1RXFA

Deacetoxycephalosporin c synthase complexed with fe(ii)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
307
structure length
264
Chain Sequence
DTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDLVIDFFEHGSEAEKRAVTSPVPTMRRGFTGSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFMAPHYDLSMVTLIQQTPCAGFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAAPRTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a cephalosporin synthase.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHASE
total genus 82
structure length 264
sequence length 307
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1rxfA00
2VBPA 1ODNA 1W05A 1UO9A 2IVJA 1HB1A 1UOGA 1W2NA 2JB8A 1IPSA 1UNBA 3OOXA 1W2AX 5APAA 1OC1A 1BLZA 1W06A 1W04A 2BJSA 2Y60A 2VCMA 1QIQA 1E5SA 1HB4A 3ZKUA 3ZOIA 1OBNA 4RGKA 1UOFA 4BB3A 1RXGA 1RXFA 1W3XA 1QJEA 1W3VA 1W9YA 1HJGA 2DBIA 2CSGA 2IVIB 2JB4A 2VAUA 1W28A 4XAEA 1W03A 1GP4A 1E5IA 2WO7A 5C3OA 1QJFA 2VBBA 1E5RA 1UOBA 1HB3A 2VBDA 2Y6FA 5C3RA 2BRTA 2DBNA 2BU9A 2VE1A 1BK0A 5C3PA 5C3SA 3ZKYA 5C3QA 1GP5A 1WA6X 1GP6A 1E5HA 1HJFA 1HB2A 1UZWA 1W2OA 1DCSA 1ODMA 3ON7A
chains in the Genus database with same CATH superfamily
1Q8QA 2Q8EA 4QX8A 2WLPA 2DUPA 1W8TA 1XC6A 1E57A 4YG6A 3ZSKA 1H1IA 1H8TB 4YG0A 4FPFA 4WM7B 3N9PA 1CIYA 2IFRA 2LRPA 2RJKA 4UYBA 5B4XA 3WR0A 1VAMA 4XUPA 5FMDA 2W0XA 4UWDA 1YQ6A 4QXKA 4YSFA 1W39A 4A7YA 2XJVA 1NAEA 1JZ5A 4MGZE 3IDAA 1DYOA 1W8UA 2XVLA 3CIHA 1NA1B 1S0GA 2LM3A 3W5MA 3AZZA 3VBUB 4JCKA 5JXIA 4CEWA 2XKOA 4QPGB 4IGPA 1GQHA 2X5IC 3PU8A 4P5HA 5J48A 4GKYA 3VV1A 1W05A 2RMU3 3PHMA 5IT6A 2P37A 4XFAA 2DTWA 4CP0A 1LNSA 3W59A 1POV1 4K6BA 2AYHA 3SKVA 3F95A 1I1EA 2E6VA 1FOD3 2MNGA 2G1MA 5FIXA 2ILMA 4H55A 3VKLA 4GB32 4FTBA 3WNPA 3VD3A 2HWE2 2CDOA 3CHXA 2ET1A 2JDAA 2R32A 2WZR3 3FN9A 3L9JT 5DMYA 1F2NA 1OH3A 1SBEA 3LIHA 3ZFGB 4AFBA 5FKCA 2TNFA 3E6BA 1DQ4A 5ABJA 1F5JA 1O8PA 2YC2A 3C3VA 2SBAA 1W8FA 4XHXA 1ZX5A 3AXEA 3HD8B 3ST7A 1H6YA 4YPJA 2W9XA 4WBBA 2C9AA 1DQ0A 1GWLA 2YROA 4HVRA 4P9WA 4ASKA 2E7AA 3DF0A 1MS0A 4XF9A 3W5NA 1C8M2 3NV1A 5C71A 1FMD1 4IESA 5T5PA 1RHI3 3DYPA 2XJUA 4C0BA 2E7QA 1UOFA 3WY6A 2DU1A 4N7IA 3ORJA 2B42B 3RZGA 4RN5A 3WINE 5C33A 1OLQA 1GSLA 2MEV3 4Q0PA 2CDPA 4DXZA 2ET7A 3ITQA 4QKDA 3I2JA 4GJYA 4COYA 4IE7A 3CQOA 3AM2A 5ANNA 1AR92 3H42B 1AR82 4FQ4A 3SCGA 5FP3A 4QHZA 4CDUC 2W68A 5A3OA 2CHHA 2NM1A 3JXSA 4JX0A 4P14A 5IK5A 4Q29A 5GLUA 3IMNA 3OPWA 3B02A 3LA2A 5LA2A 1VBB3 4MVTA 3OOXA 2V5YA 4GIQA 2WWUA 5DG2A 4BQYA 1AR63 5JAXA 3DL3A 4K3UA 5HI0A 1MQTC 3I97A 2RG4A 3PVEA 3WG1A 1N1TA 3IKWA 3PUAA 5FP9A 5DPNA 2VXJA 2H6BA 2ZGUA 5A32A 1AR83 2I2SA 4OLLA 5I0SA 4UAPA 2F4PA 3ACIA 1QDCA 4L99A 2CL2A 5EJ3A 1WMEA 2OQ7A 4GULA 4N7UA 1XE8A 5GLWA 5FYUA 5BNNC 3E97A 1OLMA 2BP6A 4UF0B 1F4AA 3EQEA 4QX3A 4FP2A 1QJY2 4GZ9A 2XWBB 3AMPA 1SBDA 1M06G 4EN9B 1IS5A 2ZMNA 2IXIA 3TEWA 4CDWA 1GZCA 3WG4A 4EROA 1RUH1 4QDQA 3VB9A 5FP7A 1T6GC 1W04A 1VAVA 3PDQA 2I07B 5GLZA 2C4XA 2JKXA 3LD8A 4Q27A 1EV13 1PHMA 3ZN6B 2XPJA 2BVVA 2Q0AA 3URFA 1RUC1 4KWJA 4A4AA 4DINB 2VOKA 4UFMA 1PZ8A 1TZOA 2BRTA 4EWDA 1R083 4CPBD 1O3RA 2P4EA 2RVAA 1DU3D 4HPKB 4OZOA 2W39A 4XVHA 3ZXJA 1C8NA 3S30A 1AJKA 2G9FA 5L36A 2FZ2A 4CSWA 2HEYF 5FLJA 3AMHA 4Q4X1 1W9SA 5GZCA 2A7AA 1QGLA 1QJX2 1AJOA 1J3PA 3FLRA 3QLQA 3N9MA 4RQPB 1Z7S3 1KDKA 4LKEA 1DZRA 1L7QA 1TE1B 2BJSA 2C5DA 3ALQA 2VNRA 2OUHA 4AEDC 4CRQA 2DVGA 2Y6HA 4M4RA 2IVIB 4QX7A 4XFGA 2W1WA 1A78A 4A44A 3DV8A 3MLJA 3TOJA 1W8WA 4F3JA 4I0WB 5A33A 3T09A 4BM8A 3THTA 4LORA 5FYMA 2VNOA 3R4SA 4E2SA 1PMIA 2XJSA 1JHJA 1W6OA 4G4FA 5JXHA 1D0HA 3KZ4C 4Q4X2 5FKBA 3ASIA 1QJX1 1AL21 3MIDA 2VZPA 4OULA 4PI2A 1OKOA 3B7MA 4OQ9A 3POYA 1ZA7A 4XZUG 1W0PA 2A5ZA 4DFSA 2WNVB 1DCSA 1UW8A 3LA7A 4AFMA 3VBFB 4LK6A 1YFWA 3MO4A 5FYVA 3V56A 2PA7A 1UIKA 3OD0A 4LBQD 1TQ5A 4PLMA 3WCSA 3KVAA 2HWC3 1QXJA 1GYKA 4L9BA 1PNFA 2BGOA 1LENA 2JDKA 4QHOA 2ARCA 2WKKA 4YGCA 5A1AA 2FMDA 5FZAA 2PAEA 2FCVA 5FK7A 1ZRRA 2WSUA 3EO6A 1V6MA 2JG8A 2G9ZA 4QX1A 1VBA1 2DVDA 3MFAA 5FZLA 3RWNA 3VZKA 3O7OA 3TAYA 4ES9A 3SCHA 5A6YA 5C6CA 3NSTA 2GH8A 4Y26A 2GMEA 5DDJ1 2ZJCA 3WLUA 1W90A 2WS93 3I3BA 4IDZA 1T2XA 5A33B 1OD5A 3LEKA 4ZY9A 1DQ2A 2A6ZA 2JE9A 5F5CA 1ZA4A 2ZZJA 3VBUC 1BLZA 3R6SA 5EJ1B 3MI8A 1XYPA 3LZZA 5FAXA 3MZHA 2DYCA 2ES3A 4BB3A 3ZFEA 1QEXA 4NHYA 4YFZA 2VAUA 4ET7A 1IQAA 5CEHA 5IVCA 4KU7A 4NAOA 2QQUA 3VLBB 1H30A 5FZEA 3K48A 1WMFA 4M3CB 2QE3A 1QDOA 2WAAA 2WDBA 4NIDA 1HV0A 1AF9A 2JE7A 4GWJA 1NZCA 2XXZA 3OBRA 4YW7A 1JODA 4BIOA 1NE4A 3GALA 3MHZA 3O0VA 3GZTB 3D5OA 4B7EA 3S6PA 3BTYA 3PTRB 3QACA 1QXRA 2HJIA 4QQPA 1NYWA 4LE3A 3AKPA 5A7NA 1ND3C 3HNYM 1OA4A 2VCBA 4QKNA 4LBQB 5IK7A 1R1A1 1YJKA 4UW5A 1BK1A 3LDKA 2XJQA 2R0HA 5I8SA 2VMHA 3VDDA 1PO13 5I8TA 1ULGA 3VL9A 3K2OA 4F7ZA 3D0JA 4GWIA 1H8TA 3FHAA 5LZ6A 5CBLA 4BQ1A 3N9LA 1MPXA 3O0XA 2IXKA 3P6BA 4M0NA 1X82A 1GOFA 3TYJA 5C3PA 1X36A 3UJOA 4D7TA 4AEJA 4A42A 2VL4A 5DAQA 4YW1A 1HXS3 1DP0A 4H14A 4XJAA 2IVJA 5A70A 1PO22 2JG8B 3K4ZA 1WCKA 2OPWA 2ID4A 2VXRA 5FBJA 4AI8A 2CAVA 4JGZC 4GB31 3VDDC 3J9SA 4YVWA 3PTYA 1GUIA 4IEZA 1LOFC 1QJEA 2CWSA 4LBKA 4YGEA 1VBC3 1JOPA 1G9FA 2WIIB 4JQTA 2Q8OA 1GKBA 3VBOC 1V6IA 4IE0A 1JZ7A 3ME2A 5KR7A 4J6GA 4LO8A 4PDWB 5A3WA 1QMJA 1YRZA 3CL1A 4W6WA 4XFFA 1O7FA 3VDDB 1GU3A 4ZHNA 1W8HA 2VZ1A 1HJFA 4LBQA 1YQCA 2HYKA 4UW4A 3KCCA 2CAUA 4MGQA 2W92A 4A45A 2J1RA 3B00A 4W8JA 2OW4A 1ZVFA 2HWB1 2Y64A 1GBGA 4FQZA 3UT0A 4YW5A 1PK6C 4FOWA 1W6OB 1S0DA 2B9UA 1LOEA 4IV3B 2JWPA 4XHBA 4XMIA 4YVWC 3TRSB 1QQP2 5FY1A 5F7UA 5LRSA 4V2VA 5GALA 5JOZA 4M3CF 1TMF2 2N7GA 1SDWA 2VOTA 3JBG1 4WVVA 1HRI1 2DV9A 3CO2A 3POEA 3WDVA 1KRIA 3G6JB 4Z1VA 1HB3A 2D93A 3EBRA 2UYBA 3P3NA 5E89A 3QBQA 4NPMA 2P1BA 5FO7B 1E5HA 1NKGA 2A70A 3OCPA 4WM8B 4IGQA 1C28A 2IWGB 4CP1A 1R092 3N7KA 4J1WA 1LHNA 4AZZA 1OQ1A 1QQP1 1YIFA 2EIGA 1CX4A 3DUIA 5FZ3A 2C26A 2DTYA 4CPBA 4FTSA 4FPHA 3ZYBA 2VUAA 4PDWA 5CFCB 3VKMA 1ULEA 2BNOA 3UJQA 4I01A 4RGKA 4OYUA 1UZVA 3ZM8A 1AL22 2QFEA 3UK9A 1GOGA 4Q4Y1 4ATFA 4JQRA 3VDCA 4GWMA 2Q1FA 4CXWA 5A7SA 1LTEA 5JMOA 5L7OC 3VDBA 2VZRA 2JG8C 3ILFA 1CWPA 2PHDA 2WZPP 1NLRA 1VLNA 3T2QA 2ADDA 2ZBJA 3RS6A 2ZEXA 4LA2A 1Z0HA 5FUNA 4R4XA 4CP2A 5DQ0A 3BU0A 1AYM1 1R64A 2W1SA 2XH6A 1CAXA 5EP9A 3VKNA 4CVUA 1CJDA 3K46A 2DUOA 1CQ9A 3BB6A 5LK5A 3MLKA 3VN4A 3BU7A 1G9CA 3ZKUA 3WF4A 2YPJA 1GANA 3KT1A 4Q0SA 4JDOA 3D0SA 4QWNA 3LWCA 2QQPA 1W9FA 3N7LA 2F4LA 4FXGB 2LROA 1PO12 4I0BA 4C90A 1MR5A 2VTFA 5FZHA 4DEQA 3ZPYA 1DGRN 3Q8AA 2TBVA 3R4DB 3I8TA 4JC1A 2OQ6A 3ZFGC 1N3QA 4DQAA 4YZ5A 1HX6A 1V6LA 4NUBA 3KGZA 5FZKA 4MO3M 4Q5OA 4OI0A 1WLTA 1WZXA 5AC92 1YFYA 3NJXA 1UO9A 4AHWA 3USUA 3D8CA 2VQ0A 3KCYA 4AQ2A 4O7XA 5FYTA 4KMQA 4ZZ5A 2Q1ZB 1PGL2 1XNAA 2QNKA 2QQOA 4AK3A 5JSPA 4QPWA 1JZ6A 1DGRA 3HWJA 4ZU7A 3KMHA 1X8EA 4YM1A 5FZOB 3EHKA 5EPAA 4Q4W1 2WZR2 3TEZA 4UT5A 1V00A 5I93A 1N1VA 4AGRA 3WXPA 3TB0A 2GMMA 2EF6A 4ZONA 3F2ZA 1VMHA 2Y6FA 1RUF3 4NE9A 3O1TA 5AC91 4RQPA 5JUVA 1VBE3 2Y6GA 3H3ZA 4AW7A 3T2PA 1COV1 5KHGA 3OGJA 2P6HA 1IOAA 1HQLA 1C8M3 1ODNA 1KJLA 4NRQA 1APNA 3ZSLA 4Q4W2 1TEIA 2V09A 5C5UA 1NX9A 2WFF3 2DDUA 1VIWB 4GQ7A 4HONA 2K46A 5FV3A 5IK8A 2JDNA 5FQ0B 2W94A 4CA9A 3CEWA 5C8CC 4RR3C 3BPZA 4GWNA 3ZYPA 1WBLA 1HW5A 1TMF3 4HMZA 4W50A 3MF6A 4JRLA 1AL23 4QMAA 3ABZA 3IN9A 3LOBA 5F32A 1UXZA 5A80A 1XSQA 2OUJA 1XU2A 5F2SA 3V0AA 4XBLA 5C70A 3LSEA 4JAAA 4L2NA 4ORFA 1U5YA 1FX5A 1PIV3 1H1AA 4NIAA 5J98B 1D7PM 4I3GA 4IL7A 5IFPA 3B5LB 1ZBE1 2RV9A 1ALYA 1O3TA 5DUWA 1R1ZA 1O4ZA 4IV1C 1O4TA 2BNMA 2E9QA 3RMXA 3WNKA 1UY1A 2BV4A 1EPWA 1RXGA 1RXFA 2V5DA 3OBTA 4LE4A 4CDXB 1PX4A 2CSGA 4IERA 2R0FA 4Z07A 4BWOA 2Z2SB 5FJHA 1F8VA 1ULPA 1RMU1 3RGBA 5AFBA 3C8XA 1NE6A 2WINB 3OGRA 1PIV2 5FTTC 2VVDA 3U78A 1A6CA 5EYYA 2CTVA 2WJSA 1AXYA 1S2EA 5FYYA 4BMBA 4L92A 2VW1A 2QQWA 4TZDA 4LO6B 3VHPA 3K77A 3O1VA 1UPSA 1PZ7A 4P02B 4K7JA 2XR4A 3AJZA 3ZFGA 4FAGA 2A71A 3IT8A 4HBNA 4TWTA 1HQNA 3MYXA 4JVAA 5FY8A 4H7LA 1ZZ6A 1J58A 3GDBA 4TLFA 1YUDA 1OMIA 2AEZA 2QBXA 5FY0A 5GM0A 1RUD2 3KLSA 3E5QA 1Y43B 2ENRA 4K9SA 2IXHA 4RS5A 1RUI3 5T3NA 5B2GB 2D6PA 4BQWA 3BOPA 2VBDA 1OURA 4IGOA 2DFCA 4IEWA 1S0FA 2KXLA 5FQ0A 3LF7A 4CCLA 4XZPA 5BNNA 4DZGA 4CCKA 4XW3A 4NO4A 2ZEWA 1WLCA 1PO23 1HXS2 4AVVA 4IETA 5F6KA 4MGIE 1CVNA 2HBUA 1AYN2 1MACA 1W2TA 4Q4V2 2WT0A 5F8PA 4A7KA 1SLAA 4IEOA 1XYOA 5A7WB 5CFDC 2R6QA 4AAPA 2PHTA 4K20A 5C8WA 2NZ9A 5F3GA 5DABA 2HWD2 3K4DA 2XLFA 4BQ3A 3DGTA 1DLLA 4LO4B 2HBTA 2D5HA 2RDQA 3DEMA 1MS3A 1VRBA 2MEV2 1STMA 4LA3A 2BBVA 2RS11 1K5MC 5GZEA 3PIGA 3ZIWA 1NQJA 3H1WA 4CEYC 3N36A 3FLTA 2QDRA 5KHHA 1PVC1 2VQTA 3OJBA 2RMU2 4AVTA 5F1RA 4CDQC 1LGNA 3O12A 4BQ2A 2EA7A 2D40A 3WNNA 2RS32 3OGVA 4P00B 4X6RB 1BCXA 3ZPOA 4ZZ8A 3LE0A 4BJ0A 5CB7A 3CU7A 3KHBA 2KA3A 3I2GA 4DB5A 5DN2A 3NAPA 1N3OA 1LEMA 1ND2B 2D7FA 2VBBA 3KV9A 2GC0A 5F5IA 4YZ1A 1QOTA 1YQ2A 2VOVA 5KXDA 1YHFA 2B7YA 4OI1A 3UGHA 1S4CA 3HIFA 1RUE1 2V4AA 1R091 5EJZB 1JUHA 5HCAA 1H1MA 2JICA 3QH6A 2FDHA 5EHDA 3VZMA 3NWKA 2WN2A 3W58A 2VGDA 4E2QA 4MXWB 2YBKA 2EIDA 2WT1A 5FYSA 2R063 3HNMA 1BQPA 4LHNA 3KGLA 3V64A 1VE0A 2VMDA 2ZCWA 4HPKA 3ZN5A 5ABJB 4CU9A 2IUWA 1EUTA 2C6SA 3TEYA 4QHBA 3S0MA 1G86A 3ES1A 4AE2A 1RUD3 4YARA 1BMV1 3P5BA 4GH4A 2PHLA 3ZIXA 1YLLA 2XHKA 3IIAA 4XIOA 3VZOA 4CDUA 1RVF1 4HN0A 2OKXA 3FFQA 1O3QA 2XJRA 4QPIA 1OLME 3OBZA 3ZMOA 2A6WA 2W52A 4FP3A 4D8MA 1I9RA 1ULOA 3SH4A 3MV01 4RHV2 3B93A 4B7KA 5KXBA 1J3QA 1IKPA 4Q0VA 4FBFA 3WHUA 4JTOA 4LMFA 4CU7A 2KR2A 2L9LA 3P1IA 1CZTA 2YYOA 4R8HA 1M4WA 4NHLA 3ENRA 5C5TA 4I3PA 5KXCA 2R073 3RZLA 4PF5A 3POJA 2Y0OA 4AQ6A 4FO9A 2FDJA 5FPZA 4DMIA 2RS52 1W6QB 4C8DA 3UL2A 1RL3A 2PLV2 2X05A 2WAOA 2SLIA 2JENA 2DWRA 2RR12 3HT2A 1J84A 4QXHA 3WW2A 4R9DA 5EYXA 1GOHA 1RUOA 1JYTA 4LIUA 5K0UC 3T3YA 5K0UB 1SEFA 4FOVA 3RJRA 4HKOA 4N43B 3WHTA 1ENRA 3T1MA 2AENA 3LFMA 1V6KA 1LJ7A 4YFWA 2VZQA 1ASJ3 1KJRA 1UX6A 1OKQA 2I45A 3SNMA 5GKAC 3PIJA 3POWA 2A3XA 1F35A 4KL1A 4LBOA 1S0EA 2ZGSA 4M4PA 3GHNA 3H8OA 5E1RA 3M3OA 1EY2A 3AP4A 3RZKA 5KHJA 1GZ9A 2PQSA 4N53A 4QPIB 5FZDA 2ZZQA 4NIIA 4AFCA 4JKMA 2XONA 2D6LX 1D4M1 2WO3A 2YZ4A 4XFHA 1PK6B 5FFOC 4AQTA 1RUF2 2PMWB 5JLVA 5BUVA 2QVSB 1QHDA 3PUSA 2WYSA 3ZXGA 3KHCA 4XUOA 4ARYA 4OFGA 1POV3 3POIA 4L97A 1X7NA 2H0VA 2OPKA 4RD7A 2XKPA 3GCWA 4NR1A 1W6PB 3ZYJB 1WD4A 5FOBB 1GWKA 1V9U1 1H2KA 1OLRA 1MQTB 3VHRA 5ACA1 4K8RB 2Y6KA 4QPYA 3AX4A 1HQWA 4Q4W3 3HT1A 4N90A 5CG9A 2BUKA 2HWF1 4FI9A 1SMVA 2VM9A 2BOIA 4AL9A 1PZ9A 5KC6A 4KBZA 1AR62 4UOJA 2VD7A 3HMYA 3RYKA 1U5XA 2JDZA 1Q43A 2FBEA 4XQ4A 2FD8A 4GMP0 1QJFA 3GF6A 3KD4A 4LOSA 4TXWA 3A0KA 3O0WA 2VUCA 5FYBA 2ARXA 4HXCA 1ULDA 3OY8B 3VBSB 4LLFA 3ACFA 3GXUA 3RPQA 2ZGTA 5A3PA 5FZ7A 3SH3A 5JXGA 2QZ2A 3JD73 1Q8VA 3LAGA 2BGCA 1D4VB 2ATFA 3NAPB 1XB9A 1XJAA 4DUVA 3WD5A 2E63A 1DQ6A 1VB2A 3OSDA 2E26A 1NT0A 2DCYA 3ES4A 2X8KA 1W2NA 2VJXA 3DKWA 4CUGA 2YPDA 2MEV1 1TMF1 5LA9A 4EWEA 2VUDA 2ZOEB 1RUH2 1HRI2 2VOWA 2ZGPA 1VBD3 4R4ZA 2JB4A 4W6XA 4D6RA 2KD7A 4DXTA 1GNHA 3JU9A 1UMIA 5DAVA 1TME3 4A2UA 3HBZA 2YBSA 3GZAA 4IEXA 2ARAA 2E53A 4IE6A 5FPLA 5CISA 4OZXA 1XOYA 2YMZA 5IWFA 3ZSMA 4CEYB 4AHZA 4QQOA 1GZWB 1ZBE3 1LRHA 3HOBA 1WW6A 3EB7A 4QXBA 4RHV3 4B8EA 2QQJA 4EE2A 4IEUA 1UU5A 3LFIA 1YO8A 1JW6A 4AI1A 3J8F1 1C57A 1UKGA 4URTA 4Y1XA 3O1SA 1AXZA 2RM23 3X29B 2P3IA 2XGXA 1IS3A 4XFIA 3WDWA 3GGLA 3IB3A 2RS53 1LR5A 2PTMA 4FFHA 5A7WA 4KQ7A 3WOGA 3ZVXA 3WX5A 1IPJA 5EIYB 4NOTA 3VZNA 2XUEA 4XDPA 5ABJC 4COVA 2CWMA 5C3QA 3MV11 5KWRA 2ZGNA 2ZX4A 5A3TA 2YB7A 5IAXA 1W0NA 5T55A 2GP3A 4NMIA 4ZS3A 1PX3A 3MIFA 4L8QA 1ZZ7A 3FJSA 4QX0A 3U11A 2X10A 1GNYA 2UYAA 2RJLA 2VTXA 4NAMA 1F4HA 5BYNA 2D3RA 5FZFA 3TN91 1JXNA 3VD7A 4DOUA 1QIQA 1F31A 1SZBA 4WM8A 4B1LA 3WF2A 2D5FA 2HWE3 5FP4A 5GZFA 5J37A 3R0RA 4Y3OA 2AREA 4HVOA 2OYZA 1OUXA 3KQ4B 5D2AA 1QF3A 2EIBA 3H8RA 4PLOA 2JDPA 4NROA 2VE1A 2VZSA 4FFGA 4YZ4A 4Q4X3 4LNVA 2RMU1 3I2OA 4KH9A 3VBHC 2BZDA 1EUUA 1ZBA1 4AEDA 5CKNA 3Q8CA 1S0BA 5L7OB 2JDHA 4FSJA 5HBAA 2WFF2 5JZGA 2GP5A 4HKLA 1K5MB 2PLV1 1GWMA 3GNEA 1DHKB 1GNZA 2GC3A 3CMGA 5D21A 3DXTA 1VRH1 1W3XA 3JB4C 5E88A 2UY8A 3D4KA 4BQ5A 2DFBA 4XJWA 1QNWA 2ERFA 4CCEA 5KHKA 1VBD2 2E51A 2OS2A 1KQRA 1OXCA 4XBQA 1WKYA 3WUCA 4WVMB 2A3WA 2VMCA 3CJXA 3UKNA 5A7OA 5FO8B 4AVCA 3AP6A 1CESA 2D6OX 5FLIA 1K3IA 5DAXA 4P9GA 4KGQA 3IDEA 5JVVA 3AZYA 4N43C 2O8QA 2UWBA 3AFKA 1WLWA 3NQHA 4FOYA 4FPYA 4PBOA 2Q8CA 4E2GA 4OUSA 1MZ5A 2VY0A 3KV5A 2WWSA 1SFNA 1U12A 2GU9A 4XPVA 3H8XA 5LB6A 4UFJA 2VCMA 3ZOIA 3AP9A 3ZFFC 1IKQA 1LODA 1BJQA 2K2SA 3AYCA 1K42A 4BCUA 1BMV2 1J3RA 4QX5A 2F17A 4TTGA 4BHPA 2IC1A 5J09A 4A6SA 3MEPA 4DUWA 3D3AA 2WNUB 5CU1A 3O1RA 3BIEA 3ACLA 3DPRC 2WS91 4CP9A 1BBT1 2WNEA 1QH7A 3H7YA 1RUG3 3ZX7A 1VBB1 2NMNA 4KU8A 3V0BA 1SCSA 3AYAA 3ON7A 4JGYA 4KBBA 4QGNA 4G3YC 4GD4A 4YW2A 3B3QE 1V70A 5IYYA 2YGLA 5JOWA 4EWAA 4A6OA 1ZYBA 2QQNA 2WABA 4R9AA 1LGBA 1ZRCA 1OVPA 2ZXQA 4DIQA 3EYPA 5D8AC 4EZ4A 3JUUA 4IE5A 1FOD1 3NV3A 1ENSA 1I3HA 2VQAA 2YC0A 1UIJA 3M3EA 2ZA9A 5C4WA 3LKJA 1C1LA 1G6NA 5FXVA 3I3EA 3B69A 5DXDA 3M7AA 1BK0A 1R082 4EJRA 1POQA 5SV8A 3K3OA 5FYIA 4QKBA 1S2KA 1Q8OA 2A6XA 2XJTA 3PVNA 2E31A 5F6LB 1GZTA 3LDRA 3AB0A 2D6NA 1ULFA 1RC6A 2YG0A 5DZFA 2A6VA 5BNPB 4CZSA 3T0AA 1DGWA 3SKJE 1ZM1A 5J1XA 1Z7S2 2EAAA 3O1OA 1DGLA 4WZCA 3KVBA 2R7EB 4FPEA 1J83A 1Y4WA 4DY3A 2BPA2 5L9RA 2Y8KA 1E5SA 4F83A 1TNFA 3POBA 5CYYA 2A6YA 2VMGA 1W6NA 1R081 5BNOA 2BVBA 4RGAA 1LU2A 3LB9A 3MICA 4CXXA 4MG2A 4YRDA 5E8AA 2HEWF 5ISLA 5FPVA 1FYUA 1O5UA 3LQCA 5FY9A 3BCWA 3ZXEA 3BTZA 4LBMA 3M1HA 2NN8A 5JPMB 1AZDA 1IG3A 2PHWA 5LBCA 4LT5A 4BYYA 2W46A 4GA9A 3I2KA 3NMBA 4YNIA 1XPWA 3AMQA 1OPOA 2UWCA 3CJIB 5FRAA 2Y6JA 4YVSB 2AH2A 1AYN1 3CJIC 2ZGOA 4FPOB 4Q4V1 4NHXA 3WCRA 1Y3TA 4D7SA 4Q8KA 3AKTA 4Q8LA 4LO7A 1KITA 1UY3A 3VL8A 5CFCC 2VR4A 4PI0A 3BN6A 5FCCA 1OA2A 1XBFA 1H6XA 5HXVA 3LGRA 4CCJA 1VBC1 2BW8A 2ZGLA 3INAA 5BNOC 1RUJ2 1H4GA 3WSOA 3N7MA 4XFBA 2GAUA 1PM4A 4XAEA 1E5IA 2RS12 2WO2A 4O65A 1JBCA 3NKTA 2GC1A 1VBE2 2UURA 1A8MA 1VALA 1WW7A 2Q5TA 4MXWA 1TNRA 4XACA 3ZSEA 5J36A 1JUIA 2DCKA 2R042 1GP6A 1V9U3 2BNNA 2YFUA 3IDCB 3MIBA 4WM7A 1C5HA 5DZGA 3KCXA 3LPFA 1IS4A 1N1YA 1RUG2 4RGGA 1CAVB 1TVGA 1Y9QA 2EXJA 2WQ4A 3OBAA 1KDMA 4QB1A 1UY2A 4Y33A 3TNQA 5BNNB 1ND3A 1HRI3 3U4SA 4LOTA 1SPPB 3PJYA 5FY4A 4OQ8A 5C9AC 3S5QA 2LS6A 1RUH3 4J25A 1X33A 1UYYA 4OHYA 5C3OA 4BLIA 1E5RA 4QB6A 4FAHA 3I2IA 4YM0A 4LIVA 3RI9A 4LHKA 3I3DA 4YW6A 5FREA 1OI6A 2O0OA 3HQXA 1NOVA 4X8PA 1CJPA 3VHOA 4OMCA 4ASMB 3WP4A 2ADEA 1UCXA 1PGW2 3OG2A 4QB2A 1XNCA 2WUHA 1VPHA 3V0AB 4GMP1 1GQGA 4IEVA 1VBD1 4Q4Y3 5GZDA 3BUCA 2R30A 2WNUC 4M01A 4MGSA 2LTNA 1HJGA 3DKQA 1S55A 1VAKA 2YFZA 2ZMKA 2ZX3A 3O1PA 1DFQA 2BYVE 4FPJA 1AR71 2HWD3 4GXLA 3S7EA 5I0TA 3WV6A 4CU8A 3GBFA 5HV0A 2J1VA 4P08A 2DCJA 4RHV1 1D0GA 2GSYA 3OB8A 4D0QA 1UN1A 3J4UH 2V4VA 5DAWA 1O4YA 1WWYA 2DCZA 2RM21 2VMEA 2WO1A 2WZEA 2ZHLA 3AKQA 1IS6A 1VBA2 1ZNPA 1MVQA 1WMDA 1YNAA 4DXRA 4OCTA 3A7QA 2C9KA 4OHXA 1H9WA 1NCQC 3OYWB 2RS51 2XB6C 3B01A 4Y5SA 2DBIA 4S2GA 3UYJA 1URXA 3V0BB 1HN0A 4XOGA 1WMXA 1LCLA 3EXUA 5FJKA 5LBEA 2HWC1 1WBFA 3B9CA 2Y34A 5BNPA 4URAA 1MZ6A 3HPNA 1UD1A 1Y9MA 2XBO3 4MXVA 1Q8PA 3ZO0B 1JYWA 4RYDA 4PQQA 2JE8A 4PT6A 2Y6LA 4BPZA 2WRAA 2Y38A 5JXJA 1OPMA 1ZBA2 5IVFA 1AR93 2YC4A 1ASJ2 1OHFA 3P3PA 1L7RA 4HN1A 4QKFA 2XHNA 4SBVA 1FOD2 1XNBA 3RZZA 4AHXA 2P3KA 5HV4A 2HWC2 2P34A 1BEV1 5LK7B 2OA2A 5AFEA 2A1XA 1X50A 2Y26A 3AZWA 1JYXA 3D82A 5I91A 3VBRC 2BEOA 4YVSA 2JKBA 2ZABA 3H3UA 4MGYE 5JWPA 1JZ4A 4D3WA 3VD9A 2BWAA 5K8SA 1XRUA 4HLTA 1REDA 1RMU2 2YHJA 1BZWA 1YEWA 1SHWB 2B5HA 3ZDVA 5C9AA 3WNXA 4Y22B 2HWB3 1US3A 5FBZA 1BEV2 5FMBA 5FZMA 3T4VA 4JTNA 4U36A 5FUIA 5L9VA 1FPN1 2PQQA 2PYTA 4NRPA 3NV2A 3O1UA 4JDNA 4QM9A 4YZ3A 3NJYA 1HB1A 3J7NA 1RJ8A 1H4HA 3M4FA 1FT9A 2PFWA 3JBG3 3MIHA 3Q8FA 2OX0A 4FPCA 2VQUA 4OUEA 1XNTA 5I0UA 5FZCA 4INDA 5HCFA 4YG3A 1CZVA 2KM2A 1JN2P 1ENXA 1YQ5A 1WCDJ 1KFXL 1MZFA 1UYZA 1U0AA 4XETA 4BU2A 2Y33A 2D3PA 4I30A 5FPUA 1FPN2 3RI8A 5CVRA 1KS5A 1MVEA 3NO8A 4MADA 2W08A 3WW4A 4I02A 2VULA 4ONUA 5M0TA 1JYNA 3QCWA 3ZFFA 1SPPA 3E5XA 3ZXLA 1YIPA 1YYNA 3FLPA 1O6UA 1RUJ1 2RDSA 4AVSA 1OQDA 4XE9A 4ZKTB 3KB5A 4LTAA 1SLCA 5A3MA 1SCRA 1HXS1 2XQXA 4LLOA 5J96B 2JG9B 1PM7A 1X9TA 4EN0A 1HRV1 3IM0A 3ZFEC 4Z2AA 4AGGA 1V6NA 2LALA 1ZZBA 2VC9A 5FR3A 3ACGA 3IWZA 5HCHA 4COZA 3HEIA 1JZ2A 1LULA 1NLQA 3ZYFA 2JIGA 2VCCA 3T30A 2GALA 3BKZA 1RUG1 1ZRIA 4JKKA 3ZXFA 4EZHA 1O5LA 4AVBA 1NXMA 1S0IA 2XVGA 2NLRA 2XBO2 1LOFA 3A22A 4N9IA 3VBHA 2D6KA 1REFA 1SLLA 3KT4A 1ZREA 3ZYHA 4ES8A 4BISA 2FDKA 4BIFA 2RS31 3C7EA 2XMLA 1RUI1 2RDNA 1HB4A 2W91A 1SQ4A 4RL7A 4UW3A 3THPA 2W2IA 1OVSA 3HBKA 1ONAA 3AMMA 2GNMA 4HG6B 2QTWB 4LBNA 4TN7A 4HK8A 3ZN4A 4A3XA 1UMZA 3VBRB 4AQSA 3U10A 2RHPA 4UFLA 3N9OA 3LEIA 5K7PA 4QQLA 2BU9A 4K8FA 2VZVA 5DUVA 4XJ8A 2EICA 2VZ3A 3WQ1A 1WA6X 3C7GA 5IW0A 3K4AA 4RS5B 3QOPA 4S2FA 1OF3A 2WA4A 4OHZA 3S5AA 4KWLA 2B39A 3ZXKA 4BZ4A 4E9KA 5FZ9A 2NP0A 3WW1A 3WP5A 4M3CA 2BFUL 3RZJA 1HLCA 3I49A 3OD4A 3OGSA 3AYEA 2B4KA 1YI7A 2WLQA 5JSOA 1AR72 4RR3B 1GZWA 1OSGA 1DF0A 3WT3A 5IHRA 4XDOA 2OXBA 3NRUA 3ZMNA 5F3CA 1UZ0A 3CJIA 3FFZA 4HFSA 1QXPA 2P6CA 4QQHA 4LITA 1VBE1 3BI3A 2FHRA 4S2DA 1LOBA 1B35B 3MBWA 5CFCA 5FMOL 1NCQB 2R043 4R9CA 4WV8A 4CUAA 3B94A 4TYSA 4HT1T 1I5PA 3KF5A 1MS9A 5H9QA 1W9TA 2J22A 2WFF1 2V73A 3SC7X 4EV0A 5LWBA 5JZGC 4JGYC 1YWKA 3OPZA 4PIXA 1HKDA 1JYVA 4CUCA 1OFSA 5FK8A 4YYOA 4FCAA 3VD4A 2AC1A 4XF4A 4XTPA 2QQLA 4C1XA 4LKSA 5GLTA 1OBNA 2R062 3H1MA 2J1AA 3UV9A 3WG2A 3WP3A 1DGWX 2NQYA 2H0BA 2FCUA 4MX3A 4QXCA 3ZXAC 4RS5C 3N9NA 1CPMA 3PURA 1SFYA 3POFA 2VMIA 3H50A 2D43A 2Z4FA 2G4IA 2O8OA 5FXWA 1PMJX 2RR11 1Z78A 5GZGA 4UFHA 2YUEA 1NY71 1IZ3A 4RFT0 3TWIA 3PL0A 3I59A 1GQPA 2R061 3AYDA 2X09A 1XQNA 3U1XA 1QJY3 4HVQA 1UL9A 1I6XA 4AOCA 2B8MA 2DCTA 5EV7A 3PMSA 1I5ZA 3BGAA 2CGOA 2R072 4E8DA 1QJZA 5FMCA 1CZSA 1QJU2 1W28A 5HPOA 5TSWA 4A41A 1UZZA 2ETEA 5T52A 1YXWA 4BLJA 4AR2A 1OOPC 3SEPA 3GBGA 1VJ2A 2JIJA 2RJ2A 4W6YA 2VOXA 4BXSV 2AEYA 4KWKA 5A3UA 1H0BA 2DU0A 2PHXA 5ANQA 5L73A 4UW6A 3HN1A 3E6CC 1RUF1 1V6OA 3GM8A 3H9AA 5FUPA 3AVSA 1N47A 3DPRB 2X53S 4GMP3 5A1LA 5AC93 4LUMA 1ZRFA 2A73B 1K5JA 1R1A2 2VZUA 2XL7A 3IAQA 3OY8A 4U2AA 3MDPA 2R16A 2MHFA 2XUMA 1UMHA 4CDUB 3C7FA 3FE5A 4DS0A 3CDZB 5FZBA 1G9AA 4XQDA 4XIKA 2WA3A 3I4IA 1FMD3 2HWF2 1MS5A 3BVCA 3FZ3A 1POV0 2JJ6A 4X6QB 4UBGA 4CDWB 4JGYB 4WVWA 3M3QA 3OUJA 4ISQA 4Y5TA 2BGPA 1JH5A 1H2LA 3A21A 1PO21 1QOOA 2D3SA 3IPVA 3KV6A 4E4SA 3GHMA 1PVC2 1ASJ1 1Z7S1 1YFUA 4NIGA 2I74A 4PCRA 2WN3A 1AL0G 4LBLA 5JIAA 4QT6A 1B35C 4Z8BA 1PIV1 4MZUA 1H2NA 3RRDA 2BDRA 5BNPC 4P5YA 1WUVA 1A8DA 2P2KA 2PHUA 2WQZC 1A3KA 2X29A 3GCXA 4RA0A 3VKFC 2PN5A 1NXD1 2C24A 3CNAA 4Z2WA 1PNGA 2EVXA 3MPBA 4XABA 2Z79A 1XE0A 2ZHNA 4KG8A 3RQ0A 5BV6A 3E1F1 3SEEA 2ZGRA 2ZGKA 4MSVA 4HK9A 1S2BA 4IV1A 3A23A 3RG0A 5A6QA 4UXAA 2YY1A 3SISA 3T08A 2QCSB 1OA3A 4CYDA 1ND2A 1W2UA 5ACA3 2ZPXA 4Y24A 4CXYA 2NYYA 4GH4B 1XNDA 2VO5A 3MW4A 1LHVA 3NKGA 4N8MA 4DRVA 2WBKA 2FDFA 2FDIA 4BA6A 3S7IA 2VZTA 5JIUA 4MGKE 2ARBA 3SITA 1EAH1 5K4LA 1AYM2 2CGPA 3BOWA 4CDWC 5EZWA 2XQRA 4YLZA 3LEGA 3J8F2 4CCNA 5L9BA 4QAWA 4PJYA 1NLSA 4WVZA 3U4XA 3OUHA 1GP4A 2ZGQA 2VG9A 1XE7A 2GZWA 1W0OA 1EV11 1JU4A 2JG9A 4XDQA 3KS7A 1H8TC 4XUNA 3WNLA 3MLLA 1RUC3 3EMRA 5FYCA 5T50A 1C4RA 2DURA 1W2OA 3RVHA 5FZIA 5T5LA 2D6MA 4JHZA 4QD2A 2HEVF 3ROUA 2XLAA 1OOPA 3Q8EA 4Y1ZA 4A3ZA 2Y0IA 4XCAA 4Q4Y2 1UNBA 1G9BA 1LAJA 4AAXA 2IXCA 1HRV2 5I0DA 1XSRA 1HV1A 4PBPA 3RYRA 3VBFC 1JZ3A 4YGBA 2WNVC 2ZKNA 4XYXA 4CDQB 3V65A 3I7DA 1CAUB 3OF1A 5FYZA 3ZYIB 2W3JA 1QJU3 4I2OA 4PLNA 4DEVA 2JDUA 3IMMA 3K75B 1IQDC 5H9PA 2QKDA 1DDLA 3OUIA 4H2AA 2VECA 2BOJA 2WZR1 4I09A 5C3SA 5KBFA 2XJPA 3EJKA 3ZN6A 1K45A 1VMJA 4JRAA 1SLIA 3MW2A 5FPXA 4IEPA 3VD5A 1JTZX 2WL1A 3C7HA 1QJX3 1Q3EA 2W5FA 2VW2A 4N53B 2WYFA 2VU9A 4QDRA 1R1A3 4ASLA 5LATA 4LXLA 1Q8SA 1COV2 1FATA 3SH5A 1NQDA 1PO11 3LIGA 3PUIA 4WZFA 3R4UA 4D7YA 1RUE2 1CD3G 2GNTA 4C91A 3RWKX 3JCIA 2Z5WA 4MOAA 1NZIA 1JI6A 5IATA 4KNCA 2Z42A 5HCBA 3N7JA 1T6BX 1EYBA 3IBMA 4ARXA 3JQWA 2ZGMA 1W6PA 2C0ZA 2DBNA 2GMPA 1NCRC 4NWVA 4GALA 2CY6A 2P5BA 4IV3C 4XURA 1DZQA 2K9ZA 4YVWB 3WDXA 5C8CA 1RUNA 2P3YA 4RR3A 3WUDA 4MV2A 3TEXA 1UZWA 3AL6A 2PHFA 5F3IA 3IZOA 3MGUA 4D69A 1UU4A 1PGL1 1VBA3 3T2OA 1RINA 3AXDA 5C7GA 2FQPA 4H3WA 5L19A 4R52A 5IVVA 4Z82A 3AP5A 2W47A 4UBHA 4E4HA 3MUZ1 5DDJ3 3TBDA 4K1YA 1NA1A 5LY2A 2HH9A 3AMNA 2E32A 3BALA 3LOIA 4PDWC 5IVJA 5IK4A 1CGPA 1AR61 4BMEA 4DY5A 3N9QA 2EIEA 5A3NA 1WLDA 2VTXJ 4ZPIA 2FDGA 2EAKA 3J7MA 4TLGA 4AWDA 2WSVA 3ZR5A 4ZS2A 3FMGA 1MQTA 4XEZA 5CZKA 5IUQA 4BOWA 1C1FA 2JXAA 4AXOA 1U5IA 5FZOA 4CDQA 3JD72 5FZ6A 2MPFA 2WS92 3UESA 5C4WB 1ZZ9A 4QPGC 1CR7A 2JECA 1MZEA 3MPPG 4MH0E 1B35A 4B1MA 2J1SA 1AVBA 2BQPA 3K51A 1V0AA 3I2HA 2DVFA 1ACCA 1Y9GA 3DCQA 3LPGA 4UFKA 4EN7B 3NNJA 4LJHA 1GICA 5KHIA 3MIEA 4UI9L 5K9YA 4OHVA 2E7TA 2YU2A 4LHSA 4YVSC 5LEJA 1XU1A 1RTVA 4N43A 3FUOA 2ZAAA 1W8OA 3JD71 4LR4A 2J42A 4N9HA 4XF3A 2GNDA 3ZXDA 1PVXA 3M8LA 1W8NA 2IXJA 3L2YA 5DAPA 1HIXA 2JEMA 5I0RA 2WT2A 1BVVA 1ZBE2 5F3EA 2J1EA 4FFIA 5IVYA 2J1UA 1X8MA 4OI4A 3WEZA 2ZX0A 4MUVA 1DYPA 3UGFA 4CCCA 1UWWA 1YC61 2VPVA 3GZUC 2WZ8A 2LW8A 3DYMA 4HOOA 1SACA 1C5IA 2QQVA 3WF3A 4D94A 4XJUA 2HLEA 5JOXA 4NHMA 3DPRA 3ELNA 3K3NA 5JI7A 3ETPA 3ZYGA 1FAYA 1GLHA 4LKFA 4G9SB 5FDBA 2RR13 2JG9C 1FI2A 4Y1UA 1GR3A 2G9GA 5C3RA 1GV9A 2PAKA 4K40A 5FY7A 5FOJB 5A6ZA 1QJY1 1RGSA 1HDKA 3N3HA 1QKQA 1AUYA 1MEC1 1B09A 4LUKA 3BTXA 2OVUA 4Y20B 3WVJA 4UFIA 4Z92B 3SHRA 3UKVA 1LEDA 1NCRA 1CN1A 1O3SA 3KSCA 2O1QA 2ZAHA 2AACA 3MW3A 4ITCA 4DUXA 2R1BA 5C9AB 4Q1PA 4KGGA 1UY0A 2RDRA 3H7JA 5FO9B 2Q30A 1VBC2 3ZLIA 4OMDA 4D6SA 4XQWA 3USUB 1CAVA 2JDYA 3AKRA 2NPIA 3FWEA 2ZEYA 3KM5A 2QQMA 2VMFA 4H7MA 1NA1C 2CYFA 5F37A 1P8JA 2XL9A 4M3CE 3VDAA 3I3QA 4XXAA 5CAZA 3HVDA 1GP5A 5CFDA 3SXWA 5HXMA 3KV4A 3THDA 3FBMA 1D2SA 4OVEA 4XMAA 2WR9A 4YZ2A 1U5ZA 2Q1MA 2O14A 1NUKA 1LU1A 1DIWA 2HWB2 2OIIA 4CTEA 4P9XA 4HL0A 3PJQA 4QQ2A 5I8YA 3IAPA 3NNGA 2UWAA 2ZMLA 1H8VA 2XLGA 4HZFA 5IFTA 2WNOA 1Q5OA 4FOQA 3LSDA 4Y20A 5CA6A 4JHTA 4IEQA 1WCSA 1VR3A 1KD7A 4NHKA 5H9RA 5JZGB 3J7HA 3MIGA 3T4HB 4GKXA 3GJBA 1UU6A 3LCPA 5L7OA 2BBAA 1ZBA3 1DLCA 4IV3A 4DO0A 3WF1A 4B29A 2QUOA 2BTVC 4DXSA 1TME1 3ZFEB 3T0BA 3WQBA 5LBBA 4CDXC 1GMMA 2DVAA 1DG6A 4XUQA 1S1AA 4Q2FA 3E6DA 3N4MA 4AGVA 1RVF2 1CONA 3GBWA 3FHQA 1UOGA 3ECQA 4V1PA 5G04L 1VRH3 1PGW1 1WCUA 3FBYA 2HYXA 3T1LA 4QGLA 3WNMA 5APAA 1AX2A 4JV4A 2VW0A 4FT8A 2JD9A 4E27A 4XTMA 2YGMA 1ZZCA 1LECA 1BHGA 2ZACA 4Q0UA 4EQVA 1OD3A 1BKZA 5JMCA 4SLIA 3PUHA 2WQ8A 3J8F3 4R9BA 1TME2 1CIWA 1CX1A 1QH6A 1N1SA 2ZX2A 3POSA 4K21A 4RFRB 1EV12 2IXLA 3VBHB 4BK5A 3O1MA 3H3LA 1UAIA 4M00A 2ZHKA 4COWA 1ND3B 2D98A 2G19A 3BODA 3FL7A 3OYWA 3ATGA 4PIZA 1YI9A 4Y5Z0 1F5FA 1UYPA 2X5IB 5AVPA 2W1QA 3HQUA 5EWSA 4CDXA 1S0CA 2Q4SA 2YU1A 4MHUA 5F9TA 2PAMA 1VBB2 5JCTA 2VNGA 1AX0A 1WA4A 2AGSA 4NJ4A 4XF1A 3W20A 3T0DA 4XILA 4FVVA 4LPLA 2E33A 4XXPA 3NNFA 1US2A 2ZS6B 1GFF2 2P3JA 1LGCA 2R1DA 3PU3A 4ISRA 3TN93 2GC2A 3L2HA 5E6HA 4GB33 1W6MB 5KC5A 4NN0A 5CNAA 1ULCA 2HWE1 4M0HA 4YGDA 4AVAA 3AC0A 1NY72 4XFCA 1BYHA 5GLVA 3VBOB 1FXZA 5F5AA 4AI9A 1HB2A 4AEMA 2TUNA 2IZWA 4GJZA 4LK7A 5JPNB 1UXXX 4QM8A 1F15A 3JZVA 1ODMA 2VVFA 3CZUA 4QX2A 2XWJB 1COV3 5JDBA 3HR9A 2YV8A 4RSUA 1O59A 1OC1A 1C8M1 2Y60A 3IPVB 3PNAA 3J7LA 1QJU1 1UOJA 3ZFFB 5D8AA 1FMD2 1SLBA 1UF2C 3I2DA 2PELA 2PLV3 3DYOA 2IFWA 1LHOA 4LULA 4X8NA 3NNLA 1OUSA 4LEJA 2QQKA 4JDMA 3UKTA 3E5UA 1X9PA 4Y1VA 1IGOA 3BTAA 2W95A 5LW9A 3HQRA 3VZJA 3AVRA 3HJRA 4CEWC 4AFAA 3U07A 1L3JA 2EXHA 3H1YA 3DN7A 2ZEZA 4E8CA 1OF4A 4QDSA 5DZEA 3C2UA 4FTEA 2CU5A 2RE9A 4Y4RA 4IE4A 3UGGA 1JYIA 4CU6A 1JYCA 4HKWA 1JMUB 3BYWA 3N35A 3THCA 5FZ4A 4CEWB 1QQP3 5LY1A 3I3MA 3AFGA 1LB2A 1H2MA 4B3NA 2WFPA 1H9PA 5BNQA 2VNVA 5C8CB 3BIWE 2RS13 3UETA 1NG0A 2H6CA 1YCIA 3JB8A 3A4UA 1JOBA 1MS4A 4S2HA 4YW4A 4E4DX 3AK0A 1XYNA 3ZDSA 5KXEA 4RQPC 4MLOA 3AP7A 3O14A 4MGTA 4KI5M 4P9YA 3PUQA 5BY5A 4EN6B 1WGPA 1LOCA 1QWRA 2QJVA 2GH2A 1RB8G 1W8ZA 1G9DA 5F2WA 1KXGA 4YM3A 4F8AA 5FPBA 4Y1YA 4AHYA 1BBT3 1BEV3 5T54A 1J1TA 1RIRA 4IUGA 1AYM3 5DG1A 2D44A 1W06A 3PLQA 1J1LA 1QU0A 4PF1A 3JBG2 3VZLA 5JSRA 2W87A 3H0OA 3VBFA 3WDTA 2F6BA 2FZ1A 3Q8BA 4JGZB 5A7QA 4O61A 4AI0A 1QOSA 3BPSA 4BDVB 1C3HA 4J1XA 1O91A 5LBFA 2EALA 3OPTA 4WM7C 1HN1A 3RSJA 3QH7A 4XC9A 1IHMA 5CKQA 5GJ6A 5JOYA 2XOMA 3WG3A 5ERLA 2CNAA 1EAH2 3DXUA 3ZR6A 3WW3A 3GYDA 5G05L 4GH4C 3OEAA 4WVMA 4Q26A 1RUD1 1NCQA 2X5IA 3I54A 4QU2A 4XF0A 5F5QA 5CADA 1SG3A 4P9JA 1DQ1A 1FNZA 1KGYA 3CLPA 4N53C 3TN92 1EPZA 4LO5B 1UQXA 4O9EA 2ZKLA 4ZU4A 2OT7A 2P17A 2ORXA 4JKLA 1K5MA 4AF9A 4BH9A 1WW4A 1DYKA 4HSJA 1LHWA 4DPNA 4P9IA 3KT7A 3ETQA 4KG0A 5A3LA 5CKMA 4BXFA 5FLHA 2JDMA 3RMYA 1A34A 1YQ8A 4OUMA 1W6MA 1IPSA 1FV3A 2GNBA 1AYN3 3NV4A 4Q4V3 4ZU5A 3RNSA 4CEYA 5A6XA 5T5JA 4OHWA 2WNUA 3U0ZA 4XCBA 2GDFA 1AR73 1W3VA 2HWD1 4NWWA 5FPAA 1RHI1 4AFDA 4AI3A 1ENQA 2J7MA 1CAXB 1ST8A 1MEC3 3NJZA 4IEYA 4JGZA 1EP0A 4B4QA 2BWCA 4WM8C 2DF7A 3NAPC 5BXXA 5J7MA 1DQ5A 2JD4A 2RS33 3I2FA 4CUBA 2GN7A 4NVPA 4DNYA 1CAUA 5FMOS 1V6JA 2K0GA 5DDJ2 1RUE3 1LOAA 3VBSC 3VBOA 2A3YA 2WWJA 4MHRA 3JQXA 3RFRA 3SMHA 3U14A 3NW4A 1RHI2 1DZTA 1O8SA 1VMFA 4XJ9A 4L0PA 4CP9B 3POGA 1D4M3 1RITA 2FCTA 1W9YA 5LCWL 5FY5A 1CAWB 1OOPB 4BQXA 1UPIA 2WO7A 4BQ4A 3NL1A 3LEMA 3ACHA 1OT5A 3OGGA 3PMEA 2JX9A 1SFPA 1JHNA 4I0AA 4LKDA 3M3IA 5FZ8A 5D8AB 2QDNA 1AR81 1ZRDA 3IDBB 1RMU3 1FNYA 3FX3A 3Q9OA 4TSVA 3TNPB 3PVBB 5LEKA 3ZSJA 4YW3A 4HSLA 3WNOA 3SQOA 2UU8A 5LA0A 5BNOB 3IIIA 1DBNA 5FZ0A 5H9SA 4B4PA 1BBT2 1QNYA 1Y7BA 3VKOA 4FFFA 5CIRA 3NVCA 4ZXKA 1SLTA 4NIHA 1JS9A 2YBPA 4META 2EXKA 3AZVA 5T5OA 5CG8A 5LASA 3D6EA 1REEA 4Q0QA 5JR7B 2FMYA 2UY9A 5AVAA 5IVEA 1L7LA 2RM22 4FXKB 4Y22A 2EXIA 2R071 3M70A 4K1ZA 2DUQA 4C0HA 3M2MA 4XBNA 1W99A 4V2WA 5FZ1A 4HETA 5FWEA 3WP6A 1AXKA 1V9U2 2QQIA 3GJAA 1ZZ8A 4B4RA 1NCRB 3VUOA 3RJ2X 1FPN3 2A75A 1W6NB 2B9VA 1ND2C 5A7PA 5JR2A 5D1IA 1CAWA 4PIYA 4NPLA 5EXOA 1UYXA 3H8UA 3SLIA 4DRRA 4E4ZA 3RZMA 2ZTNA 3RZHA 2VCAA 3AKSA 3DECA 3FHIB 3MF9A 1W6QA 5FP8A 2YDEA 4XAAA 1OH4A 3VHNA 3R05A 2XDVA 1OQEA 2D97A 5A32B 3VBUA 5K0UA 1KS4A 2QZ3A 3WZ1A 1JOJA 1AX1A 5LA1A 5SV5A 3RYPA 4CCDA 1WW5A 1YFXA 4QU1A 3CBNA 3S57A 4W65A 4C1WA 4LHLA 1RUC2 2R49A 4IW3A 3NNMA 1YJLA 4NPRA 4Q1RA 1KFUL 1LESA 3CZJA 2XG3A 4PQ9A 1RJ7A 3WDUA 3MFCA 3WF0A 1UZYA 3FUQA 4YM2A 1AHSA 2XBO1 2XVKA 5EFUA 5B4NA 5FXXA 3LDBA 5J3UA 1W9WA 1IG0A 4OI2A 1VP6A 1XNKA 3PVOA 1PVC3 1HRV3 4CCMA 4KWUA 3USSA 3WQ7A 5C4WC 5FWJA 1AR91 3WQ0A 4EN8B 3U75A 4GAZA 1BVP1 1PK6A 4CCOA 3C7OA 1BXHA 1RUI2 5IAVA 2WNVA 4O9GA 4BE3A 4EYUA 4PHZA 1WCQA 3HAGA 3I59B 3LA3A 3OTFA 3SCFA 4Y4YA 1F9KA 1S0JA 4COUA 5IVBA 1W03A 1OFNA 1G8WA 2HWF3 2J1TA 3B9IA 3ILNA 1D4M2 3U37A 5IJRA 1UOBA 4ATEA 4XUTA 3HN3A 1J59A 3OEBA 5BPXA 4AI2A 1LKNA 4W4ZA 3FC0A 4FPKA 1MEC2 4CE8A 2VZOA 3CF6E 3W9AA 4XJZA 1SBFA 3VBRA 2TEPA 1MS8A 2HKXA 4P9LA 2VBPA 2ZX1A 4ZXEA 3ZYRA 1PGSA 1UKRA 1SDDB 3ILRA 3T2TA 5ACA2 1PMHX 1R093 2B45X 2JB8A 2AR6A 2PHRA 1K12A 4IXLA 3W21A 4FPLA 5EQUA 1W2AX 2WC2A 3KWVA 2AUYA 1UX7A 3CKHA 3UNPA 2CGNA 4D6QA 5E16A 3NJVA 1JU3A 4QPGA 2C1FA 2ORZA 3KQRA 4UF0A 2BFUS 2Q8DA 3KF3A 1XXNA 4FPGA 2LUWA 4YWAA 3RDIA 1IPKA 2OZJA 3G7DA 3AJYA 4HANA 4MYEA 2ZHMA 2CV6A 2NMOA 3ZKYA 4QGMA 5A1FA 1LHUA 1TG7A 2BERA 2DVBA 2VH9A 5LRRA 4AEKA 5JI9A 1RYYA 1VB4A 1WD3A 1RVF3 4LBJA 3O5SA 3HNBM 4NRMA 3VBSA 4IV1B 3QD6A 5DUUA 5FYHA 2VUJA 4LQRA 4L11A 3GZEA 3M3CA 5FZGA 1RUJ3 2PXJA 4A7ZA 3AZXA 4BK4A 2B46X 5DUXA 4QPIC 3AL5A 4AEDB 2AZ5A 1N3PA 4JZRA 2YXSA 4AYUA 5CFDB 4IQPA 3MUY1 2Z69A 1KEXA 2VVEA 5FXZA 1JZ8A 2R041 2V72A 3VGIA 1FV2A 1LOGA 1MS1A 1Q56A 3APBA 1CPNA 1QY4A 1G7YA 2OZ6A 2GN3A 1D2QA 3J26N 2W1UA 3A0NA 3WDYA 1UY4A 1EAH3 1VRH2 5F39A 4AG4A
chains in the Genus database with same CATH topology
2VBPA 1ODNA 1W05A 1UO9A 2IVJA 1HB1A 1UOGA 1W2NA 2JB8A 1IPSA 1UNBA 3OOXA 1W2AX 5APAA 1OC1A 1BLZA 1W06A 1W04A 2BJSA 2Y60A 2VCMA 1QIQA 1E5SA 1HB4A 3ZKUA 3ZOIA 1OBNA 4RGKA 1UOFA 4BB3A 1RXGA 1RXFA 1W3XA 1QJEA 1W3VA 1W9YA 1HJGA 2DBIA 2CSGA 2IVIB 2JB4A 2VAUA 1W28A 4XAEA 1W03A 1GP4A 1E5IA 2WO7A 5C3OA 1QJFA 2VBBA 1E5RA 1UOBA 1HB3A 2VBDA 2Y6FA 5C3RA 2BRTA 2DBNA 2BU9A 2VE1A 1BK0A 5C3PA 5C3SA 3ZKYA 5C3QA 1GP5A 1WA6X 1GP6A 1E5HA 1HJFA 1HB2A 1UZWA 1W2OA 1DCSA 1ODMA 3ON7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBP A;  1ODN A;  1W05 A;  1UO9 A;  2IVJ A;  1HB1 A;  1UOG A;  1W2N A;  2JB8 A;  1IPS A;  1UNB A;  3OOX A;  1W2A X;  5APA A;  1OC1 A;  1BLZ A;  1W06 A;  1W04 A;  2BJS A;  2Y60 A;  2VCM A;  1QIQ A;  1E5S A;  1HB4 A;  3ZKU A;  3ZOI A;  1OBN A;  4RGK A;  1UOF A;  4BB3 A;  1RXG A;  1RXF A;  1W3X A;  1QJE A;  1W3V A;  1W9Y A;  1HJG A;  2DBI A;  2CSG A;  2IVI B;  2JB4 A;  2VAU A;  1W28 A;  4XAE A;  1W03 A;  1GP4 A;  1E5I A;  2WO7 A;  5C3O A;  1QJF A;  2VBB A;  1E5R A;  1UOB A;  1HB3 A;  2VBD A;  2Y6F A;  5C3R A;  2BRT A;  2DBN A;  2BU9 A;  2VE1 A;  1BK0 A;  5C3P A;  5C3S A;  3ZKY A;  5C3Q A;  1GP5 A;  1WA6 X;  1GP6 A;  1E5H A;  1HJF A;  1HB2 A;  1UZW A;  1W2O A;  1DCS A;  1ODM A;  3ON7 A; 
#chains in the Genus database with same CATH topology
 1Q8Q A;  2Q8E A;  4QX8 A;  2WLP A;  2DUP A;  1W8T A;  1XC6 A;  1E57 A;  4YG6 A;  3ZSK A;  1H1I A;  1H8T B;  4YG0 A;  4FPF A;  4WM7 B;  3N9P A;  1CIY A;  2IFR A;  2LRP A;  2RJK A;  4UYB A;  5B4X A;  3WR0 A;  1VAM A;  4XUP A;  5FMD A;  2W0X A;  4UWD A;  1YQ6 A;  4QXK A;  4YSF A;  1W39 A;  4A7Y A;  2XJV A;  1NAE A;  1JZ5 A;  4MGZ E;  3IDA A;  1DYO A;  1W8U A;  2XVL A;  3CIH A;  1NA1 B;  1S0G A;  2LM3 A;  3W5M A;  3AZZ A;  3VBU B;  4JCK A;  5JXI A;  4CEW A;  2XKO A;  4QPG B;  4IGP A;  1GQH A;  2X5I C;  3PU8 A;  4P5H A;  5J48 A;  4GKY A;  3VV1 A;  1W05 A;  2RMU 3;  3PHM A;  5IT6 A;  2P37 A;  4XFA A;  2DTW A;  4CP0 A;  1LNS A;  3W59 A;  1POV 1;  4K6B A;  2AYH A;  3SKV A;  3F95 A;  1I1E A;  2E6V A;  1FOD 3;  2MNG A;  2G1M A;  5FIX A;  2ILM A;  4H55 A;  3VKL A;  4GB3 2;  4FTB A;  3WNP A;  3VD3 A;  2HWE 2;  2CDO A;  3CHX A;  2ET1 A;  2JDA A;  2R32 A;  2WZR 3;  3FN9 A;  3L9J T;  5DMY A;  1F2N A;  1OH3 A;  1SBE A;  3LIH A;  3ZFG B;  4AFB A;  5FKC A;  2TNF A;  3E6B A;  1DQ4 A;  5ABJ A;  1F5J A;  1O8P A;  2YC2 A;  3C3V A;  2SBA A;  1W8F A;  4XHX A;  1ZX5 A;  3AXE A;  3HD8 B;  3ST7 A;  1H6Y A;  4YPJ A;  2W9X A;  4WBB A;  2C9A A;  1DQ0 A;  1GWL A;  2YRO A;  4HVR A;  4P9W A;  4ASK A;  2E7A A;  3DF0 A;  1MS0 A;  4XF9 A;  3W5N A;  1C8M 2;  3NV1 A;  5C71 A;  1FMD 1;  4IES A;  5T5P A;  1RHI 3;  3DYP A;  2XJU A;  4C0B A;  2E7Q A;  1UOF A;  3WY6 A;  2DU1 A;  4N7I A;  3ORJ A;  2B42 B;  3RZG A;  4RN5 A;  3WIN E;  5C33 A;  1OLQ A;  1GSL A;  2MEV 3;  4Q0P A;  2CDP A;  4DXZ A;  2ET7 A;  3ITQ A;  4QKD A;  3I2J A;  4GJY A;  4COY A;  4IE7 A;  3CQO A;  3AM2 A;  5ANN A;  1AR9 2;  3H42 B;  1AR8 2;  4FQ4 A;  3SCG A;  5FP3 A;  4QHZ A;  4CDU C;  2W68 A;  5A3O A;  2CHH A;  2NM1 A;  3JXS A;  4JX0 A;  4P14 A;  5IK5 A;  4Q29 A;  5GLU A;  3IMN A;  3OPW A;  3B02 A;  3LA2 A;  5LA2 A;  1VBB 3;  4MVT A;  3OOX A;  2V5Y A;  4GIQ A;  2WWU A;  5DG2 A;  4BQY A;  1AR6 3;  5JAX A;  3DL3 A;  4K3U A;  5HI0 A;  1MQT C;  3I97 A;  2RG4 A;  3PVE A;  3WG1 A;  1N1T A;  3IKW A;  3PUA A;  5FP9 A;  5DPN A;  2VXJ A;  2H6B A;  2ZGU A;  5A32 A;  1AR8 3;  2I2S A;  4OLL A;  5I0S A;  4UAP A;  2F4P A;  3ACI A;  1QDC A;  4L99 A;  2CL2 A;  5EJ3 A;  1WME A;  2OQ7 A;  4GUL A;  4N7U A;  1XE8 A;  5GLW A;  5FYU A;  5BNN C;  3E97 A;  1OLM A;  2BP6 A;  4UF0 B;  1F4A A;  3EQE A;  4QX3 A;  4FP2 A;  1QJY 2;  4GZ9 A;  2XWB B;  3AMP A;  1SBD A;  1M06 G;  4EN9 B;  1IS5 A;  2ZMN A;  2IXI A;  3TEW A;  4CDW A;  1GZC A;  3WG4 A;  4ERO A;  1RUH 1;  4QDQ A;  3VB9 A;  5FP7 A;  1T6G C;  1W04 A;  1VAV A;  3PDQ A;  2I07 B;  5GLZ A;  2C4X A;  2JKX A;  3LD8 A;  4Q27 A;  1EV1 3;  1PHM A;  3ZN6 B;  2XPJ A;  2BVV A;  2Q0A A;  3URF A;  1RUC 1;  4KWJ A;  4A4A A;  4DIN B;  2VOK A;  4UFM A;  1PZ8 A;  1TZO A;  2BRT A;  4EWD A;  1R08 3;  4CPB D;  1O3R A;  2P4E A;  2RVA A;  1DU3 D;  4HPK B;  4OZO A;  2W39 A;  4XVH A;  3ZXJ A;  1C8N A;  3S30 A;  1AJK A;  2G9F A;  5L36 A;  2FZ2 A;  4CSW A;  2HEY F;  5FLJ A;  3AMH A;  4Q4X 1;  1W9S A;  5GZC A;  2A7A A;  1QGL A;  1QJX 2;  1AJO A;  1J3P A;  3FLR A;  3QLQ A;  3N9M A;  4RQP B;  1Z7S 3;  1KDK A;  4LKE A;  1DZR A;  1L7Q A;  1TE1 B;  2BJS A;  2C5D A;  3ALQ A;  2VNR A;  2OUH A;  4AED C;  4CRQ A;  2DVG A;  2Y6H A;  4M4R A;  2IVI B;  4QX7 A;  4XFG A;  2W1W A;  1A78 A;  4A44 A;  3DV8 A;  3MLJ A;  3TOJ A;  1W8W A;  4F3J A;  4I0W B;  5A33 A;  3T09 A;  4BM8 A;  3THT A;  4LOR A;  5FYM A;  2VNO A;  3R4S A;  4E2S A;  1PMI A;  2XJS A;  1JHJ A;  1W6O A;  4G4F A;  5JXH A;  1D0H A;  3KZ4 C;  4Q4X 2;  5FKB A;  3ASI A;  1QJX 1;  1AL2 1;  3MID A;  2VZP A;  4OUL A;  4PI2 A;  1OKO A;  3B7M A;  4OQ9 A;  3POY A;  1ZA7 A;  4XZU G;  1W0P A;  2A5Z A;  4DFS A;  2WNV B;  1DCS A;  1UW8 A;  3LA7 A;  4AFM A;  3VBF B;  4LK6 A;  1YFW A;  3MO4 A;  5FYV A;  3V56 A;  2PA7 A;  1UIK A;  3OD0 A;  4LBQ D;  1TQ5 A;  4PLM A;  3WCS A;  3KVA A;  2HWC 3;  1QXJ A;  1GYK A;  4L9B A;  1PNF A;  2BGO A;  1LEN A;  2JDK A;  4QHO A;  2ARC A;  2WKK A;  4YGC A;  5A1A A;  2FMD A;  5FZA A;  2PAE A;  2FCV A;  5FK7 A;  1ZRR A;  2WSU A;  3EO6 A;  1V6M A;  2JG8 A;  2G9Z A;  4QX1 A;  1VBA 1;  2DVD A;  3MFA A;  5FZL A;  3RWN A;  3VZK A;  3O7O A;  3TAY A;  4ES9 A;  3SCH A;  5A6Y A;  5C6C A;  3NST A;  2GH8 A;  4Y26 A;  2GME A;  5DDJ 1;  2ZJC A;  3WLU A;  1W90 A;  2WS9 3;  3I3B A;  4IDZ A;  1T2X A;  5A33 B;  1OD5 A;  3LEK A;  4ZY9 A;  1DQ2 A;  2A6Z A;  2JE9 A;  5F5C A;  1ZA4 A;  2ZZJ A;  3VBU C;  1BLZ A;  3R6S A;  5EJ1 B;  3MI8 A;  1XYP A;  3LZZ A;  5FAX A;  3MZH A;  2DYC A;  2ES3 A;  4BB3 A;  3ZFE A;  1QEX A;  4NHY A;  4YFZ A;  2VAU A;  4ET7 A;  1IQA A;  5CEH A;  5IVC A;  4KU7 A;  4NAO A;  2QQU A;  3VLB B;  1H30 A;  5FZE A;  3K48 A;  1WMF A;  4M3C B;  2QE3 A;  1QDO A;  2WAA A;  2WDB A;  4NID A;  1HV0 A;  1AF9 A;  2JE7 A;  4GWJ A;  1NZC A;  2XXZ A;  3OBR A;  4YW7 A;  1JOD A;  4BIO A;  1NE4 A;  3GAL A;  3MHZ A;  3O0V A;  3GZT B;  3D5O A;  4B7E A;  3S6P A;  3BTY A;  3PTR B;  3QAC A;  1QXR A;  2HJI A;  4QQP A;  1NYW A;  4LE3 A;  3AKP A;  5A7N A;  1ND3 C;  3HNY M;  1OA4 A;  2VCB A;  4QKN A;  4LBQ B;  5IK7 A;  1R1A 1;  1YJK A;  4UW5 A;  1BK1 A;  3LDK A;  2XJQ A;  2R0H A;  5I8S A;  2VMH A;  3VDD A;  1PO1 3;  5I8T A;  1ULG A;  3VL9 A;  3K2O A;  4F7Z A;  3D0J A;  4GWI A;  1H8T A;  3FHA A;  5LZ6 A;  5CBL A;  4BQ1 A;  3N9L A;  1MPX A;  3O0X A;  2IXK A;  3P6B A;  4M0N A;  1X82 A;  1GOF A;  3TYJ A;  5C3P A;  1X36 A;  3UJO A;  4D7T A;  4AEJ A;  4A42 A;  2VL4 A;  5DAQ A;  4YW1 A;  1HXS 3;  1DP0 A;  4H14 A;  4XJA A;  2IVJ A;  5A70 A;  1PO2 2;  2JG8 B;  3K4Z A;  1WCK A;  2OPW A;  2ID4 A;  2VXR A;  5FBJ A;  4AI8 A;  2CAV A;  4JGZ C;  4GB3 1;  3VDD C;  3J9S A;  4YVW A;  3PTY A;  1GUI A;  4IEZ A;  1LOF C;  1QJE A;  2CWS A;  4LBK A;  4YGE A;  1VBC 3;  1JOP A;  1G9F A;  2WII B;  4JQT A;  2Q8O A;  1GKB A;  3VBO C;  1V6I A;  4IE0 A;  1JZ7 A;  3ME2 A;  5KR7 A;  4J6G A;  4LO8 A;  4PDW B;  5A3W A;  1QMJ A;  1YRZ A;  3CL1 A;  4W6W A;  4XFF A;  1O7F A;  3VDD B;  1GU3 A;  4ZHN A;  1W8H A;  2VZ1 A;  1HJF A;  4LBQ A;  1YQC A;  2HYK A;  4UW4 A;  3KCC A;  2CAU A;  4MGQ A;  2W92 A;  4A45 A;  2J1R A;  3B00 A;  4W8J A;  2OW4 A;  1ZVF A;  2HWB 1;  2Y64 A;  1GBG A;  4FQZ A;  3UT0 A;  4YW5 A;  1PK6 C;  4FOW A;  1W6O B;  1S0D A;  2B9U A;  1LOE A;  4IV3 B;  2JWP A;  4XHB A;  4XMI A;  4YVW C;  3TRS B;  1QQP 2;  5FY1 A;  5F7U A;  5LRS A;  4V2V A;  5GAL A;  5JOZ A;  4M3C F;  1TMF 2;  2N7G A;  1SDW A;  2VOT A;  3JBG 1;  4WVV A;  1HRI 1;  2DV9 A;  3CO2 A;  3POE A;  3WDV A;  1KRI A;  3G6J B;  4Z1V A;  1HB3 A;  2D93 A;  3EBR A;  2UYB A;  3P3N A;  5E89 A;  3QBQ A;  4NPM A;  2P1B A;  5FO7 B;  1E5H A;  1NKG A;  2A70 A;  3OCP A;  4WM8 B;  4IGQ A;  1C28 A;  2IWG B;  4CP1 A;  1R09 2;  3N7K A;  4J1W A;  1LHN A;  4AZZ A;  1OQ1 A;  1QQP 1;  1YIF A;  2EIG A;  1CX4 A;  3DUI A;  5FZ3 A;  2C26 A;  2DTY A;  4CPB A;  4FTS A;  4FPH A;  3ZYB A;  2VUA A;  4PDW A;  5CFC B;  3VKM A;  1ULE A;  2BNO A;  3UJQ A;  4I01 A;  4RGK A;  4OYU A;  1UZV A;  3ZM8 A;  1AL2 2;  2QFE A;  3UK9 A;  1GOG A;  4Q4Y 1;  4ATF A;  4JQR A;  3VDC A;  4GWM A;  2Q1F A;  4CXW A;  5A7S A;  1LTE A;  5JMO A;  5L7O C;  3VDB A;  2VZR A;  2JG8 C;  3ILF A;  1CWP A;  2PHD A;  2WZP P;  1NLR A;  1VLN A;  3T2Q A;  2ADD A;  2ZBJ A;  3RS6 A;  2ZEX A;  4LA2 A;  1Z0H A;  5FUN A;  4R4X A;  4CP2 A;  5DQ0 A;  3BU0 A;  1AYM 1;  1R64 A;  2W1S A;  2XH6 A;  1CAX A;  5EP9 A;  3VKN A;  4CVU A;  1CJD A;  3K46 A;  2DUO A;  1CQ9 A;  3BB6 A;  5LK5 A;  3MLK A;  3VN4 A;  3BU7 A;  1G9C A;  3ZKU A;  3WF4 A;  2YPJ A;  1GAN A;  3KT1 A;  4Q0S A;  4JDO A;  3D0S A;  4QWN A;  3LWC A;  2QQP A;  1W9F A;  3N7L A;  2F4L A;  4FXG B;  2LRO A;  1PO1 2;  4I0B A;  4C90 A;  1MR5 A;  2VTF A;  5FZH A;  4DEQ A;  3ZPY A;  1DGR N;  3Q8A A;  2TBV A;  3R4D B;  3I8T A;  4JC1 A;  2OQ6 A;  3ZFG C;  1N3Q A;  4DQA A;  4YZ5 A;  1HX6 A;  1V6L A;  4NUB A;  3KGZ A;  5FZK A;  4MO3 M;  4Q5O A;  4OI0 A;  1WLT A;  1WZX A;  5AC9 2;  1YFY A;  3NJX A;  1UO9 A;  4AHW A;  3USU A;  3D8C A;  2VQ0 A;  3KCY A;  4AQ2 A;  4O7X A;  5FYT A;  4KMQ A;  4ZZ5 A;  2Q1Z B;  1PGL 2;  1XNA A;  2QNK A;  2QQO A;  4AK3 A;  5JSP A;  4QPW A;  1JZ6 A;  1DGR A;  3HWJ A;  4ZU7 A;  3KMH A;  1X8E A;  4YM1 A;  5FZO B;  3EHK A;  5EPA A;  4Q4W 1;  2WZR 2;  3TEZ A;  4UT5 A;  1V00 A;  5I93 A;  1N1V A;  4AGR A;  3WXP A;  3TB0 A;  2GMM A;  2EF6 A;  4ZON A;  3F2Z A;  1VMH A;  2Y6F A;  1RUF 3;  4NE9 A;  3O1T A;  5AC9 1;  4RQP A;  5JUV A;  1VBE 3;  2Y6G A;  3H3Z A;  4AW7 A;  3T2P A;  1COV 1;  5KHG A;  3OGJ A;  2P6H A;  1IOA A;  1HQL A;  1C8M 3;  1ODN A;  1KJL A;  4NRQ A;  1APN A;  3ZSL A;  4Q4W 2;  1TEI A;  2V09 A;  5C5U A;  1NX9 A;  2WFF 3;  2DDU A;  1VIW B;  4GQ7 A;  4HON A;  2K46 A;  5FV3 A;  5IK8 A;  2JDN A;  5FQ0 B;  2W94 A;  4CA9 A;  3CEW A;  5C8C C;  4RR3 C;  3BPZ A;  4GWN A;  3ZYP A;  1WBL A;  1HW5 A;  1TMF 3;  4HMZ A;  4W50 A;  3MF6 A;  4JRL A;  1AL2 3;  4QMA A;  3ABZ A;  3IN9 A;  3LOB A;  5F32 A;  1UXZ A;  5A80 A;  1XSQ A;  2OUJ A;  1XU2 A;  5F2S A;  3V0A A;  4XBL A;  5C70 A;  3LSE A;  4JAA A;  4L2N A;  4ORF A;  1U5Y A;  1FX5 A;  1PIV 3;  1H1A A;  4NIA A;  5J98 B;  1D7P M;  4I3G A;  4IL7 A;  5IFP A;  3B5L B;  1ZBE 1;  2RV9 A;  1ALY A;  1O3T A;  5DUW A;  1R1Z A;  1O4Z A;  4IV1 C;  1O4T A;  2BNM A;  2E9Q A;  3RMX A;  3WNK A;  1UY1 A;  2BV4 A;  1EPW A;  1RXG A;  1RXF A;  2V5D A;  3OBT A;  4LE4 A;  4CDX B;  1PX4 A;  2CSG A;  4IER A;  2R0F A;  4Z07 A;  4BWO A;  2Z2S B;  5FJH A;  1F8V A;  1ULP A;  1RMU 1;  3RGB A;  5AFB A;  3C8X A;  1NE6 A;  2WIN B;  3OGR A;  1PIV 2;  5FTT C;  2VVD A;  3U78 A;  1A6C A;  5EYY A;  2CTV A;  2WJS A;  1AXY A;  1S2E A;  5FYY A;  4BMB A;  4L92 A;  2VW1 A;  2QQW A;  4TZD A;  4LO6 B;  3VHP A;  3K77 A;  3O1V A;  1UPS A;  1PZ7 A;  4P02 B;  4K7J A;  2XR4 A;  3AJZ A;  3ZFG A;  4FAG A;  2A71 A;  3IT8 A;  4HBN A;  4TWT A;  1HQN A;  3MYX A;  4JVA A;  5FY8 A;  4H7L A;  1ZZ6 A;  1J58 A;  3GDB A;  4TLF A;  1YUD A;  1OMI A;  2AEZ A;  2QBX A;  5FY0 A;  5GM0 A;  1RUD 2;  3KLS A;  3E5Q A;  1Y43 B;  2ENR A;  4K9S A;  2IXH A;  4RS5 A;  1RUI 3;  5T3N A;  5B2G B;  2D6P A;  4BQW A;  3BOP A;  2VBD A;  1OUR A;  4IGO A;  2DFC A;  4IEW A;  1S0F A;  2KXL A;  5FQ0 A;  3LF7 A;  4CCL A;  4XZP A;  5BNN A;  4DZG A;  4CCK A;  4XW3 A;  4NO4 A;  2ZEW A;  1WLC A;  1PO2 3;  1HXS 2;  4AVV A;  4IET A;  5F6K A;  4MGI E;  1CVN A;  2HBU A;  1AYN 2;  1MAC A;  1W2T A;  4Q4V 2;  2WT0 A;  5F8P A;  4A7K A;  1SLA A;  4IEO A;  1XYO A;  5A7W B;  5CFD C;  2R6Q A;  4AAP A;  2PHT A;  4K20 A;  5C8W A;  2NZ9 A;  5F3G A;  5DAB A;  2HWD 2;  3K4D A;  2XLF A;  4BQ3 A;  3DGT A;  1DLL A;  4LO4 B;  2HBT A;  2D5H A;  2RDQ A;  3DEM A;  1MS3 A;  1VRB A;  2MEV 2;  1STM A;  4LA3 A;  2BBV A;  2RS1 1;  1K5M C;  5GZE A;  3PIG A;  3ZIW A;  1NQJ A;  3H1W A;  4CEY C;  3N36 A;  3FLT A;  2QDR A;  5KHH A;  1PVC 1;  2VQT A;  3OJB A;  2RMU 2;  4AVT A;  5F1R A;  4CDQ C;  1LGN A;  3O12 A;  4BQ2 A;  2EA7 A;  2D40 A;  3WNN A;  2RS3 2;  3OGV A;  4P00 B;  4X6R B;  1BCX A;  3ZPO A;  4ZZ8 A;  3LE0 A;  4BJ0 A;  5CB7 A;  3CU7 A;  3KHB A;  2KA3 A;  3I2G A;  4DB5 A;  5DN2 A;  3NAP A;  1N3O A;  1LEM A;  1ND2 B;  2D7F A;  2VBB A;  3KV9 A;  2GC0 A;  5F5I A;  4YZ1 A;  1QOT A;  1YQ2 A;  2VOV A;  5KXD A;  1YHF A;  2B7Y A;  4OI1 A;  3UGH A;  1S4C A;  3HIF A;  1RUE 1;  2V4A A;  1R09 1;  5EJZ B;  1JUH A;  5HCA A;  1H1M A;  2JIC A;  3QH6 A;  2FDH A;  5EHD A;  3VZM A;  3NWK A;  2WN2 A;  3W58 A;  2VGD A;  4E2Q A;  4MXW B;  2YBK A;  2EID A;  2WT1 A;  5FYS A;  2R06 3;  3HNM A;  1BQP A;  4LHN A;  3KGL A;  3V64 A;  1VE0 A;  2VMD A;  2ZCW A;  4HPK A;  3ZN5 A;  5ABJ B;  4CU9 A;  2IUW A;  1EUT A;  2C6S A;  3TEY A;  4QHB A;  3S0M A;  1G86 A;  3ES1 A;  4AE2 A;  1RUD 3;  4YAR A;  1BMV 1;  3P5B A;  4GH4 A;  2PHL A;  3ZIX A;  1YLL A;  2XHK A;  3IIA A;  4XIO A;  3VZO A;  4CDU A;  1RVF 1;  4HN0 A;  2OKX A;  3FFQ A;  1O3Q A;  2XJR A;  4QPI A;  1OLM E;  3OBZ A;  3ZMO A;  2A6W A;  2W52 A;  4FP3 A;  4D8M A;  1I9R A;  1ULO A;  3SH4 A;  3MV0 1;  4RHV 2;  3B93 A;  4B7K A;  5KXB A;  1J3Q A;  1IKP A;  4Q0V A;  4FBF A;  3WHU A;  4JTO A;  4LMF A;  4CU7 A;  2KR2 A;  2L9L A;  3P1I A;  1CZT A;  2YYO A;  4R8H A;  1M4W A;  4NHL A;  3ENR A;  5C5T A;  4I3P A;  5KXC A;  2R07 3;  3RZL A;  4PF5 A;  3POJ A;  2Y0O A;  4AQ6 A;  4FO9 A;  2FDJ A;  5FPZ A;  4DMI A;  2RS5 2;  1W6Q B;  4C8D A;  3UL2 A;  1RL3 A;  2PLV 2;  2X05 A;  2WAO A;  2SLI A;  2JEN A;  2DWR A;  2RR1 2;  3HT2 A;  1J84 A;  4QXH A;  3WW2 A;  4R9D A;  5EYX A;  1GOH A;  1RUO A;  1JYT A;  4LIU A;  5K0U C;  3T3Y A;  5K0U B;  1SEF A;  4FOV A;  3RJR A;  4HKO A;  4N43 B;  3WHT A;  1ENR A;  3T1M A;  2AEN A;  3LFM A;  1V6K A;  1LJ7 A;  4YFW A;  2VZQ A;  1ASJ 3;  1KJR A;  1UX6 A;  1OKQ A;  2I45 A;  3SNM A;  5GKA C;  3PIJ A;  3POW A;  2A3X A;  1F35 A;  4KL1 A;  4LBO A;  1S0E A;  2ZGS A;  4M4P A;  3GHN A;  3H8O A;  5E1R A;  3M3O A;  1EY2 A;  3AP4 A;  3RZK A;  5KHJ A;  1GZ9 A;  2PQS A;  4N53 A;  4QPI B;  5FZD A;  2ZZQ A;  4NII A;  4AFC A;  4JKM A;  2XON A;  2D6L X;  1D4M 1;  2WO3 A;  2YZ4 A;  4XFH A;  1PK6 B;  5FFO C;  4AQT A;  1RUF 2;  2PMW B;  5JLV A;  5BUV A;  2QVS B;  1QHD A;  3PUS A;  2WYS A;  3ZXG A;  3KHC A;  4XUO A;  4ARY A;  4OFG A;  1POV 3;  3POI A;  4L97 A;  1X7N A;  2H0V A;  2OPK A;  4RD7 A;  2XKP A;  3GCW A;  4NR1 A;  1W6P B;  3ZYJ B;  1WD4 A;  5FOB B;  1GWK A;  1V9U 1;  1H2K A;  1OLR A;  1MQT B;  3VHR A;  5ACA 1;  4K8R B;  2Y6K A;  4QPY A;  3AX4 A;  1HQW A;  4Q4W 3;  3HT1 A;  4N90 A;  5CG9 A;  2BUK A;  2HWF 1;  4FI9 A;  1SMV A;  2VM9 A;  2BOI A;  4AL9 A;  1PZ9 A;  5KC6 A;  4KBZ A;  1AR6 2;  4UOJ A;  2VD7 A;  3HMY A;  3RYK A;  1U5X A;  2JDZ A;  1Q43 A;  2FBE A;  4XQ4 A;  2FD8 A;  4GMP 0;  1QJF A;  3GF6 A;  3KD4 A;  4LOS A;  4TXW A;  3A0K A;  3O0W A;  2VUC A;  5FYB A;  2ARX A;  4HXC A;  1ULD A;  3OY8 B;  3VBS B;  4LLF A;  3ACF A;  3GXU A;  3RPQ A;  2ZGT A;  5A3P A;  5FZ7 A;  3SH3 A;  5JXG A;  2QZ2 A;  3JD7 3;  1Q8V A;  3LAG A;  2BGC A;  1D4V B;  2ATF A;  3NAP B;  1XB9 A;  1XJA A;  4DUV A;  3WD5 A;  2E63 A;  1DQ6 A;  1VB2 A;  3OSD A;  2E26 A;  1NT0 A;  2DCY A;  3ES4 A;  2X8K A;  1W2N A;  2VJX A;  3DKW A;  4CUG A;  2YPD A;  2MEV 1;  1TMF 1;  5LA9 A;  4EWE A;  2VUD A;  2ZOE B;  1RUH 2;  1HRI 2;  2VOW A;  2ZGP A;  1VBD 3;  4R4Z A;  2JB4 A;  4W6X A;  4D6R A;  2KD7 A;  4DXT A;  1GNH A;  3JU9 A;  1UMI A;  5DAV A;  1TME 3;  4A2U A;  3HBZ A;  2YBS A;  3GZA A;  4IEX A;  2ARA A;  2E53 A;  4IE6 A;  5FPL A;  5CIS A;  4OZX A;  1XOY A;  2YMZ A;  5IWF A;  3ZSM A;  4CEY B;  4AHZ A;  4QQO A;  1GZW B;  1ZBE 3;  1LRH A;  3HOB A;  1WW6 A;  3EB7 A;  4QXB A;  4RHV 3;  4B8E A;  2QQJ A;  4EE2 A;  4IEU A;  1UU5 A;  3LFI A;  1YO8 A;  1JW6 A;  4AI1 A;  3J8F 1;  1C57 A;  1UKG A;  4URT A;  4Y1X A;  3O1S A;  1AXZ A;  2RM2 3;  3X29 B;  2P3I A;  2XGX A;  1IS3 A;  4XFI A;  3WDW A;  3GGL A;  3IB3 A;  2RS5 3;  1LR5 A;  2PTM A;  4FFH A;  5A7W A;  4KQ7 A;  3WOG A;  3ZVX A;  3WX5 A;  1IPJ A;  5EIY B;  4NOT A;  3VZN A;  2XUE A;  4XDP A;  5ABJ C;  4COV A;  2CWM A;  5C3Q A;  3MV1 1;  5KWR A;  2ZGN A;  2ZX4 A;  5A3T A;  2YB7 A;  5IAX A;  1W0N A;  5T55 A;  2GP3 A;  4NMI A;  4ZS3 A;  1PX3 A;  3MIF A;  4L8Q A;  1ZZ7 A;  3FJS A;  4QX0 A;  3U11 A;  2X10 A;  1GNY A;  2UYA A;  2RJL A;  2VTX A;  4NAM A;  1F4H A;  5BYN A;  2D3R A;  5FZF A;  3TN9 1;  1JXN A;  3VD7 A;  4DOU A;  1QIQ A;  1F31 A;  1SZB A;  4WM8 A;  4B1L A;  3WF2 A;  2D5F A;  2HWE 3;  5FP4 A;  5GZF A;  5J37 A;  3R0R A;  4Y3O A;  2ARE A;  4HVO A;  2OYZ A;  1OUX A;  3KQ4 B;  5D2A A;  1QF3 A;  2EIB A;  3H8R A;  4PLO A;  2JDP A;  4NRO A;  2VE1 A;  2VZS A;  4FFG A;  4YZ4 A;  4Q4X 3;  4LNV A;  2RMU 1;  3I2O A;  4KH9 A;  3VBH C;  2BZD A;  1EUU A;  1ZBA 1;  4AED A;  5CKN A;  3Q8C A;  1S0B A;  5L7O B;  2JDH A;  4FSJ A;  5HBA A;  2WFF 2;  5JZG A;  2GP5 A;  4HKL A;  1K5M B;  2PLV 1;  1GWM A;  3GNE A;  1DHK B;  1GNZ A;  2GC3 A;  3CMG A;  5D21 A;  3DXT A;  1VRH 1;  1W3X A;  3JB4 C;  5E88 A;  2UY8 A;  3D4K A;  4BQ5 A;  2DFB A;  4XJW A;  1QNW A;  2ERF A;  4CCE A;  5KHK A;  1VBD 2;  2E51 A;  2OS2 A;  1KQR A;  1OXC A;  4XBQ A;  1WKY A;  3WUC A;  4WVM B;  2A3W A;  2VMC A;  3CJX A;  3UKN A;  5A7O A;  5FO8 B;  4AVC A;  3AP6 A;  1CES A;  2D6O X;  5FLI A;  1K3I A;  5DAX A;  4P9G A;  4KGQ A;  3IDE A;  5JVV A;  3AZY A;  4N43 C;  2O8Q A;  2UWB A;  3AFK A;  1WLW A;  3NQH A;  4FOY A;  4FPY A;  4PBO A;  2Q8C A;  4E2G A;  4OUS A;  1MZ5 A;  2VY0 A;  3KV5 A;  2WWS A;  1SFN A;  1U12 A;  2GU9 A;  4XPV A;  3H8X A;  5LB6 A;  4UFJ A;  2VCM A;  3ZOI A;  3AP9 A;  3ZFF C;  1IKQ A;  1LOD A;  1BJQ A;  2K2S A;  3AYC A;  1K42 A;  4BCU A;  1BMV 2;  1J3R A;  4QX5 A;  2F17 A;  4TTG A;  4BHP A;  2IC1 A;  5J09 A;  4A6S A;  3MEP A;  4DUW A;  3D3A A;  2WNU B;  5CU1 A;  3O1R A;  3BIE A;  3ACL A;  3DPR C;  2WS9 1;  4CP9 A;  1BBT 1;  2WNE A;  1QH7 A;  3H7Y A;  1RUG 3;  3ZX7 A;  1VBB 1;  2NMN A;  4KU8 A;  3V0B A;  1SCS A;  3AYA A;  3ON7 A;  4JGY A;  4KBB A;  4QGN A;  4G3Y C;  4GD4 A;  4YW2 A;  3B3Q E;  1V70 A;  5IYY A;  2YGL A;  5JOW A;  4EWA A;  4A6O A;  1ZYB A;  2QQN A;  2WAB A;  4R9A A;  1LGB A;  1ZRC A;  1OVP A;  2ZXQ A;  4DIQ A;  3EYP A;  5D8A C;  4EZ4 A;  3JUU A;  4IE5 A;  1FOD 1;  3NV3 A;  1ENS A;  1I3H A;  2VQA A;  2YC0 A;  1UIJ A;  3M3E A;  2ZA9 A;  5C4W A;  3LKJ A;  1C1L A;  1G6N A;  5FXV A;  3I3E A;  3B69 A;  5DXD A;  3M7A A;  1BK0 A;  1R08 2;  4EJR A;  1POQ A;  5SV8 A;  3K3O A;  5FYI A;  4QKB A;  1S2K A;  1Q8O A;  2A6X A;  2XJT A;  3PVN A;  2E31 A;  5F6L B;  1GZT A;  3LDR A;  3AB0 A;  2D6N A;  1ULF A;  1RC6 A;  2YG0 A;  5DZF A;  2A6V A;  5BNP B;  4CZS A;  3T0A A;  1DGW A;  3SKJ E;  1ZM1 A;  5J1X A;  1Z7S 2;  2EAA A;  3O1O A;  1DGL A;  4WZC A;  3KVB A;  2R7E B;  4FPE A;  1J83 A;  1Y4W A;  4DY3 A;  2BPA 2;  5L9R A;  2Y8K A;  1E5S A;  4F83 A;  1TNF A;  3POB A;  5CYY A;  2A6Y A;  2VMG A;  1W6N A;  1R08 1;  5BNO A;  2BVB A;  4RGA A;  1LU2 A;  3LB9 A;  3MIC A;  4CXX A;  4MG2 A;  4YRD A;  5E8A A;  2HEW F;  5ISL A;  5FPV A;  1FYU A;  1O5U A;  3LQC A;  5FY9 A;  3BCW A;  3ZXE A;  3BTZ A;  4LBM A;  3M1H A;  2NN8 A;  5JPM B;  1AZD A;  1IG3 A;  2PHW A;  5LBC A;  4LT5 A;  4BYY A;  2W46 A;  4GA9 A;  3I2K A;  3NMB A;  4YNI A;  1XPW A;  3AMQ A;  1OPO A;  2UWC A;  3CJI B;  5FRA A;  2Y6J A;  4YVS B;  2AH2 A;  1AYN 1;  3CJI C;  2ZGO A;  4FPO B;  4Q4V 1;  4NHX A;  3WCR A;  1Y3T A;  4D7S A;  4Q8K A;  3AKT A;  4Q8L A;  4LO7 A;  1KIT A;  1UY3 A;  3VL8 A;  5CFC C;  2VR4 A;  4PI0 A;  3BN6 A;  5FCC A;  1OA2 A;  1XBF A;  1H6X A;  5HXV A;  3LGR A;  4CCJ A;  1VBC 1;  2BW8 A;  2ZGL A;  3INA A;  5BNO C;  1RUJ 2;  1H4G A;  3WSO A;  3N7M A;  4XFB A;  2GAU A;  1PM4 A;  4XAE A;  1E5I A;  2RS1 2;  2WO2 A;  4O65 A;  1JBC A;  3NKT A;  2GC1 A;  1VBE 2;  2UUR A;  1A8M A;  1VAL A;  1WW7 A;  2Q5T A;  4MXW A;  1TNR A;  4XAC A;  3ZSE A;  5J36 A;  1JUI A;  2DCK A;  2R04 2;  1GP6 A;  1V9U 3;  2BNN A;  2YFU A;  3IDC B;  3MIB A;  4WM7 A;  1C5H A;  5DZG A;  3KCX A;  3LPF A;  1IS4 A;  1N1Y A;  1RUG 2;  4RGG A;  1CAV B;  1TVG A;  1Y9Q A;  2EXJ A;  2WQ4 A;  3OBA A;  1KDM A;  4QB1 A;  1UY2 A;  4Y33 A;  3TNQ A;  5BNN B;  1ND3 A;  1HRI 3;  3U4S A;  4LOT A;  1SPP B;  3PJY A;  5FY4 A;  4OQ8 A;  5C9A C;  3S5Q A;  2LS6 A;  1RUH 3;  4J25 A;  1X33 A;  1UYY A;  4OHY A;  5C3O A;  4BLI A;  1E5R A;  4QB6 A;  4FAH A;  3I2I A;  4YM0 A;  4LIV A;  3RI9 A;  4LHK A;  3I3D A;  4YW6 A;  5FRE A;  1OI6 A;  2O0O A;  3HQX A;  1NOV A;  4X8P A;  1CJP A;  3VHO A;  4OMC A;  4ASM B;  3WP4 A;  2ADE A;  1UCX A;  1PGW 2;  3OG2 A;  4QB2 A;  1XNC A;  2WUH A;  1VPH A;  3V0A B;  4GMP 1;  1GQG A;  4IEV A;  1VBD 1;  4Q4Y 3;  5GZD A;  3BUC A;  2R30 A;  2WNU C;  4M01 A;  4MGS A;  2LTN A;  1HJG A;  3DKQ A;  1S55 A;  1VAK A;  2YFZ A;  2ZMK A;  2ZX3 A;  3O1P A;  1DFQ A;  2BYV E;  4FPJ A;  1AR7 1;  2HWD 3;  4GXL A;  3S7E A;  5I0T A;  3WV6 A;  4CU8 A;  3GBF A;  5HV0 A;  2J1V A;  4P08 A;  2DCJ A;  4RHV 1;  1D0G A;  2GSY A;  3OB8 A;  4D0Q A;  1UN1 A;  3J4U H;  2V4V A;  5DAW A;  1O4Y A;  1WWY A;  2DCZ A;  2RM2 1;  2VME A;  2WO1 A;  2WZE A;  2ZHL A;  3AKQ A;  1IS6 A;  1VBA 2;  1ZNP A;  1MVQ A;  1WMD A;  1YNA A;  4DXR A;  4OCT A;  3A7Q A;  2C9K A;  4OHX A;  1H9W A;  1NCQ C;  3OYW B;  2RS5 1;  2XB6 C;  3B01 A;  4Y5S A;  2DBI A;  4S2G A;  3UYJ A;  1URX A;  3V0B B;  1HN0 A;  4XOG A;  1WMX A;  1LCL A;  3EXU A;  5FJK A;  5LBE A;  2HWC 1;  1WBF A;  3B9C A;  2Y34 A;  5BNP A;  4URA A;  1MZ6 A;  3HPN A;  1UD1 A;  1Y9M A;  2XBO 3;  4MXV A;  1Q8P A;  3ZO0 B;  1JYW A;  4RYD A;  4PQQ A;  2JE8 A;  4PT6 A;  2Y6L A;  4BPZ A;  2WRA A;  2Y38 A;  5JXJ A;  1OPM A;  1ZBA 2;  5IVF A;  1AR9 3;  2YC4 A;  1ASJ 2;  1OHF A;  3P3P A;  1L7R A;  4HN1 A;  4QKF A;  2XHN A;  4SBV A;  1FOD 2;  1XNB A;  3RZZ A;  4AHX A;  2P3K A;  5HV4 A;  2HWC 2;  2P34 A;  1BEV 1;  5LK7 B;  2OA2 A;  5AFE A;  2A1X A;  1X50 A;  2Y26 A;  3AZW A;  1JYX A;  3D82 A;  5I91 A;  3VBR C;  2BEO A;  4YVS A;  2JKB A;  2ZAB A;  3H3U A;  4MGY E;  5JWP A;  1JZ4 A;  4D3W A;  3VD9 A;  2BWA A;  5K8S A;  1XRU A;  4HLT A;  1RED A;  1RMU 2;  2YHJ A;  1BZW A;  1YEW A;  1SHW B;  2B5H A;  3ZDV A;  5C9A A;  3WNX A;  4Y22 B;  2HWB 3;  1US3 A;  5FBZ A;  1BEV 2;  5FMB A;  5FZM A;  3T4V A;  4JTN A;  4U36 A;  5FUI A;  5L9V A;  1FPN 1;  2PQQ A;  2PYT A;  4NRP A;  3NV2 A;  3O1U A;  4JDN A;  4QM9 A;  4YZ3 A;  3NJY A;  1HB1 A;  3J7N A;  1RJ8 A;  1H4H A;  3M4F A;  1FT9 A;  2PFW A;  3JBG 3;  3MIH A;  3Q8F A;  2OX0 A;  4FPC A;  2VQU A;  4OUE A;  1XNT A;  5I0U A;  5FZC A;  4IND A;  5HCF A;  4YG3 A;  1CZV A;  2KM2 A;  1JN2 P;  1ENX A;  1YQ5 A;  1WCD J;  1KFX L;  1MZF A;  1UYZ A;  1U0A A;  4XET A;  4BU2 A;  2Y33 A;  2D3P A;  4I30 A;  5FPU A;  1FPN 2;  3RI8 A;  5CVR A;  1KS5 A;  1MVE A;  3NO8 A;  4MAD A;  2W08 A;  3WW4 A;  4I02 A;  2VUL A;  4ONU A;  5M0T A;  1JYN A;  3QCW A;  3ZFF A;  1SPP A;  3E5X A;  3ZXL A;  1YIP A;  1YYN A;  3FLP A;  1O6U A;  1RUJ 1;  2RDS A;  4AVS A;  1OQD A;  4XE9 A;  4ZKT B;  3KB5 A;  4LTA A;  1SLC A;  5A3M A;  1SCR A;  1HXS 1;  2XQX A;  4LLO A;  5J96 B;  2JG9 B;  1PM7 A;  1X9T A;  4EN0 A;  1HRV 1;  3IM0 A;  3ZFE C;  4Z2A A;  4AGG A;  1V6N A;  2LAL A;  1ZZB A;  2VC9 A;  5FR3 A;  3ACG A;  3IWZ A;  5HCH A;  4COZ A;  3HEI A;  1JZ2 A;  1LUL A;  1NLQ A;  3ZYF A;  2JIG A;  2VCC A;  3T30 A;  2GAL A;  3BKZ A;  1RUG 1;  1ZRI A;  4JKK A;  3ZXF A;  4EZH A;  1O5L A;  4AVB A;  1NXM A;  1S0I A;  2XVG A;  2NLR A;  2XBO 2;  1LOF A;  3A22 A;  4N9I A;  3VBH A;  2D6K A;  1REF A;  1SLL A;  3KT4 A;  1ZRE A;  3ZYH A;  4ES8 A;  4BIS A;  2FDK A;  4BIF A;  2RS3 1;  3C7E A;  2XML A;  1RUI 1;  2RDN A;  1HB4 A;  2W91 A;  1SQ4 A;  4RL7 A;  4UW3 A;  3THP A;  2W2I A;  1OVS A;  3HBK A;  1ONA A;  3AMM A;  2GNM A;  4HG6 B;  2QTW B;  4LBN A;  4TN7 A;  4HK8 A;  3ZN4 A;  4A3X A;  1UMZ A;  3VBR B;  4AQS A;  3U10 A;  2RHP A;  4UFL A;  3N9O A;  3LEI A;  5K7P A;  4QQL A;  2BU9 A;  4K8F A;  2VZV A;  5DUV A;  4XJ8 A;  2EIC A;  2VZ3 A;  3WQ1 A;  1WA6 X;  3C7G A;  5IW0 A;  3K4A A;  4RS5 B;  3QOP A;  4S2F A;  1OF3 A;  2WA4 A;  4OHZ A;  3S5A A;  4KWL A;  2B39 A;  3ZXK A;  4BZ4 A;  4E9K A;  5FZ9 A;  2NP0 A;  3WW1 A;  3WP5 A;  4M3C A;  2BFU L;  3RZJ A;  1HLC A;  3I49 A;  3OD4 A;  3OGS A;  3AYE A;  2B4K A;  1YI7 A;  2WLQ A;  5JSO A;  1AR7 2;  4RR3 B;  1GZW A;  1OSG A;  1DF0 A;  3WT3 A;  5IHR A;  4XDO A;  2OXB A;  3NRU A;  3ZMN A;  5F3C A;  1UZ0 A;  3CJI A;  3FFZ A;  4HFS A;  1QXP A;  2P6C A;  4QQH A;  4LIT A;  1VBE 1;  3BI3 A;  2FHR A;  4S2D A;  1LOB A;  1B35 B;  3MBW A;  5CFC A;  5FMO L;  1NCQ B;  2R04 3;  4R9C A;  4WV8 A;  4CUA A;  3B94 A;  4TYS A;  4HT1 T;  1I5P A;  3KF5 A;  1MS9 A;  5H9Q A;  1W9T A;  2J22 A;  2WFF 1;  2V73 A;  3SC7 X;  4EV0 A;  5LWB A;  5JZG C;  4JGY C;  1YWK A;  3OPZ A;  4PIX A;  1HKD A;  1JYV A;  4CUC A;  1OFS A;  5FK8 A;  4YYO A;  4FCA A;  3VD4 A;  2AC1 A;  4XF4 A;  4XTP A;  2QQL A;  4C1X A;  4LKS A;  5GLT A;  1OBN A;  2R06 2;  3H1M A;  2J1A A;  3UV9 A;  3WG2 A;  3WP3 A;  1DGW X;  2NQY A;  2H0B A;  2FCU A;  4MX3 A;  4QXC A;  3ZXA C;  4RS5 C;  3N9N A;  1CPM A;  3PUR A;  1SFY A;  3POF A;  2VMI A;  3H50 A;  2D43 A;  2Z4F A;  2G4I A;  2O8O A;  5FXW A;  1PMJ X;  2RR1 1;  1Z78 A;  5GZG A;  4UFH A;  2YUE A;  1NY7 1;  1IZ3 A;  4RFT 0;  3TWI A;  3PL0 A;  3I59 A;  1GQP A;  2R06 1;  3AYD A;  2X09 A;  1XQN A;  3U1X A;  1QJY 3;  4HVQ A;  1UL9 A;  1I6X A;  4AOC A;  2B8M A;  2DCT A;  5EV7 A;  3PMS A;  1I5Z A;  3BGA A;  2CGO A;  2R07 2;  4E8D A;  1QJZ A;  5FMC A;  1CZS A;  1QJU 2;  1W28 A;  5HPO A;  5TSW A;  4A41 A;  1UZZ A;  2ETE A;  5T52 A;  1YXW A;  4BLJ A;  4AR2 A;  1OOP C;  3SEP A;  3GBG A;  1VJ2 A;  2JIJ A;  2RJ2 A;  4W6Y A;  2VOX A;  4BXS V;  2AEY A;  4KWK A;  5A3U A;  1H0B A;  2DU0 A;  2PHX A;  5ANQ A;  5L73 A;  4UW6 A;  3HN1 A;  3E6C C;  1RUF 1;  1V6O A;  3GM8 A;  3H9A A;  5FUP A;  3AVS A;  1N47 A;  3DPR B;  2X53 S;  4GMP 3;  5A1L A;  5AC9 3;  4LUM A;  1ZRF A;  2A73 B;  1K5J A;  1R1A 2;  2VZU A;  2XL7 A;  3IAQ A;  3OY8 A;  4U2A A;  3MDP A;  2R16 A;  2MHF A;  2XUM A;  1UMH A;  4CDU B;  3C7F A;  3FE5 A;  4DS0 A;  3CDZ B;  5FZB A;  1G9A A;  4XQD A;  4XIK A;  2WA3 A;  3I4I A;  1FMD 3;  2HWF 2;  1MS5 A;  3BVC A;  3FZ3 A;  1POV 0;  2JJ6 A;  4X6Q B;  4UBG A;  4CDW B;  4JGY B;  4WVW A;  3M3Q A;  3OUJ A;  4ISQ A;  4Y5T A;  2BGP A;  1JH5 A;  1H2L A;  3A21 A;  1PO2 1;  1QOO A;  2D3S A;  3IPV A;  3KV6 A;  4E4S A;  3GHM A;  1PVC 2;  1ASJ 1;  1Z7S 1;  1YFU A;  4NIG A;  2I74 A;  4PCR A;  2WN3 A;  1AL0 G;  4LBL A;  5JIA A;  4QT6 A;  1B35 C;  4Z8B A;  1PIV 1;  4MZU A;  1H2N A;  3RRD A;  2BDR A;  5BNP C;  4P5Y A;  1WUV A;  1A8D A;  2P2K A;  2PHU A;  2WQZ C;  1A3K A;  2X29 A;  3GCX A;  4RA0 A;  3VKF C;  2PN5 A;  1NXD 1;  2C24 A;  3CNA A;  4Z2W A;  1PNG A;  2EVX A;  3MPB A;  4XAB A;  2Z79 A;  1XE0 A;  2ZHN A;  4KG8 A;  3RQ0 A;  5BV6 A;  3E1F 1;  3SEE A;  2ZGR A;  2ZGK A;  4MSV A;  4HK9 A;  1S2B A;  4IV1 A;  3A23 A;  3RG0 A;  5A6Q A;  4UXA A;  2YY1 A;  3SIS A;  3T08 A;  2QCS B;  1OA3 A;  4CYD A;  1ND2 A;  1W2U A;  5ACA 3;  2ZPX A;  4Y24 A;  4CXY A;  2NYY A;  4GH4 B;  1XND A;  2VO5 A;  3MW4 A;  1LHV A;  3NKG A;  4N8M A;  4DRV A;  2WBK A;  2FDF A;  2FDI A;  4BA6 A;  3S7I A;  2VZT A;  5JIU A;  4MGK E;  2ARB A;  3SIT A;  1EAH 1;  5K4L A;  1AYM 2;  2CGP A;  3BOW A;  4CDW C;  5EZW A;  2XQR A;  4YLZ A;  3LEG A;  3J8F 2;  4CCN A;  5L9B A;  4QAW A;  4PJY A;  1NLS A;  4WVZ A;  3U4X A;  3OUH A;  1GP4 A;  2ZGQ A;  2VG9 A;  1XE7 A;  2GZW A;  1W0O A;  1EV1 1;  1JU4 A;  2JG9 A;  4XDQ A;  3KS7 A;  1H8T C;  4XUN A;  3WNL A;  3MLL A;  1RUC 3;  3EMR A;  5FYC A;  5T50 A;  1C4R A;  2DUR A;  1W2O A;  3RVH A;  5FZI A;  5T5L A;  2D6M A;  4JHZ A;  4QD2 A;  2HEV F;  3ROU A;  2XLA A;  1OOP A;  3Q8E A;  4Y1Z A;  4A3Z A;  2Y0I A;  4XCA A;  4Q4Y 2;  1UNB A;  1G9B A;  1LAJ A;  4AAX A;  2IXC A;  1HRV 2;  5I0D A;  1XSR A;  1HV1 A;  4PBP A;  3RYR A;  3VBF C;  1JZ3 A;  4YGB A;  2WNV C;  2ZKN A;  4XYX A;  4CDQ B;  3V65 A;  3I7D A;  1CAU B;  3OF1 A;  5FYZ A;  3ZYI B;  2W3J A;  1QJU 3;  4I2O A;  4PLN A;  4DEV A;  2JDU A;  3IMM A;  3K75 B;  1IQD C;  5H9P A;  2QKD A;  1DDL A;  3OUI A;  4H2A A;  2VEC A;  2BOJ A;  2WZR 1;  4I09 A;  5C3S A;  5KBF A;  2XJP A;  3EJK A;  3ZN6 A;  1K45 A;  1VMJ A;  4JRA A;  1SLI A;  3MW2 A;  5FPX A;  4IEP A;  3VD5 A;  1JTZ X;  2WL1 A;  3C7H A;  1QJX 3;  1Q3E A;  2W5F A;  2VW2 A;  4N53 B;  2WYF A;  2VU9 A;  4QDR A;  1R1A 3;  4ASL A;  5LAT A;  4LXL A;  1Q8S A;  1COV 2;  1FAT A;  3SH5 A;  1NQD A;  1PO1 1;  3LIG A;  3PUI A;  4WZF A;  3R4U A;  4D7Y A;  1RUE 2;  1CD3 G;  2GNT A;  4C91 A;  3RWK X;  3JCI A;  2Z5W A;  4MOA A;  1NZI A;  1JI6 A;  5IAT A;  4KNC A;  2Z42 A;  5HCB A;  3N7J A;  1T6B X;  1EYB A;  3IBM A;  4ARX A;  3JQW A;  2ZGM A;  1W6P A;  2C0Z A;  2DBN A;  2GMP A;  1NCR C;  4NWV A;  4GAL A;  2CY6 A;  2P5B A;  4IV3 C;  4XUR A;  1DZQ A;  2K9Z A;  4YVW B;  3WDX A;  5C8C A;  1RUN A;  2P3Y A;  4RR3 A;  3WUD A;  4MV2 A;  3TEX A;  1UZW A;  3AL6 A;  2PHF A;  5F3I A;  3IZO A;  3MGU A;  4D69 A;  1UU4 A;  1PGL 1;  1VBA 3;  3T2O A;  1RIN A;  3AXD A;  5C7G A;  2FQP A;  4H3W A;  5L19 A;  4R52 A;  5IVV A;  4Z82 A;  3AP5 A;  2W47 A;  4UBH A;  4E4H A;  3MUZ 1;  5DDJ 3;  3TBD A;  4K1Y A;  1NA1 A;  5LY2 A;  2HH9 A;  3AMN A;  2E32 A;  3BAL A;  3LOI A;  4PDW C;  5IVJ A;  5IK4 A;  1CGP A;  1AR6 1;  4BME A;  4DY5 A;  3N9Q A;  2EIE A;  5A3N A;  1WLD A;  2VTX J;  4ZPI A;  2FDG A;  2EAK A;  3J7M A;  4TLG A;  4AWD A;  2WSV A;  3ZR5 A;  4ZS2 A;  3FMG A;  1MQT A;  4XEZ A;  5CZK A;  5IUQ A;  4BOW A;  1C1F A;  2JXA A;  4AXO A;  1U5I A;  5FZO A;  4CDQ A;  3JD7 2;  5FZ6 A;  2MPF A;  2WS9 2;  3UES A;  5C4W B;  1ZZ9 A;  4QPG C;  1CR7 A;  2JEC A;  1MZE A;  3MPP G;  4MH0 E;  1B35 A;  4B1M A;  2J1S A;  1AVB A;  2BQP A;  3K51 A;  1V0A A;  3I2H A;  2DVF A;  1ACC A;  1Y9G A;  3DCQ A;  3LPG A;  4UFK A;  4EN7 B;  3NNJ A;  4LJH A;  1GIC A;  5KHI A;  3MIE A;  4UI9 L;  5K9Y A;  4OHV A;  2E7T A;  2YU2 A;  4LHS A;  4YVS C;  5LEJ A;  1XU1 A;  1RTV A;  4N43 A;  3FUO A;  2ZAA A;  1W8O A;  3JD7 1;  4LR4 A;  2J42 A;  4N9H A;  4XF3 A;  2GND A;  3ZXD A;  1PVX A;  3M8L A;  1W8N A;  2IXJ A;  3L2Y A;  5DAP A;  1HIX A;  2JEM A;  5I0R A;  2WT2 A;  1BVV A;  1ZBE 2;  5F3E A;  2J1E A;  4FFI A;  5IVY A;  2J1U A;  1X8M A;  4OI4 A;  3WEZ A;  2ZX0 A;  4MUV A;  1DYP A;  3UGF A;  4CCC A;  1UWW A;  1YC6 1;  2VPV A;  3GZU C;  2WZ8 A;  2LW8 A;  3DYM A;  4HOO A;  1SAC A;  1C5I A;  2QQV A;  3WF3 A;  4D94 A;  4XJU A;  2HLE A;  5JOX A;  4NHM A;  3DPR A;  3ELN A;  3K3N A;  5JI7 A;  3ETP A;  3ZYG A;  1FAY A;  1GLH A;  4LKF A;  4G9S B;  5FDB A;  2RR1 3;  2JG9 C;  1FI2 A;  4Y1U A;  1GR3 A;  2G9G A;  5C3R A;  1GV9 A;  2PAK A;  4K40 A;  5FY7 A;  5FOJ B;  5A6Z A;  1QJY 1;  1RGS A;  1HDK A;  3N3H A;  1QKQ A;  1AUY A;  1MEC 1;  1B09 A;  4LUK A;  3BTX A;  2OVU A;  4Y20 B;  3WVJ A;  4UFI A;  4Z92 B;  3SHR A;  3UKV A;  1LED A;  1NCR A;  1CN1 A;  1O3S A;  3KSC A;  2O1Q A;  2ZAH A;  2AAC A;  3MW3 A;  4ITC A;  4DUX A;  2R1B A;  5C9A B;  4Q1P A;  4KGG A;  1UY0 A;  2RDR A;  3H7J A;  5FO9 B;  2Q30 A;  1VBC 2;  3ZLI A;  4OMD A;  4D6S A;  4XQW A;  3USU B;  1CAV A;  2JDY A;  3AKR A;  2NPI A;  3FWE A;  2ZEY A;  3KM5 A;  2QQM A;  2VMF A;  4H7M A;  1NA1 C;  2CYF A;  5F37 A;  1P8J A;  2XL9 A;  4M3C E;  3VDA A;  3I3Q A;  4XXA A;  5CAZ A;  3HVD A;  1GP5 A;  5CFD A;  3SXW A;  5HXM A;  3KV4 A;  3THD A;  3FBM A;  1D2S A;  4OVE A;  4XMA A;  2WR9 A;  4YZ2 A;  1U5Z A;  2Q1M A;  2O14 A;  1NUK A;  1LU1 A;  1DIW A;  2HWB 2;  2OII A;  4CTE A;  4P9X A;  4HL0 A;  3PJQ A;  4QQ2 A;  5I8Y A;  3IAP A;  3NNG A;  2UWA A;  2ZML A;  1H8V A;  2XLG A;  4HZF A;  5IFT A;  2WNO A;  1Q5O A;  4FOQ A;  3LSD A;  4Y20 A;  5CA6 A;  4JHT A;  4IEQ A;  1WCS A;  1VR3 A;  1KD7 A;  4NHK A;  5H9R A;  5JZG B;  3J7H A;  3MIG A;  3T4H B;  4GKX A;  3GJB A;  1UU6 A;  3LCP A;  5L7O A;  2BBA A;  1ZBA 3;  1DLC A;  4IV3 A;  4DO0 A;  3WF1 A;  4B29 A;  2QUO A;  2BTV C;  4DXS A;  1TME 1;  3ZFE B;  3T0B A;  3WQB A;  5LBB A;  4CDX C;  1GMM A;  2DVA A;  1DG6 A;  4XUQ A;  1S1A A;  4Q2F A;  3E6D A;  3N4M A;  4AGV A;  1RVF 2;  1CON A;  3GBW A;  3FHQ A;  1UOG A;  3ECQ A;  4V1P A;  5G04 L;  1VRH 3;  1PGW 1;  1WCU A;  3FBY A;  2HYX A;  3T1L A;  4QGL A;  3WNM A;  5APA A;  1AX2 A;  4JV4 A;  2VW0 A;  4FT8 A;  2JD9 A;  4E27 A;  4XTM A;  2YGM A;  1ZZC A;  1LEC A;  1BHG A;  2ZAC A;  4Q0U A;  4EQV A;  1OD3 A;  1BKZ A;  5JMC A;  4SLI A;  3PUH A;  2WQ8 A;  3J8F 3;  4R9B A;  1TME 2;  1CIW A;  1CX1 A;  1QH6 A;  1N1S A;  2ZX2 A;  3POS A;  4K21 A;  4RFR B;  1EV1 2;  2IXL A;  3VBH B;  4BK5 A;  3O1M A;  3H3L A;  1UAI A;  4M00 A;  2ZHK A;  4COW A;  1ND3 B;  2D98 A;  2G19 A;  3BOD A;  3FL7 A;  3OYW A;  3ATG A;  4PIZ A;  1YI9 A;  4Y5Z 0;  1F5F A;  1UYP A;  2X5I B;  5AVP A;  2W1Q A;  3HQU A;  5EWS A;  4CDX A;  1S0C A;  2Q4S A;  2YU1 A;  4MHU A;  5F9T A;  2PAM A;  1VBB 2;  5JCT A;  2VNG A;  1AX0 A;  1WA4 A;  2AGS A;  4NJ4 A;  4XF1 A;  3W20 A;  3T0D A;  4XIL A;  4FVV A;  4LPL A;  2E33 A;  4XXP A;  3NNF A;  1US2 A;  2ZS6 B;  1GFF 2;  2P3J A;  1LGC A;  2R1D A;  3PU3 A;  4ISR A;  3TN9 3;  2GC2 A;  3L2H A;  5E6H A;  4GB3 3;  1W6M B;  5KC5 A;  4NN0 A;  5CNA A;  1ULC A;  2HWE 1;  4M0H A;  4YGD A;  4AVA A;  3AC0 A;  1NY7 2;  4XFC A;  1BYH A;  5GLV A;  3VBO B;  1FXZ A;  5F5A A;  4AI9 A;  1HB2 A;  4AEM A;  2TUN A;  2IZW A;  4GJZ A;  4LK7 A;  5JPN B;  1UXX X;  4QM8 A;  1F15 A;  3JZV A;  1ODM A;  2VVF A;  3CZU A;  4QX2 A;  2XWJ B;  1COV 3;  5JDB A;  3HR9 A;  2YV8 A;  4RSU A;  1O59 A;  1OC1 A;  1C8M 1;  2Y60 A;  3IPV B;  3PNA A;  3J7L A;  1QJU 1;  1UOJ A;  3ZFF B;  5D8A A;  1FMD 2;  1SLB A;  1UF2 C;  3I2D A;  2PEL A;  2PLV 3;  3DYO A;  2IFW A;  1LHO A;  4LUL A;  4X8N A;  3NNL A;  1OUS A;  4LEJ A;  2QQK A;  4JDM A;  3UKT A;  3E5U A;  1X9P A;  4Y1V A;  1IGO A;  3BTA A;  2W95 A;  5LW9 A;  3HQR A;  3VZJ A;  3AVR A;  3HJR A;  4CEW C;  4AFA A;  3U07 A;  1L3J A;  2EXH A;  3H1Y A;  3DN7 A;  2ZEZ A;  4E8C A;  1OF4 A;  4QDS A;  5DZE A;  3C2U A;  4FTE A;  2CU5 A;  2RE9 A;  4Y4R A;  4IE4 A;  3UGG A;  1JYI A;  4CU6 A;  1JYC A;  4HKW A;  1JMU B;  3BYW A;  3N35 A;  3THC A;  5FZ4 A;  4CEW B;  1QQP 3;  5LY1 A;  3I3M A;  3AFG A;  1LB2 A;  1H2M A;  4B3N A;  2WFP A;  1H9P A;  5BNQ A;  2VNV A;  5C8C B;  3BIW E;  2RS1 3;  3UET A;  1NG0 A;  2H6C A;  1YCI A;  3JB8 A;  3A4U A;  1JOB A;  1MS4 A;  4S2H A;  4YW4 A;  4E4D X;  3AK0 A;  1XYN A;  3ZDS A;  5KXE A;  4RQP C;  4MLO A;  3AP7 A;  3O14 A;  4MGT A;  4KI5 M;  4P9Y A;  3PUQ A;  5BY5 A;  4EN6 B;  1WGP A;  1LOC A;  1QWR A;  2QJV A;  2GH2 A;  1RB8 G;  1W8Z A;  1G9D A;  5F2W A;  1KXG A;  4YM3 A;  4F8A A;  5FPB A;  4Y1Y A;  4AHY A;  1BBT 3;  1BEV 3;  5T54 A;  1J1T A;  1RIR A;  4IUG A;  1AYM 3;  5DG1 A;  2D44 A;  1W06 A;  3PLQ A;  1J1L A;  1QU0 A;  4PF1 A;  3JBG 2;  3VZL A;  5JSR A;  2W87 A;  3H0O A;  3VBF A;  3WDT A;  2F6B A;  2FZ1 A;  3Q8B A;  4JGZ B;  5A7Q A;  4O61 A;  4AI0 A;  1QOS A;  3BPS A;  4BDV B;  1C3H A;  4J1X A;  1O91 A;  5LBF A;  2EAL A;  3OPT A;  4WM7 C;  1HN1 A;  3RSJ A;  3QH7 A;  4XC9 A;  1IHM A;  5CKQ A;  5GJ6 A;  5JOY A;  2XOM A;  3WG3 A;  5ERL A;  2CNA A;  1EAH 2;  3DXU A;  3ZR6 A;  3WW3 A;  3GYD A;  5G05 L;  4GH4 C;  3OEA A;  4WVM A;  4Q26 A;  1RUD 1;  1NCQ A;  2X5I A;  3I54 A;  4QU2 A;  4XF0 A;  5F5Q A;  5CAD A;  1SG3 A;  4P9J A;  1DQ1 A;  1FNZ A;  1KGY A;  3CLP A;  4N53 C;  3TN9 2;  1EPZ A;  4LO5 B;  1UQX A;  4O9E A;  2ZKL A;  4ZU4 A;  2OT7 A;  2P17 A;  2ORX A;  4JKL A;  1K5M A;  4AF9 A;  4BH9 A;  1WW4 A;  1DYK A;  4HSJ A;  1LHW A;  4DPN A;  4P9I A;  3KT7 A;  3ETQ A;  4KG0 A;  5A3L A;  5CKM A;  4BXF A;  5FLH A;  2JDM A;  3RMY A;  1A34 A;  1YQ8 A;  4OUM A;  1W6M A;  1IPS A;  1FV3 A;  2GNB A;  1AYN 3;  3NV4 A;  4Q4V 3;  4ZU5 A;  3RNS A;  4CEY A;  5A6X A;  5T5J A;  4OHW A;  2WNU A;  3U0Z A;  4XCB A;  2GDF A;  1AR7 3;  1W3V A;  2HWD 1;  4NWW A;  5FPA A;  1RHI 1;  4AFD A;  4AI3 A;  1ENQ A;  2J7M A;  1CAX B;  1ST8 A;  1MEC 3;  3NJZ A;  4IEY A;  4JGZ A;  1EP0 A;  4B4Q A;  2BWC A;  4WM8 C;  2DF7 A;  3NAP C;  5BXX A;  5J7M A;  1DQ5 A;  2JD4 A;  2RS3 3;  3I2F A;  4CUB A;  2GN7 A;  4NVP A;  4DNY A;  1CAU A;  5FMO S;  1V6J A;  2K0G A;  5DDJ 2;  1RUE 3;  1LOA A;  3VBS C;  3VBO A;  2A3Y A;  2WWJ A;  4MHR A;  3JQX A;  3RFR A;  3SMH A;  3U14 A;  3NW4 A;  1RHI 2;  1DZT A;  1O8S A;  1VMF A;  4XJ9 A;  4L0P A;  4CP9 B;  3POG A;  1D4M 3;  1RIT A;  2FCT A;  1W9Y A;  5LCW L;  5FY5 A;  1CAW B;  1OOP B;  4BQX A;  1UPI A;  2WO7 A;  4BQ4 A;  3NL1 A;  3LEM A;  3ACH A;  1OT5 A;  3OGG A;  3PME A;  2JX9 A;  1SFP A;  1JHN A;  4I0A A;  4LKD A;  3M3I A;  5FZ8 A;  5D8A B;  2QDN A;  1AR8 1;  1ZRD A;  3IDB B;  1RMU 3;  1FNY A;  3FX3 A;  3Q9O A;  4TSV A;  3TNP B;  3PVB B;  5LEK A;  3ZSJ A;  4YW3 A;  4HSL A;  3WNO A;  3SQO A;  2UU8 A;  5LA0 A;  5BNO B;  3III A;  1DBN A;  5FZ0 A;  5H9S A;  4B4P A;  1BBT 2;  1QNY A;  1Y7B A;  3VKO A;  4FFF A;  5CIR A;  3NVC A;  4ZXK A;  1SLT A;  4NIH A;  1JS9 A;  2YBP A;  4MET A;  2EXK A;  3AZV A;  5T5O A;  5CG8 A;  5LAS A;  3D6E A;  1REE A;  4Q0Q A;  5JR7 B;  2FMY A;  2UY9 A;  5AVA A;  5IVE A;  1L7L A;  2RM2 2;  4FXK B;  4Y22 A;  2EXI A;  2R07 1;  3M70 A;  4K1Z A;  2DUQ A;  4C0H A;  3M2M A;  4XBN A;  1W99 A;  4V2W A;  5FZ1 A;  4HET A;  5FWE A;  3WP6 A;  1AXK A;  1V9U 2;  2QQI A;  3GJA A;  1ZZ8 A;  4B4R A;  1NCR B;  3VUO A;  3RJ2 X;  1FPN 3;  2A75 A;  1W6N B;  2B9V A;  1ND2 C;  5A7P A;  5JR2 A;  5D1I A;  1CAW A;  4PIY A;  4NPL A;  5EXO A;  1UYX A;  3H8U A;  3SLI A;  4DRR A;  4E4Z A;  3RZM A;  2ZTN A;  3RZH A;  2VCA A;  3AKS A;  3DEC A;  3FHI B;  3MF9 A;  1W6Q A;  5FP8 A;  2YDE A;  4XAA A;  1OH4 A;  3VHN A;  3R05 A;  2XDV A;  1OQE A;  2D97 A;  5A32 B;  3VBU A;  5K0U A;  1KS4 A;  2QZ3 A;  3WZ1 A;  1JOJ A;  1AX1 A;  5LA1 A;  5SV5 A;  3RYP A;  4CCD A;  1WW5 A;  1YFX A;  4QU1 A;  3CBN A;  3S57 A;  4W65 A;  4C1W A;  4LHL A;  1RUC 2;  2R49 A;  4IW3 A;  3NNM A;  1YJL A;  4NPR A;  4Q1R A;  1KFU L;  1LES A;  3CZJ A;  2XG3 A;  4PQ9 A;  1RJ7 A;  3WDU A;  3MFC A;  3WF0 A;  1UZY A;  3FUQ A;  4YM2 A;  1AHS A;  2XBO 1;  2XVK A;  5EFU A;  5B4N A;  5FXX A;  3LDB A;  5J3U A;  1W9W A;  1IG0 A;  4OI2 A;  1VP6 A;  1XNK A;  3PVO A;  1PVC 3;  1HRV 3;  4CCM A;  4KWU A;  3USS A;  3WQ7 A;  5C4W C;  5FWJ A;  1AR9 1;  3WQ0 A;  4EN8 B;  3U75 A;  4GAZ A;  1BVP 1;  1PK6 A;  4CCO A;  3C7O A;  1BXH A;  1RUI 2;  5IAV A;  2WNV A;  4O9G A;  4BE3 A;  4EYU A;  4PHZ A;  1WCQ A;  3HAG A;  3I59 B;  3LA3 A;  3OTF A;  3SCF A;  4Y4Y A;  1F9K A;  1S0J A;  4COU A;  5IVB A;  1W03 A;  1OFN A;  1G8W A;  2HWF 3;  2J1T A;  3B9I A;  3ILN A;  1D4M 2;  3U37 A;  5IJR A;  1UOB A;  4ATE A;  4XUT A;  3HN3 A;  1J59 A;  3OEB A;  5BPX A;  4AI2 A;  1LKN A;  4W4Z A;  3FC0 A;  4FPK A;  1MEC 2;  4CE8 A;  2VZO A;  3CF6 E;  3W9A A;  4XJZ A;  1SBF A;  3VBR A;  2TEP A;  1MS8 A;  2HKX A;  4P9L A;  2VBP A;  2ZX1 A;  4ZXE A;  3ZYR A;  1PGS A;  1UKR A;  1SDD B;  3ILR A;  3T2T A;  5ACA 2;  1PMH X;  1R09 3;  2B45 X;  2JB8 A;  2AR6 A;  2PHR A;  1K12 A;  4IXL A;  3W21 A;  4FPL A;  5EQU A;  1W2A X;  2WC2 A;  3KWV A;  2AUY A;  1UX7 A;  3CKH A;  3UNP A;  2CGN A;  4D6Q A;  5E16 A;  3NJV A;  1JU3 A;  4QPG A;  2C1F A;  2ORZ A;  3KQR A;  4UF0 A;  2BFU S;  2Q8D A;  3KF3 A;  1XXN A;  4FPG A;  2LUW A;  4YWA A;  3RDI A;  1IPK A;  2OZJ A;  3G7D A;  3AJY A;  4HAN A;  4MYE A;  2ZHM A;  2CV6 A;  2NMO A;  3ZKY A;  4QGM A;  5A1F A;  1LHU A;  1TG7 A;  2BER A;  2DVB A;  2VH9 A;  5LRR A;  4AEK A;  5JI9 A;  1RYY A;  1VB4 A;  1WD3 A;  1RVF 3;  4LBJ A;  3O5S A;  3HNB M;  4NRM A;  3VBS A;  4IV1 B;  3QD6 A;  5DUU A;  5FYH A;  2VUJ A;  4LQR A;  4L11 A;  3GZE A;  3M3C A;  5FZG A;  1RUJ 3;  2PXJ A;  4A7Z A;  3AZX A;  4BK4 A;  2B46 X;  5DUX A;  4QPI C;  3AL5 A;  4AED B;  2AZ5 A;  1N3P A;  4JZR A;  2YXS A;  4AYU A;  5CFD B;  4IQP A;  3MUY 1;  2Z69 A;  1KEX A;  2VVE A;  5FXZ A;  1JZ8 A;  2R04 1;  2V72 A;  3VGI A;  1FV2 A;  1LOG A;  1MS1 A;  1Q56 A;  3APB A;  1CPN A;  1QY4 A;  1G7Y A;  2OZ6 A;  2GN3 A;  1D2Q A;  3J26 N;  2W1U A;  3A0N A;  3WDY A;  1UY4 A;  1EAH 3;  1VRH 2;  5F39 A;  4AG4 A; 
#chains in the Genus database with same CATH homology
 2VBP A;  1ODN A;  1W05 A;  1UO9 A;  2IVJ A;  1HB1 A;  1UOG A;  1W2N A;  2JB8 A;  1IPS A;  1UNB A;  3OOX A;  1W2A X;  5APA A;  1OC1 A;  1BLZ A;  1W06 A;  1W04 A;  2BJS A;  2Y60 A;  2VCM A;  1QIQ A;  1E5S A;  1HB4 A;  3ZKU A;  3ZOI A;  1OBN A;  4RGK A;  1UOF A;  4BB3 A;  1RXG A;  1RXF A;  1W3X A;  1QJE A;  1W3V A;  1W9Y A;  1HJG A;  2DBI A;  2CSG A;  2IVI B;  2JB4 A;  2VAU A;  1W28 A;  4XAE A;  1W03 A;  1GP4 A;  1E5I A;  2WO7 A;  5C3O A;  1QJF A;  2VBB A;  1E5R A;  1UOB A;  1HB3 A;  2VBD A;  2Y6F A;  5C3R A;  2BRT A;  2DBN A;  2BU9 A;  2VE1 A;  1BK0 A;  5C3P A;  5C3S A;  3ZKY A;  5C3Q A;  1GP5 A;  1WA6 X;  1GP6 A;  1E5H A;  1HJF A;  1HB2 A;  1UZW A;  1W2O A;  1DCS A;  1ODM A;  3ON7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...