3 A;  4IEY A;  1MAC A;  4BU2 A;  3AMP A;  1VE0 A;  2QTW B;  2GMM A;  2VPV A;  4M3C A;  3MF9 A;  1Z7S 2;  2W94 A;  4LUK A;  4XJU A;  3WDT A;  3HIF A;  4AFC A;  5L73 A;  2ZAA A;  1PK6 A;  3MID A;  3OD0 A;  5EXO A;  3ZPO A;  4RS5 A;  4LNV A;  2H0B A;  1AL2 2;  1EUU A;  4CCO A;  3AZY A;  5A6Z A;  4LBQ B;  3A7Q A;  4U36 A;  4OMC A;  3VDA A;  1JXN A;  4QHZ A;  1SAC A;  4K8F A;  5FZD A;  3EMR A;  1OPO A;  1OLQ A;  2WAO A;  2QBX A;  5GZF A;  3RZG A;  5C8C B;  1NE4 A;  1OA2 A;  5LBB A;  3OF1 A;  3L2H A;  1W04 A;  2FDJ A;  3O1P A;  1KS4 A;  1QJU 1;  1O4Y A;  5I0S A;  5FBZ A;  2VZV A;  1APN A;  4X8N A;  4GKY A;  1KXG A;  2YC2 A;  1S0D A;  4L99 A;  2PMW B;  2ZMK A;  3N9O A;  1AX0 A;  1GV9 A;  2Y38 A;  3WSO A;  2FZ1 A;  3OGV A;  5FY1 A;  1YO8 A;  2ARB A;  4H14 A;  3CNA A;  5FYM A;  4CCD A;  2D3R A;  1TMF 2;  3MPB A;  5JPN B;  4PT6 A;  1Y43 B;  4N43 B;  4R8H A;  2QQW A;  4WM8 A;  3FWE A;  1TME 2;  2VXR A;  1QF3 A;  1CN1 A;  4QPI A;  2BU9 A;  1U5Z A;  1W2N A;  1WW6 A;  4LBJ A;  3VBH B;  1QH6 A;  3ATG A;  1XXN A;  3TRS B;  2F4P A;  3SMH A;  2IFW A;  2VUA A;  5BNO A;  1NX9 A;  3HQU A;  2XJU A;  4XQW A;  3BTZ A;  1SEF A;  4ZHN A;  4EV0 A;  3WQ7 A;  5JOZ A;  1LHV A;  1LRH A;  4WBB A;  2HWF 2;  5EFU A;  4EJR A;  3DYM A;  2Z69 A;  2ZGN A;  3RNS A;  4CEY C;  3DYP A;  4FPO B;  1PVC 1;  1QOS A;  5HV0 A;  1LHU A;  3ACL A;  3P3N A;  1LU2 A;  4FFI A;  2C4X A;  2R0F A;  1EV1 3;  5FOJ B;  4FO9 A;  2JG9 C;  2VU9 A;  4LE3 A;  1C5I A;  1C5H A;  2J1R A;  3MEP A;  1XYN A;  3DYO A;  4XDQ A;  2DCZ A;  4Y4Y A;  4XCB A;  4AGR A;  4CU7 A;  2G4I A;  3NNG A;  3W5M A;  4HON A;  4DMI A;  1X7N A;  3JXS A;  5GLV A;  2CYF A;  1R1A 2;  3AZZ A;  2AH2 A;  3M3I A;  4KU7 A;  2V72 A;  4Y22 B;  1VBD 3;  3IPV A;  4A3Z A;  4EWD A;  1W39 A;  1JZ6 A;  1I5P A;  1V0A A;  4Q4Y 3;  5C9A C;  4PQ9 A;  1AL0 G;  2VZU A;  2V5Y A;  3WT3 A;  1ND2 A;  2IXH A;  2JIC A;  3TNQ A;  1GWL A;  4AI1 A;  4GWJ A;  3HMY A;  3PJY A;  5IVE A;  3DL3 A;  1XNA A;  5C3P A;  2EIG A;  4I2O A;  2ET1 A;  3AYC A;  5EPA A;  3UK9 A;  4CRQ A;  1C3H A;  2RHP A;  1RUO A;  5IJR A;  3I2G A;  3U10 A;  1GMM A;  4LBO A;  1LU1 A;  2PAM A;  3JB8 A;  1MR5 A;  4YGE A;  4AED A;  5IAX A;  1PO2 3;  5I0U A;  1BEV 3;  4JGY A;  3T0A A;  4OHY A;  1YNA A;  4CUB A;  3N9Q A;  1V6I A;  4YRD A;  3TAY A;  1EPZ A;  3ES1 A;  2GAL A;  2C24 A;  3WUC A;  4CPB D;  3LIG A;  1J83 A;  2P3K A;  2WR9 A;  3D4K A;  4DXZ A;  3E5Q A;  4P9W A;  4XJA A;  1WA6 X;  1CJD A;  2XJQ A;  2X10 A;  3CZJ A;  3POW A;  1F9K A;  4G9S B;  1RUF 1;  1OBN A;  2RVA A;  2D6M A;  3VHN A;  3BPZ A;  1NKG A;  4F7Z A;  3F2Z A;  5F5I A;  4A7K A;  3ZLI A;  2TNF A;  2VMC A;  3VD4 A;  1ULG A;  1SDD B;  1PVC 2;  3NKT A;  1RHI 1;  4GB3 3;  1CQ9 A;  1FMD 1;  4RQP C;  3I2F A;  5J36 A;  2Q1F A;  2AUY A;  1UY2 A;  4IDZ A;  1SFN A;  5B4N A;  5FP9 A;  1F4A A;  1PX4 A;  5BV6 A;  2EAA A;  1EPW A;  4NHX A;  1ENX A;  2WLP A;  1W90 A;  5FMD A;  1KJL A;  2WJS A;  1TQ5 A;  4LK7 A;  4CP9 A;  5F6K A;  4BIS A;  4ASK A;  5DAW A;  5BYN A;  5EQU A;  1R09 3;  3KSC A;  3AP5 A;  3NNF A;  2BQP A;  3IIA A;  4I3G A;  4CP1 A;  1D7P M;  2ID4 A;  2K0G A;  3POE A;  4BQ5 A;  1EV1 2;  3K46 A;  1L7L A;  4KQ7 A;  1LKN A;  3GGL A;  5A1L A;  1QNW A;  2ZGK A;  4MHR A;  4RR3 B;  4R9A A;  4XJ8 A;  1FT9 A;  3MBW A;  1Y9M A;  2UY8 A;  1WA4 A;  3ZOI A;  1Q56 A;  2J1U A;  4JDM A;  1D4M 3;  4R52 A;  4URT A;  3R4S A;  4CDW C;  3KWV A;  3HNY M;  4UF0 B;  1ULD A;  3AL6 A;  5T50 A;  3TEY A;  1HJG A;  3E1F 1;  3JBG 3;  3C2U A;  1WW7 A;  2EAL A;  3O0X A;  2Q8D A;  1VBD 2;  1CX4 A;  3KLS A;  4I0B A;  2VC9 A;  5T54 A;  3VBH A;  4Q4Y 2;  1QIQ A;  1CAX B;  1UOJ A;  2D5F A;  3ST7 A;  5CG9 A;  1W6N B;  1H6X A;  2Z5W A;  1QWR A;  1UZ0 A;  1VMF A;  3J26 N;  2NQY A;  1OF4 A;  4FCA A;  1XYO A;  1OQE A;  4WVZ A;  3V65 A;  1ODN A;  1RUF 2;  4Z2A A;  1C8M 3;  3N7J A;  4OHV A;  2PHF A;  4FFG A;  4LBL A;  3N3H A;  1ZVF A;  4RA0 A;  4X6Q B;  5FRE A;  5IUQ A;  4A7Y A;  1PO2 2;  5JOY A;  3CL1 A;  4HN0 A;  1RUH 3;  3IBM A;  1VMJ A;  5I8T A;  2R7E B;  1FMD 2;  4E8C A;  1W9Y A;  2A5Z A;  2D98 A;  4Q0U A;  5JOW A;  4GWI A;  1VLN A;  2WFP A;  3AL5 A;  5IK5 A;  3BAL A;  1CIW A;  1NAE A;  3HVD A;  4QT6 A;  2D3S A;  2VZT A;  3OY8 B;  2GDF A;  4AK3 A;  2AC1 A;  2Y6L A;  1JOJ A;  3DF0 A;  2PA7 A;  1X36 A;  4K1Z A;  1S0C A;  3DKQ A;  3SXW A;  3NV3 A;  3I8T A;  1O4Z A;  4BQ3 A;  5KXC A;  4O9E A;  3O1V A;  4NIH A;  3OG2 A;  4LHL A;  2PTM A;  4HPK A;  4OYU A;  4XFG A;  1DQ2 A;  3MDP A;  3WVJ A;  4CCL A;  4JGZ C;  3CMG A;  3BUC A;  2EAK A;  4OHX A;  4EN0 A;  2WQ8 A;  4HL0 A;  4KMQ A;  4ZPI A;  1BKZ A;  2VTX A;  2V4A A;  1H8T C;  1VBE 3;  1EUT A;  4XF3 A;  1AYM 1;  2BGP A;  4LOS A;  3Q8E A;  2VUC A;  1R09 2;  3FZ3 A;  2RS3 3;  2GN7 A;  1S0G A;  4K1Y A;  3JD7 3;  2E32 A;  1CAW A;  4Z07 A;  2VEC A;  2TUN A;  1L7Q A;  2TEP A;  3LPF A;  3PJQ A;  4KU8 A;  2W1W A;  3U4S A;  4BQ1 A;  5FR3 A;  1AR9 3;  4XF9 A;  4H2A A;  5DAX A;  2WN2 A;  4HVR A;  4NO4 A;  4Y26 A;  2WLQ A;  4AGV A;  4YZ3 A;  1UX7 A;  2VZQ A;  4LUL A;  4CP2 A;  4XEZ A;  5F3C A;  1XU1 A;  1GOG A;  2DU1 A;  3UKN A;  3D3A A;  5ABJ B;  1YQ5 A;  3RPQ A;  4AL9 A;  1CPM A;  2VUD A;  2VOV A;  4MET A;  1XE7 A;  3RZL A;  1D4M 2;  4QHB A;  3ILF A;  3K4A A;  5GJ6 A;  3AXE A;  2O1Q A;  3ZSK A;  1IGO A;  1ND3 C;  3ILN A;  3GZA A;  4KH9 A;  5T5P A;  3UGG A;  1DYO A;  1HQW A;  3JBG 2;  4GMP 3;  3MF6 A;  2UY9 A;  1SHW B;  2ET7 A;  2QQJ A;  3MV1 1;  1DGR A;  1TVG A;  3JUU A;  2HYX A;  1QMJ A;  3WF1 A;  4IEV A;  4MGQ A;  2HWC 1;  3JZV A;  4ZXE A;  1I5Z A;  2O14 A;  1QQP 1;  2P6H A;  4CP0 A;  3RZH A;  2CGO A;  3WW3 A;  2QQM A;  2QQO A;  3BU0 A;  1C8M 2;  2GP3 A;  2LAL A;  2JDM A;  3H8X A;  2QZ2 A;  5LK5 A;  2NZ9 A;  3HBZ A;  3B94 A;  1V6N A;  1HIX A;  3M4F A;  1HJF A;  5FZ4 A;  4D7T A;  1U5I A;  1VB2 A;  4URA A;  2BW8 A;  1W2O A;  1G9D A;  2JDA A;  1O3R A;  1DQ6 A;  2P3Y A;  5FYC A;  4IW3 A;  3GJA A;  1VPH A;  1JZ8 A;  3I59 B;  1CAU A;  3K48 A;  1OKO A;  4PLN A;  5APA A;  1OLM A;  4UF0 A;  1NG0 A;  5FYZ A;  1W05 A;  2WS9 1;  2VO5 A;  1XSQ A;  4C91 A;  2KD7 A;  5FY8 A;  2VH9 A;  3UNP A;  1ZBE 1;  1W6N A;  1W8N A;  2Q5T A;  2W92 A;  4A7Z A;  4D6R A;  5CBL A;  2ZX3 A;  3AVS A;  1UY3 A;  1MS9 A;  2GH8 A;  2DCK A;  3USS A;  1Q43 A;  1GFF 2;  2XL9 A;  2QDN A;  3BCW A;  1LGN A;  5JUV A;  1BQP A;  2XJR A;  4RD7 A;  4Q4V 3;  1DLC A;  4IQP A;  3VBR A;  2RS3 2;  3GZU C;  5IVB A;  3VB9 A;  2J1A A;  3JD7 2;  4A2U A;  4NWV A;  3UES A;  3GF6 A;  5A7P A;  3U07 A;  1O3Q A;  4CCN A;  4AI2 A;  3POI A;  2YC0 A;  2ZGS A;  2Y26 A;  3D0J A;  3QOP A;  4PI2 A;  4QX7 A;  2WO1 A;  2YBP A;  3IB3 A;  3VBS B;  3U75 A;  3OY8 A;  1XJA A;  5I8S A;  4QPG B;  5HBA A;  4NUB A;  5A3O A;  3OYW B;  4XIK A;  4FOQ A;  4MXV A;  1AXK A;  1EAH 3;  4P9G A;  3USU B;  1AX1 A;  1W9S A;  2VOT A;  1H6Y A;  1BVV A;  4COU A;  4HN1 A;  3TOJ A;  2B4K A;  3ZYH A;  3ZFG C;  4Q1P A;  1H30 A;  1NA1 C;  2ZKN A;  4PF5 A;  3CJX A;  3NL1 A;  4XJZ A;  5LEK A;  4LBN A;  1Z0H A;  4BDV B;  2G9Z A;  3M70 A;  3T2P A;  3ZSJ A;  4YVW C;  4XE9 A;  3BU7 A;  3I3Q A;  3NJZ A;  2ERF A;  5H9P A;  5LY2 A;  2XVK A;  5DQ0 A;  4DPN A;  1IS4 A;  4ATF A;  3Q9O A;  4M01 A;  3Q8A A;  2WBK A;  3O1T A;  5GZG A;  4CCJ A;  2VR4 A;  3O7O A;  4LOT A;  2YUE A;  5EZW A;  4P9I A;  5LRR A;  3WD5 A;  4YW5 A;  2Y64 A;  2ZCW A;  3ACH A;  3KQ4 B;  4QU2 A;  4MXW A;  1ST8 A;  3MIC A;  2Y0I A;  2IC1 A;  1RXG A;  3AJZ A;  3ZXD A;  1MS1 A;  5ABJ A;  3KT7 A;  4PIX A;  3E5X A;  4AW7 A;  4BB3 A;  4W4Z A;  3C7H A;  1W03 A;  1RVF 3;  1AR7 3;  2BJS A;  4IES A;  1JYW A;  1UF2 C;  1FX5 A;  3P6B A;  1HB3 A;  2OII A;  2ZHN A;  2X5I B;  2RJL A;  3LOI A;  4XTM A;  3WDW A;  4N53 A;  4G4F A;  3N9P A;  2AZ5 A;  4JC1 A;  1TNR A;  4AQ2 A;  1OQD A;  1W6Q A;  3FL7 A;  4XFC A;  2XQR A;  4C1W A;  1NLS A;  4NR1 A;  4YW3 A;  3QBQ A;  4MSV A;  1PNF A;  1FPN 3;  1AR6 1;  1NZC A;  2Y6F A;  4JQT A;  1UAI A;  3S7I A;  3ACI A;  1N3O A;  1PK6 C;  3AKT A;  1N47 A;  4WM7 B;  1UOG A;  4RS5 C;  2O0O A;  2ZHK A;  3V0B B;  1I1E A;  1W6M A;  4GIQ A;  4N8M A;  4YVS A;  3WX5 A;  3BIW E;  2KA3 A;  1VR3 A;  5JDB A;  1D2Q A;  2HWD 1;  4Y1U A;  1JBC A;  3KF3 A;  2DWR A;  1C1L A;  3I59 A;  1WCK A;  2QCS B;  2ZAH A;  4UFI A;  2L9L A;  5FZI A;  4OI0 A;  1W3V A;  4LQR A;  2XOM A;  4HFS A;  3ELN A;  3PUH A;  4CDX B;  4D6S A;  2WKK A;  1EAH 2;  2D7F A;  5GZD A;  1U12 A;  3RWN A;  3OBZ A;  4B7E A;  4EWA A;  5AC9 1;  4JZR A;  4FAG A;  2ADD A;  3AMQ A;  5HI0 A;  2FCV A;  2RJK A;  3BB6 A;  3E97 A;  1W0O A;  4HMZ A;  2J42 A;  1OVS A;  2ZXQ A;  1U5Y A;  2WO3 A;  4WM8 C;  4XF1 A;  2JE7 A;  3RRD A;  1KD7 A;  1C28 A;  4HXC A;  3D6E A;  3ZXK A;  3KCY A;  3AMH A;  3N7L A;  3NAP B;  5F6L B;  5BNO C;  3VKL A;  1W8H A;  5IVJ A;  5CFD B;  3KHC A;  4XTP A;  1PO1 3;  4GKX A;  1JTZ X;  3H8R A;  5FZ6 A;  3CLP A;  4M0H A;  4MVT A;  4CXX A;  1NXD 1;  5FY4 A;  5C7G A;  4YW2 A;  2CV6 A;  5C3Q A;  4ITC A;  2XON A;  3BVC A;  3NW4 A;  1VAM A;  4BCU A;  5FOB B;  5M0T A;  3MO4 A;  2YBS A;  2IVI B;  3B5L B;  1H8T A;  2PXJ A;  4ET7 A;  5EYY A;  2R16 A;  2VTX J;  4QPG A;  4Q4W 3;  5FYS A;  2GC2 A;  1S4C A;  3OYW A;  1J3P A;  3HQR A;  4Y5T A;  1C1F A;  3VBO B;  5L7O B;  2WWJ A;  2XLF A;  1RVF 2;  2B5H A;  3H7Y A;  4TTG A;  1OQ1 A;  2XH6 A;  2GN3 A;  3LA2 A;  3RZZ A;  3USU A;  2WNE A;  5J37 A;  4BXS V;  1JH5 A;  5IWF A;  3O1M A;  5DUV A;  5G05 L;  2RS1 3;  2JDH A;  2WSV A;  4UW5 A;  3KT4 A;  4IE4 A;  4I01 A;  3C7G A;  2YG0 A;  2JB4 A;  2XJP A;  3UKT A;  2OXB A;  4F8A A;  1FPN 2;  3NRU A;  4XMI A;  1AYN 3;  1NY7 1;  5D8A C;  5DXD A;  5JIU A;  1W8W A;  3FBY A;  1S0F A;  3A4U A;  2CNA A;  2HWE 1;  1SZB A;  4KNC A;  2VNG A;  5FQ0 B;  5LAS A;  3VBF B;  5FLH A;  1HB2 A;  1YFU A;  1HQN A;  4F83 A;  4YZ5 A;  1G9B A;  4XFB A;  1LR5 A;  4XPV A;  3ECQ A;  2JG8 A;  1K5M B;  3LIH A;  1LTE A;  4AED C;  4BE3 A;  4AVT A;  4CXY A;  4JGY C;  4NAO A;  1WZX A;  1PIV 1;  1G6N A;  2Z79 A;  3ZXL A;  4B4P A;  5K0U B;  1MS0 A;  2DVB A;  2YY1 A;  2JDK A;  1Y3T A;  3GJB A;  2MEV 1;  5I91 A;  2VL4 A;  1JMU B;  1QJE A;  1EYB A;  1PZ8 A;  2X5I A;  4LO6 B;  1CPN A;  3B00 A;  4XQD A;  1NLQ A;  2B46 X;  2VTF A;  5FV3 A;  2ZAB A;  3QD6 A;  3S57 A;  4BIF A;  3DGT A;  3T3Y A;  2RR1 3;  2XJV A;  4E27 A;  4QKF A;  4WM7 A;  2B9V A;  3WEZ A;  2GC3 A;  5IVV A;  1K12 A;  2QQP A;  2RS5 3;  1GP5 A;  2J1E A;  5IFT A;  1IKQ A;  3KVB A;  3V0B A;  4UFH A;  4FTB A;  4XW3 A;  3WG4 A;  3M8L A;  1PO1 2;  5JSO A;  4L11 A;  2A6Y A;  3KV9 A;  2XDV A;  1LHO A;  5FZF A;  1OT5 A;  1RUD 1;  5E16 A;  4QX3 A;  4B8E A;  2E53 A;  2EXJ A;  1E5H A;  4K6B A;  4N9I A;  4COY A;  1DCS A;  1O4T A;  2Q30 A;  5DAQ A;  4CCE A;  2R07 1;  4Y5Z 0;  4OVE A;  2GH2 A;  4D7Y A;  1W8U A;  4EZ4 A;  5E6H A;  3TYJ A;  2RR1 1;  3I2D A;  1H2N A;  4UFL A;  1WME A;  3WHT A;  3J7H A;  2LUW A;  1NY7 2;  5FZ7 A;  1E57 A;  2ZML A;  4OUE A;  3WDU A;  4CDX A;  2IXJ A;  2D44 A;  2HWE 2;  3RYP A;  5A3W A;  3GAL A;  2WAB A;  2W3J A;  3SEE A;  2E26 A;  4W6Y A;  2DVG A;  5JMO A;  1GOF A;  4Q8L A;  1P8J A;  2XML A;  5A32 B;  1W8F A;  2JDP A;  1J84 A;  3AP4 A;  4AG4 A;  4LK6 A;  1WMX A;  3DCQ A;  1PMI A;  4PHZ A;  1LB2 A;  3OCP A;  3KT1 A;  3VBH C;  3ZN6 B;  1N3P A;  3OBT A;  1AL2 1;  4MV2 A;  4XYX A;  5EYX A;  4FSJ A;  1AYN 2;  2G9G A;  1OUX A;  4F3J A;  1BYH A;  1DYP A;  5CFD A;  1A3K A;  2WA4 A;  2XKO A;  1QXJ A;  2YU2 A;  5DAV A;  2MEV 2;  3WZ1 A;  5LAT A;  4UFM A;  1BXH A;  1BLZ A;  2ATF A;  3S5Q A;  3ZFG A;  4E2S A;  1NA1 A;  2P17 A;  5FP8 A;  2Q8E A;  5FP7 A;  3M7A A;  2Q1Z B;  1PHM A;  5C4W B;  2HYK A;  2W39 A;  1JS9 A;  1S0E A;  1PMH X;  2QQN A;  4XJW A;  5C71 A;  1A6C A;  1UPS A;  2FHR A;  3POF A;  4PLO A;  4A45 A;  5FXZ A;  4I30 A;  2I07 B;  3VBO A;  3OGJ A;  2Y6H A;  5L7O A;  2XHN A;  4IL7 A;  3PTR B;  3VGI A;  3U0Z A;  1UYZ A;  1HN0 A;  1TMF 1;  3LSD A;  3ZMN A;  4A4A A;  2JE8 A;  2XWB B;  2ZHL A;  5HXV A;  4XXA A;  3ACG A;  5CKM A;  4CYD A;  1TME 1;  3H3U A;  2A3X A;  4BJ0 A;  4XHB A;  4QGM A;  2R49 A;  5T55 A;  2WNV B;  3H1W A;  4FFF A;  5DN2 A;  3ZKY A;  3FLR A;  1ZBA 1;  5FIX A;  2R07 2;  3C3V A;  2R1B A;  1LJ7 A;  3TEX A;  2HWF 1;  2RR1 2;  1G9C A;  5BUV A;  4RGA A;  4B1M A;  2AEN A;  4S2F A;  3ON7 A;  1LED A;  5FQ0 A;  5FZH A;  2RS5 2;  3ZIW A;  1ZRR A;  4MGK E;  1ZM1 A;  1UKR A;  2RMU 3;  2ES3 A;  4OMD A;  1POV 0;  3FHQ A;  1IPS A;  2P4E A;  3MW3 A;  4NRQ A;  2WT1 A;  4J25 A;  5K0U A;  1IPJ A;  4LUM A;  3H7J A;  2VOX A;  4R4X A;  3T4V A;  4AE2 A;  5FK8 A;  5FZ1 A;  3WNK A;  3HN3 A;  3I2K A;  5TSW A;  2H0V A;  3ZFF A;  2VBB A;  1KGY A;  1R1A 1;  4HLT A;  1NZI A;  4YG6 A;  1JU4 A;  3L2Y A;  1IKP A;  4O65 A;  3SH4 A;  4TN7 A;  2GMP A;  3MIE A;  4MGS A;  5LA0 A;  4YM2 A;  3ZSE A;  3FHA A;  3C7F A;  4PIZ A;  3AMN A;  5HCA A;  4PI0 A;  4LHK A;  2A7A A;  1K42 A;  2B9U A;  1S2K A;  4YG3 A;  3GHN A;  3PIG A;  4QQ2 A;  3HNM A;  1NOV A;  3RI8 A;  1RUI 3;  2DVF A;  3BPS A;  2DF7 A;  3ILR A;  1QJX 3;  4OFG A;  5FWJ A;  3KV5 A;  2RDQ A;  4Z1V A;  1ZRI A;  4JV4 A;  2HBT A;  5FZA A;  2IVJ A;  2PHU A;  5C3R A;  1V6O A;  1WLT A;  3NWK A;  1XYP A;  4P5H A;  1KRI A;  2BEO A;  3I3E A;  1VRH 3;  2F6B A;  3CJI B;  4Q4X 3;  5KBF A;  3TEW A;  3ITQ A;  5JR2 A;  1ZBA 2;  2WNO A;  4RR3 C;  5CU1 A;  1MS8 A;  1AR8 3;  4LO5 B;  1UYX A;  4GQ7 A;  4L0P A;  3SIS A;  4BQ2 A;  2XGX A;  4X6R B;  4QGL A;  2CL2 A;  3VD9 A;  3BTA A;  4IEZ A;  5A32 A;  1SLL A;  1O5U A;  3VKM A;  1D0G A;  3BKZ A;  1A34 A;  1F35 A;  1DZR A;  3T09 A;  4Z82 A;  3BTY A;  5D1I A;  2WII B;  2VY0 A;  3OJB A;  5HCF A;  3RZK A;  4CTE A;  2W1Q A;  5FYB A;  1XE8 A;  5A1A A;  4MGY E;  1OA4 A;  3CF6 E;  4D69 A;  3PL0 A;  3NJV A;  4UOJ A;  3MI8 A;  5EHD A;  4NMI A;  2FMD A;  4XFA A;  1QDO A;  2DCT A;  5F32 A;  1UY0 A;  1MQT B;  2TBV A;  2WO7 A;  1SBE A;  1EV1 1;  2J1V A;  4Q1R A;  5C4W A;  2RMU 2;  1RJ8 A;  5FUP A;  3VBR C;  5D8A A;  1ZZ8 A;  3RG0 A;  1XNT A;  1YCI A;  1H2K A;  2Q8C A;  2PHR A;  4E2Q A;  5JI7 A;  2G19 A;  3WV6 A;  1ULO A;  5G04 L;  2GC0 A;  3MHZ A;  4DUX A;  4Q27 A;  4XBL A;  5FLJ A;  2NP0 A;  2VZS A;  2PLV 3;  2C0Z A;  5FZL A;  1J59 A;  4JKM A;  5A3P A;  4OQ8 A;  3MGU A;  1LEC A;  4H55 A;  1VBD 1;  4FP2 A;  1OFS A;  2BER A;  1KIT A;  1XOY A;  2JJ6 A;  2WNV A;  4Q4Y 1;  4A6O A;  4YAR A;  5I0R A;  1CX1 A;  2E7T A;  5FUN A;  5KWR A;  4PDW B;  1GNY A;  3TNP B;  3KV6 A;  4BZ4 A;  2XUE A;  5FY9 A;  4BQY A;  4ISR A;  1GU3 A;  1RED A;  4CDQ B;  5D21 A;  3DXT A;  5E1R A;  5I0T A;  1ULF A;  2ZGM A;  1ONA A;  4HBN A;  4UWD A;  1F8V A;  3HOB A;  3VD3 A;  1RUI 2;  3RMY A;  3G6J B;  5JZG B;  1PO2 1;  1QJX 2;  1BEV 1;  1O8S A;  2R6Q A;  2GNT A;  3IAQ A;  4IV1 B;  5FZE A;  2KXL A;  2ZEZ A;  5K7P A;  1V9U 3;  1F31 A;  3JB4 C;  1JYT A;  5IVF A;  2OT7 A;  4IEW A;  5ANQ A;  4IV3 B;  1BK0 A;  2W46 A;  1H4G A;  3H3Z A;  3AZW A;  4Q4X 2;  2BGO A;  4XFH A;  4DFS A;  3NNJ A;  2ZX2 A;  1G86 A;  1DGW A;  2YPD A;  3LPG A;  3N35 A;  4LBQ A;  1UZV A;  1AR8 2;  3AYE A;  1QJY 3;  2VQA A;  3K3O A;  3E5U A;  3WQ1 A;  4B7K A;  5ABJ C;  4XUO A;  3J4U H;  1X82 A;  4UBH A;  4AQT A;  1WLW A;  4IGQ A;  5JXJ A;  5C8C A;  1OLR A;  3ES4 A;  5BNN B;  4GB3 1;  1QEX A;  1GWK A;  3MIG A;  2HLE A;  4H7L A;  4D8M A;  2YRO A;  4NRO A;  2P6C A;  4L92 A;  3LKJ A;  3SKV A;  1GQP A;  4BYY A;  4N90 A;  4CXW A;  4N53 C;  3GM8 A;  1FXZ A;  1UYY A;  3SNM A;  3W58 A;  4DO0 A;  2H6B A;  1JW6 A;  1WGP A;  1UOB A;  3Q8F A;  5JXI A;  1UMH A;  3D5O A;  4SLI A;  5EJZ B;  2YFZ A;  2WNU B;  3SLI A;  5F7U A;  5E89 A;  1UKG A;  4ORF A;  1AF9 A;  2VNR A;  1R09 1;  3N7M A;  3ME2 A;  1W0N A;  2DBI A;  3OB8 A;  3VDC A;  4AYU A;  4N43 A;  4PBO A;  2E9Q A;  1E5R A;  1YJK A;  4D94 A;  4XVH A;  2NPI A;  1MEC 3;  3C8X A;  3C7O A;  4GWN A;  3ZO0 B;  3DPR B;  1H0B A;  3BOW A;  3VBU B;  2ZX0 A;  3MW2 A;  1WD3 A;  3D82 A;  4RGG A;  2A75 A;  1D2S A;  5EV7 A;  5FO7 B;  5T5L A;  1DQ1 A;  1OUR A;  4YVS C;  4ONU A;  3TBD A;  1IS6 A;  2ZX1 A;  4XCA A;  1D4M 1;  1GAN A;  3LB9 A;  5FPU A;  1SLC A;  2WDB A;  1WCQ A;  1S0B A;  2PLV 2;  5FY7 A;  4BLI A;  1ENQ A;  3JBG 1;  4PJY A;  1BBT 3;  2PN5 A;  1BEV 2;  1HX6 A;  3E6C C;  4M3C F;  1GZT A;  5DZE A;  4TWT A;  1Q5O A;  3K51 A;  5J48 A;  2FDI A;  4GJY A;  4A42 A;  1OFN A;  3LE0 A;  1UCX A;  5T3N A;  4RHV 3;  3WHU A;  4WVM B;  1J3Q A;  2BNN A;  2HWB 3;  5C3O A;  1C8M 1;  2OPK A;  2A6W A;  4I02 A;  3WF3 A;  4MG2 A;  4N7I A;  4Y22 A;  1K45 A;  5DAP A;  2VMF A;  1AJK A;  1RUH 1;  2R06 3;  1Q8S A;  5L9B A;  4GB3 2;  5A3M A;  4NHK A;  3T2T A;  2DTW A;  3APB A;  2SBA A;  4EN7 B;  2Y33 A;  3MLK A;  4I09 A;  3RWK X;  3K4Z A;  1LGB A;  5A3U A;  1FNY A;  4H7M A;  4IE6 A;  4NOT A;  1LOE A;  3PVE A;  1ULE A;  2PQS A;  5I0D A;  4GA9 A;  5FPA A;  1GP4 A;  2XBO 3;  2ILM A;  4QPG C;  4IEX A;  1GIC A;  1ZZ7 A;  4QPY A;  2R06 1;  1UY4 A;  3IDB B;  2PHD A;  4E2G A;  3VKF C;  3VKO A;  1Q8V A;  3MV0 1;  2DBN A;  5AVP A;  4PDW A;  1HQL A;  3B9C A;  4GH4 B;  4AI9 A;  1RUC 3;  4B4Q A;  2WL1 A;  2E63 A;  3EHK A;  4HKO A;  4JTO A;  1DZT A;  4CDQ A;  1KFU L;  2BPA 2;  4N9H A;  2OUJ A;  1VBA 3;  2W2I A;  4KI5 M;  5FUI A;  4YZ1 A;  2K2S A;  1UO9 A;  5DUX A;  2FDK A;  1VBE 1;  1WMF A;  4Q2F A;  1CJP A;  4K3U A;  5JZG A;  1VB4 A;  1LHN A;  3I2I A;  5KC6 A;  4IV1 A;  2RS3 1;  4W8J A;  2JX9 A;  3JD7 1;  3H3L A;  5I8Y A;  3UV9 A;  1LOD A;  4RQP B;  1IPK A;  3K75 B;  4ASL A;  4LIV A;  1AR9 1;  3K2O A;  5A3L A;  3OSD A;  5B4X A;  3WF4 A;  4AGG A;  4XC9 A;  4JQR A;  4IV3 A;  5BXX A;  3UET A;  1DBN A;  1O6U A;  2CWS A;  1JZ3 A;  2EXK A;  1UPI A;  3H0O A;  2JG8 C;  3I7D A;  1S2B A;  3H42 B;  2MPF A;  1IOA A;  4R9C A;  4BME A;  5KHJ A;  3U14 A;  2EF6 A;  1GWM A;  2ORZ A;  4QKB A;  4JTN A;  3THP A;  4HKL A;  5JPM B;  5LWB A;  1XNK A;  3FLT A;  4BQX A;  5BNN A;  3UGF A;  4GMP 1;  2JEN A;  1BBT 2;  2GME A;  3RYR A;  1XNB A;  1B35 B;  1RUH 2;  1SBF A;  1HRI 3;  2JDN A;  4V2V A;  2X5I C;  4RR3 A;  2CU5 A;  2VCA A;  3A0K A;  1CD3 G;  3DUI A;  4LKE A;  1F4H A;  4RFT 0;  2AR6 A;  1M06 G;  2WC2 A;  4L2N A;  4XDO A;  1O3S A;  2WNU A;  3ZKU A;  4YSF A;  1JYI A;  4FPC A;  1GUI A;  1UOF A;  3KGL A;  4YYO A;  2ARC A;  2UUR A;  4J6G A;  3AP7 A;  4MX3 A;  2JEM A;  2EIE A;  1ALY A;  4CDU B;  1ZA4 A;  3MIH A;  3M3E A;  4QDS A;  5DMY A;  1DHK B;  3F95 A;  2WT0 A;  4WM7 C;  1Q8O A;  1RXF A;  2B8M A;  2R06 2;  5CZK A;  3DPR A;  4CUC A;  2VVD A;  1LGC A;  4YW1 A;  1CAX A;  1YYN A;  2JIG A;  3VBU A;  3BOP A;  5C8W A;  3ZXF A;  4IND A;  4EYU A;  5FJH A;  4KGQ A;  3IZO A;  4HG6 B;  2A6X A;  3NO8 A;  3UJO A;  3IMN A;  4AFD A;  4FXG B;  4LJH A;  2A71 A;  3WNM A;  4B4R A;  2NLR A;  1VBB 3;  4ISQ A;  5IHR A;  4A41 A;  2A73 B;  2OZ6 A;  3ZYG A;  1VBE 2;  3WF2 A;  4Q8K A;  2XBO 2;  4MGT A;  2D43 A;  1Y7B A;  5F39 A;  1YC6 1;  3GCW A;  3ZM8 A;  4DQA A;  3WNN A;  5CAZ A;  4CDX C;  2VQU A;  1CIY A;  3MLL A;  5A33 B;  1TEI A;  3BGA A;  1AR9 2;  4G3Y C;  4NAM A;  5FPV A;  3JQX A;  3AZV A;  3CIH A;  1RUC 2;  4QAW A;  4DUV A;  2XHK A;  1AX2 A;  3CZU A;  3OPW A;  4WVM A;  5CFC B;  1IQA A;  1URX A;  4XQ4 A;  3III A;  4UXA A;  4Y3O A;  1UL9 A;  1VBA 2;  1V00 A;  1W2U A;  5FPX A;  1AZD A;  3UT0 A;  2DDU A;  1CZS A;  3OGG A;  4Q4V 1;  1I6X A;  1IZ3 A;  5DDJ 3;  4YGB A;  1LAJ A;  3RZJ A;  1RUG 3;  2J22 A;  1KFX L;  1W2A X;  5CFD C;  5A80 A;  1JOP A;  2WIN B;  3ALQ A;  4LOR A;  2CWM A;  3M3Q A;  1NXM A;  4LBQ D;  2PHX A;  4QX2 A;  2WUH A;  1OMI A;  3E6B A;  3WW2 A;  4MOA A;  4JCK A;  4DIN B;  2X09 A;  4Q26 A;  5AFE A;  3T08 A;  2WZR 3;  1X9T A;  2Q0A A;  5F9T A;  4NHY A;  1XND A;  3IDC B;  1N1Y A;  1HRV 3;  1EAH 1;  5GLW A;  3VBO C;  2ARX A;  2NMO A;  4RN5 A;  5L7O C;  4QQP A;  3OGS A;  4Q0Q A;  1W6O B;  2JDY A;  2WYS A;  3DV8 A;  5FDB A;  4GH4 A;  1HRI 2;  3WG3 A;  3ZYP A;  4TSV A;  2WQ4 A;  5FMO L;  3PHM A;  2DUQ A;  5H9S A;  5JI9 A;  3DN7 A;  3N9M A;  5LY1 A;  4NVP A;  5FMO S;  3PU3 A;  4GMP 0;  1UMI A;  1QDC A;  2QVS B;  4M4R A;  2ORX A;  5BNQ A;  2G9F A;  2FDH A;  2UU8 A;  1LUL A;  1VBC 3;  3W9A A;  1ND3 B;  1OF3 A;  1UN1 A;  4AFM A;  5CAD A;  4LIT A;  5GLZ A;  2W1S A;  3A0N A;  1U5X A;  4JRL A;  4OI1 A;  3PME A;  4GD4 A;  1E5S A;  5FJK A;  5H9R A;  2B7Y A;  2VQ0 A;  1IS5 A;  2W08 A;  1ENR A;  3I3D A;  1X9P A;  1G9F A;  3PVO A;  4DOU A;  3POS A;  3H50 A;  4Y33 A;  3VDD B;  5LBC A;  1K5M C;  1GZW B;  2W95 A;  1I3H A;  1WMD A;  3B7M A;  4FQZ A;  4H3W A;  1T6G C;  4UW6 A;  4C0H A;  4LKF A;  4YGC A;  1DQ5 A;  3R0R A;  3UL2 A;  1RVF 1;  1AR7 1;  1R64 A;  4NRM A;  4XOG A;  4ZS3 A;  5K0U C;  3OUH A;  3SCF A;  2BNO A;  2WZE A;  4Q4V 2;  1GZ9 A;  1REE A;  4P00 B;  1B35 A;  1Y4W A;  3CU7 A;  3VLB B;  2Y6J A;  2BTV C;  1LNS A;  4KWK A;  5FZM A;  5AVA A;  1WBF A;  3POY A;  4R9B A;  4QKN A;  4ZS2 A;  4CZS A;  1STM A;  1ZZ9 A;  1DYK A;  2VVF A;  4UT5 A;  1SPP B;  1FPN 1;  2OVU A;  1NQJ A;  1X8E A;  2P37 A;  1BHG A;  1GYK A;  2AEZ A;  2VW0 A;  5FPL A;  4MUV A;  2VOK A;  3VZK A;  4JVA A;  3ABZ A;  3O0W A;  1DGR N;  5KHK A;  2W0X A;  5LW9 A;  4K8R B;  4CDU A;  1NCR B;  3AFK A;  2I74 A;  4MGI E;  5LBF A;  2EXI A;  5DDJ 2;  5FYH A;  1RUG 2;  4ES9 A;  1ZYB A;  2RM2 3;  1R1Z A;  1HDK A;  4YM0 A;  3B01 A;  3UYJ A;  2BVB A;  2V4V A;  4S2H A;  1VAL A;  3SHR A;  5A7W B;  1GP6 A;  2X8K A;  3AXD A;  3WDX A;  3OEA A;  4CU9 A;  1OOP B;  2WWS A;  2W91 A;  2WZR 2;  1FOD 3;  4NWW A;  3J8F 3;  1IG0 A;  4W6X A;  2UYB A;  1G8W A;  2ZS6 B;  4M3C E;  4K21 A;  1YFY A;  1ZX5 A;  3WCR A;  5GZC A;  1HRV 2;  2ETE A;  4COV A;  3AC0 A;  3SH5 A;  5LZ6 A;  2QKD A;  2YDE A;  1K5J A;  1OC1 A;  2W87 A;  3C7E A;  4OUM A;  3WP4 A;  5IT6 A;  2A70 A;  5CNA A;  1H1M A;  3T0D A;  2IFR A;  3WQ0 A;  1RMU 3;  2W52 A;  2XB6 C;  1YFX A;  3A23 A;  4ZZ5 A;  2ZGP A;  3G7D A;  4XDP A;  3VBS A;  2VMI A;  1L3J A;  3AKR A;  3ZYI B;  1LOF A;  3HNB M;  2EIB A;  4A6S A;  4ZZ8 A;  1EP0 A;  1XBF A;  2XR4 A;  5CFC A;  3NMB A;  4YFZ A;  1RUE 3;  3VL9 A;  4XAC A;  3WP3 A;  5FZ9 A;  3EQE A;  2R04 3;  2VUL A;  1AR7 2;  3ORJ A;  4LKS A;  1VBC 2;  2DYC A;  4GWM A;  1FAT A;  1GBG A;  4PQQ A;  1PO1 1;  1UZY A;  4BLJ A;  2VZ1 A;  4E4D X;  4AHX A;  4S2D A;  3PTY A;  4N7U A;  1RMU 1;  4Y24 A;  3FUQ A;  3SH3 A;  4AEM A;  4AVC A;  1Y9Q A;  1W2T A;  1JYX A;  2F4L A;  4UYB A;  2JDZ A;  4FPK A;  4EZH A;  2VAU A;  3OD4 A;  4HOO A;  4FPF A;  4Q4W 1;  5C4W C;  5ACA 3;  1O3T A;  3NV1 A;  3P5B A;  1NYW A;  1ZA7 A;  1YIF A;  3B9I A;  5JMC A;  2FQP A;  3UJQ A;  4AZZ A;  4AF9 A;  3ZN5 A;  5KXD A;  3O12 A;  4UW3 A;  3QLQ A;  2PAK A;  4CE8 A;  5A1F A;  1YJL A;  4MO3 M;  3KMH A;  1QJZ A;  2RS1 1;  4P08 A;  4COW A;  3AM2 A;  4FPL A;  3IAP A;  3ZX7 A;  3V56 A;  3NST A;  5FMC A;  4QB1 A;  1ULP A;  1U0A A;  2WNV C;  4ZON A;  4BMB A;  3HBK A;  4CSW A;  2PFW A;  1AYN 1;  3HN1 A;  3CDZ B;  5FYU A;  3BIE A;  4NIG A;  5F2W A;  2YC4 A;  1XQN A;  3LFI A;  2WT2 A;  2XVL A;  3V0A B;  5J3U A;  3NNL A;  4AAP A;  2PQQ A;  5F5A A;  4LKD A;  1BCX A;  4BHP A;  2HEW F;  4QMA A;  2BDR A;  1US2 A;  1G9A A;  4HK9 A;  4GJZ A;  2YHJ A;  1X8M A;  2ZMN A;  3CBN A;  2CDP A;  1PZ7 A;  2WYF A;  2DFC A;  4HSJ A;  4MH0 E;  3HAG A;  2ZAC A;  1X50 A;  1DG6 A;  2RM2 2;  3E6D A;  3OPT A;  2ENR A;  4I3P A;  3KHB A;  1UYP A;  5FZ0 A;  3NKG A;  3PUR A;  1SCR A;  1IQD C;  2ZGL A;  2ZGO A;  3VDD A;  3VKN A;  3WW4 A;  5LK7 B;  3GBW A;  1QY4 A;  3ZYR A;  1JZ7 A;  1NCQ B;  3LDB A;  1W28 A;  5KHG A;  1JI6 A;  4BA6 A;  3LA7 A;  5F5Q A;  5C5T A;  3ZYB A;  1FOD 2;  1PK6 B;  2D5H A;  2JE9 A;  3J8F 2;  3PLQ A;  4AEK A;  1UXZ A;  3W20 A;  1XE0 A;  3A22 A;  1JYV A;  1MZF A;  1VAK A;  2QJV A;  1ZRC A;  4FAH A;  1SCS A;  1POV 3;  1XNC A;  2RDR A;  3SKJ E;  3H1M A;  4DXT A;  4ES8 A;  1UX6 A;  3VD5 A;  1RMU 2;  5C8C C;  1CR7 A;  3GCX A;  1HXS 3;  3WCS A;  2Y60 A;  5IVY A;  2XQX A;  3W59 A;  4ASM B;  4CU8 A;  4Q4W 2;  4WVV A;  4YZ2 A;  1OVP A;  2IXI A;  3POJ A;  4ZY9 A;  1NCR A;  2RS5 1;  1UY1 A;  1DDL A;  2ARA A;  5FPZ A;  2R04 2;  1H1I A;  3WY6 A;  3O1S A;  1A8D A;  3TN9 3;  4AVB A;  1OH3 A;  2VOW A;  1S55 A;  2LRP A;  1NQD A;  1YUD A;  2ZX4 A;  3MFC A;  4IE0 A;  3I2O A;  4NID A;  1NT0 A;  4BPZ A;  4CCM A;  4IXL A;  2RS1 2;  5FPB A;  1FI2 A;  1Z7S 3;  3IMM A;  4N43 C;  1DU3 D;  5A7W A;  2ZA9 A;  4Y20 B;  1D0H A;  1QKQ A;  4WM8 B;  3FUO A;  4QPI B;  3GXU A;  1UW8 A;  4RL7 A;  3WDY A;  3AKS A;  3NAP A;  4LO8 A;  5ACA 2;  4QX0 A;  2GND A;  4CEW B;  1O8P A;  2W47 A;  1ASJ 3;  2RV9 A;  1JOB A;  1B09 A;  4KWJ A;  2RE9 A;  4LBK A;  5FKB A;  2LW8 A;  2IXC A;  1X33 A;  2JD4 A;  5BNP B;  2GNB A;  1TE1 B;  1RUN A;  3N4M A;  1ULC A;  2EXH A;  1UZW A;  4KG8 A;  5JXH A;  4A3X A;  2DCY A;  3HQX A;  5GM0 A;  3ZR5 A;  3LF7 A;  1NUK A;  3R4U A;  2IXK A;  5DUW A;  3ZDS A;  3INA A;  2HBU A;  3RSJ A;  3AYA A;  5FY0 A;  5GKA C;  2WA3 A;  1V70 A;  1HW5 A;  3CHX A;  4I0A A;  1QHD A;  4Y1V A;  2LTN A;  1N1T A;  1SG3 A;  2E6V A;  1POQ A;  1UWW A;  3OEB A;  2O8O A;  3I2J A;  4IEQ A;  3ASI A;  3GNE A;  4BQ4 A;  3ZR6 A;  1MQT C;  3IPV B;  4BXF A;  2YXS A;  4NPR A;  3ZSL A;  5DZF A;  1MZE A;  4Q0S A;  5IAT A;  5KXB A;  3O1U A;  3ZYJ B;  1RIN A;  3D8C A;  3MIB A;  1Y9G A;  2KM2 A;  3ZFE B;  1UQX A;  1ND2 B;  2E7Q A;  2VZO A;  5LRS A;  5C6C A;  4XUQ A;  3ZXG A;  5D2A A;  4C1X A;  5JLV A;  3LWC A;  1JYN A;  1FYU A;  1JZ2 A;  3VBF A;  4IEU A;  2ZOE B;  1QXP A;  3OUJ A;  1ZZB A;  3IT8 A;  1K5M A;  4LTA A;  3M1H A;  4YPJ A;  3LEK A;  2AAC A;  5FCC A;  4FI9 A;  2JD9 A;  3U11 A;  4DEQ A;  4NN0 A;  1HXS 2;  3PIJ A;  1WKY A;  4YGD A;  2P3J A;  2RDS A;  4PDW C;  1IS3 A;  1WW5 A;  2W68 A;  3V0A A;  2LS6 A;  2C9A A;  3KCX A;  4MLO A;  3I2H A;  2RDN A;  3BOD A;  4CDQ C;  4D3W A;  3GZE A;  2HH9 A;  2NN8 A;  2Y8K A;  5FP4 A;  4LEJ A;  4PBP A;  3TN9 2;  5C3S A;  2RMU 1;  5JZG C;  3RFR A;  4Z2W A;  3GBF A;  4IV1 C;  3UGH A;  3LFM A;  2JKX A;  4UFJ A;  1H2M A;  1NCQ A;  1UIK A;  4Y1X A;  3RVH A;  4JX0 A;  4DY5 A;  1CON A;  1QJU 3;  1S0J A;  4GXL A;  3AJY A;  4IV3 C;  1RJ7 A;  5J96 B;  1E5I A;  1RGS A;  4D7S A;  5EP9 A;  1YHF A;  4CP9 B;  3CQO A;  1ASJ 2;  4LIU A;  4YM1 A;  4K7J A;  3PUS A;  5IK8 A;  2W1U A;  4JRA A;  4XBQ A;  1A8M A;  3WR0 A;  5BNN C;  2IWG B;  3M3C A;  5FTT C;  4DRV A;  1YQ6 A;  3I49 A;  2OPW A;  2OUH A;  3MIF A;  4PIY A;  5HPO A;  3MW4 A;  4CCK A;  4FVV A;  3ENR A;  4IER A;  2VXJ A;  1CAV B;  3PVB B;  3ROU A;  2E31 A;  1RUI 1;  2R30 A;  4WV8 A;  1RTV A;  5FAX A;  4AAX A;  1QJX 1;  2WQZ C;  3AK0 A;  1UNB A;  2WNU C;  1HKD A;  2EID A;  4KL1 A;  3KM5 A;  1J3R A;  4QD2 A;  1REF A;  2WZP P;  3HT1 A;  1PVC 3;  1PM7 A;  3WP5 A;  2AEY A;  2UYA A;  1GNH A;  2DUP A;  4V2W A;  3PUA A;  2YGM A;  1G7Y A;  4Y20 A;  2QQU A;  5F3G A;  1AVB A;  4ZXK A;  4PF1 A;  1DQ4 A;  1VRH 1;  4GAL A;  5FYT A;  4Q4X 1;  3I3M A;  3KB5 A;  3ZN6 A;  1CZV A;  2V73 A;  3DPR C;  1QGL A;  5FO9 B;  1HV1 A;  3VBU C;  3I4I A;  1AR8 1;  2FD8 A;  4CEW A;  5F37 A;  2FCU A;  3RYK A;  1TZO A;  3FFQ A;  1XU2 A;  4A44 A;  2LM3 A;  2QQL A;  4FOV A;  3ZFF B;  5BNP A;  4JAA A;  3TWI A;  3KV4 A;  1O59 A;  4ZU7 A;  1MZ5 A;  2QNK A;  3OTF A;  3GZT B;  1ENS A;  4FFH A;  4GUL A;  3MFA A;  3SCG A;  3WG1 A;  1OD5 A;  4LE4 A;  5C5U A;  4IET A;  4QX8 A;  4PCR A;  4U2A A;  4AVA A;  1MZ6 A;  3LDR A;  4FPE A;  3I97 A;  4YWA A;  3VHO A;  2WAA A;  3LEG A;  4DY3 A;  4WVW A;  5BY5 A;  2BYV E;  3SC7 X;  1T6B X;  3VDB A;  4LBM A;  4XUR A;  1XC6 A;  2C26 A;  4JKL A;  2DU0 A;  2D6L X;  4UI9 L;  2PHL A;  1H9W A;  1LEM A;  1MPX A;  4XMA A;  2MNG A;  2XXZ A;  1BMV 1;  3FX3 A;  5K4L A;  3WQB A;  4FPJ A;  3JU9 A;  2Q4S A;  3VHP A;  2P2K A;  1HN1 A;  1QOO A;  3ZFE A;  3KCC A;  4QWN A;  2DVD A;  1OLM E;  4DZG A;  4HVQ A;  1QJU 2;  4K9S A;  3FLP A;  5FMB A;  4XUN A;  4HPK B;  5LBE A;  4QGN A;  2CY6 A;  4P14 A;  2PLV 1;  3LGR A;  4OZX A;  1PZ9 A;  2Z42 A;  1RUF 3;  4QQL A;  5FK7 A;  3BTX A;  1DQ0 A;  3EB7 A;  2CDO A;  1OI6 A;  3WUD A;  5GZE A;  5T52 A;  2DVA A;  2Y34 A;  1PX3 A;  2VMH A;  3HR9 A;  3QH7 A;  1CAW B;  1RHI 3;  4OLL A;  1FMD 3;  4QQO A;  2X29 A;  1OH4 A;  3PNA A;  3WP6 A;  4ZKT B;  1VRH 2;  1WWY A;  5A6X A;  4GH4 C;  1N3Q A;  5JCT A;  3PUQ A;  3J7M A;  3UKV A;  4Y1Z A;  2HEY F;  2K9Z A;  4NII A;  3U78 A;  3T1M A;  1KEX A;  1W6P B;  5L9V A;  3ZN4 A;  2VMG A;  1JYC A;  3O5S A;  1W99 A;  2VCB A;  3S6P A;  2FDG A;  1KDK A;  1LOB A;  1V9U 1;  1PGL 1;  2ZKL A;  4FQ4 A;  1JU3 A;  2PHW A;  1T2X A;  1YI7 A;  3K77 A;  2JWP A;  4KWU A;  3R05 A;  3JCI A;  4FT8 A;  2VM9 A;  2VUJ A;  2E33 A;  4LPL A;  2ZEX A;  2D97 A;  1KS5 A;  1QJY 1;  1SFY A;  2PHT A;  4HSL A;  4QXC A;  4AFB A;  4JHZ A;  1J58 A;  4C8D A;  1SLB A;  1QU0 A;  4QPW A;  3MLJ A;  4Z8B A;  4AOC A;  2OZJ A;  3RJR A;  5FZ3 A;  5IW0 A;  3I3B A;  4AI8 A;  4LHN A;  1DLL A;  3DEC A;  3AYD A;  1PMJ X;  2BGC A;  2VZP A;  1YIP A;  3T1L A;  1BMV 2;  1B35 C;  4KBZ A;  3CJI A;  4LHS A;  3RJ2 X;  1S1A A;  2KR2 A;  4TZD A;  3P1I A;  1LOA A;  2QQK A;  4XBN A;  4HAN A;  1CAV A;  3U37 A;  4OUL A;  2VD7 A;  3GYD A;  5FZ8 A;  4AEJ A;  1HLC A;  2P3I A;  4JHT A;  5FXW A;  2VE1 A;  3U1X A;  2XLG A;  2JB8 A;  5J1X A;  1F5F A;  4CEY B;  4WZC A;  1SMV A;  2G1M A;  2D93 A;  1CAU B;  3AMM A;  5JVV A;  2VQT A;  4DXS A;  1WUV A;  1MEC 1;  3GHM A;  1W9T A;  4Q0P A;  2YZ4 A;  4CDU C;  1F5J A;  2JG9 B;  5C70 A;  1XRU A;  5LEJ A;  3PUI A;  2BBA A;  2C6S A;  2WN3 A;  5F2S A;  1OPM A;  2N7G A;  2OX0 A;  3SEP A;  3LEM A;  3VZL A;  3DKW A;  2Z4F A;  2BOJ A;  5BPX A;  4KG0 A;  1CVN A;  3O14 A;  4CUA A;  2D6N A;  3EJK A;  4AVS A;  3RZM A;  2OS2 A;  1WD4 A;  4LLO A;  1S2E A;  1FV2 A;  1MVQ A;  1BBT 1;  2D6P A;  1SDW A;  2JIJ A;  1MQT A;  3FFZ A;  3MYX A;  3OGR A;  3Q8B A;  2NYY A;  4QQH A;  3HJR A;  4DIQ A;  5C9A B;  1V9U 2;  1PGL 2;  3T0B A;  3VBR B;  5SV8 A;  3WNL A;  1OUS A;  4O9G A;  1YRZ A;  1RHI 2;  3QAC A;  1QJF A;  4YW6 A;  5HV4 A;  4XJ9 A;  4QDR A;  3WOG A;  3BYW A;  4RHV 1;  1C57 A;  3DEM A;  3PU8 A;  2QE3 A;  4W6W A;  5L19 A;  3POG A;  2GU9 A;  2HWB 1;  1GZC A;  2XWJ B;  3VBS C;  5IK7 A;  3T2O A;  1QJY 2;  1LOF C;  3J9S A;  5DAB A;  5CFC C;  1GOH A;  4IGO A;  2BOI A;  3P3P A;  2WSU A;  4FP3 A;  5EJ1 B;  3ZSM A;  5J09 A;  4AR2 A;  1AYM 3;  5FZG A;  3THC A;  4LMF A;  4TYS A;  5FYV A;  4E9K A;  4XAE A;  2WZ8 A;  1K3I A;  1N1V A;  3ACF A;  5JR7 B;  1BVP 1;  1UMZ A;  4LLF A;  1DIW A;  4YW7 A;  1J1L A;  3ZXE A;  2FCT A;  1VJ2 A;  1W3X A;  3B69 A;  3VZO A;  1FV3 A;  3LCP A;  4MYE A;  1OKQ A;  1ZZ6 A;  4FXK B;  4V1P A;  3VHR A;  5FZC A;  2XBO 1;  2XUM A;  1ACC A;  4FPY A;  2BVV A;  3U4X A;  4MZU A;  4XXP A;  3ETP A;  4R4Z A;  2HKX A;  4BIO A;  3NV2 A;  1JZ4 A;  3OBR A;  3WNP A;  1MEC 2;  4QKD A;  1RUC 1;  1RUJ 3;  2EIC A;  1RC6 A;  4FOY A;  1WW4 A;  4AWD A;  4L8Q A;  1LHW A;  3TEZ A;  1OSG A;  3D0S A;  1RIR A;  1PVX A;  1QOT A;  1VBA 1;  2CAV A;  1AXY A;  4MXW B;  2WFF 3;  4OHZ A;  1W6P A;  1RIT A;  2GAU A;  2HWC 3;  1YQC A;  4EN8 B;  3M2M A;  1DGL A;  1QQP 3;  4I0W B;  3NQH A;  5JIA A;  4AQS A;  4JDN A;  3WLU A;  2JEC A;  2B42 B;  2J7M A;  5AFB A;  1ZRD A;  2WO2 A;  1W9F A;  1LOG A;  2ZEY A;  3GBG A;  1RUJ 1;  4N53 B;  3PDQ A;  3FJS A;  2BUK A;  4QB6 A;  1BZW A;  1LOC A;  4P02 B;  5CIS A;  1W6Q B;  3VUO A;  4P9X A;  1MVE A;  5IK4 A;  2WFF 1;  3VDD C;  3WW1 A;  2QQV A;  4Q29 A;  4RHV 2;  1FAY A;  2VNV A;  4P5Y A;  2XPJ A;  1COV 3;  1TG7 A;  2YPJ A;  2HWB 2;  2VBP A;  3GDB A;  4CDW B;  2R32 A;  1GQH A;  1V6L A;  3LAG A;  4M00 A;  3R4D B;  4J1X A;  1CWP A;  1US3 A;  5IFP A;  5A3T A;  1HRI 1;  1WCU A;  2WS9 3;  3QH6 A;  2OA2 A;  2D6O X;  1W6M B;  1VAV A;  2Y6K A;  4OI2 A;  2IXL A;  4QX1 A;  3B3Q E;  2ZGR A;  4DB5 A;  4NJ4 A;  4PLM A;  1ZBE 3;  4XUT A;  1DZQ A;  4YVS B;  1W8T A;  5F3E A;  4XUP A;  2NMN A;  1COV 1;  3HD8 B;  3RMX A;  4CEY A;  2P1B A;  1H4H A;  2J1S A;  4LA2 A;  1RYY A;  4D0Q A;  3NVC A;  3FC0 A;  1GNZ A;  3OUI A;  2DFB A;  2B45 X;  5A7O A;  5FXV A;  5K9Y A;  3BI3 A;  5CB7 A;  4FTE A;  3H9A A;  1NCR C;  1AYM 2;  2JG9 A;  1W06 A;  4QXH A;  5FKC A;  2LRO A;  3AFG A;  3S5A A;  2YYO A;  3R6S A;  1W9W A;  3ZXJ A;  1HB1 A;  1GSL A;  3ZMO A;  5CKQ A;  1WBL A;  1I9R A;  2BP6 A;  4QHO A;  3SIT A;  4ZU4 A;  4AFA A;  1UD1 A;  3LEI A;  4Q0V A;  4HK8 A;  5E88 A;  1VBB 1;  4OUS A;  4XFF A;  2MHF A;  3N7K A;  4ATE A;  3ZXA C;  1OOP C;  2C9K A;  1GLH A;  2VCC A;  3WNO A;  4FPG A;  2CAU A;  4OCT A;  2BRT A;  3NAP C;  1VIW B;  2Z2S B;  2DCJ A;  4BK5 A;  4AHW A;  5C9A A;  4YZ4 A;  1QXR A;  1JUH A;  2IUW A;  2QQI A;  2UWB A;  2VG9 A;  3X29 B;  2AGS A;  3KD4 A;  2OKX A;  3MPP G;  4NIA A;  5I93 A;  1RUJ 2;  2XLA A;  3N9N A;  4LO4 B;  3M3O A;  4JGZ B;  4IE5 A;  4XHX A;  1YI9 A;  4DNY A;  1IG3 A;  2K46 A;  4B1L A;  2WFF 2;  1AXZ A;  3O1R A;  1H8T B;  2HWC 2;  2Y0O A;  5JWP A;  4K40 A;  1QNY A;  1QQP 2;  3I54 A;  2OQ7 A;  2YGL A;  5DDJ 1;  2EA7 A;  1RUG 1;  4KWL A;  2UWA A;  4XAB A;  1N1S A;  2IZW A;  3SQO A;  2CTV A;  2ZGU A;  4B3N A;  3POB A;  3EBR A;  1V6J A;  1GQG A;  3AP6 A;  2ZZJ A;  5IVC A;  5ERL A;  5DZG A;  2X53 S;  4UW4 A;  3THD A;  2VW1 A;  2WZR 1;  1UU6 A;  3WG2 A;  2BNM A;  2A3W A;  3RS6 A;  1HRV 1;  1COV 2;  4FPH A;  1DP0 A;  3SCH A;  1GR3 A;  4RQP A;  4NHL A;  3AKQ A;  4HT1 T;  2VME A;  4EWE A;  5CG8 A;  5F5C A;  2F17 A;  3VBF C;  1YEW A;  2WS9 2;  5FZO B;  4CU6 A;  3L9J T;  1AUY A;  4KGG A;  4XF0 A;  3ZVX A;  4Y5S A;  2QZ3 A;  3WIN E;  2RG4 A;  4DUW A;  2CSG A;  2JG8 B;  2YFU A;  1ZRE A;  4CCC A;  3EXU A;  1SLI A;  3Q8C A;  1ZBE 2;  2RJ2 A;  1SFP A;  3OPZ A;  5DG2 A;  3N9L A;  1O5L A;  1WLC A;  1OHF A;  3O0V A;  1AR6 3;  1VBC 1;  2JKB A;  3ZPY A;  1VBB 2;  4XZU G;  2Y6G A;  4XZP A;  4NHM A;  4OHW A;  2DV9 A;  4ARX A;  4EN9 B;  3LD8 A;  1VP6 A;  4AHY A;  4IUG A;  1TNF A;  3NNM A;  2PYT A;  4L97 A;  1WCD J;  4FTS A;  3FBM A;  2DTY A;  1Q8P A;  3A21 A;  4AI0 A;  5HXM A;  3ETQ A;  2OYZ A;  4MAD A;  5T5J A;  1RL3 A;  5E8A A;  3AP9 A;  2ZJC A;  2I2S A;  3FMG A;  2HWD 3;  4Q5O A;  2BBV A;  4W65 A;  1AHS A;  1NCQ C;  2E7A A;  2JXA A;  4S2G A;  4Y4R A;  1OXC A;  5CVR A;  5HCB A;  4B29 A;  4CDW A;  2XKP A;  3FN9 A;  3PVN A;  2D3P A;  3AB0 A;  2ZHM A;  4TLF A;  2VBD A;  2YBK A;  1JUI A;  1EY2 A;  2AYH A;  4XIL A;  4YW4 A;  2BWA A;  3LQC A;  1V6K A;  2A1X A;  3AZX A;  3LZZ A;  4XF4 A;  4YM3 A;  5GAL A;  5AC9 3;  3HT2 A;  3URF A;  4DS0 A;  3VV1 A;  5LCW L;  2X05 A;  1OA3 A;  4BM8 A;  3S30 A;  5FZK A;  1XB9 A;  3T2Q A;  5FRA A;  4AXO A;  1ZZC A;  2O8Q A;  3KGZ A;  3KS7 A;  4ERO A;  1A78 A;  2FMY A;  5KXE A;  3BN6 A;  4YG0 A;  3NJX A;  2NM1 A;  2QUO A;  4TLG A;  2J1T A;  3WNX A;  4XAA A;  3THT A;  4EQV A;  2VW2 A;  2BV4 A;  5A33 A;  2C1F A;  4OZO A;  3VZN A;  2RM2 1;  3QCW A;  5LB6 A;  3N36 A;  4D6Q A;  5CKN A;  5F1R A;  5JSR A;  4LT5 A;  1BJQ A;  4E8D A;  5FO8 B;  4XET A;  5IYY A;  3ZDV A;  2XVG A;  4O7X A;  1Z78 A;  2W9X A;  3MUZ 1;  1PGW 1;  5LA1 A;  1AJO A;  1JHJ A;  2VJX A;  2I45 A;  1M4W A;  5IAV A;  3W5N A;  1FOD 1;  1SLT A;  2YB7 A;  3J8F 1;  3AVR A;  3S7E A;  4QPI C;  2HEV F;  2XL7 A;  4BWO A;  3JQW A;  1O91 A;  3KZ4 C;  2Q8O A;  4R9D A;  2Q1M A;  5DPN A;  3CEW A;  4CEW C;  3KVA A;  4COZ A;  3HEI A;  1MS5 A;  4QXB A;  4MGZ E;  2BFU L;  2OQ6 A;  1YWK A;  3PMS A;  1R08 3;  3LSE A;  1DF0 A;  1SLA A;  2BFU S;  2FBE A;  4RYD A;  4AI3 A;  4JGZ A;  5B2G B;  3ZFG B;  1UU4 A;  5BNP C;  1NA1 B;  4OI4 A;  3EO6 A;  4UFK A;  1ODM A;  4QDQ A;  5JXG A;  5FYI A;  4YLZ A;  3VL8 A;  1KDM A;  1RUE 1;  2WWU A;  4YVW B;  3EYP A;  3WF0 A;  2VNO A;  5JAX A;  3B93 A;  2R04 1;  4YNI A;  5L9R A;  1AR6 2;  2A6V A;  4IEP A;  5A6Q A;  4FBF A;  4LXL A;  2OW4 A;  1PM4 A;  2VMD A;  3IDA A;  3OBA A;  2HWE 3;  1W6O A;  5DG1 A;  5JOX A;  4GAZ A;  1PNG A;  2DUR A;  1KJR A;  1R08 1;  1VMH A;  3IM0 A;  4EN6 B;  2ZPX A;  1NLR A;  4E4Z A;  2ZGT A;  5A6Y A;  1LEN A;  3KQR A;  3H1Y A;  4RGK A;  1XSR A;  3H8U A;  5GLT A;  1GKB A;  5H9Q A;  1D4V B;  3J7N A;  4DXR A;  1W8Z A;  5ACA 1;  2FDF A;  4HKW A;  5FY5 A;  5FFO C;  1PIV 3;  2HWD 2;  1FNZ A;  4XIO A;  4JDO A;  3ZFE C;  4DRR A;  4KBB A;  3J7L A;  1ND3 A;  1NE6 A;  3CO2 A;  3HWJ A;  1UU5 A;  2XJT A;  1ND2 C;  2PAE A;  2CHH A;  2XG3 A;  3DXU A;  4FOW A;  4IGP A;  3VD7 A;  4BQW A;  3IDE A;  3MZH A;  1CGP A;  3MUY 1;  5KHI A;  2CGP A;  1S0I A;  2MEV 3;  4GZ9 A;  2BWC A;  1J1T A;  5FZO A;  2GC1 A;  4J1W A;  1O7F A;  4K20 A;  2YMZ A;  2V09 A;  5A7Q A;  4L9B A;  1GZW A;  1YXW A;  1Q8Q A;  4M3C B;  4M4P A;  3RQ0 A;  4CA9 A;  4W50 A;  5AC9 2;  2ZTN A;  2C5D A;  3HPN A;  1PGW 2;  2P34 A;  4NPM A;  2WRA A;  1WCS A;  4QXK A;  3VN4 A;  1MS3 A;  4CUG A;  5ISL A;  2P5B A;  2ZGQ A;  5FBJ A;  3WXP A;  3H8O A;  2YV8 A;  5A7N A;  5FXX A;  3RGB A;  4IE7 A;  4RS5 B;  3IN9 A;  2VGD A;  3B02 A;  3IWZ A;  4WZF A;  4P9L A;  1RB8 G;  4E4S A;  1MS4 A;  1L7R A;  1SQ4 A;  2H6C A;  4Y1Y A;  1F2N A;  2ADE A;  2EVX A;  4IEO A;  4O61 A;  5FWE A;  4BK4 A;  3W21 A;  1C4R A;  4LA3 A;  2R1D A;  3AX4 A;  3CKH A;  1RUD 3;  1SPP A;  2E51 A;  1Q3E A;  2QFE A;  2V5D A;  2VVE A;  4C0B A;  1H9P A;  1OD3 A;  1VRB A;  5EJ3 A;  5F3I A;  4QM8 A;  5GLU A;  4UBG A;  4HET A;  3K4D A;  4HZF A;  2R07 3;  3K3N A;  1LCL A;  1RUE 2;  1V6M A;  1DGW X;  3LDK A;  4LO7 A;  4CPB A;  4QM9 A;  2A6Z A;  4NRP A;  5DUU A;  1YLL A;  1CZT A;  2FZ2 A;  3LOB A;  4OQ9 A;  5KC5 A;  4LR4 A;  2BZD A;  1F15 A;  5K8S A;  2A3Y A;  1POV 1;  3AKP A;  2ZEW A;  3V64 A;  4EE2 A;  3FHI B;  4AHZ A;  2D6K A;  4NPL A;  4QB2 A;  1JOD A;  3TB0 A;  4BH9 A;  5KR7 A;  1R08 2;  5FYY A;  4X8P A;  1HXS 1;  5T5O A;  4YFW A;  2GZW A;  3ZYF A;  3OOX A;  1OOP A;  5JSP A;  2W5F A;  5EIY B;  1BK1 A;  2CGN A;  4SBV A;  1C8N A;  3VZJ A;  3CJI C;  5BNO B;  4DEV A;  3NJY A;  1AL2 3;  1IHM A;  2B39 A;  5FLI A;  5HCH A;  5CEH A;  2VZ3 A;  4QU1 A;  4ZU5 A;  3TN9 1;  1DFQ A;  2ZZQ A;  2GP5 A;  1CES A;  1UIJ A;  4TXW A;  1LES A;  5FZB A;  1ZRF A;  5L36 A;  1H2L A;  3FE5 A;  4BOW A;  4MHU A;  5EWS A;  1JZ5 A;  1Z7S 1;  1UZZ A;  5LA2 A;  1WLD A;  3S0M A;  3IKW A;  5J7M A;  1SBD A;  1JHN A;  3T30 A;  5ANN A;  2JDU A;  4M0N A; 
#chains in the Genus database with same CATH homology
 1HB4 A;  4XAE A;  1E5S A;  1E5H A;  1ODN A;  1DCS A;  1W3V A;  1ODM A;  1W3X A;  1UOB A;  2IVJ A;  1W9Y A;  5C3R A;  2DBI A;  5C3S A;  1E5R A;  3ZKU A;  1UOF A;  4RGK A;  5C3P A;  1RXF A;  1E5I A;  5C3Q A;  2CSG A;  2Y60 A;  2IVI B;  1BLZ A;  2VCM A;  1GP6 A;  1WA6 X;  2WO7 A;  1OBN A;  2VBP A;  5C3O A;  1UNB A;  2JB4 A;  1OC1 A;  2VE1 A;  2JB8 A;  3ZKY A;  2VBD A;  1HB2 A;  1RXG A;  1W28 A;  1W2A X;  4BB3 A;  1W04 A;  1W03 A;  1GP4 A;  3ON7 A;  2BJS A;  1UZW A;  1HB3 A;  1W06 A;  2DBN A;  3OOX A;  1HB1 A;  1QJE A;  1IPS A;  2VAU A;  2Y6F A;  1UO9 A;  1HJF A;  3ZOI A;  1QJF A;  2BU9 A;  2VBB A;  1W2N A;  2BRT A;  1BK0 A;  1UOG A;  1W2O A;  1HJG A;  5APA A;  1QIQ A;  1GP5 A;  1W05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...